4F03A

Crystal structure of the glutathione transferase gte1 from phanerochaete chrysosporium
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
251
structure length
251
Chain Sequence
AQPIVFYDIPSNERIKHSPWSPNTWKIRYALNYKGLKYKTEWVEYPDIAGVVQKLGGKPTEKTPDGRDHYTLPVIYDPNTKKVVEDSAAIAKYLDETYPDTPKLFPAGTDAFQAAFLDFAWPVLGFPVFMLVILDTANSLLPRSHDYFRSTREQKFGKKLEELATEEEWAKVEAGLAKLKGYLDANGKGNDLLLMGAQGGITYSDIQIASFFVWAKIIWGEGSEKWKRLISLHDGKWAQFYAQFTKFEQVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione transferase
publication title Characterization of a Phanerochaete chrysosporium Glutathione Transferase Reveals a Novel Structural and Functional Class with Ligandin Properties.
pubmed doi rcsb
source organism Phanerochaete chrysosporium
molecule tags Transferase
total genus 93
structure length 251
sequence length 251
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4f03A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4f03A01
2YJ7A 3F4TA 4IJ3A 2LTKA 5ECIB 4NHZA 4HU7A 2YZUA 1K0AA 4IJIA 4P3YB 1JFUA 5EVOA 5C04A 5F06A 2R37A 1TOFA 1MDKA 1AUCA 1SYXA 3RDWA 2L6CA 4KDUA 3IOSA 4QQ7A 2ON5A 3KP9A 3ME8A 4NXIA 4HI7A 4KX4A 2KUCA 4KB3A 1J9BA 4EKZA 5ID2B 4TVEA 1SJIA 1WWJA 4K7NA 2IMEA 4GCIA 5H5QA 5IMVA 5IOXA 2FWFA 3CSHA 3TB2A 5CRWA 5GAPD 2QSIA 3Q74A 1SKWB 1U3IA 5G31A 3BOAA 5D96A 2EC4A 2V6KA 1HNBA 1QK8A 5ECNB 4HJ2A 2K8SA 5H5SA 4XIHA 4F82A 1TTZA 1GNWA 3UEMA 5ID2A 2OBIA 4WXTA 3IR4A 2X99A 3U6VA 4TXOA 1VGLA 4ZB6A 2NTOA 5LCZA 8GSSA 3DWVA 2R6KA 2HSYA 1OE8A 4XCSA 1KEBA 4AJ8A 5L71A 2GGTA 4WKWA 1BG5A 3WT1A 2AYTA 2H76A 2H6XA 3KTLA 4HUAA 4MK3A 3IPZA 3C71A 1V58A 5ECPB 2H74A 1XFLA 3APSA 3O3TA 4MZCA 4ZL9A 2B5YA 2VIMA 3D6IA 3LEFA 4BWQA 1PRXA 4IQ1A 1GUMA 3LQ7A 4JU5A 2DJKA 3MSZA 5F0GA 5ECQB 3DKSA 3HY2A 2HSHA 2GDRA 2HXKA 1AXDA 1LU4A 3ZREA 5LD0A 3C1RA 1V2AA 1A2JA 2MBTA 3I43A 5DCHA 3EC3A 3UAPA 2HZEA 2TRCP 2DBCA 3KMNA 4IKHA 3I9V2 17GSA 2H8LA 1O7UA 3QDNA 1TK8B 4EE0A 4NAXA 1Z7PA 1I5GA 1PSQA 2PBJA 2VD1A 4DEJA 3GSSA 2K9FA 2WZ9A 4V1Ap 3ZVJA 2CZ3A 3GL5A 1MEKA 4IBPA 1LBKA 1UVZA 1EEMA 3L78A 4JR6A 3TKQA 4BVYA 4ZIJA 1PGTA 1TP9A 1X0RA 4NPBA 3I6AA 1V40A 2HSMA 4ISDA 3GIXA 2DJJA 1X9WB 2VCWA 4IP1A 1X5CA 1RK4A 1H4OA 2QGVA 4MCUA 2PVQA 1QUWA 4MMMA 2GVPA 1ZOFA 3H79A 1EGOA 4YH2A 4HOJA 2I4AA 3ISOA 1GLQA 3EWLA 4GRFA 4RQXA 2YPMA 1Z6MA 5IMFA 4F2IA 5AISA 3TRQA 5HFKA 3TDGA 5KN2A 2K8VA 1KBNA 1K0CA 3GH9A 4IELA 4OWYA 3EINA 1G7EA 2YV9A 2V41A 3TKRA 4F0BA 3F8UA 2JSZA 4TR1B 3RPNA 4NV5A 2XBIA 2GS3A 3GTUB 13GSA 2BJXA 3UOMA 2VLTA 3JCML 1WOUA 4I8BA 4JEDA 2I81A 3UVTA 3DD3A 2YWIA 3HYPA 2H01A 3TJFA 2DJ0A 1B48A 4EDZA 1YJ6A 3APOA 1S3DA 2IFQB 3H4KA 6GSSA 3GHAA 2IIYA 1TRWA 5B6MA 1PN9A 1JZOA 2VM2A 4YQUA 2J9HA 3PR8A 4PTSA 2GQLA 2HRFA 2AJQB 3IAM2 1UC7A 4TR3A 5IM9A 1T00A 3HVVA 1XW5A 4PQ1A 4DSRA 1V9WA 4X0XA 2HFDA 4BWSA 1WMJA 1JLVA 3L9SA 3H93A 2YCDA 2MZCA 11GSA 4PUAA 4ZILA 2P31A 5DALA 1YF0A 3G7JA 3QAWA 4KCAA 1G6WA 1F3BA 16GSA 2WRTA 1ST9A 3KCMA 1R5AA 1ON4A 3G7IA 2LUSA 2PVOC 3GN3A 4KW6A 5CRGA 1XOBA 1FVKA 3S9FA 3UVHA 5GZZB 4TRXA 5A4UA 4XRAA 3EMXA 4MF7A 1SYRA 1SJZA 2H72A 4G0LA 2I1UA 2JSYA 1TK0B 2IJYA 3QFAC 3ZRDA 1GSEA 1GL8A 2F8AA 3M1GA 2C0DA 1XXUA 2H30A 1XZOA 4KNDA 3EVIA 3LXZA 4JE1A 4NMUA 2VAFA 1GTBA 4KSOA 5KN1A 2B3SA 2IPAA 1TK5B 4LMVA 5DCGA 3D4MA 1GRXA 3GSTA 5D9TA 6GSYA 1FAAA 3KEBA 3IC8A 1SJ6A 2H0IA 5G2ZA 2DJ3A 2OE3A 4IW9A 3M8NA 5EL8A 2F3MA 2JU5A 3IA1A 3DIEA 1ILOA 2H71A 3KGKA 5LNKe 1T8EB 4G2EA 3FYGA 4XS1A 3ME7A 1ERUA 2IMIA 3CXGA 3C7MA 1SD8A 4IN0A 3ZVJD 2HSNB 5HR2A 3LG6A 5GSTA 2KP1A 1OC9B 4KGIA 1USBA 4PNFA 4KF9A 1HNAA 3KH7A 2YWMA 1GNEA 12GSA 1X9MB 5G30A 22GSA 1E6BA 2REMA 2MMZA 3HXSA 5D73A 2PMTA 4OFTA 2WFCA 4ZB9A 3ERWA 4EF0A 3WYWA 1T4YA 4YQVA 1VF4A 3CBUA 3VFIA 4YAPA 1GULA 4PURA 1GTUA 2H0GA 1HD2A 5FT3A 3APQA 2XPDA 1EZKA 3GUSA 1RQMA 4POMA 1XBSA 2IL3A 1VF3A 5F07A 1M2BA 1TRVA 3TJGA 4X43A 2GSTA 1WE0A 3FZ5A 3L9UA 3PPUA 2WB9A 10GSA 1PKWA 1GSQA 1G6YA 4ULXA 3HDCA 2GZYA 4MJEA 2A2RA 4LLRA 2LKUA 4XS4B 1V57A 3WGEA 4KAEA 4I6XA 5G1KA 4ZL8A 1T1VA 3EE2A 5A5KA 3EU4A 2F8FA 5J41A 4KSMA 3GKXA 3GFKA 1QFNA 4L0UA 3VWUA 1VF2A 1PA3A 3A5WA 4AF2A 5HR0A 2P5QA 2CX3A 2QC7A 2OADA 4K1FA 4ECIA 3IXRA 3GMFA 9GSSA 1GH2A 3C8EA 2PWJA 4DSSA 20GSA 5ENUA 4HEA2 3Q19A 4OO4A 4NV2A 2B1KA 3LYKA 2M72A 2CT6A 3ERFA 3M9JA 1G0TA 3TUEA 2KHPA 4K7OA 3HKRA 1NW2A 3UARA 4OO5A 4G10A 2IMKA 4GWRA 4HU9A 1ZL9A 2IWTA 1F6MC 2X8GA 1GSUA 3HCZA 1TW9A 1SU9A 3EYTA 4WBRD 4OD7A 3PH9A 4FYUA 4RQRA 4TR0A 4EC0A 1TDIA 5B8BA 2JZRA 4TXOB 2FNOA 1DSBA 2VLUA 1A8YA 4V2MA 3IE3A 1YEXA 2OBKA 2X64A 5CAXA 1DUGA 2EIOA 5IMDA 2V2GA 4MH3A 2HYXA 4POKA 1X9SB 5E59A 4KH7A 2H66A 2CAIA 1A0RP 2YANA 2C3QA 1XIYA 5J3RA 3F3QA 1U88A 4H86A 3TJKA 2WCIA 3VI5A 1WRYA 2AAWA 2H70A 5IPHA 1SL0B 4BVXA 1W89A 2CX4A 4F9ZA 5IMCA 3KJYA 1X5EA 2C1YA 1GTIA 3GYKA 4O5RA 3KIJA 4IGJA 5DVBA 2R5GA 3D22A 1XPVA 1THXA 3W8JA 3A2VA 4POBA 2HZEB 5INYA 1ERTA 4WBJA 3TRXA 3GNJA 3V1WA 2YOIA 4DVCA 1GSFA 3D4TA 3WD6A 5AIXA 1QXHA 2N5FA 4GTUA 2RIIA 3TCOA 1K0MA 2LV3A 2E7PA 4ID0A 1M99A 3VK9A 5GSSA 1TI3A 4BVYB 4AJ6A 2LNSA 2LRTA 4HZ2A 3CMIA 1B4QA 6GSUA 2AHEA 3IK7A 2C0GA 5KN0A 3GRXA 1XWBA 2HSMB 5A4VA 2B7JA 5CRHA 2C4JA 5IMAA 4MH2A 4ACSA 4MZBA 3VWWA 2H6YA 2DMLA 3UBLA 18GSA 5JCUA 3RHBA 3FZ4A 1MTCA 4LL4B 3R2QA 5KEJA 2VCVA 3C73A 2JL4A 1AQXA 5ECMB 1JZDA 3IK9A 3FRCA 4GLTA 3KXOA 2FA8A 1QMVA 2QKEA 4PX1A 4GQFA 4EVMA 2YNXA 4WF5A 5ECKB 2H19A 2JADA 3Q6OA 4X1UA 1TJDA 5D8IA 2VCXA 3DYRA 1Q4JA 4N0ZA 2VOCA 4Q5FA 4CHSA 2FD3A 4I2UA 3P8WA 4WETA 5J9BA 1XVWA 3F6DA 3MWHA 1JZRA 2FCHA 2FWEA 3LYPA 5EY6A 1GWCA 3E3EA 4IQAA 1TXXA 2H75A 5D9WA 2MYGA 3ZZXA 2AV4A 4HS1A 2RM6A 4PQIA 3KD0A 4MABA 2K6VA 4J56E 1BEDA 3P7XA 2HZFA 4BPYA 1YEPA 4LMWA 2A2SA 1SK2A 2HLSA 1UN2A 1SL1B 2IMFA 4TN8A 5B7CA 1YZXA 2YWOA 2GZZA 1EP7A 2GT5A 3BJ5A 4L5OA 3IC4A 2ES7A 3M9KA 4TR4A 2RM5A 2OACA 4MF6A 2WS2A 4ECJA 3GA4A 5B6NA 1YY7A 2DJ2A 1XWKA 2E0QA 1GSDA 4L5LA 1PKZA 4IP6A 1M2DA 3TOUA 2YWNA 5HR3A 1T4ZA 5DALB 4FIWA 3E9JB 1HNCA 2O87A 5IO0A 5DQYA 4MJBA 1EV4A 2MMNA 3IBHA 1SD9A 2I3YA 3HJMA 2PPTA 2NBSA 3VI7A 1A2MA 3NZNA 2HRKA 4AGSA 1FO5A 2MMOA 1WIKA 4K7IA 3FR9A 2AB6A 3ZIJA 3LWAA 2N5BA 3GH6A 4CDOA 5DJLA 3TKSE 1PL1A 2G2QA 4MF5A 3HJOA 3ZTLA 2B6MA 2DJ1A 2DMMA 2FWGA 4GQCA 4MA9A 4EDYA 1F9MA 3M3MA 2HT9A 1XW9A 1JHBA 2RLIA 5HFGA 2FGXA 1DBYA 1OC8A 1MDIA 1ERVA 2P5RA 2C0EA 4PQHA 3FK8A 1AQVA 4N0VA 4MP4A 1FB0A 4Z7XA 1QQ2A 3FR3A 3CRTA 1O8XA 1A23A 3UL3A 3L9VA 3UBKA 1GP1A 5HR1A 1ACVA 2GSSA 2O85A 3HVXA 1URMA 5DDLA 5D93A 3HHVA 4FQUA 2LQOA 4POLA 1Z7RA 3DVXA 3QD9A 1RW1A 1K0OA 1OE7A 5CNWA 4O32A 2CVBA 2F51A 2J23A 4L0WA 3TJBA 3G9BA 3IAS2 1O6JA 3DRNA 1FHEA 1GSSA 3TJJA 1F37A 3W8SA 3IRAA 2HQTA 3H8QA 4FYCA 2GTUA 3RPPA 2B1LA 4NWYA 4WEYA 4E8HA 1GTAA 1X5DA 4K9ZA 1ML6A 1PQNA 3PGTA 3MNGA 2TIRA 2D2ZA 1ZCPA 2XC2A 1BX9A 1XWCA 2XHFA 2CVKA 2H1BA 2L5LA 2MBSA 1YQ1A 2AUVA 3HVSA 4ML1A 2V6OA 2X8HA 2B7KA 1A24A 1LJRA 4LA1A 2VM1A 2EIQA 1DE1A 3CTGA 5IOWA 3FHKA 3GKNA 1HYUA 2WGRA 3L4NA 1WP0A 1PD21 6GSWA 4V2NA 4O7HA 3LSZA 3K8NA 5AGYA 5BMUA 3FEUA 3LORA 3BBYA 4G9HA 4DSQA 3O76A 4J2FA 2HNLA 2L5OA 4N11A 1NHYA 2DIYA 1EWXA 2GT6A 4DSSB 4WR4A 2VL2C 4G19A 4ZBDA 5JWRB 5A4WA 4YAVA 3WGXA 4CW9A 3P2AA 2OKAA 2PGTA 4XTSA 2OE1A 2LRCA 1DE2A 3ZLPA 1ZZYA 2FUG2 4ECCA 3VURA 3HA9A 1CQHA 1AC1A 4WF4A 3C1SA 2R4VA 4I2TA 4KDYA 3GX0A 3F3RA 2VCQA 6GSTA 5DAKA 4BL7A 2JZSA 5AIVA 4GSTA 4GSSA 2DIZA 4PNGA 1YKCA 4G0IA 4HQZA 2GSRA 3A3TA 2YV7A 3KTBA 2CVDA 4FH8A 2RUFA 1XWAA 1XOAA 2H1GA 3L0HA 2HE3A 3ZITA 4ZL7A 3IHQA 5CYYA 1B4PA 1M2AA 1EGRA 1AQWA 2VCZA 2NVLA 1ZMAA 3R3EA 5ECHB 4HQSA 4MJAA 1WJKA 4XHMA 4GXZA 2CA8A 5ELGA 1OKDA 1S3AA 1K3YA 3OR5A 4BVXB 5CRDA 4JRRA 1ERWA 5FWGA 2HRNA 7GSSA 1H75A 3HZ8A 1PL2A 3F6FA 3BCKA 2GQMA 1ZGNA 2LNTA 1R7HA 1A2LA 5ECSA 1THOA 2VUPA 2FWHA 5ECOB 2B5EA 2V32A 3D21A 3DVWA 3LJRA 2VD0A 1BQ7A 2C8UA 1T7PB 1NM3A 1BYEA 4K2DA 1JLWA 3GURA 1MDJA 2CAQA 2A4VA 4F0CA 2ALBA 1AAZA 4OMVA 3ZMKA 4ZXGA 2FA4A 3QR6A 4PXOA 3LFLA 2B5XA 4ML6A 1K0DA 4Q5NA 4ILFA 1O8WA 3QPMA 3VWVA 3CRUA 2BTOT 2VL3A 4FYBA 5FHIA 14GSA 3FW2A 4TXVA 2DC5A 3D0ZA 3KP8A 1FW1A 4K0NA 2IN3A 2JACA 1PX7A 1JZWA 3DXBA 2NDOA 4RI6A 2GZPA 3FZ9A 3ZMLA 4ZBBA 4IVFA 4E8EA 1K3OA 2O7KA 3SWLA 6GSXA 3UJ1A 2P0GA 5IO2A 3VPQA 5JWQB 4IS0A 3GKKA 1O81A 1BAYA 1TI1A 4OFNA 3ZIVA 1F3AA 4JBBA 5F8BA 1J08A 2C0FA 1GLPA 2M80A 4IHUA 1XCCA 4PGTA 1R5PA 5C00A 3MDKA 2L4QA 2XBQA 3ERGA 2GLRA 2PN8A 4EUYA 1N8JA 3RHCA 3DMLA 3FKFA 2R3XA 3LGCA 5E4WA 5IQYA 2M46A 4MPFA 1UA5A 3QFBC 2VLVA 3H1NA 1OKTA 1PMTA 4ZBAA 2PUKC 3VPTA 1TU7A 3W6GA 3BD2A 3KM6A 3EMPA 1ZYQB 4MLYA 2YN1A 2LRNA 3GX8A 1FVJA 3RAZA 4Q5RA 2L4CA 1KTEA 1Z3EA 5G5FA 3QAGA 3F4SA 4MDCA 5IPGA 5JCGA 5HQPA 3GL3A 1BJXA 2C3NA 1WPIA 2JZTA 1K0BA 2BMXA 1CQGA 3J7Yb 5ABRA 3TGZA 5IIZA 1TU8A 4G0KA 4TKYA 3TKSC 1U3AA 3FZAA 1SENA 1EOHA 2VL2A 2E2GA 1C72A 1W4VA 2CV4A 1M0UA 1M9AA 1I9DA 3MAKA 3CYNA 4XRDA 4KUNA 2C3TA 3FR6A 4OCEA 2I9HA 4OCFA 4I5QA 1B9XC 2OE0A 2HRKB 1K3LA 1NHOA 1OYJA 4GSNA 2VL9A 5CREA 3J7Yk 1MD3A 3LXTA 2DLXA 1OC3A 5JCWA 2WJUA 1G7OA 4JZQA 2OJLA 4XS6A 3QAVA 1GUKA 3CTFA 3TKPA 2X8CA 3DGQA 4BA7A 1GSYA 4RI7A 4EXJA 1AIUA 4TR1A 1TRUA 4PUFC 1SK1A 5G5EA 2IMDA 3GTUA 5CP1A 6GSVA 2LJRA 2FHEA 2VCTA 1TKDB 4HJMA 4QL7A 1GUHA 3GV1A 4GF0A 3GKMA 1XVQA 1FB6A 2Z9SA 3F0IA 3KZQA 5AN1A 3TOTA 2L57A 2H73A 3DEXA 5ECRB 2PERA 5ELAA 2N5AA 1M9BA 2H1DA 1N2AA 4V1Ag 3G7YA 3ZFBA 1Y6EA 2F9SA 2IFQA 4OFMA 3VWXA 1U6TA 4QL9A 3O6TA 1V98A 2LJAA 1XW6A 3WGDA 1ABAA 1U87A 1Z9HA 1Z5YE 3P90A 5H5RA 2R2JA 4LL1B 3SBCA 4HZ4A 1IYIA 1Q98A 2HI7A 3CSIA 4I97A 1S3CA 2LJKA 3KMOA 5IMZA 19GSA 1MD4A 3FY7A 1FOVA 2H1AA 1OVNA 1A0FA 1YF1A 3NOFA 2LSTA 3HJPA 4N10A 2PU9C 1VF1A 2GQKA 1XWGA 2LS5A 3WT2A 2OA7A 2YP6A 4J57E 4ZB8A 5HFIA 3IV4A 3ED3A 1O85A 2V1MA 3F9UA 1R4WA 4NHWA 2KLXA 2WDUA 5EPFA 3D5JA 4Q5QA 3N9JA 3PINA 3QMXA 1QGVA 3ZYWA 3NIVA 2WULA 5GAND 3E0UA 2ZUPA 1SL2B 4ECBA 3A2WA 3N5OA 3ZL5A 3QCPA 1F2EA 1O73A 3BCIA 5ECLB 1M7TA 4KA0A 3F4RA 2EIRA 5J5NA 1E2YA 1YKAA 2L59A 4YQMA 2NPBA 1VRSD 2CZ2A 1B9YC 5COHA 2O89A 3QOUA 4N30A 5JWOB 2LEGA 2HRAA 3I69A 4MJCA 1SKRB 3IDVA 4K6XA 3VLNA 5D9XA 3CSJA 3F63A 4USSA 2KP2A 5CO3A 3UMAA 4TOPA 4HDEA 2FLSA 2G0FA 3US3A 3ZFLA 1EEJA 5DBQA 1IYHA 2RUEA 3AY8A 3HZ4A 5J9CA 3TRPA 1EV9A 1K0NA 1T3BA 2XPEA 1FG4A 3U5RE 3HD5A 5B8AA 4EO3A 1J0FA 5D9VA 4D73B 3Q18A 5J4UA 1OC9A 1YDKA 1SK0A 2E2MA 1AW9A 4FO5A 4MPGA 2VO4A 2YJHA 4K0GA 4JR4A 2H6ZA 2UZ8A 1A8LA 4KDXA 4O92A 4AJ7A 5DAKB 4BL7B 1NSWA 4TW5A 2KOKA 2L6DA 2O8VB 5DQSA 5F05A 1B8XA 2K18A 2LQQA 5KN3A 4WR5A 2ZNMA 1R26A 2FY6A 2GSQA 2TRXA 1KNGA 1EP8A 3TKSA 1ZYEA 2ZCTA 1EOGA 4D73A 2H0HA 4F03A 1Z6NA 2YZHA 4KCEA 4KE3A 2ON7A 1Y25A 2MMAA 1HQOA 5G1LA 2C80A 3UIWA 1OAZA 1SKSB 3M0FA 3EU3A 2DSAA 2CQ9A 1PX6A 4RUVA 4L8EA 4K8MA 3EURA 3KH9A 3A2XA 4XS4A 5DJMA 4MZWA 4EL1A 3RBTA 4V2LA 1TRSA
