3N5OA

Crystal structure of putative glutathione transferase from coccidioides immitis bound to glutathione
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
228
structure length
228
Chain Sequence
TPNFELYGYFRSSCSGRLRIAFHLKSIPYTRHPVNLLKGEQHSDTYKSLNPTNTVPLLVVSNINNTVSPSSASFSIGQSLAALEYLEEALPTNARPLLPPISNPVARAHVRTICNIIACDVQPVTNLKIQKKVKALDGDPTVWSRDLATQGFGAVEKLLELSAGRFCVGDEITLADVCLVPAVWAAERVGMDLARFPITKRVFEEMLKEEAVQKAHWQKQEDTPEDLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords glutathione transferase
publication title Structures of a putative zeta-class glutathione S-transferase from the pathogenic fungus Coccidioides immitis.
pubmed doi rcsb
source organism Coccidioides immitis
molecule tags Transferase
total genus 78
structure length 228
sequence length 228
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2010-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13409 GST_N_2 Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3n5oA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3n5oA01
2UZ8A 1GSFA 2HQTA 3C8EA 2C4JA 5ELAA 1O8XA 1KBNA 1ZZYA 3GL5A 5F07A 5ENUA 5H5SA 2FA4A 2VCTA 3FR6A 2B6MA 5B6NA 2F8AA 5ECIB 3Q18A 4K0GA 1WP0A 1GULA 1XWGA 2GSQA 2DJ2A 3GTUA 2I9HA 4POMA 3KGKA 5CAXA 2KHPA 5KN2A 2HE3A 2CQ9A 1XZOA 3A2WA 1YJ6A 2HYXA 3QCPA 4GF0A 6GSWA 5ECPB 3IRAA 4NV5A 1PN9A 1T3BA 4K7OA 4PNFA 5IQYA 4KB3A 1X9SB 2LRCA 2YJHA 3ZVJD 4KH7A 3KP9A 2CVBA 4N11A 1EOHA 1M2DA 3QR6A 3D6IA 1DE2A 1XOBA 3KP8A 3KTBA 1A2MA 4V2LA 5IM9A 2CAIA 2EIQA 3D22A 3D4TA 5F05A 2IMIA 2RLIA 1FOVA 1Z5YE 1O73A 3EMPA 2GQLA 4TXOB 1MDJA 3LGCA 4FYCA 2VCWA 4MJEA 2HT9A 3HZ8A 3UARA 4ML6A 1U3AA 3TRXA 4MDCA 5AN1A 5D96A 2YWOA 5DQSA 4V1Ap 3TKRA 4NMUA 1C72A 2QGVA 2HRKB 4XS1A 1A2LA 5DQYA 1GNEA 1VRSD 3QOUA 2L5OA 4AJ6A 2DJJA 3MNGA 4TR4A 4TXOA 3TDGA 4PTSA 5CNWA 3ZFLA 3F0IA 2VD0A 4WXTA 3EYTA 2R5GA 1SENA 2YZUA 3CTFA 2HZFA 4G0IA 4K0NA 4LA1A 2HNLA 2ZCTA 3G7YA 1XIYA 2EC4A 4OFNA 2HRKA 1G6WA 3UBLA 2B3SA 4IHUA 2GDRA 3GH9A 4ZXGA 5J4UA 3QMXA 4PUAA 4I8BA 1J0FA 4HQZA 1QMVA 4G0KA 4EF0A 2H30A 3FZAA 2XBIA 3OR5A 5FT3A 1VF1A 5IMCA 5GAND 1G0TA 3F4TA 4OD7A 3E9JB 3VWXA 3D5JA 2WB9A 2PWJA 3K8NA 4HU9A 3QAWA 4XHMA 1N8JA 4JBBA 1BQ7A 2O85A 1YKAA 4BL7A 3W8SA 2ZUPA 4FIWA 2DIYA 2YWMA 3L9UA 4V2MA 5F06A 3HD5A 4MLYA 1GWCA 3F3QA 2C3TA 2GQMA 2A4VA 5CRDA 1GRXA 1TRWA 3TKSC 2YZHA 4DSQA 4NAXA 2OJLA 3PGTA 3KH9A 1BG5A 1GP1A 4TKYA 3US3A 4NPBA 1F6MC 5ABRA 2FNOA 5HQPA 3APSA 3LG6A 1I9DA 1B4QA 2R6KA 4P3YB 4QL7A 4E8HA 3PINA 2IMEA 3VWVA 3IOSA 3D21A 4N30A 2FCHA 1HQOA 3D0ZA 1XWCA 2PVQA 1M2AA 4PURA 1ERWA 2C0GA 1SD9A 1HYUA 1K0OA 3ZREA 1H4OA 2IJYA 3RDWA 2LKUA 3E3EA 2GGTA 10GSA 2VUPA 2A2RA 1GSQA 2DJ3A 3LEFA 2X8HA 1AAZA 3GX8A 1O6JA 1SJ6A 4BVYB 6GSYA 2DMMA 1EGRA 2GLRA 1G7EA 4K1FA 5ID2A 5HR3A 2DIZA 1TK8B 3HJOA 5DJMA 2I1UA 4K7NA 3GYKA 3UVHA 1WOUA 2H0GA 2PPTA 2GT6A 2M72A 1A23A 3IAM2 3TRQA 2C0FA 3I9V2 2OKAA 5IO0A 1MEKA 4BVYA 1E2YA 5BMUA 2L5LA 2WFCA 2C3QA 4GQCA 2YJ7A 2H6ZA 3CSHA 1PX7A 4BWQA 4Q5FA 4K8MA 1DSBA 1GSDA 2ON7A 3HJPA 2ES7A 2LQQA 2XPDA 3VWWA 1IYIA 5IOXA 3EC3A 1ABAA 3GMFA 2DC5A 1RQMA 4AGSA 2V1MA 4G19A 2G2QA 2H1BA 2HLSA 1QGVA 4K2DA 2VD1A 1AQWA 3VWUA 13GSA 2GZZA 5B6MA 5B8AA 1YEXA 1YF0A 1K3OA 17GSA 3HY2A 2QSIA 2C3NA 2V6OA 1SK1A 1T7PB 4ZB6A 3RAZA 2GSSA 4TR3A 1OC8A 5CYYA 4ZB9A 1R5PA 1O85A 5CRWA 2LNSA 1F37A 4CDOA 4LL1B 1QXHA 2FWGA 4YQMA 3IK9A 4G0LA 4AJ8A 4RI7A 3G7IA 1T8EB 2BTOT 4MF5A 2YV9A 1KEBA 2WZ9A 1ZYQB 3FZ4A 4BVXB 4PX1A 3H79A 2F51A 4I6XA 3L4NA 4HQSA 3FYGA 3WGDA 3BJ5A 3HJMA 4HUAA 1JLVA 2WS2A 4XTSA 4N0ZA 1LJRA 4EXJA 1GLQA 2FA8A 3KTLA 6GSXA 1BJXA 3F6DA 1NSWA 1W89A 2GQKA 2JZSA 2VLUA 2LV3A 4BVXA 1TJDA 5JWRB 1TI3A 5ECKB 3LJRA 1UC7A 2LNTA 1B48A 3KXOA 1PA3A 3WT1A 5CREA 2WULA 3GV1A 1Z3EA 2IWTA 1B4PA 2HSHA 2MYGA 1PKWA 1QUWA 4IW9A 4HI7A 2J9HA 1XVQA 3SBCA 5B7CA 4OFTA 4MJBA 1J08A 2AV4A 4JR4A 4GSSA 3P7XA 5A4UA 5ECRB 2HFDA 6GSUA 3KD0A 2R37A 3ZL5A 14GSA 4MP4A 4HU7A 3I69A 5G1KA 3PPUA 5HFKA 3F63A 4F03A 5J9CA 1M99A 5C00A 3CSIA 5A5KA 1NHOA 1S3CA 1CQGA 1R26A 2HI7A 3UIWA 4I97A 2VM1A 3RBTA 1EV4A 5IO2A 3R2QA 3TJGA 1R7HA 4KE3A 1MTCA 1X5EA 5IMDA 4POLA 2B1LA 5IPGA 1FO5A 4PQHA 3S9FA 3H93A 4RI6A 3EU3A 5FWGA 4PQIA 2LQOA 1WPIA 3QAVA 3IHQA 1AC1A 1H75A 4GWRA 3NZNA 2P5RA 3KMNA 2G0FA 4KAEA 1E6BA 4EDYA 3GKNA 4L5OA 3C71A 2YWNA 3FZ9A 3TKQA 11GSA 1OVNA 2FWFA 5A4VA 2LRTA 2FWHA 3RPPA 3LFLA 3KIJA 1YF1A 2CT6A 1JZRA 4HZ2A 2N5AA 4EE0A 4J57E 1X0RA 4RUVA 1JFUA 5KN0A 1Q98A 4MJCA 3TKPA 3M9KA 3ME8A 3HVXA 3VI5A 2YNXA 1EOGA 1AXDA 2V2GA 1TRSA 1U87A 2LJRA 1DUGA 1ZOFA 4F2IA 1HNAA 1GSUA 2O89A 5ECOB 3ISOA 5CP1A 4ILFA 1UVZA 5EL8A 1Z6NA 5IMVA 2YCDA 1GH2A 1T00A 2H6YA 4ISDA 2FLSA 2FWEA 4LMVA 1TKDB 1V40A 2PGTA 3MWHA 3FY7A 1A0RP 5DCGA 3HVSA 3V1WA 3BBYA 3VURA 2MBTA 2RM6A 4NWYA 1PSQA 3ZITA 2WDUA 2MMAA 1GUMA 5KEJA 4NXIA 3C1RA 2VM2A 3Q19A 1V2AA 1OE7A 5GAPD 4X43A 4K6XA 5GSSA 4GLTA 5IPHA 2QKEA 2B5XA 1XW6A 2JZTA 3IBHA 2MBSA 3M0FA 3NIVA 1O7UA 1YEPA 2IL3A 3GNJA 1SYRA 4OWYA 4MABA 4USSA 1LU4A 3CRUA 4ML1A 4MMMA 2JSZA 3ZRDA 3MDKA 1SL0B 1GSSA 2P31A 1USBA 3L9VA 4O32A 3M1GA 5EY6A 5IMZA 4L0UA 1Z6MA 4V2NA 4MA9A 1SL2B 1XW9A 3IDVA 2HZEB 2NPBA 4XS4B 3GN3A 3HYPA 2LJKA 1ZMAA 1FB6A 2XHFA 4WEYA 2VIMA 4K9ZA 1FB0A 1A24A 2VL3A 2OBKA 5AIVA 3IR4A 1FAAA 1V9WA 2VLTA 4HOJA 3MAKA 3CMIA 1JHBA 4KDUA 4IVFA 2B5EA 1ERVA 3IC4A 1A2JA 2IN3A 2F9SA 1K3LA 4NV2A 2MMZA 1PL2A 2HZEA 3PR8A 3QDNA 1PQNA 2O7KA 3HVVA 3IXRA 5DAKB 4O7HA 2IMKA 1EWXA 2GZPA 5D73A 4DVCA 2YOIA 1NHYA 1SK2A 1ACVA 4DEJA 1HNCA 3BCKA 5J9BA 1EP8A 1QQ2A 2DJ1A 1PKZA 1NM3A 1RK4A 1TK5B 4DSRA 1B8XA 1K3YA 3GA4A 3ZYWA 4D73B 2Z9SA 3AY8A 1SYXA 2H71A 2FGXA 4KCEA 4V1Ag 5C04A 2E7PA 4QQ7A 5DAKA 3TGZA 1BX9A 4OCFA 3W8JA 1XPVA 1X9WB 3EINA 1QK8A 3EVIA 2WJUA 2YP6A 4TXVA 4G9HA 4NHZA 4HJ2A 1MD4A 1WIKA 3UEMA 2NDOA 3IA1A 4JR6A 3RPNA 2AYTA 4D73A 3GHAA 2P0GA 4JEDA 2LSTA 4MZCA 2IIYA 3BD2A 3M3MA 2L4CA 3DIEA 1V98A 2GVPA 2HSMB 4ECJA 1AW9A 1EEMA 2VLVA 2YWIA 1ON4A 2V41A 3DWVA 2PVOC 2B7KA 1OAZA 2B1KA 20GSA 1X9MB 2TIRA 5G2ZA 4GSNA 4X1UA 2M80A 4TN8A 3GURA 2PU9C 1AUCA 3GFKA 2R4VA 2VAFA 3FZ5A 2MMNA 3WGEA 2VOCA 4ZBAA 1MDKA 4GRFA 1ML6A 2HSMA 3C1SA 4MH3A 2K9FA 4EKZA 4ZILA 1A8YA 3IV4A 4ZL8A 3GSTA 4AJ7A 2H1AA 5ECQB 4GQFA 3ED3A 2H6XA 4NHWA 4RQRA 1FW1A 1OKDA 1GNWA 6GSTA 4MCUA 5ECHB 16GSA 4PNGA 2F8FA 1SL1B 3HZ4A 3GKKA 2DJKA 2YANA 2H8LA 1FG4A 4YQVA 1T4YA 2JL4A 2H74A 4EC0A 1T4ZA 1TTZA 1DE1A 3TJJA 1OE8A 3LWAA 4MPGA 2MZCA 4OCEA 4GSTA 1FHEA 5IMFA 2H0IA 4KA0A 2I81A 3UL3A 1U6TA 2I4AA 2ON5A 3LQ7A 2VL2A 3TKSE 1MD3A 1GL8A 4KF9A 4EL1A 4ZL9A 3VLNA 2R2JA 3O3TA 3EWLA 4IS0A 4LMWA 1AIUA 5ECSA 3UAPA 1K0BA 1PMTA 3A2VA 2E2GA 3F4SA 3M9JA 2LJAA 1NW2A 3LYKA 1FVJA 2AB6A 2ZNMA 1TXXA 3GIXA 3WGXA 3E0UA 4MF7A 1F3BA 5HFIA 3FHKA 5B8BA 4ECIA 6GSVA 1KNGA 1VF3A 3FRCA 3J7Yb 2FHEA 1M0UA 1X5CA 4EVMA 5JCWA 5F0GA 2H73A 1THXA 4Z7XA 2N5BA 3GL3A 3LYPA 12GSA 4KDYA 5AIXA 3MSZA 3TB2A 2VCXA 2CA8A 4PXOA 4AF2A 1XXUA 5LNKe 5AGYA 1OKTA 2F3MA 2LRNA 2C8UA 2HSNB 2IPAA 2L4QA 2KP2A 1ILOA 3QFAC 3JCML 4WR4A 4IKHA 3CBUA 1K0NA 1EZKA 3H1NA 1W4VA 3QFBC 5DALB 2R3XA 1XWAA 3GKXA 1WE0A 3Q6OA 4IBPA 4MZBA 1GLPA 9GSSA 3IC8A 3VPTA 1JZOA 1TRVA 4Q5NA 3G9BA 3QD9A 3LSZA 4WBJA 3GH6A 2HRAA 1GUKA 2K6VA 2TRXA 3BCIA 3J7Yk 1XW5A 1ZYEA 5DALA 4ZL7A 2KUCA 4ZBDA 5F8BA 2YN1A 1OYJA 1K0DA 3QAGA 1S3AA 1A8LA 2NBSA 5DDLA 3W6GA 3GRXA 4F0CA 1PGTA 4IELA 1OC3A 3DXBA 1VF2A 4O5RA 3A3TA 4BPYA 2C80A 1IYHA 4IGJA 3RHBA 1SU9A 1GSYA 4LLRA 2LTKA 3ZIVA 4JZQA 2FD3A 2J23A 3TJFA 5G31A 4N10A 2FY6A 3KCMA 3LXZA 1TW9A 3GX0A 4IP1A 5HR2A 4KX4A 4XS6A 2EIRA 2PERA 3CYNA 3SWLA 5DBQA 5ECNB 3DVWA 3TRPA 3FEUA 2X99A 3KMOA 4KGIA 1K0CA 5ECLB 2V32A 1VF4A 1SK0A 1U88A 4OO5A 1YQ1A 2WCIA 3TOUA 3ZFBA 5EPFA 1T1VA 1XWBA 5D93A 4KDXA 4TR1B 2OE3A 4N0VA 4G2EA 1B9XC 2BMXA 2WRTA 3VPQA 4F82A 1M2BA 3KEBA 3D4MA 1I5GA 2K8SA 5J5NA 2PN8A 3L0HA 4ZIJA 3ERWA 4IJIA 4ACSA 1TU7A 5CO3A 7GSSA 2CVKA 5LD0A 4KUNA 4K7IA 1UA5A 2DBCA 4QL9A 4ULXA 1CQHA 2C1YA 3UBKA 3HXSA 4WKWA 2H66A 5GZZB 4TR1A 1TP9A 1Y25A 1JLWA 4JU5A 1HNBA 2H72A 1GTBA 2HXKA 5HR0A 3F9UA 2KLXA 3G7JA 4OO4A 1KTEA 4KNDA 3TJBA 3QPMA 4TRXA 4MH2A 2CX3A 3FR9A 3I6AA 1LBKA 2H0HA 5D9TA 2O8VB 2IMDA 1GSEA 1ERUA 2PMTA 4WETA 3ZZXA 2X64A 1EV9A 3NOFA 2VCVA 4YAPA 3KH7A 3HDCA 3PH9A 1V57A 1M7TA 1BEDA 5KN1A 1WMJA 2VL2C 2PUKC 2BJXA 3EU4A 1R5AA 2N5FA 2DJ0A 4IN0A 5E59A 1A0FA 3RHCA 2L57A 2JACA 4ID0A 4EO3A 3TCOA 3UJ1A 1BYEA 2AJQB 1SD8A 1TU8A 1G6YA 2WGRA 4XRAA 4HJMA 4E8EA 3U6VA 1TI1A 4F9ZA 4MK3A 4ECCA 1XOAA 4IQ1A 1YZXA 4O92A 5ECMB 3DMLA 3ZVJA 3DD3A 2KP1A 5D8IA 1VGLA 4FQUA 2DSAA 2AAWA 3GSSA 1SKWB 4BL7B 2MMOA 3F6FA 3APOA 4X0XA 4Q5RA 4KW6A 5COHA 2K18A 2H70A 1XBSA 1B9YC 1AQXA 3UOMA 3KJYA 4OMVA 4MPFA 2OA7A 2CZ2A 4XRDA 2E2MA 4YQUA 4IQAA 2LUSA 6GSSA 4XS4A 5E4WA 5GSTA 3H4KA 5HR1A 2YPMA 4ZB8A 4WF4A 1F2EA 3N5OA 1UN2A 1O81A 3CTGA 2ALBA 3ZMLA 4TW5A 3WYWA 2EIOA 3A2XA 4HS1A 2B7JA 3FR3A 3I43A 1EEJA 4WBRD 1Q4JA 1ERTA 5AISA 3ZIJA 3ZMKA 2H1GA 2VCQA 4FYUA 3ZLPA 4TR0A 4XCSA 1SJZA 4OFMA 3TOTA 2L59A 3P90A 2RUEA 3F3RA 5JCGA 4MF6A 4BA7A 1M9BA 2AHEA 3ERFA 5CRGA 1V58A 3IE3A 3WD6A 2IMFA 2GSRA 3ME7A 3DKSA 5D9WA 2H76A 4LL4B 3CRTA 1J9BA 4FYBA 4I2TA 4L0WA 5ID2B 1F9MA 1YKCA 4HDEA 4POKA 1N2AA 4HEA2 2IFQB 4JRRA 3C7MA 4IJ3A 3VFIA 4ZBBA 3P8WA 2GTUA 1GUHA 1YY7A 4FH8A 5KN3A 3FK8A 8GSSA 2OACA 4PGTA 5DVBA 2XC2A 2M46A 5IOWA 5DJLA 5ELGA 2JSYA 4CW9A 3CXGA 1TDIA 2O87A 2HRFA 1TOFA 1XFLA 1M9AA 2IFQA 2E0QA 4DSSB 4L5LA 2HRNA 4Q5QA 2JZRA 3VI7A 3DVXA 19GSA 18GSA 4RQXA 1F3AA 2CVDA 2PBJA 4HZ4A 2OBIA 1SKSB 1PRXA 2H19A 3TJKA 3N9JA 1GTAA 2RIIA 2RM5A 3A5WA 3FKFA 5H5QA 1QFNA 1S3DA 3ZTLA 4FO5A 3P2AA 1TK0B 4I2UA 4TVEA 1EGOA 4DSSA 3F8UA 2HSYA 4EDZA 2X8GA 3DGQA 2VCZA 2CX4A 2C0DA 3GUSA 1R4WA 4CHSA 5JCUA 3O6TA 4J2FA 2JADA 2CZ3A 2NVLA 3H8QA 1Y6EA 4G10A 3U5RE 4EUYA 1G7OA 4XIHA 1AQVA 2DLXA 2LEGA 1ZCPA 5CRHA 4ECBA 2JU5A 5DCHA 1WWJA 1PL1A 2DMLA 2CAQA 5D9XA 5G5FA 5JWOB 1ST9A 2X8CA 3DEXA 3Q74A 3HKRA 3GKMA 1EP7A 1X5DA 4L8EA 2TRCP 1GTUA 2LS5A 1YDKA 5G5EA 4JE1A 4KSMA 1DBYA 4I5QA 2H01A 3UMAA 1Z7RA 4MZWA 1BAYA 1O8WA 2CV4A 3ERGA 4TOPA 4GCIA 3R3EA 1OC9B 1GTIA 2YV7A 4GTUA 3HCZA 2GSTA 2H1DA 5J3RA 5INYA 2XBQA 3O76A 3TUEA 1TRUA 2OE0A 3DYRA 5G1LA 3EE2A 3EMXA 1MDIA 1PD21 3HHVA 3L78A 5G30A 2L6DA 3DRNA 3WT2A 1OC9A 1XWKA 4IP6A 4J56E 1URMA 5L71A 1Z9HA 2FUG2 4H86A 1K0MA 1PX6A 1THOA 1Z7PA 5FHIA 1ZGNA 1JZDA 4WR5A 2V6KA 3LXTA 2OE1A 3APQA 3TKSA 2NTOA 2GZYA 2GT5A 3EURA 5IIZA 5J41A 2A2SA 2GS3A 1HD2A 2C0EA 1U3IA 5H5RA 4MJAA 2AUVA 2RUFA 3L9SA 2QC7A 3UVTA 2VL9A 4GXZA 2K8VA 3IK7A 4WF5A 2P5QA 1K0AA 3HA9A 3KZQA 4POBA 2KOKA 3LORA 2L6CA 3CSJA 5JWQB 2REMA 1XCCA 1RW1A 4KSOA 2H75A 5EVOA 5HFGA 4YAVA 3C73A 3M8NA 2B5YA 4YH2A 1SKRB 5D9VA 5A4WA 5LCZA 4KCAA 1SJIA 1ZL9A 22GSA 3BOAA 3KM6A 1WJKA 3FW2A 4PUFC 3IPZA 2I3YA 3F4RA 4F0BA 1WRYA 5IMAA 3VK9A 4PQ1A 4BWSA 1XVWA 2VO4A 3GTUB 3IAS2 2XPEA 1JZWA 2D2ZA 1FVKA 2OADA
