3ISOA

Crystal structure of 26 kda gst of clonorchis sinensis in p3221 symmetry
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
218
structure length
218
Chain Sequence
MAPVLGYWKIRGLAQPIRLLLEYVGDSYEEHSYGRCDGEKWQNDKHNLGLELPNLPYYKDGNFSLTQSLAILRYIADKHNMIGNTPVERAKISMIEGGLVDLRAGVSRIAYQETFEQLKVPYLQQLPSTLRMWSQFLGNNSYLHGSTPTHLDFMFYEALDVIRYLDPTSVEAFPNLMQFIHRIEALPNIKAFMESDRFIKWPLNGWSAYFGGGDAPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative glutathione transferase
publication title A histidine substitution confers metal binding affinity to a Schistosoma japonicum Glutathione S-transferase.
pubmed doi rcsb
source organism Clonorchis sinensis
molecule tags Transferase
total genus 78
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3isoA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3isoA01
4J56E 5ID2A 4ZB8A 1KNGA 3D6IA 1K0OA 5IMCA 4L5OA 1AAZA 4TXVA 4CDOA 3GA4A 5HFGA 3LYPA 1PD21 4ZBDA 5CRDA 1LJRA 5EY6A 1GL8A 1N8JA 3ZVJA 3VLNA 3CRUA 4L0UA 1AQWA 4EXJA 1VRSD 4EKZA 2CAIA 4XRAA 2K8SA 3N5OA 1ZL9A 1JZRA 4TW5A 1PKZA 4AJ8A 5CP1A 4HQSA 2H1AA 2B5EA 4F2IA 3GMFA 5LCZA 2HSHA 4ZILA 1AC1A 2PPTA 5FWGA 4NMUA 5JWRB 3ZIJA 2AHEA 3FKFA 2V1MA 5ENUA 3Q74A 2LS5A 1ACVA 4MDCA 2FY6A 3APQA 4E8EA 3GYKA 1EV4A 1A24A 4K7IA 4MABA 3GNJA 4WXTA 2D2ZA 3FRCA 3C73A 2WS2A 3LFLA 2YP6A 2H73A 1W89A 2KUCA 3CYNA 2IIYA 1X9SB 4N0ZA 1PL1A 1QUWA 1SKWB 2E2MA 4MZBA 1PMTA 1U87A 1F9MA 4ECJA 2CAQA 2QKEA 1DE2A 3QPMA 3CXGA 2AYTA 2IMFA 3H8QA 3K8NA 5A4WA 2H66A 3E3EA 4MA9A 2C80A 4EF0A 3GUSA 1YQ1A 2X64A 3FZ9A 3M8NA 4QL7A 2M80A 2LRCA 2VM2A 3QAGA 2PMTA 2EC4A 1SL2B 5AISA 4KNDA 4AGSA 1AXDA 2N5BA 2L5LA 2LRNA 2O85A 1GSDA 3CMIA 2GS3A 1M9BA 1SKRB 4MJEA 4X0XA 1K0CA 1AQXA 4G0IA 1OYJA 3IBHA 