1F3BA

Crystal structure of mgsta1-1 in complex with glutathione conjugate of benzo[a]pyrene epoxide
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
222
structure length
221
Chain Sequence
AGKPVLHYFNARGRMECIRWLLAAAGVEFEEKFIQSPEDLEKLKKDGNLMFDQVPMVEIDGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYSEGILDLTEMIGQLVLPPDQREAKTALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLEVLLYVEEFDASLLTPFPLLKAFKSRISSLPNVKKFLQPGSQRKPPMDAKQIQEARKAFKIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE YA CHAIN
publication title Residue R216 and catalytic efficiency of a murine class alpha glutathione S-transferase toward benzo[a]pyrene 7(R),8(S)-diol 9(S), 10(R)-epoxide.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 81
structure length 221
sequence length 222
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2000-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1f3bA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1f3bA01
4TN8A 2FHEA 4O32A 1T00A 4OFMA 4ZB9A 2DBCA 2JZTA 3K8NA 4ZB6A 2VLTA 4EDYA 2VLVA 4XIHA 1O81A 3F8UA 2A2SA 4IJ3A 3GKNA 1TU8A 2REMA 2FUG2 2YZUA 4MJEA 1O8WA 3MAKA 1M7TA 2LUSA 4TR3A 1XWKA 4USSA 4K8MA 5G5FA 3WD6A 1R7HA 3GHAA 3TJKA 4X0XA 2ZCTA 5AIXA 5A5KA 1ZL9A 3M1GA 3I69A 2H19A 4F0CA 2GQKA 2BMXA 2PWJA 2JZSA 3G7JA 1EOGA 1B48A 2XPEA 2DJKA 3DD3A 3UVTA 3UMAA 1JLWA 1E6BA 4MPFA 4LL4B 2UZ8A 3IE3A 1OE7A 1AXDA 5DCHA 3RHCA 1TRUA 2DJ1A 2WDUA 2R3XA 5F05A 2PN8A 3EU4A 3BBYA 3LJRA 1XIYA 1VF1A 1A0RP 3ERWA 3O3TA 6GSXA 4WF4A 3TJGA 2EIRA 2RUFA 1G0TA 2CAQA 1NW2A 5IOWA 5AGYA 4YQUA 3DVXA 2EIOA 2OE0A 3HA9A 2YV7A 2OBIA 1T7PB 5DJMA 17GSA 2H01A 2VO4A 1ZYEA 2ZNMA 2LQOA 4N0ZA 4HU7A 4K9ZA 4IELA 5CRHA 4NV2A 3CYNA 3ME7A 4X43A 2WB9A 2CVBA 3IK7A 2LNTA 1GTUA 3IR4A 3UARA 5DALA 1SL1B 3F9UA 1EP8A 3TCOA 3DVWA 3RHBA 2L4CA 1ZYQB 2XBIA 4GF0A 1EV4A 2IJYA 1K0DA 2Z9SA 2N5BA 4ZB8A 1V2AA 4H86A 5CNWA 3V1WA 1ERVA 3GL5A 3KP9A 3QPMA 4JZQA 1Z7PA 2HZFA 4PURA 2HFDA 5JCUA 4WEYA 1A0FA 4KE3A 5AISA 2YWMA 4ZBDA 2DJ2A 1Y6EA 3ERFA 3GNJA 4BWQA 3ZIJA 3TKPA 18GSA 5J5NA 3AY8A 5JWRB 2PVQA 4K1FA 3TGZA 1ON4A 1GTIA 3GKMA 2P5RA 5IO0A 2DJJA 4FQUA 2OBKA 3LWAA 3VPQA 2IMKA 4MPGA 1MDKA 4RI6A 4V2NA 3A2XA 1SL0B 1SJIA 5J3RA 1QMVA 5ECOB 5IMDA 3G7IA 3CRUA 2C80A 4POKA 1PMTA 2PU9C 3Q6OA 3F6FA 3TKRA 4XTSA 2H0HA 1AIUA 1LJRA 1WWJA 3RBTA 5J9BA 4IP6A 1GL8A 3F0IA 3HYPA 4BVXB 2H75A 5IPGA 3I6AA 4ZBBA 1ST9A 5DQSA 2H0IA 4KDYA 2YWIA 2GDRA 3L9VA 1DBYA 4WKWA 2HSMA 3UAPA 3PINA 4JU5A 1PKWA 4IP1A 4KDUA 2HRKB 1BJXA 1F9MA 4MZCA 4TKYA 1GNWA 3DKSA 4WR4A 4E8EA 3IHQA 4TOPA 2LS5A 1G6WA 3LYPA 4LMVA 5IM9A 1PL1A 5F0GA 4XRDA 3L0HA 4PQ1A 1GSQA 2I9HA 5INYA 4KSMA 5F06A 4HEA2 2H30A 3KJYA 3KIJA 2AJQB 1QFNA 5ECHB 3VK9A 4MP4A 1EOHA 5G31A 3CMIA 4MMMA 2F9SA 5J4UA 5HFKA 1Z9HA 4IQAA 1FO5A 3WGDA 4EDZA 1XPVA 1F3BA 2V6KA 1IYHA 2H71A 2QKEA 3HVSA 2B6MA 3GKKA 1R5PA 1TTZA 1GTBA 3D0ZA 1JZRA 4MDCA 4FIWA 3D6IA 2YN1A 4HQZA 1EGOA 2HNLA 2HI7A 1ERWA 1GWCA 2L5LA 1T1VA 4WR5A 3R3EA 4K7IA 1WOUA 4FYUA 1CQGA 4AJ8A 2KUCA 5A4VA 2CT6A 1F37A 3ZMLA 2PBJA 2CZ2A 1B9YC 1BG5A 4MF6A 4I6XA 2EC4A 5JWQB 16GSA 3VI5A 3FKFA 1R5AA 1UVZA 2WGRA 2IMDA 1GH2A 3R2QA 4J57E 4GQFA 1K0AA 1H75A 4RI7A 1SK1A 1Z6MA 5D9VA 1GSYA 1PSQA 4HDEA 4GCIA 3F4RA 4FYCA 5KN3A 1U88A 5EPFA 1X9SB 3KZQA 1PGTA 5HR0A 3KEBA 3FEUA 5G30A 5DAKB 1BX9A 4O7HA 4ECIA 1FG4A 1FVKA 1O6JA 1PX6A 1V40A 2F8AA 1YEPA 3LYKA 1OKTA 4MH2A 4NXIA 1O85A 4BL7B 3SBCA 3CSIA 4OCFA 2YJ7A 2FWEA 3MSZA 4HU9A 4F03A 2IFQB 4KGIA 2RIIA 2GS3A 3QAVA 1OC3A 1XWCA 3QFBC 1TK8B 2CA8A 3FR9A 1FB0A 4GRFA 1NHYA 4BWSA 3ZMKA 1M99A 1XWGA 2P31A 2IMFA 3APQA 3M9JA 5ENUA 5D9XA 5BMUA 4PQHA 3HXSA 5IMFA 1FHEA 4ACSA 4ZBAA 2LSTA 4V1Ap 4D73B 4NHWA 1TP9A 4TR1A 1SK2A 5DCGA 3QOUA 2HT9A 4DVCA 4KAEA 3N5OA 1U3IA 2JSZA 2YWOA 1K3LA 5DQYA 2VD1A 2VUPA 3KTBA 4EC0A 3EC3A 1YKAA 1GNEA 2GGTA 2O7KA 2DIZA 4KSOA 2N5AA 2YCDA 5A4UA 4L0UA 1PL2A 3PPUA 3KMNA 2H66A 5HQPA 1XW6A 3KGKA 3GTUB 6GSVA 3UL3A 2O87A 4PGTA 2XPDA 4ECJA 3C73A 4PUFC 2YPMA 1EEJA 3HJPA 4JEDA 4X1UA 3A5WA 4TR0A 4ECBA 1K3YA 2LEGA 3DRNA 2IIYA 3CTFA 3IPZA 3KM6A 3TDGA 1S3CA 3VFIA 2CVKA 3CTGA 2PMTA 1AQXA 4N30A 3LQ7A 4XS4A 5FHIA 4I5QA 1K0NA 4G9HA 13GSA 2WULA 2L57A 4BPYA 1Z7RA 1HQOA 3M8NA 3FR3A 3VPTA 3LFLA 1MEKA 5B8BA 2FLSA 2HRFA 1F3AA 2VL2C 2YOIA 2K18A 22GSA 4XHMA 3L78A 3C8EA 1QUWA 1ZZYA 1ACVA 3LGCA 4V2LA 1NHOA 1K0CA 3RAZA 5H5RA 4IW9A 3JCML 3QAWA 1GLQA 1CQHA 1JLVA 2GZYA 5D9WA 4IHUA 4ML6A 3QD9A 2NTOA 4N10A 1RW1A 1AC1A 1K3OA 3E9JB 2NPBA 3TKSC 2P0GA 2DC5A 2FD3A 1YZXA 1SJZA 10GSA 3HKRA 4JBBA 2DMLA 1K0OA 2CVDA 5ID2A 2F3MA 5D93A 4DEJA 2CX4A 4RQXA 3FZ9A 4IJIA 2LJRA 3I9V2 4RUVA 5EY6A 5A4WA 2C8UA 3GKXA 5E4WA 2H6ZA 1URMA 3KH7A 5FT3A 1X9WB 3PR8A 5IMCA 1THOA 3HJMA 1O7UA 4TR4A 3UVHA 3NOFA 5JWOB 3TRXA 1OAZA 1W4VA 1X5CA 1U87A 1ZOFA 3QDNA 1SKWB 2MBSA 1GUHA 2GVPA 1A24A 3C7MA 2N5FA 2E2MA 2VL3A 5IMAA 3D22A 4YAVA 2IMEA 2IL3A 3S9FA 4NPBA 4IN0A 1HNAA 3KMOA 2GSTA 2DSAA 3KXOA 3LEFA 2GSSA 3TB2A 1M0UA 3P90A 4GSNA 2FY6A 2FCHA 4HJ2A 2HRNA 3BD2A 2K8SA 4MABA 5CO3A 3EURA 2OADA 3TJJA 2V32A 1TW9A 1Q4JA 1MDJA 2B3SA 3D4MA 2VLUA 1AQWA 1EEMA 2QSIA 3FK8A 4JE1A 2D2ZA 2VL9A 3GURA 3VWWA 3QAGA 1THXA 4GLTA 4Q5RA 2K8VA 1VF3A 3GA4A 1GSFA 3HJOA 1X5EA 2YP6A 6GSUA 4BVXA 1J0FA 6GSWA 2L6CA 2L5OA 5KEJA 5IQYA 4HUAA 3PGTA 4MK3A 1SKSB 1WP0A 1X9MB 4LLRA 1EP7A 1A8LA 5LNKe 2CQ9A 1AAZA 3VLNA 4ZL9A 3ERGA 5G1KA 5GAND 5G5EA 4E8HA 5EL8A 2HRKA 3UEMA 3KP8A 2WRTA 4JR4A 1XCCA 5JCWA 5AIVA 3GL3A 1UA5A 1ABAA 2H6YA 4GQCA 2H1AA 3FZ4A 2PERA 1OYJA 4L8EA 2IN3A 1X5DA 5F8BA 2TIRA 2X8HA 1TRSA 1SJ6A 3QCPA 2YV9A 2R5GA 1XOBA 2E7PA 4I2TA 1OC8A 4G2EA 1BEDA 2B7KA 5D96A 1FB6A 2V1MA 4KDXA 1DE2A 4ML1A 4BVYA 5DJLA 3EYTA 1FOVA 3BCIA 4POBA 1WIKA 2OE3A 2QGVA 4EE0A 4OO4A 3GUSA 4NHZA 2WFCA 1Z5YE 3TJBA 4OFNA 1ILOA 2LJKA 1PA3A 3ZIVA 8GSSA 1TDIA 4HZ2A 5ECSA 4F82A 3RPPA 2B1LA 2JACA 5J41A 2OE1A 1UN2A 2RM6A 1A2LA 4G10A 3IV4A 1W89A 3IAM2 4LMWA 2VCZA 1T4ZA 4P3YB 4TXOA 3PH9A 5D9TA 4KCAA 7GSSA 1F2EA 2J9HA 3UOMA 1A2JA 1NM3A 1MD3A 3C1RA 1LU4A 2PVOC 5JCGA 5KN1A 3HVXA 4POLA 2I3YA 4PUAA 1QQ2A 3APOA 2H73A 5H5SA 2H6XA 1Y25A 2WCIA 1TRVA 1ERTA 2DLXA 2VL2A 4OCEA 3UIWA 5E59A 2HSHA 5IMVA 5ABRA 3TJFA 1RK4A 3ZVJA 2VM2A 1N8JA 2LRTA 4WF5A 2VCVA 5ECIB 4XRAA 1AUCA 2HQTA 5LCZA 2R4VA 2GTUA 2AHEA 4POMA 1GSEA 3BOAA 4ILFA 3RPNA 4KF9A 2MZCA 3ZL5A 1Q98A 4KNDA 5COHA 2HXKA 5G1LA 3EMXA 4OMVA 2QC7A 2L6DA 3FW2A 2R6KA 2L59A 2GZZA 4BL7A 2ALBA 3KTLA 1OC9B 1R26A 4WETA 4F2IA 5ELAA 1GSSA 1GSUA 3APSA 2X8GA 3G9BA 4EVMA 4DSSA 4J2FA 5KN2A 5IOXA 1AQVA 3ME8A 1S3AA 4EXJA 2C3TA 3ZYWA 1SYRA 3HVVA 3FR6A 3L9UA 3GV1A 4QL7A 4ZIJA 1TI3A 2LJAA 3ZRDA 4MJBA 4K7NA 4IS0A 3H8QA 3I43A 1YF1A 5B8AA 1MTCA 1YY7A 2VD0A 3F4TA 5F07A 4CHSA 3LXTA 2MYGA 2MMZA 1TK0B 12GSA 1PQNA 2K6VA 2K9FA 1YJ6A 3CRTA 3DYRA 3KD0A 3FRCA 2E2GA 1I9DA 3A2WA 2A4VA 2B5XA 2HSNB 1VF4A 1GUMA 1R4WA 2GSQA 3CSHA 2HE3A 3FHKA 4AJ7A 2HRAA 2P5QA 2JSYA 2B1KA 1Z3EA 4K0GA 1YF0A 5C00A 5ECKB 1SU9A 2LRCA 1ZGNA 4Q5NA 1A2MA 3DEXA 19GSA 1ERUA 3F3QA 2RM5A 1YKCA 3GTUA 3HD5A 4RQRA 2DMMA 4KH7A 4OFTA 3OR5A 4I97A 2I81A 3DXBA 3GIXA 4WBJA 4XCSA 5D73A 1E2YA 2KOKA 1JFUA 5B6NA 4PX1A 1TJDA 4HJMA 3W8JA 1O73A 1VRSD 3NZNA 2H70A 3D21A 3H79A 3HHVA 2R2JA 1AW9A 4K2DA 3EMPA 3ZREA 1XFLA 4J56E 2VCTA 4ISDA 4WXTA 2C0EA 3IA1A 2FNOA 4K7OA 2AUVA 1HNBA 1A8YA 2NDOA 3KH9A 3WGXA 1USBA 2M46A 3LXZA 2GSRA 2JL4A 1JZWA 3F63A 5ECMB 2C3NA 1RQMA 3IK9A 1M2BA 3O76A 3US3A 2R37A 3ZFBA 4TXVA 4IGJA 1M2AA 4WBRD 5B6MA 4YAPA 2FA4A 3G7YA 1YDKA 3D4TA 3VURA 3HZ8A 2YJHA 3MDKA 1GULA 4IQ1A 2EIQA 1PX7A 1XWAA 2VM1A 1C72A 4K0NA 5ELGA 4L0WA 2CX3A 4TRXA 4KW6A 2GT6A 2DIYA 1SL2B 2OACA 4ZL8A 1TKDB 3EU3A 1PRXA 3VWVA 3HDCA 2IPAA 4V2MA 1TI1A 2RLIA 3ED3A 2M72A 4NWYA 1FAAA 3IBHA 4MJAA 3EWLA 2C0GA 1YQ1A 4TVEA 1TK5B 5HFIA 4GTUA 2YWNA 2DJ0A 4ID0A 1G7EA 3DWVA 1NSWA 3U6VA 4PNFA 1BYEA 5HR2A 2HZEB 3H1NA 2CZ3A 2H76A 1GTAA 5IIZA 1TU7A 2MMOA 2KP2A 4MA9A 4KCEA 4Z7XA 4ECCA 3ZFLA 2RUEA 3L4NA 4OO5A 4ZXGA 3HY2A 5H5QA 3C1SA 3Q18A 5IO2A 4XS4B 1EZKA 4EUYA 2XC2A 4Q5QA 2PGTA 1SD8A 4G0LA 4HQSA 2JZRA 3IXRA 3UJ1A 4L5LA 3WGEA 5GAPD 3ISOA 2NVLA 4AF2A 1PKZA 1X0RA 1M9AA 1PN9A 3O6TA 4HZ4A 3CBUA 3L9SA 2PPTA 3VI7A 1B4QA 1IYIA 2BJXA 2ES7A 3ZZXA 3WYWA 3MNGA 2GZPA 2OJLA 5EVOA 1K0MA 3TRQA 4DSRA 2VCWA 4NV5A 2CV4A 1QGVA 1ZMAA 1B4PA 1HYUA 4FH8A 3GRXA 1B8XA 2HLSA 3ZITA 1TOFA 3QR6A 2LKUA 5ID2B 2O85A 4Q5FA 4F0BA 3GMFA 1XW9A 2V2GA 2C0DA 4G0IA 2XHFA 9GSSA 4ZL7A 2ON7A 1QK8A 1M9BA 3P7XA 2LTKA 2YANA 2GLRA 2KP1A 1SD9A 1G6YA 1JZOA 5B7CA 5GZZB 4IBPA 1SYXA 2M80A 2X99A 2YNXA 2LNSA 1XOAA 1J9BA 1EWXA 2V41A 1MDIA 3IRAA 1ZCPA 2AYTA 3UBKA 5HR3A 4BA7A 4KB3A 5CRGA 2YZHA 3IOSA 3VWXA 1FVJA 5HR1A 4XS6A 3M9KA 3IDVA 5DALB 1MD4A 3GN3A 1K0BA 3BCKA 3UBLA 5KN0A 3A3TA 4EKZA 5ECRB 1GLPA 4OD7A 2ON5A 3N9JA 1H4OA 1LBKA 2H1GA 3FYGA 5FWGA 6GSTA 2C0FA 2ZUPA 2CAIA 1DUGA 2C3QA 1M2DA 5G2ZA 2FWGA 4YQVA 11GSA 2I1UA 4LA1A 4OWYA 1G7OA 1EGRA 2AB6A 2DJ3A 1OVNA 3P8WA 3GSSA 3DGQA 3ZVJD 1EV9A 1HNCA 1YEXA 1KEBA 1VGLA 3QMXA 4XS1A 1F6MC 4L5OA 2G2QA 1OKDA 4CW9A 2OA7A 3F4SA 1S3DA 2H72A 2GT5A 2GQMA 4TW5A 4KX4A 2VOCA 1BAYA 1Z6NA 1GUKA 4I2UA 1V57A 2X64A 4NMUA 1UC7A 3Q19A 6GSYA 3TUEA 3E0UA 4MZWA 1DSBA 4QL9A 3VWUA 2X8CA 5DBQA 3CSJA 2VCQA 2O89A 4I8BA 3FY7A 2TRXA 1OC9A 4IKHA 2B5EA 1XVQA 2FWFA 2IMIA 2LV3A 1B9XC 2NBSA 3MWHA 1WE0A 3GX0A 4V1Ag 1VF2A 1WJKA 2J23A 1GSDA 4PNGA 4NAXA 1XZOA 4GWRA 1XVWA 3D5JA 5C04A 4MF5A 4JRRA 4G0KA 3GH6A 2HSMB 4BVYB 1FW1A 1WMJA 1V9WA 2FGXA 3J7Yb 4MJCA 20GSA 2BTOT 2KHPA 4JR6A 5D8IA 4N0VA 5IPHA 2IWTA 5ECPB 5DAKA 3TKSA 3WT1A 4G19A 4MF7A 3IC4A 3U5RE 5J9CA 2OKAA 1SENA 3M3MA 5HFGA 4FO5A 4HS1A 3H4KA 1HD2A 3M0FA 3GH9A 3EINA 3EVIA 4KUNA 4TXOB 1GP1A 3GSTA 2VCXA 4DSQA 5GSTA 2IFQA 3P2AA 3W8SA 2F8FA 4MZBA 2VIMA 1ML6A 4GSSA 4PTSA 2O8VB 4HOJA 5ECNB 5DDLA 1N2AA 4GSTA 2H1DA 3IC8A 1PD21 1V98A 2PUKC 2WS2A 2FA8A 3F3RA 2JADA 3H93A 2H8LA 3TKSE 1T4YA 4CDOA 3LSZA 1T3BA 3LORA 3GX8A 4D73A 2MMAA 4YQMA 1DE1A 3NIVA 4EO3A 2VAFA 2HYXA 3DMLA 3QFAC 2AV4A 5CYYA 1A23A 1TXXA 3LG6A 1KBNA 2H1BA 2GQLA 5L71A 2H74A 3HZ4A 2B5YA 4K6XA 3Q74A 4QQ7A 3J7Yk 3ZTLA 2WJUA 5ECQB 1TRWA 2F51A 4EF0A 4HI7A 5GSSA 1XBSA 2H0GA 2L4QA 2A2RA 1XW5A 4ZILA 2HSYA 3WT2A 3FZ5A 3BJ5A 5DVBA 4DSSB 3KCMA 3E3EA 1WRYA 4LL1B 4AJ6A 2I4AA 5IMZA 4F9ZA 3HCZA 1GRXA 1XXUA 5CAXA 3C71A 1JHBA 5ECLB 1U6TA 3ZLPA 1JZDA 4YH2A 2FWHA 6GSSA 2E0QA 2AAWA 2KLXA 4ULXA 3IAS2 3A2VA 5CRDA 4IVFA 3FZAA 1KNGA 4N11A 3EE2A 3RDWA 3SWLA 3GFKA 4AGSA 1O8XA 5CP1A 5CREA 3DIEA 4GXZA 1OE8A 5LD0A 3W6GA 1U3AA 2TRCP 1V58A 3TKQA 5AN1A 4KA0A 2MBTA 4O92A 4MLYA 4O5RA 1BQ7A 4EL1A 3TOTA 1I5GA 1J08A 5CRWA 2V6OA 1T8EB 4MCUA 4PXOA 14GSA 2HZEA 2C1YA 1QXHA 3GYKA 3TOUA 1SKRB 2MMNA 4TR1B 1KTEA 4FYBA 4PQIA 2JU5A 2G0FA 3TRPA 2LRNA 2B7JA 2C4JA 1XWBA 2WZ9A 1WPIA 3F6DA 2LQQA 1SK0A 2XBQA 3CXGA 4MH3A