chains in the Genus database with same CATH superfamily
2UZ8A 1GSFA 2HQTA 3C8EA 2C4JA 5ELAA 1O8XA 1KBNA 1ZZYA 4E68A 3GL5A 5F07A 5ENUA 5H5SA 2FA4A 2VCTA 3FR6A 2B6MA 5B6NA 2F8AA 5ECIB 3Q18A 4K0GA 1WP0A 1GULA 1XWGA 2GSQA 2DJ2A 3GTUA 2I9HA 4POMA 2WW2A 3KGKA 5CAXA 2KHPA 5KN2A 2X49A 2HE3A 2CQ9A 1XZOA 3A2WA 1YJ6A 2HYXA 3QCPA 4GF0A 6GSWA 5ECPB 3IRAA 4NV5A 1PN9A 1T3BA 4K7OA 4PNFA 5IQYA 4KB3A 1X9SB 2LRCA 2YJHA 3ZVJD 4KH7A 3KP9A 2CVBA 4N11A 1EOHA 1M2DA 3QR6A 3D6IA 1DE2A 1XOBA 3KP8A 3KTBA 1A2MA 4V2LA 5IM9A 2CAIA 2EIQA 3D22A 3D4TA 5F05A 2IMIA 2RLIA 1FOVA 1Z5YE 1O73A 3EMPA 2GQLA 4TXOB 1MDJA 3LGCA 4FYCA 2VCWA 4MJEA 1ZYPA 2HT9A 3HZ8A 3UARA 4ML6A 1U3AA 3TRXA 4MDCA 5AN1A 5D96A 2YWOA 5DQSA 4V1Ap 3TKRA 4NMUA 1C72A 2QGVA 2HRKB 4XS1A 1A2LA 5DQYA 1GNEA 1VRSD 3QOUA 2L5OA 4AJ6A 2DJJA 3MNGA 4TR4A 4TXOA 3TDGA 4PTSA 5CNWA 3ZFLA 3F0IA 2VD0A 4WXTA 3EYTA 2R5GA 1SENA 2YZUA 3CTFA 2HZFA 4G0IA 4K0NA 4LA1A 2HNLA 2ZCTA 3G7YA 1XIYA 2EC4A 4OFNA 2HRKA 1G6WA 2O5VA 3UBLA 2B3SA 4AI6A 4IHUA 2GDRA 3GH9A 4ZXGA 5J4UA 3QMXA 4PUAA 4I8BA 1J0FA 4HQZA 1QMVA 4G0KA 4EF0A 2H30A 2DKIA 3FZAA 2XBIA 3OR5A 5FT3A 1VF1A 5IMCA 5GAND 1G0TA 3F4TA 4OD7A 3E9JB 3VWXA 3D5JA 2WB9A 2PWJA 3K8NA 4HU9A 3QAWA 4XHMA 1N8JA 2R0PA 4JBBA 1BQ7A 2O85A 1YKAA 4BL7A 4K5RA 3W8SA 2ZUPA 1SVMA 4FIWA 2DIYA 2YWMA 3L9UA 4V2MA 5F06A 2EFCA 3HD5A 4MLYA 1GWCA 3F3QA 2C3TA 2GQMA 2A4VA 5CRDA 1GRXA 1TRWA 3TKSC 2YZHA 4DSQA 3RGBC 4NAXA 2OJLA 3PGTA 3KH9A 1BG5A 4PHZC 1GP1A 4TKYA 3US3A 4NPBA 1F6MC 5ABRA 2FNOA 5HQPA 3APSA 3LG6A 1I9DA 1B4QA 2R6KA 4P3YB 1N25A 4QL7A 4E8HA 3PINA 2IMEA 2WVXB 3VWVA 3IOSA 3D21A 4N30A 2FCHA 4Z2RA 1HQOA 3D0ZA 1XWCA 2PVQA 1M2AA 1Y1UA 4PURA 1ERWA 2C0GA 1SD9A 1HYUA 1K0OA 3ZREA 1H4OA 3MIXA 2IJYA 3RDWA 2LKUA 3E3EA 2GGTA 1S3RA 10GSA 2VUPA 2WVXA 2A2RA 4GDFA 1GSQA 2DJ3A 3LEFA 2X8HA 1AAZA 3GX8A 1O6JA 1SJ6A 4BVYB 6GSYA 2DMMA 1EGRA 5BMUB 2GLRA 4K2XA 1G7EA 4K1FA 5ID2A 5HR3A 2DIZA 1TK8B 3HJOA 5DJMA 2I1UA 4K7NA 3GYKA 3UVHA 1WOUA 2H0GA 2PPTA 2GT6A 2M72A 1A23A 3IAM2 3TRQA 2C0FA 3I9V2 2OKAA 5IO0A 1MEKA 1BG1A 4BVYA 1E2YA 5BMUA 2L5LA 2WFCA 2C3QA 4GQCA 2YJ7A 2H6ZA 3CSHA 1PX7A 4BWQA 4Q5FA 4K8MA 1DSBA 1GSDA 2ON7A 3HJPA 2ES7A 2LQQA 2XPDA 3VWWA 1IYIA 5IOXA 3EC3A 1ABAA 3GMFA 2DC5A 1RQMA 4AGSA 5A34A 2V1MA 4G19A 2G2QA 2H1BA 2HLSA 1QGVA 4K2DA 2VD1A 1AQWA 3VWUA 13GSA 2GZZA 5B6MA 4Z2UA 5B8AA 1YEXA 2A4HA 1YF0A 1K3OA 17GSA 3HY2A 2QSIA 2C3NA 2V6OA 1SK1A 1T7PB 4ZB6A 3RAZA 2GSSA 4TR3A 1OC8A 5CYYA 4ZB9A 1R5PA 1O85A 5CRWA 5A5HB 1F37A 2LNSA 4O5QA 4CDOA 4LL1B 3TU3B 1QXHA 2FWGA 4YQMA 3IK9A 4G0LA 4AJ8A 4RI7A 3G7IA 1T8EB 2BTOT 4MF5A 2YV9A 1KEBA 2WZ9A 1ZYQB 3FZ4A 4BVXB 4PX1A 3H79A 2F51A 4I6XA 3L4NA 4HQSA 3FYGA 3WGDA 3BJ5A 3HJMA 4HUAA 1JLVA 2WS2A 4XTSA 4N0ZA 1LJRA 5A5HA 1FOHA 4EXJA 1GLQA 2FA8A 3KTLA 6GSXA 1BJXA 2WW3A 3F6DA 1NSWA 4EIQA 1W89A 2DKHA 2GQKA 2JZSA 2VLUA 2LV3A 4BVXA 1TJDA 5JWRB 1TI3A 5ECKB 3LJRA 1UC7A 2LNTA 1B48A 3KXOA 1PA3A 3WT1A 5CREA 2WULA 3GV1A 1Z3EA 2IWTA 1B4PA 2HSHA 2MYGA 1PKWA 1QUWA 4IW9A 3CWGA 4HI7A 2J9HA 1XVQA 3SBCA 5B7CA 4OFTA 4MJBA 1J08A 2AV4A 4JR4A 4GSSA 3P7XA 5A4UA 5ECRB 2HFDA 6GSUA 2QA2A 3KD0A 2R37A 3ZL5A 14GSA 4MP4A 4HU7A 3I69A 5G1KA 3PPUA 5HFKA 3F63A 4F03A 5J9CA 1M99A 5C00A 3CSIA 5A5KA 1NHOA 1S3CA 1CQGA 1R26A 2HI7A 2R0GA 3UIWA 4I97A 2VM1A 3RBTA 1EV4A 5IO2A 3R2QA 3TJGA 1R7HA 4KE3A 1MTCA 1X5EA 5IMDA 4POLA 2B1LA 5IPGA 1FO5A 4PQHA 3S9FA 3H93A 4RI6A 3EU3A 5FWGA 4PQIA 2LQOA 1WPIA 3QAVA 3IHQA 1AC1A 1H75A 4GWRA 1SVOA 3NZNA 2P5RA 3KMNA 2G0FA 4KAEA 4PI2C 1E6BA 4EDYA 3GKNA 4L5OA 3C71A 2YWNA 3FZ9A 3TKQA 11GSA 1OVNA 2FWFA 5A4VA 2LRTA 2FWHA 3RPPA 3LFLA 3KIJA 1YF1A 2CT6A 1JZRA 4HZ2A 2N5AA 4EE0A 4J57E 1X0RA 4RUVA 1JFUA 5KN0A 1Q98A 4MJCA 3TKPA 3M9KA 3ME8A 3HVXA 3VI5A 2YNXA 1EOGA 5BRTA 1AXDA 2V2GA 1TRSA 1U87A 2LJRA 1DUGA 1ZOFA 4F2IA 1HNAA 1GSUA 2O89A 4QMKA 5ECOB 3ISOA 5CP1A 4ILFA 1UVZA 5EL8A 1Z6NA 5IMVA 2YCDA 1GH2A 1T00A 2H6YA 4ISDA 2FLSA 2X4AA 2FWEA 4LMVA 4YKFA 1TKDB 1V40A 2PGTA 1A0RP 3FY7A 3MWHA 5DCGA 3HVSA 3V1WA 3BBYA 3VURA 2MBTA 2RM6A 4NWYA 1PSQA 3ZITA 2WDUA 4A5PA 2MMAA 1GUMA 5KEJA 4NXIA 3C1RA 2VM2A 3Q19A 1V2AA 1OE7A 5GAPD 4X43A 4K6XA 5GSSA 4GLTA 5IPHA 2QKEA 2B5XA 1XW6A 2JZTA 3IBHA 2MBSA 3M0FA 1ZYNA 3NIVA 1O7UA 4ICYA 1YEPA 2IL3A 3GNJA 1SYRA 4OWYA 4MABA 4USSA 1LU4A 3CRUA 4ML1A 4MMMA 2JSZA 4AKIA 3ZRDA 3MDKA 1SL0B 1GSSA 2P31A 1USBA 3L9VA 4O32A 3M1GA 5EY6A 5IMZA 4L0UA 1Z6MA 4V2NA 4MA9A 1SL2B 1XW9A 3IDVA 2HZEB 2NPBA 4XS4B 3GN3A 3HYPA 2LJKA 1ZMAA 1FB6A 2XHFA 4WEYA 2VIMA 4K9ZA 1FB0A 1A24A 2VL3A 2OBKA 5AIVA 3IR4A 1FAAA 3CQFA 1V9WA 2VLTA 4HOJA 3MAKA 3CMIA 1JHBA 4KDUA 4IVFA 2H1LA 2B5EA 1ERVA 3IC4A 1A2JA 2IN3A 2F9SA 1K3LA 4NV2A 2MMZA 1PL2A 2HZEA 3PR8A 3QDNA 1PQNA 2O7KA 3HVVA 3IXRA 5DAKB 4O7HA 2IMKA 1EWXA 2GZPA 5D73A 4DVCA 2R0CA 2YOIA 1NHYA 1SK2A 1ACVA 4DEJA 1HNCA 3BCKA 5J9BA 1EP8A 1QQ2A 2DJ1A 1PKZA 1NM3A 1RK4A 1TK5B 4DSRA 1B8XA 1K3YA 3GA4A 3ZYWA 4D73B 2Z9SA 3AY8A 1SYXA 2H71A 2FGXA 4KCEA 4V1Ag 5C04A 2E7PA 4QQ7A 5DAKA 3TGZA 1BX9A 4OCFA 3W8JA 1XPVA 1X9WB 3EINA 1QK8A 3EVIA 2WJUA 2YP6A 4TXVA 4G9HA 4NHZA 4HJ2A 1MD4A 1WIKA 3UEMA 5KOXA 2NDOA 3IA1A 4JR6A 3RPNA 2AYTA 4D73A 3GHAA 2P0GA 4JEDA 2LSTA 4MZCA 4O5UA 2IIYA 5J47A 3BD2A 3M3MA 2L4CA 3DIEA 1V98A 2GVPA 2HSMB 4ECJA 1AW9A 1EEMA 1PFOA 2VLVA 2YWIA 1ON4A 2V41A 3DWVA 2PVOC 2B7KA 1S4BP 1OAZA 2B1KA 20GSA 1X9MB 2TIRA 5G2ZA 4GSNA 4X1UA 2M80A 4TN8A 1PN0A 3GURA 2PU9C 1AUCA 3GFKA 2R4VA 2VAFA 3FZ5A 2MMNA 3WGEA 2VOCA 4ZBAA 1MDKA 4GRFA 1ML6A 2HSMA 3C1SA 4MH3A 2K9FA 4EKZA 4ZILA 1A8YA 3IV4A 4Z2TA 4ZL8A 3GSTA 4AJ7A 2H1AA 5ECQB 4GQFA 3ED3A 2H6XA 4NHWA 4RQRA 1FW1A 1OKDA 3A5IA 1GNWA 6GSTA 4MCUA 5ECHB 16GSA 4PNGA 2O3EA 2F8FA 1SL1B 3HZ4A 3GKKA 2DJKA 2YANA 2H8LA 1FG4A 4YQVA 1T4YA 2JL4A 2H74A 4EC0A 1T4ZA 1TTZA 1DE1A 3TJJA 1OE8A 3LWAA 4MPGA 2MZCA 4X4JA 4OCEA 4GSTA 2VKZG 3FMWA 1FHEA 5IMFA 2H0IA 4KA0A 2I81A 3UL3A 1U6TA 2I4AA 2ON5A 3LQ7A 2VL2A 3TKSE 1MD3A 1GL8A 4KF9A 4EL1A 4ZL9A 3VLNA 2R2JA 3O3TA 3EWLA 4IS0A 4LMWA 1AIUA 5ECSA 3UAPA 1K0BA 1PMTA 3A2VA 2E2GA 3F4SA 3M9JA 2LJAA 1NW2A 3LYKA 1FVJA 2AB6A 2ZNMA 1TXXA 3GIXA 3WGXA 3E0UA 4MF7A 1F3BA 4AKGA 5HFIA 3FHKA 5B8BA 3RFRC 4ECIA 6GSVA 1KNGA 1VF3A 3FRCA 5J40A 3J7Yb 2FHEA 1M0UA 1X5CA 4EVMA 5JCWA 5F0GA 2H73A 1THXA 4Z7XA 2N5BA 3MYDA 3GL3A 3LYPA 12GSA 4KDYA 5AIXA 3MSZA 3TB2A 2VCXA 2CA8A 4PXOA 4AF2A 1XXUA 5LNKe 5AGYA 1OKTA 2F3MA 2LRNA 2C8UA 2HSNB 2IPAA 2L4QA 2KP2A 1ILOA 3QFAC 3JCML 4WR4A 4IKHA 3CBUA 1K0NA 4AKHA 1EZKA 3H1NA 1W4VA 3QFBC 5DALB 2R3XA 1SVLA 1XWAA 3GKXA 1WE0A 3Q6OA 4IBPA 4MZBA 1GLPA 9GSSA 3IC8A 2HSNA 3VPTA 1JZOA 1TRVA 4Q5NA 3G9BA 3QD9A 3LSZA 4WBJA 3GH6A 2HRAA 1GUKA 2K6VA 2TRXA 3BCIA 3J7Yk 1XW5A 1ZYEA 5DALA 4ZL7A 2KUCA 4ZBDA 5F8BA 2YN1A 1OYJA 1K0DA 3QAGA 1S3AA 1A8LA 2NBSA 5DDLA 3W6GA 3GRXA 1M3IA 4F0CA 1PGTA 4IELA 1OC3A 3DXBA 1VF2A 4O5RA 3A3TA 4BPYA 2C80A 1IYHA 4IGJA 3RHBA 1SU9A 1GSYA 4LLRA 2LTKA 3ZIVA 4JZQA 2FD3A 2J23A 3TJFA 5G31A 4N10A 2FY6A 3KCMA 3LXZA 1TW9A 3GX0A 4IP1A 5HR2A 4G01A 4KX4A 4XS6A 2EIRA 2PERA 3CYNA 3SWLA 5DBQA 5ECNB 3DVWA 3TRPA 3FEUA 2X99A 3KMOA 4KGIA 1K0CA 3HVNA 5ECLB 2V32A 1VF4A 1SK0A 1U88A 4OO5A 1YQ1A 2WCIA 3TOUA 3ZFBA 5EPFA 1T1VA 4PI0C 1XWBA 5D93A 4KDXA 4TR1B 2OE3A 4N0VA 1XG8A 4G2EA 1B9XC 2BMXA 2WRTA 3VPQA 4F82A 1M2BA 3KEBA 3D4MA 1I5GA 2K8SA 5J5NA 2PN8A 3L0HA 4ZIJA 3ERWA 4IJIA 4ACSA 1TU7A 5CO3A 7GSSA 2CVKA 5LD0A 4KUNA 4K7IA 1UA5A 2DBCA 4QL9A 2A2PA 4ULXA 1CQHA 2C1YA 3UBKA 3HXSA 1YEWC 4WKWA 2H66A 5GZZB 4TR1A 1TP9A 1Y25A 1JLWA 4JU5A 1HNBA 2H72A 1GTBA 2HXKA 5HR0A 3F9UA 2KLXA 2EFDA 3G7JA 4OO4A 1KTEA 4KNDA 3TJBA 3QPMA 4MNNA 4TRXA 4MH2A 2CX3A 3FR9A 3I6AA 1LBKA 2H0HA 5D9TA 2EFHA 2O8VB 2WVYA 4EIPA 2IMDA 1GSEA 1ERUA 2PMTA 4WETA 3ZZXA 2X64A 1EV9A 3NOFA 2VCVA 4YAPA 3EPTA 3KH7A 3HDCA 3PH9A 1V57A 1M7TA 1BEDA 5KN1A 1WMJA 2VL2C 2PUKC 2BJXA 3EU4A 1R5AA 2N5FA 2DJ0A 4IN0A 5E59A 1A0FA 3RHCA 4AKXB 2L57A 2JACA 4ID0A 4EO3A 3TCOA 3UJ1A 1BYEA 2AJQB 1SD8A 1TU8A 1G6YA 2WGRA 4XRAA 4HJMA 4E8EA 3U6VA 1TI1A 4F9ZA 3CHXC 4MK3A 4ECCA 1XOAA 4IQ1A 1YZXA 4O92A 5ECMB 3DMLA 3ZVJA 3DD3A 2KP1A 5D8IA 1VGLA 4FQUA 2DSAA 2AAWA 3GSSA 1SKWB 4BL7B 2MMOA 3F6FA 3APOA 4X0XA 4Q5RA 4KW6A 5COHA 2K18A 2H70A 3IHGA 1XBSA 1B9YC 1AQXA 3UOMA 3KJYA 4OMVA 4MPFA 2OA7A 2CZ2A 4XRDA 2E2MA 4YQUA 4IQAA 2LUSA 6GSSA 4XS4A 4HSCX 4BIKA 5E4WA 5GSTA 3H4KA 5HR1A 3LW9A 2YPMA 4ZB8A 4WF4A 1F2EA 3N5OA 4W66A 1UN2A 1O81A 3CTGA 2ALBA 3ZMLA 4TW5A 3WYWA 2EIOA 3A2XA 4HS1A 2B7JA 3FR3A 3I43A 1EEJA 4WBRD 1Q4JA 1ERTA 5AISA 3ZIJA 3ZMKA 2H1GA 2VCQA 4FYUA 3ZLPA 4TR0A 4XCSA 1SJZA 4OFMA 5J4YA 3TOTA 2L59A 3P90A 2RUEA 3F3RA 5JCGA 4MF6A 4BA7A 1M9BA 2AHEA 3ERFA 5CRGA 1V58A 3IE3A 3WD6A 2IMFA 2GSRA 3ME7A 