3ISOA

Crystal structure of 26 kda gst of clonorchis sinensis in p3221 symmetry
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
218
structure length
218
Chain Sequence
b'MAPVLGYWKIRGLAQPIRLLLEYVGDSYEEHSYGRCDGEKWQNDKHNLGLELPNLPYYKDGNFSLTQSLAILRYIADKHNMIGNTPVERAKISMIEGGLVDLRAGVSRIAYQETFEQLKVPYLQQLPSTLRMWSQFLGNNSYLHGSTPTHLDFMFYEALDVIRYLDPTSVEAFPNLMQFIHRIEALPNIKAFMESDRFIKWPLNGWSAYFGGGDAPPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative glutathione transferase
publication title A histidine substitution confers metal binding affinity to a Schistosoma japonicum Glutathione S-transferase.
pubmed doi rcsb
source organism Clonorchis sinensis
molecule tags Transferase
total genus 78
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3isoA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3isoA01
6GSUA 1NHYA 2YCDA 4RI7A 1KNGA 3TOUA 4HZ4A 2VOCA 3PH9A 2R5GA 5G2ZA 2VLVA 1PRXA 1PL1A 2I1UA 3GKMA 4ZL9A 5HR0A 1FAAA 1O85A 4KW6A 4G2EA 2GSTA 4DVCA 4OCEA 4KSOA 2HSMB 2O87A 3US3A 3UJ1A 2YN1A 1DE1A 4K0GA 4JRRA 5ECLB 2CAQA 2GSQA 4TXOB 3C8EA 1E2YA 1DE2A 2H6YA 2XBQA 3RHBA 4XS4B 2DJ3A 2AJQB 1GSDA 4BA7A 1SJZA 2GZYA 4LLRA 2WDUA 2FA8A 2N5FA 1FB0A 1QMVA 2WZ9A 4K9ZA 5BMUA 3C7MA 3APQA 1TKDB 4KDXA 4GSSA 4YQUA 1XOAA 4RI6A 2P0GA 4JR6A 2YANA 4POMA 1TJDA 3WD6A 3ZYWA 5IM9A 3M3MA 1HQOA 4BL7A 1F2EA 5AIVA 4D73B 5DDLA 2HRKA 3GH6A 1TK8B 5JWRB 3F9UA 1AQVA 4PX1A 2H6ZA 2Z9SA 3WYWA 2H8LA 4MF6A 3DRNA 4GTUA 2OA7A 2JZRA 5JCGA 3CYNA 4NHZA 1MDJA 2WS2A 1WPIA 2QKEA 2MMNA 3KP8A 1AQWA 4KSMA 2H74A 1K0DA 3GSSA 2LS5A 2JADA 4OFTA 1SK1A 4X1UA 2IMDA 3ZLPA 2EC4A 2IWTA 2C0FA 4TR0A 3DYRA 1XZOA 3FZ9A 1GL8A 2X64A 1XW6A 3IC4A 3EU3A 4DSSB 4IJ3A 2DIYA 3DGQA 4L0WA 1X0RA 1YF1A 1SL0B 2HRKB 1ERVA 2CX4A 3C73A 4TR1A 3HDCA 2WJUA 2VUPA 1JHBA 2R6KA 4MA9A 3APOA 4TKYA 3H79A 2V32A 3KZQA 1H4OA 3FR6A 3H1NA 4Z7XA 5C04A 4X0XA 4PQHA 5JCUA 4PTSA 3TDGA 1V2AA 4PNFA 1VRSD 5IOXA 5GAPD 2DLXA 3IR4A 5AISA 4BVYA 4ID0A 3FRCA 1MTCA 2MMAA 4KCEA 4Q5FA 3A3TA 2JZTA 4TR1B 4KUNA 4BWQA 4ZL7A 4BVXA 1W4VA 1XW5A 2HZFA 4NWYA 4NHWA 1CQGA 5J9BA 2CVDA 1PN9A 5F06A 3KEBA 4MH3A 4OFNA 2TRCP 2VLUA 3QFBC 2V41A 5HR1A 3RPNA 5LCZA 2VCWA 3FZ4A 2JSYA 2L6CA 1K3OA 1TOFA 5A5KA 1FG4A 4KA0A 5ELAA 4ECJA 3FKFA 1YKCA 5CRHA 1GTIA 4JR4A 4FH8A 2RIIA 11GSA 4HEA2 4HQZA 4MH2A 4BVYB 3KTLA 7GSSA 20GSA 10GSA 1U88A 5B7CA 1AC1A 1SENA 3W8SA 2X8GA 5DALA 2B7JA 5B6MA 3IV4A 3F63A 3HJPA 3TRQA 3RHCA 3DIEA 2O89A 2FWEA 1ILOA 2GZPA 3IK9A 3HVSA 2CVBA 2IFQB 1GUKA 1GH2A 4EDZA 4Q5QA 3FEUA 1XW9A 3G7YA 2VIMA 1ZMAA 2HE3A 2KP1A 5AIXA 2EIRA 2FWHA 3ZIJA 2ZUPA 4O5RA 4WXTA 5G30A 3GSTA 1YKAA 4L8EA 3EURA 2E2MA 1G7OA 3A2WA 5EPFA 1YF0A 2H1BA 3PINA 1F3AA 2B3SA 1TK0B 5B8AA 1YDKA 1TRUA 3HZ4A 4KH7A 2B5EA 1LJRA 6GSSA 3HD5A 2X8HA 2RUEA 2CZ3A 3SBCA 1EV9A 4X43A 3NOFA 2IMFA 1YY7A 3PPUA 3ZVJA 3TGZA 2LNSA 4KE3A 2O8VB 2VL2C 2VLTA 1W89A 5GSTA 2B1LA 3C71A 2F51A 4MK3A 4IELA 2M72A 2OE3A 3O76A 1EEJA 2VAFA 3Q74A 1SKSB 1F3BA 1KEBA 4N0ZA 2VCXA 2F9SA 4USSA 4K7IA 4HU9A 1SK0A 2GS3A 3APSA 3IAM2 3TB2A 2DJ2A 4WKWA 1YQ1A 4QQ7A 3GH9A 1R7HA 4ECIA 1TI3A 3UIWA 1EGOA 3M8NA 3OR5A 4MJCA 3PR8A 4LMVA 4EUYA 4V2LA 4F9ZA 2YPMA 3UMAA 3HZ8A 1X9MB 2IPAA 2O7KA 1EP7A 1ZYEA 4OD7A 1C72A 4PQ1A 3KM6A 1GSYA 2H1AA 4I8BA 4KCAA 4KDYA 3ZITA 2IJYA 4HS1A 2B5XA 1U87A 3KMOA 3ZTLA 2GQKA 1T1VA 4ISDA 4K7OA 2YV7A 2H19A 1AW9A 4AGSA 2XHFA 2GQLA 3IK7A 2GVPA 2V6KA 3D22A 2YP6A 6GSXA 2PBJA 3KP9A 3UEMA 2N5BA 4MF5A 4GQFA 1O8WA 3KH7A 4KB3A 1SK2A 2GT5A 2HFDA 4NXIA 2H72A 4MABA 2GZZA 1ZCPA 4JE1A 4WBRD 2KOKA 1DUGA 4V1Ag 1GNEA 1V98A 2OE1A 3UBLA 5CO3A 2WULA 1IYHA 17GSA 2HLSA 1XFLA 2LEGA 3J7Yk 4POBA 1WRYA 2PMTA 5LNKe 3GUSA 1VF3A 6GSYA 5F8BA 4JBBA 2E7PA 1O6JA 1NSWA 4KGIA 2DJ0A 3UBKA 1JFUA 2CQ9A 3VI5A 2H01A 3TJJA 1AUCA 3NZNA 2JU5A 2X8CA 5KN1A 5C00A 2K18A 3NIVA 2HYXA 4O32A 1A24A 2E0QA 5ECQB 4YH2A 2QSIA 3U6VA 4MZWA 5D93A 2AHEA 3DXBA 8GSSA 3CXGA 3TRXA 1ON4A 2OE0A 2H73A 3P90A 4MMMA 3HKRA 4HOJA 1PSQA 1ST9A 2PERA 1EEMA 1KBNA 3BJ5A 3H8QA 2WRTA 1SD9A 3ME7A 3UL3A 4IBPA 5A4WA 4KF9A 2PPTA 2QGVA 4FIWA 3G7IA 1M2AA 1XWAA 1GUMA 5IMAA 1ML6A 3HJMA 2DJKA 4XRAA 4AJ8A 2R3XA 3VWWA 3ZFLA 1TXXA 4FYBA 2I81A 4XCSA 4L5LA 4I5QA 5ENUA 4GSNA 2MZCA 3F4RA 2C0GA 1CQHA 4P3YB 1XBSA 3D5JA 1GSEA 2FHEA 2C3TA 2ON5A 5IPHA 3HCZA 4MZCA 1SKRB 3UOMA 4FQUA 4XRDA 2H66A 2FNOA 4ACSA 2CA8A 2KLXA 1PGTA 5FHIA 1TU8A 4XTSA 1XIYA 3UVHA 2GSRA 3QD9A 2YNXA 5FT3A 3W6GA 3DWVA 4XS1A 1BAYA 3HHVA 1K0BA 3DVXA 3VURA 3C1RA 3DVWA 5EY6A 4NAXA 1EP8A 1Y6EA 3F3RA 1UC7A 4GCIA 1TRVA 3IC8A 5JWOB 1Z6MA 2CT6A 2A2SA 1T4YA 1XCCA 1ACVA 2E2GA 3A2XA 1URMA 2J23A 1J08A 4J56E 4AF2A 3IRAA 2B7KA 5CREA 3A5WA 3PGTA 2EIOA 2H70A 2RLIA 1TW9A 1YEPA 1BG5A 1ABAA 3CRUA 2FLSA 1GUHA 1F37A 1RW1A 3ERFA 4LMWA 4EF0A 1XOBA 1ZYQB 2DIZA 1JZRA 5F05A 3WGXA 5AGYA 2WFCA 3F3QA 1BEDA 1A0RP 1ERTA 1K3YA 5IMZA 4H86A 4BL7B 1YZXA 2LSTA 3RAZA 2P5RA 2C80A 4MP4A 4ZBBA 3ED3A 3LEFA 2GLRA 2ES7A 5G1LA 5LD0A 2HRFA 14GSA 3UVTA 4NMUA 4BWSA 4EDYA 1XWKA 3D0ZA 3CTGA 1UA5A 4POKA 3D4MA 5G5EA 3A2VA 5CAXA 1E6BA 2YJHA 3GURA 5G5FA 2CV4A 5D9WA 1WOUA 5A4UA 3M1GA 5IO0A 5F07A 1ZL9A 1X9SB 2BMXA 4MDCA 1EWXA 3MAKA 1O73A 3E9JB 4K6XA 4G0LA 1MEKA 2B1KA 4BPYA 3RPPA 4ZBAA 4EKZA 5J5NA 1EV4A 2OKAA 2LNTA 4NV2A 1MD3A 1GTUA 2IMKA 1OC9A 3GRXA 1B9YC 2FWFA 4IJIA 1FHEA 1N2AA 2HZEA 3R3EA 1R5PA 3C1SA 5G31A 3WT1A 3IHQA 4OCFA 5HR2A 1JZDA 4I97A 1V57A 2REMA 4ZILA 4BVXB 4MPFA 3VI7A 1XVWA 3TJBA 4GXZA 3KGKA 1A2MA 3QAWA 3GFKA 3IPZA 3TKPA 2VCTA 3ZMKA 1AQXA 1SKWB 1PX7A 1YJ6A 1M99A 2H0IA 2HXKA 1QQ2A 1ZGNA 2LJRA 3CSJA 3D21A 1USBA 1G7EA 5KN3A 4XIHA 3CTFA 5COHA 5DCGA 2AB6A 2AV4A 3EVIA 1B8XA 5CRDA 3J7Yb 4WBJA 2YWIA 2YWMA 5GSSA 2GGTA 3AY8A 1TRSA 1Y25A 3ZZXA 3K8NA 3WGDA 1VF2A 3FR9A 4FO5A 5DALB 1M9AA 2XPEA 1XWGA 3ZREA 2LRCA 3QDNA 3QAVA 4N10A 4K2DA 2H0GA 3GN3A 1TRWA 5H5RA 1Q4JA 1X9WB 4CDOA 1PQNA 3LXTA 3L9UA 1UN2A 3ISOA 3ZVJD 1SL1B 3L4NA 5DCHA 4L5OA 3GMFA 1GRXA 3LYKA 3FZAA 1WIKA 1Z6NA 3I69A 4TR4A 3HY2A 3TRPA 4F0CA 3LWAA 4G19A 1B4QA 1XWBA 5ECPB 19GSA 1SD8A 4V2NA 4IW9A 5ECNB 4G0KA 3ZRDA 3HYPA 3UARA 1T00A 2J9HA 4ULXA 2K8SA 1R4WA 4CHSA 3TOTA 1TK5B 1PKWA 2DSAA 1T3BA 3FHKA 4GLTA 1A2LA 1HNAA 2LKUA 2XPDA 1QFNA 2G0FA 1YEXA 3FY7A 4EE0A 4FYCA 3M9JA 3F8UA 3CMIA 5ECSA 1ZZYA 2LRTA 5E59A 5JCWA 1TDIA 2YJ7A 1IYIA 1AIUA 2B5YA 1WE0A 5KN2A 3VFIA 1K0OA 3EMPA 6GSWA 16GSA 4IQ1A 4OO4A 1DSBA 2LJAA 3LJRA 1TTZA 3P8WA 5J4UA 1PA3A 3ZIVA 3DEXA 2WB9A 1SL2B 1RQMA 5IMCA 4TR3A 9GSSA 4MF7A 1SYRA 5GAND 3DKSA 1A0FA 1S3CA 3O6TA 2NVLA 1ERWA 3M9KA 1Z9HA 4WETA 4IN0A 1X5EA 2YWNA 5FWGA 4IP6A 1EZKA 2DMLA 5B6NA 3RDWA 1A2JA 2H30A 1B48A 3KD0A 4GRFA 2AUVA 4ILFA 2VD1A 2PUKC 1AXDA 3N9JA 5F0GA 3TCOA 4PXOA 1FVJA 18GSA 1U3AA 3QFAC 3H4KA 4HUAA 1GULA 2PWJA 3O3TA 2L4QA 1UVZA 1OC8A 4AJ6A 2H6XA 1A8YA 1I5GA 2LJKA 4PGTA 4GWRA 4WEYA 2P31A 2JACA 4RUVA 5DAKA 2L5OA 3JCML 3GL5A 4LL1B 3L78A 3TUEA 1FO5A 4GQCA 3LYPA 1PMTA 5ID2A 5EL8A 4ZBDA 2KP2A 3EYTA 2A4VA 4RQRA 1HNCA 1I9DA 1G6WA 3F4SA 1MD4A 3FZ5A 1O8XA 3TKSE 5J9CA 2CX3A 2L5LA 3LFLA 1WMJA 1X5CA 4KAEA 2GTUA 3QMXA 3Q19A 4NV5A 5H5SA 4MJBA 4IKHA 1EOGA 1QUWA 1JLVA 2GT6A 4N0VA 2H76A 2MYGA 3IE3A 5DAKB 1NHOA 4K7NA 3BD2A 2MMZA 5CYYA 2C3NA 3LSZA 5ECKB 4FYUA 1M9BA 1FVKA 4TXVA 3M0FA 4Q5RA 1XVQA 5ECHB 4YAPA 3ERGA 2FWGA 2L4CA 2FA4A 2I4AA 2HSMA 2OBIA 1X5DA 3VPQA 3RBTA 3D4TA 3TJGA 3D6IA 4TXOA 1G6YA 2UZ8A 3GKXA 4IHUA 4DSRA 2WCIA 4XS4A 1V40A 4EC0A 3HA9A 4WF4A 4L0UA 2FD3A 2H75A 4XS6A 3EMXA 1XXUA 3TKRA 4V2MA 3HVXA 4PUAA 2V6OA 1J0FA 1H75A 5CRWA 4F03A 2C0DA 2C4JA 2OADA 1MDKA 2C3QA 2HRNA 3I43A 2H1DA 2N5AA 1S3AA 1K0CA 1PX6A 4F82A 4EO3A 4D73A 3TKQA 2YWOA 4TN8A 2YV9A 2XBIA 2VCQA 1T8EB 1NM3A 22GSA 1TI1A 1Z7RA 3G7JA 3FR3A 1QXHA 2H0HA 5HR3A 1PKZA 5KEJA 4HJMA 2HQTA 2IL3A 3P2AA 4IS0A 4IVFA 3IOSA 3GKNA 4DSSA 2HSNB 3QAGA 4LL4B 1Z3EA 3HVVA 2R2JA 3F6DA 4YQVA 1BQ7A 1B4PA 4AJ7A 3ERWA 1GTAA 1GWCA 4ML6A 2HRAA 3R2QA 2L57A 3DD3A 4OFMA 2YZHA 2FUG2 2DC5A 4JEDA 3E3EA 5HFGA 2HNLA 2PVQA 4ECBA 1A8LA 1B9XC 1FW1A 4K8MA 4ZL8A 2IMIA 2IMEA 5KN0A 2CAIA 1BYEA 1BJXA 2BTOT 2LV3A 1GP1A 1VGLA 1GLQA 4WR5A 5AN1A 5CRGA 2VCVA 5DQYA 4LA1A 2F3MA 5ABRA 1Z7PA 4O92A 3ZFBA 3VWXA 3LG6A 2B6MA 3MSZA 1OKDA 4QL9A 2JZSA 4K1FA 2HSYA 2QC7A 2PU9C 5DJMA 4ZXGA 1SYXA 1EGRA 4MJEA 3KIJA 4I2UA 2VO4A 4ECCA 4F2IA 3SWLA 3P7XA 2A2RA 3CRTA 2M46A 5INYA 1HYUA 3QOUA 5J3RA 2BJXA 2VL3A 1GSQA 3EC3A 2LUSA 5ECMB 4PURA 1VF4A 4J57E 2PN8A 4G0IA 4YAVA 1MDIA 4GSTA 2H1GA 2ALBA 3VWUA 4YQMA 4HJ2A 3KTBA 1OAZA 1OKTA 1WJKA 2YOIA 1F9MA 3F4TA 1T7PB 2F8FA 4MPGA 5JWQB 3CSIA 4Q5NA 4TW5A 4OO5A 4QL7A 3TJKA 1M0UA 2F8AA 4MCUA 4DEJA 2NDOA 3KJYA 3CBUA 3LXZA 3BCIA 2IIYA 4ML1A 1T4ZA 4IGJA 2IFQA 1BX9A 3GIXA 1K0NA 1R5AA 1K0MA 3KCMA 3IA1A 4TVEA 2K6VA 1EOHA 2ZNMA 2R4VA 1THXA 5ECRB 3EINA 2OACA 3F0IA 1OC9B 2M80A 5CNWA 1A23A 2K8VA 1OVNA 4HI7A 2HZEB 5IMDA 3FK8A 2RUFA 4JU5A 1WWJA 1U3IA 2P5QA 2RM6A 1TP9A 4MLYA 5DQSA 5A4VA 4EVMA 5IOWA 2L59A 1FOVA 4HDEA 2GSSA 3LGCA 5D9TA 3S9FA 2V1MA 4MJAA 5DBQA 1QGVA 2C0EA 2X99A 3WT2A 3G9BA 4O7HA 2FY6A 4J2FA 4WR4A 1WP0A 1FB6A 3GKKA 2VM1A 2VM2A 2MBSA 3TKSA 3QPMA 3GX8A 4F0BA 1M7TA 2DMMA 4ZB6A 2KUCA 5IQYA 2LRNA 1F6MC 2VL2A 4E8HA 2MMOA 3TJFA 3H93A 5D9XA 2KHPA 2CZ2A 3IBHA 1OE7A 6GSVA 4PQIA 2AAWA 5ELGA 5D9VA 2XC2A 5ECOB 3MDKA 5HFKA 4PNGA 5D8IA 3HXSA 1V58A 3QR6A 2I3YA 3N5OA 3IXRA 3U5RE 5ECIB 3LORA 4MZBA 1GLPA 2HI7A 3CSHA 3GX0A 1THOA 4HZ2A 3UAPA 4KX4A 3Q18A 3VPTA 4POLA 5DJLA 4NPBA 2ZCTA 3TKSC 3EU4A 2H71A 3FYGA 5E4WA 2R37A 2OJLA 3FW2A 1JLWA 4G9HA 2LQQA 2TIRA 1HNBA 5L71A 1SJIA 4OMVA 4RQXA 1RK4A 4GF0A 1V9WA 4PUFC 2IN3A 3I6AA 2D2ZA 1DBYA 4K0NA 5D73A 1U6TA 4KDUA 4ZIJA 3GV1A 4N30A 1KTEA 1Q98A 2PVOC 3MNGA 3KH9A 1J9BA 1NW2A 5IO2A 2JL4A 3L0HA 2LTKA 2C8UA 1GSUA 3GTUA 2GQMA 3L9VA 1OE8A 3W8JA 3GHAA 3MWHA 3GL3A 3E0UA 5GZZB 2I9HA 1JZOA 2FGXA 1G0TA 2CVKA 4OWYA 5J41A 1AAZA 4WF5A 3BOAA 4CW9A 3IDVA 3L9SA 3DMLA 3EWLA 5G1KA 2MBTA 3QCPA 2VCZA 3GA4A 5HFIA 2EIQA 2DJ1A 4XHMA 3BBYA 3WGEA 4TOPA 1XWCA 3ZMLA 5D96A 2NBSA 2OBKA 2HSHA 1GSSA 1R26A 2RM5A 1PD21 3KMNA 1GNWA 2DBCA 3GTUB 5IPGA 5DVBA 3IAS2 1SJ6A 4ZB8A 3GNJA 4I2TA 4N11A 4ZB9A 1O7UA 5CP1A 4KNDA 2JSZA 3GYKA 1HD2A 1VF1A 5EVOA 4V1Ap 2V2GA 1O81A 2WGRA 1ERUA 2C1YA 1K0AA 3I9V2 6GSTA 2LQOA 2AYTA 1S3DA 1N8JA 1PL2A 3KXOA 4E8EA 1XPVA 4HU7A 2PGTA 1LBKA 1TU7A 2YZUA 2DJJA 12GSA 4EXJA 4G10A 3BCKA 4DSQA 5H5QA 3ME8A 3HJOA 5HQPA 5IMVA 1M2DA 3Q6OA 2HT9A 2TRXA 4TRXA 1K3LA 2G2QA 2NPBA 1GSFA 3VLNA 2O85A 1Z5YE 2VL9A 2ON7A 5IMFA 1LU4A 2FCHA 2NTOA 4I6XA 1OC3A 4JZQA 1OYJA 3LQ7A 4IQAA 3F6FA 1ZOFA 3ZL5A 5ID2B 1SU9A 1M2BA 2K9FA 3VK9A 2GDRA 4HQSA 2L6DA 2VD0A 13GSA 1GTBA 3EE2A 3V1WA 5B8BA 1JZWA 1QK8A 4EL1A 3VWVA 4IP1A 5IIZA
