1F3BA

Crystal structure of mgsta1-1 in complex with glutathione conjugate of benzo[a]pyrene epoxide
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
222
structure length
221
Chain Sequence
AGKPVLHYFNARGRMECIRWLLAAAGVEFEEKFIQSPEDLEKLKKDGNLMFDQVPMVEIDGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYSEGILDLTEMIGQLVLPPDQREAKTALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLEVLLYVEEFDASLLTPFPLLKAFKSRISSLPNVKKFLQPGSQRKPPMDAKQIQEARKAFKIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE YA CHAIN
publication title Residue R216 and catalytic efficiency of a murine class alpha glutathione S-transferase toward benzo[a]pyrene 7(R),8(S)-diol 9(S), 10(R)-epoxide.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 81
structure length 221
sequence length 222
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2000-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1f3bA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1f3bA01
3TRQA 5L71A 3HKRA 5B8BA 3BBYA 4BVYB 2GQKA 2DJ1A 2PERA 1N2AA 5DDLA 4JU5A 4BWSA 1JZDA 4EO3A 1EEJA 1A0FA 1PMTA 5JWRB 3D22A 3ZFLA 3GURA 1ERWA 1SYXA 4I8BA 2G0FA 1YY7A 3DEXA 2OBKA 3H1NA 5E59A 1Q4JA 5G5FA 2F9SA 2FCHA 5J41A 3IHQA 5EPFA 2IMIA 3VK9A 1RK4A 1ZYQB 1FHEA 4WR5A 2BMXA 3VURA 4LMVA 2H75A 4OO5A 1F6MC 3DIEA 4EL1A 3FHKA 4ECJA 4MLYA 3DD3A 2H6ZA 3TJGA 3C1RA 3UBLA 1SKSB 1S3AA 6GSYA 2H70A 3KCMA 4TR1A 5ECNB 2I3YA 1SJ6A 3TDGA 1GH2A 1EOGA 4ECCA 3I9V2 2H01A 2B5XA 2B5YA 4F2IA 5J4UA 2ES7A 4ECBA 1Z7PA 2YJ7A 3HVVA 5FWGA 2MMAA 3HJPA 1HNCA 4PXOA 1UN2A 2KLXA 3J7Yk 5IOXA 2GSTA 3GA4A 2L57A 4KE3A 1R5PA 3GSTA 2PUKC 2YANA 4MH2A 5D73A 3GV1A 2YCDA 1DSBA 3HXSA 3F9UA 3M0FA 4XS6A 2WRTA 3D0ZA 5J3RA 2HSNB 2K18A 3F4SA 1XWCA 5DQYA 2HT9A 5IIZA 3WD6A 1WIKA 2VL2A 2FA8A 2VLUA 1TU8A 1WWJA 1NM3A 1G0TA 3LFLA 5JCWA 2VL2C 2V6KA 3ERWA 2DC5A 2AAWA 2K8VA 1HYUA 2KP2A 1F2EA 2H19A 2I81A 2IPAA 4FO5A 4GLTA 4KSMA 3D6IA 2OADA 4ZL7A 2GGTA 2FWEA 2H8LA 3LXTA 2AV4A 5CO3A 3FZ9A 1G7EA 4YQUA 2IMFA 1USBA 4O32A 1AUCA 2H74A 1PKZA 1WE0A 1AC1A 1OC9A 1Q98A 3IR4A 1R26A 2VCQA 3A2WA 1U87A 4L5OA 2F8AA 4FQUA 2FGXA 3BCKA 1GSEA 2C3QA 1GTBA 2AJQB 4BA7A 5LCZA 4IBPA 4PNGA 3BD2A 1V98A 2WDUA 3F63A 1OKTA 1V2AA 3QR6A 5HR0A 1Y6EA 3C71A 4I5QA 1XWKA 5HQPA 4Q5FA 5ECRB 1H4OA 3QDNA 2IFQB 5AIXA 1CQGA 1XOAA 1SYRA 1XW9A 1S3CA 2VCVA 4D73A 3IPZA 2CVKA 4K7OA 1FB0A 2I4AA 2LQQA 2GDRA 3L78A 2PBJA 4G10A 3TJKA 3L9UA 4RUVA 1O85A 3HVSA 4PUFC 5BMUA 3WGEA 4F82A 1WOUA 4O92A 1TXXA 5ECSA 3A2VA 4BVYA 3QFBC 2YV7A 2JL4A 3UOMA 4CW9A 20GSA 4GXZA 2HZFA 4EVMA 4MZWA 5G30A 5AIVA 3KP8A 1V9WA 5KN3A 3VI7A 1VRSD 1GRXA 2IJYA 2FNOA 2O87A 4MK3A 3CTFA 4HEA2 1SJIA 2KUCA 4FIWA 4MJBA 1EOHA 1QUWA 1W89A 4GSTA 5GAND 2WJUA 3US3A 1GNEA 4Q5RA 3QFAC 2CZ2A 3QPMA 4IQAA 3TKRA 2DJ3A 1AXDA 4ZILA 2O85A 5GSTA 1XWBA 4LL1B 3RHBA 3ISOA 1S3DA 13GSA 4N0ZA 4TKYA 3BCIA 4ULXA 2GT5A 1EGOA 4G9HA 5KN1A 3MDKA 2LSTA 1SD9A 2YZUA 1MDIA 5DCHA 4TR1B 4IP1A 1M0UA 1URMA 1HNAA 2LNTA 3L9SA 1SL1B 5IO2A 5G31A 5IOWA 5ID2B 4HDEA 2DMLA 3WYWA 1G6YA 3ZYWA 1Z3EA 3GSSA 4NMUA 1ML6A 2HRKB 1GP1A 1XCCA 4ZBDA 2CZ3A 1XW5A 3APOA 2DIYA 4ZIJA 2I9HA 3C1SA 2HSMB 1MD4A 1BJXA 1T4YA 3FR3A 1TW9A 2J23A 3TKQA 2LJKA 3M1GA 1PD21 1K0MA 3HZ8A 5A4WA 1O81A 1YKAA 4KB3A 2NDOA 2TIRA 2H73A 4ILFA 1OAZA 5IQYA 3GRXA 2DLXA 1VGLA 3KD0A 5HR2A 1XIYA 1AAZA 1SJZA 1K0OA 4N0VA 3FEUA 4ZB6A 3DWVA 1RQMA 2DJ0A 2FD3A 4EF0A 3ERGA 3IA1A 4MJEA 1V40A 1TK5B 2MBTA 2YOIA 5G5EA 1ZZYA 4HZ4A 2VCXA 1LBKA 4O7HA 3LEFA 2LEGA 2C8UA 5GAPD 1MDJA 1J0FA 3VWUA 3TJJA 1XZOA 3Q18A 1SU9A 2VAFA 3GL3A 2H1DA 4MPFA 3TCOA 4WR4A 2C0GA 1WMJA 2TRXA 2F8FA 2GSQA 5B7CA 5D8IA 1UC7A 3D4TA 3WT1A 3VFIA 1U88A 4NV2A 3MNGA 1J9BA 3ZITA 1ON4A 1A8LA 4ID0A 3ME8A 2CVDA 2IFQA 3FYGA 2FWGA 3IOSA 2VM2A 4KSOA 3H93A 5ECIB 3IE3A 4V2MA 2B1LA 4ZXGA 1LU4A 3TKSE 1Z7RA 1KTEA 1X9SB 1TK8B 1O8XA 1LJRA 1OVNA 5IMAA 5IMDA 3UVTA 5HFGA 1T00A 1PKWA 4V1Ap 3TKSA 4IS0A 4NHWA 4POMA 5D9TA 3ZTLA 5F07A 3G7YA 2P0GA 4KX4A 5CP1A 5IMFA 2PGTA 3HDCA 2QSIA 3CSHA 5EVOA 2UZ8A 4YH2A 4BVXB 3C73A 3KZQA 3ZIVA 5DAKB 3FY7A 1XOBA 1YEXA 4EUYA 2DSAA 3QAGA 4XS1A 5CRWA 3DMLA 2B7JA 2X8CA 1Z9HA 1O7UA 2DMMA 3EMPA 5ECHB 4IHUA 5B6MA 4K0GA 5DALA 1KNGA 5A4VA 2H0GA 3HZ4A 3UEMA 1XBSA 2F3MA 4XIHA 2V1MA 3UARA 2N5BA 3RAZA 3H4KA 2RIIA 4K0NA 4DEJA 2V41A 3LJRA 3QAVA 5LD0A 5IO0A 2B1KA 3P2AA 1VF3A 1HNBA 1IYIA 2P31A 1GSFA 4NHZA 2WZ9A 4MH3A 1WRYA 2IL3A 3H79A 3DYRA 5DVBA 3KH9A 3EWLA 4F03A 2Z9SA 5EL8A 2PPTA 2PU9C 3A2XA 2C0EA 4N30A 4I6XA 4FYBA 3GKKA 2B3SA 1GUKA 1ILOA 2GSSA 4F9ZA 1M2AA 1ERVA 4ZL9A 2ON7A 3M8NA 3V1WA 4HI7A 5G1KA 4JEDA 3JCML 2VCZA 1ZOFA 3CRUA 2OE1A 3ZL5A 5ID2A 3TJFA 4HZ2A 3P8WA 4KDUA 2X64A 2HNLA 2C3NA 4GTUA 2R2JA 4ML1A 4P3YB 2HRKA 4O5RA 3HJOA 3J7Yb 1GSUA 3IC8A 5B6NA 1ZYEA 4JRRA 1A2JA 4KF9A 1YEPA 4EC0A 5G1LA 2HI7A 4Z7XA 1XVQA 2HSMA 2AYTA 4XCSA 3FZ4A 4GWRA 3UBKA 4ZBBA 1FO5A 1QK8A 2A2RA 9GSSA 3ZMLA 3VWWA 1ZGNA 4NWYA 4K8MA 4F0CA 1GNWA 3KMOA 1G6WA 2YN1A 1AQXA 3ZIJA 4WETA 2DIZA 3IK7A 5D93A 5D9WA 2H1GA 3AY8A 2OE0A 2VL3A 4DSQA 2LRTA 3WGXA 2L5LA 3LXZA 4Q5QA 3KEBA 3FR6A 3FZ5A 1YF0A 2YWOA 1R5AA 4BWQA 4WF4A 1X0RA 1VF4A 4OMVA 1EP8A 1K3YA 4MABA 3Q19A 4MMMA 3ZLPA 1GLPA 3PR8A 12GSA 2LRNA 1THOA 3WGDA 5G2ZA 3MWHA 2O8VB 1M2DA 2MMOA 4LL4B 1A2MA 3OR5A 3A3TA 4J57E 2GS3A 3F0IA 3R2QA 4PTSA 3IXRA 4NAXA 3ZREA 2YPMA 4KH7A 2VM1A 1K3LA 2I1UA 2VO4A 4TOPA 5J9CA 2K8SA 4WXTA 3KXOA 4K7IA 6GSUA 4EDZA 4ISDA 2X99A 2WGRA 4H86A 10GSA 1E6BA 2L6CA 4WKWA 5C04A 1XPVA 2O7KA 4I2UA 1A8YA 2DBCA 5F06A 2E2MA 2V32A 3FK8A 4I2TA 1ZMAA 3ED3A 1Y25A 2ALBA 4NXIA 5ECOB 2ON5A 2MYGA 2FUG2 4FH8A 5ELAA 5HFKA 5DBQA 2OE3A 1I9DA 5IMCA 4BVXA 4ML6A 2LQOA 3RHCA 5DAKA 1HQOA 3VWXA 1WP0A 3ZFBA 1V57A 2TRCP 2XHFA 1TJDA 1ZL9A 3Q74A 4MCUA 4RI6A 1SENA 3HHVA 2FWHA 1ZCPA 1Z5YE 4V2NA 2AHEA 4JE1A 2HYXA 3FRCA 1CQHA 1FVJA 2WFCA 1K0CA 1OC3A 5CAXA 1JZWA 3F4RA 4GF0A 5INYA 4CHSA 3QAWA 3VPTA 5HR1A 5DALB 4WBRD 2NBSA 3EU4A 1KBNA 3O76A 3D4MA 4GSSA 4POBA 2VCWA 2CV4A 1A24A 3TRXA 3RPPA 4PQIA 1F37A 1F3BA 5GZZB 4KNDA 2PWJA 5CNWA 5A5KA 2HXKA 1DUGA 3EURA 2YWMA 2RLIA 1QFNA 3UMAA 2WCIA 7GSSA 4J2FA 4LA1A 4OFTA 4F0BA 3GKMA 4MZBA 4DSRA 4G2EA 1B9YC 4ZL8A 4TW5A 3HJMA 1EGRA 1YQ1A 1TOFA 2BJXA 4ZB8A 1MDKA 1X5EA 4TN8A 1C72A 3VWVA 5AGYA 4HU9A 2LUSA 1G7OA 2CQ9A 1GWCA 4IP6A 2VLTA 1GSDA 3FKFA 2CA8A 4L8EA 2KHPA 3IAM2 4KCEA 2HSHA 1AW9A 4V1Ag 4MF7A 3GUSA 3GN3A 5A4UA 4MJCA 2GSRA 2XC2A 2CAQA 3HY2A 1XXUA 5IMZA 1O73A 2X8HA 5J9BA 1JLVA 5ENUA 2LJAA 2DJ2A 4TR3A 1OYJA 3GX8A 1EEMA 3UAPA 3NIVA 4QQ7A 1BG5A 2WULA 1PL2A 3RDWA 1GUHA 2KP1A 5GSSA 3EU3A 5LNKe 4L0WA 2N5FA 1NHOA 1B48A 3BJ5A 2MBSA 5EY6A 2HZEA 4HOJA 1AQWA 1AIUA 4EXJA 1UVZA 1EV9A 4TRXA 1FB6A 4V2LA 4USSA 3GIXA 3TJBA 2HFDA 3TOUA 6GSSA 4YAPA 3CSJA 2FY6A 4MDCA 1FW1A 1NHYA 5ECMB 1ERTA 1TRVA 4IGJA 2REMA 2AUVA 2XPEA 5H5SA 4QL7A 3EVIA 2R3XA 4PQ1A 4BPYA 2LKUA 2X8GA 3FZAA 3ZRDA 3KTBA 4AJ7A 3H8QA 4OCEA 4MF6A 2VLVA 1SK0A 4WEYA 3S9FA 1TRUA 2XBQA 4HQZA 5CRDA 2FWFA 2F51A 5F05A 3TUEA 5HR3A 3F3QA 1E2YA 3EE2A 4X0XA 1U3IA 4KW6A 3M9KA 1TK0B 22GSA 4GQCA 2KOKA 1R7HA 4YQMA 2H0HA 3IDVA 4BL7B 3GHAA 4JZQA 2H66A 1OC8A 1X9MB 3DXBA 5HFIA 5IMVA 4GSNA 4HJ2A 3UVHA 1GLQA 3LWAA 1M2BA 3MSZA 2JZTA 2YV9A 4TXOB 5CRHA 3QCPA 4LLRA 2IMEA 4G0KA 3APSA 3EINA 3GL5A 2NVLA 5FHIA 5D9XA 3E3EA 2C4JA 3G7IA 2IMDA 1PA3A 3CBUA 2HQTA 4GRFA 4TXVA 4I97A 4RQXA 2C80A 2B5EA 1PQNA 2A4VA 2HSYA 5CRGA 2AB6A 3CTGA 5DJMA 16GSA 4WBJA 1BYEA 4EDYA 1X9WB 4L5LA 1QQ2A 2H72A 3F3RA 2GQMA 1EZKA 3GYKA 5E4WA 1H75A 1ERUA 1SD8A 1B9XC 2B6MA 2IMKA 6GSXA 3NOFA 1B4PA 2E2GA 3GKXA 2D2ZA 2ZNMA 2BTOT 4MA9A 2K9FA 4E8HA 2JZSA 4IQ1A 1YZXA 3KTLA 3VPQA 1SK1A 4Q5NA 4TVEA 2QKEA 2VL9A 1EV4A 2GZZA 4XRDA 2VD0A 2B7KA 2LTKA 1IYHA 5CREA 3LG6A 1FVKA 3P90A 2G2QA 1DE1A 3QOUA 4XS4B 3M9JA 5J5NA 2GLRA 3ERFA 1THXA 1ABAA 1FG4A 1TRWA 3ME7A 4MJAA 2FHEA 4HS1A 2OJLA 4FYUA 3KMNA 4N10A 2XBIA 3G9BA 3SBCA 4RQRA 3HVXA 4TR4A 4MP4A 1XFLA 5JCGA 1FOVA 3BOAA 1XVWA 2M46A 3W8SA 1K0AA 2YJHA 2WB9A 2MMZA 3ZMKA 3IV4A 4KDYA 1SK2A 6GSTA 4J56E 3KJYA 4OFMA 3VLNA 4JR6A 2H30A 3IBHA 3LSZA 2MMNA 3PGTA 5KN2A 4G0IA 2YNXA 3QMXA 5DCGA 6GSWA 4PQHA 1GSQA 3DVXA 3PINA 2O89A 1PSQA 2K6VA 2QC7A 1X5CA 4K1FA 4ZB9A 1RW1A 4OCFA 3FW2A 3WT2A 1BEDA 2M72A 5CYYA 5JWQB 5H5QA 3N9JA 2L4CA 1TRSA 3TB2A 1BQ7A 1YDKA 5D96A 3DKSA 3F6FA 1EWXA 5IPGA 4IVFA 4IN0A 3I69A 1MTCA 3KH7A 2J9HA 1T4ZA 3C7MA 2HZEB 4PUAA 2PVQA 4HU7A 2HRFA 3W8JA 3TGZA 2MZCA 4RI7A 2RM5A 4DSSB 1A0RP 4EKZA 5AN1A 2CVBA 2VD1A 4XHMA 1TDIA 4WF5A 1T8EB 1O8WA 3TOTA 3NZNA 5JWOB 2GQLA 3PPUA 1OE8A 3CYNA 4YQVA 1OKDA 3N5OA 5KN0A 1N8JA 18GSA 1PRXA 3L9VA 3TKPA 3K8NA 3GX0A 2JSYA 1PGTA 1T1VA 1K0BA 1M7TA 1M9BA 5ELGA 4KA0A 2L4QA 4GQFA 1I5GA 3F6DA 4BL7A 3A5WA 2GZPA 4PURA 4PNFA 3LGCA 11GSA 1PN9A 3D21A 2NTOA 2EIQA 4AJ8A 1F3AA 4AF2A 4K9ZA 2P5QA 3HYPA 2R5GA 1QXHA 2VOCA 5B8AA 2V2GA 2CAIA 2DJKA 3IC4A 4EE0A 4IELA 4JR4A 1GTIA 4IJIA 2C0DA 4TXOA 3CXGA 3ZVJD 3F4TA 1TI1A 14GSA 4K7NA 3L4NA 1YF1A 3MAKA 2PN8A 1M99A 1TTZA 1ACVA 2M80A 3UJ1A 3TRPA 2OKAA 5IM9A 2R4VA 2C0FA 2C3TA 1T3BA 4QL9A 1VF2A 1GSYA 2JZRA 3EYTA 3D5JA 4LMWA 4MZCA 2JSZA 1PX7A 2CX3A 2IWTA 2YZHA 1B4QA 1J08A 3QD9A 3M3MA 2ZCTA 5ECKB 2L59A 2CX4A 1QMVA 3APQA 3GH9A 4G0LA 1WJKA 3U6VA 3DVWA 3RBTA 4KDXA 4HUAA 3GH6A 3PH9A 2FLSA 3GTUB 2JU5A 1X5DA 3GKNA 4HQSA 4OO4A 1TP9A 1SKWB 3KIJA 2R6KA 5IPHA 3IRAA 3ZZXA 1FAAA 3UL3A 3U5RE 1TKDB 4YAVA 5H5RA 3F8UA 2H1AA 4TR0A 4XS4A 1M9AA 1T7PB 3IAS2 1ST9A 3DGQA 2L6DA 1A23A 1BX9A 3LYPA 3CRTA 3GFKA 2NPBA 4OFNA 3R3EA 2V6OA 2LNSA 2GTUA 2WS2A 2FA4A 2L5OA 2HRAA 2H1BA 1JFUA 17GSA 3KGKA 4HJMA 1GSSA 1YKCA 1GTUA 5ECLB 3IK9A 3CMIA 1BAYA 4IW9A 2LRCA 6GSVA 1TI3A 2LJRA 2N5AA 1AQVA 1JHBA 1K3OA 4KAEA 1K0NA 3HA9A 3Q6OA 5ECQB 5COHA 5F8BA 4PX1A 1U6TA 5FT3A 4FYCA 3RPNA 2YWNA 1GULA 1NW2A 3VI5A 1PX6A 3G7JA 3SWLA 2QGVA 2RUFA 4X1UA 4PGTA 2H6YA 4ECIA 1QGVA 3L0HA 1SL0B 3I43A 3O6TA 3O3TA 5DQSA 4NPBA 2OBIA 4E8EA 4KCAA 1MEKA 3C8EA 4GCIA 3DRNA 2RM6A 4X43A 1V58A 4POKA 3E9JB 2VUPA 1XWAA 1JZOA 2ZUPA 2VIMA 4DSSA 1K0DA 1UA5A 3CSIA 1DBYA 1WPIA 1PL1A 5AISA 2A2SA 1OE7A 2JADA 1VF1A 3E0UA 4CDOA 1MD3A 4OD7A 4G19A 2H71A 1TU7A 1JZRA 3FR9A 1R4WA 2JACA 1F9MA 8GSSA 2CT6A 1SKRB 3EMXA 4AGSA 5KEJA 2PMTA 5C00A 1W4VA 3HD5A 5D9VA 1KEBA 4ZBAA 2RUEA 2P5RA 3EC3A 4N11A 2OACA 4OWYA 3KM6A 2LV3A 2GZYA 4DVCA 1B8XA 3GNJA 2EIRA 2HRNA 1SL2B 1HD2A 3W6GA 3GMFA 4KUNA 3UIWA 1OC9B 4AJ6A 1Z6MA 5ECPB 4XRAA 5ABRA 2EC4A 4XTSA 2YP6A 4NV5A 2H6XA 1GL8A 5DJLA 1JLWA 2EIOA 3P7XA 1XW6A 2H0IA 4ACSA 5JCUA 19GSA 2R37A 2C1YA 3LYKA 1U3AA 2IIYA 1XWGA 2IN3A 2GVPA 4IJ3A 2LS5A 2E7PA 1YJ6A 2YWIA 3ZVJA 3LQ7A 1Z6NA 1DE2A 2VCTA 4IKHA 3TKSC 1GTAA 3I6AA 4D73B 3LORA 3GTUA 4KGIA 4K6XA 4L0UA 4MPGA 4MF5A 2GT6A 1EP7A 4POLA 2DJJA 5F0GA 2E0QA 2H76A 2PVOC 3HCZA 2XPDA 1A2LA 2OA7A 1NSWA 1GUMA 2HLSA 1O6JA 4K2DA 4JBBA 3KP9A 2HE3A