chains in the Genus database with same CATH superfamily
2YJ7A 3F4TA 4IJ3A 2LTKA 5ECIB 4NHZA 4HU7A 2YZUA 1K0AA 4IJIA 4P3YB 1JFUA 5EVOA 5C04A 5F06A 2R37A 1TOFA 1MDKA 1AUCA 1SYXA 3RDWA 2L6CA 4KDUA 3IOSA 4QQ7A 2ON5A 3KP9A 4CY6A 3ME8A 4NXIA 4HI7A 3CHXC 4KX4A 2KUCA 4KB3A 1J9BA 4EKZA 1Y1UA 5ID2B 4TVEA 1SJIA 1WWJA 4K7NA 2IMEA 4GCIA 5H5QA 5IMVA 5IOXA 2FWFA 3CSHA 3TB2A 5CRWA 5GAPD 5A5HB 2QSIA 3Q74A 1SKWB 1U3IA 5G31A 3BOAA 5D96A 2EC4A 2V6KA 1HNBA 1QK8A 5ECNB 4HJ2A 2K8SA 5H5SA 4XIHA 4F82A 1TTZA 1GNWA 3UEMA 5ID2A 2OBIA 4WXTA 3IR4A 2X99A 3U6VA 4TXOA 1VGLA 4ZB6A 2NTOA 5LCZA 8GSSA 3DWVA 2R6KA 2HSYA 1OE8A 4XCSA 1KEBA 4AJ8A 5L71A 2GGTA 4WKWA 1BG5A 3WT1A 2AYTA 2H76A 2H6XA 3KTLA 4HUAA 4MK3A 3IPZA 3C71A 1V58A 5ECPB 2H74A 1XFLA 3APSA 3O3TA 4MZCA 4ZL9A 2B5YA 2VIMA 3D6IA 3LEFA 4BWQA 1PRXA 4IQ1A 1GUMA 3LQ7A 4JU5A 2DJKA 3MSZA 5F0GA 5ECQB 3DKSA 3HY2A 5J4VA 2HSHA 2GDRA 2HXKA 1AXDA 3FMWA 1LU4A 3ZREA 5LD0A 3C1RA 1V2AA 1A2JA 2MBTA 3I43A 5DCHA 3EC3A 3UAPA 2HZEA 2TRCP 2DBCA 3KMNA 4IKHA 3I9V2 17GSA 2H8LA 1O7UA 3QDNA 1TK8B 4EE0A 4NAXA 1Z7PA 1I5GA 1PSQA 4PHZC 2PBJA 2VD1A 4DEJA 3GSSA 2K9FA 2WZ9A 4V1Ap 3ZVJA 2CZ3A 3GL5A 1MEKA 4IBPA 1LBKA 1UVZA 1EEMA 3L78A 4JR6A 3TKQA 4BVYA 4ZIJA 1PGTA 1TP9A 1X0RA 2O5VA 4NPBA 2EFEA 3I6AA 1V40A 2HSMA 4ISDA 3GIXA 2DJJA 1X9WB 2VCWA 4IP1A 1X5CA 1RK4A 1H4OA 2QGVA 4MCUA 2PVQA 1QUWA 4MMMA 2GVPA 1ZOFA 3H79A 1EGOA 4YH2A 4HOJA 2I4AA 3ISOA 1GLQA 3EWLA 4GRFA 4RQXA 4AKGA 2YPMA 1Z6MA 5IMFA 4F2IA 5AISA 3TRQA 5HFKA 3TDGA 5KN2A 2K8VA 1KBNA 1K0CA 3GH9A 4IELA 4OWYA 3EINA 4EIQA 1G7EA 2YV9A 2V41A 3TKRA 4N3ZA 4F0BA 3F8UA 2JSZA 4TR1B 4Z2RA 3RPNA 4NV5A 2XBIA 2WVXA 2GS3A 3GTUB 13GSA 2BJXA 3RGBC 3UOMA 2VLTA 3JCML 1WOUA 4I8BA 4JEDA 2I81A 3UVTA 3DD3A 2OT3A 2YWIA 3HYPA 2H01A 3TJFA 2DJ0A 1B48A 4EDZA 1YJ6A 3APOA 1S3DA 2IFQB 3H4KA 6GSSA 3GHAA 2IIYA 1TRWA 5B6MA 1PN9A 1JZOA 2VM2A 4YQUA 2J9HA 3PR8A 4PTSA 2GQLA 2HRFA 2AJQB 3IAM2 1UC7A 4TR3A 5IM9A 1T00A 3HVVA 1XW5A 4PQ1A 5BRTA 4DSRA 1V9WA 4X0XA 2HFDA 4BWSA 1WMJA 1JLVA 3L9SA 3H93A 2YCDA 2MZCA 11GSA 4PUAA 2EFCA 4ZILA 2P31A 4AI6A 5DALA 1YF0A 3G7JA 3QAWA 4KCAA 3MIXA 3TU3B 1G6WA 1F3BA 16GSA 2WRTA 1ST9A 3KCMA 1R5AA 1ON4A 3G7IA 2LUSA 2PVOC 2VKZG 3GN3A 4KW6A 5CRGA 1XOBA 1FVKA 3S9FA 3UVHA 5GZZB 4TRXA 5A4UA 4XRAA 5A1NB 3EMXA 4MF7A 2H72A 1SJZA 1SYRA 4G0LA 2I1UA 2JSYA 1TK0B 2QA1A 2IJYA 3QFAC 3ZRDA 1GSEA 1GL8A 2F8AA 3M1GA 2C0DA 1XXUA 2WVZA 2H30A 1XZOA 4KNDA 3EVIA 3LXZA 4JE1A 4NMUA 2VAFA 1GTBA 4KSOA 5KN1A 2B3SA 2IPAA 4BIKA 1TK5B 4LMVA 5DCGA 3D4MA 1GRXA 3GSTA 5D9TA 6GSYA 1FAAA 3KEBA 4QMKA 3IC8A 1SJ6A 2H0IA 5G2ZA 2DJ3A 2OE3A 4IW9A 3M8NA 5EL8A 2F3MA 2JU5A 3IA1A 1TXUA 2DKIA 3DIEA 1BG1A 1ILOA 2H71A 2R0GA 3KGKA 5LNKe 1T8EB 1I1IP 4G2EA 3FYGA 4XS1A 3ME7A 1ERUA 2IMIA 3CXGA 3C7MA 1SD8A 4IN0A 3ZVJD 2HSNB 5HR2A 3LG6A 5GSTA 2KP1A 1OC9B 4KGIA 1USBA 2R0PA 4PNFA 4KF9A 1HNAA 3KH7A 2YWMA 1GNEA 12GSA 1X9MB 5G30A 22GSA 1E6BA 2REMA 2MMZA 3HXSA 5D73A 2PMTA 4OFTA 2WFCA 4ZB9A 3ERWA 4EF0A 2H1LA 1YVLA 1YEWC 3WYWA 1T4YA 4YQVA 1VF4A 3CBUA 3VFIA 4YAPA 1GULA 4PURA 1GTUA 2H0GA 1HD2A 5FT3A 3APQA 2XPDA 1EZKA 3GUSA 1RQMA 4POMA 1XBSA 2IL3A 1VF3A 5F07A 1M2BA 1TRVA 3TJGA 4X43A 2GSTA 1WE0A 3FZ5A 3L9UA 3PPUA 2WB9A 10GSA 3IHGA 1PKWA 1GSQA 1G6YA 4ULXA 3HDCA 2GZYA 4MJEA 2A2RA 4LLRA 2LKUA 4XS4B 1V57A 3WGEA 4KAEA 4I6XA 5G1KA 4ZL8A 1T1VA 3EE2A 5A5KA 3EU4A 2F8FA 5J41A 4KSMA 3GKXA 3GFKA 1QFNA 4L0UA 3VWUA 1VF2A 1PA3A 3A5WA 4AF2A 5HR0A 2P5QA 2CX3A 2QC7A 2OADA 4K1FA 4ECIA 3IXRA 3GMFA 9GSSA 1GH2A 3C8EA 2PWJA 4DSSA 2X49A 20GSA 5ENUA 4HEA2 3Q19A 4AKHA 4OO4A 4NV2A 3A5IA 2B1KA 3LYKA 2M72A 2CT6A 3ERFA 3M9JA 1G0TA 3TUEA 2QA2A 4O5UA 2KHPA 4K7OA 3HKRA 1NW2A 2WVYA 3UARA 4OO5A 4G10A 2IMKA 4GWRA 4HU9A 1ZL9A 2IWTA 1F6MC 2X8GA 1GSUA 4G01A 3HCZA 1TW9A 1SU9A 3EYTA 4WBRD 4OD7A 3PH9A 4FYUA 4RQRA 4TR0A 4EC0A 1TDIA 5B8BA 2JZRA 4TXOB 2FNOA 1DSBA 2VLUA 1A8YA 4V2MA 3IE3A 1YEXA 2OBKA 2X64A 5CAXA 1DUGA 2EIOA 5IMDA 2V2GA 4MH3A 2HYXA 4POKA 1X9SB 5E59A 4KH7A 2H66A 2CAIA 1A0RP 2WW0A 2YANA 2C3QA 1XIYA 5J3RA 3F3QA 1U88A 4H86A 3TJKA 2WCIA 3VI5A 1WRYA 4A5PA 2AAWA 2H70A 5IPHA 1SL0B 4BVXA 1W89A 2CX4A 4F9ZA 5IMCA 3KJYA 1X5EA 2C1YA 1GTIA 3GYKA 4O5RA 3KIJA 4IGJA 5DVBA 2R5GA 3D22A 1XPVA 1THXA 1ZYPA 3W8JA 3A2VA 4POBA 2HZEB 5INYA 1ERTA 4WBJA 3TRXA 1M3IA 3GNJA 3V1WA 2YOIA 4DVCA 1GSFA 3D4TA 3WD6A 5AIXA 1QXHA 2N5FA 4GTUA 2RIIA 3TCOA 1K0MA 2LV3A 2E7PA 4ID0A 1M99A 3VK9A 5GSSA 1TI3A 4BVYB 4AJ6A 2LNSA 2LRTA 4HZ2A 3CMIA 1B4QA 1BF5A 6GSUA 2AHEA 3IK7A 2C0GA 5KN0A 3GRXA 1XWBA 1PN0A 2HSMB 5A4VA 4K5RA 3RFRC 2B7JA 5CRHA 2C4JA 5IMAA 3CQFA 4MH2A 4ACSA 4MZBA 3VWWA 2H6YA 2DMLA 3UBLA 3MYDA 18GSA 5JCUA 3RHBA 3FZ4A 1MTCA 4LL4B 3R2QA 5KEJA 2VCVA 3C73A 2JL4A 1AQXA 5ECMB 1JZDA 3IK9A 3FRCA 4GLTA 3KXOA 2FA8A 1QMVA 2QKEA 4PX1A 4GQFA 4EVMA 2YNXA 4WF5A 5ECKB 2H19A 2JADA 3Q6OA 4X1UA 1TJDA 5D8IA 2VCXA 3DYRA 1Q4JA 4N0ZA 2VOCA 4Q5FA 4CHSA 2FD3A 2WVXB 4I2UA 2O3EA 3P8WA 4WETA 5J9BA 1XVWA 3F6DA 3MWHA 1JZRA 2FCHA 2FWEA 3LYPA 5EY6A 1GWCA 3E3EA 4IQAA 1TXXA 2H75A 5D9WA 2MYGA 3ZZXA 2AV4A 4HS1A 2RM6A 4PQIA 3KD0A 4MABA 2K6VA 4J56E 1BEDA 3P7XA 1FOHA 2HZFA 4BPYA 1YEPA 4LMWA 2A2SA 1SK2A 2HLSA 1UN2A 1SL1B 2IMFA 5J40A 4TN8A 5B7CA 1YZXA 2YWOA 2GZZA 1EP7A 2GT5A 3BJ5A 4L5OA 3LW9A 3IC4A 2ES7A 3M9KA 4TR4A 2RM5A 2OACA 4MF6A 3HVNA 2WS2A 4ECJA 3GA4A 5B6NA 1YY7A 2DJ2A 1XWKA 2E0QA 1GSDA 4L5LA 4O5QA 1PKZA 4IP6A 1M2DA 3TOUA 2YWNA 5HR3A 1T4ZA 5DALB 4FIWA 3E9JB 1HNCA 2O87A 5IO0A 5DQYA 4MJBA 1EV4A 2MMNA 3IBHA 1SD9A 2I3YA 3HJMA 2PPTA 2NBSA 3VI7A 1A2MA 4PI0C 3NZNA 2HRKA 4ZB7A 4AGSA 1FO5A 2DKHA 2MMOA 1WIKA 4K7IA 3FR9A 2AB6A 4E68A 3ZIJA 3LWAA 2N5BA 3GH6A 4CDOA 5DJLA 3TKSE 1PL1A 2G2QA 4MF5A 3HJOA 3ZTLA 2B6MA 2DJ1A 2DMMA 2FWGA 4GQCA 4MA9A 4EDYA 1F9MA 4W66A 3M3MA 2HT9A 1XW9A 1JHBA 2RLIA 5HFGA 2FGXA 1DBYA 1OC8A 1MDIA 1ERVA 2P5RA 2C0EA 4PQHA 3FK8A 1AQVA 4N0VA 4MP4A 1FB0A 4Z7XA 3EPTA 1QQ2A 3FR3A 3CRTA 1O8XA 1A23A 3UL3A 3L9VA 5A34A 3UBKA 1GP1A 5HR1A 1ACVA 2GSSA 2O85A 3HVXA 1URMA 5DDLA 5D93A 3HHVA 4FQUA 2LQOA 4POLA 1Z7RA 3DVXA 3QD9A 1RW1A 1K0OA 1OE7A 5CNWA 4O32A 2CVBA 2F51A 2J23A 4L0WA 3TJBA 3G9BA 4YKFA 3IAS2 1O6JA 3DRNA 1FHEA 1GSSA 3TJJA 1F37A 3W8SA 3IRAA 2HQTA 3H8QA 4FYCA 2GTUA 5KOXA 3RPPA 2B1LA 4NWYA 4WEYA 4E8HA 1GTAA 1X5DA 4K9ZA 1ML6A 1PQNA 3PGTA 3MNGA 2TIRA 2D2ZA 1ZCPA 2XC2A 1BX9A 1XWCA 2XHFA 2CVKA 2H1BA 2L5LA 2MBSA 1YQ1A 2AUVA 3HVSA 4ML1A 2V6OA 2X8HA 2B7KA 1A24A 1LJRA 4LA1A 2VM1A 2EIQA 1DE1A 3CTGA 5IOWA 3FHKA 3GKNA 1HYUA 2WGRA 3L4NA 1WP0A 1PD21 6GSWA 4V2NA 4O7HA 3LSZA 3K8NA 5AGYA 5BMUA 3FEUA 3LORA 3BBYA 4G9HA 4DSQA 3O76A 4AKIA 4J2FA 2HNLA 2L5OA 4N11A 1NHYA 2DIYA 1EWXA 2GT6A 4DSSB 4WR4A 2VL2C 4G19A 4ZBDA 5JWRB 5A4WA 4YAVA 3WGXA 4CW9A 3P2AA 2OKAA 2PGTA 4XTSA 2X4AA 2OE1A 2LRCA 1DE2A 3ZLPA 1ZZYA 2FUG2 4ECCA 1SVMA 3VURA 3HA9A 1CQHA 1AC1A 4WF4A 3C1SA 2R4VA 4I2TA 4KDYA 3GX0A 3F3RA 2VCQA 6GSTA 5DAKA 4BL7A 2JZSA 5AIVA 4GSTA 4GSSA 2DIZA 4PNGA 1YKCA 4G0IA 4HQZA 2GSRA 2O36A 3A3TA 2YV7A 3KTBA 2CVDA 4FH8A 2RUFA 1XWAA 1XOAA 2H1GA 3L0HA 2HE3A 3ZITA 4ZL7A 3IHQA 5CYYA 1B4PA 1M2AA 1EGRA 1AQWA 2VCZA 2NVLA 1ZMAA 3R3EA 5ECHB 4HQSA 4MJAA 1WJKA 4XHMA 4GXZA 2CA8A 5ELGA 1OKDA 1S3AA 2WW2A 1K3YA 3OR5A 4BVXB 5CRDA 4JRRA 1ERWA 5FWGA 2HRNA 7GSSA 1H75A 3HZ8A 1PL2A 3F6FA 3BCKA 2GQMA 1ZGNA 2LNTA 1R7HA 1A2LA 5ECSA 1THOA 2VUPA 2FWHA 5ECOB 2B5EA 2V32A 3D21A 3DVWA 3LJRA 2VD0A 1BQ7A 2C8UA 1T7PB 1NM3A 1BYEA 4K2DA 1JLWA 3GURA 1MDJA 2WW1A 2CAQA 2A4VA 4F0CA 1SVOA 2ALBA 1AAZA 4OMVA 3ZMKA 4ZXGA 2FA4A 3QR6A 4PXOA 3LFLA 2B5XA 2UV8G 4ML6A 1K0DA 5KOWA 3CWGA 4Q5NA 4ILFA 1O8WA 3QPMA 3VWVA 3CRUA 2BTOT 2VL3A 5FHIA 4FYBA 14GSA 3FW2A 4TXVA 2DC5A 3D0ZA 4PI2C 3KP8A 1FW1A 4K0NA 2IN3A 2JACA 1PX7A 1JZWA 3DXBA 2NDOA 4RI6A 2GZPA 3FZ9A 5A5HA 3ZMLA 4ZBBA 4IVFA 4E8EA 1K3OA 2O7KA 3SWLA 1S3RA 6GSXA 3UJ1A 2P0GA 5IO2A 2WW3A 3VPQA 5JWQB 4IS0A 3GKKA 1O81A 1BAYA 1TI1A 4OFNA 3ZIVA 1F3AA 4JBBA 5F8BA 1J08A 2C0FA 1GLPA 2M80A 4IHUA 1XCCA 4PGTA 1R5PA 5C00A 3MDKA 2WZSA 2L4QA 2XBQA 4CY8A 4ICYA 3ERGA 2GLRA 2PN8A 4EUYA 1N8JA 3RHCA 4Z2TA 3DMLA 3FKFA 2R3XA 3LGCA 5E4WA 5IQYA 2M46A 4MPFA 1UA5A 3QFBC 2VLVA 3H1NA 1OKTA 1PMTA 4ZBAA 2PUKC 3VPTA 1TU7A 3W6GA 3BD2A 3KM6A 3EMPA 1ZYQB 4MLYA 2YN1A 2LRNA 3GX8A 1FVJA 3RAZA 4Q5RA 2L4CA 4FXYP 1KTEA 1Z3EA 5G5FA 3QAGA 3F4SA 4MDCA 5IPGA 5JCGA 5HQPA 3GL3A 1BJXA 2C3NA 1WPIA 2JZTA 4X4JA 1K0BA 2BMXA 1CQGA 3J7Yb 5ABRA 3TGZA 5IIZA 1TU8A 4G0KA 4TKYA 3TKSC 1U3AA 3FZAA 1SENA 1EOHA 2VL2A 2E2GA 1C72A 1W4VA 2CV4A 1M0UA 1M9AA 1I9DA 3MAKA 3CYNA 4XRDA 4HSCX 4KUNA 2C3TA 3FR6A 4OCEA 2I9HA 4OCFA 4I5QA 1B9XC 2OE0A 4EIPA 2HRKB 1K3LA 1NHOA 1OYJA 4GSNA 2VL9A 5CREA 3J7Yk 1MD3A 3LXTA 2DLXA 4MNNA 1OC3A 5JCWA 2WJUA 1G7OA 4JZQA 4AKXB 2OJLA 4XS6A 3QAVA 1GUKA 3CTFA 3TKPA 