2C4JA

Human glutathione-s-transferase m2-2 t210s mutant in complex with glutathione-styrene oxide conjugate
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
217
structure length
217
Chain Sequence
PMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLUTATHIONE S-TRANSFERASE MU 2
publication title Alternative Mutations of a Positively Selected Residue Elicit Gain or Loss of Functionalities in Enzyme Evolution.
pubmed doi rcsb
source organism Homo sapiens
total genus 80
structure length 217
sequence length 217
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2005-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2c4jA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2c4jA01
3CSIA 4OWYA 1A0FA 3AY8A 2D2ZA 2WS2A 2HSHA 1FO5A 5D8IA 4X1UA 1EV4A 4ZILA 1X5DA 2B7JA 1LJRA 1Z6NA 2OBKA 2VCZA 3A2VA 4N11A 1G0TA 3F9UA 2N5BA 1GSDA 2HE3A 3DD3A 6GSYA 1PA3A 1O7UA 4WBRD 4GSSA 5JWOB 3KIJA 2AUVA 3HA9A 5D9VA 4ZXGA 2JACA 1HD2A 4XIHA 4HJMA 2YJ7A 4GSNA 1S3DA 2X8GA 1M99A 1YY7A 3F8UA 5AIXA 5F06A 3HDCA 4K2DA 4G0KA 1WPIA 1SL0B 5D73A 20GSA 2V41A 5DBQA 4POKA 3E3EA 3D22A 1XWKA 2O85A 4F03A 2I3YA 1Z5YE 2QGVA 2DLXA 1V40A 4V2NA 2ALBA 1BAYA 3J7Yb 4IELA 2YP6A 3LXZA 4PTSA 5C00A 1K0OA 4TR4A 4AJ6A 2XC2A 4EL1A 4IJ3A 2OJLA 1FAAA 3HD5A 4XS4A 4PQIA 2E7PA 4OFTA 1TOFA 3IC4A 2KLXA 1YKCA 3GSTA 3F63A 1T4YA 2J23A 4LMWA 4G2EA 1ACVA 2X8CA 4KW6A 3HZ4A 2MMOA 3ZZXA 2HI7A 3NIVA 1MDKA 18GSA 4KE3A 4POBA 5FHIA 3M1GA 3KP9A 3G9BA 4MJCA 1F3BA 3LFLA 3FR9A 2E2MA 3QDNA 4XRDA 4HJ2A 2DSAA 2XBIA 3GA4A 4NWYA 2H1BA 2KHPA 22GSA 1TKDB 11GSA 4KSOA 5E59A 2PN8A 3CMIA 1O85A 3KTBA 2JL4A 4KF9A 1TDIA 5F05A 4I2UA 1GSUA 3IAS2 1PX7A 1KBNA 4RQXA 2G0FA 1XVQA 1XW9A 1ML6A 1B4PA 3A5WA 3M9KA 3FK8A 3IE3A 2PWJA 3VWWA 1THOA 5CRDA 5HR1A 3HVSA 1SL1B 1SJ6A 3OR5A 5B6NA 2DJ1A 2JZSA 2P0GA 5CP1A 5DQSA 2PVQA 2JZRA 1FG4A 4L5OA 1GSSA 2RUFA 3DVWA 4GQFA 1BYEA 4J2FA 5D9XA 3ZVJD 3BOAA 4LMVA 4BWQA 3UBLA 1WE0A 2H0GA 3GYKA 2H19A 5GZZB 3IC8A 4Q5RA 2HSMA 1AXDA 1VF1A 2B6MA 2CX4A 1GWCA 1A8LA 3QD9A 4EC0A 4LL1B 2YWNA 1PL1A 4OFMA 4KX4A 1O8XA 2HLSA 2NDOA 1SYRA 2YN1A 4GRFA 3TKSA 1PKZA 4CDOA 4WF4A 4JR6A 2WDUA 1AQWA 1K0DA 4IBPA 4ECJA 3GTUA 4GXZA 2FA4A 3UOMA 5DCHA 2VL9A 1KNGA 1SK1A 1GLQA 5DDLA 2QSIA 5IMAA 2EC4A 2L57A 3TUEA 3CTFA 2LNTA 4FYBA 5AIVA 2AV4A 2GSSA 1S3AA 2MBTA 3QAGA 4V1Ag 3GH6A 1M0UA 4MA9A 8GSSA 2PGTA 3R2QA 3KGKA 5AN1A 1EP7A 2C0FA 1GP1A 2AAWA 2OE0A 5J9BA 4PQHA 5B7CA 5HQPA 2C0DA 2XHFA 12GSA 2A2RA 3TKPA 3MNGA 3F4SA 3ZMLA 1V2AA 5KEJA 3KEBA 3N5OA 2L4QA 1XWGA 4MJBA 5IOXA 1XWBA 2C3TA 4G0IA 1W89A 3APSA 1FW1A 2WGRA 6GSXA 2YOIA 3IV4A 4HU7A 3WT2A 3KXOA 2HRAA 3G7IA 3M8NA 3GN3A 1GH2A 2CAIA 2I4AA 2DJJA 3H1NA 3HJOA 2YV9A 3DEXA 1FVKA 2VOCA 2FHEA 3WYWA 4DSSB 3QFBC 3GL3A 4ZL7A 2UZ8A 2X64A 1TK0B 6GSWA 4PXOA 1A2MA 1ZCPA 4IP6A 4EE0A 3SBCA 4ZIJA 1ILOA 3DYRA 5DQYA 5J9CA 3H93A 1ABAA 4TR0A 1TI3A 5B8AA 3TGZA 17GSA 2HXKA 4MF5A 1GSEA 5J5NA 1GTIA 1H75A 3ZYWA 2FCHA 1QQ2A 2GSRA 1X9MB 5COHA 3MDKA 3BCIA 1B9YC 3F6DA 1QK8A 3LSZA 2GSTA 3ZLPA 4J56E 1GNEA 4QQ7A 4X43A 3P2AA 1TXXA 1YKAA 5G5FA 2TRCP 3VFIA 5J3RA 4YH2A 2LSTA 5ID2B 5ECHB 4XTSA 1BJXA 3I69A 2YANA 2BMXA 1WIKA 5HR3A 2I1UA 2OACA 4AJ8A 4IP1A 5CRGA 3US3A 4BL7B 4Z7XA 4YQVA 4OFNA 1BX9A 2NBSA 4HDEA 2L5LA 2VO4A 3LJRA 3MAKA 5ECPB 2FNOA 2C4JA 2EIQA 1GSFA 2NPBA 1F2EA 2V1MA 1XWCA 3H8QA 4POLA 2LRNA 1A2JA 1HYUA 1EP8A 2RM6A 2PERA 1X5CA 5F07A 1Q98A 3D5JA 2VCVA 1O8WA 1M2AA 4BWSA 4IN0A 4AJ7A 1MEKA 3KP8A 3L0HA 4TXVA 1QUWA 3A2XA 1M2BA 3ZIJA 4IVFA 1K0MA 1JFUA 4I5QA 1SK2A 1XIYA 2PUKC 5IM9A 3L9SA 2LV3A 3FKFA 4V1Ap 4KCAA 1TK5B 1H4OA 3RHBA 1A2LA 5ECIB 2CQ9A 1HNBA 2HZFA 3NZNA 1LU4A 1GL8A 5C04A 4I6XA 1XFLA 1MDIA 3ZREA 2H72A 2I81A 4CHSA 3C1RA 3G7JA 1NHOA 3QAVA 4GTUA 5CYYA 1CQHA 3D0ZA 1JLVA 2CV4A 5D9WA 4K1FA 4DSSA 2YCDA 3TJJA 3TJGA 1LBKA 2HRFA 2H6XA 2R5GA 3BCKA 1K3YA 2E0QA 4XRAA 3CRUA 5D93A 2AYTA 3TRXA 3C71A 2C3NA 5A4WA 1AAZA 4EO3A 2HRNA 4LLRA 1B4QA 1XZOA 2K18A 4WEYA 2HFDA 1M7TA 3H79A 1BQ7A 1TI1A 5L71A 1YF1A 3UJ1A 1ZGNA 4NV2A 2LJRA 3KCMA 2VAFA 2MMAA 4D73A 3TOTA 3GKXA 3W8SA 3J7Yk 1SJZA 5DALB 4MF7A 3A3TA 3HXSA 3KD0A 1DSBA 4G0LA 1THXA 1TU7A 2GS3A 3K8NA 2V6KA 4PNFA 5JCGA 3TKRA 4KDUA 3QR6A 3TOUA 4O5RA 3DVXA 3KTLA 2B5EA 4V2LA 1ERVA 4O32A 2B7KA 4TXOB 4WKWA 5DJMA 1A8YA 1WP0A 3D4MA 2IWTA 3FR3A 1CQGA 1F37A 2E2GA 3D4TA 4FIWA 2LJAA 2DBCA 3DRNA 3GH9A 3VPQA 1YEPA 4BVYB 4RI7A 2FWFA 4K0NA 1B9XC 3WD6A 4L5LA 4MMMA 5IPGA 2GT6A 1U3IA 3HJPA 4TR1A 4FYUA 5IO0A 5DJLA 4USSA 1HQOA 2RLIA 1GSYA 5HR0A 2DMLA 2YWMA 4K0GA 2PPTA 1TRWA 1X5EA 2WFCA 1JZRA 3DWVA 5G31A 2GGTA 2WJUA 3ZFBA 4GLTA 3EINA 3GURA 3LORA 1EEMA 2JU5A 4AF2A 3F3QA 4JE1A 3FHKA 1AUCA 2JZTA 1JHBA 1E6BA 3P7XA 4JZQA 1ON4A 1SYXA 2CZ3A 16GSA 3LWAA 4HEA2 3TRQA 3F4RA 1EOGA 3M9JA 4WR5A 5EPFA 2RIIA 2OBIA 5IIZA 3GNJA 3PINA 2VL2C 2A2SA 2VLVA 4F2IA 1SKRB 4K7NA 2H0HA 3M3MA 1OC9B 2F3MA 7GSSA 5D9TA 2R3XA 2R4VA 1DE1A 2DJ0A 1URMA 2GZYA 3BD2A 3APQA 2X99A 5DVBA 3EYTA 2PU9C 4F82A 4KA0A 1FB0A 3KM6A 4IQ1A 1XOBA 5IMZA 2DJ3A 1I5GA 1Z9HA 1B48A 3TDGA 1NHYA 4YQUA 1MD3A 3VLNA 4WF5A 2HT9A 2OE1A 2IMDA 5KN1A 3GV1A 2IFQB 2GQMA 4JR4A 5D96A 6GSTA 5IO2A 3ISOA 2HSYA 4FYCA 5ECNB 4PUAA 5B8BA 2N5AA 1UC7A 1TK8B 4F0BA 4GCIA 4O92A 4QL9A 4TOPA 3V1WA 2CZ2A 2GZPA 3GL5A 2VM1A 3RDWA 6GSVA 2GDRA 1SK0A 4ECBA 2GSQA 4RUVA 3P90A 3FRCA 2AB6A 1R5PA 2JADA 2OA7A 3I43A 5G1LA 3TKSE 2H8LA 1W4VA 4MCUA 1ZYEA 5HFKA 4O7HA 2H6YA 1EOHA 2K9FA 1HNAA 3D21A 4GQCA 4I2TA 1TRSA 2K8SA 4XCSA 4K7OA 1GNWA 2H71A 1OE7A 5HR2A 2M80A 1MDJA 4MPFA 2H74A 1B8XA 1NM3A 4IJIA 3N9JA 3UIWA 2A4VA 1WWJA 2P5RA 4MH3A 1EWXA 5H5RA 4FH8A 1XPVA 3ZFLA 2H66A 2YNXA 2B5YA 2V6OA 1GTBA 2H75A 1DBYA 6GSUA 2GT5A 4EUYA 4ILFA 3HJMA 4L0UA 1U3AA 4EVMA 3KJYA 2C80A 2P5QA 4I8BA 2HQTA 2TIRA 5KN2A 4NMUA 4V2MA 2C3QA 1J9BA 5E4WA 3VURA 2G2QA 1Z7PA 3ERWA 3RPNA 5JWRB 4ULXA 1MD4A 3CBUA 1JZOA 3C1SA 3FZ4A 1PKWA 2HRKB 4BVXB 2PVOC 3EU3A 2NTOA 4MH2A 1K0NA 3G7YA 3ME7A 1K0AA 4HZ2A 4XS1A 4ISDA 2I9HA 4KH7A 1WMJA 1SD9A 4AGSA 1KEBA 2KUCA 4NPBA 5F8BA 4KAEA 4WXTA 2GVPA 4KSMA 1OAZA 2Z9SA 3ZRDA 2L6DA 2DMMA 3TJKA 1K0CA 2M72A 1VGLA 1BG5A 4K7IA 3DGQA 1GTAA 1ZOFA 4LA1A 5GSSA 3GKNA 1OE8A 4ZBBA 1XBSA 2LJKA 1T00A 1XW5A 1TRVA 1TW9A 5HFIA 4NV5A 3ERFA 4G19A 1ERUA 4MABA 2YZUA 4N10A 2H70A 3UVTA 5J41A 1N2AA 1E2YA 3IK7A 2IMFA 3KZQA 3L9VA 5ABRA 4IS0A 3FW2A 3HHVA 3F3RA 5CAXA 3GSSA 2EIRA 1DUGA 1PRXA 2VD0A 3ERGA 3IXRA 1MTCA 3KMNA 1EGRA 2DJ2A 1OYJA 2FD3A 5CREA 2N5FA 3IA1A 2VCTA 3FEUA 2H76A 3VI5A 2MMNA 3TJBA 2AJQB 1YQ1A 2IPAA 2LNSA 3CXGA 2B3SA 4K6XA 2B5XA 4LL4B 3LQ7A 3TB2A 4G10A 4MF6A 4JBBA 3RAZA 5HFGA 1PSQA 3D6IA 1XCCA 2C8UA 3BJ5A 2FWGA 2YZHA 1DE2A 4XHMA 1EEJA 1R26A 1QMVA 2MYGA 5IMFA 4IQAA 1WRYA 2P31A 2CVKA 1G7OA 2QC7A 1UA5A 1A24A 3F0IA 4PGTA 3APOA 2HSNB 3F4TA 4MZCA 4OCEA 4PQ1A 3KH7A 1FHEA 4KGIA 4HQSA 4QL7A 2LUSA 4TR3A 2F51A 2DIZA 4ECIA 3GKMA 4TRXA 4K9ZA 1FB6A 1XVWA 4EF0A 3EWLA 3C73A 5F0GA 4HQZA 2HRKA 4BVXA 1OKTA 2ZCTA 4OMVA 5BMUA 1T1VA 4EKZA 4WETA 2AHEA 4MP4A 4XS6A 5ELAA 1FVJA 4MLYA 1HNCA 1Z6MA 2ON5A 4HUAA 5JWQB 3C7MA 4MJAA 4NHZA 1GUMA 3IRAA 3E9JB 3IPZA 5ECSA 4ID0A 1Q4JA 6GSSA 3GKKA 3VK9A 2C0EA 2X8HA 3U6VA 2GLRA 3ZITA 1XW6A 1EGOA 5J4UA 3IDVA 1FOVA 1OVNA 5G5EA 3WGEA 2VL3A 4HZ4A 4OCFA 1WJKA 4Q5NA 3H4KA 14GSA 3FR6A 4BA7A 2HSMB 2ES7A 1ST9A 4WBJA 3WT1A 3KMOA 5IOWA 2DIYA 2L4CA 5GAND 1A23A 2JSYA 3O6TA 3QAWA 1UVZA 1AW9A 3ME8A 1AIUA 4KDXA 5ID2A 2VLUA 1ZYQB 2XPEA 1TTZA 4MDCA 3CSHA 2DC5A 4Q5QA 2O87A 4DEJA 3FZ9A 2FUG2 1TU8A 1GTUA 2IMIA 4BL7A 3KH9A 3GTUB 1XXUA 1I9DA 5A4VA 3FY7A 3TRPA 2O8VB 2C1YA 3S9FA 4EDZA 1N8JA 3O76A 1J08A 2VD1A 4HS1A 4MZBA 2KOKA 1R5AA 3TCOA 2YJHA 4PX1A 1GUKA 4Q5FA 2ON7A 4YAVA 1K3LA 2CA8A 2IIYA 4EDYA 5KN0A 2H0IA 1SD8A 2DJKA 5AGYA 3O3TA 3WGDA 2CVBA 2FWHA 2L6CA 5ECOB 1JZDA 1WOUA 1F6MC 5IMDA 4NAXA 3QOUA 2NVLA 5DAKB 3VWXA 4L8EA 1YF0A 3M0FA 1ERTA 1V58A 3C8EA 4ZL9A 1EZKA 3F6FA 9GSSA 5B6MA 4EXJA 3R3EA 5G1KA 5G2ZA 1RW1A 3HY2A 2XBQA 5H5SA 2H30A 3MSZA 1SL2B 2BTOT 1G6WA 4N0VA 1A0RP 2IN3A 5ECLB 1VF4A 2XPDA 1VRSD 3EE2A 1Z7RA 2HZEB 2ZUPA 4JRRA 3GX8A 3RHCA 2VCWA 3JCML 3BBYA 2WCIA 1QGVA 1XWAA 1JLWA 4KB3A 4HI7A 2LKUA 1BEDA 2V32A 2B1KA 2IJYA 2RM5A 4WR4A 2BJXA 2O89A 2MMZA 2H73A 1ZZYA 5CNWA 4ML6A 3CRTA 1T8EB 1T7PB 2LQQA 4GWRA 4OO5A 3HZ8A 5AISA 2VIMA 2F9SA 2VL2A 3LXTA 4NHWA 3UARA 1EV9A 5LNKe 3TKSC 1TJDA 3Q19A 3IBHA 3LG6A 5INYA 2R37A 1PL2A 1SU9A 4X0XA 4KCEA 5DALA 3L9UA 2HYXA 2LS5A 1M2DA 5JCWA 1O81A 4IW9A 4F9ZA 3GHAA 4F0CA 3LYPA 1OC3A 3WGXA 1NSWA 1R4WA 4ZB6A 4GF0A 3DMLA 2YWIA 4OO4A 1YJ6A 1OC8A 4H86A 3Q18A 5FWGA 4KNDA 2VLTA 1IYHA 4YQMA 4MPGA 3ED3A 2RUEA 1Z3EA 3EMPA 1V57A 4CW9A 2M46A 4ZB9A 3FYGA 4IKHA 5KN3A 4TXOA 4MJEA 3ZTLA 1S3CA 2WB9A 3I9V2 4N30A 1XOAA 3IK9A 4J57E 5DCGA 1GUHA 3IR4A 3GUSA 5EY6A 4HOJA 1YZXA 4GSTA 1VF3A 2F8FA 2H1DA 3W8JA 4ECCA 1RK4A 4BVYA 3U5RE 2LQOA 3IOSA 2TRXA 1ZL9A 4HU9A 2VCQA 2WZ9A 3UAPA 3GMFA 2ZNMA 4ML1A 1J0FA 13GSA 1ZMAA 3ZMKA 2FLSA 1V9WA 2HNLA 1C72A 2H1AA 2R2JA 1F3AA 5ECRB 1O73A 3Q6OA 2CAQA 5DAKA 2FWEA 2R6KA 1M9AA 5IMCA 3VI7A 4FO5A 2LTKA 4L0WA 1PN9A 3L4NA 4ZL8A 2PMTA 1PQNA 5CRWA 3RBTA 3FZ5A 3GIXA 1GSQA 4ZB8A 3HYPA 4KUNA 3EMXA 1K3OA 3IHQA 1GULA 2GZZA 5IQYA 2REMA 1VF2A 4JEDA 3VWVA 4DSRA 5ELGA 4E8EA 2OE3A 2GQKA 1U6TA 2MZCA 1G6YA 4I97A 5EVOA 2CVDA 3W6GA 2WRTA 3LEFA 2HZEA 4NXIA 3QPMA 2VM2A 3VPTA 3PGTA 3HVVA 3NOFA 2PBJA 1SKSB 3TKQA 2L5OA 4MK3A 3UVHA 2K8VA 3E0UA 1SKWB 2WULA 2JSZA 1OC9A 4YAPA 1V98A 3HCZA 3QCPA 1T4ZA 3HVXA 3DKSA 1YEXA 2FY6A 4BPYA 5ECQB 5ECMB 1SJIA 1QXHA 1M9BA 4PUFC 1JZWA 2YV7A 5FT3A 1GLPA 2GTUA 5GAPD 1F9MA 2LEGA 3EU4A 3ZVJA 3I6AA 5ENUA 3P8WA 5A4UA 3LGCA 1TP9A 5CO3A 4G9HA 5A5KA 1AC1A 4TW5A 10GSA 2IFQA 2O7KA 2EIOA 1PX6A 5CRHA 3HKRA 4JU5A 3UMAA 2J9HA 3EC3A 1AQXA 1O6JA 2LRCA 5IMVA 2CT6A 5G30A 2IMKA 4ZBAA 1OKDA 5GSTA 1YDKA 2FA8A 2K6VA 4DSQA 5LCZA 2YPMA 4RQRA 5H5QA 5LD0A 4MZWA 1TRUA 4D73B 3QMXA 19GSA 4E8HA 3LYKA 1KTEA 4OD7A 1K0BA 1PD21 1AQVA 2FGXA 2CX3A 1PGTA 1X0RA 3DXBA 3UL3A 4TKYA 5JCUA 1G7EA 1R7HA 2KP2A 5EL8A 3IAM2 2B1LA 2F8AA 4XS4B 4KDYA 3PPUA 4ACSA 1IYIA 2LRTA 2OADA 3EVIA 2C0GA 1Y6EA 1RQMA 3GX0A 2V2GA 4P3YB 3GRXA 3QFAC 2IL3A 1NW2A 1T3BA 3FZAA 2VCXA 4FQUA 4TVEA 3PH9A 4ZBDA 2QKEA 2H1GA 4K8MA 4IHUA 2KP1A 1U87A 2YWOA 1Y25A 3ZIVA 1USBA 3PR8A 3EURA 1UN2A 1ERWA 4TR1B 1X9SB 4N0ZA 1X9WB 3UEMA 3TJFA 1U88A 5ECKB 4PNGA 4IGJA 2OKAA 3DIEA 4RI6A 4PURA 3CYNA 2L59A 4DVCA 2GQLA 1SENA 4TN8A 3MWHA 1QFNA 2H01A 3SWLA 1GRXA 2H6ZA 1PMTA 3VWUA 2MBSA 3CTGA 4POMA 3RPPA 5IPHA 3ZL5A 3CSJA 2IMEA 3A2WA 3GFKA 2VUPA 3Q74A 3UBKA 3L78A
