1F3BA

Crystal structure of mgsta1-1 in complex with glutathione conjugate of benzo[a]pyrene epoxide
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
222
structure length
221
Chain Sequence
AGKPVLHYFNARGRMECIRWLLAAAGVEFEEKFIQSPEDLEKLKKDGNLMFDQVPMVEIDGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYSEGILDLTEMIGQLVLPPDQREAKTALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLEVLLYVEEFDASLLTPFPLLKAFKSRISSLPNVKKFLQPGSQRKPPMDAKQIQEARKAFKIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLUTATHIONE S-TRANSFERASE YA CHAIN
publication title Residue R216 and catalytic efficiency of a murine class alpha glutathione S-transferase toward benzo[a]pyrene 7(R),8(S)-diol 9(S), 10(R)-epoxide.
pubmed doi rcsb
source organism Mus musculus
total genus 81
structure length 221
sequence length 222
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2000-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1f3bA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1f3bA01
1ON4A 4OCEA 3KH7A 4XS4B 2HI7A 3DYRA 1QGVA 4MCUA 4ECBA 2A4VA 5A5KA 2H1DA 3D21A 4TXOA 1WE0A 3TRPA 1VF2A 1ERWA 2V41A 4KNDA 3VWXA 3MNGA 3ME7A 2L4QA 4MF6A 4Q5NA 3HJOA 3O76A 2VCZA 1XWKA 5GZZB 4N10A 1WIKA 2BJXA 2DBCA 2YANA 4WBJA 4XS1A 3KH9A 3GKKA 2H1AA 5CRWA 2CX4A 2MYGA 1S3CA 3M0FA 2RUEA 5COHA 12GSA 2H01A 4K2DA 5CRGA 5J3RA 3EURA 1EGRA 3APQA 2NPBA 4J57E 3KD0A 2VCQA 1HNCA 3H8QA 4V2MA 1YKAA 3IR4A 1EOHA 3FZ9A 1V98A 1FO5A 2XHFA 4I5QA 4MJEA 4ISDA 1SKWB 2XC2A 2VL2A 2FWEA 3O3TA 1UC7A 4F0CA 1TK5B 2VD1A 2M80A 2MMAA 2TRCP 1R26A 3N5OA 2RM5A 1T4ZA 5IO2A 3CXGA 1V57A 1PL1A 4ZXGA 2E7PA 3GL3A 4ZL7A 4WXTA 4MH3A 4MA9A 1T3BA 1OC3A 1Y6EA 1QMVA 5ECNB 3F3QA 2HZEA 2V6OA 1ILOA 5B7CA 4EXJA 4FIWA 3L0HA 1LU4A 1GTUA 2ES7A 1TJDA 1JZWA 5B8AA 2HSHA 1PA3A 3VPQA 5KN2A 2V32A 1GRXA 1ST9A 2AHEA 3TKSC 2VIMA 2IFQA 4JBBA 5IPGA 5B6MA 1A2JA 3IBHA 2C0FA 1GLQA 4LL1B 1PRXA 2IMFA 2H72A 3LGCA 1YEXA 4YH2A 5G5FA 1MDIA 4EUYA 2HNLA 1FAAA 1UVZA 4ZL9A 2WZ9A 3ZVJA 2HE3A 3P90A 4HU9A 3TKRA 2P0GA 3EMPA 4PNGA 1JZDA 3LSZA 4JU5A 2QGVA 5ECHB 2TIRA 3F0IA 5ABRA 2V1MA 2H71A 3HVXA 4AJ7A 5GSSA 5G31A 4OFMA 1SJZA 3HD5A 2YV9A 3VI7A 3VWVA 4IS0A 1HQOA 4WR4A 3VI5A 1OC9B 1QQ2A 3RHBA 3QAVA 2C8UA 3RPNA 5A4VA 2B3SA 2JACA 3ZITA 3TJBA 3SWLA 3A2WA 1TRUA 2HYXA 1RQMA 6GSYA 2GQKA 4X0XA 4XCSA 3G7JA 4XIHA 3D4TA 4I2UA 2HT9A 1XOAA 5DCGA 4YAVA 4EVMA 1ZYQB 1PGTA 3W8JA 4V2NA 2AB6A 2YOIA 2K6VA 3UARA 3UL3A 4XS4A 1AQWA 1Z3EA 4HDEA 2G2QA 2DLXA 2JZTA 4PNFA 4PTSA 3QMXA 5DALB 2JSZA 4IGJA 2MMOA 1GNEA 4MJBA 1H75A 3IXRA 2CVBA 4KB3A 2GSRA 2GDRA 2PMTA 4JEDA 4I8BA 3LORA 3TRQA 3IC4A 1N8JA 2DMMA 3GKMA 3F4SA 2CX3A 3UVHA 3HZ4A 1M99A 1TI1A 4ILFA 4K6XA 4PGTA 2WFCA 1FG4A 4G0IA 1MD3A 1K3YA 3LEFA 3BJ5A 2LJRA 1FB0A 1YEPA 3ZMLA 1MD4A 2I4AA 3FKFA 2H0GA 2J9HA 1TTZA 5JWRB 5DBQA 3IDVA 1F2EA 2H19A 4HQSA 4POLA 2D2ZA 1O85A 4MF5A 1J9BA 1ZMAA 5F8BA 3HVVA 1Z9HA 3TRXA 2FD3A 1K0NA 4QQ7A 2FNOA 2DIZA 2N5AA 5JCUA 2WCIA 3LXTA 2F3MA 3KIJA 3UOMA 3K8NA 1SK2A 1DBYA 3KCMA 4H86A 11GSA 3TDGA 1FW1A 2KLXA 3NOFA 1TI3A 1E6BA 1OYJA 4MZBA 4RI6A 3EU4A 2H1GA 3GTUB 3WT1A 2CQ9A 1OE8A 1PL2A 1JZRA 5JCWA 1QXHA 4IJIA 2N5BA 3APOA 1XXUA 2QKEA 5DCHA 3IAS2 2VOCA 2MBTA 5D93A 2TRXA 2OKAA 4MZCA 5ID2B 1ML6A 4WKWA 1SENA 4HU7A 1O73A 2LKUA 1TU7A 3APSA 3U6VA 2IMKA 4ZB9A 3W8SA 2ZCTA 3C1RA 1GWCA 5FHIA 4EE0A 3LG6A 3H79A 4TW5A 1TK0B 2GT5A 4K7OA 5C04A 5HFKA 1K0BA 3DRNA 2YZUA 5F05A 4EDZA 2OBIA 4G2EA 4N11A 2VCWA 2DSAA 4NMUA 5J5NA 2X99A 1M9AA 3F8UA 2RLIA 1KBNA 1O6JA 3ZZXA 2YJHA 5DJMA 2GSQA 1GNWA 5H5QA 4OFTA 2LUSA 1ZGNA 2DC5A 2EIOA 1EEMA 4GQFA 2KOKA 1KTEA 2HRNA 3C7MA 5KEJA 4FYBA 2JSYA 3GH9A 1XVQA 2R3XA 2JZSA 3FEUA 2LRCA 2IMEA 2L57A 1OC9A 1BYEA 2R37A 3WGDA 4AJ8A 1AQVA 1PQNA 2C3QA 3C73A 2V2GA 2YV7A 3TJKA 4ZBDA 3ZVJD 4I97A 3EYTA 3TKSA 3I43A 5IQYA 3PINA 4KA0A 1AQXA 5JWQB 5GAND 5DVBA 5C00A 3FY7A 2PWJA 4MDCA 1FOVA 3DD3A 2ON5A 2PERA 4JR4A 1AAZA 3E9JB 4BWQA 4GWRA 1BX9A 1IYIA 3GSSA 2VL9A 1YQ1A 3M1GA 4EDYA 1XWCA 3JCML 4L5OA 5DALA 1B48A 3Q74A 3UAPA 2FLSA 3M9KA 5EVOA 3IC8A 4G19A 3TOUA 2IIYA 1V40A 4MLYA 1GTIA 2DJKA 3N9JA 1U3AA 5DJLA 1TP9A 5A4WA 4IHUA 5IOXA 1QFNA 4Q5QA 2L6DA 1HYUA 4PURA 3G7IA 3ZLPA 3M3MA 5ECQB 2B5EA 4HOJA 2KUCA 3QAGA 3GRXA 5KN1A 4JRRA 1ZZYA 4AGSA 4NWYA 1UA5A 4GTUA 1CQGA 2C0EA 1M7TA 3LXZA 2DJ2A 4LA1A 3CSIA 1X9WB 5EY6A 4G9HA 2AUVA 1ERVA 4KCAA 3NIVA 1K0CA 3HDCA 3KM6A 4ULXA 4I6XA 1K3OA 5LNKe 5JWOB 3WD6A 1EV9A 1R5PA 4HJ2A 2HRKB 3TKQA 4L0WA 2CT6A 1GULA 2EC4A 5HQPA 2N5FA 3VURA 4YQUA 4NAXA 2DMLA 3A2VA 3FW2A 2LNTA 4NHWA 4ZL8A 3IPZA 4FYCA 3TKPA 1U3IA 3TGZA 1GUHA 2B7JA 1ZYEA 2YCDA 2LNSA 1F3BA 3I69A 2H75A 3GTUA 1X5DA 1AW9A 2WB9A 1XW5A 4IQ1A 3HCZA 3QFAC 1XWGA 2J23A 2AV4A 3H93A 1XW9A 4NHZA 3TUEA 3FR6A 5EL8A 2YWIA 4XRDA 1Z5YE 2P5QA 4TN8A 3P8WA 4LL4B 3ZFLA 5ECIB 5ID2A 1IYHA 4CDOA 2VM2A 1QUWA 2DJ0A 1SD9A 5D73A 4OD7A 2LRTA 3RDWA 3DMLA 3ERWA 1O7UA 5GSTA 4TR3A 3C8EA 4V2LA 1YY7A 3V1WA 4EO3A 1K0MA 2HXKA 2LTKA 1GUMA 2FY6A 1X0RA 1OKTA 2WJUA 3E3EA 5KN0A 3DXBA 2XBIA 4POBA 5ECSA 2I1UA 2VLTA 1PSQA 2H6ZA 3ERFA 2FGXA 1KNGA 3F6DA 3OR5A 4NXIA 1MEKA 5LD0A 3A2XA 3CBUA 3ISOA 4O5RA 6GSTA 4CHSA 4Q5RA 3W6GA 4HQZA 3UMAA 2H76A 3TJFA 3HYPA 2FA8A 3SBCA 3GNJA 1SKSB 1X9SB 5FT3A 3Q19A 1S3DA 4OWYA 2IN3A 5F07A 4TXVA 5D8IA 3NZNA 1FVJA 3CSJA 3RBTA 3RPPA 2C4JA 4JR6A 3HHVA 4TRXA 1T7PB 2K8SA 1YKCA 3IHQA 5AIXA 1M2DA 2GSSA 2L59A 4IBPA 2L6CA 1RK4A 1A2LA 3CRTA 2O7KA 4OFNA 2OACA 1TK8B 2IPAA 3ED3A 4BPYA 16GSA 9GSSA 1GLPA 1OE7A 2GT6A 5DQYA 3DVXA 3KEBA 2PN8A 5IMDA 5IMAA 2VUPA 2HQTA 4XS6A 1GTAA 2CA8A 3AY8A 1G6YA 2ZUPA 1TXXA 1FHEA 4TR0A 2C3NA 1T8EB 4GSNA 4KDUA 5G30A 5F0GA 4KF9A 4L8EA 3EMXA 3HXSA 4E8EA 5CRHA 4PUFC 1O8XA 3UVTA 5L71A 1EZKA 5LCZA 4LMVA 1SJIA 5CRDA 2YJ7A 2MZCA 3WT2A 2VLVA 2NDOA 2XBQA 2L4CA 2HRKA 4F0BA 2CZ3A 1O8WA 1GP1A 1YF0A 2REMA 1Z6MA 3D5JA 4PUAA 3O6TA 4KH7A 1F37A 3L4NA 1CQHA 3CTGA 2DJ3A 1WRYA 1ABAA 2H74A 4WETA 3FR9A 2M46A 2PGTA 2E2MA 3BCIA 4ZIJA 3UBLA 4E8HA 4MABA 2CV4A 2LJAA 4OCFA 3WGXA 5H5SA 2F51A 1B9YC 4WF4A 1SK0A 3IK9A 3GUSA 5ELAA 2JZRA 3GL5A 2O8VB 3I9V2 5HFGA 2M72A 1F9MA 4I2TA 2JL4A 5ECMB 1BJXA 3KMOA 18GSA 4FQUA 3ME8A 3DIEA 3HY2A 2WRTA 4GSSA 2FWGA 1PMTA 2EIRA 2YP6A 2RIIA 4X43A 1AC1A 1GSFA 3TB2A 5D9WA 2E0QA 2HSYA 4DEJA 1V58A 1B9XC 2GQLA 2X8HA 3U5RE 3WGEA 1JFUA 5D9VA 1Z6NA 4MP4A 4G0LA 4DVCA 4FYUA 2HLSA 3VWUA 1X5CA 4K7IA 3LWAA 2HRFA 2MMZA 4MF7A 1XOBA 5IMCA 5AIVA 1LBKA 4EF0A 3GX8A 5FWGA 5AN1A 1XVWA 3ERGA 4G0KA 1BQ7A 3L9SA 2F8AA 1XPVA 2YWNA 4IELA 2H66A 3EU3A 1K3LA 2P31A 2Z9SA 4MMMA 4KW6A 4AJ6A 1EWXA 2HSMB 4K9ZA 1G7OA 1RW1A 1NSWA 3UEMA 1B4QA 1VRSD 2HRAA 5G5EA 3IK7A 3F9UA 3F3RA 3KJYA 1SU9A 1ZCPA 4WF5A 1OKDA 4Z7XA 3L78A 2OE3A 3BBYA 3HJPA 3GH6A 4YAPA 4MJCA 1SD8A 1XFLA 1WMJA 5HR1A 5D9XA 4ML6A 3HA9A 4HJMA 4IW9A 3QR6A 1S3AA 3EC3A 1SKRB 1X9MB 4PQIA 1Z7RA 4RI7A 2O87A 2WDUA 3MDKA 2R2JA 3GV1A 1TDIA 4TOPA 4KX4A 3CYNA 4ECJA 5CAXA 1YZXA 3ZIVA 4ECCA 4KDXA 4IN0A 3ZIJA 5JCGA 1OVNA 3H4KA 4PQHA 4ZBBA 2BTOT 1I5GA 3FK8A 2AAWA 3S9FA 3GA4A 4IVFA 3QPMA 2I9HA 4FH8A 2C1YA 2L5OA 2PU9C 4BL7B 1EP7A 2FWFA 1C72A 2IMIA 2JADA 5DAKB 2GZZA 3ZMKA 3QOUA 6GSSA 10GSA 1E2YA 3GYKA 2H0HA 2YZHA 1XWBA 3HKRA 6GSWA 1DSBA 3P7XA 4IP1A 2H8LA 1G0TA 2G0FA 4OO5A 1T00A 1J08A 3DGQA 2I3YA 2IMDA 5E4WA 5IMZA 1XIYA 2K18A 1R5AA 1VF1A 1Y25A 4ID0A 4J2FA 3GKNA 2WGRA 2IL3A 1O81A 2LQQA 1BEDA 1A8YA 1TU8A 3CRUA 3KMNA 5HR2A 4LLRA 2FA4A 3GFKA 1A2MA 3TKSE 4N0VA 5ECKB 4HS1A 3GHAA 3CMIA 1MDKA 5INYA 1OAZA 2VD0A 4KDYA 3VFIA 1XZOA 4ECIA 2LEGA 5A4UA 2QC7A 2E2GA 2H1BA 4LMWA 2RM6A 4GXZA 4RQXA 2VCVA 2ALBA 2YWOA 2VCTA 3ZL5A 5B8BA 2JU5A 5CYYA 2FHEA 4EKZA 1USBA 3FZ4A 2VCXA 2YNXA 5H5RA 3KXOA 2DJJA 4YQMA 3KGKA 4YQVA 1XW6A 4TR1B 4USSA 1A8LA 3ZFBA 5BMUA 1A0RP 4KCEA 1F3AA 4BVXA 2CVDA 1TW9A 1NW2A 4HI7A 4Q5FA 5AISA 1URMA 3ZREA 3D22A 3P2AA 2C3TA 20GSA 2F8FA 1TRSA 2RUFA 2IJYA 1GTBA 1SK1A 3UIWA 4HZ4A 4GRFA 3EE2A 2B5YA 4O7HA 3A3TA 4GCIA 4KUNA 2YN1A 2X8CA 4NV5A 1TRWA 1HD2A 5B6NA 2PBJA 3M9JA 2R6KA 4ZBAA 2CAIA 1GSEA 4KGIA 5E59A 2GGTA 1OC8A 4MK3A 2A2SA 3R3EA 1H4OA 2KP2A 4IP6A 3GN3A 1TOFA 4PX1A 1V9WA 4G10A 13GSA 4RQRA 2VM1A 6GSXA 3QFBC 3FHKA 4POKA 5HFIA 1KEBA 1ACVA 2HSMA 2F9SA 1NM3A 3UBKA 1GSSA 1W4VA 3KZQA 1PKZA 2PPTA 5G1LA 3KTBA 3LYPA 1ERUA 1B4PA 1M2BA 4ZB6A 2OE1A 3FR3A 2GSTA 5IIZA 2LQOA 1B8XA 6GSUA 2ZNMA 3HVSA 1MTCA 3IAM2 5EPFA 1GSYA 2H6YA 4V1Ag 1K0DA 4ZB8A 3D0ZA 1A0FA 2IWTA 3PPUA 2OBKA 4JE1A 1YJ6A 1PX6A 4MPFA 4TVEA 2KP1A 2QSIA 2AJQB 3TCOA 3IRAA 4K0NA 5ECPB 3RHCA 1TKDB 1J0FA 1QK8A 2H0IA 2H73A 2B1KA 1JHBA 2LJKA 3G7YA 1Q4JA 4QL7A 1NHYA 3EWLA 2KHPA 1SL1B 2HZFA 4DSSB 4BL7A 3ZTLA 3QD9A 4AF2A 1SYRA 3VLNA 5ECLB 3QDNA 1AUCA 2VLUA 2C0GA 5IPHA 4D73B 5DAKA 5ELGA 1FVKA 3F4RA 2PUKC 2WS2A 1YDKA 3H1NA 1DE2A 2OADA 3LJRA 1AIUA 5ECRB 4BVYB 5CREA 4K7NA 2PVQA 4TKYA 2VL3A 2GZYA 1WJKA 3E0UA 1T1VA 3RAZA 3BD2A 4L0UA 4QL9A 1DE1A 5DDLA 5G1KA 1PKWA 7GSSA 2A2RA 4POMA 4XRAA 3G9BA 3QAWA 3QCPA 4BA7A 2I81A 4V1Ap 2UZ8A 1BAYA 2GS3A 1GSQA 3I6AA 4MH2A 1M0UA 4F82A 1R4WA 2K9FA 2OE0A 1ZL9A 3VWWA 5AGYA 2VL2C 8GSSA 3L9UA 2K8VA 4NV2A 5IMVA 4TXOB 4F9ZA 2X8GA 1DUGA 2V6KA 1MDJA 3Q18A 17GSA 3LFLA 4PQ1A 4GLTA 1EV4A 3GX0A 3GURA 1I9DA 1EOGA 1XWAA 2C80A 3LYKA 2B6MA 4N30A 4XTSA 4WBRD 3IV4A 4JZQA 2DIYA 2DJ1A 4GSTA 4MZWA 3IA1A 4GQCA 2MMNA 4FO5A 2O89A 4O32A 4NPBA 4TR4A 1ZOFA 5CNWA 4TR1A 5HR3A 3TJJA 1BG5A 2VO4A 3HJMA 5IOWA 3FRCA 2O85A 1PX7A 4XHMA 4ZILA 2YPMA 1EEJA 2X64A 3Q6OA 1WOUA 2BMXA 3KTLA 1Z7PA 3EINA 3D4MA 4F2IA 2R5GA 5J9CA 4MJAA 1GL8A 1SL2B 1N2AA 5IMFA 1GSUA 3VPTA 3DKSA 5GAPD 3CTFA 4O92A 3ZYWA 3GMFA 4GF0A 2P5RA 4BVXB 2FUG2 1TRVA 4L5LA 2H6XA 2NVLA 1VGLA 4N0ZA 3IOSA 2C0DA 2H30A 5IO0A 1A24A 2XPDA 1JZOA 4MPGA 4EC0A 3A5WA 2VAFA 3F63A 1FB6A 4DSQA 3C1SA 2FCHA 3PR8A 3US3A 5ECOB 3TJGA 3F6FA 4IKHA 5CO3A 3L9VA 5F06A 3C71A 2HFDA 2LS5A 2PVOC 4IJ3A 3J7Yb 2AYTA 1A23A 1G6WA 3PGTA 1SJ6A 2HZEB 2LRNA 1AXDA 3DVWA 3MSZA 3GKXA 1W89A 2YWMA 3FZAA 3F4TA 4HEA2 1SYXA 5HR0A 3HZ8A 1GSDA 1K0AA 1LJRA 1V2AA 3LQ7A 5D96A 2FWHA 2L5LA 1WPIA 1PD21 2NBSA 3M8NA 5G2ZA 1SL0B 3GSTA 4HZ2A 1U87A 1THOA 4DSRA 2GTUA 3WYWA 4KE3A 2IFQB 4RUVA 1VF3A 1XCCA 3BOAA 6GSVA 1UN2A 4KSOA 3TOTA 2GVPA 1WWJA 5KN3A 3BCKA 1VF4A 2OJLA 4K1FA 1NHOA 3CSHA 3D6IA 3KP8A 1K0OA 2H70A 3EVIA 1Q98A 5D9TA 2LSTA 4HUAA 1HNAA 3FZ5A 22GSA 3R2QA 3DWVA 1U88A 3MWHA 2HSNB 3KP9A 2B5XA 2CZ2A 5J4UA 1M9BA 4KSMA 3J7Yk 4ACSA 2CVKA 3IE3A 2NTOA 1YF1A 1HNBA 3MAKA 4K8MA 4ML1A 4CW9A 4DSSA 1GH2A 1WP0A 1JLWA 4J56E 2B1LA 1X5EA 4OO4A 1R7HA 5CP1A 4X1UA 1M2AA 1G7EA 14GSA 4D73A 1ERTA 4BWSA 5J9BA 2R4VA 3UJ1A 2B7KA 4KAEA 4P3YB 2OA7A 3VK9A 1JLVA 2LV3A 2ON7A 4BVYA 1F6MC 4IQAA 5J41A 2GQMA 2GZPA 4PXOA 2MBSA 4EL1A 2WULA 1U6TA 3FYGA 1EP8A 3GIXA 2GLRA 5IM9A 1T4YA 1XBSA 19GSA 1THXA 4F03A 5DQSA 1PN9A 3DEXA 1EGOA 4OMVA 2XPEA 5ENUA 1GUKA 3PH9A 4K0GA 4WEYA 4WR5A 2EIQA 3ZRDA 2CAQA