3DKSA 5D9WA 2H76A 4LL4B 3CRTA 1J9BA 4FYBA 4I2TA 4L0WA 5ID2B 1F9MA 1YKCA 4HDEA 4POKA 1N2AA 4HEA2 2IFQB 4JRRA 3C7MA 4IJ3A 3VFIA 4ZBBA 3P8WA 2GTUA 2O36A 1GUHA 1YY7A 4FH8A 5KN3A 4CY6A 3FK8A 4N3ZA 8GSSA 2OACA 4PGTA 5DVBA 2XC2A 2M46A 2WW0A 5IOWA 5DJLA 5ELGA 2JSYA 4CW9A 3CXGA 1TDIA 2O87A 2WZSA 2HRFA 1TOFA 1I1IP 1XFLA 1M9AA 2IFQA 2E0QA 4DSSB 4L5LA 2HRNA 4Q5QA 2JZRA 3VI7A 3DVXA 19GSA 18GSA 4RQXA 1F3AA 2CVDA 2PBJA 4HZ4A 5A34B 2OBIA 1SKSB 3HMJG 1PRXA 2H19A 3TJKA 3N9JA 1GTAA 2RIIA 2RM5A 3A5WA 3FKFA 5A1NB 5H5QA 1QFNA 1S3DA 3ZTLA 4FO5A 3P2AA 1TK0B 4I2UA 4TVEA 1EGOA 4DSSA 3F8UA 2HSYA 4EDZA 2X8GA 3DGQA 4ZB7A 2VCZA 2CX4A 2C0DA 3GUSA 1R4WA 4CHSA 5JCUA 3O6TA 4J2FA 2JADA 2CZ3A 2NVLA 3H8QA 1Y6EA 4G10A 3U5RE 5A1NA 4EUYA 1G7OA 4XIHA 1AQVA 2DLXA 2LEGA 1ZCPA 5CRHA 4ECBA 5J4VA 2JU5A 5DCHA 2OT3A 1WWJA 1PL1A 2DMLA 2CAQA 5D9XA 4K5SA 5G5FA 5JWOB 1M3JA 1ST9A 2X8CA 3DEXA 3Q74A 3HKRA 3GKMA 1EP7A 1X5DA 4L8EA 2TRCP 1GTUA 2LS5A 1YDKA 5G5EA 4JE1A 4KSMA 1DBYA 4I5QA 2H01A 3UMAA 1Z7RA 4MZWA 1BAYA 1O8WA 1BF5A 2CV4A 3ERGA 4TOPA 4GCIA 3R3EA 1OC9B 1GTIA 2YV7A 4GTUA 3HCZA 2GSTA 2H1DA 5J3RA 5INYA 2XBQA 2QA1A 3O76A 3TUEA 1TRUA 2OE0A 3DYRA 2WW1A 5G1LA 3EE2A 3EMXA 1MDIA 1PD21 3HHVA 3L78A 5G30A 5KOWA 2L6DA 3DRNA 3WT2A 1OC9A 1XWKA 4IP6A 4J56E 1URMA 5L71A 1Z9HA 2FUG2 4H86A 1K0MA 4FXYP 1PX6A 1THOA 1Z7PA 5FHIA 1ZGNA 1JZDA 4WR5A 2V6KA 3LXTA 2OE1A 3APQA 3TKSA 2NTOA 2GZYA 2GT5A 3EURA 5IIZA 5J41A 2A2SA 2GS3A 1TXUA 2C0EA 1HD2A 4YKGA 1U3IA 5H5RA 4MJAA 2AUVA 2WVZA 2RUFA 3L9SA 2QC7A 1YVLA 3UVTA 2VL9A 4GXZA 2K8VA 3IK7A 4WF5A 2P5QA 1K0AA 3HA9A 3KZQA 4POBA 2KOKA 2UV8G 3LORA 2L6CA 3CSJA 5JWQB 2REMA 1XCCA 1RW1A 4KSOA 2H75A 5EVOA 5HFGA 4YAVA 3C73A 3M8NA 2B5YA 2EFEA 4YH2A 1SKRB 5D9VA 5A4WA 5LCZA 4KCAA 1SJIA 1ZL9A 22GSA 3BOAA 3KM6A 1WJKA 3FW2A 4PUFC 3IPZA 2I3YA 3F4RA 4F0BA 1WRYA 5IMAA 3VK9A 4PQ1A 4BWSA 1XVWA 4CY8A 2VO4A 3GTUB 3IAS2 2XPEA 1JZWA 2D2ZA 1FVKA 2OADA
chains in the Genus database with same CATH topology
2UZ8A 1GSFA 2HQTA 3C8EA 2C4JA 5ELAA 1O8XA 1KBNA 1ZZYA 4E68A 3GL5A 5F07A 5ENUA 5H5SA 2FA4A 2VCTA 3FR6A 2B6MA 5B6NA 2F8AA 5ECIB 3Q18A 4K0GA 1WP0A 1GULA 1XWGA 2GSQA 2DJ2A 3GTUA 2I9HA 4POMA 3KGKA 5CAXA 2KHPA 5KN2A 2X49A 2HE3A 2CQ9A 1XZOA 3A2WA 1YJ6A 2HYXA 3QCPA 4GF0A 6GSWA 5ECPB 3IRAA 4NV5A 1PN9A 1T3BA 4K7OA 4PNFA 5IQYA 4KB3A 1X9SB 2LRCA 2YJHA 3ZVJD 4KH7A 3KP9A 2CVBA 4N11A 1EOHA 1M2DA 3QR6A 3D6IA 1DE2A 1XOBA 3KP8A 3KTBA 1A2MA 4V2LA 5IM9A 2CAIA 2EIQA 3D22A 3D4TA 5F05A 2IMIA 2RLIA 1FOVA 1Z5YE 1O73A 3EMPA 2GQLA 4TXOB 1MDJA 3LGCA 4FYCA 2VCWA 4MJEA 1ZYPA 2HT9A 3HZ8A 3UARA 4ML6A 1U3AA 3TRXA 4MDCA 5AN1A 5D96A 2YWOA 5DQSA 4V1Ap 3TKRA 4NMUA 1C72A 2QGVA 2HRKB 4XS1A 1A2LA 5DQYA 1GNEA 1VRSD 3QOUA 2L5OA 4AJ6A 2DJJA 3MNGA 4TR4A 4TXOA 3TDGA 4PTSA 5CNWA 3ZFLA 3F0IA 2VD0A 4WXTA 3EYTA 2R5GA 1SENA 2YZUA 3CTFA 2HZFA 4G0IA 4K0NA 4LA1A 2HNLA 2ZCTA 3G7YA 1XIYA 2EC4A 4OFNA 2HRKA 1G6WA 2O5VA 3UBLA 2B3SA 4AI6A 4IHUA 2GDRA 3GH9A 4ZXGA 5J4UA 3QMXA 4PUAA 4I8BA 1J0FA 4HQZA 1QMVA 4G0KA 4EF0A 2H30A 2DKIA 3FZAA 2XBIA 3OR5A 5FT3A 1VF1A 5IMCA 5GAND 1G0TA 3F4TA 4OD7A 3E9JB 3VWXA 3D5JA 2WB9A 2PWJA 3K8NA 4HU9A 3QAWA 4XHMA 1N8JA 2R0PA 4JBBA 1BQ7A 2O85A 1YKAA 4BL7A 4K5RA 3W8SA 2ZUPA 1SVMA 4FIWA 2DIYA 2YWMA 3L9UA 4V2MA 5F06A 2EFCA 3HD5A 4MLYA 1GWCA 3F3QA 2C3TA 2GQMA 2A4VA 5CRDA 1GRXA 1TRWA 3TKSC 2YZHA 4DSQA 4NAXA 2OJLA 3PGTA 3KH9A 1BG5A 1GP1A 4TKYA 3US3A 4NPBA 1F6MC 5ABRA 2FNOA 5HQPA 3APSA 3LG6A 1I9DA 1B4QA 2R6KA 4P3YB 1N25A 4QL7A 4E8HA 3PINA 2IMEA 3VWVA 3IOSA 3D21A 4N30A 2FCHA 4Z2RA 1HQOA 3D0ZA 1XWCA 2PVQA 1M2AA 1Y1UA 4PURA 1ERWA 2C0GA 1SD9A 1HYUA 1K0OA 3ZREA 1H4OA 3MIXA 2IJYA 3RDWA 2LKUA 3E3EA 2GGTA 10GSA 2VUPA 2A2RA 4GDFA 1GSQA 2DJ3A 3LEFA 2X8HA 1AAZA 3GX8A 1O6JA 1SJ6A 4BVYB 6GSYA 2DMMA 1EGRA 5BMUB 2GLRA 4K2XA 1G7EA 4K1FA 5ID2A 5HR3A 2DIZA 1TK8B 3HJOA 5DJMA 2I1UA 4K7NA 3GYKA 3UVHA 1WOUA 2H0GA 2PPTA 2GT6A 2M72A 1A23A 3IAM2 3TRQA 2C0FA 3I9V2 2OKAA 5IO0A 1MEKA 1BG1A 4BVYA 1E2YA 5BMUA 2L5LA 2WFCA 2C3QA 4GQCA 2YJ7A 2H6ZA 3CSHA 1PX7A 4BWQA 4Q5FA 4K8MA 1DSBA 1GSDA 2ON7A 3HJPA 2ES7A 2LQQA 2XPDA 3VWWA 1IYIA 5IOXA 3EC3A 1ABAA 3GMFA 2DC5A 1RQMA 4AGSA 5A34A 2V1MA 4G19A 2G2QA 2H1BA 2HLSA 1QGVA 4K2DA 2VD1A 1AQWA 3VWUA 13GSA 2GZZA 5B6MA 4Z2UA 5B8AA 1YEXA 2A4HA 1YF0A 1K3OA 17GSA 3HY2A 2QSIA 2C3NA 2V6OA 1SK1A 1T7PB 4ZB6A 3RAZA 2GSSA 4TR3A 1OC8A 5CYYA 4ZB9A 1R5PA 1O85A 5CRWA 5A5HB 1F37A 2LNSA 4O5QA 4CDOA 4LL1B 3TU3B 1QXHA 2FWGA 4YQMA 3IK9A 4G0LA 4AJ8A 4RI7A 3G7IA 1T8EB 2BTOT 4MF5A 2YV9A 1KEBA 2WZ9A 1ZYQB 3FZ4A 4BVXB 4PX1A 3H79A 2F51A 4I6XA 3L4NA 4HQSA 3FYGA 3WGDA 3BJ5A 3HJMA 4HUAA 1JLVA 2WS2A 4XTSA 4N0ZA 1LJRA 5A5HA 1FOHA 4EXJA 1GLQA 2FA8A 3KTLA 6GSXA 1BJXA 3F6DA 1NSWA 4EIQA 1W89A 2DKHA 2GQKA 2JZSA 2VLUA 2LV3A 4BVXA 1TJDA 5JWRB 1TI3A 5ECKB 3LJRA 1UC7A 2LNTA 1B48A 3KXOA 1PA3A 3WT1A 5CREA 2WULA 3GV1A 1Z3EA 2IWTA 1B4PA 2HSHA 2MYGA 1PKWA 1QUWA 4IW9A 3CWGA 4HI7A 2J9HA 1XVQA 3SBCA 5B7CA 4OFTA 4MJBA 1J08A 2AV4A 4JR4A 4GSSA 3P7XA 5A4UA 5ECRB 2HFDA 6GSUA 2QA2A 3KD0A 2R37A 3ZL5A 14GSA 4MP4A 4HU7A 3I69A 5G1KA 3PPUA 5HFKA 3F63A 4F03A 5J9CA 1M99A 5C00A 3CSIA 5A5KA 1NHOA 1S3CA 1CQGA 1R26A 2HI7A 2R0GA 3UIWA 4I97A 2VM1A 3RBTA 1EV4A 5IO2A 3R2QA 3TJGA 1R7HA 4KE3A 1MTCA 1X5EA 5IMDA 4POLA 2B1LA 5IPGA 1FO5A 4PQHA 3S9FA 3H93A 4RI6A 3EU3A 5FWGA 4PQIA 2LQOA 1WPIA 3QAVA 3IHQA 1AC1A 1H75A 4GWRA 1SVOA 3NZNA 2P5RA 3KMNA 2G0FA 4KAEA 1E6BA 4EDYA 3GKNA 4L5OA 3C71A 2YWNA 3FZ9A 3TKQA 11GSA 1OVNA 2FWFA 5A4VA 2LRTA 2FWHA 3RPPA 3LFLA 3KIJA 1YF1A 2CT6A 1JZRA 4HZ2A 2N5AA 4EE0A 4J57E 1X0RA 4RUVA 1JFUA 5KN0A 1Q98A 4MJCA 3TKPA 3M9KA 3ME8A 3HVXA 3VI5A 2YNXA 1EOGA 5BRTA 1AXDA 2V2GA 1TRSA 1U87A 2LJRA 1DUGA 1ZOFA 4F2IA 1HNAA 1GSUA 2O89A 4QMKA 5ECOB 3ISOA 5CP1A 4ILFA 1UVZA 5EL8A 1Z6NA 5IMVA 2YCDA 1GH2A 1T00A 2H6YA 4ISDA 2FLSA 2X4AA 2FWEA 4LMVA 4YKFA 1TKDB 1V40A 2PGTA 3MWHA 3FY7A 1A0RP 5DCGA 3HVSA 3V1WA 3BBYA 3VURA 2MBTA 2RM6A 4NWYA 1PSQA 3ZITA 2WDUA 4A5PA 2MMAA 1GUMA 5KEJA 4NXIA 3C1RA 2VM2A 3Q19A 1V2AA 1OE7A 5GAPD 4X43A 4K6XA 5GSSA 4GLTA 5IPHA 2QKEA 2B5XA 1XW6A 2JZTA 3IBHA 2MBSA 3M0FA 1ZYNA 3NIVA 1O7UA 4ICYA 1YEPA 2IL3A 3GNJA 1SYRA 4OWYA 4MABA 4USSA 1LU4A 3CRUA 4ML1A 4MMMA 2JSZA 4AKIA 3ZRDA 3MDKA 1SL0B 1GSSA 2P31A 1USBA 3L9VA 4O32A 3M1GA 5EY6A 5IMZA 4L0UA 1Z6MA 4V2NA 4MA9A 1SL2B 1XW9A 3IDVA 2HZEB 2NPBA 4XS4B 3GN3A 3HYPA 2LJKA 1ZMAA 1FB6A 2XHFA 4WEYA 2VIMA 4K9ZA 1FB0A 1A24A 2VL3A 2OBKA 5AIVA 3IR4A 1FAAA 1V9WA 2VLTA 4HOJA 3MAKA 3CMIA 1JHBA 4KDUA 4IVFA 2H1LA 2B5EA 1ERVA 3IC4A 1A2JA 2IN3A 2F9SA 1K3LA 4NV2A 2MMZA 1PL2A 2HZEA 3PR8A 3QDNA 1PQNA 2O7KA 3HVVA 3IXRA 5DAKB 4O7HA 2IMKA 1EWXA 2GZPA 5D73A 4DVCA 2R0CA 2YOIA 1NHYA 1SK2A 1ACVA 4DEJA 1HNCA 3BCKA 5J9BA 1EP8A 1QQ2A 2DJ1A 1PKZA 1NM3A 1RK4A 1TK5B 4DSRA 1B8XA 1K3YA 3GA4A 3ZYWA 4D73B 2Z9SA 3AY8A 1SYXA 2H71A 2FGXA 4KCEA 4V1Ag 5C04A 2E7PA 4QQ7A 5DAKA 3TGZA 1BX9A 4OCFA 3W8JA 1XPVA 1X9WB 3EINA 1QK8A 3EVIA 2WJUA 2YP6A 4TXVA 4G9HA 4NHZA 4HJ2A 1MD4A 1WIKA 3UEMA 5KOXA 2NDOA 3IA1A 4JR6A 3RPNA 2AYTA 4D73A 3GHAA 2P0GA 4JEDA 2LSTA 4MZCA 4O5UA 2IIYA 5J47A 3BD2A 3M3MA 2L4CA 3DIEA 1V98A 2GVPA 2HSMB 4ECJA 1AW9A 1EEMA 2VLVA 2YWIA 1ON4A 2V41A 3DWVA 2PVOC 2B7KA 1OAZA 2B1KA 20GSA 1X9MB 2TIRA 5G2ZA 4GSNA 4X1UA 2M80A 4TN8A 1PN0A 3GURA 2PU9C 1AUCA 3GFKA 2R4VA 2VAFA 3FZ5A 2MMNA 3WGEA 2VOCA 4ZBAA 1MDKA 4GRFA 1ML6A 2HSMA 3C1SA 4MH3A 2K9FA 4EKZA 4ZILA 1A8YA 3IV4A 4Z2TA 4ZL8A 3GSTA 4AJ7A 2H1AA 5ECQB 4GQFA 3ED3A 2H6XA 4NHWA 4RQRA 1FW1A 1OKDA 3A5IA 1GNWA 6GSTA 4MCUA 5ECHB 16GSA 4PNGA 2F8FA 1SL1B 3HZ4A 3GKKA 2DJKA 2YANA 2H8LA 1FG4A 4YQVA 1T4YA 2JL4A 2H74A 4EC0A 1T4ZA 1TTZA 1DE1A 3TJJA 1OE8A 3LWAA 4MPGA 2MZCA 4X4JA 4OCEA 4GSTA 2VKZG 3FMWA 1FHEA 5IMFA 2H0IA 4KA0A 2I81A 3UL3A 1U6TA 2I4AA 2ON5A 3LQ7A 2VL2A 3TKSE 1MD3A 1GL8A 4KF9A 4EL1A 4ZL9A 3VLNA 2R2JA 3O3TA 3EWLA 4IS0A 4LMWA 1AIUA 5ECSA 3UAPA 1K0BA 1PMTA 3A2VA 2E2GA 3F4SA 3M9JA 2LJAA 1NW2A 3LYKA 1FVJA 2AB6A 2ZNMA 1TXXA 3GIXA 3WGXA 3E0UA 4MF7A 1F3BA 4AKGA 5HFIA 3FHKA 5B8BA 4ECIA 6GSVA 1KNGA 1VF3A 3FRCA 5J40A 3J7Yb 2FHEA 1M0UA 1X5CA 4EVMA 5JCWA 5F0GA 2H73A 1THXA 4Z7XA 2N5BA 3MYDA 3GL3A 3LYPA 12GSA 4KDYA 5AIXA 3MSZA 3TB2A 2VCXA 2CA8A 4PXOA 4AF2A 1XXUA 5LNKe 5AGYA 1OKTA 2F3MA 2LRNA 2C8UA 2HSNB 2IPAA 2L4QA 2KP2A 1ILOA 3QFAC 3JCML 4WR4A 4IKHA 3CBUA 1K0NA 4AKHA 1EZKA 3H1NA 1W4VA 3QFBC 5DALB 2R3XA 1SVLA 1XWAA 3GKXA 1WE0A 3Q6OA 4IBPA 4MZBA 1GLPA 9GSSA 3IC8A 2HSNA 3VPTA 1JZOA 1TRVA 4Q5NA 3G9BA 3QD9A 3LSZA 4WBJA 3GH6A 2HRAA 1GUKA 2K6VA 2TRXA 3BCIA 3J7Yk 1XW5A 1ZYEA 5DALA 4ZL7A 2KUCA 4ZBDA 5F8BA 2YN1A 1OYJA 1K0DA 3QAGA 1S3AA 1A8LA 2NBSA 5DDLA 3W6GA 3GRXA 4F0CA 1PGTA 4IELA 1OC3A 3DXBA 1VF2A 4O5RA 3A3TA 4BPYA 2C80A 1IYHA 4IGJA 3RHBA 1SU9A 1GSYA 4LLRA 2LTKA 3ZIVA 4JZQA 2FD3A 2J23A 3TJFA 5G31A 4N10A 2FY6A 3KCMA 3LXZA 1TW9A 3GX0A 4IP1A 5HR2A 4G01A 4KX4A 4XS6A 2EIRA 2PERA 3CYNA 3SWLA 5DBQA 5ECNB 3DVWA 3TRPA 3FEUA 2X99A 3KMOA 4KGIA 1K0CA 5ECLB 2V32A 1VF4A 1SK0A 1U88A 4OO5A 1YQ1A 2WCIA 3TOUA 3ZFBA 5EPFA 1T1VA 1XWBA 5D93A 4KDXA 4TR1B 2OE3A 4N0VA 4G2EA 1B9XC 2BMXA 2WRTA 3VPQA 4F82A 1M2BA 3KEBA 3D4MA 1I5GA 2K8SA 5J5NA 2PN8A 3L0HA 4ZIJA 3ERWA 4IJIA 4ACSA 1TU7A 5CO3A 7GSSA 2CVKA 5LD0A 4KUNA 4K7IA 1UA5A 2DBCA 4QL9A 2A2PA 4ULXA 1CQHA 2C1YA 3UBKA 3HXSA 4WKWA 2H66A 5GZZB 4TR1A 1TP9A 1Y25A 1JLWA 4JU5A 1HNBA 2H72A 1GTBA 2HXKA 5HR0A 3F9UA 2KLXA 2EFDA 3G7JA 4OO4A 1KTEA 4KNDA 3TJBA 3QPMA 4MNNA 4TRXA 4MH2A 2CX3A 3FR9A 3I6AA 1LBKA 2H0HA 5D9TA 2EFHA 2O8VB 4EIPA 2IMDA 1GSEA 1ERUA 2PMTA 4WETA 3ZZXA 2X64A 1EV9A 3NOFA 2VCVA 4YAPA 3EPTA 3KH7A 3HDCA 3PH9A 1V57A 1M7TA 1BEDA 5KN1A 1WMJA 2VL2C 2PUKC 2BJXA 3EU4A 1R5AA 2N5FA 2DJ0A 4IN0A 5E59A 1A0FA 3RHCA 4AKXB 2L57A 2JACA 4ID0A 4EO3A 3TCOA 3UJ1A 1BYEA 2AJQB 1SD8A 1TU8A 1G6YA 2WGRA 4XRAA 