3ISOA

Crystal structure of 26 kda gst of clonorchis sinensis in p3221 symmetry
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
218
structure length
218
Chain Sequence
MAPVLGYWKIRGLAQPIRLLLEYVGDSYEEHSYGRCDGEKWQNDKHNLGLELPNLPYYKDGNFSLTQSLAILRYIADKHNMIGNTPVERAKISMIEGGLVDLRAGVSRIAYQETFEQLKVPYLQQLPSTLRMWSQFLGNNSYLHGSTPTHLDFMFYEALDVIRYLDPTSVEAFPNLMQFIHRIEALPNIKAFMESDRFIKWPLNGWSAYFGGGDAPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Putative glutathione transferase
publication title A histidine substitution confers metal binding affinity to a Schistosoma japonicum Glutathione S-transferase.
pubmed doi rcsb
source organism Clonorchis sinensis
total genus 78
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3isoA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3isoA01
1HQOA 1V2AA 3U6VA 4ID0A 3RDWA 4HU7A 2HRKA 3IA1A 3FZ9A 4CW9A 2AYTA 4ECBA 2R6KA 1GLQA 2YP6A 4XTSA 1OKDA 4ZBDA 1ZCPA 2L59A 2X8CA 1K3OA 4NHWA 1K0AA 2PN8A 3ZLPA 5DDLA 2XPEA 4CDOA 1Z7RA 4TVEA 4MZWA 3L9SA 5B7CA 3C1RA 3PH9A 1OE8A 4ZL9A 4HUAA 3S9FA 2CVBA 1QGVA 2O8VB 2H75A 2VM2A 4JU5A 2V2GA 1YEPA 1EEMA 1AQXA 1ZMAA 5HFKA 1PGTA 3TDGA 3TKSA 3W8JA 2E7PA 1G7EA 2LQOA 1OC8A 2A2RA 1I5GA 10GSA 3QFBC 1FVKA 1SKSB 2LRNA 1GUKA 1O6JA 4P3YB 4ILFA 2B1LA 3IK9A 1XFLA 2IMFA 4N0ZA 4I97A 4LL4B 5IMZA 4BVYA 3IAM2 4MF6A 1YDKA 3CMIA 2YOIA 1XXUA 1FOVA 5G1LA 6GSTA 1O7UA 2HI7A 3HVXA 2LNSA 3O6TA 3HVSA 3E9JB 5ECMB 2L4QA 4J57E 3QAVA 3GFKA 3EMPA 3A2WA 1V40A 1M9AA 4HJ2A 1XW6A 4HDEA 3FR3A 1THOA 1GSFA 4XS4B 3EURA 5DCHA 4ECJA 4QQ7A 3I9V2 5F05A 4EDYA 4N0VA 3FY7A 3GKNA 4GWRA 5F07A 4BVYB 2FWFA 2N5FA 4K1FA 1UN2A 4QL9A 3LG6A 3IE3A 2KLXA 3FHKA 1H75A 4TRXA 1C72A 3IOSA 2C3TA 1ST9A 2H30A 2GZPA 2H1AA 2OADA 2OBKA 4K8MA 1M7TA 2TIRA 2H1DA 5JCWA 4K7IA 5ELAA 2GZYA 4WF4A 1YY7A 2GVPA 5B8AA 3KXOA 1VF1A 3ZMKA 2C0FA 3GURA 1ZGNA 1YEXA 4GSNA 3UAPA 1GSYA 4IN0A 3EINA 3ZZXA 4HS1A 2X8HA 4MJCA 1X5CA 2YJ7A 2R4VA 4L0WA 4ZB9A 4G2EA 1A2JA 3WT2A 1K0CA 1FO5A 1MTCA 4PTSA 1PMTA 1J08A 3TJKA 1MEKA 2I81A 4MH2A 1Y25A 1MD3A 5ECKB 2HQTA 3DIEA 4KE3A 4Q5NA 1W89A 1OE7A 5CYYA 5IMDA 3FR6A 2HRNA 3VI5A 5B6NA 2VO4A 1THXA 4LL1B 1SD8A 4OO4A 5GAPD 3M8NA 2OJLA 5J4UA 1GUHA 4MA9A 2MMZA 4LA1A 2L5OA 4X0XA 3I69A 2IMIA 3UBKA 1UVZA 4HZ4A 3FW2A 2VCZA 2BTOT 5DALA 2FGXA 3LFLA 3VWUA 2FWGA 3ZL5A 2FY6A 5ECSA 4XS6A 4BPYA 2YZUA 3LGCA 2R2JA 4N10A 4GCIA 4DSSB 4MZBA 2FWHA 3EYTA 3M3MA 3FK8A 1V98A 5CRWA 3UVTA 4IP1A 3F8UA 4ZBAA 3VPTA 2KHPA 4TOPA 1DE1A 2WULA 2WJUA 4L0UA 3ERFA 4PGTA 4HQSA 1OC9A 3LEFA 1T8EB 3EU3A 4JE1A 4G0LA 1UA5A 3VI7A 3TRQA 4POBA 2BJXA 1H4OA 2DJ2A 5F06A 1EEJA 4XCSA 1TK0B 1FVJA 4ISDA 5FWGA 5DALB 1HD2A 2GTUA 3D4MA 1XVWA 4PQ1A 2CX3A 5J9CA 4I6XA 4L5OA 4IHUA 3W8SA 1N8JA 1TI1A 3FZ4A 2B3SA 4FQUA 3GH6A 2AUVA 1QK8A 1PQNA 2PPTA 1HNAA 1B4QA 2VCXA 4GLTA 2QC7A 3QCPA 2LJKA 1OC9B 2FUG2 4JZQA 3KGKA 4KDYA 4ZL8A 2YWOA 1WE0A 1CQHA 2B7JA 3N9JA 1FB6A 1U3AA 5IO2A 3A3TA 4BVXA 4WKWA 1YKAA 2GDRA 19GSA 2I9HA 5IMAA 3QOUA 2IL3A 2HSNB 3TKQA 3QD9A 4EUYA 3WGDA 1K0BA 2PWJA 1USBA 2L4CA 1EGOA 3GL3A 5FT3A 3VWXA 2CVDA 1U3IA 3V1WA 5AISA 3ZFLA 4I2UA 4XIHA 1JZOA 4G9HA 2VD1A 5H5QA 2E2GA 3C8EA 5A4VA 1MDKA 6GSUA 5ECHB 1HYUA 5DJMA 4BVXB 5EL8A 3DVWA 2K8VA 1TK8B 1BG5A 4KH7A 1KTEA 3ZMLA 4IW9A 2HYXA 2C8UA 3ZFBA 2B5EA 2CV4A 4F2IA 2DJ3A 4EDZA 2WRTA 1TRSA 2AJQB 1QUWA 3ZVJD 1R4WA 3LORA 4F82A 4TXOB 1IYHA 20GSA 3DRNA 2NDOA 1J9BA 5ABRA 1A23A 1FHEA 1R5PA 4RQXA 3MDKA 4KCEA 2GQKA 2E2MA 1WIKA 3LJRA 4EE0A 4F9ZA 2P0GA 2P5QA 1V9WA 3HJMA 3VPQA 2NPBA 3HY2A 3GYKA 4F0BA 3EMXA 5J5NA 2C3QA 4KCAA 1SK2A 2DSAA 5FHIA 4FH8A 2HNLA 18GSA 4ZXGA 5LNKe 4TW5A 5GZZB 1VGLA 4YH2A 1S3CA 3CSJA 4TR1B 3WGEA 1AW9A 2VIMA 2PGTA 5G31A 3ZYWA 1XWBA 5J9BA 2VLVA 5H5RA 3UJ1A 2O87A 2Z9SA 1TW9A 1VRSD 4ACSA 5JWOB 4RI6A 4DSRA 2JACA 3DVXA 3PINA 1PX6A 2O85A 3VWVA 3HXSA 1A8LA 1RK4A 3VFIA 4ZIJA 3DXBA 5KN1A 3GMFA 5INYA 1BAYA 1M2BA 2JSYA 2L5LA 3GKXA 5DVBA 1BX9A 1K3LA 4FYUA 4YQUA 2RUEA 2EC4A 3M1GA 4V1Ap 1F6MC 5JCGA 3CXGA 3UEMA 5LD0A 1DUGA 2VCQA 3GN3A 3GKKA 4KA0A 2KUCA 1T3BA 1QMVA 2PVOC 3CRUA 1XIYA 3E0UA 1O81A 3F4TA 2IMEA 1K0MA 4O32A 5A4UA 3U5RE 1F3BA 4MZCA 1GNWA 1F2EA 1GWCA 2CX4A 2P5RA 1B9XC 2VLUA 4NAXA 1WOUA 3GNJA 3KCMA 4XRAA 4GF0A 2YZHA 2PMTA 4LLRA 3UMAA 1KBNA 2VL3A 2F8AA 2OE1A 2HZFA 2LRCA 4N11A 1Y6EA 2H76A 5IMCA 4OCEA 2HSHA 1AIUA 4I5QA 2HRKB 1U88A 2YV9A 1F3AA 1NW2A 1BYEA 4F03A 1J0FA 2WDUA 3OR5A 2H01A 2NTOA 1M0UA 1OAZA 2C4JA 3BCKA 2R5GA 3QR6A 2VCWA 4IQAA 1DSBA 3TRPA 1GULA 4KF9A 5KN3A 1A2LA 1ON4A 3RPPA 4RI7A 3HD5A 3VURA 4ZILA 4MDCA 2GLRA 2JZSA 2LJAA 6GSSA 5KN0A 5G5FA 5DAKA 4K9ZA 2VD0A 3R2QA 5AGYA 4IGJA 2HRFA 2YNXA 3APOA 2X99A 2V32A 2L6CA 2F3MA 1XW5A 5D8IA 2DIZA 1E2YA 2GGTA 1AAZA 3DYRA 5H5SA 3L4NA 4KSMA 3F63A 2VL9A 2REMA 3KP8A 1O8XA 3GSSA 4NPBA 2M46A 2DLXA 2XPDA 2GSTA 1OYJA 3Q74A 4KUNA 4BL7A 4OD7A 3DWVA 5ECIB 2FA8A 3KZQA 4PNFA 5D9XA 1EWXA 2MBSA 1O73A 3G7JA 3IK7A 2JL4A 3HDCA 2LRTA 2XBIA 3TJGA 2KP1A 4NV2A 2L6DA 1GNEA 2B7KA 4EXJA 2RM6A 2K8SA 2VL2C 2LEGA 1SK0A 1GUMA 1OC3A 2WGRA 14GSA 3GKMA 1LBKA 5G2ZA 2H6YA 1ERWA 2OA7A 2OE0A 3KP9A 3ZITA 3BCIA 2D2ZA 1X5DA 4BL7B 4QL7A 2YWNA 1EV4A 1PN9A 4XS1A 2AAWA 4KX4A 1TOFA 2IN3A 2WB9A 2FD3A 2RM5A 3KD0A 3F4SA 4FYBA 2H1BA 5IMFA 3WYWA 2NBSA 4GQFA 4EC0A 4MABA 4ZBBA 2EIRA 5CO3A 3TJJA 3DMLA 3DGQA 4X43A 5ID2A 2VLTA 2HFDA 4MPFA 5D9TA 1TRWA 2XHFA 4HQZA 2PBJA 3TJFA 1SENA 4AJ8A 2GSRA 2JSZA 1Z5YE 5HFGA 5DBQA 4HJMA 1AUCA 2GS3A 4WF5A 1B4PA 1ABAA 4ZB6A 5KN2A 2R3XA 2PU9C 2PVQA 4USSA 3CSIA 1GP1A 1X0RA 1AXDA 4DVCA 2HRAA 1SL2B 3CBUA 1TK5B 3EVIA 2H0IA 2OACA 5DJLA 5JWQB 5ID2B 2CVKA 3RHBA 1EP7A 3US3A 4HOJA 3FRCA 2GQMA 1X9SB 4I2TA 1K0OA 4AJ6A 2YCDA 3SWLA 3BJ5A 1GL8A 2H8LA 2L57A 5C00A 3FZ5A 5ECLB 4KSOA 2H70A 4EL1A 1LU4A 3IDVA 3KTBA 3C7MA 4IJIA 2IIYA 1G6WA 2LSTA 1A8YA 4YQVA 3P8WA 2MBTA 5D9WA 3L9VA 3TGZA 4G0IA 1O85A 1EOGA 3HYPA 1AQWA 2LJRA 1WPIA 3APQA 7GSSA 1XOAA 5HR1A 2IPAA 1M9BA 2AHEA 4LMWA 2LNTA 3L9UA 4J56E 3IC4A 3FR9A 2A2SA 2GZZA 4Q5RA 1SJ6A 1F37A 3DKSA 3O3TA 1AQVA 3QFAC 2K6VA 1PRXA 4KDXA 9GSSA 3H79A 3GUSA 2LV3A 5IOWA 1SL1B 3MWHA 4G19A 1MDJA 4NHZA 1TXXA 4OFNA 2H0GA 3R3EA 3TJBA 2DJ1A 4NWYA 1TRVA 2DJKA 1JHBA 1SJIA 2MMAA 3GA4A 1FW1A 2PUKC 1VF2A 2FA4A 1ERTA 3FEUA 4JBBA 5D73A 4RUVA 2YV7A 3CTFA 1XPVA 4IBPA 12GSA 1XCCA 3I43A 2DJ0A 5HR0A 3HKRA 2F9SA 5BMUA 2VL2A 4O7HA 1M99A 1X9WB 1ERVA 4ECIA 4D73A 3HHVA 4ML1A 2EIOA 5G5EA 5AIVA 2GSSA 3PR8A 1T7PB 4MPGA 3QMXA 3MSZA 2N5AA 3NIVA 2AB6A 3QDNA 4MMMA 4HZ2A 3ED3A 1HNBA 4GTUA 1XOBA 4BA7A 1EP8A 22GSA 4GXZA 4X1UA 1Q4JA 3EWLA 2CZ3A 4IQ1A 3EC3A 1ZOFA 4POLA 2YWMA 2BMXA 3HJPA 2AV4A 5IM9A 5IIZA 4D73B 4JR6A 2HLSA 4AJ7A 2FHEA 3A2VA 3KIJA 2ES7A 4BWQA 1U6TA 5LCZA 3ZIVA 4KAEA 4G0KA 1Z6NA 4MP4A 3KMNA 4RQRA 2IFQA 4J2FA 3H93A 3TCOA 1FAAA 3F3QA 4AF2A 5CP1A 2HSMA 1I9DA 3M9JA 4EVMA 3GL5A 2WCIA 2B5YA 4DSQA 1EV9A 5J41A 3TKSE 4K6XA 4L5LA 4ULXA 3CRTA 3SBCA 1GTBA 2JZRA 2FWEA 5IPGA 1GRXA 3UIWA 4ML6A 1JLVA 3G7YA 3P90A 2IFQB 2VCTA 2V1MA 3GTUA 1A0RP 3HJOA 4EF0A 3CTGA 2DC5A 3Q18A 4E8EA 5IPHA 1XWGA 3L0HA 2ZUPA 4KNDA 1LJRA 3LSZA 1EZKA 4WETA 3D21A 1XBSA 2HSMB 3F4RA 4IELA 5J3RA 3C73A 5EVOA 1R26A 3IAS2 4XRDA 1XVQA 5AIXA 3ZVJA 6GSVA 1GH2A 2YWIA 2OE3A 2H19A 3LWAA 5ENUA 2MYGA 2ZNMA 3K8NA 1SJZA 1S3DA 3E3EA 2DIYA 5DQSA 13GSA 1YJ6A 4TKYA 2I3YA 2XBQA 5CRDA 3BBYA 3GTUB 1SD9A 1GSQA 5CREA 5A4WA 4MF7A 3I6AA 3M9KA 3TRXA 1MDIA 3UL3A 5CNWA 4V2MA 3GX0A 3M0FA 3LXZA 3DD3A 1PX7A 1AC1A 2E0QA 3VLNA 2VUPA 4FO5A 1XZOA 5GAND 2C0GA 4OCFA 2JADA 2TRCP 4NXIA 4POKA 1IYIA 4OFMA 1ILOA 3FKFA 2GQLA 3IV4A 2DJJA 2F8FA 1HNCA 1JFUA 5CAXA 4IVFA 2C3NA 3Q19A 2H74A 4HU9A 5D93A 2G0FA 2F51A 4XS4A 4DEJA 3BD2A 4I8BA 1XWKA 2ON5A 4LMVA 2V6KA 4KDUA 2CQ9A 1GTAA 5HR3A 2FLSA 1JLWA 3APSA 3DEXA 2H1GA 1NM3A 2WZ9A 5ECOB 4HEA2 1GSUA 1QFNA 3GIXA 3J7Yk 2NVLA 3RHCA 3IXRA 2IWTA 3D6IA 3MNGA 3KJYA 3D4TA 1XWAA 2QKEA 2X64A 5IMVA 1GTIA 2CAQA 4PXOA 3H4KA 5F0GA 3D5JA 4N30A 3C71A 1ZL9A 3D0ZA 2C0EA 4H86A 6GSYA 3GX8A 3ME8A 3ZIJA 1T00A 2IMKA 5HR2A 3GV1A 1JZDA 4MLYA 1WP0A 3MAKA 4ECCA 5IQYA 3IBHA 1Q98A 1SYRA 3LYKA 2CZ2A 1BEDA 3NZNA 4WXTA 5IOXA 1U87A 5E4WA 4V2NA 2GSQA 4MJEA 2VCVA 2H71A 1RQMA 1PD21 5DAKB 1GSEA 3TOTA 3F0IA 5A5KA 3WT1A 3F6DA 4PX1A 4MH3A 3P2AA 4WBJA 4OWYA 1WMJA 5B8BA 4HI7A 1OVNA 3ERGA 3LYPA 3QAWA 1E6BA 3F6FA 1G0TA 3QPMA 2V6OA 3VWWA 1K0DA 1YZXA 1A0FA 1G6YA 5KEJA 1B9YC 3H1NA 1KEBA 2GT6A 1A24A 3IRAA 1PL2A 1FG4A 1SKRB 2J23A 1TU7A 5DCGA 4BWSA 1WRYA 3KH9A 1F9MA 3PPUA 3KM6A 2LUSA 1Z3EA 2C0DA 1SYXA 6GSXA 2TRXA 1B8XA 3QAGA 3TKRA 5L71A 3UBLA 1ZYEA 3PGTA 3HCZA 2H66A 1SK1A 1K3YA 1GLPA 4GSSA 1ZZYA 2EIQA 1W4VA 1V58A 2DMLA 2UZ8A 2K18A 2IJYA 2LTKA 2M80A 5DQYA 2WS2A 3HZ4A 2CA8A 1NHOA 2ALBA 4KW6A 3CYNA 2PERA 1RW1A 1WJKA 4DSSA 4G10A 2CT6A 2DMMA 3FZAA 2CAIA 5ECQB 3CSHA 4MJBA 3WD6A 2H6ZA 5JCUA 1M2DA 4K2DA 1YF0A 3H8QA 5EY6A 3FYGA 2RLIA 2C1YA 2HXKA 4ZB8A 2B1KA 16GSA 2K9FA 1GTUA 3BOAA 1CQGA 2LS5A 3L78A 4Z7XA 1SU9A 2O7KA 1TTZA 3Q6OA 4WBRD 3TOUA 1YQ1A 1QQ2A 3HA9A 3GRXA 5JWRB 4CHSA 4FIWA 1FB0A 1X5EA 2A4VA 4IJ3A 2ON7A 2MMOA 2GT5A 4GQCA 3TB2A 4YQMA 1GSDA 2DBCA 2R37A 4Q5QA 3KEBA 3ME7A 3ISOA 2HT9A 5G30A 4OFTA 5CRHA 3ZRDA 2B5XA 2HSYA 3EE2A 4K7NA 2X8GA 3LQ7A 3W6GA 4E8HA 4AGSA 5C04A 2N5BA 1URMA 1TP9A 3J7Yb 1BQ7A 3AY8A 1OKTA 1ERUA 1TU8A 1Z7PA 1N2AA 17GSA 4MJAA 2JZTA 3UVHA 1TRUA 1TI3A 4JRRA 1BJXA 2JU5A 8GSSA 2VOCA 5CRGA 2YPMA 5D9VA 3TKPA 4GSTA 2YN1A 1NSWA 2OBIA 1ZYQB 5AN1A 3P7XA 3ZTLA 1X9MB 3RAZA 4YAPA 4K7OA 2IMDA 4POMA 5E59A 1MD4A 3O76A 1PKWA 4V2LA 3TUEA 1SKWB 1TJDA 3LXTA 2H0HA 2M72A 2LQQA 5COHA 1T4YA 2I4AA 4ZL7A 1VF3A 4MCUA 1YKCA 2J9HA 4K0GA 4KB3A 4EO3A 3KMOA 1PKZA 2H6XA 5ECNB 1TDIA 4OO5A 4IP6A 2H72A 1SL0B 2QSIA 4TXOA 3TKSC 3NOFA 2HZEA 2FCHA 2LKUA 2YANA 1JZWA 2P31A 3F3RA 3RBTA 2ZCTA 5ECPB 1K0NA 4Q5FA 3KH7A 3GH9A 1NHYA 4PQIA 3D22A 1DBYA 3UARA 2FNOA 4L8EA 1UC7A 3F9UA 2H73A 4PQHA 2MMNA 3ZREA 5B6MA 3HVVA 3EU4A 4TN8A 1JZRA 2VM1A 3KTLA 2HE3A 5G1KA 1VF4A 4YAVA 4WR4A 2WFCA 5GSTA 2HZEB 4PNGA 4K0NA 1WWJA 1R7HA 3N5OA 1ACVA 5ECRB 4TR1A 3G9BA 4O92A 11GSA 3UOMA 3HZ8A 2QGVA 3IC8A 4WEYA 2C80A 2V41A 2B6MA 1PL1A 4TR0A 2RUFA 4F0CA 4IS0A 5F8BA 2MZCA 1EOHA 4PUFC 4EKZA 4KGIA 4PUAA 4PURA 2VAFA 2I1UA 2RIIA 1YF1A 1PSQA 2KOKA 1Z6MA 1O8WA 1M2AA 2OKAA 1TKDB 5IO0A 4OMVA 5EPFA 2G2QA 1Z9HA 1T4ZA 3GHAA 3IPZA 4V1Ag 4XHMA 4IKHA 1B48A 1R5AA 4FYCA 5D96A 1EGRA 4WR5A 3RPNA 1QXHA 3GSTA 4JEDA 3IR4A 2XC2A 4TXVA 3C1SA 1XWCA 3A5WA 4O5RA 3G7IA 3A2XA 1T1VA 1KNGA 1ML6A 4NMUA 2YJHA 3VK9A 6GSWA 4TR3A 3IHQA 4JR4A 4NV5A 2KP2A 4TR4A 4MK3A 5ELGA 4GRFA 1GSSA 1V57A 5GSSA 3ERWA 1PA3A 2O89A 3WGXA 1A2MA 4MF5A 1S3AA 1G7OA 1DE2A 5HFIA 1XW9A 5HQPA 3JCML