chains in the Genus database with same CATH superfamily
1ON4A 4OCEA 3KH7A 4XS4B 2HI7A 3DYRA 1QGVA 4MCUA 4ECBA 2A4VA 5A5KA 2H1DA 3D21A 4TXOA 1WE0A 3TRPA 1VF2A 1ERWA 2V41A 4KNDA 4AKHA 3VWXA 3MNGA 4AKGA 3ME7A 2L4QA 4MF6A 4Q5NA 3HJOA 2QA2A 3O76A 2VCZA 1XWKA 5GZZB 4N10A 1WIKA 2BJXA 2DBCA 2YANA 4WBJA 4XS1A 3KH9A 3GKKA 2H1AA 5CRWA 2CX4A 2MYGA 1S3CA 3M0FA 2RUEA 5COHA 12GSA 2H01A 4K2DA 5CRGA 5J3RA 3EURA 1EGRA 3APQA 2NPBA 4J57E 3KD0A 2VCQA 1HNCA 3H8QA 4V2MA 1YKAA 3IR4A 1EOHA 3FZ9A 1V98A 1FO5A 2XHFA 4I5QA 4MJEA 4ISDA 1SKWB 2XC2A 2VL2A 5J40A 2FWEA 3O3TA 1UC7A 4F0CA 1TK5B 2DKHA 2VD1A 2M80A 2MMAA 2TRCP 1R26A 3N5OA 2RM5A 3RGBC 1T4ZA 1BG1A 5IO2A 3CXGA 1V57A 1PL1A 4ZXGA 2DKIA 2E7PA 3GL3A 4ZL7A 4WXTA 4MH3A 4MA9A 1T3BA 1OC3A 1Y6EA 1QMVA 5ECNB 3F3QA 2HZEA 2V6OA 1ILOA 5B7CA 1Y1UA 4EXJA 4FIWA 3L0HA 1LU4A 4E68A 2R0GA 1M3IA 1GTUA 2ES7A 1TJDA 1JZWA 5B8AA 2HSHA 1PA3A 3VPQA 5KN2A 2V32A 1GRXA 2WVXB 1ST9A 2AHEA 3TKSC 2VIMA 2IFQA 4JBBA 5IPGA 5B6MA 1A2JA 3IBHA 2C0FA 1GLQA 4LL1B 1PRXA 2IMFA 2H72A 3LGCA 1YEXA 4YH2A 5G5FA 1MDIA 4EUYA 2HNLA 1FAAA 1UVZA 4ZL9A 2WZ9A 3ZVJA 2HE3A 3P90A 4HU9A 3TKRA 2P0GA 3EMPA 4PNGA 1JZDA 3LSZA 4JU5A 2HSNA 2QGVA 3LW9A 5ECHB 2TIRA 3F0IA 5ABRA 2V1MA 5J47A 4PI2C 2H71A 3HVXA 4AJ7A 5GSSA 5G31A 4OFMA 1SJZA 3HD5A 2YV9A 3VI7A 3VWVA 4IS0A 1HQOA 4WR4A 3VI5A 1OC9B 1QQ2A 4PI0C 3RHBA 3QAVA 2C8UA 3RPNA 5A4VA 2B3SA 2JACA 3ZITA 3RFRC 3TJBA 3SWLA 3A2WA 1TRUA 2HYXA 1RQMA 6GSYA 2GQKA 4X0XA 4XCSA 3G7JA 4XIHA 3D4TA 4I2UA 2HT9A 1XOAA 5DCGA 4YAVA 4EVMA 1ZYQB 1PGTA 3W8JA 4V2NA 2AB6A 2YOIA 2K6VA 3UARA 3UL3A 4XS4A 1AQWA 1Z3EA 4HDEA 2G2QA 2DLXA 2JZTA 4PNFA 4PTSA 3QMXA 5DALB 2JSZA 4IGJA 2MMOA 3IHGA 1GNEA 4MJBA 1H75A 3IXRA 2CVBA 4KB3A 2GSRA 2GDRA 4HSCX 2PMTA 4JEDA 2A2PA 4I8BA 3LORA 3TRQA 3IC4A 1N8JA 2DMMA 3GKMA 3F4SA 2CX3A 3UVHA 3HZ4A 1M99A 1TI1A 4ILFA 4K6XA 4PGTA 2WFCA 1FG4A 4G0IA 1MD3A 1K3YA 3LEFA 3BJ5A 2LJRA 1FB0A 1YEPA 3ZMLA 1MD4A 2I4AA 3FKFA 2H0GA 2J9HA 1TTZA 5JWRB 3TU3B 5DBQA 3IDVA 1F2EA 2H19A 4HQSA 4POLA 2D2ZA 1O85A 4MF5A 4ZB7A 1J9BA 1ZMAA 5F8BA 3HVVA 1Z9HA 3TRXA 2FD3A 1K0NA 1ZYNA 4QQ7A 2FNOA 1SVLA 2N5AA 2DIZA 5JCUA 2WCIA 3LXTA 2F3MA 3KIJA 3UOMA 3K8NA 1SK2A 1DBYA 3KCMA 4H86A 11GSA 3TDGA 1FW1A 2KLXA 3NOFA 1TI3A 1E6BA 1OYJA 4MZBA 4RI6A 2R0CA 3EU4A 2H1GA 3GTUB 3WT1A 2CQ9A 1OE8A 1PL2A 1JZRA 5JCWA 1QXHA 4IJIA 2N5BA 3APOA 1XXUA 2QKEA 5DCHA 3IAS2 2VOCA 2MBTA 5D93A 2TRXA 2OKAA 4MZCA 5ID2B 1ML6A 4WKWA 1SENA 4HU7A 1O73A 2LKUA 4EIPA 1TU7A 3APSA 3U6VA 2IMKA 4ZB9A 3W8SA 2ZCTA 3C1RA 4N3ZA 2WVXA 1GWCA 5FHIA 4EE0A 3LG6A 3H79A 4TW5A 1TK0B 2GT5A 4K7OA 5C04A 5HFKA 1K0BA 3DRNA 2YZUA 5F05A 4EDZA 2OBIA 4G2EA 4N11A 2VCWA 2DSAA 4NMUA 5J5NA 2X99A 1M9AA 3F8UA 2RLIA 1KBNA 1O6JA 3ZZXA 2YJHA 5DJMA 2GSQA 1GNWA 5H5QA 4OFTA 2LUSA 1ZGNA 2DC5A 2EIOA 1EEMA 4GQFA 2KOKA 2R0PA 1KTEA 2HRNA 3C7MA 5KEJA 4AKIA 4FYBA 2JSYA 3GH9A 1XVQA 2R3XA 2JZSA 3FEUA 2LRCA 5KOWA 2IMEA 2L57A 1OC9A 1BYEA 2R37A 3WGDA 4AJ8A 1AQVA 1PQNA 2C3QA 3C73A 2V2GA 2YV7A 3TJKA 4ZBDA 3ZVJD 4I97A 3EYTA 3TKSA 3I43A 5IQYA 3PINA 4KA0A 1AQXA 2WVZA 5JWQB 5GAND 5DVBA 5C00A 3FY7A 2PWJA 4MDCA 1FOVA 3DD3A 2ON5A 2PERA 4JR4A 1AAZA 3E9JB 4BWQA 4GWRA 1BX9A 1IYIA 3GSSA 1SVOA 2VL9A 1YQ1A 3M1GA 4EDYA 1XWCA 1FOHA 3JCML 4L5OA 5DALA 1B48A 3Q74A 3UAPA 2FLSA 3M9KA 5EVOA 3IC8A 4G19A 3TOUA 2IIYA 1V40A 4MLYA 1GTIA 2DJKA 3N9JA 1U3AA 5DJLA 1TP9A 5A4WA 4IHUA 5IOXA 1QFNA 4Q5QA 2L6DA 1HYUA 4PURA 3G7IA 3ZLPA 3M3MA 5ECQB 2B5EA 4HOJA 2KUCA 3QAGA 4Z2RA 3GRXA 5KN1A 4JRRA 1ZZYA 4AGSA 4NWYA 1UA5A 4GTUA 1CQGA 2C0EA 1M7TA 3LXZA 2DJ2A 4LA1A 4X4JA 3CSIA 1X9WB 1N25A 5EY6A 4G9HA 2AUVA 1ERVA 4KCAA 3NIVA 1K0CA 3HDCA 3KM6A 4ULXA 4I6XA 1K3OA 5LNKe 5JWOB 3WD6A 1EV9A 1R5PA 4HJ2A 2HRKB 3TKQA 4L0WA 2CT6A 1GULA 2EC4A 5HQPA 2N5FA 3VURA 4YQUA 4NAXA 2DMLA 3A2VA 3HVNA 3FW2A 2LNTA 4NHWA 4ZL8A 3IPZA 4FYCA 3TKPA 4K5RA 1U3IA 3TGZA 1GUHA 2B7JA 1ZYEA 2YCDA 2LNSA 1F3BA 3I69A 2H75A 3GTUA 1X5DA 1AW9A 2WB9A 1XW5A 4IQ1A 3HCZA 3QFAC 2VKZG 1XWGA 2J23A 2AV4A 3H93A 1XW9A 4NHZA 3TUEA 3FR6A 5EL8A 2YWIA 4XRDA 1Z5YE 2P5QA 4TN8A 3P8WA 4LL4B 3ZFLA 5ECIB 5ID2A 1IYHA 4CDOA 2VM2A 1QUWA 2DJ0A 2O36A 1SD9A 5D73A 4OD7A 2LRTA 3RDWA 5A34B 3DMLA 3ERWA 1O7UA 4G01A 5GSTA 4TR3A 3C8EA 4V2LA 1S4BP 1YY7A 3V1WA 4EO3A 1K0MA 2HXKA 2EFCA 2LTKA 1GUMA 2FY6A 1X0RA 1OKTA 2WJUA 3E3EA 5KN0A 3DXBA 2XBIA 4POBA 5ECSA 2I1UA 2UV8G 2VLTA 4K2XA 1PSQA 4Z2UA 2H6ZA 3ERFA 2FGXA 1KNGA 3F6DA 3OR5A 4NXIA 1MEKA 3CWGA 5LD0A 3A2XA 3CBUA 3ISOA 4O5RA 6GSTA 4CHSA 4Q5RA 3W6GA 4HQZA 3UMAA 2H76A 3TJFA 3HYPA 2FA8A 3SBCA 3GNJA 1SKSB 1X9SB 5FT3A 3Q19A 1S3DA 4OWYA 2IN3A 5F07A 4TXVA 5D8IA 3NZNA 1FVJA 3CSJA 3RBTA 3RPPA 2C4JA 4JR6A 3HHVA 4TRXA 1T7PB 2K8SA 4YKGA 1YKCA 3IHQA 5AIXA 1M2DA 2GSSA 2L59A 4IBPA 2L6CA 1RK4A 1A2LA 3CRTA 2O7KA 4OFNA 2OACA 4A5PA 1TK8B 2IPAA 3ED3A 4BPYA 16GSA 5J4VA 9GSSA 1GLPA 1OE7A 1ZYPA 2GT6A 5DQYA 3DVXA 3KEBA 2PN8A 5IMDA 5IMAA 2VUPA 2WVYA 2HQTA 4XS6A 1GTAA 2CA8A 3AY8A 1G6YA 2ZUPA 1TXXA 1FHEA 5KOXA 4TR0A 2C3NA 1T8EB 4GSNA 4KDUA 5G30A 2WW3A 5F0GA 4KF9A 4L8EA 3EMXA 3MIXA 3HXSA 4E8EA 5CRHA 4PUFC 1O8XA 3UVTA 5L71A 1EZKA 5LCZA 4LMVA 2A4HA 1SJIA 5CRDA 2YJ7A 2MZCA 3WT2A 2VLVA 2NDOA 2XBQA 3CQFA 2L4CA 2HRKA 4F0BA 2CZ3A 1O8WA 1GP1A 1YF0A 2REMA 1Z6MA 3D5JA 4W66A 4PUAA 3O6TA 4KH7A 1F37A 2X49A 3L4NA 1CQHA 3CTGA 2DJ3A 1WRYA 1ABAA 2H74A 4WETA 3FR9A 2M46A 2PGTA 2E2MA 3BCIA 4ZIJA 3UBLA 4E8HA 4MABA 2CV4A 2LJAA 4OCFA 3WGXA 5H5SA 2F51A 1B9YC 4WF4A 1SK0A 3IK9A 3GUSA 4PHZC 5ELAA 2JZRA 3GL5A 2O8VB 3I9V2 5HFGA 2M72A 1F9MA 5BMUB 4I2TA 2JL4A 5ECMB 1BJXA 3KMOA 18GSA 4FQUA 3ME8A 3DIEA 3HY2A 4O5QA 2WRTA 4GSSA 2FWGA 3HMJG 1PMTA 5A34A 2EIRA 2YP6A 2RIIA 4AI6A 4X43A 1AC1A 1GSFA 3TB2A 5D9WA 2E0QA 2HSYA 4DEJA 1V58A 1B9XC 2GQLA 2X8HA 3U5RE 3WGEA 1JFUA 2EFHA 5D9VA 1Z6NA 4MP4A 4G0LA 4DVCA 4FYUA 2HLSA 3VWUA 1X5CA 4K7IA 3LWAA 2HRFA 2MMZA 4MF7A 1XOBA 5IMCA 5AIVA 1LBKA 4EF0A 3GX8A 5FWGA 4Z2TA 5AN1A 1XVWA 3ERGA 4G0KA 1BQ7A 3L9SA 2F8AA 4ICYA 1XPVA 2YWNA 4IELA 2H66A 3EU3A 1K3LA 2P31A 2Z9SA 4MMMA 4KW6A 2H1LA 4AJ6A 1EWXA 2HSMB 4K9ZA 1G7OA 1RW1A 1NSWA 3UEMA 1B4QA 1TXUA 1VRSD 2HRAA 5G5EA 3IK7A 3F9UA 3F3RA 3KJYA 1SU9A 1ZCPA 4WF5A 1PFOA 1OKDA 4Z7XA 3L78A 2OE3A 3BBYA 3HJPA 3GH6A 4YAPA 4MJCA 1SD8A 1XFLA 1WMJA 5HR1A 5D9XA 4ML6A 3HA9A 4HJMA 4IW9A 3QR6A 1S3AA 3EC3A 1SKRB 1X9MB 4PQIA 1Z7RA 4RI7A 2O87A 2WDUA 3MDKA 2R2JA 3GV1A 1TDIA 4TOPA 4KX4A 3CYNA 4ECJA 5CAXA 1YZXA 3ZIVA 4ECCA 4KDXA 4IN0A 3ZIJA 5JCGA 1OVNA 3H4KA 4PQHA 4ZBBA 2BTOT 1I5GA 3FK8A 2AAWA 3S9FA 3GA4A 4CY8A 4IVFA 3QPMA 2I9HA 4FH8A 1SVMA 2C1YA 2L5OA 2PU9C 4BL7B 1EP7A 2FWFA 1C72A 2IMIA 2JADA 5DAKB 2GZZA 3ZMKA 3QOUA 6GSSA 10GSA 1E2YA 3GYKA 2H0HA 2YZHA 1XWBA 3HKRA 6GSWA 1DSBA 3P7XA 4IP1A 2H8LA 1G0TA 2G0FA 4OO5A 1T00A 1J08A 3DGQA 2I3YA 2IMDA 5E4WA 5IMZA 1XIYA 2K18A 1R5AA 1VF1A 1Y25A 4ID0A 4J2FA 3GKNA 2WGRA 2IL3A 1O81A 2LQQA 1BEDA 1A8YA 1TU8A 3CRUA 3KMNA 5HR2A 4LLRA 2FA4A 3GFKA 1A2MA 3TKSE 4N0VA 5ECKB 4HS1A 3GHAA 3CMIA 1MDKA 5INYA 1OAZA 2VD0A 4KDYA 2QA1A 3VFIA 2EFDA 1XZOA 4ECIA 2LEGA 5A4UA 2QC7A 2E2GA 2H1BA 4LMWA 2RM6A 4GXZA 4RQXA 2VCVA 2ALBA 2YWOA 2VCTA 3ZL5A 5B8BA 2JU5A 5CYYA 2FHEA 4EKZA 1USBA 3FZ4A 2VCXA 2YNXA 5H5RA 3KXOA 2DJJA 4YQMA 3KGKA 4EIQA 1M3JA 4YQVA 1XW6A 4TR1B 4USSA 1A8LA 3ZFBA 5BMUA 1BF5A 1A0RP 4KCEA 1F3AA 4BVXA 2CVDA 1TW9A 1NW2A 4HI7A 4Q5FA 5AISA 5A1NA 1URMA 3ZREA 3D22A 3P2AA 2C3TA 20GSA 2F8FA 1TRSA 2RUFA 2IJYA 1GTBA 1SK1A 3UIWA 4HZ4A 4GRFA 4MNNA 3EE2A 2B5YA 4O7HA 3A3TA 4GCIA 4KUNA 2YN1A 2X8CA 4NV5A 1TRWA 1HD2A 5B6NA 2PBJA 3M9JA 2R6KA 4ZBAA 2CAIA 1GSEA 4KGIA 5E59A 2GGTA 1OC8A 4MK3A 2A2SA 3R3EA 1H4OA 2KP2A 3CHXC 4IP6A 3GN3A 1TOFA 4PX1A 1YVLA 1V9WA 4G10A 13GSA 4RQRA 2VM1A 6GSXA 3QFBC 3FHKA 4POKA 5HFIA 1KEBA 1ACVA 2HSMA 2F9SA 3MYDA 1NM3A 3UBKA 1GSSA 1W4VA 3KZQA 1PKZA 2PPTA 5G1LA 3KTBA 1XG8A 3LYPA 1ERUA 1B4PA 1M2BA 4ZB6A 2OE1A 3FR3A 2GSTA 5IIZA 2LQOA 1B8XA 6GSUA 2ZNMA 3HVSA 2WW1A 1MTCA 3IAM2 5EPFA 1GSYA 2H6YA 4V1Ag 1K0DA 4ZB8A 3D0ZA 1A0FA 2IWTA 3PPUA 4CY6A 2OBKA 4JE1A 1YJ6A 1PX6A 4YKFA 4MPFA 4TVEA 2KP1A 5A5HB 2QSIA 2AJQB 3TCOA 2EFEA 3IRAA 4K0NA 2WZSA 5ECPB 3RHCA 1TKDB 1J0FA 1QK8A 2H0IA 2H73A 3FMWA 2B1KA 1JHBA 2LJKA 3G7YA 1Q4JA 4QL7A 1NHYA 5J4YA 3EWLA 2KHPA 1SL1B 2HZFA 4DSSB 4BL7A 3ZTLA 3QD9A 4AF2A 1SYRA 3VLNA 5ECLB 3QDNA 1AUCA 2VLUA 2C0GA 5IPHA 4D73B 5DAKA 5ELGA 1FVKA 3F4RA 2PUKC 2WS2A 1YDKA 3H1NA 1DE2A 2OADA 3LJRA 1AIUA 5ECRB 4BVYB 5CREA 4K7NA 2PVQA 4TKYA 2VL3A 2GZYA 1WJKA 1S3RA 3E0UA 1T1VA 3RAZA 3BD2A 4L0UA 4QL9A 1DE1A 5DDLA 5G1KA 1PKWA 7GSSA 2A2RA 4POMA 4XRAA 3G9BA 2X4AA 3QAWA 3QCPA 4BA7A 2I81A 4V1Ap 2UZ8A 1BAYA 2GS3A 1GSQA 3I6AA 4MH2A 1M0UA 4F82A 1R4WA 2K9FA 2OE0A 1ZL9A 3VWWA 5AGYA 2VL2C 8GSSA 