chains in the Genus database with same CATH superfamily
3CSIA 4OWYA 1A0FA 3AY8A 2D2ZA 2WS2A 2HSHA 1FO5A 5D8IA 4X1UA 1EV4A 4ZILA 1X5DA 2B7JA 1LJRA 1Z6NA 2OBKA 2VCZA 3A2VA 4N11A 1G0TA 3F9UA 2N5BA 1GSDA 2HE3A 3DD3A 6GSYA 1PA3A 2R0PA 1O7UA 4WBRD 3CWGA 4GSSA 5JWOB 3KIJA 2AUVA 3HA9A 5D9VA 4ZXGA 2JACA 1HD2A 4XIHA 4HJMA 2YJ7A 2R0CA 4GSNA 1PFOA 1S3DA 2X8GA 5BRTA 1M99A 1YY7A 1N25A 5AIXA 3F8UA 2WW3A 5F06A 3HDCA 4K2DA 4G0KA 1WPIA 1SL0B 5D73A 20GSA 2V41A 5DBQA 4POKA 3E3EA 3D22A 1XWKA 2O85A 4F03A 2I3YA 1Z5YE 2QGVA 2DLXA 1V40A 2X49A 3IHGA 4V2NA 2ALBA 1BAYA 3J7Yb 4IELA 2YP6A 3LXZA 4PTSA 5C00A 1K0OA 4TR4A 4AJ6A 5J40A 2XC2A 4EL1A 4IJ3A 2OJLA 1M3JA 1FAAA 3HD5A 4XS4A 4PQIA 2E7PA 1S4BP 4OFTA 2OT3A 1TOFA 3IC4A 2KLXA 1YKCA 3GSTA 3F63A 1T4YA 2J23A 4LMWA 4G2EA 1ACVA 4HSCX 2X8CA 4KW6A 3HZ4A 2MMOA 3ZZXA 2HI7A 3NIVA 1MDKA 18GSA 4KE3A 4POBA 5FHIA 3M1GA 3KP9A 3G9BA 4MJCA 2WVXA 1F3BA 3LFLA 3FR9A 2E2MA 3QDNA 4XRDA 4HJ2A 2DSAA 2XBIA 3GA4A 4NWYA 2H1BA 2KHPA 22GSA 1TKDB 11GSA 4KSOA 5E59A 2PN8A 3CMIA 1O85A 5J4VA 3KTBA 2JL4A 4KF9A 1TDIA 5F05A 5A5HA 4I2UA 1GSUA 3IAS2 1PX7A 1KBNA 4RQXA 2G0FA 1XVQA 1XW9A 1ML6A 1B4PA 3A5WA 3M9KA 3FK8A 3IE3A 2PWJA 3VWWA 1THOA 5CRDA 5HR1A 3HVSA 1SL1B 1SJ6A 3OR5A 5B6NA 2DJ1A 2JZSA 2P0GA 3LW9A 5KOXA 5CP1A 5DQSA 2PVQA 2JZRA 1FG4A 4L5OA 1GSSA 2RUFA 3DVWA 4GQFA 1BYEA 4J2FA 5D9XA 3ZVJD 3BOAA 4LMVA 4BWQA 3UBLA 1WE0A 2H0GA 3GYKA 2H19A 5GZZB 3IC8A 4Q5RA 2HSMA 1AXDA 1VF1A 2B6MA 2CX4A 1GWCA 1A8LA 3QD9A 4EC0A 4LL1B 2YWNA 1PL1A 4OFMA 4KX4A 1O8XA 2HLSA 2NDOA 1SYRA 2YN1A 4GRFA 3TKSA 1PKZA 4CDOA 4WF4A 4JR6A 2WDUA 1AQWA 1K0DA 4IBPA 4ECJA 3GTUA 2O5VA 4GXZA 2FA4A 4A5PA 1PN0A 3UOMA 5DCHA 2VL9A 1KNGA 1SK1A 1GLQA 5DDLA 2QSIA 5IMAA 1BG1A 2EC4A 1YVLA 2L57A 3TUEA 3CTFA 2LNTA 4FYBA 5AIVA 2AV4A 2GSSA 1S3AA 2MBTA 3QAGA 4V1Ag 3GH6A 1M0UA 4MA9A 8GSSA 2PGTA 3R2QA 3KGKA 5AN1A 1EP7A 2C0FA 1GP1A 2AAWA 2OE0A 4PHZC 5J9BA 4PQHA 5B7CA 5HQPA 2C0DA 2XHFA 12GSA 2A2RA 3TKPA 3MNGA 3F4SA 3ZMLA 1V2AA 5KEJA 3KEBA 3N5OA 2L4QA 1XWGA 4O5QA 4MJBA 5IOXA 1XWBA 2C3TA 4G0IA 1W89A 3APSA 1FW1A 2WGRA 6GSXA 2YOIA 3IV4A 4HU7A 3WT2A 3KXOA 2HRAA 3G7IA 3M8NA 3GN3A 1GH2A 2CAIA 2I4AA 2DJJA 1TXUA 3H1NA 3HJOA 2YV9A 3DEXA 1FVKA 4ZB7A 4X4JA 2VOCA 5J4YA 2FHEA 3WYWA 4DSSB 3QFBC 3GL3A 4ZL7A 2UZ8A 2X64A 1TK0B 6GSWA 4PXOA 1A2MA 1ZCPA 4IP6A 4EE0A 3SBCA 4ZIJA 1ILOA 3DYRA 5DQYA 5J9CA 3H93A 1ABAA 4TR0A 1TI3A 5B8AA 3TGZA 17GSA 2HXKA 4MF5A 1GSEA 5J5NA 1GTIA 1H75A 3ZYWA 2FCHA 1QQ2A 2GSRA 1X9MB 5COHA 3MDKA 3BCIA 1B9YC 3F6DA 1QK8A 3LSZA 2GSTA 3ZLPA 4J56E 1GNEA 4QQ7A 3TU3B 4X43A 3P2AA 1TXXA 1YKAA 4AKXB 5G5FA 2TRCP 3VFIA 5J3RA 4YH2A 2LSTA 5ID2B 5ECHB 4XTSA 1BJXA 3I69A 2YANA 2BMXA 1WIKA 5HR3A 3CHXC 2I1UA 2OACA 4AI6A 4AJ8A 3MYDA 4IP1A 5CRGA 1ZYPA 3US3A 4BL7B 4Z7XA 4YQVA 4OFNA 1BX9A 2NBSA 4HDEA 2L5LA 2VO4A 3LJRA 3MAKA 5ECPB 2FNOA 2C4JA 2EIQA 1GSFA 2NPBA 1F2EA 2V1MA 1XWCA 3H8QA 4N3ZA 4POLA 1SVOA 2LRNA 1A2JA 1HYUA 1EP8A 2RM6A 2PERA 4K5RA 1X5CA 5F07A 1Q98A 3D5JA 2VCVA 1O8WA 2A2PA 4AKIA 1M2AA 4BWSA 4IN0A 4AJ7A 1MEKA 3KP8A 3L0HA 4TXVA 1QUWA 3A2XA 1M2BA 3ZIJA 4IVFA 1YEWC 1K0MA 1JFUA 4I5QA 1SK2A 2O3EA 1XIYA 2PUKC 5IM9A 4FXYP 3L9SA 2LV3A 3FKFA 4V1Ap 4KCAA 1TK5B 1H4OA 3RHBA 1A2LA 5ECIB 2CQ9A 1HNBA 2HZFA 3NZNA 1LU4A 1GL8A 5C04A 4I6XA 1XFLA 1MDIA 3ZREA 2H72A 2I81A 4CHSA 3C1RA 5A34B 3G7JA 1NHOA 3QAVA 4GTUA 5CYYA 1CQHA 3D0ZA 1JLVA 2CV4A 5D9WA 4K1FA 4DSSA 2YCDA 3TJJA 3TJGA 1LBKA 2HRFA 2H6XA 2R5GA 3BCKA 1K3YA 4PI0C 2E0QA 4XRAA 3CRUA 5D93A 2AYTA 3TRXA 3C71A 2C3NA 5A4WA 1AAZA 4EO3A 2HRNA 4LLRA 4K2XA 1B4QA 1XZOA 2K18A 4WEYA 2HFDA 1M7TA 3H79A 1BQ7A 1TI1A 5L71A 1YF1A 3UJ1A 1ZGNA 4NV2A 2LJRA 1SVLA 3KCMA 2VAFA 2MMAA 4D73A 3TOTA 3GKXA 3W8SA 3J7Yk 1SJZA 5DALB 4MF7A 3A3TA 3HXSA 3KD0A 1DSBA 4G0LA 1THXA 1TU7A 2GS3A 3K8NA 2V6KA 4PNFA 5JCGA 3TKRA 4KDUA 3QR6A 3TOUA 4O5RA 3DVXA 3KTLA 2B5EA 4V2LA 1ERVA 4O32A 2B7KA 4TXOB 2EFHA 4WKWA 5DJMA 1A8YA 1WP0A 3D4MA 2IWTA 3FR3A 1CQGA 1F37A 2E2GA 3D4TA 4FIWA 2LJAA 2DBCA 3DRNA 2H1LA 3GH9A 4CY6A 3VPQA 1YEPA 4BVYB 4RI7A 2FWFA 4K0NA 1B9XC 3WD6A 4L5LA 4MMMA 5IPGA 2GT6A 1U3IA 3HJPA 4TR1A 4FYUA 5IO0A 5DJLA 4USSA 1HQOA 2RLIA 1GSYA 5HR0A 2DMLA 2YWMA 4K0GA 2PPTA 1TRWA 1X5EA 2WFCA 1JZRA 3DWVA 5G31A 2GGTA 4Z2RA 2WJUA 3ZFBA 4GLTA 3EINA 3GURA 3LORA 2WW1A 1EEMA 2JU5A 4AF2A 3F3QA 4JE1A 2O36A 3FHKA 1AUCA 2JZTA 1JHBA 1E6BA 3P7XA 4JZQA 1ON4A 2WW0A 4MNNA 1SYXA 2CZ3A 16GSA 3LWAA 4HEA2 2X4AA 5A34A 3TRQA 3F4RA 1EOGA 3M9JA 4WR5A 5EPFA 2RIIA 2OBIA 5IIZA 3GNJA 3PINA 2VL2C 2A2SA 2VLVA 4F2IA 1SKRB 4K7NA 2H0HA 3M3MA 1OC9B 2F3MA 7GSSA 5D9TA 2R3XA 2R4VA 1DE1A 2DJ0A 1URMA 2GZYA 3BD2A 3APQA 2X99A 5DVBA 3EYTA 2PU9C 4F82A 4KA0A 1FB0A 3KM6A 4IQ1A 1XOBA 5IMZA 4YKGA 2DJ3A 1I5GA 1Z9HA 1B48A 3TDGA 1NHYA 4YQUA 1MD3A 3VLNA 3A5IA 4WF5A 2HT9A 2OE1A 2IMDA 5KN1A 3GV1A 2IFQB 2QA1A 2GQMA 4JR4A 5D96A 6GSTA 5IO2A 3ISOA 2HSYA 4FYCA 5ECNB 4PUAA 5B8BA 2N5AA 1UC7A 1TK8B 2WW2A 4F0BA 4GCIA 4O92A 4QL9A 4TOPA 3V1WA 2CZ2A 2GZPA 3GL5A 2VM1A 3RDWA 6GSVA 2GDRA 1SK0A 4ECBA 2GSQA 4RUVA 3P90A 3FRCA 2AB6A 1R5PA 2JADA 3FMWA 2OA7A 3I43A 5G1LA 3TKSE 2H8LA 1W4VA 4MCUA 1ZYEA 5HFKA 4O7HA 2H6YA 1EOHA 3RFRC 2K9FA 1HNAA 3D21A 4GQCA 4I2TA 1TRSA 2K8SA 4XCSA 4K7OA 1GNWA 2H71A 1OE7A 5HR2A 4Z2TA 2M80A 1MDJA 4MPFA 2H74A 1B8XA 2UV8G 1NM3A 4IJIA 3N9JA 3UIWA 2A4VA 1WWJA 2P5RA 4MH3A 4PI2C 1EWXA 5H5RA 4FH8A 1XPVA 3ZFLA 2H66A 2YNXA 2B5YA 2V6OA 1GTBA 4EIQA 2H75A 1DBYA 6GSUA 2GT5A 4EUYA 4ILFA 3HJMA 4L0UA 1U3AA 4EVMA 3KJYA 2C80A 2P5QA 4I8BA 2HQTA 2TIRA 5KN2A 4NMUA 4V2MA 2C3QA 1J9BA 5E4WA 4QMKA 3VURA 2G2QA 3HMJG 1Z7PA 3ERWA 3RPNA 5JWRB 4ULXA 1MD4A 3CBUA 1JZOA 3C1SA 3FZ4A 1PKWA 2HRKB 4BVXB 2PVOC 3EU3A 2NTOA 4MH2A 1K0NA 5BMUB 3G7YA 1K0AA 3ME7A 4HZ2A 4XS1A 4ISDA 2I9HA 4KH7A 1WMJA 1SD9A 4AGSA 1KEBA 2KUCA 4NPBA 5F8BA 4KAEA 4WXTA 2GVPA 4KSMA 1OAZA 2Z9SA 3ZRDA 2L6DA 2DMMA 3TJKA 1K0CA 2M72A 1VGLA 1BG5A 4K7IA 3DGQA 1GTAA 2WVZA 1ZOFA 4LA1A 5GSSA 3GKNA 1OE8A 4ZBBA 1XBSA 2LJKA 1T00A 1XW5A 1TRVA 1TW9A 5HFIA 4NV5A 3ERFA 4G19A 1ERUA 4MABA 2YZUA 4N10A 2H70A 2VKZG 3UVTA 5J41A 1N2AA 1E2YA 3IK7A 4AKHA 2IMFA 3KZQA 3L9VA 5ABRA 4IS0A 3FW2A 3HHVA 3F3RA 3MIXA 5CAXA 3GSSA 2EIRA 1DUGA 1PRXA 2VD0A 3ERGA 3IXRA 1MTCA 3KMNA 1EGRA 2DJ2A 1OYJA 2FD3A 5CREA 2N5FA 3IA1A 2VCTA 3FEUA 2H76A 3VI5A 2MMNA 3TJBA 2AJQB 1YQ1A 2IPAA 2LNSA 3CXGA 4EIPA 2B3SA 4K6XA 2B5XA 4LL4B 3LQ7A 3TB2A 4G10A 4MF6A 4JBBA 3RAZA 5HFGA 1PSQA 3D6IA 1XCCA 2C8UA 3BJ5A 2FWGA 2YZHA 1DE2A 4XHMA 1EEJA 1R26A 1QMVA 2MYGA 5IMFA 4IQAA 1S3RA 1WRYA 2P31A 2CVKA 1G7OA 2QC7A 1UA5A 1A24A 3F0IA 4PGTA 1ZYNA 3APOA 2HSNB 3F4TA 4MZCA 4OCEA 4PQ1A 3KH7A 1FHEA 4KGIA 4HQSA 4QL7A 2LUSA 4TR3A 2F51A 4E68A 2DIZA 4CY8A 4ECIA 3GKMA 4TRXA 4K9ZA 1FB6A 1XVWA 4EF0A 3EWLA 3EPTA 3C73A 5F0GA 4HQZA 2HRKA 4BVXA 1OKTA 2ZCTA 4OMVA 5BMUA 1T1VA 4EKZA 4WETA 2AHEA 4MP4A 4XS6A 5ELAA 1FVJA 4MLYA 1HNCA 1Z6MA 2ON5A 4HUAA 1Y1UA 5JWQB 3C7MA 4MJAA 4NHZA 1GUMA 3IRAA 4YKFA 3E9JB 3IPZA 5ECSA 4ID0A 1Q4JA 6GSSA 3GKKA 3VK9A 2C0EA 2X8HA 3U6VA 2GLRA 3HVNA 3ZITA 1XW6A 1EGOA 5J4UA 3IDVA 1FOVA 1OVNA 5G5EA 3WGEA 2VL3A 2WZSA 4HZ4A 4OCFA 1WJKA 4Q5NA 3H4KA 14GSA 3FR6A 4BA7A 2HSMB 2ES7A 1ST9A 4WBJA 3WT1A 3KMOA 5IOWA 2DIYA 2L4CA 5GAND 1A23A 2JSYA 3O6TA 3QAWA 1UVZA 2EFCA 1AW9A 3ME8A 1AIUA 4KDXA 5ID2A 2VLUA 1ZYQB 2XPEA 1TTZA 4MDCA 3CSHA 2DC5A 4Q5QA 2O87A 4DEJA 3FZ9A 2FUG2 1TU8A 1GTUA 2IMIA 4BL7A 3KH9A 3GTUB 1XXUA 1I9DA 5A4VA 3FY7A 1XG8A 3TRPA 2O8VB 2C1YA 4ICYA 3S9FA 4EDZA 1N8JA 3O76A 1J08A 2VD1A 4HS1A 4MZBA 2KOKA 1R5AA 3TCOA 2YJHA 4PX1A 1GUKA 4Q5FA 2ON7A 4YAVA 5A1NB 1K3LA 2CA8A 2IIYA 4EDYA 5KN0A 2H0IA 1SD8A 2DJKA 5AGYA 3O3TA 3WGDA 2CVBA 2FWHA 2L6CA 5ECOB 1JZDA 1WOUA 1F6MC 5IMDA 4NAXA 3QOUA 2NVLA 5DAKB 3VWXA 4L8EA 1YF0A 3M0FA 1ERTA 1V58A 3C8EA 4ZL9A 1EZKA 3F6FA 9GSSA 5B6MA 4EXJA 3R3EA 5G1KA 5G2ZA 2HSNA 1RW1A 3HY2A 2XBQA 5H5SA 2H30A 3MSZA 1SL2B 2BTOT 1G6WA 4N0VA 1A0RP 2IN3A 5ECLB 1VF4A 2XPDA 1VRSD 3EE2A 1M3IA 1Z7RA 2HZEB 2ZUPA 4JRRA 3GX8A 3RHCA 2VCWA 3JCML 3BBYA 2WCIA 1QGVA 1XWAA 1JLWA 4KB3A 4HI7A 2LKUA 1BEDA 2V32A 2B1KA 2IJYA 2RM5A 4WR4A 2BJXA 2O89A 2MMZA 2H73A 1ZZYA 5CNWA 4ML6A 3CRTA 1T8EB 1T7PB 2LQQA 4GWRA 4OO5A 3HZ8A 5AISA 2VIMA 2F9SA 2VL2A 3LXTA 2A4HA 4NHWA 3UARA 1EV9A 2EFEA 5LNKe 3TKSC 1TJDA 3Q19A 3IBHA 3LG6A 5INYA 2R37A 1PL2A 1SU9A 4X0XA 4KCEA 5DALA 3L9UA 2HYXA 2LS5A 1M2DA 5JCWA 1O81A 4IW9A 4F9ZA 3GHAA 2DKIA 4F0CA 3LYPA 1OC3A 3WGXA 1NSWA 1R4WA 5KOWA 4ZB6A 4GDFA 4GF0A 3DMLA 2YWIA 4OO4A 1YJ6A 1OC8A 4H86A 3Q18A 5FWGA 4KNDA 2VLTA 1IYHA 4YQMA 4MPGA 3ED3A 2RUEA 1Z3EA 3EMPA 1V57A 4CW9A 2M46A 4ZB9A 3FYGA 4IKHA 5KN3A 4TXOA 4MJEA 3ZTLA 1S3CA 4BIKA 2WB9A 3I9V2 4N30A 1XOAA 3IK9A 4J57E 5DCGA 1GUHA 3IR4A 3GUSA 5EY6A 4HOJA 1YZXA 4GSTA 1VF3A 2F8FA 2H1DA 3W8JA 4ECCA 1RK4A 5A1NA 4BVYA 3U5RE 2LQOA 3IOSA 4AKGA 2TRXA 1ZL9A 2VCQA 4HU9A 2WZ9A 3UAPA 3GMFA 2QA2A 2ZNMA 4ML1A 1J0FA 13GSA 1ZMAA 2R0GA 3ZMKA 2FLSA 1V9WA 2HNLA 1C72A 2H1AA 