3EYTA 1O7UA 1OC9A 5GAND 5IPGA 1TKDB 1VF4A 2K6VA 2LV3A 3R3EA 2OKAA 2CV4A 2Z9SA 5ELAA 4JBBA 1RW1A 4FQUA 2HZFA 4Q5QA 4F0BA 4H86A 2VM1A 1GWCA 5ECMB 4DVCA 2HNLA 2FWEA 4QQ7A 4N10A 1UA5A 2JZSA 1UC7A 3LXZA 2IPAA 5ECQB 2O87A 1R4WA 3UVHA 1ST9A 1KBNA 2VCQA 4BVXB 3GV1A 3GTUB 4TKYA 2V32A 4DSSA 4LMWA 4IELA 4GSTA 5ECSA 1TK5B 5IIZA 1FB0A 3ZITA 4IKHA 1N2AA 2VIMA 4HOJA 3KTBA 3UL3A 3EU4A 3D4TA 3HJMA 2DBCA 4IJIA 2R6KA 2FHEA 4K9ZA 1EP8A 3BOAA 2FA4A 2R2JA 3KCMA 4ECIA 4RI7A 2L4CA 5IMDA 4BWQA 2BMXA 2IJYA 3PGTA 5G5FA 5DVBA 5CRWA 4IP6A 10GSA 4K8MA 5DBQA 1XBSA 1CQHA 1SU9A 2H76A 3IDVA 3TB2A 3M0FA 1QQ2A 2L6DA 3WT1A 3WYWA 1F3AA 2HXKA 2VCVA 2NPBA 1WE0A 5B7CA 2L6CA 2VL2C 1GLPA 3IV4A 1XOAA 4IJ3A 1XZOA 1NM3A 1IYHA 3CTGA 4XTSA 1JLWA 3D22A 22GSA 5IMVA 5ECKB 2A2SA 3QDNA 4USSA 1PRXA 3L9VA 3ZL5A 1I9DA 1VF3A 2HZEB 2X8GA 1XPVA 5F0GA 1PX7A 11GSA 1A23A 2YWNA 1THXA 3DRNA 5B6NA 1M7TA 4YAPA 1K0DA 2HSMB 1R7HA 2HT9A 3IA1A 5D96A 4O92A 1G6WA 2NDOA 2YZUA 2H71A 2WJUA 1XIYA 4FO5A 1EWXA 4IQ1A 2LTKA 2NTOA 4BWSA 5DQYA 1A2MA 1TRVA 4OO5A 3QAVA 4HU9A 4GWRA 4PNGA 4YAVA 4I6XA 1SK0A 2H75A 1Z7RA 2YV7A 3TJKA 2I81A 4X1UA 2HLSA 3LEFA 1XWGA 1YEXA 5FHIA 5CAXA 4XHMA 2QSIA 2PVQA 1V58A 4V1Ap 2B5XA 3W6GA 2LNTA 2DJ0A 2P31A 1USBA 3H1NA 2JL4A 2OA7A 5IPHA 4MPFA 1OKDA 5G1LA 4NHZA 1XWAA 3ISOA 5ECIB 4L5LA 4JRRA 3LXTA 3P90A 3LYKA 2WRTA 3MWHA 3E0UA 2DMMA 19GSA 1SKSB 4FYCA 4BVXA 2HRKB 1MD4A 2B7KA 3GTUA 4CW9A 6GSWA 2H30A 2C1YA 5ECLB 1MDKA 5G1KA 5D73A 4ULXA 2EIQA 2FCHA 4YQUA 5IQYA 3IOSA 1OVNA 6GSUA 3TRXA 2GGTA 1Q4JA 2H1BA 3LJRA 3EMPA 3KM6A 3FR6A 5J41A 3M9KA 3TKSE 5DJMA 4G2EA 3VWUA 3APSA 5J9CA 3Q19A 1Z3EA 5HR0A 3MAKA 3C71A 1KTEA 2CT6A 4GLTA 1SYXA 5IMFA 1WP0A 2JSYA 3L78A 1BG5A 3I9V2 4KDYA 1YKAA 3GKNA 1OKTA 2C3QA 2L59A 