3L9UA 2K8VA 2O5VA 4NV2A 5IMVA 4TXOB 4F9ZA 2X8GA 1DUGA 2V6KA 1MDJA 3Q18A 17GSA 3LFLA 4PQ1A 4GLTA 3GX0A 1EV4A 3GURA 1I9DA 1EOGA 1XWAA 2C80A 3LYKA 2B6MA 4N30A 4XTSA 4WBRD 3IV4A 4JZQA 2DIYA 2DJ1A 5BRTA 4GSTA 4MZWA 3IA1A 4GQCA 2MMNA 4FO5A 2O89A 4O32A 4NPBA 4TR4A 1ZOFA 5CNWA 4TR1A 5HR3A 3TJJA 2WW0A 1BG5A 2VO4A 3HJMA 5IOWA 3FRCA 2O85A 1PX7A 4XHMA 4ZILA 2YPMA 1PN0A 1EEJA 2X64A 3Q6OA 1WOUA 2BMXA 3KTLA 1Z7PA 3EINA 3D4MA 4F2IA 2R5GA 5J9CA 4MJAA 1GL8A 1SL2B 1N2AA 5IMFA 1GSUA 3VPTA 3DKSA 5GAPD 3CTFA 4O92A 3ZYWA 3GMFA 4GF0A 2P5RA 4BVXB 2FUG2 1TRVA 4L5LA 2H6XA 2NVLA 3A5IA 1VGLA 5A1NB 3IOSA 4N0ZA 2C0DA 2H30A 5IO0A 1A24A 2XPDA 1JZOA 4MPGA 2O3EA 4EC0A 3A5WA 2OT3A 2VAFA 3F63A 1FB6A 4DSQA 3C1SA 2FCHA 3PR8A 3US3A 5ECOB 3TJGA 3F6FA 4IKHA 5CO3A 3L9VA 5F06A 4QMKA 3C71A 2HFDA 1I1IP 2LS5A 2PVOC 4IJ3A 3J7Yb 2AYTA 1A23A 1G6WA 3PGTA 1SJ6A 2HZEB 2LRNA 1AXDA 3DVWA 3MSZA 3GKXA 1W89A 2YWMA 3FZAA 3F4TA 4HEA2 1SYXA 5HR0A 3HZ8A 1GSDA 1K0AA 1LJRA 1V2AA 3LQ7A 4AKXB 5D96A 2FWHA 2L5LA 1WPIA 1PD21 2NBSA 3M8NA 4O5UA 5G2ZA 1SL0B 3GSTA 4HZ2A 1U87A 1THOA 4DSRA 2GTUA 3WYWA 4KE3A 2IFQB 4RUVA 1VF3A 1XCCA 3BOAA 6GSVA 1UN2A 4KSOA 3TOTA 2GVPA 1WWJA 5KN3A 4GDFA 3BCKA 1VF4A 4FXYP 2OJLA 4K1FA 1NHOA 3CSHA 3D6IA 3KP8A 1K0OA 2H70A 3EVIA 1Q98A 5D9TA 2LSTA 4HUAA 5A5HA 1HNAA 3FZ5A 22GSA 3R2QA 3DWVA 1U88A 3MWHA 2HSNB 3KP9A 2B5XA 2CZ2A 5J4UA 1M9BA 4KSMA 3J7Yk 4ACSA 2CVKA 3IE3A 2NTOA 1YF1A 3EPTA 1HNBA 3MAKA 4K8MA 4ML1A 4CW9A 4DSSA 1GH2A 1WP0A 1JLWA 4J56E 4K5SA 2B1LA 1X5EA 4OO4A 1R7HA 5CP1A 4X1UA 1M2AA 1G7EA 14GSA 4D73A 1ERTA 4BWSA 5J9BA 2R4VA 3UJ1A 2B7KA 4KAEA 4P3YB 2OA7A 3VK9A 1JLVA 2LV3A 2ON7A 4BVYA 1YEWC 1F6MC 2WW2A 4IQAA 5J41A 2GQMA 2GZPA 4PXOA 2MBSA 4EL1A 2WULA 1U6TA 3FYGA 1EP8A 3GIXA 2GLRA 5IM9A 1T4YA 1XBSA 19GSA 1THXA 4F03A 5DQSA 1PN9A 3DEXA 1EGOA 4OMVA 4BIKA 2XPEA 5ENUA 1GUKA 3PH9A 4K0GA 4WEYA 4WR5A 2EIQA 3ZRDA 2CAQA
chains in the Genus database with same CATH topology
1ON4A 4OCEA 3KH7A 4XS4B 2HI7A 3DYRA 1QGVA 4MCUA 4ECBA 2A4VA 5A5KA 2H1DA 3D21A 4TXOA 1WE0A 3TRPA 1VF2A 1ERWA 2V41A 4KNDA 4AKHA 3VWXA 3MNGA 4AKGA 3ME7A 2L4QA 4MF6A 4Q5NA 3HJOA 2QA2A 3O76A 2VCZA 1XWKA 5GZZB 4N10A 1WIKA 2BJXA 2DBCA 2YANA 4WBJA 4XS1A 3KH9A 3GKKA 2H1AA 5CRWA 2CX4A 2MYGA 1S3CA 3M0FA 2RUEA 5COHA 12GSA 2H01A 4K2DA 5CRGA 5J3RA 3EURA 1EGRA 3APQA 2NPBA 4J57E 3KD0A 2VCQA 1HNCA 3H8QA 4V2MA 1YKAA 3IR4A 1EOHA 3FZ9A 1V98A 1FO5A 2XHFA 4I5QA 4MJEA 4ISDA 1SKWB 2XC2A 2VL2A 5J40A 2FWEA 3O3TA 1UC7A 4F0CA 1TK5B 2DKHA 2VD1A 2M80A 2MMAA 2TRCP 1R26A 3N5OA 2RM5A 1T4ZA 1BG1A 5IO2A 3CXGA 1V57A 1PL1A 4ZXGA 2DKIA 2E7PA 3GL3A 4ZL7A 4WXTA 4MH3A 4MA9A 1T3BA 1OC3A 1Y6EA 1QMVA 5ECNB 3F3QA 2HZEA 2V6OA 1ILOA 5B7CA 1Y1UA 4EXJA 4FIWA 3L0HA 1LU4A 4E68A 2R0GA 1GTUA 2ES7A 1TJDA 1JZWA 5B8AA 2HSHA 1PA3A 3VPQA 5KN2A 2V32A 1GRXA 1ST9A 2AHEA 3TKSC 2VIMA 2IFQA 4JBBA 5IPGA 5B6MA 1A2JA 3IBHA 2C0FA 1GLQA 4LL1B 1PRXA 2IMFA 2H72A 3LGCA 1YEXA 4YH2A 5G5FA 1MDIA 4EUYA 2HNLA 1FAAA 1UVZA 4ZL9A 2WZ9A 3ZVJA 2HE3A 3P90A 4HU9A 3TKRA 2P0GA 3EMPA 4PNGA 1JZDA 3LSZA 4JU5A 2HSNA 2QGVA 3LW9A 5ECHB 2TIRA 3F0IA 5ABRA 2V1MA 5J47A 2H71A 3HVXA 4AJ7A 5GSSA 5G31A 4OFMA 1SJZA 3HD5A 2YV9A 3VI7A 3VWVA 4IS0A 1HQOA 4WR4A 3VI5A 1OC9B 1QQ2A 3RHBA 3QAVA 2C8UA 3RPNA 5A4VA 2B3SA 2JACA 3ZITA 3TJBA 3SWLA 3A2WA 1TRUA 2HYXA 1RQMA 6GSYA 2GQKA 4X0XA 4XCSA 3G7JA 4XIHA 3D4TA 4I2UA 2HT9A 1XOAA 5DCGA 4YAVA 4EVMA 1ZYQB 1PGTA 3W8JA 4V2NA 2AB6A 2YOIA 2K6VA 3UARA 3UL3A 4XS4A 1AQWA 1Z3EA 4HDEA 2G2QA 2DLXA 2JZTA 4PNFA 4PTSA 3QMXA 5DALB 2JSZA 4IGJA 2MMOA 3IHGA 1GNEA 4MJBA 1H75A 3IXRA 2CVBA 4KB3A 2GSRA 2GDRA 2PMTA 4JEDA 2A2PA 4I8BA 3LORA 3TRQA 3IC4A 1N8JA 2DMMA 3GKMA 3F4SA 2CX3A 3UVHA 3HZ4A 1M99A 1TI1A 4ILFA 4K6XA 4PGTA 2WFCA 1FG4A 4G0IA 1MD3A 1K3YA 3LEFA 3BJ5A 2LJRA 1FB0A 1YEPA 3ZMLA 1MD4A 2I4AA 3FKFA 2H0GA 2J9HA 1TTZA 5JWRB 3TU3B 5DBQA 3IDVA 1F2EA 2H19A 4HQSA 4POLA 2D2ZA 1O85A 4MF5A 4ZB7A 1J9BA 1ZMAA 5F8BA 3HVVA 1Z9HA 3TRXA 2FD3A 1K0NA 1ZYNA 4QQ7A 2FNOA 1SVLA 2N5AA 2DIZA 5JCUA 2WCIA 3LXTA 2F3MA 3KIJA 3UOMA 3K8NA 1SK2A 1DBYA 3KCMA 4H86A 11GSA 3TDGA 1FW1A 2KLXA 3NOFA 1TI3A 1E6BA 1OYJA 4MZBA 4RI6A 2R0CA 3EU4A 2H1GA 3GTUB 3WT1A 2CQ9A 1OE8A 1PL2A 1JZRA 5JCWA 1QXHA 4IJIA 2N5BA 3APOA 1XXUA 2QKEA 5DCHA 3IAS2 2VOCA 2MBTA 5D93A 2TRXA 2OKAA 4MZCA 5ID2B 1ML6A 4WKWA 1SENA 4HU7A 1O73A 2LKUA 4EIPA 1TU7A 3APSA 3U6VA 2IMKA 4ZB9A 3W8SA 2ZCTA 3C1RA 4N3ZA 1GWCA 5FHIA 4EE0A 3LG6A 3H79A 4TW5A 1TK0B 2GT5A 4K7OA 5C04A 5HFKA 1K0BA 3DRNA 2YZUA 5F05A 4EDZA 2OBIA 4G2EA 4N11A 2VCWA 2DSAA 4NMUA 5J5NA 2X99A 1M9AA 3F8UA 2RLIA 1KBNA 1O6JA 3ZZXA 2YJHA 5DJMA 2GSQA 1GNWA 5H5QA 4OFTA 2LUSA 1ZGNA 2DC5A 2EIOA 1EEMA 4GQFA 2KOKA 2R0PA 1KTEA 2HRNA 3C7MA 5KEJA 4AKIA 4FYBA 2JSYA 3GH9A 1XVQA 2R3XA 2JZSA 3FEUA 2LRCA 5KOWA 2IMEA 2L57A 1OC9A 1BYEA 2R37A 3WGDA 4AJ8A 1AQVA 1PQNA 2C3QA 3C73A 2V2GA 2YV7A 3TJKA 4ZBDA 3ZVJD 4I97A 3EYTA 3TKSA 3I43A 5IQYA 3PINA 4KA0A 1AQXA 5JWQB 5GAND 5DVBA 5C00A 3FY7A 2PWJA 4MDCA 1FOVA 3DD3A 2ON5A 2PERA 4JR4A 1AAZA 3E9JB 4BWQA 4GWRA 1BX9A 1IYIA 3GSSA 1SVOA 2VL9A 1YQ1A 3M1GA 4EDYA 1XWCA 1FOHA 3JCML 4L5OA 5DALA 1B48A 3Q74A 3UAPA 2FLSA 3M9KA 5EVOA 3IC8A 4G19A 3TOUA 2IIYA 1V40A 4MLYA 1GTIA 2DJKA 3N9JA 1U3AA 5DJLA 1TP9A 5A4WA 4IHUA 5IOXA 1QFNA 4Q5QA 2L6DA 1HYUA 4PURA 3G7IA 3ZLPA 3M3MA 5ECQB 2B5EA 4HOJA 2KUCA 3QAGA 4Z2RA 3GRXA 5KN1A 4JRRA 1ZZYA 4AGSA 4NWYA 1UA5A 4GTUA 1CQGA 2C0EA 1M7TA 3LXZA 2DJ2A 4LA1A 4X4JA 3CSIA 1X9WB 1N25A 5EY6A 4G9HA 2AUVA 1ERVA 4KCAA 3NIVA 1K0CA 3HDCA 3KM6A 4ULXA 4I6XA 1K3OA 5LNKe 5JWOB 3WD6A 1EV9A 1R5PA 4HJ2A 2HRKB 3TKQA 4L0WA 2CT6A 1GULA 2EC4A 5HQPA 2N5FA 3VURA 4YQUA 4NAXA 2DMLA 3A2VA 3FW2A 2LNTA 4NHWA 4ZL8A 3IPZA 4FYCA 3TKPA 4K5RA 1U3IA 3TGZA 1GUHA 2B7JA 1ZYEA 2YCDA 2LNSA 1F3BA 3I69A 2H75A 3GTUA 1X5DA 1AW9A 2WB9A 1XW5A 4IQ1A 3HCZA 3QFAC 2VKZG 1XWGA 2J23A 2AV4A 3H93A 1XW9A 4NHZA 3TUEA 3FR6A 5EL8A 2YWIA 4XRDA 1Z5YE 2P5QA 4TN8A 3P8WA 4LL4B 3ZFLA 5ECIB 5ID2A 1IYHA 4CDOA 2VM2A 1QUWA 2DJ0A 1SD9A 5D73A 4OD7A 2LRTA 3RDWA 5A34B 3DMLA 3ERWA 1O7UA 4G01A 5GSTA 4TR3A 3C8EA 4V2LA 1YY7A 3V1WA 4EO3A 1K0MA 2HXKA 2EFCA 2LTKA 1GUMA 2FY6A 1X0RA 1OKTA 2WJUA 3E3EA 5KN0A 3DXBA 2XBIA 4POBA 5ECSA 2I1UA 2UV8G 2VLTA 4K2XA 1PSQA 4Z2UA 2H6ZA 3ERFA 2FGXA 1KNGA 3F6DA 3OR5A 4NXIA 1MEKA 3CWGA 5LD0A 3A2XA 3CBUA 3ISOA 4O5RA 6GSTA 4CHSA 4Q5RA 3W6GA 4HQZA 3UMAA 2H76A 3TJFA 3HYPA 2FA8A 3SBCA 3GNJA 1SKSB 1X9SB 5FT3A 3Q19A 1S3DA 4OWYA 2IN3A 5F07A 4TXVA 5D8IA 3NZNA 1FVJA 3CSJA 3RBTA 3RPPA 2C4JA 4JR6A 3HHVA 4TRXA 1T7PB 2K8SA 4YKGA 1YKCA 3IHQA 5AIXA 1M2DA 2GSSA 2L59A 4IBPA 2L6CA 1RK4A 1A2LA 3CRTA 2O7KA 4OFNA 2OACA 4A5PA 1TK8B 2IPAA 3ED3A 4BPYA 16GSA 5J4VA 9GSSA 1GLPA 1OE7A 1ZYPA 2GT6A 5DQYA 3DVXA 3KEBA 2PN8A 5IMDA 5IMAA 2VUPA 2HQTA 4XS6A 1GTAA 2CA8A 3AY8A 1G6YA 2ZUPA 1TXXA 1FHEA 5KOXA 4TR0A 2C3NA 1T8EB 4GSNA 4KDUA 5G30A 5F0GA 4KF9A 4L8EA 3EMXA 3MIXA 3HXSA 4E8EA 5CRHA 4PUFC 1O8XA 3UVTA 5L71A 1EZKA 5LCZA 4LMVA 2A4HA 1SJIA 5CRDA 2YJ7A 2MZCA 3WT2A 2VLVA 2NDOA 2XBQA 2L4CA 2HRKA 4F0BA 2CZ3A 1O8WA 1GP1A 1YF0A 2REMA 1Z6MA 3D5JA 4W66A 4PUAA 3O6TA 4KH7A 1F37A 2X49A 3L4NA 1CQHA 3CTGA 2DJ3A 1WRYA 1ABAA 2H74A 4WETA 3FR9A 2M46A 2PGTA 2E2MA 3BCIA 4ZIJA 3UBLA 4E8HA 4MABA 2CV4A 2LJAA 4OCFA 3WGXA 5H5SA 2F51A 1B9YC 4WF4A 1SK0A 3IK9A 3GUSA 5ELAA 2JZRA 3GL5A 2O8VB 3I9V2 5HFGA 2M72A 1F9MA 5BMUB 4I2TA 2JL4A 5ECMB 1BJXA 3KMOA 18GSA 4FQUA 3ME8A 3DIEA 3HY2A 4O5QA 2WRTA 4GSSA 2FWGA 3HMJG 1PMTA 5A34A 2EIRA 2YP6A 2RIIA 4AI6A 4X43A 1AC1A 1GSFA 3TB2A 5D9WA 2E0QA 2HSYA 4DEJA 1V58A 1B9XC 2GQLA 2X8HA 3U5RE 3WGEA 1JFUA 2EFHA 5D9VA 1Z6NA 4MP4A 4G0LA 4DVCA 4FYUA 2HLSA 3VWUA 1X5CA 4K7IA 3LWAA 2HRFA 2MMZA 4MF7A 1XOBA 5IMCA 5AIVA 1LBKA 4EF0A 3GX8A 5FWGA 4Z2TA 5AN1A 1XVWA 3ERGA 4G0KA 1BQ7A 3L9SA 2F8AA 4ICYA 1XPVA 2YWNA 4IELA 2H66A 3EU3A 1K3LA 2P31A 2Z9SA 4MMMA 4KW6A 2H1LA 4AJ6A 1EWXA 2HSMB 4K9ZA 1G7OA 1RW1A 1NSWA 3UEMA 1B4QA 1TXUA 1VRSD 2HRAA 5G5EA 3IK7A 3F9UA 3F3RA 3KJYA 1SU9A 1ZCPA 4WF5A 1OKDA 4Z7XA 3L78A 2OE3A 3BBYA 3HJPA 3GH6A 4YAPA 4MJCA 1SD8A 1XFLA 1WMJA 5HR1A 5D9XA 4ML6A 3HA9A 4HJMA 4IW9A 3QR6A 1S3AA 3EC3A 1SKRB 1X9MB 4PQIA 1Z7RA 4RI7A 2O87A 2WDUA 3MDKA 2R2JA 3GV1A 1TDIA 4TOPA 4KX4A 3CYNA 4ECJA 5CAXA 1YZXA 3ZIVA 4ECCA 4KDXA 4IN0A 3ZIJA 5JCGA 1OVNA 3H4KA 4PQHA 4ZBBA 2BTOT 1I5GA 3FK8A 2AAWA 3S9FA 3GA4A 4CY8A 4IVFA 3QPMA 2I9HA 4FH8A 1SVMA 2C1YA 2L5OA 2PU9C 4BL7B 1EP7A 2FWFA 1C72A 2IMIA 2JADA 5DAKB 2GZZA 3ZMKA 3QOUA 6GSSA 10GSA 1E2YA 3GYKA 2H0HA 2YZHA 1XWBA 3HKRA 6GSWA 1DSBA 3P7XA 4IP1A 2H8LA 1G0TA 2G0FA 4OO5A 1T00A 1J08A 3DGQA 2I3YA 2IMDA 5E4WA 5IMZA 1XIYA 2K18A 1R5AA 1VF1A 1Y25A 4ID0A 4J2FA 3GKNA 2WGRA 2IL3A 1O81A 2LQQA 1BEDA 1A8YA 1TU8A 3CRUA 3KMNA 5HR2A 4LLRA 2FA4A 3GFKA 1A2MA 3TKSE 4N0VA 5ECKB 4HS1A 3GHAA 3CMIA 1MDKA 5INYA 1OAZA 2VD0A 4KDYA 2QA1A 3VFIA 2EFDA 1XZOA 4ECIA 2LEGA 5A4UA 2QC7A 2E2GA 2H1BA 4LMWA 2RM6A 4GXZA 4RQXA 2VCVA 2ALBA 2YWOA 2VCTA 3ZL5A 5B8BA 2JU5A 5CYYA 2FHEA 4EKZA 1USBA 3FZ4A 2VCXA 2YNXA 5H5RA 3KXOA 2DJJA 4YQMA 3KGKA 4EIQA 4YQVA 1XW6A 4TR1B 4USSA 1A8LA 3ZFBA 5BMUA 1BF5A 1A0RP 4KCEA 1F3AA 4BVXA 2CVDA 1TW9A 1NW2A 4HI7A 4Q5FA 5AISA 5A1NA 1URMA 3ZREA 3D22A 3P2AA 2C3TA 20GSA 2F8FA 1TRSA 2RUFA 2IJYA 1GTBA 1SK1A 3UIWA 4HZ4A 4GRFA 4MNNA 3EE2A 2B5YA 4O7HA 3A3TA 4GCIA 4KUNA 2YN1A 2X8CA 4NV5A 1TRWA 1HD2A 5B6NA 2PBJA 3M9JA 2R6KA 4ZBAA 2CAIA 1GSEA 4KGIA 5E59A 2GGTA 1OC8A 4MK3A 2A2SA 3R3EA 1H4OA 2KP2A 4IP6A 3GN3A 1TOFA 4PX1A 1YVLA 1V9WA 4G10A 13GSA 4RQRA 2VM1A 6GSXA 3QFBC 3FHKA 4POKA 5HFIA 1KEBA 1ACVA 2HSMA 2F9SA 3MYDA 1NM3A 3UBKA 1GSSA 1W4VA 3KZQA 1PKZA 2PPTA 5G1LA 3KTBA 3LYPA 1ERUA 1B4PA 1M2BA 4ZB6A 2OE1A 3FR3A 2GSTA 5IIZA 2LQOA 1B8XA 6GSUA 2ZNMA 3HVSA 1MTCA 3IAM2 5EPFA 1GSYA 2H6YA 4V1Ag 1K0DA 4ZB8A 3D0ZA 1A0FA 2IWTA 3PPUA 