chains in the Genus database with same CATH superfamily
1HQOA 1V2AA 3U6VA 4ID0A 3RDWA 4HU7A 2DKIA 2HRKA 3IA1A 3FZ9A 4CW9A 2AYTA 4ECBA 2R6KA 1GLQA 2YP6A 4XTSA 1OKDA 4ZBDA 1ZCPA 2L59A 2X8CA 1K3OA 4NHWA 1K0AA 2PN8A 3ZLPA 5DDLA 2XPEA 4CDOA 1Z7RA 4TVEA 4MZWA 3L9SA 5B7CA 3C1RA 3PH9A 1OE8A 4ZL9A 4HUAA 3S9FA 2CVBA 1QGVA 4EIQA 2O8VB 2H75A 2VM2A 4JU5A 2V2GA 1YEPA 1EEMA 1AQXA 1ZMAA 5HFKA 1PGTA 2WVXB 3TDGA 3TKSA 3W8JA 2E7PA 1M3IA 1G7EA 2LQOA 1OC8A 2A2RA 1I5GA 10GSA 3QFBC 1FVKA 1SKSB 2LRNA 1GUKA 1O6JA 4P3YB 5J4VA 4ILFA 2B1LA 3IK9A 1XFLA 2IMFA 4N0ZA 4I97A 4LL4B 5IMZA 4BVYA 3IAM2 4MF6A 1Y1UA 1YDKA 3CMIA 1ZYNA 3IHGA 2YOIA 1XXUA 1FOVA 5G1LA 6GSTA 1M3JA 1O7UA 2HI7A 3HVXA 4CY6A 2VKZG 2LNSA 3O6TA 3HVSA 3E9JB 5ECMB 2L4QA 4J57E 3QAVA 3GFKA 3EMPA 3A2WA 1V40A 1M9AA 4HJ2A 1XW6A 1PFOA 4HDEA 3FR3A 1THOA 1GSFA 4XS4B 3EURA 5DCHA 4ECJA 4QQ7A 3I9V2 5F05A 4EDYA 4N0VA 3FY7A 3GKNA 4GWRA 5F07A 4BVYB 2FWFA 2N5FA 4K1FA 1UN2A 4QL9A 3LG6A 3IE3A 2KLXA 3FHKA 1H75A 4TRXA 1C72A 3IOSA 2C3TA 1ST9A 2EFDA 2H30A 2GZPA 2H1AA 2OADA 4K5SA 1PN0A 2OBKA 4K8MA 1M7TA 2TIRA 2H1DA 5JCWA 4K7IA 5ELAA 2GZYA 4WF4A 1YY7A 2GVPA 5B8AA 3KXOA 1VF1A 3ZMKA 2C0FA 3GURA 1ZGNA 1YEXA 4GSNA 3UAPA 1GSYA 4O5QA 4IN0A 3EINA 3ZZXA 4HS1A 2X8HA 4MJCA 1X5CA 2YJ7A 2R4VA 4L0WA 4ZB9A 4G2EA 4AKGA 1A2JA 3WT2A 1K0CA 1FO5A 1MTCA 4PTSA 1PMTA 1J08A 3TJKA 1MEKA 2I81A 4MH2A 1Y25A 4O5UA 1MD3A 5ECKB 2HQTA 3DIEA 4KE3A 4Q5NA 1W89A 1OE7A 5CYYA 5IMDA 3FR6A 2HRNA 3VI5A 5B6NA 2VO4A 1THXA 4LL1B 1SD8A 4OO4A 5GAPD 3M8NA 2OJLA 5J4UA 1GUHA 4MA9A 2MMZA 4LA1A 2L5OA 4X0XA 3I69A 2IMIA 3UBKA 1UVZA 4HZ4A 2WVYA 3FW2A 2VCZA 2BTOT 5DALA 3FMWA 2FGXA 3LFLA 3VWUA 5KOWA 2FWGA 3ZL5A 2FY6A 5ECSA 4XS6A 4BPYA 2YZUA 3LGCA 2R2JA 4N10A 4GCIA 4DSSB 4MZBA 2FWHA 3EYTA 3M3MA 3FK8A 1V98A 5CRWA 3UVTA 4IP1A 4PHZC 3F8UA 4ZBAA 3VPTA 2KHPA 4TOPA 1DE1A 2WULA 2WJUA 4L0UA 3ERFA 4PGTA 4HQSA 1OC9A 3LEFA 1T8EB 3EU3A 4JE1A 4G0LA 1UA5A 3VI7A 3TRQA 4POBA 2BJXA 1H4OA 2DJ2A 5F06A 1EEJA 4XCSA 1TK0B 1FVJA 4ISDA 5FWGA 5DALB 1HD2A 2GTUA 3D4MA 1XVWA 4PQ1A 2CX3A 5J9CA 2WW1A 4I6XA 4L5OA 3W8SA 1N8JA 4IHUA 1TI1A 3FZ4A 2B3SA 4FQUA 3GH6A 1ZYPA 2AUVA 1QK8A 1PQNA 2PPTA 1HNAA 1B4QA 2VCXA 4GLTA 2QC7A 3QCPA 2LJKA 1OC9B 2FUG2 4JZQA 3KGKA 4KDYA 4ZL8A 2YWOA 1WE0A 1CQHA 2B7JA 3N9JA 1FB6A 1U3AA 5IO2A 3A3TA 4BVXA 4WKWA 1YKAA 2GDRA 19GSA 2I9HA 5IMAA 3QOUA 2IL3A 2HSNB 3TKQA 3QD9A 4EUYA 3WGDA 1K0BA 2PWJA 1USBA 2A4HA 2L4CA 1EGOA 3GL3A 5FT3A 3VWXA 2CVDA 1U3IA 3V1WA 5AISA 3ZFLA 4I2UA 4XIHA 1JZOA 4G9HA 2VD1A 5H5QA 3CQFA 2E2GA 3C8EA 5A4VA 1MDKA 6GSUA 5ECHB 1HYUA 5DJMA 4BVXB 5EL8A 3DVWA 2K8VA 1TK8B 1BG5A 4KH7A 1KTEA 3ZMLA 1XG8A 4IW9A 2HYXA 2C8UA 3ZFBA 2B5EA 2CV4A 4F2IA 3TU3B 2DJ3A 4EDZA 2WRTA 1TRSA 5BRTA 2AJQB 1QUWA 3ZVJD 1R4WA 3LORA 4F82A 4TXOB 1IYHA 20GSA 3DRNA 2NDOA 1I1IP 1J9BA 5ABRA 1A23A 1FHEA 1R5PA 4RQXA 3MDKA 4KCEA 2GQKA 2E2MA 1WIKA 4EIPA 3LJRA 5A1NB 4EE0A 4F9ZA 2P0GA 4Z2RA 2P5QA 1V9WA 3HJMA 3VPQA 2NPBA 3HY2A 3GYKA 4F0BA 3EMXA 5J5NA 2C3QA 4KCAA 1SK2A 2DSAA 5FHIA 4FH8A 2HNLA 18GSA 4ZXGA 5LNKe 4TW5A 5GZZB 1VGLA 4YH2A 1S3CA 3CSJA 4TR1B 3WGEA 1AW9A 2VIMA 2PGTA 5G31A 3ZYWA 1XWBA 5J9BA 2VLVA 5H5RA 3UJ1A 2O87A 2Z9SA 1TW9A 1VRSD 4ACSA 5JWOB 4RI6A 4DSRA 2JACA 3DVXA 4AKHA 5J47A 3PINA 1PX6A 2O85A 3VWVA 3HXSA 1A8LA 1RK4A 3VFIA 4ZIJA 3DXBA 5KN1A 4N3ZA 3GMFA 5INYA 1BG1A 1BAYA 1M2BA 2JSYA 2L5LA 3GKXA 5DVBA 1BX9A 1K3LA 4FYUA 4YQUA 2RUEA 2EC4A 3M1GA 4V1Ap 1F6MC 5JCGA 3CXGA 3UEMA 5LD0A 1DUGA 2VCQA 3GN3A 3GKKA 4KA0A 2KUCA 2O3EA 1T3BA 1QMVA 2PVOC 3CRUA 1XIYA 3E0UA 1O81A 3F4TA 2IMEA 1K0MA 3MYDA 3MIXA 4O32A 5A4UA 3U5RE 1F3BA 4MZCA 1GNWA 1F2EA 1GWCA 2CX4A 2P5RA 1B9XC 2VLUA 4NAXA 1WOUA 3GNJA 3KCMA 4XRAA 4GF0A 2YZHA 2PMTA 4LLRA 4A5PA 3UMAA 1KBNA 2VL3A 2F8AA 2OE1A 2HZFA 2LRCA 4N11A 1Y6EA 2H76A 5IMCA 4OCEA 2O36A 2HSHA 1AIUA 4I5QA 2HRKB 1U88A 2YV9A 1F3AA 1NW2A 1BYEA 4F03A 1J0FA 2WDUA 3OR5A 2H01A 2NTOA 1M0UA 1OAZA 2C4JA 2EFHA 3BCKA 2R5GA 3QR6A 2VCWA 4IQAA 1DSBA 3TRPA 1GULA 4KF9A 5KN3A 1A2LA 1ON4A 3RPPA 4RI7A 3HD5A 3VURA 4ZILA 2R0GA 4MDCA 2GLRA 2JZSA 2LJAA 2QA2A 6GSSA 5KN0A 5G5FA 5DAKA 4K9ZA 2VD0A 3R2QA 5AGYA 4IGJA 2HRFA 2YNXA 3APOA 2X99A 2V32A 2L6CA 2F3MA 2WZSA 1XW5A 5D8IA 1S4BP 2DIZA 1E2YA 2GGTA 1AAZA 3DYRA 5H5SA 3L4NA 4KSMA 3F63A 2VL9A 2REMA 3KP8A 1O8XA 3GSSA 4NPBA 2M46A 2DLXA 2XPDA 2GSTA 1OYJA 3Q74A 4KUNA 4BL7A 4OD7A 4ICYA 3DWVA 5ECIB 2FA8A 3KZQA 4PNFA 5D9XA 1EWXA 2MBSA 1O73A 3G7JA 3IK7A 4Z2UA 2JL4A 3HDCA 2LRTA 2XBIA 3TJGA 2KP1A 4NV2A 2L6DA 1GNEA 2B7KA 4EXJA 2RM6A 2K8SA 2VL2C 2LEGA 1SK0A 1GUMA 1OC3A 2WGRA 14GSA 3GKMA 1LBKA 5G2ZA 2H6YA 1ERWA 2OA7A 2OE0A 2R0PA 3KP9A 3ZITA 3BCIA 2D2ZA 1X5DA 4BL7B 4QL7A 2YWNA 1EV4A 1PN9A 4XS1A 2AAWA 4KX4A 1TOFA 1SVLA 2IN3A 2WB9A 3LW9A 2FD3A 2RM5A 3KD0A 3F4SA 4FYBA 2H1BA 5IMFA 3WYWA 2NBSA 4GQFA 4EC0A 4MABA 4ZBBA 2EIRA 5CO3A 3TJJA 3DMLA 3DGQA 4X43A 5ID2A 2VLTA 2HFDA 4MPFA 5D9TA 1TRWA 2XHFA 4HQZA 4AKIA 2PBJA 3TJFA 1SENA 4AJ8A 2GSRA 2JSZA 1Z5YE 5HFGA 5DBQA 4HJMA 1AUCA 2GS3A 4WF5A 1B4PA 1ABAA 4ZB6A 5KN2A 2R3XA 2PU9C 2PVQA 4USSA 3CSIA 4ZB7A 1GP1A 1X0RA 4HSCX 1AXDA 4DVCA 2HRAA 1SL2B 3CBUA 1TK5B 3EVIA 2H0IA 2OACA 5DJLA 5JWQB 5ID2B 2CVKA 3RHBA 1EP7A 3US3A 4HOJA 3FRCA 2A2PA 2GQMA 1X9SB 4I2TA 1K0OA 4AJ6A 2YCDA 2O5VA 3SWLA 3BJ5A 1GL8A 2H8LA 2L57A 5C00A 3FZ5A 5ECLB 4KSOA 2H70A 4EL1A 1LU4A 3IDVA 3KTBA 3C7MA 4IJIA 2IIYA 1G6WA 2LSTA 1A8YA 4YQVA 3P8WA 3CWGA 2MBTA 5D9WA 3L9VA 3TGZA 4G0IA 1O85A 1EOGA 3HYPA 1AQWA 2LJRA 1WPIA 3APQA 7GSSA 1XOAA 5HR1A 2IPAA 1M9BA 2AHEA 4LMWA 2LNTA 3L9UA 4J56E 3IC4A 2WW2A 3FR9A 2A2SA 3A5IA 2GZZA 4Q5RA 1SJ6A 1F37A 5A34A 3DKSA 3O3TA 2X4AA 4Z2TA 1AQVA 3QFAC 2K6VA 2EFEA 1PRXA 4KDXA 9GSSA 3H79A 3GUSA 2LV3A 5IOWA 1SL1B 3MWHA 2R0CA 4G19A 1MDJA 4NHZA 1TXXA 4OFNA 2H0GA 3R3EA 3TJBA 2DJ1A 4NWYA 1TRVA 2DJKA 1JHBA 1SJIA 2MMAA 3GA4A 4MNNA 1FW1A 2PUKC 1VF2A 2FA4A 5A34B 1ERTA 3FEUA 4JBBA 5D73A 4RUVA 2YV7A 3CTFA 2EFCA 1XPVA 4IBPA 12GSA 1SVOA 1XCCA 3I43A 2DJ0A 4BIKA 5HR0A 3HKRA 2F9SA 5KOXA 5BMUA 2VL2A 4O7HA 1M99A 1X9WB 1ERVA 4ECIA 4D73A 3HHVA 4ML1A 2EIOA 5G5EA 5AIVA 2GSSA 3PR8A 1T7PB 4MPGA 3QMXA 3MSZA 2N5AA 3NIVA 2AB6A 3QDNA 4MMMA 4QMKA 4HZ2A 3ED3A 1HNBA 4GTUA 1XOBA 4BA7A 1EP8A 22GSA 4GXZA 4X1UA 1Q4JA 3EWLA 2CZ3A 4IQ1A 3EC3A 1ZOFA 4POLA 2YWMA 2BMXA 3HJPA 2AV4A 5IM9A 5IIZA 4D73B 4JR6A 2HLSA 4AJ7A 2FHEA 3A2VA 3KIJA 2ES7A 4BWQA 4W66A 1U6TA 4E68A 5LCZA 3ZIVA 4KAEA 4G0KA 1Z6NA 4MP4A 3KMNA 4RQRA 2IFQA 4J2FA 3H93A 3TCOA 1FAAA 3F3QA 4AF2A 5CP1A 2HSMA 1I9DA 3M9JA 4EVMA 3GL5A 2WCIA 2B5YA 4DSQA 1EV9A 5J41A 3TKSE 1YEWC 4K6XA 4L5LA 4ULXA 3CRTA 4YKFA 3SBCA 1GTBA 3EPTA 2JZRA 2FWEA 5IPGA 1GRXA 4AI6A 3UIWA 4ML6A 1JLVA 3G7YA 3P90A 2IFQB 2VCTA 2V1MA 3GTUA 1A0RP 3HJOA 4EF0A 3CTGA 2DC5A 3Q18A 4E8EA 5IPHA 1XWGA 3L0HA 2ZUPA 4KNDA 1LJRA 3LSZA 1EZKA 4WETA 3D21A 1XBSA 2HSMB 3F4RA 4IELA 5J3RA 3C73A 1S3RA 5EVOA 1R26A 3IAS2 4XRDA 1XVQA 5AIXA 3ZVJA 6GSVA 1GH2A 2YWIA 2OE3A 2H19A 3LWAA 5ENUA 2MYGA 2ZNMA 3K8NA 1SJZA 1S3DA 2WVXA 3E3EA 2DIYA 5DQSA 13GSA 1YJ6A 4TKYA 2I3YA 2XBQA 5CRDA 3BBYA 3GTUB 1TXUA 1SD9A 1GSQA 5CREA 5A4WA 4MF7A 3I6AA 3M9KA 3TRXA 1MDIA 3UL3A 5CNWA 4V2MA 3GX0A 3M0FA 3LXZA 3DD3A 1PX7A 1AC1A 2E0QA 3VLNA 2VUPA 4FO5A 1XZOA 5GAND 2C0GA 4OCFA 2JADA 2TRCP 3CHXC 4NXIA 4POKA 1IYIA 4OFMA 1ILOA 3FKFA 2GQLA 3IV4A 2DJJA 2F8FA 1HNCA 1JFUA 5CAXA 4IVFA 2C3NA 3Q19A 2H74A 4HU9A 5D93A 2G0FA 2F51A 4XS4A 4DEJA 3BD2A 4I8BA 1XWKA 2ON5A 4FXYP 2UV8G 4LMVA 2V6KA 4KDUA 2CQ9A 1GTAA 5HR3A 2FLSA 1JLWA 3APSA 3DEXA 2H1GA 1NM3A 2WZ9A 5ECOB 4HEA2 1GSUA 1QFNA 3GIXA 3J7Yk 2NVLA 3RHCA 3IXRA 2IWTA 3D6IA 3MNGA 3KJYA 3D4TA 1XWAA 2QKEA 2X64A 5IMVA 1GTIA 2CAQA 4PXOA 3H4KA 5F0GA 3D5JA 4YKGA 4N30A 3C71A 1ZL9A 3D0ZA 2C0EA 4H86A 6GSYA 3GX8A 3ME8A 3ZIJA 1T00A 2IMKA 5HR2A 3GV1A 1JZDA 4MLYA 1WP0A 3MAKA 4ECCA 5IQYA 3IBHA 1Q98A 1SYRA 3LYKA 2CZ2A 1BEDA 3NZNA 4WXTA 5IOXA 1U87A 5E4WA 4V2NA 2GSQA 4MJEA 2VCVA 2H71A 1RQMA 1PD21 5DAKB 1GSEA 3TOTA 3F0IA 5A5KA 3WT1A 3F6DA 4PX1A 4MH3A 3P2AA 4WBJA 4OWYA 4K5RA 1WMJA 5B8BA 4HI7A 1OVNA 3ERGA 3LYPA 3QAWA 1E6BA 3F6FA 1G0TA 3QPMA 2V6OA 3VWWA 1K0DA 1YZXA 1A0FA 1G6YA 5KEJA 1B9YC 3H1NA 1KEBA 2GT6A 1A24A 3IRAA 1PL2A 1FG4A 1SKRB 2J23A 1TU7A 5DCGA 4BWSA 1WRYA 3KH9A 1F9MA 3PPUA 3KM6A 1SVMA 2LUSA 1Z3EA 2C0DA 1SYXA 6GSXA 2TRXA 1B8XA 3QAGA 3TKRA 5L71A 3UBLA 1ZYEA 3PGTA 3HCZA 2H66A 1SK1A 1K3YA 1GLPA 4GSSA 1ZZYA 2EIQA 1W4VA 1V58A 2DMLA 2UZ8A 2K18A 5J40A 2IJYA 2LTKA 2M80A 5DQYA 2WS2A 3HZ4A 2CA8A 1NHOA 2ALBA 4KW6A 3CYNA 2PERA 1RW1A 4PI0C 1WJKA 4DSSA 4G10A 2CT6A 2DMMA 3FZAA 2CAIA 5ECQB 3CSHA 4MJBA 3WD6A 2H6ZA 5JCUA 1M2DA 4K2DA 1YF0A 3H8QA 5EY6A 3FYGA 2RLIA 2C1YA 2HXKA 4ZB8A 2B1KA 16GSA 2K9FA 1GTUA 3BOAA 1CQGA 2LS5A 3L78A 4Z7XA 1SU9A 2O7KA 1TTZA 3Q6OA 4WBRD 3TOUA 1YQ1A 1QQ2A 3HA9A 3GRXA 5JWRB 4CHSA 4FIWA 1FB0A 1X5EA 2A4VA 4IJ3A 2ON7A 2MMOA 2GT5A 4GQCA 3TB2A 