4F03A

Crystal structure of the glutathione transferase gte1 from phanerochaete chrysosporium
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
251
structure length
251
Chain Sequence
AQPIVFYDIPSNERIKHSPWSPNTWKIRYALNYKGLKYKTEWVEYPDIAGVVQKLGGKPTEKTPDGRDHYTLPVIYDPNTKKVVEDSAAIAKYLDETYPDTPKLFPAGTDAFQAAFLDFAWPVLGFPVFMLVILDTANSLLPRSHDYFRSTREQKFGKKLEELATEEEWAKVEAGLAKLKGYLDANGKGNDLLLMGAQGGITYSDIQIASFFVWAKIIWGEGSEKWKRLISLHDGKWAQFYAQFTKFEQVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione transferase
publication title Characterization of a Phanerochaete chrysosporium Glutathione Transferase Reveals a Novel Structural and Functional Class with Ligandin Properties.
pubmed doi rcsb
source organism Phanerochaete chrysosporium
total genus 93
structure length 251
sequence length 251
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4f03A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4f03A01
3HVXA 1XFLA 4V1Ap 2MMZA 4TRXA 2XHFA 4KA0A 4WR4A 3W6GA 2VAFA 4HEA2 1HNAA 4Q5FA 3US3A 2DJ0A 1YJ6A 3GIXA 3J7Yk 3KH9A 3TJBA 2ZUPA 4X43A 2FLSA 2X8HA 3C7MA 2A2SA 4BWSA 2J9HA 3RPPA 1GSDA 4F0CA 5ECSA 5CRGA 2GGTA 3P8WA 3M9KA 4JR4A 2QKEA 1F3BA 4OD7A 4ID0A 4DEJA 4WBJA 3C73A 3ZVJA 5H5SA 1M2DA 1M7TA 5F06A 3N5OA 1XOBA 5COHA 4AJ8A 1GNWA 3W8JA 4TXVA 9GSSA 3RPNA 1JZRA 16GSA 1TRVA 1SENA 1T3BA 1U6TA 2LRTA 5KN0A 1MDKA 5D9WA 1GTAA 5JCGA 4CHSA 5AIVA 4TOPA 3CSJA 2KP2A 3RBTA 2OADA 3M1GA 1G7EA 3HZ8A 7GSSA 3FW2A 3SWLA 1QXHA 4MF7A 2H73A 1HNBA 3VLNA 4AF2A 4GCIA 1UA5A 1XVQA 2HRFA 1UVZA 3LEFA 1A0RP 2I9HA 3G7JA 2VCVA 1X0RA 3KEBA 2CX3A 2X64A 1G6YA 2C3NA 4WF5A 5D9XA 2DIYA 2WDUA 3CRUA 2B5EA 2GSRA 2OE3A 3KGKA 5B6NA 1A8YA 4P3YB 4DVCA 3OR5A 4I5QA 3TUEA 1N2AA 4EKZA 4IQAA 4L0UA 3UEMA 3S9FA 1ABAA 4GSSA 1GTUA 2X99A 4Z7XA 4HS1A 3EURA 1GSSA 2DJ1A 2YPMA 1ZL9A 5DQYA 2HSNB 4TKYA 4KDXA 2GDRA 1Z6MA 4MH2A 2RUFA 1S3CA 3UBLA 5G2ZA 1TW9A 2VM2A 5KN2A 1E6BA 2JZTA 2KOKA 1FVKA 1K3OA 2PUKC 4KW6A 1W89A 1ERWA 4JBBA 4POLA 2CV4A 2GQKA 1TRUA 3ZZXA 2IMEA 1XVWA 4FQUA 1XW9A 4K8MA 4TN8A 5J41A 5E59A 1GSFA 1VF4A 2GQLA 3GTUB 3LQ7A 1R5AA 1AW9A 1Q98A 2ON5A 2WB9A 4H86A 3BCKA 2CAIA 3WGXA 1Z7PA 3HY2A 3MSZA 4MZWA 2HNLA 3QMXA 3TJGA 1QK8A 1GRXA 4FYCA 1O85A 5DCHA 1M0UA 2IWTA 1GSEA 4AJ6A 2DJJA 2H76A 2CVKA 3EVIA 1FW1A 2XPDA 1GUMA 1SYRA 3GRXA 5KN1A 3PPUA 1ERUA 1EGRA 3L0HA 3HKRA 1T4ZA 3UMAA 5IMAA 3CSIA 4F9ZA 1PN9A 1BX9A 3PR8A 1AUCA 4I97A 4F2IA 3NOFA 2IN3A 4WETA 22GSA 4BVXB 1LJRA 4IHUA 3DGQA 4KB3A 2H6XA 4TW5A 3ERWA 3GFKA 2OE1A 3Q6OA 4JEDA 1KTEA 2V6KA 1THXA 1OC9B 4GF0A 1T4YA 4V2NA 4POMA 2FGXA 2DJKA 1TRSA 4TR4A 1PL1A 3GTUA 2F8AA 2BMXA 4YQUA 1VF1A 2R5GA 5DDLA 2TIRA 4ZILA 1F3AA 3WT2A 2JL4A 3ZL5A 2C0GA 2NBSA 3ZMLA 3DVXA 1WJKA 1XCCA 2HFDA 2MMAA 4MPGA 1KEBA 4NHWA 1UN2A 3C71A 3TRXA 2HYXA 1SK0A 1V2AA 5IPHA 2HRKB 2REMA 3TKQA 2HZFA 1WOUA 1FAAA 5A4UA 4IQ1A 2JADA 3IOSA 1SD9A 4MCUA 2DJ3A 1VRSD 4PQ1A 3BCIA 3VWUA 1PSQA 1XWBA 2H0IA 2VD0A 1H75A 2WCIA 1YKCA 1A2JA 2F8FA 3UAPA 1T1VA 2B7JA 5FWGA 2N5BA 1Z7RA 3IC8A 1GSUA 3ZFBA 1V58A 4MPFA 5INYA 1YZXA 2VL2A 3TKSA 1VGLA 3GH6A 2H74A 1TKDB 3GX0A 3KJYA 1OC9A 1Z5YE 4EVMA 5KEJA 2GZYA 2A2RA 3EINA 2JZSA 1M99A 1AC1A 3M8NA 1EOHA 2FWFA 2QGVA 2X8CA 3ZYWA 4GXZA 4MLYA 5E4WA 3MAKA 2EIOA 4ZBBA 2CX4A 3E3EA 1PKZA 1O6JA 2FWEA 3LWAA 4KCAA 4XRAA 4EDYA 2YZHA 3IXRA 4FYUA 1XXUA 1USBA 3CBUA 4MF5A 2HZEB 2LNTA 1GLPA 1XWAA 2H1AA 1MD4A 2CT6A 2L5OA 2YJ7A 3D5JA 4KUNA 5HFIA 4DSSB 1AQVA 4CDOA 1PKWA 4ISDA 1B8XA 2EIQA 3KP9A 1ERTA 4PNFA 3VWWA 3G9BA 4O92A 2H0GA 4FO5A 1K0OA 5LD0A 2H72A 1XOAA 3QOUA 2L6CA 1GSQA 2GSSA 4OFNA 2KHPA 2DMMA 2VL3A 4E8EA 1ACVA 2EC4A 3KTLA 2P5QA 2E2GA 4NXIA 1MD3A 4TR1B 2HSYA 1OC3A 2UZ8A 3TKSC 3O76A 4RQRA 4HU7A 3KZQA 1R26A 4POBA 4G0IA 2YWOA 5C04A 4YQVA 5L71A 2HSMB 2HXKA 3CTFA 2YNXA 6GSUA 2H0HA 1YQ1A 5AGYA 3DD3A 4X0XA 4V1Ag 1WPIA 4N0VA 5A4WA 2V2GA 1OYJA 1X9MB 3IR4A 1A23A 3F4RA 1GSYA 3QFBC 3VI7A 4FYBA 2KLXA 3KMOA 4MJAA 1V98A 1TK8B 2HZEA 1F9MA 3L9VA 1GULA 3N9JA 1EEJA 3W8SA 2XC2A 2LSTA 4PUFC 2QSIA 5D9VA 1N8JA 5EY6A 4DSSA 4L8EA 4MA9A 3EU4A 1OE8A 2YCDA 4GQCA 2C0FA 5AN1A 2XBQA 3SBCA 2V41A 2VCXA 3KD0A 1K0BA 2MYGA 4USSA 2VUPA 4IW9A 4PNGA 3ZREA 4ULXA 3ED3A 2QC7A 1Y6EA 4BPYA 2LJAA 3D4TA 1MDJA 2WRTA 4LMVA 3IDVA 5D96A 1QGVA 3UBKA 3DEXA 3P90A 2A4VA 1T7PB 2NDOA 4OMVA 1ZCPA 4G19A 2AAWA 4AGSA 3A5WA 1K0MA 1ZMAA 3TDGA 4TR1A 5EPFA 4IBPA 3GYKA 1EOGA 3Q19A 3D21A 5JWRB 4HJMA 4K7OA 4N30A 3VFIA 4ZB6A 4EE0A 2I4AA 2VIMA 3A3TA 3P7XA 4NV5A 1CQHA 3L9SA 4BVYB 1H4OA 2H19A 2K8VA 5A5KA 1FOVA 5GAPD 2VOCA 4O5RA 5JWQB 3FZ9A 2DLXA 3FEUA 4D73B 2E0QA 1TU8A 4KDUA 1T00A 1G6WA 2WS2A 2AUVA 2H6ZA 4G10A 4V2MA 1A2MA 4IGJA 5ECNB 1YEPA 3M0FA 3EYTA 4JRRA 3V1WA 1G7OA 2WFCA 2HRNA 1AQWA 3KCMA 2YP6A 4ZIJA 2L4CA 3HCZA 2DC5A 4QL7A 4K0NA 3TKRA 4PXOA 1V57A 4G2EA 1XWCA 2J23A 5CYYA 1S3DA 4HOJA 5F8BA 5CRWA 4GSNA 2O89A 3APSA 2O85A 3U6VA 1X5EA 3VPQA 5IOXA 6GSWA 1OVNA 2JSYA 2PGTA 2HLSA 5J4UA 2P31A 2HQTA 4JZQA 5CREA 4IJIA 5H5RA 3E0UA 4KNDA 4ACSA 2GT5A 3TJJA 2PVOC 3LJRA 1XW6A 3TCOA 1GUHA 3EMPA 1OKDA 1DSBA 3ZTLA 1XPVA 2PU9C 5B7CA 2PERA 3GKKA 3L4NA 3KH7A 3GKMA 2Z9SA 4BVYA 1PRXA 5DJLA 4EDZA 1M2BA 1HYUA 4ILFA 1TRWA 5IMZA 5LCZA 4WF4A 4Q5NA 2IIYA 1NM3A 4D73A 1B9YC 3CYNA 4KE3A 1SKRB 4ZL9A 3GKNA 1SKSB 2LQOA 2F3MA 3O6TA 3TOUA 3HVSA 4MK3A 2YV7A 3BD2A 2MZCA 3HA9A 5HR1A 3IHQA 3TOTA 2C0EA 2I3YA 2HSHA 1OC8A 1X9SB 5CRHA 2B1LA 3F6DA 2H1BA 5ELGA 1FO5A 2CZ3A 2M80A 3HJMA 1JLVA 5EVOA 2MBSA 4K0GA 4ECCA 4F0BA 5D9TA 1PD21 3ZITA 2YOIA 2LTKA 3GX8A 4IKHA 3GHAA 1EV9A 1PL2A 2OJLA 5JWOB 1ZYEA 5J9CA 3H1NA 4ML1A 2V32A 4I2UA 3RDWA 11GSA 1T8EB 3K8NA 3IAS2 3IAM2 2LV3A 3GKXA 2AJQB 4HI7A 4YH2A 2FY6A 5JCWA 2PMTA 2CVBA 2VM1A 1SL0B 1K0AA 2LNSA 2RM5A 1EP7A 2RM6A 4PTSA 2V6OA 5LNKe 1E2YA 2CVDA 3D6IA 4KH7A 2N5FA 5ECQB 4XS4B 1XZOA 3GL5A 4ECIA 14GSA 1BJXA 2K9FA 2TRCP 5IMDA 5FT3A 5ECPB 2OACA 1WMJA 4PX1A 1TXXA 2LRCA 1DUGA 1QUWA 2C8UA 2DSAA 3HD5A 1WE0A 3H8QA 2F9SA 4LLRA 3ZIVA 2HI7A 3FKFA 1K0CA 3FYGA 1BQ7A 4KSOA 2LJKA 3RAZA 6GSVA 5IOWA 2FHEA 4PUAA 4PURA 3PINA 5DCGA 3ZIJA 3BBYA 4TXOB 3GH9A 1VF2A 3F4TA 1AQXA 1JZWA 2R6KA 4Q5RA 4WEYA 4WBRD 2FWGA 3DIEA 4KF9A 3G7YA 4HU9A 4ML6A 4GLTA 2M46A 2IMIA 5DAKB 1GH2A 1GWCA 4MABA 4K2DA 2YWNA 3BJ5A 1X5CA 1ST9A 3FK8A 1AIUA 3APQA 1SJZA 1SL1B 2MMOA 3EE2A 4JE1A 2WZ9A 1BAYA 3IK9A 4BVXA 5GAND 2VLVA 1U3AA 4TR0A 4EXJA 1ML6A 1ERVA 4IVFA 4N10A 5ELAA 2B1KA 2O8VB 4G0KA 1ZGNA 2NVLA 5D8IA 3F4SA 4XS4A 5ECKB 2H1GA 4F82A 2YJHA 2H8LA 1URMA 3CTGA 5EL8A 1ZYQB 5ECLB 3FR3A 2WJUA 3G7IA 2GVPA 5DQSA 4K7NA 1A8LA 3VWVA 3PGTA 2JSZA 1FG4A 1QFNA 2DBCA 3LXZA 1V40A 3DWVA 2RUEA 3DKSA 1M9BA 4J56E 4TR3A 4HDEA 4JR6A 2YANA 3GSSA 3QDNA 4MZBA 3QAVA 5J9BA 3QR6A 2E2MA 2H30A 3HXSA 4KX4A 3R3EA 4TXOA 2HRKA 4RQXA 1X5DA 2IMFA 1AXDA 3LGCA 2H6YA 1KNGA 1TP9A 3HJOA 3IPZA 5HR2A 5H5QA 2CQ9A 5G1KA 3UL3A 3ZRDA 4MP4A 2PVQA 2HE3A 3GURA 20GSA 5HR3A 2GLRA 2OKAA 2YWIA 5DAKA 1MDIA 3J7Yb 3BOAA 2BJXA 1ILOA 5J5NA 3DYRA 1HQOA 4NPBA 2PBJA 3GUSA 5CNWA 3IC4A 1SK1A 1JZOA 1G0TA 3F6FA 2LKUA 3HJPA 5CO3A 4O7HA 5F05A 1Z9HA 1EGOA 1UC7A 4MZCA 2AB6A 5CRDA 3ZFLA 2NPBA 4OO5A 3TKSE 1PMTA 3D22A 4ZXGA 2GZPA 4WXTA 3GMFA 4RI6A 5IIZA 5C00A 4X1UA 5GSTA 2RIIA 2F51A 2L4QA 3KMNA 5DJMA 3IE3A 2G2QA 2GS3A 4N11A 2ALBA 2GSTA 2MMNA 4J57E 1YF1A 2WGRA 1TI3A 1FHEA 6GSYA 1YF0A 1M2AA 3HZ4A 6GSSA 6GSTA 2WULA 4JU5A 3EWLA 2AHEA 2VCWA 2H1DA 3TKPA 2L6DA 4YAPA 4QL9A 2C80A 4ZBDA 4DSRA 1JZDA 1THOA 3FR6A 2B5YA 4BL7B 3QAWA 1R7HA 4K1FA 5AISA 3QD9A 4O32A 4LL4B 1I9DA 3UIWA 4OCFA 4ZB8A 1LBKA 5DBQA 3D0ZA 4FIWA 5ID2B 2MBTA 4GSTA 1MTCA 2RLIA 2JACA 2GZZA 1DE2A 5IMVA 4KAEA 1C72A 5G1LA 3MWHA 5B8BA 4MJCA 3VURA 1K3LA 3KM6A 4XS1A 2B6MA 3ZVJD 4MJEA 5F0GA 3VK9A 3L78A 1JLWA 1B48A 1K0DA 2OE0A 3PH9A 2HSMA 1O8XA 5ECHB 4NWYA 5IMCA 4OCEA 4TVEA 1GUKA 5J3RA 2FA8A 4XRDA 3FR9A 3R2QA 2BTOT 2P5RA 5G5FA 4OFMA 3CSHA 2GTUA 2OBIA 2PN8A 1U87A 4L0WA 2C3QA 4EF0A 3H79A 2YZUA 3HDCA 4BA7A 3GA4A 3TJFA 2D2ZA 3JCML 1XIYA 4ECBA 3I6AA 2R3XA 3H4KA 2LQQA 1GTIA 1QMVA 3FZAA 2PPTA 1JHBA 1M9AA 5IO0A 4XIHA 1V9WA 3IBHA 5FHIA 1NW2A 4HZ4A 3VI5A 2VD1A 2O87A 3RHCA 4OWYA 5G5EA 4I8BA 1A24A 4GQFA 2VL9A 4BL7A 3IRAA 3A2XA 1F6MC 5ENUA 4NAXA 1SU9A 2JU5A 2FA4A 1S3AA 2GQMA 3UOMA 4L5OA 5ID2A 10GSA 2JZRA 1SK2A 2GSQA 1FB0A 1O73A 3AY8A 2ES7A 2C0DA 1JFUA 4POKA 3GN3A 4ZB9A 2X8GA 2LEGA 5IPGA 1O8WA 2LJRA 1YDKA 4EUYA 2KP1A 5IO2A 5BMUA 1TK0B 5D93A 4MDCA 1B4PA 2CA8A 2LUSA 2K18A 4K9ZA 4WR5A 3WGDA 1F37A 4LMWA 2H66A 1QQ2A 1O81A 3UJ1A 1TDIA 2VLUA 4RUVA 1GLQA 3O3TA 3IA1A 4YQMA 3TB2A 3I43A 3VPTA 3WYWA 4IP1A 5G31A 3ZMKA 5B8AA 3EMXA 3FHKA 1IYIA 5IQYA 1OE7A 5IMFA 3Q74A 1K3YA 3KXOA 3FZ4A 3FRCA 3MNGA 3QFAC 1ON4A 2LS5A 1YY7A 3F0IA 3P2AA 4QQ7A 4FH8A 4IJ3A 4J2FA 5HR0A 4NV2A 1WRYA 1PX6A 1J0FA 2C1YA 2FCHA 1DE1A 3LG6A 4YAVA 13GSA 3ERFA 1K0NA 3FZ5A 3KP8A 2HT9A 1GL8A 2L57A 1ZZYA 4K7IA 3TRPA 1GP1A 1HNCA 18GSA 1Z6NA 1BYEA 5D73A 4MF6A 2FUG2 3TJKA 3DMLA 4OFTA 1WWJA 4ECJA 3HYPA 4OO4A 1WP0A 5GZZB 4GTUA 3F3RA 4G0LA 1VF3A 1SYXA 2V1MA 3KIJA 3TRQA 4EL1A 1RW1A 2IMKA 4V2LA 2L5LA 3IK7A 1HD2A 1J08A 3KTBA 2VLTA 2HRAA 1BEDA 2IJYA 1F2EA 1U88A 2VCQA 5ECRB 1B9XC 3E9JB 3CXGA 1TJDA 1XWKA 4KDYA 4HZ2A 1NHOA 1RQMA 2IMDA 5ECMB 2O7KA 1DBYA 3D4MA 3APOA 4K6XA 5A4VA 2FWHA 2B7KA 3WGEA 5HFGA 1R5PA 3CRTA 1SL2B 2IFQB 3UVTA 19GSA 1EZKA 4XHMA 3LYKA 5DALB 2H71A 3MDKA 12GSA 1PX7A 4IN0A 1TOFA 1EV4A 2E7PA 3U5RE 4L5LA 1X9WB 2R2JA 4Q5QA 3GSTA 5ABRA 1W4VA 1RK4A 4GRFA 4EC0A 3HVVA 2EIRA 2R37A 4XCSA 1SKWB 2G0FA 1I5GA 1NHYA 4MMMA 1GTBA 1Y25A 3I69A 5CAXA 2LRNA 6GSXA 3C8EA 3DVWA 2H70A 2PWJA 5AIXA 1FVJA 3LXTA 4PQHA 2H75A 4BWQA 8GSSA 2C3TA 4IP6A 2ZNMA 3F8UA 4MH3A 2TRXA 1A0FA 1A2LA 2XBIA 4IELA 1XBSA 1BG5A 2ON7A 3WT1A 4ZL7A 1TU7A 5HQPA 4PGTA 4PQIA 3WD6A 5JCUA 2R4VA 1OAZA 3GL3A 3M9JA 2L59A 1J9BA 3A2WA 1AAZA 5CP1A 2VO4A 3RHBA 2ZCTA 4HJ2A 3C1RA 3LSZA 3LFLA 4I6XA 3ERGA 3M3MA 1IYHA 2FNOA 3DRNA 4DSQA 2KUCA 4ZL8A 3I9V2 1TTZA 1WIKA 2IFQA 3IV4A 3ME8A 1TK5B 2DJ2A 3UARA 1O7UA 5GSSA 3F3QA 2GT6A 17GSA 5DALA 1YKAA 4HUAA 1XW5A 2CAQA 2VCZA 5ECOB 2YWMA 1B4QA 1EEMA 1MEKA 1SJIA 4NMUA 4I2TA 4EO3A 5IM9A 1EWXA 1OKTA 3L9UA 4HQSA 5F07A 1SD8A 3QCPA 4LA1A 2K6VA 3DXBA 4NHZA 1CQGA 3VWXA 4KCEA 4HQZA 2P0GA 2YV9A 2K8SA 3H93A 2VCTA 2IL3A 1U3IA 4XTSA 4LL1B 1ZOFA 2N5AA 3A2VA 3NIVA 3CMIA 3ME7A 1Z3EA 2AYTA 1LU4A 3FY7A 3ZLPA 2M72A 2AV4A 5G30A 3GNJA 3LORA 5B6MA 2NTOA 4KSMA 3QPMA 4N0ZA 3GV1A 1SJ6A 2DIZA 1PA3A 4MJBA 1XWGA 3NZNA 5ECIB 2FD3A 4E8HA 2B5XA 2OBKA 2VL2C 2IPAA 5HFKA 4F03A 4RI7A 1PGTA 3ISOA 4KGIA 1GNEA 4XS6A 1EP8A 1PQNA 2YN1A 4CW9A 2I81A 1YEXA 1FB6A 4GWRA 3QAGA 1NSWA 3C1SA 4ZBAA 2XPEA 3HHVA 2I1UA 2DMLA 1KBNA 3Q18A 1R4WA 1Q4JA 3UVHA 3EU3A 3TGZA 2OA7A 2B3SA 2CZ2A 3F9UA 5KN3A 2H01A 4AJ7A 5DVBA 4WKWA 4IS0A 1TI1A 4G9HA 3EC3A 3LYPA 3F63A 2C4JA