4CY6A 2OBKA 4JE1A 1YJ6A 1PX6A 4YKFA 4MPFA 4TVEA 2KP1A 5A5HB 2QSIA 2AJQB 3TCOA 2EFEA 3IRAA 4K0NA 5ECPB 3RHCA 1TKDB 1J0FA 1QK8A 2H0IA 2H73A 3FMWA 2B1KA 1JHBA 2LJKA 3G7YA 1Q4JA 4QL7A 1NHYA 5J4YA 3EWLA 2KHPA 1SL1B 2HZFA 4DSSB 4BL7A 3ZTLA 3QD9A 4AF2A 1SYRA 3VLNA 5ECLB 3QDNA 1AUCA 2VLUA 2C0GA 5IPHA 4D73B 5DAKA 5ELGA 1FVKA 3F4RA 2PUKC 2WS2A 1YDKA 3H1NA 1DE2A 2OADA 3LJRA 1AIUA 5ECRB 4BVYB 5CREA 4K7NA 2PVQA 4TKYA 2VL3A 2GZYA 1WJKA 3E0UA 1T1VA 3RAZA 3BD2A 4L0UA 4QL9A 1DE1A 5DDLA 5G1KA 1PKWA 7GSSA 2A2RA 4POMA 4XRAA 3G9BA 2X4AA 3QAWA 3QCPA 4BA7A 2I81A 4V1Ap 2UZ8A 1BAYA 2GS3A 1GSQA 3I6AA 4MH2A 1M0UA 4F82A 1R4WA 2K9FA 2OE0A 1ZL9A 3VWWA 5AGYA 2VL2C 8GSSA 3L9UA 2K8VA 2O5VA 4NV2A 5IMVA 4TXOB 4F9ZA 2X8GA 1DUGA 2V6KA 1MDJA 3Q18A 17GSA 3LFLA 4PQ1A 4GLTA 3GX0A 1EV4A 3GURA 1I9DA 1EOGA 1XWAA 2C80A 3LYKA 2B6MA 4N30A 4XTSA 4WBRD 3IV4A 4JZQA 2DIYA 2DJ1A 5BRTA 4GSTA 4MZWA 3IA1A 4GQCA 2MMNA 4FO5A 2O89A 4O32A 4NPBA 4TR4A 1ZOFA 5CNWA 4TR1A 5HR3A 3TJJA 1BG5A 2VO4A 3HJMA 5IOWA 3FRCA 2O85A 1PX7A 4XHMA 4ZILA 2YPMA 1PN0A 1EEJA 2X64A 3Q6OA 1WOUA 2BMXA 3KTLA 1Z7PA 3EINA 3D4MA 4F2IA 2R5GA 5J9CA 4MJAA 1GL8A 1SL2B 1N2AA 5IMFA 1GSUA 3VPTA 3DKSA 5GAPD 3CTFA 4O92A 3ZYWA 3GMFA 4GF0A 2P5RA 4BVXB 2FUG2 1TRVA 4L5LA 2H6XA 2NVLA 3A5IA 1VGLA 5A1NB 3IOSA 4N0ZA 2C0DA 2H30A 5IO0A 1A24A 2XPDA 1JZOA 4MPGA 4EC0A 3A5WA 2OT3A 2VAFA 3F63A 1FB6A 4DSQA 3C1SA 2FCHA 3PR8A 3US3A 5ECOB 3TJGA 3F6FA 4IKHA 5CO3A 3L9VA 5F06A 4QMKA 3C71A 2HFDA 2LS5A 2PVOC 4IJ3A 3J7Yb 2AYTA 1A23A 1G6WA 3PGTA 1SJ6A 2HZEB 2LRNA 1AXDA 3DVWA 3MSZA 3GKXA 1W89A 2YWMA 3FZAA 3F4TA 4HEA2 1SYXA 5HR0A 3HZ8A 1GSDA 1K0AA 1LJRA 1V2AA 3LQ7A 4AKXB 5D96A 2FWHA 2L5LA 1WPIA 1PD21 2NBSA 3M8NA 4O5UA 5G2ZA 1SL0B 3GSTA 4HZ2A 1U87A 1THOA 4DSRA 2GTUA 3WYWA 4KE3A 2IFQB 4RUVA 1VF3A 1XCCA 3BOAA 6GSVA 1UN2A 4KSOA 3TOTA 2GVPA 1WWJA 5KN3A 4GDFA 3BCKA 1VF4A 2OJLA 4K1FA 1NHOA 3CSHA 3D6IA 3KP8A 1K0OA 2H70A 3EVIA 1Q98A 5D9TA 2LSTA 4HUAA 5A5HA 1HNAA 3FZ5A 22GSA 3R2QA 3DWVA 1U88A 3MWHA 2HSNB 3KP9A 2B5XA 2CZ2A 5J4UA 1M9BA 4KSMA 3J7Yk 4ACSA 2CVKA 3IE3A 2NTOA 1YF1A 3EPTA 1HNBA 3MAKA 4K8MA 4ML1A 4CW9A 4DSSA 1GH2A 1WP0A 1JLWA 4J56E 4K5SA 2B1LA 1X5EA 4OO4A 1R7HA 5CP1A 4X1UA 1M2AA 1G7EA 14GSA 4D73A 1ERTA 4BWSA 5J9BA 2R4VA 3UJ1A 2B7KA 4KAEA 4P3YB 2OA7A 3VK9A 1JLVA 2LV3A 2ON7A 4BVYA 1F6MC 4IQAA 5J41A 2GQMA 2GZPA 4PXOA 2MBSA 4EL1A 2WULA 1U6TA 3FYGA 1EP8A 3GIXA 2GLRA 5IM9A 1T4YA 1XBSA 19GSA 1THXA 4F03A 5DQSA 1PN9A 3DEXA 1EGOA 4OMVA 2XPEA 5ENUA 1GUKA 3PH9A 4K0GA 4WEYA 4WR5A 2EIQA 3ZRDA 2CAQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ON4 A;  4OCE A;  3KH7 A;  4XS4 B;  2HI7 A;  3DYR A;  1QGV A;  4MCU A;  4ECB A;  2A4V A;  5A5K A;  2H1D A;  3D21 A;  4TXO A;  1WE0 A;  3TRP A;  1VF2 A;  1ERW A;  2V41 A;  4KND A;  3VWX A;  3MNG A;  3ME7 A;  2L4Q A;  4MF6 A;  4Q5N A;  3HJO A;  3O76 A;  2VCZ A;  1XWK A;  5GZZ B;  4N10 A;  1WIK A;  2BJX A;  2DBC A;  2YAN A;  4WBJ A;  4XS1 A;  3KH9 A;  3GKK A;  2H1A A;  5CRW A;  2CX4 A;  2MYG A;  1S3C A;  3M0F A;  2RUE A;  5COH A;  12GS A;  2H01 A;  4K2D A;  5CRG A;  5J3R A;  3EUR A;  1EGR A;  3APQ A;  2NPB A;  4J57 E;  3KD0 A;  2VCQ A;  1HNC A;  3H8Q A;  4V2M A;  1YKA A;  3IR4 A;  1EOH A;  3FZ9 A;  1V98 A;  1FO5 A;  2XHF A;  4I5Q A;  4MJE A;  4ISD A;  1SKW B;  2XC2 A;  2VL2 A;  2FWE A;  3O3T A;  1UC7 A;  4F0C A;  1TK5 B;  2VD1 A;  2M80 A;  2MMA A;  2TRC P;  1R26 A;  3N5O A;  2RM5 A;  1T4Z A;  5IO2 A;  3CXG A;  1V57 A;  1PL1 A;  4ZXG A;  2E7P A;  3GL3 A;  4ZL7 A;  4WXT A;  4MH3 A;  4MA9 A;  1T3B A;  1OC3 A;  1Y6E A;  1QMV A;  5ECN B;  3F3Q A;  2HZE A;  2V6O A;  1ILO A;  5B7C A;  4EXJ A;  4FIW A;  3L0H A;  1LU4 A;  1GTU A;  2ES7 A;  1TJD A;  1JZW A;  5B8A A;  2HSH A;  1PA3 A;  3VPQ A;  5KN2 A;  2V32 A;  1GRX A;  1ST9 A;  2AHE A;  3TKS C;  2VIM A;  2IFQ A;  4JBB A;  5IPG A;  5B6M A;  1A2J A;  3IBH A;  2C0F A;  1GLQ A;  4LL1 B;  1PRX A;  2IMF A;  2H72 A;  3LGC A;  1YEX A;  4YH2 A;  5G5F A;  1MDI A;  4EUY A;  2HNL A;  1FAA A;  1UVZ A;  4ZL9 A;  2WZ9 A;  3ZVJ A;  2HE3 A;  3P90 A;  4HU9 A;  3TKR A;  2P0G A;  3EMP A;  4PNG A;  1JZD A;  3LSZ A;  4JU5 A;  2QGV A;  5ECH B;  2TIR A;  3F0I A;  5ABR A;  2V1M A;  2H71 A;  3HVX A;  4AJ7 A;  5GSS A;  5G31 A;  4OFM A;  1SJZ A;  3HD5 A;  2YV9 A;  3VI7 A;  3VWV A;  4IS0 A;  1HQO A;  4WR4 A;  3VI5 A;  1OC9 B;  1QQ2 A;  3RHB A;  3QAV A;  2C8U A;  3RPN A;  5A4V A;  2B3S A;  2JAC A;  3ZIT A;  3TJB A;  3SWL A;  3A2W A;  1TRU A;  2HYX A;  1RQM A;  6GSY A;  2GQK A;  4X0X A;  4XCS A;  3G7J A;  4XIH A;  3D4T A;  4I2U A;  2HT9 A;  1XOA A;  5DCG A;  4YAV A;  4EVM A;  1ZYQ B;  1PGT A;  3W8J A;  4V2N A;  2AB6 A;  2YOI A;  2K6V A;  3UAR A;  3UL3 A;  4XS4 A;  1AQW A;  1Z3E A;  4HDE A;  2G2Q A;  2DLX A;  2JZT A;  4PNF A;  4PTS A;  3QMX A;  5DAL B;  2JSZ A;  4IGJ A;  2MMO A;  1GNE A;  4MJB A;  1H75 A;  3IXR A;  2CVB A;  4KB3 A;  2GSR A;  2GDR A;  2PMT A;  4JED A;  4I8B A;  3LOR A;  3TRQ A;  3IC4 A;  1N8J A;  2DMM A;  3GKM A;  3F4S A;  2CX3 A;  3UVH A;  3HZ4 A;  1M99 A;  1TI1 A;  4ILF A;  4K6X A;  4PGT A;  2WFC A;  1FG4 A;  4G0I A;  1MD3 A;  1K3Y A;  3LEF A;  3BJ5 A;  2LJR A;  1FB0 A;  1YEP A;  3ZML A;  1MD4 A;  2I4A A;  3FKF A;  2H0G A;  2J9H A;  1TTZ A;  5JWR B;  5DBQ A;  3IDV A;  1F2E A;  2H19 A;  4HQS A;  4POL A;  2D2Z A;  1O85 A;  4MF5 A;  1J9B A;  1ZMA A;  5F8B A;  3HVV A;  1Z9H A;  3TRX A;  2FD3 A;  1K0N A;  4QQ7 A;  2FNO A;  2DIZ A;  2N5A A;  5JCU A;  2WCI A;  3LXT A;  2F3M A;  3KIJ A;  3UOM A;  3K8N A;  1SK2 A;  1DBY A;  3KCM A;  4H86 A;  11GS A;  3TDG A;  1FW1 A;  2KLX A;  3NOF A;  1TI3 A;  1E6B A;  1OYJ A;  4MZB A;  4RI6 A;  3EU4 A;  2H1G A;  3GTU B;  3WT1 A;  2CQ9 A;  1OE8 A;  1PL2 A;  1JZR A;  5JCW A;  1QXH A;  4IJI A;  2N5B A;  3APO A;  1XXU A;  2QKE A;  5DCH A;  3IAS 2;  2VOC A;  2MBT A;  5D93 A;  2TRX A;  2OKA A;  4MZC A;  5ID2 B;  1ML6 A;  4WKW A;  1SEN A;  4HU7 A;  1O73 A;  2LKU A;  1TU7 A;  3APS A;  3U6V A;  2IMK A;  4ZB9 A;  3W8S A;  2ZCT A;  3C1R A;  1GWC A;  5FHI A;  4EE0 A;  3LG6 A;  3H79 A;  4TW5 A;  1TK0 B;  2GT5 A;  4K7O A;  5C04 A;  5HFK A;  1K0B A;  3DRN A;  2YZU A;  5F05 A;  4EDZ A;  2OBI A;  4G2E A;  4N11 A;  2VCW A;  2DSA A;  4NMU A;  5J5N A;  2X99 A;  1M9A A;  3F8U A;  2RLI A;  1KBN A;  1O6J A;  3ZZX A;  2YJH A;  5DJM A;  2GSQ A;  1GNW A;  5H5Q A;  4OFT A;  2LUS A;  1ZGN A;  2DC5 A;  2EIO A;  1EEM A;  4GQF A;  2KOK A;  1KTE A;  2HRN A;  3C7M A;  5KEJ A;  4FYB A;  2JSY A;  3GH9 A;  1XVQ A;  2R3X A;  2JZS A;  3FEU A;  2LRC A;  2IME A;  2L57 A;  1OC9 A;  1BYE A;  2R37 A;  3WGD A;  4AJ8 A;  1AQV A;  1PQN A;  2C3Q A;  3C73 A;  2V2G A;  2YV7 A;  3TJK A;  4ZBD A;  3ZVJ D;  4I97 A;  3EYT A;  3TKS A;  3I43 A;  5IQY A;  3PIN A;  4KA0 A;  1AQX A;  5JWQ B;  5GAN D;  5DVB A;  5C00 A;  3FY7 A;  2PWJ A;  4MDC A;  1FOV A;  3DD3 A;  2ON5 A;  2PER A;  4JR4 A;  1AAZ A;  3E9J B;  4BWQ A;  4GWR A;  1BX9 A;  1IYI A;  3GSS A;  2VL9 A;  1YQ1 A;  3M1G A;  4EDY A;  1XWC A;  3JCM L;  4L5O A;  5DAL A;  1B48 A;  3Q74 A;  3UAP A;  2FLS A;  3M9K A;  5EVO A;  3IC8 A;  4G19 A;  3TOU A;  2IIY A;  1V40 A;  4MLY A;  1GTI A;  2DJK A;  3N9J A;  1U3A A;  5DJL A;  1TP9 A;  5A4W A;  4IHU A;  5IOX A;  1QFN A;  4Q5Q A;  2L6D A;  1HYU A;  4PUR A;  3G7I A;  3ZLP A;  3M3M A;  5ECQ B;  2B5E A;  4HOJ A;  2KUC A;  3QAG A;  3GRX A;  5KN1 A;  4JRR A;  1ZZY A;  4AGS A;  4NWY A;  1UA5 A;  4GTU A;  1CQG A;  2C0E A;  1M7T A;  3LXZ A;  2DJ2 A;  4LA1 A;  3CSI A;  1X9W B;  5EY6 A;  4G9H A;  2AUV A;  1ERV A;  4KCA A;  3NIV A;  1K0C A;  3HDC A;  3KM6 A;  4ULX A;  4I6X A;  1K3O A;  5LNK e;  5JWO B;  3WD6 A;  1EV9 A;  1R5P A;  4HJ2 A;  2HRK B;  3TKQ A;  4L0W A;  2CT6 A;  1GUL A;  2EC4 A;  5HQP A;  2N5F A;  3VUR A;  4YQU A;  4NAX A;  2DML A;  3A2V A;  3FW2 A;  2LNT A;  4NHW A;  4ZL8 A;  3IPZ A;  4FYC A;  3TKP A;  1U3I A;  3TGZ A;  1GUH A;  2B7J A;  1ZYE A;  2YCD A;  2LNS A;  1F3B A;  3I69 A;  2H75 A;  3GTU A;  1X5D A;  1AW9 A;  2WB9 A;  1XW5 A;  4IQ1 A;  3HCZ A;  3QFA C;  1XWG A;  2J23 A;  2AV4 A;  3H93 A;  1XW9 A;  4NHZ A;  3TUE A;  3FR6 A;  5EL8 A;  2YWI A;  4XRD A;  1Z5Y E;  2P5Q A;  4TN8 A;  3P8W A;  4LL4 B;  3ZFL A;  5ECI B;  5ID2 A;  1IYH A;  4CDO A;  2VM2 A;  1QUW A;  2DJ0 A;  1SD9 A;  5D73 A;  4OD7 A;  2LRT A;  3RDW A;  3DML A;  3ERW A;  1O7U A;  5GST A;  4TR3 A;  3C8E A;  4V2L A;  1YY7 A;  3V1W A;  4EO3 A;  1K0M A;  2HXK A;  2LTK A;  1GUM A;  2FY6 A;  1X0R A;  1OKT A;  2WJU A;  3E3E A;  5KN0 A;  3DXB A;  2XBI A;  4POB A;  5ECS A;  2I1U A;  2VLT A;  1PSQ A;  2H6Z A;  3ERF A;  2FGX A;  1KNG A;  3F6D A;  3OR5 A;  4NXI A;  1MEK A;  5LD0 A;  3A2X A;  3CBU A;  3ISO A;  4O5R A;  6GST A;  4CHS A;  4Q5R A;  3W6G A;  4HQZ A;  3UMA A;  2H76 A;  3TJF A;  3HYP A;  2FA8 A;  3SBC A;  3GNJ A;  1SKS B;  1X9S B;  5FT3 A;  3Q19 A;  1S3D A;  4OWY A;  2IN3 A;  5F07 A;  4TXV A;  5D8I A;  3NZN A;  1FVJ A;  3CSJ A;  3RBT A;  3RPP A;  2C4J A;  4JR6 A;  3HHV A;  4TRX A;  1T7P B;  2K8S A;  1YKC A;  3IHQ A;  5AIX A;  1M2D A;  2GSS A;  2L59 A;  4IBP A;  2L6C A;  1RK4 A;  1A2L A;  3CRT A;  2O7K A;  4OFN A;  2OAC A;  1TK8 B;  2IPA A;  3ED3 A;  4BPY A;  16GS A;  9GSS A;  1GLP A;  1OE7 A;  2GT6 A;  5DQY A;  3DVX A;  3KEB A;  2PN8 A;  5IMD A;  5IMA A;  2VUP A;  2HQT A;  4XS6 A;  1GTA A;  2CA8 A;  3AY8 A;  1G6Y A;  2ZUP A;  1TXX A;  1FHE A;  4TR0 A;  2C3N A;  1T8E B;  4GSN A;  4KDU A;  5G30 A;  5F0G A;  4KF9 A;  4L8E A;  3EMX A;  3HXS A;  4E8E A;  5CRH A;  4PUF C;  1O8X A;  3UVT A;  5L71 A;  1EZK A;  5LCZ A;  4LMV A;  1SJI A;  5CRD A;  2YJ7 A;  2MZC A;  3WT2 A;  2VLV A;  2NDO A;  2XBQ A;  2L4C A;  2HRK A;  4F0B A;  2CZ3 A;  