chains in the Genus database with same CATH superfamily
6GSUA 1NHYA 2YCDA 4RI7A 1KNGA 3TOUA 4HZ4A 2VOCA 3PH9A 2R5GA 5G2ZA 2VLVA 1PRXA 1PL1A 2I1UA 3GKMA 4ZL9A 5HR0A 1FAAA 1O85A 4KW6A 4G2EA 2GSTA 4DVCA 2QA1A 4OCEA 4KSOA 2HSMB 2O87A 3US3A 3UJ1A 2YN1A 2A2PA 1DE1A 4K0GA 4JRRA 5ECLB 2CAQA 2GSQA 4TXOB 3C8EA 1E2YA 1DE2A 2H6YA 2XBQA 3RHBA 4XS4B 2DJ3A 2AJQB 1GSDA 4BA7A 1TXUA 1SJZA 2GZYA 4LLRA 2WDUA 2FA8A 2N5FA 1FB0A 1QMVA 2WZ9A 4K9ZA 5BMUA 3C7MA 3APQA 1TKDB 4KDXA 4GSSA 4YQUA 1XOAA 4RI6A 4PI2C 4FXYP 2P0GA 4JR6A 2YANA 4POMA 1TJDA 3WD6A 3ZYWA 2H1LA 5IM9A 3M3MA 1HQOA 4BL7A 1F2EA 5AIVA 4D73B 5DDLA 2HRKA 3GH6A 1TK8B 2WW2A 5JWRB 3F9UA 1AQVA 4PX1A 2H6ZA 2Z9SA 3WYWA 2H8LA 4MF6A 3DRNA 4GTUA 2OA7A 2JZRA 5JCGA 3CYNA 4NHZA 1MDJA 5A1NA 2WS2A 1WPIA 2QKEA 5IIZA 2MMNA 3KP8A 1AQWA 4KSMA 2H74A 1K0DA 3GSSA 2LS5A 2JADA 4OFTA 1SK1A 4X1UA 2IMDA 4Z2RA 3ZLPA 2EC4A 2IWTA 2C0FA 4TR0A 3DYRA 1XZOA 3FZ9A 1GL8A 2X64A 1XW6A 3IC4A 3EU3A 4DSSB 4O5QA 4IJ3A 2DIYA 3DGQA 4L0WA 1X0RA 1YF1A 1SL0B 2HRKB 1ERVA 2CX4A 3C73A 4TR1A 3HDCA 2WJUA 2VUPA 1JHBA 2R6KA 4MA9A 3APOA 4TKYA 3H79A 2V32A 3KZQA 1H4OA 3FR6A 3H1NA 4Z7XA 5C04A 4X0XA 4PQHA 5JCUA 4PTSA 3TDGA 1V2AA 4PNFA 1VRSD 4Z2TA 5IOXA 5GAPD 2DLXA 3IR4A 5AISA 4BVYA 2R0PA 4ID0A 3FRCA 1MTCA 2MMAA 4KCEA 4Q5FA 3A3TA 2JZTA 4TR1B 4KUNA 4BWQA 4ZL7A 4BVXA 1W4VA 1XW5A 2HZFA 4NWYA 2A4HA 4NHWA 1CQGA 5J9BA 2CVDA 1PN9A 5F06A 3KEBA 4MH3A 4OFNA 2TRCP 2VLUA 3QFBC 2V41A 3MYDA 5HR1A 3RPNA 5LCZA 2VCWA 3FZ4A 2JSYA 2L6CA 1K3OA 1TOFA 5A5KA 1FG4A 4KA0A 5ELAA 4ECJA 3FKFA 1YKCA 5CRHA 1GTIA 4JR4A 4FH8A 2RIIA 11GSA 4HEA2 4HQZA 4MH2A 4BVYB 3KTLA 7GSSA 20GSA 1PN0A 10GSA 1U88A 5B7CA 1AC1A 1SENA 4AKHA 3W8SA 2X8GA 5DALA 2B7JA 5B6MA 3IV4A 3F63A 3HJPA 3TRQA 4CY8A 3RHCA 3DIEA 2O89A 2FWEA 1ILOA 2GZPA 3IK9A 3HVSA 2CVBA 2IFQB 1GUKA 1GH2A 4EDZA 4Q5QA 4K2XA 4K5RA 3FEUA 1XW9A 3G7YA 2VIMA 1ZMAA 1BF5A 2HE3A 2KP1A 5AIXA 2EIRA 2FWHA 3ZIJA 2ZUPA 4O5RA 3A5IA 4WXTA 5G30A 3GSTA 1YKAA 4L8EA 3EURA 2E2MA 1G7OA 3A2WA 5EPFA 1YF0A 2H1BA 3PINA 1F3AA 2B3SA 1TK0B 5B8AA 1YDKA 1TRUA 3HZ4A 4KH7A 2B5EA 4YKGA 1LJRA 1M3JA 6GSSA 3HD5A 2X8HA 2RUEA 2CZ3A 3SBCA 1M3IA 1EV9A 4X43A 3NOFA 2IMFA 1YY7A 3PPUA 3ZVJA 3TGZA 2LNSA 4KE3A 2O8VB 2VL2C 2VLTA 1W89A 5GSTA 2B1LA 3C71A 2F51A 4MK3A 4IELA 3CHXC 2M72A 2OE3A 3O76A 1EEJA 2VAFA 3Q74A 1SKSB 1F3BA 1KEBA 4N0ZA 2VCXA 2F9SA 2WW0A 4USSA 4K7IA 4HU9A 4EIQA 1SK0A 2GS3A 3APSA 3IAM2 3TB2A 2DJ2A 4WKWA 1YQ1A 4E68A 4QQ7A 3GH9A 1R7HA 4ECIA 1TI3A 3UIWA 1EGOA 3M8NA 3OR5A 4MJCA 3PR8A 4LMVA 4EUYA 4V2LA 4F9ZA 2YPMA 3UMAA 3HZ8A 2EFDA 1X9MB 2IPAA 2O7KA 1EP7A 1ZYEA 4OD7A 1C72A 4PQ1A 3KM6A 1GSYA 2H1AA 4I8BA 4KCAA 2WW1A 4KDYA 3ZITA 2IJYA 4HS1A 2B5XA 1U87A 2O36A 3KMOA 3ZTLA 2GQKA 1T1VA 4ISDA 4K7OA 2YV7A 2H19A 1AW9A 4AGSA 2XHFA 2GQLA 3IK7A 2GVPA 2V6KA 3D22A 5A5HA 2YP6A 6GSXA 2PBJA 3KP9A 3UEMA 2N5BA 4MF5A 4GQFA 1O8WA 3KH7A 4KB3A 1SK2A 2GT5A 2HFDA 4NXIA 2H72A 4MABA 2GZZA 1ZCPA 4JE1A 4WBRD 2KOKA 1DUGA 4V1Ag 1GNEA 1V98A 2OE1A 3UBLA 1ZYNA 5CO3A 2WULA 1IYHA 17GSA 2HLSA 1XFLA 2LEGA 3J7Yk 4POBA 5J4YA 1WRYA 2PMTA 5LNKe 3GUSA 1VF3A 6GSYA 5F8BA 4JBBA 2E7PA 1O6JA 1NSWA 4AKIA 4KGIA 2DJ0A 3UBKA 1JFUA 2CQ9A 3VI5A 2H01A 3TJJA 1AUCA 3NZNA 2JU5A 2X8CA 5KN1A 5C00A 4PHZC 2K18A 3NIVA 2HYXA 4O32A 1A24A 2E0QA 5ECQB 4YH2A 2QSIA 3U6VA 4MZWA 5D93A 2AHEA 4AKXB 3TU3B 3DXBA 8GSSA 3CXGA 3TRXA 1ON4A 2OE0A 2H73A 3P90A 4MMMA 3HKRA 4HOJA 1PSQA 1ST9A 2PERA 1EEMA 1KBNA 3BJ5A 3H8QA 3CWGA 2WRTA 1SD9A 3ME7A 3UL3A 4IBPA 5A4WA 4KF9A 2WVYA 2PPTA 2QGVA 3FMWA 4FIWA 3G7IA 1M2AA 1XWAA 1GUMA 5IMAA 1ML6A 3HJMA 4ZB7A 2DJKA 4XRAA 4EIPA 4AJ8A 2QA2A 2R3XA 3VWWA 3ZFLA 1TXXA 4FYBA 2I81A 4XCSA 4L5LA 4I5QA 5ENUA 4ICYA 4GSNA 2MZCA 3F4RA 2C0GA 1CQHA 4P3YB 2WVXA 1XBSA 3D5JA 1GSEA 2FHEA 2C3TA 2ON5A 5IPHA 3HCZA 4MZCA 1SKRB 3UOMA 4FQUA 4XRDA 2H66A 2FNOA 4ACSA 2CA8A 2KLXA 1PGTA 5FHIA 1TU8A 4XTSA 1XIYA 3UVHA 2GSRA 3QD9A 2YNXA 5FT3A 3W6GA 3DWVA 4XS1A 1BAYA 4K5SA 3HHVA 1K0BA 3DVXA 3VURA 3C1RA 3DVWA 5EY6A 4NAXA 1EP8A 1Y6EA 3F3RA 1UC7A 4GCIA 1TRVA 3IC8A 5JWOB 1Z6MA 2CT6A 2A2SA 1T4YA 1XCCA 1ACVA 2E2GA 3A2XA 1URMA 2J23A 1J08A 4J56E 5BRTA 4AF2A 3IRAA 2B7KA 1SVLA 5CREA 3A5WA 3PGTA 3HMJG 2EIOA 2H70A 2RLIA 1TW9A 1YEPA 1BG5A 1ABAA 3CRUA 2FLSA 1GUHA 4X4JA 1F37A 1RW1A 3ERFA 4LMWA 5BMUB 4EF0A 1XOBA 1ZYQB 2DIZA 1JZRA 5F05A 3WGXA 5AGYA 2WFCA 3F3QA 1BEDA 1A0RP 1ERTA 1K3YA 5IMZA 4H86A 4BL7B 1YZXA 2LSTA 3RAZA 2P5RA 2C80A 4MP4A 4ZBBA 3ED3A 3LEFA 2GLRA 2ES7A 5G1LA 5LD0A 1SVOA 2HRFA 14GSA 3UVTA 4NMUA 4BWSA 4BIKA 4EDYA 1XWKA 3D0ZA 3CTGA 5J40A 1UA5A 5A1NB 4POKA 3D4MA 5G5EA 3A2VA 5CAXA 1E6BA 2YJHA 3GURA 5G5FA 2CV4A 5D9WA 1WOUA 5A4UA 3M1GA 5IO0A 5F07A 1ZL9A 1X9SB 2BMXA 4MDCA 1EWXA 3MAKA 1O73A 3E9JB 2VKZG 4K6XA 4G0LA 1MEKA 2B1KA 4BPYA 3RPPA 4ZBAA 4EKZA 5J5NA 1EV4A 2OKAA 2LNTA 4NV2A 1MD3A 1GTUA 2IMKA 5A34A 1OC9A 3GRXA 2UV8G 1B9YC 2FWFA 2OT3A 4IJIA 1FHEA 1N2AA 2HZEA 3R3EA 1R5PA 3C1SA 5G31A 3WT1A 4AI6A 3IHQA 4OCFA 5HR2A 1JZDA 4I97A 1V57A 2REMA 4ZILA 4BVXB 4MPFA 3VI7A 1XVWA 3TJBA 4GXZA 3LW9A 3KGKA 1A2MA 3QAWA 3GFKA 3IPZA 3TKPA 2VCTA 3ZMKA 1AQXA 1SKWB 1PX7A 1YJ6A 1M99A 2H0IA 2HXKA 1QQ2A 5A34B 1ZGNA 2LJRA 3CSJA 3D21A 1USBA 1G7EA 5KN3A 4XIHA 3CTFA 5COHA 5DCGA 2AB6A 2AV4A 3EVIA 1B8XA 5CRDA 3J7Yb 4WBJA 2YWIA 2YWMA 5GSSA 2GGTA 3AY8A 1TRSA 1Y25A 3ZZXA 3K8NA 3WGDA 1VF2A 3FR9A 4FO5A 5DALB 1M9AA 2XPEA 1XWGA 3ZREA 2LRCA 3QDNA 3QAVA 4N10A 4K2DA 2H0GA 3GN3A 1TRWA 5H5RA 1Q4JA 1X9WB 4CDOA 1PQNA 3LXTA 3L9UA 1UN2A 3ISOA 3ZVJD 1SL1B 3L4NA 5DCHA 4L5OA 3GMFA 1GRXA 3LYKA 3FZAA 1WIKA 1Z6NA 3I69A 4TR4A 3HY2A 3TRPA 4F0CA 3LWAA 4G19A 2R0CA 1B4QA 1XWBA 5ECPB 19GSA 1SD8A 4V2NA 4IW9A 5ECNB 4G0KA 3ZRDA 3HYPA 3UARA 1T00A 2J9HA 1YVLA 4ULXA 2K8SA 1R4WA 4CHSA 2X4AA 3TOTA 1TK5B 1PKWA 2DSAA 1T3BA 3FHKA 3IHGA 4GLTA 1A2LA 1HNAA 2LKUA 2XPDA 1QFNA 2G0FA 1YEXA 3FY7A 4EE0A 4FYCA 3M9JA 3F8UA 3CMIA 5ECSA 1ZZYA 3RFRC 2LRTA 5E59A 5JCWA 1TDIA 2YJ7A 1IYIA 1AIUA 2B5YA 1WE0A 5KN2A 3VFIA 1K0OA 3EMPA 6GSWA 16GSA 4IQ1A 4OO4A 1DSBA 2LJAA 3LJRA 1TTZA 3P8WA 5J4UA 1PA3A 3ZIVA 3DEXA 2WB9A 1I1IP 1SL2B 1RQMA 4YKFA 5IMCA 1YEWC 4TR3A 9GSSA 4MF7A 5J47A 1SYRA 5GAND 3DKSA 1A0FA 1S3CA 3O6TA 2NVLA 4GDFA 1ERWA 2DKIA 3M9KA 1Z9HA 4WETA 4IN0A 1X5EA 2YWNA 5FWGA 4IP6A 1EZKA 2DMLA 5B6NA 3RDWA 1A2JA 2H30A 1B48A 3KD0A 4GRFA 2AUVA 4ILFA 2VD1A 2PUKC 1AXDA 3N9JA 5F0GA 3TCOA 4PXOA 1FVJA 18GSA 1U3AA 3QFAC 3H4KA 4HUAA 1GULA 2PWJA 3O3TA 2L4QA 1UVZA 1OC8A 4AJ6A 2H6XA 1A8YA 1I5GA 2LJKA 4PGTA 4GWRA 4WEYA 2P31A 2JACA 4RUVA 5DAKA 2L5OA 3JCML 3GL5A 4LL1B 3L78A 3TUEA 1FO5A 4GQCA 3LYPA 1PMTA 5ID2A 5EL8A 4ZBDA 2KP2A 3EYTA 5A5HB 2A4VA 4RQRA 1HNCA 1I9DA 1G6WA 3F4SA 1MD4A 3FZ5A 1O8XA 3TKSE 5J9CA 2CX3A 2L5LA 3LFLA 1WMJA 1X5CA 4KAEA 2GTUA 3QMXA 3Q19A 4NV5A 5H5SA 4MJBA 4IKHA 1EOGA 1QUWA 1JLVA 2GT6A 4N0VA 2H76A 2MYGA 3IE3A 5DAKB 1NHOA 4K7NA 3BD2A 2MMZA 5CYYA 2C3NA 4CY6A 3LSZA 5ECKB 4FYUA 1M9BA 1FVKA 4TXVA 3MIXA 3M0FA 4Q5RA 1XVQA 5ECHB 4YAPA 3ERGA 2FWGA 2L4CA 2FA4A 2I4AA 2HSMA 2OBIA 1X5DA 3VPQA 3RBTA 3D4TA 3TJGA 3D6IA 4TXOA 1G6YA 2UZ8A 3GKXA 4IHUA 4DSRA 2WCIA 4XS4A 1V40A 4EC0A 3HA9A 4WF4A 4L0UA 2FD3A 2H75A 4XS6A 3EMXA 1XXUA 3TKRA 4V2MA 3HVXA 4PUAA 2V6OA 1J0FA 1H75A 5CRWA 4F03A 2C0DA 2C4JA 2OADA 1MDKA 2C3QA 2HSNA 2HRNA 3I43A 2H1DA 2N5AA 1S3AA 1K0CA 1PX6A 4F82A 4EO3A 4D73A 3TKQA 2YWOA 4TN8A 2YV9A 2XBIA 2VCQA 1T8EB 1NM3A 22GSA 1TI1A 1Z7RA 3G7JA 5KOWA 3FR3A 1QXHA 2H0HA 5HR3A 1PKZA 5KEJA 4HJMA 2HQTA 2IL3A 3P2AA 4IS0A 4IVFA 2WVXB 1FOHA 3IOSA 2O3EA 3GKNA 4DSSA 2HSNB 3QAGA 4LL4B 1Z3EA 3HVVA 2R2JA 3F6DA 4YQVA 1BQ7A 1B4PA 4AJ7A 3ERWA 1GTAA 1GWCA 4ML6A 2HRAA 3R2QA 2L57A 1S3RA 3DD3A 4G01A 4OFMA 2YZHA 2FUG2 2DC5A 4JEDA 3E3EA 1N25A 5HFGA 2HNLA 1Y1UA 2PVQA 4ECBA 1A8LA 1B9XC 1FW1A 4K8MA 4ZL8A 2IMIA 2IMEA 5KN0A 2CAIA 1BYEA 1BJXA 2BTOT 2LV3A 1GP1A 1VGLA 1GLQA 4WR5A 5AN1A 5CRGA 2VCVA 5DQYA 4LA1A 2F3MA 5ABRA 1Z7PA 4O92A 3ZFBA 3VWXA 3LG6A 2B6MA 3MSZA 4O5UA 1OKDA 4QL9A 2JZSA 4K1FA 2HSYA 2QC7A 2PU9C 5DJMA 4ZXGA 1SYXA 1EGRA 3RGBC 4MJEA 3KIJA 4I2UA 2VO4A 4ECCA 4F2IA 3SWLA 3P7XA 2A2RA 3CRTA 2M46A 5INYA 1HYUA 3QOUA 5J3RA 2BJXA 2VL3A 3HVNA 1GSQA 3EC3A 2LUSA 5ECMB 4AKGA 4PURA 1VF4A 4J57E 2PN8A 4G0IA 4YAVA 1MDIA 4GSTA 2H1GA 2ALBA 3VWUA 4YQMA 4HJ2A 3KTBA 1S4BP 1OAZA 1OKTA 1WJKA 2YOIA 1F9MA 3F4TA 1T7PB 2F8FA 4MPGA 5JWQB 2R0GA 3CSIA 4Q5NA 4PI0C 4TW5A 4OO5A 4QL7A 3TJKA 1M0UA 2F8AA 4MCUA 4DEJA 2NDOA 3KJYA 3CBUA 1SVMA 2EFCA 3LXZA 3BCIA 2IIYA 4ML1A 1T4ZA 4IGJA 2IFQA 1BX9A 3GIXA 1K0NA 1R5AA 1K0MA 3KCMA 3IA1A 4TVEA 2K6VA 1EOHA 2ZNMA 2R4VA 1THXA 5ECRB 3EINA 2OACA 3F0IA 1OC9B 2M80A 5CNWA 1A23A 2DKHA 2K8VA 1OVNA 4HI7A 2HZEB 5IMDA 3FK8A 2RUFA 4JU5A 1WWJA 1U3IA 2P5QA 2RM6A 1TP9A 4MLYA 5DQSA 5A4VA 4EVMA 5IOWA 2L59A 1FOVA 4HDEA 2GSSA 1XG8A 3LGCA 5D9TA 3S9FA 2V1MA 2EFHA 4MJAA 5DBQA 1QGVA 2C0EA 2X99A 3WT2A 3G9BA 