chains in the Genus database with same CATH superfamily
3HVXA 1XFLA 4V1Ap 2MMZA 4TRXA 2XHFA 4KA0A 4WR4A 3W6GA 2VAFA 4HEA2 1HNAA 4Q5FA 3US3A 2DJ0A 1YJ6A 3GIXA 3J7Yk 3KH9A 3TJBA 4AI6A 2ZUPA 4X43A 2FLSA 2X8HA 3C7MA 2A2SA 2WVZA 4BWSA 3CHXC 2J9HA 3RPPA 1GSDA 4F0CA 5ECSA 5CRGA 2GGTA 3P8WA 3M9KA 4JR4A 2QKEA 1F3BA 4OD7A 4ID0A 4DEJA 4WBJA 3C73A 3TU3B 3ZVJA 5H5SA 1M2DA 1M7TA 5F06A 3N5OA 1ZYNA 1XOBA 5COHA 4AJ8A 1GNWA 3W8JA 4TXVA 9GSSA 3RPNA 1JZRA 16GSA 1TRVA 1SENA 1T3BA 1U6TA 2LRTA 5KN0A 3RGBC 1MDKA 5D9WA 1GTAA 5JCGA 4CHSA 4X4JA 5AIVA 4TOPA 3CSJA 2KP2A 3RBTA 2OADA 3M1GA 1G7EA 4MNNA 3HZ8A 7GSSA 3FW2A 2EFEA 3SWLA 1QXHA 4MF7A 2H73A 1HNBA 3VLNA 4AF2A 4GCIA 1UA5A 1XVQA 2HRFA 1UVZA 3LEFA 1A0RP 2I9HA 3G7JA 2VCVA 1X0RA 3KEBA 2CX3A 2X64A 1G6YA 2C3NA 4WF5A 3MIXA 5D9XA 2DIYA 2WDUA 3CRUA 4N3ZA 2B5EA 2GSRA 2OE3A 3KGKA 2X4AA 5B6NA 1A8YA 4P3YB 4DVCA 3OR5A 4I5QA 1SVOA 3TUEA 1N2AA 4EKZA 4IQAA 4L0UA 3UEMA 3S9FA 1ABAA 4GSSA 1GTUA 2X99A 4Z7XA 4HS1A 3EURA 1GSSA 2DJ1A 2YPMA 1ZL9A 5DQYA 2HSNB 4TKYA 4KDXA 2GDRA 1Z6MA 4MH2A 2RUFA 1S3CA 3UBLA 5G2ZA 1TW9A 2VM2A 5KN2A 1E6BA 2JZTA 2KOKA 1FVKA 1K3OA 2PUKC 4KW6A 1W89A 1ERWA 4JBBA 4POLA 2CV4A 2GQKA 1TRUA 3ZZXA 2IMEA 1XVWA 4FQUA 2DKHA 1XW9A 4K8MA 4TN8A 5J41A 5E59A 1GSFA 1VF4A 2GQLA 3GTUB 3LQ7A 1R5AA 1AW9A 1Q98A 2ON5A 2WB9A 4H86A 3BCKA 2CAIA 3WGXA 1Z7PA 3HY2A 3MSZA 4W66A 4MZWA 2HNLA 3QMXA 3TJGA 1QK8A 1GRXA 4FYCA 1O85A 5DCHA 1M0UA 1BG1A 2IWTA 1GSEA 4AJ6A 2DJJA 5J47A 2H76A 2CVKA 4O5QA 3EVIA 1FW1A 2XPDA 1GUMA 5A5HB 2O36A 1SYRA 2HSNA 3GRXA 5KN1A 3PPUA 1ERUA 1EGRA 3L0HA 3HKRA 1T4ZA 2O3EA 3UMAA 5IMAA 3CSIA 4F9ZA 1PN9A 1BX9A 3PR8A 1I1IP 1AUCA 4I97A 4F2IA 3NOFA 2IN3A 1YEWC 4WETA 22GSA 4BVXB 1LJRA 4IHUA 3DGQA 1PN0A 2H6XA 4KB3A 4TW5A 3ERWA 3GFKA 2OE1A 3Q6OA 2WVXB 4JEDA 1KTEA 2V6KA 1THXA 1OC9B 4GF0A 1T4YA 4V2NA 4POMA 2FGXA 2DJKA 1TRSA 4TR4A 1PL1A 3GTUA 2F8AA 2BMXA 4YQUA 1VF1A 2R5GA 5DDLA 2TIRA 4ZILA 1F3AA 3WT2A 2JL4A 3ZL5A 2C0GA 2NBSA 4EIPA 3ZMLA 3DVXA 1WJKA 1XCCA 2HFDA 2MMAA 4MPGA 1KEBA 4NHWA 1UN2A 3C71A 3TRXA 2HYXA 1SK0A 1V2AA 5IPHA 4CY6A 2HRKB 2REMA 3TKQA 2HZFA 1WOUA 1FAAA 5A4UA 4IQ1A 2JADA 3FMWA 5A5HA 3IOSA 1SD9A 4MCUA 2DJ3A 1VRSD 4PQ1A 3BCIA 3VWUA 1PSQA 1XWBA 2H0IA 2VD0A 1H75A 4AKGA 2WCIA 1YKCA 1A2JA 2F8FA 3UAPA 1T1VA 2B7JA 5FWGA 2N5BA 1Z7RA 3IC8A 1GSUA 3ZFBA 2WZSA 1V58A 4MPFA 5INYA 1YZXA 2VL2A 3TKSA 2WVXA 1VGLA 3GH6A 2H74A 1TKDB 3GX0A 3KJYA 1OC9A 1Z5YE 4EVMA 5KEJA 2GZYA 4ZB7A 2A2RA 3EINA 2JZSA 1M99A 1AC1A 3M8NA 1EOHA 2FWFA 2QGVA 2X8CA 3ZYWA 4GXZA 4MLYA 5E4WA 3MAKA 2EIOA 4ZBBA 2CX4A 3E3EA 1PKZA 1O6JA 2FWEA 3LWAA 4KCAA 4XRAA 4EDYA 2YZHA 3IXRA 4FYUA 1XXUA 1USBA 3CBUA 4MF5A 2HZEB 2LNTA 1GLPA 1XWAA 2H1AA 1MD4A 2CT6A 2L5OA 2YJ7A 3D5JA 5BRTA 4KUNA 5HFIA 4DSSB 1AQVA 4CDOA 1PKWA 4ISDA 1B8XA 2EIQA 3KP9A 3RFRC 1ERTA 4PNFA 3VWWA 3G9BA 5A1NB 4O92A 2H0GA 4FO5A 1K0OA 5LD0A 2H72A 2H1LA 2EFCA 1XOAA 3QOUA 2L6CA 5KOWA 1GSQA 2GSSA 4OFNA 2KHPA 2DMMA 2VL3A 4E8EA 1ACVA 2EC4A 3KTLA 2P5QA 2E2GA 4A5PA 4NXIA 1MD3A 4TR1B 2HSYA 1OC3A 2UZ8A 3TKSC 3O76A 4RQRA 4HU7A 3KZQA 1R26A 4POBA 4G0IA 2YWOA 5C04A 4YQVA 5L71A 2HSMB 2HXKA 3CTFA 2YNXA 6GSUA 2H0HA 1YQ1A 5AGYA 3DD3A 4X0XA 4V1Ag 1WPIA 4AKIA 4N0VA 5A4WA 2V2GA 1OYJA 1X9MB 3IR4A 1A23A 3F4RA 1GSYA 3QFBC 3VI7A 4FYBA 2KLXA 3KMOA 4MJAA 1V98A 1TK8B 2HZEA 1F9MA 3L9VA 4Z2UA 1GULA 3N9JA 1EEJA 3W8SA 2XC2A 2LSTA 4PUFC 2QSIA 5D9VA 1N8JA 5EY6A 1PFOA 4DSSA 4L8EA 4MA9A 3EU4A 1OE8A 2YCDA 4GQCA 2C0FA 4AKHA 5AN1A 2XBQA 3SBCA 2V41A 2VCXA 5A1NA 3KD0A 1K0BA 2MYGA 4USSA 2VUPA 4IW9A 4PNGA 3ZREA 4ULXA 3ED3A 2QC7A 1Y6EA 4BPYA 2LJAA 3D4TA 1MDJA 2WRTA 4LMVA 3IDVA 5D96A 1QGVA 3LW9A 3UBKA 3DEXA 3P90A 2A4VA 1T7PB 2NDOA 4OMVA 1ZCPA 4G19A 2AAWA 4AGSA 3A5WA 1K0MA 1ZMAA 3TDGA 4TR1A 5EPFA 4IBPA 3GYKA 1EOGA 3Q19A 3D21A 5JWRB 4HJMA 5BMUB 4K7OA 4N30A 3VFIA 4ZB6A 4EE0A 2I4AA 2VIMA 3A3TA 3P7XA 4NV5A 1CQHA 3CWGA 3L9SA 4BVYB 1H4OA 2H19A 2K8VA 5A5KA 1FOVA 5GAPD 2VOCA 4O5RA 5JWQB 3FZ9A 2DLXA 3FEUA 4D73B 2E0QA 1TU8A 4KDUA 1T00A 4Z2RA 1G6WA 2WS2A 2AUVA 2H6ZA 4G10A 4V2MA 1A2MA 4IGJA 5ECNB 1YEPA 3M0FA 3EYTA 4JRRA 3V1WA 1G7OA 2WFCA 5A34A 2HRNA 1AQWA 3KCMA 2YP6A 4ZIJA 2L4CA 3HCZA 2DC5A 4QL7A 4K0NA 3TKRA 4PXOA 1V57A 4G2EA 1XWCA 2J23A 5CYYA 1S3DA 4HOJA 5F8BA 4ICYA 5CRWA 4GSNA 2O89A 3APSA 2O85A 3U6VA 1X5EA 3VPQA 5IOXA 6GSWA 1OVNA 2JSYA 2PGTA 2HLSA 5J4UA 2P31A 2HQTA 4JZQA 5CREA 4IJIA 5H5RA 3E0UA 4KNDA 4ACSA 2GT5A 3TJJA 2PVOC 4HSCX 3LJRA 1XW6A 3TCOA 1GUHA 3EMPA 1OKDA 1DSBA 3ZTLA 1XPVA 2X49A 2PU9C 5B7CA 2PERA 3GKKA 3L4NA 3KH7A 3GKMA 2Z9SA 4BVYA 1PRXA 5DJLA 4EDZA 1M2BA 1HYUA 4ILFA 1TRWA 2WW2A 5IMZA 5LCZA 4WF4A 4Q5NA 2IIYA 1NM3A 4D73A 1B9YC 3CYNA 4KE3A 1SKRB 4ZL9A 3GKNA 1SKSB 2LQOA 2F3MA 3O6TA 3TOUA 3HVSA 4MK3A 2YV7A 3BD2A 2MZCA 3HA9A 5HR1A 4GDFA 3IHQA 3TOTA 2C0EA 2I3YA 2HSHA 1OC8A 1X9SB 5CRHA 2B1LA 3F6DA 2H1BA 5ELGA 1FO5A 2CZ3A 2M80A 3HJMA 1JLVA 5EVOA 2MBSA 4K0GA 4ECCA 4F0BA 5D9TA 1PD21 3ZITA 2DKIA 2YOIA 2LTKA 3GX8A 4IKHA 3GHAA 1EV9A 1PL2A 3HMJG 2OJLA 2A2PA 5JWOB 1ZYEA 5J9CA 3H1NA 4E68A 4ML1A 2V32A 4I2UA 3RDWA 11GSA 1T8EB 3K8NA 3IAS2 3IAM2 2LV3A 3GKXA 1S4BP 2AJQB 4HI7A 4YH2A 2FY6A 5JCWA 2PMTA 2CVBA 2VM1A 1SL0B 1K0AA 2LNSA 2RM5A 1EP7A 2RM6A 4PTSA 2V6OA 5LNKe 1E2YA 2CVDA 3D6IA 4KH7A 2N5FA 5ECQB 4XS4B 1XZOA 3GL5A 4ECIA 14GSA 1BJXA 2K9FA 2TRCP 5IMDA 5FT3A 5ECPB 2OACA 5J40A 1WMJA 4PX1A 1TXXA 2LRCA 1DUGA 1QUWA 2C8UA 2DSAA 3HD5A 1WE0A 3H8QA 2F9SA 4LLRA 3ZIVA 2HI7A 3FKFA 1K0CA 3EPTA 3FYGA 1BQ7A 4KSOA 2LJKA 3RAZA 6GSVA 5IOWA 2FHEA 4PUAA 4PURA 3PINA 4K2XA 5DCGA 3ZIJA 3BBYA 3HVNA 2R0CA 4TXOB 3GH9A 1VF2A 3F4TA 2QA1A 1AQXA 1JZWA 2R6KA 4Q5RA 4WEYA 4WBRD 2FWGA 3DIEA 4KF9A 3G7YA 4HU9A 4ML6A 4GLTA 2M46A 2IMIA 5DAKB 1GH2A 1GWCA 4MABA 4K2DA 2YWNA 3BJ5A 1X5CA 1ST9A 3FK8A 1AIUA 3APQA 1SJZA 1SL1B 2MMOA 3EE2A 4JE1A 2WZ9A 1BAYA 3IK9A 4BVXA 1N25A 5GAND 2VLVA 1U3AA 4TR0A 4EXJA 1ML6A 1ERVA 4IVFA 4N10A 5ELAA 2B1KA 2O8VB 4G0KA 4CY8A 1ZGNA 2NVLA 5D8IA 3F4SA 4XS4A 5ECKB 2H1GA 4F82A 2YJHA 2H8LA 1URMA 3CTGA 5EL8A 1ZYQB 5ECLB 3FR3A 2WJUA 2O5VA 3G7IA 2GVPA 5DQSA 4K7NA 1A8LA 3VWVA 3PGTA 2JSZA 1FG4A 1QFNA 2DBCA 3LXZA 1V40A 3DWVA 2RUEA 3DKSA 1M9BA 4J56E 4TR3A 4HDEA 4JR6A 2YANA 3GSSA 3QDNA 4MZBA 1BF5A 3QAVA 5J9BA 3QR6A 2E2MA 2H30A 3HXSA 4KX4A 3R3EA 4TXOA 2HRKA 4RQXA 1X5DA 2IMFA 1AXDA 3LGCA 2H6YA 1KNGA 1TP9A 3HJOA 3IPZA 5HR2A 5H5QA 2CQ9A 5G1KA 3UL3A 3ZRDA 4MP4A 1S3RA 2PVQA 2HE3A 3GURA 20GSA 5HR3A 2GLRA 2OKAA 2YWIA 5DAKA 1MDIA 3J7Yb 3BOAA 2BJXA 1ILOA 5J5NA 3DYRA 1HQOA 4NPBA 2PBJA 1ZYPA 3GUSA 5CNWA 3IC4A 1SK1A 1FOHA 1JZOA 1G0TA 3F6FA 2LKUA 3HJPA 5CO3A 4O7HA 5F05A 1Z9HA 1EGOA 1UC7A 4MZCA 2AB6A 5CRDA 3ZFLA 2NPBA 4OO5A 3TKSE 1PMTA 3D22A 4ZXGA 2GZPA 3MYDA 4WXTA 3GMFA 4RI6A 5IIZA 5C00A 4X1UA 5GSTA 2RIIA 2F51A 2L4QA 3KMNA 5DJMA 3IE3A 2G2QA 2GS3A 4N11A 2ALBA 2GSTA 1YVLA 2MMNA 4J57E 1YF1A 2WGRA 4BIKA 1TI3A 1FHEA 6GSYA 1YF0A 1M2AA 3HZ4A 6GSSA 6GSTA 2WULA 4JU5A 3EWLA 2AHEA 2VCWA 2H1DA 3TKPA 2L6DA 4YAPA 4QL9A 2C80A 4ZBDA 4DSRA 1JZDA 1THOA 3FR6A 2B5YA 4BL7B 3QAWA 1R7HA 4K1FA 5AISA 3QD9A 4O32A 1M3IA 4LL4B 1I9DA 3UIWA 4OCFA 4ZB8A 1LBKA 5DBQA 3D0ZA 4FIWA 5ID2B 2MBTA 4GSTA 1MTCA 2RLIA 2JACA 2GZZA 1DE2A 4EIQA 5IMVA 4KAEA 1C72A 5G1LA 3MWHA 5B8BA 4MJCA 3VURA 1K3LA 3KM6A 4XS1A 2B6MA 3ZVJD 4MJEA 5F0GA 3VK9A 3L78A 1JLWA 1B48A 1K0DA 2OE0A 3PH9A 2HSMA 1O8XA 5ECHB 4NWYA 5IMCA 4OCEA 4TVEA 1GUKA 5J3RA 2FA8A 4XRDA 3FR9A 3R2QA 2BTOT 2P5RA 5G5FA 4OFMA 3CSHA 2GTUA 2OBIA 2PN8A 1U87A 4L0WA 2C3QA 4EF0A 3H79A 2YZUA 3HDCA 4BA7A 3GA4A 3TJFA 2D2ZA 3JCML 4G01A 1XIYA 4ECBA 3I6AA 2R3XA 2R0PA 3H4KA 2LQQA 1GTIA 1QMVA 3FZAA 2PPTA 1JHBA 1M9AA 5IO0A 4XIHA 1V9WA 3IBHA 5FHIA 1NW2A 4HZ4A 3VI5A 2VD1A 2O87A 1M3JA 3RHCA 4OWYA 5G5EA 4I8BA 1A24A 4GQFA 2EFDA 2VL9A 4BL7A 3IRAA 3A2XA 1F6MC 5ENUA 4NAXA 1SU9A 2JU5A 2FA4A 4K5SA 1S3AA 2GQMA 3UOMA 4L5OA 5ID2A 10GSA 2JZRA 1SK2A 2GSQA 1FB0A 1O73A 3AY8A 2ES7A 2C0DA 1JFUA 4POKA 4Z2TA 3GN3A 4YKFA 4ZB9A 2X8GA 2LEGA 5IPGA 2UV8G 1O8WA 2LJRA 1YDKA 4EUYA 2KP1A 5IO2A 5BMUA 1TK0B 5D93A 4MDCA 1B4PA 2CA8A 2LUSA 2K18A 4K9ZA 4WR5A 5KOXA 3WGDA 1F37A 4LMWA 2H66A 4PI2C 1QQ2A 1O81A 3UJ1A 1TDIA 4FXYP 2VLUA 4RUVA 1GLQA 3O3TA 3IA1A 4YQMA 3TB2A 3I43A 1XG8A 3VPTA 3WYWA 4IP1A 2R0GA 5G31A 3ZMKA 5B8AA 3EMXA 3FHKA 1IYIA 5IQYA 1OE7A 5IMFA 3Q74A 1K3YA 3KXOA 1TXUA 3FZ4A 3FRCA 3MNGA 3QFAC 1ON4A 2LS5A 1YY7A 3F0IA 3P2AA 4QQ7A 4FH8A 4IJ3A 4J2FA 5HR0A 4NV2A 1WRYA 1PX6A 1J0FA 2C1YA 2FCHA 2OT3A 1DE1A 3LG6A 4YAVA 4O5UA 13GSA 3ERFA 1K0NA 3FZ5A 3KP8A 2HT9A 1GL8A 2L57A 1ZZYA 1SVMA 4K7IA 3TRPA 5J4YA 1GP1A 1HNCA 18GSA 1Z6NA 1BYEA 2VKZG 5D73A 4MF6A 2FUG2 3TJKA 3DMLA 4OFTA 1WWJA 4ECJA 3HYPA 4OO4A 1WP0A 5GZZB 4GTUA 3F3RA 4G0LA 1VF3A 1SVLA 1SYXA 2V1MA 3KIJA 3TRQA 4EL1A 1RW1A 2IMKA 4V2LA 