chains in the Genus database with same CATH superfamily
4TN8A 2FHEA 4O32A 1T00A 4OFMA 4ZB9A 2DBCA 2JZTA 3K8NA 4ZB6A 2VLTA 4EDYA 2VLVA 4XIHA 3RGBC 1O81A 3F8UA 2A2SA 4IJ3A 3GKNA 1TU8A 2REMA 2FUG2 2YZUA 4MJEA 1O8WA 3MAKA 1M7TA 2LUSA 3MYDA 4TR3A 1XWKA 4USSA 4K8MA 5G5FA 3WD6A 1R7HA 3GHAA 3TJKA 4X0XA 2ZCTA 5AIXA 5A5KA 1ZL9A 3M1GA 3I69A 2H19A 4F0CA 2GQKA 2BMXA 2PWJA 2JZSA 3G7JA 1EOGA 1B48A 2XPEA 2DJKA 3DD3A 3UVTA 3UMAA 1JLWA 1E6BA 4MPFA 4LL4B 2UZ8A 3IE3A 1OE7A 4CY8A 1AXDA 5DCHA 3RHCA 1TRUA 2DJ1A 2WDUA 2R3XA 5F05A 5J47A 2PN8A 3EU4A 3BBYA 3LJRA 1XIYA 1VF1A 1A0RP 3ERWA 3O3TA 6GSXA 4WF4A 3TJGA 2EIRA 2RUFA 1G0TA 2CAQA 1NW2A 5IOWA 5AGYA 4YQUA 3DVXA 2EIOA 2OE0A 3HA9A 2YV7A 2OBIA 1T7PB 5DJMA 17GSA 2H01A 2VO4A 1ZYEA 2ZNMA 4ICYA 1I1IP 2LQOA 4N0ZA 4HU7A 4K9ZA 4IELA 5CRHA 4NV2A 3CYNA 3ME7A 4X43A 2WB9A 2CVBA 3IK7A 2LNTA 1GTUA 3IR4A 3UARA 5DALA 1SL1B 3F9UA 1EP8A 3TCOA 3DVWA 3RHBA 2L4CA 1ZYQB 2XBIA 4GF0A 1EV4A 2IJYA 1K0DA 2Z9SA 2N5BA 4ZB8A 1V2AA 4CY6A 4H86A 5CNWA 3V1WA 1ERVA 3GL5A 3KP9A 3QPMA 4JZQA 1Z7PA 2HZFA 4PURA 2HFDA 5JCUA 4WEYA 1A0FA 4KE3A 5AISA 2YWMA 4ZBDA 2DJ2A 1Y6EA 3ERFA 3GNJA 4BWQA 3ZIJA 3TKPA 18GSA 5J5NA 3AY8A 5JWRB 2WVZA 2PVQA 4K1FA 3TGZA 1ON4A 1GTIA 3GKMA 2P5RA 5IO0A 2DJJA 4FQUA 2OBKA 3LWAA 3VPQA 2IMKA 4MPGA 1MDKA 4RI6A 4V2NA 3A2XA 1SL0B 1SJIA 5J3RA 1QMVA 5ECOB 5IMDA 3G7IA 3CRUA 2C80A 1TXUA 4POKA 1PMTA 2PU9C 3Q6OA 3F6FA 3TKRA 4XTSA 2H0HA 1AIUA 1LJRA 1WWJA 3HMJG 3RBTA 5J9BA 4IP6A 1GL8A 3F0IA 3HYPA 4BVXB 2H75A 5IPGA 3I6AA 4ZBBA 1ST9A 5DQSA 2H0IA 2QA2A 4KDYA 2YWIA 2GDRA 2DKIA 3L9VA 1DBYA 4WKWA 2HSMA 3UAPA 3PINA 4JU5A 1PKWA 4IP1A 4KDUA 2HRKB 1BJXA 1F9MA 4MZCA 4PHZC 4O5QA 4TKYA 1GNWA 3DKSA 4WR4A 4K5SA 4E8EA 3IHQA 4TOPA 2LS5A 1G6WA 3LYPA 4LMVA 5IM9A 1PL1A 5F0GA 4XRDA 3L0HA 4PQ1A 1GSQA 2I9HA 5INYA 4KSMA 5F06A 4HEA2 2H30A 3KJYA 3KIJA 2AJQB 1QFNA 5ECHB 3VK9A 4MP4A 1EOHA 5G31A 3CMIA 4MMMA 2F9SA 5J4UA 2QA1A 5HFKA 1Z9HA 2WW3A 4IQAA 1FO5A 3WGDA 4EDZA 1XPVA 1F3BA 2V6KA 1IYHA 2H71A 2QKEA 3HVSA 2B6MA 3GKKA 1R5PA 1TTZA 1GTBA 3D0ZA 1JZRA 4MDCA 4FIWA 3D6IA 2YN1A 4HQZA 1EGOA 2HNLA 3FMWA 2HI7A 1ERWA 1GWCA 2L5LA 1T1VA 1YEWC 4WR5A 3R3EA 4K7IA 1WOUA 4BIKA 4FYUA 1CQGA 4AJ8A 2KUCA 5A4VA 2CT6A 1F37A 3EPTA 3ZMLA 2EFDA 2PBJA 2CZ2A 1B9YC 1BG5A 4MF6A 3IHGA 4I6XA 2EC4A 5JWQB 16GSA 2A2PA 3VI5A 3FKFA 1R5AA 1UVZA 2WGRA 2IMDA 1GH2A 3R2QA 4J57E 4GQFA 1K0AA 1H75A 4RI7A 1SK1A 1Z6MA 5D9VA 1GSYA 1PSQA 4HDEA 4GCIA 3F4RA 4FYCA 5KN3A 4EIPA 1U88A 5EPFA 2O36A 1X9SB 3KZQA 1PGTA 5HR0A 3MIXA 3KEBA 1ZYPA 3FEUA 5G30A 5DAKB 1BX9A 4O7HA 4ECIA 1FG4A 1FVKA 1O6JA 1PX6A 1V40A 2F8AA 1YEPA 3LYKA 1OKTA 4MH2A 4NXIA 1O85A 4BL7B 3SBCA 4AKIA 3CSIA 4OCFA 2YJ7A 2FWEA 3MSZA 4HU9A 4F03A 2IFQB 4KGIA 2RIIA 2GS3A 3QAVA 1OC3A 1XWCA 3QFBC 1TK8B 2CA8A 3FR9A 1FB0A 4GRFA 1NHYA 1M3IA 4BWSA 3ZMKA 1M99A 1XWGA 2P31A 2IMFA 3APQA 3M9JA 5ENUA 5D9XA 5BMUA 4PQHA 3HXSA 5IMFA 1FHEA 4ACSA 4ZBAA 2LSTA 4V1Ap 4D73B 4NHWA 1TP9A 4TR1A 1SK2A 5DCGA 3QOUA 2HT9A 4DVCA 4KAEA 3N5OA 1U3IA 2JSZA 2YWOA 1K3LA 5A5HA 5DQYA 2VD1A 2VUPA 3KTBA 4EC0A 3EC3A 1YKAA 1SVMA 1GNEA 2GGTA 2O7KA 2DIZA 4KSOA 2N5AA 2YCDA 5A4UA 4L0UA 1PL2A 1PFOA 3PPUA 3KMNA 2H66A 4Z2UA 5HQPA 1XW6A 3KGKA 3GTUB 6GSVA 3UL3A 2O87A 4PGTA 2XPDA 1Y1UA 4ECJA 3C73A 4PUFC 2YPMA 1EEJA 3HJPA 4JEDA 4X1UA 3A5WA 4TR0A 4ECBA 1K3YA 2LEGA 3DRNA 2IIYA 3CTFA 3IPZA 3KM6A 3TDGA 1XG8A 1S3CA 3VFIA 2CVKA 3CTGA 2PMTA 1AQXA 4N30A 3LQ7A 4XS4A 5FHIA 4I5QA 1K0NA 4G9HA 13GSA 2WULA 2L57A 4BPYA 1Z7RA 1HQOA 3M8NA 3FR3A 3VPTA 3LFLA 1MEKA 5B8BA 2FLSA 2HRFA 1F3AA 2VL2C 2YOIA 2K18A 22GSA 4XHMA 3L78A 3C8EA 1QUWA 1ZZYA 1ACVA 3LGCA 4V2LA 1NHOA 1K0CA 3RAZA 5H5RA 4IW9A 3JCML 3QAWA 1GLQA 1CQHA 1JLVA 2GZYA 5D9WA 4IHUA 4ML6A 2NTOA 3QD9A 4N10A 1RW1A 1AC1A 2EFHA 1K3OA 3E9JB 2NPBA 3TKSC 2P0GA 2DC5A 2FD3A 1YZXA 1SJZA 10GSA 3HKRA 4JBBA 2DMLA 1K0OA 2CVDA 5ID2A 2F3MA 5D93A 4DEJA 2CX4A 4RQXA 3FZ9A 4IJIA 2WVXB 2LJRA 3I9V2 4RUVA 5EY6A 5A4WA 2C8UA 3GKXA 5E4WA 2H6ZA 1URMA 3KH7A 5FT3A 2A4HA 2R0PA 1X9WB 3PR8A 5IMCA 1THOA 3HJMA 1O7UA 4TR4A 3UVHA 4ZB7A 3NOFA 5JWOB 3TRXA 1OAZA 1W4VA 1X5CA 1U87A 1ZOFA 3QDNA 1SKWB 2MBSA 1GUHA 2GVPA 2R0GA 4GDFA 1A24A 3C7MA 2N5FA 2E2MA 2VL3A 5IMAA 3D22A 4YAVA 2IMEA 2IL3A 3S9FA 4NPBA 4IN0A 1HNAA 3KMOA 2GSTA 2DSAA 3KXOA 3LEFA 2GSSA 3TB2A 1M0UA 3P90A 4GSNA 2FY6A 2FCHA 4HJ2A 2HRNA 3BD2A 2K8SA 4MABA 5CO3A 3EURA 2OADA 3TJJA 1SVOA 1S4BP 2V32A 1TW9A 1Q4JA 1MDJA 2B3SA 3D4MA 2VLUA 1AQWA 1EEMA 2QSIA 3FK8A 4JE1A 2D2ZA 2VL9A 3GURA 3VWWA 3QAGA 1THXA 4GLTA 4Q5RA 2K8VA 1VF3A 3GA4A 1GSFA 3HJOA 1X5EA 2YP6A 6GSUA 4BVXA 1J0FA 6GSWA 2L6CA 2L5OA 5KEJA 5IQYA 4HUAA 3PGTA 4MK3A 1SKSB 2EFEA 1WP0A 1X9MB 4LLRA 1EP7A 1A8LA 5LNKe 2CQ9A 1AAZA 3VLNA 4ZL9A 3ERGA 5G1KA 5GAND 5G5EA 4E8HA 5EL8A 2HRKA 3UEMA 3KP8A 2WRTA 4JR4A 1XCCA 5JCWA 4EIQA 5AIVA 3GL3A 1UA5A 1ABAA 2H6YA 1ZYNA 4GQCA 2H1AA 3FZ4A 2PERA 1OYJA 4L8EA 2IN3A 1X5DA 5F8BA 2TIRA 2X8HA 4K2XA 1TRSA 1SJ6A 3QCPA 2YV9A 2R5GA 2H1LA 1XOBA 2E7PA 4I2TA 1OC8A 4G2EA 1BEDA 2B7KA 5D96A 1FB6A 2V1MA 4KDXA 1DE2A 4ML1A 4BVYA 5DJLA 3EYTA 1FOVA 3BCIA 4POBA 1WIKA 2OE3A 2QGVA 4EE0A 4OO4A 3GUSA 4NHZA 2WFCA 1Z5YE 3TJBA 4OFNA 1ILOA 2LJKA 1PA3A 3ZIVA 8GSSA 1TDIA 4HZ2A 5ECSA 4F82A 3RPPA 2B1LA 2JACA 5J41A 2OE1A 1UN2A 2RM6A 1A2LA 4G10A 2X49A 3IV4A 5J4VA 1W89A 3IAM2 4LMWA 2VCZA 1T4ZA 4P3YB 4TXOA 3PH9A 5D9TA 4KCAA 7GSSA 1F2EA 2J9HA 3UOMA 1A2JA 1NM3A 1MD3A 3C1RA 1LU4A 2PVOC 5JCGA 5KN1A 3HVXA 4POLA 2I3YA 4PUAA 1QQ2A 3APOA 2H73A 5H5SA 2H6XA 1Y25A 2WCIA 1TRVA 1ERTA 2DLXA 2VL2A 4OCEA 3UIWA 5E59A 2HSHA 5IMVA 5ABRA 3TJFA 1RK4A 3ZVJA 2VM2A 1N8JA 2LRTA 4WF5A 2VCVA 5ECIB 1PN0A 4XRAA 1AUCA 2HQTA 5LCZA 2R4VA 2GTUA 2AHEA 4POMA 1GSEA 3BOAA 4ILFA 3RPNA 4KF9A 2MZCA 3ZL5A 1Q98A 4KNDA 1S3RA 5COHA 2HXKA 5G1LA 3EMXA 1M3JA 4OMVA 2QC7A 2L6DA 3FW2A 2R6KA 2L59A 2GZZA 4BL7A 2ALBA 3KTLA 1OC9B 1R26A 4WETA 4F2IA 5ELAA 5J40A 1GSSA 1GSUA 3APSA 2X8GA 3G9BA 4EVMA 4DSSA 4J2FA 5KN2A 5IOXA 1AQVA 3ME8A 1S3AA 4EXJA 2C3TA 3ZYWA 1SYRA 3HVVA 3FR6A 3L9UA 3GV1A 2OT3A 4QL7A 4ZIJA 1TI3A 2LJAA 3ZRDA 5KOWA 4MJBA 4K7NA 4IS0A 3H8QA 3I43A 1YF1A 5B8AA 1MTCA 1YY7A 2VD0A 3F4TA 5F07A 4CHSA 3LXTA 2MYGA 2MMZA 1TK0B 12GSA 1PQNA 2K6VA 2K9FA 1YJ6A 3CRTA 3DYRA 3KD0A 1SVLA 3FRCA 2E2GA 1I9DA 3A2WA 2A4VA 2B5XA 5BRTA 2HSNB 1VF4A 1GUMA 1R4WA 2GSQA 3CSHA 2HE3A 3FHKA 4AJ7A 2HRAA 2P5QA 2JSYA 2B1KA 1Z3EA 4K0GA 1YF0A 5C00A 5A1NA 5ECKB 1SU9A 5J4YA 2WW0A 2LRCA 1ZGNA 4Q5NA 1A2MA 3DEXA 19GSA 4Z2TA 1ERUA 3F3QA 4PI2C 2RM5A 1YKCA 3GTUA 3HD5A 4RQRA 2DMMA 4KH7A 4OFTA 3OR5A 4I97A 5KOXA 2I81A 4YKFA 3DXBA 3GIXA 4WBJA 4XCSA 5D73A 1E2YA 2KOKA 1JFUA 5A34A 5B6NA 4PX1A 1TJDA 4HJMA 3W8JA 2VKZG 1O73A 1VRSD 3NZNA 2H70A 3D21A 2X4AA 3H79A 3HHVA 2R2JA 1AW9A 4K2DA 3EMPA 3ZREA 1XFLA 4J56E 2VCTA 4ISDA 4WXTA 2C0EA 3IA1A 2FNOA 3HVNA 4K7OA 2AUVA 1HNBA 4N3ZA 1A8YA 2NDOA 3KH9A 3WGXA 1USBA 2M46A 4AKXB 3LXZA 2GSRA 1YVLA 2JL4A 1JZWA 3F63A 5ECMB 2C3NA 1RQMA 3IK9A 1M2BA 3O76A 3TU3B 3US3A 1N25A 3ZFBA 2R37A 4TXVA 4IGJA 1M2AA 4WBRD 5B6MA 4YAPA 2FA4A 5BMUB 3G7YA 1YDKA 3D4TA 3VURA 3HZ8A 2YJHA 3MDKA 1GULA 4IQ1A 2EIQA 1PX7A 1XWAA 2VM1A 2WW1A 1C72A 4K0NA 5ELGA 4L0WA 2CX3A 4TRXA 4KW6A 2GT6A 2DIYA 1SL2B 2OACA 4ZL8A 1TKDB 3EU3A 1PRXA 3VWVA 3HDCA 2IPAA 4V2MA 1TI1A 2RLIA 3ED3A 2M72A 4NWYA 2WVXA 1FAAA 3IBHA 4MJAA 3EWLA 2C0GA 1YQ1A 4AKGA 4O5UA 4TVEA 1TK5B 5HFIA 4GTUA 2YWNA 2DJ0A 4ID0A 1G7EA 3DWVA 1NSWA 3U6VA 4PNFA 1BYEA 5HR2A 2HZEB 3H1NA 2CZ3A 2H76A 1GTAA 5IIZA 1TU7A 2MMOA 2KP2A 4MA9A 4KCEA 4Z7XA 4ECCA 3ZFLA 2RUEA 3L4NA 3CQFA 4OO5A 4ZXGA 4A5PA 2EFCA 3HY2A 5H5QA 3C1SA 3Q18A 5IO2A 4XS4B 1EZKA 4EUYA 2XC2A 4Q5QA 2PGTA 1SD8A 4G0LA 4HQSA 2JZRA 3IXRA 3UJ1A 4L5LA 3WGEA 5GAPD 3ISOA 2NVLA 4AF2A 1PKZA 1X0RA 1M9AA 1PN9A 3O6TA 4HZ4A 3CBUA 4FXYP 3L9SA 2PPTA 3VI7A 1B4QA 1IYIA 2BJXA 2ES7A 3ZZXA 3WYWA 3MNGA 2GZPA 2OJLA 4HSCX 5EVOA 1K0MA 3TRQA 4DSRA 2VCWA 4NV5A 2DKHA 2CV4A 1QGVA 1ZMAA 1B4PA 1HYUA 4FH8A 3GRXA 1B8XA 2HLSA 3ZITA 1TOFA 2WW2A 3QR6A 4QMKA 2LKUA 2R0CA 5ID2B 2O85A 4Q5FA 4F0BA 3GMFA 1XW9A 2V2GA 2C0DA 4G0IA 2XHFA 9GSSA 4AKHA 4ZL7A 2ON7A 1QK8A 1M9BA 3P7XA 2LTKA 2YANA 2GLRA 2KP1A 1SD9A 1G6YA 1JZOA 5B7CA 5GZZB 4IBPA 1SYXA 2M80A 2X99A 2YNXA 2LNSA 1XOAA 1J9BA 1EWXA 2V41A 1MDIA 2O5VA 3IRAA 1ZCPA 2AYTA 3UBKA 5HR3A 3CWGA 4BA7A 4KB3A 5CRGA 2YZHA 3IOSA 3VWXA 1FVJA 5HR1A 4XS6A 3M9KA 3IDVA 4W66A 5DALB 3RFRC 1MD4A 3GN3A 1K0BA 3BCKA 3UBLA 5KN0A 3A3TA 4EKZA 5ECRB 1GLPA 4OD7A 2ON5A 3N9JA 1H4OA 3LW9A 1LBKA 2H1GA 3FYGA 5FWGA 6GSTA 2C0FA 2ZUPA 2CAIA 1DUGA 2C3QA 1M2DA 5G2ZA 2FWGA 4YQVA 11GSA 2I1UA 4LA1A 4OWYA 1G7OA 3CHXC 1EGRA 2AB6A 2DJ3A 1OVNA 3P8WA 3GSSA 3DGQA 3ZVJD 1EV9A 1HNCA 2WVYA 1YEXA 1KEBA 1VGLA 3QMXA 4XS1A 1F6MC 4L5OA 2G2QA 1OKDA 4CW9A 