chains in the Genus database with same CATH superfamily
3TRQA 5L71A 3HKRA 5B8BA 3BBYA 4BVYB 2GQKA 2DJ1A 2PERA 1N2AA 5DDLA 4JU5A 4BWSA 4K5SA 1JZDA 4EO3A 1EEJA 1A0FA 1PMTA 5JWRB 3D22A 3ZFLA 3GURA 1ERWA 1SYXA 4I8BA 3LW9A 2G0FA 1YY7A 3DEXA 2OBKA 3H1NA 5E59A 1Q4JA 5G5FA 2F9SA 2FCHA 5J41A 3IHQA 5EPFA 2IMIA 3VK9A 1RK4A 2WW1A 1ZYQB 1FHEA 4WR5A 2BMXA 3VURA 4LMVA 2H75A 4OO5A 1F6MC 3DIEA 4EL1A 3FHKA 4ECJA 4MLYA 3DD3A 2H6ZA 2VKZG 3TJGA 3C1RA 3UBLA 1SKSB 1S3AA 1SVOA 6GSYA 2O36A 2H70A 3KCMA 4TR1A 5BRTA 5ECNB 3MYDA 2I3YA 1SJ6A 3TDGA 1GH2A 2O5VA 1EOGA 4ECCA 3I9V2 2H01A 2B5XA 2B5YA 4F2IA 5J4UA 2ES7A 4ECBA 1Z7PA 2YJ7A 3HVVA 2R0CA 5FWGA 2MMAA 3HJPA 1HNCA 4PXOA 1UN2A 2KLXA 3J7Yk 5IOXA 4X4JA 2GSTA 3GA4A 2L57A 4KE3A 1R5PA 3GSTA 2PUKC 2YANA 4Z2UA 1PN0A 4MH2A 2O3EA 5D73A 3GV1A 2YCDA 1DSBA 3HXSA 3F9UA 3M0FA 4XS6A 2WRTA 3D0ZA 5J3RA 2HSNB 2K18A 3F4SA 1XWCA 5DQYA 2HT9A 5IIZA 3WD6A 1WIKA 2VL2A 2FA8A 2VLUA 1TU8A 1WWJA 1NM3A 1G0TA 3LFLA 5JCWA 2VL2C 2V6KA 4PI0C 3ERWA 2DC5A 2AAWA 2K8VA 1HYUA 2KP2A 1F2EA 2H19A 2I81A 2IPAA 4FO5A 4GLTA 4KSMA 4HSCX 3D6IA 2OADA 3CHXC 4ZL7A 2GGTA 4W66A 2FWEA 2H8LA 3LXTA 2AV4A 5CO3A 3FZ9A 3A5IA 1G7EA 2WVXA 4YQUA 2IMFA 1USBA 4O32A 1AUCA 2H74A 1PKZA 1WE0A 1AC1A 5A5HA 1OC9A 1Q98A 3IR4A 1R26A 2VCQA 3A2WA 1U87A 4L5OA 2F8AA 4FQUA 2FGXA 3BCKA 1GSEA 2C3QA 1GTBA 2AJQB 4YKFA 4BA7A 5LCZA 4IBPA 2A4HA 4PNGA 1S4BP 3BD2A 1V98A 2WDUA 3F63A 1OKTA 1V2AA 3QR6A 5HR0A 1Y6EA 3RGBC 3C71A 4I5QA 1XWKA 5HQPA 4Q5FA 2DKIA 5ECRB 1H4OA 3QDNA 2IFQB 5AIXA 1CQGA 1XOAA 1SYRA 1XW9A 1S3CA 2VCVA 4D73A 3IPZA 2CVKA 4K7OA 1FB0A 2I4AA 2LQQA 2GDRA 3L78A 2PBJA 4G10A 3TJKA 3L9UA 4GDFA 4RUVA 1O85A 3HVSA 1I1IP 4PUFC 5BMUA 3WGEA 4F82A 1WOUA 4O92A 1TXXA 5ECSA 3A2VA 4BVYA 3QFBC 2YV7A 2JL4A 3UOMA 4CW9A 20GSA 4GXZA 2HZFA 4EVMA 4MZWA 5G30A 5AIVA 3KP8A 1V9WA 5KN3A 3VI7A 1VRSD 1GRXA 2IJYA 2FNOA 2O87A 4MK3A 3CTFA 4HEA2 1SJIA 2KUCA 4FIWA 4MJBA 1EOHA 1QUWA 1W89A 4GSTA 5GAND 2WJUA 3US3A 1GNEA 4Q5RA 3QFAC 2CZ2A 3QPMA 4IQAA 5J47A 3TKRA 2DJ3A 1AXDA 5KOXA 4ZILA 2O85A 5GSTA 1XWBA 4LL1B 3RHBA 3ISOA 1S3DA 13GSA 4N0ZA 4TKYA 3BCIA 4ULXA 2GT5A 1EGOA 4G9HA 5KN1A 3MDKA 2LSTA 1SD9A 2YZUA 1MDIA 5DCHA 4TR1B 4IP1A 1M0UA 1URMA 1HNAA 2LNTA 3CQFA 3L9SA 4Z2TA 1SL1B 5IO2A 5G31A 5IOWA 5ID2B 4HDEA 2DMLA 3WYWA 1G6YA 3ZYWA 1Z3EA 3GSSA 5J40A 4NMUA 1ML6A 2HRKB 1GP1A 1XCCA 2HSNA 4ZB7A 4ZBDA 2CZ3A 3TU3B 1XW5A 3APOA 2DIYA 4ZIJA 2I9HA 3C1SA 2HSMB 1MD4A 1BJXA 1T4YA 3FR3A 1TW9A 2J23A 1ZYNA 3TKQA 2LJKA 3M1GA 1PD21 1K0MA 3HZ8A 5A4WA 1O81A 1YKAA 4O5QA 4KB3A 2NDOA 2TIRA 2H73A 4ILFA 1OAZA 5IQYA 3GRXA 2DLXA 1VGLA 3KD0A 5HR2A 1XIYA 1AAZA 1SJZA 1K0OA 4N0VA 3FEUA 4ZB6A 3DWVA 1RQMA 2DJ0A 2FD3A 4EF0A 3ERGA 3IA1A 4MJEA 1V40A 1TK5B 2MBTA 2YOIA 5G5EA 1ZZYA 4HZ4A 2VCXA 1LBKA 4O7HA 3LEFA 2LEGA 2C8UA 5A1NB 1MDJA 5GAPD 1J0FA 3VWUA 3TJJA 1XZOA 3Q18A 1SU9A 4AKXB 2VAFA 3GL3A 2H1DA 4MPFA 3TCOA 2UV8G 4WR4A 2C0GA 1WMJA 2TRXA 2F8FA 2GSQA 5B7CA 2R0PA 5D8IA 1UC7A 3D4TA 3CWGA 3WT1A 3VFIA 1U88A 4NV2A 3MNGA 1J9BA 3ZITA 1ON4A 1A8LA 4ID0A 1YEWC 3ME8A 2CVDA 2IFQA 3FYGA 2FWGA 3IOSA 2VM2A 4KSOA 3H93A 5ECIB 3IE3A 4V2MA 2B1LA 4ZXGA 1LU4A 3TKSE 1Z7RA 1KTEA 1X9SB 4PI2C 1TK8B 1O8XA 1LJRA 1OVNA 5IMAA 5IMDA 3UVTA 5HFGA 1T00A 1PKWA 4V1Ap 3TKSA 4IS0A 4NHWA 4POMA 5D9TA 3ZTLA 5F07A 3G7YA 2P0GA 4KX4A 5CP1A 5IMFA 2PGTA 3HDCA 2QSIA 3CSHA 5J4YA 4O5UA 5EVOA 2UZ8A 4YH2A 4BVXB 3C73A 3KZQA 3ZIVA 5DAKB 3FY7A 1XOBA 1YEXA 4EUYA 2DSAA 3QAGA 4XS1A 5CRWA 3DMLA 2B7JA 2QA1A 2X8CA 1Z9HA 1O7UA 2DMMA 3EMPA 5ECHB 4IHUA 5B6MA 4K0GA 1Y1UA 5DALA 1KNGA 4EIPA 5A4VA 2H0GA 3HZ4A 3UEMA 1XBSA 2F3MA 4XIHA 2V1MA 3UARA 2N5BA 3RAZA 3H4KA 2RIIA 4K0NA 4DEJA 2V41A 3LJRA 3QAVA 5LD0A 5IO0A 2B1KA 3P2AA 1VF3A 1TXUA 1HNBA 1IYIA 2P31A 1GSFA 4NHZA 2WZ9A 4MH3A 1WRYA 2EFHA 2IL3A 3H79A 3DYRA 5DVBA 3KH9A 3EWLA 4F03A 2Z9SA 5EL8A 2PPTA 2PU9C 3A2XA 2C0EA 4N30A 4I6XA 4FYBA 3GKKA 2B3SA 1GUKA 1ILOA 2GSSA 4F9ZA 1M2AA 1ERVA 4ZL9A 2ON7A 3M8NA 3V1WA 4HI7A 5G1KA 4JEDA 3JCML 2VCZA 1ZOFA 3CRUA 2OE1A 3ZL5A 5ID2A 3TJFA 4HZ2A 3P8WA 4KDUA 2X64A 2HNLA 2C3NA 4GTUA 1S3RA 2R2JA 4ML1A 4P3YB 2HRKA 1BG1A 4O5RA 3HJOA 3J7Yb 1GSUA 3IC8A 5B6NA 1ZYEA 4JRRA 1A2JA 4KF9A 1YEPA 4EC0A 5G1LA 2HI7A 4Z7XA 1XVQA 2HSMA 2AYTA 4XCSA 3FZ4A 4GWRA 2WVZA 3UBKA 4ZBBA 1FO5A 1QK8A 2A2RA 9GSSA 3ZMLA 3VWWA 1ZGNA 4NWYA 4K8MA 4F0CA 1GNWA 3KMOA 1G6WA 2YN1A 1AQXA 3ZIJA 4WETA 2DIZA 3IK7A 5D93A 5D9WA 2H1GA 3AY8A 2OE0A 2VL3A 4DSQA 2LRTA 3WGXA 2L5LA 3LXZA 4Q5QA 3KEBA 3FR6A 3FZ5A 1YF0A 2YWOA 1R5AA 4BWQA 4WF4A 1X0RA 1VF4A 4OMVA 1EP8A 1K3YA 5A1NA 4MABA 3Q19A 4MMMA 3ZLPA 1GLPA 3PR8A 12GSA 2LRNA 1THOA 3WGDA 5G2ZA 3MWHA 2O8VB 1M2DA 2MMOA 4LL4B 1A2MA 3OR5A 3A3TA 4J57E 2GS3A 3F0IA 3R2QA 4PTSA 3IXRA 4NAXA 3ZREA 2YPMA 4KH7A 2VM1A 1K3LA 2I1UA 2VO4A 4TOPA 5J9CA 2K8SA 4WXTA 1BF5A 3KXOA 4K7IA 6GSUA 4EDZA 4ISDA 2X99A 2WGRA 4H86A 4K2XA 4BIKA 10GSA 1E6BA 2L6CA 4WKWA 5C04A 1XPVA 2O7KA 4I2UA 1A8YA 2DBCA 5F06A 2E2MA 2V32A 3FK8A 4I2TA 1ZMAA 3ED3A 1Y25A 2ALBA 4NXIA 5ECOB 2MYGA 2ON5A 2FUG2 2A2PA 4FH8A 2EFEA 5ELAA 5HFKA 5DBQA 2OE3A 1I9DA 5IMCA 4BVXA 4ML6A 2LQOA 3RHCA 5DAKA 1HQOA 3VWXA 1WP0A 3ZFBA 4N3ZA 4YKGA 1V57A 2TRCP 2XHFA 1TJDA 1ZL9A 3Q74A 4MCUA 4RI6A 1SENA 3HHVA 2FWHA 1ZCPA 1Z5YE 4V2NA 2AHEA 4JE1A 2HYXA 3FRCA 1CQHA 1FVJA 2WFCA 1K0CA 1OC3A 5CAXA 1JZWA 3F4RA 4GF0A 5INYA 4CHSA 3QAWA 3VPTA 5HR1A 5DALB 4WBRD 2NBSA 3EU4A 1KBNA 3O76A 3D4MA 4GSSA 4POBA 2VCWA 2CV4A 1A24A 3TRXA 3RPPA 4PQIA 1F37A 1F3BA 5GZZB 4KNDA 2PWJA 5CNWA 5A5KA 2HXKA 1DUGA 3EURA 2YWMA 2RLIA 1ZYPA 1PFOA 1QFNA 3UMAA 2WCIA 7GSSA 4J2FA 4LA1A 4CY6A 2WW3A 4OFTA 4F0BA 4PHZC 3GKMA 4MZBA 4DSRA 4G2EA 1B9YC 4ZL8A 4TW5A 3HJMA 1EGRA 1YQ1A 1TOFA 2BJXA 4ZB8A 1MDKA 1X5EA 4TN8A 3HVNA 1C72A 3VWVA 5AGYA 4HU9A 2LUSA 1G7OA 2CQ9A 1GWCA 4IP6A 2VLTA 1GSDA 3FKFA 2CA8A 4L8EA 2KHPA 3IAM2 4KCEA 2HSHA 1AW9A 4V1Ag 4MF7A 3GUSA 3GN3A 5A4UA 4MJCA 2GSRA 4EIQA 2XC2A 2CAQA 3HY2A 1XXUA 5IMZA 1O73A 2X8HA 5J9BA 1JLVA 5ENUA 2LJAA 2DJ2A 4TR3A 1OYJA 3GX8A 4CY8A 1EEMA 3UAPA 3NIVA 4QQ7A 1BG5A 2WULA 1PL2A 3RDWA 1GUHA 2KP1A 5GSSA 3EU3A 5LNKe 4L0WA 2N5FA 1NHOA 1B48A 3BJ5A 2MBSA 5EY6A 2HZEA 4HOJA 1AQWA 1AIUA 4EXJA 1UVZA 3RFRC 1EV9A 4TRXA 1FB6A 4V2LA 4USSA 3GIXA 3TJBA 2HFDA 3TOUA 6GSSA 4YAPA 3CSJA 2FY6A 4MDCA 1FW1A 1NHYA 5ECMB 1ERTA 1TRVA 4IGJA 2REMA 2AUVA 2XPEA 5H5SA 4QL7A 3EVIA 2R3XA 1XG8A 4PQ1A 4BPYA 2LKUA 2X8GA 3FZAA 3ZRDA 3KTBA 4AJ7A 3H8QA 4OCEA 4MF6A 2VLVA 1SK0A 4WEYA 3S9FA 1TRUA 2XBQA 4HQZA 5CRDA 2FWFA 2F51A 5F05A 4AKHA 3TUEA 5HR3A 3F3QA 1E2YA 3EE2A 4X0XA 1U3IA 4KW6A 2H1LA 3M9KA 1TK0B 22GSA 4GQCA 2KOKA 1R7HA 2DKHA 4YQMA 2H0HA 3IDVA 4BL7B 3GHAA 4JZQA 2H66A 5A34B 1OC8A 1X9MB 3DXBA 5HFIA 5IMVA 4GSNA 4E68A 4HJ2A 3UVHA 1GLQA 1N25A 3LWAA 1M2BA 3MSZA 2JZTA 2YV9A 4TXOB 5CRHA 2EFDA 3QCPA 4LLRA 2IMEA 4G0KA 3APSA 3EINA 3GL5A 2NVLA 5FHIA 5D9XA 3E3EA 2C4JA 3G7IA 2IMDA 1PA3A 3CBUA 2HQTA 4GRFA 4TXVA 4I97A 4RQXA 2C80A 2B5EA 1SVLA 1PQNA 2A4VA 2HSYA 5CRGA 2AB6A 3CTGA 5DJMA 16GSA 4WBJA 1BYEA 4EDYA 1X9WB 2EFCA 4L5LA 1QQ2A 2H72A 3F3RA 2GQMA 1EZKA 3GYKA 5E4WA 1H75A 1ERUA 1SD8A 1B9XC 2B6MA 2IMKA 6GSXA 3NOFA 1B4PA 2E2GA 3GKXA 2D2ZA 2ZNMA 2BTOT 4MA9A 2K9FA 4E8HA 2JZSA 4IQ1A 1YZXA 3KTLA 3VPQA 1SK1A 4Q5NA 4TVEA 2QKEA 2VL9A 1EV4A 2GZZA 4XRDA 2VD0A 2WW2A 4AI6A 2B7KA 2LTKA 1IYHA 5CREA 3LG6A 1FVKA 3P90A 2G2QA 1DE1A 3QOUA 4XS4B 3M9JA 5J5NA 2GLRA 3ERFA 1THXA 1ABAA 1FG4A 1TRWA 3ME7A 4MJAA 2FHEA 4HS1A 2OJLA 4FYUA 3KMNA 4N10A 2XBIA 3G9BA 3SBCA 4RQRA 3HVXA 4TR4A 4MP4A 1XFLA 4G01A 5JCGA 1FOVA 3BOAA 1XVWA 2M46A 3W8SA 1K0AA 2YJHA 2WB9A 2MMZA 3ZMKA 3IV4A 4KDYA 1SK2A 6GSTA 4J56E 3KJYA 4OFMA 3VLNA 3HMJG 4JR6A 2H30A 3IBHA 3LSZA 2MMNA 2X49A 3PGTA 5KN2A 4G0IA 2YNXA 1M3JA 3QMXA 5DCGA 6GSWA 4PQHA 1GSQA 3DVXA 3PINA 2O89A 1PSQA 2K6VA 2QC7A 1X5CA 4K1FA 4ZB9A 1RW1A 4OCFA 3FW2A 3WT2A 1BEDA 2M72A 5CYYA 5JWQB 5H5QA 3N9JA 2L4CA 1TRSA 3TB2A 1BQ7A 1YDKA 5D96A 3DKSA 3F6FA 1FOHA 1EWXA 5IPGA 4IVFA 4IN0A 3I69A 1MTCA 3KH7A 2J9HA 1T4ZA 3C7MA 2HZEB 4PUAA 2PVQA 4HU7A 2HRFA 3W8JA 3TGZA 2MZCA 4RI7A 2RM5A 4DSSB 1A0RP 2WVYA 4EKZA 5AN1A 2CVBA 4K5RA 2VD1A 4XHMA 1TDIA 4WF5A 1T8EB 1O8WA 3TOTA 3NZNA 5JWOB 2GQLA 3PPUA 1OE8A 3CYNA 4YQVA 1OKDA 3N5OA 5KN0A 1N8JA 18GSA 4MNNA 1PRXA 3L9VA 3TKPA 3K8NA 3GX0A 2JSYA 1PGTA 1T1VA 1K0BA 1M7TA 1M9BA 5ELGA 4KA0A 2L4QA 4GQFA 1I5GA 3F6DA 4FXYP 4BL7A 3A5WA 2GZPA 4PURA 4PNFA 5A34A 3LGCA 11GSA 1PN9A 3D21A 3EPTA 2NTOA 2EIQA 1F3AA 4AF2A 4K9ZA 2P5QA 4AJ8A 3HYPA 2R5GA 1QXHA 2VOCA 5B8AA 2V2GA 2CAIA 2DJKA 3IC4A 4EE0A 4IELA 4JR4A 1GTIA 4IJIA 2C0DA 4TXOA 3CXGA 3ZVJD 3F4TA 1TI1A 14GSA 4K7NA 3L4NA 1YF1A 3MAKA 2PN8A 2QA2A 1M99A 1TTZA 1ACVA 2M80A 3UJ1A 3TRPA 2OKAA 5IM9A 2R4VA 2C0FA 2C3TA 1T3BA 4QL9A 1VF2A 1GSYA 