2X8CA 3DGQA 4BA7A 1GSYA 4RI7A 4EXJA 1AIUA 4TR1A 1TRUA 4PUFC 1SK1A 5G5EA 2IMDA 3GTUA 5CP1A 6GSVA 2LJRA 2FHEA 2VCTA 1TKDB 4HJMA 4QL7A 1GUHA 3GV1A 4GF0A 3GKMA 1XVQA 1FB6A 2Z9SA 3F0IA 3KZQA 5AN1A 3TOTA 2L57A 2H73A 3DEXA 5ECRB 2PERA 5ELAA 2N5AA 1M9BA 2H1DA 1N2AA 4V1Ag 3G7YA 4GDFA 3ZFBA 1Y6EA 2F9SA 2IFQA 5A34B 4OFMA 3VWXA 1U6TA 4QL9A 3O6TA 1V98A 2LJAA 1XW6A 3WGDA 1ABAA 1U87A 1Z9HA 1Z5YE 3P90A 5H5RA 2R2JA 4LL1B 3SBCA 4HZ4A 1IYIA 1Q98A 2HI7A 3CSIA 4I97A 1S3CA 2LJKA 3KMOA 5IMZA 19GSA 1MD4A 3FY7A 1FOVA 2H1AA 1OVNA 1A0FA 1YF1A 3NOFA 2LSTA 3HJPA 4N10A 2PU9C 1VF1A 2GQKA 1XWGA 2LS5A 3WT2A 2OA7A 2YP6A 4J57E 4ZB8A 5HFIA 3IV4A 3ED3A 1O85A 2V1MA 3F9UA 1R4WA 4NHWA 2KLXA 2WDUA 5EPFA 3D5JA 2R0CA 4Q5QA 3N9JA 3PINA 3QMXA 1QGVA 3ZYWA 5J47A 3NIVA 1XG8A 2WULA 5GAND 1SVLA 3E0UA 2ZUPA 1SL2B 4ECBA 5A1NA 4Z2UA 3A2WA 3N5OA 3ZL5A 3QCPA 1F2EA 1PFOA 1O73A 3BCIA 2EFDA 5ECLB 1M7TA 4KA0A 3F4RA 2EIRA 5J5NA 1E2YA 1YKAA 2L59A 4YQMA 2NPBA 1VRSD 2A4HA 2CZ2A 1B9YC 5BMUB 2EFHA 5COHA 2O89A 3QOUA 4N30A 5JWOB 2LEGA 2HRAA 3I69A 4MJCA 1SKRB 3IDVA 4K6XA 3VLNA 5D9XA 3CSJA 3F63A 4USSA 2KP2A 5CO3A 3UMAA 4TOPA 4HDEA 2FLSA 2G0FA 3US3A 1N25A 3ZFLA 1EEJA 5DBQA 1IYHA 2RUEA 2A2PA 3AY8A 3HZ4A 5J9CA 3TRPA 1EV9A 1K0NA 1T3BA 2XPEA 1FG4A 3U5RE 3HD5A 5B8AA 4EO3A 1J0FA 5D9VA 2HSNA 4D73B 3Q18A 5J4UA 1OC9A 1YDKA 1SK0A 2E2MA 1AW9A 4FO5A 4MPGA 2VO4A 2YJHA 4K0GA 4JR4A 2H6ZA 2UZ8A 1A8LA 4KDXA 4O92A 4AJ7A 5DAKB 4BL7B 1NSWA 4TW5A 2KOKA 2L6DA 2O8VB 5DQSA 4K5SA 5F05A 1B8XA 2K18A 1M3JA 2LQQA 5KN3A 4WR5A 2ZNMA 1R26A 2FY6A 2GSQA 2TRXA 1KNGA 1EP8A 3TKSA 1ZYEA 2ZCTA 1EOGA 4D73A 2H0HA 4F03A 4YKGA 1Z6NA 2YZHA 4KCEA 4KE3A 2ON7A 1Y25A 2MMAA 4K2XA 1HQOA 3HMJG 5G1LA 2C80A 3UIWA 1OAZA 1SKSB 3EU3A 3M0FA 1S4BP 2DSAA 2CQ9A 1PX6A 1ZYNA 4L8EA 4RUVA 4K8MA 3EURA 3KH9A 3A2XA 4XS4A 5DJMA 4MZWA 4EL1A 3RBTA 5J4YA 4V2LA 1TRSA
chains in the Genus database with same CATH topology
2YJ7A 3F4TA 4IJ3A 2LTKA 5ECIB 4NHZA 4HU7A 2YZUA 1K0AA 4IJIA 4P3YB 1JFUA 5EVOA 5C04A 5F06A 2R37A 1TOFA 1MDKA 1AUCA 1SYXA 3RDWA 2L6CA 4KDUA 3IOSA 4QQ7A 2ON5A 3KP9A 4CY6A 3ME8A 4NXIA 4HI7A 4KX4A 2KUCA 4KB3A 1J9BA 4EKZA 1Y1UA 5ID2B 4TVEA 1SJIA 1WWJA 4K7NA 2IMEA 4GCIA 5H5QA 5IMVA 5IOXA 2FWFA 3CSHA 3TB2A 5CRWA 5GAPD 5A5HB 2QSIA 3Q74A 1SKWB 1U3IA 5G31A 3BOAA 5D96A 2EC4A 2V6KA 1HNBA 1QK8A 5ECNB 4HJ2A 2K8SA 5H5SA 4XIHA 4F82A 1TTZA 1GNWA 3UEMA 5ID2A 2OBIA 4WXTA 3IR4A 2X99A 3U6VA 4TXOA 1VGLA 4ZB6A 2NTOA 5LCZA 8GSSA 3DWVA 2R6KA 2HSYA 1OE8A 4XCSA 1KEBA 4AJ8A 5L71A 2GGTA 4WKWA 1BG5A 3WT1A 2AYTA 2H76A 2H6XA 3KTLA 4HUAA 4MK3A 3IPZA 3C71A 1V58A 5ECPB 2H74A 1XFLA 3APSA 3O3TA 4MZCA 4ZL9A 2B5YA 2VIMA 3D6IA 3LEFA 4BWQA 1PRXA 4IQ1A 1GUMA 3LQ7A 4JU5A 2DJKA 3MSZA 5F0GA 5ECQB 3DKSA 3HY2A 5J4VA 2HSHA 2GDRA 2HXKA 1AXDA 3FMWA 1LU4A 3ZREA 5LD0A 3C1RA 1V2AA 1A2JA 2MBTA 3I43A 5DCHA 3EC3A 3UAPA 2HZEA 2TRCP 2DBCA 3KMNA 4IKHA 3I9V2 17GSA 2H8LA 1O7UA 3QDNA 1TK8B 4EE0A 4NAXA 1Z7PA 1I5GA 1PSQA 2PBJA 2VD1A 4DEJA 3GSSA 2K9FA 2WZ9A 4V1Ap 3ZVJA 2CZ3A 3GL5A 1MEKA 4IBPA 1LBKA 1UVZA 1EEMA 3L78A 4JR6A 3TKQA 4BVYA 4ZIJA 1PGTA 1TP9A 1X0RA 2O5VA 4NPBA 2EFEA 3I6AA 1V40A 2HSMA 4ISDA 3GIXA 2DJJA 1X9WB 2VCWA 4IP1A 1X5CA 1RK4A 1H4OA 2QGVA 4MCUA 2PVQA 1QUWA 4MMMA 2GVPA 1ZOFA 3H79A 1EGOA 4YH2A 4HOJA 2I4AA 3ISOA 1GLQA 3EWLA 4GRFA 4RQXA 4AKGA 2YPMA 1Z6MA 5IMFA 4F2IA 5AISA 3TRQA 5HFKA 3TDGA 5KN2A 2K8VA 1KBNA 1K0CA 3GH9A 4IELA 4OWYA 3EINA 4EIQA 1G7EA 2YV9A 2V41A 3TKRA 4N3ZA 4F0BA 3F8UA 2JSZA 4TR1B 4Z2RA 3RPNA 4NV5A 2XBIA 2GS3A 3GTUB 13GSA 2BJXA 3UOMA 2VLTA 3JCML 1WOUA 4I8BA 4JEDA 2I81A 3UVTA 3DD3A 2OT3A 2YWIA 3HYPA 2H01A 3TJFA 2DJ0A 1B48A 4EDZA 1YJ6A 3APOA 1S3DA 2IFQB 3H4KA 6GSSA 3GHAA 2IIYA 1TRWA 5B6MA 1PN9A 1JZOA 2VM2A 4YQUA 2J9HA 3PR8A 4PTSA 2GQLA 2HRFA 2AJQB 3IAM2 1UC7A 4TR3A 5IM9A 1T00A 3HVVA 1XW5A 4PQ1A 5BRTA 4DSRA 1V9WA 4X0XA 2HFDA 4BWSA 1WMJA 1JLVA 3L9SA 3H93A 2YCDA 2MZCA 11GSA 4PUAA 2EFCA 4ZILA 2P31A 4AI6A 5DALA 1YF0A 3G7JA 3QAWA 4KCAA 3MIXA 3TU3B 1G6WA 1F3BA 16GSA 2WRTA 1ST9A 3KCMA 1R5AA 1ON4A 3G7IA 2LUSA 2PVOC 2VKZG 3GN3A 4KW6A 5CRGA 1XOBA 1FVKA 3S9FA 3UVHA 5GZZB 4TRXA 5A4UA 4XRAA 5A1NB 3EMXA 4MF7A 2H72A 1SJZA 1SYRA 4G0LA 2I1UA 2JSYA 1TK0B 2QA1A 2IJYA 3QFAC 3ZRDA 1GSEA 1GL8A 2F8AA 3M1GA 2C0DA 1XXUA 2H30A 1XZOA 4KNDA 3EVIA 3LXZA 4JE1A 4NMUA 2VAFA 1GTBA 4KSOA 5KN1A 2B3SA 2IPAA 1TK5B 4LMVA 5DCGA 3D4MA 1GRXA 3GSTA 5D9TA 6GSYA 1FAAA 3KEBA 4QMKA 3IC8A 1SJ6A 2H0IA 5G2ZA 2DJ3A 2OE3A 4IW9A 3M8NA 5EL8A 2F3MA 2JU5A 3IA1A 1TXUA 2DKIA 3DIEA 1BG1A 1ILOA 2H71A 3KGKA 2R0GA 5LNKe 1T8EB 4G2EA 3FYGA 4XS1A 3ME7A 1ERUA 2IMIA 3CXGA 3C7MA 1SD8A 4IN0A 3ZVJD 2HSNB 5HR2A 3LG6A 5GSTA 2KP1A 1OC9B 4KGIA 1USBA 2R0PA 4PNFA 4KF9A 1HNAA 3KH7A 2YWMA 1GNEA 12GSA 1X9MB 5G30A 22GSA 1E6BA 2REMA 2MMZA 3HXSA 5D73A 2PMTA 4OFTA 2WFCA 4ZB9A 3ERWA 4EF0A 2H1LA 1YVLA 3WYWA 1T4YA 4YQVA 1VF4A 3CBUA 3VFIA 4YAPA 1GULA 4PURA 1GTUA 2H0GA 1HD2A 5FT3A 3APQA 2XPDA 1EZKA 3GUSA 1RQMA 4POMA 1XBSA 2IL3A 1VF3A 5F07A 1M2BA 1TRVA 3TJGA 4X43A 2GSTA 1WE0A 3FZ5A 3L9UA 3PPUA 2WB9A 10GSA 3IHGA 1PKWA 1GSQA 1G6YA 4ULXA 3HDCA 2GZYA 4MJEA 2A2RA 4LLRA 2LKUA 4XS4B 1V57A 3WGEA 4KAEA 4I6XA 5G1KA 4ZL8A 1T1VA 3EE2A 5A5KA 3EU4A 2F8FA 5J41A 4KSMA 3GKXA 3GFKA 1QFNA 4L0UA 3VWUA 1VF2A 1PA3A 3A5WA 4AF2A 5HR0A 2P5QA 2CX3A 2QC7A 2OADA 4K1FA 4ECIA 3IXRA 3GMFA 9GSSA 1GH2A 3C8EA 2PWJA 4DSSA 2X49A 20GSA 5ENUA 4HEA2 3Q19A 4AKHA 4OO4A 4NV2A 3A5IA 2B1KA 3LYKA 2M72A 2CT6A 3ERFA 3M9JA 1G0TA 3TUEA 2QA2A 4O5UA 2KHPA 4K7OA 3HKRA 1NW2A 3UARA 4OO5A 4G10A 2IMKA 4GWRA 4HU9A 1ZL9A 2IWTA 1F6MC 2X8GA 1GSUA 4G01A 3HCZA 1TW9A 1SU9A 3EYTA 4WBRD 4OD7A 3PH9A 4FYUA 4RQRA 4TR0A 4EC0A 1TDIA 5B8BA 2JZRA 4TXOB 2FNOA 1DSBA 2VLUA 1A8YA 4V2MA 3IE3A 1YEXA 2OBKA 2X64A 5CAXA 1DUGA 2EIOA 5IMDA 2V2GA 4MH3A 2HYXA 4POKA 1X9SB 5E59A 4KH7A 2H66A 2CAIA 1A0RP 2YANA 2C3QA 1XIYA 5J3RA 3F3QA 1U88A 4H86A 3TJKA 2WCIA 3VI5A 1WRYA 4A5PA 2AAWA 2H70A 5IPHA 1SL0B 4BVXA 1W89A 2CX4A 4F9ZA 5IMCA 3KJYA 1X5EA 2C1YA 1GTIA 3GYKA 4O5RA 3KIJA 4IGJA 5DVBA 2R5GA 3D22A 1XPVA 1THXA 1ZYPA 3W8JA 3A2VA 4POBA 2HZEB 5INYA 1ERTA 4WBJA 3TRXA 3GNJA 3V1WA 2YOIA 4DVCA 1GSFA 3D4TA 3WD6A 5AIXA 1QXHA 2N5FA 4GTUA 2RIIA 3TCOA 1K0MA 2LV3A 2E7PA 4ID0A 1M99A 3VK9A 5GSSA 1TI3A 4BVYB 4AJ6A 2LNSA 2LRTA 4HZ2A 3CMIA 1B4QA 1BF5A 6GSUA 2AHEA 3IK7A 2C0GA 5KN0A 3GRXA 1XWBA 1PN0A 2HSMB 5A4VA 4K5RA 2B7JA 5CRHA 2C4JA 5IMAA 4MH2A 4ACSA 4MZBA 3VWWA 2H6YA 2DMLA 3UBLA 3MYDA 18GSA 5JCUA 3RHBA 3FZ4A 1MTCA 4LL4B 3R2QA 5KEJA 2VCVA 3C73A 2JL4A 1AQXA 5ECMB 1JZDA 3IK9A 3FRCA 4GLTA 3KXOA 2FA8A 1QMVA 2QKEA 4PX1A 4GQFA 4EVMA 2YNXA 4WF5A 5ECKB 2H19A 2JADA 3Q6OA 4X1UA 1TJDA 5D8IA 2VCXA 3DYRA 1Q4JA 4N0ZA 2VOCA 4Q5FA 4CHSA 2FD3A 4I2UA 3P8WA 4WETA 5J9BA 1XVWA 3F6DA 3MWHA 1JZRA 2FCHA 2FWEA 3LYPA 5EY6A 1GWCA 3E3EA 4IQAA 1TXXA 2H75A 5D9WA 2MYGA 3ZZXA 2AV4A 4HS1A 2RM6A 4PQIA 3KD0A 4MABA 2K6VA 4J56E 1BEDA 3P7XA 1FOHA 2HZFA 4BPYA 1YEPA 4LMWA 2A2SA 1SK2A 2HLSA 1UN2A 1SL1B 2IMFA 5J40A 4TN8A 5B7CA 1YZXA 2YWOA 2GZZA 1EP7A 2GT5A 3BJ5A 4L5OA 3LW9A 3IC4A 2ES7A 3M9KA 4TR4A 2RM5A 2OACA 4MF6A 2WS2A 4ECJA 3GA4A 5B6NA 1YY7A 2DJ2A 1XWKA 2E0QA 1GSDA 4L5LA 4O5QA 1PKZA 4IP6A 1M2DA 3TOUA 2YWNA 5HR3A 1T4ZA 5DALB 4FIWA 3E9JB 1HNCA 2O87A 5IO0A 5DQYA 4MJBA 1EV4A 2MMNA 3IBHA 1SD9A 2I3YA 3HJMA 2PPTA 2NBSA 3VI7A 1A2MA 3NZNA 2HRKA 4ZB7A 4AGSA 1FO5A 2DKHA 2MMOA 1WIKA 4K7IA 3FR9A 2AB6A 4E68A 3ZIJA 3LWAA 2N5BA 3GH6A 4CDOA 5DJLA 3TKSE 1PL1A 2G2QA 4MF5A 3HJOA 3ZTLA 2B6MA 2DJ1A 2DMMA 2FWGA 4GQCA 4MA9A 4EDYA 1F9MA 4W66A 3M3MA 2HT9A 1XW9A 1JHBA 2RLIA 5HFGA 2FGXA 1DBYA 1OC8A 1MDIA 1ERVA 2P5RA 2C0EA 4PQHA 3FK8A 1AQVA 4N0VA 4MP4A 1FB0A 4Z7XA 3EPTA 1QQ2A 3FR3A 3CRTA 1O8XA 1A23A 3UL3A 3L9VA 5A34A 3UBKA 1GP1A 5HR1A 1ACVA 2GSSA 2O85A 3HVXA 1URMA 5DDLA 5D93A 3HHVA 4FQUA 2LQOA 4POLA 1Z7RA 3DVXA 3QD9A 1RW1A 1K0OA 1OE7A 5CNWA 4O32A 2CVBA 2F51A 2J23A 4L0WA 3TJBA 3G9BA 4YKFA 3IAS2 1O6JA 3DRNA 1FHEA 1GSSA 3TJJA 1F37A 3W8SA 3IRAA 2HQTA 3H8QA 4FYCA 2GTUA 5KOXA 3RPPA 2B1LA 4NWYA 4WEYA 4E8HA 1GTAA 1X5DA 4K9ZA 1ML6A 1PQNA 3PGTA 3MNGA 2TIRA 2D2ZA 1ZCPA 2XC2A 1BX9A 1XWCA 2XHFA 2CVKA 2H1BA 2L5LA 2MBSA 1YQ1A 2AUVA 3HVSA 4ML1A 2V6OA 2X8HA 2B7KA 1A24A 1LJRA 4LA1A 2VM1A 2EIQA 1DE1A 3CTGA 5IOWA 3FHKA 3GKNA 1HYUA 2WGRA 3L4NA 1WP0A 1PD21 6GSWA 4V2NA 4O7HA 3LSZA 3K8NA 5AGYA 5BMUA 3FEUA 3LORA 3BBYA 4G9HA 4DSQA 3O76A 4AKIA 4J2FA 2HNLA 2L5OA 4N11A 1NHYA 2DIYA 1EWXA 2GT6A 4DSSB 4WR4A 2VL2C 4G19A 4ZBDA 5JWRB 5A4WA 4YAVA 3WGXA 4CW9A 3P2AA 2OKAA 2PGTA 4XTSA 2X4AA 2OE1A 2LRCA 1DE2A 3ZLPA 1ZZYA 2FUG2 4ECCA 1SVMA 3VURA 3HA9A 1CQHA 1AC1A 4WF4A 3C1SA 2R4VA 4I2TA 4KDYA 3GX0A 3F3RA 2VCQA 6GSTA 5DAKA 4BL7A 2JZSA 5AIVA 4GSTA 4GSSA 2DIZA 4PNGA 1YKCA 4G0IA 4HQZA 2GSRA 3A3TA 2YV7A 3KTBA 2CVDA 4FH8A 2RUFA 1XWAA 1XOAA 2H1GA 3L0HA 2HE3A 3ZITA 4ZL7A 3IHQA 5CYYA 1B4PA 1M2AA 1EGRA 1AQWA 2VCZA 2NVLA 1ZMAA 3R3EA 5ECHB 4HQSA 4MJAA 1WJKA 4XHMA 4GXZA 2CA8A 5ELGA 1OKDA 1S3AA 1K3YA 3OR5A 4BVXB 5CRDA 4JRRA 1ERWA 5FWGA 2HRNA 7GSSA 1H75A 3HZ8A 1PL2A 3F6FA 3BCKA 2GQMA 1ZGNA 2LNTA 1R7HA 1A2LA 5ECSA 1THOA 2VUPA 2FWHA 5ECOB 2B5EA 2V32A 3D21A 3DVWA 3LJRA 2VD0A 1BQ7A 2C8UA 1T7PB 1NM3A 1BYEA 4K2DA 1JLWA 3GURA 1MDJA 2CAQA 2A4VA 4F0CA 1SVOA 2ALBA 1AAZA 4OMVA 3ZMKA 4ZXGA 2FA4A 3QR6A 4PXOA 3LFLA 2B5XA 2UV8G 4ML6A 1K0DA 5KOWA 3CWGA 4Q5NA 4ILFA 1O8WA 3QPMA 3VWVA 3CRUA 2BTOT 2VL3A 5FHIA 4FYBA 14GSA 3FW2A 4TXVA 2DC5A 3D0ZA 3KP8A 1FW1A 4K0NA 2IN3A 2JACA 1PX7A 1JZWA 3DXBA 2NDOA 4RI6A 2GZPA 3FZ9A 5A5HA 3ZMLA 4ZBBA 4IVFA 4E8EA 1K3OA 2O7KA 3SWLA 6GSXA 3UJ1A 2P0GA 5IO2A 3VPQA 5JWQB 4IS0A 3GKKA 1O81A 1BAYA 1TI1A 4OFNA 3ZIVA 1F3AA 4JBBA 5F8BA 1J08A 2C0FA 1GLPA 2M80A 4IHUA 1XCCA 4PGTA 1R5PA 5C00A 3MDKA 2L4QA 2XBQA 4CY8A 4ICYA 3ERGA 2GLRA 2PN8A 4EUYA 1N8JA 3RHCA 4Z2TA 