4O7HA 2FY6A 4J2FA 4WR4A 1WP0A 1FB6A 3GKKA 2VM1A 2VM2A 2MBSA 4Z2UA 3TKSA 3QPMA 3GX8A 4F0BA 1M7TA 2DMMA 4ZB6A 2KUCA 5IQYA 2LRNA 1F6MC 2VL2A 4E8HA 2MMOA 3TJFA 3H93A 5D9XA 2KHPA 2CZ2A 3IBHA 1OE7A 6GSVA 4PQIA 2AAWA 5ELGA 5D9VA 2XC2A 5ECOB 3MDKA 5HFKA 4PNGA 5D8IA 3HXSA 1V58A 3QR6A 2I3YA 3N5OA 3IXRA 3U5RE 5ECIB 3LORA 4MZBA 1GLPA 2HI7A 3CSHA 3GX0A 2O5VA 5KOXA 1THOA 4HZ2A 3UAPA 4KX4A 3Q18A 3VPTA 4POLA 5DJLA 4NPBA 2ZCTA 3TKSC 2X49A 3EU4A 2H71A 4QMKA 3FYGA 5E4WA 2R37A 2OJLA 3FW2A 1JLWA 4G9HA 2LQQA 2TIRA 1BG1A 1HNBA 5L71A 1SJIA 4OMVA 4RQXA 1RK4A 4GF0A 1V9WA 4PUFC 2IN3A 3I6AA 2D2ZA 1DBYA 4K0NA 5D73A 1U6TA 4KDUA 4ZIJA 3GV1A 4N30A 1KTEA 1Q98A 2PVOC 3MNGA 3KH9A 1J9BA 1NW2A 5IO2A 2JL4A 3L0HA 2LTKA 2C8UA 2WZSA 1GSUA 3GTUA 2GQMA 3EPTA 3L9VA 1OE8A 3W8JA 4MNNA 3GHAA 3MWHA 3GL3A 3E0UA 5GZZB 2I9HA 1JZOA 2FGXA 1G0TA 2CVKA 4OWYA 5J41A 1AAZA 4WF5A 2WW3A 3BOAA 4CW9A 3IDVA 3L9SA 3DMLA 3EWLA 5G1KA 2MBTA 3QCPA 2VCZA 3GA4A 5HFIA 2EIQA 2DJ1A 4XHMA 3BBYA 3WGEA 4TOPA 1XWCA 3ZMLA 5D96A 2NBSA 2OBKA 2HSHA 1GSSA 1R26A 2RM5A 1PD21 3KMNA 1GNWA 2DBCA 3GTUB 5IPGA 5DVBA 3IAS2 1SJ6A 4ZB8A 3GNJA 4I2TA 4N11A 4ZB9A 1O7UA 5CP1A 4KNDA 2JSZA 3GYKA 1HD2A 1PFOA 1VF1A 4HSCX 5EVOA 4V1Ap 2V2GA 1O81A 2WGRA 1ERUA 2C1YA 1K0AA 3I9V2 6GSTA 2LQOA 2AYTA 1S3DA 1N8JA 1PL2A 3KXOA 4E8EA 1XPVA 4HU7A 2PGTA 1LBKA 1TU7A 2YZUA 2DJJA 12GSA 4EXJA 4G10A 3BCKA 4DSQA 5H5QA 3ME8A 3HJOA 5HQPA 5IMVA 4W66A 1M2DA 3Q6OA 2HT9A 2TRXA 4TRXA 1K3LA 2G2QA 2NPBA 1GSFA 2WVZA 3VLNA 2O85A 4N3ZA 1Z5YE 2VL9A 4A5PA 2ON7A 5IMFA 1LU4A 2FCHA 2NTOA 4I6XA 1OC3A 4JZQA 1OYJA 3LQ7A 4IQAA 3F6FA 1ZOFA 3ZL5A 5ID2B 1SU9A 1M2BA 2K9FA 3VK9A 2GDRA 4HQSA 2L6DA 2VD0A 13GSA 1GTBA 3EE2A 5J4VA 1ZYPA 3V1WA 5B8BA 1JZWA 1QK8A 3CQFA 4EL1A 3VWVA 4IP1A 2EFEA
chains in the Genus database with same CATH topology
6GSUA 1NHYA 2YCDA 4RI7A 1KNGA 3TOUA 4HZ4A 2VOCA 3PH9A 2R5GA 5G2ZA 2VLVA 1PRXA 1PL1A 2I1UA 3GKMA 4ZL9A 5HR0A 1FAAA 1O85A 4KW6A 4G2EA 2GSTA 4DVCA 2QA1A 4OCEA 4KSOA 2HSMB 2O87A 3US3A 3UJ1A 2YN1A 2A2PA 1DE1A 4K0GA 4JRRA 5ECLB 2CAQA 2GSQA 4TXOB 3C8EA 1E2YA 1DE2A 2H6YA 2XBQA 3RHBA 4XS4B 2DJ3A 2AJQB 1GSDA 4BA7A 1TXUA 1SJZA 2GZYA 4LLRA 2WDUA 2FA8A 2N5FA 1FB0A 1QMVA 2WZ9A 4K9ZA 5BMUA 3C7MA 3APQA 1TKDB 4KDXA 4GSSA 4YQUA 1XOAA 4RI6A 2P0GA 4JR6A 2YANA 4POMA 1TJDA 3WD6A 3ZYWA 2H1LA 5IM9A 3M3MA 1HQOA 4BL7A 1F2EA 5AIVA 4D73B 5DDLA 2HRKA 3GH6A 1TK8B 5JWRB 3F9UA 1AQVA 4PX1A 2H6ZA 2Z9SA 3WYWA 2H8LA 4MF6A 3DRNA 4GTUA 2OA7A 2JZRA 5JCGA 3CYNA 4NHZA 1MDJA 5A1NA 2WS2A 1WPIA 2QKEA 5IIZA 2MMNA 3KP8A 1AQWA 4KSMA 2H74A 1K0DA 3GSSA 2LS5A 2JADA 4OFTA 1SK1A 4X1UA 2IMDA 4Z2RA 3ZLPA 2EC4A 2IWTA 2C0FA 4TR0A 3DYRA 1XZOA 3FZ9A 1GL8A 2X64A 1XW6A 3IC4A 3EU3A 4DSSB 4O5QA 4IJ3A 2DIYA 3DGQA 4L0WA 1X0RA 1YF1A 1SL0B 2HRKB 1ERVA 2CX4A 3C73A 4TR1A 3HDCA 2WJUA 2VUPA 1JHBA 2R6KA 4MA9A 3APOA 4TKYA 3H79A 2V32A 3KZQA 1H4OA 3FR6A 3H1NA 4Z7XA 5C04A 4X0XA 4PQHA 5JCUA 4PTSA 3TDGA 1V2AA 4PNFA 1VRSD 4Z2TA 5IOXA 5GAPD 2DLXA 3IR4A 5AISA 4BVYA 2R0PA 4ID0A 3FRCA 1MTCA 2MMAA 4KCEA 4Q5FA 3A3TA 2JZTA 4TR1B 4KUNA 4BWQA 4ZL7A 4BVXA 1W4VA 1XW5A 2HZFA 4NWYA 2A4HA 4NHWA 1CQGA 5J9BA 2CVDA 1PN9A 5F06A 3KEBA 4MH3A 4OFNA 2TRCP 2VLUA 3QFBC 2V41A 3MYDA 5HR1A 3RPNA 5LCZA 2VCWA 3FZ4A 2JSYA 2L6CA 1K3OA 1TOFA 5A5KA 1FG4A 4KA0A 5ELAA 4ECJA 3FKFA 1YKCA 5CRHA 1GTIA 4JR4A 4FH8A 2RIIA 11GSA 4HEA2 4HQZA 4MH2A 4BVYB 3KTLA 7GSSA 20GSA 1PN0A 10GSA 1U88A 5B7CA 1AC1A 1SENA 4AKHA 3W8SA 2X8GA 5DALA 2B7JA 5B6MA 3IV4A 3F63A 3HJPA 3TRQA 4CY8A 3RHCA 3DIEA 2O89A 2FWEA 1ILOA 2GZPA 3IK9A 3HVSA 2CVBA 2IFQB 1GUKA 1GH2A 4EDZA 4Q5QA 4K2XA 4K5RA 3FEUA 1XW9A 3G7YA 2VIMA 1ZMAA 1BF5A 2HE3A 2KP1A 5AIXA 2EIRA 2FWHA 3ZIJA 2ZUPA 4O5RA 3A5IA 4WXTA 5G30A 3GSTA 1YKAA 4L8EA 3EURA 2E2MA 1G7OA 3A2WA 5EPFA 1YF0A 2H1BA 3PINA 1F3AA 2B3SA 1TK0B 5B8AA 1YDKA 1TRUA 3HZ4A 4KH7A 2B5EA 4YKGA 1LJRA 6GSSA 3HD5A 2X8HA 2RUEA 2CZ3A 3SBCA 1EV9A 4X43A 3NOFA 2IMFA 1YY7A 3PPUA 3ZVJA 3TGZA 2LNSA 4KE3A 2O8VB 2VL2C 2VLTA 1W89A 5GSTA 2B1LA 3C71A 2F51A 4MK3A 4IELA 2M72A 2OE3A 3O76A 1EEJA 2VAFA 3Q74A 1SKSB 1F3BA 1KEBA 4N0ZA 2VCXA 2F9SA 4USSA 4K7IA 4HU9A 4EIQA 1SK0A 2GS3A 3APSA 3IAM2 3TB2A 2DJ2A 4WKWA 1YQ1A 4E68A 4QQ7A 3GH9A 1R7HA 4ECIA 1TI3A 3UIWA 1EGOA 3M8NA 3OR5A 4MJCA 3PR8A 4LMVA 4EUYA 4V2LA 4F9ZA 2YPMA 3UMAA 3HZ8A 2EFDA 1X9MB 2IPAA 2O7KA 1EP7A 1ZYEA 4OD7A 1C72A 4PQ1A 3KM6A 1GSYA 2H1AA 4I8BA 4KCAA 4KDYA 3ZITA 2IJYA 4HS1A 2B5XA 1U87A 3KMOA 3ZTLA 2GQKA 1T1VA 4ISDA 4K7OA 2YV7A 2H19A 1AW9A 4AGSA 2XHFA 2GQLA 3IK7A 2GVPA 2V6KA 3D22A 5A5HA 2YP6A 6GSXA 2PBJA 3KP9A 3UEMA 2N5BA 4MF5A 4GQFA 1O8WA 3KH7A 4KB3A 1SK2A 2GT5A 2HFDA 4NXIA 2H72A 4MABA 2GZZA 1ZCPA 4JE1A 4WBRD 2KOKA 1DUGA 4V1Ag 1GNEA 1V98A 2OE1A 3UBLA 1ZYNA 5CO3A 2WULA 1IYHA 17GSA 2HLSA 1XFLA 2LEGA 3J7Yk 4POBA 5J4YA 1WRYA 2PMTA 5LNKe 3GUSA 1VF3A 6GSYA 5F8BA 4JBBA 2E7PA 1O6JA 1NSWA 4AKIA 4KGIA 2DJ0A 3UBKA 1JFUA 2CQ9A 3VI5A 2H01A 3TJJA 1AUCA 3NZNA 2JU5A 2X8CA 5KN1A 5C00A 2K18A 3NIVA 2HYXA 4O32A 1A24A 2E0QA 5ECQB 4YH2A 2QSIA 3U6VA 4MZWA 5D93A 2AHEA 4AKXB 3TU3B 3DXBA 8GSSA 3CXGA 3TRXA 1ON4A 2OE0A 2H73A 3P90A 4MMMA 3HKRA 4HOJA 1PSQA 1ST9A 2PERA 1EEMA 1KBNA 3BJ5A 3H8QA 3CWGA 2WRTA 1SD9A 3ME7A 3UL3A 4IBPA 5A4WA 4KF9A 2PPTA 2QGVA 3FMWA 4FIWA 3G7IA 1M2AA 1XWAA 1GUMA 5IMAA 1ML6A 3HJMA 4ZB7A 2DJKA 4XRAA 4EIPA 4AJ8A 2QA2A 2R3XA 3VWWA 3ZFLA 1TXXA 4FYBA 2I81A 4XCSA 4L5LA 4I5QA 5ENUA 4ICYA 4GSNA 2MZCA 3F4RA 2C0GA 1CQHA 4P3YB 1XBSA 3D5JA 1GSEA 2FHEA 2C3TA 2ON5A 5IPHA 3HCZA 4MZCA 1SKRB 3UOMA 4FQUA 4XRDA 2H66A 2FNOA 4ACSA 2CA8A 2KLXA 1PGTA 5FHIA 1TU8A 4XTSA 1XIYA 3UVHA 2GSRA 3QD9A 2YNXA 5FT3A 3W6GA 3DWVA 4XS1A 1BAYA 4K5SA 3HHVA 1K0BA 3DVXA 3VURA 3C1RA 3DVWA 5EY6A 4NAXA 1EP8A 1Y6EA 3F3RA 1UC7A 4GCIA 1TRVA 3IC8A 5JWOB 1Z6MA 2CT6A 2A2SA 1T4YA 1XCCA 1ACVA 2E2GA 3A2XA 1URMA 2J23A 1J08A 4J56E 5BRTA 4AF2A 3IRAA 2B7KA 1SVLA 5CREA 3A5WA 3PGTA 3HMJG 2EIOA 2H70A 2RLIA 1TW9A 1YEPA 1BG5A 1ABAA 3CRUA 2FLSA 1GUHA 4X4JA 1F37A 1RW1A 3ERFA 4LMWA 5BMUB 4EF0A 1XOBA 1ZYQB 2DIZA 1JZRA 5F05A 3WGXA 5AGYA 2WFCA 3F3QA 1BEDA 1A0RP 1ERTA 1K3YA 5IMZA 4H86A 4BL7B 1YZXA 2LSTA 3RAZA 2P5RA 2C80A 4MP4A 4ZBBA 3ED3A 3LEFA 2GLRA 2ES7A 5G1LA 5LD0A 1SVOA 2HRFA 14GSA 3UVTA 4NMUA 4BWSA 4EDYA 1XWKA 3D0ZA 3CTGA 5J40A 1UA5A 5A1NB 4POKA 3D4MA 5G5EA 3A2VA 5CAXA 1E6BA 2YJHA 3GURA 5G5FA 2CV4A 5D9WA 1WOUA 5A4UA 3M1GA 5IO0A 5F07A 1ZL9A 1X9SB 2BMXA 4MDCA 1EWXA 3MAKA 1O73A 3E9JB 2VKZG 4K6XA 4G0LA 1MEKA 2B1KA 4BPYA 3RPPA 4ZBAA 4EKZA 5J5NA 1EV4A 2OKAA 2LNTA 4NV2A 1MD3A 1GTUA 2IMKA 5A34A 1OC9A 3GRXA 2UV8G 1B9YC 2FWFA 2OT3A 4IJIA 1FHEA 1N2AA 2HZEA 3R3EA 1R5PA 3C1SA 5G31A 3WT1A 4AI6A 3IHQA 4OCFA 5HR2A 1JZDA 4I97A 1V57A 2REMA 4ZILA 4BVXB 4MPFA 3VI7A 1XVWA 3TJBA 4GXZA 3LW9A 3KGKA 1A2MA 3QAWA 3GFKA 3IPZA 3TKPA 2VCTA 3ZMKA 1AQXA 1SKWB 1PX7A 1YJ6A 1M99A 2H0IA 2HXKA 1QQ2A 5A34B 1ZGNA 2LJRA 3CSJA 3D21A 1USBA 1G7EA 5KN3A 4XIHA 3CTFA 5COHA 5DCGA 2AB6A 2AV4A 3EVIA 1B8XA 5CRDA 3J7Yb 4WBJA 2YWIA 2YWMA 5GSSA 2GGTA 3AY8A 1TRSA 1Y25A 3ZZXA 3K8NA 3WGDA 1VF2A 3FR9A 4FO5A 5DALB 1M9AA 2XPEA 1XWGA 3ZREA 2LRCA 3QDNA 3QAVA 4N10A 4K2DA 2H0GA 3GN3A 1TRWA 5H5RA 1Q4JA 1X9WB 4CDOA 1PQNA 3LXTA 3L9UA 1UN2A 3ISOA 3ZVJD 1SL1B 3L4NA 5DCHA 4L5OA 3GMFA 1GRXA 3LYKA 3FZAA 1WIKA 1Z6NA 3I69A 4TR4A 3HY2A 3TRPA 4F0CA 3LWAA 4G19A 2R0CA 1B4QA 1XWBA 5ECPB 19GSA 1SD8A 4V2NA 4IW9A 5ECNB 4G0KA 3ZRDA 3HYPA 3UARA 1T00A 2J9HA 1YVLA 4ULXA 2K8SA 1R4WA 4CHSA 2X4AA 3TOTA 1TK5B 1PKWA 2DSAA 1T3BA 3FHKA 3IHGA 4GLTA 1A2LA 1HNAA 2LKUA 2XPDA 1QFNA 2G0FA 1YEXA 3FY7A 4EE0A 4FYCA 3M9JA 3F8UA 3CMIA 5ECSA 1ZZYA 2LRTA 5E59A 5JCWA 1TDIA 2YJ7A 1IYIA 1AIUA 2B5YA 1WE0A 5KN2A 3VFIA 1K0OA 3EMPA 6GSWA 16GSA 4IQ1A 4OO4A 1DSBA 2LJAA 3LJRA 1TTZA 3P8WA 5J4UA 1PA3A 3ZIVA 3DEXA 2WB9A 1SL2B 1RQMA 4YKFA 5IMCA 4TR3A 9GSSA 4MF7A 5J47A 1SYRA 5GAND 3DKSA 1A0FA 1S3CA 3O6TA 2NVLA 4GDFA 1ERWA 2DKIA 3M9KA 1Z9HA 4WETA 4IN0A 1X5EA 2YWNA 5FWGA 4IP6A 1EZKA 2DMLA 5B6NA 3RDWA 1A2JA 2H30A 1B48A 3KD0A 4GRFA 2AUVA 4ILFA 2VD1A 2PUKC 1AXDA 3N9JA 5F0GA 3TCOA 4PXOA 1FVJA 18GSA 1U3AA 3QFAC 3H4KA 4HUAA 1GULA 2PWJA 3O3TA 2L4QA 1UVZA 1OC8A 4AJ6A 2H6XA 1A8YA 1I5GA 2LJKA 4PGTA 4GWRA 4WEYA 2P31A 2JACA 4RUVA 5DAKA 2L5OA 3JCML 3GL5A 4LL1B 3L78A 3TUEA 1FO5A 4GQCA 3LYPA 1PMTA 5ID2A 5EL8A 4ZBDA 2KP2A 3EYTA 5A5HB 2A4VA 4RQRA 1HNCA 1I9DA 1G6WA 3F4SA 1MD4A 3FZ5A 1O8XA 3TKSE 5J9CA 2CX3A 2L5LA 3LFLA 1WMJA 1X5CA 4KAEA 2GTUA 3QMXA 3Q19A 4NV5A 5H5SA 4MJBA 4IKHA 1EOGA 1QUWA 1JLVA 2GT6A 4N0VA 2H76A 2MYGA 3IE3A 5DAKB 1NHOA 4K7NA 3BD2A 2MMZA 5CYYA 2C3NA 4CY6A 3LSZA 5ECKB 4FYUA 1M9BA 1FVKA 4TXVA 3MIXA 3M0FA 4Q5RA 1XVQA 5ECHB 4YAPA 3ERGA 2FWGA 2L4CA 2FA4A 2I4AA 2HSMA 2OBIA 1X5DA 3VPQA 3RBTA 3D4TA 3TJGA 3D6IA 4TXOA 1G6YA 2UZ8A 3GKXA 4IHUA 4DSRA 2WCIA 4XS4A 1V40A 4EC0A 3HA9A 4WF4A 4L0UA 2FD3A 2H75A 4XS6A 3EMXA 1XXUA 3TKRA 4V2MA 3HVXA 4PUAA 2V6OA 1J0FA 1H75A 5CRWA 4F03A 2C0DA 2C4JA 2OADA 1MDKA 2C3QA 2HSNA 2HRNA 3I43A 2H1DA 2N5AA 1S3AA 1K0CA 1PX6A 4F82A 4EO3A 4D73A 3TKQA 2YWOA 4TN8A 2YV9A 2XBIA 2VCQA 1T8EB 1NM3A 22GSA 1TI1A 1Z7RA 3G7JA 5KOWA 3FR3A 1QXHA 2H0HA 5HR3A 1PKZA 5KEJA 4HJMA 2HQTA 2IL3A 3P2AA 4IS0A 4IVFA 1FOHA 3IOSA 3GKNA 4DSSA 2HSNB 3QAGA 4LL4B 1Z3EA 3HVVA 2R2JA 3F6DA 4YQVA 1BQ7A 1B4PA 4AJ7A 3ERWA 1GTAA 1GWCA 4ML6A 2HRAA 3R2QA 2L57A 3DD3A 4G01A 4OFMA 2YZHA 2FUG2 2DC5A 4JEDA 3E3EA 1N25A 5HFGA 2HNLA 1Y1UA 2PVQA 4ECBA 1A8LA 1B9XC 1FW1A 4K8MA 4ZL8A 2IMIA 2IMEA 5KN0A 2CAIA 1BYEA 1BJXA 2BTOT 2LV3A 1GP1A 1VGLA 1GLQA 4WR5A 5AN1A 5CRGA 2VCVA 5DQYA 4LA1A 2F3MA 5ABRA 1Z7PA 4O92A 3ZFBA 3VWXA 3LG6A 2B6MA 3MSZA 4O5UA 1OKDA 4QL9A 2JZSA 4K1FA 2HSYA 2QC7A 2PU9C 5DJMA 4ZXGA 1SYXA 1EGRA 4MJEA 3KIJA 4I2UA 2VO4A 4ECCA 4F2IA 3SWLA 3P7XA 2A2RA 3CRTA 2M46A 5INYA 1HYUA 3QOUA 