2JZRA 3EYTA 3D5JA 4LMWA 4MZCA 2JSZA 1PX7A 2CX3A 2IWTA 2YZHA 1B4QA 2WZSA 1J08A 3QD9A 3M3MA 2R0GA 2ZCTA 5ECKB 4AKIA 2L59A 2CX4A 1QMVA 3APQA 3GH9A 4G0LA 1WJKA 3U6VA 3DVWA 3RBTA 4KDXA 4HUAA 3GH6A 3PH9A 2FLSA 3GTUB 2JU5A 1X5DA 3GKNA 4HQSA 4OO4A 1TP9A 1SKWB 3KIJA 2R6KA 5IPHA 3IRAA 3ZZXA 1FAAA 3UL3A 3U5RE 1TKDB 4YAVA 5H5RA 3F8UA 2H1AA 4TR0A 4XS4A 1M9AA 1T7PB 3IAS2 1ST9A 3DGQA 2L6DA 1A23A 4QMKA 1BX9A 3LYPA 3CRTA 3GFKA 2NPBA 4OFNA 3R3EA 2V6OA 2LNSA 2GTUA 4A5PA 2WS2A 2FA4A 2L5OA 2HRAA 2H1BA 1JFUA 17GSA 3KGKA 4HJMA 1GSSA 1YKCA 1GTUA 5ECLB 3IK9A 3CMIA 1BAYA 4IW9A 2LRCA 4Z2RA 6GSVA 1TI3A 2LJRA 2N5AA 1AQVA 5KOWA 1JHBA 1K3OA 4KAEA 1K0NA 3HA9A 3Q6OA 5ECQB 5COHA 5F8BA 4PX1A 1U6TA 5FT3A 4FYCA 3RPNA 2YWNA 1GULA 1NW2A 3VI5A 1PX6A 3G7JA 3SWLA 2QGVA 2RUFA 4X1UA 4PGTA 2H6YA 4ECIA 1QGVA 3L0HA 1SL0B 3I43A 3O6TA 3O3TA 5DQSA 4NPBA 2OBIA 4E8EA 4KCAA 1MEKA 3C8EA 4GCIA 1SVMA 3DRNA 2RM6A 4X43A 1V58A 4POKA 1YVLA 3E9JB 2VUPA 1XWAA 2OT3A 1JZOA 2WW0A 2ZUPA 2VIMA 4DSSA 1K0DA 1UA5A 3CSIA 1DBYA 1WPIA 1PL1A 5AISA 2A2SA 1OE7A 5J4VA 2JADA 1VF1A 3E0UA 4CDOA 1MD3A 4OD7A 4G19A 2H71A 1TU7A 1JZRA 3FR9A 1R4WA 2JACA 3MIXA 1F9MA 8GSSA 2CT6A 1SKRB 3EMXA 4AGSA 5KEJA 2PMTA 5C00A 1W4VA 3HD5A 5D9VA 1KEBA 4ZBAA 2RUEA 2P5RA 3EC3A 2WVXB 4N11A 2OACA 4OWYA 3KM6A 2LV3A 2GZYA 4DVCA 1B8XA 3GNJA 2EIRA 2HRNA 1SL2B 3IHGA 3FMWA 1HD2A 3W6GA 3GMFA 4KUNA 3UIWA 5A5HB 1OC9B 4AKGA 4AJ6A 1Z6MA 5ECPB 1M3IA 4XRAA 4ICYA 5ABRA 2EC4A 4XTSA 2X4AA 2YP6A 4NV5A 2H6XA 1GL8A 5DJLA 1JLWA 2EIOA 3P7XA 1XW6A 2H0IA 4ACSA 5JCUA 19GSA 2R37A 2C1YA 3LYKA 1U3AA 2IIYA 1XWGA 2IN3A 2GVPA 4IJ3A 2LS5A 2E7PA 1YJ6A 2YWIA 3ZVJA 3LQ7A 1Z6NA 1DE2A 2VCTA 4IKHA 3TKSC 1GTAA 3I6AA 4D73B 3LORA 3GTUA 4KGIA 4K6XA 4L0UA 4MPGA 4MF5A 2GT6A 1EP7A 4POLA 2DJJA 5F0GA 2E0QA 2H76A 2PVOC 3HCZA 2XPDA 1A2LA 2OA7A 1NSWA 1GUMA 2HLSA 1O6JA 4K2DA 5BMUB 4JBBA 3KP9A 2HE3A
chains in the Genus database with same CATH topology
3TRQA 5L71A 3HKRA 5B8BA 3BBYA 4BVYB 2GQKA 2DJ1A 2PERA 1N2AA 5DDLA 4JU5A 4BWSA 4K5SA 1JZDA 4EO3A 1EEJA 1A0FA 1PMTA 5JWRB 3D22A 3ZFLA 3GURA 1ERWA 1SYXA 4I8BA 3LW9A 2G0FA 1YY7A 3DEXA 2OBKA 3H1NA 5E59A 1Q4JA 5G5FA 2F9SA 2FCHA 5J41A 3IHQA 5EPFA 2IMIA 3VK9A 1RK4A 1ZYQB 1FHEA 4WR5A 2BMXA 3VURA 4LMVA 2H75A 4OO5A 1F6MC 3DIEA 4EL1A 3FHKA 4ECJA 4MLYA 3DD3A 2H6ZA 2VKZG 3TJGA 3C1RA 3UBLA 1SKSB 1S3AA 1SVOA 6GSYA 2H70A 3KCMA 4TR1A 5BRTA 5ECNB 3MYDA 2I3YA 1SJ6A 3TDGA 1GH2A 2O5VA 1EOGA 4ECCA 3I9V2 2H01A 2B5XA 2B5YA 4F2IA 5J4UA 2ES7A 4ECBA 1Z7PA 2YJ7A 3HVVA 2R0CA 5FWGA 2MMAA 3HJPA 1HNCA 4PXOA 1UN2A 2KLXA 3J7Yk 5IOXA 4X4JA 2GSTA 3GA4A 2L57A 4KE3A 1R5PA 3GSTA 2PUKC 2YANA 4Z2UA 1PN0A 4MH2A 5D73A 3GV1A 2YCDA 1DSBA 3HXSA 3F9UA 3M0FA 4XS6A 2WRTA 3D0ZA 5J3RA 2HSNB 2K18A 3F4SA 1XWCA 5DQYA 2HT9A 5IIZA 3WD6A 1WIKA 2VL2A 2FA8A 2VLUA 1TU8A 1WWJA 1NM3A 1G0TA 3LFLA 5JCWA 2VL2C 2V6KA 3ERWA 2DC5A 2AAWA 2K8VA 1HYUA 2KP2A 1F2EA 2H19A 2I81A 2IPAA 4FO5A 4GLTA 4KSMA 3D6IA 2OADA 4ZL7A 2GGTA 4W66A 2FWEA 2H8LA 3LXTA 2AV4A 5CO3A 3FZ9A 3A5IA 1G7EA 4YQUA 2IMFA 1USBA 4O32A 1AUCA 2H74A 1PKZA 1WE0A 1AC1A 5A5HA 1OC9A 1Q98A 3IR4A 1R26A 2VCQA 3A2WA 1U87A 4L5OA 2F8AA 4FQUA 2FGXA 3BCKA 1GSEA 2C3QA 1GTBA 2AJQB 4YKFA 4BA7A 5LCZA 4IBPA 2A4HA 4PNGA 3BD2A 1V98A 2WDUA 3F63A 1OKTA 1V2AA 3QR6A 5HR0A 1Y6EA 3C71A 4I5QA 1XWKA 5HQPA 4Q5FA 2DKIA 5ECRB 1H4OA 3QDNA 2IFQB 5AIXA 1CQGA 1XOAA 1SYRA 1XW9A 1S3CA 2VCVA 4D73A 3IPZA 2CVKA 4K7OA 1FB0A 2I4AA 2LQQA 2GDRA 3L78A 2PBJA 4G10A 3TJKA 3L9UA 4GDFA 4RUVA 1O85A 3HVSA 4PUFC 5BMUA 3WGEA 4F82A 1WOUA 4O92A 1TXXA 5ECSA 3A2VA 4BVYA 3QFBC 2YV7A 2JL4A 3UOMA 4CW9A 20GSA 4GXZA 2HZFA 4EVMA 4MZWA 5G30A 5AIVA 3KP8A 1V9WA 5KN3A 3VI7A 1VRSD 1GRXA 2IJYA 2FNOA 2O87A 4MK3A 3CTFA 4HEA2 1SJIA 2KUCA 4FIWA 4MJBA 1EOHA 1QUWA 1W89A 4GSTA 5GAND 2WJUA 3US3A 1GNEA 4Q5RA 3QFAC 2CZ2A 3QPMA 4IQAA 5J47A 3TKRA 2DJ3A 1AXDA 5KOXA 4ZILA 2O85A 5GSTA 1XWBA 4LL1B 3RHBA 3ISOA 1S3DA 13GSA 4N0ZA 4TKYA 3BCIA 4ULXA 2GT5A 1EGOA 4G9HA 5KN1A 3MDKA 2LSTA 1SD9A 2YZUA 1MDIA 5DCHA 4TR1B 4IP1A 1M0UA 1URMA 1HNAA 2LNTA 3L9SA 4Z2TA 1SL1B 5IO2A 5G31A 5IOWA 5ID2B 4HDEA 2DMLA 3WYWA 1G6YA 3ZYWA 1Z3EA 3GSSA 5J40A 4NMUA 1ML6A 2HRKB 1GP1A 1XCCA 2HSNA 4ZB7A 4ZBDA 2CZ3A 3TU3B 1XW5A 3APOA 2DIYA 4ZIJA 2I9HA 3C1SA 2HSMB 1MD4A 1BJXA 1T4YA 3FR3A 1TW9A 2J23A 1ZYNA 3TKQA 2LJKA 3M1GA 1PD21 1K0MA 3HZ8A 5A4WA 1O81A 1YKAA 4O5QA 4KB3A 2NDOA 2TIRA 2H73A 4ILFA 1OAZA 5IQYA 3GRXA 2DLXA 1VGLA 3KD0A 5HR2A 1XIYA 1AAZA 1SJZA 1K0OA 4N0VA 3FEUA 4ZB6A 3DWVA 1RQMA 2DJ0A 2FD3A 4EF0A 3ERGA 3IA1A 4MJEA 1V40A 1TK5B 2MBTA 2YOIA 5G5EA 1ZZYA 4HZ4A 2VCXA 1LBKA 4O7HA 3LEFA 2LEGA 2C8UA 5A1NB 1MDJA 5GAPD 1J0FA 3VWUA 3TJJA 1XZOA 3Q18A 1SU9A 4AKXB 2VAFA 3GL3A 2H1DA 4MPFA 3TCOA 2UV8G 4WR4A 2C0GA 1WMJA 2TRXA 2F8FA 2GSQA 5B7CA 2R0PA 5D8IA 1UC7A 3D4TA 3CWGA 3WT1A 3VFIA 1U88A 4NV2A 3MNGA 1J9BA 3ZITA 1ON4A 1A8LA 4ID0A 3ME8A 2CVDA 2IFQA 3FYGA 2FWGA 3IOSA 2VM2A 4KSOA 3H93A 5ECIB 3IE3A 4V2MA 2B1LA 4ZXGA 1LU4A 3TKSE 1Z7RA 1KTEA 1X9SB 1TK8B 1O8XA 1LJRA 1OVNA 5IMAA 5IMDA 3UVTA 5HFGA 1T00A 1PKWA 4V1Ap 3TKSA 4IS0A 4NHWA 4POMA 5D9TA 3ZTLA 5F07A 3G7YA 2P0GA 4KX4A 5CP1A 5IMFA 2PGTA 3HDCA 2QSIA 3CSHA 5J4YA 4O5UA 5EVOA 2UZ8A 4YH2A 4BVXB 3C73A 3KZQA 3ZIVA 5DAKB 3FY7A 1XOBA 1YEXA 4EUYA 2DSAA 3QAGA 4XS1A 5CRWA 3DMLA 2B7JA 2QA1A 2X8CA 1Z9HA 1O7UA 2DMMA 3EMPA 5ECHB 4IHUA 5B6MA 4K0GA 1Y1UA 5DALA 1KNGA 4EIPA 5A4VA 2H0GA 3HZ4A 3UEMA 1XBSA 2F3MA 4XIHA 2V1MA 3UARA 2N5BA 3RAZA 3H4KA 2RIIA 4K0NA 4DEJA 2V41A 3LJRA 3QAVA 5LD0A 5IO0A 2B1KA 3P2AA 1VF3A 1TXUA 1HNBA 1IYIA 2P31A 1GSFA 4NHZA 2WZ9A 4MH3A 1WRYA 2EFHA 2IL3A 3H79A 3DYRA 5DVBA 3KH9A 3EWLA 4F03A 2Z9SA 5EL8A 2PPTA 2PU9C 3A2XA 2C0EA 4N30A 4I6XA 4FYBA 3GKKA 2B3SA 1GUKA 1ILOA 2GSSA 4F9ZA 1M2AA 1ERVA 4ZL9A 2ON7A 3M8NA 3V1WA 4HI7A 5G1KA 4JEDA 3JCML 2VCZA 1ZOFA 3CRUA 2OE1A 3ZL5A 5ID2A 3TJFA 4HZ2A 3P8WA 4KDUA 2X64A 2HNLA 2C3NA 4GTUA 2R2JA 4ML1A 4P3YB 2HRKA 1BG1A 4O5RA 3HJOA 3J7Yb 1GSUA 3IC8A 5B6NA 1ZYEA 4JRRA 1A2JA 4KF9A 1YEPA 4EC0A 5G1LA 2HI7A 4Z7XA 1XVQA 2HSMA 2AYTA 4XCSA 3FZ4A 4GWRA 3UBKA 4ZBBA 1FO5A 1QK8A 2A2RA 9GSSA 3ZMLA 3VWWA 1ZGNA 4NWYA 4K8MA 4F0CA 1GNWA 3KMOA 1G6WA 2YN1A 1AQXA 3ZIJA 4WETA 2DIZA 3IK7A 5D93A 5D9WA 2H1GA 3AY8A 2OE0A 2VL3A 4DSQA 2LRTA 3WGXA 2L5LA 3LXZA 4Q5QA 3KEBA 3FR6A 3FZ5A 1YF0A 2YWOA 1R5AA 4BWQA 4WF4A 1X0RA 1VF4A 4OMVA 1EP8A 1K3YA 5A1NA 4MABA 3Q19A 4MMMA 3ZLPA 1GLPA 3PR8A 12GSA 2LRNA 1THOA 3WGDA 5G2ZA 3MWHA 2O8VB 1M2DA 2MMOA 4LL4B 1A2MA 3OR5A 3A3TA 4J57E 2GS3A 3F0IA 3R2QA 4PTSA 3IXRA 4NAXA 3ZREA 2YPMA 4KH7A 2VM1A 1K3LA 2I1UA 2VO4A 4TOPA 5J9CA 2K8SA 4WXTA 1BF5A 3KXOA 4K7IA 6GSUA 4EDZA 4ISDA 2X99A 2WGRA 4H86A 4K2XA 10GSA 1E6BA 2L6CA 4WKWA 5C04A 1XPVA 2O7KA 4I2UA 1A8YA 2DBCA 5F06A 2E2MA 2V32A 3FK8A 4I2TA 1ZMAA 3ED3A 1Y25A 2ALBA 4NXIA 5ECOB 2MYGA 2ON5A 2FUG2 2A2PA 4FH8A 2EFEA 5ELAA 5HFKA 5DBQA 2OE3A 1I9DA 5IMCA 4BVXA 4ML6A 2LQOA 3RHCA 5DAKA 1HQOA 3VWXA 1WP0A 3ZFBA 4N3ZA 4YKGA 1V57A 2TRCP 2XHFA 1TJDA 1ZL9A 3Q74A 4MCUA 4RI6A 1SENA 3HHVA 2FWHA 1ZCPA 1Z5YE 4V2NA 2AHEA 4JE1A 2HYXA 3FRCA 1CQHA 1FVJA 2WFCA 1K0CA 1OC3A 5CAXA 1JZWA 3F4RA 4GF0A 5INYA 4CHSA 3QAWA 3VPTA 5HR1A 5DALB 4WBRD 2NBSA 3EU4A 1KBNA 3O76A 3D4MA 4GSSA 4POBA 2VCWA 2CV4A 1A24A 3TRXA 3RPPA 4PQIA 1F37A 1F3BA 5GZZB 4KNDA 2PWJA 5CNWA 5A5KA 2HXKA 1DUGA 3EURA 2YWMA 2RLIA 1ZYPA 1QFNA 3UMAA 2WCIA 7GSSA 4J2FA 4LA1A 4CY6A 4OFTA 4F0BA 3GKMA 4MZBA 4DSRA 4G2EA 1B9YC 4ZL8A 4TW5A 3HJMA 1EGRA 1YQ1A 1TOFA 2BJXA 4ZB8A 1MDKA 1X5EA 4TN8A 1C72A 3VWVA 5AGYA 4HU9A 2LUSA 1G7OA 2CQ9A 1GWCA 4IP6A 2VLTA 1GSDA 3FKFA 2CA8A 4L8EA 2KHPA 3IAM2 4KCEA 2HSHA 1AW9A 4V1Ag 4MF7A 3GUSA 3GN3A 5A4UA 4MJCA 2GSRA 4EIQA 2XC2A 2CAQA 3HY2A 1XXUA 5IMZA 1O73A 2X8HA 5J9BA 1JLVA 5ENUA 2LJAA 2DJ2A 4TR3A 1OYJA 3GX8A 4CY8A 1EEMA 3UAPA 3NIVA 4QQ7A 1BG5A 2WULA 1PL2A 3RDWA 1GUHA 2KP1A 5GSSA 3EU3A 5LNKe 4L0WA 2N5FA 1NHOA 1B48A 3BJ5A 2MBSA 5EY6A 2HZEA 4HOJA 1AQWA 1AIUA 4EXJA 1UVZA 1EV9A 4TRXA 1FB6A 4V2LA 4USSA 3GIXA 3TJBA 2HFDA 3TOUA 6GSSA 4YAPA 3CSJA 2FY6A 4MDCA 1FW1A 1NHYA 5ECMB 1ERTA 1TRVA 4IGJA 2REMA 2AUVA 2XPEA 5H5SA 4QL7A 3EVIA 2R3XA 4PQ1A 4BPYA 2LKUA 2X8GA 3FZAA 3ZRDA 3KTBA 4AJ7A 3H8QA 4OCEA 4MF6A 2VLVA 1SK0A 4WEYA 3S9FA 1TRUA 2XBQA 4HQZA 5CRDA 2FWFA 2F51A 5F05A 4AKHA 3TUEA 5HR3A 3F3QA 1E2YA 3EE2A 4X0XA 1U3IA 4KW6A 2H1LA 3M9KA 1TK0B 22GSA 4GQCA 2KOKA 1R7HA 2DKHA 4YQMA 2H0HA 3IDVA 4BL7B 3GHAA 4JZQA 2H66A 5A34B 1OC8A 1X9MB 3DXBA 5HFIA 5IMVA 4GSNA 4E68A 4HJ2A 3UVHA 1GLQA 1N25A 3LWAA 1M2BA 3MSZA 2JZTA 2YV9A 4TXOB 5CRHA 2EFDA 3QCPA 4LLRA 2IMEA 4G0KA 3APSA 3EINA 3GL5A 2NVLA 5FHIA 5D9XA 3E3EA 2C4JA 3G7IA 2IMDA 1PA3A 3CBUA 2HQTA 4GRFA 4TXVA 4I97A 4RQXA 2C80A 2B5EA 1SVLA 1PQNA 2A4VA 2HSYA 5CRGA 2AB6A 3CTGA 5DJMA 16GSA 4WBJA 1BYEA 4EDYA 1X9WB 2EFCA 4L5LA 1QQ2A 2H72A 3F3RA 2GQMA 1EZKA 3GYKA 5E4WA 1H75A 1ERUA 1SD8A 1B9XC 2B6MA 2IMKA 6GSXA 3NOFA 1B4PA 2E2GA 3GKXA 2D2ZA 2ZNMA 2BTOT 4MA9A 2K9FA 4E8HA 2JZSA 4IQ1A 1YZXA 3KTLA 3VPQA 1SK1A 4Q5NA 4TVEA 2QKEA 2VL9A 1EV4A 2GZZA 4XRDA 2VD0A 2B7KA 4AI6A 2LTKA 1IYHA 5CREA 3LG6A 1FVKA 3P90A 2G2QA 1DE1A 3QOUA 4XS4B 3M9JA 5J5NA 2GLRA 3ERFA 1THXA 1ABAA 1FG4A 1TRWA 3ME7A 4MJAA 2FHEA 4HS1A 2OJLA 4FYUA 3KMNA 4N10A 2XBIA 3G9BA 3SBCA 4RQRA 3HVXA 4TR4A 4MP4A 1XFLA 4G01A 5JCGA 1FOVA 3BOAA 1XVWA 2M46A 3W8SA 1K0AA 2YJHA 2WB9A 2MMZA 3ZMKA 3IV4A 4KDYA 1SK2A 6GSTA 4J56E 3KJYA 4OFMA 3VLNA 3HMJG 4JR6A 2H30A 3IBHA 3LSZA 2MMNA 2X49A 3PGTA 5KN2A 4G0IA 2YNXA 3QMXA 5DCGA 6GSWA 4PQHA 1GSQA 3DVXA 3PINA 2O89A 1PSQA 2K6VA 2QC7A 1X5CA 4K1FA 4ZB9A 1RW1A 4OCFA 3FW2A 3WT2A 1BEDA 2M72A 5CYYA 5JWQB 5H5QA 3N9JA 2L4CA 1TRSA 3TB2A 1BQ7A 1YDKA 5D96A 3DKSA 3F6FA 1FOHA 1EWXA 5IPGA 4IVFA 4IN0A 3I69A 1MTCA 3KH7A 2J9HA 1T4ZA 3C7MA 2HZEB 4PUAA 2PVQA 4HU7A 2HRFA 3W8JA 3TGZA 2MZCA 