4YQMA 1GSDA 2DBCA 2R37A 4Q5QA 3KEBA 3ME7A 3ISOA 2HT9A 5G30A 4OFTA 5CRHA 3ZRDA 2B5XA 2HSYA 3EE2A 4K7NA 2X8GA 3LQ7A 4X4JA 4E8HA 3W6GA 4AGSA 5C04A 2N5BA 1URMA 1TP9A 3J7Yb 1BQ7A 3AY8A 4GDFA 1BF5A 1OKTA 1ERUA 5A5HA 1TU8A 1Z7PA 4CY8A 1N2AA 2HSNA 17GSA 4MJAA 2JZTA 3UVHA 1TRUA 2WW3A 1TI3A 4JRRA 1BJXA 2JU5A 8GSSA 2VOCA 5CRGA 2YPMA 5D9VA 3TKPA 4GSTA 2YN1A 1NSWA 2OBIA 1ZYQB 5AN1A 3P7XA 3ZTLA 1X9MB 3RAZA 4YAPA 4K7OA 2IMDA 4POMA 5E59A 1MD4A 3O76A 1PKWA 5A5HB 4V2LA 3TUEA 1SKWB 2WVZA 2WW0A 1TJDA 3LXTA 2H0HA 1N25A 2M72A 2LQQA 5COHA 1T4YA 2I4AA 4ZL7A 1VF3A 4MCUA 1YKCA 2J9HA 4K0GA 4KB3A 4EO3A 3KMOA 1PKZA 2H6XA 5ECNB 1TDIA 2DKHA 4OO5A 4IP6A 2H72A 1SL0B 2QSIA 4TXOA 3TKSC 3NOFA 2HZEA 2QA1A 2FCHA 2LKUA 2YANA 1JZWA 2P31A 3F3RA 3RBTA 2ZCTA 5ECPB 4K2XA 1K0NA 4Q5FA 3KH7A 3GH9A 1NHYA 4PQIA 3D22A 1DBYA 5A1NA 3UARA 2FNOA 4L8EA 1UC7A 3F9UA 2H73A 4PQHA 2MMNA 3ZREA 5B6MA 3HVVA 3EU4A 4TN8A 1JZRA 2VM1A 5J4YA 3KTLA 2HE3A 5G1KA 1VF4A 4YAVA 4WR4A 2WFCA 5GSTA 2HZEB 4PNGA 4K0NA 3HMJG 1WWJA 1R7HA 3N5OA 1ACVA 5ECRB 4PI2C 4TR1A 3G9BA 4O92A 11GSA 5BMUB 3UOMA 3HZ8A 2QGVA 3IC8A 4WEYA 2C80A 2V41A 2B6MA 1PL1A 4TR0A 2RUFA 4F0CA 4IS0A 5F8BA 2MZCA 1EOHA 4PUFC 4EKZA 4G01A 2H1LA 4KGIA 4PUAA 4PURA 2VAFA 2I1UA 2RIIA 1YF1A 1PSQA 2KOKA 1Z6MA 1O8WA 1M2AA 2OKAA 1YVLA 1TKDB 5IO0A 4OMVA 5EPFA 2G2QA 2X49A 1Z9HA 1T4ZA 3GHAA 3IPZA 4V1Ag 4XHMA 4IKHA 1B48A 1R5AA 4FYCA 5D96A 1EGRA 4WR5A 3RPNA 1QXHA 3GSTA 4JEDA 3IR4A 2OT3A 2XC2A 4TXVA 3C1SA 1XWCA 3A5WA 4O5RA 4AKXB 3G7IA 3A2XA 3RFRC 1T1VA 1KNGA 1ML6A 4NMUA 2YJHA 3VK9A 6GSWA 4TR3A 3IHQA 4JR4A 4NV5A 1FOHA 2KP2A 3HVNA 4TR4A 4MK3A 5ELGA 4GRFA 1GSSA 1V57A 5GSSA 3ERWA 1PA3A 2O89A 3WGXA 1A2MA 4MF5A 1S3AA 1G7OA 1DE2A 5HFIA 1XW9A 3RGBC 3JCML 5HQPA
chains in the Genus database with same CATH topology
1HQOA 1V2AA 3U6VA 4ID0A 3RDWA 4HU7A 2DKIA 2HRKA 3IA1A 3FZ9A 4CW9A 2AYTA 4ECBA 2R6KA 1GLQA 2YP6A 4XTSA 1OKDA 4ZBDA 1ZCPA 2L59A 2X8CA 1K3OA 4NHWA 1K0AA 2PN8A 3ZLPA 5DDLA 2XPEA 4CDOA 1Z7RA 4TVEA 4MZWA 3L9SA 5B7CA 3C1RA 3PH9A 1OE8A 4ZL9A 4HUAA 3S9FA 2CVBA 1QGVA 4EIQA 2O8VB 2H75A 2VM2A 4JU5A 2V2GA 1YEPA 1EEMA 1AQXA 1ZMAA 5HFKA 1PGTA 3TDGA 3TKSA 3W8JA 2E7PA 1G7EA 2LQOA 1OC8A 2A2RA 1I5GA 10GSA 3QFBC 1FVKA 1SKSB 2LRNA 1GUKA 1O6JA 4P3YB 5J4VA 4ILFA 2B1LA 3IK9A 1XFLA 2IMFA 4N0ZA 4I97A 4LL4B 5IMZA 4BVYA 3IAM2 4MF6A 1Y1UA 1YDKA 3CMIA 1ZYNA 3IHGA 2YOIA 1XXUA 1FOVA 5G1LA 6GSTA 1O7UA 2HI7A 3HVXA 4CY6A 2VKZG 2LNSA 3O6TA 3HVSA 3E9JB 5ECMB 2L4QA 4J57E 3QAVA 3GFKA 3EMPA 3A2WA 1V40A 1M9AA 4HJ2A 1XW6A 4HDEA 3FR3A 1THOA 1GSFA 4XS4B 3EURA 5DCHA 4ECJA 4QQ7A 3I9V2 5F05A 4EDYA 4N0VA 3FY7A 3GKNA 4GWRA 5F07A 4BVYB 2FWFA 2N5FA 4K1FA 1UN2A 4QL9A 3LG6A 3IE3A 2KLXA 3FHKA 1H75A 4TRXA 1C72A 3IOSA 2C3TA 1ST9A 2EFDA 2H30A 2GZPA 2H1AA 2OADA 4K5SA 1PN0A 2OBKA 4K8MA 1M7TA 2TIRA 2H1DA 5JCWA 4K7IA 5ELAA 2GZYA 4WF4A 1YY7A 2GVPA 5B8AA 3KXOA 1VF1A 3ZMKA 2C0FA 3GURA 1ZGNA 1YEXA 4GSNA 3UAPA 1GSYA 4O5QA 4IN0A 3EINA 3ZZXA 4HS1A 2X8HA 4MJCA 1X5CA 2YJ7A 2R4VA 4L0WA 4ZB9A 4G2EA 4AKGA 1A2JA 3WT2A 1K0CA 1FO5A 1MTCA 4PTSA 1PMTA 1J08A 3TJKA 1MEKA 2I81A 4MH2A 1Y25A 4O5UA 1MD3A 5ECKB 2HQTA 3DIEA 4KE3A 4Q5NA 1W89A 1OE7A 5CYYA 5IMDA 3FR6A 2HRNA 3VI5A 5B6NA 2VO4A 1THXA 4LL1B 1SD8A 4OO4A 5GAPD 3M8NA 2OJLA 5J4UA 1GUHA 4MA9A 2MMZA 4LA1A 2L5OA 4X0XA 3I69A 2IMIA 3UBKA 1UVZA 4HZ4A 3FW2A 2VCZA 2BTOT 5DALA 3FMWA 2FGXA 3LFLA 3VWUA 5KOWA 2FWGA 3ZL5A 2FY6A 5ECSA 4XS6A 4BPYA 2YZUA 3LGCA 2R2JA 4N10A 4GCIA 4DSSB 4MZBA 2FWHA 3EYTA 3M3MA 3FK8A 1V98A 5CRWA 3UVTA 4IP1A 3F8UA 4ZBAA 3VPTA 2KHPA 4TOPA 1DE1A 2WULA 2WJUA 4L0UA 3ERFA 4PGTA 4HQSA 1OC9A 3LEFA 1T8EB 3EU3A 4JE1A 4G0LA 1UA5A 3VI7A 3TRQA 4POBA 2BJXA 1H4OA 2DJ2A 5F06A 1EEJA 4XCSA 1TK0B 1FVJA 4ISDA 5FWGA 5DALB 1HD2A 2GTUA 3D4MA 1XVWA 4PQ1A 2CX3A 5J9CA 4I6XA 4L5OA 3W8SA 1N8JA 4IHUA 1TI1A 3FZ4A 2B3SA 4FQUA 3GH6A 1ZYPA 2AUVA 1QK8A 1PQNA 2PPTA 1HNAA 1B4QA 2VCXA 4GLTA 2QC7A 3QCPA 2LJKA 1OC9B 2FUG2 4JZQA 3KGKA 4KDYA 4ZL8A 2YWOA 1WE0A 1CQHA 2B7JA 3N9JA 1FB6A 1U3AA 5IO2A 3A3TA 4BVXA 4WKWA 1YKAA 2GDRA 19GSA 2I9HA 5IMAA 3QOUA 2IL3A 2HSNB 3TKQA 3QD9A 4EUYA 3WGDA 1K0BA 2PWJA 1USBA 2A4HA 2L4CA 1EGOA 3GL3A 5FT3A 3VWXA 2CVDA 1U3IA 3V1WA 5AISA 3ZFLA 4I2UA 4XIHA 1JZOA 4G9HA 2VD1A 5H5QA 2E2GA 3C8EA 5A4VA 1MDKA 6GSUA 5ECHB 1HYUA 5DJMA 4BVXB 5EL8A 3DVWA 2K8VA 1TK8B 1BG5A 4KH7A 1KTEA 3ZMLA 4IW9A 2HYXA 2C8UA 3ZFBA 2B5EA 2CV4A 4F2IA 3TU3B 2DJ3A 4EDZA 2WRTA 1TRSA 5BRTA 2AJQB 1QUWA 3ZVJD 1R4WA 3LORA 4F82A 4TXOB 1IYHA 20GSA 3DRNA 2NDOA 1J9BA 5ABRA 1A23A 1FHEA 1R5PA 4RQXA 3MDKA 4KCEA 2GQKA 2E2MA 1WIKA 4EIPA 3LJRA 5A1NB 4EE0A 4F9ZA 2P0GA 4Z2RA 2P5QA 1V9WA 3HJMA 3VPQA 2NPBA 3HY2A 3GYKA 4F0BA 3EMXA 5J5NA 2C3QA 4KCAA 1SK2A 2DSAA 5FHIA 4FH8A 2HNLA 18GSA 4ZXGA 5LNKe 4TW5A 5GZZB 1VGLA 4YH2A 1S3CA 3CSJA 4TR1B 3WGEA 1AW9A 2VIMA 2PGTA 5G31A 3ZYWA 1XWBA 5J9BA 2VLVA 5H5RA 3UJ1A 2O87A 2Z9SA 1TW9A 1VRSD 4ACSA 5JWOB 4RI6A 4DSRA 2JACA 3DVXA 4AKHA 5J47A 3PINA 1PX6A 2O85A 3VWVA 3HXSA 1A8LA 1RK4A 3VFIA 4ZIJA 3DXBA 5KN1A 4N3ZA 3GMFA 5INYA 1BG1A 1BAYA 1M2BA 2JSYA 2L5LA 3GKXA 5DVBA 1BX9A 1K3LA 4FYUA 4YQUA 2RUEA 2EC4A 3M1GA 4V1Ap 1F6MC 5JCGA 3CXGA 3UEMA 5LD0A 1DUGA 2VCQA 3GN3A 3GKKA 4KA0A 2KUCA 1T3BA 1QMVA 2PVOC 3CRUA 1XIYA 3E0UA 1O81A 3F4TA 2IMEA 1K0MA 3MYDA 3MIXA 4O32A 5A4UA 3U5RE 1F3BA 4MZCA 1GNWA 1F2EA 1GWCA 2CX4A 2P5RA 1B9XC 2VLUA 4NAXA 1WOUA 3GNJA 3KCMA 4XRAA 4GF0A 2YZHA 2PMTA 4LLRA 4A5PA 3UMAA 1KBNA 2VL3A 2F8AA 2OE1A 2HZFA 2LRCA 4N11A 1Y6EA 2H76A 5IMCA 4OCEA 2HSHA 1AIUA 4I5QA 2HRKB 1U88A 2YV9A 1F3AA 1NW2A 1BYEA 4F03A 1J0FA 2WDUA 3OR5A 2H01A 2NTOA 1M0UA 1OAZA 2C4JA 2EFHA 3BCKA 2R5GA 3QR6A 2VCWA 4IQAA 1DSBA 3TRPA 1GULA 4KF9A 5KN3A 1A2LA 1ON4A 3RPPA 4RI7A 3HD5A 3VURA 4ZILA 2R0GA 4MDCA 2GLRA 2JZSA 2LJAA 2QA2A 6GSSA 5KN0A 5G5FA 5DAKA 4K9ZA 2VD0A 3R2QA 5AGYA 4IGJA 2HRFA 2YNXA 3APOA 2X99A 2V32A 2L6CA 2F3MA 1XW5A 5D8IA 2DIZA 1E2YA 2GGTA 1AAZA 3DYRA 5H5SA 3L4NA 4KSMA 3F63A 2VL9A 2REMA 3KP8A 1O8XA 3GSSA 4NPBA 2M46A 2DLXA 2XPDA 2GSTA 1OYJA 3Q74A 4KUNA 4BL7A 4OD7A 4ICYA 3DWVA 5ECIB 2FA8A 3KZQA 4PNFA 5D9XA 1EWXA 2MBSA 1O73A 3G7JA 3IK7A 4Z2UA 2JL4A 3HDCA 2LRTA 2XBIA 3TJGA 2KP1A 4NV2A 2L6DA 1GNEA 2B7KA 4EXJA 2RM6A 2K8SA 2VL2C 2LEGA 1SK0A 1GUMA 1OC3A 2WGRA 14GSA 3GKMA 1LBKA 5G2ZA 2H6YA 1ERWA 2OA7A 2OE0A 2R0PA 3KP9A 3ZITA 3BCIA 2D2ZA 1X5DA 4BL7B 4QL7A 2YWNA 1EV4A 1PN9A 4XS1A 2AAWA 4KX4A 1TOFA 1SVLA 2IN3A 2WB9A 3LW9A 2FD3A 2RM5A 3KD0A 3F4SA 4FYBA 2H1BA 5IMFA 3WYWA 2NBSA 4GQFA 4EC0A 4MABA 4ZBBA 2EIRA 5CO3A 3TJJA 3DMLA 3DGQA 4X43A 5ID2A 2VLTA 2HFDA 4MPFA 5D9TA 1TRWA 2XHFA 4HQZA 4AKIA 2PBJA 3TJFA 1SENA 4AJ8A 2GSRA 2JSZA 1Z5YE 5HFGA 5DBQA 4HJMA 1AUCA 2GS3A 4WF5A 1B4PA 1ABAA 4ZB6A 5KN2A 2R3XA 2PU9C 2PVQA 4USSA 3CSIA 4ZB7A 1GP1A 1X0RA 1AXDA 4DVCA 2HRAA 1SL2B 3CBUA 1TK5B 3EVIA 2H0IA 2OACA 5DJLA 5JWQB 5ID2B 2CVKA 3RHBA 1EP7A 3US3A 4HOJA 3FRCA 2A2PA 2GQMA 1X9SB 4I2TA 1K0OA 4AJ6A 2YCDA 2O5VA 3SWLA 3BJ5A 1GL8A 2H8LA 2L57A 5C00A 3FZ5A 5ECLB 4KSOA 2H70A 4EL1A 1LU4A 3IDVA 3KTBA 3C7MA 4IJIA 2IIYA 1G6WA 2LSTA 1A8YA 4YQVA 3P8WA 3CWGA 2MBTA 5D9WA 3L9VA 3TGZA 4G0IA 1O85A 1EOGA 3HYPA 1AQWA 2LJRA 1WPIA 3APQA 7GSSA 1XOAA 5HR1A 2IPAA 1M9BA 2AHEA 4LMWA 2LNTA 3L9UA 4J56E 3IC4A 3FR9A 2A2SA 3A5IA 2GZZA 4Q5RA 1SJ6A 1F37A 5A34A 3DKSA 3O3TA 2X4AA 4Z2TA 1AQVA 3QFAC 2K6VA 2EFEA 1PRXA 4KDXA 9GSSA 3H79A 3GUSA 2LV3A 5IOWA 1SL1B 3MWHA 2R0CA 4G19A 1MDJA 4NHZA 1TXXA 4OFNA 2H0GA 3R3EA 3TJBA 2DJ1A 4NWYA 1TRVA 2DJKA 1JHBA 1SJIA 2MMAA 3GA4A 4MNNA 1FW1A 2PUKC 1VF2A 2FA4A 5A34B 1ERTA 3FEUA 4JBBA 5D73A 4RUVA 2YV7A 3CTFA 2EFCA 1XPVA 4IBPA 12GSA 1SVOA 1XCCA 3I43A 2DJ0A 5HR0A 3HKRA 2F9SA 5KOXA 5BMUA 2VL2A 4O7HA 1M99A 1X9WB 1ERVA 4ECIA 4D73A 3HHVA 4ML1A 2EIOA 5G5EA 5AIVA 2GSSA 3PR8A 1T7PB 4MPGA 3QMXA 3MSZA 2N5AA 3NIVA 2AB6A 3QDNA 4MMMA 4QMKA 4HZ2A 3ED3A 1HNBA 4GTUA 1XOBA 4BA7A 1EP8A 22GSA 4GXZA 4X1UA 1Q4JA 3EWLA 2CZ3A 4IQ1A 3EC3A 1ZOFA 4POLA 2YWMA 2BMXA 3HJPA 2AV4A 5IM9A 5IIZA 4D73B 4JR6A 2HLSA 4AJ7A 2FHEA 3A2VA 3KIJA 2ES7A 4BWQA 4W66A 1U6TA 4E68A 5LCZA 3ZIVA 4KAEA 4G0KA 1Z6NA 4MP4A 3KMNA 4RQRA 2IFQA 4J2FA 3H93A 3TCOA 1FAAA 3F3QA 4AF2A 5CP1A 2HSMA 1I9DA 3M9JA 4EVMA 3GL5A 2WCIA 2B5YA 4DSQA 1EV9A 5J41A 3TKSE 4K6XA 4L5LA 4ULXA 3CRTA 4YKFA 3SBCA 1GTBA 3EPTA 2JZRA 2FWEA 5IPGA 1GRXA 4AI6A 3UIWA 4ML6A 1JLVA 3G7YA 3P90A 2IFQB 2VCTA 2V1MA 3GTUA 1A0RP 3HJOA 4EF0A 3CTGA 2DC5A 3Q18A 4E8EA 5IPHA 1XWGA 3L0HA 2ZUPA 4KNDA 1LJRA 3LSZA 1EZKA 4WETA 3D21A 1XBSA 2HSMB 3F4RA 4IELA 5J3RA 3C73A 5EVOA 1R26A 3IAS2 4XRDA 1XVQA 5AIXA 3ZVJA 6GSVA 1GH2A 2YWIA 2OE3A 2H19A 3LWAA 5ENUA 2MYGA 2ZNMA 3K8NA 1SJZA 1S3DA 3E3EA 2DIYA 5DQSA 13GSA 1YJ6A 4TKYA 2I3YA 2XBQA 5CRDA 3BBYA 3GTUB 1TXUA 1SD9A 1GSQA 5CREA 5A4WA 4MF7A 3I6AA 3M9KA 3TRXA 1MDIA 3UL3A 5CNWA 4V2MA 3GX0A 3M0FA 3LXZA 3DD3A 1PX7A 1AC1A 2E0QA 3VLNA 2VUPA 4FO5A 1XZOA 5GAND 2C0GA 4OCFA 2JADA 2TRCP 4NXIA 4POKA 1IYIA 4OFMA 1ILOA 3FKFA 2GQLA 3IV4A 2DJJA 2F8FA 1HNCA 1JFUA 5CAXA 4IVFA 2C3NA 3Q19A 2H74A 4HU9A 5D93A 2G0FA 2F51A 4XS4A 4DEJA 3BD2A 4I8BA 1XWKA 2ON5A 2UV8G 4LMVA 2V6KA 4KDUA 2CQ9A 1GTAA 5HR3A 2FLSA 1JLWA 3APSA 3DEXA 2H1GA 1NM3A 2WZ9A 5ECOB 4HEA2 1GSUA 1QFNA 3GIXA 3J7Yk 2NVLA 3RHCA 3IXRA 2IWTA 3D6IA 3MNGA 3KJYA 3D4TA 1XWAA 2QKEA 2X64A 5IMVA 1GTIA 2CAQA 4PXOA 3H4KA 5F0GA 3D5JA 4YKGA 4N30A 3C71A 1ZL9A 3D0ZA 2C0EA 4H86A 6GSYA 3GX8A 3ME8A 3ZIJA 1T00A 2IMKA 5HR2A 3GV1A 1JZDA 4MLYA 1WP0A 3MAKA 4ECCA 5IQYA 3IBHA 1Q98A 1SYRA 3LYKA 2CZ2A 1BEDA 3NZNA 4WXTA 5IOXA 1U87A 5E4WA 4V2NA 2GSQA 4MJEA 2VCVA 2H71A 1RQMA 1PD21 5DAKB 1GSEA 3TOTA 3F0IA 5A5KA 3WT1A 3F6DA 4PX1A 4MH3A 3P2AA 4WBJA 4OWYA 4K5RA 1WMJA 5B8BA 4HI7A 1OVNA 3ERGA 3LYPA 3QAWA 1E6BA 3F6FA 1G0TA 3QPMA 2V6OA 3VWWA 1K0DA 1YZXA 1A0FA 1G6YA 5KEJA 1B9YC 