3DMLA 3FKFA 2R3XA 3LGCA 5E4WA 5IQYA 2M46A 4MPFA 1UA5A 3QFBC 2VLVA 3H1NA 1OKTA 1PMTA 4ZBAA 2PUKC 3VPTA 1TU7A 3W6GA 3BD2A 3KM6A 3EMPA 1ZYQB 4MLYA 2YN1A 2LRNA 3GX8A 1FVJA 3RAZA 4Q5RA 2L4CA 1KTEA 1Z3EA 5G5FA 3QAGA 3F4SA 4MDCA 5IPGA 5JCGA 5HQPA 3GL3A 1BJXA 2C3NA 1WPIA 2JZTA 4X4JA 1K0BA 2BMXA 1CQGA 3J7Yb 5ABRA 3TGZA 5IIZA 1TU8A 4G0KA 4TKYA 3TKSC 1U3AA 3FZAA 1SENA 1EOHA 2VL2A 2E2GA 1C72A 1W4VA 2CV4A 1M0UA 1M9AA 1I9DA 3MAKA 3CYNA 4XRDA 4KUNA 2C3TA 3FR6A 4OCEA 2I9HA 4OCFA 4I5QA 1B9XC 2OE0A 4EIPA 2HRKB 1K3LA 1NHOA 1OYJA 4GSNA 2VL9A 5CREA 3J7Yk 1MD3A 3LXTA 2DLXA 4MNNA 1OC3A 5JCWA 2WJUA 1G7OA 4JZQA 4AKXB 2OJLA 4XS6A 3QAVA 1GUKA 3CTFA 3TKPA 2X8CA 3DGQA 4BA7A 1GSYA 4RI7A 4EXJA 1AIUA 4TR1A 1TRUA 4PUFC 1SK1A 5G5EA 2IMDA 3GTUA 5CP1A 6GSVA 2LJRA 2FHEA 2VCTA 1TKDB 4HJMA 4QL7A 1GUHA 3GV1A 4GF0A 3GKMA 1XVQA 1FB6A 2Z9SA 3F0IA 3KZQA 5AN1A 3TOTA 2L57A 2H73A 3DEXA 5ECRB 2PERA 5ELAA 2N5AA 1M9BA 2H1DA 1N2AA 4V1Ag 3G7YA 4GDFA 3ZFBA 1Y6EA 2F9SA 2IFQA 5A34B 4OFMA 3VWXA 1U6TA 4QL9A 3O6TA 1V98A 2LJAA 1XW6A 3WGDA 1ABAA 1U87A 1Z9HA 1Z5YE 3P90A 5H5RA 2R2JA 4LL1B 3SBCA 4HZ4A 1IYIA 1Q98A 2HI7A 3CSIA 4I97A 1S3CA 2LJKA 3KMOA 5IMZA 19GSA 1MD4A 3FY7A 1FOVA 2H1AA 1OVNA 1A0FA 1YF1A 3NOFA 2LSTA 3HJPA 4N10A 2PU9C 1VF1A 2GQKA 1XWGA 2LS5A 3WT2A 2OA7A 2YP6A 4J57E 4ZB8A 5HFIA 3IV4A 3ED3A 1O85A 2V1MA 3F9UA 1R4WA 4NHWA 2KLXA 2WDUA 5EPFA 3D5JA 2R0CA 4Q5QA 3N9JA 3PINA 3QMXA 1QGVA 3ZYWA 5J47A 3NIVA 2WULA 5GAND 1SVLA 3E0UA 2ZUPA 1SL2B 4ECBA 5A1NA 4Z2UA 3A2WA 3N5OA 3ZL5A 3QCPA 1F2EA 1O73A 3BCIA 2EFDA 5ECLB 1M7TA 4KA0A 3F4RA 2EIRA 5J5NA 1E2YA 1YKAA 2L59A 4YQMA 2NPBA 1VRSD 2A4HA 2CZ2A 1B9YC 5BMUB 2EFHA 5COHA 2O89A 3QOUA 4N30A 5JWOB 2LEGA 2HRAA 3I69A 4MJCA 1SKRB 3IDVA 4K6XA 3VLNA 5D9XA 3CSJA 3F63A 4USSA 2KP2A 5CO3A 3UMAA 4TOPA 4HDEA 2FLSA 2G0FA 3US3A 1N25A 3ZFLA 1EEJA 5DBQA 1IYHA 2RUEA 2A2PA 3AY8A 3HZ4A 5J9CA 3TRPA 1EV9A 1K0NA 1T3BA 2XPEA 1FG4A 3U5RE 3HD5A 5B8AA 4EO3A 1J0FA 5D9VA 2HSNA 4D73B 3Q18A 5J4UA 1OC9A 1YDKA 1SK0A 2E2MA 1AW9A 4FO5A 4MPGA 2VO4A 2YJHA 4K0GA 4JR4A 2H6ZA 2UZ8A 1A8LA 4KDXA 4O92A 4AJ7A 5DAKB 4BL7B 1NSWA 4TW5A 2KOKA 2L6DA 2O8VB 5DQSA 4K5SA 5F05A 1B8XA 2K18A 2LQQA 5KN3A 4WR5A 2ZNMA 1R26A 2FY6A 2GSQA 2TRXA 1KNGA 1EP8A 3TKSA 1ZYEA 2ZCTA 1EOGA 4D73A 2H0HA 4F03A 4YKGA 1Z6NA 2YZHA 4KCEA 4KE3A 2ON7A 1Y25A 2MMAA 4K2XA 1HQOA 3HMJG 5G1LA 2C80A 3UIWA 1OAZA 1SKSB 3M0FA 3EU3A 2DSAA 2CQ9A 1PX6A 1ZYNA 4L8EA 4RUVA 4K8MA 3EURA 3KH9A 3A2XA 4XS4A 5DJMA 4MZWA 4EL1A 3RBTA 5J4YA 4V2LA 1TRSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YJ7 A;  3F4T A;  4IJ3 A;  2LTK A;  5ECI B;  4NHZ A;  4HU7 A;  2YZU A;  1K0A A;  4IJI A;  4P3Y B;  1JFU A;  5EVO A;  5C04 A;  5F06 A;  2R37 A;  1TOF A;  1MDK A;  1AUC A;  1SYX A;  3RDW A;  2L6C A;  4KDU A;  3IOS A;  4QQ7 A;  2ON5 A;  3KP9 A;  3ME8 A;  4NXI A;  4HI7 A;  4KX4 A;  2KUC A;  4KB3 A;  1J9B A;  4EKZ A;  5ID2 B;  4TVE A;  1SJI A;  1WWJ A;  4K7N A;  2IME A;  4GCI A;  5H5Q A;  5IMV A;  5IOX A;  2FWF A;  3CSH A;  3TB2 A;  5CRW A;  5GAP D;  2QSI A;  3Q74 A;  1SKW B;  1U3I A;  5G31 A;  3BOA A;  5D96 A;  2EC4 A;  2V6K A;  1HNB A;  1QK8 A;  5ECN B;  4HJ2 A;  2K8S A;  5H5S A;  4XIH A;  4F82 A;  1TTZ A;  1GNW A;  3UEM A;  5ID2 A;  2OBI A;  4WXT A;  3IR4 A;  2X99 A;  3U6V A;  4TXO A;  1VGL A;  4ZB6 A;  2NTO A;  5LCZ A;  8GSS A;  3DWV A;  2R6K A;  2HSY A;  1OE8 A;  4XCS A;  1KEB A;  4AJ8 A;  5L71 A;  2GGT A;  4WKW A;  1BG5 A;  3WT1 A;  2AYT A;  2H76 A;  2H6X A;  3KTL A;  4HUA A;  4MK3 A;  3IPZ A;  3C71 A;  1V58 A;  5ECP B;  2H74 A;  1XFL A;  3APS A;  3O3T A;  4MZC A;  4ZL9 A;  2B5Y A;  2VIM A;  3D6I A;  3LEF A;  4BWQ A;  1PRX A;  4IQ1 A;  1GUM A;  3LQ7 A;  4JU5 A;  2DJK A;  3MSZ A;  5F0G A;  5ECQ B;  3DKS A;  3HY2 A;  2HSH A;  2GDR A;  2HXK A;  1AXD A;  1LU4 A;  3ZRE A;  5LD0 A;  3C1R A;  1V2A A;  1A2J A;  2MBT A;  3I43 A;  5DCH A;  3EC3 A;  3UAP A;  2HZE A;  2TRC P;  2DBC A;  3KMN A;  4IKH A;  3I9V 2;  17GS A;  2H8L A;  1O7U A;  3QDN A;  1TK8 B;  4EE0 A;  4NAX A;  1Z7P A;  1I5G A;  1PSQ A;  2PBJ A;  2VD1 A;  4DEJ A;  3GSS A;  2K9F A;  2WZ9 A;  4V1A p;  3ZVJ A;  2CZ3 A;  3GL5 A;  1MEK A;  4IBP A;  1LBK A;  1UVZ A;  1EEM A;  3L78 A;  4JR6 A;  3TKQ A;  4BVY A;  4ZIJ A;  1PGT A;  1TP9 A;  1X0R A;  4NPB A;  3I6A A;  1V40 A;  2HSM A;  4ISD A;  3GIX A;  2DJJ A;  1X9W B;  2VCW A;  4IP1 A;  1X5C A;  1RK4 A;  1H4O A;  2QGV A;  4MCU A;  2PVQ A;  1QUW A;  4MMM A;  2GVP A;  1ZOF A;  3H79 A;  1EGO A;  4YH2 A;  4HOJ A;  2I4A A;  3ISO A;  1GLQ A;  3EWL A;  4GRF A;  4RQX A;  2YPM A;  1Z6M A;  5IMF A;  4F2I A;  5AIS A;  3TRQ A;  5HFK A;  3TDG A;  5KN2 A;  2K8V A;  1KBN A;  1K0C A;  3GH9 A;  4IEL A;  4OWY A;  3EIN A;  1G7E A;  2YV9 A;  2V41 A;  3TKR A;  4F0B A;  3F8U A;  2JSZ A;  4TR1 B;  3RPN A;  4NV5 A;  2XBI A;  2GS3 A;  3GTU B;  13GS A;  2BJX A;  3UOM A;  2VLT A;  3JCM L;  1WOU A;  4I8B A;  4JED A;  2I81 A;  3UVT A;  3DD3 A;  2YWI A;  3HYP A;  2H01 A;  3TJF A;  2DJ0 A;  1B48 A;  4EDZ A;  1YJ6 A;  3APO A;  1S3D A;  2IFQ B;  3H4K A;  6GSS A;  3GHA A;  2IIY A;  1TRW A;  5B6M A;  1PN9 A;  1JZO A;  2VM2 A;  4YQU A;  2J9H A;  3PR8 A;  4PTS A;  2GQL A;  2HRF A;  2AJQ B;  3IAM 2;  1UC7 A;  4TR3 A;  5IM9 A;  1T00 A;  3HVV A;  1XW5 A;  4PQ1 A;  4DSR A;  1V9W A;  4X0X A;  2HFD A;  4BWS A;  1WMJ A;  1JLV A;  3L9S A;  3H93 A;  2YCD A;  2MZC A;  11GS A;  4PUA A;  4ZIL A;  2P31 A;  5DAL A;  1YF0 A;  3G7J A;  3QAW A;  4KCA A;  1G6W A;  1F3B A;  16GS A;  2WRT A;  1ST9 A;  3KCM A;  1R5A A;  1ON4 A;  3G7I A;  2LUS A;  2PVO C;  3GN3 A;  4KW6 A;  5CRG A;  1XOB A;  1FVK A;  3S9F A;  3UVH A;  5GZZ B;  4TRX A;  5A4U A;  4XRA A;  3EMX A;  4MF7 A;  1SYR A;  1SJZ A;  2H72 A;  4G0L A;  2I1U A;  2JSY A;  1TK0 B;  2IJY A;  3QFA C;  3ZRD A;  1GSE A;  1GL8 A;  2F8A A;  3M1G A;  2C0D A;  1XXU A;  2H30 A;  1XZO A;  4KND A;  3EVI A;  3LXZ A;  4JE1 A;  4NMU A;  2VAF A;  1GTB A;  4KSO A;  5KN1 A;  2B3S A;  2IPA A;  1TK5 B;  4LMV A;  5DCG A;  3D4M A;  1GRX A;  3GST A;  5D9T A;  6GSY A;  1FAA A;  3KEB A;  3IC8 A;  1SJ6 A;  2H0I A;  5G2Z A;  2DJ3 A;  2OE3 A;  4IW9 A;  3M8N A;  5EL8 A;  2F3M A;  2JU5 A;  3IA1 A;  3DIE A;  1ILO A;  2H71 A;  3KGK A;  5LNK e;  1T8E B;  4G2E A;  3FYG A;  4XS1 A;  3ME7 A;  1ERU A;  2IMI A;  3CXG A;  3C7M A;  1SD8 A;  4IN0 A;  3ZVJ D;  2HSN B;  5HR2 A;  3LG6 A;  5GST A;  2KP1 A;  1OC9 B;  4KGI A;  1USB A;  4PNF A;  4KF9 A;  1HNA A;  3KH7 A;  2YWM A;  1GNE A;  12GS A;  1X9M B;  5G30 A;  22GS A;  1E6B A;  2REM A;  2MMZ A;  3HXS A;  5D73 A;  2PMT A;  4OFT A;  2WFC A;  4ZB9 A;  3ERW A;  4EF0 A;  3WYW A;  1T4Y A;  4YQV A;  1VF4 A;  3CBU A;  3VFI A;  4YAP A;  1GUL A;  4PUR A;  1GTU A;  2H0G A;  1HD2 A;  5FT3 A;  3APQ A;  2XPD A;  1EZK A;  3GUS A;  1RQM A;  4POM A;  1XBS A;  2IL3 A;  1VF3 A;  5F07 A;  1M2B A;  1TRV A;  3TJG A;  4X43 A;  2GST A;  1WE0 A;  3FZ5 A;  3L9U A;  3PPU A;  2WB9 A;  10GS A;  1PKW A;  1GSQ A;  1G6Y A;  4ULX A;  3HDC A;  2GZY A;  4MJE A;  2A2R A;  4LLR A;  2LKU A;  4XS4 B;  1V57 A;  3WGE A;  4KAE A;  4I6X A;  5G1K A;  4ZL8 A;  1T1V A;  3EE2 A;  5A5K A;  3EU4 A;  2F8F A;  5J41 A;  4KSM A;  3GKX A;  3GFK A;  1QFN A;  4L0U A;  3VWU A;  1VF2 A;  1PA3 A;  3A5W A;  4AF2 A;  5HR0 A;  2P5Q A;  2CX3 A;  2QC7 A;  2OAD A;  4K1F A;  4ECI A;  3IXR A;  3GMF A;  9GSS A;  1GH2 A;  3C8E A;  2PWJ A;  4DSS A;  20GS A;  5ENU A;  4HEA 2;  3Q19 A;  4OO4 A;  4NV2 A;  2B1K A;  3LYK A;  2M72 A;  2CT6 A;  3ERF A;  3M9J A;  1G0T A;  3TUE A;  2KHP A;  4K7O A;  3HKR A;  1NW2 A;  3UAR A;  4OO5 A;  4G10 A;  2IMK A;  4GWR A;  4HU9 A;  1ZL9 A;  2IWT A;  1F6M C;  2X8G A;  1GSU A;  3HCZ A;  1TW9 A;  1SU9 A;  3EYT A;  4WBR D;  4OD7 A;  3PH9 A;  4FYU A;  4RQR A;  4TR0 A;  4EC0 A;  1TDI A;  5B8B A;  2JZR A;  4TXO B;  2FNO A;  1DSB A;  2VLU A;  1A8Y A;  4V2M A;  3IE3 A;  1YEX A;  2OBK A;  2X64 A;  5CAX A;  1DUG A;  2EIO A;  5IMD A;  2V2G A;  4MH3 A;  2HYX A;  4POK A;  1X9S B;  5E59 A;  4KH7 A;  2H66 A;  2CAI A;  1A0R P;  2YAN A;  2C3Q A;  1XIY A;  5J3R A;  3F3Q A;  1U88 A;  4H86 A;  3TJK A;  2WCI A;  3VI5 A;  1WRY A;  2AAW A;  2H70 A;  5IPH A;  1SL0 B;  4BVX A;  1W89 A;  2CX4 A;  4F9Z A;  5IMC A;  3KJY A;  1X5E A;  2C1Y A;  1GTI A;  3GYK A;  4O5R A;  3KIJ A;  4IGJ A;  5DVB A;  2R5G A;  3D22 A;  1XPV A;  1THX A;  3W8J A;  3A2V A;  4POB A;  2HZE B;  5INY A;  1ERT A;  4WBJ A;  3TRX A;  3GNJ A;  3V1W A;  2YOI A;  4DVC A;  1GSF A;  3D4T A;  3WD6 A;  5AIX A;  1QXH A;  2N5F A;  4GTU A;  2RII A;  3TCO A;  1K0M A;  2LV3 A;  2E7P A;  4ID0 A;  1M99 A;  3VK9 A;  5GSS A;  1TI3 A;  4BVY B;  4AJ6 A;  2LNS A;  2LRT A;  4HZ2 A;  3CMI A;  1B4Q A;  6GSU A;  2AHE A;  3IK7 A;  2C0G A;  5KN0 A;  3GRX A;  1XWB A;  2HSM B;  5A4V A;  2B7J A;  5CRH A;  2C4J A;  5IMA A;  4MH2 A;  4ACS A;  4MZB A;  3VWW A;  2H6Y A;  2DML A;  3UBL A;  18GS A;  5JCU A;  3RHB A;  3FZ4 A;  1MTC A;  4LL4 B;  3R2Q A;  5KEJ A;  2VCV A;  3C73 A;  2JL4 A;  1AQX A;  5ECM B;  1JZD A;  3IK9 A;  3FRC A;  4GLT A;  3KXO A;  2FA8 A;  1QMV A;  2QKE A;  4PX1 A;  4GQF A;  4EVM A;  2YNX A;  4WF5 A;  5ECK B;  2H19 A;  2JAD A;  3Q6O A;  4X1U A;  1TJD A;  5D8I A;  2VCX A;  3DYR A;  1Q4J A;  4N0Z A;  2VOC A;  4Q5F A;  4CHS A;  2FD3 A;  4I2U A;  3P8W A;  4WET A;  5J9B A;  1XVW A;  3F6D A;  3MWH A;  1JZR A;  2FCH A;  2FWE A;  3LYP A;  5EY6 A;  1GWC A;  3E3E A;  4IQA A;  1TXX A;  2H75 A;  5D9W A;  2MYG A;  3ZZX A;  2AV4 A;  4HS1 A;  2RM6 A;  4PQI A;  3KD0 A;  4MAB A;  2K6V A;  4J56 E;  1BED A;  3P7X A;  2HZF A;  4BPY A;  1YEP A;  4LMW A;  2A2S A;  1SK2 A;  2HLS A;  1UN2 A;  1SL1 B;  2IMF A;  4TN8 A;  5B7C A;  1YZX A;  2YWO