5J3RA 2BJXA 2VL3A 1GSQA 3EC3A 2LUSA 5ECMB 4AKGA 4PURA 1VF4A 4J57E 2PN8A 4G0IA 4YAVA 1MDIA 4GSTA 2H1GA 2ALBA 3VWUA 4YQMA 4HJ2A 3KTBA 1OAZA 1OKTA 1WJKA 2YOIA 1F9MA 3F4TA 1T7PB 2F8FA 4MPGA 5JWQB 2R0GA 3CSIA 4Q5NA 4TW5A 4OO5A 4QL7A 3TJKA 1M0UA 2F8AA 4MCUA 4DEJA 2NDOA 3KJYA 3CBUA 1SVMA 2EFCA 3LXZA 3BCIA 2IIYA 4ML1A 1T4ZA 4IGJA 2IFQA 1BX9A 3GIXA 1K0NA 1R5AA 1K0MA 3KCMA 3IA1A 4TVEA 2K6VA 1EOHA 2ZNMA 2R4VA 1THXA 5ECRB 3EINA 2OACA 3F0IA 1OC9B 2M80A 5CNWA 1A23A 2DKHA 2K8VA 1OVNA 4HI7A 2HZEB 5IMDA 3FK8A 2RUFA 4JU5A 1WWJA 1U3IA 2P5QA 2RM6A 1TP9A 4MLYA 5DQSA 5A4VA 4EVMA 5IOWA 2L59A 1FOVA 4HDEA 2GSSA 3LGCA 5D9TA 3S9FA 2V1MA 2EFHA 4MJAA 5DBQA 1QGVA 2C0EA 2X99A 3WT2A 3G9BA 4O7HA 2FY6A 4J2FA 4WR4A 1WP0A 1FB6A 3GKKA 2VM1A 2VM2A 2MBSA 4Z2UA 3TKSA 3QPMA 3GX8A 4F0BA 1M7TA 2DMMA 4ZB6A 2KUCA 5IQYA 2LRNA 1F6MC 2VL2A 4E8HA 2MMOA 3TJFA 3H93A 5D9XA 2KHPA 2CZ2A 3IBHA 1OE7A 6GSVA 4PQIA 2AAWA 5ELGA 5D9VA 2XC2A 5ECOB 3MDKA 5HFKA 4PNGA 5D8IA 3HXSA 1V58A 3QR6A 2I3YA 3N5OA 3IXRA 3U5RE 5ECIB 3LORA 4MZBA 1GLPA 2HI7A 3CSHA 3GX0A 2O5VA 5KOXA 1THOA 4HZ2A 3UAPA 4KX4A 3Q18A 3VPTA 4POLA 5DJLA 4NPBA 2ZCTA 3TKSC 2X49A 3EU4A 2H71A 4QMKA 3FYGA 5E4WA 2R37A 2OJLA 3FW2A 1JLWA 4G9HA 2LQQA 2TIRA 1BG1A 1HNBA 5L71A 1SJIA 4OMVA 4RQXA 1RK4A 4GF0A 1V9WA 4PUFC 2IN3A 3I6AA 2D2ZA 1DBYA 4K0NA 5D73A 1U6TA 4KDUA 4ZIJA 3GV1A 4N30A 1KTEA 1Q98A 2PVOC 3MNGA 3KH9A 1J9BA 1NW2A 5IO2A 2JL4A 3L0HA 2LTKA 2C8UA 1GSUA 3GTUA 2GQMA 3EPTA 3L9VA 1OE8A 3W8JA 4MNNA 3GHAA 3MWHA 3GL3A 3E0UA 5GZZB 2I9HA 1JZOA 2FGXA 1G0TA 2CVKA 4OWYA 5J41A 1AAZA 4WF5A 3BOAA 4CW9A 3IDVA 3L9SA 3DMLA 3EWLA 5G1KA 2MBTA 3QCPA 2VCZA 3GA4A 5HFIA 2EIQA 2DJ1A 4XHMA 3BBYA 3WGEA 4TOPA 1XWCA 3ZMLA 5D96A 2NBSA 2OBKA 2HSHA 1GSSA 1R26A 2RM5A 1PD21 3KMNA 1GNWA 2DBCA 3GTUB 5IPGA 5DVBA 3IAS2 1SJ6A 4ZB8A 3GNJA 4I2TA 4N11A 4ZB9A 1O7UA 5CP1A 4KNDA 2JSZA 3GYKA 1HD2A 1VF1A 5EVOA 4V1Ap 2V2GA 1O81A 2WGRA 1ERUA 2C1YA 1K0AA 3I9V2 6GSTA 2LQOA 2AYTA 1S3DA 1N8JA 1PL2A 3KXOA 4E8EA 1XPVA 4HU7A 2PGTA 1LBKA 1TU7A 2YZUA 2DJJA 12GSA 4EXJA 4G10A 3BCKA 4DSQA 5H5QA 3ME8A 3HJOA 5HQPA 5IMVA 4W66A 1M2DA 3Q6OA 2HT9A 2TRXA 4TRXA 1K3LA 2G2QA 2NPBA 1GSFA 3VLNA 2O85A 4N3ZA 1Z5YE 2VL9A 4A5PA 2ON7A 5IMFA 1LU4A 2FCHA 2NTOA 4I6XA 1OC3A 4JZQA 1OYJA 3LQ7A 4IQAA 3F6FA 1ZOFA 3ZL5A 5ID2B 1SU9A 1M2BA 2K9FA 3VK9A 2GDRA 4HQSA 2L6DA 2VD0A 13GSA 1GTBA 3EE2A 5J4VA 1ZYPA 3V1WA 5B8BA 1JZWA 1QK8A 4EL1A 3VWVA 4IP1A 2EFEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 6GSU A;  1NHY A;  2YCD A;  4RI7 A;  1KNG A;  3TOU A;  4HZ4 A;  2VOC A;  3PH9 A;  2R5G A;  5G2Z A;  2VLV A;  1PRX A;  1PL1 A;  2I1U A;  3GKM A;  4ZL9 A;  5HR0 A;  1FAA A;  1O85 A;  4KW6 A;  4G2E A;  2GST A;  4DVC A;  4OCE A;  4KSO A;  2HSM B;  2O87 A;  3US3 A;  3UJ1 A;  2YN1 A;  1DE1 A;  4K0G A;  4JRR A;  5ECL B;  2CAQ A;  2GSQ A;  4TXO B;  3C8E A;  1E2Y A;  1DE2 A;  2H6Y A;  2XBQ A;  3RHB A;  4XS4 B;  2DJ3 A;  2AJQ B;  1GSD A;  4BA7 A;  1SJZ A;  2GZY A;  4LLR A;  2WDU A;  2FA8 A;  2N5F A;  1FB0 A;  1QMV A;  2WZ9 A;  4K9Z A;  5BMU A;  3C7M A;  3APQ A;  1TKD B;  4KDX A;  4GSS A;  4YQU A;  1XOA A;  4RI6 A;  2P0G A;  4JR6 A;  2YAN A;  4POM A;  1TJD A;  3WD6 A;  3ZYW A;  5IM9 A;  3M3M A;  1HQO A;  4BL7 A;  1F2E A;  5AIV A;  4D73 B;  5DDL A;  2HRK A;  3GH6 A;  1TK8 B;  5JWR B;  3F9U A;  1AQV A;  4PX1 A;  2H6Z A;  2Z9S A;  3WYW A;  2H8L A;  4MF6 A;  3DRN A;  4GTU A;  2OA7 A;  2JZR A;  5JCG A;  3CYN A;  4NHZ A;  1MDJ A;  2WS2 A;  1WPI A;  2QKE A;  2MMN A;  3KP8 A;  1AQW A;  4KSM A;  2H74 A;  1K0D A;  3GSS A;  2LS5 A;  2JAD A;  4OFT A;  1SK1 A;  4X1U A;  2IMD A;  3ZLP A;  2EC4 A;  2IWT A;  2C0F A;  4TR0 A;  3DYR A;  1XZO A;  3FZ9 A;  1GL8 A;  2X64 A;  1XW6 A;  3IC4 A;  3EU3 A;  4DSS B;  4IJ3 A;  2DIY A;  3DGQ A;  4L0W A;  1X0R A;  1YF1 A;  1SL0 B;  2HRK B;  1ERV A;  2CX4 A;  3C73 A;  4TR1 A;  3HDC A;  2WJU A;  2VUP A;  1JHB A;  2R6K A;  4MA9 A;  3APO A;  4TKY A;  3H79 A;  2V32 A;  3KZQ A;  1H4O A;  3FR6 A;  3H1N A;  4Z7X A;  5C04 A;  4X0X A;  4PQH A;  5JCU A;  4PTS A;  3TDG A;  1V2A A;  4PNF A;  1VRS D;  5IOX A;  5GAP D;  2DLX A;  3IR4 A;  5AIS A;  4BVY A;  4ID0 A;  3FRC A;  1MTC A;  2MMA A;  4KCE A;  4Q5F A;  3A3T A;  2JZT A;  4TR1 B;  4KUN A;  4BWQ A;  4ZL7 A;  4BVX A;  1W4V A;  1XW5 A;  2HZF A;  4NWY A;  4NHW A;  1CQG A;  5J9B A;  2CVD A;  1PN9 A;  5F06 A;  3KEB A;  4MH3 A;  4OFN A;  2TRC P;  2VLU A;  3QFB C;  2V41 A;  5HR1 A;  3RPN A;  5LCZ A;  2VCW A;  3FZ4 A;  2JSY A;  2L6C A;  1K3O A;  1TOF A;  5A5K A;  1FG4 A;  4KA0 A;  5ELA A;  4ECJ A;  3FKF A;  1YKC A;  5CRH A;  1GTI A;  4JR4 A;  4FH8 A;  2RII A;  11GS A;  4HEA 2;  4HQZ A;  4MH2 A;  4BVY B;  3KTL A;  7GSS A;  20GS A;  10GS A;  1U88 A;  5B7C A;  1AC1 A;  1SEN A;  3W8S A;  2X8G A;  5DAL A;  2B7J A;  5B6M A;  3IV4 A;  3F63 A;  3HJP A;  3TRQ A;  3RHC A;  3DIE A;  2O89 A;  2FWE A;  1ILO A;  2GZP A;  3IK9 A;  3HVS A;  2CVB A;  2IFQ B;  1GUK A;  1GH2 A;  4EDZ A;  4Q5Q A;  3FEU A;  1XW9 A;  3G7Y A;  2VIM A;  1ZMA A;  2HE3 A;  2KP1 A;  5AIX A;  2EIR A;  2FWH A;  3ZIJ A;  2ZUP A;  4O5R A;  4WXT A;  5G30 A;  3GST A;  1YKA A;  4L8E A;  3EUR A;  2E2M A;  1G7O A;  3A2W A;  5EPF A;  1YF0 A;  2H1B A;  3PIN A;  1F3A A;  2B3S A;  1TK0 B;  5B8A A;  1YDK A;  1TRU A;  3HZ4 A;  4KH7 A;  2B5E A;  1LJR A;  6GSS A;  3HD5 A;  2X8H A;  2RUE A;  2CZ3 A;  3SBC A;  1EV9 A;  4X43 A;  3NOF A;  2IMF A;  1YY7 A;  3PPU A;  3ZVJ A;  3TGZ A;  2LNS A;  4KE3 A;  2O8V B;  2VL2 C;  2VLT A;  1W89 A;  5GST A;  2B1L A;  3C71 A;  2F51 A;  4MK3 A;  4IEL A;  2M72 A;  2OE3 A;  3O76 A;  1EEJ A;  2VAF A;  3Q74 A;  1SKS B;  1F3B A;  1KEB A;  4N0Z A;  2VCX A;  2F9S A;  4USS A;  4K7I A;  4HU9 A;  1SK0 A;  2GS3 A;  3APS A;  3IAM 2;  3TB2 A;  2DJ2 A;  4WKW A;  1YQ1 A;  4QQ7 A;  3GH9 A;  1R7H A;  4ECI A;  1TI3 A;  3UIW A;  1EGO A;  3M8N A;  3OR5 A;  4MJC A;  3PR8 A;  4LMV A;  4EUY A;  4V2L A;  4F9Z A;  2YPM A;  3UMA A;  3HZ8 A;  1X9M B;  2IPA A;  2O7K A;  1EP7 A;  1ZYE A;  4OD7 A;  1C72 A;  4PQ1 A;  3KM6 A;  1GSY A;  2H1A A;  4I8B A;  4KCA A;  4KDY A;  3ZIT A;  2IJY A;  4HS1 A;  2B5X A;  1U87 A;  3KMO A;  3ZTL A;  2GQK A;  1T1V A;  4ISD A;  4K7O A;  2YV7 A;  2H19 A;  1AW9 A;  4AGS A;  2XHF A;  2GQL A;  3IK7 A;  2GVP A;  2V6K A;  3D22 A;  2YP6 A;  6GSX A;  2PBJ A;  3KP9 A;  3UEM A;  2N5B A;  4MF5 A;  4GQF A;  1O8W A;  3KH7 A;  4KB3 A;  1SK2 A;  2GT5 A;  2HFD A;  4NXI A;  2H72 A;  4MAB A;  2GZZ A;  1ZCP A;  4JE1 A;  4WBR D;  2KOK A;  1DUG A;  4V1A g;  1GNE A;  1V98 A;  2OE1 A;  3UBL A;  5CO3 A;  2WUL A;  1IYH A;  17GS A;  2HLS A;  1XFL A;  2LEG A;  3J7Y k;  4POB A;  1WRY A;  2PMT A;  5LNK e;  3GUS A;  1VF3 A;  6GSY A;  5F8B A;  4JBB A;  2E7P A;  1O6J A;  1NSW A;  4KGI A;  2DJ0 A;  3UBK A;  1JFU A;  2CQ9 A;  3VI5 A;  2H01 A;  3TJJ A;  1AUC A;  3NZN A;  2JU5 A;  2X8C A;  5KN1 A;  5C00 A;  2K18 A;  3NIV A;  2HYX A;  4O32 A;  1A24 A;  2E0Q A;  5ECQ B;  4YH2 A;  2QSI A;  3U6V A;  4MZW A;  5D93 A;  2AHE A;  3DXB A;  8GSS A;  3CXG A;  3TRX A;  1ON4 A;  2OE0 A;  2H73 A;  3P90 A;  4MMM A;  3HKR A;  4HOJ A;  1PSQ A;  1ST9 A;  2PER A;  1EEM A;  1KBN A;  3BJ5 A;  3H8Q A;  2WRT A;  1SD9 A;  3ME7 A;  3UL3 A;  4IBP A;  5A4W A;  4KF9 A;  2PPT A;  2QGV A;  4FIW A;  3G7I A;  1M2A A;  1XWA A;  1GUM A;  5IMA A;  1ML6 A;  3HJM A;  2DJK A;  4XRA A;  4AJ8 A;  2R3X A;  3VWW A;  3ZFL A;  1TXX A;  4FYB A;  2I81 A;  4XCS A;  4L5L A;  4I5Q A;  5ENU A;  4GSN A;  2MZC A;  3F4R A;  2C0G A;  1CQH A;  4P3Y B;  1XBS A;  3D5J A;  1GSE A;  2FHE A;  2C3T A;  2ON5 A;  5IPH A;  3HCZ A;  4MZC A;  1SKR B;  3UOM A;  4FQU A;  4XRD A;  2H66 A;  2FNO A;  4ACS A;  2CA8 A;  2KLX A;  1PGT A;  5FHI A;  1TU8 A;  4XTS A;  1XIY A;  3UVH A;  2GSR A;  3QD9 A;  2YNX A;  5FT3 A;  3W6G A;  3DWV A;  4XS1 A;  1BAY A;  3HHV A;  1K0B A;  3DVX A;  3VUR A;  3C1R A;  3DVW A;  5EY6 A;  4NAX A;  1EP8 A;  1Y6E A;  3F3R A;  1UC7 A;  4GCI A;  1TRV A;  3IC8 A;  5JWO B;  1Z6M A;  2CT6 A;  2A2S A;  1T4Y A;  1XCC A;  1ACV A;  2E2G A;  3A2X A;  1URM A;  2J23 A;  1J08 A;  4J56 E;  4AF2 A;  3IRA A;  2B7K A;  5CRE A;  3A5W A;  3PGT A;  2EIO A;  2H70 A;  2RLI A;  1TW9 A;  1YEP A;  1BG5 A;  1ABA A;  3CRU A;  2FLS A;  1GUH A;  1F37 A;  1RW1 A;  3ERF A;  4LMW A;  4EF0 A;  1XOB A;  1ZYQ B;  2DIZ A;  1JZR A;  5F05 A;  3WGX A;  5AGY A;  2WFC A;  3F3Q A;  1BED A;  1A0R P;  1ERT A;  1K3Y A;  5IMZ A;  4H86 A;  4BL7 B;  1YZX A;  2LST A;  3RAZ A;  2P5R A;  2C80 A;  4MP4 A;  4ZBB A;  3ED3 A;  3LEF A;  2GLR A;  2ES7 A;  5G1L A;  5LD0 A;  2HRF A;  14GS A;  3UVT A;  4NMU A;  4BWS A;  4EDY A;  1XWK A;  3D0Z A;  3CTG A;  1UA5 A;  4POK A;  3D4M A;  5G5E A;  3A2V A;  5CAX A;  1E6B A;  2YJH A;  3GUR A;  5G5F A;  2CV4 A;  5D9W A;  1WOU A;  5A4U A;  3M1G A;  5IO0 A;  5F07 A;  1ZL9 A;  1X9S B;  2BMX A;  4MDC A;  1EWX A;  3MAK A;  1O73 A;  3E9J B;  4K6X A;  4G0L A;  1MEK A;  2B1K A;  4BPY A;  3RPP A;  4ZBA A;  4EKZ A;  5J5N A;  1EV4 A;  2OKA A;  2LNT A;  4NV2 A;  1MD3 A;  1GTU A;  2IMK A;  1OC9 A;  3GRX A;  1B9Y C;  2FWF A;  4IJI A;  1FHE A;  1N2A A;  2HZE A;  3R3E A;  1R5P A;  3C1S A;  5G31 A;  3WT1 A;  3IHQ A;  4OCF A;  5HR2 A;  1JZD A;  4I97 A;  1V57 A;  2REM A;  4ZIL A;  4BVX B;  4MPF A;  3VI7 A;  1XVW A;  3TJB A;  4GXZ A;  3KGK A;  1A2M A;  3QAW A;  3GFK A;  3IPZ A;  3TKP A;  2VCT A;  3ZMK A;  1AQX A;  1SKW B;  1PX7 A;  1YJ6 A;  1M99 A;  2H0I A;  2HXK A;  1QQ2 A;  1ZGN A;  2LJR A;  3CSJ A;  3D21 A;  1USB A;  1G7E A;  5KN3 A;  4XIH A;  3CTF A;  5COH A;  5DCG A;  2AB6 A;  2AV4 A;  3EVI A;  1B8X A;  5CRD A;  3J7Y b;  4WBJ A;  2YWI A;  2YWM A;  5GSS A;  2GGT A;  