1O8W A;  1GP1 A;  1YF0 A;  2REM A;  1Z6M A;  3D5J A;  4PUA A;  3O6T A;  4KH7 A;  1F37 A;  3L4N A;  1CQH A;  3CTG A;  2DJ3 A;  1WRY A;  1ABA A;  2H74 A;  4WET A;  3FR9 A;  2M46 A;  2PGT A;  2E2M A;  3BCI A;  4ZIJ A;  3UBL A;  4E8H A;  4MAB A;  2CV4 A;  2LJA A;  4OCF A;  3WGX A;  5H5S A;  2F51 A;  1B9Y C;  4WF4 A;  1SK0 A;  3IK9 A;  3GUS A;  5ELA A;  2JZR A;  3GL5 A;  2O8V B;  3I9V 2;  5HFG A;  2M72 A;  1F9M A;  4I2T A;  2JL4 A;  5ECM B;  1BJX A;  3KMO A;  18GS A;  4FQU A;  3ME8 A;  3DIE A;  3HY2 A;  2WRT A;  4GSS A;  2FWG A;  1PMT A;  2EIR A;  2YP6 A;  2RII A;  4X43 A;  1AC1 A;  1GSF A;  3TB2 A;  5D9W A;  2E0Q A;  2HSY A;  4DEJ A;  1V58 A;  1B9X C;  2GQL A;  2X8H A;  3U5R E;  3WGE A;  1JFU A;  5D9V A;  1Z6N A;  4MP4 A;  4G0L A;  4DVC A;  4FYU A;  2HLS A;  3VWU A;  1X5C A;  4K7I A;  3LWA A;  2HRF A;  2MMZ A;  4MF7 A;  1XOB A;  5IMC A;  5AIV A;  1LBK A;  4EF0 A;  3GX8 A;  5FWG A;  5AN1 A;  1XVW A;  3ERG A;  4G0K A;  1BQ7 A;  3L9S A;  2F8A A;  1XPV A;  2YWN A;  4IEL A;  2H66 A;  3EU3 A;  1K3L A;  2P31 A;  2Z9S A;  4MMM A;  4KW6 A;  4AJ6 A;  1EWX A;  2HSM B;  4K9Z A;  1G7O A;  1RW1 A;  1NSW A;  3UEM A;  1B4Q A;  1VRS D;  2HRA A;  5G5E A;  3IK7 A;  3F9U A;  3F3R A;  3KJY A;  1SU9 A;  1ZCP A;  4WF5 A;  1OKD A;  4Z7X A;  3L78 A;  2OE3 A;  3BBY A;  3HJP A;  3GH6 A;  4YAP A;  4MJC A;  1SD8 A;  1XFL A;  1WMJ A;  5HR1 A;  5D9X A;  4ML6 A;  3HA9 A;  4HJM A;  4IW9 A;  3QR6 A;  1S3A A;  3EC3 A;  1SKR B;  1X9M B;  4PQI A;  1Z7R A;  4RI7 A;  2O87 A;  2WDU A;  3MDK A;  2R2J A;  3GV1 A;  1TDI A;  4TOP A;  4KX4 A;  3CYN A;  4ECJ A;  5CAX A;  1YZX A;  3ZIV A;  4ECC A;  4KDX A;  4IN0 A;  3ZIJ A;  5JCG A;  1OVN A;  3H4K A;  4PQH A;  4ZBB A;  2BTO T;  1I5G A;  3FK8 A;  2AAW A;  3S9F A;  3GA4 A;  4IVF A;  3QPM A;  2I9H A;  4FH8 A;  2C1Y A;  2L5O A;  2PU9 C;  4BL7 B;  1EP7 A;  2FWF A;  1C72 A;  2IMI A;  2JAD A;  5DAK B;  2GZZ A;  3ZMK A;  3QOU A;  6GSS A;  10GS A;  1E2Y A;  3GYK A;  2H0H A;  2YZH A;  1XWB A;  3HKR A;  6GSW A;  1DSB A;  3P7X A;  4IP1 A;  2H8L A;  1G0T A;  2G0F A;  4OO5 A;  1T00 A;  1J08 A;  3DGQ A;  2I3Y A;  2IMD A;  5E4W A;  5IMZ A;  1XIY A;  2K18 A;  1R5A A;  1VF1 A;  1Y25 A;  4ID0 A;  4J2F A;  3GKN A;  2WGR A;  2IL3 A;  1O81 A;  2LQQ A;  1BED A;  1A8Y A;  1TU8 A;  3CRU A;  3KMN A;  5HR2 A;  4LLR A;  2FA4 A;  3GFK A;  1A2M A;  3TKS E;  4N0V A;  5ECK B;  4HS1 A;  3GHA A;  3CMI A;  1MDK A;  5INY A;  1OAZ A;  2VD0 A;  4KDY A;  3VFI A;  1XZO A;  4ECI A;  2LEG A;  5A4U A;  2QC7 A;  2E2G A;  2H1B A;  4LMW A;  2RM6 A;  4GXZ A;  4RQX A;  2VCV A;  2ALB A;  2YWO A;  2VCT A;  3ZL5 A;  5B8B A;  2JU5 A;  5CYY A;  2FHE A;  4EKZ A;  1USB A;  3FZ4 A;  2VCX A;  2YNX A;  5H5R A;  3KXO A;  2DJJ A;  4YQM A;  3KGK A;  4YQV A;  1XW6 A;  4TR1 B;  4USS A;  1A8L A;  3ZFB A;  5BMU A;  1A0R P;  4KCE A;  1F3A A;  4BVX A;  2CVD A;  1TW9 A;  1NW2 A;  4HI7 A;  4Q5F A;  5AIS A;  1URM A;  3ZRE A;  3D22 A;  3P2A A;  2C3T A;  20GS A;  2F8F A;  1TRS A;  2RUF A;  2IJY A;  1GTB A;  1SK1 A;  3UIW A;  4HZ4 A;  4GRF A;  3EE2 A;  2B5Y A;  4O7H A;  3A3T A;  4GCI A;  4KUN A;  2YN1 A;  2X8C A;  4NV5 A;  1TRW A;  1HD2 A;  5B6N A;  2PBJ A;  3M9J A;  2R6K A;  4ZBA A;  2CAI A;  1GSE A;  4KGI A;  5E59 A;  2GGT A;  1OC8 A;  4MK3 A;  2A2S A;  3R3E A;  1H4O A;  2KP2 A;  4IP6 A;  3GN3 A;  1TOF A;  4PX1 A;  1V9W A;  4G10 A;  13GS A;  4RQR A;  2VM1 A;  6GSX A;  3QFB C;  3FHK A;  4POK A;  5HFI A;  1KEB A;  1ACV A;  2HSM A;  2F9S A;  1NM3 A;  3UBK A;  1GSS A;  1W4V A;  3KZQ A;  1PKZ A;  2PPT A;  5G1L A;  3KTB A;  3LYP A;  1ERU A;  1B4P A;  1M2B A;  4ZB6 A;  2OE1 A;  3FR3 A;  2GST A;  5IIZ A;  2LQO A;  1B8X A;  6GSU A;  2ZNM A;  3HVS A;  1MTC A;  3IAM 2;  5EPF A;  1GSY A;  2H6Y A;  4V1A g;  1K0D A;  4ZB8 A;  3D0Z A;  1A0F A;  2IWT A;  3PPU A;  2OBK A;  4JE1 A;  1YJ6 A;  1PX6 A;  4MPF A;  4TVE A;  2KP1 A;  2QSI A;  2AJQ B;  3TCO A;  3IRA A;  4K0N A;  5ECP B;  3RHC A;  1TKD B;  1J0F A;  1QK8 A;  2H0I A;  2H73 A;  2B1K A;  1JHB A;  2LJK A;  3G7Y A;  1Q4J A;  4QL7 A;  1NHY A;  3EWL A;  2KHP A;  1SL1 B;  2HZF A;  4DSS B;  4BL7 A;  3ZTL A;  3QD9 A;  4AF2 A;  1SYR A;  3VLN A;  5ECL B;  3QDN A;  1AUC A;  2VLU A;  2C0G A;  5IPH A;  4D73 B;  5DAK A;  5ELG A;  1FVK A;  3F4R A;  2PUK C;  2WS2 A;  1YDK A;  3H1N A;  1DE2 A;  2OAD A;  3LJR A;  1AIU A;  5ECR B;  4BVY B;  5CRE A;  4K7N A;  2PVQ A;  4TKY A;  2VL3 A;  2GZY A;  1WJK A;  3E0U A;  1T1V A;  3RAZ A;  3BD2 A;  4L0U A;  4QL9 A;  1DE1 A;  5DDL A;  5G1K A;  1PKW A;  7GSS A;  2A2R A;  4POM A;  4XRA A;  3G9B A;  3QAW A;  3QCP A;  4BA7 A;  2I81 A;  4V1A p;  2UZ8 A;  1BAY A;  2GS3 A;  1GSQ A;  3I6A A;  4MH2 A;  1M0U A;  4F82 A;  1R4W A;  2K9F A;  2OE0 A;  1ZL9 A;  3VWW A;  5AGY A;  2VL2 C;  8GSS A;  3L9U A;  2K8V A;  4NV2 A;  5IMV A;  4TXO B;  4F9Z A;  2X8G A;  1DUG A;  2V6K A;  1MDJ A;  3Q18 A;  17GS A;  3LFL A;  4PQ1 A;  4GLT A;  1EV4 A;  3GX0 A;  3GUR A;  1I9D A;  1EOG A;  1XWA A;  2C80 A;  3LYK A;  2B6M A;  4N30 A;  4XTS A;  4WBR D;  3IV4 A;  4JZQ A;  2DIY A;  2DJ1 A;  4GST A;  4MZW A;  3IA1 A;  4GQC A;  2MMN A;  4FO5 A;  2O89 A;  4O32 A;  4NPB A;  4TR4 A;  1ZOF A;  5CNW A;  4TR1 A;  5HR3 A;  3TJJ A;  1BG5 A;  2VO4 A;  3HJM A;  5IOW A;  3FRC A;  2O85 A;  1PX7 A;  4XHM A;  4ZIL A;  2YPM A;  1EEJ A;  2X64 A;  3Q6O A;  1WOU A;  2BMX A;  3KTL A;  1Z7P A;  3EIN A;  3D4M A;  4F2I A;  2R5G A;  5J9C A;  4MJA A;  1GL8 A;  1SL2 B;  1N2A A;  5IMF A;  1GSU A;  3VPT A;  3DKS A;  5GAP D;  3CTF A;  4O92 A;  3ZYW A;  3GMF A;  4GF0 A;  2P5R A;  4BVX B;  2FUG 2;  1TRV A;  4L5L A;  2H6X A;  2NVL A;  1VGL A;  4N0Z A;  3IOS A;  2C0D A;  2H30 A;  5IO0 A;  1A24 A;  2XPD A;  1JZO A;  4MPG A;  4EC0 A;  3A5W A;  2VAF A;  3F63 A;  1FB6 A;  4DSQ A;  3C1S A;  2FCH A;  3PR8 A;  3US3 A;  5ECO B;  3TJG A;  3F6F A;  4IKH A;  5CO3 A;  3L9V A;  5F06 A;  3C71 A;  2HFD A;  2LS5 A;  2PVO C;  4IJ3 A;  3J7Y b;  2AYT A;  1A23 A;  1G6W A;  3PGT A;  1SJ6 A;  2HZE B;  2LRN A;  1AXD A;  3DVW A;  3MSZ A;  3GKX A;  1W89 A;  2YWM A;  3FZA A;  3F4T A;  4HEA 2;  1SYX A;  5HR0 A;  3HZ8 A;  1GSD A;  1K0A A;  1LJR A;  1V2A A;  3LQ7 A;  5D96 A;  2FWH A;  2L5L A;  1WPI A;  1PD2 1;  2NBS A;  3M8N A;  5G2Z A;  1SL0 B;  3GST A;  4HZ2 A;  1U87 A;  1THO A;  4DSR A;  2GTU A;  3WYW A;  4KE3 A;  2IFQ B;  4RUV A;  1VF3 A;  1XCC A;  3BOA A;  6GSV A;  1UN2 A;  4KSO A;  3TOT A;  2GVP A;  1WWJ A;  5KN3 A;  3BCK A;  1VF4 A;  2OJL A;  4K1F A;  1NHO A;  3CSH A;  3D6I A;  3KP8 A;  1K0O A;  2H70 A;  3EVI A;  1Q98 A;  5D9T A;  2LST A;  4HUA A;  1HNA A;  3FZ5 A;  22GS A;  3R2Q A;  3DWV A;  1U88 A;  3MWH A;  2HSN B;  3KP9 A;  2B5X A;  2CZ2 A;  5J4U A;  1M9B A;  4KSM A;  3J7Y k;  4ACS A;  2CVK A;  3IE3 A;  2NTO A;  1YF1 A;  1HNB A;  3MAK A;  4K8M A;  4ML1 A;  4CW9 A;  4DSS A;  1GH2 A;  1WP0 A;  1JLW A;  4J56 E;  2B1L A;  1X5E A;  4OO4 A;  1R7H A;  5CP1 A;  4X1U A;  1M2A A;  1G7E A;  14GS A;  4D73 A;  1ERT A;  4BWS A;  5J9B A;  2R4V A;  3UJ1 A;  2B7K A;  4KAE A;  4P3Y B;  2OA7 A;  3VK9 A;  1JLV A;  2LV3 A;  2ON7 A;  4BVY A;  1F6M C;  4IQA A;  5J41 A;  2GQM A;  2GZP A;  4PXO A;  2MBS A;  4EL1 A;  2WUL A;  1U6T A;  3FYG A;  1EP8 A;  3GIX A;  2GLR A;  5IM9 A;  1T4Y A;  1XBS A;  19GS A;  1THX A;  4F03 A;  5DQS A;  1PN9 A;  3DEX A;  1EGO A;  4OMV A;  2XPE A;  5ENU A;  1GUK A;  3PH9 A;  4K0G A;  4WEY A;  4WR5 A;  2EIQ A;  3ZRD A;  2CAQ A; 
#chains in the Genus database with same CATH topology
 1ON4 A;  4OCE A;  3KH7 A;  4XS4 B;  2HI7 A;  3DYR A;  1QGV A;  4MCU A;  4ECB A;  2A4V A;  5A5K A;  2H1D A;  3D21 A;  4TXO A;  1WE0 A;  3TRP A;  1VF2 A;  1ERW A;  2V41 A;  4KND A;  4AKH A;  3VWX A;  3MNG A;  4AKG A;  3ME7 A;  2L4Q A;  4MF6 A;  4Q5N A;  3HJO A;  2QA2 A;  3O76 A;  2VCZ A;  1XWK A;  5GZZ B;  4N10 A;  1WIK A;  2BJX A;  2DBC A;  2YAN A;  4WBJ A;  4XS1 A;  3KH9 A;  3GKK A;  2H1A A;  5CRW A;  2CX4 A;  2MYG A;  1S3C A;  3M0F A;  2RUE A;  5COH A;  12GS A;  2H01 A;  4K2D A;  5CRG A;  5J3R A;  3EUR A;  1EGR A;  3APQ A;  2NPB A;  4J57 E;  3KD0 A;  2VCQ A;  1HNC A;  3H8Q A;  4V2M A;  1YKA A;  3IR4 A;  1EOH A;  3FZ9 A;  1V98 A;  1FO5 A;  2XHF A;  4I5Q A;  4MJE A;  4ISD A;  1SKW B;  2XC2 A;  2VL2 A;  5J40 A;  2FWE A;  3O3T A;  1UC7 A;  4F0C A;  1TK5 B;  2DKH A;  2VD1 A;  2M80 A;  2MMA A;  2TRC P;  1R26 A;  3N5O A;  2RM5 A;  3RGB C;  1T4Z A;  1BG1 A;  5IO2 A;  3CXG A;  1V57 A;  1PL1 A;  4ZXG A;  2DKI A;  2E7P A;  3GL3 A;  4ZL7 A;  4WXT A;  4MH3 A;  4MA9 A;  1T3B A;  1OC3 A;  1Y6E A;  1QMV A;  5ECN B;  3F3Q A;  2HZE A;  2V6O A;  1ILO A;  5B7C A;  1Y1U A;  4EXJ A;  4FIW A;  3L0H A;  1LU4 A;  4E68 A;  2R0G A;  1M3I A;  1GTU A;  2ES7 A;  1TJD A;  1JZW A;  5B8A A;  2HSH A;  1PA3 A;  3VPQ A;  5KN2 A;  2V32 A;  1GRX A;  2WVX B;  1ST9 A;  2AHE A;  3TKS C;  2VIM A;  2IFQ A;  4JBB A;  5IPG A;  5B6M A;  1A2J A;  3IBH A;  2C0F A;  1GLQ A;  4LL1 B;  1PRX A;  2IMF A;  2H72 A;  3LGC A;  1YEX A;  4YH2 A;  5G5F A;  1MDI A;  4EUY A;  2HNL A;  1FAA A;  1UVZ A;  4ZL9 A;  2WZ9 A;  3ZVJ A;  2HE3 A;  3P90 A;  4HU9 A;  3TKR A;  2P0G A;  3EMP A;  4PNG A;  1JZD A;  3LSZ A;  4JU5 A;  2HSN A;  2QGV A;  3LW9 A;  5ECH B;  2TIR A;  3F0I A;  5ABR A;  2V1M A;  5J47 A;  4PI2 C;  2H71 A;  3HVX A;  4AJ7 A;  5GSS A;  5G31 A;  4OFM A;  1SJZ A;  3HD5 A;  2YV9 A;  3VI7 A;  3VWV A;  4IS0 A;  1HQO A;  4WR4 A;  3VI5 A;  1OC9 B;  1QQ2 A;  4PI0 C;  3RHB A;  3QAV A;  2C8U A;  3RPN A;  5A4V A;  2B3S A;  2JAC A;  3ZIT A;  3RFR C;  3TJB A;  3SWL A;  3A2W A;  1TRU A;  2HYX A;  1RQM A;  6GSY A;  2GQK A;  4X0X A;  4XCS A;  3G7J A;  4XIH A;  3D4T A;  