2R2JA 1F3AA 5ECRB 1O73A 3Q6OA 2CAQA 5DAKA 2FWEA 2R6KA 1FOHA 1M9AA 5IMCA 3VI7A 2LTKA 4FO5A 4L0WA 1PN9A 3L4NA 4ZL8A 2PMTA 1PQNA 5CRWA 3RBTA 3FZ5A 3GIXA 1GSQA 4ZB8A 3HYPA 4KUNA 3EMXA 1K3OA 3IHQA 1GULA 2GZZA 5IQYA 2REMA 1VF2A 4JEDA 3VWVA 4DSRA 5ELGA 4E8EA 2OE3A 2GQKA 1U6TA 2MZCA 1G6YA 4I97A 5EVOA 2CVDA 3W6GA 2WRTA 3LEFA 2HZEA 4NXIA 3QPMA 2VM2A 3VPTA 1BF5A 3PGTA 3HVVA 3NOFA 2PBJA 1SKSB 3TKQA 2L5OA 4MK3A 3UVHA 2K8VA 3E0UA 2WVYA 2WULA 1SKWB 2JSZA 1OC9A 4YAPA 1V98A 3HCZA 3QCPA 1T4ZA 3HVXA 3DKSA 3RGBC 1YEXA 2FY6A 4BPYA 5ECQB 5ECMB 1SJIA 1QXHA 1M9BA 4PUFC 1JZWA 2YV7A 5FT3A 1GLPA 2GTUA 5GAPD 1I1IP 2EFDA 1F9MA 2LEGA 3EU4A 3ZVJA 3I6AA 5ENUA 3P8WA 5A4UA 3LGCA 1TP9A 5CO3A 4G9HA 5A5KA 1AC1A 4TW5A 10GSA 2IFQA 2O7KA 2EIOA 1PX6A 5CRHA 4G01A 3HKRA 2DKHA 4JU5A 3UMAA 2J9HA 3EC3A 2LRCA 1AQXA 1O6JA 5IMVA 2CT6A 5G30A 2IMKA 4ZBAA 1OKDA 5GSTA 1YDKA 2FA8A 2K6VA 4DSQA 5LCZA 2YPMA 4RQRA 5H5QA 5LD0A 4MZWA 1TRUA 4D73B 3QMXA 19GSA 4E8HA 3LYKA 1KTEA 4OD7A 1K0BA 1PD21 1AQVA 2FGXA 2CX3A 1PGTA 1X0RA 3DXBA 3UL3A 4TKYA 5JCUA 1G7EA 1R7HA 2KP2A 5EL8A 3IAM2 2B1LA 2F8AA 4XS4B 4KDYA 3PPUA 4ACSA 1IYIA 2LRTA 2OADA 3EVIA 2C0GA 1Y6EA 1RQMA 3GX0A 2V2GA 4P3YB 3GRXA 3QFAC 2IL3A 1NW2A 1T3BA 3FZAA 2VCXA 4FQUA 4TVEA 3PH9A 4ZBDA 2QKEA 2H1GA 4O5UA 4K8MA 4IHUA 2KP1A 1U87A 2YWOA 3CQFA 2WVXB 1Y25A 3ZIVA 1USBA 3PR8A 3EURA 1UN2A 1ERWA 4TR1B 1X9SB 1SVMA 4N0ZA 1X9WB 4W66A 3UEMA 3TJFA 1U88A 5ECKB 4PNGA 4IGJA 2OKAA 3DIEA 4RI6A 4PURA 5A5HB 3CYNA 2L59A 4DVCA 2GQLA 1SENA 4TN8A 3MWHA 1QFNA 2H01A 3SWLA 1GRXA 2H6ZA 1PMTA 3VWUA 2MBSA 3CTGA 4POMA 3RPPA 5IPHA 3ZL5A 3CSJA 4K5SA 5J47A 2IMEA 3A2WA 3GFKA 2VUPA 3Q74A 3UBKA 4Z2UA 3L78A
chains in the Genus database with same CATH topology
3CSIA 4OWYA 1A0FA 3AY8A 2D2ZA 2WS2A 2HSHA 1FO5A 5D8IA 4X1UA 1EV4A 4ZILA 1X5DA 2B7JA 1LJRA 1Z6NA 2OBKA 2VCZA 3A2VA 4N11A 1G0TA 3F9UA 2N5BA 1GSDA 2HE3A 3DD3A 6GSYA 1PA3A 2R0PA 1O7UA 4WBRD 3CWGA 4GSSA 5JWOB 3KIJA 2AUVA 3HA9A 5D9VA 4ZXGA 2JACA 1HD2A 4XIHA 4HJMA 2YJ7A 2R0CA 4GSNA 1S3DA 2X8GA 5BRTA 1M99A 1YY7A 1N25A 5AIXA 3F8UA 5F06A 3HDCA 4K2DA 4G0KA 1WPIA 1SL0B 5D73A 20GSA 2V41A 5DBQA 4POKA 3E3EA 3D22A 1XWKA 2O85A 4F03A 2I3YA 1Z5YE 2QGVA 2DLXA 1V40A 2X49A 3IHGA 4V2NA 2ALBA 1BAYA 3J7Yb 4IELA 2YP6A 3LXZA 4PTSA 5C00A 1K0OA 4TR4A 4AJ6A 5J40A 2XC2A 4EL1A 4IJ3A 2OJLA 1FAAA 3HD5A 4XS4A 4PQIA 2E7PA 4OFTA 2OT3A 1TOFA 3IC4A 2KLXA 1YKCA 3GSTA 3F63A 1T4YA 2J23A 4LMWA 4G2EA 1ACVA 2X8CA 4KW6A 3HZ4A 2MMOA 3ZZXA 2HI7A 3NIVA 1MDKA 18GSA 4KE3A 4POBA 5FHIA 3M1GA 3KP9A 3G9BA 4MJCA 1F3BA 3LFLA 3FR9A 2E2MA 3QDNA 4XRDA 4HJ2A 2DSAA 2XBIA 3GA4A 4NWYA 2H1BA 2KHPA 22GSA 1TKDB 11GSA 4KSOA 5E59A 2PN8A 3CMIA 1O85A 3KTBA 5J4VA 2JL4A 4KF9A 1TDIA 5F05A 5A5HA 4I2UA 1GSUA 3IAS2 1PX7A 1KBNA 4RQXA 2G0FA 1XVQA 1XW9A 1ML6A 1B4PA 3A5WA 3M9KA 3FK8A 3IE3A 2PWJA 3VWWA 1THOA 5CRDA 5HR1A 3HVSA 1SL1B 1SJ6A 3OR5A 5B6NA 2DJ1A 2JZSA 2P0GA 3LW9A 5KOXA 5CP1A 5DQSA 2PVQA 2JZRA 1FG4A 4L5OA 1GSSA 2RUFA 3DVWA 4GQFA 1BYEA 4J2FA 5D9XA 3ZVJD 3BOAA 4LMVA 4BWQA 3UBLA 1WE0A 2H0GA 3GYKA 2H19A 5GZZB 3IC8A 4Q5RA 2HSMA 1AXDA 1VF1A 2B6MA 2CX4A 1GWCA 1A8LA 3QD9A 4EC0A 4LL1B 2YWNA 1PL1A 4OFMA 4KX4A 1O8XA 2HLSA 2NDOA 1SYRA 2YN1A 4GRFA 3TKSA 1PKZA 4CDOA 4WF4A 4JR6A 2WDUA 1AQWA 1K0DA 4IBPA 4ECJA 3GTUA 2O5VA 4GXZA 2FA4A 4A5PA 1PN0A 3UOMA 5DCHA 2VL9A 1KNGA 1SK1A 1GLQA 5DDLA 2QSIA 5IMAA 1BG1A 2EC4A 1YVLA 2L57A 3TUEA 3CTFA 2LNTA 4FYBA 5AIVA 2AV4A 2GSSA 1S3AA 2MBTA 3QAGA 4V1Ag 3GH6A 1M0UA 4MA9A 8GSSA 2PGTA 3R2QA 3KGKA 5AN1A 1EP7A 2C0FA 1GP1A 2AAWA 2OE0A 5J9BA 4PQHA 5B7CA 5HQPA 2C0DA 2XHFA 12GSA 2A2RA 3TKPA 3MNGA 3F4SA 3ZMLA 1V2AA 5KEJA 3KEBA 3N5OA 2L4QA 1XWGA 4O5QA 4MJBA 5IOXA 1XWBA 2C3TA 4G0IA 1W89A 3APSA 1FW1A 2WGRA 6GSXA 2YOIA 3IV4A 4HU7A 3WT2A 3KXOA 2HRAA 3G7IA 3M8NA 3GN3A 1GH2A 2CAIA 2I4AA 2DJJA 1TXUA 3H1NA 3HJOA 2YV9A 3DEXA 1FVKA 4ZB7A 4X4JA 2VOCA 5J4YA 2FHEA 3WYWA 4DSSB 3QFBC 3GL3A 4ZL7A 2UZ8A 2X64A 1TK0B 6GSWA 4PXOA 1A2MA 1ZCPA 4IP6A 4EE0A 3SBCA 4ZIJA 1ILOA 3DYRA 5DQYA 5J9CA 3H93A 1ABAA 4TR0A 1TI3A 5B8AA 3TGZA 17GSA 2HXKA 4MF5A 1GSEA 5J5NA 1GTIA 1H75A 3ZYWA 2FCHA 1QQ2A 2GSRA 1X9MB 5COHA 3MDKA 3BCIA 1B9YC 3F6DA 1QK8A 3LSZA 2GSTA 3ZLPA 4J56E 1GNEA 4QQ7A 3TU3B 4X43A 3P2AA 1TXXA 1YKAA 4AKXB 5G5FA 2TRCP 3VFIA 5J3RA 4YH2A 2LSTA 5ID2B 5ECHB 4XTSA 1BJXA 3I69A 2YANA 2BMXA 1WIKA 5HR3A 2I1UA 2OACA 4AI6A 4AJ8A 3MYDA 4IP1A 5CRGA 1ZYPA 3US3A 4BL7B 4Z7XA 4YQVA 4OFNA 1BX9A 2NBSA 4HDEA 2L5LA 2VO4A 3LJRA 3MAKA 5ECPB 2FNOA 2C4JA 2EIQA 1GSFA 2NPBA 1F2EA 2V1MA 1XWCA 3H8QA 4N3ZA 4POLA 1SVOA 2LRNA 1A2JA 1HYUA 1EP8A 2RM6A 2PERA 4K5RA 1X5CA 5F07A 1Q98A 3D5JA 2VCVA 1O8WA 2A2PA 4AKIA 1M2AA 4BWSA 4IN0A 4AJ7A 1MEKA 3KP8A 3L0HA 4TXVA 1QUWA 3A2XA 1M2BA 3ZIJA 4IVFA 1K0MA 1JFUA 4I5QA 1SK2A 1XIYA 2PUKC 5IM9A 3L9SA 2LV3A 3FKFA 4V1Ap 4KCAA 1TK5B 1H4OA 3RHBA 1A2LA 5ECIB 2CQ9A 1HNBA 2HZFA 3NZNA 1LU4A 1GL8A 5C04A 4I6XA 1XFLA 1MDIA 3ZREA 2H72A 2I81A 4CHSA 3C1RA 5A34B 3G7JA 1NHOA 3QAVA 4GTUA 5CYYA 1CQHA 3D0ZA 1JLVA 2CV4A 5D9WA 4K1FA 4DSSA 2YCDA 3TJJA 3TJGA 1LBKA 2HRFA 2H6XA 2R5GA 3BCKA 1K3YA 2E0QA 4XRAA 3CRUA 5D93A 2AYTA 3TRXA 3C71A 2C3NA 5A4WA 1AAZA 4EO3A 2HRNA 4LLRA 4K2XA 1B4QA 1XZOA 2K18A 4WEYA 2HFDA 1M7TA 3H79A 1BQ7A 1TI1A 5L71A 1YF1A 3UJ1A 1ZGNA 4NV2A 2LJRA 1SVLA 3KCMA 2VAFA 2MMAA 4D73A 3TOTA 3GKXA 3W8SA 3J7Yk 1SJZA 5DALB 4MF7A 3A3TA 3HXSA 3KD0A 1DSBA 4G0LA 1THXA 1TU7A 2GS3A 3K8NA 2V6KA 4PNFA 5JCGA 3TKRA 4KDUA 3QR6A 3TOUA 4O5RA 3DVXA 3KTLA 2B5EA 4V2LA 1ERVA 4O32A 2B7KA 4TXOB 2EFHA 4WKWA 5DJMA 1A8YA 1WP0A 3D4MA 2IWTA 3FR3A 1CQGA 1F37A 2E2GA 3D4TA 4FIWA 2LJAA 2DBCA 3DRNA 2H1LA 3GH9A 4CY6A 3VPQA 1YEPA 4BVYB 4RI7A 2FWFA 4K0NA 1B9XC 3WD6A 4L5LA 4MMMA 5IPGA 2GT6A 1U3IA 3HJPA 4TR1A 4FYUA 5IO0A 5DJLA 4USSA 1HQOA 2RLIA 1GSYA 5HR0A 2DMLA 2YWMA 4K0GA 2PPTA 1TRWA 1X5EA 2WFCA 1JZRA 3DWVA 5G31A 2GGTA 4Z2RA 2WJUA 3ZFBA 4GLTA 3EINA 3GURA 3LORA 1EEMA 2JU5A 4AF2A 3F3QA 4JE1A 3FHKA 1AUCA 2JZTA 1JHBA 1E6BA 3P7XA 4JZQA 1ON4A 4MNNA 1SYXA 2CZ3A 16GSA 3LWAA 4HEA2 2X4AA 5A34A 3TRQA 3F4RA 1EOGA 3M9JA 4WR5A 5EPFA 2RIIA 2OBIA 5IIZA 3GNJA 3PINA 2VL2C 2A2SA 2VLVA 4F2IA 1SKRB 4K7NA 2H0HA 3M3MA 1OC9B 2F3MA 7GSSA 5D9TA 2R3XA 2R4VA 1DE1A 2DJ0A 1URMA 2GZYA 3BD2A 3APQA 2X99A 5DVBA 3EYTA 2PU9C 4F82A 4KA0A 1FB0A 3KM6A 4IQ1A 1XOBA 5IMZA 4YKGA 2DJ3A 1I5GA 1Z9HA 1B48A 3TDGA 1NHYA 4YQUA 1MD3A 3VLNA 3A5IA 4WF5A 2HT9A 2OE1A 2IMDA 5KN1A 3GV1A 2IFQB 2QA1A 2GQMA 4JR4A 5D96A 6GSTA 5IO2A 3ISOA 2HSYA 4FYCA 5ECNB 4PUAA 5B8BA 2N5AA 1UC7A 1TK8B 4F0BA 4GCIA 4O92A 4QL9A 4TOPA 3V1WA 2CZ2A 2GZPA 3GL5A 2VM1A 3RDWA 6GSVA 2GDRA 1SK0A 4ECBA 2GSQA 4RUVA 3P90A 3FRCA 2AB6A 1R5PA 2JADA 3FMWA 2OA7A 3I43A 5G1LA 3TKSE 2H8LA 1W4VA 4MCUA 1ZYEA 5HFKA 4O7HA 2H6YA 1EOHA 2K9FA 1HNAA 3D21A 4GQCA 4I2TA 1TRSA 2K8SA 4XCSA 4K7OA 1GNWA 2H71A 1OE7A 5HR2A 4Z2TA 2M80A 1MDJA 4MPFA 2H74A 1B8XA 2UV8G 1NM3A 4IJIA 3N9JA 3UIWA 2A4VA 1WWJA 2P5RA 4MH3A 1EWXA 5H5RA 4FH8A 1XPVA 3ZFLA 2H66A 2YNXA 2B5YA 2V6OA 1GTBA 4EIQA 2H75A 1DBYA 6GSUA 2GT5A 4EUYA 4ILFA 3HJMA 4L0UA 1U3AA 4EVMA 3KJYA 2C80A 2P5QA 4I8BA 2HQTA 2TIRA 5KN2A 4NMUA 4V2MA 2C3QA 1J9BA 5E4WA 4QMKA 3VURA 2G2QA 3HMJG 1Z7PA 3ERWA 3RPNA 5JWRB 4ULXA 1MD4A 3CBUA 1JZOA 3C1SA 3FZ4A 1PKWA 2HRKB 4BVXB 2PVOC 3EU3A 2NTOA 4MH2A 1K0NA 5BMUB 3G7YA 1K0AA 3ME7A 4HZ2A 4XS1A 4ISDA 2I9HA 4KH7A 1WMJA 1SD9A 4AGSA 1KEBA 2KUCA 4NPBA 5F8BA 4KAEA 4WXTA 2GVPA 4KSMA 1OAZA 2Z9SA 3ZRDA 2L6DA 2DMMA 3TJKA 1K0CA 2M72A 1VGLA 1BG5A 4K7IA 3DGQA 1GTAA 1ZOFA 4LA1A 5GSSA 3GKNA 1OE8A 4ZBBA 1XBSA 2LJKA 1T00A 1XW5A 1TRVA 1TW9A 5HFIA 4NV5A 3ERFA 4G19A 1ERUA 4MABA 2YZUA 4N10A 2H70A 2VKZG 3UVTA 5J41A 1N2AA 1E2YA 3IK7A 4AKHA 2IMFA 3KZQA 3L9VA 5ABRA 4IS0A 3FW2A 3HHVA 3F3RA 3MIXA 5CAXA 3GSSA 2EIRA 1DUGA 1PRXA 2VD0A 3ERGA 3IXRA 1MTCA 3KMNA 1EGRA 2DJ2A 1OYJA 2FD3A 5CREA 2N5FA 3IA1A 2VCTA 3FEUA 2H76A 3VI5A 2MMNA 3TJBA 2AJQB 1YQ1A 2IPAA 2LNSA 3CXGA 4EIPA 2B3SA 4K6XA 2B5XA 4LL4B 3LQ7A 3TB2A 4G10A 4MF6A 4JBBA 3RAZA 5HFGA 1PSQA 3D6IA 1XCCA 2C8UA 3BJ5A 2FWGA 2YZHA 1DE2A 4XHMA 1EEJA 1R26A 1QMVA 2MYGA 5IMFA 4IQAA 1WRYA 2P31A 2CVKA 1G7OA 2QC7A 1UA5A 1A24A 3F0IA 4PGTA 1ZYNA 3APOA 2HSNB 3F4TA 4MZCA 4OCEA 4PQ1A 3KH7A 1FHEA 4KGIA 4HQSA 4QL7A 2LUSA 4TR3A 2F51A 4E68A 2DIZA 4CY8A 4ECIA 3GKMA 4TRXA 4K9ZA 1FB6A 1XVWA 4EF0A 3EWLA 3EPTA 3C73A 5F0GA 4HQZA 2HRKA 4BVXA 1OKTA 2ZCTA 4OMVA 5BMUA 1T1VA 4EKZA 4WETA 2AHEA 4MP4A 4XS6A 5ELAA 1FVJA 4MLYA 1HNCA 1Z6MA 2ON5A 4HUAA 1Y1UA 5JWQB 3C7MA 4MJAA 4NHZA 1GUMA 3IRAA 4YKFA 3E9JB 3IPZA 5ECSA 4ID0A 1Q4JA 6GSSA 3GKKA 3VK9A 2C0EA 2X8HA 3U6VA 2GLRA 3ZITA 1XW6A 1EGOA 5J4UA 3IDVA 1FOVA 1OVNA 5G5EA 3WGEA 2VL3A 4HZ4A 4OCFA 1WJKA 4Q5NA 3H4KA 14GSA 3FR6A 4BA7A 2HSMB 2ES7A 1ST9A 4WBJA 3WT1A 3KMOA 5IOWA 2DIYA 2L4CA 5GAND 1A23A 2JSYA 3O6TA 3QAWA 1UVZA 2EFCA 3ME8A 1AW9A 1AIUA 4KDXA 5ID2A 2VLUA 1ZYQB 2XPEA 1TTZA 4MDCA 3CSHA 2DC5A 4Q5QA 2O87A 4DEJA 3FZ9A 2FUG2 1TU8A 1GTUA 2IMIA 4BL7A 3KH9A 3GTUB 1XXUA 1I9DA 5A4VA 3FY7A 3TRPA 2O8VB 2C1YA 4ICYA 3S9FA 4EDZA 1N8JA 3O76A 1J08A 2VD1A 4HS1A 4MZBA 2KOKA 1R5AA 3TCOA 2YJHA 4PX1A 1GUKA 4Q5FA 2ON7A 4YAVA 5A1NB 1K3LA 2CA8A 2IIYA 4EDYA 5KN0A 2H0IA 1SD8A 2DJKA 5AGYA 3O3TA 3WGDA 2CVBA 2FWHA 2L6CA 5ECOB 1JZDA 1WOUA 1F6MC 5IMDA 4NAXA 3QOUA 2NVLA 5DAKB 3VWXA 4L8EA 1YF0A 3M0FA 1ERTA 1V58A 3C8EA 4ZL9A 1EZKA 3F6FA 9GSSA 5B6MA 4EXJA 3R3EA 5G1KA 5G2ZA 2HSNA 1RW1A 3HY2A 2XBQA 5H5SA 2H30A 3MSZA 1SL2B 2BTOT 1G6WA 4N0VA 1A0RP 2IN3A 5ECLB 1VF4A 2XPDA 1VRSD 3EE2A 1Z7RA 2HZEB 2ZUPA 4JRRA 3GX8A 3RHCA 2VCWA 3JCML 3BBYA 2WCIA 1QGVA 1XWAA 1JLWA 4KB3A 4HI7A 2LKUA 1BEDA 2V32A 2B1KA 2IJYA 2RM5A 4WR4A 2BJXA 2O89A 2MMZA 2H73A 1ZZYA 5CNWA 4ML6A 3CRTA 1T8EB 1T7PB 2LQQA 4GWRA 4OO5A 3HZ8A 5AISA 2VIMA 2F9SA 2VL2A 3LXTA 