3H1NA 1KEBA 2GT6A 1A24A 3IRAA 1PL2A 1FG4A 1SKRB 2J23A 1TU7A 5DCGA 4BWSA 1WRYA 3KH9A 1F9MA 3PPUA 3KM6A 1SVMA 2LUSA 1Z3EA 2C0DA 1SYXA 6GSXA 2TRXA 1B8XA 3QAGA 3TKRA 5L71A 3UBLA 1ZYEA 3PGTA 3HCZA 2H66A 1SK1A 1K3YA 1GLPA 4GSSA 1ZZYA 2EIQA 1W4VA 1V58A 2DMLA 2UZ8A 2K18A 5J40A 2IJYA 2LTKA 2M80A 5DQYA 2WS2A 3HZ4A 2CA8A 1NHOA 2ALBA 4KW6A 3CYNA 2PERA 1RW1A 1WJKA 4DSSA 4G10A 2CT6A 2DMMA 3FZAA 2CAIA 5ECQB 3CSHA 4MJBA 3WD6A 2H6ZA 5JCUA 1M2DA 4K2DA 1YF0A 3H8QA 5EY6A 3FYGA 2RLIA 2C1YA 2HXKA 4ZB8A 2B1KA 16GSA 2K9FA 1GTUA 3BOAA 1CQGA 2LS5A 3L78A 4Z7XA 1SU9A 2O7KA 1TTZA 3Q6OA 4WBRD 3TOUA 1YQ1A 1QQ2A 3HA9A 3GRXA 5JWRB 4CHSA 4FIWA 1FB0A 1X5EA 2A4VA 4IJ3A 2ON7A 2MMOA 2GT5A 4GQCA 3TB2A 4YQMA 1GSDA 2DBCA 2R37A 4Q5QA 3KEBA 3ME7A 3ISOA 2HT9A 5G30A 4OFTA 5CRHA 3ZRDA 2B5XA 2HSYA 3EE2A 4K7NA 2X8GA 3LQ7A 4X4JA 4E8HA 3W6GA 4AGSA 5C04A 2N5BA 1URMA 1TP9A 3J7Yb 1BQ7A 3AY8A 4GDFA 1BF5A 1OKTA 1ERUA 5A5HA 1TU8A 1Z7PA 4CY8A 1N2AA 2HSNA 17GSA 4MJAA 2JZTA 3UVHA 1TRUA 1TI3A 4JRRA 1BJXA 2JU5A 8GSSA 2VOCA 5CRGA 2YPMA 5D9VA 3TKPA 4GSTA 2YN1A 1NSWA 2OBIA 1ZYQB 5AN1A 3P7XA 3ZTLA 1X9MB 3RAZA 4YAPA 4K7OA 2IMDA 4POMA 5E59A 1MD4A 3O76A 1PKWA 5A5HB 4V2LA 3TUEA 1SKWB 1TJDA 3LXTA 2H0HA 1N25A 2M72A 2LQQA 5COHA 1T4YA 2I4AA 4ZL7A 1VF3A 4MCUA 1YKCA 2J9HA 4K0GA 4KB3A 4EO3A 3KMOA 1PKZA 2H6XA 5ECNB 1TDIA 2DKHA 4OO5A 4IP6A 2H72A 1SL0B 2QSIA 4TXOA 3TKSC 3NOFA 2HZEA 2QA1A 2FCHA 2LKUA 2YANA 1JZWA 2P31A 3F3RA 3RBTA 2ZCTA 5ECPB 4K2XA 1K0NA 4Q5FA 3KH7A 3GH9A 1NHYA 4PQIA 3D22A 1DBYA 5A1NA 3UARA 2FNOA 4L8EA 1UC7A 3F9UA 2H73A 4PQHA 2MMNA 3ZREA 5B6MA 3HVVA 3EU4A 4TN8A 1JZRA 2VM1A 5J4YA 3KTLA 2HE3A 5G1KA 1VF4A 4YAVA 4WR4A 2WFCA 5GSTA 2HZEB 4PNGA 4K0NA 3HMJG 1WWJA 1R7HA 3N5OA 1ACVA 5ECRB 4TR1A 3G9BA 4O92A 11GSA 5BMUB 3UOMA 3HZ8A 2QGVA 3IC8A 4WEYA 2C80A 2V41A 2B6MA 1PL1A 4TR0A 2RUFA 4F0CA 4IS0A 5F8BA 2MZCA 1EOHA 4PUFC 4EKZA 4G01A 2H1LA 4KGIA 4PUAA 4PURA 2VAFA 2I1UA 2RIIA 1YF1A 1PSQA 2KOKA 1Z6MA 1O8WA 1M2AA 2OKAA 1YVLA 1TKDB 5IO0A 4OMVA 5EPFA 2G2QA 2X49A 1Z9HA 1T4ZA 3GHAA 3IPZA 4V1Ag 4XHMA 4IKHA 1B48A 1R5AA 4FYCA 5D96A 1EGRA 4WR5A 3RPNA 1QXHA 3GSTA 4JEDA 3IR4A 2OT3A 2XC2A 4TXVA 3C1SA 1XWCA 3A5WA 4O5RA 4AKXB 3G7IA 3A2XA 1T1VA 1KNGA 1ML6A 4NMUA 2YJHA 3VK9A 6GSWA 4TR3A 3IHQA 4JR4A 4NV5A 1FOHA 2KP2A 4TR4A 4MK3A 5ELGA 4GRFA 1GSSA 1V57A 5GSSA 3ERWA 1PA3A 2O89A 3WGXA 1A2MA 4MF5A 1S3AA 1G7OA 1DE2A 5HFIA 1XW9A 5HQPA 3JCML
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HQO A;  1V2A A;  3U6V A;  4ID0 A;  3RDW A;  4HU7 A;  2HRK A;  3IA1 A;  3FZ9 A;  4CW9 A;  2AYT A;  4ECB A;  2R6K A;  1GLQ A;  2YP6 A;  4XTS A;  1OKD A;  4ZBD A;  1ZCP A;  2L59 A;  2X8C A;  1K3O A;  4NHW A;  1K0A A;  2PN8 A;  3ZLP A;  5DDL A;  2XPE A;  4CDO A;  1Z7R A;  4TVE A;  4MZW A;  3L9S A;  5B7C A;  3C1R A;  3PH9 A;  1OE8 A;  4ZL9 A;  4HUA A;  3S9F A;  2CVB A;  1QGV A;  2O8V B;  2H75 A;  2VM2 A;  4JU5 A;  2V2G A;  1YEP A;  1EEM A;  1AQX A;  1ZMA A;  5HFK A;  1PGT A;  3TDG A;  3TKS A;  3W8J A;  2E7P A;  1G7E A;  2LQO A;  1OC8 A;  2A2R A;  1I5G A;  10GS A;  3QFB C;  1FVK A;  1SKS B;  2LRN A;  1GUK A;  1O6J A;  4P3Y B;  4ILF A;  2B1L A;  3IK9 A;  1XFL A;  2IMF A;  4N0Z A;  4I97 A;  4LL4 B;  5IMZ A;  4BVY A;  3IAM 2;  4MF6 A;  1YDK A;  3CMI A;  2YOI A;  1XXU A;  1FOV A;  5G1L A;  6GST A;  1O7U A;  2HI7 A;  3HVX A;  2LNS A;  3O6T A;  3HVS A;  3E9J B;  5ECM B;  2L4Q A;  4J57 E;  3QAV A;  3GFK A;  3EMP A;  3A2W A;  1V40 A;  1M9A A;  4HJ2 A;  1XW6 A;  4HDE A;  3FR3 A;  1THO A;  1GSF A;  4XS4 B;  3EUR A;  5DCH A;  4ECJ A;  4QQ7 A;  3I9V 2;  5F05 A;  4EDY A;  4N0V A;  3FY7 A;  3GKN A;  4GWR A;  5F07 A;  4BVY B;  2FWF A;  2N5F A;  4K1F A;  1UN2 A;  4QL9 A;  3LG6 A;  3IE3 A;  2KLX A;  3FHK A;  1H75 A;  4TRX A;  1C72 A;  3IOS A;  2C3T A;  1ST9 A;  2H30 A;  2GZP A;  2H1A A;  2OAD A;  2OBK A;  4K8M A;  1M7T A;  2TIR A;  2H1D A;  5JCW A;  4K7I A;  5ELA A;  2GZY A;  4WF4 A;  1YY7 A;  2GVP A;  5B8A A;  3KXO A;  1VF1 A;  3ZMK A;  2C0F A;  3GUR A;  1ZGN A;  1YEX A;  4GSN A;  3UAP A;  1GSY A;  4IN0 A;  3EIN A;  3ZZX A;  4HS1 A;  2X8H A;  4MJC A;  1X5C A;  2YJ7 A;  2R4V A;  4L0W A;  4ZB9 A;  4G2E A;  1A2J A;  3WT2 A;  1K0C A;  1FO5 A;  1MTC A;  4PTS A;  1PMT A;  1J08 A;  3TJK A;  1MEK A;  2I81 A;  4MH2 A;  1Y25 A;  1MD3 A;  5ECK B;  2HQT A;  3DIE A;  4KE3 A;  4Q5N A;  1W89 A;  1OE7 A;  5CYY A;  5IMD A;  3FR6 A;  2HRN A;  3VI5 A;  5B6N A;  2VO4 A;  1THX A;  4LL1 B;  1SD8 A;  4OO4 A;  5GAP D;  3M8N A;  2OJL A;  5J4U A;  1GUH A;  4MA9 A;  2MMZ A;  4LA1 A;  2L5O A;  4X0X A;  3I69 A;  2IMI A;  3UBK A;  1UVZ A;  4HZ4 A;  3FW2 A;  2VCZ A;  2BTO T;  5DAL A;  2FGX A;  3LFL A;  3VWU A;  2FWG A;  3ZL5 A;  2FY6 A;  5ECS A;  4XS6 A;  4BPY A;  2YZU A;  3LGC A;  2R2J A;  4N10 A;  4GCI A;  4DSS B;  4MZB A;  2FWH A;  3EYT A;  3M3M A;  3FK8 A;  1V98 A;  5CRW A;  3UVT A;  4IP1 A;  3F8U A;  4ZBA A;  3VPT A;  2KHP A;  4TOP A;  1DE1 A;  2WUL A;  2WJU A;  4L0U A;  3ERF A;  4PGT A;  4HQS A;  1OC9 A;  3LEF A;  1T8E B;  3EU3 A;  4JE1 A;  4G0L A;  1UA5 A;  3VI7 A;  3TRQ A;  4POB A;  2BJX A;  1H4O A;  2DJ2 A;  5F06 A;  1EEJ A;  4XCS A;  1TK0 B;  1FVJ A;  4ISD A;  5FWG A;  5DAL B;  1HD2 A;  2GTU A;  3D4M A;  1XVW A;  4PQ1 A;  2CX3 A;  5J9C A;  4I6X A;  4L5O A;  4IHU A;  3W8S A;  1N8J A;  1TI1 A;  3FZ4 A;  2B3S A;  4FQU A;  3GH6 A;  2AUV A;  1QK8 A;  1PQN A;  2PPT A;  1HNA A;  1B4Q A;  2VCX A;  4GLT A;  2QC7 A;  3QCP A;  2LJK A;  1OC9 B;  2FUG 2;  4JZQ A;  3KGK A;  4KDY A;  4ZL8 A;  2YWO A;  1WE0 A;  1CQH A;  2B7J A;  3N9J A;  1FB6 A;  1U3A A;  5IO2 A;  3A3T A;  4BVX A;  4WKW A;  1YKA A;  2GDR A;  19GS A;  2I9H A;  5IMA A;  3QOU A;  2IL3 A;  2HSN B;  3TKQ A;  3QD9 A;  4EUY A;  3WGD A;  1K0B A;  2PWJ A;  1USB A;  2L4C A;  1EGO A;  3GL3 A;  5FT3 A;  3VWX A;  2CVD A;  1U3I A;  3V1W A;  5AIS A;  3ZFL A;  4I2U A;  4XIH A;  1JZO A;  4G9H A;  2VD1 A;  5H5Q A;  2E2G A;  3C8E A;  5A4V A;  1MDK A;  6GSU A;  5ECH B;  1HYU A;  5DJM A;  4BVX B;  5EL8 A;  3DVW A;  2K8V A;  1TK8 B;  1BG5 A;  4KH7 A;  1KTE A;  3ZML A;  4IW9 A;  2HYX A;  2C8U A;  3ZFB A;  2B5E A;  2CV4 A;  4F2I A;  2DJ3 A;  4EDZ A;  2WRT A;  1TRS A;  2AJQ B;  1QUW A;  3ZVJ D;  1R4W A;  3LOR A;  4F82 A;  4TXO B;  1IYH A;  20GS A;  3DRN A;  2NDO A;  1J9B A;  5ABR A;  1A23 A;  1FHE A;  1R5P A;  4RQX A;  3MDK A;  4KCE A;  2GQK A;  2E2M A;  1WIK A;  3LJR A;  4EE0 A;  4F9Z A;  2P0G A;  2P5Q A;  1V9W A;  3HJM A;  3VPQ A;  2NPB A;  3HY2 A;  3GYK A;  4F0B A;  3EMX A;  5J5N A;  2C3Q A;  4KCA A;  1SK2 A;  2DSA A;  5FHI A;  4FH8 A;  2HNL A;  18GS A;  4ZXG A;  5LNK e;  4TW5 A;  5GZZ B;  1VGL A;  4YH2 A;  1S3C A;  3CSJ A;  4TR1 B;  3WGE A;  1AW9 A;  2VIM A;  2PGT A;  5G31 A;  3ZYW A;  1XWB A;  5J9B A;  2VLV A;  5H5R A;  3UJ1 A;  2O87 A;  2Z9S A;  1TW9 A;  1VRS D;  4ACS A;  5JWO B;  4RI6 A;  4DSR A;  2JAC A;  3DVX A;  3PIN A;  1PX6 A;  2O85 A;  3VWV A;  3HXS A;  1A8L A;  1RK4 A;  3VFI A;  4ZIJ A;  3DXB A;  5KN1 A;  3GMF A;  5INY A;  1BAY A;  1M2B A;  2JSY A;  2L5L A;  3GKX A;  5DVB A;  1BX9 A;  1K3L A;  4FYU A;  4YQU A;  2RUE A;  2EC4 A;  3M1G A;  4V1A p;  1F6M C;  5JCG A;  3CXG A;  3UEM A;  5LD0 A;  1DUG A;  2VCQ A;  3GN3 A;  3GKK A;  4KA0 A;  2KUC A;  1T3B A;  1QMV A;  2PVO C;  3CRU A;  1XIY A;  3E0U A;  1O81 A;  3F4T A;  2IME A;  1K0M A;  4O32 A;  5A4U A;  3U5R E;  1F3B A;  4MZC A;  1GNW A;  1F2E A;  1GWC A;  2CX4 A;  2P5R A;  1B9X C;  2VLU A;  4NAX A;  1WOU A;  3GNJ A;  3KCM A;  4XRA A;  4GF0 A;  2YZH A;  2PMT A;  4LLR A;  3UMA A;  1KBN A;  2VL3 A;  2F8A A;  2OE1 A;  2HZF A;  2LRC A;  4N11 A;  1Y6E A;  2H76 A;  5IMC A;  4OCE A;  2HSH A;  1AIU A;  4I5Q A;  2HRK B;  1U88 A;  2YV9 A;  1F3A A;  1NW2 A;  1BYE A;  4F03 A;  1J0F A;  2WDU A;  3OR5 A;  2H01 A;  2NTO A;  1M0U A;  1OAZ A;  2C4J A;  3BCK A;  2R5G A;  3QR6 A;  2VCW A;  4IQA A;  1DSB A;  3TRP A;  1GUL A;  4KF9 A;  5KN3 A;  1A2L A;  1ON4 A;  3RPP A;  4RI7 A;  3HD5 A;  3VUR A;  4ZIL A;  4MDC A;  2GLR A;  2JZS A;  2LJA A;  6GSS A;  5KN0 A;  5G5F A;  5DAK A;  4K9Z A;  2VD0 A;  3R2Q A;  5AGY A;  4IGJ A;  2HRF A;  2YNX A;  3APO A;  2X99 A;  2V32 A;  2L6C A;  2F3M A;  1XW5 A;  5D8I A;  2DIZ A;  1E2Y A;  2GGT A;  1AAZ A;  3DYR A;  5H5S A;  3L4N A;  4KSM A;  3F63 A;  2VL9 A;  2REM A;  3KP8 A;  1O8X A;  3GSS A;  4NPB A;  2M46 A;  2DLX A;  2XPD A;  2GST A;  1OYJ A;  3Q74 A;  4KUN A;  4BL7 A;  4OD7 A;  3DWV A;  5ECI B;  2FA8 A;  3KZQ A;  4PNF A;  5D9X A;  1EWX A;  2MBS A;  1O73 A;  3G7J A;  3IK7 A;  2JL4 A;  3HDC A;  2LRT A;  2XBI A;  3TJG A;  2KP1 A;  4NV2 A;  2L6D A;  1GNE A;  2B7K A;  4EXJ A;  2RM6 A;  2K8S A;  2VL2 C;  2LEG A;  1SK0 A;  1GUM A;  1OC3 A;  2WGR A;  14GS A;  3GKM A;  1LBK A;  5G2Z A;  2H6Y A;  1ERW A;  2OA7 A;  2OE0 A;  3KP9 A;  3ZIT A;  3BCI A;  2D2Z A;  1X5D A;  4BL7 B;  4QL7 A;  2YWN A;  1EV4 A;  1PN9 A;  4XS1 A;  2AAW A;  4KX4 A;  1TOF A;  2IN3 A;  2WB9 A;  2FD3 A;  2RM5 A;  3KD0 A;  3F4S A;  4FYB A;  2H1B A;  5IMF A;  3WYW A;  2NBS A;  4GQF A;  4EC0 A;  4MAB A;  4ZBB A;  2EIR A;  5CO3 A;  3TJJ A;  3DML A;  3DGQ A;  4X43 A;  5ID2 A;  2VLT A;  2HFD A;  4MPF A;  5D9T A;  1TRW A;  2XHF A;  4HQZ A;  2PBJ A;  3TJF A;  1SEN A;  4AJ8 A;  2GSR A;  2JSZ A;  1Z5Y E;  5HFG A;  5DBQ A;  4HJM A;  1AUC A;  2GS3 A;  4WF5 A;  1B4P A;  1ABA A;  4ZB6 A;  5KN2 A;  2R3X A;  2PU9 C;  2PVQ A;  4USS A;  3CSI A;  1GP1 A;  1X0R A;  1AXD A;  4DVC A;  2HRA A;  1SL2 B;  3CBU A;  1TK5 B;  3EVI A;  2H0I A;  2OAC A;  5DJL A;  5JWQ B;  5ID2 B;  2CVK A;  3RHB A;  1EP7 A;  3US3 A;  4HOJ A;  3FRC A;  2GQM A;  1X9S B;  4I2T A;  1K0O A;  4AJ6 A;  2YCD