4OD7A 2B1LA 3DKSA 2H6YA 5KN2A 2LJKA 2N5FA 2XHFA 5IOWA 2IN3A 2VO4A 2CVDA 4WF4A 2LJAA 3MSZA 3L4NA 2PN8A 2DJ1A 2DC5A 2REMA 3DVWA 1OE8A 3US3A 4BVYB 1EP7A 1K0MA 4LA1A 4JE1A 1K0AA 3WGDA 3IHQA 4OFNA 1J9BA 1FB6A 3WGXA 3HYPA 2GT6A 4LL1B 1XWCA 2WULA 3TJBA 3F4TA 5C00A 4I97A 3GKKA 3KMNA 3M3MA 4TOPA 5H5RA 3P7XA 3V1WA 5GSTA 2X8CA 3DMLA 2CVKA 1BJXA 1JZDA 4WF5A 2HSNB 1TU8A 3QCPA 4MF7A 1H4OA 3ZTLA 2C8UA 2DJ3A 5DQSA 3CSIA 1FHEA 2HSMA 4DSQA 2VCXA 2B1KA 3IC8A 3ZREA 2JSZA 4WKWA 1NHYA 3ZFLA 3Q18A 1Z6MA 4LMVA 5CRGA 4KAEA 3DIEA 2FA8A 5ELGA 4PX1A 1F2EA 2GZPA 2P5QA 4XIHA 1T7PB 2X8HA 3IPZA 3J7Yk 4XRDA 2XC2A 3RPNA 3DWVA 2DSAA 4KF9A 1EEMA 1GTBA 5D93A 3FYGA 1X5DA 3TJGA 3HJPA 1THOA 3P8WA 1GNWA 5HFKA 4POBA 1WOUA 3IRAA 2DLXA 4PGTA 2WCIA 1SJZA 2H70A 5BMUA 4OO4A 4BA7A 4NHWA 2NVLA 5KEJA 2F51A 2VLUA 1QGVA 2IFQA 1SL1B 1ZGNA 4G19A 5LD0A 1T8EB 2BJXA 2C0DA 5H5QA 2IWTA 3D0ZA 2OACA 2VCWA 2HRKA 1F37A 2OE3A 4OCEA 1JHBA 4IP1A 3HVXA 2O8VB 3ME8A 1GULA 3O3TA 4MF5A 3FZ5A 1AQVA 4POLA 5F07A 1LU4A 1Z7PA 2H19A 3PH9A 1TI3A 4WR4A 3UARA 1M2AA 2PVOC 3PR8A 3AY8A 4N30A 5G31A 3QFBC 4N11A 5D9TA 3GFKA 1EV9A 4O32A 3KH7A 4KX4A 5L71A 3DXBA 4ECCA 4ISDA 2YJHA 2MYGA 4JEDA 2RUFA 4V2NA 4KCAA 3ERGA 1EOHA 4EL1A 2C0FA 3NIVA 1YJ6A 1YF1A 4E8HA 5JWOB 3I69A 4V2LA 4TN8A 1HYUA 1Y25A 3ZZXA 3GIXA 3LWAA 5E59A 1ERWA 2GQLA 3G9BA 4ZL7A 1EGOA 4RUVA 4Q5FA 3DD3A 4BVYA 4TR1B 1GUHA 3F6DA 3G7JA 3KXOA 2LSTA 1XVQA 3OR5A 2N5AA 4NV2A 1PL2A 2GZZA 4MPGA 2OADA 1X0RA 2KP1A 4ILFA 2CZ2A 2OE0A 3WT2A 2LEGA 2YJ7A 1G0TA 2BTOT 1OAZA 4PXOA 2HYXA 3HY2A 2G0FA 4KB3A 3A2XA 3IR4A 4JZQA 4Q5NA 4KCEA 4KSMA 5KN1A 2H6XA 5DCHA 3HCZA 4LLRA 1U3IA 3D5JA 4PQIA 3QMXA 2VL3A 1R5AA 1O8XA 3A2WA 6GSVA 1SD8A 5ABRA 1T1VA 3VWXA 2J9HA 4F82A 3G7YA 1TRSA 2LUSA 3IXRA 