2A4HA 4NHWA 3UARA 1EV9A 2EFEA 5LNKe 3TKSC 1TJDA 3Q19A 3IBHA 3LG6A 5INYA 2R37A 1PL2A 1SU9A 4X0XA 4KCEA 5DALA 3L9UA 2HYXA 2LS5A 1M2DA 5JCWA 1O81A 4IW9A 4F9ZA 3GHAA 2DKIA 4F0CA 3LYPA 1OC3A 3WGXA 1NSWA 1R4WA 5KOWA 4ZB6A 4GDFA 4GF0A 3DMLA 2YWIA 4OO4A 1YJ6A 1OC8A 4H86A 3Q18A 5FWGA 4KNDA 2VLTA 1IYHA 4YQMA 4MPGA 3ED3A 2RUEA 1Z3EA 3EMPA 1V57A 4CW9A 2M46A 4ZB9A 3FYGA 4IKHA 5KN3A 4TXOA 4MJEA 3ZTLA 1S3CA 2WB9A 3I9V2 4N30A 1XOAA 3IK9A 4J57E 5DCGA 1GUHA 3IR4A 3GUSA 5EY6A 4HOJA 1YZXA 4GSTA 1VF3A 2F8FA 2H1DA 3W8JA 4ECCA 1RK4A 5A1NA 4BVYA 3U5RE 2LQOA 3IOSA 4AKGA 2TRXA 1ZL9A 2VCQA 4HU9A 2WZ9A 3UAPA 3GMFA 2QA2A 2ZNMA 4ML1A 1J0FA 13GSA 1ZMAA 2R0GA 3ZMKA 2FLSA 1V9WA 2HNLA 1C72A 2H1AA 2R2JA 1F3AA 5ECRB 1O73A 3Q6OA 2CAQA 5DAKA 2FWEA 2R6KA 1FOHA 1M9AA 5IMCA 3VI7A 2LTKA 4FO5A 4L0WA 1PN9A 3L4NA 4ZL8A 2PMTA 1PQNA 5CRWA 3RBTA 3FZ5A 3GIXA 1GSQA 4ZB8A 3HYPA 4KUNA 3EMXA 1K3OA 3IHQA 1GULA 2GZZA 5IQYA 2REMA 1VF2A 4JEDA 3VWVA 4DSRA 5ELGA 4E8EA 2OE3A 2GQKA 1U6TA 2MZCA 1G6YA 4I97A 5EVOA 2CVDA 3W6GA 2WRTA 3LEFA 2HZEA 4NXIA 3QPMA 2VM2A 3VPTA 1BF5A 3PGTA 3HVVA 3NOFA 2PBJA 1SKSB 3TKQA 2L5OA 4MK3A 3UVHA 2K8VA 3E0UA 1SKWB 2WULA 2JSZA 1OC9A 4YAPA 1V98A 3HCZA 3QCPA 1T4ZA 3HVXA 3DKSA 1YEXA 2FY6A 4BPYA 5ECQB 5ECMB 1SJIA 1QXHA 1M9BA 4PUFC 1JZWA 2YV7A 5FT3A 1GLPA 2GTUA 5GAPD 2EFDA 1F9MA 2LEGA 3EU4A 3ZVJA 3I6AA 5ENUA 3P8WA 5A4UA 3LGCA 1TP9A 5CO3A 4G9HA 5A5KA 1AC1A 4TW5A 10GSA 2IFQA 2O7KA 2EIOA 1PX6A 5CRHA 4G01A 3HKRA 2DKHA 4JU5A 3UMAA 2J9HA 3EC3A 2LRCA 1AQXA 1O6JA 5IMVA 2CT6A 5G30A 2IMKA 4ZBAA 1OKDA 5GSTA 1YDKA 2FA8A 2K6VA 4DSQA 5LCZA 2YPMA 4RQRA 5H5QA 5LD0A 4MZWA 1TRUA 4D73B 3QMXA 19GSA 4E8HA 3LYKA 1KTEA 4OD7A 1K0BA 1PD21 1AQVA 2FGXA 2CX3A 1PGTA 1X0RA 3DXBA 3UL3A 4TKYA 5JCUA 1G7EA 1R7HA 2KP2A 5EL8A 3IAM2 2B1LA 2F8AA 4XS4B 4KDYA 3PPUA 4ACSA 1IYIA 2LRTA 2OADA 3EVIA 2C0GA 1Y6EA 1RQMA 3GX0A 2V2GA 4P3YB 3GRXA 3QFAC 2IL3A 1NW2A 1T3BA 3FZAA 2VCXA 4FQUA 4TVEA 3PH9A 4ZBDA 2QKEA 2H1GA 4O5UA 4K8MA 4IHUA 2KP1A 1U87A 2YWOA 1Y25A 3ZIVA 1USBA 3PR8A 3EURA 1UN2A 1ERWA 4TR1B 1X9SB 1SVMA 4N0ZA 1X9WB 4W66A 3UEMA 3TJFA 1U88A 5ECKB 4PNGA 4IGJA 2OKAA 3DIEA 4RI6A 4PURA 5A5HB 3CYNA 2L59A 4DVCA 2GQLA 1SENA 4TN8A 3MWHA 1QFNA 2H01A 3SWLA 1GRXA 2H6ZA 1PMTA 3VWUA 2MBSA 3CTGA 4POMA 3RPPA 5IPHA 3ZL5A 3CSJA 4K5SA 5J47A 2IMEA 3A2WA 3GFKA 2VUPA 3Q74A 3UBKA 4Z2UA 3L78A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CSI A;  4OWY A;  1A0F A;  3AY8 A;  2D2Z A;  2WS2 A;  2HSH A;  1FO5 A;  5D8I A;  4X1U A;  1EV4 A;  4ZIL A;  1X5D A;  2B7J A;  1LJR A;  1Z6N A;  2OBK A;  2VCZ A;  3A2V A;  4N11 A;  1G0T A;  3F9U A;  2N5B A;  1GSD A;  2HE3 A;  3DD3 A;  6GSY A;  1PA3 A;  1O7U A;  4WBR D;  4GSS A;  5JWO B;  3KIJ A;  2AUV A;  3HA9 A;  5D9V A;  4ZXG A;  2JAC A;  1HD2 A;  4XIH A;  4HJM A;  2YJ7 A;  4GSN A;  1S3D A;  2X8G A;  1M99 A;  1YY7 A;  3F8U A;  5AIX A;  5F06 A;  3HDC A;  4K2D A;  4G0K A;  1WPI A;  1SL0 B;  5D73 A;  20GS A;  2V41 A;  5DBQ A;  4POK A;  3E3E A;  3D22 A;  1XWK A;  2O85 A;  4F03 A;  2I3Y A;  1Z5Y E;  2QGV A;  2DLX A;  1V40 A;  4V2N A;  2ALB A;  1BAY A;  3J7Y b;  4IEL A;  2YP6 A;  3LXZ A;  4PTS A;  5C00 A;  1K0O A;  4TR4 A;  4AJ6 A;  2XC2 A;  4EL1 A;  4IJ3 A;  2OJL A;  1FAA A;  3HD5 A;  4XS4 A;  4PQI A;  2E7P A;  4OFT A;  1TOF A;  3IC4 A;  2KLX A;  1YKC A;  3GST A;  3F63 A;  1T4Y A;  2J23 A;  4LMW A;  4G2E A;  1ACV A;  2X8C A;  4KW6 A;  3HZ4 A;  2MMO A;  3ZZX A;  2HI7 A;  3NIV A;  1MDK A;  18GS A;  4KE3 A;  4POB A;  5FHI A;  3M1G A;  3KP9 A;  3G9B A;  4MJC A;  1F3B A;  3LFL A;  3FR9 A;  2E2M A;  3QDN A;  4XRD A;  4HJ2 A;  2DSA A;  2XBI A;  3GA4 A;  4NWY A;  2H1B A;  2KHP A;  22GS A;  1TKD B;  11GS A;  4KSO A;  5E59 A;  2PN8 A;  3CMI A;  1O85 A;  3KTB A;  2JL4 A;  4KF9 A;  1TDI A;  5F05 A;  4I2U A;  1GSU A;  3IAS 2;  1PX7 A;  1KBN A;  4RQX A;  2G0F A;  1XVQ A;  1XW9 A;  1ML6 A;  1B4P A;  3A5W A;  3M9K A;  3FK8 A;  3IE3 A;  2PWJ A;  3VWW A;  1THO A;  5CRD A;  5HR1 A;  3HVS A;  1SL1 B;  1SJ6 A;  3OR5 A;  5B6N A;  2DJ1 A;  2JZS A;  2P0G A;  5CP1 A;  5DQS A;  2PVQ A;  2JZR A;  1FG4 A;  4L5O A;  1GSS A;  2RUF A;  3DVW A;  4GQF A;  1BYE A;  4J2F A;  5D9X A;  3ZVJ D;  3BOA A;  4LMV A;  4BWQ A;  3UBL A;  1WE0 A;  2H0G A;  3GYK A;  2H19 A;  5GZZ B;  3IC8 A;  4Q5R A;  2HSM A;  1AXD A;  1VF1 A;  2B6M A;  2CX4 A;  1GWC A;  1A8L A;  3QD9 A;  4EC0 A;  4LL1 B;  2YWN A;  1PL1 A;  4OFM A;  4KX4 A;  1O8X A;  2HLS A;  2NDO A;  1SYR A;  2YN1 A;  4GRF A;  3TKS A;  1PKZ A;  4CDO A;  4WF4 A;  4JR6 A;  2WDU A;  1AQW A;  1K0D A;  4IBP A;  4ECJ A;  3GTU A;  4GXZ A;  2FA4 A;  3UOM A;  5DCH A;  2VL9 A;  1KNG A;  1SK1 A;  1GLQ A;  5DDL A;  2QSI A;  5IMA A;  2EC4 A;  2L57 A;  3TUE A;  3CTF A;  2LNT A;  4FYB A;  5AIV A;  2AV4 A;  2GSS A;  1S3A A;  2MBT A;  3QAG A;  4V1A g;  3GH6 A;  1M0U A;  4MA9 A;  8GSS A;  2PGT A;  3R2Q A;  3KGK A;  5AN1 A;  1EP7 A;  2C0F A;  1GP1 A;  2AAW A;  2OE0 A;  5J9B A;  4PQH A;  5B7C A;  5HQP A;  2C0D A;  2XHF A;  12GS A;  2A2R A;  3TKP A;  3MNG A;  3F4S A;  3ZML A;  1V2A A;  5KEJ A;  3KEB A;  3N5O A;  2L4Q A;  1XWG A;  4MJB A;  5IOX A;  1XWB A;  2C3T A;  4G0I A;  1W89 A;  3APS A;  1FW1 A;  2WGR A;  6GSX A;  2YOI A;  3IV4 A;  4HU7 A;  3WT2 A;  3KXO A;  2HRA A;  3G7I A;  3M8N A;  3GN3 A;  1GH2 A;  2CAI A;  2I4A A;  2DJJ A;  3H1N A;  3HJO A;  2YV9 A;  3DEX A;  1FVK A;  2VOC A;  2FHE A;  3WYW A;  4DSS B;  3QFB C;  3GL3 A;  4ZL7 A;  2UZ8 A;  2X64 A;  1TK0 B;  6GSW A;  4PXO A;  1A2M A;  1ZCP A;  4IP6 A;  4EE0 A;  3SBC A;  4ZIJ A;  1ILO A;  3DYR A;  5DQY A;  5J9C A;  3H93 A;  1ABA A;  4TR0 A;  1TI3 A;  5B8A A;  3TGZ A;  17GS A;  2HXK A;  4MF5 A;  1GSE A;  5J5N A;  1GTI A;  1H75 A;  3ZYW A;  2FCH A;  1QQ2 A;  2GSR A;  1X9M B;  5COH A;  3MDK A;  3BCI A;  1B9Y C;  3F6D A;  1QK8 A;  3LSZ A;  2GST A;  3ZLP A;  4J56 E;  1GNE A;  4QQ7 A;  4X43 A;  3P2A A;  1TXX A;  1YKA A;  5G5F A;  2TRC P;  3VFI A;  5J3R A;  4YH2 A;  2LST A;  5ID2 B;  5ECH B;  4XTS A;  1BJX A;  3I69 A;  2YAN A;  2BMX A;  1WIK A;  5HR3 A;  2I1U A;  2OAC A;  4AJ8 A;  4IP1 A;  5CRG A;  3US3 A;  4BL7 B;  4Z7X A;  4YQV A;  4OFN A;  1BX9 A;  2NBS A;  4HDE A;  2L5L A;  2VO4 A;  3LJR A;  3MAK A;  5ECP B;  2FNO A;  2C4J A;  2EIQ A;  1GSF A;  2NPB A;  1F2E A;  2V1M A;  1XWC A;  3H8Q A;  4POL A;  2LRN A;  1A2J A;  1HYU A;  1EP8 A;  2RM6 A;  2PER A;  1X5C A;  5F07 A;  1Q98 A;  3D5J A;  2VCV A;  1O8W A;  1M2A A;  4BWS A;  4IN0 A;  4AJ7 A;  1MEK A;  3KP8 A;  3L0H A;  4TXV A;  1QUW A;  3A2X A;  1M2B A;  3ZIJ A;  4IVF A;  1K0M A;  1JFU A;  4I5Q A;  1SK2 A;  1XIY A;  2PUK C;  5IM9 A;  3L9S A;  2LV3 A;  3FKF A;  4V1A p;  4KCA A;  1TK5 B;  1H4O A;  3RHB A;  1A2L A;  5ECI B;  2CQ9 A;  1HNB A;  2HZF A;  3NZN A;  1LU4 A;  1GL8 A;  5C04 A;  4I6X A;  1XFL A;  1MDI A;  3ZRE A;  2H72 A;  2I81 A;  4CHS A;  3C1R A;  3G7J A;  1NHO A;  3QAV A;  4GTU A;  5CYY A;  1CQH A;  3D0Z A;  1JLV A;  2CV4 A;  5D9W A;  4K1F A;  4DSS A;  2YCD A;  3TJJ A;  3TJG A;  1LBK A;  2HRF A;  2H6X A;  2R5G A;  3BCK A;  1K3Y A;  2E0Q A;  4XRA A;  3CRU A;  5D93 A;  2AYT A;  3TRX A;  3C71 A;  2C3N A;  5A4W A;  1AAZ A;  4EO3 A;  2HRN A;  4LLR A;  1B4Q A;  1XZO A;  2K18 A;  4WEY A;  2HFD A;  1M7T A;  3H79 A;  1BQ7 A;  1TI1 A;  5L71 A;  1YF1 A;  3UJ1 A;  1ZGN A;  4NV2 A;  2LJR A;  3KCM A;  2VAF A;  2MMA A;  4D73 A;  3TOT A;  3GKX A;  3W8S A;  3J7Y k;  1SJZ A;  5DAL B;  4MF7 A;  3A3T A;  3HXS A;  3KD0 A;  1DSB A;  4G0L A;  1THX A;  1TU7 A;  2GS3 A;  3K8N A;  2V6K A;  4PNF A;  5JCG A;  3TKR A;  4KDU A;  3QR6 A;  3TOU A;  4O5R A;  3DVX A;  3KTL A;  2B5E A;  4V2L A;  1ERV A;  4O32 A;  2B7K A;  4TXO B;  4WKW A;  5DJM A;  1A8Y A;  1WP0 A;  3D4M A;  2IWT A;  3FR3 A;  1CQG A;  1F37 A;  2E2G A;  3D4T A;  4FIW A;  2LJA A;  2DBC A;  3DRN A;  3GH9 A;  3VPQ A;  1YEP A;  4BVY B;  4RI7 A;  2FWF A;  4K0N A;  1B9X C;  3WD6 A;  4L5L A;  4MMM A;  5IPG A;  2GT6 A;  1U3I A;  3HJP A;  4TR1 A;  4FYU A;  5IO0 A;  5DJL A;  4USS A;  1HQO A;  2RLI A;  1GSY A;  5HR0 A;  2DML A;  2YWM A;  4K0G A;  2PPT A;  1TRW A;  1X5E A;  2WFC A;  1JZR A;  3DWV A;  5G31 A;  2GGT A;  2WJU A;  3ZFB A;  4GLT A;  3EIN A;  3GUR A;  3LOR A;  1EEM A;  2JU5 A;  4AF2 A;  3F3Q A;  4JE1 A;  3FHK A;  1AUC A;  2JZT A;  1JHB A;  1E6B A;  3P7X A;  4JZQ A;  1ON4 A;  1SYX A;  2CZ3 A;  16GS A;  3LWA A;  4HEA 2;  3TRQ A;  3F4R A;  1EOG A;  3M9J A;  4WR5 A;  5EPF A;  2RII A;  2OBI A;  5IIZ A;  3GNJ A;  3PIN A;  2VL2 C;  2A2S A;  2VLV A;  4F2I A;  1SKR B;  4K7N A;  2H0H A;  3M3M A;  1OC9 B;  2F3M A;  7GSS A;  5D9T A;  2R3X A;  2R4V A;  1DE1 A;  2DJ0 A;  1URM A;  2GZY A;  3BD2 A;  3APQ A;  2X99 A;  5DVB A;  3EYT A;  2PU9 C;  4F82 A;  4KA0 A;  1FB0 A;  3KM6 A;  4IQ1 A;  1XOB A;  5IMZ A;  2DJ3 A;  1I5G A;  1Z9H A;  1B48 A;  3TDG A;  1NHY A;  4YQU A;  1MD3 A;  3VLN A;  4WF5 A;  2HT9 A;  2OE1 A;  2IMD A;  5KN1 A;  3GV1 A;  2IFQ B;  2GQM A;  4JR4 A;  5D96 A;  6GST A;  5IO2 A;  3ISO A;  2HSY A;  4FYC A;  5ECN B;  4PUA A;  5B8B A;  2N5A A;  1UC7 A;  1TK8 B;  4F0B A;  4GCI A;  4O92 A;  4QL9 A;  4TOP A;  3V1W A;  2CZ2 A;  2GZP A;  3GL5 A;  2VM1 A;  3RDW A;  6GSV A;  2GDR A;  1SK0 A;  4ECB A;  2GSQ A;  4RUV A;  3P90 A;  3FRC A;  2AB6 A;  1R5P A;  2JAD A;  2OA7 A;  3I43 A;  5G1L A;  3TKS E;  2H8L A;  1W4V A;  4MCU A;  1ZYE A;  5HFK A;  4O7H A;  2H6Y A;  1EOH A;  2K9F A;  1HNA A;  3D21 A;  4GQC A;  4I2T A;  1TRS A;  2K8S A;  4XCS A;  4K7O A;  1GNW A;  2H71 A;  1OE7 A;  5HR2 A;  2M80 A;  1MDJ A;  4MPF A;  2H74 A;  1B8X A;  1NM3 A;  4IJI A;  3N9J A;  3UIW A;  2A4V A;  1WWJ A;  2P5R A;  4MH3 A;  1EWX A;  5H5R