3AY8 A;  1TRS A;  1Y25 A;  3ZZX A;  3K8N A;  3WGD A;  1VF2 A;  3FR9 A;  4FO5 A;  5DAL B;  1M9A A;  2XPE A;  1XWG A;  3ZRE A;  2LRC A;  3QDN A;  3QAV A;  4N10 A;  4K2D A;  2H0G A;  3GN3 A;  1TRW A;  5H5R A;  1Q4J A;  1X9W B;  4CDO A;  1PQN A;  3LXT A;  3L9U A;  1UN2 A;  3ISO A;  3ZVJ D;  1SL1 B;  3L4N A;  5DCH A;  4L5O A;  3GMF A;  1GRX A;  3LYK A;  3FZA A;  1WIK A;  1Z6N A;  3I69 A;  4TR4 A;  3HY2 A;  3TRP A;  4F0C A;  3LWA A;  4G19 A;  1B4Q A;  1XWB A;  5ECP B;  19GS A;  1SD8 A;  4V2N A;  4IW9 A;  5ECN B;  4G0K A;  3ZRD A;  3HYP A;  3UAR A;  1T00 A;  2J9H A;  4ULX A;  2K8S A;  1R4W A;  4CHS A;  3TOT A;  1TK5 B;  1PKW A;  2DSA A;  1T3B A;  3FHK A;  4GLT A;  1A2L A;  1HNA A;  2LKU A;  2XPD A;  1QFN A;  2G0F A;  1YEX A;  3FY7 A;  4EE0 A;  4FYC A;  3M9J A;  3F8U A;  3CMI A;  5ECS A;  1ZZY A;  2LRT A;  5E59 A;  5JCW A;  1TDI A;  2YJ7 A;  1IYI A;  1AIU A;  2B5Y A;  1WE0 A;  5KN2 A;  3VFI A;  1K0O A;  3EMP A;  6GSW A;  16GS A;  4IQ1 A;  4OO4 A;  1DSB A;  2LJA A;  3LJR A;  1TTZ A;  3P8W A;  5J4U A;  1PA3 A;  3ZIV A;  3DEX A;  2WB9 A;  1SL2 B;  1RQM A;  5IMC A;  4TR3 A;  9GSS A;  4MF7 A;  1SYR A;  5GAN D;  3DKS A;  1A0F A;  1S3C A;  3O6T A;  2NVL A;  1ERW A;  3M9K A;  1Z9H A;  4WET A;  4IN0 A;  1X5E A;  2YWN A;  5FWG A;  4IP6 A;  1EZK A;  2DML A;  5B6N A;  3RDW A;  1A2J A;  2H30 A;  1B48 A;  3KD0 A;  4GRF A;  2AUV A;  4ILF A;  2VD1 A;  2PUK C;  1AXD A;  3N9J A;  5F0G A;  3TCO A;  4PXO A;  1FVJ A;  18GS A;  1U3A A;  3QFA C;  3H4K A;  4HUA A;  1GUL A;  2PWJ A;  3O3T A;  2L4Q A;  1UVZ A;  1OC8 A;  4AJ6 A;  2H6X A;  1A8Y A;  1I5G A;  2LJK A;  4PGT A;  4GWR A;  4WEY A;  2P31 A;  2JAC A;  4RUV A;  5DAK A;  2L5O A;  3JCM L;  3GL5 A;  4LL1 B;  3L78 A;  3TUE A;  1FO5 A;  4GQC A;  3LYP A;  1PMT A;  5ID2 A;  5EL8 A;  4ZBD A;  2KP2 A;  3EYT A;  2A4V A;  4RQR A;  1HNC A;  1I9D A;  1G6W A;  3F4S A;  1MD4 A;  3FZ5 A;  1O8X A;  3TKS E;  5J9C A;  2CX3 A;  2L5L A;  3LFL A;  1WMJ A;  1X5C A;  4KAE A;  2GTU A;  3QMX A;  3Q19 A;  4NV5 A;  5H5S A;  4MJB A;  4IKH A;  1EOG A;  1QUW A;  1JLV A;  2GT6 A;  4N0V A;  2H76 A;  2MYG A;  3IE3 A;  5DAK B;  1NHO A;  4K7N A;  3BD2 A;  2MMZ A;  5CYY A;  2C3N A;  3LSZ A;  5ECK B;  4FYU A;  1M9B A;  1FVK A;  4TXV A;  3M0F A;  4Q5R A;  1XVQ A;  5ECH B;  4YAP A;  3ERG A;  2FWG A;  2L4C A;  2FA4 A;  2I4A A;  2HSM A;  2OBI A;  1X5D A;  3VPQ A;  3RBT A;  3D4T A;  3TJG A;  3D6I A;  4TXO A;  1G6Y A;  2UZ8 A;  3GKX A;  4IHU A;  4DSR A;  2WCI A;  4XS4 A;  1V40 A;  4EC0 A;  3HA9 A;  4WF4 A;  4L0U A;  2FD3 A;  2H75 A;  4XS6 A;  3EMX A;  1XXU A;  3TKR A;  4V2M A;  3HVX A;  4PUA A;  2V6O A;  1J0F A;  1H75 A;  5CRW A;  4F03 A;  2C0D A;  2C4J A;  2OAD A;  1MDK A;  2C3Q A;  2HRN A;  3I43 A;  2H1D A;  2N5A A;  1S3A A;  1K0C A;  1PX6 A;  4F82 A;  4EO3 A;  4D73 A;  3TKQ A;  2YWO A;  4TN8 A;  2YV9 A;  2XBI A;  2VCQ A;  1T8E B;  1NM3 A;  22GS A;  1TI1 A;  1Z7R A;  3G7J A;  3FR3 A;  1QXH A;  2H0H A;  5HR3 A;  1PKZ A;  5KEJ A;  4HJM A;  2HQT A;  2IL3 A;  3P2A A;  4IS0 A;  4IVF A;  3IOS A;  3GKN A;  4DSS A;  2HSN B;  3QAG A;  4LL4 B;  1Z3E A;  3HVV A;  2R2J A;  3F6D A;  4YQV A;  1BQ7 A;  1B4P A;  4AJ7 A;  3ERW A;  1GTA A;  1GWC A;  4ML6 A;  2HRA A;  3R2Q A;  2L57 A;  3DD3 A;  4OFM A;  2YZH A;  2FUG 2;  2DC5 A;  4JED A;  3E3E A;  5HFG A;  2HNL A;  2PVQ A;  4ECB A;  1A8L A;  1B9X C;  1FW1 A;  4K8M A;  4ZL8 A;  2IMI A;  2IME A;  5KN0 A;  2CAI A;  1BYE A;  1BJX A;  2BTO T;  2LV3 A;  1GP1 A;  1VGL A;  1GLQ A;  4WR5 A;  5AN1 A;  5CRG A;  2VCV A;  5DQY A;  4LA1 A;  2F3M A;  5ABR A;  1Z7P A;  4O92 A;  3ZFB A;  3VWX A;  3LG6 A;  2B6M A;  3MSZ A;  1OKD A;  4QL9 A;  2JZS A;  4K1F A;  2HSY A;  2QC7 A;  2PU9 C;  5DJM A;  4ZXG A;  1SYX A;  1EGR A;  4MJE A;  3KIJ A;  4I2U A;  2VO4 A;  4ECC A;  4F2I A;  3SWL A;  3P7X A;  2A2R A;  3CRT A;  2M46 A;  5INY A;  1HYU A;  3QOU A;  5J3R A;  2BJX A;  2VL3 A;  1GSQ A;  3EC3 A;  2LUS A;  5ECM B;  4PUR A;  1VF4 A;  4J57 E;  2PN8 A;  4G0I A;  4YAV A;  1MDI A;  4GST A;  2H1G A;  2ALB A;  3VWU A;  4YQM A;  4HJ2 A;  3KTB A;  1OAZ A;  1OKT A;  1WJK A;  2YOI A;  1F9M A;  3F4T A;  1T7P B;  2F8F A;  4MPG A;  5JWQ B;  3CSI A;  4Q5N A;  4TW5 A;  4OO5 A;  4QL7 A;  3TJK A;  1M0U A;  2F8A A;  4MCU A;  4DEJ A;  2NDO A;  3KJY A;  3CBU A;  3LXZ A;  3BCI A;  2IIY A;  4ML1 A;  1T4Z A;  4IGJ A;  2IFQ A;  1BX9 A;  3GIX A;  1K0N A;  1R5A A;  1K0M A;  3KCM A;  3IA1 A;  4TVE A;  2K6V A;  1EOH A;  2ZNM A;  2R4V A;  1THX A;  5ECR B;  3EIN A;  2OAC A;  3F0I A;  1OC9 B;  2M80 A;  5CNW A;  1A23 A;  2K8V A;  1OVN A;  4HI7 A;  2HZE B;  5IMD A;  3FK8 A;  2RUF A;  4JU5 A;  1WWJ A;  1U3I A;  2P5Q A;  2RM6 A;  1TP9 A;  4MLY A;  5DQS A;  5A4V A;  4EVM A;  5IOW A;  2L59 A;  1FOV A;  4HDE A;  2GSS A;  3LGC A;  5D9T A;  3S9F A;  2V1M A;  4MJA A;  5DBQ A;  1QGV A;  2C0E A;  2X99 A;  3WT2 A;  3G9B A;  4O7H A;  2FY6 A;  4J2F A;  4WR4 A;  1WP0 A;  1FB6 A;  3GKK A;  2VM1 A;  2VM2 A;  2MBS A;  3TKS A;  3QPM A;  3GX8 A;  4F0B A;  1M7T A;  2DMM A;  4ZB6 A;  2KUC A;  5IQY A;  2LRN A;  1F6M C;  2VL2 A;  4E8H A;  2MMO A;  3TJF A;  3H93 A;  5D9X A;  2KHP A;  2CZ2 A;  3IBH A;  1OE7 A;  6GSV A;  4PQI A;  2AAW A;  5ELG A;  5D9V A;  2XC2 A;  5ECO B;  3MDK A;  5HFK A;  4PNG A;  5D8I A;  3HXS A;  1V58 A;  3QR6 A;  2I3Y A;  3N5O A;  3IXR A;  3U5R E;  5ECI B;  3LOR A;  4MZB A;  1GLP A;  2HI7 A;  3CSH A;  3GX0 A;  1THO A;  4HZ2 A;  3UAP A;  4KX4 A;  3Q18 A;  3VPT A;  4POL A;  5DJL A;  4NPB A;  2ZCT A;  3TKS C;  3EU4 A;  2H71 A;  3FYG A;  5E4W A;  2R37 A;  2OJL A;  3FW2 A;  1JLW A;  4G9H A;  2LQQ A;  2TIR A;  1HNB A;  5L71 A;  1SJI A;  4OMV A;  4RQX A;  1RK4 A;  4GF0 A;  1V9W A;  4PUF C;  2IN3 A;  3I6A A;  2D2Z A;  1DBY A;  4K0N A;  5D73 A;  1U6T A;  4KDU A;  4ZIJ A;  3GV1 A;  4N30 A;  1KTE A;  1Q98 A;  2PVO C;  3MNG A;  3KH9 A;  1J9B A;  1NW2 A;  5IO2 A;  2JL4 A;  3L0H A;  2LTK A;  2C8U A;  1GSU A;  3GTU A;  2GQM A;  3L9V A;  1OE8 A;  3W8J A;  3GHA A;  3MWH A;  3GL3 A;  3E0U A;  5GZZ B;  2I9H A;  1JZO A;  2FGX A;  1G0T A;  2CVK A;  4OWY A;  5J41 A;  1AAZ A;  4WF5 A;  3BOA A;  4CW9 A;  3IDV A;  3L9S A;  3DML A;  3EWL A;  5G1K A;  2MBT A;  3QCP A;  2VCZ A;  3GA4 A;  5HFI A;  2EIQ A;  2DJ1 A;  4XHM A;  3BBY A;  3WGE A;  4TOP A;  1XWC A;  3ZML A;  5D96 A;  2NBS A;  2OBK A;  2HSH A;  1GSS A;  1R26 A;  2RM5 A;  1PD2 1;  3KMN A;  1GNW A;  2DBC A;  3GTU B;  5IPG A;  5DVB A;  3IAS 2;  1SJ6 A;  4ZB8 A;  3GNJ A;  4I2T A;  4N11 A;  4ZB9 A;  1O7U A;  5CP1 A;  4KND A;  2JSZ A;  3GYK A;  1HD2 A;  1VF1 A;  5EVO A;  4V1A p;  2V2G A;  1O81 A;  2WGR A;  1ERU A;  2C1Y A;  1K0A A;  3I9V 2;  6GST A;  2LQO A;  2AYT A;  1S3D A;  1N8J A;  1PL2 A;  3KXO A;  4E8E A;  1XPV A;  4HU7 A;  2PGT A;  1LBK A;  1TU7 A;  2YZU A;  2DJJ A;  12GS A;  4EXJ A;  4G10 A;  3BCK A;  4DSQ A;  5H5Q A;  3ME8 A;  3HJO A;  5HQP A;  5IMV A;  1M2D A;  3Q6O A;  2HT9 A;  2TRX A;  4TRX A;  1K3L A;  2G2Q A;  2NPB A;  1GSF A;  3VLN A;  2O85 A;  1Z5Y E;  2VL9 A;  2ON7 A;  5IMF A;  1LU4 A;  2FCH A;  2NTO A;  4I6X A;  1OC3 A;  4JZQ A;  1OYJ A;  3LQ7 A;  4IQA A;  3F6F A;  1ZOF A;  3ZL5 A;  5ID2 B;  1SU9 A;  1M2B A;  2K9F A;  3VK9 A;  2GDR A;  4HQS A;  2L6D A;  2VD0 A;  13GS A;  1GTB A;  3EE2 A;  3V1W A;  5B8B A;  1JZW A;  1QK8 A;  4EL1 A;  3VWV A;  4IP1 A;  5IIZ A; 
#chains in the Genus database with same CATH topology
 6GSU A;  1NHY A;  2YCD A;  4RI7 A;  1KNG A;  3TOU A;  4HZ4 A;  2VOC A;  3PH9 A;  2R5G A;  5G2Z A;  2VLV A;  1PRX A;  1PL1 A;  2I1U A;  3GKM A;  4ZL9 A;  5HR0 A;  1FAA A;  1O85 A;  4KW6 A;  4G2E A;  2GST A;  4DVC A;  2QA1 A;  4OCE A;  4KSO A;  2HSM B;  2O87 A;  3US3 A;  3UJ1 A;  2YN1 A;  2A2P A;  1DE1 A;  4K0G A;  4JRR A;  5ECL B;  2CAQ A;  2GSQ A;  4TXO B;  3C8E A;  1E2Y A;  1DE2 A;  2H6Y A;  2XBQ A;  3RHB A;  4XS4 B;  2DJ3 A;  2AJQ B;  1GSD A;  4BA7 A;  1TXU A;  1SJZ A;  2GZY A;  4LLR A;  2WDU A;  2FA8 A;  2N5F A;  1FB0 A;  1QMV A;  2WZ9 A;  4K9Z A;  5BMU A;  3C7M A;  3APQ A;  1TKD B;  4KDX A;  4GSS A;  4YQU A;  1XOA A;  4RI6 A;  4PI2 C;  4FXY P;  2P0G A;  4JR6 A;  2YAN A;  4POM A;  1TJD A;  3WD6 A;  3ZYW A;  2H1L A;  5IM9 A;  3M3M A;  1HQO A;  4BL7 A;  1F2E A;  5AIV A;  4D73 B;  5DDL A;  2HRK A;  3GH6 A;  1TK8 B;  2WW2 A;  5JWR B;  3F9U A;  1AQV A;  4PX1 A;  2H6Z A;  2Z9S A;  3WYW A;  2H8L A;  4MF6 A;  3DRN A;  4GTU A;  2OA7 A;  2JZR A;  5JCG A;  3CYN A;  4NHZ A;  1MDJ A;  5A1N A;  2WS2 A;  1WPI A;  2QKE A;  5IIZ A;  2MMN A;  3KP8 A;  1AQW A;  4KSM A;  2H74 A;  1K0D A;  3GSS A;  2LS5 A;  2JAD A;  4OFT A;  1SK1 A;  4X1U A;  2IMD A;  4Z2R A;  3ZLP A;  2EC4 A;  2IWT A;  2C0F A;  4TR0 A;  3DYR A;  1XZO A;  3FZ9 A;  1GL8 A;  2X64 A;  1XW6 A;  3IC4 A;  3EU3 A;  4DSS B;  4O5Q A;  4IJ3 A;  2DIY A;  3DGQ A;  4L0W A;  1X0R A;  1YF1 A;  1SL0 B;  2HRK B;  1ERV A;  2CX4 A;  3C73 A;  4TR1 A;  3HDC A;  2WJU A;  2VUP A;  1JHB A;  2R6K A;  4MA9 A;  3APO A;  4TKY A;  3H79 A;  2V32 A;  3KZQ A;  1H4O A;  3FR6 A;  3H1N A;  4Z7X A;  5C04 A;  4X0X A;  4PQH A;  5JCU A;  4PTS A;  3TDG A;  1V2A A;  4PNF A;  1VRS D;  4Z2T A;  5IOX A;  5GAP D;  2DLX A;  3IR4 A;  5AIS A;  4BVY A;  2R0P A;  4ID0 A;  3FRC A;  1MTC A;  2MMA A;  4KCE A;  4Q5F A;  3A3T A;  2JZT A;  4TR1 B;  4KUN A;  4BWQ A;  4ZL7 A;  4BVX A;  1W4V A;  1XW5 A;  2HZF A;  4NWY A;  2A4H A;  4NHW A;  1CQG A;  5J9B A;  2CVD A;  1PN9 A;  5F06 A;  3KEB A;  4MH3 A;  4OFN A;  2TRC P;  2VLU A;  3QFB C;  2V41 A;  3MYD A;  5HR1 A;  3RPN A;  5LCZ A;  2VCW A;  3FZ4 A;  2JSY A;  2L6C A;  1K3O A;  1TOF A;  5A5K A;  1FG4 A;  4KA0 A;  5ELA A;  