1OC3A 1YZXA 4MZWA 3GHAA 5CNWA 1M2DA 1X5CA 2AJQB 1TJDA 4ZL9A 4EDYA 1OC8A 2TIRA 5E4WA 2IMKA 1HNBA 4MLYA 2VD0A 5EL8A 5IOXA 1R5PA 1DSBA 5JCWA 2B5YA 5DDLA 1ZCPA 5INYA 2DMLA 2LQOA 2O89A 3EURA 2OBKA 2R37A 3QFAC 5HR1A 4ZXGA 1B8XA 1GLQA 1M99A 5DJLA 2H8LA 3BCKA 1M0UA 2GQKA 2V41A 2VLVA 3F3RA 4HUAA 4TR4A 1B9YC 12GSA 4RI6A 4CHSA 3H93A 3KEBA 2XBQA 3IK7A 1GSFA 3VK9A 3RAZA 4TR3A 3TKRA 4PQ1A 3GX0A 3A2VA 3KJYA 1TTZA 3ED3A 4ZB6A 4EC0A 5GSSA 1PX6A 2VAFA 2L5OA 3UEMA 2X99A 1ERUA 3UIWA 2MZCA 5J3RA 4V1Ag 3KP9A 2E0QA 2PUKC 4MCUA 5CRHA 1WIKA 2DIZA 1SL0B 3C1RA 4IBPA 2HSYA 3HVSA 5ECRB 2WZ9A 4KDXA 1TRUA 1Z9HA 2HQTA 2H6ZA 1PN9A 2CQ9A 1ERTA 1XOBA 3GH6A 2DJKA 2FGXA 4ID0A 1FAAA 3TDGA 9GSSA 4DSRA 2CX3A 4YH2A 5CO3A 2OBIA 3HXSA 5A4VA 3UAPA 3D4MA 1HD2A 3GL3A 2KHPA 2LNSA 5FT3A 1QXHA 1J0FA 3CBUA 1B4PA 4ZL8A 4EO3A 1O81A 1A8YA 1TP9A 5HQPA 4KGIA 5CREA 2VD1A 3F4SA 3TCOA 3LORA 1XFLA 3VURA 4KSOA 4TR1A 4WBJA 4J2FA 1R26A 3U5RE 1NW2A 1PKWA 2VOCA 3CRTA 2ALBA 2ZCTA 1RQMA 1A8LA 4Z7XA 1FW1A 3BD2A 1WRYA 2ZUPA 2MBTA 4XS4B 1HNCA 1GTAA 4OFTA 2CX4A 1A0FA 4MJAA 2YWOA 3D21A 3M9JA 4PNFA 14GSA 3EE2A 3GURA 1HNAA 6GSXA 2GQMA 2B3SA 1ZYQB 1TXXA 4I5QA 3ZFBA 4GSSA 4I8BA 2XBIA 4NAXA 3FHKA 4MZCA 3VWVA 1X9MB 1X5EA 4YQVA 5GZZB 4X43A 1GUKA 2VCTA 3KD0A 2WB9A 1XWKA 2L4QA 3GX8A 3N9JA 3EC3A 2RIIA 2F8FA 5J4UA 4TXOB 4D73B 2WFCA 2CZ3A 1PA3A 4HZ2A 2IMEA 3E9JB 1OE7A 1TK8B 3IAS2 4IS0A 3ERWA 1SK1A 1FVKA 5ECNB 2MMOA 3GH9A 1GSQA 1VGLA 2C4JA 2JZRA 5KN0A 2LRTA 2M46A 1GSYA 2YN1A 1EZKA 2YWIA 1GSSA 4EE0A 2ES7A 3U6VA 3TOUA 1RK4A 3ZMKA 1ZMAA 4K6XA 5IO0A 5A5KA 5G30A 16GSA 2OJLA 17GSA 1UN2A 3HJOA 2ON5A 2GDRA 4GCIA 4XS6A 1G6YA 2MMZA 2AAWA 4ML1A 3C7MA 3KP8A 2ON7A 4PQHA 1FO5A 3VPTA 3GSSA 1O8WA 3BCIA 2AV4A 1U3AA 3UVTA 2HZEA 