4RI7A 2RM5A 4DSSB 1A0RP 4EKZA 5AN1A 2CVBA 4K5RA 2VD1A 4XHMA 1TDIA 4WF5A 1T8EB 1O8WA 3TOTA 3NZNA 5JWOB 2GQLA 3PPUA 1OE8A 3CYNA 4YQVA 1OKDA 3N5OA 5KN0A 1N8JA 18GSA 4MNNA 1PRXA 3L9VA 3TKPA 3K8NA 3GX0A 2JSYA 1PGTA 1T1VA 1K0BA 1M7TA 1M9BA 5ELGA 4KA0A 2L4QA 4GQFA 1I5GA 3F6DA 4BL7A 3A5WA 2GZPA 4PURA 4PNFA 5A34A 3LGCA 11GSA 1PN9A 3D21A 3EPTA 2NTOA 2EIQA 1F3AA 4AF2A 4K9ZA 2P5QA 4AJ8A 3HYPA 2R5GA 1QXHA 2VOCA 5B8AA 2V2GA 2CAIA 2DJKA 3IC4A 4EE0A 4IELA 4JR4A 1GTIA 4IJIA 2C0DA 4TXOA 3CXGA 3ZVJD 3F4TA 1TI1A 14GSA 4K7NA 3L4NA 1YF1A 3MAKA 2PN8A 2QA2A 1M99A 1TTZA 1ACVA 2M80A 3UJ1A 3TRPA 2OKAA 5IM9A 2R4VA 2C0FA 2C3TA 1T3BA 4QL9A 1VF2A 1GSYA 2JZRA 3EYTA 3D5JA 4LMWA 4MZCA 2JSZA 1PX7A 2CX3A 2IWTA 2YZHA 1B4QA 1J08A 3QD9A 3M3MA 2R0GA 2ZCTA 5ECKB 4AKIA 2L59A 2CX4A 1QMVA 3APQA 3GH9A 4G0LA 1WJKA 3U6VA 3DVWA 3RBTA 4KDXA 4HUAA 3GH6A 3PH9A 2FLSA 3GTUB 2JU5A 1X5DA 3GKNA 4HQSA 4OO4A 1TP9A 1SKWB 3KIJA 2R6KA 5IPHA 3IRAA 3ZZXA 1FAAA 3UL3A 3U5RE 1TKDB 4YAVA 5H5RA 3F8UA 2H1AA 4TR0A 4XS4A 1M9AA 1T7PB 3IAS2 1ST9A 3DGQA 2L6DA 1A23A 4QMKA 1BX9A 3LYPA 3CRTA 3GFKA 2NPBA 4OFNA 3R3EA 2V6OA 2LNSA 2GTUA 4A5PA 2WS2A 2FA4A 2L5OA 2HRAA 2H1BA 1JFUA 17GSA 3KGKA 4HJMA 1GSSA 1YKCA 1GTUA 5ECLB 3IK9A 3CMIA 1BAYA 4IW9A 2LRCA 4Z2RA 6GSVA 1TI3A 2LJRA 2N5AA 1AQVA 5KOWA 1JHBA 1K3OA 4KAEA 1K0NA 3HA9A 3Q6OA 5ECQB 5COHA 5F8BA 4PX1A 1U6TA 5FT3A 4FYCA 3RPNA 2YWNA 1GULA 1NW2A 3VI5A 1PX6A 3G7JA 3SWLA 2QGVA 2RUFA 4X1UA 4PGTA 2H6YA 4ECIA 1QGVA 3L0HA 1SL0B 3I43A 3O6TA 3O3TA 5DQSA 4NPBA 2OBIA 4E8EA 4KCAA 1MEKA 3C8EA 4GCIA 1SVMA 3DRNA 2RM6A 4X43A 1V58A 4POKA 1YVLA 3E9JB 2VUPA 1XWAA 2OT3A 1JZOA 2ZUPA 2VIMA 4DSSA 1K0DA 1UA5A 3CSIA 1DBYA 1WPIA 1PL1A 5AISA 2A2SA 1OE7A 5J4VA 2JADA 1VF1A 3E0UA 4CDOA 1MD3A 4OD7A 4G19A 2H71A 1TU7A 1JZRA 3FR9A 1R4WA 2JACA 3MIXA 1F9MA 8GSSA 2CT6A 1SKRB 3EMXA 4AGSA 5KEJA 2PMTA 5C00A 1W4VA 3HD5A 5D9VA 1KEBA 4ZBAA 2RUEA 2P5RA 3EC3A 4N11A 2OACA 4OWYA 3KM6A 2LV3A 2GZYA 4DVCA 1B8XA 3GNJA 2EIRA 2HRNA 1SL2B 3IHGA 3FMWA 1HD2A 3W6GA 3GMFA 4KUNA 3UIWA 5A5HB 1OC9B 4AKGA 4AJ6A 1Z6MA 5ECPB 4XRAA 4ICYA 5ABRA 2EC4A 4XTSA 2X4AA 2YP6A 4NV5A 2H6XA 1GL8A 5DJLA 1JLWA 2EIOA 3P7XA 1XW6A 2H0IA 4ACSA 5JCUA 19GSA 2R37A 2C1YA 3LYKA 1U3AA 2IIYA 1XWGA 2IN3A 2GVPA 4IJ3A 2LS5A 2E7PA 1YJ6A 2YWIA 3ZVJA 3LQ7A 1Z6NA 1DE2A 2VCTA 4IKHA 3TKSC 1GTAA 3I6AA 4D73B 3LORA 3GTUA 4KGIA 4K6XA 4L0UA 4MPGA 4MF5A 2GT6A 1EP7A 4POLA 2DJJA 5F0GA 2E0QA 2H76A 2PVOC 3HCZA 2XPDA 1A2LA 2OA7A 1NSWA 1GUMA 2HLSA 1O6JA 4K2DA 5BMUB 4JBBA 3KP9A 2HE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TRQ A;  5L71 A;  3HKR A;  5B8B A;  3BBY A;  4BVY B;  2GQK A;  2DJ1 A;  2PER A;  1N2A A;  5DDL A;  4JU5 A;  4BWS A;  1JZD A;  4EO3 A;  1EEJ A;  1A0F A;  1PMT A;  5JWR B;  3D22 A;  3ZFL A;  3GUR A;  1ERW A;  1SYX A;  4I8B A;  2G0F A;  1YY7 A;  3DEX A;  2OBK A;  3H1N A;  5E59 A;  1Q4J A;  5G5F A;  2F9S A;  2FCH A;  5J41 A;  3IHQ A;  5EPF A;  2IMI A;  3VK9 A;  1RK4 A;  1ZYQ B;  1FHE A;  4WR5 A;  2BMX A;  3VUR A;  4LMV A;  2H75 A;  4OO5 A;  1F6M C;  3DIE A;  4EL1 A;  3FHK A;  4ECJ A;  4MLY A;  3DD3 A;  2H6Z A;  3TJG A;  3C1R A;  3UBL A;  1SKS B;  1S3A A;  6GSY A;  2H70 A;  3KCM A;  4TR1 A;  5ECN B;  2I3Y A;  1SJ6 A;  3TDG A;  1GH2 A;  1EOG A;  4ECC A;  3I9V 2;  2H01 A;  2B5X A;  2B5Y A;  4F2I A;  5J4U A;  2ES7 A;  4ECB A;  1Z7P A;  2YJ7 A;  3HVV A;  5FWG A;  2MMA A;  3HJP A;  1HNC A;  4PXO A;  1UN2 A;  2KLX A;  3J7Y k;  5IOX A;  2GST A;  3GA4 A;  2L57 A;  4KE3 A;  1R5P A;  3GST A;  2PUK C;  2YAN A;  4MH2 A;  5D73 A;  3GV1 A;  2YCD A;  1DSB A;  3HXS A;  3F9U A;  3M0F A;  4XS6 A;  2WRT A;  3D0Z A;  5J3R A;  2HSN B;  2K18 A;  3F4S A;  1XWC A;  5DQY A;  2HT9 A;  5IIZ A;  3WD6 A;  1WIK A;  2VL2 A;  2FA8 A;  2VLU A;  1TU8 A;  1WWJ A;  1NM3 A;  1G0T A;  3LFL A;  5JCW A;  2VL2 C;  2V6K A;  3ERW A;  2DC5 A;  2AAW A;  2K8V A;  1HYU A;  2KP2 A;  1F2E A;  2H19 A;  2I81 A;  2IPA A;  4FO5 A;  4GLT A;  4KSM A;  3D6I A;  2OAD A;  4ZL7 A;  2GGT A;  2FWE A;  2H8L A;  3LXT A;  2AV4 A;  5CO3 A;  3FZ9 A;  1G7E A;  4YQU A;  2IMF A;  1USB A;  4O32 A;  1AUC A;  2H74 A;  1PKZ A;  1WE0 A;  1AC1 A;  1OC9 A;  1Q98 A;  3IR4 A;  1R26 A;  2VCQ A;  3A2W A;  1U87 A;  4L5O A;  2F8A A;  4FQU A;  2FGX A;  3BCK A;  1GSE A;  2C3Q A;  1GTB A;  2AJQ B;  4BA7 A;  5LCZ A;  4IBP A;  4PNG A;  3BD2 A;  1V98 A;  2WDU A;  3F63 A;  1OKT A;  1V2A A;  3QR6 A;  5HR0 A;  1Y6E A;  3C71 A;  4I5Q A;  1XWK A;  5HQP A;  4Q5F A;  5ECR B;  1H4O A;  3QDN A;  2IFQ B;  5AIX A;  1CQG A;  1XOA A;  1SYR A;  1XW9 A;  1S3C A;  2VCV A;  4D73 A;  3IPZ A;  2CVK A;  4K7O A;  1FB0 A;  2I4A A;  2LQQ A;  2GDR A;  3L78 A;  2PBJ A;  4G10 A;  3TJK A;  3L9U A;  4RUV A;  1O85 A;  3HVS A;  4PUF C;  5BMU A;  3WGE A;  4F82 A;  1WOU A;  4O92 A;  1TXX A;  5ECS A;  3A2V A;  4BVY A;  3QFB C;  2YV7 A;  2JL4 A;  3UOM A;  4CW9 A;  20GS A;  4GXZ A;  2HZF A;  4EVM A;  4MZW A;  5G30 A;  5AIV A;  3KP8 A;  1V9W A;  5KN3 A;  3VI7 A;  1VRS D;  1GRX A;  2IJY A;  2FNO A;  2O87 A;  4MK3 A;  3CTF A;  4HEA 2;  1SJI A;  2KUC A;  4FIW A;  4MJB A;  1EOH A;  1QUW A;  1W89 A;  4GST A;  5GAN D;  2WJU A;  3US3 A;  1GNE A;  4Q5R A;  3QFA C;  2CZ2 A;  3QPM A;  4IQA A;  3TKR A;  2DJ3 A;  1AXD A;  4ZIL A;  2O85 A;  5GST A;  1XWB A;  4LL1 B;  3RHB A;  3ISO A;  1S3D A;  13GS A;  4N0Z A;  4TKY A;  3BCI A;  4ULX A;  2GT5 A;  1EGO A;  4G9H A;  5KN1 A;  3MDK A;  2LST A;  1SD9 A;  2YZU A;  1MDI A;  5DCH A;  4TR1 B;  4IP1 A;  1M0U A;  1URM A;  1HNA A;  2LNT A;  3L9S A;  1SL1 B;  5IO2 A;  5G31 A;  5IOW A;  5ID2 B;  4HDE A;  2DML A;  3WYW A;  1G6Y A;  3ZYW A;  1Z3E A;  3GSS A;  4NMU A;  1ML6 A;  2HRK B;  1GP1 A;  1XCC A;  4ZBD A;  2CZ3 A;  1XW5 A;  3APO A;  2DIY A;  4ZIJ A;  2I9H A;  3C1S A;  2HSM B;  1MD4 A;  1BJX A;  1T4Y A;  3FR3 A;  1TW9 A;  2J23 A;  3TKQ A;  2LJK A;  3M1G A;  1PD2 1;  1K0M A;  3HZ8 A;  5A4W A;  1O81 A;  1YKA A;  4KB3 A;  2NDO A;  2TIR A;  2H73 A;  4ILF A;  1OAZ A;  5IQY A;  3GRX A;  2DLX A;  1VGL A;  3KD0 A;  5HR2 A;  1XIY A;  1AAZ A;  1SJZ A;  1K0O A;  4N0V A;  3FEU A;  4ZB6 A;  3DWV A;  1RQM A;  2DJ0 A;  2FD3 A;  4EF0 A;  3ERG A;  3IA1 A;  4MJE A;  1V40 A;  1TK5 B;  2MBT A;  2YOI A;  5G5E A;  1ZZY A;  4HZ4 A;  2VCX A;  1LBK A;  4O7H A;  3LEF A;  2LEG A;  2C8U A;  5GAP D;  1MDJ A;  1J0F A;  3VWU A;  3TJJ A;  1XZO A;  3Q18 A;  1SU9 A;  2VAF A;  3GL3 A;  2H1D A;  4MPF A;  3TCO A;  4WR4 A;  2C0G A;  1WMJ A;  2TRX A;  2F8F A;  2GSQ A;  5B7C A;  5D8I A;  1UC7 A;  3D4T A;  3WT1 A;  3VFI A;  1U88 A;  4NV2 A;  3MNG A;  1J9B A;  3ZIT A;  1ON4 A;  1A8L A;  4ID0 A;  3ME8 A;  2CVD A;  2IFQ A;  3FYG A;  2FWG A;  3IOS A;  2VM2 A;  4KSO A;  3H93 A;  5ECI B;  3IE3 A;  4V2M A;  2B1L A;  4ZXG A;  1LU4 A;  3TKS E;  1Z7R A;  1KTE A;  1X9S B;  1TK8 B;  1O8X A;  1LJR A;  1OVN A;  5IMA A;  5IMD A;  3UVT A;  5HFG A;  1T00 A;  1PKW A;  4V1A p;  3TKS A;  4IS0 A;  4NHW A;  4POM A;  5D9T A;  3ZTL A;  5F07 A;  3G7Y A;  2P0G A;  4KX4 A;  5CP1 A;  5IMF A;  2PGT A;  3HDC A;  2QSI A;  3CSH A;  5EVO A;  2UZ8 A;  4YH2 A;  4BVX B;  3C73 A;  3KZQ A;  3ZIV A;  5DAK B;  3FY7 A;  1XOB A;  1YEX A;  4EUY A;  2DSA A;  3QAG A;  4XS1 A;  5CRW A;  3DML A;  2B7J A;  2X8C A;  1Z9H A;  1O7U A;  2DMM A;  3EMP A;  5ECH B;  4IHU A;  5B6M A;  4K0G A;  5DAL A;  1KNG A;  5A4V A;  2H0G A;  3HZ4 A;  3UEM A;  1XBS A;  2F3M A;  4XIH A;  2V1M A;  3UAR A;  2N5B A;  3RAZ A;  3H4K A;  2RII A;  4K0N A;  4DEJ A;  2V41 A;  3LJR A;  3QAV A;  5LD0 A;  5IO0 A;  2B1K A;  3P2A A;  1VF3 A;  1HNB A;  1IYI A;  2P31 A;  1GSF A;  4NHZ A;  2WZ9 A;  4MH3 A;  1WRY A;  2IL3 A;  3H79 A;  3DYR A;  5DVB A;  3KH9 A;  3EWL A;  4F03 A;  2Z9S A;  5EL8 A;  2PPT A;  2PU9 C;  3A2X A;  2C0E A;  4N30 A;  4I6X A;  4FYB A;  3GKK A;  2B3S A;  1GUK A;  1ILO A;  2GSS A;  4F9Z A;  1M2A A;  1ERV A;  4ZL9 A;  2ON7 A;  3M8N A;  3V1W A;  4HI7 A;  5G1K A;  4JED A;  3JCM L;  2VCZ A;  1ZOF A;  3CRU A;  2OE1 A;  3ZL5 A;  5ID2 A;  3TJF A;  4HZ2 A;  3P8W A;  4KDU A;  2X64 A;  2HNL A;  2C3N A;  4GTU A;  2R2J A;  4ML1 A;  4P3Y B;  2HRK A;  4O5R A;  3HJO A;  3J7Y b;  1GSU A;  3IC8 A;  5B6N A;  1ZYE A;  4JRR A;  1A2J A;  4KF9 A;  1YEP A;  4EC0 A;  5G1L A;  2HI7 A;  4Z7X A;  1XVQ A;  2HSM A;  2AYT A;  4XCS A;  3FZ4 A;  4GWR A;  3UBK A;  4ZBB A;  1FO5 A;  1QK8 A;  2A2R A;  9GSS A;  3ZML A;  3VWW A;  1ZGN A;  4NWY A;  4K8M A;  4F0C A;  1GNW A;  3KMO A;  1G6W A;  2YN1 A;  1AQX A;  3ZIJ A;  4WET A;  2DIZ A;  3IK7 A;  5D93 A;  5D9W A;  2H1G A;  3AY8 A;  2OE0 A;  2VL3 A;  4DSQ A;  2LRT A;  3WGX A;  2L5L A;  3LXZ A;  4Q5Q A;  3KEB A;  3FR6 A;  3FZ5 A;  1YF0 A;  2YWO A;  1R5A A;  4BWQ A;  4WF4 A;  1X0R A;  1VF4 A;  4OMV A;  1EP8 A;  1K3Y A;  4MAB A;  3Q19 A;  4MMM A;  3ZLP A;  1GLP A;  3PR8 A;  12GS A;  2LRN A;  1THO A;  3WGD A;  5G2Z A;  3MWH A;  2O8V B;  1M2D A;  2MMO A;  4LL4 B;  1A2M A;  3OR5 A;  3A3T A;  4J57 E;  2GS3 A;  3F0I A;  3R2Q A;  4PTS A;  3IXR A;  4NAX A;  3ZRE A;  2YPM A;  4KH7 A;  2VM1 A;  1K3L A;  2I1U A;  2VO4 A;  4TOP A;  5J9C A;  2K8S A;  4WXT A;  3KXO A;  4K7I A;  6GSU A;  4EDZ A;  4ISD A;  2X99 A;  2WGR A;  4H86 A;  10GS A;  1E6B A;  2L6C A;  4WKW A;  5C04 A;  1XPV A;  2O7K A;  4I2U A;  1A8Y A;  2DBC A;  5F06 A;  2E2M A;  2V32 A;  3FK8 A;  4I2T A;  1ZMA A;  3ED3 A;  1Y25 A;  2ALB A;  4NXI A;  5ECO B;  2ON5 A;  2MYG A;  2FUG 2;  4FH8 A;  5ELA A;  5HFK A;  5DBQ A;  2OE3 A;  1I9D A;  5IMC A;  4BVX A;  4ML6 A;  2LQO A;  3RHC A;  5DAK A;  1HQO A;  3VWX A;  1WP0 A;  3ZFB A;  1V57 A;  2TRC P;  2XHF A;  1TJD A;  1ZL9 A;  3Q74 A;  4MCU A;  4RI6 A;  1SEN A;  3HHV A;  2FWH A;  1ZCP A;  1Z5Y E;  4V2N