2OA7A 3F4SA 1S3DA 2H72A 2GT5A 2GQMA 4PI0C 4TW5A 4KX4A 2VOCA 1BAYA 1Z6NA 1GUKA 4I2UA 1V57A 2X64A 4NMUA 1UC7A 3Q19A 6GSYA 3TUEA 3E0UA 4MZWA 1DSBA 4QL9A 3VWUA 2X8CA 5DBQA 3CSJA 2VCQA 2O89A 4I8BA 3FY7A 2TRXA 1OC9A 4IKHA 2B5EA 1XVQA 2FWFA 2IMIA 2LV3A 1B9XC 2NBSA 3MWHA 1WE0A 3GX0A 4V1Ag 1VF2A 1WJKA 2J23A 1GSDA 4PNGA 4NAXA 1XZOA 4GWRA 1XVWA 3D5JA 5C04A 4MF5A 4JRRA 4G0KA 3GH6A 2HSMB 4BVYB 1FW1A 1WMJA 1V9WA 2FGXA 3J7Yb 4MJCA 20GSA 2BTOT 2KHPA 4JR6A 5D8IA 4N0VA 5IPHA 2IWTA 5ECPB 5DAKA 3TKSA 3WT1A 4MNNA 4G19A 4MF7A 3IC4A 3U5RE 5J9CA 2OKAA 1SENA 3M3MA 5HFGA 4FO5A 4HS1A 3H4KA 1HD2A 4YKGA 3M0FA 3GH9A 3EINA 3EVIA 4KUNA 4TXOB 1GP1A 3GSTA 2VCXA 4DSQA 5GSTA 2IFQA 4K5RA 2HSNA 3P2AA 3W8SA 2O3EA 2F8FA 4MZBA 2VIMA 1ML6A 4GSSA 4PTSA 2O8VB 4HOJA 5ECNB 5DDLA 1N2AA 4GSTA 2H1DA 3IC8A 1PD21 1V98A 2WZSA 2PUKC 2WS2A 2FA8A 3F3RA 2JADA 3H93A 2H8LA 3TKSE 1T4YA 4CDOA 3LSZA 1T3BA 3LORA 3GX8A 4D73A 2MMAA 4YQMA 1DE1A 3NIVA 4EO3A 2VAFA 4AI6A 2HYXA 3DMLA 3QFAC 2AV4A 5CYYA 1A23A 1TXXA 3LG6A 1KBNA 2H1BA 2GQLA 5L71A 2H74A 3HZ4A 2B5YA 4K6XA 3Q74A 4QQ7A 3J7Yk 3ZTLA 2WJUA 5ECQB 1TRWA 2F51A 4EF0A 4HI7A 5GSSA 1XBSA 2H0GA 2L4QA 2A2RA 1XW5A 4ZILA 2HSYA 3WT2A 3FZ5A 3BJ5A 5DVBA 4DSSB 3KCMA 3E3EA 1BF5A 1WRYA 4LL1B 4AJ6A 2I4AA 5IMZA 4F9ZA 3HCZA 1GRXA 1XXUA 5CAXA 3C71A 1JHBA 5ECLB 1U6TA 3ZLPA 1JZDA 4YH2A 2FWHA 6GSSA 2E0QA 2AAWA 2KLXA 2UV8G 4ULXA 3IAS2 3A2VA 5CRDA 4IVFA 3FZAA 1KNGA 4N11A 3EE2A 3RDWA 3A5IA 3SWLA 3GFKA 4AGSA 1O8XA 5CP1A 5CREA 3DIEA 4GXZA 1OE8A 5LD0A 3W6GA 1U3AA 2TRCP 1V58A 3TKQA 5AN1A 4KA0A 2MBTA 5A1NB 4O92A 4MLYA 4G01A 4O5RA 1BQ7A 4EL1A 3TOTA 1I5GA 1J08A 5CRWA 2V6OA 1T8EB 4MCUA 4PXOA 14GSA 2HZEA 2C1YA 1QXHA 3GYKA 1BG1A 3TOUA 1SKRB 1FOHA 2MMNA 4TR1B 5A34B 1KTEA 4FYBA 4PQIA 2JU5A 2G0FA 3TRPA 2LRNA 2B7JA 2C4JA 1XWBA 2WZ9A 4E68A 5A5HB 4X4JA 4Z2RA 1WPIA 3F6DA 2LQQA 1SK0A 2XBQA 3CXGA 4MH3A
chains in the Genus database with same CATH topology
4TN8A 2FHEA 4O32A 1T00A 4OFMA 4ZB9A 2DBCA 2JZTA 3K8NA 4ZB6A 2VLTA 4EDYA 2VLVA 4XIHA 1O81A 3F8UA 2A2SA 4IJ3A 3GKNA 1TU8A 2REMA 2FUG2 2YZUA 4MJEA 1O8WA 3MAKA 1M7TA 2LUSA 3MYDA 4TR3A 1XWKA 4USSA 4K8MA 5G5FA 3WD6A 1R7HA 3GHAA 3TJKA 4X0XA 2ZCTA 5AIXA 5A5KA 1ZL9A 3M1GA 3I69A 2H19A 4F0CA 2GQKA 2BMXA 2PWJA 2JZSA 3G7JA 1EOGA 1B48A 2XPEA 2DJKA 3DD3A 3UVTA 3UMAA 1JLWA 1E6BA 4MPFA 4LL4B 2UZ8A 3IE3A 1OE7A 4CY8A 1AXDA 5DCHA 3RHCA 1TRUA 2DJ1A 2WDUA 2R3XA 5F05A 5J47A 2PN8A 3EU4A 3BBYA 3LJRA 1XIYA 1VF1A 1A0RP 3ERWA 3O3TA 6GSXA 4WF4A 3TJGA 2EIRA 2RUFA 1G0TA 2CAQA 1NW2A 5IOWA 5AGYA 4YQUA 3DVXA 2EIOA 2OE0A 3HA9A 2YV7A 2OBIA 1T7PB 5DJMA 17GSA 2H01A 2VO4A 1ZYEA 2ZNMA 4ICYA 2LQOA 4N0ZA 4HU7A 4K9ZA 4IELA 5CRHA 4NV2A 3CYNA 3ME7A 4X43A 2WB9A 2CVBA 3IK7A 2LNTA 1GTUA 3IR4A 3UARA 5DALA 1SL1B 3F9UA 1EP8A 3TCOA 3DVWA 3RHBA 2L4CA 1ZYQB 2XBIA 4GF0A 1EV4A 2IJYA 1K0DA 2Z9SA 2N5BA 4ZB8A 1V2AA 4CY6A 4H86A 5CNWA 3V1WA 1ERVA 3GL5A 3KP9A 3QPMA 4JZQA 1Z7PA 2HZFA 4PURA 2HFDA 5JCUA 4WEYA 1A0FA 4KE3A 5AISA 2YWMA 4ZBDA 2DJ2A 1Y6EA 3ERFA 3GNJA 4BWQA 3ZIJA 3TKPA 18GSA 5J5NA 3AY8A 5JWRB 2PVQA 4K1FA 3TGZA 1ON4A 1GTIA 3GKMA 2P5RA 5IO0A 2DJJA 4FQUA 2OBKA 3LWAA 3VPQA 2IMKA 4MPGA 1MDKA 4RI6A 4V2NA 3A2XA 1SL0B 1SJIA 5J3RA 1QMVA 5ECOB 5IMDA 3G7IA 3CRUA 2C80A 1TXUA 4POKA 1PMTA 2PU9C 3Q6OA 3F6FA 3TKRA 4XTSA 2H0HA 1AIUA 1LJRA 1WWJA 3HMJG 3RBTA 5J9BA 4IP6A 1GL8A 3F0IA 3HYPA 4BVXB 2H75A 5IPGA 3I6AA 4ZBBA 1ST9A 5DQSA 2H0IA 2QA2A 4KDYA 2YWIA 2GDRA 2DKIA 3L9VA 1DBYA 4WKWA 2HSMA 3UAPA 3PINA 4JU5A 1PKWA 4IP1A 4KDUA 2HRKB 1BJXA 1F9MA 4MZCA 4O5QA 4TKYA 1GNWA 3DKSA 4WR4A 4K5SA 4E8EA 3IHQA 4TOPA 2LS5A 1G6WA 3LYPA 4LMVA 5IM9A 1PL1A 5F0GA 4XRDA 3L0HA 4PQ1A 1GSQA 2I9HA 5INYA 4KSMA 5F06A 4HEA2 2H30A 3KJYA 3KIJA 2AJQB 1QFNA 5ECHB 3VK9A 4MP4A 1EOHA 5G31A 3CMIA 4MMMA 2F9SA 5J4UA 2QA1A 5HFKA 1Z9HA 4IQAA 1FO5A 3WGDA 4EDZA 1XPVA 1F3BA 2V6KA 1IYHA 2H71A 2QKEA 3HVSA 2B6MA 3GKKA 1R5PA 1TTZA 1GTBA 3D0ZA 1JZRA 4MDCA 4FIWA 3D6IA 2YN1A 4HQZA 1EGOA 2HNLA 3FMWA 2HI7A 1ERWA 1GWCA 2L5LA 1T1VA 4WR5A 3R3EA 4K7IA 1WOUA 4FYUA 1CQGA 4AJ8A 2KUCA 5A4VA 2CT6A 1F37A 3EPTA 3ZMLA 2EFDA 2PBJA 2CZ2A 1B9YC 1BG5A 4MF6A 3IHGA 4I6XA 2EC4A 5JWQB 16GSA 2A2PA 3VI5A 3FKFA 1R5AA 1UVZA 2WGRA 2IMDA 1GH2A 3R2QA 4J57E 4GQFA 1K0AA 1H75A 4RI7A 1SK1A 1Z6MA 5D9VA 1GSYA 1PSQA 4HDEA 4GCIA 3F4RA 4FYCA 5KN3A 4EIPA 1U88A 5EPFA 1X9SB 3KZQA 1PGTA 5HR0A 3MIXA 3KEBA 1ZYPA 3FEUA 5G30A 5DAKB 1BX9A 4O7HA 4ECIA 1FG4A 1FVKA 1O6JA 1PX6A 1V40A 2F8AA 1YEPA 3LYKA 1OKTA 4MH2A 4NXIA 1O85A 4BL7B 3SBCA 4AKIA 3CSIA 4OCFA 2YJ7A 2FWEA 3MSZA 4HU9A 4F03A 2IFQB 4KGIA 2RIIA 2GS3A 3QAVA 1OC3A 1XWCA 3QFBC 1TK8B 2CA8A 3FR9A 1FB0A 4GRFA 1NHYA 4BWSA 3ZMKA 1M99A 1XWGA 2P31A 2IMFA 3APQA 3M9JA 5ENUA 5D9XA 5BMUA 4PQHA 3HXSA 5IMFA 1FHEA 4ACSA 4ZBAA 2LSTA 4V1Ap 4D73B 4NHWA 1TP9A 4TR1A 1SK2A 5DCGA 3QOUA 2HT9A 4DVCA 4KAEA 3N5OA 1U3IA 2JSZA 2YWOA 1K3LA 5A5HA 5DQYA 2VD1A 2VUPA 3KTBA 4EC0A 3EC3A 1YKAA 1SVMA 1GNEA 2GGTA 2O7KA 2DIZA 4KSOA 2N5AA 2YCDA 5A4UA 4L0UA 1PL2A 3PPUA 3KMNA 2H66A 4Z2UA 5HQPA 1XW6A 3KGKA 3GTUB 6GSVA 3UL3A 2O87A 4PGTA 2XPDA 1Y1UA 4ECJA 3C73A 4PUFC 2YPMA 1EEJA 3HJPA 4JEDA 4X1UA 3A5WA 4TR0A 4ECBA 1K3YA 2LEGA 3DRNA 2IIYA 3CTFA 3IPZA 3KM6A 3TDGA 1S3CA 3VFIA 2CVKA 3CTGA 2PMTA 1AQXA 4N30A 3LQ7A 4XS4A 5FHIA 4I5QA 1K0NA 4G9HA 13GSA 2WULA 2L57A 4BPYA 1Z7RA 1HQOA 3M8NA 3FR3A 3VPTA 3LFLA 1MEKA 5B8BA 2FLSA 2HRFA 1F3AA 2VL2C 2YOIA 2K18A 22GSA 4XHMA 3L78A 3C8EA 1QUWA 1ZZYA 1ACVA 3LGCA 4V2LA 1NHOA 1K0CA 3RAZA 5H5RA 4IW9A 3JCML 3QAWA 1GLQA 1CQHA 1JLVA 2GZYA 5D9WA 4IHUA 4ML6A 2NTOA 3QD9A 4N10A 1RW1A 1AC1A 2EFHA 1K3OA 3E9JB 2NPBA 3TKSC 2P0GA 2DC5A 2FD3A 1YZXA 1SJZA 10GSA 3HKRA 4JBBA 2DMLA 1K0OA 2CVDA 5ID2A 2F3MA 5D93A 4DEJA 2CX4A 4RQXA 3FZ9A 4IJIA 2LJRA 3I9V2 4RUVA 5EY6A 5A4WA 2C8UA 3GKXA 5E4WA 2H6ZA 1URMA 3KH7A 5FT3A 2A4HA 2R0PA 1X9WB 3PR8A 5IMCA 1THOA 3HJMA 1O7UA 4TR4A 3UVHA 4ZB7A 3NOFA 5JWOB 3TRXA 1OAZA 1W4VA 1X5CA 1U87A 1ZOFA 3QDNA 1SKWB 2MBSA 1GUHA 2GVPA 2R0GA 4GDFA 1A24A 3C7MA 2N5FA 2E2MA 2VL3A 5IMAA 3D22A 4YAVA 2IMEA 2IL3A 3S9FA 4NPBA 4IN0A 1HNAA 3KMOA 2GSTA 2DSAA 3KXOA 3LEFA 2GSSA 3TB2A 1M0UA 3P90A 4GSNA 2FY6A 2FCHA 4HJ2A 2HRNA 3BD2A 2K8SA 4MABA 5CO3A 3EURA 2OADA 3TJJA 1SVOA 2V32A 1TW9A 1Q4JA 1MDJA 2B3SA 3D4MA 2VLUA 1AQWA 1EEMA 2QSIA 3FK8A 4JE1A 2D2ZA 2VL9A 3GURA 3VWWA 3QAGA 1THXA 4GLTA 4Q5RA 2K8VA 1VF3A 3GA4A 1GSFA 3HJOA 1X5EA 2YP6A 6GSUA 4BVXA 1J0FA 6GSWA 2L6CA 2L5OA 5KEJA 5IQYA 4HUAA 3PGTA 4MK3A 1SKSB 2EFEA 1WP0A 1X9MB 4LLRA 1EP7A 1A8LA 5LNKe 2CQ9A 1AAZA 3VLNA 4ZL9A 3ERGA 5G1KA 5GAND 5G5EA 4E8HA 5EL8A 2HRKA 3UEMA 3KP8A 2WRTA 4JR4A 1XCCA 5JCWA 4EIQA 5AIVA 3GL3A 1UA5A 1ABAA 2H6YA 1ZYNA 4GQCA 2H1AA 3FZ4A 2PERA 1OYJA 4L8EA 2IN3A 1X5DA 5F8BA 2TIRA 2X8HA 4K2XA 1TRSA 1SJ6A 3QCPA 2YV9A 2R5GA 2H1LA 1XOBA 2E7PA 4I2TA 1OC8A 4G2EA 1BEDA 2B7KA 5D96A 1FB6A 2V1MA 4KDXA 1DE2A 4ML1A 4BVYA 5DJLA 3EYTA 1FOVA 3BCIA 4POBA 1WIKA 2OE3A 2QGVA 4EE0A 4OO4A 3GUSA 4NHZA 2WFCA 1Z5YE 3TJBA 4OFNA 1ILOA 2LJKA 1PA3A 3ZIVA 8GSSA 1TDIA 4HZ2A 5ECSA 4F82A 3RPPA 2B1LA 2JACA 5J41A 2OE1A 1UN2A 2RM6A 1A2LA 4G10A 2X49A 3IV4A 5J4VA 1W89A 3IAM2 4LMWA 2VCZA 1T4ZA 4P3YB 4TXOA 3PH9A 5D9TA 4KCAA 7GSSA 1F2EA 2J9HA 3UOMA 1A2JA 1NM3A 1MD3A 3C1RA 1LU4A 2PVOC 5JCGA 5KN1A 3HVXA 4POLA 2I3YA 4PUAA 1QQ2A 3APOA 2H73A 5H5SA 2H6XA 1Y25A 2WCIA 1TRVA 1ERTA 2DLXA 2VL2A 4OCEA 3UIWA 5E59A 2HSHA 5IMVA 5ABRA 3TJFA 1RK4A 3ZVJA 2VM2A 1N8JA 2LRTA 4WF5A 2VCVA 5ECIB 1PN0A 4XRAA 1AUCA 2HQTA 5LCZA 2R4VA 2GTUA 2AHEA 4POMA 1GSEA 3BOAA 4ILFA 3RPNA 4KF9A 2MZCA 3ZL5A 1Q98A 4KNDA 5COHA 2HXKA 5G1LA 3EMXA 4OMVA 2QC7A 2L6DA 3FW2A 2R6KA 2L59A 2GZZA 4BL7A 2ALBA 3KTLA 1OC9B 1R26A 4WETA 4F2IA 5ELAA 5J40A 1GSSA 1GSUA 3APSA 2X8GA 3G9BA 4EVMA 4DSSA 4J2FA 5KN2A 5IOXA 1AQVA 3ME8A 1S3AA 4EXJA 2C3TA 3ZYWA 1SYRA 3HVVA 3FR6A 3L9UA 3GV1A 2OT3A 4QL7A 4ZIJA 1TI3A 2LJAA 3ZRDA 5KOWA 4MJBA 4K7NA 4IS0A 3H8QA 3I43A 1YF1A 5B8AA 1MTCA 1YY7A 2VD0A 3F4TA 5F07A 4CHSA 3LXTA 2MYGA 2MMZA 1TK0B 12GSA 1PQNA 2K6VA 2K9FA 1YJ6A 3CRTA 3DYRA 3KD0A 1SVLA 3FRCA 2E2GA 1I9DA 3A2WA 2A4VA 2B5XA 5BRTA 2HSNB 1VF4A 1GUMA 1R4WA 2GSQA 3CSHA 2HE3A 3FHKA 4AJ7A 2HRAA 2P5QA 2JSYA 2B1KA 1Z3EA 4K0GA 1YF0A 5C00A 5A1NA 5ECKB 1SU9A 5J4YA 2LRCA 1ZGNA 4Q5NA 1A2MA 3DEXA 19GSA 4Z2TA 1ERUA 3F3QA 2RM5A 1YKCA 3GTUA 3HD5A 4RQRA 2DMMA 4KH7A 4OFTA 3OR5A 4I97A 5KOXA 2I81A 4YKFA 3DXBA 3GIXA 4WBJA 4XCSA 5D73A 1E2YA 2KOKA 1JFUA 5A34A 5B6NA 4PX1A 1TJDA 4HJMA 3W8JA 2VKZG 1O73A 1VRSD 3NZNA 2H70A 3D21A 2X4AA 3H79A 3HHVA 2R2JA 1AW9A 4K2DA 3EMPA 3ZREA 1XFLA 4J56E 2VCTA 4ISDA 4WXTA 2C0EA 3IA1A 2FNOA 4K7OA 2AUVA 1HNBA 4N3ZA 1A8YA 2NDOA 3KH9A 3WGXA 1USBA 2M46A 4AKXB 3LXZA 2GSRA 1YVLA 2JL4A 1JZWA 3F63A 5ECMB 2C3NA 1RQMA 3IK9A 1M2BA 3O76A 3TU3B 3US3A 1N25A 3ZFBA 2R37A 4TXVA 4IGJA 1M2AA 4WBRD 5B6MA 4YAPA 2FA4A 5BMUB 3G7YA 1YDKA 3D4TA 3VURA 3HZ8A 2YJHA 3MDKA 1GULA 4IQ1A 2EIQA 1PX7A 1XWAA 2VM1A 1C72A 4K0NA 5ELGA 4L0WA 2CX3A 4TRXA 4KW6A 2GT6A 2DIYA 1SL2B 2OACA 4ZL8A 1TKDB 3EU3A 1PRXA 3VWVA 3HDCA 2IPAA 4V2MA 1TI1A 2RLIA 3ED3A 2M72A 4NWYA 1FAAA 3IBHA 4MJAA 3EWLA 2C0GA 1YQ1A 4AKGA 4O5UA 4TVEA 1TK5B 5HFIA 4GTUA 2YWNA 2DJ0A 4ID0A 1G7EA 3DWVA 1NSWA 3U6VA 4PNFA 1BYEA 5HR2A 2HZEB 3H1NA 2CZ3A 2H76A 1GTAA 5IIZA 1TU7A 2MMOA 2KP2A 4MA9A 4KCEA 4Z7XA 4ECCA 3ZFLA 2RUEA 3L4NA 4OO5A 4ZXGA 4A5PA 2EFCA 3HY2A 5H5QA 3C1SA 3Q18A 5IO2A 4XS4B 1EZKA 4EUYA 2XC2A 4Q5QA 2PGTA 1SD8A 4G0LA 4HQSA 2JZRA 3IXRA 3UJ1A 4L5LA 3WGEA 5GAPD 3ISOA 2NVLA 4AF2A 1PKZA 1X0RA 1M9AA 1PN9A 3O6TA 4HZ4A 3CBUA 3L9SA 2PPTA 3VI7A 1B4QA 1IYIA 2BJXA 2ES7A 3ZZXA 3WYWA 3MNGA 2GZPA 2OJLA 5EVOA 1K0MA 3TRQA 4DSRA 2VCWA 4NV5A 2DKHA 2CV4A 1QGVA 1ZMAA 1B4PA 1HYUA 4FH8A 3GRXA 1B8XA 2HLSA 3ZITA 1TOFA 3QR6A 4QMKA 2LKUA 2R0CA 5ID2B 2O85A 4Q5FA 4F0BA 3GMFA 1XW9A 2V2GA 