A;  4FH8 A;  1XPV A;  3ZFL A;  2H66 A;  2YNX A;  2B5Y A;  2V6O A;  1GTB A;  2H75 A;  1DBY A;  6GSU A;  2GT5 A;  4EUY A;  4ILF A;  3HJM A;  4L0U A;  1U3A A;  4EVM A;  3KJY A;  2C80 A;  2P5Q A;  4I8B A;  2HQT A;  2TIR A;  5KN2 A;  4NMU A;  4V2M A;  2C3Q A;  1J9B A;  5E4W A;  3VUR A;  2G2Q A;  1Z7P A;  3ERW A;  3RPN A;  5JWR B;  4ULX A;  1MD4 A;  3CBU A;  1JZO A;  3C1S A;  3FZ4 A;  1PKW A;  2HRK B;  4BVX B;  2PVO C;  3EU3 A;  2NTO A;  4MH2 A;  1K0N A;  3G7Y A;  3ME7 A;  1K0A A;  4HZ2 A;  4XS1 A;  4ISD A;  2I9H A;  4KH7 A;  1WMJ A;  1SD9 A;  4AGS A;  1KEB A;  2KUC A;  4NPB A;  5F8B A;  4KAE A;  4WXT A;  2GVP A;  4KSM A;  1OAZ A;  2Z9S A;  3ZRD A;  2L6D A;  2DMM A;  3TJK A;  1K0C A;  2M72 A;  1VGL A;  1BG5 A;  4K7I A;  3DGQ A;  1GTA A;  1ZOF A;  4LA1 A;  5GSS A;  3GKN A;  1OE8 A;  4ZBB A;  1XBS A;  2LJK A;  1T00 A;  1XW5 A;  1TRV A;  1TW9 A;  5HFI A;  4NV5 A;  3ERF A;  4G19 A;  1ERU A;  4MAB A;  2YZU A;  4N10 A;  2H70 A;  3UVT A;  5J41 A;  1N2A A;  1E2Y A;  3IK7 A;  2IMF A;  3KZQ A;  3L9V A;  5ABR A;  4IS0 A;  3FW2 A;  3HHV A;  3F3R A;  5CAX A;  3GSS A;  2EIR A;  1DUG A;  1PRX A;  2VD0 A;  3ERG A;  3IXR A;  1MTC A;  3KMN A;  1EGR A;  2DJ2 A;  1OYJ A;  2FD3 A;  5CRE A;  2N5F A;  3IA1 A;  2VCT A;  3FEU A;  2H76 A;  3VI5 A;  2MMN A;  3TJB A;  2AJQ B;  1YQ1 A;  2IPA A;  2LNS A;  3CXG A;  2B3S A;  4K6X A;  2B5X A;  4LL4 B;  3LQ7 A;  3TB2 A;  4G10 A;  4MF6 A;  4JBB A;  3RAZ A;  5HFG A;  1PSQ A;  3D6I A;  1XCC A;  2C8U A;  3BJ5 A;  2FWG A;  2YZH A;  1DE2 A;  4XHM A;  1EEJ A;  1R26 A;  1QMV A;  2MYG A;  5IMF A;  4IQA A;  1WRY A;  2P31 A;  2CVK A;  1G7O A;  2QC7 A;  1UA5 A;  1A24 A;  3F0I A;  4PGT A;  3APO A;  2HSN B;  3F4T A;  4MZC A;  4OCE A;  4PQ1 A;  3KH7 A;  1FHE A;  4KGI A;  4HQS A;  4QL7 A;  2LUS A;  4TR3 A;  2F51 A;  2DIZ A;  4ECI A;  3GKM A;  4TRX A;  4K9Z A;  1FB6 A;  1XVW A;  4EF0 A;  3EWL A;  3C73 A;  5F0G A;  4HQZ A;  2HRK A;  4BVX A;  1OKT A;  2ZCT A;  4OMV A;  5BMU A;  1T1V A;  4EKZ A;  4WET A;  2AHE A;  4MP4 A;  4XS6 A;  5ELA A;  1FVJ A;  4MLY A;  1HNC A;  1Z6M A;  2ON5 A;  4HUA A;  5JWQ B;  3C7M A;  4MJA A;  4NHZ A;  1GUM A;  3IRA A;  3E9J B;  3IPZ A;  5ECS A;  4ID0 A;  1Q4J A;  6GSS A;  3GKK A;  3VK9 A;  2C0E A;  2X8H A;  3U6V A;  2GLR A;  3ZIT A;  1XW6 A;  1EGO A;  5J4U A;  3IDV A;  1FOV A;  1OVN A;  5G5E A;  3WGE A;  2VL3 A;  4HZ4 A;  4OCF A;  1WJK A;  4Q5N A;  3H4K A;  14GS A;  3FR6 A;  4BA7 A;  2HSM B;  2ES7 A;  1ST9 A;  4WBJ A;  3WT1 A;  3KMO A;  5IOW A;  2DIY A;  2L4C A;  5GAN D;  1A23 A;  2JSY A;  3O6T A;  3QAW A;  1UVZ A;  1AW9 A;  3ME8 A;  1AIU A;  4KDX A;  5ID2 A;  2VLU A;  1ZYQ B;  2XPE A;  1TTZ A;  4MDC A;  3CSH A;  2DC5 A;  4Q5Q A;  2O87 A;  4DEJ A;  3FZ9 A;  2FUG 2;  1TU8 A;  1GTU A;  2IMI A;  4BL7 A;  3KH9 A;  3GTU B;  1XXU A;  1I9D A;  5A4V A;  3FY7 A;  3TRP A;  2O8V B;  2C1Y A;  3S9F A;  4EDZ A;  1N8J A;  3O76 A;  1J08 A;  2VD1 A;  4HS1 A;  4MZB A;  2KOK A;  1R5A A;  3TCO A;  2YJH A;  4PX1 A;  1GUK A;  4Q5F A;  2ON7 A;  4YAV A;  1K3L A;  2CA8 A;  2IIY A;  4EDY A;  5KN0 A;  2H0I A;  1SD8 A;  2DJK A;  5AGY A;  3O3T A;  3WGD A;  2CVB A;  2FWH A;  2L6C A;  5ECO B;  1JZD A;  1WOU A;  1F6M C;  5IMD A;  4NAX A;  3QOU A;  2NVL A;  5DAK B;  3VWX A;  4L8E A;  1YF0 A;  3M0F A;  1ERT A;  1V58 A;  3C8E A;  4ZL9 A;  1EZK A;  3F6F A;  9GSS A;  5B6M A;  4EXJ A;  3R3E A;  5G1K A;  5G2Z A;  1RW1 A;  3HY2 A;  2XBQ A;  5H5S A;  2H30 A;  3MSZ A;  1SL2 B;  2BTO T;  1G6W A;  4N0V A;  1A0R P;  2IN3 A;  5ECL B;  1VF4 A;  2XPD A;  1VRS D;  3EE2 A;  1Z7R A;  2HZE B;  2ZUP A;  4JRR A;  3GX8 A;  3RHC A;  2VCW A;  3JCM L;  3BBY A;  2WCI A;  1QGV A;  1XWA A;  1JLW A;  4KB3 A;  4HI7 A;  2LKU A;  1BED A;  2V32 A;  2B1K A;  2IJY A;  2RM5 A;  4WR4 A;  2BJX A;  2O89 A;  2MMZ A;  2H73 A;  1ZZY A;  5CNW A;  4ML6 A;  3CRT A;  1T8E B;  1T7P B;  2LQQ A;  4GWR A;  4OO5 A;  3HZ8 A;  5AIS A;  2VIM A;  2F9S A;  2VL2 A;  3LXT A;  4NHW A;  3UAR A;  1EV9 A;  5LNK e;  3TKS C;  1TJD A;  3Q19 A;  3IBH A;  3LG6 A;  5INY A;  2R37 A;  1PL2 A;  1SU9 A;  4X0X A;  4KCE A;  5DAL A;  3L9U A;  2HYX A;  2LS5 A;  1M2D A;  5JCW A;  1O81 A;  4IW9 A;  4F9Z A;  3GHA A;  4F0C A;  3LYP A;  1OC3 A;  3WGX A;  1NSW A;  1R4W A;  4ZB6 A;  4GF0 A;  3DML A;  2YWI A;  4OO4 A;  1YJ6 A;  1OC8 A;  4H86 A;  3Q18 A;  5FWG A;  4KND A;  2VLT A;  1IYH A;  4YQM A;  4MPG A;  3ED3 A;  2RUE A;  1Z3E A;  3EMP A;  1V57 A;  4CW9 A;  2M46 A;  4ZB9 A;  3FYG A;  4IKH A;  5KN3 A;  4TXO A;  4MJE A;  3ZTL A;  1S3C A;  2WB9 A;  3I9V 2;  4N30 A;  1XOA A;  3IK9 A;  4J57 E;  5DCG A;  1GUH A;  3IR4 A;  3GUS A;  5EY6 A;  4HOJ A;  1YZX A;  4GST A;  1VF3 A;  2F8F A;  2H1D A;  3W8J A;  4ECC A;  1RK4 A;  4BVY A;  3U5R E;  2LQO A;  3IOS A;  2TRX A;  1ZL9 A;  4HU9 A;  2VCQ A;  2WZ9 A;  3UAP A;  3GMF A;  2ZNM A;  4ML1 A;  1J0F A;  13GS A;  1ZMA A;  3ZMK A;  2FLS A;  1V9W A;  2HNL A;  1C72 A;  2H1A A;  2R2J A;  1F3A A;  5ECR B;  1O73 A;  3Q6O A;  2CAQ A;  5DAK A;  2FWE A;  2R6K A;  1M9A A;  5IMC A;  3VI7 A;  4FO5 A;  2LTK A;  4L0W A;  1PN9 A;  3L4N A;  4ZL8 A;  2PMT A;  1PQN A;  5CRW A;  3RBT A;  3FZ5 A;  3GIX A;  1GSQ A;  4ZB8 A;  3HYP A;  4KUN A;  3EMX A;  1K3O A;  3IHQ A;  1GUL A;  2GZZ A;  5IQY A;  2REM A;  1VF2 A;  4JED A;  3VWV A;  4DSR A;  5ELG A;  4E8E A;  2OE3 A;  2GQK A;  1U6T A;  2MZC A;  1G6Y A;  4I97 A;  5EVO A;  2CVD A;  3W6G A;  2WRT A;  3LEF A;  2HZE A;  4NXI A;  3QPM A;  2VM2 A;  3VPT A;  3PGT A;  3HVV A;  3NOF A;  2PBJ A;  1SKS B;  3TKQ A;  2L5O A;  4MK3 A;  3UVH A;  2K8V A;  3E0U A;  1SKW B;  2WUL A;  2JSZ A;  1OC9 A;  4YAP A;  1V98 A;  3HCZ A;  3QCP A;  1T4Z A;  3HVX A;  3DKS A;  1YEX A;  2FY6 A;  4BPY A;  5ECQ B;  5ECM B;  1SJI A;  1QXH A;  1M9B A;  4PUF C;  1JZW A;  2YV7 A;  5FT3 A;  1GLP A;  2GTU A;  5GAP D;  1F9M A;  2LEG A;  3EU4 A;  3ZVJ A;  3I6A A;  5ENU A;  3P8W A;  5A4U A;  3LGC A;  1TP9 A;  5CO3 A;  4G9H A;  5A5K A;  1AC1 A;  4TW5 A;  10GS A;  2IFQ A;  2O7K A;  2EIO A;  1PX6 A;  5CRH A;  3HKR A;  4JU5 A;  3UMA A;  2J9H A;  3EC3 A;  1AQX A;  1O6J A;  2LRC A;  5IMV A;  2CT6 A;  5G30 A;  2IMK A;  4ZBA A;  1OKD A;  5GST A;  1YDK A;  2FA8 A;  2K6V A;  4DSQ A;  5LCZ A;  2YPM A;  4RQR A;  5H5Q A;  5LD0 A;  4MZW A;  1TRU A;  4D73 B;  3QMX A;  19GS A;  4E8H A;  3LYK A;  1KTE A;  4OD7 A;  1K0B A;  1PD2 1;  1AQV A;  2FGX A;  2CX3 A;  1PGT A;  1X0R A;  3DXB A;  3UL3 A;  4TKY A;  5JCU A;  1G7E A;  1R7H A;  2KP2 A;  5EL8 A;  3IAM 2;  2B1L A;  2F8A A;  4XS4 B;  4KDY A;  3PPU A;  4ACS A;  1IYI A;  2LRT A;  2OAD A;  3EVI A;  2C0G A;  1Y6E A;  1RQM A;  3GX0 A;  2V2G A;  4P3Y B;  3GRX A;  3QFA C;  2IL3 A;  1NW2 A;  1T3B A;  3FZA A;  2VCX A;  4FQU A;  4TVE A;  3PH9 A;  4ZBD A;  2QKE A;  2H1G A;  4K8M A;  4IHU A;  2KP1 A;  1U87 A;  2YWO A;  1Y25 A;  3ZIV A;  1USB A;  3PR8 A;  3EUR A;  1UN2 A;  1ERW A;  4TR1 B;  1X9S B;  4N0Z A;  1X9W B;  3UEM A;  3TJF A;  1U88 A;  5ECK B;  4PNG A;  4IGJ A;  2OKA A;  3DIE A;  4RI6 A;  4PUR A;  3CYN A;  2L59 A;  4DVC A;  2GQL A;  1SEN A;  4TN8 A;  3MWH A;  1QFN A;  2H01 A;  3SWL A;  1GRX A;  2H6Z A;  1PMT A;  3VWU A;  2MBS A;  3CTG A;  4POM A;  3RPP A;  5IPH A;  3ZL5 A;  3CSJ A;  2IME A;  3A2W A;  3GFK A;  2VUP A;  3Q74 A;  3UBK A;  3L78 A; 
#chains in the Genus database with same CATH topology
 3CSI A;  4OWY A;  1A0F A;  3AY8 A;  2D2Z A;  2WS2 A;  2HSH A;  1FO5 A;  5D8I A;  4X1U A;  1EV4 A;  4ZIL A;  1X5D A;  2B7J A;  1LJR A;  1Z6N A;  2OBK A;  2VCZ A;  3A2V A;  4N11 A;  1G0T A;  3F9U A;  2N5B A;  1GSD A;  2HE3 A;  3DD3 A;  6GSY A;  1PA3 A;  2R0P A;  1O7U A;  4WBR D;  3CWG A;  4GSS A;  5JWO B;  3KIJ A;  2AUV A;  3HA9 A;  5D9V A;  4ZXG A;  2JAC A;  1HD2 A;  4XIH A;  4HJM A;  2YJ7 A;  2R0C A;  4GSN A;  1PFO A;  1S3D A;  2X8G A;  5BRT A;  1M99 A;  1YY7 A;  1N25 A;  5AIX A;  3F8U A;  2WW3 A;  5F06 A;  3HDC A;  4K2D A;  4G0K A;  1WPI A;  1SL0 B;  5D73 A;  20GS A;  2V41 A;  5DBQ A;  4POK A;  3E3E A;  3D22 A;  1XWK A;  2O85 A;  4F03 A;  2I3Y A;  1Z5Y E;  2QGV A;  2DLX A;  1V40 A;  2X49 A;  3IHG A;  4V2N A;  2ALB A;  1BAY A;  3J7Y b;  4IEL A;  2YP6 A;  3LXZ A;  4PTS A;  5C00 A;  1K0O A;  4TR4 A;  4AJ6 A;  5J40 A;  2XC2 A;  4EL1 A;  4IJ3 A;  2OJL A;  1M3J A;  1FAA A;  3HD5 A;  4XS4 A;  4PQI A;  2E7P A;  1S4B P;  4OFT A;  2OT3 A;  1TOF A;  3IC4 A;  2KLX A;  1YKC A;  3GST A;  3F63 A;  1T4Y A;  2J23 A;  4LMW A;  4G2E A;  1ACV A;  4HSC X;  2X8C A;  4KW6 A;  3HZ4 A;  2MMO A;  3ZZX A;  2HI7 A;  3NIV A;  1MDK A;  18GS A;  4KE3 A;  4POB A;  5FHI A;  3M1G A;  3KP9 A;  3G9B A;  4MJC A;  2WVX A;  1F3B A;  3LFL A;  3FR9 A;  2E2M A;  3QDN A;  4XRD A;  4HJ2 A;  2DSA A;  2XBI A;  3GA4 A;  4NWY A;  2H1B A;  2KHP A;  22GS A;  1TKD B;  11GS A;  4KSO A;  5E59 A;  2PN8 A;  3CMI A;  1O85 A;  5J4V A;  3KTB A;  2JL4 A;  4KF9 A;  1TDI A;  5F05 A;  5A5H A;  4I2U A;  1GSU A;  3IAS 2;  1PX7 A;  1KBN A;  4RQX A;  2G0F A;  1XVQ A;  1XW9 A;  1ML6 A;  1B4P A;  3A5W A;  3M9K A;  3FK8 A;  3IE3 A;  2PWJ A;  3VWW A;  1THO A;  5CRD A;  5HR1 A;  3HVS A;  1SL1 B;  1SJ6 A;  3OR5 A;  5B6N A;  2DJ1 A;  2JZS A;  2P0G A;  3LW9 A;  5KOX A;  5CP1 A;  5DQS A;  2PVQ A;  2JZR A;  1FG4 A;  4L5O A;  1GSS A;  2RUF A;  3DVW A;  4GQF A;  1BYE A;  4J2F A;  5D9X A;  3ZVJ D;  3BOA A;  4LMV A;  4BWQ A;  3UBL A;  1WE0 A;  2H0G A;  3GYK A;  2H19 A;  5GZZ B;  3IC8 A;  4Q5R A;  2HSM A;  1AXD A;  1VF1 A;  2B6M A;  2CX4 A;  1GWC A;  1A8L A;  3QD9 A;  4EC0 A;  4LL1 B;  2YWN A;  1PL1 A;  4OFM A;  4KX4 A;  1O8X A;  2HLS A;  2NDO A;  1SYR A;  2YN1 A;  4GRF A;  3TKS A;  