4I2U A;  2HT9 A;  1XOA A;  5DCG A;  4YAV A;  4EVM A;  1ZYQ B;  1PGT A;  3W8J A;  4V2N A;  2AB6 A;  2YOI A;  2K6V A;  3UAR A;  3UL3 A;  4XS4 A;  1AQW A;  1Z3E A;  4HDE A;  2G2Q A;  2DLX A;  2JZT A;  4PNF A;  4PTS A;  3QMX A;  5DAL B;  2JSZ A;  4IGJ A;  2MMO A;  3IHG A;  1GNE A;  4MJB A;  1H75 A;  3IXR A;  2CVB A;  4KB3 A;  2GSR A;  2GDR A;  4HSC X;  2PMT A;  4JED A;  2A2P A;  4I8B A;  3LOR A;  3TRQ A;  3IC4 A;  1N8J A;  2DMM A;  3GKM A;  3F4S A;  2CX3 A;  3UVH A;  3HZ4 A;  1M99 A;  1TI1 A;  4ILF A;  4K6X A;  4PGT A;  2WFC A;  1FG4 A;  4G0I A;  1MD3 A;  1K3Y A;  3LEF A;  3BJ5 A;  2LJR A;  1FB0 A;  1YEP A;  3ZML A;  1MD4 A;  2I4A A;  3FKF A;  2H0G A;  2J9H A;  1TTZ A;  5JWR B;  3TU3 B;  5DBQ A;  3IDV A;  1F2E A;  2H19 A;  4HQS A;  4POL A;  2D2Z A;  1O85 A;  4MF5 A;  4ZB7 A;  1J9B A;  1ZMA A;  5F8B A;  3HVV A;  1Z9H A;  3TRX A;  2FD3 A;  1K0N A;  1ZYN A;  4QQ7 A;  2FNO A;  1SVL A;  2N5A A;  2DIZ A;  5JCU A;  2WCI A;  3LXT A;  2F3M A;  3KIJ A;  3UOM A;  3K8N A;  1SK2 A;  1DBY A;  3KCM A;  4H86 A;  11GS A;  3TDG A;  1FW1 A;  2KLX A;  3NOF A;  1TI3 A;  1E6B A;  1OYJ A;  4MZB A;  4RI6 A;  2R0C A;  3EU4 A;  2H1G A;  3GTU B;  3WT1 A;  2CQ9 A;  1OE8 A;  1PL2 A;  1JZR A;  5JCW A;  1QXH A;  4IJI A;  2N5B A;  3APO A;  1XXU A;  2QKE A;  5DCH A;  3IAS 2;  2VOC A;  2MBT A;  5D93 A;  2TRX A;  2OKA A;  4MZC A;  5ID2 B;  1ML6 A;  4WKW A;  1SEN A;  4HU7 A;  1O73 A;  2LKU A;  4EIP A;  1TU7 A;  3APS A;  3U6V A;  2IMK A;  4ZB9 A;  3W8S A;  2ZCT A;  3C1R A;  4N3Z A;  2WVX A;  1GWC A;  5FHI A;  4EE0 A;  3LG6 A;  3H79 A;  4TW5 A;  1TK0 B;  2GT5 A;  4K7O A;  5C04 A;  5HFK A;  1K0B A;  3DRN A;  2YZU A;  5F05 A;  4EDZ A;  2OBI A;  4G2E A;  4N11 A;  2VCW A;  2DSA A;  4NMU A;  5J5N A;  2X99 A;  1M9A A;  3F8U A;  2RLI A;  1KBN A;  1O6J A;  3ZZX A;  2YJH A;  5DJM A;  2GSQ A;  1GNW A;  5H5Q A;  4OFT A;  2LUS A;  1ZGN A;  2DC5 A;  2EIO A;  1EEM A;  4GQF A;  2KOK A;  2R0P A;  1KTE A;  2HRN A;  3C7M A;  5KEJ A;  4AKI A;  4FYB A;  2JSY A;  3GH9 A;  1XVQ A;  2R3X A;  2JZS A;  3FEU A;  2LRC A;  5KOW A;  2IME A;  2L57 A;  1OC9 A;  1BYE A;  2R37 A;  3WGD A;  4AJ8 A;  1AQV A;  1PQN A;  2C3Q A;  3C73 A;  2V2G A;  2YV7 A;  3TJK A;  4ZBD A;  3ZVJ D;  4I97 A;  3EYT A;  3TKS A;  3I43 A;  5IQY A;  3PIN A;  4KA0 A;  1AQX A;  2WVZ A;  5JWQ B;  5GAN D;  5DVB A;  5C00 A;  3FY7 A;  2PWJ A;  4MDC A;  1FOV A;  3DD3 A;  2ON5 A;  2PER A;  4JR4 A;  1AAZ A;  3E9J B;  4BWQ A;  4GWR A;  1BX9 A;  1IYI A;  3GSS A;  1SVO A;  2VL9 A;  1YQ1 A;  3M1G A;  4EDY A;  1XWC A;  1FOH A;  3JCM L;  4L5O A;  5DAL A;  1B48 A;  3Q74 A;  3UAP A;  2FLS A;  3M9K A;  5EVO A;  3IC8 A;  4G19 A;  3TOU A;  2IIY A;  1V40 A;  4MLY A;  1GTI A;  2DJK A;  3N9J A;  1U3A A;  5DJL A;  1TP9 A;  5A4W A;  4IHU A;  5IOX A;  1QFN A;  4Q5Q A;  2L6D A;  1HYU A;  4PUR A;  3G7I A;  3ZLP A;  3M3M A;  5ECQ B;  2B5E A;  4HOJ A;  2KUC A;  3QAG A;  4Z2R A;  3GRX A;  5KN1 A;  4JRR A;  1ZZY A;  4AGS A;  4NWY A;  1UA5 A;  4GTU A;  1CQG A;  2C0E A;  1M7T A;  3LXZ A;  2DJ2 A;  4LA1 A;  4X4J A;  3CSI A;  1X9W B;  1N25 A;  5EY6 A;  4G9H A;  2AUV A;  1ERV A;  4KCA A;  3NIV A;  1K0C A;  3HDC A;  3KM6 A;  4ULX A;  4I6X A;  1K3O A;  5LNK e;  5JWO B;  3WD6 A;  1EV9 A;  1R5P A;  4HJ2 A;  2HRK B;  3TKQ A;  4L0W A;  2CT6 A;  1GUL A;  2EC4 A;  5HQP A;  2N5F A;  3VUR A;  4YQU A;  4NAX A;  2DML A;  3A2V A;  3HVN A;  3FW2 A;  2LNT A;  4NHW A;  4ZL8 A;  3IPZ A;  4FYC A;  3TKP A;  4K5R A;  1U3I A;  3TGZ A;  1GUH A;  2B7J A;  1ZYE A;  2YCD A;  2LNS A;  1F3B A;  3I69 A;  2H75 A;  3GTU A;  1X5D A;  1AW9 A;  2WB9 A;  1XW5 A;  4IQ1 A;  3HCZ A;  3QFA C;  2VKZ G;  1XWG A;  2J23 A;  2AV4 A;  3H93 A;  1XW9 A;  4NHZ A;  3TUE A;  3FR6 A;  5EL8 A;  2YWI A;  4XRD A;  1Z5Y E;  2P5Q A;  4TN8 A;  3P8W A;  4LL4 B;  3ZFL A;  5ECI B;  5ID2 A;  1IYH A;  4CDO A;  2VM2 A;  1QUW A;  2DJ0 A;  2O36 A;  1SD9 A;  5D73 A;  4OD7 A;  2LRT A;  3RDW A;  5A34 B;  3DML A;  3ERW A;  1O7U A;  4G01 A;  5GST A;  4TR3 A;  3C8E A;  4V2L A;  1S4B P;  1YY7 A;  3V1W A;  4EO3 A;  1K0M A;  2HXK A;  2EFC A;  2LTK A;  1GUM A;  2FY6 A;  1X0R A;  1OKT A;  2WJU A;  3E3E A;  5KN0 A;  3DXB A;  2XBI A;  4POB A;  5ECS A;  2I1U A;  2UV8 G;  2VLT A;  4K2X A;  1PSQ A;  4Z2U A;  2H6Z A;  3ERF A;  2FGX A;  1KNG A;  3F6D A;  3OR5 A;  4NXI A;  1MEK A;  3CWG A;  5LD0 A;  3A2X A;  3CBU A;  3ISO A;  4O5R A;  6GST A;  4CHS A;  4Q5R A;  3W6G A;  4HQZ A;  3UMA A;  2H76 A;  3TJF A;  3HYP A;  2FA8 A;  3SBC A;  3GNJ A;  1SKS B;  1X9S B;  5FT3 A;  3Q19 A;  1S3D A;  4OWY A;  2IN3 A;  5F07 A;  4TXV A;  5D8I A;  3NZN A;  1FVJ A;  3CSJ A;  3RBT A;  3RPP A;  2C4J A;  4JR6 A;  3HHV A;  4TRX A;  1T7P B;  2K8S A;  4YKG A;  1YKC A;  3IHQ A;  5AIX A;  1M2D A;  2GSS A;  2L59 A;  4IBP A;  2L6C A;  1RK4 A;  1A2L A;  3CRT A;  2O7K A;  4OFN A;  2OAC A;  4A5P A;  1TK8 B;  2IPA A;  3ED3 A;  4BPY A;  16GS A;  5J4V A;  9GSS A;  1GLP A;  1OE7 A;  1ZYP A;  2GT6 A;  5DQY A;  3DVX A;  3KEB A;  2PN8 A;  5IMD A;  5IMA A;  2VUP A;  2WVY A;  2HQT A;  4XS6 A;  1GTA A;  2CA8 A;  3AY8 A;  1G6Y A;  2ZUP A;  1TXX A;  1FHE A;  5KOX A;  4TR0 A;  2C3N A;  1T8E B;  4GSN A;  4KDU A;  5G30 A;  2WW3 A;  5F0G A;  4KF9 A;  4L8E A;  3EMX A;  3MIX A;  3HXS A;  4E8E A;  5CRH A;  4PUF C;  1O8X A;  3UVT A;  5L71 A;  1EZK A;  5LCZ A;  4LMV A;  2A4H A;  1SJI A;  5CRD A;  2YJ7 A;  2MZC A;  3WT2 A;  2VLV A;  2NDO A;  2XBQ A;  3CQF A;  2L4C A;  2HRK A;  4F0B A;  2CZ3 A;  1O8W A;  1GP1 A;  1YF0 A;  2REM A;  1Z6M A;  3D5J A;  4W66 A;  4PUA A;  3O6T A;  4KH7 A;  1F37 A;  2X49 A;  3L4N A;  1CQH A;  3CTG A;  2DJ3 A;  1WRY A;  1ABA A;  2H74 A;  4WET A;  3FR9 A;  2M46 A;  2PGT A;  2E2M A;  3BCI A;  4ZIJ A;  3UBL A;  4E8H A;  4MAB A;  2CV4 A;  2LJA A;  4OCF A;  3WGX A;  5H5S A;  2F51 A;  1B9Y C;  4WF4 A;  1SK0 A;  3IK9 A;  3GUS A;  4PHZ C;  5ELA A;  2JZR A;  3GL5 A;  2O8V B;  3I9V 2;  5HFG A;  2M72 A;  1F9M A;  5BMU B;  4I2T A;  2JL4 A;  5ECM B;  1BJX A;  3KMO A;  18GS A;  4FQU A;  3ME8 A;  3DIE A;  3HY2 A;  4O5Q A;  2WRT A;  4GSS A;  2FWG A;  3HMJ G;  1PMT A;  5A34 A;  2EIR A;  2YP6 A;  2RII A;  4AI6 A;  4X43 A;  1AC1 A;  1GSF A;  3TB2 A;  5D9W A;  2E0Q A;  2HSY A;  4DEJ A;  1V58 A;  1B9X C;  2GQL A;  2X8H A;  3U5R E;  3WGE A;  1JFU A;  2EFH A;  5D9V A;  1Z6N A;  4MP4 A;  4G0L A;  4DVC A;  4FYU A;  2HLS A;  3VWU A;  1X5C A;  4K7I A;  3LWA A;  2HRF A;  2MMZ A;  4MF7 A;  1XOB A;  5IMC A;  5AIV A;  1LBK A;  4EF0 A;  3GX8 A;  5FWG A;  4Z2T A;  5AN1 A;  1XVW A;  3ERG A;  4G0K A;  1BQ7 A;  3L9S A;  2F8A A;  4ICY A;  1XPV A;  2YWN A;  4IEL A;  2H66 A;  3EU3 A;  1K3L A;  2P31 A;  2Z9S A;  4MMM A;  4KW6 A;  2H1L A;  4AJ6 A;  1EWX A;  2HSM B;  4K9Z A;  1G7O A;  1RW1 A;  1NSW A;  3UEM A;  1B4Q A;  1TXU A;  1VRS D;  2HRA A;  5G5E A;  3IK7 A;  3F9U A;  3F3R A;  3KJY A;  1SU9 A;  1ZCP A;  4WF5 A;  1PFO A;  1OKD A;  4Z7X A;  3L78 A;  2OE3 A;  3BBY A;  3HJP A;  3GH6 A;  4YAP A;  4MJC A;  1SD8 A;  1XFL A;  1WMJ A;  5HR1 A;  5D9X A;  4ML6 A;  3HA9 A;  4HJM A;  4IW9 A;  3QR6 A;  1S3A A;  3EC3 A;  1SKR B;  1X9M B;  4PQI A;  1Z7R A;  4RI7 A;  2O87 A;  2WDU A;  3MDK A;  2R2J A;  3GV1 A;  1TDI A;  4TOP A;  4KX4 A;  3CYN A;  4ECJ A;  5CAX A;  1YZX A;  3ZIV A;  4ECC A;  4KDX A;  4IN0 A;  3ZIJ A;  5JCG A;  1OVN A;  3H4K A;  4PQH A;  4ZBB A;  2BTO T;  1I5G A;  3FK8 A;  2AAW A;  3S9F A;  3GA4 A;  4CY8 A;  4IVF A;  3QPM A;  2I9H A;  4FH8 A;  1SVM A;  2C1Y A;  2L5O A;  2PU9 C;  4BL7 B;  1EP7 A;  2FWF A;  1C72 A;  2IMI A;  2JAD A;  5DAK B;  2GZZ A;  3ZMK A;  3QOU A;  6GSS A;  10GS A;  1E2Y A;  3GYK A;  2H0H A;  2YZH A;  1XWB A;  3HKR A;  6GSW A;  1DSB A;  3P7X A;  4IP1 A;  2H8L A;  1G0T A;  2G0F A;  4OO5 A;  1T00 A;  1J08 A;  3DGQ A;  2I3Y A;  2IMD A;  5E4W A;  5IMZ A;  1XIY A;  2K18 A;  1R5A A;  1VF1 A;  1Y25 A;  4ID0 A;  4J2F A;  3GKN A;  2WGR A;  2IL3 A;  1O81 A;  2LQQ A;  1BED A;  1A8Y A;  1TU8 A;  3CRU A;  3KMN A;  5HR2 A;  4LLR A;  2FA4 A;  3GFK A;  1A2M A;  3TKS E;  4N0V A;  5ECK B;  4HS1 A;  3GHA A;  3CMI A;  1MDK A;  5INY A;  1OAZ A;  2VD0 A;  4KDY A;  2QA1 A;  3VFI A;  2EFD A;  1XZO A;  4ECI A;  2LEG A;  5A4U A;  2QC7 A;  2E2G A;  2H1B A;  4LMW A;  2RM6 A;  4GXZ A;  4RQX A;  2VCV A;  2ALB A;  2YWO A;  2VCT A;  3ZL5 A;  5B8B A;  2JU5 A;  5CYY A;  2FHE A;  4EKZ A;  1USB A;  3FZ4 A;  2VCX A;  2YNX A;  5H5R A;  3KXO A;  2DJJ A;  4YQM A;  3KGK A;  4EIQ A;  1M3J A;  4YQV A;  1XW6 A;  4TR1 B;  4USS A;  1A8L A;  3ZFB A;  5BMU A;  1BF5 A;  1A0R P;  4KCE A;  1F3A A;  4BVX A;  2CVD A;  1TW9 A;  1NW2 A;  4HI7 A;  4Q5F A;  5AIS A;  5A1N A;  1URM A;  3ZRE A;  3D22 A;  3P2A A;  2C3T A;  20GS A;  2F8F A;  1TRS A;  2RUF A;  2IJY A;  1GTB A;  1SK1 A;  3UIW A;  4HZ4 A;  4GRF A;  4MNN A;  3EE2 A;  2B5Y A;  4O7H A;  3A3T A;  4GCI A;  4KUN A;  2YN1 A;  2X8C A;  4NV5 A;  1TRW A;  1HD2 A;  5B6N A;  2PBJ A;  3M9J A;  2R6K A;  4ZBA A;  2CAI A;  1GSE A;  4KGI A;  5E59 A;  2GGT A;  1OC8 A;  4MK3 A;  2A2S A;  3R3E A;  1H4O A;  2KP2 A;  3CHX C;  4IP6 A;  3GN3 A;  1TOF A;  4PX1 A;  1YVL A;  1V9W A;  4G10 A;  13GS A;  4RQR A;  2VM1 A;  6GSX A;  3QFB C;  3FHK A;  4POK A;  5HFI A;  1KEB A;  1ACV A;  2HSM A;  2F9S A;  3MYD A;  1NM3 A;  3UBK A;  1GSS A;  1W4V A;  3KZQ A;  1PKZ A;  2PPT A;  5G1L A;  3KTB A;  1XG8 A;  3LYP A;  1ERU A;  1B4P A;  1M2B A;  4ZB6 A;  2OE1 A;  3FR3 A;  2GST A;  5IIZ A;  2LQO A;  1B8X A;  6GSU A;  2ZNM A;  3HVS A;  2WW1 A;  1MTC A;  3IAM 2;  5EPF A;  1GSY A;  2H6Y A;  4V1A g;  1K0D A;  4ZB8 A;  3D0Z A;  1A0F A;  2IWT A;  3PPU A;  4CY6 A;  2OBK A;  4JE1 A;  1YJ6 A;  1PX6 