A;  2GZZ A;  1EP7 A;  2GT5 A;  3BJ5 A;  4L5O A;  3IC4 A;  2ES7 A;  3M9K A;  4TR4 A;  2RM5 A;  2OAC A;  4MF6 A;  2WS2 A;  4ECJ A;  3GA4 A;  5B6N A;  1YY7 A;  2DJ2 A;  1XWK A;  2E0Q A;  1GSD A;  4L5L A;  1PKZ A;  4IP6 A;  1M2D A;  3TOU A;  2YWN A;  5HR3 A;  1T4Z A;  5DAL B;  4FIW A;  3E9J B;  1HNC A;  2O87 A;  5IO0 A;  5DQY A;  4MJB A;  1EV4 A;  2MMN A;  3IBH A;  1SD9 A;  2I3Y A;  3HJM A;  2PPT A;  2NBS A;  3VI7 A;  1A2M A;  3NZN A;  2HRK A;  4AGS A;  1FO5 A;  2MMO A;  1WIK A;  4K7I A;  3FR9 A;  2AB6 A;  3ZIJ A;  3LWA A;  2N5B A;  3GH6 A;  4CDO A;  5DJL A;  3TKS E;  1PL1 A;  2G2Q A;  4MF5 A;  3HJO A;  3ZTL A;  2B6M A;  2DJ1 A;  2DMM A;  2FWG A;  4GQC A;  4MA9 A;  4EDY A;  1F9M A;  3M3M A;  2HT9 A;  1XW9 A;  1JHB A;  2RLI A;  5HFG A;  2FGX A;  1DBY A;  1OC8 A;  1MDI A;  1ERV A;  2P5R A;  2C0E A;  4PQH A;  3FK8 A;  1AQV A;  4N0V A;  4MP4 A;  1FB0 A;  4Z7X A;  1QQ2 A;  3FR3 A;  3CRT A;  1O8X A;  1A23 A;  3UL3 A;  3L9V A;  3UBK A;  1GP1 A;  5HR1 A;  1ACV A;  2GSS A;  2O85 A;  3HVX A;  1URM A;  5DDL A;  5D93 A;  3HHV A;  4FQU A;  2LQO A;  4POL A;  1Z7R A;  3DVX A;  3QD9 A;  1RW1 A;  1K0O A;  1OE7 A;  5CNW A;  4O32 A;  2CVB A;  2F51 A;  2J23 A;  4L0W A;  3TJB A;  3G9B A;  3IAS 2;  1O6J A;  3DRN A;  1FHE A;  1GSS A;  3TJJ A;  1F37 A;  3W8S A;  3IRA A;  2HQT A;  3H8Q A;  4FYC A;  2GTU A;  3RPP A;  2B1L A;  4NWY A;  4WEY A;  4E8H A;  1GTA A;  1X5D A;  4K9Z A;  1ML6 A;  1PQN A;  3PGT A;  3MNG A;  2TIR A;  2D2Z A;  1ZCP A;  2XC2 A;  1BX9 A;  1XWC A;  2XHF A;  2CVK A;  2H1B A;  2L5L A;  2MBS A;  1YQ1 A;  2AUV A;  3HVS A;  4ML1 A;  2V6O A;  2X8H A;  2B7K A;  1A24 A;  1LJR A;  4LA1 A;  2VM1 A;  2EIQ A;  1DE1 A;  3CTG A;  5IOW A;  3FHK A;  3GKN A;  1HYU A;  2WGR A;  3L4N A;  1WP0 A;  1PD2 1;  6GSW A;  4V2N A;  4O7H A;  3LSZ A;  3K8N A;  5AGY A;  5BMU A;  3FEU A;  3LOR A;  3BBY A;  4G9H A;  4DSQ A;  3O76 A;  4J2F A;  2HNL A;  2L5O A;  4N11 A;  1NHY A;  2DIY A;  1EWX A;  2GT6 A;  4DSS B;  4WR4 A;  2VL2 C;  4G19 A;  4ZBD A;  5JWR B;  5A4W A;  4YAV A;  3WGX A;  4CW9 A;  3P2A A;  2OKA A;  2PGT A;  4XTS A;  2OE1 A;  2LRC A;  1DE2 A;  3ZLP A;  1ZZY A;  2FUG 2;  4ECC A;  3VUR A;  3HA9 A;  1CQH A;  1AC1 A;  4WF4 A;  3C1S A;  2R4V A;  4I2T A;  4KDY A;  3GX0 A;  3F3R A;  2VCQ A;  6GST A;  5DAK A;  4BL7 A;  2JZS A;  5AIV A;  4GST A;  4GSS A;  2DIZ A;  4PNG A;  1YKC A;  4G0I A;  4HQZ A;  2GSR A;  3A3T A;  2YV7 A;  3KTB A;  2CVD A;  4FH8 A;  2RUF A;  1XWA A;  1XOA A;  2H1G A;  3L0H A;  2HE3 A;  3ZIT A;  4ZL7 A;  3IHQ A;  5CYY A;  1B4P A;  1M2A A;  1EGR A;  1AQW A;  2VCZ A;  2NVL A;  1ZMA A;  3R3E A;  5ECH B;  4HQS A;  4MJA A;  1WJK A;  4XHM A;  4GXZ A;  2CA8 A;  5ELG A;  1OKD A;  1S3A A;  1K3Y A;  3OR5 A;  4BVX B;  5CRD A;  4JRR A;  1ERW A;  5FWG A;  2HRN A;  7GSS A;  1H75 A;  3HZ8 A;  1PL2 A;  3F6F A;  3BCK A;  2GQM A;  1ZGN A;  2LNT A;  1R7H A;  1A2L A;  5ECS A;  1THO A;  2VUP A;  2FWH A;  5ECO B;  2B5E A;  2V32 A;  3D21 A;  3DVW A;  3LJR A;  2VD0 A;  1BQ7 A;  2C8U A;  1T7P B;  1NM3 A;  1BYE A;  4K2D A;  1JLW A;  3GUR A;  1MDJ A;  2CAQ A;  2A4V A;  4F0C A;  2ALB A;  1AAZ A;  4OMV A;  3ZMK A;  4ZXG A;  2FA4 A;  3QR6 A;  4PXO A;  3LFL A;  2B5X A;  4ML6 A;  1K0D A;  4Q5N A;  4ILF A;  1O8W A;  3QPM A;  3VWV A;  3CRU A;  2BTO T;  2VL3 A;  4FYB A;  5FHI A;  14GS A;  3FW2 A;  4TXV A;  2DC5 A;  3D0Z A;  3KP8 A;  1FW1 A;  4K0N A;  2IN3 A;  2JAC A;  1PX7 A;  1JZW A;  3DXB A;  2NDO A;  4RI6 A;  2GZP A;  3FZ9 A;  3ZML A;  4ZBB A;  4IVF A;  4E8E A;  1K3O A;  2O7K A;  3SWL A;  6GSX A;  3UJ1 A;  2P0G A;  5IO2 A;  3VPQ A;  5JWQ B;  4IS0 A;  3GKK A;  1O81 A;  1BAY A;  1TI1 A;  4OFN A;  3ZIV A;  1F3A A;  4JBB A;  5F8B A;  1J08 A;  2C0F A;  1GLP A;  2M80 A;  4IHU A;  1XCC A;  4PGT A;  1R5P A;  5C00 A;  3MDK A;  2L4Q A;  2XBQ A;  3ERG A;  2GLR A;  2PN8 A;  4EUY A;  1N8J A;  3RHC A;  3DML A;  3FKF A;  2R3X A;  3LGC A;  5E4W A;  5IQY A;  2M46 A;  4MPF A;  1UA5 A;  3QFB C;  2VLV A;  3H1N A;  1OKT A;  1PMT A;  4ZBA A;  2PUK C;  3VPT A;  1TU7 A;  3W6G A;  3BD2 A;  3KM6 A;  3EMP A;  1ZYQ B;  4MLY A;  2YN1 A;  2LRN A;  3GX8 A;  1FVJ A;  3RAZ A;  4Q5R A;  2L4C A;  1KTE A;  1Z3E A;  5G5F A;  3QAG A;  3F4S A;  4MDC A;  5IPG A;  5JCG A;  5HQP A;  3GL3 A;  1BJX A;  2C3N A;  1WPI A;  2JZT A;  1K0B A;  2BMX A;  1CQG A;  3J7Y b;  5ABR A;  3TGZ A;  5IIZ A;  1TU8 A;  4G0K A;  4TKY A;  3TKS C;  1U3A A;  3FZA A;  1SEN A;  1EOH A;  2VL2 A;  2E2G A;  1C72 A;  1W4V A;  2CV4 A;  1M0U A;  1M9A A;  1I9D A;  3MAK A;  3CYN A;  4XRD A;  4KUN A;  2C3T A;  3FR6 A;  4OCE A;  2I9H A;  4OCF A;  4I5Q A;  1B9X C;  2OE0 A;  2HRK B;  1K3L A;  1NHO A;  1OYJ A;  4GSN A;  2VL9 A;  5CRE A;  3J7Y k;  1MD3 A;  3LXT A;  2DLX A;  1OC3 A;  5JCW A;  2WJU A;  1G7O A;  4JZQ A;  2OJL A;  4XS6 A;  3QAV A;  1GUK A;  3CTF A;  3TKP A;  2X8C A;  3DGQ A;  4BA7 A;  1GSY A;  4RI7 A;  4EXJ A;  1AIU A;  4TR1 A;  1TRU A;  4PUF C;  1SK1 A;  5G5E A;  2IMD A;  3GTU A;  5CP1 A;  6GSV A;  2LJR A;  2FHE A;  2VCT A;  1TKD B;  4HJM A;  4QL7 A;  1GUH A;  3GV1 A;  4GF0 A;  3GKM A;  1XVQ A;  1FB6 A;  2Z9S A;  3F0I A;  3KZQ A;  5AN1 A;  3TOT A;  2L57 A;  2H73 A;  3DEX A;  5ECR B;  2PER A;  5ELA A;  2N5A A;  1M9B A;  2H1D A;  1N2A A;  4V1A g;  3G7Y A;  3ZFB A;  1Y6E A;  2F9S A;  2IFQ A;  4OFM A;  3VWX A;  1U6T A;  4QL9 A;  3O6T A;  1V98 A;  2LJA A;  1XW6 A;  3WGD A;  1ABA A;  1U87 A;  1Z9H A;  1Z5Y E;  3P90 A;  5H5R A;  2R2J A;  4LL1 B;  3SBC A;  4HZ4 A;  1IYI A;  1Q98 A;  2HI7 A;  3CSI A;  4I97 A;  1S3C A;  2LJK A;  3KMO A;  5IMZ A;  19GS A;  1MD4 A;  3FY7 A;  1FOV A;  2H1A A;  1OVN A;  1A0F A;  1YF1 A;  3NOF A;  2LST A;  3HJP A;  4N10 A;  2PU9 C;  1VF1 A;  2GQK A;  1XWG A;  2LS5 A;  3WT2 A;  2OA7 A;  2YP6 A;  4J57 E;  4ZB8 A;  5HFI A;  3IV4 A;  3ED3 A;  1O85 A;  2V1M A;  3F9U A;  1R4W A;  4NHW A;  2KLX A;  2WDU A;  5EPF A;  3D5J A;  4Q5Q A;  3N9J A;  3PIN A;  3QMX A;  1QGV A;  3ZYW A;  3NIV A;  2WUL A;  5GAN D;  3E0U A;  2ZUP A;  1SL2 B;  4ECB A;  3A2W A;  3N5O A;  3ZL5 A;  3QCP A;  1F2E A;  1O73 A;  3BCI A;  5ECL B;  1M7T A;  4KA0 A;  3F4R A;  2EIR A;  5J5N A;  1E2Y A;  1YKA A;  2L59 A;  4YQM A;  2NPB A;  1VRS D;  2CZ2 A;  1B9Y C;  5COH A;  2O89 A;  3QOU A;  4N30 A;  5JWO B;  2LEG A;  2HRA A;  3I69 A;  4MJC A;  1SKR B;  3IDV A;  4K6X A;  3VLN A;  5D9X A;  3CSJ A;  3F63 A;  4USS A;  2KP2 A;  5CO3 A;  3UMA A;  4TOP A;  4HDE A;  2FLS A;  2G0F A;  3US3 A;  3ZFL A;  1EEJ A;  5DBQ A;  1IYH A;  2RUE A;  3AY8 A;  3HZ4 A;  5J9C A;  3TRP A;  1EV9 A;  1K0N A;  1T3B A;  2XPE A;  1FG4 A;  3U5R E;  3HD5 A;  5B8A A;  4EO3 A;  1J0F A;  5D9V A;  4D73 B;  3Q18 A;  5J4U A;  1OC9 A;  1YDK A;  1SK0 A;  2E2M A;  1AW9 A;  4FO5 A;  4MPG A;  2VO4 A;  2YJH A;  4K0G A;  4JR4 A;  2H6Z A;  2UZ8 A;  1A8L A;  4KDX A;  4O92 A;  4AJ7 A;  5DAK B;  4BL7 B;  1NSW A;  4TW5 A;  2KOK A;  2L6D A;  2O8V B;  5DQS A;  5F05 A;  1B8X A;  2K18 A;  2LQQ A;  5KN3 A;  4WR5 A;  2ZNM A;  1R26 A;  2FY6 A;  2GSQ A;  2TRX A;  1KNG A;  1EP8 A;  3TKS A;  1ZYE A;  2ZCT A;  1EOG A;  4D73 A;  2H0H A;  4F03 A;  1Z6N A;  2YZH A;  4KCE A;  4KE3 A;  2ON7 A;  1Y25 A;  2MMA A;  1HQO A;  5G1L A;  2C80 A;  3UIW A;  1OAZ A;  1SKS B;  3M0F A;  3EU3 A;  2DSA A;  2CQ9 A;  1PX6 A;  4RUV A;  4L8E A;  4K8M A;  3EUR A;  3KH9 A;  3A2X A;  4XS4 A;  5DJM A;  4MZW A;  4EL1 A;  3RBT A;  4V2L A;  1TRS A; 
#chains in the Genus database with same CATH topology
 2YJ7 A;  3F4T A;  4IJ3 A;  2LTK A;  5ECI B;  4NHZ A;  4HU7 A;  2YZU A;  1K0A A;  4IJI A;  4P3Y B;  1JFU A;  5EVO A;  5C04 A;  5F06 A;  2R37 A;  1TOF A;  1MDK A;  1AUC A;  1SYX A;  3RDW A;  2L6C A;  4KDU A;  3IOS A;  4QQ7 A;  2ON5 A;  3KP9 A;  4CY6 A;  3ME8 A;  4NXI A;  4HI7 A;  3CHX C;  4KX4 A;  2KUC A;  4KB3 A;  1J9B A;  4EKZ A;  1Y1U A;  5ID2 B;  4TVE A;  1SJI A;  1WWJ A;  4K7N A;  2IME A;  4GCI A;  5H5Q A;  5IMV A;  5IOX A;  2FWF A;  3CSH A;  3TB2 A;  5CRW A;  5GAP D;  5A5H B;  2QSI A;  3Q74 A;  1SKW B;  1U3I A;  5G31 A;  3BOA A;  5D96 A;  2EC4 A;  2V6K A;  1HNB A;  1QK8 A;  5ECN B;  4HJ2 A;  2K8S A;  5H5S A;  4XIH A;  4F82 A;  1TTZ A;  1GNW A;  3UEM A;  5ID2 A;  2OBI A;  4WXT A;  3IR4 A;  2X99 A;  3U6V A;  4TXO A;  1VGL A;  4ZB6 A;  2NTO A;  5LCZ A;  8GSS A;  3DWV A;  2R6K A;  2HSY A;  1OE8 A;  4XCS A;  1KEB A;  4AJ8 A;  5L71 A;  2GGT A;  4WKW A;  1BG5 A;  3WT1 A;  2AYT A;  2H76 A;  2H6X A;  3KTL A;  4HUA A;  4MK3 A;  3IPZ A;  3C71 A;  1V58 A;  5ECP B;  2H74 A;  1XFL A;  3APS A;  3O3T A;  4MZC A;  4ZL9 A;  2B5Y A;  2VIM A;  3D6I A;  3LEF A;  4BWQ A;  1PRX A;  4IQ1 A;  1GUM A;  3LQ7 A;  4JU5 A;  2DJK A;  3MSZ A;  5F0G A;  5ECQ B;  3DKS A;  3HY2 A;  5J4V A;  2HSH A;  2GDR A;  2HXK A;  1AXD A;  3FMW A;  1LU4 A;  3ZRE A;  5LD0 A;  3C1R A;  1V2A A;  1A2J A;  2MBT A;  3I43 A;  5DCH A;  3EC3 A;  3UAP A;  2HZE A;  2TRC P;  2DBC A;  3KMN A;  4IKH A;  3I9V 2;  17GS A;  2H8L A;  1O7U A;  3QDN A;  1TK8 B;  4EE0 A;  4NAX A;  1Z7P A;  1I5G A;  1PSQ A;  4PHZ C;  2PBJ A;  2VD1 A;  4DEJ A;  3GSS A;  2K9F A;  2WZ9 A;  4V1A p;  3ZVJ A;  2CZ3 A;  3GL5 A;  1MEK A;  4IBP A;  1LBK A;  1UVZ A;  1EEM A;  3L78 A;  4JR6 A;  3TKQ A;  4BVY A;  4ZIJ A;  1PGT A;  1TP9 A;  1X0R A;  2O5V A;  4NPB A;  2EFE A;  3I6A A;  1V40 A;  2HSM A;  4ISD A;  3GIX A;  2DJJ A;  1X9W B;  2VCW A;  4IP1 A;  1X5C A;  1RK4 A;  1H4O A;  2QGV A;  4MCU A;  2PVQ A;  1QUW A;  4MMM A;  2GVP A;  1ZOF A;  3H79 A;  1EGO A;  4YH2 A;  4HOJ A;  2I4A A;  3ISO A;  1GLQ A;  3EWL A;  4GRF A;  4RQX A;  4AKG A;  2YPM A;  1Z6M A;  5IMF A;  4F2I A;  5AIS A;  3TRQ A;  5HFK A;  3TDG A;  