4ECJ A;  3FKF A;  1YKC A;  5CRH A;  1GTI A;  4JR4 A;  4FH8 A;  2RII A;  11GS A;  4HEA 2;  4HQZ A;  4MH2 A;  4BVY B;  3KTL A;  7GSS A;  20GS A;  1PN0 A;  10GS A;  1U88 A;  5B7C A;  1AC1 A;  1SEN A;  4AKH A;  3W8S A;  2X8G A;  5DAL A;  2B7J A;  5B6M A;  3IV4 A;  3F63 A;  3HJP A;  3TRQ A;  4CY8 A;  3RHC A;  3DIE A;  2O89 A;  2FWE A;  1ILO A;  2GZP A;  3IK9 A;  3HVS A;  2CVB A;  2IFQ B;  1GUK A;  1GH2 A;  4EDZ A;  4Q5Q A;  4K2X A;  4K5R A;  3FEU A;  1XW9 A;  3G7Y A;  2VIM A;  1ZMA A;  1BF5 A;  2HE3 A;  2KP1 A;  5AIX A;  2EIR A;  2FWH A;  3ZIJ A;  2ZUP A;  4O5R A;  3A5I A;  4WXT A;  5G30 A;  3GST A;  1YKA A;  4L8E A;  3EUR A;  2E2M A;  1G7O A;  3A2W A;  5EPF A;  1YF0 A;  2H1B A;  3PIN A;  1F3A A;  2B3S A;  1TK0 B;  5B8A A;  1YDK A;  1TRU A;  3HZ4 A;  4KH7 A;  2B5E A;  4YKG A;  1LJR A;  1M3J A;  6GSS A;  3HD5 A;  2X8H A;  2RUE A;  2CZ3 A;  3SBC A;  1M3I A;  1EV9 A;  4X43 A;  3NOF A;  2IMF A;  1YY7 A;  3PPU A;  3ZVJ A;  3TGZ A;  2LNS A;  4KE3 A;  2O8V B;  2VL2 C;  2VLT A;  1W89 A;  5GST A;  2B1L A;  3C71 A;  2F51 A;  4MK3 A;  4IEL A;  3CHX C;  2M72 A;  2OE3 A;  3O76 A;  1EEJ A;  2VAF A;  3Q74 A;  1SKS B;  1F3B A;  1KEB A;  4N0Z A;  2VCX A;  2F9S A;  2WW0 A;  4USS A;  4K7I A;  4HU9 A;  4EIQ A;  1SK0 A;  2GS3 A;  3APS A;  3IAM 2;  3TB2 A;  2DJ2 A;  4WKW A;  1YQ1 A;  4E68 A;  4QQ7 A;  3GH9 A;  1R7H A;  4ECI A;  1TI3 A;  3UIW A;  1EGO A;  3M8N A;  3OR5 A;  4MJC A;  3PR8 A;  4LMV A;  4EUY A;  4V2L A;  4F9Z A;  2YPM A;  3UMA A;  3HZ8 A;  2EFD A;  1X9M B;  2IPA A;  2O7K A;  1EP7 A;  1ZYE A;  4OD7 A;  1C72 A;  4PQ1 A;  3KM6 A;  1GSY A;  2H1A A;  4I8B A;  4KCA A;  2WW1 A;  4KDY A;  3ZIT A;  2IJY A;  4HS1 A;  2B5X A;  1U87 A;  2O36 A;  3KMO A;  3ZTL A;  2GQK A;  1T1V A;  4ISD A;  4K7O A;  2YV7 A;  2H19 A;  1AW9 A;  4AGS A;  2XHF A;  2GQL A;  3IK7 A;  2GVP A;  2V6K A;  3D22 A;  5A5H A;  2YP6 A;  6GSX A;  2PBJ A;  3KP9 A;  3UEM A;  2N5B A;  4MF5 A;  4GQF A;  1O8W A;  3KH7 A;  4KB3 A;  1SK2 A;  2GT5 A;  2HFD A;  4NXI A;  2H72 A;  4MAB A;  2GZZ A;  1ZCP A;  4JE1 A;  4WBR D;  2KOK A;  1DUG A;  4V1A g;  1GNE A;  1V98 A;  2OE1 A;  3UBL A;  1ZYN A;  5CO3 A;  2WUL A;  1IYH A;  17GS A;  2HLS A;  1XFL A;  2LEG A;  3J7Y k;  4POB A;  5J4Y A;  1WRY A;  2PMT A;  5LNK e;  3GUS A;  1VF3 A;  6GSY A;  5F8B A;  4JBB A;  2E7P A;  1O6J A;  1NSW A;  4AKI A;  4KGI A;  2DJ0 A;  3UBK A;  1JFU A;  2CQ9 A;  3VI5 A;  2H01 A;  3TJJ A;  1AUC A;  3NZN A;  2JU5 A;  2X8C A;  5KN1 A;  5C00 A;  4PHZ C;  2K18 A;  3NIV A;  2HYX A;  4O32 A;  1A24 A;  2E0Q A;  5ECQ B;  4YH2 A;  2QSI A;  3U6V A;  4MZW A;  5D93 A;  2AHE A;  4AKX B;  3TU3 B;  3DXB A;  8GSS A;  3CXG A;  3TRX A;  1ON4 A;  2OE0 A;  2H73 A;  3P90 A;  4MMM A;  3HKR A;  4HOJ A;  1PSQ A;  1ST9 A;  2PER A;  1EEM A;  1KBN A;  3BJ5 A;  3H8Q A;  3CWG A;  2WRT A;  1SD9 A;  3ME7 A;  3UL3 A;  4IBP A;  5A4W A;  4KF9 A;  2WVY A;  2PPT A;  2QGV A;  3FMW A;  4FIW A;  3G7I A;  1M2A A;  1XWA A;  1GUM A;  5IMA A;  1ML6 A;  3HJM A;  4ZB7 A;  2DJK A;  4XRA A;  4EIP A;  4AJ8 A;  2QA2 A;  2R3X A;  3VWW A;  3ZFL A;  1TXX A;  4FYB A;  2I81 A;  4XCS A;  4L5L A;  4I5Q A;  5ENU A;  4ICY A;  4GSN A;  2MZC A;  3F4R A;  2C0G A;  1CQH A;  4P3Y B;  2WVX A;  1XBS A;  3D5J A;  1GSE A;  2FHE A;  2C3T A;  2ON5 A;  5IPH A;  3HCZ A;  4MZC A;  1SKR B;  3UOM A;  4FQU A;  4XRD A;  2H66 A;  2FNO A;  4ACS A;  2CA8 A;  2KLX A;  1PGT A;  5FHI A;  1TU8 A;  4XTS A;  1XIY A;  3UVH A;  2GSR A;  3QD9 A;  2YNX A;  5FT3 A;  3W6G A;  3DWV A;  4XS1 A;  1BAY A;  4K5S A;  3HHV A;  1K0B A;  3DVX A;  3VUR A;  3C1R A;  3DVW A;  5EY6 A;  4NAX A;  1EP8 A;  1Y6E A;  3F3R A;  1UC7 A;  4GCI A;  1TRV A;  3IC8 A;  5JWO B;  1Z6M A;  2CT6 A;  2A2S A;  1T4Y A;  1XCC A;  1ACV A;  2E2G A;  3A2X A;  1URM A;  2J23 A;  1J08 A;  4J56 E;  5BRT A;  4AF2 A;  3IRA A;  2B7K A;  1SVL A;  5CRE A;  3A5W A;  3PGT A;  3HMJ G;  2EIO A;  2H70 A;  2RLI A;  1TW9 A;  1YEP A;  1BG5 A;  1ABA A;  3CRU A;  2FLS A;  1GUH A;  4X4J A;  1F37 A;  1RW1 A;  3ERF A;  4LMW A;  5BMU B;  4EF0 A;  1XOB A;  1ZYQ B;  2DIZ A;  1JZR A;  5F05 A;  3WGX A;  5AGY A;  2WFC A;  3F3Q A;  1BED A;  1A0R P;  1ERT A;  1K3Y A;  5IMZ A;  4H86 A;  4BL7 B;  1YZX A;  2LST A;  3RAZ A;  2P5R A;  2C80 A;  4MP4 A;  4ZBB A;  3ED3 A;  3LEF A;  2GLR A;  2ES7 A;  5G1L A;  5LD0 A;  1SVO A;  2HRF A;  14GS A;  3UVT A;  4NMU A;  4BWS A;  4BIK A;  4EDY A;  1XWK A;  3D0Z A;  3CTG A;  5J40 A;  1UA5 A;  5A1N B;  4POK A;  3D4M A;  5G5E A;  3A2V A;  5CAX A;  1E6B A;  2YJH A;  3GUR A;  5G5F A;  2CV4 A;  5D9W A;  1WOU A;  5A4U A;  3M1G A;  5IO0 A;  5F07 A;  1ZL9 A;  1X9S B;  2BMX A;  4MDC A;  1EWX A;  3MAK A;  1O73 A;  3E9J B;  2VKZ G;  4K6X A;  4G0L A;  1MEK A;  2B1K A;  4BPY A;  3RPP A;  4ZBA A;  4EKZ A;  5J5N A;  1EV4 A;  2OKA A;  2LNT A;  4NV2 A;  1MD3 A;  1GTU A;  2IMK A;  5A34 A;  1OC9 A;  3GRX A;  2UV8 G;  1B9Y C;  2FWF A;  2OT3 A;  4IJI A;  1FHE A;  1N2A A;  2HZE A;  3R3E A;  1R5P A;  3C1S A;  5G31 A;  3WT1 A;  4AI6 A;  3IHQ A;  4OCF A;  5HR2 A;  1JZD A;  4I97 A;  1V57 A;  2REM A;  4ZIL A;  4BVX B;  4MPF A;  3VI7 A;  1XVW A;  3TJB A;  4GXZ A;  3LW9 A;  3KGK A;  1A2M A;  3QAW A;  3GFK A;  3IPZ A;  3TKP A;  2VCT A;  3ZMK A;  1AQX A;  1SKW B;  1PX7 A;  1YJ6 A;  1M99 A;  2H0I A;  2HXK A;  1QQ2 A;  5A34 B;  1ZGN A;  2LJR A;  3CSJ A;  3D21 A;  1USB A;  1G7E A;  5KN3 A;  4XIH A;  3CTF A;  5COH A;  5DCG A;  2AB6 A;  2AV4 A;  3EVI A;  1B8X A;  5CRD A;  3J7Y b;  4WBJ A;  2YWI A;  2YWM A;  5GSS A;  2GGT A;  3AY8 A;  1TRS A;  1Y25 A;  3ZZX A;  3K8N A;  3WGD A;  1VF2 A;  3FR9 A;  4FO5 A;  5DAL B;  1M9A A;  2XPE A;  1XWG A;  3ZRE A;  2LRC A;  3QDN A;  3QAV A;  4N10 A;  4K2D A;  2H0G A;  3GN3 A;  1TRW A;  5H5R A;  1Q4J A;  1X9W B;  4CDO A;  1PQN A;  3LXT A;  3L9U A;  1UN2 A;  3ISO A;  3ZVJ D;  1SL1 B;  3L4N A;  5DCH A;  4L5O A;  3GMF A;  1GRX A;  3LYK A;  3FZA A;  1WIK A;  1Z6N A;  3I69 A;  4TR4 A;  3HY2 A;  3TRP A;  4F0C A;  3LWA A;  4G19 A;  2R0C A;  1B4Q A;  1XWB A;  5ECP B;  19GS A;  1SD8 A;  4V2N A;  4IW9 A;  5ECN B;  4G0K A;  3ZRD A;  3HYP A;  3UAR A;  1T00 A;  2J9H A;  1YVL A;  4ULX A;  2K8S A;  1R4W A;  4CHS A;  2X4A A;  3TOT A;  1TK5 B;  1PKW A;  2DSA A;  1T3B A;  3FHK A;  3IHG A;  4GLT A;  1A2L A;  1HNA A;  2LKU A;  2XPD A;  1QFN A;  2G0F A;  1YEX A;  3FY7 A;  4EE0 A;  4FYC A;  3M9J A;  3F8U A;  3CMI A;  5ECS A;  1ZZY A;  3RFR C;  2LRT A;  5E59 A;  5JCW A;  1TDI A;  2YJ7 A;  1IYI A;  1AIU A;  2B5Y A;  1WE0 A;  5KN2 A;  3VFI A;  1K0O A;  3EMP A;  6GSW A;  16GS A;  4IQ1 A;  4OO4 A;  1DSB A;  2LJA A;  3LJR A;  1TTZ A;  3P8W A;  5J4U A;  1PA3 A;  3ZIV A;  3DEX A;  2WB9 A;  1I1I P;  1SL2 B;  1RQM A;  4YKF A;  5IMC A;  1YEW C;  4TR3 A;  9GSS A;  4MF7 A;  5J47 A;  1SYR A;  5GAN D;  3DKS A;  1A0F A;  1S3C A;  3O6T A;  2NVL A;  4GDF A;  1ERW A;  2DKI A;  3M9K A;  1Z9H A;  4WET A;  4IN0 A;  1X5E A;  2YWN A;  5FWG A;  4IP6 A;  1EZK A;  2DML A;  5B6N A;  3RDW A;  1A2J A;  2H30 A;  1B48 A;  3KD0 A;  4GRF A;  2AUV A;  4ILF A;  2VD1 A;  2PUK C;  1AXD A;  3N9J A;  5F0G A;  3TCO A;  4PXO A;  1FVJ A;  18GS A;  1U3A A;  3QFA C;  3H4K A;  4HUA A;  1GUL A;  2PWJ A;  3O3T A;  2L4Q A;  1UVZ A;  1OC8 A;  4AJ6 A;  2H6X A;  1A8Y A;  1I5G A;  2LJK A;  4PGT A;  4GWR A;  4WEY A;  2P31 A;  2JAC A;  4RUV A;  5DAK A;  2L5O A;  3JCM L;  3GL5 A;  4LL1 B;  3L78 A;  3TUE A;  1FO5 A;  4GQC A;  3LYP A;  1PMT A;  5ID2 A;  5EL8 A;  4ZBD A;  2KP2 A;  3EYT A;  5A5H B;  2A4V A;  4RQR A;  1HNC A;  1I9D A;  1G6W A;  3F4S A;  1MD4 A;  3FZ5 A;  1O8X A;  3TKS E;  5J9C A;  2CX3 A;  2L5L A;  3LFL A;  1WMJ A;  1X5C A;  4KAE A;  2GTU A;  3QMX A;  3Q19 A;  4NV5 A;  5H5S A;  4MJB A;  4IKH A;  1EOG A;  1QUW A;  1JLV A;  2GT6 A;  4N0V A;  2H76 A;  2MYG A;  3IE3 A;  5DAK B;  1NHO A;  4K7N A;  3BD2 A;  2MMZ A;  5CYY A;  2C3N A;  4CY6 A;  3LSZ A;  5ECK B;  4FYU A;  1M9B A;  1FVK A;  4TXV A;  3MIX A;  3M0F A;  4Q5R A;  1XVQ A;  5ECH B;  4YAP A;  3ERG A;  2FWG A;  2L4C A;  2FA4 A;  2I4A A;  2HSM A;  2OBI A;  1X5D A;  3VPQ A;  3RBT A;  3D4T A;  3TJG A;  3D6I A;  4TXO A;  1G6Y A;  2UZ8 A;  3GKX A;  4IHU A;  4DSR A;  2WCI A;  4XS4 A;  1V40 A;  4EC0 A;  3HA9 A;  4WF4 A;  4L0U A;  2FD3 A;  2H75 A;  4XS6 A;  3EMX A;  1XXU A;  3TKR A;  4V2M A;  3HVX A;  4PUA A;  2V6O A;  1J0F A;  1H75 A;  5CRW A;  4F03 A;  2C0D A;  2C4J A;  2OAD A;  1MDK A;  2C3Q A;  2HSN A;  2HRN A;  3I43 A;  2H1D A;  2N5A A;  1S3A A;  1K0C A;  1PX6 A;  4F82 A;  4EO3 A;  4D73 A;  3TKQ A;  2YWO A;  4TN8 A;  2YV9 A;  2XBI A;  2VCQ A;  1T8E B;  1NM3 A;  22GS A;  1TI1 A;  1Z7R A;  3G7J A;  5KOW A;  3FR3 A;  1QXH A;  2H0H A;  5HR3 A;  1PKZ A;  5KEJ A;  4HJM A;  2HQT A;  2IL3 A;  3P2A A;  4IS0 A;  4IVF A;  2WVX B;  1FOH A;  3IOS A;  2O3E A;  3GKN A;  4DSS A;  2HSN B;  3QAG A;  4LL4 B;  1Z3E A;  3HVV A;  2R2J A;  3F6D A;  4YQV A;  1BQ7 A;  1B4P A;  4AJ7 A;  3ERW A;  1GTA A;  1GWC A;  4ML6 A;  2HRA A;  3R2Q A;  2L57 A;  1S3R A;  3DD3 A;  4G01 A;  4OFM A;  2YZH A;  2FUG 2;  2DC5 A;  4JED A;  3E3E A;  1N25 A;  5HFG A;  2HNL A;  1Y1U A;  2PVQ A;  4ECB A;  1A8L A;  1B9X C;  1FW1 A;  4K8M A;  4ZL8 A;  2IMI A;  2IME A;  5KN0 A;  2CAI A;  1BYE A;  1BJX A;  2BTO T;  2LV3 A;  1GP1 A;  1VGL A;  1GLQ A;  4WR5 A;  5AN1 A;  5CRG A;  2VCV A;  5DQY A;  4LA1 A;  2F3M A;  5ABR A;  1Z7P A;  4O92 A;  3ZFB A;  3VWX A;  3LG6 A;  2B6M A;  3MSZ A;  4O5U A;  1OKD A;  4QL9 A;  2JZS A;  4K1F A;  2HSY A;  2QC7 A;  2PU9 C;  5DJM A;  4ZXG A;  1SYX A;  1EGR A;  3RGB C;  4MJE A;  3KIJ A;  4I2U A;  2VO4 A;  4ECC A;  4F2I A;  3SWL A;  