A;  3SWL A;  3BJ5 A;  1GL8 A;  2H8L A;  2L57 A;  5C00 A;  3FZ5 A;  5ECL B;  4KSO A;  2H70 A;  4EL1 A;  1LU4 A;  3IDV A;  3KTB A;  3C7M A;  4IJI A;  2IIY A;  1G6W A;  2LST A;  1A8Y A;  4YQV A;  3P8W A;  2MBT A;  5D9W A;  3L9V A;  3TGZ A;  4G0I A;  1O85 A;  1EOG A;  3HYP A;  1AQW A;  2LJR A;  1WPI A;  3APQ A;  7GSS A;  1XOA A;  5HR1 A;  2IPA A;  1M9B A;  2AHE A;  4LMW A;  2LNT A;  3L9U A;  4J56 E;  3IC4 A;  3FR9 A;  2A2S A;  2GZZ A;  4Q5R A;  1SJ6 A;  1F37 A;  3DKS A;  3O3T A;  1AQV A;  3QFA C;  2K6V A;  1PRX A;  4KDX A;  9GSS A;  3H79 A;  3GUS A;  2LV3 A;  5IOW A;  1SL1 B;  3MWH A;  4G19 A;  1MDJ A;  4NHZ A;  1TXX A;  4OFN A;  2H0G A;  3R3E A;  3TJB A;  2DJ1 A;  4NWY A;  1TRV A;  2DJK A;  1JHB A;  1SJI A;  2MMA A;  3GA4 A;  1FW1 A;  2PUK C;  1VF2 A;  2FA4 A;  1ERT A;  3FEU A;  4JBB A;  5D73 A;  4RUV A;  2YV7 A;  3CTF A;  1XPV A;  4IBP A;  12GS A;  1XCC A;  3I43 A;  2DJ0 A;  5HR0 A;  3HKR A;  2F9S A;  5BMU A;  2VL2 A;  4O7H A;  1M99 A;  1X9W B;  1ERV A;  4ECI A;  4D73 A;  3HHV A;  4ML1 A;  2EIO A;  5G5E A;  5AIV A;  2GSS A;  3PR8 A;  1T7P B;  4MPG A;  3QMX A;  3MSZ A;  2N5A A;  3NIV A;  2AB6 A;  3QDN A;  4MMM A;  4HZ2 A;  3ED3 A;  1HNB A;  4GTU A;  1XOB A;  4BA7 A;  1EP8 A;  22GS A;  4GXZ A;  4X1U A;  1Q4J A;  3EWL A;  2CZ3 A;  4IQ1 A;  3EC3 A;  1ZOF A;  4POL A;  2YWM A;  2BMX A;  3HJP A;  2AV4 A;  5IM9 A;  5IIZ A;  4D73 B;  4JR6 A;  2HLS A;  4AJ7 A;  2FHE A;  3A2V A;  3KIJ A;  2ES7 A;  4BWQ A;  1U6T A;  5LCZ A;  3ZIV A;  4KAE A;  4G0K A;  1Z6N A;  4MP4 A;  3KMN A;  4RQR A;  2IFQ A;  4J2F A;  3H93 A;  3TCO A;  1FAA A;  3F3Q A;  4AF2 A;  5CP1 A;  2HSM A;  1I9D A;  3M9J A;  4EVM A;  3GL5 A;  2WCI A;  2B5Y A;  4DSQ A;  1EV9 A;  5J41 A;  3TKS E;  4K6X A;  4L5L A;  4ULX A;  3CRT A;  3SBC A;  1GTB A;  2JZR A;  2FWE A;  5IPG A;  1GRX A;  3UIW A;  4ML6 A;  1JLV A;  3G7Y A;  3P90 A;  2IFQ B;  2VCT A;  2V1M A;  3GTU A;  1A0R P;  3HJO A;  4EF0 A;  3CTG A;  2DC5 A;  3Q18 A;  4E8E A;  5IPH A;  1XWG A;  3L0H A;  2ZUP A;  4KND A;  1LJR A;  3LSZ A;  1EZK A;  4WET A;  3D21 A;  1XBS A;  2HSM B;  3F4R A;  4IEL A;  5J3R A;  3C73 A;  5EVO A;  1R26 A;  3IAS 2;  4XRD A;  1XVQ A;  5AIX A;  3ZVJ A;  6GSV A;  1GH2 A;  2YWI A;  2OE3 A;  2H19 A;  3LWA A;  5ENU A;  2MYG A;  2ZNM A;  3K8N A;  1SJZ A;  1S3D A;  3E3E A;  2DIY A;  5DQS A;  13GS A;  1YJ6 A;  4TKY A;  2I3Y A;  2XBQ A;  5CRD A;  3BBY A;  3GTU B;  1SD9 A;  1GSQ A;  5CRE A;  5A4W A;  4MF7 A;  3I6A A;  3M9K A;  3TRX A;  1MDI A;  3UL3 A;  5CNW A;  4V2M A;  3GX0 A;  3M0F A;  3LXZ A;  3DD3 A;  1PX7 A;  1AC1 A;  2E0Q A;  3VLN A;  2VUP A;  4FO5 A;  1XZO A;  5GAN D;  2C0G A;  4OCF A;  2JAD A;  2TRC P;  4NXI A;  4POK A;  1IYI A;  4OFM A;  1ILO A;  3FKF A;  2GQL A;  3IV4 A;  2DJJ A;  2F8F A;  1HNC A;  1JFU A;  5CAX A;  4IVF A;  2C3N A;  3Q19 A;  2H74 A;  4HU9 A;  5D93 A;  2G0F A;  2F51 A;  4XS4 A;  4DEJ A;  3BD2 A;  4I8B A;  1XWK A;  2ON5 A;  4LMV A;  2V6K A;  4KDU A;  2CQ9 A;  1GTA A;  5HR3 A;  2FLS A;  1JLW A;  3APS A;  3DEX A;  2H1G A;  1NM3 A;  2WZ9 A;  5ECO B;  4HEA 2;  1GSU A;  1QFN A;  3GIX A;  3J7Y k;  2NVL A;  3RHC A;  3IXR A;  2IWT A;  3D6I A;  3MNG A;  3KJY A;  3D4T A;  1XWA A;  2QKE A;  2X64 A;  5IMV A;  1GTI A;  2CAQ A;  4PXO A;  3H4K A;  5F0G A;  3D5J A;  4N30 A;  3C71 A;  1ZL9 A;  3D0Z A;  2C0E A;  4H86 A;  6GSY A;  3GX8 A;  3ME8 A;  3ZIJ A;  1T00 A;  2IMK A;  5HR2 A;  3GV1 A;  1JZD A;  4MLY A;  1WP0 A;  3MAK A;  4ECC A;  5IQY A;  3IBH A;  1Q98 A;  1SYR A;  3LYK A;  2CZ2 A;  1BED A;  3NZN A;  4WXT A;  5IOX A;  1U87 A;  5E4W A;  4V2N A;  2GSQ A;  4MJE A;  2VCV A;  2H71 A;  1RQM A;  1PD2 1;  5DAK B;  1GSE A;  3TOT A;  3F0I A;  5A5K A;  3WT1 A;  3F6D A;  4PX1 A;  4MH3 A;  3P2A A;  4WBJ A;  4OWY A;  1WMJ A;  5B8B A;  4HI7 A;  1OVN A;  3ERG A;  3LYP A;  3QAW A;  1E6B A;  3F6F A;  1G0T A;  3QPM A;  2V6O A;  3VWW A;  1K0D A;  1YZX A;  1A0F A;  1G6Y A;  5KEJ A;  1B9Y C;  3H1N A;  1KEB A;  2GT6 A;  1A24 A;  3IRA A;  1PL2 A;  1FG4 A;  1SKR B;  2J23 A;  1TU7 A;  5DCG A;  4BWS A;  1WRY A;  3KH9 A;  1F9M A;  3PPU A;  3KM6 A;  2LUS A;  1Z3E A;  2C0D A;  1SYX A;  6GSX A;  2TRX A;  1B8X A;  3QAG A;  3TKR A;  5L71 A;  3UBL A;  1ZYE A;  3PGT A;  3HCZ A;  2H66 A;  1SK1 A;  1K3Y A;  1GLP A;  4GSS A;  1ZZY A;  2EIQ A;  1W4V A;  1V58 A;  2DML A;  2UZ8 A;  2K18 A;  2IJY A;  2LTK A;  2M80 A;  5DQY A;  2WS2 A;  3HZ4 A;  2CA8 A;  1NHO A;  2ALB A;  4KW6 A;  3CYN A;  2PER A;  1RW1 A;  1WJK A;  4DSS A;  4G10 A;  2CT6 A;  2DMM A;  3FZA A;  2CAI A;  5ECQ B;  3CSH A;  4MJB A;  3WD6 A;  2H6Z A;  5JCU A;  1M2D A;  4K2D A;  1YF0 A;  3H8Q A;  5EY6 A;  3FYG A;  2RLI A;  2C1Y A;  2HXK A;  4ZB8 A;  2B1K A;  16GS A;  2K9F A;  1GTU A;  3BOA A;  1CQG A;  2LS5 A;  3L78 A;  4Z7X A;  1SU9 A;  2O7K A;  1TTZ A;  3Q6O A;  4WBR D;  3TOU A;  1YQ1 A;  1QQ2 A;  3HA9 A;  3GRX A;  5JWR B;  4CHS A;  4FIW A;  1FB0 A;  1X5E A;  2A4V A;  4IJ3 A;  2ON7 A;  2MMO A;  2GT5 A;  4GQC A;  3TB2 A;  4YQM A;  1GSD A;  2DBC A;  2R37 A;  4Q5Q A;  3KEB A;  3ME7 A;  3ISO A;  2HT9 A;  5G30 A;  4OFT A;  5CRH A;  3ZRD A;  2B5X A;  2HSY A;  3EE2 A;  4K7N A;  2X8G A;  3LQ7 A;  3W6G A;  4E8H A;  4AGS A;  5C04 A;  2N5B A;  1URM A;  1TP9 A;  3J7Y b;  1BQ7 A;  3AY8 A;  1OKT A;  1ERU A;  1TU8 A;  1Z7P A;  1N2A A;  17GS A;  4MJA A;  2JZT A;  3UVH A;  1TRU A;  1TI3 A;  4JRR A;  1BJX A;  2JU5 A;  8GSS A;  2VOC A;  5CRG A;  2YPM A;  5D9V A;  3TKP A;  4GST A;  2YN1 A;  1NSW A;  2OBI A;  1ZYQ B;  5AN1 A;  3P7X A;  3ZTL A;  1X9M B;  3RAZ A;  4YAP A;  4K7O A;  2IMD A;  4POM A;  5E59 A;  1MD4 A;  3O76 A;  1PKW A;  4V2L A;  3TUE A;  1SKW B;  1TJD A;  3LXT A;  2H0H A;  2M72 A;  2LQQ A;  5COH A;  1T4Y A;  2I4A A;  4ZL7 A;  1VF3 A;  4MCU A;  1YKC A;  2J9H A;  4K0G A;  4KB3 A;  4EO3 A;  3KMO A;  1PKZ A;  2H6X A;  5ECN B;  1TDI A;  4OO5 A;  4IP6 A;  2H72 A;  1SL0 B;  2QSI A;  4TXO A;  3TKS C;  3NOF A;  2HZE A;  2FCH A;  2LKU A;  2YAN A;  1JZW A;  2P31 A;  3F3R A;  3RBT A;  2ZCT A;  5ECP B;  1K0N A;  4Q5F A;  3KH7 A;  3GH9 A;  1NHY A;  4PQI A;  3D22 A;  1DBY A;  3UAR A;  2FNO A;  4L8E A;  1UC7 A;  3F9U A;  2H73 A;  4PQH A;  2MMN A;  3ZRE A;  5B6M A;  3HVV A;  3EU4 A;  4TN8 A;  1JZR A;  2VM1 A;  3KTL A;  2HE3 A;  5G1K A;  1VF4 A;  4YAV A;  4WR4 A;  2WFC A;  5GST A;  2HZE B;  4PNG A;  4K0N A;  1WWJ A;  1R7H A;  3N5O A;  1ACV A;  5ECR B;  4TR1 A;  3G9B A;  4O92 A;  11GS A;  3UOM A;  3HZ8 A;  2QGV A;  3IC8 A;  4WEY A;  2C80 A;  2V41 A;  2B6M A;  1PL1 A;  4TR0 A;  2RUF A;  4F0C A;  4IS0 A;  5F8B A;  2MZC A;  1EOH A;  4PUF C;  4EKZ A;  4KGI A;  4PUA A;  4PUR A;  2VAF A;  2I1U A;  2RII A;  1YF1 A;  1PSQ A;  2KOK A;  1Z6M A;  1O8W A;  1M2A A;  2OKA A;  1TKD B;  5IO0 A;  4OMV A;  5EPF A;  2G2Q A;  1Z9H A;  1T4Z A;  3GHA A;  3IPZ A;  4V1A g;  4XHM A;  4IKH A;  1B48 A;  1R5A A;  4FYC A;  5D96 A;  1EGR A;  4WR5 A;  3RPN A;  1QXH A;  3GST A;  4JED A;  3IR4 A;  2XC2 A;  4TXV A;  3C1S A;  1XWC A;  3A5W A;  4O5R A;  3G7I A;  3A2X A;  1T1V A;  1KNG A;  1ML6 A;  4NMU A;  2YJH A;  3VK9 A;  6GSW A;  4TR3 A;  3IHQ A;  4JR4 A;  4NV5 A;  2KP2 A;  4TR4 A;  4MK3 A;  5ELG A;  4GRF A;  1GSS A;  1V57 A;  5GSS A;  3ERW A;  1PA3 A;  2O89 A;  3WGX A;  1A2M A;  4MF5 A;  1S3A A;  1G7O A;  1DE2 A;  5HFI A;  1XW9 A;  5HQP A;  3JCM L; 
#chains in the Genus database with same CATH topology
 1HQO A;  1V2A A;  3U6V A;  4ID0 A;  3RDW A;  4HU7 A;  2DKI A;  2HRK A;  3IA1 A;  3FZ9 A;  4CW9 A;  2AYT A;  4ECB A;  2R6K A;  1GLQ A;  2YP6 A;  4XTS A;  1OKD A;  4ZBD A;  1ZCP A;  2L59 A;  2X8C A;  1K3O A;  4NHW A;  1K0A A;  2PN8 A;  3ZLP A;  5DDL A;  2XPE A;  4CDO A;  1Z7R A;  4TVE A;  4MZW A;  3L9S A;  5B7C A;  3C1R A;  3PH9 A;  1OE8 A;  4ZL9 A;  4HUA A;  3S9F A;  2CVB A;  1QGV A;  4EIQ A;  2O8V B;  2H75 A;  2VM2 A;  4JU5 A;  2V2G A;  1YEP A;  1EEM A;  1AQX A;  1ZMA A;  5HFK A;  1PGT A;  2WVX B;  3TDG A;  3TKS A;  3W8J A;  2E7P A;  1M3I A;  1G7E A;  2LQO A;  1OC8 A;  2A2R A;  1I5G A;  10GS A;  3QFB C;  1FVK A;  1SKS B;  2LRN A;  1GUK A;  1O6J A;  4P3Y B;  5J4V A;  4ILF A;  2B1L A;  3IK9 A;  1XFL A;  2IMF A;  4N0Z A;  4I97 A;  4LL4 B;  5IMZ A;  4BVY A;  3IAM 2;  4MF6 A;  1Y1U A;  1YDK A;  3CMI A;  1ZYN A;  3IHG A;  2YOI A;  1XXU A;  1FOV A;  5G1L A;  6GST A;  1M3J A;  1O7U A;  2HI7 A;  3HVX A;  4CY6 A;  2VKZ G;  2LNS A;  3O6T A;  3HVS A;  3E9J B;  5ECM B;  2L4Q A;  4J57 E;  3QAV A;  3GFK A;  3EMP A;  3A2W A;  1V40 A;  1M9A A;  4HJ2 A;  1XW6 A;  1PFO A;  4HDE A;  3FR3 A;  1THO A;  1GSF A;  4XS4 B;  3EUR A;  5DCH A;  4ECJ A;  4QQ7 A;  3I9V 2;  5F05 A;  4EDY A;  4N0V A;  3FY7 A;  3GKN A;  4GWR A;  5F07 A;  4BVY B;  2FWF A;  2N5F A;  4K1F A;  1UN2 A;  4QL9 A;  3LG6 A;  3IE3 A;  2KLX A;  3FHK A;  1H75 A;  4TRX A;  1C72 A;  3IOS A;  2C3T A;  1ST9 A;  2EFD A;  2H30 A;  2GZP A;  2H1A A;  2OAD A;  4K5S A;  1PN0 A;  2OBK A;  4K8M A;  1M7T A;  2TIR A;  2H1D A;  5JCW A;  4K7I A;  5ELA A;  2GZY A;  4WF4 A;  1YY7 A;  2GVP A;  5B8A A;  3KXO A;  1VF1 A;  3ZMK A;  2C0F A;  3GUR A;  1ZGN A;  1YEX A;  4GSN A;  3UAP A;  1GSY A;  4O5Q A;  4IN0 A;  3EIN A;  3ZZX A;  4HS1 A;  2X8H A;  4MJC A;  1X5C A;  2YJ7 A;  2R4V A;  4L0W A;  4ZB9 A;  4G2E A;  4AKG A;  1A2J A;  3WT2 A;  1K0C A;  1FO5 A;  1MTC A;  4PTS A;  1PMT A;  1J08 A;  3TJK A;  1MEK A;  2I81 A;  4MH2 A;  1Y25 A;  4O5U A;  1MD3 A;  5ECK B;  2HQT A;  3DIE A;  4KE3 A;  4Q5N A;  1W89 A;  1OE7 A;  5CYY A;  5IMD A;  3FR6 A;  2HRN A;  3VI5 A;  5B6N A;  2VO4 A;  1THX A;  4LL1 B;  1SD8 A;  4OO4 A;  5GAP D;  3M8N A;  2OJL A;  5J4U A;  1GUH A;  