A;  4YKF A;  4MPF A;  4TVE A;  2KP1 A;  5A5H B;  2QSI A;  2AJQ B;  3TCO A;  2EFE A;  3IRA A;  4K0N A;  2WZS A;  5ECP B;  3RHC A;  1TKD B;  1J0F A;  1QK8 A;  2H0I A;  2H73 A;  3FMW A;  2B1K A;  1JHB A;  2LJK A;  3G7Y A;  1Q4J A;  4QL7 A;  1NHY A;  5J4Y A;  3EWL A;  2KHP A;  1SL1 B;  2HZF A;  4DSS B;  4BL7 A;  3ZTL A;  3QD9 A;  4AF2 A;  1SYR A;  3VLN A;  5ECL B;  3QDN A;  1AUC A;  2VLU A;  2C0G A;  5IPH A;  4D73 B;  5DAK A;  5ELG A;  1FVK A;  3F4R A;  2PUK C;  2WS2 A;  1YDK A;  3H1N A;  1DE2 A;  2OAD A;  3LJR A;  1AIU A;  5ECR B;  4BVY B;  5CRE A;  4K7N A;  2PVQ A;  4TKY A;  2VL3 A;  2GZY A;  1WJK A;  1S3R A;  3E0U A;  1T1V A;  3RAZ A;  3BD2 A;  4L0U A;  4QL9 A;  1DE1 A;  5DDL A;  5G1K A;  1PKW A;  7GSS A;  2A2R A;  4POM A;  4XRA A;  3G9B A;  2X4A A;  3QAW A;  3QCP A;  4BA7 A;  2I81 A;  4V1A p;  2UZ8 A;  1BAY A;  2GS3 A;  1GSQ A;  3I6A A;  4MH2 A;  1M0U A;  4F82 A;  1R4W A;  2K9F A;  2OE0 A;  1ZL9 A;  3VWW A;  5AGY A;  2VL2 C;  8GSS A;  3L9U A;  2K8V A;  2O5V A;  4NV2 A;  5IMV A;  4TXO B;  4F9Z A;  2X8G A;  1DUG A;  2V6K A;  1MDJ A;  3Q18 A;  17GS A;  3LFL A;  4PQ1 A;  4GLT A;  3GX0 A;  1EV4 A;  3GUR A;  1I9D A;  1EOG A;  1XWA A;  2C80 A;  3LYK A;  2B6M A;  4N30 A;  4XTS A;  4WBR D;  3IV4 A;  4JZQ A;  2DIY A;  2DJ1 A;  5BRT A;  4GST A;  4MZW A;  3IA1 A;  4GQC A;  2MMN A;  4FO5 A;  2O89 A;  4O32 A;  4NPB A;  4TR4 A;  1ZOF A;  5CNW A;  4TR1 A;  5HR3 A;  3TJJ A;  2WW0 A;  1BG5 A;  2VO4 A;  3HJM A;  5IOW A;  3FRC A;  2O85 A;  1PX7 A;  4XHM A;  4ZIL A;  2YPM A;  1PN0 A;  1EEJ A;  2X64 A;  3Q6O A;  1WOU A;  2BMX A;  3KTL A;  1Z7P A;  3EIN A;  3D4M A;  4F2I A;  2R5G A;  5J9C A;  4MJA A;  1GL8 A;  1SL2 B;  1N2A A;  5IMF A;  1GSU A;  3VPT A;  3DKS A;  5GAP D;  3CTF A;  4O92 A;  3ZYW A;  3GMF A;  4GF0 A;  2P5R A;  4BVX B;  2FUG 2;  1TRV A;  4L5L A;  2H6X A;  2NVL A;  3A5I A;  1VGL A;  5A1N B;  3IOS A;  4N0Z A;  2C0D A;  2H30 A;  5IO0 A;  1A24 A;  2XPD A;  1JZO A;  4MPG A;  2O3E A;  4EC0 A;  3A5W A;  2OT3 A;  2VAF A;  3F63 A;  1FB6 A;  4DSQ A;  3C1S A;  2FCH A;  3PR8 A;  3US3 A;  5ECO B;  3TJG A;  3F6F A;  4IKH A;  5CO3 A;  3L9V A;  5F06 A;  4QMK A;  3C71 A;  2HFD A;  1I1I P;  2LS5 A;  2PVO C;  4IJ3 A;  3J7Y b;  2AYT A;  1A23 A;  1G6W A;  3PGT A;  1SJ6 A;  2HZE B;  2LRN A;  1AXD A;  3DVW A;  3MSZ A;  3GKX A;  1W89 A;  2YWM A;  3FZA A;  3F4T A;  4HEA 2;  1SYX A;  5HR0 A;  3HZ8 A;  1GSD A;  1K0A A;  1LJR A;  1V2A A;  3LQ7 A;  4AKX B;  5D96 A;  2FWH A;  2L5L A;  1WPI A;  1PD2 1;  2NBS A;  3M8N A;  4O5U A;  5G2Z A;  1SL0 B;  3GST A;  4HZ2 A;  1U87 A;  1THO A;  4DSR A;  2GTU A;  3WYW A;  4KE3 A;  2IFQ B;  4RUV A;  1VF3 A;  1XCC A;  3BOA A;  6GSV A;  1UN2 A;  4KSO A;  3TOT A;  2GVP A;  1WWJ A;  5KN3 A;  4GDF A;  3BCK A;  1VF4 A;  4FXY P;  2OJL A;  4K1F A;  1NHO A;  3CSH A;  3D6I A;  3KP8 A;  1K0O A;  2H70 A;  3EVI A;  1Q98 A;  5D9T A;  2LST A;  4HUA A;  5A5H A;  1HNA A;  3FZ5 A;  22GS A;  3R2Q A;  3DWV A;  1U88 A;  3MWH A;  2HSN B;  3KP9 A;  2B5X A;  2CZ2 A;  5J4U A;  1M9B A;  4KSM A;  3J7Y k;  4ACS A;  2CVK A;  3IE3 A;  2NTO A;  1YF1 A;  3EPT A;  1HNB A;  3MAK A;  4K8M A;  4ML1 A;  4CW9 A;  4DSS A;  1GH2 A;  1WP0 A;  1JLW A;  4J56 E;  4K5S A;  2B1L A;  1X5E A;  4OO4 A;  1R7H A;  5CP1 A;  4X1U A;  1M2A A;  1G7E A;  14GS A;  4D73 A;  1ERT A;  4BWS A;  5J9B A;  2R4V A;  3UJ1 A;  2B7K A;  4KAE A;  4P3Y B;  2OA7 A;  3VK9 A;  1JLV A;  2LV3 A;  2ON7 A;  4BVY A;  1YEW C;  1F6M C;  2WW2 A;  4IQA A;  5J41 A;  2GQM A;  2GZP A;  4PXO A;  2MBS A;  4EL1 A;  2WUL A;  1U6T A;  3FYG A;  1EP8 A;  3GIX A;  2GLR A;  5IM9 A;  1T4Y A;  1XBS A;  19GS A;  1THX A;  4F03 A;  5DQS A;  1PN9 A;  3DEX A;  1EGO A;  4OMV A;  4BIK A;  2XPE A;  5ENU A;  1GUK A;  3PH9 A;  4K0G A;  4WEY A;  4WR5 A;  2EIQ A;  3ZRD A;  2CAQ A; 
#chains in the Genus database with same CATH homology
 1ON4 A;  4OCE A;  3KH7 A;  4XS4 B;  2HI7 A;  3DYR A;  1QGV A;  4MCU A;  4ECB A;  2A4V A;  5A5K A;  2H1D A;  3D21 A;  4TXO A;  1WE0 A;  3TRP A;  1VF2 A;  1ERW A;  2V41 A;  4KND A;  4AKH A;  3VWX A;  3MNG A;  4AKG A;  3ME7 A;  2L4Q A;  4MF6 A;  4Q5N A;  3HJO A;  2QA2 A;  3O76 A;  2VCZ A;  1XWK A;  5GZZ B;  4N10 A;  1WIK A;  2BJX A;  2DBC A;  2YAN A;  4WBJ A;  4XS1 A;  3KH9 A;  3GKK A;  2H1A A;  5CRW A;  2CX4 A;  2MYG A;  1S3C A;  3M0F A;  2RUE A;  5COH A;  12GS A;  2H01 A;  4K2D A;  5CRG A;  5J3R A;  3EUR A;  1EGR A;  3APQ A;  2NPB A;  4J57 E;  3KD0 A;  2VCQ A;  1HNC A;  3H8Q A;  4V2M A;  1YKA A;  3IR4 A;  1EOH A;  3FZ9 A;  1V98 A;  1FO5 A;  2XHF A;  4I5Q A;  4MJE A;  4ISD A;  1SKW B;  2XC2 A;  2VL2 A;  5J40 A;  2FWE A;  3O3T A;  1UC7 A;  4F0C A;  1TK5 B;  2DKH A;  2VD1 A;  2M80 A;  2MMA A;  2TRC P;  1R26 A;  3N5O A;  2RM5 A;  1T4Z A;  1BG1 A;  5IO2 A;  3CXG A;  1V57 A;  1PL1 A;  4ZXG A;  2DKI A;  2E7P A;  3GL3 A;  4ZL7 A;  4WXT A;  4MH3 A;  4MA9 A;  1T3B A;  1OC3 A;  1Y6E A;  1QMV A;  5ECN B;  3F3Q A;  2HZE A;  2V6O A;  1ILO A;  5B7C A;  1Y1U A;  4EXJ A;  4FIW A;  3L0H A;  1LU4 A;  4E68 A;  2R0G A;  1GTU A;  2ES7 A;  1TJD A;  1JZW A;  5B8A A;  2HSH A;  1PA3 A;  3VPQ A;  5KN2 A;  2V32 A;  1GRX A;  1ST9 A;  2AHE A;  3TKS C;  2VIM A;  2IFQ A;  4JBB A;  5IPG A;  5B6M A;  1A2J A;  3IBH A;  2C0F A;  1GLQ A;  4LL1 B;  1PRX A;  2IMF A;  2H72 A;  3LGC A;  1YEX A;  4YH2 A;  5G5F A;  1MDI A;  4EUY A;  2HNL A;  1FAA A;  1UVZ A;  4ZL9 A;  2WZ9 A;  3ZVJ A;  2HE3 A;  3P90 A;  4HU9 A;  3TKR A;  2P0G A;  3EMP A;  4PNG A;  1JZD A;  3LSZ A;  4JU5 A;  2HSN A;  2QGV A;  3LW9 A;  5ECH B;  2TIR A;  3F0I A;  5ABR A;  2V1M A;  5J47 A;  2H71 A;  3HVX A;  4AJ7 A;  5GSS A;  5G31 A;  4OFM A;  1SJZ A;  3HD5 A;  2YV9 A;  3VI7 A;  3VWV A;  4IS0 A;  1HQO A;  4WR4 A;  3VI5 A;  1OC9 B;  1QQ2 A;  3RHB A;  3QAV A;  2C8U A;  3RPN A;  5A4V A;  2B3S A;  2JAC A;  3ZIT A;  3TJB A;  3SWL A;  3A2W A;  1TRU A;  2HYX A;  1RQM A;  6GSY A;  2GQK A;  4X0X A;  4XCS A;  3G7J A;  4XIH A;  3D4T A;  4I2U A;  2HT9 A;  1XOA A;  5DCG A;  4YAV A;  4EVM A;  1ZYQ B;  1PGT A;  3W8J A;  4V2N A;  2AB6 A;  2YOI A;  2K6V A;  3UAR A;  3UL3 A;  4XS4 A;  1AQW A;  1Z3E A;  4HDE A;  2G2Q A;  2DLX A;  2JZT A;  4PNF A;  4PTS A;  3QMX A;  5DAL B;  2JSZ A;  4IGJ A;  2MMO A;  3IHG A;  1GNE A;  4MJB A;  1H75 A;  3IXR A;  2CVB A;  4KB3 A;  2GSR A;  2GDR A;  2PMT A;  4JED A;  2A2P A;  4I8B A;  3LOR A;  3TRQ A;  3IC4 A;  1N8J A;  2DMM A;  3GKM A;  3F4S A;  2CX3 A;  3UVH A;  3HZ4 A;  1M99 A;  1TI1 A;  4ILF A;  4K6X A;  4PGT A;  2WFC A;  1FG4 A;  4G0I A;  1MD3 A;  1K3Y A;  3LEF A;  3BJ5 A;  2LJR A;  1FB0 A;  1YEP A;  3ZML A;  1MD4 A;  2I4A A;  3FKF A;  2H0G A;  2J9H A;  1TTZ A;  5JWR B;  3TU3 B;  5DBQ A;  3IDV A;  1F2E A;  2H19 A;  4HQS A;  4POL A;  2D2Z A;  1O85 A;  4MF5 A;  4ZB7 A;  1J9B A;  1ZMA A;  5F8B A;  3HVV A;  1Z9H A;  3TRX A;  2FD3 A;  1K0N A;  1ZYN A;  4QQ7 A;  2FNO A;  1SVL A;  2N5A A;  2DIZ A;  5JCU A;  2WCI A;  3LXT A;  2F3M A;  3KIJ A;  3UOM A;  3K8N A;  1SK2 A;  1DBY A;  3KCM A;  4H86 A;  11GS A;  3TDG A;  1FW1 A;  2KLX A;  3NOF A;  1TI3 A;  1E6B A;  1OYJ A;  4MZB A;  4RI6 A;  2R0C A;  3EU4 A;  2H1G A;  3GTU B;  3WT1 A;  2CQ9 A;  1OE8 A;  1PL2 A;  1JZR A;  5JCW A;  1QXH A;  4IJI A;  2N5B A;  3APO A;  1XXU A;  2QKE A;  5DCH A;  3IAS 2;  2VOC A;  2MBT A;  5D93 A;  2TRX A;  2OKA A;  4MZC A;  5ID2 B;  1ML6 A;  4WKW A;  1SEN A;  4HU7 A;  1O73 A;  2LKU A;  4EIP A;  1TU7 A;  3APS A;  3U6V A;  2IMK A;  4ZB9 A;  3W8S A;  2ZCT A;  3C1R A;  4N3Z A;  1GWC A;  5FHI A;  4EE0 A;  3LG6 A;  3H79 A;  4TW5 A;  1TK0 B;  2GT5 A;  4K7O A;  5C04 A;  5HFK A;  1K0B A;  3DRN A;  2YZU A;  5F05 A;  4EDZ A;  2OBI A;  4G2E A;  4N11 A;  2VCW A;  2DSA A;  4NMU A;  5J5N A;  2X99 A;  1M9A A;  3F8U A;  2RLI A;  1KBN A;  1O6J A;  3ZZX A;  2YJH A;  5DJM A;  2GSQ A;  1GNW A;  5H5Q A;  4OFT A;  2LUS A;  1ZGN A;  2DC5 A;  2EIO A;  1EEM A;  4GQF A;  2KOK A;  2R0P A;  1KTE A;  2HRN A;  3C7M A;  5KEJ A;  4AKI A;  4FYB A;  2JSY A;  3GH9 A;  1XVQ A;  2R3X A;  2JZS A;  3FEU A;  2LRC A;  5KOW A;  2IME A;  2L57 A;  1OC9 A;  1BYE A;  2R37 A;  3WGD A;  4AJ8 A;  1AQV A;  1PQN A;  2C3Q A;  3C73 A;  2V2G A;  2YV7 A;  3TJK A;  4ZBD A;  3ZVJ D;  4I97 A;  3EYT A;  3TKS A;  3I43 A;  5IQY A;  3PIN A;  4KA0 A;  1AQX A;  5JWQ B;  5GAN D;  5DVB A;  5C00 A;  3FY7 A;  2PWJ A;  4MDC A;  1FOV A;  3DD3 A;  2ON5 A;  2PER A;  4JR4 A;  1AAZ A;  3E9J B;  4BWQ A;  4GWR A;  1BX9 A;  1IYI A;  3GSS A;  1SVO A;  2VL9 A;  1YQ1 A;  3M1G A;  4EDY A;  1XWC A;  1FOH A;  3JCM L;  4L5O A;  5DAL A;  1B48 A;  3Q74 A;  3UAP A;  2FLS A;  3M9K A;  5EVO A;  3IC8 A;  4G19 A;  3TOU A;  2IIY A;  1V40 A;  4MLY A;  1GTI A;  2DJK A;  3N9J A;  1U3A A;  5DJL A;  1TP9 A;  5A4W A;  4IHU A;  5IOX A;  1QFN A;  4Q5Q A;  2L6D A;  1HYU A;  4PUR A;  3G7I A;  3ZLP A;  3M3M A;  5ECQ B;  2B5E A;  4HOJ A;  2KUC A;  3QAG A;  4Z2R A;  3GRX A;  5KN1 A;  4JRR A;  1ZZY A;  4AGS A;  4NWY A;  1UA5 A;  4GTU A;  1CQG A;  2C0E A;  1M7T A;  3LXZ A;  2DJ2 A;  4LA1 A;  4X4J A;  3CSI A;  1X9W B;  1N25 A;  5EY6 A;  4G9H A;  2AUV A;  1ERV A;  4KCA A;  3NIV A;  1K0C A;  3HDC A;  3KM6 A;  4ULX A;  4I6X A;  1K3O A;  5LNK e;  5JWO B;  3WD6 A;  1EV9 A;  1R5P A;  4HJ2 A;  2HRK B;  3TKQ A;  4L0W A;  2CT6 A;  1GUL A;  2EC4 A;  5HQP A;  2N5F A;  3VUR A;  4YQU A;  4NAX A;  2DML A;  3A2V A;  3FW2 A;  2LNT A;  4NHW A;  4ZL8 A;  3IPZ A;  4FYC A;  3TKP A;  4K5R A;  1U3I A;  3TGZ A;  1GUH A;  2B7J A;  1ZYE A;  2YCD A;  2LNS A;  1F3B A;  3I69 A;  2H75 A;  3GTU A;  1X5D A;  1AW9 A;  2WB9 A;  1XW5 A;  4IQ1 A;  3HCZ A;  3QFA C;  2VKZ G;  1XWG A;  2J23 A;  2AV4 