2C0DA 4G0IA 2XHFA 9GSSA 4AKHA 4ZL7A 2ON7A 1QK8A 1M9BA 3P7XA 2LTKA 2YANA 2GLRA 2KP1A 1SD9A 1G6YA 1JZOA 5B7CA 5GZZB 4IBPA 1SYXA 2M80A 2X99A 2YNXA 2LNSA 1XOAA 1J9BA 1EWXA 2V41A 1MDIA 2O5VA 3IRAA 1ZCPA 2AYTA 3UBKA 5HR3A 3CWGA 4BA7A 4KB3A 5CRGA 2YZHA 3IOSA 3VWXA 1FVJA 5HR1A 4XS6A 3M9KA 3IDVA 4W66A 5DALB 1MD4A 3GN3A 1K0BA 3BCKA 3UBLA 5KN0A 3A3TA 4EKZA 5ECRB 1GLPA 4OD7A 2ON5A 3N9JA 1H4OA 3LW9A 1LBKA 2H1GA 3FYGA 5FWGA 6GSTA 2C0FA 2ZUPA 2CAIA 1DUGA 2C3QA 1M2DA 5G2ZA 2FWGA 4YQVA 11GSA 2I1UA 4LA1A 4OWYA 1G7OA 1EGRA 2AB6A 2DJ3A 1OVNA 3P8WA 3GSSA 3DGQA 3ZVJD 1EV9A 1HNCA 1YEXA 1KEBA 1VGLA 3QMXA 4XS1A 1F6MC 4L5OA 2G2QA 1OKDA 4CW9A 2OA7A 3F4SA 1S3DA 2H72A 2GT5A 2GQMA 4TW5A 4KX4A 2VOCA 1BAYA 1Z6NA 1GUKA 4I2UA 1V57A 2X64A 4NMUA 1UC7A 3Q19A 6GSYA 3TUEA 3E0UA 4MZWA 1DSBA 4QL9A 3VWUA 2X8CA 5DBQA 3CSJA 2VCQA 2O89A 4I8BA 3FY7A 2TRXA 1OC9A 4IKHA 2B5EA 1XVQA 2FWFA 2IMIA 2LV3A 1B9XC 2NBSA 3MWHA 1WE0A 3GX0A 4V1Ag 1VF2A 1WJKA 2J23A 1GSDA 4PNGA 4NAXA 1XZOA 4GWRA 1XVWA 3D5JA 5C04A 4MF5A 4JRRA 4G0KA 3GH6A 2HSMB 4BVYB 1FW1A 1WMJA 1V9WA 2FGXA 3J7Yb 4MJCA 20GSA 2BTOT 2KHPA 4JR6A 5D8IA 4N0VA 5IPHA 2IWTA 5ECPB 5DAKA 3TKSA 3WT1A 4MNNA 4G19A 4MF7A 3IC4A 3U5RE 5J9CA 2OKAA 1SENA 3M3MA 5HFGA 4FO5A 4HS1A 3H4KA 1HD2A 4YKGA 3M0FA 3GH9A 3EINA 3EVIA 4KUNA 4TXOB 1GP1A 3GSTA 2VCXA 4DSQA 5GSTA 2IFQA 4K5RA 2HSNA 3P2AA 3W8SA 2F8FA 4MZBA 2VIMA 1ML6A 4GSSA 4PTSA 2O8VB 4HOJA 5ECNB 5DDLA 1N2AA 4GSTA 2H1DA 3IC8A 1PD21 1V98A 2PUKC 2WS2A 2FA8A 3F3RA 2JADA 3H93A 2H8LA 3TKSE 1T4YA 4CDOA 3LSZA 1T3BA 3LORA 3GX8A 4D73A 2MMAA 4YQMA 1DE1A 3NIVA 4EO3A 2VAFA 4AI6A 2HYXA 3DMLA 3QFAC 2AV4A 5CYYA 1A23A 1TXXA 3LG6A 1KBNA 2H1BA 2GQLA 5L71A 2H74A 3HZ4A 2B5YA 4K6XA 3Q74A 4QQ7A 3J7Yk 3ZTLA 2WJUA 5ECQB 1TRWA 2F51A 4EF0A 4HI7A 5GSSA 1XBSA 2H0GA 2L4QA 2A2RA 1XW5A 4ZILA 2HSYA 3WT2A 3FZ5A 3BJ5A 5DVBA 4DSSB 3KCMA 3E3EA 1BF5A 1WRYA 4LL1B 4AJ6A 2I4AA 5IMZA 4F9ZA 3HCZA 1GRXA 1XXUA 5CAXA 3C71A 1JHBA 5ECLB 1U6TA 3ZLPA 1JZDA 4YH2A 2FWHA 6GSSA 2E0QA 2AAWA 2KLXA 2UV8G 4ULXA 3IAS2 3A2VA 5CRDA 4IVFA 3FZAA 1KNGA 4N11A 3EE2A 3RDWA 3A5IA 3SWLA 3GFKA 4AGSA 1O8XA 5CP1A 5CREA 3DIEA 4GXZA 1OE8A 5LD0A 3W6GA 1U3AA 2TRCP 1V58A 3TKQA 5AN1A 4KA0A 2MBTA 5A1NB 4O92A 4MLYA 4G01A 4O5RA 1BQ7A 4EL1A 3TOTA 1I5GA 1J08A 5CRWA 2V6OA 1T8EB 4MCUA 4PXOA 14GSA 2HZEA 2C1YA 1QXHA 3GYKA 1BG1A 3TOUA 1SKRB 1FOHA 2MMNA 4TR1B 5A34B 1KTEA 4FYBA 4PQIA 2JU5A 2G0FA 3TRPA 2LRNA 2B7JA 2C4JA 1XWBA 2WZ9A 4E68A 5A5HB 4X4JA 4Z2RA 1WPIA 3F6DA 2LQQA 1SK0A 2XBQA 3CXGA 4MH3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TN8 A;  2FHE A;  4O32 A;  1T00 A;  4OFM A;  4ZB9 A;  2DBC A;  2JZT A;  3K8N A;  4ZB6 A;  2VLT A;  4EDY A;  2VLV A;  4XIH A;  1O81 A;  3F8U A;  2A2S A;  4IJ3 A;  3GKN A;  1TU8 A;  2REM A;  2FUG 2;  2YZU A;  4MJE A;  1O8W A;  3MAK A;  1M7T A;  2LUS A;  4TR3 A;  1XWK A;  4USS A;  4K8M A;  5G5F A;  3WD6 A;  1R7H A;  3GHA A;  3TJK A;  4X0X A;  2ZCT A;  5AIX A;  5A5K A;  1ZL9 A;  3M1G A;  3I69 A;  2H19 A;  4F0C A;  2GQK A;  2BMX A;  2PWJ A;  2JZS A;  3G7J A;  1EOG A;  1B48 A;  2XPE A;  2DJK A;  3DD3 A;  3UVT A;  3UMA A;  1JLW A;  1E6B A;  4MPF A;  4LL4 B;  2UZ8 A;  3IE3 A;  1OE7 A;  1AXD A;  5DCH A;  3RHC A;  1TRU A;  2DJ1 A;  2WDU A;  2R3X A;  5F05 A;  2PN8 A;  3EU4 A;  3BBY A;  3LJR A;  1XIY A;  1VF1 A;  1A0R P;  3ERW A;  3O3T A;  6GSX A;  4WF4 A;  3TJG A;  2EIR A;  2RUF A;  1G0T A;  2CAQ A;  1NW2 A;  5IOW A;  5AGY A;  4YQU A;  3DVX A;  2EIO A;  2OE0 A;  3HA9 A;  2YV7 A;  2OBI A;  1T7P B;  5DJM A;  17GS A;  2H01 A;  2VO4 A;  1ZYE A;  2ZNM A;  2LQO A;  4N0Z A;  4HU7 A;  4K9Z A;  4IEL A;  5CRH A;  4NV2 A;  3CYN A;  3ME7 A;  4X43 A;  2WB9 A;  2CVB A;  3IK7 A;  2LNT A;  1GTU A;  3IR4 A;  3UAR A;  5DAL A;  1SL1 B;  3F9U A;  1EP8 A;  3TCO A;  3DVW A;  3RHB A;  2L4C A;  1ZYQ B;  2XBI A;  4GF0 A;  1EV4 A;  2IJY A;  1K0D A;  2Z9S A;  2N5B A;  4ZB8 A;  1V2A A;  4H86 A;  5CNW A;  3V1W A;  1ERV A;  3GL5 A;  3KP9 A;  3QPM A;  4JZQ A;  1Z7P A;  2HZF A;  4PUR A;  2HFD A;  5JCU A;  4WEY A;  1A0F A;  4KE3 A;  5AIS A;  2YWM A;  4ZBD A;  2DJ2 A;  1Y6E A;  3ERF A;  3GNJ A;  4BWQ A;  3ZIJ A;  3TKP A;  18GS A;  5J5N A;  3AY8 A;  5JWR B;  2PVQ A;  4K1F A;  3TGZ A;  1ON4 A;  1GTI A;  3GKM A;  2P5R A;  5IO0 A;  2DJJ A;  4FQU A;  2OBK A;  3LWA A;  3VPQ A;  2IMK A;  4MPG A;  1MDK A;  4RI6 A;  4V2N A;  3A2X A;  1SL0 B;  1SJI A;  5J3R A;  1QMV A;  5ECO B;  5IMD A;  3G7I A;  3CRU A;  2C80 A;  4POK A;  1PMT A;  2PU9 C;  3Q6O A;  3F6F A;  3TKR A;  4XTS A;  2H0H A;  1AIU A;  1LJR A;  1WWJ A;  3RBT A;  5J9B A;  4IP6 A;  1GL8 A;  3F0I A;  3HYP A;  4BVX B;  2H75 A;  5IPG A;  3I6A A;  4ZBB A;  1ST9 A;  5DQS A;  2H0I A;  4KDY A;  2YWI A;  2GDR A;  3L9V A;  1DBY A;  4WKW A;  2HSM A;  3UAP A;  3PIN A;  4JU5 A;  1PKW A;  4IP1 A;  4KDU A;  2HRK B;  1BJX A;  1F9M A;  4MZC A;  4TKY A;  1GNW A;  3DKS A;  4WR4 A;  4E8E A;  3IHQ A;  4TOP A;  2LS5 A;  1G6W A;  3LYP A;  4LMV A;  5IM9 A;  1PL1 A;  5F0G A;  4XRD A;  3L0H A;  4PQ1 A;  1GSQ A;  2I9H A;  5INY A;  4KSM A;  5F06 A;  4HEA 2;  2H30 A;  3KJY A;  3KIJ A;  2AJQ B;  1QFN A;  5ECH B;  3VK9 A;  4MP4 A;  1EOH A;  5G31 A;  3CMI A;  4MMM A;  2F9S A;  5J4U A;  5HFK A;  1Z9H A;  4IQA A;  1FO5 A;  3WGD A;  4EDZ A;  1XPV A;  1F3B A;  2V6K A;  1IYH A;  2H71 A;  2QKE A;  3HVS A;  2B6M A;  3GKK A;  1R5P A;  1TTZ A;  1GTB A;  3D0Z A;  1JZR A;  4MDC A;  4FIW A;  3D6I A;  2YN1 A;  4HQZ A;  1EGO A;  2HNL A;  2HI7 A;  1ERW A;  1GWC A;  2L5L A;  1T1V A;  4WR5 A;  3R3E A;  4K7I A;  1WOU A;  4FYU A;  1CQG A;  4AJ8 A;  2KUC A;  5A4V A;  2CT6 A;  1F37 A;  3ZML A;  2PBJ A;  2CZ2 A;  1B9Y C;  1BG5 A;  4MF6 A;  4I6X A;  2EC4 A;  5JWQ B;  16GS A;  3VI5 A;  3FKF A;  1R5A A;  1UVZ A;  2WGR A;  2IMD A;  1GH2 A;  3R2Q A;  4J57 E;  4GQF A;  1K0A A;  1H75 A;  4RI7 A;  1SK1 A;  1Z6M A;  5D9V A;  1GSY A;  1PSQ A;  4HDE A;  4GCI A;  3F4R A;  4FYC A;  5KN3 A;  1U88 A;  5EPF A;  1X9S B;  3KZQ A;  1PGT A;  5HR0 A;  3KEB A;  3FEU A;  5G30 A;  5DAK B;  1BX9 A;  4O7H A;  4ECI A;  1FG4 A;  1FVK A;  1O6J A;  1PX6 A;  1V40 A;  2F8A A;  1YEP A;  3LYK A;  1OKT A;  4MH2 A;  4NXI A;  1O85 A;  4BL7 B;  3SBC A;  3CSI A;  4OCF A;  2YJ7 A;  2FWE A;  3MSZ A;  4HU9 A;  4F03 A;  2IFQ B;  4KGI A;  2RII A;  2GS3 A;  3QAV A;  1OC3 A;  1XWC A;  3QFB C;  1TK8 B;  2CA8 A;  3FR9 A;  1FB0 A;  4GRF A;  1NHY A;  4BWS A;  3ZMK A;  1M99 A;  1XWG A;  2P31 A;  2IMF A;  3APQ A;  3M9J A;  5ENU A;  5D9X A;  5BMU A;  4PQH A;  3HXS A;  5IMF A;  1FHE A;  4ACS A;  4ZBA A;  2LST A;  4V1A p;  4D73 B;  4NHW A;  1TP9 A;  4TR1 A;  1SK2 A;  5DCG A;  3QOU A;  2HT9 A;  4DVC A;  4KAE A;  3N5O A;  1U3I A;  2JSZ A;  2YWO A;  1K3L A;  5DQY A;  2VD1 A;  2VUP A;  3KTB A;  4EC0 A;  3EC3 A;  1YKA A;  1GNE A;  2GGT A;  2O7K A;  2DIZ A;  4KSO A;  2N5A A;  2YCD A;  5A4U A;  4L0U A;  1PL2 A;  3PPU A;  3KMN A;  2H66 A;  5HQP A;  1XW6 A;  3KGK A;  3GTU B;  6GSV A;  3UL3 A;  2O87 A;  4PGT A;  2XPD A;  4ECJ A;  3C73 A;  4PUF C;  2YPM A;  1EEJ A;  3HJP A;  4JED A;  4X1U A;  3A5W A;  4TR0 A;  4ECB A;  1K3Y A;  2LEG A;  3DRN A;  2IIY A;  3CTF A;  3IPZ A;  3KM6 A;  3TDG A;  1S3C A;  3VFI A;  2CVK A;  3CTG A;  2PMT A;  1AQX A;  4N30 A;  3LQ7 A;  4XS4 A;  5FHI A;  4I5Q A;  1K0N A;  4G9H A;  13GS A;  2WUL A;  2L57 A;  4BPY A;  1Z7R A;  1HQO A;  3M8N A;  3FR3 A;  3VPT A;  3LFL A;  1MEK A;  5B8B A;  2FLS A;  2HRF A;  1F3A A;  2VL2 C;  2YOI A;  2K18 A;  22GS A;  4XHM A;  3L78 A;  3C8E A;  1QUW A;  1ZZY A;  1ACV A;  3LGC A;  4V2L A;  1NHO A;  1K0C A;  3RAZ A;  5H5R A;  4IW9 A;  3JCM L;  3QAW A;  1GLQ A;  1CQH A;  1JLV A;  2GZY A;  5D9W A;  4IHU A;  4ML6 A;  3QD9 A;  2NTO A;  4N10 A;  1RW1 A;  1AC1 A;  1K3O A;  3E9J B;  2NPB A;  3TKS C;  2P0G A;  2DC5 A;  2FD3 A;  1YZX A;  1SJZ A;  10GS A;  3HKR A;  4JBB A;  2DML A;  1K0O A;  2CVD A;  5ID2 A;  2F3M A;  5D93 A;  4DEJ A;  2CX4 A;  4RQX A;  3FZ9 A;  4IJI A;  2LJR A;  3I9V 2;  4RUV A;  5EY6 A;  5A4W A;  2C8U A;  3GKX A;  5E4W A;  2H6Z A;  1URM A;  3KH7 A;  5FT3 A;  1X9W B;  3PR8 A;  5IMC A;  1THO A;  3HJM A;  1O7U A;  4TR4 A;  3UVH A;  3NOF A;  5JWO B;  3TRX A;  1OAZ A;  1W4V A;  1X5C A;  1U87 A;  1ZOF A;  3QDN A;  1SKW B;  2MBS A;  1GUH A;  2GVP A;  1A24 A;  3C7M A;  2N5F A;  2E2M A;  2VL3 A;  5IMA A;  3D22 A;  4YAV A;  2IME A;  2IL3 A;  3S9F A;  4NPB A;  4IN0 A;  1HNA A;  3KMO A;  2GST A;  2DSA A;  3KXO A;  3LEF A;  2GSS A;  3TB2 A;  1M0U A;  3P90 A;  4GSN A;  2FY6 A;  2FCH A;  4HJ2 A;  2HRN A;  3BD2 A;  2K8S A;  4MAB A;  5CO3 A;  3EUR A;  2OAD A;  3TJJ A;  2V32 A;  1TW9 A;  1Q4J A;  1MDJ A;  2B3S A;  3D4M A;  2VLU A;  1AQW A;  1EEM A;  2QSI A;  3FK8 A;  4JE1 A;  2D2Z A;  2VL9 A;  3GUR A;  3VWW A;  3QAG A;  1THX A;  4GLT A;  4Q5R A;  2K8V A;  1VF3 A;  3GA4 A;  1GSF A;  3HJO A;  1X5E A;  2YP6 A;  6GSU A;  4BVX A;  1J0F A;  6GSW A;  2L6C A;  2L5O A;  5KEJ A;  5IQY A;  4HUA A;  3PGT A;  4MK3 A;  1SKS B;  1WP0 A;  1X9M B;  4LLR A;  1EP7 A;  1A8L A;  5LNK e;  2CQ9 A;  1AAZ A;  3VLN A;  4ZL9 A;  3ERG A;  5G1K A;  5GAN D;  5G5E A;  4E8H A;  5EL8 A;  2HRK A;  3UEM A;  3KP8 A;  2WRT A;  4JR4 A;  1XCC A;  5JCW A;  5AIV A;  3GL3 A;  1UA5 A;  1ABA A;  2H6Y A;  4GQC A;  2H1A A;  3FZ4 A;  2PER A;  1OYJ A;  4L8E A;  2IN3 A;  1X5D A;  5F8B A;  2TIR A;  2X8H A;  1TRS A;  1SJ6 A;  3QCP A;  2YV9 A;  2R5G A;  1XOB A;  2E7P A;  4I2T A;  1OC8 A;  4G2E A;  1BED A;  2B7K A;  5D96 A;  1FB6 A;  2V1M A;  4KDX A;  1DE2 A;  4ML1 A;  4BVY A;  5DJL A;  3EYT A;  1FOV A;  3BCI A;  4POB A;  1WIK A;  2OE3 A;  2QGV A;  4EE0 A;  4OO4 A;  3GUS A;  4NHZ A;  2WFC A;  1Z5Y E;  3TJB A;  4OFN