2L5LA 3IK7A 1HD2A 1J08A 3KTBA 2VLTA 2HRAA 1BEDA 2IJYA 1F2EA 1U88A 2VCQA 5ECRB 1B9XC 3E9JB 3CXGA 1TJDA 1XWKA 4KDYA 4HZ2A 1NHOA 1RQMA 2IMDA 3IHGA 5ECMB 2O7KA 1DBYA 3D4MA 3APOA 4K6XA 5A4VA 2FWHA 2B7KA 3WGEA 5HFGA 1R5PA 3CRTA 1SL2B 2IFQB 3UVTA 19GSA 1EZKA 4XHMA 3LYKA 5DALB 2H71A 3MDKA 12GSA 1PX7A 4IN0A 1TOFA 1EV4A 2E7PA 3U5RE 4L5LA 1X9WB 2R2JA 4Q5QA 3GSTA 5ABRA 1W4VA 1RK4A 4GRFA 4EC0A 3HVVA 2EIRA 2R37A 4XCSA 1SKWB 2G0FA 1I5GA 1NHYA 4MMMA 1GTBA 1Y25A 3I69A 4K5RA 5CAXA 2LRNA 6GSXA 3C8EA 3DVWA 2H70A 2PWJA 5AIXA 1FVJA 3LXTA 4PQHA 2H75A 4BWQA 8GSSA 2WW3A 2C3TA 2A4HA 4IP6A 2ZNMA 3F8UA 4YKGA 4MH3A 2TRXA 1A0FA 1A2LA 2XBIA 4IELA 1XBSA 1BG5A 2ON7A 3WT1A 4ZL7A 1TU7A 5HQPA 4PGTA 4PQIA 4PHZC 3WD6A 5JCUA 2R4VA 1OAZA 3GL3A 3M9JA 2L59A 1J9BA 3A2WA 1AAZA 5CP1A 2VO4A 3RHBA 2ZCTA 4HJ2A 3C1RA 3LSZA 3LFLA 2WW1A 4QMKA 4I6XA 3ERGA 3M3MA 1IYHA 5J4VA 2FNOA 3DRNA 4DSQA 2KUCA 4ZL8A 3I9V2 1TTZA 1WIKA 4AKXB 2IFQA 3IV4A 3ME8A 1TK5B 2DJ2A 3UARA 1O7UA 2WW0A 5GSSA 3F3QA 2GT6A 17GSA 5DALA 1YKAA 4HUAA 1XW5A 2CAQA 2VCZA 5ECOB 2YWMA 4PI0C 1B4QA 3CQFA 1EEMA 1MEKA 1SJIA 4NMUA 4I2TA 4EO3A 5IM9A 1EWXA 1OKTA 3L9UA 4HQSA 5F07A 1SD8A 3QCPA 4LA1A 2K6VA 3DXBA 4NHZA 1CQGA 3VWXA 4KCEA 4HQZA 2P0GA 3A5IA 2YV9A 2K8SA 2QA2A 3H93A 2VCTA 2IL3A 1U3IA 4XTSA 4LL1B 1ZOFA 2N5AA 3A2VA 3NIVA 3CMIA 3ME7A 1Z3EA 2AYTA 1LU4A 3FY7A 3ZLPA 2M72A 2AV4A 5G30A 3GNJA 3LORA 5B6MA 2NTOA 4KSMA 3QPMA 4N0ZA 3GV1A 1SJ6A 2DIZA 1PA3A 4MJBA 2WVYA 1XWGA 3NZNA 5ECIB 2FD3A 4E8HA 2B5XA 2OBKA 2VL2C 2IPAA 5HFKA 4F03A 4RI7A 1PGTA 3ISOA 4KGIA 1GNEA 4XS6A 1EP8A 1PQNA 2YN1A 4CW9A 2I81A 1YEXA 1FB6A 4GWRA 3QAGA 1NSWA 3C1SA 4ZBAA 2XPEA 3HHVA 2I1UA 2DMLA 1KBNA 3Q18A 1R4WA 1Q4JA 1Y1UA 3UVHA 3EU3A 3TGZA 2OA7A 2B3SA 2CZ2A 3F9UA 5KN3A 2H01A 4AJ7A 2EFHA 5DVBA 4WKWA 4IS0A 1TI1A 4G9HA 3EC3A 5A34B 3LYPA 3F63A 2C4JA
chains in the Genus database with same CATH topology
3HVXA 1XFLA 4V1Ap 2MMZA 4TRXA 2XHFA 4KA0A 4WR4A 3W6GA 2VAFA 4HEA2 1HNAA 4Q5FA 3US3A 2DJ0A 1YJ6A 3GIXA 3J7Yk 3KH9A 3TJBA 4AI6A 2ZUPA 4X43A 2FLSA 2X8HA 3C7MA 2A2SA 4BWSA 2J9HA 3RPPA 1GSDA 4F0CA 5ECSA 5CRGA 2GGTA 3P8WA 3M9KA 4JR4A 2QKEA 1F3BA 4OD7A 4ID0A 4DEJA 4WBJA 3C73A 3TU3B 3ZVJA 5H5SA 1M2DA 1M7TA 5F06A 3N5OA 1ZYNA 1XOBA 5COHA 4AJ8A 1GNWA 3W8JA 4TXVA 9GSSA 3RPNA 1JZRA 16GSA 1TRVA 1SENA 1T3BA 1U6TA 2LRTA 5KN0A 1MDKA 5D9WA 1GTAA 5JCGA 4CHSA 4X4JA 5AIVA 4TOPA 3CSJA 2KP2A 3RBTA 3M1GA 2OADA 1G7EA 4MNNA 3HZ8A 7GSSA 3FW2A 2EFEA 3SWLA 1QXHA 4MF7A 2H73A 1HNBA 3VLNA 4AF2A 4GCIA 1UA5A 1XVQA 2HRFA 1UVZA 3LEFA 1A0RP 2I9HA 3G7JA 2VCVA 1X0RA 3KEBA 2CX3A 2X64A 1G6YA 2C3NA 4WF5A 3MIXA 5D9XA 2DIYA 2WDUA 3CRUA 4N3ZA 2B5EA 2GSRA 2OE3A 3KGKA 2X4AA 5B6NA 1A8YA 4P3YB 4DVCA 3OR5A 4I5QA 1SVOA 3TUEA 1N2AA 4EKZA 4IQAA 4L0UA 3UEMA 3S9FA 1ABAA 4GSSA 1GTUA 2X99A 4Z7XA 4HS1A 3EURA 1GSSA 2DJ1A 2YPMA 1ZL9A 5DQYA 2HSNB 4TKYA 4KDXA 2GDRA 1Z6MA 4MH2A 2RUFA 1S3CA 3UBLA 5G2ZA 1TW9A 2VM2A 5KN2A 1E6BA 2JZTA 2KOKA 1FVKA 1K3OA 2PUKC 4KW6A 1W89A 1ERWA 4JBBA 4POLA 2CV4A 2GQKA 1TRUA 3ZZXA 2IMEA 1XVWA 4FQUA 2DKHA 1XW9A 4K8MA 4TN8A 5J41A 5E59A 1GSFA 1VF4A 2GQLA 3GTUB 3LQ7A 1R5AA 1AW9A 1Q98A 2ON5A 2WB9A 4H86A 3BCKA 2CAIA 3WGXA 1Z7PA 3HY2A 3MSZA 4W66A 4MZWA 2HNLA 3QMXA 3TJGA 1QK8A 1GRXA 4FYCA 1O85A 5DCHA 1M0UA 1BG1A 2IWTA 1GSEA 4AJ6A 2DJJA 5J47A 2H76A 2CVKA 4O5QA 3EVIA 1FW1A 2XPDA 1GUMA 5A5HB 1SYRA 2HSNA 3GRXA 5KN1A 3PPUA 1ERUA 1EGRA 3L0HA 3HKRA 1T4ZA 3UMAA 5IMAA 3CSIA 4F9ZA 1PN9A 1BX9A 3PR8A 1AUCA 4I97A 4F2IA 3NOFA 2IN3A 4WETA 22GSA 4BVXB 1LJRA 4IHUA 3DGQA 1PN0A 2H6XA 4KB3A 4TW5A 3ERWA 3GFKA 2OE1A 3Q6OA 4JEDA 1KTEA 2V6KA 1THXA 1OC9B 4GF0A 1T4YA 4V2NA 4POMA 2FGXA 2DJKA 1TRSA 4TR4A 1PL1A 3GTUA 2F8AA 2BMXA 4YQUA 1VF1A 2R5GA 5DDLA 2TIRA 4ZILA 1F3AA 3WT2A 2JL4A 3ZL5A 2C0GA 2NBSA 4EIPA 3ZMLA 3DVXA 1WJKA 1XCCA 2HFDA 2MMAA 4MPGA 1KEBA 4NHWA 1UN2A 3C71A 3TRXA 2HYXA 1SK0A 1V2AA 5IPHA 4CY6A 2HRKB 2REMA 3TKQA 2HZFA 1WOUA 1FAAA 5A4UA 4IQ1A 2JADA 3FMWA 5A5HA 3IOSA 1SD9A 4MCUA 2DJ3A 1VRSD 4PQ1A 3BCIA 3VWUA 1PSQA 1XWBA 2H0IA 2VD0A 1H75A 4AKGA 2WCIA 1YKCA 1A2JA 2F8FA 3UAPA 1T1VA 2B7JA 5FWGA 2N5BA 1Z7RA 3IC8A 1GSUA 3ZFBA 1V58A 4MPFA 5INYA 1YZXA 2VL2A 3TKSA 1VGLA 3GH6A 2H74A 1TKDB 3GX0A 3KJYA 1OC9A 1Z5YE 4EVMA 5KEJA 2GZYA 4ZB7A 2A2RA 3EINA 2JZSA 1M99A 1AC1A 3M8NA 1EOHA 2FWFA 2QGVA 2X8CA 3ZYWA 4GXZA 4MLYA 5E4WA 3MAKA 2EIOA 4ZBBA 2CX4A 3E3EA 1PKZA 1O6JA 2FWEA 3LWAA 4KCAA 4XRAA 4EDYA 2YZHA 3IXRA 4FYUA 1XXUA 1USBA 3CBUA 4MF5A 2HZEB 2LNTA 1GLPA 1XWAA 2H1AA 1MD4A 2CT6A 2L5OA 2YJ7A 3D5JA 5BRTA 4KUNA 5HFIA 4DSSB 1AQVA 4CDOA 1PKWA 4ISDA 1B8XA 2EIQA 3KP9A 1ERTA 4PNFA 3VWWA 3G9BA 5A1NB 4O92A 2H0GA 4FO5A 1K0OA 5LD0A 2H72A 2H1LA 2EFCA 1XOAA 3QOUA 2L6CA 5KOWA 1GSQA 2GSSA 4OFNA 2KHPA 2DMMA 2VL3A 4E8EA 1ACVA 2EC4A 3KTLA 2P5QA 2E2GA 4A5PA 4NXIA 1MD3A 4TR1B 2HSYA 1OC3A 2UZ8A 3TKSC 3O76A 4RQRA 4HU7A 3KZQA 1R26A 4POBA 4G0IA 2YWOA 5C04A 4YQVA 5L71A 2HSMB 2HXKA 3CTFA 2YNXA 6GSUA 2H0HA 1YQ1A 5AGYA 3DD3A 4X0XA 4V1Ag 1WPIA 4AKIA 4N0VA 5A4WA 2V2GA 1OYJA 1X9MB 3IR4A 1A23A 3F4RA 1GSYA 3QFBC 3VI7A 4FYBA 2KLXA 3KMOA 4MJAA 1V98A 1TK8B 2HZEA 1F9MA 3L9VA 4Z2UA 1GULA 3N9JA 1EEJA 3W8SA 2XC2A 2LSTA 4PUFC 2QSIA 5D9VA 1N8JA 5EY6A 4DSSA 4L8EA 4MA9A 3EU4A 1OE8A 2YCDA 4GQCA 2C0FA 4AKHA 5AN1A 2XBQA 3SBCA 2V41A 2VCXA 5A1NA 3KD0A 1K0BA 2MYGA 4USSA 2VUPA 4IW9A 4PNGA 3ZREA 4ULXA 3ED3A 2QC7A 1Y6EA 4BPYA 2LJAA 3D4TA 1MDJA 2WRTA 4LMVA 3IDVA 5D96A 1QGVA 3LW9A 3UBKA 3DEXA 3P90A 2A4VA 1T7PB 2NDOA 4OMVA 1ZCPA 4G19A 2AAWA 4AGSA 3A5WA 1K0MA 1ZMAA 3TDGA 4TR1A 5EPFA 4IBPA 3GYKA 1EOGA 3Q19A 3D21A 5JWRB 4HJMA 5BMUB 4K7OA 4N30A 3VFIA 4ZB6A 4EE0A 2I4AA 2VIMA 3A3TA 3P7XA 4NV5A 1CQHA 3CWGA 3L9SA 4BVYB 1H4OA 2H19A 2K8VA 5A5KA 1FOVA 5GAPD 2VOCA 4O5RA 5JWQB 3FZ9A 2DLXA 3FEUA 4D73B 2E0QA 1TU8A 4KDUA 1T00A 4Z2RA 1G6WA 2WS2A 2AUVA 2H6ZA 4G10A 4V2MA 1A2MA 4IGJA 5ECNB 1YEPA 3M0FA 3EYTA 4JRRA 3V1WA 1G7OA 2WFCA 5A34A 2HRNA 1AQWA 3KCMA 2YP6A 4ZIJA 2L4CA 3HCZA 2DC5A 4QL7A 4K0NA 3TKRA 4PXOA 1V57A 4G2EA 1XWCA 2J23A 5CYYA 1S3DA 4HOJA 5F8BA 4ICYA 5CRWA 4GSNA 2O89A 3APSA 2O85A 3U6VA 1X5EA 3VPQA 5IOXA 6GSWA 1OVNA 2JSYA 2PGTA 2HLSA 5J4UA 2P31A 2HQTA 4JZQA 5CREA 4IJIA 5H5RA 3E0UA 4KNDA 4ACSA 2GT5A 3TJJA 2PVOC 3LJRA 1XW6A 3TCOA 1GUHA 3EMPA 1OKDA 1DSBA 3ZTLA 1XPVA 2X49A 2PU9C 5B7CA 2PERA 3GKKA 3L4NA 3KH7A 3GKMA 2Z9SA 4BVYA 1PRXA 5DJLA 4EDZA 1M2BA 1HYUA 4ILFA 1TRWA 5IMZA 5LCZA 4WF4A 4Q5NA 2IIYA 1NM3A 4D73A 1B9YC 3CYNA 4KE3A 1SKRB 4ZL9A 3GKNA 1SKSB 2LQOA 2F3MA 3O6TA 3TOUA 3HVSA 4MK3A 2YV7A 3BD2A 2MZCA 3HA9A 5HR1A 4GDFA 3IHQA 3TOTA 2C0EA 2I3YA 2HSHA 1OC8A 1X9SB 5CRHA 2B1LA 3F6DA 2H1BA 5ELGA 1FO5A 2CZ3A 2M80A 3HJMA 1JLVA 5EVOA 2MBSA 4K0GA 4ECCA 4F0BA 5D9TA 1PD21 3ZITA 2DKIA 2YOIA 2LTKA 3GX8A 4IKHA 3GHAA 1EV9A 1PL2A 3HMJG 2OJLA 2A2PA 5JWOB 1ZYEA 5J9CA 3H1NA 4E68A 4ML1A 2V32A 4I2UA 3RDWA 11GSA 1T8EB 3K8NA 3IAS2 3IAM2 2LV3A 3GKXA 2AJQB 4HI7A 4YH2A 2FY6A 5JCWA 2PMTA 2CVBA 2VM1A 1SL0B 1K0AA 2LNSA 2RM5A 1EP7A 2RM6A 4PTSA 2V6OA 5LNKe 1E2YA 2CVDA 3D6IA 4KH7A 2N5FA 5ECQB 4XS4B 1XZOA 3GL5A 4ECIA 14GSA 1BJXA 2K9FA 2TRCP 5IMDA 5FT3A 5ECPB 2OACA 5J40A 1WMJA 4PX1A 1TXXA 2LRCA 1DUGA 1QUWA 2C8UA 2DSAA 3HD5A 1WE0A 3H8QA 2F9SA 4LLRA 3ZIVA 2HI7A 3FKFA 1K0CA 3EPTA 3FYGA 1BQ7A 4KSOA 2LJKA 3RAZA 6GSVA 5IOWA 2FHEA 4PUAA 4PURA 3PINA 4K2XA 5DCGA 3ZIJA 3BBYA 2R0CA 4TXOB 3GH9A 1VF2A 3F4TA 2QA1A 1AQXA 1JZWA 2R6KA 4Q5RA 4WEYA 4WBRD 2FWGA 3DIEA 4KF9A 3G7YA 4HU9A 4ML6A 4GLTA 2M46A 2IMIA 5DAKB 1GH2A 1GWCA 4MABA 4K2DA 2YWNA 3BJ5A 1X5CA 1ST9A 3FK8A 1AIUA 3APQA 1SJZA 1SL1B 2MMOA 3EE2A 4JE1A 2WZ9A 1BAYA 3IK9A 4BVXA 1N25A 5GAND 2VLVA 1U3AA 4TR0A 4EXJA 1ML6A 1ERVA 4IVFA 4N10A 5ELAA 2B1KA 2O8VB 4G0KA 4CY8A 1ZGNA 2NVLA 5D8IA 3F4SA 4XS4A 5ECKB 2H1GA 4F82A 2YJHA 2H8LA 1URMA 3CTGA 5EL8A 1ZYQB 5ECLB 3FR3A 2WJUA 2O5VA 3G7IA 2GVPA 5DQSA 4K7NA 1A8LA 3VWVA 3PGTA 2JSZA 1FG4A 1QFNA 2DBCA 3LXZA 1V40A 3DWVA 2RUEA 3DKSA 1M9BA 4J56E 4TR3A 4HDEA 4JR6A 2YANA 3GSSA 3QDNA 4MZBA 1BF5A 3QAVA 5J9BA 3QR6A 2E2MA 2H30A 3HXSA 4KX4A 3R3EA 4TXOA 2HRKA 4RQXA 1X5DA 2IMFA 1AXDA 3LGCA 2H6YA 1KNGA 1TP9A 3HJOA 3IPZA 5HR2A 5H5QA 2CQ9A 5G1KA 3UL3A 3ZRDA 4MP4A 2PVQA 2HE3A 3GURA 20GSA 5HR3A 2GLRA 2OKAA 2YWIA 5DAKA 1MDIA 3J7Yb 3BOAA 2BJXA 1ILOA 5J5NA 3DYRA 1HQOA 4NPBA 2PBJA 1ZYPA 3GUSA 5CNWA 3IC4A 1SK1A 1FOHA 1JZOA 1G0TA 3F6FA 2LKUA 3HJPA 5CO3A 4O7HA 5F05A 1Z9HA 1EGOA 1UC7A 4MZCA 2AB6A 5CRDA 3ZFLA 2NPBA 4OO5A 3TKSE 1PMTA 3D22A 4ZXGA 2GZPA 3MYDA 4WXTA 3GMFA 4RI6A 5IIZA 5C00A 4X1UA 5GSTA 2RIIA 2F51A 2L4QA 3KMNA 5DJMA 3IE3A 2G2QA 2GS3A 4N11A 2ALBA 2GSTA 1YVLA 2MMNA 4J57E 1YF1A 2WGRA 1TI3A 1FHEA 6GSYA 1YF0A 1M2AA 3HZ4A 6GSSA 6GSTA 2WULA 4JU5A 3EWLA 2AHEA 2VCWA 2H1DA 3TKPA 2L6DA 4YAPA 4QL9A 2C80A 4ZBDA 4DSRA 1JZDA 1THOA 3FR6A 2B5YA 4BL7B 3QAWA 1R7HA 4K1FA 5AISA 3QD9A 4O32A 4LL4B 1I9DA 3UIWA 4OCFA 4ZB8A 1LBKA 5DBQA 3D0ZA 4FIWA 5ID2B 2MBTA 4GSTA 1MTCA 2RLIA 2JACA 2GZZA 1DE2A 4EIQA 5IMVA 4KAEA 1C72A 5G1LA 3MWHA 5B8BA 4MJCA 3VURA 1K3LA 3KM6A 4XS1A 2B6MA 3ZVJD 4MJEA 5F0GA 3VK9A 3L78A 1JLWA 1B48A 1K0DA 2OE0A 3PH9A 2HSMA 1O8XA 5ECHB 4NWYA 5IMCA 4OCEA 4TVEA 1GUKA 5J3RA 2FA8A 4XRDA 3FR9A 3R2QA 2BTOT 2P5RA 5G5FA 4OFMA 3CSHA 2GTUA 2OBIA 2PN8A 1U87A 4L0WA 2C3QA 4EF0A 3H79A 2YZUA 3HDCA 4BA7A 3GA4A 3TJFA 2D2ZA 3JCML 4G01A 1XIYA 4ECBA 3I6AA 2R3XA 2R0PA 3H4KA 2LQQA 1GTIA 1QMVA 3FZAA 2PPTA 1JHBA 1M9AA 5IO0A 4XIHA 1V9WA 3IBHA 5FHIA 1NW2A 4HZ4A 3VI5A 2VD1A 2O87A 3RHCA 4OWYA 5G5EA 4I8BA 1A24A 4GQFA 2EFDA 2VL9A 4BL7A 3IRAA 3A2XA 1F6MC 5ENUA 4NAXA 1SU9A 2JU5A 2FA4A 4K5SA 1S3AA 2GQMA 3UOMA 4L5OA 5ID2A 10GSA 2JZRA 1SK2A 2GSQA 1FB0A 1O73A 3AY8A 2ES7A 2C0DA 1JFUA 4POKA 4Z2TA 3GN3A 4YKFA 4ZB9A 2X8GA 2LEGA 5IPGA 2UV8G 1O8WA 2LJRA 1YDKA 4EUYA 2KP1A 5IO2A 5BMUA 1TK0B 5D93A 