4HJMA 4E8EA 3U6VA 1TI1A 4F9ZA 4MK3A 4ECCA 1XOAA 4IQ1A 1YZXA 4O92A 5ECMB 3DMLA 3ZVJA 3DD3A 2KP1A 5D8IA 1VGLA 4FQUA 2DSAA 2AAWA 3GSSA 1SKWB 4BL7B 2MMOA 3F6FA 3APOA 4X0XA 4Q5RA 4KW6A 5COHA 2K18A 2H70A 3IHGA 1XBSA 1B9YC 1AQXA 3UOMA 3KJYA 4OMVA 4MPFA 2OA7A 2CZ2A 4XRDA 2E2MA 4YQUA 4IQAA 2LUSA 6GSSA 4XS4A 5E4WA 5GSTA 3H4KA 5HR1A 3LW9A 2YPMA 4ZB8A 4WF4A 1F2EA 3N5OA 4W66A 1UN2A 1O81A 3CTGA 2ALBA 3ZMLA 4TW5A 3WYWA 2EIOA 3A2XA 4HS1A 2B7JA 3FR3A 3I43A 1EEJA 4WBRD 1Q4JA 1ERTA 5AISA 3ZIJA 3ZMKA 2H1GA 2VCQA 4FYUA 3ZLPA 4TR0A 4XCSA 1SJZA 4OFMA 5J4YA 3TOTA 2L59A 3P90A 2RUEA 3F3RA 5JCGA 4MF6A 4BA7A 1M9BA 2AHEA 3ERFA 5CRGA 1V58A 3IE3A 3WD6A 2IMFA 2GSRA 3ME7A 3DKSA 5D9WA 2H76A 4LL4B 3CRTA 1J9BA 4FYBA 4I2TA 4L0WA 5ID2B 1F9MA 1YKCA 4HDEA 4POKA 1N2AA 4HEA2 2IFQB 4JRRA 3C7MA 4IJ3A 3VFIA 4ZBBA 3P8WA 2GTUA 1GUHA 1YY7A 4FH8A 5KN3A 4CY6A 3FK8A 4N3ZA 8GSSA 2OACA 4PGTA 5DVBA 2XC2A 2M46A 5IOWA 5DJLA 5ELGA 2JSYA 4CW9A 3CXGA 1TDIA 2O87A 2HRFA 1TOFA 1XFLA 1M9AA 2IFQA 2E0QA 4DSSB 4L5LA 2HRNA 4Q5QA 2JZRA 3VI7A 3DVXA 19GSA 18GSA 4RQXA 1F3AA 2CVDA 2PBJA 4HZ4A 5A34B 2OBIA 1SKSB 3HMJG 1PRXA 2H19A 3TJKA 3N9JA 1GTAA 2RIIA 2RM5A 3A5WA 3FKFA 5A1NB 5H5QA 1QFNA 1S3DA 3ZTLA 4FO5A 3P2AA 1TK0B 4I2UA 4TVEA 1EGOA 4DSSA 3F8UA 2HSYA 4EDZA 2X8GA 3DGQA 4ZB7A 2VCZA 2CX4A 2C0DA 3GUSA 1R4WA 4CHSA 5JCUA 3O6TA 4J2FA 2JADA 2CZ3A 2NVLA 3H8QA 1Y6EA 4G10A 3U5RE 5A1NA 4EUYA 1G7OA 4XIHA 1AQVA 2DLXA 2LEGA 1ZCPA 5CRHA 4ECBA 5J4VA 2JU5A 5DCHA 2OT3A 1WWJA 1PL1A 2DMLA 2CAQA 5D9XA 4K5SA 5G5FA 5JWOB 1ST9A 2X8CA 3DEXA 3Q74A 3HKRA 3GKMA 1EP7A 1X5DA 4L8EA 2TRCP 1GTUA 2LS5A 1YDKA 5G5EA 4JE1A 4KSMA 1DBYA 4I5QA 2H01A 3UMAA 1Z7RA 4MZWA 1BAYA 1O8WA 1BF5A 2CV4A 3ERGA 4TOPA 4GCIA 3R3EA 1OC9B 1GTIA 2YV7A 4GTUA 3HCZA 2GSTA 2H1DA 5J3RA 5INYA 2XBQA 2QA1A 3O76A 3TUEA 1TRUA 2OE0A 3DYRA 5G1LA 3EE2A 3EMXA 1MDIA 1PD21 3HHVA 3L78A 5G30A 5KOWA 2L6DA 3DRNA 3WT2A 1OC9A 1XWKA 4IP6A 4J56E 1URMA 5L71A 1Z9HA 2FUG2 4H86A 1K0MA 1PX6A 1THOA 1Z7PA 5FHIA 1ZGNA 1JZDA 4WR5A 2V6KA 3LXTA 2OE1A 3APQA 3TKSA 2NTOA 2GZYA 2GT5A 3EURA 5IIZA 5J41A 2A2SA 2GS3A 1TXUA 1HD2A 2C0EA 4YKGA 1U3IA 5H5RA 4MJAA 2AUVA 2RUFA 3L9SA 2QC7A 1YVLA 3UVTA 2VL9A 4GXZA 2K8VA 3IK7A 4WF5A 2P5QA 1K0AA 3HA9A 3KZQA 4POBA 2KOKA 2UV8G 3LORA 2L6CA 3CSJA 5JWQB 2REMA 1XCCA 1RW1A 4KSOA 2H75A 5EVOA 5HFGA 4YAVA 3C73A 3M8NA 2B5YA 2EFEA 4YH2A 1SKRB 5D9VA 5A4WA 5LCZA 4KCAA 1SJIA 1ZL9A 22GSA 3BOAA 3KM6A 1WJKA 3FW2A 4PUFC 3IPZA 2I3YA 3F4RA 4F0BA 1WRYA 5IMAA 3VK9A 4PQ1A 4BWSA 1XVWA 4CY8A 2VO4A 3GTUB 3IAS2 2XPEA 1JZWA 2D2ZA 1FVKA 2OADA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UZ8 A;  1GSF A;  2HQT A;  3C8E A;  2C4J A;  5ELA A;  1O8X A;  1KBN A;  1ZZY A;  3GL5 A;  5F07 A;  5ENU A;  5H5S A;  2FA4 A;  2VCT A;  3FR6 A;  2B6M A;  5B6N A;  2F8A A;  5ECI B;  3Q18 A;  4K0G A;  1WP0 A;  1GUL A;  1XWG A;  2GSQ A;  2DJ2 A;  3GTU A;  2I9H A;  4POM A;  3KGK A;  5CAX A;  2KHP A;  5KN2 A;  2HE3 A;  2CQ9 A;  1XZO A;  3A2W A;  1YJ6 A;  2HYX A;  3QCP A;  4GF0 A;  6GSW A;  5ECP B;  3IRA A;  4NV5 A;  1PN9 A;  1T3B A;  4K7O A;  4PNF A;  5IQY A;  4KB3 A;  1X9S B;  2LRC A;  2YJH A;  3ZVJ D;  4KH7 A;  3KP9 A;  2CVB A;  4N11 A;  1EOH A;  1M2D A;  3QR6 A;  3D6I A;  1DE2 A;  1XOB A;  3KP8 A;  3KTB A;  1A2M A;  4V2L A;  5IM9 A;  2CAI A;  2EIQ A;  3D22 A;  3D4T A;  5F05 A;  2IMI A;  2RLI A;  1FOV A;  1Z5Y E;  1O73 A;  3EMP A;  2GQL A;  4TXO B;  1MDJ A;  3LGC A;  4FYC A;  2VCW A;  4MJE A;  2HT9 A;  3HZ8 A;  3UAR A;  4ML6 A;  1U3A A;  3TRX A;  4MDC A;  5AN1 A;  5D96 A;  2YWO A;  5DQS A;  4V1A p;  3TKR A;  4NMU A;  1C72 A;  2QGV A;  2HRK B;  4XS1 A;  1A2L A;  5DQY A;  1GNE A;  1VRS D;  3QOU A;  2L5O A;  4AJ6 A;  2DJJ A;  3MNG A;  4TR4 A;  4TXO A;  3TDG A;  4PTS A;  5CNW A;  3ZFL A;  3F0I A;  2VD0 A;  4WXT A;  3EYT A;  2R5G A;  1SEN A;  2YZU A;  3CTF A;  2HZF A;  4G0I A;  4K0N A;  4LA1 A;  2HNL A;  2ZCT A;  3G7Y A;  1XIY A;  2EC4 A;  4OFN A;  2HRK A;  1G6W A;  3UBL A;  2B3S A;  4IHU A;  2GDR A;  3GH9 A;  4ZXG A;  5J4U A;  3QMX A;  4PUA A;  4I8B A;  1J0F A;  4HQZ A;  1QMV A;  4G0K A;  4EF0 A;  2H30 A;  3FZA A;  2XBI A;  3OR5 A;  5FT3 A;  1VF1 A;  5IMC A;  5GAN D;  1G0T A;  3F4T A;  4OD7 A;  3E9J B;  3VWX A;  3D5J A;  2WB9 A;  2PWJ A;  3K8N A;  4HU9 A;  3QAW A;  4XHM A;  1N8J A;  4JBB A;  1BQ7 A;  2O85 A;  1YKA A;  4BL7 A;  3W8S A;  2ZUP A;  4FIW A;  2DIY A;  2YWM A;  3L9U A;  4V2M A;  5F06 A;  3HD5 A;  4MLY A;  1GWC A;  3F3Q A;  2C3T A;  2GQM A;  2A4V A;  5CRD A;  1GRX A;  1TRW A;  3TKS C;  2YZH A;  4DSQ A;  4NAX A;  2OJL A;  3PGT A;  3KH9 A;  1BG5 A;  1GP1 A;  4TKY A;  3US3 A;  4NPB A;  1F6M C;  5ABR A;  2FNO A;  5HQP A;  3APS A;  3LG6 A;  1I9D A;  1B4Q A;  2R6K A;  4P3Y B;  4QL7 A;  4E8H A;  3PIN A;  2IME A;  3VWV A;  3IOS A;  3D21 A;  4N30 A;  2FCH A;  1HQO A;  3D0Z A;  1XWC A;  2PVQ A;  1M2A A;  4PUR A;  1ERW A;  2C0G A;  1SD9 A;  1HYU A;  1K0O A;  3ZRE A;  1H4O A;  2IJY A;  3RDW A;  2LKU A;  3E3E A;  2GGT A;  10GS A;  2VUP A;  2A2R A;  1GSQ A;  2DJ3 A;  3LEF A;  2X8H A;  1AAZ A;  3GX8 A;  1O6J A;  1SJ6 A;  4BVY B;  6GSY A;  2DMM A;  1EGR A;  2GLR A;  1G7E A;  4K1F A;  5ID2 A;  5HR3 A;  2DIZ A;  1TK8 B;  3HJO A;  5DJM A;  2I1U A;  4K7N A;  3GYK A;  3UVH A;  1WOU A;  2H0G A;  2PPT A;  2GT6 A;  2M72 A;  1A23 A;  3IAM 2;  3TRQ A;  2C0F A;  3I9V 2;  2OKA A;  5IO0 A;  1MEK A;  4BVY A;  1E2Y A;  5BMU A;  2L5L A;  2WFC A;  2C3Q A;  4GQC A;  2YJ7 A;  2H6Z A;  3CSH A;  1PX7 A;  4BWQ A;  4Q5F A;  4K8M A;  1DSB A;  1GSD A;  2ON7 A;  3HJP A;  2ES7 A;  2LQQ A;  2XPD A;  3VWW A;  1IYI A;  5IOX A;  3EC3 A;  1ABA A;  3GMF A;  2DC5 A;  1RQM A;  4AGS A;  2V1M A;  4G19 A;  2G2Q A;  2H1B A;  2HLS A;  1QGV A;  4K2D A;  2VD1 A;  1AQW A;  3VWU A;  13GS A;  2GZZ A;  5B6M A;  5B8A A;  1YEX A;  1YF0 A;  1K3O A;  17GS A;  3HY2 A;  2QSI A;  2C3N A;  2V6O A;  1SK1 A;  1T7P B;  4ZB6 A;  3RAZ A;  2GSS A;  4TR3 A;  1OC8 A;  5CYY A;  4ZB9 A;  1R5P A;  1O85 A;  5CRW A;  2LNS A;  1F37 A;  4CDO A;  4LL1 B;  1QXH A;  2FWG A;  4YQM A;  3IK9 A;  4G0L A;  4AJ8 A;  4RI7 A;  3G7I A;  1T8E B;  2BTO T;  4MF5 A;  2YV9 A;  1KEB A;  2WZ9 A;  1ZYQ B;  3FZ4 A;  4BVX B;  4PX1 A;  3H79 A;  2F51 A;  4I6X A;  3L4N A;  4HQS A;  3FYG A;  3WGD A;  3BJ5 A;  3HJM A;  4HUA A;  1JLV A;  2WS2 A;  4XTS A;  4N0Z A;  1LJR A;  4EXJ A;  1GLQ A;  2FA8 A;  3KTL A;  6GSX A;  1BJX A;  3F6D A;  1NSW A;  1W89 A;  2GQK A;  2JZS A;  2VLU A;  2LV3 A;  4BVX A;  1TJD A;  5JWR B;  1TI3 A;  5ECK B;  3LJR A;  1UC7 A;  2LNT A;  1B48 A;  3KXO A;  1PA3 A;  3WT1 A;  5CRE A;  2WUL A;  3GV1 A;  1Z3E A;  2IWT A;  1B4P A;  2HSH A;  2MYG A;  1PKW A;  1QUW A;  4IW9 A;  4HI7 A;  2J9H A;  1XVQ A;  3SBC A;  5B7C A;  4OFT A;  4MJB A;  1J08 A;  2AV4 A;  4JR4 A;  4GSS A;  3P7X A;  5A4U A;  5ECR B;  2HFD A;  6GSU A;  3KD0 A;  2R37 A;  3ZL5 A;  14GS A;  4MP4 A;  4HU7 A;  3I69 A;  5G1K A;  3PPU A;  5HFK A;  3F63 A;  4F03 A;  5J9C A;  1M99 A;  5C00 A;  3CSI A;  5A5K A;  1NHO A;  1S3C A;  1CQG A;  1R26 A;  2HI7 A;  3UIW A;  4I97 A;  2VM1 A;  3RBT A;  1EV4 A;  5IO2 A;  3R2Q A;  3TJG A;  1R7H A;  4KE3 A;  1MTC A;  1X5E A;  5IMD A;  4POL A;  2B1L A;  5IPG A;  1FO5 A;  4PQH A;  3S9F A;  3H93 A;  4RI6 A;  3EU3 A;  5FWG A;  4PQI A;  2LQO A;  1WPI A;  3QAV A;  3IHQ A;  1AC1 A;  1H75 A;  4GWR A;  3NZN A;  2P5R A;  3KMN A;  2G0F A;  4KAE A;  1E6B A;  4EDY A;  3GKN A;  4L5O A;  3C71 A;  2YWN A;  3FZ9 A;  3TKQ A;  11GS A;  1OVN A;  2FWF A;  5A4V A;  2LRT A;  2FWH A;  3RPP A;  3LFL A;  3KIJ A;  1YF1 A;  2CT6 A;  1JZR A;  4HZ2 A;  2N5A A;  4EE0 A;  4J57 E;  1X0R A;  4RUV A;  1JFU A;  5KN0 A;  1Q98 A;  4MJC A;  3TKP A;  3M9K A;  3ME8 A;  3HVX A;  3VI5 A;  2YNX A;  1EOG A;  1AXD A;  2V2G A;  1TRS A;  1U87 A;  2LJR A;  1DUG A;  1ZOF A;  4F2I A;  1HNA A;  1GSU A;  2O89 A;  5ECO B;  3ISO A;  5CP1 A;  4ILF A;  1UVZ A;  5EL8 A;  1Z6N A;  5IMV A;  2YCD A;  1GH2 A;  1T00 A;  2H6Y A;  4ISD A;  2FLS A;  2FWE A;  4LMV A;  1TKD B;  1V40 A;  2PGT A;  3MWH A;  3FY7 A;  1A0R P;  5DCG A;  3HVS A;  3V1W A;  3BBY A;  3VUR A;  2MBT A;  2RM6 A;  4NWY A;  1PSQ A;  3ZIT A;  2WDU A;  2MMA A;  1GUM A;  5KEJ A;  4NXI A;  3C1R A;  2VM2 A;  3Q19 A;  1V2A A;  1OE7 A;  5GAP D;  4X43 A;  4K6X A;  5GSS A;  4GLT A;  5IPH A;  2QKE A;  2B5X A;  1XW6 A;  2JZT A;  3IBH A;  2MBS A;  3M0F A;  3NIV A;  1O7U A;  1YEP A;  2IL3 A;  3GNJ A;  1SYR A;  4OWY A;  4MAB A;  4USS A;  1LU4 A;  3CRU A;  4ML1 A;  4MMM A;  2JSZ A;  3ZRD A;  3MDK A;  1SL0 B;  1GSS A;  2P31 A;  1USB A;  3L9V A;  4O32 A;  3M1G A;  5EY6 A;  5IMZ A;  4L0U A;  1Z6M A;  4V2N A;  4MA9 A;  1SL2 B;  1XW9 A;  3IDV A;  2HZE B;  2NPB A;  4XS4 B;  3GN3 A;  3HYP A;  2LJK A;  1ZMA A;  1FB6 A;  2XHF A;  4WEY A;  2VIM A;  4K9Z A;  1FB0 A;  1A24 A;  2VL3 A;  2OBK A;  5AIV A;  3IR4 A;  1FAA A;  1V9W A;  2VLT A;  4HOJ A;  3MAK A;  3CMI A;  1JHB A;  4KDU A;  4IVF A;  2B5E A;  1ERV A;  3IC4 A;  1A2J A;  2IN3 A;  2F9S A;  1K3L A;  4NV2 A;  2MMZ A;  1PL2 A;  2HZE A;  3PR8 A;  3QDN A;  1PQN A;  2O7K A;  3HVV A;  3IXR A;  5DAK B;  4O7H A;  2IMK A;  1EWX A;  2GZP A;  5D73 A;  4DVC A;  2YOI A;  1NHY A;  1SK2 A;  1ACV A;  4DEJ A;  1HNC A;  3BCK A;  5J9B A;  1EP8 A;  1QQ2 A;  2DJ1 A;  1PKZ A;  1NM3 A;  1RK4 A;  1TK5 B;  4DSR A;  1B8X A;  1K3Y A;  3GA4 A;  3ZYW A;  4D73 B;  2Z9S A;  3AY8 A;  1SYX A;  2H71 A;  2FGX A;  4KCE A;  4V1A g;  5C04 A;  2E7P A;  4QQ7 A;  5DAK A;  3TGZ A;  1BX9 A;  4OCF A;  3W8J A;  1XPV A;  1X9W B;  3EIN A;  1QK8 A;  3EVI A;  2WJU A;  2YP6 A;  4TXV A;  4G9H A;  4NHZ A;  4HJ2 A;  1MD4 A;  1WIK A;  3UEM A;  2NDO A;  3IA1 A;  4JR6 A;  3RPN A;  2AYT