1PKZ A;  4CDO A;  4WF4 A;  4JR6 A;  2WDU A;  1AQW A;  1K0D A;  4IBP A;  4ECJ A;  3GTU A;  2O5V A;  4GXZ A;  2FA4 A;  4A5P A;  1PN0 A;  3UOM A;  5DCH A;  2VL9 A;  1KNG A;  1SK1 A;  1GLQ A;  5DDL A;  2QSI A;  5IMA A;  1BG1 A;  2EC4 A;  1YVL A;  2L57 A;  3TUE A;  3CTF A;  2LNT A;  4FYB A;  5AIV A;  2AV4 A;  2GSS A;  1S3A A;  2MBT A;  3QAG A;  4V1A g;  3GH6 A;  1M0U A;  4MA9 A;  8GSS A;  2PGT A;  3R2Q A;  3KGK A;  5AN1 A;  1EP7 A;  2C0F A;  1GP1 A;  2AAW A;  2OE0 A;  4PHZ C;  5J9B A;  4PQH A;  5B7C A;  5HQP A;  2C0D A;  2XHF A;  12GS A;  2A2R A;  3TKP A;  3MNG A;  3F4S A;  3ZML A;  1V2A A;  5KEJ A;  3KEB A;  3N5O A;  2L4Q A;  1XWG A;  4O5Q A;  4MJB A;  5IOX A;  1XWB A;  2C3T A;  4G0I A;  1W89 A;  3APS A;  1FW1 A;  2WGR A;  6GSX A;  2YOI A;  3IV4 A;  4HU7 A;  3WT2 A;  3KXO A;  2HRA A;  3G7I A;  3M8N A;  3GN3 A;  1GH2 A;  2CAI A;  2I4A A;  2DJJ A;  1TXU A;  3H1N A;  3HJO A;  2YV9 A;  3DEX A;  1FVK A;  4ZB7 A;  4X4J A;  2VOC A;  5J4Y A;  2FHE A;  3WYW A;  4DSS B;  3QFB C;  3GL3 A;  4ZL7 A;  2UZ8 A;  2X64 A;  1TK0 B;  6GSW A;  4PXO A;  1A2M A;  1ZCP A;  4IP6 A;  4EE0 A;  3SBC A;  4ZIJ A;  1ILO A;  3DYR A;  5DQY A;  5J9C A;  3H93 A;  1ABA A;  4TR0 A;  1TI3 A;  5B8A A;  3TGZ A;  17GS A;  2HXK A;  4MF5 A;  1GSE A;  5J5N A;  1GTI A;  1H75 A;  3ZYW A;  2FCH A;  1QQ2 A;  2GSR A;  1X9M B;  5COH A;  3MDK A;  3BCI A;  1B9Y C;  3F6D A;  1QK8 A;  3LSZ A;  2GST A;  3ZLP A;  4J56 E;  1GNE A;  4QQ7 A;  3TU3 B;  4X43 A;  3P2A A;  1TXX A;  1YKA A;  4AKX B;  5G5F A;  2TRC P;  3VFI A;  5J3R A;  4YH2 A;  2LST A;  5ID2 B;  5ECH B;  4XTS A;  1BJX A;  3I69 A;  2YAN A;  2BMX A;  1WIK A;  5HR3 A;  3CHX C;  2I1U A;  2OAC A;  4AI6 A;  4AJ8 A;  3MYD A;  4IP1 A;  5CRG A;  1ZYP A;  3US3 A;  4BL7 B;  4Z7X A;  4YQV A;  4OFN A;  1BX9 A;  2NBS A;  4HDE A;  2L5L A;  2VO4 A;  3LJR A;  3MAK A;  5ECP B;  2FNO A;  2C4J A;  2EIQ A;  1GSF A;  2NPB A;  1F2E A;  2V1M A;  1XWC A;  3H8Q A;  4N3Z A;  4POL A;  1SVO A;  2LRN A;  1A2J A;  1HYU A;  1EP8 A;  2RM6 A;  2PER A;  4K5R A;  1X5C A;  5F07 A;  1Q98 A;  3D5J A;  2VCV A;  1O8W A;  2A2P A;  4AKI A;  1M2A A;  4BWS A;  4IN0 A;  4AJ7 A;  1MEK A;  3KP8 A;  3L0H A;  4TXV A;  1QUW A;  3A2X A;  1M2B A;  3ZIJ A;  4IVF A;  1YEW C;  1K0M A;  1JFU A;  4I5Q A;  1SK2 A;  2O3E A;  1XIY A;  2PUK C;  5IM9 A;  4FXY P;  3L9S A;  2LV3 A;  3FKF A;  4V1A p;  4KCA A;  1TK5 B;  1H4O A;  3RHB A;  1A2L A;  5ECI B;  2CQ9 A;  1HNB A;  2HZF A;  3NZN A;  1LU4 A;  1GL8 A;  5C04 A;  4I6X A;  1XFL A;  1MDI A;  3ZRE A;  2H72 A;  2I81 A;  4CHS A;  3C1R A;  5A34 B;  3G7J A;  1NHO A;  3QAV A;  4GTU A;  5CYY A;  1CQH A;  3D0Z A;  1JLV A;  2CV4 A;  5D9W A;  4K1F A;  4DSS A;  2YCD A;  3TJJ A;  3TJG A;  1LBK A;  2HRF A;  2H6X A;  2R5G A;  3BCK A;  1K3Y A;  4PI0 C;  2E0Q A;  4XRA A;  3CRU A;  5D93 A;  2AYT A;  3TRX A;  3C71 A;  2C3N A;  5A4W A;  1AAZ A;  4EO3 A;  2HRN A;  4LLR A;  4K2X A;  1B4Q A;  1XZO A;  2K18 A;  4WEY A;  2HFD A;  1M7T A;  3H79 A;  1BQ7 A;  1TI1 A;  5L71 A;  1YF1 A;  3UJ1 A;  1ZGN A;  4NV2 A;  2LJR A;  1SVL A;  3KCM A;  2VAF A;  2MMA A;  4D73 A;  3TOT A;  3GKX A;  3W8S A;  3J7Y k;  1SJZ A;  5DAL B;  4MF7 A;  3A3T A;  3HXS A;  3KD0 A;  1DSB A;  4G0L A;  1THX A;  1TU7 A;  2GS3 A;  3K8N A;  2V6K A;  4PNF A;  5JCG A;  3TKR A;  4KDU A;  3QR6 A;  3TOU A;  4O5R A;  3DVX A;  3KTL A;  2B5E A;  4V2L A;  1ERV A;  4O32 A;  2B7K A;  4TXO B;  2EFH A;  4WKW A;  5DJM A;  1A8Y A;  1WP0 A;  3D4M A;  2IWT A;  3FR3 A;  1CQG A;  1F37 A;  2E2G A;  3D4T A;  4FIW A;  2LJA A;  2DBC A;  3DRN A;  2H1L A;  3GH9 A;  4CY6 A;  3VPQ A;  1YEP A;  4BVY B;  4RI7 A;  2FWF A;  4K0N A;  1B9X C;  3WD6 A;  4L5L A;  4MMM A;  5IPG A;  2GT6 A;  1U3I A;  3HJP A;  4TR1 A;  4FYU A;  5IO0 A;  5DJL A;  4USS A;  1HQO A;  2RLI A;  1GSY A;  5HR0 A;  2DML A;  2YWM A;  4K0G A;  2PPT A;  1TRW A;  1X5E A;  2WFC A;  1JZR A;  3DWV A;  5G31 A;  2GGT A;  4Z2R A;  2WJU A;  3ZFB A;  4GLT A;  3EIN A;  3GUR A;  3LOR A;  2WW1 A;  1EEM A;  2JU5 A;  4AF2 A;  3F3Q A;  4JE1 A;  2O36 A;  3FHK A;  1AUC A;  2JZT A;  1JHB A;  1E6B A;  3P7X A;  4JZQ A;  1ON4 A;  2WW0 A;  4MNN A;  1SYX A;  2CZ3 A;  16GS A;  3LWA A;  4HEA 2;  2X4A A;  5A34 A;  3TRQ A;  3F4R A;  1EOG A;  3M9J A;  4WR5 A;  5EPF A;  2RII A;  2OBI A;  5IIZ A;  3GNJ A;  3PIN A;  2VL2 C;  2A2S A;  2VLV A;  4F2I A;  1SKR B;  4K7N A;  2H0H A;  3M3M A;  1OC9 B;  2F3M A;  7GSS A;  5D9T A;  2R3X A;  2R4V A;  1DE1 A;  2DJ0 A;  1URM A;  2GZY A;  3BD2 A;  3APQ A;  2X99 A;  5DVB A;  3EYT A;  2PU9 C;  4F82 A;  4KA0 A;  1FB0 A;  3KM6 A;  4IQ1 A;  1XOB A;  5IMZ A;  4YKG A;  2DJ3 A;  1I5G A;  1Z9H A;  1B48 A;  3TDG A;  1NHY A;  4YQU A;  1MD3 A;  3VLN A;  3A5I A;  4WF5 A;  2HT9 A;  2OE1 A;  2IMD A;  5KN1 A;  3GV1 A;  2IFQ B;  2QA1 A;  2GQM A;  4JR4 A;  5D96 A;  6GST A;  5IO2 A;  3ISO A;  2HSY A;  4FYC A;  5ECN B;  4PUA A;  5B8B A;  2N5A A;  1UC7 A;  1TK8 B;  2WW2 A;  4F0B A;  4GCI A;  4O92 A;  4QL9 A;  4TOP A;  3V1W A;  2CZ2 A;  2GZP A;  3GL5 A;  2VM1 A;  3RDW A;  6GSV A;  2GDR A;  1SK0 A;  4ECB A;  2GSQ A;  4RUV A;  3P90 A;  3FRC A;  2AB6 A;  1R5P A;  2JAD A;  3FMW A;  2OA7 A;  3I43 A;  5G1L A;  3TKS E;  2H8L A;  1W4V A;  4MCU A;  1ZYE A;  5HFK A;  4O7H A;  2H6Y A;  1EOH A;  3RFR C;  2K9F A;  1HNA A;  3D21 A;  4GQC A;  4I2T A;  1TRS A;  2K8S A;  4XCS A;  4K7O A;  1GNW A;  2H71 A;  1OE7 A;  5HR2 A;  4Z2T A;  2M80 A;  1MDJ A;  4MPF A;  2H74 A;  1B8X A;  2UV8 G;  1NM3 A;  4IJI A;  3N9J A;  3UIW A;  2A4V A;  1WWJ A;  2P5R A;  4MH3 A;  4PI2 C;  1EWX A;  5H5R A;  4FH8 A;  1XPV A;  3ZFL A;  2H66 A;  2YNX A;  2B5Y A;  2V6O A;  1GTB A;  4EIQ A;  2H75 A;  1DBY A;  6GSU A;  2GT5 A;  4EUY A;  4ILF A;  3HJM A;  4L0U A;  1U3A A;  4EVM A;  3KJY A;  2C80 A;  2P5Q A;  4I8B A;  2HQT A;  2TIR A;  5KN2 A;  4NMU A;  4V2M A;  2C3Q A;  1J9B A;  5E4W A;  4QMK A;  3VUR A;  2G2Q A;  3HMJ G;  1Z7P A;  3ERW A;  3RPN A;  5JWR B;  4ULX A;  1MD4 A;  3CBU A;  1JZO A;  3C1S A;  3FZ4 A;  1PKW A;  2HRK B;  4BVX B;  2PVO C;  3EU3 A;  2NTO A;  4MH2 A;  1K0N A;  5BMU B;  3G7Y A;  1K0A A;  3ME7 A;  4HZ2 A;  4XS1 A;  4ISD A;  2I9H A;  4KH7 A;  1WMJ A;  1SD9 A;  4AGS A;  1KEB A;  2KUC A;  4NPB A;  5F8B A;  4KAE A;  4WXT A;  2GVP A;  4KSM A;  1OAZ A;  2Z9S A;  3ZRD A;  2L6D A;  2DMM A;  3TJK A;  1K0C A;  2M72 A;  1VGL A;  1BG5 A;  4K7I A;  3DGQ A;  1GTA A;  2WVZ A;  1ZOF A;  4LA1 A;  5GSS A;  3GKN A;  1OE8 A;  4ZBB A;  1XBS A;  2LJK A;  1T00 A;  1XW5 A;  1TRV A;  1TW9 A;  5HFI A;  4NV5 A;  3ERF A;  4G19 A;  1ERU A;  4MAB A;  2YZU A;  4N10 A;  2H70 A;  2VKZ G;  3UVT A;  5J41 A;  1N2A A;  1E2Y A;  3IK7 A;  4AKH A;  2IMF A;  3KZQ A;  3L9V A;  5ABR A;  4IS0 A;  3FW2 A;  3HHV A;  3F3R A;  3MIX A;  5CAX A;  3GSS A;  2EIR A;  1DUG A;  1PRX A;  2VD0 A;  3ERG A;  3IXR A;  1MTC A;  3KMN A;  1EGR A;  2DJ2 A;  1OYJ A;  2FD3 A;  5CRE A;  2N5F A;  3IA1 A;  2VCT A;  3FEU A;  2H76 A;  3VI5 A;  2MMN A;  3TJB A;  2AJQ B;  1YQ1 A;  2IPA A;  2LNS A;  3CXG A;  4EIP A;  2B3S A;  4K6X A;  2B5X A;  4LL4 B;  3LQ7 A;  3TB2 A;  4G10 A;  4MF6 A;  4JBB A;  3RAZ A;  5HFG A;  1PSQ A;  3D6I A;  1XCC A;  2C8U A;  3BJ5 A;  2FWG A;  2YZH A;  1DE2 A;  4XHM A;  1EEJ A;  1R26 A;  1QMV A;  2MYG A;  5IMF A;  4IQA A;  1S3R A;  1WRY A;  2P31 A;  2CVK A;  1G7O A;  2QC7 A;  1UA5 A;  1A24 A;  3F0I A;  4PGT A;  1ZYN A;  3APO A;  2HSN B;  3F4T A;  4MZC A;  4OCE A;  4PQ1 A;  3KH7 A;  1FHE A;  4KGI A;  4HQS A;  4QL7 A;  2LUS A;  4TR3 A;  2F51 A;  4E68 A;  2DIZ A;  4CY8 A;  4ECI A;  3GKM A;  4TRX A;  4K9Z A;  1FB6 A;  1XVW A;  4EF0 A;  3EWL A;  3EPT A;  3C73 A;  5F0G A;  4HQZ A;  2HRK A;  4BVX A;  1OKT A;  2ZCT A;  4OMV A;  5BMU A;  1T1V A;  4EKZ A;  4WET A;  2AHE A;  4MP4 A;  4XS6 A;  5ELA A;  1FVJ A;  4MLY A;  1HNC A;  1Z6M A;  2ON5 A;  4HUA A;  1Y1U A;  5JWQ B;  3C7M A;  4MJA A;  4NHZ A;  1GUM A;  3IRA A;  4YKF A;  3E9J B;  3IPZ A;  5ECS A;  4ID0 A;  1Q4J A;  6GSS A;  3GKK A;  3VK9 A;  2C0E A;  2X8H A;  3U6V A;  2GLR A;  3HVN A;  3ZIT A;  1XW6 A;  1EGO A;  5J4U A;  3IDV A;  1FOV A;  1OVN A;  5G5E A;  3WGE A;  2VL3 A;  2WZS A;  4HZ4 A;  4OCF A;  1WJK A;  4Q5N A;  3H4K A;  14GS A;  3FR6 A;  4BA7 A;  2HSM B;  2ES7 A;  1ST9 A;  4WBJ A;  3WT1 A;  3KMO A;  5IOW A;  2DIY A;  2L4C A;  5GAN D;  1A23 A;  2JSY A;  3O6T A;  3QAW A;  1UVZ A;  2EFC A;  1AW9 A;  3ME8 A;  1AIU A;  4KDX A;  5ID2 A;  2VLU A;  1ZYQ B;  2XPE A;  1TTZ A;  4MDC A;  3CSH A;  2DC5 A;  4Q5Q A;  2O87 A;  4DEJ A;  3FZ9 A;  2FUG 2;  1TU8 A;  1GTU A;  2IMI A;  4BL7 A;  3KH9 A;  3GTU B;  1XXU A;  1I9D A;  5A4V A;  3FY7 A;  1XG8 A;  3TRP A;  2O8V B;  2C1Y A;  4ICY A;  3S9F A;  4EDZ A;  1N8J A;  3O76 A;  1J08 A;  2VD1 A;  4HS1 A;  4MZB A;  2KOK A;  1R5A A;  3TCO A;  2YJH A;  4PX1 A;  1GUK A;  4Q5F A;  2ON7 A;  4YAV A;  5A1N B;  1K3L A;  2CA8 A;  2IIY A;  4EDY A;  5KN0 A;  2H0I A;  1SD8 A;  2DJK A;  5AGY A;  3O3T A;  3WGD A;  2CVB A;  2FWH A;  2L6C A;  5ECO B;  1JZD A;  1WOU A;  1F6M C;  5IMD A;  4NAX A;  3QOU A;  2NVL A;  5DAK B;  3VWX A;  4L8E A;  1YF0 A;  3M0F A;  1ERT A;  1V58 A;  3C8E A;  4ZL9 A;  1EZK A;  3F6F A;  9GSS A;  5B6M A;  4EXJ A;  3R3E A;  5G1K A;  5G2Z A;  2HSN A;  1RW1 A;  3HY2 A;  2XBQ A;  5H5S A;  2H30 A;  3MSZ A;  1SL2 B;  2BTO T;  1G6W A;  4N0V A;  1A0R P;  2IN3 A;  5ECL B;  1VF4 A;  2XPD A;  1VRS D;  3EE2 A;  1M3I A;  1Z7R A;  2HZE B;  2ZUP A;  4JRR A;  3GX8 A;  3RHC A;  2VCW A;  3JCM L;  3BBY A;  2WCI A;  1QGV A;  1XWA A;  1JLW A;  4KB3 A;  4HI7 A;  2LKU A;  1BED A;  2V32 A;  2B1K A;  2IJY A;  2RM5 A;  