4MA9 A;  2MMZ A;  4LA1 A;  2L5O A;  4X0X A;  3I69 A;  2IMI A;  3UBK A;  1UVZ A;  4HZ4 A;  2WVY A;  3FW2 A;  2VCZ A;  2BTO T;  5DAL A;  3FMW A;  2FGX A;  3LFL A;  3VWU A;  5KOW A;  2FWG A;  3ZL5 A;  2FY6 A;  5ECS A;  4XS6 A;  4BPY A;  2YZU A;  3LGC A;  2R2J A;  4N10 A;  4GCI A;  4DSS B;  4MZB A;  2FWH A;  3EYT A;  3M3M A;  3FK8 A;  1V98 A;  5CRW A;  3UVT A;  4IP1 A;  4PHZ C;  3F8U A;  4ZBA A;  3VPT A;  2KHP A;  4TOP A;  1DE1 A;  2WUL A;  2WJU A;  4L0U A;  3ERF A;  4PGT A;  4HQS A;  1OC9 A;  3LEF A;  1T8E B;  3EU3 A;  4JE1 A;  4G0L A;  1UA5 A;  3VI7 A;  3TRQ A;  4POB A;  2BJX A;  1H4O A;  2DJ2 A;  5F06 A;  1EEJ A;  4XCS A;  1TK0 B;  1FVJ A;  4ISD A;  5FWG A;  5DAL B;  1HD2 A;  2GTU A;  3D4M A;  1XVW A;  4PQ1 A;  2CX3 A;  5J9C A;  2WW1 A;  4I6X A;  4L5O A;  3W8S A;  1N8J A;  4IHU A;  1TI1 A;  3FZ4 A;  2B3S A;  4FQU A;  3GH6 A;  1ZYP A;  2AUV A;  1QK8 A;  1PQN A;  2PPT A;  1HNA A;  1B4Q A;  2VCX A;  4GLT A;  2QC7 A;  3QCP A;  2LJK A;  1OC9 B;  2FUG 2;  4JZQ A;  3KGK A;  4KDY A;  4ZL8 A;  2YWO A;  1WE0 A;  1CQH A;  2B7J A;  3N9J A;  1FB6 A;  1U3A A;  5IO2 A;  3A3T A;  4BVX A;  4WKW A;  1YKA A;  2GDR A;  19GS A;  2I9H A;  5IMA A;  3QOU A;  2IL3 A;  2HSN B;  3TKQ A;  3QD9 A;  4EUY A;  3WGD A;  1K0B A;  2PWJ A;  1USB A;  2A4H A;  2L4C A;  1EGO A;  3GL3 A;  5FT3 A;  3VWX A;  2CVD A;  1U3I A;  3V1W A;  5AIS A;  3ZFL A;  4I2U A;  4XIH A;  1JZO A;  4G9H A;  2VD1 A;  5H5Q A;  3CQF A;  2E2G A;  3C8E A;  5A4V A;  1MDK A;  6GSU A;  5ECH B;  1HYU A;  5DJM A;  4BVX B;  5EL8 A;  3DVW A;  2K8V A;  1TK8 B;  1BG5 A;  4KH7 A;  1KTE A;  3ZML A;  1XG8 A;  4IW9 A;  2HYX A;  2C8U A;  3ZFB A;  2B5E A;  2CV4 A;  4F2I A;  3TU3 B;  2DJ3 A;  4EDZ A;  2WRT A;  1TRS A;  5BRT A;  2AJQ B;  1QUW A;  3ZVJ D;  1R4W A;  3LOR A;  4F82 A;  4TXO B;  1IYH A;  20GS A;  3DRN A;  2NDO A;  1I1I P;  1J9B A;  5ABR A;  1A23 A;  1FHE A;  1R5P A;  4RQX A;  3MDK A;  4KCE A;  2GQK A;  2E2M A;  1WIK A;  4EIP A;  3LJR A;  5A1N B;  4EE0 A;  4F9Z A;  2P0G A;  4Z2R A;  2P5Q A;  1V9W A;  3HJM A;  3VPQ A;  2NPB A;  3HY2 A;  3GYK A;  4F0B A;  3EMX A;  5J5N A;  2C3Q A;  4KCA A;  1SK2 A;  2DSA A;  5FHI A;  4FH8 A;  2HNL A;  18GS A;  4ZXG A;  5LNK e;  4TW5 A;  5GZZ B;  1VGL A;  4YH2 A;  1S3C A;  3CSJ A;  4TR1 B;  3WGE A;  1AW9 A;  2VIM A;  2PGT A;  5G31 A;  3ZYW A;  1XWB A;  5J9B A;  2VLV A;  5H5R A;  3UJ1 A;  2O87 A;  2Z9S A;  1TW9 A;  1VRS D;  4ACS A;  5JWO B;  4RI6 A;  4DSR A;  2JAC A;  3DVX A;  4AKH A;  5J47 A;  3PIN A;  1PX6 A;  2O85 A;  3VWV A;  3HXS A;  1A8L A;  1RK4 A;  3VFI A;  4ZIJ A;  3DXB A;  5KN1 A;  4N3Z A;  3GMF A;  5INY A;  1BG1 A;  1BAY A;  1M2B A;  2JSY A;  2L5L A;  3GKX A;  5DVB A;  1BX9 A;  1K3L A;  4FYU A;  4YQU A;  2RUE A;  2EC4 A;  3M1G A;  4V1A p;  1F6M C;  5JCG A;  3CXG A;  3UEM A;  5LD0 A;  1DUG A;  2VCQ A;  3GN3 A;  3GKK A;  4KA0 A;  2KUC A;  2O3E A;  1T3B A;  1QMV A;  2PVO C;  3CRU A;  1XIY A;  3E0U A;  1O81 A;  3F4T A;  2IME A;  1K0M A;  3MYD A;  3MIX A;  4O32 A;  5A4U A;  3U5R E;  1F3B A;  4MZC A;  1GNW A;  1F2E A;  1GWC A;  2CX4 A;  2P5R A;  1B9X C;  2VLU A;  4NAX A;  1WOU A;  3GNJ A;  3KCM A;  4XRA A;  4GF0 A;  2YZH A;  2PMT A;  4LLR A;  4A5P A;  3UMA A;  1KBN A;  2VL3 A;  2F8A A;  2OE1 A;  2HZF A;  2LRC A;  4N11 A;  1Y6E A;  2H76 A;  5IMC A;  4OCE A;  2O36 A;  2HSH A;  1AIU A;  4I5Q A;  2HRK B;  1U88 A;  2YV9 A;  1F3A A;  1NW2 A;  1BYE A;  4F03 A;  1J0F A;  2WDU A;  3OR5 A;  2H01 A;  2NTO A;  1M0U A;  1OAZ A;  2C4J A;  2EFH A;  3BCK A;  2R5G A;  3QR6 A;  2VCW A;  4IQA A;  1DSB A;  3TRP A;  1GUL A;  4KF9 A;  5KN3 A;  1A2L A;  1ON4 A;  3RPP A;  4RI7 A;  3HD5 A;  3VUR A;  4ZIL A;  2R0G A;  4MDC A;  2GLR A;  2JZS A;  2LJA A;  2QA2 A;  6GSS A;  5KN0 A;  5G5F A;  5DAK A;  4K9Z A;  2VD0 A;  3R2Q A;  5AGY A;  4IGJ A;  2HRF A;  2YNX A;  3APO A;  2X99 A;  2V32 A;  2L6C A;  2F3M A;  2WZS A;  1XW5 A;  5D8I A;  1S4B P;  2DIZ A;  1E2Y A;  2GGT A;  1AAZ A;  3DYR A;  5H5S A;  3L4N A;  4KSM A;  3F63 A;  2VL9 A;  2REM A;  3KP8 A;  1O8X A;  3GSS A;  4NPB A;  2M46 A;  2DLX A;  2XPD A;  2GST A;  1OYJ A;  3Q74 A;  4KUN A;  4BL7 A;  4OD7 A;  4ICY A;  3DWV A;  5ECI B;  2FA8 A;  3KZQ A;  4PNF A;  5D9X A;  1EWX A;  2MBS A;  1O73 A;  3G7J A;  3IK7 A;  4Z2U A;  2JL4 A;  3HDC A;  2LRT A;  2XBI A;  3TJG A;  2KP1 A;  4NV2 A;  2L6D A;  1GNE A;  2B7K A;  4EXJ A;  2RM6 A;  2K8S A;  2VL2 C;  2LEG A;  1SK0 A;  1GUM A;  1OC3 A;  2WGR A;  14GS A;  3GKM A;  1LBK A;  5G2Z A;  2H6Y A;  1ERW A;  2OA7 A;  2OE0 A;  2R0P A;  3KP9 A;  3ZIT A;  3BCI A;  2D2Z A;  1X5D A;  4BL7 B;  4QL7 A;  2YWN A;  1EV4 A;  1PN9 A;  4XS1 A;  2AAW A;  4KX4 A;  1TOF A;  1SVL A;  2IN3 A;  2WB9 A;  3LW9 A;  2FD3 A;  2RM5 A;  3KD0 A;  3F4S A;  4FYB A;  2H1B A;  5IMF A;  3WYW A;  2NBS A;  4GQF A;  4EC0 A;  4MAB A;  4ZBB A;  2EIR A;  5CO3 A;  3TJJ A;  3DML A;  3DGQ A;  4X43 A;  5ID2 A;  2VLT A;  2HFD A;  4MPF A;  5D9T A;  1TRW A;  2XHF A;  4HQZ A;  4AKI A;  2PBJ A;  3TJF A;  1SEN A;  4AJ8 A;  2GSR A;  2JSZ A;  1Z5Y E;  5HFG A;  5DBQ A;  4HJM A;  1AUC A;  2GS3 A;  4WF5 A;  1B4P A;  1ABA A;  4ZB6 A;  5KN2 A;  2R3X A;  2PU9 C;  2PVQ A;  4USS A;  3CSI A;  4ZB7 A;  1GP1 A;  1X0R A;  4HSC X;  1AXD A;  4DVC A;  2HRA A;  1SL2 B;  3CBU A;  1TK5 B;  3EVI A;  2H0I A;  2OAC A;  5DJL A;  5JWQ B;  5ID2 B;  2CVK A;  3RHB A;  1EP7 A;  3US3 A;  4HOJ A;  3FRC A;  2A2P A;  2GQM A;  1X9S B;  4I2T A;  1K0O A;  4AJ6 A;  2YCD A;  2O5V A;  3SWL A;  3BJ5 A;  1GL8 A;  2H8L A;  2L57 A;  5C00 A;  3FZ5 A;  5ECL B;  4KSO A;  2H70 A;  4EL1 A;  1LU4 A;  3IDV A;  3KTB A;  3C7M A;  4IJI A;  2IIY A;  1G6W A;  2LST A;  1A8Y A;  4YQV A;  3P8W A;  3CWG A;  2MBT A;  5D9W A;  3L9V A;  3TGZ A;  4G0I A;  1O85 A;  1EOG A;  3HYP A;  1AQW A;  2LJR A;  1WPI A;  3APQ A;  7GSS A;  1XOA A;  5HR1 A;  2IPA A;  1M9B A;  2AHE A;  4LMW A;  2LNT A;  3L9U A;  4J56 E;  3IC4 A;  2WW2 A;  3FR9 A;  2A2S A;  3A5I A;  2GZZ A;  4Q5R A;  1SJ6 A;  1F37 A;  5A34 A;  3DKS A;  3O3T A;  2X4A A;  4Z2T A;  1AQV A;  3QFA C;  2K6V A;  2EFE A;  1PRX A;  4KDX A;  9GSS A;  3H79 A;  3GUS A;  2LV3 A;  5IOW A;  1SL1 B;  3MWH A;  2R0C A;  4G19 A;  1MDJ A;  4NHZ A;  1TXX A;  4OFN A;  2H0G A;  3R3E A;  3TJB A;  2DJ1 A;  4NWY A;  1TRV A;  2DJK A;  1JHB A;  1SJI A;  2MMA A;  3GA4 A;  4MNN A;  1FW1 A;  2PUK C;  1VF2 A;  2FA4 A;  5A34 B;  1ERT A;  3FEU A;  4JBB A;  5D73 A;  4RUV A;  2YV7 A;  3CTF A;  2EFC A;  1XPV A;  4IBP A;  12GS A;  1SVO A;  1XCC A;  3I43 A;  2DJ0 A;  4BIK A;  5HR0 A;  3HKR A;  2F9S A;  5KOX A;  5BMU A;  2VL2 A;  4O7H A;  1M99 A;  1X9W B;  1ERV A;  4ECI A;  4D73 A;  3HHV A;  4ML1 A;  2EIO A;  5G5E A;  5AIV A;  2GSS A;  3PR8 A;  1T7P B;  4MPG A;  3QMX A;  3MSZ A;  2N5A A;  3NIV A;  2AB6 A;  3QDN A;  4MMM A;  4QMK A;  4HZ2 A;  3ED3 A;  1HNB A;  4GTU A;  1XOB A;  4BA7 A;  1EP8 A;  22GS A;  4GXZ A;  4X1U A;  1Q4J A;  3EWL A;  2CZ3 A;  4IQ1 A;  3EC3 A;  1ZOF A;  4POL A;  2YWM A;  2BMX A;  3HJP A;  2AV4 A;  5IM9 A;  5IIZ A;  4D73 B;  4JR6 A;  2HLS A;  4AJ7 A;  2FHE A;  3A2V A;  3KIJ A;  2ES7 A;  4BWQ A;  4W66 A;  1U6T A;  4E68 A;  5LCZ A;  3ZIV A;  4KAE A;  4G0K A;  1Z6N A;  4MP4 A;  3KMN A;  4RQR A;  2IFQ A;  4J2F A;  3H93 A;  3TCO A;  1FAA A;  3F3Q A;  4AF2 A;  5CP1 A;  2HSM A;  1I9D A;  3M9J A;  4EVM A;  3GL5 A;  2WCI A;  2B5Y A;  4DSQ A;  1EV9 A;  5J41 A;  3TKS E;  1YEW C;  4K6X A;  4L5L A;  4ULX A;  3CRT A;  4YKF A;  3SBC A;  1GTB A;  3EPT A;  2JZR A;  2FWE A;  5IPG A;  1GRX A;  4AI6 A;  3UIW A;  4ML6 A;  1JLV A;  3G7Y A;  3P90 A;  2IFQ B;  2VCT A;  2V1M A;  3GTU A;  1A0R P;  3HJO A;  4EF0 A;  3CTG A;  2DC5 A;  3Q18 A;  4E8E A;  5IPH A;  1XWG A;  3L0H A;  2ZUP A;  4KND A;  1LJR A;  3LSZ A;  1EZK A;  4WET A;  3D21 A;  1XBS A;  2HSM B;  3F4R A;  4IEL A;  5J3R A;  3C73 A;  1S3R A;  5EVO A;  1R26 A;  3IAS 2;  4XRD A;  1XVQ A;  5AIX A;  3ZVJ A;  6GSV A;  1GH2 A;  2YWI A;  2OE3 A;  2H19 A;  3LWA A;  5ENU A;  2MYG A;  2ZNM A;  3K8N A;  1SJZ A;  1S3D A;  2WVX A;  3E3E A;  2DIY A;  5DQS A;  13GS A;  1YJ6 A;  4TKY A;  2I3Y A;  2XBQ A;  5CRD A;  3BBY A;  3GTU B;  1TXU A;  1SD9 A;  1GSQ A;  5CRE A;  5A4W A;  4MF7 A;  3I6A A;  3M9K A;  3TRX A;  1MDI A;  3UL3 A;  5CNW A;  4V2M A;  3GX0 A;  3M0F A;  3LXZ A;  3DD3 A;  1PX7 A;  1AC1 A;  2E0Q A;  3VLN A;  2VUP A;  4FO5 A;  1XZO A;  5GAN D;  2C0G A;  4OCF A;  2JAD A;  2TRC P;  3CHX C;  4NXI A;  4POK A;  1IYI A;  4OFM A;  1ILO A;  3FKF A;  2GQL A;  3IV4 A;  2DJJ A;  2F8F A;  1HNC A;  1JFU A;  5CAX A;  4IVF A;  2C3N A;  3Q19 A;  2H74 A;  4HU9 A;  5D93 A;  2G0F A;  2F51 A;  4XS4 A;  4DEJ A;  3BD2 A;  4I8B A;  1XWK A;  2ON5 A;  4FXY P;  2UV8 G;  4LMV A;  2V6K A;  4KDU A;  2CQ9 A;  1GTA A;  5HR3 A;  2FLS A;  1JLW A;  3APS A;  3DEX A;  2H1G A;  1NM3 A;  2WZ9 A;  5ECO B;  4HEA 2;  1GSU A;  1QFN A;  3GIX A;  3J7Y k;  2NVL A;  3RHC A;  3IXR A;  2IWT A;  3D6I A;  3MNG A;  3KJY A;  3D4T A;  1XWA A;  2QKE A;  2X64 A;  5IMV A;  1GTI A;  2CAQ A;  4PXO A;  3H4K A;  5F0G A;  3D5J A;  4YKG A;  4N30 A;  3C71 A;  1ZL9 A;  3D0Z A;  2C0E A;  4H86 A;  6GSY A;  3GX8 A;  3ME8 A;  3ZIJ A;  1T00 A;  2IMK A;  5HR2 A;  3GV1 A;  1JZD A;  4MLY A;  1WP0 A;  3MAK A;  4ECC A;  5IQY A;  3IBH A;  1Q98 A;  1SYR A;  3LYK A;  2CZ2 A;  1BED A;  3NZN A;  4WXT A;  5IOX A;  1U87 A;  5E4W A;  4V2N A;  2GSQ A;  4MJE A;  2VCV A;  2H71 A;  1RQM A;  1PD2 1;  5DAK B;  1GSE A;  3TOT A;  3F0I A;  5A5K A;  3WT1 A;  3F6D A;  4PX1 A;  4MH3 A;  3P2A A;  4WBJ A;  4OWY A;  4K5R A;  1WMJ A;  5B8B A;  4HI7 A;  1OVN A;  3ERG A;  3LYP A;  3QAW A;  1E6B