A;  2AHE A;  4JE1 A;  2HYX A;  3FRC A;  1CQH A;  1FVJ A;  2WFC A;  1K0C A;  1OC3 A;  5CAX A;  1JZW A;  3F4R A;  4GF0 A;  5INY A;  4CHS A;  3QAW A;  3VPT A;  5HR1 A;  5DAL B;  4WBR D;  2NBS A;  3EU4 A;  1KBN A;  3O76 A;  3D4M A;  4GSS A;  4POB A;  2VCW A;  2CV4 A;  1A24 A;  3TRX A;  3RPP A;  4PQI A;  1F37 A;  1F3B A;  5GZZ B;  4KND A;  2PWJ A;  5CNW A;  5A5K A;  2HXK A;  1DUG A;  3EUR A;  2YWM A;  2RLI A;  1QFN A;  3UMA A;  2WCI A;  7GSS A;  4J2F A;  4LA1 A;  4OFT A;  4F0B A;  3GKM A;  4MZB A;  4DSR A;  4G2E A;  1B9Y C;  4ZL8 A;  4TW5 A;  3HJM A;  1EGR A;  1YQ1 A;  1TOF A;  2BJX A;  4ZB8 A;  1MDK A;  1X5E A;  4TN8 A;  1C72 A;  3VWV A;  5AGY A;  4HU9 A;  2LUS A;  1G7O A;  2CQ9 A;  1GWC A;  4IP6 A;  2VLT A;  1GSD A;  3FKF A;  2CA8 A;  4L8E A;  2KHP A;  3IAM 2;  4KCE A;  2HSH A;  1AW9 A;  4V1A g;  4MF7 A;  3GUS A;  3GN3 A;  5A4U A;  4MJC A;  2GSR A;  2XC2 A;  2CAQ A;  3HY2 A;  1XXU A;  5IMZ A;  1O73 A;  2X8H A;  5J9B A;  1JLV A;  5ENU A;  2LJA A;  2DJ2 A;  4TR3 A;  1OYJ A;  3GX8 A;  1EEM A;  3UAP A;  3NIV A;  4QQ7 A;  1BG5 A;  2WUL A;  1PL2 A;  3RDW A;  1GUH A;  2KP1 A;  5GSS A;  3EU3 A;  5LNK e;  4L0W A;  2N5F A;  1NHO A;  1B48 A;  3BJ5 A;  2MBS A;  5EY6 A;  2HZE A;  4HOJ A;  1AQW A;  1AIU A;  4EXJ A;  1UVZ A;  1EV9 A;  4TRX A;  1FB6 A;  4V2L A;  4USS A;  3GIX A;  3TJB A;  2HFD A;  3TOU A;  6GSS A;  4YAP A;  3CSJ A;  2FY6 A;  4MDC A;  1FW1 A;  1NHY A;  5ECM B;  1ERT A;  1TRV A;  4IGJ A;  2REM A;  2AUV A;  2XPE A;  5H5S A;  4QL7 A;  3EVI A;  2R3X A;  4PQ1 A;  4BPY A;  2LKU A;  2X8G A;  3FZA A;  3ZRD A;  3KTB A;  4AJ7 A;  3H8Q A;  4OCE A;  4MF6 A;  2VLV A;  1SK0 A;  4WEY A;  3S9F A;  1TRU A;  2XBQ A;  4HQZ A;  5CRD A;  2FWF A;  2F51 A;  5F05 A;  3TUE A;  5HR3 A;  3F3Q A;  1E2Y A;  3EE2 A;  4X0X A;  1U3I A;  4KW6 A;  3M9K A;  1TK0 B;  22GS A;  4GQC A;  2KOK A;  1R7H A;  4YQM A;  2H0H A;  3IDV A;  4BL7 B;  3GHA A;  4JZQ A;  2H66 A;  1OC8 A;  1X9M B;  3DXB A;  5HFI A;  5IMV A;  4GSN A;  4HJ2 A;  3UVH A;  1GLQ A;  3LWA A;  1M2B A;  3MSZ A;  2JZT A;  2YV9 A;  4TXO B;  5CRH A;  3QCP A;  4LLR A;  2IME A;  4G0K A;  3APS A;  3EIN A;  3GL5 A;  2NVL A;  5FHI A;  5D9X A;  3E3E A;  2C4J A;  3G7I A;  2IMD A;  1PA3 A;  3CBU A;  2HQT A;  4GRF A;  4TXV A;  4I97 A;  4RQX A;  2C80 A;  2B5E A;  1PQN A;  2A4V A;  2HSY A;  5CRG A;  2AB6 A;  3CTG A;  5DJM A;  16GS A;  4WBJ A;  1BYE A;  4EDY A;  1X9W B;  4L5L A;  1QQ2 A;  2H72 A;  3F3R A;  2GQM A;  1EZK A;  3GYK A;  5E4W A;  1H75 A;  1ERU A;  1SD8 A;  1B9X C;  2B6M A;  2IMK A;  6GSX A;  3NOF A;  1B4P A;  2E2G A;  3GKX A;  2D2Z A;  2ZNM A;  2BTO T;  4MA9 A;  2K9F A;  4E8H A;  2JZS A;  4IQ1 A;  1YZX A;  3KTL A;  3VPQ A;  1SK1 A;  4Q5N A;  4TVE A;  2QKE A;  2VL9 A;  1EV4 A;  2GZZ A;  4XRD A;  2VD0 A;  2B7K A;  2LTK A;  1IYH A;  5CRE A;  3LG6 A;  1FVK A;  3P90 A;  2G2Q A;  1DE1 A;  3QOU A;  4XS4 B;  3M9J A;  5J5N A;  2GLR A;  3ERF A;  1THX A;  1ABA A;  1FG4 A;  1TRW A;  3ME7 A;  4MJA A;  2FHE A;  4HS1 A;  2OJL A;  4FYU A;  3KMN A;  4N10 A;  2XBI A;  3G9B A;  3SBC A;  4RQR A;  3HVX A;  4TR4 A;  4MP4 A;  1XFL A;  5JCG A;  1FOV A;  3BOA A;  1XVW A;  2M46 A;  3W8S A;  1K0A A;  2YJH A;  2WB9 A;  2MMZ A;  3ZMK A;  3IV4 A;  4KDY A;  1SK2 A;  6GST A;  4J56 E;  3KJY A;  4OFM A;  3VLN A;  4JR6 A;  2H30 A;  3IBH A;  3LSZ A;  2MMN A;  3PGT A;  5KN2 A;  4G0I A;  2YNX A;  3QMX A;  5DCG A;  6GSW A;  4PQH A;  1GSQ A;  3DVX A;  3PIN A;  2O89 A;  1PSQ A;  2K6V A;  2QC7 A;  1X5C A;  4K1F A;  4ZB9 A;  1RW1 A;  4OCF A;  3FW2 A;  3WT2 A;  1BED A;  2M72 A;  5CYY A;  5JWQ B;  5H5Q A;  3N9J A;  2L4C A;  1TRS A;  3TB2 A;  1BQ7 A;  1YDK A;  5D96 A;  3DKS A;  3F6F A;  1EWX A;  5IPG A;  4IVF A;  4IN0 A;  3I69 A;  1MTC A;  3KH7 A;  2J9H A;  1T4Z A;  3C7M A;  2HZE B;  4PUA A;  2PVQ A;  4HU7 A;  2HRF A;  3W8J A;  3TGZ A;  2MZC A;  4RI7 A;  2RM5 A;  4DSS B;  1A0R P;  4EKZ A;  5AN1 A;  2CVB A;  2VD1 A;  4XHM A;  1TDI A;  4WF5 A;  1T8E B;  1O8W A;  3TOT A;  3NZN A;  5JWO B;  2GQL A;  3PPU A;  1OE8 A;  3CYN A;  4YQV A;  1OKD A;  3N5O A;  5KN0 A;  1N8J A;  18GS A;  1PRX A;  3L9V A;  3TKP A;  3K8N A;  3GX0 A;  2JSY A;  1PGT A;  1T1V A;  1K0B A;  1M7T A;  1M9B A;  5ELG A;  4KA0 A;  2L4Q A;  4GQF A;  1I5G A;  3F6D A;  4BL7 A;  3A5W A;  2GZP A;  4PUR A;  4PNF A;  3LGC A;  11GS A;  1PN9 A;  3D21 A;  2NTO A;  2EIQ A;  4AJ8 A;  1F3A A;  4AF2 A;  4K9Z A;  2P5Q A;  3HYP A;  2R5G A;  1QXH A;  2VOC A;  5B8A A;  2V2G A;  2CAI A;  2DJK A;  3IC4 A;  4EE0 A;  4IEL A;  4JR4 A;  1GTI A;  4IJI A;  2C0D A;  4TXO A;  3CXG A;  3ZVJ D;  3F4T A;  1TI1 A;  14GS A;  4K7N A;  3L4N A;  1YF1 A;  3MAK A;  2PN8 A;  1M99 A;  1TTZ A;  1ACV A;  2M80 A;  3UJ1 A;  3TRP A;  2OKA A;  5IM9 A;  2R4V A;  2C0F A;  2C3T A;  1T3B A;  4QL9 A;  1VF2 A;  1GSY A;  2JZR A;  3EYT A;  3D5J A;  4LMW A;  4MZC A;  2JSZ A;  1PX7 A;  2CX3 A;  2IWT A;  2YZH A;  1B4Q A;  1J08 A;  3QD9 A;  3M3M A;  2ZCT A;  5ECK B;  2L59 A;  2CX4 A;  1QMV A;  3APQ A;  3GH9 A;  4G0L A;  1WJK A;  3U6V A;  3DVW A;  3RBT A;  4KDX A;  4HUA A;  3GH6 A;  3PH9 A;  2FLS A;  3GTU B;  2JU5 A;  1X5D A;  3GKN A;  4HQS A;  4OO4 A;  1TP9 A;  1SKW B;  3KIJ A;  2R6K A;  5IPH A;  3IRA A;  3ZZX A;  1FAA A;  3UL3 A;  3U5R E;  1TKD B;  4YAV A;  5H5R A;  3F8U A;  2H1A A;  4TR0 A;  4XS4 A;  1M9A A;  1T7P B;  3IAS 2;  1ST9 A;  3DGQ A;  2L6D A;  1A23 A;  1BX9 A;  3LYP A;  3CRT A;  3GFK A;  2NPB A;  4OFN A;  3R3E A;  2V6O A;  2LNS A;  2GTU A;  2WS2 A;  2FA4 A;  2L5O A;  2HRA A;  2H1B A;  1JFU A;  17GS A;  3KGK A;  4HJM A;  1GSS A;  1YKC A;  1GTU A;  5ECL B;  3IK9 A;  3CMI A;  1BAY A;  4IW9 A;  2LRC A;  6GSV A;  1TI3 A;  2LJR A;  2N5A A;  1AQV A;  1JHB A;  1K3O A;  4KAE A;  1K0N A;  3HA9 A;  3Q6O A;  5ECQ B;  5COH A;  5F8B A;  4PX1 A;  1U6T A;  5FT3 A;  4FYC A;  3RPN A;  2YWN A;  1GUL A;  1NW2 A;  3VI5 A;  1PX6 A;  3G7J A;  3SWL A;  2QGV A;  2RUF A;  4X1U A;  4PGT A;  2H6Y A;  4ECI A;  1QGV A;  3L0H A;  1SL0 B;  3I43 A;  3O6T A;  3O3T A;  5DQS A;  4NPB A;  2OBI A;  4E8E A;  4KCA A;  1MEK A;  3C8E A;  4GCI A;  3DRN A;  2RM6 A;  4X43 A;  1V58 A;  4POK A;  3E9J B;  2VUP A;  1XWA A;  1JZO A;  2ZUP A;  2VIM A;  4DSS A;  1K0D A;  1UA5 A;  3CSI A;  1DBY A;  1WPI A;  1PL1 A;  5AIS A;  2A2S A;  1OE7 A;  2JAD A;  1VF1 A;  3E0U A;  4CDO A;  1MD3 A;  4OD7 A;  4G19 A;  2H71 A;  1TU7 A;  1JZR A;  3FR9 A;  1R4W A;  2JAC A;  1F9M A;  8GSS A;  2CT6 A;  1SKR B;  3EMX A;  4AGS A;  5KEJ A;  2PMT A;  5C00 A;  1W4V A;  3HD5 A;  5D9V A;  1KEB A;  4ZBA A;  2RUE A;  2P5R A;  3EC3 A;  4N11 A;  2OAC A;  4OWY A;  3KM6 A;  2LV3 A;  2GZY A;  4DVC A;  1B8X A;  3GNJ A;  2EIR A;  2HRN A;  1SL2 B;  1HD2 A;  3W6G A;  3GMF A;  4KUN A;  3UIW A;  1OC9 B;  4AJ6 A;  1Z6M A;  5ECP B;  4XRA A;  5ABR A;  2EC4 A;  4XTS A;  2YP6 A;  4NV5 A;  2H6X A;  1GL8 A;  5DJL A;  1JLW A;  2EIO A;  3P7X A;  1XW6 A;  2H0I A;  4ACS A;  5JCU A;  19GS A;  2R37 A;  2C1Y A;  3LYK A;  1U3A A;  2IIY A;  1XWG A;  2IN3 A;  2GVP A;  4IJ3 A;  2LS5 A;  2E7P A;  1YJ6 A;  2YWI A;  3ZVJ A;  3LQ7 A;  1Z6N A;  1DE2 A;  2VCT A;  4IKH A;  3TKS C;  1GTA A;  3I6A A;  4D73 B;  3LOR A;  3GTU A;  4KGI A;  4K6X A;  4L0U A;  4MPG A;  4MF5 A;  2GT6 A;  1EP7 A;  4POL A;  2DJJ A;  5F0G A;  2E0Q A;  2H76 A;  2PVO C;  3HCZ A;  2XPD A;  1A2L A;  2OA7 A;  1NSW A;  1GUM A;  2HLS A;  1O6J A;  4K2D A;  4JBB A;  3KP9 A;  2HE3 A; 
#chains in the Genus database with same CATH topology
 3TRQ A;  5L71 A;  3HKR A;  5B8B A;  3BBY A;  4BVY B;  2GQK A;  2DJ1 A;  2PER A;  1N2A A;  5DDL A;  4JU5 A;  4BWS A;  4K5S A;  1JZD A;  4EO3 A;  1EEJ A;  1A0F A;  1PMT A;  5JWR B;  3D22 A;  3ZFL A;  3GUR A;  1ERW A;  1SYX A;  4I8B A;  3LW9 A;  2G0F A;  1YY7 A;  3DEX A;  2OBK A;  3H1N A;  5E59 A;  1Q4J A;  5G5F A;  2F9S A;  2FCH A;  5J41 A;  3IHQ A;  5EPF A;  2IMI A;  3VK9 A;  1RK4 A;  2WW1 A;  1ZYQ B;  1FHE A;  4WR5 A;  2BMX A;  3VUR A;  4LMV A;  2H75 A;  4OO5 A;  1F6M C;  3DIE A;  4EL1 A;  3FHK A;  4ECJ A;  4MLY A;  3DD3 A;  2H6Z A;  2VKZ G;  3TJG A;  3C1R A;  3UBL A;  1SKS B;  1S3A A;  1SVO A;  6GSY A;  2O36 A;  2H70 A;  3KCM A;  4TR1 A;  5BRT A;  5ECN B;  3MYD A;  2I3Y A;  1SJ6 A;  3TDG A;  1GH2 A;  2O5V A;  1EOG A;  4ECC A;  3I9V 2;  2H01 A;  2B5X A;  2B5Y A;  4F2I A;  5J4U A;  2ES7 A;  4ECB A;  1Z7P A;  2YJ7 A;  3HVV A;  2R0C A;  5FWG A;  2MMA A;  3HJP A;  1HNC A;  4PXO A;  1UN2 A;  2KLX A;  3J7Y k;  5IOX A;  4X4J A;  2GST A;  3GA4 A;  2L57 A;  4KE3 A;  1R5P A;  3GST A;  2PUK C;  2YAN A;  4Z2U A;  1PN0 A;  4MH2 A;  2O3E A;  5D73 A;  3GV1 A;  2YCD A;  1DSB A;  3HXS A;  3F9U A;  3M0F A;  4XS6 A;  2WRT A;  3D0Z A;  5J3R A;  2HSN B;  2K18 A;  3F4S A;  1XWC A;  5DQY A;  2HT9 A;  5IIZ A;  3WD6 A;  1WIK A;  2VL2 A;  2FA8 A;  2VLU A;  1TU8 A;  1WWJ A;  1NM3 A;  1G0T A;  3LFL A;  5JCW A;  2VL2 C;  2V6K A;  4PI0 C;  3ERW A;  2DC5 A;  2AAW A;  2K8V A;  1HYU A;  2KP2 A;  1F2E A;  2H19 A;  2I81 A;  2IPA A;  4FO5 A;  4GLT A;  4KSM A;  4HSC X;  3D6I A;  2OAD A;  3CHX C;  4ZL7 A;  2GGT A;  4W66 A;  2FWE A;  2H8L A;  3LXT A;  2AV4 A;  5CO3 A;  3FZ9 A;  3A5I A;  1G7E A;  2WVX A;  4YQU A;  2IMF A;  1USB A;  4O32 A;  1AUC A;  2H74 A;  1PKZ A;  1WE0 A;  1AC1 A;  5A5H A;  1OC9 A;  1Q98 A;  3IR4 A;  1R26 A;  2VCQ A;  3A2W A;  1U87 A;  4L5O A;  2F8A A;  4FQU A;  2FGX A;  3BCK A;  1GSE A;  2C3Q A;  1GTB A;  2AJQ B;  4YKF A;  4BA7 A;  5LCZ A;  4IBP A;  2A4H A;  4PNG A;  1S4B P;  3BD2 A;  1V98 A;  2WDU A;  3F63 A;  1OKT A;  1V2A A;  3QR6 A;  5HR0 A;  1Y6E A;  3RGB C;  3C71 A;  4I5Q A;  1XWK A;  5HQP A;  4Q5F A;  2DKI A;  5ECR B;  