A;  1ILO A;  2LJK A;  1PA3 A;  3ZIV A;  8GSS A;  1TDI A;  4HZ2 A;  5ECS A;  4F82 A;  3RPP A;  2B1L A;  2JAC A;  5J41 A;  2OE1 A;  1UN2 A;  2RM6 A;  1A2L A;  4G10 A;  3IV4 A;  1W89 A;  3IAM 2;  4LMW A;  2VCZ A;  1T4Z A;  4P3Y B;  4TXO A;  3PH9 A;  5D9T A;  4KCA A;  7GSS A;  1F2E A;  2J9H A;  3UOM A;  1A2J A;  1NM3 A;  1MD3 A;  3C1R A;  1LU4 A;  2PVO C;  5JCG A;  5KN1 A;  3HVX A;  4POL A;  2I3Y A;  4PUA A;  1QQ2 A;  3APO A;  2H73 A;  5H5S A;  2H6X A;  1Y25 A;  2WCI A;  1TRV A;  1ERT A;  2DLX A;  2VL2 A;  4OCE A;  3UIW A;  5E59 A;  2HSH A;  5IMV A;  5ABR A;  3TJF A;  1RK4 A;  3ZVJ A;  2VM2 A;  1N8J A;  2LRT A;  4WF5 A;  2VCV A;  5ECI B;  4XRA A;  1AUC A;  2HQT A;  5LCZ A;  2R4V A;  2GTU A;  2AHE A;  4POM A;  1GSE A;  3BOA A;  4ILF A;  3RPN A;  4KF9 A;  2MZC A;  3ZL5 A;  1Q98 A;  4KND A;  5COH A;  2HXK A;  5G1L A;  3EMX A;  4OMV A;  2QC7 A;  2L6D A;  3FW2 A;  2R6K A;  2L59 A;  2GZZ A;  4BL7 A;  2ALB A;  3KTL A;  1OC9 B;  1R26 A;  4WET A;  4F2I A;  5ELA A;  1GSS A;  1GSU A;  3APS A;  2X8G A;  3G9B A;  4EVM A;  4DSS A;  4J2F A;  5KN2 A;  5IOX A;  1AQV A;  3ME8 A;  1S3A A;  4EXJ A;  2C3T A;  3ZYW A;  1SYR A;  3HVV A;  3FR6 A;  3L9U A;  3GV1 A;  4QL7 A;  4ZIJ A;  1TI3 A;  2LJA A;  3ZRD A;  4MJB A;  4K7N A;  4IS0 A;  3H8Q A;  3I43 A;  1YF1 A;  5B8A A;  1MTC A;  1YY7 A;  2VD0 A;  3F4T A;  5F07 A;  4CHS A;  3LXT A;  2MYG A;  2MMZ A;  1TK0 B;  12GS A;  1PQN A;  2K6V A;  2K9F A;  1YJ6 A;  3CRT A;  3DYR A;  3KD0 A;  3FRC A;  2E2G A;  1I9D A;  3A2W A;  2A4V A;  2B5X A;  2HSN B;  1VF4 A;  1GUM A;  1R4W A;  2GSQ A;  3CSH A;  2HE3 A;  3FHK A;  4AJ7 A;  2HRA A;  2P5Q A;  2JSY A;  2B1K A;  1Z3E A;  4K0G A;  1YF0 A;  5C00 A;  5ECK B;  1SU9 A;  2LRC A;  1ZGN A;  4Q5N A;  1A2M A;  3DEX A;  19GS A;  1ERU A;  3F3Q A;  2RM5 A;  1YKC A;  3GTU A;  3HD5 A;  4RQR A;  2DMM A;  4KH7 A;  4OFT A;  3OR5 A;  4I97 A;  2I81 A;  3DXB A;  3GIX A;  4WBJ A;  4XCS A;  5D73 A;  1E2Y A;  2KOK A;  1JFU A;  5B6N A;  4PX1 A;  1TJD A;  4HJM A;  3W8J A;  1O73 A;  1VRS D;  3NZN A;  2H70 A;  3D21 A;  3H79 A;  3HHV A;  2R2J A;  1AW9 A;  4K2D A;  3EMP A;  3ZRE A;  1XFL A;  4J56 E;  2VCT A;  4ISD A;  4WXT A;  2C0E A;  3IA1 A;  2FNO A;  4K7O A;  2AUV A;  1HNB A;  1A8Y A;  2NDO A;  3KH9 A;  3WGX A;  1USB A;  2M46 A;  3LXZ A;  2GSR A;  2JL4 A;  1JZW A;  3F63 A;  5ECM B;  2C3N A;  1RQM A;  3IK9 A;  1M2B A;  3O76 A;  3US3 A;  2R37 A;  3ZFB A;  4TXV A;  4IGJ A;  1M2A A;  4WBR D;  5B6M A;  4YAP A;  2FA4 A;  3G7Y A;  1YDK A;  3D4T A;  3VUR A;  3HZ8 A;  2YJH A;  3MDK A;  1GUL A;  4IQ1 A;  2EIQ A;  1PX7 A;  1XWA A;  2VM1 A;  1C72 A;  4K0N A;  5ELG A;  4L0W A;  2CX3 A;  4TRX A;  4KW6 A;  2GT6 A;  2DIY A;  1SL2 B;  2OAC A;  4ZL8 A;  1TKD B;  3EU3 A;  1PRX A;  3VWV A;  3HDC A;  2IPA A;  4V2M A;  1TI1 A;  2RLI A;  3ED3 A;  2M72 A;  4NWY A;  1FAA A;  3IBH A;  4MJA A;  3EWL A;  2C0G A;  1YQ1 A;  4TVE A;  1TK5 B;  5HFI A;  4GTU A;  2YWN A;  2DJ0 A;  4ID0 A;  1G7E A;  3DWV A;  1NSW A;  3U6V A;  4PNF A;  1BYE A;  5HR2 A;  2HZE B;  3H1N A;  2CZ3 A;  2H76 A;  1GTA A;  5IIZ A;  1TU7 A;  2MMO A;  2KP2 A;  4MA9 A;  4KCE A;  4Z7X A;  4ECC A;  3ZFL A;  2RUE A;  3L4N A;  4OO5 A;  4ZXG A;  3HY2 A;  5H5Q A;  3C1S A;  3Q18 A;  5IO2 A;  4XS4 B;  1EZK A;  4EUY A;  2XC2 A;  4Q5Q A;  2PGT A;  1SD8 A;  4G0L A;  4HQS A;  2JZR A;  3IXR A;  3UJ1 A;  4L5L A;  3WGE A;  5GAP D;  3ISO A;  2NVL A;  4AF2 A;  1PKZ A;  1X0R A;  1M9A A;  1PN9 A;  3O6T A;  4HZ4 A;  3CBU A;  3L9S A;  2PPT A;  3VI7 A;  1B4Q A;  1IYI A;  2BJX A;  2ES7 A;  3ZZX A;  3WYW A;  3MNG A;  2GZP A;  2OJL A;  5EVO A;  1K0M A;  3TRQ A;  4DSR A;  2VCW A;  4NV5 A;  2CV4 A;  1QGV A;  1ZMA A;  1B4P A;  1HYU A;  4FH8 A;  3GRX A;  1B8X A;  2HLS A;  3ZIT A;  1TOF A;  3QR6 A;  2LKU A;  5ID2 B;  2O85 A;  4Q5F A;  4F0B A;  3GMF A;  1XW9 A;  2V2G A;  2C0D A;  4G0I A;  2XHF A;  9GSS A;  4ZL7 A;  2ON7 A;  1QK8 A;  1M9B A;  3P7X A;  2LTK A;  2YAN A;  2GLR A;  2KP1 A;  1SD9 A;  1G6Y A;  1JZO A;  5B7C A;  5GZZ B;  4IBP A;  1SYX A;  2M80 A;  2X99 A;  2YNX A;  2LNS A;  1XOA A;  1J9B A;  1EWX A;  2V41 A;  1MDI A;  3IRA A;  1ZCP A;  2AYT A;  3UBK A;  5HR3 A;  4BA7 A;  4KB3 A;  5CRG A;  2YZH A;  3IOS A;  3VWX A;  1FVJ A;  5HR1 A;  4XS6 A;  3M9K A;  3IDV A;  5DAL B;  1MD4 A;  3GN3 A;  1K0B A;  3BCK A;  3UBL A;  5KN0 A;  3A3T A;  4EKZ A;  5ECR B;  1GLP A;  4OD7 A;  2ON5 A;  3N9J A;  1H4O A;  1LBK A;  2H1G A;  3FYG A;  5FWG A;  6GST A;  2C0F A;  2ZUP A;  2CAI A;  1DUG A;  2C3Q A;  1M2D A;  5G2Z A;  2FWG A;  4YQV A;  11GS A;  2I1U A;  4LA1 A;  4OWY A;  1G7O A;  1EGR A;  2AB6 A;  2DJ3 A;  1OVN A;  3P8W A;  3GSS A;  3DGQ A;  3ZVJ D;  1EV9 A;  1HNC A;  1YEX A;  1KEB A;  1VGL A;  3QMX A;  4XS1 A;  1F6M C;  4L5O A;  2G2Q A;  1OKD A;  4CW9 A;  2OA7 A;  3F4S A;  1S3D A;  2H72 A;  2GT5 A;  2GQM A;  4TW5 A;  4KX4 A;  2VOC A;  1BAY A;  1Z6N A;  1GUK A;  4I2U A;  1V57 A;  2X64 A;  4NMU A;  1UC7 A;  3Q19 A;  6GSY A;  3TUE A;  3E0U A;  4MZW A;  1DSB A;  4QL9 A;  3VWU A;  2X8C A;  5DBQ A;  3CSJ A;  2VCQ A;  2O89 A;  4I8B A;  3FY7 A;  2TRX A;  1OC9 A;  4IKH A;  2B5E A;  1XVQ A;  2FWF A;  2IMI A;  2LV3 A;  1B9X C;  2NBS A;  3MWH A;  1WE0 A;  3GX0 A;  4V1A g;  1VF2 A;  1WJK A;  2J23 A;  1GSD A;  4PNG A;  4NAX A;  1XZO A;  4GWR A;  1XVW A;  3D5J A;  5C04 A;  4MF5 A;  4JRR A;  4G0K A;  3GH6 A;  2HSM B;  4BVY B;  1FW1 A;  1WMJ A;  1V9W A;  2FGX A;  3J7Y b;  4MJC A;  20GS A;  2BTO T;  2KHP A;  4JR6 A;  5D8I A;  4N0V A;  5IPH A;  2IWT A;  5ECP B;  5DAK A;  3TKS A;  3WT1 A;  4G19 A;  4MF7 A;  3IC4 A;  3U5R E;  5J9C A;  2OKA A;  1SEN A;  3M3M A;  5HFG A;  4FO5 A;  4HS1 A;  3H4K A;  1HD2 A;  3M0F A;  3GH9 A;  3EIN A;  3EVI A;  4KUN A;  4TXO B;  1GP1 A;  3GST A;  2VCX A;  4DSQ A;  5GST A;  2IFQ A;  3P2A A;  3W8S A;  2F8F A;  4MZB A;  2VIM A;  1ML6 A;  4GSS A;  4PTS A;  2O8V B;  4HOJ A;  5ECN B;  5DDL A;  1N2A A;  4GST A;  2H1D A;  3IC8 A;  1PD2 1;  1V98 A;  2PUK C;  2WS2 A;  2FA8 A;  3F3R A;  2JAD A;  3H93 A;  2H8L A;  3TKS E;  1T4Y A;  4CDO A;  3LSZ A;  1T3B A;  3LOR A;  3GX8 A;  4D73 A;  2MMA A;  4YQM A;  1DE1 A;  3NIV A;  4EO3 A;  2VAF A;  2HYX A;  3DML A;  3QFA C;  2AV4 A;  5CYY A;  1A23 A;  1TXX A;  3LG6 A;  1KBN A;  2H1B A;  2GQL A;  5L71 A;  2H74 A;  3HZ4 A;  2B5Y A;  4K6X A;  3Q74 A;  4QQ7 A;  3J7Y k;  3ZTL A;  2WJU A;  5ECQ B;  1TRW A;  2F51 A;  4EF0 A;  4HI7 A;  5GSS A;  1XBS A;  2H0G A;  2L4Q A;  2A2R A;  1XW5 A;  4ZIL A;  2HSY A;  3WT2 A;  3FZ5 A;  3BJ5 A;  5DVB A;  4DSS B;  3KCM A;  3E3E A;  1WRY A;  4LL1 B;  4AJ6 A;  2I4A A;  5IMZ A;  4F9Z A;  3HCZ A;  1GRX A;  1XXU A;  5CAX A;  3C71 A;  1JHB A;  5ECL B;  1U6T A;  3ZLP A;  1JZD A;  4YH2 A;  2FWH A;  6GSS A;  2E0Q A;  2AAW A;  2KLX A;  4ULX A;  3IAS 2;  3A2V A;  5CRD A;  4IVF A;  3FZA A;  1KNG A;  4N11 A;  3EE2 A;  3RDW A;  3SWL A;  3GFK A;  4AGS A;  1O8X A;  5CP1 A;  5CRE A;  3DIE A;  4GXZ A;  1OE8 A;  5LD0 A;  3W6G A;  1U3A A;  2TRC P;  1V58 A;  3TKQ A;  5AN1 A;  4KA0 A;  2MBT A;  4O92 A;  4MLY A;  4O5R A;  1BQ7 A;  4EL1 A;  3TOT A;  1I5G A;  1J08 A;  5CRW A;  2V6O A;  1T8E B;  4MCU A;  4PXO A;  14GS A;  2HZE A;  2C1Y A;  1QXH A;  3GYK A;  3TOU A;  1SKR B;  2MMN A;  4TR1 B;  1KTE A;  4FYB A;  4PQI A;  2JU5 A;  2G0F A;  3TRP A;  2LRN A;  2B7J A;  2C4J A;  1XWB A;  2WZ9 A;  1WPI A;  3F6D A;  2LQQ A;  1SK0 A;  2XBQ A;  3CXG A;  4MH3 A; 
#chains in the Genus database with same CATH topology
 4TN8 A;  2FHE A;  4O32 A;  1T00 A;  4OFM A;  4ZB9 A;  2DBC A;  2JZT A;  3K8N A;  4ZB6 A;  2VLT A;  4EDY A;  2VLV A;  4XIH A;  3RGB C;  1O81 A;  3F8U A;  2A2S A;  4IJ3 A;  3GKN A;  1TU8 A;  2REM A;  2FUG 2;  2YZU A;  4MJE A;  1O8W A;  3MAK A;  1M7T A;  2LUS A;  3MYD A;  4TR3 A;  1XWK A;  4USS A;  4K8M A;  5G5F A;  3WD6 A;  1R7H A;  3GHA A;  3TJK A;  4X0X A;  2ZCT A;  5AIX A;  5A5K A;  1ZL9 A;  3M1G A;  3I69 A;  2H19 A;  4F0C A;  2GQK A;  2BMX A;  2PWJ A;  2JZS A;  3G7J A;  1EOG A;  1B48 A;  2XPE A;  2DJK A;  3DD3 A;  3UVT A;  3UMA A;  1JLW A;  1E6B A;  4MPF A;  4LL4 B;  2UZ8 A;  3IE3 A;  1OE7 A;  4CY8 A;  1AXD A;  5DCH A;  3RHC A;  1TRU A;  2DJ1 A;  2WDU A;  2R3X A;  5F05 A;  5J47 A;  2PN8 A;  3EU4 A;  3BBY A;  3LJR A;  1XIY A;  1VF1 A;  1A0R P;  3ERW A;  3O3T A;  6GSX A;  4WF4 A;  3TJG A;  2EIR A;  2RUF A;  1G0T A;  2CAQ A;  1NW2 A;  5IOW A;  5AGY A;  4YQU A;  3DVX A;  2EIO A;  2OE0 A;  3HA9 A;  2YV7 A;  2OBI A;  1T7P B;  5DJM A;  17GS A;  2H01 A;  2VO4 A;  1ZYE A;  2ZNM A;  4ICY A;  1I1I P;  2LQO A;  4N0Z A;  4HU7 A;  4K9Z A;  4IEL A;  5CRH A;  4NV2 A;  3CYN A;  3ME7 A;  4X43 A;  2WB9 A;  2CVB A;  3IK7 A;  2LNT A;  1GTU A;  3IR4 A;  3UAR A;  5DAL A;  1SL1 B;  3F9U A;  1EP8 A;  3TCO A;  3DVW A;  3RHB A;  2L4C A;  1ZYQ B;  2XBI A;  4GF0 A;  1EV4 A;  2IJY A;  1K0D A;  2Z9S A;  2N5B A;  4ZB8 A;  1V2A A;  4CY6 A;  4H86 A;  5CNW A;  3V1W A;  1ERV A;  3GL5 A;  3KP9 A;  3QPM A;  4JZQ A;  1Z7P A;  2HZF A;  4PUR A;  2HFD A;  5JCU A;  4WEY A;  1A0F A;  4KE3 A;  5AIS A;  2YWM A;  4ZBD A;  2DJ2 A;  1Y6E A;  3ERF A;  3GNJ A;  4BWQ A;  3ZIJ A;  3TKP A;  18GS A;  5J5N A;  3AY8 A;  5JWR B;  2WVZ A;  2PVQ A;  4K1F A;  3TGZ A;  1ON4 A;  1GTI A;  3GKM A;  2P5R A;  5IO0 A;  2DJJ A;  4FQU A;  2OBK A;  3LWA A;  3VPQ A;  2IMK A;  4MPG A;  1MDK A;  4RI6 A;  4V2N A;  3A2X A;  1SL0 B;  1SJI A;  5J3R A;  1QMV A;  5ECO B;  5IMD A;  3G7I A;  3CRU A;  2C80 A;  1TXU A;  4POK A;  1PMT A;  2PU9 C;  3Q6O A;  3F6F A;  3TKR A;  4XTS A;  2H0H A;  1AIU A;  1LJR A;  1WWJ A;  3HMJ G;  3RBT A;  5J9B A;  4IP6 A;  1GL8 A;  3F0I A;  3HYP A;  4BVX B;  