4WR4 A;  2BJX A;  2O89 A;  2MMZ A;  2H73 A;  1ZZY A;  5CNW A;  4ML6 A;  3CRT A;  1T8E B;  1T7P B;  2LQQ A;  4GWR A;  4OO5 A;  3HZ8 A;  5AIS A;  2VIM A;  2F9S A;  2VL2 A;  3LXT A;  2A4H A;  4NHW A;  3UAR A;  1EV9 A;  2EFE A;  5LNK e;  3TKS C;  1TJD A;  3Q19 A;  3IBH A;  3LG6 A;  5INY A;  2R37 A;  1PL2 A;  1SU9 A;  4X0X A;  4KCE A;  5DAL A;  3L9U A;  2HYX A;  2LS5 A;  1M2D A;  5JCW A;  1O81 A;  4IW9 A;  4F9Z A;  3GHA A;  2DKI A;  4F0C A;  3LYP A;  1OC3 A;  3WGX A;  1NSW A;  1R4W A;  5KOW A;  4ZB6 A;  4GDF A;  4GF0 A;  3DML A;  2YWI A;  4OO4 A;  1YJ6 A;  1OC8 A;  4H86 A;  3Q18 A;  5FWG A;  4KND A;  2VLT A;  1IYH A;  4YQM A;  4MPG A;  3ED3 A;  2RUE A;  1Z3E A;  3EMP A;  1V57 A;  4CW9 A;  2M46 A;  4ZB9 A;  3FYG A;  4IKH A;  5KN3 A;  4TXO A;  4MJE A;  3ZTL A;  1S3C A;  4BIK A;  2WB9 A;  3I9V 2;  4N30 A;  1XOA A;  3IK9 A;  4J57 E;  5DCG A;  1GUH A;  3IR4 A;  3GUS A;  5EY6 A;  4HOJ A;  1YZX A;  4GST A;  1VF3 A;  2F8F A;  2H1D A;  3W8J A;  4ECC A;  1RK4 A;  5A1N A;  4BVY A;  3U5R E;  2LQO A;  3IOS A;  4AKG A;  2TRX A;  1ZL9 A;  2VCQ A;  4HU9 A;  2WZ9 A;  3UAP A;  3GMF A;  2QA2 A;  2ZNM A;  4ML1 A;  1J0F A;  13GS A;  1ZMA A;  2R0G A;  3ZMK A;  2FLS A;  1V9W A;  2HNL A;  1C72 A;  2H1A A;  2R2J A;  1F3A A;  5ECR B;  1O73 A;  3Q6O A;  2CAQ A;  5DAK A;  2FWE A;  2R6K A;  1FOH A;  1M9A A;  5IMC A;  3VI7 A;  2LTK A;  4FO5 A;  4L0W A;  1PN9 A;  3L4N A;  4ZL8 A;  2PMT A;  1PQN A;  5CRW A;  3RBT A;  3FZ5 A;  3GIX A;  1GSQ A;  4ZB8 A;  3HYP A;  4KUN A;  3EMX A;  1K3O A;  3IHQ A;  1GUL A;  2GZZ A;  5IQY A;  2REM A;  1VF2 A;  4JED A;  3VWV A;  4DSR A;  5ELG A;  4E8E A;  2OE3 A;  2GQK A;  1U6T A;  2MZC A;  1G6Y A;  4I97 A;  5EVO A;  2CVD A;  3W6G A;  2WRT A;  3LEF A;  2HZE A;  4NXI A;  3QPM A;  2VM2 A;  3VPT A;  1BF5 A;  3PGT A;  3HVV A;  3NOF A;  2PBJ A;  1SKS B;  3TKQ A;  2L5O A;  4MK3 A;  3UVH A;  2K8V A;  3E0U A;  2WVY A;  2WUL A;  1SKW B;  2JSZ A;  1OC9 A;  4YAP A;  1V98 A;  3HCZ A;  3QCP A;  1T4Z A;  3HVX A;  3DKS A;  3RGB C;  1YEX A;  2FY6 A;  4BPY A;  5ECQ B;  5ECM B;  1SJI A;  1QXH A;  1M9B A;  4PUF C;  1JZW A;  2YV7 A;  5FT3 A;  1GLP A;  2GTU A;  5GAP D;  1I1I P;  2EFD A;  1F9M A;  2LEG A;  3EU4 A;  3ZVJ A;  3I6A A;  5ENU A;  3P8W A;  5A4U A;  3LGC A;  1TP9 A;  5CO3 A;  4G9H A;  5A5K A;  1AC1 A;  4TW5 A;  10GS A;  2IFQ A;  2O7K A;  2EIO A;  1PX6 A;  5CRH A;  4G01 A;  3HKR A;  2DKH A;  4JU5 A;  3UMA A;  2J9H A;  3EC3 A;  2LRC A;  1AQX A;  1O6J A;  5IMV A;  2CT6 A;  5G30 A;  2IMK A;  4ZBA A;  1OKD A;  5GST A;  1YDK A;  2FA8 A;  2K6V A;  4DSQ A;  5LCZ A;  2YPM A;  4RQR A;  5H5Q A;  5LD0 A;  4MZW A;  1TRU A;  4D73 B;  3QMX A;  19GS A;  4E8H A;  3LYK A;  1KTE A;  4OD7 A;  1K0B A;  1PD2 1;  1AQV A;  2FGX A;  2CX3 A;  1PGT A;  1X0R A;  3DXB A;  3UL3 A;  4TKY A;  5JCU A;  1G7E A;  1R7H A;  2KP2 A;  5EL8 A;  3IAM 2;  2B1L A;  2F8A A;  4XS4 B;  4KDY A;  3PPU A;  4ACS A;  1IYI A;  2LRT A;  2OAD A;  3EVI A;  2C0G A;  1Y6E A;  1RQM A;  3GX0 A;  2V2G A;  4P3Y B;  3GRX A;  3QFA C;  2IL3 A;  1NW2 A;  1T3B A;  3FZA A;  2VCX A;  4FQU A;  4TVE A;  3PH9 A;  4ZBD A;  2QKE A;  2H1G A;  4O5U A;  4K8M A;  4IHU A;  2KP1 A;  1U87 A;  2YWO A;  3CQF A;  2WVX B;  1Y25 A;  3ZIV A;  1USB A;  3PR8 A;  3EUR A;  1UN2 A;  1ERW A;  4TR1 B;  1X9S B;  1SVM A;  4N0Z A;  1X9W B;  4W66 A;  3UEM A;  3TJF A;  1U88 A;  5ECK B;  4PNG A;  4IGJ A;  2OKA A;  3DIE A;  4RI6 A;  4PUR A;  5A5H B;  3CYN A;  2L59 A;  4DVC A;  2GQL A;  1SEN A;  4TN8 A;  3MWH A;  1QFN A;  2H01 A;  3SWL A;  1GRX A;  2H6Z A;  1PMT A;  3VWU A;  2MBS A;  3CTG A;  4POM A;  3RPP A;  5IPH A;  3ZL5 A;  3CSJ A;  4K5S A;  5J47 A;  2IME A;  3A2W A;  3GFK A;  2VUP A;  3Q74 A;  3UBK A;  4Z2U A;  3L78 A; 
#chains in the Genus database with same CATH homology
 3CSI A;  4OWY A;  1A0F A;  3AY8 A;  2D2Z A;  2WS2 A;  2HSH A;  1FO5 A;  5D8I A;  4X1U A;  1EV4 A;  4ZIL A;  1X5D A;  2B7J A;  1LJR A;  1Z6N A;  2OBK A;  2VCZ A;  3A2V A;  4N11 A;  1G0T A;  3F9U A;  2N5B A;  1GSD A;  2HE3 A;  3DD3 A;  6GSY A;  1PA3 A;  2R0P A;  1O7U A;  4WBR D;  3CWG A;  4GSS A;  5JWO B;  3KIJ A;  2AUV A;  3HA9 A;  5D9V A;  4ZXG A;  2JAC A;  1HD2 A;  4XIH A;  4HJM A;  2YJ7 A;  2R0C A;  4GSN A;  1S3D A;  2X8G A;  5BRT A;  1M99 A;  1YY7 A;  1N25 A;  5AIX A;  3F8U A;  5F06 A;  3HDC A;  4K2D A;  4G0K A;  1WPI A;  1SL0 B;  5D73 A;  20GS A;  2V41 A;  5DBQ A;  4POK A;  3E3E A;  3D22 A;  1XWK A;  2O85 A;  4F03 A;  2I3Y A;  1Z5Y E;  2QGV A;  2DLX A;  1V40 A;  2X49 A;  3IHG A;  4V2N A;  2ALB A;  1BAY A;  3J7Y b;  4IEL A;  2YP6 A;  3LXZ A;  4PTS A;  5C00 A;  1K0O A;  4TR4 A;  4AJ6 A;  5J40 A;  2XC2 A;  4EL1 A;  4IJ3 A;  2OJL A;  1FAA A;  3HD5 A;  4XS4 A;  4PQI A;  2E7P A;  4OFT A;  2OT3 A;  1TOF A;  3IC4 A;  2KLX A;  1YKC A;  3GST A;  3F63 A;  1T4Y A;  2J23 A;  4LMW A;  4G2E A;  1ACV A;  2X8C A;  4KW6 A;  3HZ4 A;  2MMO A;  3ZZX A;  2HI7 A;  3NIV A;  1MDK A;  18GS A;  4KE3 A;  4POB A;  5FHI A;  3M1G A;  3KP9 A;  3G9B A;  4MJC A;  1F3B A;  3LFL A;  3FR9 A;  2E2M A;  3QDN A;  4XRD A;  4HJ2 A;  2DSA A;  2XBI A;  3GA4 A;  4NWY A;  2H1B A;  2KHP A;  22GS A;  1TKD B;  11GS A;  4KSO A;  5E59 A;  2PN8 A;  3CMI A;  1O85 A;  3KTB A;  5J4V A;  2JL4 A;  4KF9 A;  1TDI A;  5F05 A;  5A5H A;  4I2U A;  1GSU A;  3IAS 2;  1PX7 A;  1KBN A;  4RQX A;  2G0F A;  1XVQ A;  1XW9 A;  1ML6 A;  1B4P A;  3A5W A;  3M9K A;  3FK8 A;  3IE3 A;  2PWJ A;  3VWW A;  1THO A;  5CRD A;  5HR1 A;  3HVS A;  1SL1 B;  1SJ6 A;  3OR5 A;  5B6N A;  2DJ1 A;  2JZS A;  2P0G A;  3LW9 A;  5KOX A;  5CP1 A;  5DQS A;  2PVQ A;  2JZR A;  1FG4 A;  4L5O A;  1GSS A;  2RUF A;  3DVW A;  4GQF A;  1BYE A;  4J2F A;  5D9X A;  3ZVJ D;  3BOA A;  4LMV A;  4BWQ A;  3UBL A;  1WE0 A;  2H0G A;  3GYK A;  2H19 A;  5GZZ B;  3IC8 A;  4Q5R A;  2HSM A;  1AXD A;  1VF1 A;  2B6M A;  2CX4 A;  1GWC A;  1A8L A;  3QD9 A;  4EC0 A;  4LL1 B;  2YWN A;  1PL1 A;  4OFM A;  4KX4 A;  1O8X A;  2HLS A;  2NDO A;  1SYR A;  2YN1 A;  4GRF A;  3TKS A;  1PKZ A;  4CDO A;  4WF4 A;  4JR6 A;  2WDU A;  1AQW A;  1K0D A;  4IBP A;  4ECJ A;  3GTU A;  2O5V A;  4GXZ A;  2FA4 A;  4A5P A;  1PN0 A;  3UOM A;  5DCH A;  2VL9 A;  1KNG A;  1SK1 A;  1GLQ A;  5DDL A;  2QSI A;  5IMA A;  1BG1 A;  2EC4 A;  1YVL A;  2L57 A;  3TUE A;  3CTF A;  2LNT A;  4FYB A;  5AIV A;  2AV4 A;  2GSS A;  1S3A A;  2MBT A;  3QAG A;  4V1A g;  3GH6 A;  1M0U A;  4MA9 A;  8GSS A;  2PGT A;  3R2Q A;  3KGK A;  5AN1 A;  1EP7 A;  2C0F A;  1GP1 A;  2AAW A;  2OE0 A;  5J9B A;  4PQH A;  5B7C A;  5HQP A;  2C0D A;  2XHF A;  12GS A;  2A2R A;  3TKP A;  3MNG A;  3F4S A;  3ZML A;  1V2A A;  5KEJ A;  3KEB A;  3N5O A;  2L4Q A;  1XWG A;  4O5Q A;  4MJB A;  5IOX A;  1XWB A;  2C3T A;  4G0I A;  1W89 A;  3APS A;  1FW1 A;  2WGR A;  6GSX A;  2YOI A;  3IV4 A;  4HU7 A;  3WT2 A;  3KXO A;  2HRA A;  3G7I A;  3M8N A;  3GN3 A;  1GH2 A;  2CAI A;  2I4A A;  2DJJ A;  1TXU A;  3H1N A;  3HJO A;  2YV9 A;  3DEX A;  1FVK A;  4ZB7 A;  4X4J A;  2VOC A;  5J4Y A;  2FHE A;  3WYW A;  4DSS B;  3QFB C;  3GL3 A;  4ZL7 A;  2UZ8 A;  2X64 A;  1TK0 B;  6GSW A;  4PXO A;  1A2M A;  1ZCP A;  4IP6 A;  4EE0 A;  3SBC A;  4ZIJ A;  1ILO A;  3DYR A;  5DQY A;  5J9C A;  3H93 A;  1ABA A;  4TR0 A;  1TI3 A;  5B8A A;  3TGZ A;  17GS A;  2HXK A;  4MF5 A;  1GSE A;  5J5N A;  1GTI A;  1H75 A;  3ZYW A;  2FCH A;  1QQ2 A;  2GSR A;  1X9M B;  5COH A;  3MDK A;  3BCI A;  1B9Y C;  3F6D A;  1QK8 A;  3LSZ A;  2GST A;  3ZLP A;  4J56 E;  1GNE A;  4QQ7 A;  3TU3 B;  4X43 A;  3P2A A;  1TXX A;  1YKA A;  4AKX B;  5G5F A;  2TRC P;  3VFI A;  5J3R A;  4YH2 A;  2LST A;  5ID2 B;  5ECH B;  4XTS A;  1BJX A;  3I69 A;  2YAN A;  2BMX A;  1WIK A;  5HR3 A;  2I1U A;  2OAC A;  4AI6 A;  4AJ8 A;  3MYD A;  4IP1 A;  5CRG A;  1ZYP A;  3US3 A;  4BL7 B;  4Z7X A;  4YQV A;  4OFN A;  1BX9 A;  2NBS A;  4HDE A;  2L5L A;  2VO4 A;  3LJR A;  3MAK A;  5ECP B;  2FNO A;  2C4J A;  2EIQ A;  1GSF A;  2NPB A;  1F2E A;  2V1M A;  1XWC A;  3H8Q A;  4N3Z A;  4POL A;  1SVO A;  2LRN A;  1A2J A;  1HYU A;  1EP8 A;  2RM6 A;  2PER A;  4K5R A;  1X5C A;  5F07 A;  1Q98 A;  3D5J A;  2VCV A;  1O8W A;  2A2P A;  4AKI A;  1M2A A;  4BWS A;  4IN0 A;  4AJ7 A;  1MEK A;  3KP8 A;  3L0H A;  4TXV A;  1QUW A;  3A2X A;  1M2B A;  3ZIJ A;  4IVF A;  1K0M A;  1JFU A;  4I5Q A;  1SK2 A;  1XIY A;  2PUK C;  5IM9 A;  3L9S A;  2LV3 A;  3FKF A;  4V1A p;  4KCA A;  1TK5 B;  1H4O A;  3RHB A;  1A2L A;  5ECI B;  2CQ9 A;  1HNB A;  2HZF A;  3NZN A;  1LU4 A;  1GL8 A;  5C04 A;  4I6X A;  1XFL A;  1MDI A;  3ZRE A;  2H72 A;  2I81 A;  4CHS A;  3C1R A;  5A34 B;  3G7J A;  1NHO A;  3QAV A;  4GTU A;  5CYY A;  1CQH A;  3D0Z A;  1JLV A;  2CV4 A;  5D9W A;  4K1F A;  4DSS A;  2YCD A;  3TJJ A;  3TJG A;  1LBK A;  2HRF A;  2H6X A;  2R5G A;  3BCK A;  1K3Y A;  2E0Q A;  4XRA A;  3CRU A;  5D93 A;  2AYT A;  3TRX A;  3C71 A;  2C3N A;  5A4W A;  1AAZ A;  4EO3 A;  2HRN A;  4LLR A;  4K2X A;  1B4Q A;  1XZO A;  2K18 A;  4WEY A;  2HFD A;  1M7T A;  3H79 A;  1BQ7 A;  1TI1 A;  5L71 A;  1YF1 A;  3UJ1 A;  1ZGN A;  4NV2 A;  2LJR A;  1SVL A;  3KCM A;  2VAF A;  2MMA A;  4D73 A;  3TOT A;  3GKX A;  3W8S A;  3J7Y k;  1SJZ A;  5DAL B;  4MF7 A;  3A3T A;  3HXS A;  3KD0 A;  1DSB A;  4G0L A;  1THX A;  1TU7 A;  2GS3 A;  3K8N A;  2V6K A;  4PNF A;  5JCG A;  3TKR A;  4KDU A;  3QR6 A;  3TOU A;  4O5R A;  3DVX A;  3KTL A;  2B5E A;  4V2L A;  1ERV A;  4O32 A;  2B7K A;  4TXO B;  2EFH A;  4WKW A;  5DJM A;  1A8Y A;  1WP0 A;  3D4M A;  2IWT A;  3FR3 A;  1CQG A;  1F37 A;  2E2G A;  3D4T A;  4FIW A;  2LJA A;  2DBC A;  3DRN A;  2H1L A;  3GH9 A;  4CY6 A;  3VPQ A;  1YEP A;  4BVY