5KN2 A;  2K8V A;  1KBN A;  1K0C A;  3GH9 A;  4IEL A;  4OWY A;  3EIN A;  4EIQ A;  1G7E A;  2YV9 A;  2V41 A;  3TKR A;  4N3Z A;  4F0B A;  3F8U A;  2JSZ A;  4TR1 B;  4Z2R A;  3RPN A;  4NV5 A;  2XBI A;  2WVX A;  2GS3 A;  3GTU B;  13GS A;  2BJX A;  3RGB C;  3UOM A;  2VLT A;  3JCM L;  1WOU A;  4I8B A;  4JED A;  2I81 A;  3UVT A;  3DD3 A;  2OT3 A;  2YWI A;  3HYP A;  2H01 A;  3TJF A;  2DJ0 A;  1B48 A;  4EDZ A;  1YJ6 A;  3APO A;  1S3D A;  2IFQ B;  3H4K A;  6GSS A;  3GHA A;  2IIY A;  1TRW A;  5B6M A;  1PN9 A;  1JZO A;  2VM2 A;  4YQU A;  2J9H A;  3PR8 A;  4PTS A;  2GQL A;  2HRF A;  2AJQ B;  3IAM 2;  1UC7 A;  4TR3 A;  5IM9 A;  1T00 A;  3HVV A;  1XW5 A;  4PQ1 A;  5BRT A;  4DSR A;  1V9W A;  4X0X A;  2HFD A;  4BWS A;  1WMJ A;  1JLV A;  3L9S A;  3H93 A;  2YCD A;  2MZC A;  11GS A;  4PUA A;  2EFC A;  4ZIL A;  2P31 A;  4AI6 A;  5DAL A;  1YF0 A;  3G7J A;  3QAW A;  4KCA A;  3MIX A;  3TU3 B;  1G6W A;  1F3B A;  16GS A;  2WRT A;  1ST9 A;  3KCM A;  1R5A A;  1ON4 A;  3G7I A;  2LUS A;  2PVO C;  2VKZ G;  3GN3 A;  4KW6 A;  5CRG A;  1XOB A;  1FVK A;  3S9F A;  3UVH A;  5GZZ B;  4TRX A;  5A4U A;  4XRA A;  5A1N B;  3EMX A;  4MF7 A;  2H72 A;  1SJZ A;  1SYR A;  4G0L A;  2I1U A;  2JSY A;  1TK0 B;  2QA1 A;  2IJY A;  3QFA C;  3ZRD A;  1GSE A;  1GL8 A;  2F8A A;  3M1G A;  2C0D A;  1XXU A;  2WVZ A;  2H30 A;  1XZO A;  4KND A;  3EVI A;  3LXZ A;  4JE1 A;  4NMU A;  2VAF A;  1GTB A;  4KSO A;  5KN1 A;  2B3S A;  2IPA A;  4BIK A;  1TK5 B;  4LMV A;  5DCG A;  3D4M A;  1GRX A;  3GST A;  5D9T A;  6GSY A;  1FAA A;  3KEB A;  4QMK A;  3IC8 A;  1SJ6 A;  2H0I A;  5G2Z A;  2DJ3 A;  2OE3 A;  4IW9 A;  3M8N A;  5EL8 A;  2F3M A;  2JU5 A;  3IA1 A;  1TXU A;  2DKI A;  3DIE A;  1BG1 A;  1ILO A;  2H71 A;  2R0G A;  3KGK A;  5LNK e;  1T8E B;  1I1I P;  4G2E A;  3FYG A;  4XS1 A;  3ME7 A;  1ERU A;  2IMI A;  3CXG A;  3C7M A;  1SD8 A;  4IN0 A;  3ZVJ D;  2HSN B;  5HR2 A;  3LG6 A;  5GST A;  2KP1 A;  1OC9 B;  4KGI A;  1USB A;  2R0P A;  4PNF A;  4KF9 A;  1HNA A;  3KH7 A;  2YWM A;  1GNE A;  12GS A;  1X9M B;  5G30 A;  22GS A;  1E6B A;  2REM A;  2MMZ A;  3HXS A;  5D73 A;  2PMT A;  4OFT A;  2WFC A;  4ZB9 A;  3ERW A;  4EF0 A;  2H1L A;  1YVL A;  1YEW C;  3WYW A;  1T4Y A;  4YQV A;  1VF4 A;  3CBU A;  3VFI A;  4YAP A;  1GUL A;  4PUR A;  1GTU A;  2H0G A;  1HD2 A;  5FT3 A;  3APQ A;  2XPD A;  1EZK A;  3GUS A;  1RQM A;  4POM A;  1XBS A;  2IL3 A;  1VF3 A;  5F07 A;  1M2B A;  1TRV A;  3TJG A;  4X43 A;  2GST A;  1WE0 A;  3FZ5 A;  3L9U A;  3PPU A;  2WB9 A;  10GS A;  3IHG A;  1PKW A;  1GSQ A;  1G6Y A;  4ULX A;  3HDC A;  2GZY A;  4MJE A;  2A2R A;  4LLR A;  2LKU A;  4XS4 B;  1V57 A;  3WGE A;  4KAE A;  4I6X A;  5G1K A;  4ZL8 A;  1T1V A;  3EE2 A;  5A5K A;  3EU4 A;  2F8F A;  5J41 A;  4KSM A;  3GKX A;  3GFK A;  1QFN A;  4L0U A;  3VWU A;  1VF2 A;  1PA3 A;  3A5W A;  4AF2 A;  5HR0 A;  2P5Q A;  2CX3 A;  2QC7 A;  2OAD A;  4K1F A;  4ECI A;  3IXR A;  3GMF A;  9GSS A;  1GH2 A;  3C8E A;  2PWJ A;  4DSS A;  2X49 A;  20GS A;  5ENU A;  4HEA 2;  3Q19 A;  4AKH A;  4OO4 A;  4NV2 A;  3A5I A;  2B1K A;  3LYK A;  2M72 A;  2CT6 A;  3ERF A;  3M9J A;  1G0T A;  3TUE A;  2QA2 A;  4O5U A;  2KHP A;  4K7O A;  3HKR A;  1NW2 A;  2WVY A;  3UAR A;  4OO5 A;  4G10 A;  2IMK A;  4GWR A;  4HU9 A;  1ZL9 A;  2IWT A;  1F6M C;  2X8G A;  1GSU A;  4G01 A;  3HCZ A;  1TW9 A;  1SU9 A;  3EYT A;  4WBR D;  4OD7 A;  3PH9 A;  4FYU A;  4RQR A;  4TR0 A;  4EC0 A;  1TDI A;  5B8B A;  2JZR A;  4TXO B;  2FNO A;  1DSB A;  2VLU A;  1A8Y A;  4V2M A;  3IE3 A;  1YEX A;  2OBK A;  2X64 A;  5CAX A;  1DUG A;  2EIO A;  5IMD A;  2V2G A;  4MH3 A;  2HYX A;  4POK A;  1X9S B;  5E59 A;  4KH7 A;  2H66 A;  2CAI A;  1A0R P;  2WW0 A;  2YAN A;  2C3Q A;  1XIY A;  5J3R A;  3F3Q A;  1U88 A;  4H86 A;  3TJK A;  2WCI A;  3VI5 A;  1WRY A;  4A5P A;  2AAW A;  2H70 A;  5IPH A;  1SL0 B;  4BVX A;  1W89 A;  2CX4 A;  4F9Z A;  5IMC A;  3KJY A;  1X5E A;  2C1Y A;  1GTI A;  3GYK A;  4O5R A;  3KIJ A;  4IGJ A;  5DVB A;  2R5G A;  3D22 A;  1XPV A;  1THX A;  1ZYP A;  3W8J A;  3A2V A;  4POB A;  2HZE B;  5INY A;  1ERT A;  4WBJ A;  3TRX A;  1M3I A;  3GNJ A;  3V1W A;  2YOI A;  4DVC A;  1GSF A;  3D4T A;  3WD6 A;  5AIX A;  1QXH A;  2N5F A;  4GTU A;  2RII A;  3TCO A;  1K0M A;  2LV3 A;  2E7P A;  4ID0 A;  1M99 A;  3VK9 A;  5GSS A;  1TI3 A;  4BVY B;  4AJ6 A;  2LNS A;  2LRT A;  4HZ2 A;  3CMI A;  1B4Q A;  1BF5 A;  6GSU A;  2AHE A;  3IK7 A;  2C0G A;  5KN0 A;  3GRX A;  1XWB A;  1PN0 A;  2HSM B;  5A4V A;  4K5R A;  3RFR C;  2B7J A;  5CRH A;  2C4J A;  5IMA A;  3CQF A;  4MH2 A;  4ACS A;  4MZB A;  3VWW A;  2H6Y A;  2DML A;  3UBL A;  3MYD A;  18GS A;  5JCU A;  3RHB A;  3FZ4 A;  1MTC A;  4LL4 B;  3R2Q A;  5KEJ A;  2VCV A;  3C73 A;  2JL4 A;  1AQX A;  5ECM B;  1JZD A;  3IK9 A;  3FRC A;  4GLT A;  3KXO A;  2FA8 A;  1QMV A;  2QKE A;  4PX1 A;  4GQF A;  4EVM A;  2YNX A;  4WF5 A;  5ECK B;  2H19 A;  2JAD A;  3Q6O A;  4X1U A;  1TJD A;  5D8I A;  2VCX A;  3DYR A;  1Q4J A;  4N0Z A;  2VOC A;  4Q5F A;  4CHS A;  2FD3 A;  2WVX B;  4I2U A;  2O3E A;  3P8W A;  4WET A;  5J9B A;  1XVW A;  3F6D A;  3MWH A;  1JZR A;  2FCH A;  2FWE A;  3LYP A;  5EY6 A;  1GWC A;  3E3E A;  4IQA A;  1TXX A;  2H75 A;  5D9W A;  2MYG A;  3ZZX A;  2AV4 A;  4HS1 A;  2RM6 A;  4PQI A;  3KD0 A;  4MAB A;  2K6V A;  4J56 E;  1BED A;  3P7X A;  1FOH A;  2HZF A;  4BPY A;  1YEP A;  4LMW A;  2A2S A;  1SK2 A;  2HLS A;  1UN2 A;  1SL1 B;  2IMF A;  5J40 A;  4TN8 A;  5B7C A;  1YZX A;  2YWO A;  2GZZ A;  1EP7 A;  2GT5 A;  3BJ5 A;  4L5O A;  3LW9 A;  3IC4 A;  2ES7 A;  3M9K A;  4TR4 A;  2RM5 A;  2OAC A;  4MF6 A;  3HVN A;  2WS2 A;  4ECJ A;  3GA4 A;  5B6N A;  1YY7 A;  2DJ2 A;  1XWK A;  2E0Q A;  1GSD A;  4L5L A;  4O5Q A;  1PKZ A;  4IP6 A;  1M2D A;  3TOU A;  2YWN A;  5HR3 A;  1T4Z A;  5DAL B;  4FIW A;  3E9J B;  1HNC A;  2O87 A;  5IO0 A;  5DQY A;  4MJB A;  1EV4 A;  2MMN A;  3IBH A;  1SD9 A;  2I3Y A;  3HJM A;  2PPT A;  2NBS A;  3VI7 A;  1A2M A;  4PI0 C;  3NZN A;  2HRK A;  4ZB7 A;  4AGS A;  1FO5 A;  2DKH A;  2MMO A;  1WIK A;  4K7I A;  3FR9 A;  2AB6 A;  4E68 A;  3ZIJ A;  3LWA A;  2N5B A;  3GH6 A;  4CDO A;  5DJL A;  3TKS E;  1PL1 A;  2G2Q A;  4MF5 A;  3HJO A;  3ZTL A;  2B6M A;  2DJ1 A;  2DMM A;  2FWG A;  4GQC A;  4MA9 A;  4EDY A;  1F9M A;  4W66 A;  3M3M A;  2HT9 A;  1XW9 A;  1JHB A;  2RLI A;  5HFG A;  2FGX A;  1DBY A;  1OC8 A;  1MDI A;  1ERV A;  2P5R A;  2C0E A;  4PQH A;  3FK8 A;  1AQV A;  4N0V A;  4MP4 A;  1FB0 A;  4Z7X A;  3EPT A;  1QQ2 A;  3FR3 A;  3CRT A;  1O8X A;  1A23 A;  3UL3 A;  3L9V A;  5A34 A;  3UBK A;  1GP1 A;  5HR1 A;  1ACV A;  2GSS A;  2O85 A;  3HVX A;  1URM A;  5DDL A;  5D93 A;  3HHV A;  4FQU A;  2LQO A;  4POL A;  1Z7R A;  3DVX A;  3QD9 A;  1RW1 A;  1K0O A;  1OE7 A;  5CNW A;  4O32 A;  2CVB A;  2F51 A;  2J23 A;  4L0W A;  3TJB A;  3G9B A;  4YKF A;  3IAS 2;  1O6J A;  3DRN A;  1FHE A;  1GSS A;  3TJJ A;  1F37 A;  3W8S A;  3IRA A;  2HQT A;  3H8Q A;  4FYC A;  2GTU A;  5KOX A;  3RPP A;  2B1L A;  4NWY A;  4WEY A;  4E8H A;  1GTA A;  1X5D A;  4K9Z A;  1ML6 A;  1PQN A;  3PGT A;  3MNG A;  2TIR A;  2D2Z A;  1ZCP A;  2XC2 A;  1BX9 A;  1XWC A;  2XHF A;  2CVK A;  2H1B A;  2L5L A;  2MBS A;  1YQ1 A;  2AUV A;  3HVS A;  4ML1 A;  2V6O A;  2X8H A;  2B7K A;  1A24 A;  1LJR A;  4LA1 A;  2VM1 A;  2EIQ A;  1DE1 A;  3CTG A;  5IOW A;  3FHK A;  3GKN A;  1HYU A;  2WGR A;  3L4N A;  1WP0 A;  1PD2 1;  6GSW A;  4V2N A;  4O7H A;  3LSZ A;  3K8N A;  5AGY A;  5BMU A;  3FEU A;  3LOR A;  3BBY A;  4G9H A;  4DSQ A;  3O76 A;  4AKI A;  4J2F A;  2HNL A;  2L5O A;  4N11 A;  1NHY A;  2DIY A;  1EWX A;  2GT6 A;  4DSS B;  4WR4 A;  2VL2 C;  4G19 A;  4ZBD A;  5JWR B;  5A4W A;  4YAV A;  3WGX A;  4CW9 A;  3P2A A;  2OKA A;  2PGT A;  4XTS A;  2X4A A;  2OE1 A;  2LRC A;  1DE2 A;  3ZLP A;  1ZZY A;  2FUG 2;  4ECC A;  1SVM A;  3VUR A;  3HA9 A;  1CQH A;  1AC1 A;  4WF4 A;  3C1S A;  2R4V A;  4I2T A;  4KDY A;  3GX0 A;  3F3R A;  2VCQ A;  6GST A;  5DAK A;  4BL7 A;  2JZS A;  5AIV A;  4GST A;  4GSS A;  2DIZ A;  4PNG A;  1YKC A;  4G0I A;  4HQZ A;  2GSR A;  2O36 A;  3A3T A;  2YV7 A;  3KTB A;  2CVD A;  4FH8 A;  2RUF A;  1XWA A;  1XOA A;  2H1G A;  3L0H A;  2HE3 A;  3ZIT A;  4ZL7 A;  3IHQ A;  5CYY A;  1B4P A;  1M2A A;  1EGR A;  1AQW A;  2VCZ A;  2NVL A;  1ZMA A;  3R3E A;  5ECH B;  4HQS A;  4MJA A;  1WJK A;  4XHM A;  4GXZ A;  2CA8 A;  5ELG A;  1OKD A;  1S3A A;  2WW2 A;  1K3Y A;  3OR5 A;  4BVX B;  5CRD A;  4JRR A;  1ERW A;  5FWG A;  2HRN A;  7GSS A;  1H75 A;  3HZ8 A;  1PL2 A;  3F6F A;  3BCK A;  2GQM A;  1ZGN A;  2LNT A;  1R7H A;  1A2L A;  5ECS A;  1THO A;  2VUP A;  2FWH A;  5ECO B;  2B5E A;  2V32 A;  3D21 A;  3DVW A;  3LJR A;  2VD0 A;  1BQ7 A;  2C8U A;  1T7P B;  1NM3 A;  1BYE A;  4K2D A;  1JLW A;  3GUR A;  1MDJ A;  2WW1 A;  2CAQ A;  2A4V A;  4F0C A;  1SVO A;  2ALB A;  1AAZ A;  4OMV A;  3ZMK A;  4ZXG A;  2FA4 A;  3QR6 A;  4PXO A;  3LFL A;  2B5X A;  2UV8 G;  4ML6 A;  1K0D A;  5KOW A;  3CWG A;  4Q5N A;  4ILF A;  1O8W A;  3QPM A;  3VWV A;  3CRU A;  2BTO T;  2VL3 A;  5FHI A;  4FYB A;  14GS A;  3FW2 A;  4TXV A;  2DC5 A;  3D0Z A;  4PI2 C;  3KP8 A;  1FW1 A;  4K0N A;  2IN3 A;  2JAC A;  1PX7 A;  1JZW A;  3DXB A;  2NDO A;  4RI6 A;  2GZP A;  3FZ9 A;  5A5H A;  3ZML A;  4ZBB A;  4IVF A;  4E8E A;  1K3O A;  2O7K A;  3SWL A;  1S3R A;  6GSX A;  3UJ1 A;  2P0G A;  5IO2 A;  2WW3 A;  3VPQ A;  5JWQ B;  4IS0 A;  3GKK A;  1O81 A;  1BAY A;  1TI1 A;  4OFN A;  3ZIV A;  1F3A A;  4JBB A;  5F8B A;  1J08 A;  2C0F A;  1GLP A;  2M80 A;  4IHU A;  1XCC A;  4PGT A;  1R5P A;  5C00 A;  3MDK A;  2WZS A;  2L4Q A;  2XBQ A;  4CY8 A;  4ICY A;  3ERG A;  2GLR A;  2PN8 A;  4EUY A;  1N8J