A;  4D73 A;  3GHA A;  2P0G A;  4JED A;  2LST A;  4MZC A;  2IIY A;  3BD2 A;  3M3M A;  2L4C A;  3DIE A;  1V98 A;  2GVP A;  2HSM B;  4ECJ A;  1AW9 A;  1EEM A;  2VLV A;  2YWI A;  1ON4 A;  2V41 A;  3DWV A;  2PVO C;  2B7K A;  1OAZ A;  2B1K A;  20GS A;  1X9M B;  2TIR A;  5G2Z A;  4GSN A;  4X1U A;  2M80 A;  4TN8 A;  3GUR A;  2PU9 C;  1AUC A;  3GFK A;  2R4V A;  2VAF A;  3FZ5 A;  2MMN A;  3WGE A;  2VOC A;  4ZBA A;  1MDK A;  4GRF A;  1ML6 A;  2HSM A;  3C1S A;  4MH3 A;  2K9F A;  4EKZ A;  4ZIL A;  1A8Y A;  3IV4 A;  4ZL8 A;  3GST A;  4AJ7 A;  2H1A A;  5ECQ B;  4GQF A;  3ED3 A;  2H6X A;  4NHW A;  4RQR A;  1FW1 A;  1OKD A;  1GNW A;  6GST A;  4MCU A;  5ECH B;  16GS A;  4PNG A;  2F8F A;  1SL1 B;  3HZ4 A;  3GKK A;  2DJK A;  2YAN A;  2H8L A;  1FG4 A;  4YQV A;  1T4Y A;  2JL4 A;  2H74 A;  4EC0 A;  1T4Z A;  1TTZ A;  1DE1 A;  3TJJ A;  1OE8 A;  3LWA A;  4MPG A;  2MZC A;  4OCE A;  4GST A;  1FHE A;  5IMF A;  2H0I A;  4KA0 A;  2I81 A;  3UL3 A;  1U6T A;  2I4A A;  2ON5 A;  3LQ7 A;  2VL2 A;  3TKS E;  1MD3 A;  1GL8 A;  4KF9 A;  4EL1 A;  4ZL9 A;  3VLN A;  2R2J A;  3O3T A;  3EWL A;  4IS0 A;  4LMW A;  1AIU A;  5ECS A;  3UAP A;  1K0B A;  1PMT A;  3A2V A;  2E2G A;  3F4S A;  3M9J A;  2LJA A;  1NW2 A;  3LYK A;  1FVJ A;  2AB6 A;  2ZNM A;  1TXX A;  3GIX A;  3WGX A;  3E0U A;  4MF7 A;  1F3B A;  5HFI A;  3FHK A;  5B8B A;  4ECI A;  6GSV A;  1KNG A;  1VF3 A;  3FRC A;  3J7Y b;  2FHE A;  1M0U A;  1X5C A;  4EVM A;  5JCW A;  5F0G A;  2H73 A;  1THX A;  4Z7X A;  2N5B A;  3GL3 A;  3LYP A;  12GS A;  4KDY A;  5AIX A;  3MSZ A;  3TB2 A;  2VCX A;  2CA8 A;  4PXO A;  4AF2 A;  1XXU A;  5LNK e;  5AGY A;  1OKT A;  2F3M A;  2LRN A;  2C8U A;  2HSN B;  2IPA A;  2L4Q A;  2KP2 A;  1ILO A;  3QFA C;  3JCM L;  4WR4 A;  4IKH A;  3CBU A;  1K0N A;  1EZK A;  3H1N A;  1W4V A;  3QFB C;  5DAL B;  2R3X A;  1XWA A;  3GKX A;  1WE0 A;  3Q6O A;  4IBP A;  4MZB A;  1GLP A;  9GSS A;  3IC8 A;  3VPT A;  1JZO A;  1TRV A;  4Q5N A;  3G9B A;  3QD9 A;  3LSZ A;  4WBJ A;  3GH6 A;  2HRA A;  1GUK A;  2K6V A;  2TRX A;  3BCI A;  3J7Y k;  1XW5 A;  1ZYE A;  5DAL A;  4ZL7 A;  2KUC A;  4ZBD A;  5F8B A;  2YN1 A;  1OYJ A;  1K0D A;  3QAG A;  1S3A A;  1A8L A;  2NBS A;  5DDL A;  3W6G A;  3GRX A;  4F0C A;  1PGT A;  4IEL A;  1OC3 A;  3DXB A;  1VF2 A;  4O5R A;  3A3T A;  4BPY A;  2C80 A;  1IYH A;  4IGJ A;  3RHB A;  1SU9 A;  1GSY A;  4LLR A;  2LTK A;  3ZIV A;  4JZQ A;  2FD3 A;  2J23 A;  3TJF A;  5G31 A;  4N10 A;  2FY6 A;  3KCM A;  3LXZ A;  1TW9 A;  3GX0 A;  4IP1 A;  5HR2 A;  4KX4 A;  4XS6 A;  2EIR A;  2PER A;  3CYN A;  3SWL A;  5DBQ A;  5ECN B;  3DVW A;  3TRP A;  3FEU A;  2X99 A;  3KMO A;  4KGI A;  1K0C A;  5ECL B;  2V32 A;  1VF4 A;  1SK0 A;  1U88 A;  4OO5 A;  1YQ1 A;  2WCI A;  3TOU A;  3ZFB A;  5EPF A;  1T1V A;  1XWB A;  5D93 A;  4KDX A;  4TR1 B;  2OE3 A;  4N0V A;  4G2E A;  1B9X C;  2BMX A;  2WRT A;  3VPQ A;  4F82 A;  1M2B A;  3KEB A;  3D4M A;  1I5G A;  2K8S A;  5J5N A;  2PN8 A;  3L0H A;  4ZIJ A;  3ERW A;  4IJI A;  4ACS A;  1TU7 A;  5CO3 A;  7GSS A;  2CVK A;  5LD0 A;  4KUN A;  4K7I A;  1UA5 A;  2DBC A;  4QL9 A;  4ULX A;  1CQH A;  2C1Y A;  3UBK A;  3HXS A;  4WKW A;  2H66 A;  5GZZ B;  4TR1 A;  1TP9 A;  1Y25 A;  1JLW A;  4JU5 A;  1HNB A;  2H72 A;  1GTB A;  2HXK A;  5HR0 A;  3F9U A;  2KLX A;  3G7J A;  4OO4 A;  1KTE A;  4KND A;  3TJB A;  3QPM A;  4TRX A;  4MH2 A;  2CX3 A;  3FR9 A;  3I6A A;  1LBK A;  2H0H A;  5D9T A;  2O8V B;  2IMD A;  1GSE A;  1ERU A;  2PMT A;  4WET A;  3ZZX A;  2X64 A;  1EV9 A;  3NOF A;  2VCV A;  4YAP A;  3KH7 A;  3HDC A;  3PH9 A;  1V57 A;  1M7T A;  1BED A;  5KN1 A;  1WMJ A;  2VL2 C;  2PUK C;  2BJX A;  3EU4 A;  1R5A A;  2N5F A;  2DJ0 A;  4IN0 A;  5E59 A;  1A0F A;  3RHC A;  2L57 A;  2JAC A;  4ID0 A;  4EO3 A;  3TCO A;  3UJ1 A;  1BYE A;  2AJQ B;  1SD8 A;  1TU8 A;  1G6Y A;  2WGR A;  4XRA A;  4HJM A;  4E8E A;  3U6V A;  1TI1 A;  4F9Z A;  4MK3 A;  4ECC A;  1XOA A;  4IQ1 A;  1YZX A;  4O92 A;  5ECM B;  3DML A;  3ZVJ A;  3DD3 A;  2KP1 A;  5D8I A;  1VGL A;  4FQU A;  2DSA A;  2AAW A;  3GSS A;  1SKW B;  4BL7 B;  2MMO A;  3F6F A;  3APO A;  4X0X A;  4Q5R A;  4KW6 A;  5COH A;  2K18 A;  2H70 A;  1XBS A;  1B9Y C;  1AQX A;  3UOM A;  3KJY A;  4OMV A;  4MPF A;  2OA7 A;  2CZ2 A;  4XRD A;  2E2M A;  4YQU A;  4IQA A;  2LUS A;  6GSS A;  4XS4 A;  5E4W A;  5GST A;  3H4K A;  5HR1 A;  2YPM A;  4ZB8 A;  4WF4 A;  1F2E A;  3N5O A;  1UN2 A;  1O81 A;  3CTG A;  2ALB A;  3ZML A;  4TW5 A;  3WYW A;  2EIO A;  3A2X A;  4HS1 A;  2B7J A;  3FR3 A;  3I43 A;  1EEJ A;  4WBR D;  1Q4J A;  1ERT A;  5AIS A;  3ZIJ A;  3ZMK A;  2H1G A;  2VCQ A;  4FYU A;  3ZLP A;  4TR0 A;  4XCS A;  1SJZ A;  4OFM A;  3TOT A;  2L59 A;  3P90 A;  2RUE A;  3F3R A;  5JCG A;  4MF6 A;  4BA7 A;  1M9B A;  2AHE A;  3ERF A;  5CRG A;  1V58 A;  3IE3 A;  3WD6 A;  2IMF A;  2GSR A;  3ME7 A;  3DKS A;  5D9W A;  2H76 A;  4LL4 B;  3CRT A;  1J9B A;  4FYB A;  4I2T A;  4L0W A;  5ID2 B;  1F9M A;  1YKC A;  4HDE A;  4POK A;  1N2A A;  4HEA 2;  2IFQ B;  4JRR A;  3C7M A;  4IJ3 A;  3VFI A;  4ZBB A;  3P8W A;  2GTU A;  1GUH A;  1YY7 A;  4FH8 A;  5KN3 A;  3FK8 A;  8GSS A;  2OAC A;  4PGT A;  5DVB A;  2XC2 A;  2M46 A;  5IOW A;  5DJL A;  5ELG A;  2JSY A;  4CW9 A;  3CXG A;  1TDI A;  2O87 A;  2HRF A;  1TOF A;  1XFL A;  1M9A A;  2IFQ A;  2E0Q A;  4DSS B;  4L5L A;  2HRN A;  4Q5Q A;  2JZR A;  3VI7 A;  3DVX A;  19GS A;  18GS A;  4RQX A;  1F3A A;  2CVD A;  2PBJ A;  4HZ4 A;  2OBI A;  1SKS B;  1PRX A;  2H19 A;  3TJK A;  3N9J A;  1GTA A;  2RII A;  2RM5 A;  3A5W A;  3FKF A;  5H5Q A;  1QFN A;  1S3D A;  3ZTL A;  4FO5 A;  3P2A A;  1TK0 B;  4I2U A;  4TVE A;  1EGO A;  4DSS A;  3F8U A;  2HSY A;  4EDZ A;  2X8G A;  3DGQ A;  2VCZ A;  2CX4 A;  2C0D A;  3GUS A;  1R4W A;  4CHS A;  5JCU A;  3O6T A;  4J2F A;  2JAD A;  2CZ3 A;  2NVL A;  3H8Q A;  1Y6E A;  4G10 A;  3U5R E;  4EUY A;  1G7O A;  4XIH A;  1AQV A;  2DLX A;  2LEG A;  1ZCP A;  5CRH A;  4ECB A;  2JU5 A;  5DCH A;  1WWJ A;  1PL1 A;  2DML A;  2CAQ A;  5D9X A;  5G5F A;  5JWO B;  1ST9 A;  2X8C A;  3DEX A;  3Q74 A;  3HKR A;  3GKM A;  1EP7 A;  1X5D A;  4L8E A;  2TRC P;  1GTU A;  2LS5 A;  1YDK A;  5G5E A;  4JE1 A;  4KSM A;  1DBY A;  4I5Q A;  2H01 A;  3UMA A;  1Z7R A;  4MZW A;  1BAY A;  1O8W A;  2CV4 A;  3ERG A;  4TOP A;  4GCI A;  3R3E A;  1OC9 B;  1GTI A;  2YV7 A;  4GTU A;  3HCZ A;  2GST A;  2H1D A;  5J3R A;  5INY A;  2XBQ A;  3O76 A;  3TUE A;  1TRU A;  2OE0 A;  3DYR A;  5G1L A;  3EE2 A;  3EMX A;  1MDI A;  1PD2 1;  3HHV A;  3L78 A;  5G30 A;  2L6D A;  3DRN A;  3WT2 A;  1OC9 A;  1XWK A;  4IP6 A;  4J56 E;  1URM A;  5L71 A;  1Z9H A;  2FUG 2;  4H86 A;  1K0M A;  1PX6 A;  1THO A;  1Z7P A;  5FHI A;  1ZGN A;  1JZD A;  4WR5 A;  2V6K A;  3LXT A;  2OE1 A;  3APQ A;  3TKS A;  2NTO A;  2GZY A;  2GT5 A;  3EUR A;  5IIZ A;  5J41 A;  2A2S A;  2GS3 A;  1HD2 A;  2C0E A;  1U3I A;  5H5R A;  4MJA A;  2AUV A;  2RUF A;  3L9S A;  2QC7 A;  3UVT A;  2VL9 A;  4GXZ A;  2K8V A;  3IK7 A;  4WF5 A;  2P5Q A;  1K0A A;  3HA9 A;  3KZQ A;  4POB A;  2KOK A;  3LOR A;  2L6C A;  3CSJ A;  5JWQ B;  2REM A;  1XCC A;  1RW1 A;  4KSO A;  2H75 A;  5EVO A;  5HFG A;  4YAV A;  3C73 A;  3M8N A;  2B5Y A;  4YH2 A;  1SKR B;  5D9V A;  5A4W A;  5LCZ A;  4KCA A;  1SJI A;  1ZL9 A;  22GS A;  3BOA A;  3KM6 A;  1WJK A;  3FW2 A;  4PUF C;  3IPZ A;  2I3Y A;  3F4R A;  4F0B A;  1WRY A;  5IMA A;  3VK9 A;  4PQ1 A;  4BWS A;  1XVW A;  2VO4 A;  3GTU B;  3IAS 2;  2XPE A;  1JZW A;  2D2Z A;  1FVK A;  2OAD A; 
#chains in the Genus database with same CATH topology
 2UZ8 A;  1GSF A;  2HQT A;  3C8E A;  2C4J A;  5ELA A;  1O8X A;  1KBN A;  1ZZY A;  4E68 A;  3GL5 A;  5F07 A;  5ENU A;  5H5S A;  2FA4 A;  2VCT A;  3FR6 A;  2B6M A;  5B6N A;  2F8A A;  5ECI B;  3Q18 A;  4K0G A;  1WP0 A;  1GUL A;  1XWG A;  2GSQ A;  2DJ2 A;  3GTU A;  2I9H A;  4POM A;  2WW2 A;  3KGK A;  5CAX A;  2KHP A;  5KN2 A;  2X49 A;  2HE3 A;  2CQ9 A;  1XZO A;  3A2W A;  1YJ6 A;  2HYX A;  3QCP A;  4GF0 A;  6GSW A;  5ECP B;  3IRA A;  4NV5 A;  1PN9 A;  1T3B A;  4K7O A;  4PNF A;  5IQY A;  4KB3 A;  1X9S B;  2LRC A;  2YJH A;  3ZVJ D;  4KH7 A;  3KP9 A;  2CVB A;  4N11 A;  1EOH A;  1M2D A;  3QR6 A;  3D6I A;  1DE2 A;  1XOB A;  3KP8 A;  3KTB A;  1A2M A;  4V2L A;  5IM9 A;  2CAI A;  2EIQ A;  3D22 A;  3D4T A;  5F05 A;  2IMI A;  2RLI A;  1FOV A;  1Z5Y E;  1O73 A;  3EMP A;  2GQL A;  4TXO B;  1MDJ A;  3LGC A;  4FYC A;  2VCW A;  4MJE A;  1ZYP A;  2HT9 A;  3HZ8 A;  3UAR A;  4ML6 A;  1U3A A;  3TRX A;  4MDC A;  5AN1 A;  5D96 A;  2YWO A;  5DQS A;  4V1A p;  3TKR A;  4NMU A;  1C72 A;  2QGV A;  2HRK B;  4XS1 A;  1A2L A;  5DQY A;  1GNE A;  1VRS D;  3QOU A;  2L5O A;  4AJ6 A;  2DJJ A;  3MNG A;  4TR4 A;  4TXO A;  3TDG A;  4PTS A;  5CNW A;  3ZFL A;  3F0I A;  2VD0 A;  4WXT A;  3EYT A;  2R5G A;  1SEN A;  2YZU A;  3CTF A;  2HZF A;  4G0I A;  4K0N A;  4LA1 A;  2HNL A;  2ZCT A;  3G7Y A;  1XIY A;  2EC4 A;  4OFN A;  2HRK A;  1G6W A;  2O5V A;  3UBL A;  2B3S A;  4AI6 A;  4IHU A;  2GDR A;  3GH9 A;  4ZXG A;  5J4U A;  3QMX A;  4PUA A;  4I8B A;  1J0F A;  4HQZ A;  1QMV A;  4G0K A;  4EF0 A;  2H30 A;  2DKI A;  3FZA A;  2XBI A;  3OR5 A;  5FT3 A;  1VF1 A;  5IMC A;  5GAN D;  1G0T A;  3F4T A;  4OD7 A;  3E9J B;  3VWX A;  3D5J A;  2WB9 A;  2PWJ A;  3K8N A;  4HU9 A;  3QAW A;  4XHM A;  1N8J A;  2R0P A;  4JBB A;  1BQ7 A;  2O85 A;  1YKA A;  4BL7 A;  4K5R A;  3W8S A;  2ZUP A;  1SVM A;  4FIW A;  2DIY A;  2YWM A;  3L9U A;  4V2M A;  5F06 A;  2EFC A;  3HD5 A;  4MLY A;  1GWC A;  3F3Q A;  2C3T A;  2GQM A;  2A4V A;  5CRD A;  1GRX A;  1TRW A;  3TKS C;  2YZH A;  4DSQ A;  3RGB C;  4NAX A;  2OJL A;  3PGT A;  3KH9 A;  1BG5 A;  4PHZ C;  1GP1 A;  4TKY A;  3US3 