4MDCA 1B4PA 2CA8A 2LUSA 2K18A 4K9ZA 4WR5A 5KOXA 3WGDA 1F37A 4LMWA 2H66A 1QQ2A 1O81A 3UJ1A 1TDIA 2VLUA 4RUVA 1GLQA 3O3TA 3IA1A 4YQMA 3TB2A 3I43A 3VPTA 3WYWA 4IP1A 2R0GA 5G31A 3ZMKA 5B8AA 3EMXA 3FHKA 1IYIA 5IQYA 1OE7A 5IMFA 3Q74A 1K3YA 3KXOA 1TXUA 3FZ4A 3FRCA 3MNGA 3QFAC 1ON4A 2LS5A 1YY7A 3F0IA 3P2AA 4QQ7A 4FH8A 4IJ3A 4J2FA 5HR0A 4NV2A 1WRYA 1PX6A 1J0FA 2C1YA 2FCHA 2OT3A 1DE1A 3LG6A 4YAVA 4O5UA 13GSA 3ERFA 1K0NA 3FZ5A 3KP8A 2HT9A 1GL8A 2L57A 1ZZYA 1SVMA 4K7IA 3TRPA 5J4YA 1GP1A 1HNCA 18GSA 1Z6NA 1BYEA 2VKZG 5D73A 4MF6A 2FUG2 3TJKA 3DMLA 4OFTA 1WWJA 4ECJA 3HYPA 4OO4A 1WP0A 5GZZB 4GTUA 3F3RA 4G0LA 1VF3A 1SVLA 1SYXA 2V1MA 3KIJA 3TRQA 4EL1A 1RW1A 2IMKA 4V2LA 2L5LA 3IK7A 1HD2A 1J08A 3KTBA 2VLTA 2HRAA 1BEDA 2IJYA 1F2EA 1U88A 2VCQA 5ECRB 1B9XC 3E9JB 3CXGA 1TJDA 1XWKA 4KDYA 4HZ2A 1NHOA 1RQMA 2IMDA 3IHGA 5ECMB 2O7KA 1DBYA 3D4MA 3APOA 4K6XA 5A4VA 2FWHA 2B7KA 3WGEA 5HFGA 1R5PA 3CRTA 1SL2B 2IFQB 3UVTA 19GSA 1EZKA 4XHMA 3LYKA 5DALB 2H71A 3MDKA 12GSA 1PX7A 4IN0A 1TOFA 1EV4A 2E7PA 3U5RE 4L5LA 1X9WB 2R2JA 4Q5QA 3GSTA 5ABRA 1W4VA 1RK4A 4GRFA 4EC0A 3HVVA 2EIRA 2R37A 4XCSA 1SKWB 2G0FA 1I5GA 1NHYA 4MMMA 1GTBA 1Y25A 3I69A 4K5RA 5CAXA 2LRNA 6GSXA 3C8EA 3DVWA 2H70A 2PWJA 5AIXA 1FVJA 3LXTA 4PQHA 2H75A 4BWQA 8GSSA 2C3TA 2A4HA 4IP6A 2ZNMA 3F8UA 4YKGA 4MH3A 2TRXA 1A0FA 1A2LA 2XBIA 4IELA 1XBSA 1BG5A 2ON7A 3WT1A 4ZL7A 1TU7A 5HQPA 4PGTA 4PQIA 3WD6A 5JCUA 2R4VA 1OAZA 3GL3A 3M9JA 2L59A 1J9BA 3A2WA 1AAZA 5CP1A 2VO4A 3RHBA 2ZCTA 4HJ2A 3C1RA 3LSZA 3LFLA 4QMKA 4I6XA 3ERGA 3M3MA 1IYHA 5J4VA 2FNOA 3DRNA 4DSQA 2KUCA 4ZL8A 3I9V2 1TTZA 1WIKA 4AKXB 2IFQA 3IV4A 3ME8A 1TK5B 2DJ2A 3UARA 1O7UA 5GSSA 3F3QA 2GT6A 17GSA 5DALA 1YKAA 4HUAA 1XW5A 2CAQA 2VCZA 5ECOB 2YWMA 1B4QA 1EEMA 1MEKA 1SJIA 4NMUA 4I2TA 4EO3A 5IM9A 1EWXA 1OKTA 3L9UA 4HQSA 5F07A 1SD8A 3QCPA 4LA1A 2K6VA 3DXBA 4NHZA 1CQGA 3VWXA 4KCEA 4HQZA 2P0GA 3A5IA 2YV9A 2K8SA 2QA2A 3H93A 2VCTA 2IL3A 1U3IA 4XTSA 4LL1B 1ZOFA 2N5AA 3A2VA 3NIVA 3CMIA 3ME7A 1Z3EA 2AYTA 1LU4A 3FY7A 3ZLPA 2M72A 2AV4A 5G30A 3GNJA 3LORA 5B6MA 2NTOA 4KSMA 3QPMA 4N0ZA 3GV1A 1SJ6A 2DIZA 1PA3A 4MJBA 1XWGA 3NZNA 5ECIB 2FD3A 4E8HA 2B5XA 2OBKA 2VL2C 2IPAA 5HFKA 4F03A 4RI7A 1PGTA 3ISOA 4KGIA 1GNEA 4XS6A 1EP8A 1PQNA 2YN1A 4CW9A 2I81A 1YEXA 1FB6A 4GWRA 3QAGA 1NSWA 3C1SA 4ZBAA 2XPEA 3HHVA 2I1UA 2DMLA 1KBNA 3Q18A 1R4WA 1Q4JA 1Y1UA 3UVHA 3EU3A 3TGZA 2OA7A 2B3SA 2CZ2A 3F9UA 5KN3A 2H01A 4AJ7A 2EFHA 5DVBA 4WKWA 4IS0A 1TI1A 4G9HA 3EC3A 5A34B 3LYPA 3F63A 2C4JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HVX A;  1XFL A;  4V1A p;  2MMZ A;  4TRX A;  2XHF A;  4KA0 A;  4WR4 A;  3W6G A;  2VAF A;  4HEA 2;  1HNA A;  4Q5F A;  3US3 A;  2DJ0 A;  1YJ6 A;  3GIX A;  3J7Y k;  3KH9 A;  3TJB A;  2ZUP A;  4X43 A;  2FLS A;  2X8H A;  3C7M A;  2A2S A;  4BWS A;  2J9H A;  3RPP A;  1GSD A;  4F0C A;  5ECS A;  5CRG A;  2GGT A;  3P8W A;  3M9K A;  4JR4 A;  2QKE A;  1F3B A;  4OD7 A;  4ID0 A;  4DEJ A;  4WBJ A;  3C73 A;  3ZVJ A;  5H5S A;  1M2D A;  1M7T A;  5F06 A;  3N5O A;  1XOB A;  5COH A;  4AJ8 A;  1GNW A;  3W8J A;  4TXV A;  9GSS A;  3RPN A;  1JZR A;  16GS A;  1TRV A;  1SEN A;  1T3B A;  1U6T A;  2LRT A;  5KN0 A;  1MDK A;  5D9W A;  1GTA A;  5JCG A;  4CHS A;  5AIV A;  4TOP A;  3CSJ A;  2KP2 A;  3RBT A;  2OAD A;  3M1G A;  1G7E A;  3HZ8 A;  7GSS A;  3FW2 A;  3SWL A;  1QXH A;  4MF7 A;  2H73 A;  1HNB A;  3VLN A;  4AF2 A;  4GCI A;  1UA5 A;  1XVQ A;  2HRF A;  1UVZ A;  3LEF A;  1A0R P;  2I9H A;  3G7J A;  2VCV A;  1X0R A;  3KEB A;  2CX3 A;  2X64 A;  1G6Y A;  2C3N A;  4WF5 A;  5D9X A;  2DIY A;  2WDU A;  3CRU A;  2B5E A;  2GSR A;  2OE3 A;  3KGK A;  5B6N A;  1A8Y A;  4P3Y B;  4DVC A;  3OR5 A;  4I5Q A;  3TUE A;  1N2A A;  4EKZ A;  4IQA A;  4L0U A;  3UEM A;  3S9F A;  1ABA A;  4GSS A;  1GTU A;  2X99 A;  4Z7X A;  4HS1 A;  3EUR A;  1GSS A;  2DJ1 A;  2YPM A;  1ZL9 A;  5DQY A;  2HSN B;  4TKY A;  4KDX A;  2GDR A;  1Z6M A;  4MH2 A;  2RUF A;  1S3C A;  3UBL A;  5G2Z A;  1TW9 A;  2VM2 A;  5KN2 A;  1E6B A;  2JZT A;  2KOK A;  1FVK A;  1K3O A;  2PUK C;  4KW6 A;  1W89 A;  1ERW A;  4JBB A;  4POL A;  2CV4 A;  2GQK A;  1TRU A;  3ZZX A;  2IME A;  1XVW A;  4FQU A;  1XW9 A;  4K8M A;  4TN8 A;  5J41 A;  5E59 A;  1GSF A;  1VF4 A;  2GQL A;  3GTU B;  3LQ7 A;  1R5A A;  1AW9 A;  1Q98 A;  2ON5 A;  2WB9 A;  4H86 A;  3BCK A;  2CAI A;  3WGX A;  1Z7P A;  3HY2 A;  3MSZ A;  4MZW A;  2HNL A;  3QMX A;  3TJG A;  1QK8 A;  1GRX A;  4FYC A;  1O85 A;  5DCH A;  1M0U A;  2IWT A;  1GSE A;  4AJ6 A;  2DJJ A;  2H76 A;  2CVK A;  3EVI A;  1FW1 A;  2XPD A;  1GUM A;  1SYR A;  3GRX A;  5KN1 A;  3PPU A;  1ERU A;  1EGR A;  3L0H A;  3HKR A;  1T4Z A;  3UMA A;  5IMA A;  3CSI A;  4F9Z A;  1PN9 A;  1BX9 A;  3PR8 A;  1AUC A;  4I97 A;  4F2I A;  3NOF A;  2IN3 A;  4WET A;  22GS A;  4BVX B;  1LJR A;  4IHU A;  3DGQ A;  4KB3 A;  2H6X A;  4TW5 A;  3ERW A;  3GFK A;  2OE1 A;  3Q6O A;  4JED A;  1KTE A;  2V6K A;  1THX A;  1OC9 B;  4GF0 A;  1T4Y A;  4V2N A;  4POM A;  2FGX A;  2DJK A;  1TRS A;  4TR4 A;  1PL1 A;  3GTU A;  2F8A A;  2BMX A;  4YQU A;  1VF1 A;  2R5G A;  5DDL A;  2TIR A;  4ZIL A;  1F3A A;  3WT2 A;  2JL4 A;  3ZL5 A;  2C0G A;  2NBS A;  3ZML A;  3DVX A;  1WJK A;  1XCC A;  2HFD A;  2MMA A;  4MPG A;  1KEB A;  4NHW A;  1UN2 A;  3C71 A;  3TRX A;  2HYX A;  1SK0 A;  1V2A A;  5IPH A;  2HRK B;  2REM A;  3TKQ A;  2HZF A;  1WOU A;  1FAA A;  5A4U A;  4IQ1 A;  2JAD A;  3IOS A;  1SD9 A;  4MCU A;  2DJ3 A;  1VRS D;  4PQ1 A;  3BCI A;  3VWU A;  1PSQ A;  1XWB A;  2H0I A;  2VD0 A;  1H75 A;  2WCI A;  1YKC A;  1A2J A;  2F8F A;  3UAP A;  1T1V A;  2B7J A;  5FWG A;  2N5B A;  1Z7R A;  3IC8 A;  1GSU A;  3ZFB A;  1V58 A;  4MPF A;  5INY A;  1YZX A;  2VL2 A;  3TKS A;  1VGL A;  3GH6 A;  2H74 A;  1TKD B;  3GX0 A;  3KJY A;  1OC9 A;  1Z5Y E;  4EVM A;  5KEJ A;  2GZY A;  2A2R A;  3EIN A;  2JZS A;  1M99 A;  1AC1 A;  3M8N A;  1EOH A;  2FWF A;  2QGV A;  2X8C A;  3ZYW A;  4GXZ A;  4MLY A;  5E4W A;  3MAK A;  2EIO A;  4ZBB A;  2CX4 A;  3E3E A;  1PKZ A;  1O6J A;  2FWE A;  3LWA A;  4KCA A;  4XRA A;  4EDY A;  2YZH A;  3IXR A;  4FYU A;  1XXU A;  1USB A;  3CBU A;  4MF5 A;  2HZE B;  2LNT A;  1GLP A;  1XWA A;  2H1A A;  1MD4 A;  2CT6 A;  2L5O A;  2YJ7 A;  3D5J A;  4KUN A;  5HFI A;  4DSS B;  1AQV A;  4CDO A;  1PKW A;  4ISD A;  1B8X A;  2EIQ A;  3KP9 A;  1ERT A;  4PNF A;  3VWW A;  3G9B A;  4O92 A;  2H0G A;  4FO5 A;  1K0O A;  5LD0 A;  2H72 A;  1XOA A;  3QOU A;  2L6C A;  1GSQ A;  2GSS A;  4OFN A;  2KHP A;  2DMM A;  2VL3 A;  4E8E A;  1ACV A;  2EC4 A;  3KTL A;  2P5Q A;  2E2G A;  4NXI A;  1MD3 A;  4TR1 B;  2HSY A;  1OC3 A;  2UZ8 A;  3TKS C;  3O76 A;  4RQR A;  4HU7 A;  3KZQ A;  1R26 A;  4POB A;  4G0I A;  2YWO A;  5C04 A;  4YQV A;  5L71 A;  2HSM B;  2HXK A;  3CTF A;  2YNX A;  6GSU A;  2H0H A;  1YQ1 A;  5AGY A;  3DD3 A;  4X0X A;  4V1A g;  1WPI A;  4N0V A;  5A4W A;  2V2G A;  1OYJ A;  1X9M B;  3IR4 A;  1A23 A;  3F4R A;  1GSY A;  3QFB C;  3VI7 A;  4FYB A;  2KLX A;  3KMO A;  4MJA A;  1V98 A;  1TK8 B;  2HZE A;  1F9M A;  3L9V A;  1GUL A;  3N9J A;  1EEJ A;  3W8S A;  2XC2 A;  2LST A;  4PUF C;  2QSI A;  5D9V A;  1N8J A;  5EY6 A;  4DSS A;  4L8E A;  4MA9 A;  3EU4 A;  1OE8 A;  2YCD A;  4GQC A;  2C0F A;  5AN1 A;  2XBQ A;  3SBC A;  2V41 A;  2VCX A;  3KD0 A;  1K0B A;  2MYG A;  4USS A;  2VUP A;  4IW9 A;  4PNG A;  3ZRE A;  4ULX A;  3ED3 A;  2QC7 A;  1Y6E A;  4BPY A;  2LJA A;  3D4T A;  1MDJ A;  2WRT A;  4LMV A;  3IDV A;  5D96 A;  1QGV A;  3UBK A;  3DEX A;  3P90 A;  2A4V A;  1T7P B;  2NDO A;  4OMV A;  1ZCP A;  4G19 A;  2AAW A;  4AGS A;  3A5W A;  1K0M A;  1ZMA A;  3TDG A;  4TR1 A;  5EPF A;  4IBP A;  3GYK A;  1EOG A;  3Q19 A;  3D21 A;  5JWR B;  4HJM A;  4K7O A;  4N30 A;  3VFI A;  4ZB6 A;  4EE0 A;  2I4A A;  2VIM A;  3A3T A;  3P7X A;  4NV5 A;  1CQH A;  3L9S A;  4BVY B;  1H4O A;  2H19 A;  2K8V A;  5A5K A;  1FOV A;  5GAP D;  2VOC A;  4O5R A;  5JWQ B;  3FZ9 A;  2DLX A;  3FEU A;  4D73 B;  2E0Q A;  1TU8 A;  4KDU A;  1T00 A;  1G6W A;  2WS2 A;  2AUV A;  2H6Z A;  4G10 A;  4V2M A;  1A2M A;  4IGJ A;  5ECN B;  1YEP A;  3M0F A;  3EYT A;  4JRR A;  3V1W A;  1G7O A;  2WFC A;  2HRN A;  1AQW A;  3KCM A;  2YP6 A;  4ZIJ A;  2L4C A;  3HCZ A;  2DC5 A;  4QL7 A;  4K0N A;  3TKR A;  4PXO A;  1V57 A;  4G2E A;  1XWC A;  2J23 A;  5CYY A;  1S3D A;  4HOJ A;  5F8B A;  5CRW A;  4GSN A;  2O89 A;  3APS A;  2O85 A;  3U6V A;  1X5E A;  3VPQ A;  5IOX A;  6GSW A;  1OVN A;  2JSY A;  2PGT A;  2HLS A;  5J4U A;  2P31 A;  2HQT A;  4JZQ A;  5CRE A;  4IJI A;  5H5R A;  3E0U A;  4KND A;  4ACS A;  2GT5 A;  3TJJ A;  2PVO C;  3LJR A;  1XW6 A;  3TCO A;  1GUH A;  3EMP A;  1OKD A;  1DSB A;  3ZTL A;  1XPV A;  2PU9 C;  5B7C A;  2PER A;  3GKK A;  3L4N A;  3KH7 A;  3GKM A;  2Z9S A;  4BVY A;  1PRX A;  5DJL A;  4EDZ A;  1M2B A;  1HYU A;  4ILF A;  1TRW A;  5IMZ A;  5LCZ A;  4WF4 A;  4Q5N A;  2IIY A;  1NM3 A;  4D73 A;  1B9Y C;  3CYN A;  4KE3 A;  1SKR B;  4ZL9 A;  3GKN A;  1SKS B;  2LQO A;  2F3M A;  3O6T A;  3TOU A;  3HVS A;  4MK3 A;  2YV7 A;  3BD2 A;  2MZC A;  3HA9 A;  5HR1 A;  3IHQ A;  3TOT A;  2C0E A;  2I3Y A;  2HSH A;  1OC8 A;  1X9S B;  5CRH A;  2B1L A;  3F6D A;  2H1B A;  5ELG A;  1FO5 A;  2CZ3 A;  2M80 A;  3HJM A;  1JLV A;  5EVO A;  2MBS A;  4K0G A;  4ECC A;  4F0B A;  5D9T A;  1PD2 1;  3ZIT A;  2YOI A;  2LTK A;  3GX8 A;  4IKH A;  3GHA A;  1EV9 A;  1PL2 A;  2OJL A;  5JWO B;  1ZYE A;  5J9C A;  3H1N A;  4ML1 A;  2V32 A;  4I2U A;  3RDW A;  11GS A;  1T8E B;  3K8N A;  3IAS 2;  3IAM 2;  2LV3 A;  3GKX A;  2AJQ B;  4HI7 A;  4YH2 A;  2FY6 A;  5JCW A;  2PMT A;  2CVB A;  2VM1 A;  1SL0 B;  1K0A A;  2LNS A;  2RM5 A;  1EP7 A;  2RM6 A;  4PTS A;  2V6O A;  5LNK e;  1E2Y A;  