1H4O A;  3QDN A;  2IFQ B;  5AIX A;  1CQG A;  1XOA A;  1SYR A;  1XW9 A;  1S3C A;  2VCV A;  4D73 A;  3IPZ A;  2CVK A;  4K7O A;  1FB0 A;  2I4A A;  2LQQ A;  2GDR A;  3L78 A;  2PBJ A;  4G10 A;  3TJK A;  3L9U A;  4GDF A;  4RUV A;  1O85 A;  3HVS A;  1I1I P;  4PUF C;  5BMU A;  3WGE A;  4F82 A;  1WOU A;  4O92 A;  1TXX A;  5ECS A;  3A2V A;  4BVY A;  3QFB C;  2YV7 A;  2JL4 A;  3UOM A;  4CW9 A;  20GS A;  4GXZ A;  2HZF A;  4EVM A;  4MZW A;  5G30 A;  5AIV A;  3KP8 A;  1V9W A;  5KN3 A;  3VI7 A;  1VRS D;  1GRX A;  2IJY A;  2FNO A;  2O87 A;  4MK3 A;  3CTF A;  4HEA 2;  1SJI A;  2KUC A;  4FIW A;  4MJB A;  1EOH A;  1QUW A;  1W89 A;  4GST A;  5GAN D;  2WJU A;  3US3 A;  1GNE A;  4Q5R A;  3QFA C;  2CZ2 A;  3QPM A;  4IQA A;  5J47 A;  3TKR A;  2DJ3 A;  1AXD A;  5KOX A;  4ZIL A;  2O85 A;  5GST A;  1XWB A;  4LL1 B;  3RHB A;  3ISO A;  1S3D A;  13GS A;  4N0Z A;  4TKY A;  3BCI A;  4ULX A;  2GT5 A;  1EGO A;  4G9H A;  5KN1 A;  3MDK A;  2LST A;  1SD9 A;  2YZU A;  1MDI A;  5DCH A;  4TR1 B;  4IP1 A;  1M0U A;  1URM A;  1HNA A;  2LNT A;  3CQF A;  3L9S A;  4Z2T A;  1SL1 B;  5IO2 A;  5G31 A;  5IOW A;  5ID2 B;  4HDE A;  2DML A;  3WYW A;  1G6Y A;  3ZYW A;  1Z3E A;  3GSS A;  5J40 A;  4NMU A;  1ML6 A;  2HRK B;  1GP1 A;  1XCC A;  2HSN A;  4ZB7 A;  4ZBD A;  2CZ3 A;  3TU3 B;  1XW5 A;  3APO A;  2DIY A;  4ZIJ A;  2I9H A;  3C1S A;  2HSM B;  1MD4 A;  1BJX A;  1T4Y A;  3FR3 A;  1TW9 A;  2J23 A;  1ZYN A;  3TKQ A;  2LJK A;  3M1G A;  1PD2 1;  1K0M A;  3HZ8 A;  5A4W A;  1O81 A;  1YKA A;  4O5Q A;  4KB3 A;  2NDO A;  2TIR A;  2H73 A;  4ILF A;  1OAZ A;  5IQY A;  3GRX A;  2DLX A;  1VGL A;  3KD0 A;  5HR2 A;  1XIY A;  1AAZ A;  1SJZ A;  1K0O A;  4N0V A;  3FEU A;  4ZB6 A;  3DWV A;  1RQM A;  2DJ0 A;  2FD3 A;  4EF0 A;  3ERG A;  3IA1 A;  4MJE A;  1V40 A;  1TK5 B;  2MBT A;  2YOI A;  5G5E A;  1ZZY A;  4HZ4 A;  2VCX A;  1LBK A;  4O7H A;  3LEF A;  2LEG A;  2C8U A;  5A1N B;  1MDJ A;  5GAP D;  1J0F A;  3VWU A;  3TJJ A;  1XZO A;  3Q18 A;  1SU9 A;  4AKX B;  2VAF A;  3GL3 A;  2H1D A;  4MPF A;  3TCO A;  2UV8 G;  4WR4 A;  2C0G A;  1WMJ A;  2TRX A;  2F8F A;  2GSQ A;  5B7C A;  2R0P A;  5D8I A;  1UC7 A;  3D4T A;  3CWG A;  3WT1 A;  3VFI A;  1U88 A;  4NV2 A;  3MNG A;  1J9B A;  3ZIT A;  1ON4 A;  1A8L A;  4ID0 A;  1YEW C;  3ME8 A;  2CVD A;  2IFQ A;  3FYG A;  2FWG A;  3IOS A;  2VM2 A;  4KSO A;  3H93 A;  5ECI B;  3IE3 A;  4V2M A;  2B1L A;  4ZXG A;  1LU4 A;  3TKS E;  1Z7R A;  1KTE A;  1X9S B;  4PI2 C;  1TK8 B;  1O8X A;  1LJR A;  1OVN A;  5IMA A;  5IMD A;  3UVT A;  5HFG A;  1T00 A;  1PKW A;  4V1A p;  3TKS A;  4IS0 A;  4NHW A;  4POM A;  5D9T A;  3ZTL A;  5F07 A;  3G7Y A;  2P0G A;  4KX4 A;  5CP1 A;  5IMF A;  2PGT A;  3HDC A;  2QSI A;  3CSH A;  5J4Y A;  4O5U A;  5EVO A;  2UZ8 A;  4YH2 A;  4BVX B;  3C73 A;  3KZQ A;  3ZIV A;  5DAK B;  3FY7 A;  1XOB A;  1YEX A;  4EUY A;  2DSA A;  3QAG A;  4XS1 A;  5CRW A;  3DML A;  2B7J A;  2QA1 A;  2X8C A;  1Z9H A;  1O7U A;  2DMM A;  3EMP A;  5ECH B;  4IHU A;  5B6M A;  4K0G A;  1Y1U A;  5DAL A;  1KNG A;  4EIP A;  5A4V A;  2H0G A;  3HZ4 A;  3UEM A;  1XBS A;  2F3M A;  4XIH A;  2V1M A;  3UAR A;  2N5B A;  3RAZ A;  3H4K A;  2RII A;  4K0N A;  4DEJ A;  2V41 A;  3LJR A;  3QAV A;  5LD0 A;  5IO0 A;  2B1K A;  3P2A A;  1VF3 A;  1TXU A;  1HNB A;  1IYI A;  2P31 A;  1GSF A;  4NHZ A;  2WZ9 A;  4MH3 A;  1WRY A;  2EFH A;  2IL3 A;  3H79 A;  3DYR A;  5DVB A;  3KH9 A;  3EWL A;  4F03 A;  2Z9S A;  5EL8 A;  2PPT A;  2PU9 C;  3A2X A;  2C0E A;  4N30 A;  4I6X A;  4FYB A;  3GKK A;  2B3S A;  1GUK A;  1ILO A;  2GSS A;  4F9Z A;  1M2A A;  1ERV A;  4ZL9 A;  2ON7 A;  3M8N A;  3V1W A;  4HI7 A;  5G1K A;  4JED A;  3JCM L;  2VCZ A;  1ZOF A;  3CRU A;  2OE1 A;  3ZL5 A;  5ID2 A;  3TJF A;  4HZ2 A;  3P8W A;  4KDU A;  2X64 A;  2HNL A;  2C3N A;  4GTU A;  1S3R A;  2R2J A;  4ML1 A;  4P3Y B;  2HRK A;  1BG1 A;  4O5R A;  3HJO A;  3J7Y b;  1GSU A;  3IC8 A;  5B6N A;  1ZYE A;  4JRR A;  1A2J A;  4KF9 A;  1YEP A;  4EC0 A;  5G1L A;  2HI7 A;  4Z7X A;  1XVQ A;  2HSM A;  2AYT A;  4XCS A;  3FZ4 A;  4GWR A;  2WVZ A;  3UBK A;  4ZBB A;  1FO5 A;  1QK8 A;  2A2R A;  9GSS A;  3ZML A;  3VWW A;  1ZGN A;  4NWY A;  4K8M A;  4F0C A;  1GNW A;  3KMO A;  1G6W A;  2YN1 A;  1AQX A;  3ZIJ A;  4WET A;  2DIZ A;  3IK7 A;  5D93 A;  5D9W A;  2H1G A;  3AY8 A;  2OE0 A;  2VL3 A;  4DSQ A;  2LRT A;  3WGX A;  2L5L A;  3LXZ A;  4Q5Q A;  3KEB A;  3FR6 A;  3FZ5 A;  1YF0 A;  2YWO A;  1R5A A;  4BWQ A;  4WF4 A;  1X0R A;  1VF4 A;  4OMV A;  1EP8 A;  1K3Y A;  5A1N A;  4MAB A;  3Q19 A;  4MMM A;  3ZLP A;  1GLP A;  3PR8 A;  12GS A;  2LRN A;  1THO A;  3WGD A;  5G2Z A;  3MWH A;  2O8V B;  1M2D A;  2MMO A;  4LL4 B;  1A2M A;  3OR5 A;  3A3T A;  4J57 E;  2GS3 A;  3F0I A;  3R2Q A;  4PTS A;  3IXR A;  4NAX A;  3ZRE A;  2YPM A;  4KH7 A;  2VM1 A;  1K3L A;  2I1U A;  2VO4 A;  4TOP A;  5J9C A;  2K8S A;  4WXT A;  1BF5 A;  3KXO A;  4K7I A;  6GSU A;  4EDZ A;  4ISD A;  2X99 A;  2WGR A;  4H86 A;  4K2X A;  4BIK A;  10GS A;  1E6B A;  2L6C A;  4WKW A;  5C04 A;  1XPV A;  2O7K A;  4I2U A;  1A8Y A;  2DBC A;  5F06 A;  2E2M A;  2V32 A;  3FK8 A;  4I2T A;  1ZMA A;  3ED3 A;  1Y25 A;  2ALB A;  4NXI A;  5ECO B;  2MYG A;  2ON5 A;  2FUG 2;  2A2P A;  4FH8 A;  2EFE A;  5ELA A;  5HFK A;  5DBQ A;  2OE3 A;  1I9D A;  5IMC A;  4BVX A;  4ML6 A;  2LQO A;  3RHC A;  5DAK A;  1HQO A;  3VWX A;  1WP0 A;  3ZFB A;  4N3Z A;  4YKG A;  1V57 A;  2TRC P;  2XHF A;  1TJD A;  1ZL9 A;  3Q74 A;  4MCU A;  4RI6 A;  1SEN A;  3HHV A;  2FWH A;  1ZCP A;  1Z5Y E;  4V2N A;  2AHE A;  4JE1 A;  2HYX A;  3FRC A;  1CQH A;  1FVJ A;  2WFC A;  1K0C A;  1OC3 A;  5CAX A;  1JZW A;  3F4R A;  4GF0 A;  5INY A;  4CHS A;  3QAW A;  3VPT A;  5HR1 A;  5DAL B;  4WBR D;  2NBS A;  3EU4 A;  1KBN A;  3O76 A;  3D4M A;  4GSS A;  4POB A;  2VCW A;  2CV4 A;  1A24 A;  3TRX A;  3RPP A;  4PQI A;  1F37 A;  1F3B A;  5GZZ B;  4KND A;  2PWJ A;  5CNW A;  5A5K A;  2HXK A;  1DUG A;  3EUR A;  2YWM A;  2RLI A;  1ZYP A;  1PFO A;  1QFN A;  3UMA A;  2WCI A;  7GSS A;  4J2F A;  4LA1 A;  4CY6 A;  2WW3 A;  4OFT A;  4F0B A;  4PHZ C;  3GKM A;  4MZB A;  4DSR A;  4G2E A;  1B9Y C;  4ZL8 A;  4TW5 A;  3HJM A;  1EGR A;  1YQ1 A;  1TOF A;  2BJX A;  4ZB8 A;  1MDK A;  1X5E A;  4TN8 A;  3HVN A;  1C72 A;  3VWV A;  5AGY A;  4HU9 A;  2LUS A;  1G7O A;  2CQ9 A;  1GWC A;  4IP6 A;  2VLT A;  1GSD A;  3FKF A;  2CA8 A;  4L8E A;  2KHP A;  3IAM 2;  4KCE A;  2HSH A;  1AW9 A;  4V1A g;  4MF7 A;  3GUS A;  3GN3 A;  5A4U A;  4MJC A;  2GSR A;  4EIQ A;  2XC2 A;  2CAQ A;  3HY2 A;  1XXU A;  5IMZ A;  1O73 A;  2X8H A;  5J9B A;  1JLV A;  5ENU A;  2LJA A;  2DJ2 A;  4TR3 A;  1OYJ A;  3GX8 A;  4CY8 A;  1EEM A;  3UAP A;  3NIV A;  4QQ7 A;  1BG5 A;  2WUL A;  1PL2 A;  3RDW A;  1GUH A;  2KP1 A;  5GSS A;  3EU3 A;  5LNK e;  4L0W A;  2N5F A;  1NHO A;  1B48 A;  3BJ5 A;  2MBS A;  5EY6 A;  2HZE A;  4HOJ A;  1AQW A;  1AIU A;  4EXJ A;  1UVZ A;  3RFR C;  1EV9 A;  4TRX A;  1FB6 A;  4V2L A;  4USS A;  3GIX A;  3TJB A;  2HFD A;  3TOU A;  6GSS A;  4YAP A;  3CSJ A;  2FY6 A;  4MDC A;  1FW1 A;  1NHY A;  5ECM B;  1ERT A;  1TRV A;  4IGJ A;  2REM A;  2AUV A;  2XPE A;  5H5S A;  4QL7 A;  3EVI A;  2R3X A;  1XG8 A;  4PQ1 A;  4BPY A;  2LKU A;  2X8G A;  3FZA A;  3ZRD A;  3KTB A;  4AJ7 A;  3H8Q A;  4OCE A;  4MF6 A;  2VLV A;  1SK0 A;  4WEY A;  3S9F A;  1TRU A;  2XBQ A;  4HQZ A;  5CRD A;  2FWF A;  2F51 A;  5F05 A;  4AKH A;  3TUE A;  5HR3 A;  3F3Q A;  1E2Y A;  3EE2 A;  4X0X A;  1U3I A;  4KW6 A;  2H1L A;  3M9K A;  1TK0 B;  22GS A;  4GQC A;  2KOK A;  1R7H A;  2DKH A;  4YQM A;  2H0H A;  3IDV A;  4BL7 B;  3GHA A;  4JZQ A;  2H66 A;  5A34 B;  1OC8 A;  1X9M B;  3DXB A;  5HFI A;  5IMV A;  4GSN A;  4E68 A;  4HJ2 A;  3UVH A;  1GLQ A;  1N25 A;  3LWA A;  1M2B A;  3MSZ A;  2JZT A;  2YV9 A;  4TXO B;  5CRH A;  2EFD A;  3QCP A;  4LLR A;  2IME A;  4G0K A;  3APS A;  3EIN A;  3GL5 A;  2NVL A;  5FHI A;  5D9X A;  3E3E A;  2C4J A;  3G7I A;  2IMD A;  1PA3 A;  3CBU A;  2HQT A;  4GRF A;  4TXV A;  4I97 A;  4RQX A;  2C80 A;  2B5E A;  1SVL A;  1PQN A;  2A4V A;  2HSY A;  5CRG A;  2AB6 A;  3CTG A;  5DJM A;  16GS A;  4WBJ A;  1BYE A;  4EDY A;  1X9W B;  2EFC A;  4L5L A;  1QQ2 A;  2H72 A;  3F3R A;  2GQM A;  1EZK A;  3GYK A;  5E4W A;  1H75 A;  1ERU A;  1SD8 A;  1B9X C;  2B6M A;  2IMK A;  6GSX A;  3NOF A;  1B4P A;  2E2G A;  3GKX A;  2D2Z A;  2ZNM A;  2BTO T;  4MA9 A;  2K9F A;  4E8H A;  2JZS A;  4IQ1 A;  1YZX A;  3KTL A;  3VPQ A;  1SK1 A;  4Q5N A;  4TVE A;  2QKE A;  2VL9 A;  1EV4 A;  2GZZ A;  4XRD A;  2VD0 A;  2WW2 A;  4AI6 A;  2B7K A;  2LTK A;  1IYH A;  5CRE A;  3LG6 A;  1FVK A;  3P90 A;  2G2Q A;  1DE1 A;  3QOU A;  4XS4 B;  3M9J A;  5J5N A;  2GLR A;  3ERF A;  1THX A;  1ABA A;  1FG4 A;  1TRW A;  3ME7 A;  4MJA A;  2FHE A;  4HS1 A;  2OJL A;  4FYU A;  3KMN A;  4N10 A;  2XBI A;  3G9B A;  3SBC A;  4RQR A;  3HVX A;  4TR4 A;  4MP4 A;  1XFL A;  4G01 A;  5JCG A;  1FOV A;  3BOA A;  1XVW A;  2M46 A;  3W8S A;  1K0A A;  2YJH A;  2WB9 A;  2MMZ A;  3ZMK A;  3IV4 A;  4KDY A;  1SK2 A;  6GST A;  4J56 E;  3KJY A;  4OFM A;  3VLN A;  3HMJ G;  4JR6 A;  2H30 A;  3IBH A;  3LSZ A;  2MMN A;  2X49 A;  3PGT A;  5KN2 A;  4G0I A;  2YNX A;  1M3J A;  3QMX A;  5DCG A;  6GSW A;  4PQH A;  1GSQ A;  3DVX A;  3PIN A;  2O89 A;  1PSQ A;  2K6V A;  2QC7 A;  1X5C A;  4K1F A;  4ZB9 A;  1RW1 A;  4OCF A;  3FW2 A;  3WT2 A;  1BED A;  2M72 A;  5CYY A;  5JWQ B;  5H5Q A;  3N9J A;  2L4C A;  1TRS A;  3TB2 A;  1BQ7 A;  1YDK A;  5D96 A;  3DKS A;  3F6F A;  1FOH A;  1EWX A;  5IPG A;  4IVF A;  4IN0 A;  3I69 A;  1MTC A;  3KH7 A;  2J9H A;  1T4Z A;  3C7M A;  2HZE B;  4PUA A;  2PVQ A;  4HU7 A;  2HRF A;  3W8J A;  3TGZ A;  