A;  3RHC A;  4Z2T A;  3DML A;  3FKF A;  2R3X A;  3LGC A;  5E4W A;  5IQY A;  2M46 A;  4MPF A;  1UA5 A;  3QFB C;  2VLV A;  3H1N A;  1OKT A;  1PMT A;  4ZBA A;  2PUK C;  3VPT A;  1TU7 A;  3W6G A;  3BD2 A;  3KM6 A;  3EMP A;  1ZYQ B;  4MLY A;  2YN1 A;  2LRN A;  3GX8 A;  1FVJ A;  3RAZ A;  4Q5R A;  2L4C A;  4FXY P;  1KTE A;  1Z3E A;  5G5F A;  3QAG A;  3F4S A;  4MDC A;  5IPG A;  5JCG A;  5HQP A;  3GL3 A;  1BJX A;  2C3N A;  1WPI A;  2JZT A;  4X4J A;  1K0B A;  2BMX A;  1CQG A;  3J7Y b;  5ABR A;  3TGZ A;  5IIZ A;  1TU8 A;  4G0K A;  4TKY A;  3TKS C;  1U3A A;  3FZA A;  1SEN A;  1EOH A;  2VL2 A;  2E2G A;  1C72 A;  1W4V A;  2CV4 A;  1M0U A;  1M9A A;  1I9D A;  3MAK A;  3CYN A;  4XRD A;  4HSC X;  4KUN A;  2C3T A;  3FR6 A;  4OCE A;  2I9H A;  4OCF A;  4I5Q A;  1B9X C;  2OE0 A;  4EIP A;  2HRK B;  1K3L A;  1NHO A;  1OYJ A;  4GSN A;  2VL9 A;  5CRE A;  3J7Y k;  1MD3 A;  3LXT A;  2DLX A;  4MNN A;  1OC3 A;  5JCW A;  2WJU A;  1G7O A;  4JZQ A;  4AKX B;  2OJL A;  4XS6 A;  3QAV A;  1GUK A;  3CTF A;  3TKP A;  2X8C A;  3DGQ A;  4BA7 A;  1GSY A;  4RI7 A;  4EXJ A;  1AIU A;  4TR1 A;  1TRU A;  4PUF C;  1SK1 A;  5G5E A;  2IMD A;  3GTU A;  5CP1 A;  6GSV A;  2LJR A;  2FHE A;  2VCT A;  1TKD B;  4HJM A;  4QL7 A;  1GUH A;  3GV1 A;  4GF0 A;  3GKM A;  1XVQ A;  1FB6 A;  2Z9S A;  3F0I A;  3KZQ A;  5AN1 A;  3TOT A;  2L57 A;  2H73 A;  3DEX A;  5ECR B;  2PER A;  5ELA A;  2N5A A;  1M9B A;  2H1D A;  1N2A A;  4V1A g;  3G7Y A;  4GDF A;  3ZFB A;  1Y6E A;  2F9S A;  2IFQ A;  5A34 B;  4OFM A;  3VWX A;  1U6T A;  4QL9 A;  3O6T A;  1V98 A;  2LJA A;  1XW6 A;  3WGD A;  1ABA A;  1U87 A;  1Z9H A;  1Z5Y E;  3P90 A;  5H5R A;  2R2J A;  4LL1 B;  3SBC A;  4HZ4 A;  1IYI A;  1Q98 A;  2HI7 A;  3CSI A;  4I97 A;  1S3C A;  2LJK A;  3KMO A;  5IMZ A;  19GS A;  1MD4 A;  3FY7 A;  1FOV A;  2H1A A;  1OVN A;  1A0F A;  1YF1 A;  3NOF A;  2LST A;  3HJP A;  4N10 A;  2PU9 C;  1VF1 A;  2GQK A;  1XWG A;  2LS5 A;  3WT2 A;  2OA7 A;  2YP6 A;  4J57 E;  4ZB8 A;  5HFI A;  3IV4 A;  3ED3 A;  1O85 A;  2V1M A;  3F9U A;  1R4W A;  4NHW A;  2KLX A;  2WDU A;  5EPF A;  3D5J A;  2R0C A;  4Q5Q A;  3N9J A;  3PIN A;  3QMX A;  1QGV A;  3ZYW A;  5J47 A;  3NIV A;  1XG8 A;  2WUL A;  5GAN D;  1SVL A;  3E0U A;  2ZUP A;  1SL2 B;  4ECB A;  5A1N A;  4Z2U A;  3A2W A;  3N5O A;  3ZL5 A;  3QCP A;  1F2E A;  1PFO A;  1O73 A;  3BCI A;  2EFD A;  5ECL B;  1M7T A;  4KA0 A;  3F4R A;  2EIR A;  5J5N A;  1E2Y A;  1YKA A;  2L59 A;  4YQM A;  2NPB A;  1VRS D;  2A4H A;  2CZ2 A;  1B9Y C;  5BMU B;  2EFH A;  5COH A;  2O89 A;  3QOU A;  4N30 A;  5JWO B;  2LEG A;  2HRA A;  3I69 A;  4MJC A;  1SKR B;  3IDV A;  4K6X A;  3VLN A;  5D9X A;  3CSJ A;  3F63 A;  4USS A;  2KP2 A;  5CO3 A;  3UMA A;  4TOP A;  4HDE A;  2FLS A;  2G0F A;  3US3 A;  1N25 A;  3ZFL A;  1EEJ A;  5DBQ A;  1IYH A;  2RUE A;  2A2P A;  3AY8 A;  3HZ4 A;  5J9C A;  3TRP A;  1EV9 A;  1K0N A;  1T3B A;  2XPE A;  1FG4 A;  3U5R E;  3HD5 A;  5B8A A;  4EO3 A;  1J0F A;  5D9V A;  2HSN A;  4D73 B;  3Q18 A;  5J4U A;  1OC9 A;  1YDK A;  1SK0 A;  2E2M A;  1AW9 A;  4FO5 A;  4MPG A;  2VO4 A;  2YJH A;  4K0G A;  4JR4 A;  2H6Z A;  2UZ8 A;  1A8L A;  4KDX A;  4O92 A;  4AJ7 A;  5DAK B;  4BL7 B;  1NSW A;  4TW5 A;  2KOK A;  2L6D A;  2O8V B;  5DQS A;  4K5S A;  5F05 A;  1B8X A;  2K18 A;  1M3J A;  2LQQ A;  5KN3 A;  4WR5 A;  2ZNM A;  1R26 A;  2FY6 A;  2GSQ A;  2TRX A;  1KNG A;  1EP8 A;  3TKS A;  1ZYE A;  2ZCT A;  1EOG A;  4D73 A;  2H0H A;  4F03 A;  4YKG A;  1Z6N A;  2YZH A;  4KCE A;  4KE3 A;  2ON7 A;  1Y25 A;  2MMA A;  4K2X A;  1HQO A;  3HMJ G;  5G1L A;  2C80 A;  3UIW A;  1OAZ A;  1SKS B;  3EU3 A;  3M0F A;  1S4B P;  2DSA A;  2CQ9 A;  1PX6 A;  1ZYN A;  4L8E A;  4RUV A;  4K8M A;  3EUR A;  3KH9 A;  3A2X A;  4XS4 A;  5DJM A;  4MZW A;  4EL1 A;  3RBT A;  5J4Y A;  4V2L A;  1TRS A; 
#chains in the Genus database with same CATH homology
 2YJ7 A;  3F4T A;  4IJ3 A;  2LTK A;  5ECI B;  4NHZ A;  4HU7 A;  2YZU A;  1K0A A;  4IJI A;  4P3Y B;  1JFU A;  5EVO A;  5C04 A;  5F06 A;  2R37 A;  1TOF A;  1MDK A;  1AUC A;  1SYX A;  3RDW A;  2L6C A;  4KDU A;  3IOS A;  4QQ7 A;  2ON5 A;  3KP9 A;  4CY6 A;  3ME8 A;  4NXI A;  4HI7 A;  4KX4 A;  2KUC A;  4KB3 A;  1J9B A;  4EKZ A;  1Y1U A;  5ID2 B;  4TVE A;  1SJI A;  1WWJ A;  4K7N A;  2IME A;  4GCI A;  5H5Q A;  5IMV A;  5IOX A;  2FWF A;  3CSH A;  3TB2 A;  5CRW A;  5GAP D;  5A5H B;  2QSI A;  3Q74 A;  1SKW B;  1U3I A;  5G31 A;  3BOA A;  5D96 A;  2EC4 A;  2V6K A;  1HNB A;  1QK8 A;  5ECN B;  4HJ2 A;  2K8S A;  5H5S A;  4XIH A;  4F82 A;  1TTZ A;  1GNW A;  3UEM A;  5ID2 A;  2OBI A;  4WXT A;  3IR4 A;  2X99 A;  3U6V A;  4TXO A;  1VGL A;  4ZB6 A;  2NTO A;  5LCZ A;  8GSS A;  3DWV A;  2R6K A;  2HSY A;  1OE8 A;  4XCS A;  1KEB A;  4AJ8 A;  5L71 A;  2GGT A;  4WKW A;  1BG5 A;  3WT1 A;  2AYT A;  2H76 A;  2H6X A;  3KTL A;  4HUA A;  4MK3 A;  3IPZ A;  3C71 A;  1V58 A;  5ECP B;  2H74 A;  1XFL A;  3APS A;  3O3T A;  4MZC A;  4ZL9 A;  2B5Y A;  2VIM A;  3D6I A;  3LEF A;  4BWQ A;  1PRX A;  4IQ1 A;  1GUM A;  3LQ7 A;  4JU5 A;  2DJK A;  3MSZ A;  5F0G A;  5ECQ B;  3DKS A;  3HY2 A;  5J4V A;  2HSH A;  2GDR A;  2HXK A;  1AXD A;  3FMW A;  1LU4 A;  3ZRE A;  5LD0 A;  3C1R A;  1V2A A;  1A2J A;  2MBT A;  3I43 A;  5DCH A;  3EC3 A;  3UAP A;  2HZE A;  2TRC P;  2DBC A;  3KMN A;  4IKH A;  3I9V 2;  17GS A;  2H8L A;  1O7U A;  3QDN A;  1TK8 B;  4EE0 A;  4NAX A;  1Z7P A;  1I5G A;  1PSQ A;  2PBJ A;  2VD1 A;  4DEJ A;  3GSS A;  2K9F A;  2WZ9 A;  4V1A p;  3ZVJ A;  2CZ3 A;  3GL5 A;  1MEK A;  4IBP A;  1LBK A;  1UVZ A;  1EEM A;  3L78 A;  4JR6 A;  3TKQ A;  4BVY A;  4ZIJ A;  1PGT A;  1TP9 A;  1X0R A;  2O5V A;  4NPB A;  2EFE A;  3I6A A;  1V40 A;  2HSM A;  4ISD A;  3GIX A;  2DJJ A;  1X9W B;  2VCW A;  4IP1 A;  1X5C A;  1RK4 A;  1H4O A;  2QGV A;  4MCU A;  2PVQ A;  1QUW A;  4MMM A;  2GVP A;  1ZOF A;  3H79 A;  1EGO A;  4YH2 A;  4HOJ A;  2I4A A;  3ISO A;  1GLQ A;  3EWL A;  4GRF A;  4RQX A;  4AKG A;  2YPM A;  1Z6M A;  5IMF A;  4F2I A;  5AIS A;  3TRQ A;  5HFK A;  3TDG A;  5KN2 A;  2K8V A;  1KBN A;  1K0C A;  3GH9 A;  4IEL A;  4OWY A;  3EIN A;  4EIQ A;  1G7E A;  2YV9 A;  2V41 A;  3TKR A;  4N3Z A;  4F0B A;  3F8U A;  2JSZ A;  4TR1 B;  4Z2R A;  3RPN A;  4NV5 A;  2XBI A;  2GS3 A;  3GTU B;  13GS A;  2BJX A;  3UOM A;  2VLT A;  3JCM L;  1WOU A;  4I8B A;  4JED A;  2I81 A;  3UVT A;  3DD3 A;  2OT3 A;  2YWI A;  3HYP A;  2H01 A;  3TJF A;  2DJ0 A;  1B48 A;  4EDZ A;  1YJ6 A;  3APO A;  1S3D A;  2IFQ B;  3H4K A;  6GSS A;  3GHA A;  2IIY A;  1TRW A;  5B6M A;  1PN9 A;  1JZO A;  2VM2 A;  4YQU A;  2J9H A;  3PR8 A;  4PTS A;  2GQL A;  2HRF A;  2AJQ B;  3IAM 2;  1UC7 A;  4TR3 A;  5IM9 A;  1T00 A;  3HVV A;  1XW5 A;  4PQ1 A;  5BRT A;  4DSR A;  1V9W A;  4X0X A;  2HFD A;  4BWS A;  1WMJ A;  1JLV A;  3L9S A;  3H93 A;  2YCD A;  2MZC A;  11GS A;  4PUA A;  2EFC A;  4ZIL A;  2P31 A;  4AI6 A;  5DAL A;  1YF0 A;  3G7J A;  3QAW A;  4KCA A;  3MIX A;  3TU3 B;  1G6W A;  1F3B A;  16GS A;  2WRT A;  1ST9 A;  3KCM A;  1R5A A;  1ON4 A;  3G7I A;  2LUS A;  2PVO C;  2VKZ G;  3GN3 A;  4KW6 A;  5CRG A;  1XOB A;  1FVK A;  3S9F A;  3UVH A;  5GZZ B;  4TRX A;  5A4U A;  4XRA A;  5A1N B;  3EMX A;  4MF7 A;  2H72 A;  1SJZ A;  1SYR A;  4G0L A;  2I1U A;  2JSY A;  1TK0 B;  2QA1 A;  2IJY A;  3QFA C;  3ZRD A;  1GSE A;  1GL8 A;  2F8A A;  3M1G A;  2C0D A;  1XXU A;  2H30 A;  1XZO A;  4KND A;  3EVI A;  3LXZ A;  4JE1 A;  4NMU A;  2VAF A;  1GTB A;  4KSO A;  5KN1 A;  2B3S A;  2IPA A;  1TK5 B;  4LMV A;  5DCG A;  3D4M A;  1GRX A;  3GST A;  5D9T A;  6GSY A;  1FAA A;  3KEB A;  4QMK A;  3IC8 A;  1SJ6 A;  2H0I A;  5G2Z A;  2DJ3 A;  2OE3 A;  4IW9 A;  3M8N A;  5EL8 A;  2F3M A;  2JU5 A;  3IA1 A;  1TXU A;  2DKI A;  3DIE A;  1BG1 A;  1ILO A;  2H71 A;  3KGK A;  2R0G A;  5LNK e;  1T8E B;  4G2E A;  3FYG A;  4XS1 A;  3ME7 A;  1ERU A;  2IMI A;  3CXG A;  3C7M A;  1SD8 A;  4IN0 A;  3ZVJ D;  2HSN B;  5HR2 A;  3LG6 A;  5GST A;  2KP1 A;  1OC9 B;  4KGI A;  1USB A;  2R0P A;  4PNF A;  4KF9 A;  1HNA A;  3KH7 A;  2YWM A;  1GNE A;  12GS A;  1X9M B;  5G30 A;  22GS A;  1E6B A;  2REM A;  2MMZ A;  3HXS A;  5D73 A;  2PMT A;  4OFT A;  2WFC A;  4ZB9 A;  3ERW A;  4EF0 A;  2H1L A;  1YVL A;  3WYW A;  1T4Y A;  4YQV A;  1VF4 A;  3CBU A;  3VFI A;  4YAP A;  1GUL A;  4PUR A;  1GTU A;  2H0G A;  1HD2 A;  5FT3 A;  3APQ A;  2XPD A;  1EZK A;  3GUS A;  1RQM A;  4POM A;  1XBS A;  2IL3 A;  1VF3 A;  5F07 A;  1M2B A;  1TRV A;  3TJG A;  4X43 A;  2GST A;  1WE0 A;  3FZ5 A;  3L9U A;  3PPU A;  2WB9 A;  10GS A;  3IHG A;  1PKW A;  1GSQ A;  1G6Y A;  4ULX A;  3HDC A;  2GZY A;  4MJE A;  2A2R A;  4LLR A;  2LKU A;  4XS4 B;  1V57 A;  3WGE A;  4KAE A;  4I6X A;  5G1K A;  4ZL8 A;  1T1V A;  3EE2 A;  5A5K A;  3EU4 A;  2F8F A;  5J41 A;  4KSM A;  3GKX A;  3GFK A;  1QFN A;  4L0U A;  3VWU A;  1VF2 A;  1PA3 A;  3A5W A;  4AF2 A;  5HR0 A;  2P5Q A;  2CX3 A;  2QC7 A;  2OAD A;  4K1F A;  4ECI A;  3IXR A;  3GMF A;  9GSS A;  1GH2 A;  3C8E A;  2PWJ A;  4DSS A;  2X49 A;  20GS A;  5ENU A;  4HEA 2;  3Q19 A;  4AKH A;  4OO4 A;  4NV2 A;  3A5I A;  2B1K A;  3LYK A;  2M72 A;  2CT6 A;  3ERF A;  3M9J A;  1G0T A;  3TUE A;  2QA2 A;  4O5U A;  2KHP A;  4K7O A;  3HKR A;  1NW2 A;  3UAR A;  4OO5 A;  4G10 A;  2IMK A;  4GWR A;  4HU9 A;  1ZL9 A;  2IWT A;  1F6M C;  2X8G A;  1GSU A;  4G01 A;  3HCZ A;  1TW9 A;  1SU9 A;  3EYT A;  4WBR D;  4OD7 A;  3PH9 A;  4FYU A;  4RQR A;  4TR0 A;  4EC0 A;  1TDI A;  5B8B A;  2JZR A;  4TXO B;  2FNO A;  1DSB A;  2VLU A;  1A8Y A;  4V2M A;  3IE3 A;  1YEX A;  2OBK A;  2X64 A;  5CAX A;  1DUG A;  2EIO A;  5IMD A;  2V2G A;  4MH3 A;  2HYX A;  4POK A;  1X9S B;  5E59 A;  4KH7 A;  2H66 A;  