2CVD A;  3D6I A;  4KH7 A;  2N5F A;  5ECQ B;  4XS4 B;  1XZO A;  3GL5 A;  4ECI A;  14GS A;  1BJX A;  2K9F A;  2TRC P;  5IMD A;  5FT3 A;  5ECP B;  2OAC A;  1WMJ A;  4PX1 A;  1TXX A;  2LRC A;  1DUG A;  1QUW A;  2C8U A;  2DSA A;  3HD5 A;  1WE0 A;  3H8Q A;  2F9S A;  4LLR A;  3ZIV A;  2HI7 A;  3FKF A;  1K0C A;  3FYG A;  1BQ7 A;  4KSO A;  2LJK A;  3RAZ A;  6GSV A;  5IOW A;  2FHE A;  4PUA A;  4PUR A;  3PIN A;  5DCG A;  3ZIJ A;  3BBY A;  4TXO B;  3GH9 A;  1VF2 A;  3F4T A;  1AQX A;  1JZW A;  2R6K A;  4Q5R A;  4WEY A;  4WBR D;  2FWG A;  3DIE A;  4KF9 A;  3G7Y A;  4HU9 A;  4ML6 A;  4GLT A;  2M46 A;  2IMI A;  5DAK B;  1GH2 A;  1GWC A;  4MAB A;  4K2D A;  2YWN A;  3BJ5 A;  1X5C A;  1ST9 A;  3FK8 A;  1AIU A;  3APQ A;  1SJZ A;  1SL1 B;  2MMO A;  3EE2 A;  4JE1 A;  2WZ9 A;  1BAY A;  3IK9 A;  4BVX A;  5GAN D;  2VLV A;  1U3A A;  4TR0 A;  4EXJ A;  1ML6 A;  1ERV A;  4IVF A;  4N10 A;  5ELA A;  2B1K A;  2O8V B;  4G0K A;  1ZGN A;  2NVL A;  5D8I A;  3F4S A;  4XS4 A;  5ECK B;  2H1G A;  4F82 A;  2YJH A;  2H8L A;  1URM A;  3CTG A;  5EL8 A;  1ZYQ B;  5ECL B;  3FR3 A;  2WJU A;  3G7I A;  2GVP A;  5DQS A;  4K7N A;  1A8L A;  3VWV A;  3PGT A;  2JSZ A;  1FG4 A;  1QFN A;  2DBC A;  3LXZ A;  1V40 A;  3DWV A;  2RUE A;  3DKS A;  1M9B A;  4J56 E;  4TR3 A;  4HDE A;  4JR6 A;  2YAN A;  3GSS A;  3QDN A;  4MZB A;  3QAV A;  5J9B A;  3QR6 A;  2E2M A;  2H30 A;  3HXS A;  4KX4 A;  3R3E A;  4TXO A;  2HRK A;  4RQX A;  1X5D A;  2IMF A;  1AXD A;  3LGC A;  2H6Y A;  1KNG A;  1TP9 A;  3HJO A;  3IPZ A;  5HR2 A;  5H5Q A;  2CQ9 A;  5G1K A;  3UL3 A;  3ZRD A;  4MP4 A;  2PVQ A;  2HE3 A;  3GUR A;  20GS A;  5HR3 A;  2GLR A;  2OKA A;  2YWI A;  5DAK A;  1MDI A;  3J7Y b;  3BOA A;  2BJX A;  1ILO A;  5J5N A;  3DYR A;  1HQO A;  4NPB A;  2PBJ A;  3GUS A;  5CNW A;  3IC4 A;  1SK1 A;  1JZO A;  1G0T A;  3F6F A;  2LKU A;  3HJP A;  5CO3 A;  4O7H A;  5F05 A;  1Z9H A;  1EGO A;  1UC7 A;  4MZC A;  2AB6 A;  5CRD A;  3ZFL A;  2NPB A;  4OO5 A;  3TKS E;  1PMT A;  3D22 A;  4ZXG A;  2GZP A;  4WXT A;  3GMF A;  4RI6 A;  5IIZ A;  5C00 A;  4X1U A;  5GST A;  2RII A;  2F51 A;  2L4Q A;  3KMN A;  5DJM A;  3IE3 A;  2G2Q A;  2GS3 A;  4N11 A;  2ALB A;  2GST A;  2MMN A;  4J57 E;  1YF1 A;  2WGR A;  1TI3 A;  1FHE A;  6GSY A;  1YF0 A;  1M2A A;  3HZ4 A;  6GSS A;  6GST A;  2WUL A;  4JU5 A;  3EWL A;  2AHE A;  2VCW A;  2H1D A;  3TKP A;  2L6D A;  4YAP A;  4QL9 A;  2C80 A;  4ZBD A;  4DSR A;  1JZD A;  1THO A;  3FR6 A;  2B5Y A;  4BL7 B;  3QAW A;  1R7H A;  4K1F A;  5AIS A;  3QD9 A;  4O32 A;  4LL4 B;  1I9D A;  3UIW A;  4OCF A;  4ZB8 A;  1LBK A;  5DBQ A;  3D0Z A;  4FIW A;  5ID2 B;  2MBT A;  4GST A;  1MTC A;  2RLI A;  2JAC A;  2GZZ A;  1DE2 A;  5IMV A;  4KAE A;  1C72 A;  5G1L A;  3MWH A;  5B8B A;  4MJC A;  3VUR A;  1K3L A;  3KM6 A;  4XS1 A;  2B6M A;  3ZVJ D;  4MJE A;  5F0G A;  3VK9 A;  3L78 A;  1JLW A;  1B48 A;  1K0D A;  2OE0 A;  3PH9 A;  2HSM A;  1O8X A;  5ECH B;  4NWY A;  5IMC A;  4OCE A;  4TVE A;  1GUK A;  5J3R A;  2FA8 A;  4XRD A;  3FR9 A;  3R2Q A;  2BTO T;  2P5R A;  5G5F A;  4OFM A;  3CSH A;  2GTU A;  2OBI A;  2PN8 A;  1U87 A;  4L0W A;  2C3Q A;  4EF0 A;  3H79 A;  2YZU A;  3HDC A;  4BA7 A;  3GA4 A;  3TJF A;  2D2Z A;  3JCM L;  1XIY A;  4ECB A;  3I6A A;  2R3X A;  3H4K A;  2LQQ A;  1GTI A;  1QMV A;  3FZA A;  2PPT A;  1JHB A;  1M9A A;  5IO0 A;  4XIH A;  1V9W A;  3IBH A;  5FHI A;  1NW2 A;  4HZ4 A;  3VI5 A;  2VD1 A;  2O87 A;  3RHC A;  4OWY A;  5G5E A;  4I8B A;  1A24 A;  4GQF A;  2VL9 A;  4BL7 A;  3IRA A;  3A2X A;  1F6M C;  5ENU A;  4NAX A;  1SU9 A;  2JU5 A;  2FA4 A;  1S3A A;  2GQM A;  3UOM A;  4L5O A;  5ID2 A;  10GS A;  2JZR A;  1SK2 A;  2GSQ A;  1FB0 A;  1O73 A;  3AY8 A;  2ES7 A;  2C0D A;  1JFU A;  4POK A;  3GN3 A;  4ZB9 A;  2X8G A;  2LEG A;  5IPG A;  1O8W A;  2LJR A;  1YDK A;  4EUY A;  2KP1 A;  5IO2 A;  5BMU A;  1TK0 B;  5D93 A;  4MDC A;  1B4P A;  2CA8 A;  2LUS A;  2K18 A;  4K9Z A;  4WR5 A;  3WGD A;  1F37 A;  4LMW A;  2H66 A;  1QQ2 A;  1O81 A;  3UJ1 A;  1TDI A;  2VLU A;  4RUV A;  1GLQ A;  3O3T A;  3IA1 A;  4YQM A;  3TB2 A;  3I43 A;  3VPT A;  3WYW A;  4IP1 A;  5G31 A;  3ZMK A;  5B8A A;  3EMX A;  3FHK A;  1IYI A;  5IQY A;  1OE7 A;  5IMF A;  3Q74 A;  1K3Y A;  3KXO A;  3FZ4 A;  3FRC A;  3MNG A;  3QFA C;  1ON4 A;  2LS5 A;  1YY7 A;  3F0I A;  3P2A A;  4QQ7 A;  4FH8 A;  4IJ3 A;  4J2F A;  5HR0 A;  4NV2 A;  1WRY A;  1PX6 A;  1J0F A;  2C1Y A;  2FCH A;  1DE1 A;  3LG6 A;  4YAV A;  13GS A;  3ERF A;  1K0N A;  3FZ5 A;  3KP8 A;  2HT9 A;  1GL8 A;  2L57 A;  1ZZY A;  4K7I A;  3TRP A;  1GP1 A;  1HNC A;  18GS A;  1Z6N A;  1BYE A;  5D73 A;  4MF6 A;  2FUG 2;  3TJK A;  3DML A;  4OFT A;  1WWJ A;  4ECJ A;  3HYP A;  4OO4 A;  1WP0 A;  5GZZ B;  4GTU A;  3F3R A;  4G0L A;  1VF3 A;  1SYX A;  2V1M A;  3KIJ A;  3TRQ A;  4EL1 A;  1RW1 A;  2IMK A;  4V2L A;  2L5L A;  3IK7 A;  1HD2 A;  1J08 A;  3KTB A;  2VLT A;  2HRA A;  1BED A;  2IJY A;  1F2E A;  1U88 A;  2VCQ A;  5ECR B;  1B9X C;  3E9J B;  3CXG A;  1TJD A;  1XWK A;  4KDY A;  4HZ2 A;  1NHO A;  1RQM A;  2IMD A;  5ECM B;  2O7K A;  1DBY A;  3D4M A;  3APO A;  4K6X A;  5A4V A;  2FWH A;  2B7K A;  3WGE A;  5HFG A;  1R5P A;  3CRT A;  1SL2 B;  2IFQ B;  3UVT A;  19GS A;  1EZK A;  4XHM A;  3LYK A;  5DAL B;  2H71 A;  3MDK A;  12GS A;  1PX7 A;  4IN0 A;  1TOF A;  1EV4 A;  2E7P A;  3U5R E;  4L5L A;  1X9W B;  2R2J A;  4Q5Q A;  3GST A;  5ABR A;  1W4V A;  1RK4 A;  4GRF A;  4EC0 A;  3HVV A;  2EIR A;  2R37 A;  4XCS A;  1SKW B;  2G0F A;  1I5G A;  1NHY A;  4MMM A;  1GTB A;  1Y25 A;  3I69 A;  5CAX A;  2LRN A;  6GSX A;  3C8E A;  3DVW A;  2H70 A;  2PWJ A;  5AIX A;  1FVJ A;  3LXT A;  4PQH A;  2H75 A;  4BWQ A;  8GSS A;  2C3T A;  4IP6 A;  2ZNM A;  3F8U A;  4MH3 A;  2TRX A;  1A0F A;  1A2L A;  2XBI A;  4IEL A;  1XBS A;  1BG5 A;  2ON7 A;  3WT1 A;  4ZL7 A;  1TU7 A;  5HQP A;  4PGT A;  4PQI A;  3WD6 A;  5JCU A;  2R4V A;  1OAZ A;  3GL3 A;  3M9J A;  2L59 A;  1J9B A;  3A2W A;  1AAZ A;  5CP1 A;  2VO4 A;  3RHB A;  2ZCT A;  4HJ2 A;  3C1R A;  3LSZ A;  3LFL A;  4I6X A;  3ERG A;  3M3M A;  1IYH A;  2FNO A;  3DRN A;  4DSQ A;  2KUC A;  4ZL8 A;  3I9V 2;  1TTZ A;  1WIK A;  2IFQ A;  3IV4 A;  3ME8 A;  1TK5 B;  2DJ2 A;  3UAR A;  1O7U A;  5GSS A;  3F3Q A;  2GT6 A;  17GS A;  5DAL A;  1YKA A;  4HUA A;  1XW5 A;  2CAQ A;  2VCZ A;  5ECO B;  2YWM A;  1B4Q A;  1EEM A;  1MEK A;  1SJI A;  4NMU A;  4I2T A;  4EO3 A;  5IM9 A;  1EWX A;  1OKT A;  3L9U A;  4HQS A;  5F07 A;  1SD8 A;  3QCP A;  4LA1 A;  2K6V A;  3DXB A;  4NHZ A;  1CQG A;  3VWX A;  4KCE A;  4HQZ A;  2P0G A;  2YV9 A;  2K8S A;  3H93 A;  2VCT A;  2IL3 A;  1U3I A;  4XTS A;  4LL1 B;  1ZOF A;  2N5A A;  3A2V A;  3NIV A;  3CMI A;  3ME7 A;  1Z3E A;  2AYT A;  1LU4 A;  3FY7 A;  3ZLP A;  2M72 A;  2AV4 A;  5G30 A;  3GNJ A;  3LOR A;  5B6M A;  2NTO A;  4KSM A;  3QPM A;  4N0Z A;  3GV1 A;  1SJ6 A;  2DIZ A;  1PA3 A;  4MJB A;  1XWG A;  3NZN A;  5ECI B;  2FD3 A;  4E8H A;  2B5X A;  2OBK A;  2VL2 C;  2IPA A;  5HFK A;  4F03 A;  4RI7 A;  1PGT A;  3ISO A;  4KGI A;  1GNE A;  4XS6 A;  1EP8 A;  1PQN A;  2YN1 A;  4CW9 A;  2I81 A;  1YEX A;  1FB6 A;  4GWR A;  3QAG A;  1NSW A;  3C1S A;  4ZBA A;  2XPE A;  3HHV A;  2I1U A;  2DML A;  1KBN A;  3Q18 A;  1R4W A;  1Q4J A;  3UVH A;  3EU3 A;  3TGZ A;  2OA7 A;  2B3S A;  2CZ2 A;  3F9U A;  5KN3 A;  2H01 A;  4AJ7 A;  5DVB A;  4WKW A;  4IS0 A;  1TI1 A;  4G9H A;  3EC3 A;  3LYP A;  3F63 A;  2C4J A; 
#chains in the Genus database with same CATH topology
 3HVX A;  1XFL A;  4V1A p;  2MMZ A;  4TRX A;  2XHF A;  4KA0 A;  4WR4 A;  3W6G A;  2VAF A;  4HEA 2;  1HNA A;  4Q5F A;  3US3 A;  2DJ0 A;  1YJ6 A;  3GIX A;  3J7Y k;  3KH9 A;  3TJB A;  4AI6 A;  2ZUP A;  4X43 A;  2FLS A;  2X8H A;  3C7M A;  2A2S A;  2WVZ A;  4BWS A;  3CHX C;  2J9H A;  3RPP A;  1GSD A;  4F0C A;  5ECS A;  5CRG A;  2GGT A;  3P8W A;  3M9K A;  4JR4 A;  2QKE A;  1F3B A;  4OD7 A;  4ID0 A;  4DEJ A;  4WBJ A;  3C73 A;  3TU3 B;  3ZVJ A;  5H5S A;  1M2D A;  1M7T A;  5F06 A;  3N5O A;  1ZYN A;  1XOB A;  5COH A;  4AJ8 A;  1GNW A;  3W8J A;  4TXV A;  9GSS A;  3RPN A;  1JZR A;  16GS A;  1TRV A;  1SEN A;  1T3B A;  1U6T A;  2LRT A;  5KN0 A;  3RGB C;  1MDK A;  5D9W A;  1GTA A;  5JCG A;  4CHS A;  4X4J A;  5AIV A;  4TOP A;  3CSJ A;  2KP2 A;  3RBT A;  2OAD A;  3M1G A;  1G7E A;  4MNN A;  3HZ8 A;  7GSS A;  3FW2 A;  2EFE A;  3SWL A;  1QXH A;  4MF7 A;  2H73 A;  1HNB A;  3VLN A;  4AF2 A;  4GCI A;  1UA5 A;  1XVQ A;  2HRF A;  1UVZ A;  3LEF A;  1A0R P;  2I9H A;  3G7J A;  2VCV A;  1X0R A;  3KEB A;  2CX3 A;  2X64 A;  1G6Y A;  2C3N A;  4WF5 A;  3MIX A;  5D9X A;  2DIY A;  2WDU A;  3CRU A;  4N3Z A;  2B5E A;  2GSR A;  2OE3 A;  3KGK A;  2X4A A;  5B6N A;  1A8Y A;  4P3Y B;  4DVC A;  3OR5 A;  4I5Q A;  1SVO A;  3TUE A;  1N2A A;  4EKZ A;  4IQA A;  4L0U A;  3UEM A;  3S9F A;  1ABA A;  4GSS A;  1GTU A;  2X99 A;  4Z7X A;  4HS1 A;  3EUR A;  1GSS A;  2DJ1 A;  2YPM A;  1ZL9 A;  5DQY A;  2HSN B;  4TKY A;  4KDX A;  2GDR A;  1Z6M A;  4MH2 A;  2RUF A;  1S3C A;  3UBL A;  5G2Z A;  1TW9 A;  2VM2 A;  5KN2 A;  1E6B A;  2JZT A;  2KOK A;  1FVK A;  1K3O A;  2PUK C;  4KW6 A;  1W89 A;  1ERW A;  4JBB A;  4POL A;  2CV4 A;  2GQK A;  1TRU A;  3ZZX A;  2IME A;  1XVW A;  4FQU A;  2DKH A;  1XW9 A;  4K8M A;  4TN8 A;  5J41 A;  5E59 A;  1GSF A;  1VF4 A;  2GQL A;  3GTU B;  3LQ7 A;  1R5A A;  1AW9 A;  1Q98 A;  2ON5 A;  2WB9 A;  4H86 A;  3BCK A;  2CAI A;  3WGX A;  1Z7P A;  3HY2 A;  3MSZ A;  4W66 A;  4MZW A;  2HNL A;  3QMX A;  3TJG A;  1QK8 A;  1GRX A;  4FYC A;  1O85 A;  5DCH A;  1M0U A;  1BG1 A;  2IWT A;  1GSE A;  4AJ6 A;  2DJJ A;  5J47 A;  2H76 A;  2CVK A;  4O5Q A;  3EVI A;  1FW1 A;  2XPD A;  