2H75 A;  5IPG A;  3I6A A;  4ZBB A;  1ST9 A;  5DQS A;  2H0I A;  2QA2 A;  4KDY A;  2YWI A;  2GDR A;  2DKI A;  3L9V A;  1DBY A;  4WKW A;  2HSM A;  3UAP A;  3PIN A;  4JU5 A;  1PKW A;  4IP1 A;  4KDU A;  2HRK B;  1BJX A;  1F9M A;  4MZC A;  4PHZ C;  4O5Q A;  4TKY A;  1GNW A;  3DKS A;  4WR4 A;  4K5S A;  4E8E A;  3IHQ A;  4TOP A;  2LS5 A;  1G6W A;  3LYP A;  4LMV A;  5IM9 A;  1PL1 A;  5F0G A;  4XRD A;  3L0H A;  4PQ1 A;  1GSQ A;  2I9H A;  5INY A;  4KSM A;  5F06 A;  4HEA 2;  2H30 A;  3KJY A;  3KIJ A;  2AJQ B;  1QFN A;  5ECH B;  3VK9 A;  4MP4 A;  1EOH A;  5G31 A;  3CMI A;  4MMM A;  2F9S A;  5J4U A;  2QA1 A;  5HFK A;  1Z9H A;  2WW3 A;  4IQA A;  1FO5 A;  3WGD A;  4EDZ A;  1XPV A;  1F3B A;  2V6K A;  1IYH A;  2H71 A;  2QKE A;  3HVS A;  2B6M A;  3GKK A;  1R5P A;  1TTZ A;  1GTB A;  3D0Z A;  1JZR A;  4MDC A;  4FIW A;  3D6I A;  2YN1 A;  4HQZ A;  1EGO A;  2HNL A;  3FMW A;  2HI7 A;  1ERW A;  1GWC A;  2L5L A;  1T1V A;  1YEW C;  4WR5 A;  3R3E A;  4K7I A;  1WOU A;  4BIK A;  4FYU A;  1CQG A;  4AJ8 A;  2KUC A;  5A4V A;  2CT6 A;  1F37 A;  3EPT A;  3ZML A;  2EFD A;  2PBJ A;  2CZ2 A;  1B9Y C;  1BG5 A;  4MF6 A;  3IHG A;  4I6X A;  2EC4 A;  5JWQ B;  16GS A;  2A2P A;  3VI5 A;  3FKF A;  1R5A A;  1UVZ A;  2WGR A;  2IMD A;  1GH2 A;  3R2Q A;  4J57 E;  4GQF A;  1K0A A;  1H75 A;  4RI7 A;  1SK1 A;  1Z6M A;  5D9V A;  1GSY A;  1PSQ A;  4HDE A;  4GCI A;  3F4R A;  4FYC A;  5KN3 A;  4EIP A;  1U88 A;  5EPF A;  2O36 A;  1X9S B;  3KZQ A;  1PGT A;  5HR0 A;  3MIX A;  3KEB A;  1ZYP A;  3FEU A;  5G30 A;  5DAK B;  1BX9 A;  4O7H A;  4ECI A;  1FG4 A;  1FVK A;  1O6J A;  1PX6 A;  1V40 A;  2F8A A;  1YEP A;  3LYK A;  1OKT A;  4MH2 A;  4NXI A;  1O85 A;  4BL7 B;  3SBC A;  4AKI A;  3CSI A;  4OCF A;  2YJ7 A;  2FWE A;  3MSZ A;  4HU9 A;  4F03 A;  2IFQ B;  4KGI A;  2RII A;  2GS3 A;  3QAV A;  1OC3 A;  1XWC A;  3QFB C;  1TK8 B;  2CA8 A;  3FR9 A;  1FB0 A;  4GRF A;  1NHY A;  1M3I A;  4BWS A;  3ZMK A;  1M99 A;  1XWG A;  2P31 A;  2IMF A;  3APQ A;  3M9J A;  5ENU A;  5D9X A;  5BMU A;  4PQH A;  3HXS A;  5IMF A;  1FHE A;  4ACS A;  4ZBA A;  2LST A;  4V1A p;  4D73 B;  4NHW A;  1TP9 A;  4TR1 A;  1SK2 A;  5DCG A;  3QOU A;  2HT9 A;  4DVC A;  4KAE A;  3N5O A;  1U3I A;  2JSZ A;  2YWO A;  1K3L A;  5A5H A;  5DQY A;  2VD1 A;  2VUP A;  3KTB A;  4EC0 A;  3EC3 A;  1YKA A;  1SVM A;  1GNE A;  2GGT A;  2O7K A;  2DIZ A;  4KSO A;  2N5A A;  2YCD A;  5A4U A;  4L0U A;  1PL2 A;  1PFO A;  3PPU A;  3KMN A;  2H66 A;  4Z2U A;  5HQP A;  1XW6 A;  3KGK A;  3GTU B;  6GSV A;  3UL3 A;  2O87 A;  4PGT A;  2XPD A;  1Y1U A;  4ECJ A;  3C73 A;  4PUF C;  2YPM A;  1EEJ A;  3HJP A;  4JED A;  4X1U A;  3A5W A;  4TR0 A;  4ECB A;  1K3Y A;  2LEG A;  3DRN A;  2IIY A;  3CTF A;  3IPZ A;  3KM6 A;  3TDG A;  1XG8 A;  1S3C A;  3VFI A;  2CVK A;  3CTG A;  2PMT A;  1AQX A;  4N30 A;  3LQ7 A;  4XS4 A;  5FHI A;  4I5Q A;  1K0N A;  4G9H A;  13GS A;  2WUL A;  2L57 A;  4BPY A;  1Z7R A;  1HQO A;  3M8N A;  3FR3 A;  3VPT A;  3LFL A;  1MEK A;  5B8B A;  2FLS A;  2HRF A;  1F3A A;  2VL2 C;  2YOI A;  2K18 A;  22GS A;  4XHM A;  3L78 A;  3C8E A;  1QUW A;  1ZZY A;  1ACV A;  3LGC A;  4V2L A;  1NHO A;  1K0C A;  3RAZ A;  5H5R A;  4IW9 A;  3JCM L;  3QAW A;  1GLQ A;  1CQH A;  1JLV A;  2GZY A;  5D9W A;  4IHU A;  4ML6 A;  2NTO A;  3QD9 A;  4N10 A;  1RW1 A;  1AC1 A;  2EFH A;  1K3O A;  3E9J B;  2NPB A;  3TKS C;  2P0G A;  2DC5 A;  2FD3 A;  1YZX A;  1SJZ A;  10GS A;  3HKR A;  4JBB A;  2DML A;  1K0O A;  2CVD A;  5ID2 A;  2F3M A;  5D93 A;  4DEJ A;  2CX4 A;  4RQX A;  3FZ9 A;  4IJI A;  2WVX B;  2LJR A;  3I9V 2;  4RUV A;  5EY6 A;  5A4W A;  2C8U A;  3GKX A;  5E4W A;  2H6Z A;  1URM A;  3KH7 A;  5FT3 A;  2A4H A;  2R0P A;  1X9W B;  3PR8 A;  5IMC A;  1THO A;  3HJM A;  1O7U A;  4TR4 A;  3UVH A;  4ZB7 A;  3NOF A;  5JWO B;  3TRX A;  1OAZ A;  1W4V A;  1X5C A;  1U87 A;  1ZOF A;  3QDN A;  1SKW B;  2MBS A;  1GUH A;  2GVP A;  2R0G A;  4GDF A;  1A24 A;  3C7M A;  2N5F A;  2E2M A;  2VL3 A;  5IMA A;  3D22 A;  4YAV A;  2IME A;  2IL3 A;  3S9F A;  4NPB A;  4IN0 A;  1HNA A;  3KMO A;  2GST A;  2DSA A;  3KXO A;  3LEF A;  2GSS A;  3TB2 A;  1M0U A;  3P90 A;  4GSN A;  2FY6 A;  2FCH A;  4HJ2 A;  2HRN A;  3BD2 A;  2K8S A;  4MAB A;  5CO3 A;  3EUR A;  2OAD A;  3TJJ A;  1SVO A;  1S4B P;  2V32 A;  1TW9 A;  1Q4J A;  1MDJ A;  2B3S A;  3D4M A;  2VLU A;  1AQW A;  1EEM A;  2QSI A;  3FK8 A;  4JE1 A;  2D2Z A;  2VL9 A;  3GUR A;  3VWW A;  3QAG A;  1THX A;  4GLT A;  4Q5R A;  2K8V A;  1VF3 A;  3GA4 A;  1GSF A;  3HJO A;  1X5E A;  2YP6 A;  6GSU A;  4BVX A;  1J0F A;  6GSW A;  2L6C A;  2L5O A;  5KEJ A;  5IQY A;  4HUA A;  3PGT A;  4MK3 A;  1SKS B;  2EFE A;  1WP0 A;  1X9M B;  4LLR A;  1EP7 A;  1A8L A;  5LNK e;  2CQ9 A;  1AAZ A;  3VLN A;  4ZL9 A;  3ERG A;  5G1K A;  5GAN D;  5G5E A;  4E8H A;  5EL8 A;  2HRK A;  3UEM A;  3KP8 A;  2WRT A;  4JR4 A;  1XCC A;  5JCW A;  4EIQ A;  5AIV A;  3GL3 A;  1UA5 A;  1ABA A;  2H6Y A;  1ZYN A;  4GQC A;  2H1A A;  3FZ4 A;  2PER A;  1OYJ A;  4L8E A;  2IN3 A;  1X5D A;  5F8B A;  2TIR A;  2X8H A;  4K2X A;  1TRS A;  1SJ6 A;  3QCP A;  2YV9 A;  2R5G A;  2H1L A;  1XOB A;  2E7P A;  4I2T A;  1OC8 A;  4G2E A;  1BED A;  2B7K A;  5D96 A;  1FB6 A;  2V1M A;  4KDX A;  1DE2 A;  4ML1 A;  4BVY A;  5DJL A;  3EYT A;  1FOV A;  3BCI A;  4POB A;  1WIK A;  2OE3 A;  2QGV A;  4EE0 A;  4OO4 A;  3GUS A;  4NHZ A;  2WFC A;  1Z5Y E;  3TJB A;  4OFN A;  1ILO A;  2LJK A;  1PA3 A;  3ZIV A;  8GSS A;  1TDI A;  4HZ2 A;  5ECS A;  4F82 A;  3RPP A;  2B1L A;  2JAC A;  5J41 A;  2OE1 A;  1UN2 A;  2RM6 A;  1A2L A;  4G10 A;  2X49 A;  3IV4 A;  5J4V A;  1W89 A;  3IAM 2;  4LMW A;  2VCZ A;  1T4Z A;  4P3Y B;  4TXO A;  3PH9 A;  5D9T A;  4KCA A;  7GSS A;  1F2E A;  2J9H A;  3UOM A;  1A2J A;  1NM3 A;  1MD3 A;  3C1R A;  1LU4 A;  2PVO C;  5JCG A;  5KN1 A;  3HVX A;  4POL A;  2I3Y A;  4PUA A;  1QQ2 A;  3APO A;  2H73 A;  5H5S A;  2H6X A;  1Y25 A;  2WCI A;  1TRV A;  1ERT A;  2DLX A;  2VL2 A;  4OCE A;  3UIW A;  5E59 A;  2HSH A;  5IMV A;  5ABR A;  3TJF A;  1RK4 A;  3ZVJ A;  2VM2 A;  1N8J A;  2LRT A;  4WF5 A;  2VCV A;  5ECI B;  1PN0 A;  4XRA A;  1AUC A;  2HQT A;  5LCZ A;  2R4V A;  2GTU A;  2AHE A;  4POM A;  1GSE A;  3BOA A;  4ILF A;  3RPN A;  4KF9 A;  2MZC A;  3ZL5 A;  1Q98 A;  4KND A;  1S3R A;  5COH A;  2HXK A;  5G1L A;  3EMX A;  1M3J A;  4OMV A;  2QC7 A;  2L6D A;  3FW2 A;  2R6K A;  2L59 A;  2GZZ A;  4BL7 A;  2ALB A;  3KTL A;  1OC9 B;  1R26 A;  4WET A;  4F2I A;  5ELA A;  5J40 A;  1GSS A;  1GSU A;  3APS A;  2X8G A;  3G9B A;  4EVM A;  4DSS A;  4J2F A;  5KN2 A;  5IOX A;  1AQV A;  3ME8 A;  1S3A A;  4EXJ A;  2C3T A;  3ZYW A;  1SYR A;  3HVV A;  3FR6 A;  3L9U A;  3GV1 A;  2OT3 A;  4QL7 A;  4ZIJ A;  1TI3 A;  2LJA A;  3ZRD A;  5KOW A;  4MJB A;  4K7N A;  4IS0 A;  3H8Q A;  3I43 A;  1YF1 A;  5B8A A;  1MTC A;  1YY7 A;  2VD0 A;  3F4T A;  5F07 A;  4CHS A;  3LXT A;  2MYG A;  2MMZ A;  1TK0 B;  12GS A;  1PQN A;  2K6V A;  2K9F A;  1YJ6 A;  3CRT A;  3DYR A;  3KD0 A;  1SVL A;  3FRC A;  2E2G A;  1I9D A;  3A2W A;  2A4V A;  2B5X A;  5BRT A;  2HSN B;  1VF4 A;  1GUM A;  1R4W A;  2GSQ A;  3CSH A;  2HE3 A;  3FHK A;  4AJ7 A;  2HRA A;  2P5Q A;  2JSY A;  2B1K A;  1Z3E A;  4K0G A;  1YF0 A;  5C00 A;  5A1N A;  5ECK B;  1SU9 A;  5J4Y A;  2WW0 A;  2LRC A;  1ZGN A;  4Q5N A;  1A2M A;  3DEX A;  19GS A;  4Z2T A;  1ERU A;  3F3Q A;  4PI2 C;  2RM5 A;  1YKC A;  3GTU A;  3HD5 A;  4RQR A;  2DMM A;  4KH7 A;  4OFT A;  3OR5 A;  4I97 A;  5KOX A;  2I81 A;  4YKF A;  3DXB A;  3GIX A;  4WBJ A;  4XCS A;  5D73 A;  1E2Y A;  2KOK A;  1JFU A;  5A34 A;  5B6N A;  4PX1 A;  1TJD A;  4HJM A;  3W8J A;  2VKZ G;  1O73 A;  1VRS D;  3NZN A;  2H70 A;  3D21 A;  2X4A A;  3H79 A;  3HHV A;  2R2J A;  1AW9 A;  4K2D A;  3EMP A;  3ZRE A;  1XFL A;  4J56 E;  2VCT A;  4ISD A;  4WXT A;  2C0E A;  3IA1 A;  2FNO A;  3HVN A;  4K7O A;  2AUV A;  1HNB A;  4N3Z A;  1A8Y A;  2NDO A;  3KH9 A;  3WGX A;  1USB A;  2M46 A;  4AKX B;  3LXZ A;  2GSR A;  1YVL A;  2JL4 A;  1JZW A;  3F63 A;  5ECM B;  2C3N A;  1RQM A;  3IK9 A;  1M2B A;  3O76 A;  3TU3 B;  3US3 A;  1N25 A;  3ZFB A;  2R37 A;  4TXV A;  4IGJ A;  1M2A A;  4WBR D;  5B6M A;  4YAP A;  2FA4 A;  5BMU B;  3G7Y A;  1YDK A;  3D4T A;  3VUR A;  3HZ8 A;  2YJH A;  3MDK A;  1GUL A;  4IQ1 A;  2EIQ A;  1PX7 A;  1XWA A;  2VM1 A;  2WW1 A;  1C72 A;  4K0N A;  5ELG A;  4L0W A;  2CX3 A;  4TRX A;  4KW6 A;  2GT6 A;  2DIY A;  1SL2 B;  2OAC A;  4ZL8 A;  1TKD B;  3EU3 A;  1PRX A;  3VWV A;  3HDC A;  2IPA A;  4V2M A;  1TI1 A;  2RLI A;  3ED3 A;  2M72 A;  4NWY A;  2WVX A;  1FAA A;  3IBH A;  4MJA A;  3EWL A;  2C0G A;  1YQ1 A;  4AKG A;  4O5U A;  4TVE A;  1TK5 B;  5HFI A;  4GTU A;  2YWN A;  2DJ0 A;  4ID0 A;  1G7E A;  3DWV A;  1NSW A;  3U6V A;  4PNF A;  1BYE A;  5HR2 A;  2HZE B;  3H1N A;  2CZ3 A;  2H76 A;  1GTA A;  5IIZ A;  1TU7 A;  2MMO A;  2KP2 A;  4MA9 A;  4KCE A;  4Z7X A;  4ECC A;  3ZFL A;  2RUE A;  3L4N A;  3CQF A;  4OO5 A;  4ZXG A;  4A5P A;  2EFC A;  3HY2 A;  5H5Q A;  3C1S A;  3Q18 A;  5IO2 A;  4XS4 B;  1EZK A;  4EUY A;  2XC2 A;  4Q5Q A;  2PGT A;  1SD8 A;  4G0L A;  4HQS A;  2JZR A;  3IXR A;  3UJ1 A;  4L5L A;  3WGE A;  5GAP D;  3ISO A;  2NVL A;  4AF2 A;  1PKZ A;  1X0R A;  1M9A A;  1PN9 A;  3O6T A;  4HZ4 A;  3CBU A;  4FXY P;  3L9S A;  2PPT A;  3VI7 A;  1B4Q A;  1IYI A;  2BJX A;  2ES7 A;  3ZZX A;  3WYW A;  3MNG A;  2GZP A;  2OJL A;  4HSC X;  5EVO A;  1K0M A;  3TRQ A;  4DSR A;  2VCW A;  4NV5 A;  2DKH A;  2CV4 A;  1QGV A;  1ZMA A;  1B4P A;  1HYU A;  4FH8 A;  3GRX A;  1B8X A;  2HLS A;  3ZIT A;  1TOF A;  2WW2 A;  3QR6 A;  4QMK A;  2LKU A;  2R0C A;  5ID2 B;  2O85 A;  4Q5F A;  4F0B A;  3GMF A;  1XW9 A;  