2CAI A;  1A0R P;  2YAN A;  2C3Q A;  1XIY A;  5J3R A;  3F3Q A;  1U88 A;  4H86 A;  3TJK A;  2WCI A;  3VI5 A;  1WRY A;  4A5P A;  2AAW A;  2H70 A;  5IPH A;  1SL0 B;  4BVX A;  1W89 A;  2CX4 A;  4F9Z A;  5IMC A;  3KJY A;  1X5E A;  2C1Y A;  1GTI A;  3GYK A;  4O5R A;  3KIJ A;  4IGJ A;  5DVB A;  2R5G A;  3D22 A;  1XPV A;  1THX A;  1ZYP A;  3W8J A;  3A2V A;  4POB A;  2HZE B;  5INY A;  1ERT A;  4WBJ A;  3TRX A;  3GNJ A;  3V1W A;  2YOI A;  4DVC A;  1GSF A;  3D4T A;  3WD6 A;  5AIX A;  1QXH A;  2N5F A;  4GTU A;  2RII A;  3TCO A;  1K0M A;  2LV3 A;  2E7P A;  4ID0 A;  1M99 A;  3VK9 A;  5GSS A;  1TI3 A;  4BVY B;  4AJ6 A;  2LNS A;  2LRT A;  4HZ2 A;  3CMI A;  1B4Q A;  1BF5 A;  6GSU A;  2AHE A;  3IK7 A;  2C0G A;  5KN0 A;  3GRX A;  1XWB A;  1PN0 A;  2HSM B;  5A4V A;  4K5R A;  2B7J A;  5CRH A;  2C4J A;  5IMA A;  4MH2 A;  4ACS A;  4MZB A;  3VWW A;  2H6Y A;  2DML A;  3UBL A;  3MYD A;  18GS A;  5JCU A;  3RHB A;  3FZ4 A;  1MTC A;  4LL4 B;  3R2Q A;  5KEJ A;  2VCV A;  3C73 A;  2JL4 A;  1AQX A;  5ECM B;  1JZD A;  3IK9 A;  3FRC A;  4GLT A;  3KXO A;  2FA8 A;  1QMV A;  2QKE A;  4PX1 A;  4GQF A;  4EVM A;  2YNX A;  4WF5 A;  5ECK B;  2H19 A;  2JAD A;  3Q6O A;  4X1U A;  1TJD A;  5D8I A;  2VCX A;  3DYR A;  1Q4J A;  4N0Z A;  2VOC A;  4Q5F A;  4CHS A;  2FD3 A;  4I2U A;  3P8W A;  4WET A;  5J9B A;  1XVW A;  3F6D A;  3MWH A;  1JZR A;  2FCH A;  2FWE A;  3LYP A;  5EY6 A;  1GWC A;  3E3E A;  4IQA A;  1TXX A;  2H75 A;  5D9W A;  2MYG A;  3ZZX A;  2AV4 A;  4HS1 A;  2RM6 A;  4PQI A;  3KD0 A;  4MAB A;  2K6V A;  4J56 E;  1BED A;  3P7X A;  1FOH A;  2HZF A;  4BPY A;  1YEP A;  4LMW A;  2A2S A;  1SK2 A;  2HLS A;  1UN2 A;  1SL1 B;  2IMF A;  5J40 A;  4TN8 A;  5B7C A;  1YZX A;  2YWO A;  2GZZ A;  1EP7 A;  2GT5 A;  3BJ5 A;  4L5O A;  3LW9 A;  3IC4 A;  2ES7 A;  3M9K A;  4TR4 A;  2RM5 A;  2OAC A;  4MF6 A;  2WS2 A;  4ECJ A;  3GA4 A;  5B6N A;  1YY7 A;  2DJ2 A;  1XWK A;  2E0Q A;  1GSD A;  4L5L A;  4O5Q A;  1PKZ A;  4IP6 A;  1M2D A;  3TOU A;  2YWN A;  5HR3 A;  1T4Z A;  5DAL B;  4FIW A;  3E9J B;  1HNC A;  2O87 A;  5IO0 A;  5DQY A;  4MJB A;  1EV4 A;  2MMN A;  3IBH A;  1SD9 A;  2I3Y A;  3HJM A;  2PPT A;  2NBS A;  3VI7 A;  1A2M A;  3NZN A;  2HRK A;  4ZB7 A;  4AGS A;  1FO5 A;  2DKH A;  2MMO A;  1WIK A;  4K7I A;  3FR9 A;  2AB6 A;  4E68 A;  3ZIJ A;  3LWA A;  2N5B A;  3GH6 A;  4CDO A;  5DJL A;  3TKS E;  1PL1 A;  2G2Q A;  4MF5 A;  3HJO A;  3ZTL A;  2B6M A;  2DJ1 A;  2DMM A;  2FWG A;  4GQC A;  4MA9 A;  4EDY A;  1F9M A;  4W66 A;  3M3M A;  2HT9 A;  1XW9 A;  1JHB A;  2RLI A;  5HFG A;  2FGX A;  1DBY A;  1OC8 A;  1MDI A;  1ERV A;  2P5R A;  2C0E A;  4PQH A;  3FK8 A;  1AQV A;  4N0V A;  4MP4 A;  1FB0 A;  4Z7X A;  3EPT A;  1QQ2 A;  3FR3 A;  3CRT A;  1O8X A;  1A23 A;  3UL3 A;  3L9V A;  5A34 A;  3UBK A;  1GP1 A;  5HR1 A;  1ACV A;  2GSS A;  2O85 A;  3HVX A;  1URM A;  5DDL A;  5D93 A;  3HHV A;  4FQU A;  2LQO A;  4POL A;  1Z7R A;  3DVX A;  3QD9 A;  1RW1 A;  1K0O A;  1OE7 A;  5CNW A;  4O32 A;  2CVB A;  2F51 A;  2J23 A;  4L0W A;  3TJB A;  3G9B A;  4YKF A;  3IAS 2;  1O6J A;  3DRN A;  1FHE A;  1GSS A;  3TJJ A;  1F37 A;  3W8S A;  3IRA A;  2HQT A;  3H8Q A;  4FYC A;  2GTU A;  5KOX A;  3RPP A;  2B1L A;  4NWY A;  4WEY A;  4E8H A;  1GTA A;  1X5D A;  4K9Z A;  1ML6 A;  1PQN A;  3PGT A;  3MNG A;  2TIR A;  2D2Z A;  1ZCP A;  2XC2 A;  1BX9 A;  1XWC A;  2XHF A;  2CVK A;  2H1B A;  2L5L A;  2MBS A;  1YQ1 A;  2AUV A;  3HVS A;  4ML1 A;  2V6O A;  2X8H A;  2B7K A;  1A24 A;  1LJR A;  4LA1 A;  2VM1 A;  2EIQ A;  1DE1 A;  3CTG A;  5IOW A;  3FHK A;  3GKN A;  1HYU A;  2WGR A;  3L4N A;  1WP0 A;  1PD2 1;  6GSW A;  4V2N A;  4O7H A;  3LSZ A;  3K8N A;  5AGY A;  5BMU A;  3FEU A;  3LOR A;  3BBY A;  4G9H A;  4DSQ A;  3O76 A;  4AKI A;  4J2F A;  2HNL A;  2L5O A;  4N11 A;  1NHY A;  2DIY A;  1EWX A;  2GT6 A;  4DSS B;  4WR4 A;  2VL2 C;  4G19 A;  4ZBD A;  5JWR B;  5A4W A;  4YAV A;  3WGX A;  4CW9 A;  3P2A A;  2OKA A;  2PGT A;  4XTS A;  2X4A A;  2OE1 A;  2LRC A;  1DE2 A;  3ZLP A;  1ZZY A;  2FUG 2;  4ECC A;  1SVM A;  3VUR A;  3HA9 A;  1CQH A;  1AC1 A;  4WF4 A;  3C1S A;  2R4V A;  4I2T A;  4KDY A;  3GX0 A;  3F3R A;  2VCQ A;  6GST A;  5DAK A;  4BL7 A;  2JZS A;  5AIV A;  4GST A;  4GSS A;  2DIZ A;  4PNG A;  1YKC A;  4G0I A;  4HQZ A;  2GSR A;  3A3T A;  2YV7 A;  3KTB A;  2CVD A;  4FH8 A;  2RUF A;  1XWA A;  1XOA A;  2H1G A;  3L0H A;  2HE3 A;  3ZIT A;  4ZL7 A;  3IHQ A;  5CYY A;  1B4P A;  1M2A A;  1EGR A;  1AQW A;  2VCZ A;  2NVL A;  1ZMA A;  3R3E A;  5ECH B;  4HQS A;  4MJA A;  1WJK A;  4XHM A;  4GXZ A;  2CA8 A;  5ELG A;  1OKD A;  1S3A A;  1K3Y A;  3OR5 A;  4BVX B;  5CRD A;  4JRR A;  1ERW A;  5FWG A;  2HRN A;  7GSS A;  1H75 A;  3HZ8 A;  1PL2 A;  3F6F A;  3BCK A;  2GQM A;  1ZGN A;  2LNT A;  1R7H A;  1A2L A;  5ECS A;  1THO A;  2VUP A;  2FWH A;  5ECO B;  2B5E A;  2V32 A;  3D21 A;  3DVW A;  3LJR A;  2VD0 A;  1BQ7 A;  2C8U A;  1T7P B;  1NM3 A;  1BYE A;  4K2D A;  1JLW A;  3GUR A;  1MDJ A;  2CAQ A;  2A4V A;  4F0C A;  1SVO A;  2ALB A;  1AAZ A;  4OMV A;  3ZMK A;  4ZXG A;  2FA4 A;  3QR6 A;  4PXO A;  3LFL A;  2B5X A;  2UV8 G;  4ML6 A;  1K0D A;  5KOW A;  3CWG A;  4Q5N A;  4ILF A;  1O8W A;  3QPM A;  3VWV A;  3CRU A;  2BTO T;  2VL3 A;  5FHI A;  4FYB A;  14GS A;  3FW2 A;  4TXV A;  2DC5 A;  3D0Z A;  3KP8 A;  1FW1 A;  4K0N A;  2IN3 A;  2JAC A;  1PX7 A;  1JZW A;  3DXB A;  2NDO A;  4RI6 A;  2GZP A;  3FZ9 A;  5A5H A;  3ZML A;  4ZBB A;  4IVF A;  4E8E A;  1K3O A;  2O7K A;  3SWL A;  6GSX A;  3UJ1 A;  2P0G A;  5IO2 A;  3VPQ A;  5JWQ B;  4IS0 A;  3GKK A;  1O81 A;  1BAY A;  1TI1 A;  4OFN A;  3ZIV A;  1F3A A;  4JBB A;  5F8B A;  1J08 A;  2C0F A;  1GLP A;  2M80 A;  4IHU A;  1XCC A;  4PGT A;  1R5P A;  5C00 A;  3MDK A;  2L4Q A;  2XBQ A;  4CY8 A;  4ICY A;  3ERG A;  2GLR A;  2PN8 A;  4EUY A;  1N8J A;  3RHC A;  4Z2T A;  3DML A;  3FKF A;  2R3X A;  3LGC A;  5E4W A;  5IQY A;  2M46 A;  4MPF A;  1UA5 A;  3QFB C;  2VLV A;  3H1N A;  1OKT A;  1PMT A;  4ZBA A;  2PUK C;  3VPT A;  1TU7 A;  3W6G A;  3BD2 A;  3KM6 A;  3EMP A;  1ZYQ B;  4MLY A;  2YN1 A;  2LRN A;  3GX8 A;  1FVJ A;  3RAZ A;  4Q5R A;  2L4C A;  1KTE A;  1Z3E A;  5G5F A;  3QAG A;  3F4S A;  4MDC A;  5IPG A;  5JCG A;  5HQP A;  3GL3 A;  1BJX A;  2C3N A;  1WPI A;  2JZT A;  4X4J A;  1K0B A;  2BMX A;  1CQG A;  3J7Y b;  5ABR A;  3TGZ A;  5IIZ A;  1TU8 A;  4G0K A;  4TKY A;  3TKS C;  1U3A A;  3FZA A;  1SEN A;  1EOH A;  2VL2 A;  2E2G A;  1C72 A;  1W4V A;  2CV4 A;  1M0U A;  1M9A A;  1I9D A;  3MAK A;  3CYN A;  4XRD A;  4KUN A;  2C3T A;  3FR6 A;  4OCE A;  2I9H A;  4OCF A;  4I5Q A;  1B9X C;  2OE0 A;  4EIP A;  2HRK B;  1K3L A;  1NHO A;  1OYJ A;  4GSN A;  2VL9 A;  5CRE A;  3J7Y k;  1MD3 A;  3LXT A;  2DLX A;  4MNN A;  1OC3 A;  5JCW A;  2WJU A;  1G7O A;  4JZQ A;  4AKX B;  2OJL A;  4XS6 A;  3QAV A;  1GUK A;  3CTF A;  3TKP A;  2X8C A;  3DGQ A;  4BA7 A;  1GSY A;  4RI7 A;  4EXJ A;  1AIU A;  4TR1 A;  1TRU A;  4PUF C;  1SK1 A;  5G5E A;  2IMD A;  3GTU A;  5CP1 A;  6GSV A;  2LJR A;  2FHE A;  2VCT A;  1TKD B;  4HJM A;  4QL7 A;  1GUH A;  3GV1 A;  4GF0 A;  3GKM A;  1XVQ A;  1FB6 A;  2Z9S A;  3F0I A;  3KZQ A;  5AN1 A;  3TOT A;  2L57 A;  2H73 A;  3DEX A;  5ECR B;  2PER A;  5ELA A;  2N5A A;  1M9B A;  2H1D A;  1N2A A;  4V1A g;  3G7Y A;  4GDF A;  3ZFB A;  1Y6E A;  2F9S A;  2IFQ A;  5A34 B;  4OFM A;  3VWX A;  1U6T A;  4QL9 A;  3O6T A;  1V98 A;  2LJA A;  1XW6 A;  3WGD A;  1ABA A;  1U87 A;  1Z9H A;  1Z5Y E;  3P90 A;  5H5R A;  2R2J A;  4LL1 B;  3SBC A;  4HZ4 A;  1IYI A;  1Q98 A;  2HI7 A;  3CSI A;  4I97 A;  1S3C A;  2LJK A;  3KMO A;  5IMZ A;  19GS A;  1MD4 A;  3FY7 A;  1FOV A;  2H1A A;  1OVN A;  1A0F A;  1YF1 A;  3NOF A;  2LST A;  3HJP A;  4N10 A;  2PU9 C;  1VF1 A;  2GQK A;  1XWG A;  2LS5 A;  3WT2 A;  2OA7 A;  2YP6 A;  4J57 E;  4ZB8 A;  5HFI A;  3IV4 A;  3ED3 A;  1O85 A;  2V1M A;  3F9U A;  1R4W A;  4NHW A;  2KLX A;  2WDU A;  5EPF A;  3D5J A;  2R0C A;  4Q5Q A;  3N9J A;  3PIN A;  3QMX A;  1QGV A;  3ZYW A;  5J47 A;  3NIV A;  2WUL A;  5GAN D;  1SVL A;  3E0U A;  2ZUP A;  1SL2 B;  4ECB A;  5A1N A;  4Z2U A;  3A2W A;  3N5O A;  3ZL5 A;  3QCP A;  1F2E A;  1O73 A;  3BCI A;  2EFD A;  5ECL B;  1M7T A;  4KA0 A;  3F4R A;  2EIR A;  5J5N A;  1E2Y A;  1YKA A;  2L59 A;  4YQM A;  2NPB A;  1VRS D;  2A4H A;  2CZ2 A;  1B9Y C;  5BMU B;  2EFH A;  5COH A;  2O89 A;  3QOU A;  4N30 A;  5JWO B;  2LEG A;  2HRA A;  3I69 A;  4MJC A;  1SKR B;  3IDV A;  4K6X A;  3VLN A;  5D9X A;  3CSJ A;  3F63 A;  4USS A;  2KP2 A;  5CO3 A;  3UMA A;  4TOP A;  4HDE A;  2FLS A;  2G0F A;  3US3 A;  1N25 A;  3ZFL A;  1EEJ A;  5DBQ A;  1IYH A;  2RUE A;  2A2P A;  3AY8 A;  3HZ4 A;  5J9C A;  3TRP A;  1EV9 A;  1K0N A;  1T3B A;  2XPE A;  1FG4 A;  3U5R E;  3HD5 A;  5B8A A;  4EO3 A;  1J0F A;  5D9V A;  2HSN A;  4D73 B;  3Q18 A;  5J4U A;  1OC9 A;  1YDK A;  1SK0 A;  2E2M A;  1AW9 A;  4FO5 A;  4MPG A;  2VO4 A;  2YJH A;  4K0G A;  4JR4 A;  2H6Z A;  2UZ8 A;  1A8L A;  4KDX A;  4O92 A;  4AJ7 A;  5DAK B;  4BL7 B;  1NSW A;  4TW5 A;  2KOK A;  2L6D A;  2O8V B;  5DQS A;  4K5S A;  5F05 A;  1B8X A;  2K18 A;  2LQQ A;  5KN3 A;  4WR5 A;  2ZNM A;  1R26 A;  2FY6 A;  2GSQ A;  2TRX A;  1KNG A;  1EP8 A;  3TKS A;  1ZYE A;  2ZCT A;  1EOG A;  4D73 A;  2H0H A;  4F03 A;  4YKG A;  1Z6N A;  2YZH A;  4KCE A;  4KE3 A;  2ON7 A;  1Y25 A;  2MMA A;  4K2X A;  1HQO A;  3HMJ G;  5G1L A;  2C80 A;  3UIW A;  1OAZ A;  1SKS B;  3M0F A;  3EU3 A;  2DSA A;  2CQ9 A;  1PX6 A;  1ZYN A;  4L8E A;  4RUV A;  4K8M A;  3EUR A;  3KH9 A;  3A2X A;  4XS4 A;  5DJM A;  4MZW A;  4EL1 A;  3RBT A;  5J4Y A;  4V2L A;  1TRS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...