1GUM A;  5A5H B;  2O36 A;  1SYR A;  2HSN A;  3GRX A;  5KN1 A;  3PPU A;  1ERU A;  1EGR A;  3L0H A;  3HKR A;  1T4Z A;  2O3E A;  3UMA A;  5IMA A;  3CSI A;  4F9Z A;  1PN9 A;  1BX9 A;  3PR8 A;  1I1I P;  1AUC A;  4I97 A;  4F2I A;  3NOF A;  2IN3 A;  1YEW C;  4WET A;  22GS A;  4BVX B;  1LJR A;  4IHU A;  3DGQ A;  1PN0 A;  2H6X A;  4KB3 A;  4TW5 A;  3ERW A;  3GFK A;  2OE1 A;  3Q6O A;  2WVX B;  4JED A;  1KTE A;  2V6K A;  1THX A;  1OC9 B;  4GF0 A;  1T4Y A;  4V2N A;  4POM A;  2FGX A;  2DJK A;  1TRS A;  4TR4 A;  1PL1 A;  3GTU A;  2F8A A;  2BMX A;  4YQU A;  1VF1 A;  2R5G A;  5DDL A;  2TIR A;  4ZIL A;  1F3A A;  3WT2 A;  2JL4 A;  3ZL5 A;  2C0G A;  2NBS A;  4EIP A;  3ZML A;  3DVX A;  1WJK A;  1XCC A;  2HFD A;  2MMA A;  4MPG A;  1KEB A;  4NHW A;  1UN2 A;  3C71 A;  3TRX A;  2HYX A;  1SK0 A;  1V2A A;  5IPH A;  4CY6 A;  2HRK B;  2REM A;  3TKQ A;  2HZF A;  1WOU A;  1FAA A;  5A4U A;  4IQ1 A;  2JAD A;  3FMW A;  5A5H A;  3IOS A;  1SD9 A;  4MCU A;  2DJ3 A;  1VRS D;  4PQ1 A;  3BCI A;  3VWU A;  1PSQ A;  1XWB A;  2H0I A;  2VD0 A;  1H75 A;  4AKG A;  2WCI A;  1YKC A;  1A2J A;  2F8F A;  3UAP A;  1T1V A;  2B7J A;  5FWG A;  2N5B A;  1Z7R A;  3IC8 A;  1GSU A;  3ZFB A;  2WZS A;  1V58 A;  4MPF A;  5INY A;  1YZX A;  2VL2 A;  3TKS A;  2WVX A;  1VGL A;  3GH6 A;  2H74 A;  1TKD B;  3GX0 A;  3KJY A;  1OC9 A;  1Z5Y E;  4EVM A;  5KEJ A;  2GZY A;  4ZB7 A;  2A2R A;  3EIN A;  2JZS A;  1M99 A;  1AC1 A;  3M8N A;  1EOH A;  2FWF A;  2QGV A;  2X8C A;  3ZYW A;  4GXZ A;  4MLY A;  5E4W A;  3MAK A;  2EIO A;  4ZBB A;  2CX4 A;  3E3E A;  1PKZ A;  1O6J A;  2FWE A;  3LWA A;  4KCA A;  4XRA A;  4EDY A;  2YZH A;  3IXR A;  4FYU A;  1XXU A;  1USB A;  3CBU A;  4MF5 A;  2HZE B;  2LNT A;  1GLP A;  1XWA A;  2H1A A;  1MD4 A;  2CT6 A;  2L5O A;  2YJ7 A;  3D5J A;  5BRT A;  4KUN A;  5HFI A;  4DSS B;  1AQV A;  4CDO A;  1PKW A;  4ISD A;  1B8X A;  2EIQ A;  3KP9 A;  3RFR C;  1ERT A;  4PNF A;  3VWW A;  3G9B A;  5A1N B;  4O92 A;  2H0G A;  4FO5 A;  1K0O A;  5LD0 A;  2H72 A;  2H1L A;  2EFC A;  1XOA A;  3QOU A;  2L6C A;  5KOW A;  1GSQ A;  2GSS A;  4OFN A;  2KHP A;  2DMM A;  2VL3 A;  4E8E A;  1ACV A;  2EC4 A;  3KTL A;  2P5Q A;  2E2G A;  4A5P A;  4NXI A;  1MD3 A;  4TR1 B;  2HSY A;  1OC3 A;  2UZ8 A;  3TKS C;  3O76 A;  4RQR A;  4HU7 A;  3KZQ A;  1R26 A;  4POB A;  4G0I A;  2YWO A;  5C04 A;  4YQV A;  5L71 A;  2HSM B;  2HXK A;  3CTF A;  2YNX A;  6GSU A;  2H0H A;  1YQ1 A;  5AGY A;  3DD3 A;  4X0X A;  4V1A g;  1WPI A;  4AKI A;  4N0V A;  5A4W A;  2V2G A;  1OYJ A;  1X9M B;  3IR4 A;  1A23 A;  3F4R A;  1GSY A;  3QFB C;  3VI7 A;  4FYB A;  2KLX A;  3KMO A;  4MJA A;  1V98 A;  1TK8 B;  2HZE A;  1F9M A;  3L9V A;  4Z2U A;  1GUL A;  3N9J A;  1EEJ A;  3W8S A;  2XC2 A;  2LST A;  4PUF C;  2QSI A;  5D9V A;  1N8J A;  5EY6 A;  1PFO A;  4DSS A;  4L8E A;  4MA9 A;  3EU4 A;  1OE8 A;  2YCD A;  4GQC A;  2C0F A;  4AKH A;  5AN1 A;  2XBQ A;  3SBC A;  2V41 A;  2VCX A;  5A1N A;  3KD0 A;  1K0B A;  2MYG A;  4USS A;  2VUP A;  4IW9 A;  4PNG A;  3ZRE A;  4ULX A;  3ED3 A;  2QC7 A;  1Y6E A;  4BPY A;  2LJA A;  3D4T A;  1MDJ A;  2WRT A;  4LMV A;  3IDV A;  5D96 A;  1QGV A;  3LW9 A;  3UBK A;  3DEX A;  3P90 A;  2A4V A;  1T7P B;  2NDO A;  4OMV A;  1ZCP A;  4G19 A;  2AAW A;  4AGS A;  3A5W A;  1K0M A;  1ZMA A;  3TDG A;  4TR1 A;  5EPF A;  4IBP A;  3GYK A;  1EOG A;  3Q19 A;  3D21 A;  5JWR B;  4HJM A;  5BMU B;  4K7O A;  4N30 A;  3VFI A;  4ZB6 A;  4EE0 A;  2I4A A;  2VIM A;  3A3T A;  3P7X A;  4NV5 A;  1CQH A;  3CWG A;  3L9S A;  4BVY B;  1H4O A;  2H19 A;  2K8V A;  5A5K A;  1FOV A;  5GAP D;  2VOC A;  4O5R A;  5JWQ B;  3FZ9 A;  2DLX A;  3FEU A;  4D73 B;  2E0Q A;  1TU8 A;  4KDU A;  1T00 A;  4Z2R A;  1G6W A;  2WS2 A;  2AUV A;  2H6Z A;  4G10 A;  4V2M A;  1A2M A;  4IGJ A;  5ECN B;  1YEP A;  3M0F A;  3EYT A;  4JRR A;  3V1W A;  1G7O A;  2WFC A;  5A34 A;  2HRN A;  1AQW A;  3KCM A;  2YP6 A;  4ZIJ A;  2L4C A;  3HCZ A;  2DC5 A;  4QL7 A;  4K0N A;  3TKR A;  4PXO A;  1V57 A;  4G2E A;  1XWC A;  2J23 A;  5CYY A;  1S3D A;  4HOJ A;  5F8B A;  4ICY A;  5CRW A;  4GSN A;  2O89 A;  3APS A;  2O85 A;  3U6V A;  1X5E A;  3VPQ A;  5IOX A;  6GSW A;  1OVN A;  2JSY A;  2PGT A;  2HLS A;  5J4U A;  2P31 A;  2HQT A;  4JZQ A;  5CRE A;  4IJI A;  5H5R A;  3E0U A;  4KND A;  4ACS A;  2GT5 A;  3TJJ A;  2PVO C;  4HSC X;  3LJR A;  1XW6 A;  3TCO A;  1GUH A;  3EMP A;  1OKD A;  1DSB A;  3ZTL A;  1XPV A;  2X49 A;  2PU9 C;  5B7C A;  2PER A;  3GKK A;  3L4N A;  3KH7 A;  3GKM A;  2Z9S A;  4BVY A;  1PRX A;  5DJL A;  4EDZ A;  1M2B A;  1HYU A;  4ILF A;  1TRW A;  2WW2 A;  5IMZ A;  5LCZ A;  4WF4 A;  4Q5N A;  2IIY A;  1NM3 A;  4D73 A;  1B9Y C;  3CYN A;  4KE3 A;  1SKR B;  4ZL9 A;  3GKN A;  1SKS B;  2LQO A;  2F3M A;  3O6T A;  3TOU A;  3HVS A;  4MK3 A;  2YV7 A;  3BD2 A;  2MZC A;  3HA9 A;  5HR1 A;  4GDF A;  3IHQ A;  3TOT A;  2C0E A;  2I3Y A;  2HSH A;  1OC8 A;  1X9S B;  5CRH A;  2B1L A;  3F6D A;  2H1B A;  5ELG A;  1FO5 A;  2CZ3 A;  2M80 A;  3HJM A;  1JLV A;  5EVO A;  2MBS A;  4K0G A;  4ECC A;  4F0B A;  5D9T A;  1PD2 1;  3ZIT A;  2DKI A;  2YOI A;  2LTK A;  3GX8 A;  4IKH A;  3GHA A;  1EV9 A;  1PL2 A;  3HMJ G;  2OJL A;  2A2P A;  5JWO B;  1ZYE A;  5J9C A;  3H1N A;  4E68 A;  4ML1 A;  2V32 A;  4I2U A;  3RDW A;  11GS A;  1T8E B;  3K8N A;  3IAS 2;  3IAM 2;  2LV3 A;  3GKX A;  1S4B P;  2AJQ B;  4HI7 A;  4YH2 A;  2FY6 A;  5JCW A;  2PMT A;  2CVB A;  2VM1 A;  1SL0 B;  1K0A A;  2LNS A;  2RM5 A;  1EP7 A;  2RM6 A;  4PTS A;  2V6O A;  5LNK e;  1E2Y A;  2CVD A;  3D6I A;  4KH7 A;  2N5F A;  5ECQ B;  4XS4 B;  1XZO A;  3GL5 A;  4ECI A;  14GS A;  1BJX A;  2K9F A;  2TRC P;  5IMD A;  5FT3 A;  5ECP B;  2OAC A;  5J40 A;  1WMJ A;  4PX1 A;  1TXX A;  2LRC A;  1DUG A;  1QUW A;  2C8U A;  2DSA A;  3HD5 A;  1WE0 A;  3H8Q A;  2F9S A;  4LLR A;  3ZIV A;  2HI7 A;  3FKF A;  1K0C A;  3EPT A;  3FYG A;  1BQ7 A;  4KSO A;  2LJK A;  3RAZ A;  6GSV A;  5IOW A;  2FHE A;  4PUA A;  4PUR A;  3PIN A;  4K2X A;  5DCG A;  3ZIJ A;  3BBY A;  3HVN A;  2R0C A;  4TXO B;  3GH9 A;  1VF2 A;  3F4T A;  2QA1 A;  1AQX A;  1JZW A;  2R6K A;  4Q5R A;  4WEY A;  4WBR D;  2FWG A;  3DIE A;  4KF9 A;  3G7Y A;  4HU9 A;  4ML6 A;  4GLT A;  2M46 A;  2IMI A;  5DAK B;  1GH2 A;  1GWC A;  4MAB A;  4K2D A;  2YWN A;  3BJ5 A;  1X5C A;  1ST9 A;  3FK8 A;  1AIU A;  3APQ A;  1SJZ A;  1SL1 B;  2MMO A;  3EE2 A;  4JE1 A;  2WZ9 A;  1BAY A;  3IK9 A;  4BVX A;  1N25 A;  5GAN D;  2VLV A;  1U3A A;  4TR0 A;  4EXJ A;  1ML6 A;  1ERV A;  4IVF A;  4N10 A;  5ELA A;  2B1K A;  2O8V B;  4G0K A;  4CY8 A;  1ZGN A;  2NVL A;  5D8I A;  3F4S A;  4XS4 A;  5ECK B;  2H1G A;  4F82 A;  2YJH A;  2H8L A;  1URM A;  3CTG A;  5EL8 A;  1ZYQ B;  5ECL B;  3FR3 A;  2WJU A;  2O5V A;  3G7I A;  2GVP A;  5DQS A;  4K7N A;  1A8L A;  3VWV A;  3PGT A;  2JSZ A;  1FG4 A;  1QFN A;  2DBC A;  3LXZ A;  1V40 A;  3DWV A;  2RUE A;  3DKS A;  1M9B A;  4J56 E;  4TR3 A;  4HDE A;  4JR6 A;  2YAN A;  3GSS A;  3QDN A;  4MZB A;  1BF5 A;  3QAV A;  5J9B A;  3QR6 A;  2E2M A;  2H30 A;  3HXS A;  4KX4 A;  3R3E A;  4TXO A;  2HRK A;  4RQX A;  1X5D A;  2IMF A;  1AXD A;  3LGC A;  2H6Y A;  1KNG A;  1TP9 A;  3HJO A;  3IPZ A;  5HR2 A;  5H5Q A;  2CQ9 A;  5G1K A;  3UL3 A;  3ZRD A;  4MP4 A;  1S3R A;  2PVQ A;  2HE3 A;  3GUR A;  20GS A;  5HR3 A;  2GLR A;  2OKA A;  2YWI A;  5DAK A;  1MDI A;  3J7Y b;  3BOA A;  2BJX A;  1ILO A;  5J5N A;  3DYR A;  1HQO A;  4NPB A;  2PBJ A;  1ZYP A;  3GUS A;  5CNW A;  3IC4 A;  1SK1 A;  1FOH A;  1JZO A;  1G0T A;  3F6F A;  2LKU A;  3HJP A;  5CO3 A;  4O7H A;  5F05 A;  1Z9H A;  1EGO A;  1UC7 A;  4MZC A;  2AB6 A;  5CRD A;  3ZFL A;  2NPB A;  4OO5 A;  3TKS E;  1PMT A;  3D22 A;  4ZXG A;  2GZP A;  3MYD A;  4WXT A;  3GMF A;  4RI6 A;  5IIZ A;  5C00 A;  4X1U A;  5GST A;  2RII A;  2F51 A;  2L4Q A;  3KMN A;  5DJM A;  3IE3 A;  2G2Q A;  2GS3 A;  4N11 A;  2ALB A;  2GST A;  1YVL A;  2MMN A;  4J57 E;  1YF1 A;  2WGR A;  4BIK A;  1TI3 A;  1FHE A;  6GSY A;  1YF0 A;  1M2A A;  3HZ4 A;  6GSS A;  6GST A;  2WUL A;  4JU5 A;  3EWL A;  2AHE A;  2VCW A;  2H1D A;  3TKP A;  2L6D A;  4YAP A;  4QL9 A;  2C80 A;  4ZBD A;  4DSR A;  1JZD A;  1THO A;  3FR6 A;  2B5Y A;  4BL7 B;  3QAW A;  1R7H A;  4K1F A;  5AIS A;  3QD9 A;  4O32 A;  1M3I A;  4LL4 B;  1I9D A;  3UIW A;  4OCF A;  4ZB8 A;  1LBK A;  5DBQ A;  3D0Z A;  4FIW A;  5ID2 B;  2MBT A;  4GST A;  1MTC A;  2RLI A;  2JAC A;  2GZZ A;  1DE2 A;  4EIQ A;  5IMV A;  4KAE A;  1C72 A;  5G1L A;  3MWH A;  5B8B A;  4MJC A;  3VUR A;  1K3L A;  3KM6 A;  4XS1 A;  2B6M A;  3ZVJ D;  4MJE A;  5F0G A;  3VK9 A;  3L78 A;  1JLW A;  1B48 A;  1K0D A;  2OE0 A;  3PH9 A;  2HSM A;  1O8X A;  5ECH B;  4NWY A;  5IMC A;  4OCE A;  4TVE A;  1GUK A;  5J3R A;  2FA8 A;  4XRD A;  3FR9 A;  3R2Q A;  2BTO T;  2P5R A;  5G5F A;  4OFM A;  3CSH A;  2GTU A;  2OBI A;  2PN8 A;  1U87 A;  4L0W A;  2C3Q A;  4EF0 A;  3H79 A;  2YZU A;  3HDC A;  4BA7 A;  3GA4 A;  3TJF A;  2D2Z A;  3JCM L;  4G01 A;  1XIY A;  4ECB A;  3I6A A;  2R3X A;  2R0P A;  3H4K A;  2LQQ A;  1GTI A;  1QMV A;  3FZA A;  2PPT A;  1JHB A;  1M9A A;  5IO0 A;  4XIH A;  1V9W A;  3IBH A;  5FHI A;  1NW2 A;  4HZ4 A;  3VI5 A;  2VD1 A;  2O87 A;  1M3J A;  3RHC A;  4OWY A;  5G5E A;  4I8B A;  1A24 A;  4GQF A;  2EFD A;  2VL9 A;  4BL7 A;  3IRA A;  3A2X A;  1F6M C;  5ENU A;  4NAX A;  1SU9 A;  2JU5 A;  2FA4 A;  4K5S A;  1S3A A;  2GQM A;  3UOM A;  4L5O A;  5ID2 A;  10GS A;  2JZR A;  1SK2 A;  2GSQ A;  1FB0 A;  1O73 A;  3AY8 A;  2ES7 A;  2C0D A;  1JFU A;  4POK A;  4Z2T A;  3GN3 A;  4YKF A;  4ZB9 A;  2X8G A;  2LEG A;  5IPG A;  2UV8 G;  1O8W A;  2LJR A;  1YDK A;  4EUY A;  2KP1 A;  5IO2 A;  5BMU A;  1TK0 B;  5D93 A;  4MDC