2V2G A;  2C0D A;  4G0I A;  2XHF A;  9GSS A;  4AKH A;  4ZL7 A;  2ON7 A;  1QK8 A;  1M9B A;  3P7X A;  2LTK A;  2YAN A;  2GLR A;  2KP1 A;  1SD9 A;  1G6Y A;  1JZO A;  5B7C A;  5GZZ B;  4IBP A;  1SYX A;  2M80 A;  2X99 A;  2YNX A;  2LNS A;  1XOA A;  1J9B A;  1EWX A;  2V41 A;  1MDI A;  2O5V A;  3IRA A;  1ZCP A;  2AYT A;  3UBK A;  5HR3 A;  3CWG A;  4BA7 A;  4KB3 A;  5CRG A;  2YZH A;  3IOS A;  3VWX A;  1FVJ A;  5HR1 A;  4XS6 A;  3M9K A;  3IDV A;  4W66 A;  5DAL B;  3RFR C;  1MD4 A;  3GN3 A;  1K0B A;  3BCK A;  3UBL A;  5KN0 A;  3A3T A;  4EKZ A;  5ECR B;  1GLP A;  4OD7 A;  2ON5 A;  3N9J A;  1H4O A;  3LW9 A;  1LBK A;  2H1G A;  3FYG A;  5FWG A;  6GST A;  2C0F A;  2ZUP A;  2CAI A;  1DUG A;  2C3Q A;  1M2D A;  5G2Z A;  2FWG A;  4YQV A;  11GS A;  2I1U A;  4LA1 A;  4OWY A;  1G7O A;  3CHX C;  1EGR A;  2AB6 A;  2DJ3 A;  1OVN A;  3P8W A;  3GSS A;  3DGQ A;  3ZVJ D;  1EV9 A;  1HNC A;  2WVY A;  1YEX A;  1KEB A;  1VGL A;  3QMX A;  4XS1 A;  1F6M C;  4L5O A;  2G2Q A;  1OKD A;  4CW9 A;  2OA7 A;  3F4S A;  1S3D A;  2H72 A;  2GT5 A;  2GQM A;  4PI0 C;  4TW5 A;  4KX4 A;  2VOC A;  1BAY A;  1Z6N A;  1GUK A;  4I2U A;  1V57 A;  2X64 A;  4NMU A;  1UC7 A;  3Q19 A;  6GSY A;  3TUE A;  3E0U A;  4MZW A;  1DSB A;  4QL9 A;  3VWU A;  2X8C A;  5DBQ A;  3CSJ A;  2VCQ A;  2O89 A;  4I8B A;  3FY7 A;  2TRX A;  1OC9 A;  4IKH A;  2B5E A;  1XVQ A;  2FWF A;  2IMI A;  2LV3 A;  1B9X C;  2NBS A;  3MWH A;  1WE0 A;  3GX0 A;  4V1A g;  1VF2 A;  1WJK A;  2J23 A;  1GSD A;  4PNG A;  4NAX A;  1XZO A;  4GWR A;  1XVW A;  3D5J A;  5C04 A;  4MF5 A;  4JRR A;  4G0K A;  3GH6 A;  2HSM B;  4BVY B;  1FW1 A;  1WMJ A;  1V9W A;  2FGX A;  3J7Y b;  4MJC A;  20GS A;  2BTO T;  2KHP A;  4JR6 A;  5D8I A;  4N0V A;  5IPH A;  2IWT A;  5ECP B;  5DAK A;  3TKS A;  3WT1 A;  4MNN A;  4G19 A;  4MF7 A;  3IC4 A;  3U5R E;  5J9C A;  2OKA A;  1SEN A;  3M3M A;  5HFG A;  4FO5 A;  4HS1 A;  3H4K A;  1HD2 A;  4YKG A;  3M0F A;  3GH9 A;  3EIN A;  3EVI A;  4KUN A;  4TXO B;  1GP1 A;  3GST A;  2VCX A;  4DSQ A;  5GST A;  2IFQ A;  4K5R A;  2HSN A;  3P2A A;  3W8S A;  2O3E A;  2F8F A;  4MZB A;  2VIM A;  1ML6 A;  4GSS A;  4PTS A;  2O8V B;  4HOJ A;  5ECN B;  5DDL A;  1N2A A;  4GST A;  2H1D A;  3IC8 A;  1PD2 1;  1V98 A;  2WZS A;  2PUK C;  2WS2 A;  2FA8 A;  3F3R A;  2JAD A;  3H93 A;  2H8L A;  3TKS E;  1T4Y A;  4CDO A;  3LSZ A;  1T3B A;  3LOR A;  3GX8 A;  4D73 A;  2MMA A;  4YQM A;  1DE1 A;  3NIV A;  4EO3 A;  2VAF A;  4AI6 A;  2HYX A;  3DML A;  3QFA C;  2AV4 A;  5CYY A;  1A23 A;  1TXX A;  3LG6 A;  1KBN A;  2H1B A;  2GQL A;  5L71 A;  2H74 A;  3HZ4 A;  2B5Y A;  4K6X A;  3Q74 A;  4QQ7 A;  3J7Y k;  3ZTL A;  2WJU A;  5ECQ B;  1TRW A;  2F51 A;  4EF0 A;  4HI7 A;  5GSS A;  1XBS A;  2H0G A;  2L4Q A;  2A2R A;  1XW5 A;  4ZIL A;  2HSY A;  3WT2 A;  3FZ5 A;  3BJ5 A;  5DVB A;  4DSS B;  3KCM A;  3E3E A;  1BF5 A;  1WRY A;  4LL1 B;  4AJ6 A;  2I4A A;  5IMZ A;  4F9Z A;  3HCZ A;  1GRX A;  1XXU A;  5CAX A;  3C71 A;  1JHB A;  5ECL B;  1U6T A;  3ZLP A;  1JZD A;  4YH2 A;  2FWH A;  6GSS A;  2E0Q A;  2AAW A;  2KLX A;  2UV8 G;  4ULX A;  3IAS 2;  3A2V A;  5CRD A;  4IVF A;  3FZA A;  1KNG A;  4N11 A;  3EE2 A;  3RDW A;  3A5I A;  3SWL A;  3GFK A;  4AGS A;  1O8X A;  5CP1 A;  5CRE A;  3DIE A;  4GXZ A;  1OE8 A;  5LD0 A;  3W6G A;  1U3A A;  2TRC P;  1V58 A;  3TKQ A;  5AN1 A;  4KA0 A;  2MBT A;  5A1N B;  4O92 A;  4MLY A;  4G01 A;  4O5R A;  1BQ7 A;  4EL1 A;  3TOT A;  1I5G A;  1J08 A;  5CRW A;  2V6O A;  1T8E B;  4MCU A;  4PXO A;  14GS A;  2HZE A;  2C1Y A;  1QXH A;  3GYK A;  1BG1 A;  3TOU A;  1SKR B;  1FOH A;  2MMN A;  4TR1 B;  5A34 B;  1KTE A;  4FYB A;  4PQI A;  2JU5 A;  2G0F A;  3TRP A;  2LRN A;  2B7J A;  2C4J A;  1XWB A;  2WZ9 A;  4E68 A;  5A5H B;  4X4J A;  4Z2R A;  1WPI A;  3F6D A;  2LQQ A;  1SK0 A;  2XBQ A;  3CXG A;  4MH3 A; 
#chains in the Genus database with same CATH homology
 4TN8 A;  2FHE A;  4O32 A;  1T00 A;  4OFM A;  4ZB9 A;  2DBC A;  2JZT A;  3K8N A;  4ZB6 A;  2VLT A;  4EDY A;  2VLV A;  4XIH A;  1O81 A;  3F8U A;  2A2S A;  4IJ3 A;  3GKN A;  1TU8 A;  2REM A;  2FUG 2;  2YZU A;  4MJE A;  1O8W A;  3MAK A;  1M7T A;  2LUS A;  3MYD A;  4TR3 A;  1XWK A;  4USS A;  4K8M A;  5G5F A;  3WD6 A;  1R7H A;  3GHA A;  3TJK A;  4X0X A;  2ZCT A;  5AIX A;  5A5K A;  1ZL9 A;  3M1G A;  3I69 A;  2H19 A;  4F0C A;  2GQK A;  2BMX A;  2PWJ A;  2JZS A;  3G7J A;  1EOG A;  1B48 A;  2XPE A;  2DJK A;  3DD3 A;  3UVT A;  3UMA A;  1JLW A;  1E6B A;  4MPF A;  4LL4 B;  2UZ8 A;  3IE3 A;  1OE7 A;  4CY8 A;  1AXD A;  5DCH A;  3RHC A;  1TRU A;  2DJ1 A;  2WDU A;  2R3X A;  5F05 A;  5J47 A;  2PN8 A;  3EU4 A;  3BBY A;  3LJR A;  1XIY A;  1VF1 A;  1A0R P;  3ERW A;  3O3T A;  6GSX A;  4WF4 A;  3TJG A;  2EIR A;  2RUF A;  1G0T A;  2CAQ A;  1NW2 A;  5IOW A;  5AGY A;  4YQU A;  3DVX A;  2EIO A;  2OE0 A;  3HA9 A;  2YV7 A;  2OBI A;  1T7P B;  5DJM A;  17GS A;  2H01 A;  2VO4 A;  1ZYE A;  2ZNM A;  4ICY A;  2LQO A;  4N0Z A;  4HU7 A;  4K9Z A;  4IEL A;  5CRH A;  4NV2 A;  3CYN A;  3ME7 A;  4X43 A;  2WB9 A;  2CVB A;  3IK7 A;  2LNT A;  1GTU A;  3IR4 A;  3UAR A;  5DAL A;  1SL1 B;  3F9U A;  1EP8 A;  3TCO A;  3DVW A;  3RHB A;  2L4C A;  1ZYQ B;  2XBI A;  4GF0 A;  1EV4 A;  2IJY A;  1K0D A;  2Z9S A;  2N5B A;  4ZB8 A;  1V2A A;  4CY6 A;  4H86 A;  5CNW A;  3V1W A;  1ERV A;  3GL5 A;  3KP9 A;  3QPM A;  4JZQ A;  1Z7P A;  2HZF A;  4PUR A;  2HFD A;  5JCU A;  4WEY A;  1A0F A;  4KE3 A;  5AIS A;  2YWM A;  4ZBD A;  2DJ2 A;  1Y6E A;  3ERF A;  3GNJ A;  4BWQ A;  3ZIJ A;  3TKP A;  18GS A;  5J5N A;  3AY8 A;  5JWR B;  2PVQ A;  4K1F A;  3TGZ A;  1ON4 A;  1GTI A;  3GKM A;  2P5R A;  5IO0 A;  2DJJ A;  4FQU A;  2OBK A;  3LWA A;  3VPQ A;  2IMK A;  4MPG A;  1MDK A;  4RI6 A;  4V2N A;  3A2X A;  1SL0 B;  1SJI A;  5J3R A;  1QMV A;  5ECO B;  5IMD A;  3G7I A;  3CRU A;  2C80 A;  1TXU A;  4POK A;  1PMT A;  2PU9 C;  3Q6O A;  3F6F A;  3TKR A;  4XTS A;  2H0H A;  1AIU A;  1LJR A;  1WWJ A;  3HMJ G;  3RBT A;  5J9B A;  4IP6 A;  1GL8 A;  3F0I A;  3HYP A;  4BVX B;  2H75 A;  5IPG A;  3I6A A;  4ZBB A;  1ST9 A;  5DQS A;  2H0I A;  2QA2 A;  4KDY A;  2YWI A;  2GDR A;  2DKI A;  3L9V A;  1DBY A;  4WKW A;  2HSM A;  3UAP A;  3PIN A;  4JU5 A;  1PKW A;  4IP1 A;  4KDU A;  2HRK B;  1BJX A;  1F9M A;  4MZC A;  4O5Q A;  4TKY A;  1GNW A;  3DKS A;  4WR4 A;  4K5S A;  4E8E A;  3IHQ A;  4TOP A;  2LS5 A;  1G6W A;  3LYP A;  4LMV A;  5IM9 A;  1PL1 A;  5F0G A;  4XRD A;  3L0H A;  4PQ1 A;  1GSQ A;  2I9H A;  5INY A;  4KSM A;  5F06 A;  4HEA 2;  2H30 A;  3KJY A;  3KIJ A;  2AJQ B;  1QFN A;  5ECH B;  3VK9 A;  4MP4 A;  1EOH A;  5G31 A;  3CMI A;  4MMM A;  2F9S A;  5J4U A;  2QA1 A;  5HFK A;  1Z9H A;  4IQA A;  1FO5 A;  3WGD A;  4EDZ A;  1XPV A;  1F3B A;  2V6K A;  1IYH A;  2H71 A;  2QKE A;  3HVS A;  2B6M A;  3GKK A;  1R5P A;  1TTZ A;  1GTB A;  3D0Z A;  1JZR A;  4MDC A;  4FIW A;  3D6I A;  2YN1 A;  4HQZ A;  1EGO A;  2HNL A;  3FMW A;  2HI7 A;  1ERW A;  1GWC A;  2L5L A;  1T1V A;  4WR5 A;  3R3E A;  4K7I A;  1WOU A;  4FYU A;  1CQG A;  4AJ8 A;  2KUC A;  5A4V A;  2CT6 A;  1F37 A;  3EPT A;  3ZML A;  2EFD A;  2PBJ A;  2CZ2 A;  1B9Y C;  1BG5 A;  4MF6 A;  3IHG A;  4I6X A;  2EC4 A;  5JWQ B;  16GS A;  2A2P A;  3VI5 A;  3FKF A;  1R5A A;  1UVZ A;  2WGR A;  2IMD A;  1GH2 A;  3R2Q A;  4J57 E;  4GQF A;  1K0A A;  1H75 A;  4RI7 A;  1SK1 A;  1Z6M A;  5D9V A;  1GSY A;  1PSQ A;  4HDE A;  4GCI A;  3F4R A;  4FYC A;  5KN3 A;  4EIP A;  1U88 A;  5EPF A;  1X9S B;  3KZQ A;  1PGT A;  5HR0 A;  3MIX A;  3KEB A;  1ZYP A;  3FEU A;  5G30 A;  5DAK B;  1BX9 A;  4O7H A;  4ECI A;  1FG4 A;  1FVK A;  1O6J A;  1PX6 A;  1V40 A;  2F8A A;  1YEP A;  3LYK A;  1OKT A;  4MH2 A;  4NXI A;  1O85 A;  4BL7 B;  3SBC A;  4AKI A;  3CSI A;  4OCF A;  2YJ7 A;  2FWE A;  3MSZ A;  4HU9 A;  4F03 A;  2IFQ B;  4KGI A;  2RII A;  2GS3 A;  3QAV A;  1OC3 A;  1XWC A;  3QFB C;  1TK8 B;  2CA8 A;  3FR9 A;  1FB0 A;  4GRF A;  1NHY A;  4BWS A;  3ZMK A;  1M99 A;  1XWG A;  2P31 A;  2IMF A;  3APQ A;  3M9J A;  5ENU A;  5D9X A;  5BMU A;  4PQH A;  3HXS A;  5IMF A;  1FHE A;  4ACS A;  4ZBA A;  2LST A;  4V1A p;  4D73 B;  4NHW A;  1TP9 A;  4TR1 A;  1SK2 A;  5DCG A;  3QOU A;  2HT9 A;  4DVC A;  4KAE A;  3N5O A;  1U3I A;  2JSZ A;  2YWO A;  1K3L A;  5A5H A;  5DQY A;  2VD1 A;  2VUP A;  3KTB A;  4EC0 A;  3EC3 A;  1YKA A;  1SVM A;  1GNE A;  2GGT A;  2O7K A;  2DIZ A;  4KSO A;  2N5A A;  2YCD A;  5A4U A;  4L0U A;  1PL2 A;  3PPU A;  3KMN A;  2H66 A;  4Z2U A;  5HQP A;  1XW6 A;  3KGK A;  3GTU B;  6GSV A;  3UL3 A;  2O87 A;  4PGT A;  2XPD A;  1Y1U A;  4ECJ A;  3C73 A;  4PUF C;  2YPM A;  1EEJ A;  3HJP A;  4JED A;  4X1U A;  3A5W A;  4TR0 A;  4ECB A;  1K3Y A;  2LEG A;  3DRN A;  2IIY A;  3CTF A;  3IPZ A;  3KM6 A;  3TDG A;  1S3C A;  3VFI A;  2CVK A;  3CTG A;  2PMT A;  1AQX A;  4N30 A;  3LQ7 A;  4XS4 A;  5FHI A;  4I5Q A;  1K0N A;  4G9H A;  13GS A;  2WUL A;  2L57 A;  4BPY A;  1Z7R A;  1HQO A;  3M8N A;  3FR3 A;  3VPT A;  3LFL A;  1MEK A;  5B8B A;  2FLS A;  2HRF A;  1F3A A;  2VL2 C;  2YOI A;  2K18 A;  22GS A;  4XHM A;  3L78 A;  3C8E A;  1QUW A;  1ZZY A;  1ACV A;  3LGC A;  4V2L A;  1NHO A;  1K0C A;  3RAZ A;  5H5R A;  4IW9 A;  3JCM L;  3QAW A;  1GLQ A;  1CQH A;  1JLV A;  2GZY A;  5D9W A;  4IHU A;  4ML6 A;  2NTO A;  3QD9 A;  4N10 A;  1RW1 A;  1AC1 A;  2EFH A;  1K3O A;  3E9J B;  2NPB A;  3TKS C;  2P0G A;  2DC5 A;  2FD3 A;  1YZX A;  1SJZ A;  10GS A;  3HKR A;  4JBB A;  2DML A;  1K0O A;  2CVD A;  5ID2 A;  2F3M A;  5D93 A;  4DEJ A;  2CX4 A;  4RQX A;  3FZ9 A;  4IJI A;  2LJR A;  3I9V 2;  4RUV A;  5EY6 A;  5A4W A;  2C8U A;  3GKX A;  5E4W A;  2H6Z A;  1URM A;  3KH7 A;  5FT3 A;  2A4H A;  2R0P A;  1X9W B;  