A;  4NPB A;  1F6M C;  5ABR A;  2FNO A;  5HQP A;  3APS A;  3LG6 A;  1I9D A;  1B4Q A;  2R6K A;  4P3Y B;  1N25 A;  4QL7 A;  4E8H A;  3PIN A;  2IME A;  2WVX B;  3VWV A;  3IOS A;  3D21 A;  4N30 A;  2FCH A;  4Z2R A;  1HQO A;  3D0Z A;  1XWC A;  2PVQ A;  1M2A A;  1Y1U A;  4PUR A;  1ERW A;  2C0G A;  1SD9 A;  1HYU A;  1K0O A;  3ZRE A;  1H4O A;  3MIX A;  2IJY A;  3RDW A;  2LKU A;  3E3E A;  2GGT A;  1S3R A;  10GS A;  2VUP A;  2WVX A;  2A2R A;  4GDF A;  1GSQ A;  2DJ3 A;  3LEF A;  2X8H A;  1AAZ A;  3GX8 A;  1O6J A;  1SJ6 A;  4BVY B;  6GSY A;  2DMM A;  1EGR A;  5BMU B;  2GLR A;  4K2X A;  1G7E A;  4K1F A;  5ID2 A;  5HR3 A;  2DIZ A;  1TK8 B;  3HJO A;  5DJM A;  2I1U A;  4K7N A;  3GYK A;  3UVH A;  1WOU A;  2H0G A;  2PPT A;  2GT6 A;  2M72 A;  1A23 A;  3IAM 2;  3TRQ A;  2C0F A;  3I9V 2;  2OKA A;  5IO0 A;  1MEK A;  1BG1 A;  4BVY A;  1E2Y A;  5BMU A;  2L5L A;  2WFC A;  2C3Q A;  4GQC A;  2YJ7 A;  2H6Z A;  3CSH A;  1PX7 A;  4BWQ A;  4Q5F A;  4K8M A;  1DSB A;  1GSD A;  2ON7 A;  3HJP A;  2ES7 A;  2LQQ A;  2XPD A;  3VWW A;  1IYI A;  5IOX A;  3EC3 A;  1ABA A;  3GMF A;  2DC5 A;  1RQM A;  4AGS A;  5A34 A;  2V1M A;  4G19 A;  2G2Q A;  2H1B A;  2HLS A;  1QGV A;  4K2D A;  2VD1 A;  1AQW A;  3VWU A;  13GS A;  2GZZ A;  5B6M A;  4Z2U A;  5B8A A;  1YEX A;  2A4H A;  1YF0 A;  1K3O A;  17GS A;  3HY2 A;  2QSI A;  2C3N A;  2V6O A;  1SK1 A;  1T7P B;  4ZB6 A;  3RAZ A;  2GSS A;  4TR3 A;  1OC8 A;  5CYY A;  4ZB9 A;  1R5P A;  1O85 A;  5CRW A;  5A5H B;  1F37 A;  2LNS A;  4O5Q A;  4CDO A;  4LL1 B;  3TU3 B;  1QXH A;  2FWG A;  4YQM A;  3IK9 A;  4G0L A;  4AJ8 A;  4RI7 A;  3G7I A;  1T8E B;  2BTO T;  4MF5 A;  2YV9 A;  1KEB A;  2WZ9 A;  1ZYQ B;  3FZ4 A;  4BVX B;  4PX1 A;  3H79 A;  2F51 A;  4I6X A;  3L4N A;  4HQS A;  3FYG A;  3WGD A;  3BJ5 A;  3HJM A;  4HUA A;  1JLV A;  2WS2 A;  4XTS A;  4N0Z A;  1LJR A;  5A5H A;  1FOH A;  4EXJ A;  1GLQ A;  2FA8 A;  3KTL A;  6GSX A;  1BJX A;  2WW3 A;  3F6D A;  1NSW A;  4EIQ A;  1W89 A;  2DKH A;  2GQK A;  2JZS A;  2VLU A;  2LV3 A;  4BVX A;  1TJD A;  5JWR B;  1TI3 A;  5ECK B;  3LJR A;  1UC7 A;  2LNT A;  1B48 A;  3KXO A;  1PA3 A;  3WT1 A;  5CRE A;  2WUL A;  3GV1 A;  1Z3E A;  2IWT A;  1B4P A;  2HSH A;  2MYG A;  1PKW A;  1QUW A;  4IW9 A;  3CWG A;  4HI7 A;  2J9H A;  1XVQ A;  3SBC A;  5B7C A;  4OFT A;  4MJB A;  1J08 A;  2AV4 A;  4JR4 A;  4GSS A;  3P7X A;  5A4U A;  5ECR B;  2HFD A;  6GSU A;  2QA2 A;  3KD0 A;  2R37 A;  3ZL5 A;  14GS A;  4MP4 A;  4HU7 A;  3I69 A;  5G1K A;  3PPU A;  5HFK A;  3F63 A;  4F03 A;  5J9C A;  1M99 A;  5C00 A;  3CSI A;  5A5K A;  1NHO A;  1S3C A;  1CQG A;  1R26 A;  2HI7 A;  2R0G A;  3UIW A;  4I97 A;  2VM1 A;  3RBT A;  1EV4 A;  5IO2 A;  3R2Q A;  3TJG A;  1R7H A;  4KE3 A;  1MTC A;  1X5E A;  5IMD A;  4POL A;  2B1L A;  5IPG A;  1FO5 A;  4PQH A;  3S9F A;  3H93 A;  4RI6 A;  3EU3 A;  5FWG A;  4PQI A;  2LQO A;  1WPI A;  3QAV A;  3IHQ A;  1AC1 A;  1H75 A;  4GWR A;  1SVO A;  3NZN A;  2P5R A;  3KMN A;  2G0F A;  4KAE A;  4PI2 C;  1E6B A;  4EDY A;  3GKN A;  4L5O A;  3C71 A;  2YWN A;  3FZ9 A;  3TKQ A;  11GS A;  1OVN A;  2FWF A;  5A4V A;  2LRT A;  2FWH A;  3RPP A;  3LFL A;  3KIJ A;  1YF1 A;  2CT6 A;  1JZR A;  4HZ2 A;  2N5A A;  4EE0 A;  4J57 E;  1X0R A;  4RUV A;  1JFU A;  5KN0 A;  1Q98 A;  4MJC A;  3TKP A;  3M9K A;  3ME8 A;  3HVX A;  3VI5 A;  2YNX A;  1EOG A;  5BRT A;  1AXD A;  2V2G A;  1TRS A;  1U87 A;  2LJR A;  1DUG A;  1ZOF A;  4F2I A;  1HNA A;  1GSU A;  2O89 A;  4QMK A;  5ECO B;  3ISO A;  5CP1 A;  4ILF A;  1UVZ A;  5EL8 A;  1Z6N A;  5IMV A;  2YCD A;  1GH2 A;  1T00 A;  2H6Y A;  4ISD A;  2FLS A;  2X4A A;  2FWE A;  4LMV A;  4YKF A;  1TKD B;  1V40 A;  2PGT A;  1A0R P;  3FY7 A;  3MWH A;  5DCG A;  3HVS A;  3V1W A;  3BBY A;  3VUR A;  2MBT A;  2RM6 A;  4NWY A;  1PSQ A;  3ZIT A;  2WDU A;  4A5P A;  2MMA A;  1GUM A;  5KEJ A;  4NXI A;  3C1R A;  2VM2 A;  3Q19 A;  1V2A A;  1OE7 A;  5GAP D;  4X43 A;  4K6X A;  5GSS A;  4GLT A;  5IPH A;  2QKE A;  2B5X A;  1XW6 A;  2JZT A;  3IBH A;  2MBS A;  3M0F A;  1ZYN A;  3NIV A;  1O7U A;  4ICY A;  1YEP A;  2IL3 A;  3GNJ A;  1SYR A;  4OWY A;  4MAB A;  4USS A;  1LU4 A;  3CRU A;  4ML1 A;  4MMM A;  2JSZ A;  4AKI A;  3ZRD A;  3MDK A;  1SL0 B;  1GSS A;  2P31 A;  1USB A;  3L9V A;  4O32 A;  3M1G A;  5EY6 A;  5IMZ A;  4L0U A;  1Z6M A;  4V2N A;  4MA9 A;  1SL2 B;  1XW9 A;  3IDV A;  2HZE B;  2NPB A;  4XS4 B;  3GN3 A;  3HYP A;  2LJK A;  1ZMA A;  1FB6 A;  2XHF A;  4WEY A;  2VIM A;  4K9Z A;  1FB0 A;  1A24 A;  2VL3 A;  2OBK A;  5AIV A;  3IR4 A;  1FAA A;  3CQF A;  1V9W A;  2VLT A;  4HOJ A;  3MAK A;  3CMI A;  1JHB A;  4KDU A;  4IVF A;  2H1L A;  2B5E A;  1ERV A;  3IC4 A;  1A2J A;  2IN3 A;  2F9S A;  1K3L A;  4NV2 A;  2MMZ A;  1PL2 A;  2HZE A;  3PR8 A;  3QDN A;  1PQN A;  2O7K A;  3HVV A;  3IXR A;  5DAK B;  4O7H A;  2IMK A;  1EWX A;  2GZP A;  5D73 A;  4DVC A;  2R0C A;  2YOI A;  1NHY A;  1SK2 A;  1ACV A;  4DEJ A;  1HNC A;  3BCK A;  5J9B A;  1EP8 A;  1QQ2 A;  2DJ1 A;  1PKZ A;  1NM3 A;  1RK4 A;  1TK5 B;  4DSR A;  1B8X A;  1K3Y A;  3GA4 A;  3ZYW A;  4D73 B;  2Z9S A;  3AY8 A;  1SYX A;  2H71 A;  2FGX A;  4KCE A;  4V1A g;  5C04 A;  2E7P A;  4QQ7 A;  5DAK A;  3TGZ A;  1BX9 A;  4OCF A;  3W8J A;  1XPV A;  1X9W B;  3EIN A;  1QK8 A;  3EVI A;  2WJU A;  2YP6 A;  4TXV A;  4G9H A;  4NHZ A;  4HJ2 A;  1MD4 A;  1WIK A;  3UEM A;  5KOX A;  2NDO A;  3IA1 A;  4JR6 A;  3RPN A;  2AYT A;  4D73 A;  3GHA A;  2P0G A;  4JED A;  2LST A;  4MZC A;  4O5U A;  2IIY A;  5J47 A;  3BD2 A;  3M3M A;  2L4C A;  3DIE A;  1V98 A;  2GVP A;  2HSM B;  4ECJ A;  1AW9 A;  1EEM A;  1PFO A;  2VLV A;  2YWI A;  1ON4 A;  2V41 A;  3DWV A;  2PVO C;  2B7K A;  1S4B P;  1OAZ A;  2B1K A;  20GS A;  1X9M B;  2TIR A;  5G2Z A;  4GSN A;  4X1U A;  2M80 A;  4TN8 A;  1PN0 A;  3GUR A;  2PU9 C;  1AUC A;  3GFK A;  2R4V A;  2VAF A;  3FZ5 A;  2MMN A;  3WGE A;  2VOC A;  4ZBA A;  1MDK A;  4GRF A;  1ML6 A;  2HSM A;  3C1S A;  4MH3 A;  2K9F A;  4EKZ A;  4ZIL A;  1A8Y A;  3IV4 A;  4Z2T A;  4ZL8 A;  3GST A;  4AJ7 A;  2H1A A;  5ECQ B;  4GQF A;  3ED3 A;  2H6X A;  4NHW A;  4RQR A;  1FW1 A;  1OKD A;  3A5I A;  1GNW A;  6GST A;  4MCU A;  5ECH B;  16GS A;  4PNG A;  2O3E A;  2F8F A;  1SL1 B;  3HZ4 A;  3GKK A;  2DJK A;  2YAN A;  2H8L A;  1FG4 A;  4YQV A;  1T4Y A;  2JL4 A;  2H74 A;  4EC0 A;  1T4Z A;  1TTZ A;  1DE1 A;  3TJJ A;  1OE8 A;  3LWA A;  4MPG A;  2MZC A;  4X4J A;  4OCE A;  4GST A;  2VKZ G;  3FMW A;  1FHE A;  5IMF A;  2H0I A;  4KA0 A;  2I81 A;  3UL3 A;  1U6T A;  2I4A A;  2ON5 A;  3LQ7 A;  2VL2 A;  3TKS E;  1MD3 A;  1GL8 A;  4KF9 A;  4EL1 A;  4ZL9 A;  3VLN A;  2R2J A;  3O3T A;  3EWL A;  4IS0 A;  4LMW A;  1AIU A;  5ECS A;  3UAP A;  1K0B A;  1PMT A;  3A2V A;  2E2G A;  3F4S A;  3M9J A;  2LJA A;  1NW2 A;  3LYK A;  1FVJ A;  2AB6 A;  2ZNM A;  1TXX A;  3GIX A;  3WGX A;  3E0U A;  4MF7 A;  1F3B A;  4AKG A;  5HFI A;  3FHK A;  5B8B A;  3RFR C;  4ECI A;  6GSV A;  1KNG A;  1VF3 A;  3FRC A;  5J40 A;  3J7Y b;  2FHE A;  1M0U A;  1X5C A;  4EVM A;  5JCW A;  5F0G A;  2H73 A;  1THX A;  4Z7X A;  2N5B A;  3MYD A;  3GL3 A;  3LYP A;  12GS A;  4KDY A;  5AIX A;  3MSZ A;  3TB2 A;  2VCX A;  2CA8 A;  4PXO A;  4AF2 A;  1XXU A;  5LNK e;  5AGY A;  1OKT A;  2F3M A;  2LRN A;  2C8U A;  2HSN B;  2IPA A;  2L4Q A;  2KP2 A;  1ILO A;  3QFA C;  3JCM L;  4WR4 A;  4IKH A;  3CBU A;  1K0N A;  4AKH A;  1EZK A;  3H1N A;  1W4V A;  3QFB C;  5DAL B;  2R3X A;  1SVL A;  1XWA A;  3GKX A;  1WE0 A;  3Q6O A;  4IBP A;  4MZB A;  1GLP A;  9GSS A;  3IC8 A;  2HSN A;  3VPT A;  1JZO A;  1TRV A;  4Q5N A;  3G9B A;  3QD9 A;  3LSZ A;  4WBJ A;  3GH6 A;  2HRA A;  1GUK A;  2K6V A;  2TRX A;  3BCI A;  3J7Y k;  1XW5 A;  1ZYE A;  5DAL A;  4ZL7 A;  2KUC A;  4ZBD A;  5F8B A;  2YN1 A;  1OYJ A;  1K0D A;  3QAG A;  1S3A A;  1A8L A;  2NBS A;  5DDL A;  3W6G A;  3GRX A;  1M3I A;  4F0C A;  1PGT A;  4IEL A;  1OC3 A;  3DXB A;  1VF2 A;  4O5R A;  3A3T A;  4BPY A;  2C80 A;  1IYH A;  4IGJ A;  3RHB A;  1SU9 A;  1GSY A;  4LLR A;  2LTK A;  3ZIV A;  4JZQ A;  2FD3 A;  2J23 A;  3TJF A;  5G31 A;  4N10 A;  2FY6 A;  3KCM A;  3LXZ A;  1TW9 A;  3GX0 A;  4IP1 A;  5HR2 A;  4G01 A;  4KX4 A;  4XS6 A;  2EIR A;  2PER A;  3CYN A;  3SWL A;  5DBQ A;  5ECN B;  3DVW A;  3TRP A;  3FEU A;  2X99 A;  3KMO A;  4KGI A;  1K0C A;  3HVN A;  5ECL B;  2V32 A;  1VF4 A;  1SK0 A;  1U88 A;  4OO5 A;  1YQ1 A;  2WCI A;  3TOU A;  3ZFB A;  5EPF A;  1T1V A;  4PI0 C;  1XWB A;  5D93 A;  4KDX A;  4TR1 B;  2OE3 A;  4N0V A;  1XG8 A;  4G2E A;  1B9X C;  2BMX A;  2WRT A;  3VPQ A;  4F82 A;  1M2B A;  3KEB A;  3D4M A;  1I5G A;  2K8S A;  5J5N A;  2PN8 A;  3L0H A;  4ZIJ A;  3ERW A;  4IJI A;  4ACS A;  1TU7 A;  5CO3 A;  7GSS A;  2CVK A;  5LD0 A;  4KUN A;  4K7I A;  1UA5 A;  2DBC A;  4QL9 A;  2A2P A;  4ULX A;  1CQH A;  2C1Y A;  3UBK A;  3HXS A;  1YEW C;  4WKW A;  2H66 A;  5GZZ B;  4TR1 A;  1TP9 A;  1Y25 A;  1JLW A;  4JU5 A;  1HNB A;  2H72 A;  1GTB A;  2HXK A;  5HR0 A;  3F9U A;  2KLX A;  2EFD A;  3G7J A;  4OO4 A;  1KTE A;  4KND A;  3TJB A;  3QPM A;  4MNN A;  4TRX A;  4MH2 A;  2CX3 A;  3FR9 A;  3I6A A;  1LBK A;  2H0H A;  5D9T A;  2EFH A;  2O8V B;  2WVY A;  4EIP A;  2IMD A;  1GSE A;  1ERU A;  2PMT A;  4WET A;  3ZZX A;  2X64 A;  1EV9 A;  3NOF A;  2VCV A;  4YAP A;  3EPT A;  3KH7 A;  3HDC A;  3PH9 A;  1V57 A;  1M7T A;  1BED A;  5KN1 A;  1WMJ A;  2VL2 C;  2PUK C;  2BJX A;  3EU4 A;  1R5A A;  2N5F A;  2DJ0 A;  4IN0 A;  5E59 A;  1A0F A;  3RHC A;  4AKX B;  2L57 A;  2JAC A;  4ID0 A;  4EO3 A;  3TCO A;  3UJ1 A;  1BYE A;  2AJQ B;  1SD8 A;  1TU8 A;  1G6Y A;  2WGR A;  4XRA A;  4HJM A;  4E8E A;  3U6V A;  1TI1 A;  4F9Z A;  3CHX C;  4MK3 A;  4ECC A;  1XOA A;  