A;  1B4P A;  2CA8 A;  2LUS A;  2K18 A;  4K9Z A;  4WR5 A;  5KOX A;  3WGD A;  1F37 A;  4LMW A;  2H66 A;  4PI2 C;  1QQ2 A;  1O81 A;  3UJ1 A;  1TDI A;  4FXY P;  2VLU A;  4RUV A;  1GLQ A;  3O3T A;  3IA1 A;  4YQM A;  3TB2 A;  3I43 A;  1XG8 A;  3VPT A;  3WYW A;  4IP1 A;  2R0G A;  5G31 A;  3ZMK A;  5B8A A;  3EMX A;  3FHK A;  1IYI A;  5IQY A;  1OE7 A;  5IMF A;  3Q74 A;  1K3Y A;  3KXO A;  1TXU A;  3FZ4 A;  3FRC A;  3MNG A;  3QFA C;  1ON4 A;  2LS5 A;  1YY7 A;  3F0I A;  3P2A A;  4QQ7 A;  4FH8 A;  4IJ3 A;  4J2F A;  5HR0 A;  4NV2 A;  1WRY A;  1PX6 A;  1J0F A;  2C1Y A;  2FCH A;  2OT3 A;  1DE1 A;  3LG6 A;  4YAV A;  4O5U A;  13GS A;  3ERF A;  1K0N A;  3FZ5 A;  3KP8 A;  2HT9 A;  1GL8 A;  2L57 A;  1ZZY A;  1SVM A;  4K7I A;  3TRP A;  5J4Y A;  1GP1 A;  1HNC A;  18GS A;  1Z6N A;  1BYE A;  2VKZ G;  5D73 A;  4MF6 A;  2FUG 2;  3TJK A;  3DML A;  4OFT A;  1WWJ A;  4ECJ A;  3HYP A;  4OO4 A;  1WP0 A;  5GZZ B;  4GTU A;  3F3R A;  4G0L A;  1VF3 A;  1SVL A;  1SYX A;  2V1M A;  3KIJ A;  3TRQ A;  4EL1 A;  1RW1 A;  2IMK A;  4V2L A;  2L5L A;  3IK7 A;  1HD2 A;  1J08 A;  3KTB A;  2VLT A;  2HRA A;  1BED A;  2IJY A;  1F2E A;  1U88 A;  2VCQ A;  5ECR B;  1B9X C;  3E9J B;  3CXG A;  1TJD A;  1XWK A;  4KDY A;  4HZ2 A;  1NHO A;  1RQM A;  2IMD A;  3IHG A;  5ECM B;  2O7K A;  1DBY A;  3D4M A;  3APO A;  4K6X A;  5A4V A;  2FWH A;  2B7K A;  3WGE A;  5HFG A;  1R5P A;  3CRT A;  1SL2 B;  2IFQ B;  3UVT A;  19GS A;  1EZK A;  4XHM A;  3LYK A;  5DAL B;  2H71 A;  3MDK A;  12GS A;  1PX7 A;  4IN0 A;  1TOF A;  1EV4 A;  2E7P A;  3U5R E;  4L5L A;  1X9W B;  2R2J A;  4Q5Q A;  3GST A;  5ABR A;  1W4V A;  1RK4 A;  4GRF A;  4EC0 A;  3HVV A;  2EIR A;  2R37 A;  4XCS A;  1SKW B;  2G0F A;  1I5G A;  1NHY A;  4MMM A;  1GTB A;  1Y25 A;  3I69 A;  4K5R A;  5CAX A;  2LRN A;  6GSX A;  3C8E A;  3DVW A;  2H70 A;  2PWJ A;  5AIX A;  1FVJ A;  3LXT A;  4PQH A;  2H75 A;  4BWQ A;  8GSS A;  2WW3 A;  2C3T A;  2A4H A;  4IP6 A;  2ZNM A;  3F8U A;  4YKG A;  4MH3 A;  2TRX A;  1A0F A;  1A2L A;  2XBI A;  4IEL A;  1XBS A;  1BG5 A;  2ON7 A;  3WT1 A;  4ZL7 A;  1TU7 A;  5HQP A;  4PGT A;  4PQI A;  4PHZ C;  3WD6 A;  5JCU A;  2R4V A;  1OAZ A;  3GL3 A;  3M9J A;  2L59 A;  1J9B A;  3A2W A;  1AAZ A;  5CP1 A;  2VO4 A;  3RHB A;  2ZCT A;  4HJ2 A;  3C1R A;  3LSZ A;  3LFL A;  2WW1 A;  4QMK A;  4I6X A;  3ERG A;  3M3M A;  1IYH A;  5J4V A;  2FNO A;  3DRN A;  4DSQ A;  2KUC A;  4ZL8 A;  3I9V 2;  1TTZ A;  1WIK A;  4AKX B;  2IFQ A;  3IV4 A;  3ME8 A;  1TK5 B;  2DJ2 A;  3UAR A;  1O7U A;  2WW0 A;  5GSS A;  3F3Q A;  2GT6 A;  17GS A;  5DAL A;  1YKA A;  4HUA A;  1XW5 A;  2CAQ A;  2VCZ A;  5ECO B;  2YWM A;  4PI0 C;  1B4Q A;  3CQF A;  1EEM A;  1MEK A;  1SJI A;  4NMU A;  4I2T A;  4EO3 A;  5IM9 A;  1EWX A;  1OKT A;  3L9U A;  4HQS A;  5F07 A;  1SD8 A;  3QCP A;  4LA1 A;  2K6V A;  3DXB A;  4NHZ A;  1CQG A;  3VWX A;  4KCE A;  4HQZ A;  2P0G A;  3A5I A;  2YV9 A;  2K8S A;  2QA2 A;  3H93 A;  2VCT A;  2IL3 A;  1U3I A;  4XTS A;  4LL1 B;  1ZOF A;  2N5A A;  3A2V A;  3NIV A;  3CMI A;  3ME7 A;  1Z3E A;  2AYT A;  1LU4 A;  3FY7 A;  3ZLP A;  2M72 A;  2AV4 A;  5G30 A;  3GNJ A;  3LOR A;  5B6M A;  2NTO A;  4KSM A;  3QPM A;  4N0Z A;  3GV1 A;  1SJ6 A;  2DIZ A;  1PA3 A;  4MJB A;  2WVY A;  1XWG A;  3NZN A;  5ECI B;  2FD3 A;  4E8H A;  2B5X A;  2OBK A;  2VL2 C;  2IPA A;  5HFK A;  4F03 A;  4RI7 A;  1PGT A;  3ISO A;  4KGI A;  1GNE A;  4XS6 A;  1EP8 A;  1PQN A;  2YN1 A;  4CW9 A;  2I81 A;  1YEX A;  1FB6 A;  4GWR A;  3QAG A;  1NSW A;  3C1S A;  4ZBA A;  2XPE A;  3HHV A;  2I1U A;  2DML A;  1KBN A;  3Q18 A;  1R4W A;  1Q4J A;  1Y1U A;  3UVH A;  3EU3 A;  3TGZ A;  2OA7 A;  2B3S A;  2CZ2 A;  3F9U A;  5KN3 A;  2H01 A;  4AJ7 A;  2EFH A;  5DVB A;  4WKW A;  4IS0 A;  1TI1 A;  4G9H A;  3EC3 A;  5A34 B;  3LYP A;  3F63 A;  2C4J A; 
#chains in the Genus database with same CATH homology
 3HVX A;  1XFL A;  4V1A p;  2MMZ A;  4TRX A;  2XHF A;  4KA0 A;  4WR4 A;  3W6G A;  2VAF A;  4HEA 2;  1HNA A;  4Q5F A;  3US3 A;  2DJ0 A;  1YJ6 A;  3GIX A;  3J7Y k;  3KH9 A;  3TJB A;  4AI6 A;  2ZUP A;  4X43 A;  2FLS A;  2X8H A;  3C7M A;  2A2S A;  4BWS A;  2J9H A;  3RPP A;  1GSD A;  4F0C A;  5ECS A;  5CRG A;  2GGT A;  3P8W A;  3M9K A;  4JR4 A;  2QKE A;  1F3B A;  4OD7 A;  4ID0 A;  4DEJ A;  4WBJ A;  3C73 A;  3TU3 B;  3ZVJ A;  5H5S A;  1M2D A;  1M7T A;  5F06 A;  3N5O A;  1ZYN A;  1XOB A;  5COH A;  4AJ8 A;  1GNW A;  3W8J A;  4TXV A;  9GSS A;  3RPN A;  1JZR A;  16GS A;  1TRV A;  1SEN A;  1T3B A;  1U6T A;  2LRT A;  5KN0 A;  1MDK A;  5D9W A;  1GTA A;  5JCG A;  4CHS A;  4X4J A;  5AIV A;  4TOP A;  3CSJ A;  2KP2 A;  3RBT A;  3M1G A;  2OAD A;  1G7E A;  4MNN A;  3HZ8 A;  7GSS A;  3FW2 A;  2EFE A;  3SWL A;  1QXH A;  4MF7 A;  2H73 A;  1HNB A;  3VLN A;  4AF2 A;  4GCI A;  1UA5 A;  1XVQ A;  2HRF A;  1UVZ A;  3LEF A;  1A0R P;  2I9H A;  3G7J A;  2VCV A;  1X0R A;  3KEB A;  2CX3 A;  2X64 A;  1G6Y A;  2C3N A;  4WF5 A;  3MIX A;  5D9X A;  2DIY A;  2WDU A;  3CRU A;  4N3Z A;  2B5E A;  2GSR A;  2OE3 A;  3KGK A;  2X4A A;  5B6N A;  1A8Y A;  4P3Y B;  4DVC A;  3OR5 A;  4I5Q A;  1SVO A;  3TUE A;  1N2A A;  4EKZ A;  4IQA A;  4L0U A;  3UEM A;  3S9F A;  1ABA A;  4GSS A;  1GTU A;  2X99 A;  4Z7X A;  4HS1 A;  3EUR A;  1GSS A;  2DJ1 A;  2YPM A;  1ZL9 A;  5DQY A;  2HSN B;  4TKY A;  4KDX A;  2GDR A;  1Z6M A;  4MH2 A;  2RUF A;  1S3C A;  3UBL A;  5G2Z A;  1TW9 A;  2VM2 A;  5KN2 A;  1E6B A;  2JZT A;  2KOK A;  1FVK A;  1K3O A;  2PUK C;  4KW6 A;  1W89 A;  1ERW A;  4JBB A;  4POL A;  2CV4 A;  2GQK A;  1TRU A;  3ZZX A;  2IME A;  1XVW A;  4FQU A;  2DKH A;  1XW9 A;  4K8M A;  4TN8 A;  5J41 A;  5E59 A;  1GSF A;  1VF4 A;  2GQL A;  3GTU B;  3LQ7 A;  1R5A A;  1AW9 A;  1Q98 A;  2ON5 A;  2WB9 A;  4H86 A;  3BCK A;  2CAI A;  3WGX A;  1Z7P A;  3HY2 A;  3MSZ A;  4W66 A;  4MZW A;  2HNL A;  3QMX A;  3TJG A;  1QK8 A;  1GRX A;  4FYC A;  1O85 A;  5DCH A;  1M0U A;  1BG1 A;  2IWT A;  1GSE A;  4AJ6 A;  2DJJ A;  5J47 A;  2H76 A;  2CVK A;  4O5Q A;  3EVI A;  1FW1 A;  2XPD A;  1GUM A;  5A5H B;  1SYR A;  2HSN A;  3GRX A;  5KN1 A;  3PPU A;  1ERU A;  1EGR A;  3L0H A;  3HKR A;  1T4Z A;  3UMA A;  5IMA A;  3CSI A;  4F9Z A;  1PN9 A;  1BX9 A;  3PR8 A;  1AUC A;  4I97 A;  4F2I A;  3NOF A;  2IN3 A;  4WET A;  22GS A;  4BVX B;  1LJR A;  4IHU A;  3DGQ A;  1PN0 A;  2H6X A;  4KB3 A;  4TW5 A;  3ERW A;  3GFK A;  2OE1 A;  3Q6O A;  4JED A;  1KTE A;  2V6K A;  1THX A;  1OC9 B;  4GF0 A;  1T4Y A;  4V2N A;  4POM A;  2FGX A;  2DJK A;  1TRS A;  4TR4 A;  1PL1 A;  3GTU A;  2F8A A;  2BMX A;  4YQU A;  1VF1 A;  2R5G A;  5DDL A;  2TIR A;  4ZIL A;  1F3A A;  3WT2 A;  2JL4 A;  3ZL5 A;  2C0G A;  2NBS A;  4EIP A;  3ZML A;  3DVX A;  1WJK A;  1XCC A;  2HFD A;  2MMA A;  4MPG A;  1KEB A;  4NHW A;  1UN2 A;  3C71 A;  3TRX A;  2HYX A;  1SK0 A;  1V2A A;  5IPH A;  4CY6 A;  2HRK B;  2REM A;  3TKQ A;  2HZF A;  1WOU A;  1FAA A;  5A4U A;  4IQ1 A;  2JAD A;  3FMW A;  5A5H A;  3IOS A;  1SD9 A;  4MCU A;  2DJ3 A;  1VRS D;  4PQ1 A;  3BCI A;  3VWU A;  1PSQ A;  1XWB A;  2H0I A;  2VD0 A;  1H75 A;  4AKG A;  2WCI A;  1YKC A;  1A2J A;  2F8F A;  3UAP A;  1T1V A;  2B7J A;  5FWG A;  2N5B A;  1Z7R A;  3IC8 A;  1GSU A;  3ZFB A;  1V58 A;  4MPF A;  5INY A;  1YZX A;  2VL2 A;  3TKS A;  1VGL A;  3GH6 A;  2H74 A;  1TKD B;  3GX0 A;  3KJY A;  1OC9 A;  1Z5Y E;  4EVM A;  5KEJ A;  2GZY A;  4ZB7 A;  2A2R A;  3EIN A;  2JZS A;  1M99 A;  1AC1 A;  3M8N A;  1EOH A;  2FWF A;  2QGV A;  2X8C A;  3ZYW A;  4GXZ A;  4MLY A;  5E4W A;  3MAK A;  2EIO A;  4ZBB A;  2CX4 A;  3E3E A;  1PKZ A;  1O6J A;  2FWE A;  3LWA A;  4KCA A;  4XRA A;  4EDY A;  2YZH A;  3IXR A;  4FYU A;  1XXU A;  1USB A;  3CBU A;  4MF5 A;  2HZE B;  2LNT A;  1GLP A;  1XWA A;  2H1A A;  1MD4 A;  2CT6 A;  2L5O A;  2YJ7 A;  3D5J A;  5BRT A;  4KUN A;  5HFI A;  4DSS B;  1AQV A;  4CDO A;  1PKW A;  4ISD A;  1B8X A;  2EIQ A;  3KP9 A;  1ERT A;  4PNF A;  3VWW A;  3G9B A;  5A1N B;  4O92 A;  2H0G A;  4FO5 A;  1K0O A;  5LD0 A;  2H72 A;  2H1L A;  2EFC A;  1XOA A;  3QOU A;  2L6C A;  5KOW A;  1GSQ A;  2GSS A;  4OFN A;  2KHP A;  2DMM A;  2VL3 A;  4E8E A;  1ACV A;  2EC4 A;  3KTL A;  2P5Q A;  2E2G A;  4A5P A;  4NXI A;  1MD3 A;  4TR1 B;  2HSY A;  1OC3 A;  2UZ8 A;  3TKS C;  3O76 A;  4RQR A;  4HU7 A;  3KZQ A;  1R26 A;  4POB A;  4G0I A;  2YWO A;  5C04 A;  4YQV A;  5L71 A;  2HSM B;  2HXK A;  3CTF A;  2YNX A;  6GSU A;  2H0H A;  1YQ1 A;  5AGY A;  3DD3 A;  4X0X A;  4V1A g;  1WPI A;  4AKI A;  4N0V A;  5A4W A;  2V2G A;  1OYJ A;  1X9M B;  3IR4 A;  1A23 A;  3F4R A;  1GSY A;  3QFB C;  3VI7 A;  4FYB A;  2KLX A;  3KMO A;  4MJA A;  1V98 A;  1TK8 B;  2HZE A;  1F9M A;  3L9V A;  4Z2U A;  1GUL A;  3N9J A;  1EEJ A;  3W8S A;  2XC2 A;  2LST A;  4PUF C;  2QSI A;  5D9V A;  1N8J A;  5EY6 A;  4DSS A;  4L8E A;  4MA9 A;  3EU4 A;  1OE8 A;  2YCD A;  4GQC A;  2C0F A;  4AKH A;  5AN1 A;  2XBQ A;  3SBC A;  2V41 A;  2VCX A;  5A1N A;  3KD0 A;  1K0B A;  2MYG A;  4USS A;  2VUP A;  4IW9 A;  4PNG A;  3ZRE A;  4ULX A;  3ED3 A;  2QC7 A;  1Y6E A;  4BPY A;  2LJA A;  3D4T A;  1MDJ A;  2WRT A;  4LMV A;  3IDV A;  5D96 A;  1QGV A;  3LW9 A;  3UBK A;  3DEX A;  3P90 A;  2A4V A;  1T7P B;  2NDO A;  4OMV A;  1ZCP A;  4G19 A;  2AAW A;  4AGS A;  3A5W A;  1K0M A;  1ZMA A;  3TDG A;  4TR1 A;  5EPF A;  4IBP A;  3GYK A;  1EOG A;  3Q19 A;  3D21 A;  5JWR B;  4HJM A;  5BMU B;  4K7O A;  4N30 A;  3VFI A;  4ZB6 A;  4EE0 A;  2I4A A;  2VIM A;  3A3T A;  3P7X A;  4NV5 A;  1CQH A;  3CWG A;  3L9S A;  4BVY B;  1H4O A;  2H19 A;  2K8V A;  5A5K A;  1FOV A;  5GAP D;  2VOC A;  4O5R A;  5JWQ B;  3FZ9 A;  2DLX A;  3FEU A;  4D73 B;  2E0Q A;  1TU8 A;  4KDU A;  1T00 A;  4Z2R