3P7X A;  2A2R A;  3CRT A;  2M46 A;  5INY A;  1HYU A;  3QOU A;  5J3R A;  2BJX A;  2VL3 A;  3HVN A;  1GSQ A;  3EC3 A;  2LUS A;  5ECM B;  4AKG A;  4PUR A;  1VF4 A;  4J57 E;  2PN8 A;  4G0I A;  4YAV A;  1MDI A;  4GST A;  2H1G A;  2ALB A;  3VWU A;  4YQM A;  4HJ2 A;  3KTB A;  1S4B P;  1OAZ A;  1OKT A;  1WJK A;  2YOI A;  1F9M A;  3F4T A;  1T7P B;  2F8F A;  4MPG A;  5JWQ B;  2R0G A;  3CSI A;  4Q5N A;  4PI0 C;  4TW5 A;  4OO5 A;  4QL7 A;  3TJK A;  1M0U A;  2F8A A;  4MCU A;  4DEJ A;  2NDO A;  3KJY A;  3CBU A;  1SVM A;  2EFC A;  3LXZ A;  3BCI A;  2IIY A;  4ML1 A;  1T4Z A;  4IGJ A;  2IFQ A;  1BX9 A;  3GIX A;  1K0N A;  1R5A A;  1K0M A;  3KCM A;  3IA1 A;  4TVE A;  2K6V A;  1EOH A;  2ZNM A;  2R4V A;  1THX A;  5ECR B;  3EIN A;  2OAC A;  3F0I A;  1OC9 B;  2M80 A;  5CNW A;  1A23 A;  2DKH A;  2K8V A;  1OVN A;  4HI7 A;  2HZE B;  5IMD A;  3FK8 A;  2RUF A;  4JU5 A;  1WWJ A;  1U3I A;  2P5Q A;  2RM6 A;  1TP9 A;  4MLY A;  5DQS A;  5A4V A;  4EVM A;  5IOW A;  2L59 A;  1FOV A;  4HDE A;  2GSS A;  1XG8 A;  3LGC A;  5D9T A;  3S9F A;  2V1M A;  2EFH A;  4MJA A;  5DBQ A;  1QGV A;  2C0E A;  2X99 A;  3WT2 A;  3G9B A;  4O7H A;  2FY6 A;  4J2F A;  4WR4 A;  1WP0 A;  1FB6 A;  3GKK A;  2VM1 A;  2VM2 A;  2MBS A;  4Z2U A;  3TKS A;  3QPM A;  3GX8 A;  4F0B A;  1M7T A;  2DMM A;  4ZB6 A;  2KUC A;  5IQY A;  2LRN A;  1F6M C;  2VL2 A;  4E8H A;  2MMO A;  3TJF A;  3H93 A;  5D9X A;  2KHP A;  2CZ2 A;  3IBH A;  1OE7 A;  6GSV A;  4PQI A;  2AAW A;  5ELG A;  5D9V A;  2XC2 A;  5ECO B;  3MDK A;  5HFK A;  4PNG A;  5D8I A;  3HXS A;  1V58 A;  3QR6 A;  2I3Y A;  3N5O A;  3IXR A;  3U5R E;  5ECI B;  3LOR A;  4MZB A;  1GLP A;  2HI7 A;  3CSH A;  3GX0 A;  2O5V A;  5KOX A;  1THO A;  4HZ2 A;  3UAP A;  4KX4 A;  3Q18 A;  3VPT A;  4POL A;  5DJL A;  4NPB A;  2ZCT A;  3TKS C;  2X49 A;  3EU4 A;  2H71 A;  4QMK A;  3FYG A;  5E4W A;  2R37 A;  2OJL A;  3FW2 A;  1JLW A;  4G9H A;  2LQQ A;  2TIR A;  1BG1 A;  1HNB A;  5L71 A;  1SJI A;  4OMV A;  4RQX A;  1RK4 A;  4GF0 A;  1V9W A;  4PUF C;  2IN3 A;  3I6A A;  2D2Z A;  1DBY A;  4K0N A;  5D73 A;  1U6T A;  4KDU A;  4ZIJ A;  3GV1 A;  4N30 A;  1KTE A;  1Q98 A;  2PVO C;  3MNG A;  3KH9 A;  1J9B A;  1NW2 A;  5IO2 A;  2JL4 A;  3L0H A;  2LTK A;  2C8U A;  2WZS A;  1GSU A;  3GTU A;  2GQM A;  3EPT A;  3L9V A;  1OE8 A;  3W8J A;  4MNN A;  3GHA A;  3MWH A;  3GL3 A;  3E0U A;  5GZZ B;  2I9H A;  1JZO A;  2FGX A;  1G0T A;  2CVK A;  4OWY A;  5J41 A;  1AAZ A;  4WF5 A;  2WW3 A;  3BOA A;  4CW9 A;  3IDV A;  3L9S A;  3DML A;  3EWL A;  5G1K A;  2MBT A;  3QCP A;  2VCZ A;  3GA4 A;  5HFI A;  2EIQ A;  2DJ1 A;  4XHM A;  3BBY A;  3WGE A;  4TOP A;  1XWC A;  3ZML A;  5D96 A;  2NBS A;  2OBK A;  2HSH A;  1GSS A;  1R26 A;  2RM5 A;  1PD2 1;  3KMN A;  1GNW A;  2DBC A;  3GTU B;  5IPG A;  5DVB A;  3IAS 2;  1SJ6 A;  4ZB8 A;  3GNJ A;  4I2T A;  4N11 A;  4ZB9 A;  1O7U A;  5CP1 A;  4KND A;  2JSZ A;  3GYK A;  1HD2 A;  1PFO A;  1VF1 A;  4HSC X;  5EVO A;  4V1A p;  2V2G A;  1O81 A;  2WGR A;  1ERU A;  2C1Y A;  1K0A A;  3I9V 2;  6GST A;  2LQO A;  2AYT A;  1S3D A;  1N8J A;  1PL2 A;  3KXO A;  4E8E A;  1XPV A;  4HU7 A;  2PGT A;  1LBK A;  1TU7 A;  2YZU A;  2DJJ A;  12GS A;  4EXJ A;  4G10 A;  3BCK A;  4DSQ A;  5H5Q A;  3ME8 A;  3HJO A;  5HQP A;  5IMV A;  4W66 A;  1M2D A;  3Q6O A;  2HT9 A;  2TRX A;  4TRX A;  1K3L A;  2G2Q A;  2NPB A;  1GSF A;  2WVZ A;  3VLN A;  2O85 A;  4N3Z A;  1Z5Y E;  2VL9 A;  4A5P A;  2ON7 A;  5IMF A;  1LU4 A;  2FCH A;  2NTO A;  4I6X A;  1OC3 A;  4JZQ A;  1OYJ A;  3LQ7 A;  4IQA A;  3F6F A;  1ZOF A;  3ZL5 A;  5ID2 B;  1SU9 A;  1M2B A;  2K9F A;  3VK9 A;  2GDR A;  4HQS A;  2L6D A;  2VD0 A;  13GS A;  1GTB A;  3EE2 A;  5J4V A;  1ZYP A;  3V1W A;  5B8B A;  1JZW A;  1QK8 A;  3CQF A;  4EL1 A;  3VWV A;  4IP1 A;  2EFE A; 
#chains in the Genus database with same CATH homology
 6GSU A;  1NHY A;  2YCD A;  4RI7 A;  1KNG A;  3TOU A;  4HZ4 A;  2VOC A;  3PH9 A;  2R5G A;  5G2Z A;  2VLV A;  1PRX A;  1PL1 A;  2I1U A;  3GKM A;  4ZL9 A;  5HR0 A;  1FAA A;  1O85 A;  4KW6 A;  4G2E A;  2GST A;  4DVC A;  2QA1 A;  4OCE A;  4KSO A;  2HSM B;  2O87 A;  3US3 A;  3UJ1 A;  2YN1 A;  2A2P A;  1DE1 A;  4K0G A;  4JRR A;  5ECL B;  2CAQ A;  2GSQ A;  4TXO B;  3C8E A;  1E2Y A;  1DE2 A;  2H6Y A;  2XBQ A;  3RHB A;  4XS4 B;  2DJ3 A;  2AJQ B;  1GSD A;  4BA7 A;  1TXU A;  1SJZ A;  2GZY A;  4LLR A;  2WDU A;  2FA8 A;  2N5F A;  1FB0 A;  1QMV A;  2WZ9 A;  4K9Z A;  5BMU A;  3C7M A;  3APQ A;  1TKD B;  4KDX A;  4GSS A;  4YQU A;  1XOA A;  4RI6 A;  2P0G A;  4JR6 A;  2YAN A;  4POM A;  1TJD A;  3WD6 A;  3ZYW A;  2H1L A;  5IM9 A;  3M3M A;  1HQO A;  4BL7 A;  1F2E A;  5AIV A;  4D73 B;  5DDL A;  2HRK A;  3GH6 A;  1TK8 B;  5JWR B;  3F9U A;  1AQV A;  4PX1 A;  2H6Z A;  2Z9S A;  3WYW A;  2H8L A;  4MF6 A;  3DRN A;  4GTU A;  2OA7 A;  2JZR A;  5JCG A;  3CYN A;  4NHZ A;  1MDJ A;  5A1N A;  2WS2 A;  1WPI A;  2QKE A;  5IIZ A;  2MMN A;  3KP8 A;  1AQW A;  4KSM A;  2H74 A;  1K0D A;  3GSS A;  2LS5 A;  2JAD A;  4OFT A;  1SK1 A;  4X1U A;  2IMD A;  4Z2R A;  3ZLP A;  2EC4 A;  2IWT A;  2C0F A;  4TR0 A;  3DYR A;  1XZO A;  3FZ9 A;  1GL8 A;  2X64 A;  1XW6 A;  3IC4 A;  3EU3 A;  4DSS B;  4O5Q A;  4IJ3 A;  2DIY A;  3DGQ A;  4L0W A;  1X0R A;  1YF1 A;  1SL0 B;  2HRK B;  1ERV A;  2CX4 A;  3C73 A;  4TR1 A;  3HDC A;  2WJU A;  2VUP A;  1JHB A;  2R6K A;  4MA9 A;  3APO A;  4TKY A;  3H79 A;  2V32 A;  3KZQ A;  1H4O A;  3FR6 A;  3H1N A;  4Z7X A;  5C04 A;  4X0X A;  4PQH A;  5JCU A;  4PTS A;  3TDG A;  1V2A A;  4PNF A;  1VRS D;  4Z2T A;  5IOX A;  5GAP D;  2DLX A;  3IR4 A;  5AIS A;  4BVY A;  2R0P A;  4ID0 A;  3FRC A;  1MTC A;  2MMA A;  4KCE A;  4Q5F A;  3A3T A;  2JZT A;  4TR1 B;  4KUN A;  4BWQ A;  4ZL7 A;  4BVX A;  1W4V A;  1XW5 A;  2HZF A;  4NWY A;  2A4H A;  4NHW A;  1CQG A;  5J9B A;  2CVD A;  1PN9 A;  5F06 A;  3KEB A;  4MH3 A;  4OFN A;  2TRC P;  2VLU A;  3QFB C;  2V41 A;  3MYD A;  5HR1 A;  3RPN A;  5LCZ A;  2VCW A;  3FZ4 A;  2JSY A;  2L6C A;  1K3O A;  1TOF A;  5A5K A;  1FG4 A;  4KA0 A;  5ELA A;  4ECJ A;  3FKF A;  1YKC A;  5CRH A;  1GTI A;  4JR4 A;  4FH8 A;  2RII A;  11GS A;  4HEA 2;  4HQZ A;  4MH2 A;  4BVY B;  3KTL A;  7GSS A;  20GS A;  1PN0 A;  10GS A;  1U88 A;  5B7C A;  1AC1 A;  1SEN A;  4AKH A;  3W8S A;  2X8G A;  5DAL A;  2B7J A;  5B6M A;  3IV4 A;  3F63 A;  3HJP A;  3TRQ A;  4CY8 A;  3RHC A;  3DIE A;  2O89 A;  2FWE A;  1ILO A;  2GZP A;  3IK9 A;  3HVS A;  2CVB A;  2IFQ B;  1GUK A;  1GH2 A;  4EDZ A;  4Q5Q A;  4K2X A;  4K5R A;  3FEU A;  1XW9 A;  3G7Y A;  2VIM A;  1ZMA A;  1BF5 A;  2HE3 A;  2KP1 A;  5AIX A;  2EIR A;  2FWH A;  3ZIJ A;  2ZUP A;  4O5R A;  3A5I A;  4WXT A;  5G30 A;  3GST A;  1YKA A;  4L8E A;  3EUR A;  2E2M A;  1G7O A;  3A2W A;  5EPF A;  1YF0 A;  2H1B A;  3PIN A;  1F3A A;  2B3S A;  1TK0 B;  5B8A A;  1YDK A;  1TRU A;  3HZ4 A;  4KH7 A;  2B5E A;  4YKG A;  1LJR A;  6GSS A;  3HD5 A;  2X8H A;  2RUE A;  2CZ3 A;  3SBC A;  1EV9 A;  4X43 A;  3NOF A;  2IMF A;  1YY7 A;  3PPU A;  3ZVJ A;  3TGZ A;  2LNS A;  4KE3 A;  2O8V B;  2VL2 C;  2VLT A;  1W89 A;  5GST A;  2B1L A;  3C71 A;  2F51 A;  4MK3 A;  4IEL A;  2M72 A;  2OE3 A;  3O76 A;  1EEJ A;  2VAF A;  3Q74 A;  1SKS B;  1F3B A;  1KEB A;  4N0Z A;  2VCX A;  2F9S A;  4USS A;  4K7I A;  4HU9 A;  4EIQ A;  1SK0 A;  2GS3 A;  3APS A;  3IAM 2;  3TB2 A;  2DJ2 A;  4WKW A;  1YQ1 A;  4E68 A;  4QQ7 A;  3GH9 A;  1R7H A;  4ECI A;  1TI3 A;  3UIW A;  1EGO A;  3M8N A;  3OR5 A;  4MJC A;  3PR8 A;  4LMV A;  4EUY A;  4V2L A;  4F9Z A;  2YPM A;  3UMA A;  3HZ8 A;  2EFD A;  1X9M B;  2IPA A;  2O7K A;  1EP7 A;  1ZYE A;  4OD7 A;  1C72 A;  4PQ1 A;  3KM6 A;  1GSY A;  2H1A A;  4I8B A;  4KCA A;  4KDY A;  3ZIT A;  2IJY A;  4HS1 A;  2B5X A;  1U87 A;  3KMO A;  3ZTL A;  2GQK A;  1T1V A;  4ISD A;  4K7O A;  2YV7 A;  2H19 A;  1AW9 A;  4AGS A;  2XHF A;  2GQL A;  3IK7 A;  2GVP A;  2V6K A;  3D22 A;  5A5H A;  2YP6 A;  6GSX A;  2PBJ A;  3KP9 A;  3UEM A;  2N5B A;  4MF5 A;  4GQF A;  1O8W A;  3KH7 A;  4KB3 A;  1SK2 A;  2GT5 A;  2HFD A;  4NXI A;  2H72 A;  4MAB A;  2GZZ A;  1ZCP A;  4JE1 A;  4WBR D;  2KOK A;  1DUG A;  4V1A g;  1GNE A;  1V98 A;  2OE1 A;  3UBL A;  1ZYN A;  5CO3 A;  2WUL A;  1IYH A;  17GS A;  2HLS A;  1XFL A;  2LEG A;  3J7Y k;  4POB A;  5J4Y A;  1WRY A;  2PMT A;  5LNK e;  3GUS A;  1VF3 A;  6GSY A;  5F8B A;  4JBB A;  2E7P A;  1O6J A;  1NSW A;  4AKI A;  4KGI A;  2DJ0 A;  3UBK A;  1JFU A;  2CQ9 A;  3VI5 A;  2H01 A;  3TJJ A;  1AUC A;  3NZN A;  2JU5 A;  2X8C A;  5KN1 A;  5C00 A;  2K18 A;  3NIV A;  2HYX A;  4O32 A;  1A24 A;  2E0Q A;  5ECQ B;  4YH2 A;  2QSI A;  3U6V A;  4MZW A;  5D93 A;  2AHE A;  4AKX B;  3TU3 B;  3DXB A;  8GSS A;  3CXG A;  3TRX A;  1ON4 A;  2OE0 A;  2H73 A;  3P90 A;  4MMM A;  3HKR A;  4HOJ A;  1PSQ A;  1ST9 A;  2PER A;  1EEM A;  1KBN A;  3BJ5 A;  3H8Q A;  3CWG A;  2WRT A;  1SD9 A;  3ME7 A;  3UL3 A;  4IBP A;  5A4W A;  4KF9 A;  2PPT A;  2QGV A;  3FMW A;  4FIW A;  3G7I A;  1M2A A;  1XWA A;  1GUM A;  5IMA A;  1ML6 A;  3HJM A;  4ZB7 A;  2DJK A;  4XRA A;  4EIP A;  4AJ8 A;  2QA2 A;  2R3X A;  3VWW A;  3ZFL A;  1TXX A;  4FYB A;  2I81 A;  4XCS A;  4L5L A;  4I5Q A;  5ENU A;  4ICY A;  4GSN A;  2MZC A;  3F4R A;  2C0G A;  1CQH A;  4P3Y B;  1XBS A;  3D5J A;  1GSE A;  2FHE A;  2C3T A;  2ON5 A;  5IPH A;  3HCZ A;  4MZC A;  1SKR B;  3UOM A;  4FQU A;  4XRD A;  2H66 A;  2FNO A;  4ACS A;  2CA8 A;  2KLX A;  1PGT A;  5FHI A;  1TU8 A;  4XTS A;  1XIY A;  3UVH A;  2GSR A;  3QD9 A;  2YNX A;  5FT3 A;  3W6G A;  3DWV A;  4XS1 A;  1BAY A;  4K5S A;  3HHV A;  1K0B A;  3DVX A;  3VUR A;  3C1R A;  3DVW A;  5EY6 A;  4NAX A;  1EP8 A;  1Y6E A;  3F3R A;  1UC7 