3PR8 A;  5IMC A;  1THO A;  3HJM A;  1O7U A;  4TR4 A;  3UVH A;  4ZB7 A;  3NOF A;  5JWO B;  3TRX A;  1OAZ A;  1W4V A;  1X5C A;  1U87 A;  1ZOF A;  3QDN A;  1SKW B;  2MBS A;  1GUH A;  2GVP A;  2R0G A;  4GDF A;  1A24 A;  3C7M A;  2N5F A;  2E2M A;  2VL3 A;  5IMA A;  3D22 A;  4YAV A;  2IME A;  2IL3 A;  3S9F A;  4NPB A;  4IN0 A;  1HNA A;  3KMO A;  2GST A;  2DSA A;  3KXO A;  3LEF A;  2GSS A;  3TB2 A;  1M0U A;  3P90 A;  4GSN A;  2FY6 A;  2FCH A;  4HJ2 A;  2HRN A;  3BD2 A;  2K8S A;  4MAB A;  5CO3 A;  3EUR A;  2OAD A;  3TJJ A;  1SVO A;  2V32 A;  1TW9 A;  1Q4J A;  1MDJ A;  2B3S A;  3D4M A;  2VLU A;  1AQW A;  1EEM A;  2QSI A;  3FK8 A;  4JE1 A;  2D2Z A;  2VL9 A;  3GUR A;  3VWW A;  3QAG A;  1THX A;  4GLT A;  4Q5R A;  2K8V A;  1VF3 A;  3GA4 A;  1GSF A;  3HJO A;  1X5E A;  2YP6 A;  6GSU A;  4BVX A;  1J0F A;  6GSW A;  2L6C A;  2L5O A;  5KEJ A;  5IQY A;  4HUA A;  3PGT A;  4MK3 A;  1SKS B;  2EFE A;  1WP0 A;  1X9M B;  4LLR A;  1EP7 A;  1A8L A;  5LNK e;  2CQ9 A;  1AAZ A;  3VLN A;  4ZL9 A;  3ERG A;  5G1K A;  5GAN D;  5G5E A;  4E8H A;  5EL8 A;  2HRK A;  3UEM A;  3KP8 A;  2WRT A;  4JR4 A;  1XCC A;  5JCW A;  4EIQ A;  5AIV A;  3GL3 A;  1UA5 A;  1ABA A;  2H6Y A;  1ZYN A;  4GQC A;  2H1A A;  3FZ4 A;  2PER A;  1OYJ A;  4L8E A;  2IN3 A;  1X5D A;  5F8B A;  2TIR A;  2X8H A;  4K2X A;  1TRS A;  1SJ6 A;  3QCP A;  2YV9 A;  2R5G A;  2H1L A;  1XOB A;  2E7P A;  4I2T A;  1OC8 A;  4G2E A;  1BED A;  2B7K A;  5D96 A;  1FB6 A;  2V1M A;  4KDX A;  1DE2 A;  4ML1 A;  4BVY A;  5DJL A;  3EYT A;  1FOV A;  3BCI A;  4POB A;  1WIK A;  2OE3 A;  2QGV A;  4EE0 A;  4OO4 A;  3GUS A;  4NHZ A;  2WFC A;  1Z5Y E;  3TJB A;  4OFN A;  1ILO A;  2LJK A;  1PA3 A;  3ZIV A;  8GSS A;  1TDI A;  4HZ2 A;  5ECS A;  4F82 A;  3RPP A;  2B1L A;  2JAC A;  5J41 A;  2OE1 A;  1UN2 A;  2RM6 A;  1A2L A;  4G10 A;  2X49 A;  3IV4 A;  5J4V A;  1W89 A;  3IAM 2;  4LMW A;  2VCZ A;  1T4Z A;  4P3Y B;  4TXO A;  3PH9 A;  5D9T A;  4KCA A;  7GSS A;  1F2E A;  2J9H A;  3UOM A;  1A2J A;  1NM3 A;  1MD3 A;  3C1R A;  1LU4 A;  2PVO C;  5JCG A;  5KN1 A;  3HVX A;  4POL A;  2I3Y A;  4PUA A;  1QQ2 A;  3APO A;  2H73 A;  5H5S A;  2H6X A;  1Y25 A;  2WCI A;  1TRV A;  1ERT A;  2DLX A;  2VL2 A;  4OCE A;  3UIW A;  5E59 A;  2HSH A;  5IMV A;  5ABR A;  3TJF A;  1RK4 A;  3ZVJ A;  2VM2 A;  1N8J A;  2LRT A;  4WF5 A;  2VCV A;  5ECI B;  1PN0 A;  4XRA A;  1AUC A;  2HQT A;  5LCZ A;  2R4V A;  2GTU A;  2AHE A;  4POM A;  1GSE A;  3BOA A;  4ILF A;  3RPN A;  4KF9 A;  2MZC A;  3ZL5 A;  1Q98 A;  4KND A;  5COH A;  2HXK A;  5G1L A;  3EMX A;  4OMV A;  2QC7 A;  2L6D A;  3FW2 A;  2R6K A;  2L59 A;  2GZZ A;  4BL7 A;  2ALB A;  3KTL A;  1OC9 B;  1R26 A;  4WET A;  4F2I A;  5ELA A;  5J40 A;  1GSS A;  1GSU A;  3APS A;  2X8G A;  3G9B A;  4EVM A;  4DSS A;  4J2F A;  5KN2 A;  5IOX A;  1AQV A;  3ME8 A;  1S3A A;  4EXJ A;  2C3T A;  3ZYW A;  1SYR A;  3HVV A;  3FR6 A;  3L9U A;  3GV1 A;  2OT3 A;  4QL7 A;  4ZIJ A;  1TI3 A;  2LJA A;  3ZRD A;  5KOW A;  4MJB A;  4K7N A;  4IS0 A;  3H8Q A;  3I43 A;  1YF1 A;  5B8A A;  1MTC A;  1YY7 A;  2VD0 A;  3F4T A;  5F07 A;  4CHS A;  3LXT A;  2MYG A;  2MMZ A;  1TK0 B;  12GS A;  1PQN A;  2K6V A;  2K9F A;  1YJ6 A;  3CRT A;  3DYR A;  3KD0 A;  1SVL A;  3FRC A;  2E2G A;  1I9D A;  3A2W A;  2A4V A;  2B5X A;  5BRT A;  2HSN B;  1VF4 A;  1GUM A;  1R4W A;  2GSQ A;  3CSH A;  2HE3 A;  3FHK A;  4AJ7 A;  2HRA A;  2P5Q A;  2JSY A;  2B1K A;  1Z3E A;  4K0G A;  1YF0 A;  5C00 A;  5A1N A;  5ECK B;  1SU9 A;  5J4Y A;  2LRC A;  1ZGN A;  4Q5N A;  1A2M A;  3DEX A;  19GS A;  4Z2T A;  1ERU A;  3F3Q A;  2RM5 A;  1YKC A;  3GTU A;  3HD5 A;  4RQR A;  2DMM A;  4KH7 A;  4OFT A;  3OR5 A;  4I97 A;  5KOX A;  2I81 A;  4YKF A;  3DXB A;  3GIX A;  4WBJ A;  4XCS A;  5D73 A;  1E2Y A;  2KOK A;  1JFU A;  5A34 A;  5B6N A;  4PX1 A;  1TJD A;  4HJM A;  3W8J A;  2VKZ G;  1O73 A;  1VRS D;  3NZN A;  2H70 A;  3D21 A;  2X4A A;  3H79 A;  3HHV A;  2R2J A;  1AW9 A;  4K2D A;  3EMP A;  3ZRE A;  1XFL A;  4J56 E;  2VCT A;  4ISD A;  4WXT A;  2C0E A;  3IA1 A;  2FNO A;  4K7O A;  2AUV A;  1HNB A;  4N3Z A;  1A8Y A;  2NDO A;  3KH9 A;  3WGX A;  1USB A;  2M46 A;  4AKX B;  3LXZ A;  2GSR A;  1YVL A;  2JL4 A;  1JZW A;  3F63 A;  5ECM B;  2C3N A;  1RQM A;  3IK9 A;  1M2B A;  3O76 A;  3TU3 B;  3US3 A;  1N25 A;  3ZFB A;  2R37 A;  4TXV A;  4IGJ A;  1M2A A;  4WBR D;  5B6M A;  4YAP A;  2FA4 A;  5BMU B;  3G7Y A;  1YDK A;  3D4T A;  3VUR A;  3HZ8 A;  2YJH A;  3MDK A;  1GUL A;  4IQ1 A;  2EIQ A;  1PX7 A;  1XWA A;  2VM1 A;  1C72 A;  4K0N A;  5ELG A;  4L0W A;  2CX3 A;  4TRX A;  4KW6 A;  2GT6 A;  2DIY A;  1SL2 B;  2OAC A;  4ZL8 A;  1TKD B;  3EU3 A;  1PRX A;  3VWV A;  3HDC A;  2IPA A;  4V2M A;  1TI1 A;  2RLI A;  3ED3 A;  2M72 A;  4NWY A;  1FAA A;  3IBH A;  4MJA A;  3EWL A;  2C0G A;  1YQ1 A;  4AKG A;  4O5U A;  4TVE A;  1TK5 B;  5HFI A;  4GTU A;  2YWN A;  2DJ0 A;  4ID0 A;  1G7E A;  3DWV A;  1NSW A;  3U6V A;  4PNF A;  1BYE A;  5HR2 A;  2HZE B;  3H1N A;  2CZ3 A;  2H76 A;  1GTA A;  5IIZ A;  1TU7 A;  2MMO A;  2KP2 A;  4MA9 A;  4KCE A;  4Z7X A;  4ECC A;  3ZFL A;  2RUE A;  3L4N A;  4OO5 A;  4ZXG A;  4A5P A;  2EFC A;  3HY2 A;  5H5Q A;  3C1S A;  3Q18 A;  5IO2 A;  4XS4 B;  1EZK A;  4EUY A;  2XC2 A;  4Q5Q A;  2PGT A;  1SD8 A;  4G0L A;  4HQS A;  2JZR A;  3IXR A;  3UJ1 A;  4L5L A;  3WGE A;  5GAP D;  3ISO A;  2NVL A;  4AF2 A;  1PKZ A;  1X0R A;  1M9A A;  1PN9 A;  3O6T A;  4HZ4 A;  3CBU A;  3L9S A;  2PPT A;  3VI7 A;  1B4Q A;  1IYI A;  2BJX A;  2ES7 A;  3ZZX A;  3WYW A;  3MNG A;  2GZP A;  2OJL A;  5EVO A;  1K0M A;  3TRQ A;  4DSR A;  2VCW A;  4NV5 A;  2DKH A;  2CV4 A;  1QGV A;  1ZMA A;  1B4P A;  1HYU A;  4FH8 A;  3GRX A;  1B8X A;  2HLS A;  3ZIT A;  1TOF A;  3QR6 A;  4QMK A;  2LKU A;  2R0C A;  5ID2 B;  2O85 A;  4Q5F A;  4F0B A;  3GMF A;  1XW9 A;  2V2G A;  2C0D A;  4G0I A;  2XHF A;  9GSS A;  4AKH A;  4ZL7 A;  2ON7 A;  1QK8 A;  1M9B A;  3P7X A;  2LTK A;  2YAN A;  2GLR A;  2KP1 A;  1SD9 A;  1G6Y A;  1JZO A;  5B7C A;  5GZZ B;  4IBP A;  1SYX A;  2M80 A;  2X99 A;  2YNX A;  2LNS A;  1XOA A;  1J9B A;  1EWX A;  2V41 A;  1MDI A;  2O5V A;  3IRA A;  1ZCP A;  2AYT A;  3UBK A;  5HR3 A;  3CWG A;  4BA7 A;  4KB3 A;  5CRG A;  2YZH A;  3IOS A;  3VWX A;  1FVJ A;  5HR1 A;  4XS6 A;  3M9K A;  3IDV A;  4W66 A;  5DAL B;  1MD4 A;  3GN3 A;  1K0B A;  3BCK A;  3UBL A;  5KN0 A;  3A3T A;  4EKZ A;  5ECR B;  1GLP A;  4OD7 A;  2ON5 A;  3N9J A;  1H4O A;  3LW9 A;  1LBK A;  2H1G A;  3FYG A;  5FWG A;  6GST A;  2C0F A;  2ZUP A;  2CAI A;  1DUG A;  2C3Q A;  1M2D A;  5G2Z A;  2FWG A;  4YQV A;  11GS A;  2I1U A;  4LA1 A;  4OWY A;  1G7O A;  1EGR A;  2AB6 A;  2DJ3 A;  1OVN A;  3P8W A;  3GSS A;  3DGQ A;  3ZVJ D;  1EV9 A;  1HNC A;  1YEX A;  1KEB A;  1VGL A;  3QMX A;  4XS1 A;  1F6M C;  4L5O A;  2G2Q A;  1OKD A;  4CW9 A;  2OA7 A;  3F4S A;  1S3D A;  2H72 A;  2GT5 A;  2GQM A;  4TW5 A;  4KX4 A;  2VOC A;  1BAY A;  1Z6N A;  1GUK A;  4I2U A;  1V57 A;  2X64 A;  4NMU A;  1UC7 A;  3Q19 A;  6GSY A;  3TUE A;  3E0U A;  4MZW A;  1DSB A;  4QL9 A;  3VWU A;  2X8C A;  5DBQ A;  3CSJ A;  2VCQ A;  2O89 A;  4I8B A;  3FY7 A;  2TRX A;  1OC9 A;  4IKH A;  2B5E A;  1XVQ A;  2FWF A;  2IMI A;  2LV3 A;  1B9X C;  2NBS A;  3MWH A;  1WE0 A;  3GX0 A;  4V1A g;  1VF2 A;  1WJK A;  2J23 A;  1GSD A;  4PNG A;  4NAX A;  1XZO A;  4GWR A;  1XVW A;  3D5J A;  5C04 A;  4MF5 A;  4JRR A;  4G0K A;  3GH6 A;  2HSM B;  4BVY B;  1FW1 A;  1WMJ A;  1V9W A;  2FGX A;  3J7Y b;  4MJC A;  20GS A;  2BTO T;  2KHP A;  4JR6 A;  5D8I A;  4N0V A;  5IPH A;  2IWT A;  5ECP B;  5DAK A;  3TKS A;  3WT1 A;  4MNN A;  4G19 A;  4MF7 A;  3IC4 A;  3U5R E;  5J9C A;  2OKA A;  1SEN A;  3M3M A;  5HFG A;  4FO5 A;  4HS1 A;  3H4K A;  1HD2 A;  4YKG A;  3M0F A;  3GH9 A;  3EIN A;  3EVI A;  4KUN A;  4TXO B;  1GP1 A;  3GST A;  2VCX A;  4DSQ A;  5GST A;  2IFQ A;  4K5R A;  2HSN A;  3P2A A;  3W8S A;  2F8F A;  4MZB A;  2VIM A;  1ML6 A;  4GSS A;  4PTS A;  2O8V B;  4HOJ A;  5ECN B;  5DDL A;  1N2A A;  4GST A;  2H1D A;  3IC8 A;  1PD2 1;  1V98 A;  2PUK C;  2WS2 A;  2FA8 A;  3F3R A;  2JAD A;  3H93 A;  2H8L A;  3TKS E;  1T4Y A;  4CDO A;  3LSZ A;  1T3B A;  3LOR A;  3GX8 A;  4D73 A;  2MMA A;  4YQM A;  1DE1 A;  3NIV A;  4EO3 A;  2VAF A;  4AI6 A;  2HYX A;  3DML A;  3QFA C;  2AV4 A;  5CYY A;  1A23 A;  1TXX A;  3LG6 A;  1KBN A;  2H1B A;  2GQL A;  5L71 A;  2H74 A;  3HZ4 A;  2B5Y A;  4K6X A;  3Q74 A;  4QQ7 A;  3J7Y k;  3ZTL A;  2WJU A;  5ECQ B;  1TRW A;  2F51 A;  4EF0 A;  4HI7 A;  5GSS A;  1XBS A;  2H0G A;  2L4Q A;  2A2R A;  1XW5 A;  4ZIL A;  2HSY A;  3WT2 A;  3FZ5 A;  3BJ5 A;  5DVB A;  4DSS B;  3KCM A;  3E3E A;  1BF5 A;  1WRY A;  4LL1 B;  4AJ6 A;  2I4A A;  5IMZ A;  4F9Z A;  3HCZ A;  1GRX A;  1XXU A;  5CAX A;  3C71 A;  1JHB A;  5ECL B;  1U6T A;  3ZLP A;  1JZD A;  4YH2 A;  2FWH A;  6GSS A;  2E0Q A;  2AAW A;  2KLX A;  2UV8 G;  4ULX A;  3IAS 2;  3A2V A;  5CRD A;  4IVF A;  3FZA A;  1KNG A;  4N11 A;  3EE2 A;  3RDW A;  3A5I A;  3SWL A;  3GFK A;  4AGS A;  1O8X A;  5CP1 A;  5CRE A;  3DIE A;  4GXZ A;  1OE8 A;  5LD0 A;  3W6G A;  1U3A A;  2TRC P;  1V58 A;  3TKQ A;  5AN1 A;  4KA0 A;  2MBT A;  5A1N B;  4O92 A;  4MLY A;  4G01 A;  4O5R A;  1BQ7 A;  4EL1 A;  3TOT A;  1I5G A;  1J08 A;  5CRW A;  2V6O A;  1T8E B;  4MCU A;  4PXO A;  14GS A;  2HZE A;  2C1Y A;  1QXH A;  3GYK A;  1BG1 A;  3TOU A;  1SKR B;  1FOH A;  2MMN A;  4TR1 B;  5A34 B;  1KTE A;  4FYB A;  4PQI A;  2JU5 A;  2G0F A;  3TRP A;  2LRN A;  2B7J A;  2C4J A;  1XWB A;  2WZ9 A;  4E68 A;  5A5H B;  4X4J A;  4Z2R A;  1WPI A;  3F6D A;  2LQQ A;  1SK0 A;  2XBQ A;  3CXG A;  4MH3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...