A;  1G6W A;  2WS2 A;  2AUV A;  2H6Z A;  4G10 A;  4V2M A;  1A2M A;  4IGJ A;  5ECN B;  1YEP A;  3M0F A;  3EYT A;  4JRR A;  3V1W A;  1G7O A;  2WFC A;  5A34 A;  2HRN A;  1AQW A;  3KCM A;  2YP6 A;  4ZIJ A;  2L4C A;  3HCZ A;  2DC5 A;  4QL7 A;  4K0N A;  3TKR A;  4PXO A;  1V57 A;  4G2E A;  1XWC A;  2J23 A;  5CYY A;  1S3D A;  4HOJ A;  5F8B A;  4ICY A;  5CRW A;  4GSN A;  2O89 A;  3APS A;  2O85 A;  3U6V A;  1X5E A;  3VPQ A;  5IOX A;  6GSW A;  1OVN A;  2JSY A;  2PGT A;  2HLS A;  5J4U A;  2P31 A;  2HQT A;  4JZQ A;  5CRE A;  4IJI A;  5H5R A;  3E0U A;  4KND A;  4ACS A;  2GT5 A;  3TJJ A;  2PVO C;  3LJR A;  1XW6 A;  3TCO A;  1GUH A;  3EMP A;  1OKD A;  1DSB A;  3ZTL A;  1XPV A;  2X49 A;  2PU9 C;  5B7C A;  2PER A;  3GKK A;  3L4N A;  3KH7 A;  3GKM A;  2Z9S A;  4BVY A;  1PRX A;  5DJL A;  4EDZ A;  1M2B A;  1HYU A;  4ILF A;  1TRW A;  5IMZ A;  5LCZ A;  4WF4 A;  4Q5N A;  2IIY A;  1NM3 A;  4D73 A;  1B9Y C;  3CYN A;  4KE3 A;  1SKR B;  4ZL9 A;  3GKN A;  1SKS B;  2LQO A;  2F3M A;  3O6T A;  3TOU A;  3HVS A;  4MK3 A;  2YV7 A;  3BD2 A;  2MZC A;  3HA9 A;  5HR1 A;  4GDF A;  3IHQ A;  3TOT A;  2C0E A;  2I3Y A;  2HSH A;  1OC8 A;  1X9S B;  5CRH A;  2B1L A;  3F6D A;  2H1B A;  5ELG A;  1FO5 A;  2CZ3 A;  2M80 A;  3HJM A;  1JLV A;  5EVO A;  2MBS A;  4K0G A;  4ECC A;  4F0B A;  5D9T A;  1PD2 1;  3ZIT A;  2DKI A;  2YOI A;  2LTK A;  3GX8 A;  4IKH A;  3GHA A;  1EV9 A;  1PL2 A;  3HMJ G;  2OJL A;  2A2P A;  5JWO B;  1ZYE A;  5J9C A;  3H1N A;  4E68 A;  4ML1 A;  2V32 A;  4I2U A;  3RDW A;  11GS A;  1T8E B;  3K8N A;  3IAS 2;  3IAM 2;  2LV3 A;  3GKX A;  2AJQ B;  4HI7 A;  4YH2 A;  2FY6 A;  5JCW A;  2PMT A;  2CVB A;  2VM1 A;  1SL0 B;  1K0A A;  2LNS A;  2RM5 A;  1EP7 A;  2RM6 A;  4PTS A;  2V6O A;  5LNK e;  1E2Y A;  2CVD A;  3D6I A;  4KH7 A;  2N5F A;  5ECQ B;  4XS4 B;  1XZO A;  3GL5 A;  4ECI A;  14GS A;  1BJX A;  2K9F A;  2TRC P;  5IMD A;  5FT3 A;  5ECP B;  2OAC A;  5J40 A;  1WMJ A;  4PX1 A;  1TXX A;  2LRC A;  1DUG A;  1QUW A;  2C8U A;  2DSA A;  3HD5 A;  1WE0 A;  3H8Q A;  2F9S A;  4LLR A;  3ZIV A;  2HI7 A;  3FKF A;  1K0C A;  3EPT A;  3FYG A;  1BQ7 A;  4KSO A;  2LJK A;  3RAZ A;  6GSV A;  5IOW A;  2FHE A;  4PUA A;  4PUR A;  3PIN A;  4K2X A;  5DCG A;  3ZIJ A;  3BBY A;  2R0C A;  4TXO B;  3GH9 A;  1VF2 A;  3F4T A;  2QA1 A;  1AQX A;  1JZW A;  2R6K A;  4Q5R A;  4WEY A;  4WBR D;  2FWG A;  3DIE A;  4KF9 A;  3G7Y A;  4HU9 A;  4ML6 A;  4GLT A;  2M46 A;  2IMI A;  5DAK B;  1GH2 A;  1GWC A;  4MAB A;  4K2D A;  2YWN A;  3BJ5 A;  1X5C A;  1ST9 A;  3FK8 A;  1AIU A;  3APQ A;  1SJZ A;  1SL1 B;  2MMO A;  3EE2 A;  4JE1 A;  2WZ9 A;  1BAY A;  3IK9 A;  4BVX A;  1N25 A;  5GAN D;  2VLV A;  1U3A A;  4TR0 A;  4EXJ A;  1ML6 A;  1ERV A;  4IVF A;  4N10 A;  5ELA A;  2B1K A;  2O8V B;  4G0K A;  4CY8 A;  1ZGN A;  2NVL A;  5D8I A;  3F4S A;  4XS4 A;  5ECK B;  2H1G A;  4F82 A;  2YJH A;  2H8L A;  1URM A;  3CTG A;  5EL8 A;  1ZYQ B;  5ECL B;  3FR3 A;  2WJU A;  2O5V A;  3G7I A;  2GVP A;  5DQS A;  4K7N A;  1A8L A;  3VWV A;  3PGT A;  2JSZ A;  1FG4 A;  1QFN A;  2DBC A;  3LXZ A;  1V40 A;  3DWV A;  2RUE A;  3DKS A;  1M9B A;  4J56 E;  4TR3 A;  4HDE A;  4JR6 A;  2YAN A;  3GSS A;  3QDN A;  4MZB A;  1BF5 A;  3QAV A;  5J9B A;  3QR6 A;  2E2M A;  2H30 A;  3HXS A;  4KX4 A;  3R3E A;  4TXO A;  2HRK A;  4RQX A;  1X5D A;  2IMF A;  1AXD A;  3LGC A;  2H6Y A;  1KNG A;  1TP9 A;  3HJO A;  3IPZ A;  5HR2 A;  5H5Q A;  2CQ9 A;  5G1K A;  3UL3 A;  3ZRD A;  4MP4 A;  2PVQ A;  2HE3 A;  3GUR A;  20GS A;  5HR3 A;  2GLR A;  2OKA A;  2YWI A;  5DAK A;  1MDI A;  3J7Y b;  3BOA A;  2BJX A;  1ILO A;  5J5N A;  3DYR A;  1HQO A;  4NPB A;  2PBJ A;  1ZYP A;  3GUS A;  5CNW A;  3IC4 A;  1SK1 A;  1FOH A;  1JZO A;  1G0T A;  3F6F A;  2LKU A;  3HJP A;  5CO3 A;  4O7H A;  5F05 A;  1Z9H A;  1EGO A;  1UC7 A;  4MZC A;  2AB6 A;  5CRD A;  3ZFL A;  2NPB A;  4OO5 A;  3TKS E;  1PMT A;  3D22 A;  4ZXG A;  2GZP A;  3MYD A;  4WXT A;  3GMF A;  4RI6 A;  5IIZ A;  5C00 A;  4X1U A;  5GST A;  2RII A;  2F51 A;  2L4Q A;  3KMN A;  5DJM A;  3IE3 A;  2G2Q A;  2GS3 A;  4N11 A;  2ALB A;  2GST A;  1YVL A;  2MMN A;  4J57 E;  1YF1 A;  2WGR A;  1TI3 A;  1FHE A;  6GSY A;  1YF0 A;  1M2A A;  3HZ4 A;  6GSS A;  6GST A;  2WUL A;  4JU5 A;  3EWL A;  2AHE A;  2VCW A;  2H1D A;  3TKP A;  2L6D A;  4YAP A;  4QL9 A;  2C80 A;  4ZBD A;  4DSR A;  1JZD A;  1THO A;  3FR6 A;  2B5Y A;  4BL7 B;  3QAW A;  1R7H A;  4K1F A;  5AIS A;  3QD9 A;  4O32 A;  4LL4 B;  1I9D A;  3UIW A;  4OCF A;  4ZB8 A;  1LBK A;  5DBQ A;  3D0Z A;  4FIW A;  5ID2 B;  2MBT A;  4GST A;  1MTC A;  2RLI A;  2JAC A;  2GZZ A;  1DE2 A;  4EIQ A;  5IMV A;  4KAE A;  1C72 A;  5G1L A;  3MWH A;  5B8B A;  4MJC A;  3VUR A;  1K3L A;  3KM6 A;  4XS1 A;  2B6M A;  3ZVJ D;  4MJE A;  5F0G A;  3VK9 A;  3L78 A;  1JLW A;  1B48 A;  1K0D A;  2OE0 A;  3PH9 A;  2HSM A;  1O8X A;  5ECH B;  4NWY A;  5IMC A;  4OCE A;  4TVE A;  1GUK A;  5J3R A;  2FA8 A;  4XRD A;  3FR9 A;  3R2Q A;  2BTO T;  2P5R A;  5G5F A;  4OFM A;  3CSH A;  2GTU A;  2OBI A;  2PN8 A;  1U87 A;  4L0W A;  2C3Q A;  4EF0 A;  3H79 A;  2YZU A;  3HDC A;  4BA7 A;  3GA4 A;  3TJF A;  2D2Z A;  3JCM L;  4G01 A;  1XIY A;  4ECB A;  3I6A A;  2R3X A;  2R0P A;  3H4K A;  2LQQ A;  1GTI A;  1QMV A;  3FZA A;  2PPT A;  1JHB A;  1M9A A;  5IO0 A;  4XIH A;  1V9W A;  3IBH A;  5FHI A;  1NW2 A;  4HZ4 A;  3VI5 A;  2VD1 A;  2O87 A;  3RHC A;  4OWY A;  5G5E A;  4I8B A;  1A24 A;  4GQF A;  2EFD A;  2VL9 A;  4BL7 A;  3IRA A;  3A2X A;  1F6M C;  5ENU A;  4NAX A;  1SU9 A;  2JU5 A;  2FA4 A;  4K5S A;  1S3A A;  2GQM A;  3UOM A;  4L5O A;  5ID2 A;  10GS A;  2JZR A;  1SK2 A;  2GSQ A;  1FB0 A;  1O73 A;  3AY8 A;  2ES7 A;  2C0D A;  1JFU A;  4POK A;  4Z2T A;  3GN3 A;  4YKF A;  4ZB9 A;  2X8G A;  2LEG A;  5IPG A;  2UV8 G;  1O8W A;  2LJR A;  1YDK A;  4EUY A;  2KP1 A;  5IO2 A;  5BMU A;  1TK0 B;  5D93 A;  4MDC A;  1B4P A;  2CA8 A;  2LUS A;  2K18 A;  4K9Z A;  4WR5 A;  5KOX A;  3WGD A;  1F37 A;  4LMW A;  2H66 A;  1QQ2 A;  1O81 A;  3UJ1 A;  1TDI A;  2VLU A;  4RUV A;  1GLQ A;  3O3T A;  3IA1 A;  4YQM A;  3TB2 A;  3I43 A;  3VPT A;  3WYW A;  4IP1 A;  2R0G A;  5G31 A;  3ZMK A;  5B8A A;  3EMX A;  3FHK A;  1IYI A;  5IQY A;  1OE7 A;  5IMF A;  3Q74 A;  1K3Y A;  3KXO A;  1TXU A;  3FZ4 A;  3FRC A;  3MNG A;  3QFA C;  1ON4 A;  2LS5 A;  1YY7 A;  3F0I A;  3P2A A;  4QQ7 A;  4FH8 A;  4IJ3 A;  4J2F A;  5HR0 A;  4NV2 A;  1WRY A;  1PX6 A;  1J0F A;  2C1Y A;  2FCH A;  2OT3 A;  1DE1 A;  3LG6 A;  4YAV A;  4O5U A;  13GS A;  3ERF A;  1K0N A;  3FZ5 A;  3KP8 A;  2HT9 A;  1GL8 A;  2L57 A;  1ZZY A;  1SVM A;  4K7I A;  3TRP A;  5J4Y A;  1GP1 A;  1HNC A;  18GS A;  1Z6N A;  1BYE A;  2VKZ G;  5D73 A;  4MF6 A;  2FUG 2;  3TJK A;  3DML A;  4OFT A;  1WWJ A;  4ECJ A;  3HYP A;  4OO4 A;  1WP0 A;  5GZZ B;  4GTU A;  3F3R A;  4G0L A;  1VF3 A;  1SVL A;  1SYX A;  2V1M A;  3KIJ A;  3TRQ A;  4EL1 A;  1RW1 A;  2IMK A;  4V2L A;  2L5L A;  3IK7 A;  1HD2 A;  1J08 A;  3KTB A;  2VLT A;  2HRA A;  1BED A;  2IJY A;  1F2E A;  1U88 A;  2VCQ A;  5ECR B;  1B9X C;  3E9J B;  3CXG A;  1TJD A;  1XWK A;  4KDY A;  4HZ2 A;  1NHO A;  1RQM A;  2IMD A;  3IHG A;  5ECM B;  2O7K A;  1DBY A;  3D4M A;  3APO A;  4K6X A;  5A4V A;  2FWH A;  2B7K A;  3WGE A;  5HFG A;  1R5P A;  3CRT A;  1SL2 B;  2IFQ B;  3UVT A;  19GS A;  1EZK A;  4XHM A;  3LYK A;  5DAL B;  2H71 A;  3MDK A;  12GS A;  1PX7 A;  4IN0 A;  1TOF A;  1EV4 A;  2E7P A;  3U5R E;  4L5L A;  1X9W B;  2R2J A;  4Q5Q A;  3GST A;  5ABR A;  1W4V A;  1RK4 A;  4GRF A;  4EC0 A;  3HVV A;  2EIR A;  2R37 A;  4XCS A;  1SKW B;  2G0F A;  1I5G A;  1NHY A;  4MMM A;  1GTB A;  1Y25 A;  3I69 A;  4K5R A;  5CAX A;  2LRN A;  6GSX A;  3C8E A;  3DVW A;  2H70 A;  2PWJ A;  5AIX A;  1FVJ A;  3LXT A;  4PQH A;  2H75 A;  4BWQ A;  8GSS A;  2C3T A;  2A4H A;  4IP6 A;  2ZNM A;  3F8U A;  4YKG A;  4MH3 A;  2TRX A;  1A0F A;  1A2L A;  2XBI A;  4IEL A;  1XBS A;  1BG5 A;  2ON7 A;  3WT1 A;  4ZL7 A;  1TU7 A;  5HQP A;  4PGT A;  4PQI A;  3WD6 A;  5JCU A;  2R4V A;  1OAZ A;  3GL3 A;  3M9J A;  2L59 A;  1J9B A;  3A2W A;  1AAZ A;  5CP1 A;  2VO4 A;  3RHB A;  2ZCT A;  4HJ2 A;  3C1R A;  3LSZ A;  3LFL A;  4QMK A;  4I6X A;  3ERG A;  3M3M A;  1IYH A;  5J4V A;  2FNO A;  3DRN A;  4DSQ A;  2KUC A;  4ZL8 A;  3I9V 2;  1TTZ A;  1WIK A;  4AKX B;  2IFQ A;  3IV4 A;  3ME8 A;  1TK5 B;  2DJ2 A;  3UAR A;  1O7U A;  5GSS A;  3F3Q A;  2GT6 A;  17GS A;  5DAL A;  1YKA A;  4HUA A;  1XW5 A;  2CAQ A;  2VCZ A;  5ECO B;  2YWM A;  1B4Q A;  1EEM A;  1MEK A;  1SJI A;  4NMU A;  4I2T A;  4EO3 A;  5IM9 A;  1EWX A;  1OKT A;  3L9U A;  4HQS A;  5F07 A;  1SD8 A;  3QCP A;  4LA1 A;  2K6V A;  3DXB A;  4NHZ A;  1CQG A;  3VWX A;  4KCE A;  4HQZ A;  2P0G A;  3A5I A;  2YV9 A;  2K8S A;  2QA2 A;  3H93 A;  2VCT A;  2IL3 A;  1U3I A;  4XTS A;  4LL1 B;  1ZOF A;  2N5A A;  3A2V A;  3NIV A;  3CMI A;  3ME7 A;  1Z3E A;  2AYT A;  1LU4 A;  3FY7 A;  3ZLP A;  2M72 A;  2AV4 A;  5G30 A;  3GNJ A;  3LOR A;  5B6M A;  2NTO A;  4KSM A;  3QPM A;  4N0Z A;  3GV1 A;  1SJ6 A;  2DIZ A;  1PA3 A;  4MJB A;  1XWG A;  3NZN A;  5ECI B;  2FD3 A;  4E8H A;  2B5X A;  2OBK A;  2VL2 C;  2IPA A;  5HFK A;  4F03 A;  4RI7 A;  1PGT A;  3ISO A;  4KGI A;  1GNE A;  4XS6 A;  1EP8 A;  1PQN A;  2YN1 A;  4CW9 A;  2I81 A;  1YEX A;  1FB6 A;  4GWR A;  3QAG A;  1NSW A;  3C1S A;  4ZBA A;  2XPE A;  3HHV A;  2I1U A;  2DML A;  1KBN A;  3Q18 A;  1R4W A;  1Q4J A;  1Y1U A;  3UVH A;  3EU3 A;  3TGZ A;  2OA7 A;  2B3S A;  2CZ2 A;  3F9U A;  5KN3 A;  2H01 A;  4AJ7 A;  2EFH A;  5DVB A;  4WKW A;  4IS0 A;  1TI1 A;  4G9H A;  3EC3 A;  5A34 B;  3LYP A;  3F63 A;  2C4J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...