4IQ1 A;  1YZX A;  4O92 A;  5ECM B;  3DML A;  3ZVJ A;  3DD3 A;  2KP1 A;  5D8I A;  1VGL A;  4FQU A;  2DSA A;  2AAW A;  3GSS A;  1SKW B;  4BL7 B;  2MMO A;  3F6F A;  3APO A;  4X0X A;  4Q5R A;  4KW6 A;  5COH A;  2K18 A;  2H70 A;  3IHG A;  1XBS A;  1B9Y C;  1AQX A;  3UOM A;  3KJY A;  4OMV A;  4MPF A;  2OA7 A;  2CZ2 A;  4XRD A;  2E2M A;  4YQU A;  4IQA A;  2LUS A;  6GSS A;  4XS4 A;  4HSC X;  4BIK A;  5E4W A;  5GST A;  3H4K A;  5HR1 A;  3LW9 A;  2YPM A;  4ZB8 A;  4WF4 A;  1F2E A;  3N5O A;  4W66 A;  1UN2 A;  1O81 A;  3CTG A;  2ALB A;  3ZML A;  4TW5 A;  3WYW A;  2EIO A;  3A2X A;  4HS1 A;  2B7J A;  3FR3 A;  3I43 A;  1EEJ A;  4WBR D;  1Q4J A;  1ERT A;  5AIS A;  3ZIJ A;  3ZMK A;  2H1G A;  2VCQ A;  4FYU A;  3ZLP A;  4TR0 A;  4XCS A;  1SJZ A;  4OFM A;  5J4Y A;  3TOT A;  2L59 A;  3P90 A;  2RUE A;  3F3R A;  5JCG A;  4MF6 A;  4BA7 A;  1M9B A;  2AHE A;  3ERF A;  5CRG A;  1V58 A;  3IE3 A;  3WD6 A;  2IMF A;  2GSR A;  3ME7 A;  3DKS A;  5D9W A;  2H76 A;  4LL4 B;  3CRT A;  1J9B A;  4FYB A;  4I2T A;  4L0W A;  5ID2 B;  1F9M A;  1YKC A;  4HDE A;  4POK A;  1N2A A;  4HEA 2;  2IFQ B;  4JRR A;  3C7M A;  4IJ3 A;  3VFI A;  4ZBB A;  3P8W A;  2GTU A;  2O36 A;  1GUH A;  1YY7 A;  4FH8 A;  5KN3 A;  4CY6 A;  3FK8 A;  4N3Z A;  8GSS A;  2OAC A;  4PGT A;  5DVB A;  2XC2 A;  2M46 A;  2WW0 A;  5IOW A;  5DJL A;  5ELG A;  2JSY A;  4CW9 A;  3CXG A;  1TDI A;  2O87 A;  2WZS A;  2HRF A;  1TOF A;  1I1I P;  1XFL A;  1M9A A;  2IFQ A;  2E0Q A;  4DSS B;  4L5L A;  2HRN A;  4Q5Q A;  2JZR A;  3VI7 A;  3DVX A;  19GS A;  18GS A;  4RQX A;  1F3A A;  2CVD A;  2PBJ A;  4HZ4 A;  5A34 B;  2OBI A;  1SKS B;  3HMJ G;  1PRX A;  2H19 A;  3TJK A;  3N9J A;  1GTA A;  2RII A;  2RM5 A;  3A5W A;  3FKF A;  5A1N B;  5H5Q A;  1QFN A;  1S3D A;  3ZTL A;  4FO5 A;  3P2A A;  1TK0 B;  4I2U A;  4TVE A;  1EGO A;  4DSS A;  3F8U A;  2HSY A;  4EDZ A;  2X8G A;  3DGQ A;  4ZB7 A;  2VCZ A;  2CX4 A;  2C0D A;  3GUS A;  1R4W A;  4CHS A;  5JCU A;  3O6T A;  4J2F A;  2JAD A;  2CZ3 A;  2NVL A;  3H8Q A;  1Y6E A;  4G10 A;  3U5R E;  5A1N A;  4EUY A;  1G7O A;  4XIH A;  1AQV A;  2DLX A;  2LEG A;  1ZCP A;  5CRH A;  4ECB A;  5J4V A;  2JU5 A;  5DCH A;  2OT3 A;  1WWJ A;  1PL1 A;  2DML A;  2CAQ A;  5D9X A;  4K5S A;  5G5F A;  5JWO B;  1M3J A;  1ST9 A;  2X8C A;  3DEX A;  3Q74 A;  3HKR A;  3GKM A;  1EP7 A;  1X5D A;  4L8E A;  2TRC P;  1GTU A;  2LS5 A;  1YDK A;  5G5E A;  4JE1 A;  4KSM A;  1DBY A;  4I5Q A;  2H01 A;  3UMA A;  1Z7R A;  4MZW A;  1BAY A;  1O8W A;  1BF5 A;  2CV4 A;  3ERG A;  4TOP A;  4GCI A;  3R3E A;  1OC9 B;  1GTI A;  2YV7 A;  4GTU A;  3HCZ A;  2GST A;  2H1D A;  5J3R A;  5INY A;  2XBQ A;  2QA1 A;  3O76 A;  3TUE A;  1TRU A;  2OE0 A;  3DYR A;  2WW1 A;  5G1L A;  3EE2 A;  3EMX A;  1MDI A;  1PD2 1;  3HHV A;  3L78 A;  5G30 A;  5KOW A;  2L6D A;  3DRN A;  3WT2 A;  1OC9 A;  1XWK A;  4IP6 A;  4J56 E;  1URM A;  5L71 A;  1Z9H A;  2FUG 2;  4H86 A;  1K0M A;  4FXY P;  1PX6 A;  1THO A;  1Z7P A;  5FHI A;  1ZGN A;  1JZD A;  4WR5 A;  2V6K A;  3LXT A;  2OE1 A;  3APQ A;  3TKS A;  2NTO A;  2GZY A;  2GT5 A;  3EUR A;  5IIZ A;  5J41 A;  2A2S A;  2GS3 A;  1TXU A;  2C0E A;  1HD2 A;  4YKG A;  1U3I A;  5H5R A;  4MJA A;  2AUV A;  2WVZ A;  2RUF A;  3L9S A;  2QC7 A;  1YVL A;  3UVT A;  2VL9 A;  4GXZ A;  2K8V A;  3IK7 A;  4WF5 A;  2P5Q A;  1K0A A;  3HA9 A;  3KZQ A;  4POB A;  2KOK A;  2UV8 G;  3LOR A;  2L6C A;  3CSJ A;  5JWQ B;  2REM A;  1XCC A;  1RW1 A;  4KSO A;  2H75 A;  5EVO A;  5HFG A;  4YAV A;  3C73 A;  3M8N A;  2B5Y A;  2EFE A;  4YH2 A;  1SKR B;  5D9V A;  5A4W A;  5LCZ A;  4KCA A;  1SJI A;  1ZL9 A;  22GS A;  3BOA A;  3KM6 A;  1WJK A;  3FW2 A;  4PUF C;  3IPZ A;  2I3Y A;  3F4R A;  4F0B A;  1WRY A;  5IMA A;  3VK9 A;  4PQ1 A;  4BWS A;  1XVW A;  4CY8 A;  2VO4 A;  3GTU B;  3IAS 2;  2XPE A;  1JZW A;  2D2Z A;  1FVK A;  2OAD A; 
#chains in the Genus database with same CATH homology
 2UZ8 A;  1GSF A;  2HQT A;  3C8E A;  2C4J A;  5ELA A;  1O8X A;  1KBN A;  1ZZY A;  4E68 A;  3GL5 A;  5F07 A;  5ENU A;  5H5S A;  2FA4 A;  2VCT A;  3FR6 A;  2B6M A;  5B6N A;  2F8A A;  5ECI B;  3Q18 A;  4K0G A;  1WP0 A;  1GUL A;  1XWG A;  2GSQ A;  2DJ2 A;  3GTU A;  2I9H A;  4POM A;  3KGK A;  5CAX A;  2KHP A;  5KN2 A;  2X49 A;  2HE3 A;  2CQ9 A;  1XZO A;  3A2W A;  1YJ6 A;  2HYX A;  3QCP A;  4GF0 A;  6GSW A;  5ECP B;  3IRA A;  4NV5 A;  1PN9 A;  1T3B A;  4K7O A;  4PNF A;  5IQY A;  4KB3 A;  1X9S B;  2LRC A;  2YJH A;  3ZVJ D;  4KH7 A;  3KP9 A;  2CVB A;  4N11 A;  1EOH A;  1M2D A;  3QR6 A;  3D6I A;  1DE2 A;  1XOB A;  3KP8 A;  3KTB A;  1A2M A;  4V2L A;  5IM9 A;  2CAI A;  2EIQ A;  3D22 A;  3D4T A;  5F05 A;  2IMI A;  2RLI A;  1FOV A;  1Z5Y E;  1O73 A;  3EMP A;  2GQL A;  4TXO B;  1MDJ A;  3LGC A;  4FYC A;  2VCW A;  4MJE A;  1ZYP A;  2HT9 A;  3HZ8 A;  3UAR A;  4ML6 A;  1U3A A;  3TRX A;  4MDC A;  5AN1 A;  5D96 A;  2YWO A;  5DQS A;  4V1A p;  3TKR A;  4NMU A;  1C72 A;  2QGV A;  2HRK B;  4XS1 A;  1A2L A;  5DQY A;  1GNE A;  1VRS D;  3QOU A;  2L5O A;  4AJ6 A;  2DJJ A;  3MNG A;  4TR4 A;  4TXO A;  3TDG A;  4PTS A;  5CNW A;  3ZFL A;  3F0I A;  2VD0 A;  4WXT A;  3EYT A;  2R5G A;  1SEN A;  2YZU A;  3CTF A;  2HZF A;  4G0I A;  4K0N A;  4LA1 A;  2HNL A;  2ZCT A;  3G7Y A;  1XIY A;  2EC4 A;  4OFN A;  2HRK A;  1G6W A;  2O5V A;  3UBL A;  2B3S A;  4AI6 A;  4IHU A;  2GDR A;  3GH9 A;  4ZXG A;  5J4U A;  3QMX A;  4PUA A;  4I8B A;  1J0F A;  4HQZ A;  1QMV A;  4G0K A;  4EF0 A;  2H30 A;  2DKI A;  3FZA A;  2XBI A;  3OR5 A;  5FT3 A;  1VF1 A;  5IMC A;  5GAN D;  1G0T A;  3F4T A;  4OD7 A;  3E9J B;  3VWX A;  3D5J A;  2WB9 A;  2PWJ A;  3K8N A;  4HU9 A;  3QAW A;  4XHM A;  1N8J A;  2R0P A;  4JBB A;  1BQ7 A;  2O85 A;  1YKA A;  4BL7 A;  4K5R A;  3W8S A;  2ZUP A;  1SVM A;  4FIW A;  2DIY A;  2YWM A;  3L9U A;  4V2M A;  5F06 A;  2EFC A;  3HD5 A;  4MLY A;  1GWC A;  3F3Q A;  2C3T A;  2GQM A;  2A4V A;  5CRD A;  1GRX A;  1TRW A;  3TKS C;  2YZH A;  4DSQ A;  4NAX A;  2OJL A;  3PGT A;  3KH9 A;  1BG5 A;  1GP1 A;  4TKY A;  3US3 A;  4NPB A;  1F6M C;  5ABR A;  2FNO A;  5HQP A;  3APS A;  3LG6 A;  1I9D A;  1B4Q A;  2R6K A;  4P3Y B;  1N25 A;  4QL7 A;  4E8H A;  3PIN A;  2IME A;  3VWV A;  3IOS A;  3D21 A;  4N30 A;  2FCH A;  4Z2R A;  1HQO A;  3D0Z A;  1XWC A;  2PVQ A;  1M2A A;  1Y1U A;  4PUR A;  1ERW A;  2C0G A;  1SD9 A;  1HYU A;  1K0O A;  3ZRE A;  1H4O A;  3MIX A;  2IJY A;  3RDW A;  2LKU A;  3E3E A;  2GGT A;  10GS A;  2VUP A;  2A2R A;  4GDF A;  1GSQ A;  2DJ3 A;  3LEF A;  2X8H A;  1AAZ A;  3GX8 A;  1O6J A;  1SJ6 A;  4BVY B;  6GSY A;  2DMM A;  1EGR A;  5BMU B;  2GLR A;  4K2X A;  1G7E A;  4K1F A;  5ID2 A;  5HR3 A;  2DIZ A;  1TK8 B;  3HJO A;  5DJM A;  2I1U A;  4K7N A;  3GYK A;  3UVH A;  1WOU A;  2H0G A;  2PPT A;  2GT6 A;  2M72 A;  1A23 A;  3IAM 2;  3TRQ A;  2C0F A;  3I9V 2;  2OKA A;  5IO0 A;  1MEK A;  1BG1 A;  4BVY A;  1E2Y A;  5BMU A;  2L5L A;  2WFC A;  2C3Q A;  4GQC A;  2YJ7 A;  2H6Z A;  3CSH A;  1PX7 A;  4BWQ A;  4Q5F A;  4K8M A;  1DSB A;  1GSD A;  2ON7 A;  3HJP A;  2ES7 A;  2LQQ A;  2XPD A;  3VWW A;  1IYI A;  5IOX A;  3EC3 A;  1ABA A;  3GMF A;  2DC5 A;  1RQM A;  4AGS A;  5A34 A;  2V1M A;  4G19 A;  2G2Q A;  2H1B A;  2HLS A;  1QGV A;  4K2D A;  2VD1 A;  1AQW A;  3VWU A;  13GS A;  2GZZ A;  5B6M A;  4Z2U A;  5B8A A;  1YEX A;  2A4H A;  1YF0 A;  1K3O A;  17GS A;  3HY2 A;  2QSI A;  2C3N A;  2V6O A;  1SK1 A;  1T7P B;  4ZB6 A;  3RAZ A;  2GSS A;  4TR3 A;  1OC8 A;  5CYY A;  4ZB9 A;  1R5P A;  1O85 A;  5CRW A;  5A5H B;  1F37 A;  2LNS A;  4O5Q A;  4CDO A;  4LL1 B;  3TU3 B;  1QXH A;  2FWG A;  4YQM A;  3IK9 A;  4G0L A;  4AJ8 A;  4RI7 A;  3G7I A;  1T8E B;  2BTO T;  4MF5 A;  2YV9 A;  1KEB A;  2WZ9 A;  1ZYQ B;  3FZ4 A;  4BVX B;  4PX1 A;  3H79 A;  2F51 A;  4I6X A;  3L4N A;  4HQS A;  3FYG A;  3WGD A;  3BJ5 A;  3HJM A;  4HUA A;  1JLV A;  2WS2 A;  4XTS A;  4N0Z A;  1LJR A;  5A5H A;  1FOH A;  4EXJ A;  1GLQ A;  2FA8 A;  3KTL A;  6GSX A;  1BJX A;  3F6D A;  1NSW A;  4EIQ A;  1W89 A;  2DKH A;  2GQK A;  2JZS A;  2VLU A;  2LV3 A;  4BVX A;  1TJD A;  5JWR B;  1TI3 A;  5ECK B;  3LJR A;  1UC7 A;  2LNT A;  1B48 A;  3KXO A;  1PA3 A;  3WT1 A;  5CRE A;  2WUL A;  3GV1 A;  1Z3E A;  2IWT A;  1B4P A;  2HSH A;  2MYG A;  1PKW A;  1QUW A;  4IW9 A;  3CWG A;  4HI7 A;  2J9H A;  1XVQ A;  3SBC A;  5B7C A;  4OFT A;  4MJB A;  1J08 A;  2AV4 A;  4JR4 A;  4GSS A;  3P7X A;  5A4U A;  5ECR B;  2HFD A;  6GSU A;  2QA2 A;  3KD0 A;  2R37 A;  3ZL5 A;  14GS A;  4MP4 A;  4HU7 A;  3I69 A;  5G1K A;  3PPU A;  5HFK A;  3F63 A;  4F03 A;  5J9C A;  1M99 A;  5C00 A;  3CSI A;  5A5K A;  1NHO A;  1S3C A;  1CQG A;  1R26 A;  2HI7 A;  2R0G A;  3UIW A;  4I97 A;  2VM1 A;  3RBT A;  1EV4 A;  5IO2 A;  3R2Q A;  3TJG A;  1R7H A;  4KE3 A;  1MTC A;  1X5E A;  5IMD A;  4POL A;  2B1L A;  5IPG A;  1FO5 A;  4PQH A;  3S9F A;  3H93 A;  4RI6 A;  3EU3 A;  5FWG A;  4PQI A;  2LQO A;  1WPI A;  3QAV A;  3IHQ A;  1AC1 A;  1H75 A;  4GWR A;  1SVO A;  3NZN A;  2P5R A;  3KMN A;  2G0F A;  4KAE A;  1E6B A;  4EDY A;  3GKN A;  4L5O A;  3C71 A;  2YWN A;  3FZ9 A;  3TKQ A;  11GS A;  1OVN A;  2FWF A;  5A4V A;  2LRT A;  2FWH A;  3RPP A;  3LFL A;  3KIJ A;  1YF1 A;  2CT6 A;  1JZR A;  4HZ2 A;  2N5A A;  4EE0 A;  4J57 E;  1X0R A;  4RUV A;  1JFU A;  5KN0 A;  1Q98 A;  4MJC A;  3TKP A;  3M9K A;  3ME8 A;  3HVX A;  3VI5 A;  2YNX A;  1EOG A;  5BRT A;  1AXD A;  2V2G A;  1TRS A;  1U87 A;  2LJR A;  1DUG A;  1ZOF A;  4F2I A;  1HNA A;  1GSU A;  2O89 A;  4QMK A;  5ECO B;  3ISO A;  5CP1 A;  4ILF A;  1UVZ A;  5EL8 A;  1Z6N A;  5IMV A;  2YCD A;  1GH2 A;  1T00 A;  2H6Y A;  4ISD A;  2FLS A;  2X4A A;  2FWE A;  4LMV A;  4YKF A;  1TKD B;  1V40 A;  2PGT A;  3MWH A;  