A;  4GCI A;  1TRV A;  3IC8 A;  5JWO B;  1Z6M A;  2CT6 A;  2A2S A;  1T4Y A;  1XCC A;  1ACV A;  2E2G A;  3A2X A;  1URM A;  2J23 A;  1J08 A;  4J56 E;  5BRT A;  4AF2 A;  3IRA A;  2B7K A;  1SVL A;  5CRE A;  3A5W A;  3PGT A;  3HMJ G;  2EIO A;  2H70 A;  2RLI A;  1TW9 A;  1YEP A;  1BG5 A;  1ABA A;  3CRU A;  2FLS A;  1GUH A;  4X4J A;  1F37 A;  1RW1 A;  3ERF A;  4LMW A;  5BMU B;  4EF0 A;  1XOB A;  1ZYQ B;  2DIZ A;  1JZR A;  5F05 A;  3WGX A;  5AGY A;  2WFC A;  3F3Q A;  1BED A;  1A0R P;  1ERT A;  1K3Y A;  5IMZ A;  4H86 A;  4BL7 B;  1YZX A;  2LST A;  3RAZ A;  2P5R A;  2C80 A;  4MP4 A;  4ZBB A;  3ED3 A;  3LEF A;  2GLR A;  2ES7 A;  5G1L A;  5LD0 A;  1SVO A;  2HRF A;  14GS A;  3UVT A;  4NMU A;  4BWS A;  4EDY A;  1XWK A;  3D0Z A;  3CTG A;  5J40 A;  1UA5 A;  5A1N B;  4POK A;  3D4M A;  5G5E A;  3A2V A;  5CAX A;  1E6B A;  2YJH A;  3GUR A;  5G5F A;  2CV4 A;  5D9W A;  1WOU A;  5A4U A;  3M1G A;  5IO0 A;  5F07 A;  1ZL9 A;  1X9S B;  2BMX A;  4MDC A;  1EWX A;  3MAK A;  1O73 A;  3E9J B;  2VKZ G;  4K6X A;  4G0L A;  1MEK A;  2B1K A;  4BPY A;  3RPP A;  4ZBA A;  4EKZ A;  5J5N A;  1EV4 A;  2OKA A;  2LNT A;  4NV2 A;  1MD3 A;  1GTU A;  2IMK A;  5A34 A;  1OC9 A;  3GRX A;  2UV8 G;  1B9Y C;  2FWF A;  2OT3 A;  4IJI A;  1FHE A;  1N2A A;  2HZE A;  3R3E A;  1R5P A;  3C1S A;  5G31 A;  3WT1 A;  4AI6 A;  3IHQ A;  4OCF A;  5HR2 A;  1JZD A;  4I97 A;  1V57 A;  2REM A;  4ZIL A;  4BVX B;  4MPF A;  3VI7 A;  1XVW A;  3TJB A;  4GXZ A;  3LW9 A;  3KGK A;  1A2M A;  3QAW A;  3GFK A;  3IPZ A;  3TKP A;  2VCT A;  3ZMK A;  1AQX A;  1SKW B;  1PX7 A;  1YJ6 A;  1M99 A;  2H0I A;  2HXK A;  1QQ2 A;  5A34 B;  1ZGN A;  2LJR A;  3CSJ A;  3D21 A;  1USB A;  1G7E A;  5KN3 A;  4XIH A;  3CTF A;  5COH A;  5DCG A;  2AB6 A;  2AV4 A;  3EVI A;  1B8X A;  5CRD A;  3J7Y b;  4WBJ A;  2YWI A;  2YWM A;  5GSS A;  2GGT A;  3AY8 A;  1TRS A;  1Y25 A;  3ZZX A;  3K8N A;  3WGD A;  1VF2 A;  3FR9 A;  4FO5 A;  5DAL B;  1M9A A;  2XPE A;  1XWG A;  3ZRE A;  2LRC A;  3QDN A;  3QAV A;  4N10 A;  4K2D A;  2H0G A;  3GN3 A;  1TRW A;  5H5R A;  1Q4J A;  1X9W B;  4CDO A;  1PQN A;  3LXT A;  3L9U A;  1UN2 A;  3ISO A;  3ZVJ D;  1SL1 B;  3L4N A;  5DCH A;  4L5O A;  3GMF A;  1GRX A;  3LYK A;  3FZA A;  1WIK A;  1Z6N A;  3I69 A;  4TR4 A;  3HY2 A;  3TRP A;  4F0C A;  3LWA A;  4G19 A;  2R0C A;  1B4Q A;  1XWB A;  5ECP B;  19GS A;  1SD8 A;  4V2N A;  4IW9 A;  5ECN B;  4G0K A;  3ZRD A;  3HYP A;  3UAR A;  1T00 A;  2J9H A;  1YVL A;  4ULX A;  2K8S A;  1R4W A;  4CHS A;  2X4A A;  3TOT A;  1TK5 B;  1PKW A;  2DSA A;  1T3B A;  3FHK A;  3IHG A;  4GLT A;  1A2L A;  1HNA A;  2LKU A;  2XPD A;  1QFN A;  2G0F A;  1YEX A;  3FY7 A;  4EE0 A;  4FYC A;  3M9J A;  3F8U A;  3CMI A;  5ECS A;  1ZZY A;  2LRT A;  5E59 A;  5JCW A;  1TDI A;  2YJ7 A;  1IYI A;  1AIU A;  2B5Y A;  1WE0 A;  5KN2 A;  3VFI A;  1K0O A;  3EMP A;  6GSW A;  16GS A;  4IQ1 A;  4OO4 A;  1DSB A;  2LJA A;  3LJR A;  1TTZ A;  3P8W A;  5J4U A;  1PA3 A;  3ZIV A;  3DEX A;  2WB9 A;  1SL2 B;  1RQM A;  4YKF A;  5IMC A;  4TR3 A;  9GSS A;  4MF7 A;  5J47 A;  1SYR A;  5GAN D;  3DKS A;  1A0F A;  1S3C A;  3O6T A;  2NVL A;  4GDF A;  1ERW A;  2DKI A;  3M9K A;  1Z9H A;  4WET A;  4IN0 A;  1X5E A;  2YWN A;  5FWG A;  4IP6 A;  1EZK A;  2DML A;  5B6N A;  3RDW A;  1A2J A;  2H30 A;  1B48 A;  3KD0 A;  4GRF A;  2AUV A;  4ILF A;  2VD1 A;  2PUK C;  1AXD A;  3N9J A;  5F0G A;  3TCO A;  4PXO A;  1FVJ A;  18GS A;  1U3A A;  3QFA C;  3H4K A;  4HUA A;  1GUL A;  2PWJ A;  3O3T A;  2L4Q A;  1UVZ A;  1OC8 A;  4AJ6 A;  2H6X A;  1A8Y A;  1I5G A;  2LJK A;  4PGT A;  4GWR A;  4WEY A;  2P31 A;  2JAC A;  4RUV A;  5DAK A;  2L5O A;  3JCM L;  3GL5 A;  4LL1 B;  3L78 A;  3TUE A;  1FO5 A;  4GQC A;  3LYP A;  1PMT A;  5ID2 A;  5EL8 A;  4ZBD A;  2KP2 A;  3EYT A;  5A5H B;  2A4V A;  4RQR A;  1HNC A;  1I9D A;  1G6W A;  3F4S A;  1MD4 A;  3FZ5 A;  1O8X A;  3TKS E;  5J9C A;  2CX3 A;  2L5L A;  3LFL A;  1WMJ A;  1X5C A;  4KAE A;  2GTU A;  3QMX A;  3Q19 A;  4NV5 A;  5H5S A;  4MJB A;  4IKH A;  1EOG A;  1QUW A;  1JLV A;  2GT6 A;  4N0V A;  2H76 A;  2MYG A;  3IE3 A;  5DAK B;  1NHO A;  4K7N A;  3BD2 A;  2MMZ A;  5CYY A;  2C3N A;  4CY6 A;  3LSZ A;  5ECK B;  4FYU A;  1M9B A;  1FVK A;  4TXV A;  3MIX A;  3M0F A;  4Q5R A;  1XVQ A;  5ECH B;  4YAP A;  3ERG A;  2FWG A;  2L4C A;  2FA4 A;  2I4A A;  2HSM A;  2OBI A;  1X5D A;  3VPQ A;  3RBT A;  3D4T A;  3TJG A;  3D6I A;  4TXO A;  1G6Y A;  2UZ8 A;  3GKX A;  4IHU A;  4DSR A;  2WCI A;  4XS4 A;  1V40 A;  4EC0 A;  3HA9 A;  4WF4 A;  4L0U A;  2FD3 A;  2H75 A;  4XS6 A;  3EMX A;  1XXU A;  3TKR A;  4V2M A;  3HVX A;  4PUA A;  2V6O A;  1J0F A;  1H75 A;  5CRW A;  4F03 A;  2C0D A;  2C4J A;  2OAD A;  1MDK A;  2C3Q A;  2HSN A;  2HRN A;  3I43 A;  2H1D A;  2N5A A;  1S3A A;  1K0C A;  1PX6 A;  4F82 A;  4EO3 A;  4D73 A;  3TKQ A;  2YWO A;  4TN8 A;  2YV9 A;  2XBI A;  2VCQ A;  1T8E B;  1NM3 A;  22GS A;  1TI1 A;  1Z7R A;  3G7J A;  5KOW A;  3FR3 A;  1QXH A;  2H0H A;  5HR3 A;  1PKZ A;  5KEJ A;  4HJM A;  2HQT A;  2IL3 A;  3P2A A;  4IS0 A;  4IVF A;  1FOH A;  3IOS A;  3GKN A;  4DSS A;  2HSN B;  3QAG A;  4LL4 B;  1Z3E A;  3HVV A;  2R2J A;  3F6D A;  4YQV A;  1BQ7 A;  1B4P A;  4AJ7 A;  3ERW A;  1GTA A;  1GWC A;  4ML6 A;  2HRA A;  3R2Q A;  2L57 A;  3DD3 A;  4G01 A;  4OFM A;  2YZH A;  2FUG 2;  2DC5 A;  4JED A;  3E3E A;  1N25 A;  5HFG A;  2HNL A;  1Y1U A;  2PVQ A;  4ECB A;  1A8L A;  1B9X C;  1FW1 A;  4K8M A;  4ZL8 A;  2IMI A;  2IME A;  5KN0 A;  2CAI A;  1BYE A;  1BJX A;  2BTO T;  2LV3 A;  1GP1 A;  1VGL A;  1GLQ A;  4WR5 A;  5AN1 A;  5CRG A;  2VCV A;  5DQY A;  4LA1 A;  2F3M A;  5ABR A;  1Z7P A;  4O92 A;  3ZFB A;  3VWX A;  3LG6 A;  2B6M A;  3MSZ A;  4O5U A;  1OKD A;  4QL9 A;  2JZS A;  4K1F A;  2HSY A;  2QC7 A;  2PU9 C;  5DJM A;  4ZXG A;  1SYX A;  1EGR A;  4MJE A;  3KIJ A;  4I2U A;  2VO4 A;  4ECC A;  4F2I A;  3SWL A;  3P7X A;  2A2R A;  3CRT A;  2M46 A;  5INY A;  1HYU A;  3QOU A;  5J3R A;  2BJX A;  2VL3 A;  1GSQ A;  3EC3 A;  2LUS A;  5ECM B;  4AKG A;  4PUR A;  1VF4 A;  4J57 E;  2PN8 A;  4G0I A;  4YAV A;  1MDI A;  4GST A;  2H1G A;  2ALB A;  3VWU A;  4YQM A;  4HJ2 A;  3KTB A;  1OAZ A;  1OKT A;  1WJK A;  2YOI A;  1F9M A;  3F4T A;  1T7P B;  2F8F A;  4MPG A;  5JWQ B;  2R0G A;  3CSI A;  4Q5N A;  4TW5 A;  4OO5 A;  4QL7 A;  3TJK A;  1M0U A;  2F8A A;  4MCU A;  4DEJ A;  2NDO A;  3KJY A;  3CBU A;  1SVM A;  2EFC A;  3LXZ A;  3BCI A;  2IIY A;  4ML1 A;  1T4Z A;  4IGJ A;  2IFQ A;  1BX9 A;  3GIX A;  1K0N A;  1R5A A;  1K0M A;  3KCM A;  3IA1 A;  4TVE A;  2K6V A;  1EOH A;  2ZNM A;  2R4V A;  1THX A;  5ECR B;  3EIN A;  2OAC A;  3F0I A;  1OC9 B;  2M80 A;  5CNW A;  1A23 A;  2DKH A;  2K8V A;  1OVN A;  4HI7 A;  2HZE B;  5IMD A;  3FK8 A;  2RUF A;  4JU5 A;  1WWJ A;  1U3I A;  2P5Q A;  2RM6 A;  1TP9 A;  4MLY A;  5DQS A;  5A4V A;  4EVM A;  5IOW A;  2L59 A;  1FOV A;  4HDE A;  2GSS A;  3LGC A;  5D9T A;  3S9F A;  2V1M A;  2EFH A;  4MJA A;  5DBQ A;  1QGV A;  2C0E A;  2X99 A;  3WT2 A;  3G9B A;  4O7H A;  2FY6 A;  4J2F A;  4WR4 A;  1WP0 A;  1FB6 A;  3GKK A;  2VM1 A;  2VM2 A;  2MBS A;  4Z2U A;  3TKS A;  3QPM A;  3GX8 A;  4F0B A;  1M7T A;  2DMM A;  4ZB6 A;  2KUC A;  5IQY A;  2LRN A;  1F6M C;  2VL2 A;  4E8H A;  2MMO A;  3TJF A;  3H93 A;  5D9X A;  2KHP A;  2CZ2 A;  3IBH A;  1OE7 A;  6GSV A;  4PQI A;  2AAW A;  5ELG A;  5D9V A;  2XC2 A;  5ECO B;  3MDK A;  5HFK A;  4PNG A;  5D8I A;  3HXS A;  1V58 A;  3QR6 A;  2I3Y A;  3N5O A;  3IXR A;  3U5R E;  5ECI B;  3LOR A;  4MZB A;  1GLP A;  2HI7 A;  3CSH A;  3GX0 A;  2O5V A;  5KOX A;  1THO A;  4HZ2 A;  3UAP A;  4KX4 A;  3Q18 A;  3VPT A;  4POL A;  5DJL A;  4NPB A;  2ZCT A;  3TKS C;  2X49 A;  3EU4 A;  2H71 A;  4QMK A;  3FYG A;  5E4W A;  2R37 A;  2OJL A;  3FW2 A;  1JLW A;  4G9H A;  2LQQ A;  2TIR A;  1BG1 A;  1HNB A;  5L71 A;  1SJI A;  4OMV A;  4RQX A;  1RK4 A;  4GF0 A;  1V9W A;  4PUF C;  2IN3 A;  3I6A A;  2D2Z A;  1DBY A;  4K0N A;  5D73 A;  1U6T A;  4KDU A;  4ZIJ A;  3GV1 A;  4N30 A;  1KTE A;  1Q98 A;  2PVO C;  3MNG A;  3KH9 A;  1J9B A;  1NW2 A;  5IO2 A;  2JL4 A;  3L0H A;  2LTK A;  2C8U A;  1GSU A;  3GTU A;  2GQM A;  3EPT A;  3L9V A;  1OE8 A;  3W8J A;  4MNN A;  3GHA A;  3MWH A;  3GL3 A;  3E0U A;  5GZZ B;  2I9H A;  1JZO A;  2FGX A;  1G0T A;  2CVK A;  4OWY A;  5J41 A;  1AAZ A;  4WF5 A;  3BOA A;  4CW9 A;  3IDV A;  3L9S A;  3DML A;  3EWL A;  5G1K A;  2MBT A;  3QCP A;  2VCZ A;  3GA4 A;  5HFI A;  2EIQ A;  2DJ1 A;  4XHM A;  3BBY A;  3WGE A;  4TOP A;  1XWC A;  3ZML A;  5D96 A;  2NBS A;  2OBK A;  2HSH A;  1GSS A;  1R26 A;  2RM5 A;  1PD2 1;  3KMN A;  1GNW A;  2DBC A;  3GTU B;  5IPG A;  5DVB A;  3IAS 2;  1SJ6 A;  4ZB8 A;  3GNJ A;  4I2T A;  4N11 A;  4ZB9 A;  1O7U A;  5CP1 A;  4KND A;  2JSZ A;  3GYK A;  1HD2 A;  1VF1 A;  5EVO A;  4V1A p;  2V2G A;  1O81 A;  2WGR A;  1ERU A;  2C1Y A;  1K0A A;  3I9V 2;  6GST A;  2LQO A;  2AYT A;  1S3D A;  1N8J A;  1PL2 A;  3KXO A;  4E8E A;  1XPV A;  4HU7 A;  2PGT A;  1LBK A;  1TU7 A;  2YZU A;  2DJJ A;  12GS A;  4EXJ A;  4G10 A;  3BCK A;  4DSQ A;  5H5Q A;  3ME8 A;  3HJO A;  5HQP A;  5IMV A;  4W66 A;  1M2D A;  3Q6O A;  2HT9 A;  2TRX A;  4TRX A;  1K3L A;  2G2Q A;  2NPB A;  1GSF A;  3VLN A;  2O85 A;  4N3Z A;  1Z5Y E;  2VL9 A;  4A5P A;  2ON7 A;  5IMF A;  1LU4 A;  2FCH A;  2NTO A;  4I6X A;  1OC3 A;  4JZQ A;  1OYJ A;  3LQ7 A;  4IQA A;  3F6F A;  1ZOF A;  3ZL5 A;  5ID2 B;  1SU9 A;  1M2B A;  2K9F A;  3VK9 A;  2GDR A;  4HQS A;  2L6D A;  2VD0 A;  13GS A;  1GTB A;  3EE2 A;  5J4V A;  1ZYP A;  3V1W A;  5B8B A;  1JZW A;  1QK8 A;  4EL1 A;  3VWV A;  4IP1 A;  2EFE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...