A;  3F6F A;  1G0T A;  3QPM A;  2V6O A;  3VWW A;  1K0D A;  1YZX A;  1A0F A;  1G6Y A;  5KEJ A;  1B9Y C;  3H1N A;  1KEB A;  2GT6 A;  1A24 A;  3IRA A;  1PL2 A;  1FG4 A;  1SKR B;  2J23 A;  1TU7 A;  5DCG A;  4BWS A;  1WRY A;  3KH9 A;  1F9M A;  3PPU A;  3KM6 A;  1SVM A;  2LUS A;  1Z3E A;  2C0D A;  1SYX A;  6GSX A;  2TRX A;  1B8X A;  3QAG A;  3TKR A;  5L71 A;  3UBL A;  1ZYE A;  3PGT A;  3HCZ A;  2H66 A;  1SK1 A;  1K3Y A;  1GLP A;  4GSS A;  1ZZY A;  2EIQ A;  1W4V A;  1V58 A;  2DML A;  2UZ8 A;  2K18 A;  5J40 A;  2IJY A;  2LTK A;  2M80 A;  5DQY A;  2WS2 A;  3HZ4 A;  2CA8 A;  1NHO A;  2ALB A;  4KW6 A;  3CYN A;  2PER A;  1RW1 A;  4PI0 C;  1WJK A;  4DSS A;  4G10 A;  2CT6 A;  2DMM A;  3FZA A;  2CAI A;  5ECQ B;  3CSH A;  4MJB A;  3WD6 A;  2H6Z A;  5JCU A;  1M2D A;  4K2D A;  1YF0 A;  3H8Q A;  5EY6 A;  3FYG A;  2RLI A;  2C1Y A;  2HXK A;  4ZB8 A;  2B1K A;  16GS A;  2K9F A;  1GTU A;  3BOA A;  1CQG A;  2LS5 A;  3L78 A;  4Z7X A;  1SU9 A;  2O7K A;  1TTZ A;  3Q6O A;  4WBR D;  3TOU A;  1YQ1 A;  1QQ2 A;  3HA9 A;  3GRX A;  5JWR B;  4CHS A;  4FIW A;  1FB0 A;  1X5E A;  2A4V A;  4IJ3 A;  2ON7 A;  2MMO A;  2GT5 A;  4GQC A;  3TB2 A;  4YQM A;  1GSD A;  2DBC A;  2R37 A;  4Q5Q A;  3KEB A;  3ME7 A;  3ISO A;  2HT9 A;  5G30 A;  4OFT A;  5CRH A;  3ZRD A;  2B5X A;  2HSY A;  3EE2 A;  4K7N A;  2X8G A;  3LQ7 A;  4X4J A;  4E8H A;  3W6G A;  4AGS A;  5C04 A;  2N5B A;  1URM A;  1TP9 A;  3J7Y b;  1BQ7 A;  3AY8 A;  4GDF A;  1BF5 A;  1OKT A;  1ERU A;  5A5H A;  1TU8 A;  1Z7P A;  4CY8 A;  1N2A A;  2HSN A;  17GS A;  4MJA A;  2JZT A;  3UVH A;  1TRU A;  2WW3 A;  1TI3 A;  4JRR A;  1BJX A;  2JU5 A;  8GSS A;  2VOC A;  5CRG A;  2YPM A;  5D9V A;  3TKP A;  4GST A;  2YN1 A;  1NSW A;  2OBI A;  1ZYQ B;  5AN1 A;  3P7X A;  3ZTL A;  1X9M B;  3RAZ A;  4YAP A;  4K7O A;  2IMD A;  4POM A;  5E59 A;  1MD4 A;  3O76 A;  1PKW A;  5A5H B;  4V2L A;  3TUE A;  1SKW B;  2WVZ A;  2WW0 A;  1TJD A;  3LXT A;  2H0H A;  1N25 A;  2M72 A;  2LQQ A;  5COH A;  1T4Y A;  2I4A A;  4ZL7 A;  1VF3 A;  4MCU A;  1YKC A;  2J9H A;  4K0G A;  4KB3 A;  4EO3 A;  3KMO A;  1PKZ A;  2H6X A;  5ECN B;  1TDI A;  2DKH A;  4OO5 A;  4IP6 A;  2H72 A;  1SL0 B;  2QSI A;  4TXO A;  3TKS C;  3NOF A;  2HZE A;  2QA1 A;  2FCH A;  2LKU A;  2YAN A;  1JZW A;  2P31 A;  3F3R A;  3RBT A;  2ZCT A;  5ECP B;  4K2X A;  1K0N A;  4Q5F A;  3KH7 A;  3GH9 A;  1NHY A;  4PQI A;  3D22 A;  1DBY A;  5A1N A;  3UAR A;  2FNO A;  4L8E A;  1UC7 A;  3F9U A;  2H73 A;  4PQH A;  2MMN A;  3ZRE A;  5B6M A;  3HVV A;  3EU4 A;  4TN8 A;  1JZR A;  2VM1 A;  5J4Y A;  3KTL A;  2HE3 A;  5G1K A;  1VF4 A;  4YAV A;  4WR4 A;  2WFC A;  5GST A;  2HZE B;  4PNG A;  4K0N A;  3HMJ G;  1WWJ A;  1R7H A;  3N5O A;  1ACV A;  5ECR B;  4PI2 C;  4TR1 A;  3G9B A;  4O92 A;  11GS A;  5BMU B;  3UOM A;  3HZ8 A;  2QGV A;  3IC8 A;  4WEY A;  2C80 A;  2V41 A;  2B6M A;  1PL1 A;  4TR0 A;  2RUF A;  4F0C A;  4IS0 A;  5F8B A;  2MZC A;  1EOH A;  4PUF C;  4EKZ A;  4G01 A;  2H1L A;  4KGI A;  4PUA A;  4PUR A;  2VAF A;  2I1U A;  2RII A;  1YF1 A;  1PSQ A;  2KOK A;  1Z6M A;  1O8W A;  1M2A A;  2OKA A;  1YVL A;  1TKD B;  5IO0 A;  4OMV A;  5EPF A;  2G2Q A;  2X49 A;  1Z9H A;  1T4Z A;  3GHA A;  3IPZ A;  4V1A g;  4XHM A;  4IKH A;  1B48 A;  1R5A A;  4FYC A;  5D96 A;  1EGR A;  4WR5 A;  3RPN A;  1QXH A;  3GST A;  4JED A;  3IR4 A;  2OT3 A;  2XC2 A;  4TXV A;  3C1S A;  1XWC A;  3A5W A;  4O5R A;  4AKX B;  3G7I A;  3A2X A;  3RFR C;  1T1V A;  1KNG A;  1ML6 A;  4NMU A;  2YJH A;  3VK9 A;  6GSW A;  4TR3 A;  3IHQ A;  4JR4 A;  4NV5 A;  1FOH A;  2KP2 A;  3HVN A;  4TR4 A;  4MK3 A;  5ELG A;  4GRF A;  1GSS A;  1V57 A;  5GSS A;  3ERW A;  1PA3 A;  2O89 A;  3WGX A;  1A2M A;  4MF5 A;  1S3A A;  1G7O A;  1DE2 A;  5HFI A;  1XW9 A;  3RGB C;  3JCM L;  5HQP A; 
#chains in the Genus database with same CATH homology
 1HQO A;  1V2A A;  3U6V A;  4ID0 A;  3RDW A;  4HU7 A;  2DKI A;  2HRK A;  3IA1 A;  3FZ9 A;  4CW9 A;  2AYT A;  4ECB A;  2R6K A;  1GLQ A;  2YP6 A;  4XTS A;  1OKD A;  4ZBD A;  1ZCP A;  2L59 A;  2X8C A;  1K3O A;  4NHW A;  1K0A A;  2PN8 A;  3ZLP A;  5DDL A;  2XPE A;  4CDO A;  1Z7R A;  4TVE A;  4MZW A;  3L9S A;  5B7C A;  3C1R A;  3PH9 A;  1OE8 A;  4ZL9 A;  4HUA A;  3S9F A;  2CVB A;  1QGV A;  4EIQ A;  2O8V B;  2H75 A;  2VM2 A;  4JU5 A;  2V2G A;  1YEP A;  1EEM A;  1AQX A;  1ZMA A;  5HFK A;  1PGT A;  3TDG A;  3TKS A;  3W8J A;  2E7P A;  1G7E A;  2LQO A;  1OC8 A;  2A2R A;  1I5G A;  10GS A;  3QFB C;  1FVK A;  1SKS B;  2LRN A;  1GUK A;  1O6J A;  4P3Y B;  5J4V A;  4ILF A;  2B1L A;  3IK9 A;  1XFL A;  2IMF A;  4N0Z A;  4I97 A;  4LL4 B;  5IMZ A;  4BVY A;  3IAM 2;  4MF6 A;  1Y1U A;  1YDK A;  3CMI A;  1ZYN A;  3IHG A;  2YOI A;  1XXU A;  1FOV A;  5G1L A;  6GST A;  1O7U A;  2HI7 A;  3HVX A;  4CY6 A;  2VKZ G;  2LNS A;  3O6T A;  3HVS A;  3E9J B;  5ECM B;  2L4Q A;  4J57 E;  3QAV A;  3GFK A;  3EMP A;  3A2W A;  1V40 A;  1M9A A;  4HJ2 A;  1XW6 A;  4HDE A;  3FR3 A;  1THO A;  1GSF A;  4XS4 B;  3EUR A;  5DCH A;  4ECJ A;  4QQ7 A;  3I9V 2;  5F05 A;  4EDY A;  4N0V A;  3FY7 A;  3GKN A;  4GWR A;  5F07 A;  4BVY B;  2FWF A;  2N5F A;  4K1F A;  1UN2 A;  4QL9 A;  3LG6 A;  3IE3 A;  2KLX A;  3FHK A;  1H75 A;  4TRX A;  1C72 A;  3IOS A;  2C3T A;  1ST9 A;  2EFD A;  2H30 A;  2GZP A;  2H1A A;  2OAD A;  4K5S A;  1PN0 A;  2OBK A;  4K8M A;  1M7T A;  2TIR A;  2H1D A;  5JCW A;  4K7I A;  5ELA A;  2GZY A;  4WF4 A;  1YY7 A;  2GVP A;  5B8A A;  3KXO A;  1VF1 A;  3ZMK A;  2C0F A;  3GUR A;  1ZGN A;  1YEX A;  4GSN A;  3UAP A;  1GSY A;  4O5Q A;  4IN0 A;  3EIN A;  3ZZX A;  4HS1 A;  2X8H A;  4MJC A;  1X5C A;  2YJ7 A;  2R4V A;  4L0W A;  4ZB9 A;  4G2E A;  4AKG A;  1A2J A;  3WT2 A;  1K0C A;  1FO5 A;  1MTC A;  4PTS A;  1PMT A;  1J08 A;  3TJK A;  1MEK A;  2I81 A;  4MH2 A;  1Y25 A;  4O5U A;  1MD3 A;  5ECK B;  2HQT A;  3DIE A;  4KE3 A;  4Q5N A;  1W89 A;  1OE7 A;  5CYY A;  5IMD A;  3FR6 A;  2HRN A;  3VI5 A;  5B6N A;  2VO4 A;  1THX A;  4LL1 B;  1SD8 A;  4OO4 A;  5GAP D;  3M8N A;  2OJL A;  5J4U A;  1GUH A;  4MA9 A;  2MMZ A;  4LA1 A;  2L5O A;  4X0X A;  3I69 A;  2IMI A;  3UBK A;  1UVZ A;  4HZ4 A;  3FW2 A;  2VCZ A;  2BTO T;  5DAL A;  3FMW A;  2FGX A;  3LFL A;  3VWU A;  5KOW A;  2FWG A;  3ZL5 A;  2FY6 A;  5ECS A;  4XS6 A;  4BPY A;  2YZU A;  3LGC A;  2R2J A;  4N10 A;  4GCI A;  4DSS B;  4MZB A;  2FWH A;  3EYT A;  3M3M A;  3FK8 A;  1V98 A;  5CRW A;  3UVT A;  4IP1 A;  3F8U A;  4ZBA A;  3VPT A;  2KHP A;  4TOP A;  1DE1 A;  2WUL A;  2WJU A;  4L0U A;  3ERF A;  4PGT A;  4HQS A;  1OC9 A;  3LEF A;  1T8E B;  3EU3 A;  4JE1 A;  4G0L A;  1UA5 A;  3VI7 A;  3TRQ A;  4POB A;  2BJX A;  1H4O A;  2DJ2 A;  5F06 A;  1EEJ A;  4XCS A;  1TK0 B;  1FVJ A;  4ISD A;  5FWG A;  5DAL B;  1HD2 A;  2GTU A;  3D4M A;  1XVW A;  4PQ1 A;  2CX3 A;  5J9C A;  4I6X A;  4L5O A;  3W8S A;  1N8J A;  4IHU A;  1TI1 A;  3FZ4 A;  2B3S A;  4FQU A;  3GH6 A;  1ZYP A;  2AUV A;  1QK8 A;  1PQN A;  2PPT A;  1HNA A;  1B4Q A;  2VCX A;  4GLT A;  2QC7 A;  3QCP A;  2LJK A;  1OC9 B;  2FUG 2;  4JZQ A;  3KGK A;  4KDY A;  4ZL8 A;  2YWO A;  1WE0 A;  1CQH A;  2B7J A;  3N9J A;  1FB6 A;  1U3A A;  5IO2 A;  3A3T A;  4BVX A;  4WKW A;  1YKA A;  2GDR A;  19GS A;  2I9H A;  5IMA A;  3QOU A;  2IL3 A;  2HSN B;  3TKQ A;  3QD9 A;  4EUY A;  3WGD A;  1K0B A;  2PWJ A;  1USB A;  2A4H A;  2L4C A;  1EGO A;  3GL3 A;  5FT3 A;  3VWX A;  2CVD A;  1U3I A;  3V1W A;  5AIS A;  3ZFL A;  4I2U A;  4XIH A;  1JZO A;  4G9H A;  2VD1 A;  5H5Q A;  2E2G A;  3C8E A;  5A4V A;  1MDK A;  6GSU A;  5ECH B;  1HYU A;  5DJM A;  4BVX B;  5EL8 A;  3DVW A;  2K8V A;  1TK8 B;  1BG5 A;  4KH7 A;  1KTE A;  3ZML A;  4IW9 A;  2HYX A;  2C8U A;  3ZFB A;  2B5E A;  2CV4 A;  4F2I A;  3TU3 B;  2DJ3 A;  4EDZ A;  2WRT A;  1TRS A;  5BRT A;  2AJQ B;  1QUW A;  3ZVJ D;  1R4W A;  3LOR A;  4F82 A;  4TXO B;  1IYH A;  20GS A;  3DRN A;  2NDO A;  1J9B A;  5ABR A;  1A23 A;  1FHE A;  1R5P A;  4RQX A;  3MDK A;  4KCE A;  2GQK A;  2E2M A;  1WIK A;  4EIP A;  3LJR A;  5A1N B;  4EE0 A;  4F9Z A;  2P0G A;  4Z2R A;  2P5Q A;  1V9W A;  3HJM A;  3VPQ A;  2NPB A;  3HY2 A;  3GYK A;  4F0B A;  3EMX A;  5J5N A;  2C3Q A;  4KCA A;  1SK2 A;  2DSA A;  5FHI A;  4FH8 A;  2HNL A;  18GS A;  4ZXG A;  5LNK e;  4TW5 A;  5GZZ B;  1VGL A;  4YH2 A;  1S3C A;  3CSJ A;  4TR1 B;  3WGE A;  1AW9 A;  2VIM A;  2PGT A;  5G31 A;  3ZYW A;  1XWB A;  5J9B A;  2VLV A;  5H5R A;  3UJ1 A;  2O87 A;  2Z9S A;  1TW9 A;  1VRS D;  4ACS A;  5JWO B;  4RI6 A;  4DSR A;  2JAC A;  3DVX A;  4AKH A;  5J47 A;  3PIN A;  1PX6 A;  2O85 A;  3VWV A;  3HXS A;  1A8L A;  1RK4 A;  3VFI A;  4ZIJ A;  3DXB A;  5KN1 A;  4N3Z A;  3GMF A;  5INY A;  1BG1 A;  1BAY A;  1M2B A;  2JSY A;  2L5L A;  3GKX A;  5DVB A;  1BX9 A;  1K3L A;  4FYU A;  4YQU A;  2RUE A;  2EC4 A;  3M1G A;  4V1A p;  1F6M C;  5JCG A;  3CXG A;  3UEM A;  5LD0 A;  1DUG A;  2VCQ A;  3GN3 A;  3GKK A;  4KA0 A;  2KUC A;  1T3B A;  1QMV A;  2PVO C;  3CRU A;  1XIY A;  3E0U A;  1O81 A;  3F4T A;  2IME A;  1K0M A;  3MYD A;  3MIX A;  4O32 A;  5A4U A;  3U5R E;  1F3B A;  4MZC A;  1GNW A;  1F2E A;  1GWC A;  2CX4 A;  2P5R A;  1B9X C;  2VLU A;  4NAX A;  1WOU A;  3GNJ A;  3KCM A;  4XRA A;  4GF0 A;  2YZH A;  2PMT A;  4LLR A;  4A5P A;  3UMA A;  1KBN A;  2VL3 A;  2F8A A;  2OE1 A;  2HZF A;  2LRC A;  4N11 A;  1Y6E A;  2H76 A;  5IMC A;  4OCE A;  2HSH A;  1AIU A;  4I5Q A;  2HRK B;  1U88 A;  2YV9 A;  1F3A A;  1NW2 A;  1BYE A;  4F03 A;  1J0F A;  2WDU A;  3OR5 A;  2H01 A;  2NTO A;  1M0U A;  1OAZ A;  2C4J A;  2EFH A;  3BCK A;  2R5G A;  3QR6 A;  2VCW A;  4IQA A;  1DSB A;  3TRP A;  1GUL A;  4KF9 A;  5KN3 A;  1A2L A;  1ON4 A;  3RPP A;  4RI7 A;  