A;  3H93 A;  1XW9 A;  4NHZ A;  3TUE A;  3FR6 A;  5EL8 A;  2YWI A;  4XRD A;  1Z5Y E;  2P5Q A;  4TN8 A;  3P8W A;  4LL4 B;  3ZFL A;  5ECI B;  5ID2 A;  1IYH A;  4CDO A;  2VM2 A;  1QUW A;  2DJ0 A;  1SD9 A;  5D73 A;  4OD7 A;  2LRT A;  3RDW A;  5A34 B;  3DML A;  3ERW A;  1O7U A;  4G01 A;  5GST A;  4TR3 A;  3C8E A;  4V2L A;  1YY7 A;  3V1W A;  4EO3 A;  1K0M A;  2HXK A;  2EFC A;  2LTK A;  1GUM A;  2FY6 A;  1X0R A;  1OKT A;  2WJU A;  3E3E A;  5KN0 A;  3DXB A;  2XBI A;  4POB A;  5ECS A;  2I1U A;  2UV8 G;  2VLT A;  4K2X A;  1PSQ A;  4Z2U A;  2H6Z A;  3ERF A;  2FGX A;  1KNG A;  3F6D A;  3OR5 A;  4NXI A;  1MEK A;  3CWG A;  5LD0 A;  3A2X A;  3CBU A;  3ISO A;  4O5R A;  6GST A;  4CHS A;  4Q5R A;  3W6G A;  4HQZ A;  3UMA A;  2H76 A;  3TJF A;  3HYP A;  2FA8 A;  3SBC A;  3GNJ A;  1SKS B;  1X9S B;  5FT3 A;  3Q19 A;  1S3D A;  4OWY A;  2IN3 A;  5F07 A;  4TXV A;  5D8I A;  3NZN A;  1FVJ A;  3CSJ A;  3RBT A;  3RPP A;  2C4J A;  4JR6 A;  3HHV A;  4TRX A;  1T7P B;  2K8S A;  4YKG A;  1YKC A;  3IHQ A;  5AIX A;  1M2D A;  2GSS A;  2L59 A;  4IBP A;  2L6C A;  1RK4 A;  1A2L A;  3CRT A;  2O7K A;  4OFN A;  2OAC A;  4A5P A;  1TK8 B;  2IPA A;  3ED3 A;  4BPY A;  16GS A;  5J4V A;  9GSS A;  1GLP A;  1OE7 A;  1ZYP A;  2GT6 A;  5DQY A;  3DVX A;  3KEB A;  2PN8 A;  5IMD A;  5IMA A;  2VUP A;  2HQT A;  4XS6 A;  1GTA A;  2CA8 A;  3AY8 A;  1G6Y A;  2ZUP A;  1TXX A;  1FHE A;  5KOX A;  4TR0 A;  2C3N A;  1T8E B;  4GSN A;  4KDU A;  5G30 A;  5F0G A;  4KF9 A;  4L8E A;  3EMX A;  3MIX A;  3HXS A;  4E8E A;  5CRH A;  4PUF C;  1O8X A;  3UVT A;  5L71 A;  1EZK A;  5LCZ A;  4LMV A;  2A4H A;  1SJI A;  5CRD A;  2YJ7 A;  2MZC A;  3WT2 A;  2VLV A;  2NDO A;  2XBQ A;  2L4C A;  2HRK A;  4F0B A;  2CZ3 A;  1O8W A;  1GP1 A;  1YF0 A;  2REM A;  1Z6M A;  3D5J A;  4W66 A;  4PUA A;  3O6T A;  4KH7 A;  1F37 A;  2X49 A;  3L4N A;  1CQH A;  3CTG A;  2DJ3 A;  1WRY A;  1ABA A;  2H74 A;  4WET A;  3FR9 A;  2M46 A;  2PGT A;  2E2M A;  3BCI A;  4ZIJ A;  3UBL A;  4E8H A;  4MAB A;  2CV4 A;  2LJA A;  4OCF A;  3WGX A;  5H5S A;  2F51 A;  1B9Y C;  4WF4 A;  1SK0 A;  3IK9 A;  3GUS A;  5ELA A;  2JZR A;  3GL5 A;  2O8V B;  3I9V 2;  5HFG A;  2M72 A;  1F9M A;  5BMU B;  4I2T A;  2JL4 A;  5ECM B;  1BJX A;  3KMO A;  18GS A;  4FQU A;  3ME8 A;  3DIE A;  3HY2 A;  4O5Q A;  2WRT A;  4GSS A;  2FWG A;  3HMJ G;  1PMT A;  5A34 A;  2EIR A;  2YP6 A;  2RII A;  4AI6 A;  4X43 A;  1AC1 A;  1GSF A;  3TB2 A;  5D9W A;  2E0Q A;  2HSY A;  4DEJ A;  1V58 A;  1B9X C;  2GQL A;  2X8H A;  3U5R E;  3WGE A;  1JFU A;  2EFH A;  5D9V A;  1Z6N A;  4MP4 A;  4G0L A;  4DVC A;  4FYU A;  2HLS A;  3VWU A;  1X5C A;  4K7I A;  3LWA A;  2HRF A;  2MMZ A;  4MF7 A;  1XOB A;  5IMC A;  5AIV A;  1LBK A;  4EF0 A;  3GX8 A;  5FWG A;  4Z2T A;  5AN1 A;  1XVW A;  3ERG A;  4G0K A;  1BQ7 A;  3L9S A;  2F8A A;  4ICY A;  1XPV A;  2YWN A;  4IEL A;  2H66 A;  3EU3 A;  1K3L A;  2P31 A;  2Z9S A;  4MMM A;  4KW6 A;  2H1L A;  4AJ6 A;  1EWX A;  2HSM B;  4K9Z A;  1G7O A;  1RW1 A;  1NSW A;  3UEM A;  1B4Q A;  1TXU A;  1VRS D;  2HRA A;  5G5E A;  3IK7 A;  3F9U A;  3F3R A;  3KJY A;  1SU9 A;  1ZCP A;  4WF5 A;  1OKD A;  4Z7X A;  3L78 A;  2OE3 A;  3BBY A;  3HJP A;  3GH6 A;  4YAP A;  4MJC A;  1SD8 A;  1XFL A;  1WMJ A;  5HR1 A;  5D9X A;  4ML6 A;  3HA9 A;  4HJM A;  4IW9 A;  3QR6 A;  1S3A A;  3EC3 A;  1SKR B;  1X9M B;  4PQI A;  1Z7R A;  4RI7 A;  2O87 A;  2WDU A;  3MDK A;  2R2J A;  3GV1 A;  1TDI A;  4TOP A;  4KX4 A;  3CYN A;  4ECJ A;  5CAX A;  1YZX A;  3ZIV A;  4ECC A;  4KDX A;  4IN0 A;  3ZIJ A;  5JCG A;  1OVN A;  3H4K A;  4PQH A;  4ZBB A;  2BTO T;  1I5G A;  3FK8 A;  2AAW A;  3S9F A;  3GA4 A;  4CY8 A;  4IVF A;  3QPM A;  2I9H A;  4FH8 A;  1SVM A;  2C1Y A;  2L5O A;  2PU9 C;  4BL7 B;  1EP7 A;  2FWF A;  1C72 A;  2IMI A;  2JAD A;  5DAK B;  2GZZ A;  3ZMK A;  3QOU A;  6GSS A;  10GS A;  1E2Y A;  3GYK A;  2H0H A;  2YZH A;  1XWB A;  3HKR A;  6GSW A;  1DSB A;  3P7X A;  4IP1 A;  2H8L A;  1G0T A;  2G0F A;  4OO5 A;  1T00 A;  1J08 A;  3DGQ A;  2I3Y A;  2IMD A;  5E4W A;  5IMZ A;  1XIY A;  2K18 A;  1R5A A;  1VF1 A;  1Y25 A;  4ID0 A;  4J2F A;  3GKN A;  2WGR A;  2IL3 A;  1O81 A;  2LQQ A;  1BED A;  1A8Y A;  1TU8 A;  3CRU A;  3KMN A;  5HR2 A;  4LLR A;  2FA4 A;  3GFK A;  1A2M A;  3TKS E;  4N0V A;  5ECK B;  4HS1 A;  3GHA A;  3CMI A;  1MDK A;  5INY A;  1OAZ A;  2VD0 A;  4KDY A;  2QA1 A;  3VFI A;  2EFD A;  1XZO A;  4ECI A;  2LEG A;  5A4U A;  2QC7 A;  2E2G A;  2H1B A;  4LMW A;  2RM6 A;  4GXZ A;  4RQX A;  2VCV A;  2ALB A;  2YWO A;  2VCT A;  3ZL5 A;  5B8B A;  2JU5 A;  5CYY A;  2FHE A;  4EKZ A;  1USB A;  3FZ4 A;  2VCX A;  2YNX A;  5H5R A;  3KXO A;  2DJJ A;  4YQM A;  3KGK A;  4EIQ A;  4YQV A;  1XW6 A;  4TR1 B;  4USS A;  1A8L A;  3ZFB A;  5BMU A;  1BF5 A;  1A0R P;  4KCE A;  1F3A A;  4BVX A;  2CVD A;  1TW9 A;  1NW2 A;  4HI7 A;  4Q5F A;  5AIS A;  5A1N A;  1URM A;  3ZRE A;  3D22 A;  3P2A A;  2C3T A;  20GS A;  2F8F A;  1TRS A;  2RUF A;  2IJY A;  1GTB A;  1SK1 A;  3UIW A;  4HZ4 A;  4GRF A;  4MNN A;  3EE2 A;  2B5Y A;  4O7H A;  3A3T A;  4GCI A;  4KUN A;  2YN1 A;  2X8C A;  4NV5 A;  1TRW A;  1HD2 A;  5B6N A;  2PBJ A;  3M9J A;  2R6K A;  4ZBA A;  2CAI A;  1GSE A;  4KGI A;  5E59 A;  2GGT A;  1OC8 A;  4MK3 A;  2A2S A;  3R3E A;  1H4O A;  2KP2 A;  4IP6 A;  3GN3 A;  1TOF A;  4PX1 A;  1YVL A;  1V9W A;  4G10 A;  13GS A;  4RQR A;  2VM1 A;  6GSX A;  3QFB C;  3FHK A;  4POK A;  5HFI A;  1KEB A;  1ACV A;  2HSM A;  2F9S A;  3MYD A;  1NM3 A;  3UBK A;  1GSS A;  1W4V A;  3KZQ A;  1PKZ A;  2PPT A;  5G1L A;  3KTB A;  3LYP A;  1ERU A;  1B4P A;  1M2B A;  4ZB6 A;  2OE1 A;  3FR3 A;  2GST A;  5IIZ A;  2LQO A;  1B8X A;  6GSU A;  2ZNM A;  3HVS A;  1MTC A;  3IAM 2;  5EPF A;  1GSY A;  2H6Y A;  4V1A g;  1K0D A;  4ZB8 A;  3D0Z A;  1A0F A;  2IWT A;  3PPU A;  4CY6 A;  2OBK A;  4JE1 A;  1YJ6 A;  1PX6 A;  4YKF A;  4MPF A;  4TVE A;  2KP1 A;  5A5H B;  2QSI A;  2AJQ B;  3TCO A;  2EFE A;  3IRA A;  4K0N A;  5ECP B;  3RHC A;  1TKD B;  1J0F A;  1QK8 A;  2H0I A;  2H73 A;  3FMW A;  2B1K A;  1JHB A;  2LJK A;  3G7Y A;  1Q4J A;  4QL7 A;  1NHY A;  5J4Y A;  3EWL A;  2KHP A;  1SL1 B;  2HZF A;  4DSS B;  4BL7 A;  3ZTL A;  3QD9 A;  4AF2 A;  1SYR A;  3VLN A;  5ECL B;  3QDN A;  1AUC A;  2VLU A;  2C0G A;  5IPH A;  4D73 B;  5DAK A;  5ELG A;  1FVK A;  3F4R A;  2PUK C;  2WS2 A;  1YDK A;  3H1N A;  1DE2 A;  2OAD A;  3LJR A;  1AIU A;  5ECR B;  4BVY B;  5CRE A;  4K7N A;  2PVQ A;  4TKY A;  2VL3 A;  2GZY A;  1WJK A;  3E0U A;  1T1V A;  3RAZ A;  3BD2 A;  4L0U A;  4QL9 A;  1DE1 A;  5DDL A;  5G1K A;  1PKW A;  7GSS A;  2A2R A;  4POM A;  4XRA A;  3G9B A;  2X4A A;  3QAW A;  3QCP A;  4BA7 A;  2I81 A;  4V1A p;  2UZ8 A;  1BAY A;  2GS3 A;  1GSQ A;  3I6A A;  4MH2 A;  1M0U A;  4F82 A;  1R4W A;  2K9F A;  2OE0 A;  1ZL9 A;  3VWW A;  5AGY A;  2VL2 C;  8GSS A;  3L9U A;  2K8V A;  2O5V A;  4NV2 A;  5IMV A;  4TXO B;  4F9Z A;  2X8G A;  1DUG A;  2V6K A;  1MDJ A;  3Q18 A;  17GS A;  3LFL A;  4PQ1 A;  4GLT A;  3GX0 A;  1EV4 A;  3GUR A;  1I9D A;  1EOG A;  1XWA A;  2C80 A;  3LYK A;  2B6M A;  4N30 A;  4XTS A;  4WBR D;  3IV4 A;  4JZQ A;  2DIY A;  2DJ1 A;  5BRT A;  4GST A;  4MZW A;  3IA1 A;  4GQC A;  2MMN A;  4FO5 A;  2O89 A;  4O32 A;  4NPB A;  4TR4 A;  1ZOF A;  5CNW A;  4TR1 A;  5HR3 A;  3TJJ A;  1BG5 A;  2VO4 A;  3HJM A;  5IOW A;  3FRC A;  2O85 A;  1PX7 A;  4XHM A;  4ZIL A;  2YPM A;  1PN0 A;  1EEJ A;  2X64 A;  3Q6O A;  1WOU A;  2BMX A;  3KTL A;  1Z7P A;  3EIN A;  3D4M A;  4F2I A;  2R5G A;  5J9C A;  4MJA A;  1GL8 A;  1SL2 B;  1N2A A;  5IMF A;  1GSU A;  3VPT A;  3DKS A;  5GAP D;  3CTF A;  4O92 A;  3ZYW A;  3GMF A;  4GF0 A;  2P5R A;  4BVX B;  2FUG 2;  1TRV A;  4L5L A;  2H6X A;  2NVL A;  3A5I A;  1VGL A;  5A1N B;  3IOS A;  4N0Z A;  2C0D A;  2H30 A;  5IO0 A;  1A24 A;  2XPD A;  1JZO A;  4MPG A;  4EC0 A;  3A5W A;  2OT3 A;  2VAF A;  3F63 A;  1FB6 A;  4DSQ A;  3C1S A;  2FCH A;  3PR8 A;  3US3 A;  5ECO B;  3TJG A;  3F6F A;  4IKH A;  5CO3 A;  3L9V A;  5F06 A;  4QMK A;  3C71 A;  2HFD A;  2LS5 A;  2PVO C;  4IJ3 A;  3J7Y b;  2AYT A;  1A23 A;  1G6W A;  3PGT A;  1SJ6 A;  2HZE B;  2LRN A;  1AXD A;  3DVW A;  3MSZ A;  3GKX A;  1W89 A;  2YWM A;  3FZA A;  3F4T A;  4HEA 2;  1SYX A;  5HR0 A;  3HZ8 A;  1GSD A;  1K0A A;  1LJR A;  1V2A A;  3LQ7 A;  4AKX B;  5D96 A;  2FWH A;  2L5L A;  1WPI A;  1PD2 1;  2NBS A;  3M8N A;  4O5U A;  5G2Z A;  1SL0 B;  3GST A;  4HZ2 A;  1U87 A;  1THO A;  4DSR A;  2GTU A;  3WYW A;  4KE3 A;  2IFQ B;  4RUV A;  1VF3 A;  1XCC A;  3BOA A;  6GSV A;  1UN2 A;  4KSO A;  3TOT A;  2GVP A;  1WWJ A;  5KN3 A;  4GDF A;  3BCK A;  1VF4 A;  2OJL A;  4K1F A;  1NHO A;  3CSH A;  3D6I A;  3KP8 A;  1K0O A;  2H70 A;  3EVI A;  1Q98 A;  5D9T A;  2LST A;  4HUA A;  5A5H A;  1HNA A;  3FZ5 A;  22GS A;  3R2Q A;  3DWV A;  1U88 A;  3MWH A;  2HSN B;  3KP9 A;  2B5X A;  2CZ2 A;  5J4U A;  1M9B A;  4KSM A;  3J7Y k;  4ACS A;  2CVK A;  3IE3 A;  2NTO A;  1YF1 A;  3EPT A;  1HNB A;  3MAK A;  4K8M A;  4ML1 A;  4CW9 A;  4DSS A;  1GH2 A;  1WP0 A;  1JLW A;  4J56 E;  4K5S A;  2B1L A;  1X5E A;  4OO4 A;  1R7H A;  5CP1 A;  4X1U A;  1M2A A;  1G7E A;  14GS A;  4D73 A;  1ERT A;  4BWS A;  5J9B A;  2R4V A;  3UJ1 A;  2B7K A;  4KAE A;  4P3Y B;  2OA7 A;  3VK9 A;  1JLV A;  2LV3 A;  2ON7 A;  4BVY A;  1F6M C;  4IQA A;  5J41 A;  2GQM A;  2GZP A;  4PXO A;  2MBS A;  4EL1 A;  2WUL A;  1U6T A;  3FYG A;  1EP8 A;  3GIX A;  2GLR A;  5IM9 A;  1T4Y A;  1XBS A;  19GS A;  1THX A;  4F03 A;  5DQS A;  1PN9 A;  3DEX A;  1EGO A;  4OMV A;  2XPE A;  5ENU A;  1GUK A;  3PH9 A;  4K0G A;  4WEY A;  4WR5 A;  2EIQ A;  3ZRD A;  2CAQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...