2MZC A;  4RI7 A;  2RM5 A;  4DSS B;  1A0R P;  2WVY A;  4EKZ A;  5AN1 A;  2CVB A;  4K5R A;  2VD1 A;  4XHM A;  1TDI A;  4WF5 A;  1T8E B;  1O8W A;  3TOT A;  3NZN A;  5JWO B;  2GQL A;  3PPU A;  1OE8 A;  3CYN A;  4YQV A;  1OKD A;  3N5O A;  5KN0 A;  1N8J A;  18GS A;  4MNN A;  1PRX A;  3L9V A;  3TKP A;  3K8N A;  3GX0 A;  2JSY A;  1PGT A;  1T1V A;  1K0B A;  1M7T A;  1M9B A;  5ELG A;  4KA0 A;  2L4Q A;  4GQF A;  1I5G A;  3F6D A;  4FXY P;  4BL7 A;  3A5W A;  2GZP A;  4PUR A;  4PNF A;  5A34 A;  3LGC A;  11GS A;  1PN9 A;  3D21 A;  3EPT A;  2NTO A;  2EIQ A;  1F3A A;  4AF2 A;  4K9Z A;  2P5Q A;  4AJ8 A;  3HYP A;  2R5G A;  1QXH A;  2VOC A;  5B8A A;  2V2G A;  2CAI A;  2DJK A;  3IC4 A;  4EE0 A;  4IEL A;  4JR4 A;  1GTI A;  4IJI A;  2C0D A;  4TXO A;  3CXG A;  3ZVJ D;  3F4T A;  1TI1 A;  14GS A;  4K7N A;  3L4N A;  1YF1 A;  3MAK A;  2PN8 A;  2QA2 A;  1M99 A;  1TTZ A;  1ACV A;  2M80 A;  3UJ1 A;  3TRP A;  2OKA A;  5IM9 A;  2R4V A;  2C0F A;  2C3T A;  1T3B A;  4QL9 A;  1VF2 A;  1GSY A;  2JZR A;  3EYT A;  3D5J A;  4LMW A;  4MZC A;  2JSZ A;  1PX7 A;  2CX3 A;  2IWT A;  2YZH A;  1B4Q A;  2WZS A;  1J08 A;  3QD9 A;  3M3M A;  2R0G A;  2ZCT A;  5ECK B;  4AKI A;  2L59 A;  2CX4 A;  1QMV A;  3APQ A;  3GH9 A;  4G0L A;  1WJK A;  3U6V A;  3DVW A;  3RBT A;  4KDX A;  4HUA A;  3GH6 A;  3PH9 A;  2FLS A;  3GTU B;  2JU5 A;  1X5D A;  3GKN A;  4HQS A;  4OO4 A;  1TP9 A;  1SKW B;  3KIJ A;  2R6K A;  5IPH A;  3IRA A;  3ZZX A;  1FAA A;  3UL3 A;  3U5R E;  1TKD B;  4YAV A;  5H5R A;  3F8U A;  2H1A A;  4TR0 A;  4XS4 A;  1M9A A;  1T7P B;  3IAS 2;  1ST9 A;  3DGQ A;  2L6D A;  1A23 A;  4QMK A;  1BX9 A;  3LYP A;  3CRT A;  3GFK A;  2NPB A;  4OFN A;  3R3E A;  2V6O A;  2LNS A;  2GTU A;  4A5P A;  2WS2 A;  2FA4 A;  2L5O A;  2HRA A;  2H1B A;  1JFU A;  17GS A;  3KGK A;  4HJM A;  1GSS A;  1YKC A;  1GTU A;  5ECL B;  3IK9 A;  3CMI A;  1BAY A;  4IW9 A;  2LRC A;  4Z2R A;  6GSV A;  1TI3 A;  2LJR A;  2N5A A;  1AQV A;  5KOW A;  1JHB A;  1K3O A;  4KAE A;  1K0N A;  3HA9 A;  3Q6O A;  5ECQ B;  5COH A;  5F8B A;  4PX1 A;  1U6T A;  5FT3 A;  4FYC A;  3RPN A;  2YWN A;  1GUL A;  1NW2 A;  3VI5 A;  1PX6 A;  3G7J A;  3SWL A;  2QGV A;  2RUF A;  4X1U A;  4PGT A;  2H6Y A;  4ECI A;  1QGV A;  3L0H A;  1SL0 B;  3I43 A;  3O6T A;  3O3T A;  5DQS A;  4NPB A;  2OBI A;  4E8E A;  4KCA A;  1MEK A;  3C8E A;  4GCI A;  1SVM A;  3DRN A;  2RM6 A;  4X43 A;  1V58 A;  4POK A;  1YVL A;  3E9J B;  2VUP A;  1XWA A;  2OT3 A;  1JZO A;  2WW0 A;  2ZUP A;  2VIM A;  4DSS A;  1K0D A;  1UA5 A;  3CSI A;  1DBY A;  1WPI A;  1PL1 A;  5AIS A;  2A2S A;  1OE7 A;  5J4V A;  2JAD A;  1VF1 A;  3E0U A;  4CDO A;  1MD3 A;  4OD7 A;  4G19 A;  2H71 A;  1TU7 A;  1JZR A;  3FR9 A;  1R4W A;  2JAC A;  3MIX A;  1F9M A;  8GSS A;  2CT6 A;  1SKR B;  3EMX A;  4AGS A;  5KEJ A;  2PMT A;  5C00 A;  1W4V A;  3HD5 A;  5D9V A;  1KEB A;  4ZBA A;  2RUE A;  2P5R A;  3EC3 A;  2WVX B;  4N11 A;  2OAC A;  4OWY A;  3KM6 A;  2LV3 A;  2GZY A;  4DVC A;  1B8X A;  3GNJ A;  2EIR A;  2HRN A;  1SL2 B;  3IHG A;  3FMW A;  1HD2 A;  3W6G A;  3GMF A;  4KUN A;  3UIW A;  5A5H B;  1OC9 B;  4AKG A;  4AJ6 A;  1Z6M A;  5ECP B;  1M3I A;  4XRA A;  4ICY A;  5ABR A;  2EC4 A;  4XTS A;  2X4A A;  2YP6 A;  4NV5 A;  2H6X A;  1GL8 A;  5DJL A;  1JLW A;  2EIO A;  3P7X A;  1XW6 A;  2H0I A;  4ACS A;  5JCU A;  19GS A;  2R37 A;  2C1Y A;  3LYK A;  1U3A A;  2IIY A;  1XWG A;  2IN3 A;  2GVP A;  4IJ3 A;  2LS5 A;  2E7P A;  1YJ6 A;  2YWI A;  3ZVJ A;  3LQ7 A;  1Z6N A;  1DE2 A;  2VCT A;  4IKH A;  3TKS C;  1GTA A;  3I6A A;  4D73 B;  3LOR A;  3GTU A;  4KGI A;  4K6X A;  4L0U A;  4MPG A;  4MF5 A;  2GT6 A;  1EP7 A;  4POL A;  2DJJ A;  5F0G A;  2E0Q A;  2H76 A;  2PVO C;  3HCZ A;  2XPD A;  1A2L A;  2OA7 A;  1NSW A;  1GUM A;  2HLS A;  1O6J A;  4K2D A;  5BMU B;  4JBB A;  3KP9 A;  2HE3 A; 
#chains in the Genus database with same CATH homology
 3TRQ A;  5L71 A;  3HKR A;  5B8B A;  3BBY A;  4BVY B;  2GQK A;  2DJ1 A;  2PER A;  1N2A A;  5DDL A;  4JU5 A;  4BWS A;  4K5S A;  1JZD A;  4EO3 A;  1EEJ A;  1A0F A;  1PMT A;  5JWR B;  3D22 A;  3ZFL A;  3GUR A;  1ERW A;  1SYX A;  4I8B A;  3LW9 A;  2G0F A;  1YY7 A;  3DEX A;  2OBK A;  3H1N A;  5E59 A;  1Q4J A;  5G5F A;  2F9S A;  2FCH A;  5J41 A;  3IHQ A;  5EPF A;  2IMI A;  3VK9 A;  1RK4 A;  1ZYQ B;  1FHE A;  4WR5 A;  2BMX A;  3VUR A;  4LMV A;  2H75 A;  4OO5 A;  1F6M C;  3DIE A;  4EL1 A;  3FHK A;  4ECJ A;  4MLY A;  3DD3 A;  2H6Z A;  2VKZ G;  3TJG A;  3C1R A;  3UBL A;  1SKS B;  1S3A A;  1SVO A;  6GSY A;  2H70 A;  3KCM A;  4TR1 A;  5BRT A;  5ECN B;  3MYD A;  2I3Y A;  1SJ6 A;  3TDG A;  1GH2 A;  2O5V A;  1EOG A;  4ECC A;  3I9V 2;  2H01 A;  2B5X A;  2B5Y A;  4F2I A;  5J4U A;  2ES7 A;  4ECB A;  1Z7P A;  2YJ7 A;  3HVV A;  2R0C A;  5FWG A;  2MMA A;  3HJP A;  1HNC A;  4PXO A;  1UN2 A;  2KLX A;  3J7Y k;  5IOX A;  4X4J A;  2GST A;  3GA4 A;  2L57 A;  4KE3 A;  1R5P A;  3GST A;  2PUK C;  2YAN A;  4Z2U A;  1PN0 A;  4MH2 A;  5D73 A;  3GV1 A;  2YCD A;  1DSB A;  3HXS A;  3F9U A;  3M0F A;  4XS6 A;  2WRT A;  3D0Z A;  5J3R A;  2HSN B;  2K18 A;  3F4S A;  1XWC A;  5DQY A;  2HT9 A;  5IIZ A;  3WD6 A;  1WIK A;  2VL2 A;  2FA8 A;  2VLU A;  1TU8 A;  1WWJ A;  1NM3 A;  1G0T A;  3LFL A;  5JCW A;  2VL2 C;  2V6K A;  3ERW A;  2DC5 A;  2AAW A;  2K8V A;  1HYU A;  2KP2 A;  1F2E A;  2H19 A;  2I81 A;  2IPA A;  4FO5 A;  4GLT A;  4KSM A;  3D6I A;  2OAD A;  4ZL7 A;  2GGT A;  4W66 A;  2FWE A;  2H8L A;  3LXT A;  2AV4 A;  5CO3 A;  3FZ9 A;  3A5I A;  1G7E A;  4YQU A;  2IMF A;  1USB A;  4O32 A;  1AUC A;  2H74 A;  1PKZ A;  1WE0 A;  1AC1 A;  5A5H A;  1OC9 A;  1Q98 A;  3IR4 A;  1R26 A;  2VCQ A;  3A2W A;  1U87 A;  4L5O A;  2F8A A;  4FQU A;  2FGX A;  3BCK A;  1GSE A;  2C3Q A;  1GTB A;  2AJQ B;  4YKF A;  4BA7 A;  5LCZ A;  4IBP A;  2A4H A;  4PNG A;  3BD2 A;  1V98 A;  2WDU A;  3F63 A;  1OKT A;  1V2A A;  3QR6 A;  5HR0 A;  1Y6E A;  3C71 A;  4I5Q A;  1XWK A;  5HQP A;  4Q5F A;  2DKI A;  5ECR B;  1H4O A;  3QDN A;  2IFQ B;  5AIX A;  1CQG A;  1XOA A;  1SYR A;  1XW9 A;  1S3C A;  2VCV A;  4D73 A;  3IPZ A;  2CVK A;  4K7O A;  1FB0 A;  2I4A A;  2LQQ A;  2GDR A;  3L78 A;  2PBJ A;  4G10 A;  3TJK A;  3L9U A;  4GDF A;  4RUV A;  1O85 A;  3HVS A;  4PUF C;  5BMU A;  3WGE A;  4F82 A;  1WOU A;  4O92 A;  1TXX A;  5ECS A;  3A2V A;  4BVY A;  3QFB C;  2YV7 A;  2JL4 A;  3UOM A;  4CW9 A;  20GS A;  4GXZ A;  2HZF A;  4EVM A;  4MZW A;  5G30 A;  5AIV A;  3KP8 A;  1V9W A;  5KN3 A;  3VI7 A;  1VRS D;  1GRX A;  2IJY A;  2FNO A;  2O87 A;  4MK3 A;  3CTF A;  4HEA 2;  1SJI A;  2KUC A;  4FIW A;  4MJB A;  1EOH A;  1QUW A;  1W89 A;  4GST A;  5GAN D;  2WJU A;  3US3 A;  1GNE A;  4Q5R A;  3QFA C;  2CZ2 A;  3QPM A;  4IQA A;  5J47 A;  3TKR A;  2DJ3 A;  1AXD A;  5KOX A;  4ZIL A;  2O85 A;  5GST A;  1XWB A;  4LL1 B;  3RHB A;  3ISO A;  1S3D A;  13GS A;  4N0Z A;  4TKY A;  3BCI A;  4ULX A;  2GT5 A;  1EGO A;  4G9H A;  5KN1 A;  3MDK A;  2LST A;  1SD9 A;  2YZU A;  1MDI A;  5DCH A;  4TR1 B;  4IP1 A;  1M0U A;  1URM A;  1HNA A;  2LNT A;  3L9S A;  4Z2T A;  1SL1 B;  5IO2 A;  5G31 A;  5IOW A;  5ID2 B;  4HDE A;  2DML A;  3WYW A;  1G6Y A;  3ZYW A;  1Z3E A;  3GSS A;  5J40 A;  4NMU A;  1ML6 A;  2HRK B;  1GP1 A;  1XCC A;  2HSN A;  4ZB7 A;  4ZBD A;  2CZ3 A;  3TU3 B;  1XW5 A;  3APO A;  2DIY A;  4ZIJ A;  2I9H A;  3C1S A;  2HSM B;  1MD4 A;  1BJX A;  1T4Y A;  3FR3 A;  1TW9 A;  2J23 A;  1ZYN A;  3TKQ A;  2LJK A;  3M1G A;  1PD2 1;  1K0M A;  3HZ8 A;  5A4W A;  1O81 A;  1YKA A;  4O5Q A;  4KB3 A;  2NDO A;  2TIR A;  2H73 A;  4ILF A;  1OAZ A;  5IQY A;  3GRX A;  2DLX A;  1VGL A;  3KD0 A;  5HR2 A;  1XIY A;  1AAZ A;  1SJZ A;  1K0O A;  4N0V A;  3FEU A;  4ZB6 A;  3DWV A;  1RQM A;  2DJ0 A;  2FD3 A;  4EF0 A;  3ERG A;  3IA1 A;  4MJE A;  1V40 A;  1TK5 B;  2MBT A;  2YOI A;  5G5E A;  1ZZY A;  4HZ4 A;  2VCX A;  1LBK A;  4O7H A;  3LEF A;  2LEG A;  2C8U A;  5A1N B;  1MDJ A;  5GAP D;  1J0F A;  3VWU A;  3TJJ A;  1XZO A;  3Q18 A;  1SU9 A;  4AKX B;  2VAF A;  3GL3 A;  2H1D A;  4MPF A;  3TCO A;  2UV8 G;  4WR4 A;  2C0G A;  1WMJ A;  2TRX A;  2F8F A;  2GSQ A;  5B7C A;  2R0P A;  5D8I A;  1UC7 A;  3D4T A;  3CWG A;  3WT1 A;  3VFI A;  1U88 A;  4NV2 A;  3MNG A;  1J9B A;  3ZIT A;  1ON4 A;  1A8L A;  4ID0 A;  3ME8 A;  2CVD A;  2IFQ A;  3FYG A;  2FWG A;  3IOS A;  2VM2 A;  4KSO A;  3H93 A;  5ECI B;  3IE3 A;  4V2M A;  2B1L A;  4ZXG A;  1LU4 A;  3TKS E;  1Z7R A;  1KTE A;  1X9S B;  1TK8 B;  1O8X A;  1LJR A;  1OVN A;  5IMA A;  5IMD A;  3UVT A;  5HFG A;  1T00 A;  1PKW A;  4V1A p;  3TKS A;  4IS0 A;  4NHW A;  4POM A;  5D9T A;  3ZTL A;  5F07 A;  3G7Y A;  2P0G A;  4KX4 A;  5CP1 A;  5IMF A;  2PGT A;  3HDC A;  2QSI A;  3CSH A;  5J4Y A;  4O5U A;  5EVO A;  2UZ8 A;  4YH2 A;  4BVX B;  3C73 A;  3KZQ A;  3ZIV A;  5DAK B;  3FY7 A;  1XOB A;  1YEX A;  4EUY A;  2DSA A;  3QAG A;  4XS1 A;  5CRW A;  3DML A;  2B7J A;  2QA1 A;  2X8C A;  1Z9H A;  1O7U A;  2DMM A;  3EMP A;  5ECH B;  4IHU A;  5B6M A;  4K0G A;  1Y1U A;  5DAL A;  1KNG A;  4EIP A;  5A4V A;  2H0G A;  3HZ4 A;  3UEM A;  1XBS A;  2F3M A;  4XIH A;  2V1M A;  3UAR A;  2N5B A;  3RAZ A;  3H4K A;  2RII A;  4K0N A;  4DEJ A;  2V41 A;  3LJR A;  3QAV A;  5LD0 A;  5IO0 A;  2B1K A;  3P2A A;  1VF3 A;  1TXU A;  1HNB A;  1IYI A;  2P31 A;  1GSF A;  4NHZ A;  2WZ9 A;  4MH3 A;  1WRY A;  2EFH A;  2IL3 A;  3H79 A;  3DYR A;  5DVB A;  3KH9 A;  3EWL A;  4F03 A;  2Z9S A;  5EL8 A;  2PPT A;  2PU9 C;  3A2X A;  2C0E A;  4N30 A;  4I6X A;  4FYB A;  3GKK A;  2B3S A;  1GUK A;  1ILO A;  2GSS A;  4F9Z A;  1M2A A;  1ERV A;  4ZL9 A;  2ON7 A;  3M8N A;  3V1W A;  4HI7 A;  5G1K A;  4JED A;  3JCM L;  2VCZ A;  1ZOF A;  3CRU A;  2OE1 A;  3ZL5 