B;  4RI7 A;  2FWF A;  4K0N A;  1B9X C;  3WD6 A;  4L5L A;  4MMM A;  5IPG A;  2GT6 A;  1U3I A;  3HJP A;  4TR1 A;  4FYU A;  5IO0 A;  5DJL A;  4USS A;  1HQO A;  2RLI A;  1GSY A;  5HR0 A;  2DML A;  2YWM A;  4K0G A;  2PPT A;  1TRW A;  1X5E A;  2WFC A;  1JZR A;  3DWV A;  5G31 A;  2GGT A;  4Z2R A;  2WJU A;  3ZFB A;  4GLT A;  3EIN A;  3GUR A;  3LOR A;  1EEM A;  2JU5 A;  4AF2 A;  3F3Q A;  4JE1 A;  3FHK A;  1AUC A;  2JZT A;  1JHB A;  1E6B A;  3P7X A;  4JZQ A;  1ON4 A;  4MNN A;  1SYX A;  2CZ3 A;  16GS A;  3LWA A;  4HEA 2;  2X4A A;  5A34 A;  3TRQ A;  3F4R A;  1EOG A;  3M9J A;  4WR5 A;  5EPF A;  2RII A;  2OBI A;  5IIZ A;  3GNJ A;  3PIN A;  2VL2 C;  2A2S A;  2VLV A;  4F2I A;  1SKR B;  4K7N A;  2H0H A;  3M3M A;  1OC9 B;  2F3M A;  7GSS A;  5D9T A;  2R3X A;  2R4V A;  1DE1 A;  2DJ0 A;  1URM A;  2GZY A;  3BD2 A;  3APQ A;  2X99 A;  5DVB A;  3EYT A;  2PU9 C;  4F82 A;  4KA0 A;  1FB0 A;  3KM6 A;  4IQ1 A;  1XOB A;  5IMZ A;  4YKG A;  2DJ3 A;  1I5G A;  1Z9H A;  1B48 A;  3TDG A;  1NHY A;  4YQU A;  1MD3 A;  3VLN A;  3A5I A;  4WF5 A;  2HT9 A;  2OE1 A;  2IMD A;  5KN1 A;  3GV1 A;  2IFQ B;  2QA1 A;  2GQM A;  4JR4 A;  5D96 A;  6GST A;  5IO2 A;  3ISO A;  2HSY A;  4FYC A;  5ECN B;  4PUA A;  5B8B A;  2N5A A;  1UC7 A;  1TK8 B;  4F0B A;  4GCI A;  4O92 A;  4QL9 A;  4TOP A;  3V1W A;  2CZ2 A;  2GZP A;  3GL5 A;  2VM1 A;  3RDW A;  6GSV A;  2GDR A;  1SK0 A;  4ECB A;  2GSQ A;  4RUV A;  3P90 A;  3FRC A;  2AB6 A;  1R5P A;  2JAD A;  3FMW A;  2OA7 A;  3I43 A;  5G1L A;  3TKS E;  2H8L A;  1W4V A;  4MCU A;  1ZYE A;  5HFK A;  4O7H A;  2H6Y A;  1EOH A;  2K9F A;  1HNA A;  3D21 A;  4GQC A;  4I2T A;  1TRS A;  2K8S A;  4XCS A;  4K7O A;  1GNW A;  2H71 A;  1OE7 A;  5HR2 A;  4Z2T A;  2M80 A;  1MDJ A;  4MPF A;  2H74 A;  1B8X A;  2UV8 G;  1NM3 A;  4IJI A;  3N9J A;  3UIW A;  2A4V A;  1WWJ A;  2P5R A;  4MH3 A;  1EWX A;  5H5R A;  4FH8 A;  1XPV A;  3ZFL A;  2H66 A;  2YNX A;  2B5Y A;  2V6O A;  1GTB A;  4EIQ A;  2H75 A;  1DBY A;  6GSU A;  2GT5 A;  4EUY A;  4ILF A;  3HJM A;  4L0U A;  1U3A A;  4EVM A;  3KJY A;  2C80 A;  2P5Q A;  4I8B A;  2HQT A;  2TIR A;  5KN2 A;  4NMU A;  4V2M A;  2C3Q A;  1J9B A;  5E4W A;  4QMK A;  3VUR A;  2G2Q A;  3HMJ G;  1Z7P A;  3ERW A;  3RPN A;  5JWR B;  4ULX A;  1MD4 A;  3CBU A;  1JZO A;  3C1S A;  3FZ4 A;  1PKW A;  2HRK B;  4BVX B;  2PVO C;  3EU3 A;  2NTO A;  4MH2 A;  1K0N A;  5BMU B;  3G7Y A;  1K0A A;  3ME7 A;  4HZ2 A;  4XS1 A;  4ISD A;  2I9H A;  4KH7 A;  1WMJ A;  1SD9 A;  4AGS A;  1KEB A;  2KUC A;  4NPB A;  5F8B A;  4KAE A;  4WXT A;  2GVP A;  4KSM A;  1OAZ A;  2Z9S A;  3ZRD A;  2L6D A;  2DMM A;  3TJK A;  1K0C A;  2M72 A;  1VGL A;  1BG5 A;  4K7I A;  3DGQ A;  1GTA A;  1ZOF A;  4LA1 A;  5GSS A;  3GKN A;  1OE8 A;  4ZBB A;  1XBS A;  2LJK A;  1T00 A;  1XW5 A;  1TRV A;  1TW9 A;  5HFI A;  4NV5 A;  3ERF A;  4G19 A;  1ERU A;  4MAB A;  2YZU A;  4N10 A;  2H70 A;  2VKZ G;  3UVT A;  5J41 A;  1N2A A;  1E2Y A;  3IK7 A;  4AKH A;  2IMF A;  3KZQ A;  3L9V A;  5ABR A;  4IS0 A;  3FW2 A;  3HHV A;  3F3R A;  3MIX A;  5CAX A;  3GSS A;  2EIR A;  1DUG A;  1PRX A;  2VD0 A;  3ERG A;  3IXR A;  1MTC A;  3KMN A;  1EGR A;  2DJ2 A;  1OYJ A;  2FD3 A;  5CRE A;  2N5F A;  3IA1 A;  2VCT A;  3FEU A;  2H76 A;  3VI5 A;  2MMN A;  3TJB A;  2AJQ B;  1YQ1 A;  2IPA A;  2LNS A;  3CXG A;  4EIP A;  2B3S A;  4K6X A;  2B5X A;  4LL4 B;  3LQ7 A;  3TB2 A;  4G10 A;  4MF6 A;  4JBB A;  3RAZ A;  5HFG A;  1PSQ A;  3D6I A;  1XCC A;  2C8U A;  3BJ5 A;  2FWG A;  2YZH A;  1DE2 A;  4XHM A;  1EEJ A;  1R26 A;  1QMV A;  2MYG A;  5IMF A;  4IQA A;  1WRY A;  2P31 A;  2CVK A;  1G7O A;  2QC7 A;  1UA5 A;  1A24 A;  3F0I A;  4PGT A;  1ZYN A;  3APO A;  2HSN B;  3F4T A;  4MZC A;  4OCE A;  4PQ1 A;  3KH7 A;  1FHE A;  4KGI A;  4HQS A;  4QL7 A;  2LUS A;  4TR3 A;  2F51 A;  4E68 A;  2DIZ A;  4CY8 A;  4ECI A;  3GKM A;  4TRX A;  4K9Z A;  1FB6 A;  1XVW A;  4EF0 A;  3EWL A;  3EPT A;  3C73 A;  5F0G A;  4HQZ A;  2HRK A;  4BVX A;  1OKT A;  2ZCT A;  4OMV A;  5BMU A;  1T1V A;  4EKZ A;  4WET A;  2AHE A;  4MP4 A;  4XS6 A;  5ELA A;  1FVJ A;  4MLY A;  1HNC A;  1Z6M A;  2ON5 A;  4HUA A;  1Y1U A;  5JWQ B;  3C7M A;  4MJA A;  4NHZ A;  1GUM A;  3IRA A;  4YKF A;  3E9J B;  3IPZ A;  5ECS A;  4ID0 A;  1Q4J A;  6GSS A;  3GKK A;  3VK9 A;  2C0E A;  2X8H A;  3U6V A;  2GLR A;  3ZIT A;  1XW6 A;  1EGO A;  5J4U A;  3IDV A;  1FOV A;  1OVN A;  5G5E A;  3WGE A;  2VL3 A;  4HZ4 A;  4OCF A;  1WJK A;  4Q5N A;  3H4K A;  14GS A;  3FR6 A;  4BA7 A;  2HSM B;  2ES7 A;  1ST9 A;  4WBJ A;  3WT1 A;  3KMO A;  5IOW A;  2DIY A;  2L4C A;  5GAN D;  1A23 A;  2JSY A;  3O6T A;  3QAW A;  1UVZ A;  2EFC A;  3ME8 A;  1AW9 A;  1AIU A;  4KDX A;  5ID2 A;  2VLU A;  1ZYQ B;  2XPE A;  1TTZ A;  4MDC A;  3CSH A;  2DC5 A;  4Q5Q A;  2O87 A;  4DEJ A;  3FZ9 A;  2FUG 2;  1TU8 A;  1GTU A;  2IMI A;  4BL7 A;  3KH9 A;  3GTU B;  1XXU A;  1I9D A;  5A4V A;  3FY7 A;  3TRP A;  2O8V B;  2C1Y A;  4ICY A;  3S9F A;  4EDZ A;  1N8J A;  3O76 A;  1J08 A;  2VD1 A;  4HS1 A;  4MZB A;  2KOK A;  1R5A A;  3TCO A;  2YJH A;  4PX1 A;  1GUK A;  4Q5F A;  2ON7 A;  4YAV A;  5A1N B;  1K3L A;  2CA8 A;  2IIY A;  4EDY A;  5KN0 A;  2H0I A;  1SD8 A;  2DJK A;  5AGY A;  3O3T A;  3WGD A;  2CVB A;  2FWH A;  2L6C A;  5ECO B;  1JZD A;  1WOU A;  1F6M C;  5IMD A;  4NAX A;  3QOU A;  2NVL A;  5DAK B;  3VWX A;  4L8E A;  1YF0 A;  3M0F A;  1ERT A;  1V58 A;  3C8E A;  4ZL9 A;  1EZK A;  3F6F A;  9GSS A;  5B6M A;  4EXJ A;  3R3E A;  5G1K A;  5G2Z A;  2HSN A;  1RW1 A;  3HY2 A;  2XBQ A;  5H5S A;  2H30 A;  3MSZ A;  1SL2 B;  2BTO T;  1G6W A;  4N0V A;  1A0R P;  2IN3 A;  5ECL B;  1VF4 A;  2XPD A;  1VRS D;  3EE2 A;  1Z7R A;  2HZE B;  2ZUP A;  4JRR A;  3GX8 A;  3RHC A;  2VCW A;  3JCM L;  3BBY A;  2WCI A;  1QGV A;  1XWA A;  1JLW A;  4KB3 A;  4HI7 A;  2LKU A;  1BED A;  2V32 A;  2B1K A;  2IJY A;  2RM5 A;  4WR4 A;  2BJX A;  2O89 A;  2MMZ A;  2H73 A;  1ZZY A;  5CNW A;  4ML6 A;  3CRT A;  1T8E B;  1T7P B;  2LQQ A;  4GWR A;  4OO5 A;  3HZ8 A;  5AIS A;  2VIM A;  2F9S A;  2VL2 A;  3LXT A;  2A4H A;  4NHW A;  3UAR A;  1EV9 A;  2EFE A;  5LNK e;  3TKS C;  1TJD A;  3Q19 A;  3IBH A;  3LG6 A;  5INY A;  2R37 A;  1PL2 A;  1SU9 A;  4X0X A;  4KCE A;  5DAL A;  3L9U A;  2HYX A;  2LS5 A;  1M2D A;  5JCW A;  1O81 A;  4IW9 A;  4F9Z A;  3GHA A;  2DKI A;  4F0C A;  3LYP A;  1OC3 A;  3WGX A;  1NSW A;  1R4W A;  5KOW A;  4ZB6 A;  4GDF A;  4GF0 A;  3DML A;  2YWI A;  4OO4 A;  1YJ6 A;  1OC8 A;  4H86 A;  3Q18 A;  5FWG A;  4KND A;  2VLT A;  1IYH A;  4YQM A;  4MPG A;  3ED3 A;  2RUE A;  1Z3E A;  3EMP A;  1V57 A;  4CW9 A;  2M46 A;  4ZB9 A;  3FYG A;  4IKH A;  5KN3 A;  4TXO A;  4MJE A;  3ZTL A;  1S3C A;  2WB9 A;  3I9V 2;  4N30 A;  1XOA A;  3IK9 A;  4J57 E;  5DCG A;  1GUH A;  3IR4 A;  3GUS A;  5EY6 A;  4HOJ A;  1YZX A;  4GST A;  1VF3 A;  2F8F A;  2H1D A;  3W8J A;  4ECC A;  1RK4 A;  5A1N A;  4BVY A;  3U5R E;  2LQO A;  3IOS A;  4AKG A;  2TRX A;  1ZL9 A;  2VCQ A;  4HU9 A;  2WZ9 A;  3UAP A;  3GMF A;  2QA2 A;  2ZNM A;  4ML1 A;  1J0F A;  13GS A;  1ZMA A;  2R0G A;  3ZMK A;  2FLS A;  1V9W A;  2HNL A;  1C72 A;  2H1A A;  2R2J A;  1F3A A;  5ECR B;  1O73 A;  3Q6O A;  2CAQ A;  5DAK A;  2FWE A;  2R6K A;  1FOH A;  1M9A A;  5IMC A;  3VI7 A;  2LTK A;  4FO5 A;  4L0W A;  1PN9 A;  3L4N A;  4ZL8 A;  2PMT A;  1PQN A;  5CRW A;  3RBT A;  3FZ5 A;  3GIX A;  1GSQ A;  4ZB8 A;  3HYP A;  4KUN A;  3EMX A;  1K3O A;  3IHQ A;  1GUL A;  2GZZ A;  5IQY A;  2REM A;  1VF2 A;  4JED A;  3VWV A;  4DSR A;  5ELG A;  4E8E A;  2OE3 A;  2GQK A;  1U6T A;  2MZC A;  1G6Y A;  4I97 A;  5EVO A;  2CVD A;  3W6G A;  2WRT A;  3LEF A;  2HZE A;  4NXI A;  3QPM A;  2VM2 A;  3VPT A;  1BF5 A;  3PGT A;  3HVV A;  3NOF A;  2PBJ A;  1SKS B;  3TKQ A;  2L5O A;  4MK3 A;  3UVH A;  2K8V A;  3E0U A;  1SKW B;  2WUL A;  2JSZ A;  1OC9 A;  4YAP A;  1V98 A;  3HCZ A;  3QCP A;  1T4Z A;  3HVX A;  3DKS A;  1YEX A;  2FY6 A;  4BPY A;  5ECQ B;  5ECM B;  1SJI A;  1QXH A;  1M9B A;  4PUF C;  1JZW A;  2YV7 A;  5FT3 A;  1GLP A;  2GTU A;  5GAP D;  2EFD A;  1F9M A;  2LEG A;  3EU4 A;  3ZVJ A;  3I6A A;  5ENU A;  3P8W A;  5A4U A;  3LGC A;  1TP9 A;  5CO3 A;  4G9H A;  5A5K A;  1AC1 A;  4TW5 A;  10GS A;  2IFQ A;  2O7K A;  2EIO A;  1PX6 A;  5CRH A;  4G01 A;  3HKR A;  2DKH A;  4JU5 A;  3UMA A;  2J9H A;  3EC3 A;  2LRC A;  1AQX A;  1O6J A;  5IMV A;  2CT6 A;  5G30 A;  2IMK A;  4ZBA A;  1OKD A;  5GST A;  1YDK A;  2FA8 A;  2K6V A;  4DSQ A;  5LCZ A;  2YPM A;  4RQR A;  5H5Q A;  5LD0 A;  4MZW A;  1TRU A;  4D73 B;  3QMX A;  19GS A;  4E8H A;  3LYK A;  1KTE A;  4OD7 A;  1K0B A;  1PD2 1;  1AQV A;  2FGX A;  2CX3 A;  1PGT A;  1X0R A;  3DXB A;  3UL3 A;  4TKY A;  5JCU A;  1G7E A;  1R7H A;  2KP2 A;  5EL8 A;  3IAM 2;  2B1L A;  2F8A A;  4XS4 B;  4KDY A;  3PPU A;  4ACS A;  1IYI A;  2LRT A;  2OAD A;  3EVI A;  2C0G A;  1Y6E A;  1RQM A;  3GX0 A;  2V2G A;  4P3Y B;  3GRX A;  3QFA C;  2IL3 A;  1NW2 A;  1T3B A;  3FZA A;  2VCX A;  4FQU A;  4TVE A;  3PH9 A;  4ZBD A;  2QKE A;  2H1G A;  4O5U A;  4K8M A;  4IHU A;  2KP1 A;  1U87 A;  2YWO A;  1Y25 A;  3ZIV A;  1USB A;  3PR8 A;  3EUR A;  1UN2 A;  1ERW A;  4TR1 B;  1X9S B;  1SVM A;  4N0Z A;  1X9W B;  4W66 A;  3UEM A;  3TJF A;  1U88 A;  5ECK B;  4PNG A;  4IGJ A;  2OKA A;  3DIE A;  4RI6 A;  4PUR A;  5A5H B;  3CYN A;  2L59 A;  4DVC A;  2GQL A;  1SEN A;  4TN8 A;  3MWH A;  1QFN A;  2H01 A;  3SWL A;  1GRX A;  2H6Z A;  1PMT A;  3VWU A;  2MBS A;  3CTG A;  4POM A;  3RPP A;  5IPH A;  3ZL5 A;  3CSJ A;  4K5S A;  5J47 A;  2IME A;  3A2W A;  3GFK A;  2VUP A;  3Q74 A;  3UBK A;  4Z2U A;  3L78 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...