3HD5 A;  3VUR A;  4ZIL A;  2R0G A;  4MDC A;  2GLR A;  2JZS A;  2LJA A;  2QA2 A;  6GSS A;  5KN0 A;  5G5F A;  5DAK A;  4K9Z A;  2VD0 A;  3R2Q A;  5AGY A;  4IGJ A;  2HRF A;  2YNX A;  3APO A;  2X99 A;  2V32 A;  2L6C A;  2F3M A;  1XW5 A;  5D8I A;  2DIZ A;  1E2Y A;  2GGT A;  1AAZ A;  3DYR A;  5H5S A;  3L4N A;  4KSM A;  3F63 A;  2VL9 A;  2REM A;  3KP8 A;  1O8X A;  3GSS A;  4NPB A;  2M46 A;  2DLX A;  2XPD A;  2GST A;  1OYJ A;  3Q74 A;  4KUN A;  4BL7 A;  4OD7 A;  4ICY A;  3DWV A;  5ECI B;  2FA8 A;  3KZQ A;  4PNF A;  5D9X A;  1EWX A;  2MBS A;  1O73 A;  3G7J A;  3IK7 A;  4Z2U A;  2JL4 A;  3HDC A;  2LRT A;  2XBI A;  3TJG A;  2KP1 A;  4NV2 A;  2L6D A;  1GNE A;  2B7K A;  4EXJ A;  2RM6 A;  2K8S A;  2VL2 C;  2LEG A;  1SK0 A;  1GUM A;  1OC3 A;  2WGR A;  14GS A;  3GKM A;  1LBK A;  5G2Z A;  2H6Y A;  1ERW A;  2OA7 A;  2OE0 A;  2R0P A;  3KP9 A;  3ZIT A;  3BCI A;  2D2Z A;  1X5D A;  4BL7 B;  4QL7 A;  2YWN A;  1EV4 A;  1PN9 A;  4XS1 A;  2AAW A;  4KX4 A;  1TOF A;  1SVL A;  2IN3 A;  2WB9 A;  3LW9 A;  2FD3 A;  2RM5 A;  3KD0 A;  3F4S A;  4FYB A;  2H1B A;  5IMF A;  3WYW A;  2NBS A;  4GQF A;  4EC0 A;  4MAB A;  4ZBB A;  2EIR A;  5CO3 A;  3TJJ A;  3DML A;  3DGQ A;  4X43 A;  5ID2 A;  2VLT A;  2HFD A;  4MPF A;  5D9T A;  1TRW A;  2XHF A;  4HQZ A;  4AKI A;  2PBJ A;  3TJF A;  1SEN A;  4AJ8 A;  2GSR A;  2JSZ A;  1Z5Y E;  5HFG A;  5DBQ A;  4HJM A;  1AUC A;  2GS3 A;  4WF5 A;  1B4P A;  1ABA A;  4ZB6 A;  5KN2 A;  2R3X A;  2PU9 C;  2PVQ A;  4USS A;  3CSI A;  4ZB7 A;  1GP1 A;  1X0R A;  1AXD A;  4DVC A;  2HRA A;  1SL2 B;  3CBU A;  1TK5 B;  3EVI A;  2H0I A;  2OAC A;  5DJL A;  5JWQ B;  5ID2 B;  2CVK A;  3RHB A;  1EP7 A;  3US3 A;  4HOJ A;  3FRC A;  2A2P A;  2GQM A;  1X9S B;  4I2T A;  1K0O A;  4AJ6 A;  2YCD A;  2O5V A;  3SWL A;  3BJ5 A;  1GL8 A;  2H8L A;  2L57 A;  5C00 A;  3FZ5 A;  5ECL B;  4KSO A;  2H70 A;  4EL1 A;  1LU4 A;  3IDV A;  3KTB A;  3C7M A;  4IJI A;  2IIY A;  1G6W A;  2LST A;  1A8Y A;  4YQV A;  3P8W A;  3CWG A;  2MBT A;  5D9W A;  3L9V A;  3TGZ A;  4G0I A;  1O85 A;  1EOG A;  3HYP A;  1AQW A;  2LJR A;  1WPI A;  3APQ A;  7GSS A;  1XOA A;  5HR1 A;  2IPA A;  1M9B A;  2AHE A;  4LMW A;  2LNT A;  3L9U A;  4J56 E;  3IC4 A;  3FR9 A;  2A2S A;  3A5I A;  2GZZ A;  4Q5R A;  1SJ6 A;  1F37 A;  5A34 A;  3DKS A;  3O3T A;  2X4A A;  4Z2T A;  1AQV A;  3QFA C;  2K6V A;  2EFE A;  1PRX A;  4KDX A;  9GSS A;  3H79 A;  3GUS A;  2LV3 A;  5IOW A;  1SL1 B;  3MWH A;  2R0C A;  4G19 A;  1MDJ A;  4NHZ A;  1TXX A;  4OFN A;  2H0G A;  3R3E A;  3TJB A;  2DJ1 A;  4NWY A;  1TRV A;  2DJK A;  1JHB A;  1SJI A;  2MMA A;  3GA4 A;  4MNN A;  1FW1 A;  2PUK C;  1VF2 A;  2FA4 A;  5A34 B;  1ERT A;  3FEU A;  4JBB A;  5D73 A;  4RUV A;  2YV7 A;  3CTF A;  2EFC A;  1XPV A;  4IBP A;  12GS A;  1SVO A;  1XCC A;  3I43 A;  2DJ0 A;  5HR0 A;  3HKR A;  2F9S A;  5KOX A;  5BMU A;  2VL2 A;  4O7H A;  1M99 A;  1X9W B;  1ERV A;  4ECI A;  4D73 A;  3HHV A;  4ML1 A;  2EIO A;  5G5E A;  5AIV A;  2GSS A;  3PR8 A;  1T7P B;  4MPG A;  3QMX A;  3MSZ A;  2N5A A;  3NIV A;  2AB6 A;  3QDN A;  4MMM A;  4QMK A;  4HZ2 A;  3ED3 A;  1HNB A;  4GTU A;  1XOB A;  4BA7 A;  1EP8 A;  22GS A;  4GXZ A;  4X1U A;  1Q4J A;  3EWL A;  2CZ3 A;  4IQ1 A;  3EC3 A;  1ZOF A;  4POL A;  2YWM A;  2BMX A;  3HJP A;  2AV4 A;  5IM9 A;  5IIZ A;  4D73 B;  4JR6 A;  2HLS A;  4AJ7 A;  2FHE A;  3A2V A;  3KIJ A;  2ES7 A;  4BWQ A;  4W66 A;  1U6T A;  4E68 A;  5LCZ A;  3ZIV A;  4KAE A;  4G0K A;  1Z6N A;  4MP4 A;  3KMN A;  4RQR A;  2IFQ A;  4J2F A;  3H93 A;  3TCO A;  1FAA A;  3F3Q A;  4AF2 A;  5CP1 A;  2HSM A;  1I9D A;  3M9J A;  4EVM A;  3GL5 A;  2WCI A;  2B5Y A;  4DSQ A;  1EV9 A;  5J41 A;  3TKS E;  4K6X A;  4L5L A;  4ULX A;  3CRT A;  4YKF A;  3SBC A;  1GTB A;  3EPT A;  2JZR A;  2FWE A;  5IPG A;  1GRX A;  4AI6 A;  3UIW A;  4ML6 A;  1JLV A;  3G7Y A;  3P90 A;  2IFQ B;  2VCT A;  2V1M A;  3GTU A;  1A0R P;  3HJO A;  4EF0 A;  3CTG A;  2DC5 A;  3Q18 A;  4E8E A;  5IPH A;  1XWG A;  3L0H A;  2ZUP A;  4KND A;  1LJR A;  3LSZ A;  1EZK A;  4WET A;  3D21 A;  1XBS A;  2HSM B;  3F4R A;  4IEL A;  5J3R A;  3C73 A;  5EVO A;  1R26 A;  3IAS 2;  4XRD A;  1XVQ A;  5AIX A;  3ZVJ A;  6GSV A;  1GH2 A;  2YWI A;  2OE3 A;  2H19 A;  3LWA A;  5ENU A;  2MYG A;  2ZNM A;  3K8N A;  1SJZ A;  1S3D A;  3E3E A;  2DIY A;  5DQS A;  13GS A;  1YJ6 A;  4TKY A;  2I3Y A;  2XBQ A;  5CRD A;  3BBY A;  3GTU B;  1TXU A;  1SD9 A;  1GSQ A;  5CRE A;  5A4W A;  4MF7 A;  3I6A A;  3M9K A;  3TRX A;  1MDI A;  3UL3 A;  5CNW A;  4V2M A;  3GX0 A;  3M0F A;  3LXZ A;  3DD3 A;  1PX7 A;  1AC1 A;  2E0Q A;  3VLN A;  2VUP A;  4FO5 A;  1XZO A;  5GAN D;  2C0G A;  4OCF A;  2JAD A;  2TRC P;  4NXI A;  4POK A;  1IYI A;  4OFM A;  1ILO A;  3FKF A;  2GQL A;  3IV4 A;  2DJJ A;  2F8F A;  1HNC A;  1JFU A;  5CAX A;  4IVF A;  2C3N A;  3Q19 A;  2H74 A;  4HU9 A;  5D93 A;  2G0F A;  2F51 A;  4XS4 A;  4DEJ A;  3BD2 A;  4I8B A;  1XWK A;  2ON5 A;  2UV8 G;  4LMV A;  2V6K A;  4KDU A;  2CQ9 A;  1GTA A;  5HR3 A;  2FLS A;  1JLW A;  3APS A;  3DEX A;  2H1G A;  1NM3 A;  2WZ9 A;  5ECO B;  4HEA 2;  1GSU A;  1QFN A;  3GIX A;  3J7Y k;  2NVL A;  3RHC A;  3IXR A;  2IWT A;  3D6I A;  3MNG A;  3KJY A;  3D4T A;  1XWA A;  2QKE A;  2X64 A;  5IMV A;  1GTI A;  2CAQ A;  4PXO A;  3H4K A;  5F0G A;  3D5J A;  4YKG A;  4N30 A;  3C71 A;  1ZL9 A;  3D0Z A;  2C0E A;  4H86 A;  6GSY A;  3GX8 A;  3ME8 A;  3ZIJ A;  1T00 A;  2IMK A;  5HR2 A;  3GV1 A;  1JZD A;  4MLY A;  1WP0 A;  3MAK A;  4ECC A;  5IQY A;  3IBH A;  1Q98 A;  1SYR A;  3LYK A;  2CZ2 A;  1BED A;  3NZN A;  4WXT A;  5IOX A;  1U87 A;  5E4W A;  4V2N A;  2GSQ A;  4MJE A;  2VCV A;  2H71 A;  1RQM A;  1PD2 1;  5DAK B;  1GSE A;  3TOT A;  3F0I A;  5A5K A;  3WT1 A;  3F6D A;  4PX1 A;  4MH3 A;  3P2A A;  4WBJ A;  4OWY A;  4K5R A;  1WMJ A;  5B8B A;  4HI7 A;  1OVN A;  3ERG A;  3LYP A;  3QAW A;  1E6B A;  3F6F A;  1G0T A;  3QPM A;  2V6O A;  3VWW A;  1K0D A;  1YZX A;  1A0F A;  1G6Y A;  5KEJ A;  1B9Y C;  3H1N A;  1KEB A;  2GT6 A;  1A24 A;  3IRA A;  1PL2 A;  1FG4 A;  1SKR B;  2J23 A;  1TU7 A;  5DCG A;  4BWS A;  1WRY A;  3KH9 A;  1F9M A;  3PPU A;  3KM6 A;  1SVM A;  2LUS A;  1Z3E A;  2C0D A;  1SYX A;  6GSX A;  2TRX A;  1B8X A;  3QAG A;  3TKR A;  5L71 A;  3UBL A;  1ZYE A;  3PGT A;  3HCZ A;  2H66 A;  1SK1 A;  1K3Y A;  1GLP A;  4GSS A;  1ZZY A;  2EIQ A;  1W4V A;  1V58 A;  2DML A;  2UZ8 A;  2K18 A;  5J40 A;  2IJY A;  2LTK A;  2M80 A;  5DQY A;  2WS2 A;  3HZ4 A;  2CA8 A;  1NHO A;  2ALB A;  4KW6 A;  3CYN A;  2PER A;  1RW1 A;  1WJK A;  4DSS A;  4G10 A;  2CT6 A;  2DMM A;  3FZA A;  2CAI A;  5ECQ B;  3CSH A;  4MJB A;  3WD6 A;  2H6Z A;  5JCU A;  1M2D A;  4K2D A;  1YF0 A;  3H8Q A;  5EY6 A;  3FYG A;  2RLI A;  2C1Y A;  2HXK A;  4ZB8 A;  2B1K A;  16GS A;  2K9F A;  1GTU A;  3BOA A;  1CQG A;  2LS5 A;  3L78 A;  4Z7X A;  1SU9 A;  2O7K A;  1TTZ A;  3Q6O A;  4WBR D;  3TOU A;  1YQ1 A;  1QQ2 A;  3HA9 A;  3GRX A;  5JWR B;  4CHS A;  4FIW A;  1FB0 A;  1X5E A;  2A4V A;  4IJ3 A;  2ON7 A;  2MMO A;  2GT5 A;  4GQC A;  3TB2 A;  4YQM A;  1GSD A;  2DBC A;  2R37 A;  4Q5Q A;  3KEB A;  3ME7 A;  3ISO A;  2HT9 A;  5G30 A;  4OFT A;  5CRH A;  3ZRD A;  2B5X A;  2HSY A;  3EE2 A;  4K7N A;  2X8G A;  3LQ7 A;  4X4J A;  4E8H A;  3W6G A;  4AGS A;  5C04 A;  2N5B A;  1URM A;  1TP9 A;  3J7Y b;  1BQ7 A;  3AY8 A;  4GDF A;  1BF5 A;  1OKT A;  1ERU A;  5A5H A;  1TU8 A;  1Z7P A;  4CY8 A;  1N2A A;  2HSN A;  17GS A;  4MJA A;  2JZT A;  3UVH A;  1TRU A;  1TI3 A;  4JRR A;  1BJX A;  2JU5 A;  8GSS A;  2VOC A;  5CRG A;  2YPM A;  5D9V A;  3TKP A;  4GST A;  2YN1 A;  1NSW A;  2OBI A;  1ZYQ B;  5AN1 A;  3P7X A;  3ZTL A;  1X9M B;  3RAZ A;  4YAP A;  4K7O A;  2IMD A;  4POM A;  5E59 A;  1MD4 A;  3O76 A;  1PKW A;  5A5H B;  4V2L A;  3TUE A;  1SKW B;  1TJD A;  3LXT A;  2H0H A;  1N25 A;  2M72 A;  2LQQ A;  5COH A;  1T4Y A;  2I4A A;  4ZL7 A;  1VF3 A;  4MCU A;  1YKC A;  2J9H A;  4K0G A;  4KB3 A;  4EO3 A;  3KMO A;  1PKZ A;  2H6X A;  5ECN B;  1TDI A;  2DKH A;  4OO5 A;  4IP6 A;  2H72 A;  1SL0 B;  2QSI A;  4TXO A;  3TKS C;  3NOF A;  2HZE A;  2QA1 A;  2FCH A;  2LKU A;  2YAN A;  1JZW A;  2P31 A;  3F3R A;  3RBT A;  2ZCT A;  5ECP B;  4K2X A;  1K0N A;  4Q5F A;  3KH7 A;  3GH9 A;  1NHY A;  4PQI A;  3D22 A;  1DBY A;  5A1N A;  3UAR A;  2FNO A;  4L8E A;  1UC7 A;  3F9U A;  2H73 A;  4PQH A;  2MMN A;  3ZRE A;  5B6M A;  3HVV A;  3EU4 A;  4TN8 A;  1JZR A;  2VM1 A;  5J4Y A;  3KTL A;  2HE3 A;  5G1K A;  1VF4 A;  4YAV A;  4WR4 A;  2WFC A;  5GST A;  2HZE B;  4PNG A;  4K0N A;  3HMJ G;  1WWJ A;  1R7H A;  3N5O A;  1ACV A;  5ECR B;  4TR1 A;  3G9B A;  4O92 A;  11GS A;  5BMU B;  3UOM A;  3HZ8 A;  2QGV A;  3IC8 A;  4WEY A;  2C80 A;  2V41 A;  2B6M A;  1PL1 A;  4TR0 A;  2RUF A;  4F0C A;  4IS0 A;  5F8B A;  2MZC A;  1EOH A;  4PUF C;  4EKZ A;  4G01 A;  2H1L A;  4KGI A;  4PUA A;  4PUR A;  2VAF A;  2I1U A;  2RII A;  1YF1 A;  1PSQ A;  2KOK A;  1Z6M A;  1O8W A;  1M2A A;  2OKA A;  1YVL A;  1TKD B;  5IO0 A;  4OMV A;  5EPF A;  2G2Q A;  2X49 A;  1Z9H A;  1T4Z A;  3GHA A;  3IPZ A;  4V1A g;  4XHM A;  4IKH A;  1B48 A;  1R5A A;  4FYC A;  5D96 A;  1EGR A;  4WR5 A;  3RPN A;  1QXH A;  3GST A;  4JED A;  3IR4 A;  2OT3 A;  2XC2 A;  4TXV A;  3C1S A;  1XWC A;  3A5W A;  4O5R A;  4AKX B;  3G7I A;  3A2X A;  1T1V A;  1KNG A;  1ML6 A;  4NMU A;  2YJH A;  3VK9 A;  6GSW A;  4TR3 A;  3IHQ A;  4JR4 A;  4NV5 A;  1FOH A;  2KP2 A;  4TR4 A;  4MK3 A;  5ELG A;  4GRF A;  1GSS A;  1V57 A;  5GSS A;  3ERW A;  1PA3 A;  2O89 A;  3WGX A;  1A2M A;  4MF5 A;  1S3A A;  1G7O A;  1DE2 A;  5HFI A;  1XW9 A;  5HQP A;  3JCM L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...