A;  5ID2 A;  3TJF A;  4HZ2 A;  3P8W A;  4KDU A;  2X64 A;  2HNL A;  2C3N A;  4GTU A;  2R2J A;  4ML1 A;  4P3Y B;  2HRK A;  1BG1 A;  4O5R A;  3HJO A;  3J7Y b;  1GSU A;  3IC8 A;  5B6N A;  1ZYE A;  4JRR A;  1A2J A;  4KF9 A;  1YEP A;  4EC0 A;  5G1L A;  2HI7 A;  4Z7X A;  1XVQ A;  2HSM A;  2AYT A;  4XCS A;  3FZ4 A;  4GWR A;  3UBK A;  4ZBB A;  1FO5 A;  1QK8 A;  2A2R A;  9GSS A;  3ZML A;  3VWW A;  1ZGN A;  4NWY A;  4K8M A;  4F0C A;  1GNW A;  3KMO A;  1G6W A;  2YN1 A;  1AQX A;  3ZIJ A;  4WET A;  2DIZ A;  3IK7 A;  5D93 A;  5D9W A;  2H1G A;  3AY8 A;  2OE0 A;  2VL3 A;  4DSQ A;  2LRT A;  3WGX A;  2L5L A;  3LXZ A;  4Q5Q A;  3KEB A;  3FR6 A;  3FZ5 A;  1YF0 A;  2YWO A;  1R5A A;  4BWQ A;  4WF4 A;  1X0R A;  1VF4 A;  4OMV A;  1EP8 A;  1K3Y A;  5A1N A;  4MAB A;  3Q19 A;  4MMM A;  3ZLP A;  1GLP A;  3PR8 A;  12GS A;  2LRN A;  1THO A;  3WGD A;  5G2Z A;  3MWH A;  2O8V B;  1M2D A;  2MMO A;  4LL4 B;  1A2M A;  3OR5 A;  3A3T A;  4J57 E;  2GS3 A;  3F0I A;  3R2Q A;  4PTS A;  3IXR A;  4NAX A;  3ZRE A;  2YPM A;  4KH7 A;  2VM1 A;  1K3L A;  2I1U A;  2VO4 A;  4TOP A;  5J9C A;  2K8S A;  4WXT A;  1BF5 A;  3KXO A;  4K7I A;  6GSU A;  4EDZ A;  4ISD A;  2X99 A;  2WGR A;  4H86 A;  4K2X A;  10GS A;  1E6B A;  2L6C A;  4WKW A;  5C04 A;  1XPV A;  2O7K A;  4I2U A;  1A8Y A;  2DBC A;  5F06 A;  2E2M A;  2V32 A;  3FK8 A;  4I2T A;  1ZMA A;  3ED3 A;  1Y25 A;  2ALB A;  4NXI A;  5ECO B;  2MYG A;  2ON5 A;  2FUG 2;  2A2P A;  4FH8 A;  2EFE A;  5ELA A;  5HFK A;  5DBQ A;  2OE3 A;  1I9D A;  5IMC A;  4BVX A;  4ML6 A;  2LQO A;  3RHC A;  5DAK A;  1HQO A;  3VWX A;  1WP0 A;  3ZFB A;  4N3Z A;  4YKG A;  1V57 A;  2TRC P;  2XHF A;  1TJD A;  1ZL9 A;  3Q74 A;  4MCU A;  4RI6 A;  1SEN A;  3HHV A;  2FWH A;  1ZCP A;  1Z5Y E;  4V2N A;  2AHE A;  4JE1 A;  2HYX A;  3FRC A;  1CQH A;  1FVJ A;  2WFC A;  1K0C A;  1OC3 A;  5CAX A;  1JZW A;  3F4R A;  4GF0 A;  5INY A;  4CHS A;  3QAW A;  3VPT A;  5HR1 A;  5DAL B;  4WBR D;  2NBS A;  3EU4 A;  1KBN A;  3O76 A;  3D4M A;  4GSS A;  4POB A;  2VCW A;  2CV4 A;  1A24 A;  3TRX A;  3RPP A;  4PQI A;  1F37 A;  1F3B A;  5GZZ B;  4KND A;  2PWJ A;  5CNW A;  5A5K A;  2HXK A;  1DUG A;  3EUR A;  2YWM A;  2RLI A;  1ZYP A;  1QFN A;  3UMA A;  2WCI A;  7GSS A;  4J2F A;  4LA1 A;  4CY6 A;  4OFT A;  4F0B A;  3GKM A;  4MZB A;  4DSR A;  4G2E A;  1B9Y C;  4ZL8 A;  4TW5 A;  3HJM A;  1EGR A;  1YQ1 A;  1TOF A;  2BJX A;  4ZB8 A;  1MDK A;  1X5E A;  4TN8 A;  1C72 A;  3VWV A;  5AGY A;  4HU9 A;  2LUS A;  1G7O A;  2CQ9 A;  1GWC A;  4IP6 A;  2VLT A;  1GSD A;  3FKF A;  2CA8 A;  4L8E A;  2KHP A;  3IAM 2;  4KCE A;  2HSH A;  1AW9 A;  4V1A g;  4MF7 A;  3GUS A;  3GN3 A;  5A4U A;  4MJC A;  2GSR A;  4EIQ A;  2XC2 A;  2CAQ A;  3HY2 A;  1XXU A;  5IMZ A;  1O73 A;  2X8H A;  5J9B A;  1JLV A;  5ENU A;  2LJA A;  2DJ2 A;  4TR3 A;  1OYJ A;  3GX8 A;  4CY8 A;  1EEM A;  3UAP A;  3NIV A;  4QQ7 A;  1BG5 A;  2WUL A;  1PL2 A;  3RDW A;  1GUH A;  2KP1 A;  5GSS A;  3EU3 A;  5LNK e;  4L0W A;  2N5F A;  1NHO A;  1B48 A;  3BJ5 A;  2MBS A;  5EY6 A;  2HZE A;  4HOJ A;  1AQW A;  1AIU A;  4EXJ A;  1UVZ A;  1EV9 A;  4TRX A;  1FB6 A;  4V2L A;  4USS A;  3GIX A;  3TJB A;  2HFD A;  3TOU A;  6GSS A;  4YAP A;  3CSJ A;  2FY6 A;  4MDC A;  1FW1 A;  1NHY A;  5ECM B;  1ERT A;  1TRV A;  4IGJ A;  2REM A;  2AUV A;  2XPE A;  5H5S A;  4QL7 A;  3EVI A;  2R3X A;  4PQ1 A;  4BPY A;  2LKU A;  2X8G A;  3FZA A;  3ZRD A;  3KTB A;  4AJ7 A;  3H8Q A;  4OCE A;  4MF6 A;  2VLV A;  1SK0 A;  4WEY A;  3S9F A;  1TRU A;  2XBQ A;  4HQZ A;  5CRD A;  2FWF A;  2F51 A;  5F05 A;  4AKH A;  3TUE A;  5HR3 A;  3F3Q A;  1E2Y A;  3EE2 A;  4X0X A;  1U3I A;  4KW6 A;  2H1L A;  3M9K A;  1TK0 B;  22GS A;  4GQC A;  2KOK A;  1R7H A;  2DKH A;  4YQM A;  2H0H A;  3IDV A;  4BL7 B;  3GHA A;  4JZQ A;  2H66 A;  5A34 B;  1OC8 A;  1X9M B;  3DXB A;  5HFI A;  5IMV A;  4GSN A;  4E68 A;  4HJ2 A;  3UVH A;  1GLQ A;  1N25 A;  3LWA A;  1M2B A;  3MSZ A;  2JZT A;  2YV9 A;  4TXO B;  5CRH A;  2EFD A;  3QCP A;  4LLR A;  2IME A;  4G0K A;  3APS A;  3EIN A;  3GL5 A;  2NVL A;  5FHI A;  5D9X A;  3E3E A;  2C4J A;  3G7I A;  2IMD A;  1PA3 A;  3CBU A;  2HQT A;  4GRF A;  4TXV A;  4I97 A;  4RQX A;  2C80 A;  2B5E A;  1SVL A;  1PQN A;  2A4V A;  2HSY A;  5CRG A;  2AB6 A;  3CTG A;  5DJM A;  16GS A;  4WBJ A;  1BYE A;  4EDY A;  1X9W B;  2EFC A;  4L5L A;  1QQ2 A;  2H72 A;  3F3R A;  2GQM A;  1EZK A;  3GYK A;  5E4W A;  1H75 A;  1ERU A;  1SD8 A;  1B9X C;  2B6M A;  2IMK A;  6GSX A;  3NOF A;  1B4P A;  2E2G A;  3GKX A;  2D2Z A;  2ZNM A;  2BTO T;  4MA9 A;  2K9F A;  4E8H A;  2JZS A;  4IQ1 A;  1YZX A;  3KTL A;  3VPQ A;  1SK1 A;  4Q5N A;  4TVE A;  2QKE A;  2VL9 A;  1EV4 A;  2GZZ A;  4XRD A;  2VD0 A;  2B7K A;  4AI6 A;  2LTK A;  1IYH A;  5CRE A;  3LG6 A;  1FVK A;  3P90 A;  2G2Q A;  1DE1 A;  3QOU A;  4XS4 B;  3M9J A;  5J5N A;  2GLR A;  3ERF A;  1THX A;  1ABA A;  1FG4 A;  1TRW A;  3ME7 A;  4MJA A;  2FHE A;  4HS1 A;  2OJL A;  4FYU A;  3KMN A;  4N10 A;  2XBI A;  3G9B A;  3SBC A;  4RQR A;  3HVX A;  4TR4 A;  4MP4 A;  1XFL A;  4G01 A;  5JCG A;  1FOV A;  3BOA A;  1XVW A;  2M46 A;  3W8S A;  1K0A A;  2YJH A;  2WB9 A;  2MMZ A;  3ZMK A;  3IV4 A;  4KDY A;  1SK2 A;  6GST A;  4J56 E;  3KJY A;  4OFM A;  3VLN A;  3HMJ G;  4JR6 A;  2H30 A;  3IBH A;  3LSZ A;  2MMN A;  2X49 A;  3PGT A;  5KN2 A;  4G0I A;  2YNX A;  3QMX A;  5DCG A;  6GSW A;  4PQH A;  1GSQ A;  3DVX A;  3PIN A;  2O89 A;  1PSQ A;  2K6V A;  2QC7 A;  1X5C A;  4K1F A;  4ZB9 A;  1RW1 A;  4OCF A;  3FW2 A;  3WT2 A;  1BED A;  2M72 A;  5CYY A;  5JWQ B;  5H5Q A;  3N9J A;  2L4C A;  1TRS A;  3TB2 A;  1BQ7 A;  1YDK A;  5D96 A;  3DKS A;  3F6F A;  1FOH A;  1EWX A;  5IPG A;  4IVF A;  4IN0 A;  3I69 A;  1MTC A;  3KH7 A;  2J9H A;  1T4Z A;  3C7M A;  2HZE B;  4PUA A;  2PVQ A;  4HU7 A;  2HRF A;  3W8J A;  3TGZ A;  2MZC A;  4RI7 A;  2RM5 A;  4DSS B;  1A0R P;  4EKZ A;  5AN1 A;  2CVB A;  4K5R A;  2VD1 A;  4XHM A;  1TDI A;  4WF5 A;  1T8E B;  1O8W A;  3TOT A;  3NZN A;  5JWO B;  2GQL A;  3PPU A;  1OE8 A;  3CYN A;  4YQV A;  1OKD A;  3N5O A;  5KN0 A;  1N8J A;  18GS A;  4MNN A;  1PRX A;  3L9V A;  3TKP A;  3K8N A;  3GX0 A;  2JSY A;  1PGT A;  1T1V A;  1K0B A;  1M7T A;  1M9B A;  5ELG A;  4KA0 A;  2L4Q A;  4GQF A;  1I5G A;  3F6D A;  4BL7 A;  3A5W A;  2GZP A;  4PUR A;  4PNF A;  5A34 A;  3LGC A;  11GS A;  1PN9 A;  3D21 A;  3EPT A;  2NTO A;  2EIQ A;  1F3A A;  4AF2 A;  4K9Z A;  2P5Q A;  4AJ8 A;  3HYP A;  2R5G A;  1QXH A;  2VOC A;  5B8A A;  2V2G A;  2CAI A;  2DJK A;  3IC4 A;  4EE0 A;  4IEL A;  4JR4 A;  1GTI A;  4IJI A;  2C0D A;  4TXO A;  3CXG A;  3ZVJ D;  3F4T A;  1TI1 A;  14GS A;  4K7N A;  3L4N A;  1YF1 A;  3MAK A;  2PN8 A;  2QA2 A;  1M99 A;  1TTZ A;  1ACV A;  2M80 A;  3UJ1 A;  3TRP A;  2OKA A;  5IM9 A;  2R4V A;  2C0F A;  2C3T A;  1T3B A;  4QL9 A;  1VF2 A;  1GSY A;  2JZR A;  3EYT A;  3D5J A;  4LMW A;  4MZC A;  2JSZ A;  1PX7 A;  2CX3 A;  2IWT A;  2YZH A;  1B4Q A;  1J08 A;  3QD9 A;  3M3M A;  2R0G A;  2ZCT A;  5ECK B;  4AKI A;  2L59 A;  2CX4 A;  1QMV A;  3APQ A;  3GH9 A;  4G0L A;  1WJK A;  3U6V A;  3DVW A;  3RBT A;  4KDX A;  4HUA A;  3GH6 A;  3PH9 A;  2FLS A;  3GTU B;  2JU5 A;  1X5D A;  3GKN A;  4HQS A;  4OO4 A;  1TP9 A;  1SKW B;  3KIJ A;  2R6K A;  5IPH A;  3IRA A;  3ZZX A;  1FAA A;  3UL3 A;  3U5R E;  1TKD B;  4YAV A;  5H5R A;  3F8U A;  2H1A A;  4TR0 A;  4XS4 A;  1M9A A;  1T7P B;  3IAS 2;  1ST9 A;  3DGQ A;  2L6D A;  1A23 A;  4QMK A;  1BX9 A;  3LYP A;  3CRT A;  3GFK A;  2NPB A;  4OFN A;  3R3E A;  2V6O A;  2LNS A;  2GTU A;  4A5P A;  2WS2 A;  2FA4 A;  2L5O A;  2HRA A;  2H1B A;  1JFU A;  17GS A;  3KGK A;  4HJM A;  1GSS A;  1YKC A;  1GTU A;  5ECL B;  3IK9 A;  3CMI A;  1BAY A;  4IW9 A;  2LRC A;  4Z2R A;  6GSV A;  1TI3 A;  2LJR A;  2N5A A;  1AQV A;  5KOW A;  1JHB A;  1K3O A;  4KAE A;  1K0N A;  3HA9 A;  3Q6O A;  5ECQ B;  5COH A;  5F8B A;  4PX1 A;  1U6T A;  5FT3 A;  4FYC A;  3RPN A;  2YWN A;  1GUL A;  1NW2 A;  3VI5 A;  1PX6 A;  3G7J A;  3SWL A;  2QGV A;  2RUF A;  4X1U A;  4PGT A;  2H6Y A;  4ECI A;  1QGV A;  3L0H A;  1SL0 B;  3I43 A;  3O6T A;  3O3T A;  5DQS A;  4NPB A;  2OBI A;  4E8E A;  4KCA A;  1MEK A;  3C8E A;  4GCI A;  1SVM A;  3DRN A;  2RM6 A;  4X43 A;  1V58 A;  4POK A;  1YVL A;  3E9J B;  2VUP A;  1XWA A;  2OT3 A;  1JZO A;  2ZUP A;  2VIM A;  4DSS A;  1K0D A;  1UA5 A;  3CSI A;  1DBY A;  1WPI A;  1PL1 A;  5AIS A;  2A2S A;  1OE7 A;  5J4V A;  2JAD A;  1VF1 A;  3E0U A;  4CDO A;  1MD3 A;  4OD7 A;  4G19 A;  2H71 A;  1TU7 A;  1JZR A;  3FR9 A;  1R4W A;  2JAC A;  3MIX A;  1F9M A;  8GSS A;  2CT6 A;  1SKR B;  3EMX A;  4AGS A;  5KEJ A;  2PMT A;  5C00 A;  1W4V A;  3HD5 A;  5D9V A;  1KEB A;  4ZBA A;  2RUE A;  2P5R A;  3EC3 A;  4N11 A;  2OAC A;  4OWY A;  3KM6 A;  2LV3 A;  2GZY A;  4DVC A;  1B8X A;  3GNJ A;  2EIR A;  2HRN A;  1SL2 B;  3IHG A;  3FMW A;  1HD2 A;  3W6G A;  3GMF A;  4KUN A;  3UIW A;  5A5H B;  1OC9 B;  4AKG A;  4AJ6 A;  1Z6M A;  5ECP B;  4XRA A;  4ICY A;  5ABR A;  2EC4 A;  4XTS A;  2X4A A;  2YP6 A;  4NV5 A;  2H6X A;  1GL8 A;  5DJL A;  1JLW A;  2EIO A;  3P7X A;  1XW6 A;  2H0I A;  4ACS A;  5JCU A;  19GS A;  2R37 A;  2C1Y A;  3LYK A;  1U3A A;  2IIY A;  1XWG A;  2IN3 A;  2GVP A;  4IJ3 A;  2LS5 A;  2E7P A;  1YJ6 A;  2YWI A;  3ZVJ A;  3LQ7 A;  1Z6N A;  1DE2 A;  2VCT A;  4IKH A;  3TKS C;  1GTA A;  3I6A A;  4D73 B;  3LOR A;  3GTU A;  4KGI A;  4K6X A;  4L0U A;  4MPG A;  4MF5 A;  2GT6 A;  1EP7 A;  4POL A;  2DJJ A;  5F0G A;  2E0Q A;  2H76 A;  2PVO C;  3HCZ A;  2XPD A;  1A2L A;  2OA7 A;  1NSW A;  1GUM A;  2HLS A;  1O6J A;  4K2D A;  5BMU B;  4JBB A;  3KP9 A;  2HE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...