3FY7 A;  1A0R P;  5DCG A;  3HVS A;  3V1W A;  3BBY A;  3VUR A;  2MBT A;  2RM6 A;  4NWY A;  1PSQ A;  3ZIT A;  2WDU A;  4A5P A;  2MMA A;  1GUM A;  5KEJ A;  4NXI A;  3C1R A;  2VM2 A;  3Q19 A;  1V2A A;  1OE7 A;  5GAP D;  4X43 A;  4K6X A;  5GSS A;  4GLT A;  5IPH A;  2QKE A;  2B5X A;  1XW6 A;  2JZT A;  3IBH A;  2MBS A;  3M0F A;  1ZYN A;  3NIV A;  1O7U A;  4ICY A;  1YEP A;  2IL3 A;  3GNJ A;  1SYR A;  4OWY A;  4MAB A;  4USS A;  1LU4 A;  3CRU A;  4ML1 A;  4MMM A;  2JSZ A;  4AKI A;  3ZRD A;  3MDK A;  1SL0 B;  1GSS A;  2P31 A;  1USB A;  3L9V A;  4O32 A;  3M1G A;  5EY6 A;  5IMZ A;  4L0U A;  1Z6M A;  4V2N A;  4MA9 A;  1SL2 B;  1XW9 A;  3IDV A;  2HZE B;  2NPB A;  4XS4 B;  3GN3 A;  3HYP A;  2LJK A;  1ZMA A;  1FB6 A;  2XHF A;  4WEY A;  2VIM A;  4K9Z A;  1FB0 A;  1A24 A;  2VL3 A;  2OBK A;  5AIV A;  3IR4 A;  1FAA A;  1V9W A;  2VLT A;  4HOJ A;  3MAK A;  3CMI A;  1JHB A;  4KDU A;  4IVF A;  2H1L A;  2B5E A;  1ERV A;  3IC4 A;  1A2J A;  2IN3 A;  2F9S A;  1K3L A;  4NV2 A;  2MMZ A;  1PL2 A;  2HZE A;  3PR8 A;  3QDN A;  1PQN A;  2O7K A;  3HVV A;  3IXR A;  5DAK B;  4O7H A;  2IMK A;  1EWX A;  2GZP A;  5D73 A;  4DVC A;  2R0C A;  2YOI A;  1NHY A;  1SK2 A;  1ACV A;  4DEJ A;  1HNC A;  3BCK A;  5J9B A;  1EP8 A;  1QQ2 A;  2DJ1 A;  1PKZ A;  1NM3 A;  1RK4 A;  1TK5 B;  4DSR A;  1B8X A;  1K3Y A;  3GA4 A;  3ZYW A;  4D73 B;  2Z9S A;  3AY8 A;  1SYX A;  2H71 A;  2FGX A;  4KCE A;  4V1A g;  5C04 A;  2E7P A;  4QQ7 A;  5DAK A;  3TGZ A;  1BX9 A;  4OCF A;  3W8J A;  1XPV A;  1X9W B;  3EIN A;  1QK8 A;  3EVI A;  2WJU A;  2YP6 A;  4TXV A;  4G9H A;  4NHZ A;  4HJ2 A;  1MD4 A;  1WIK A;  3UEM A;  5KOX A;  2NDO A;  3IA1 A;  4JR6 A;  3RPN A;  2AYT A;  4D73 A;  3GHA A;  2P0G A;  4JED A;  2LST A;  4MZC A;  4O5U A;  2IIY A;  5J47 A;  3BD2 A;  3M3M A;  2L4C A;  3DIE A;  1V98 A;  2GVP A;  2HSM B;  4ECJ A;  1AW9 A;  1EEM A;  2VLV A;  2YWI A;  1ON4 A;  2V41 A;  3DWV A;  2PVO C;  2B7K A;  1OAZ A;  2B1K A;  20GS A;  1X9M B;  2TIR A;  5G2Z A;  4GSN A;  4X1U A;  2M80 A;  4TN8 A;  1PN0 A;  3GUR A;  2PU9 C;  1AUC A;  3GFK A;  2R4V A;  2VAF A;  3FZ5 A;  2MMN A;  3WGE A;  2VOC A;  4ZBA A;  1MDK A;  4GRF A;  1ML6 A;  2HSM A;  3C1S A;  4MH3 A;  2K9F A;  4EKZ A;  4ZIL A;  1A8Y A;  3IV4 A;  4Z2T A;  4ZL8 A;  3GST A;  4AJ7 A;  2H1A A;  5ECQ B;  4GQF A;  3ED3 A;  2H6X A;  4NHW A;  4RQR A;  1FW1 A;  1OKD A;  3A5I A;  1GNW A;  6GST A;  4MCU A;  5ECH B;  16GS A;  4PNG A;  2F8F A;  1SL1 B;  3HZ4 A;  3GKK A;  2DJK A;  2YAN A;  2H8L A;  1FG4 A;  4YQV A;  1T4Y A;  2JL4 A;  2H74 A;  4EC0 A;  1T4Z A;  1TTZ A;  1DE1 A;  3TJJ A;  1OE8 A;  3LWA A;  4MPG A;  2MZC A;  4X4J A;  4OCE A;  4GST A;  2VKZ G;  3FMW A;  1FHE A;  5IMF A;  2H0I A;  4KA0 A;  2I81 A;  3UL3 A;  1U6T A;  2I4A A;  2ON5 A;  3LQ7 A;  2VL2 A;  3TKS E;  1MD3 A;  1GL8 A;  4KF9 A;  4EL1 A;  4ZL9 A;  3VLN A;  2R2J A;  3O3T A;  3EWL A;  4IS0 A;  4LMW A;  1AIU A;  5ECS A;  3UAP A;  1K0B A;  1PMT A;  3A2V A;  2E2G A;  3F4S A;  3M9J A;  2LJA A;  1NW2 A;  3LYK A;  1FVJ A;  2AB6 A;  2ZNM A;  1TXX A;  3GIX A;  3WGX A;  3E0U A;  4MF7 A;  1F3B A;  4AKG A;  5HFI A;  3FHK A;  5B8B A;  4ECI A;  6GSV A;  1KNG A;  1VF3 A;  3FRC A;  5J40 A;  3J7Y b;  2FHE A;  1M0U A;  1X5C A;  4EVM A;  5JCW A;  5F0G A;  2H73 A;  1THX A;  4Z7X A;  2N5B A;  3MYD A;  3GL3 A;  3LYP A;  12GS A;  4KDY A;  5AIX A;  3MSZ A;  3TB2 A;  2VCX A;  2CA8 A;  4PXO A;  4AF2 A;  1XXU A;  5LNK e;  5AGY A;  1OKT A;  2F3M A;  2LRN A;  2C8U A;  2HSN B;  2IPA A;  2L4Q A;  2KP2 A;  1ILO A;  3QFA C;  3JCM L;  4WR4 A;  4IKH A;  3CBU A;  1K0N A;  4AKH A;  1EZK A;  3H1N A;  1W4V A;  3QFB C;  5DAL B;  2R3X A;  1SVL A;  1XWA A;  3GKX A;  1WE0 A;  3Q6O A;  4IBP A;  4MZB A;  1GLP A;  9GSS A;  3IC8 A;  2HSN A;  3VPT A;  1JZO A;  1TRV A;  4Q5N A;  3G9B A;  3QD9 A;  3LSZ A;  4WBJ A;  3GH6 A;  2HRA A;  1GUK A;  2K6V A;  2TRX A;  3BCI A;  3J7Y k;  1XW5 A;  1ZYE A;  5DAL A;  4ZL7 A;  2KUC A;  4ZBD A;  5F8B A;  2YN1 A;  1OYJ A;  1K0D A;  3QAG A;  1S3A A;  1A8L A;  2NBS A;  5DDL A;  3W6G A;  3GRX A;  4F0C A;  1PGT A;  4IEL A;  1OC3 A;  3DXB A;  1VF2 A;  4O5R A;  3A3T A;  4BPY A;  2C80 A;  1IYH A;  4IGJ A;  3RHB A;  1SU9 A;  1GSY A;  4LLR A;  2LTK A;  3ZIV A;  4JZQ A;  2FD3 A;  2J23 A;  3TJF A;  5G31 A;  4N10 A;  2FY6 A;  3KCM A;  3LXZ A;  1TW9 A;  3GX0 A;  4IP1 A;  5HR2 A;  4G01 A;  4KX4 A;  4XS6 A;  2EIR A;  2PER A;  3CYN A;  3SWL A;  5DBQ A;  5ECN B;  3DVW A;  3TRP A;  3FEU A;  2X99 A;  3KMO A;  4KGI A;  1K0C A;  5ECL B;  2V32 A;  1VF4 A;  1SK0 A;  1U88 A;  4OO5 A;  1YQ1 A;  2WCI A;  3TOU A;  3ZFB A;  5EPF A;  1T1V A;  1XWB A;  5D93 A;  4KDX A;  4TR1 B;  2OE3 A;  4N0V A;  4G2E A;  1B9X C;  2BMX A;  2WRT A;  3VPQ A;  4F82 A;  1M2B A;  3KEB A;  3D4M A;  1I5G A;  2K8S A;  5J5N A;  2PN8 A;  3L0H A;  4ZIJ A;  3ERW A;  4IJI A;  4ACS A;  1TU7 A;  5CO3 A;  7GSS A;  2CVK A;  5LD0 A;  4KUN A;  4K7I A;  1UA5 A;  2DBC A;  4QL9 A;  2A2P A;  4ULX A;  1CQH A;  2C1Y A;  3UBK A;  3HXS A;  4WKW A;  2H66 A;  5GZZ B;  4TR1 A;  1TP9 A;  1Y25 A;  1JLW A;  4JU5 A;  1HNB A;  2H72 A;  1GTB A;  2HXK A;  5HR0 A;  3F9U A;  2KLX A;  2EFD A;  3G7J A;  4OO4 A;  1KTE A;  4KND A;  3TJB A;  3QPM A;  4MNN A;  4TRX A;  4MH2 A;  2CX3 A;  3FR9 A;  3I6A A;  1LBK A;  2H0H A;  5D9T A;  2EFH A;  2O8V B;  4EIP A;  2IMD A;  1GSE A;  1ERU A;  2PMT A;  4WET A;  3ZZX A;  2X64 A;  1EV9 A;  3NOF A;  2VCV A;  4YAP A;  3EPT A;  3KH7 A;  3HDC A;  3PH9 A;  1V57 A;  1M7T A;  1BED A;  5KN1 A;  1WMJ A;  2VL2 C;  2PUK C;  2BJX A;  3EU4 A;  1R5A A;  2N5F A;  2DJ0 A;  4IN0 A;  5E59 A;  1A0F A;  3RHC A;  4AKX B;  2L57 A;  2JAC A;  4ID0 A;  4EO3 A;  3TCO A;  3UJ1 A;  1BYE A;  2AJQ B;  1SD8 A;  1TU8 A;  1G6Y A;  2WGR A;  4XRA A;  4HJM A;  4E8E A;  3U6V A;  1TI1 A;  4F9Z A;  4MK3 A;  4ECC A;  1XOA A;  4IQ1 A;  1YZX A;  4O92 A;  5ECM B;  3DML A;  3ZVJ A;  3DD3 A;  2KP1 A;  5D8I A;  1VGL A;  4FQU A;  2DSA A;  2AAW A;  3GSS A;  1SKW B;  4BL7 B;  2MMO A;  3F6F A;  3APO A;  4X0X A;  4Q5R A;  4KW6 A;  5COH A;  2K18 A;  2H70 A;  3IHG A;  1XBS A;  1B9Y C;  1AQX A;  3UOM A;  3KJY A;  4OMV A;  4MPF A;  2OA7 A;  2CZ2 A;  4XRD A;  2E2M A;  4YQU A;  4IQA A;  2LUS A;  6GSS A;  4XS4 A;  5E4W A;  5GST A;  3H4K A;  5HR1 A;  3LW9 A;  2YPM A;  4ZB8 A;  4WF4 A;  1F2E A;  3N5O A;  4W66 A;  1UN2 A;  1O81 A;  3CTG A;  2ALB A;  3ZML A;  4TW5 A;  3WYW A;  2EIO A;  3A2X A;  4HS1 A;  2B7J A;  3FR3 A;  3I43 A;  1EEJ A;  4WBR D;  1Q4J A;  1ERT A;  5AIS A;  3ZIJ A;  3ZMK A;  2H1G A;  2VCQ A;  4FYU A;  3ZLP A;  4TR0 A;  4XCS A;  1SJZ A;  4OFM A;  5J4Y A;  3TOT A;  2L59 A;  3P90 A;  2RUE A;  3F3R A;  5JCG A;  4MF6 A;  4BA7 A;  1M9B A;  2AHE A;  3ERF A;  5CRG A;  1V58 A;  3IE3 A;  3WD6 A;  2IMF A;  2GSR A;  3ME7 A;  3DKS A;  5D9W A;  2H76 A;  4LL4 B;  3CRT A;  1J9B A;  4FYB A;  4I2T A;  4L0W A;  5ID2 B;  1F9M A;  1YKC A;  4HDE A;  4POK A;  1N2A A;  4HEA 2;  2IFQ B;  4JRR A;  3C7M A;  4IJ3 A;  3VFI A;  4ZBB A;  3P8W A;  2GTU A;  1GUH A;  1YY7 A;  4FH8 A;  5KN3 A;  4CY6 A;  3FK8 A;  4N3Z A;  8GSS A;  2OAC A;  4PGT A;  5DVB A;  2XC2 A;  2M46 A;  5IOW A;  5DJL A;  5ELG A;  2JSY A;  4CW9 A;  3CXG A;  1TDI A;  2O87 A;  2HRF A;  1TOF A;  1XFL A;  1M9A A;  2IFQ A;  2E0Q A;  4DSS B;  4L5L A;  2HRN A;  4Q5Q A;  2JZR A;  3VI7 A;  3DVX A;  19GS A;  18GS A;  4RQX A;  1F3A A;  2CVD A;  2PBJ A;  4HZ4 A;  5A34 B;  2OBI A;  1SKS B;  3HMJ G;  1PRX A;  2H19 A;  3TJK A;  3N9J A;  1GTA A;  2RII A;  2RM5 A;  3A5W A;  3FKF A;  5A1N B;  5H5Q A;  1QFN A;  1S3D A;  3ZTL A;  4FO5 A;  3P2A A;  1TK0 B;  4I2U A;  4TVE A;  1EGO A;  4DSS A;  3F8U A;  2HSY A;  4EDZ A;  2X8G A;  3DGQ A;  4ZB7 A;  2VCZ A;  2CX4 A;  2C0D A;  3GUS A;  1R4W A;  4CHS A;  5JCU A;  3O6T A;  4J2F A;  2JAD A;  2CZ3 A;  2NVL A;  3H8Q A;  1Y6E A;  4G10 A;  3U5R E;  5A1N A;  4EUY A;  1G7O A;  4XIH A;  1AQV A;  2DLX A;  2LEG A;  1ZCP A;  5CRH A;  4ECB A;  5J4V A;  2JU5 A;  5DCH A;  2OT3 A;  1WWJ A;  1PL1 A;  2DML A;  2CAQ A;  5D9X A;  4K5S A;  5G5F A;  5JWO B;  1ST9 A;  2X8C A;  3DEX A;  3Q74 A;  3HKR A;  3GKM A;  1EP7 A;  1X5D A;  4L8E A;  2TRC P;  1GTU A;  2LS5 A;  1YDK A;  5G5E A;  4JE1 A;  4KSM A;  1DBY A;  4I5Q A;  2H01 A;  3UMA A;  1Z7R A;  4MZW A;  1BAY A;  1O8W A;  1BF5 A;  2CV4 A;  3ERG A;  4TOP A;  4GCI A;  3R3E A;  1OC9 B;  1GTI A;  2YV7 A;  4GTU A;  3HCZ A;  2GST A;  2H1D A;  5J3R A;  5INY A;  2XBQ A;  2QA1 A;  3O76 A;  3TUE A;  1TRU A;  2OE0 A;  3DYR A;  5G1L A;  3EE2 A;  3EMX A;  1MDI A;  1PD2 1;  3HHV A;  3L78 A;  5G30 A;  5KOW A;  2L6D A;  3DRN A;  3WT2 A;  1OC9 A;  1XWK A;  4IP6 A;  4J56 E;  1URM A;  5L71 A;  1Z9H A;  2FUG 2;  4H86 A;  1K0M A;  1PX6 A;  1THO A;  1Z7P A;  5FHI A;  1ZGN A;  1JZD A;  4WR5 A;  2V6K A;  3LXT A;  2OE1 A;  3APQ A;  3TKS A;  2NTO A;  2GZY A;  2GT5 A;  3EUR A;  5IIZ A;  5J41 A;  2A2S A;  2GS3 A;  1TXU A;  1HD2 A;  2C0E A;  4YKG A;  1U3I A;  5H5R A;  4MJA A;  2AUV A;  2RUF A;  3L9S A;  2QC7 A;  1YVL A;  3UVT A;  2VL9 A;  4GXZ A;  2K8V A;  3IK7 A;  4WF5 A;  2P5Q A;  1K0A A;  3HA9 A;  3KZQ A;  4POB A;  2KOK A;  2UV8 G;  3LOR A;  2L6C A;  3CSJ A;  5JWQ B;  2REM A;  1XCC A;  1RW1 A;  4KSO A;  2H75 A;  5EVO A;  5HFG A;  4YAV A;  3C73 A;  3M8N A;  2B5Y A;  2EFE A;  4YH2 A;  1SKR B;  5D9V A;  5A4W A;  5LCZ A;  4KCA A;  1SJI A;  1ZL9 A;  22GS A;  3BOA A;  3KM6 A;  1WJK A;  3FW2 A;  4PUF C;  3IPZ A;  2I3Y A;  3F4R A;  4F0B A;  1WRY A;  5IMA A;  3VK9 A;  4PQ1 A;  4BWS A;  1XVW A;  4CY8 A;  2VO4 A;  3GTU B;  3IAS 2;  2XPE A;  1JZW A;  2D2Z A;  1FVK A;  2OAD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...