3A5WA 2M72A 1T4ZA 2HFDA 1VF1A 1TI1A 1M2BA 5B8AA 1K3OA 1ML6A 2F8AA 3H4KA 1V9WA 4BPYA 3P2AA 3KGKA 4QL9A 2MMAA 2PERA 2WDUA 3FW2A 4K0NA 3TJJA 4ACSA 1JZOA 3KTLA 4ML6A 4NV5A 1URMA 2A4VA 2H0IA 2YV9A 2G2QA 3QOUA 2YZHA 4FYUA 2FWFA 1GTUA 1GNEA 4IN0A 2FLSA 1B9XC 1SJIA 2GVPA 1GH2A 2CVBA 4K0GA 4AF2A 3EU3A 5EPFA 3R2QA 1E6BA 2RLIA 3LSZA 1QK8A 5F8BA 1XVWA 1XWBA 5IMAA 2F9SA 4WETA 3TKSA 3DVXA 2YPMA 4PUAA 3TOTA 2YANA 4MP4A 1WPIA 3L9UA 1MEKA 1GSUA 2KP2A 4XS4A 4G9HA 2MMNA 1SD9A 1TRWA 3C1SA 1B48A 2J23A 3A3TA 2K9FA 3F8UA 3F6FA 2YNXA 2R3XA 2RM6A 1K0BA 2I3YA 2V2GA 3O6TA 3F63A 2TRXA 3KIJA 4L0WA 4HJ2A 3TRPA 3MDKA 2AUVA 2L57A 4MMMA 2FWGA 3FZ4A 4RQRA 3F9UA 1AW9A 4FIWA 1F6MC 4GQCA 5AN1A 3WD6A 4IVFA 4XS1A 2FUG2 4N0VA 1ON4A 2O7KA 1ZZYA 1ZOFA 5D9VA 3M1GA 4TXOA 4D73A 1K0NA 2P0GA 1M9AA 1A2LA 2P5RA 5HFIA 4BL7B 3J7Yb 6GSTA 5B8BA 1B4QA 5A4UA 3ZRDA 4ECBA 4IGJA 5ECHB 3TJFA 3ZIVA 3LGCA 2AB6A 2HE3A 3FEUA 2TRCP 1XW9A 2PBJA 5EVOA 4I2UA 2H0GA 3UBKA 1HQOA 3EMXA 2FD3A 3FR9A 2GSSA 3HKRA 2H01A 4F9ZA 2JACA 4PUFC 3ZMLA 1WJKA 4IW9A 2B7JA 3UJ1A 1FG4A 2HRAA 3WGEA 4HDEA 2DJ2A 1TK0B 4K2DA 1MDIA 4ZBBA 2YWMA 4MJBA 4ZBAA 3RDWA 1A0RP 1TW9A 1S3DA 1O73A 5IM9A 4G0LA 3HVVA 1TU7A 1XW6A 2I9HA 2FWHA 3RBTA 2WGRA 1GSEA 3IK9A 1IYIA 2EIRA 4J57E 3VFIA 2E2GA 4GF0A 3Q6OA 1WMJA 2PU9C 4GTUA 5AGYA 1K3YA 1GP1A 3HZ4A 4GQFA 1EEJA 2IMDA 3BBYA 4Q5RA 4TVEA 2VCZA 5D9WA 3TUEA 5D9XA 1YF0A 2V6OA 18GSA 2H74A 4G0KA 1SJ6A 3JCML 4WEYA 4KA0A 2R5GA 4DEJA 3IC4A 2JZTA 2V6KA 4RQXA 5G2ZA 4K7OA 3ZYWA 3GKMA 3ZVJD 1O6JA 1GUMA 4PURA 2LQQA 1TDIA 2IL3A 3NOFA 5AIVA 4JU5A 2H1DA 1Z6NA 4POKA 3HZ8A 1XW5A 2R4VA 4AJ7A 3GL5A 1V40A 5JCGA 4EVMA 1S3CA 2PGTA 1SYRA 3W8JA 1W4VA 3ERFA 1A2JA 1YEPA 2JADA 1YDKA 3ME7A 1T4YA 1PSQA 3LG6A 1JLVA 3CSHA 4KH7A 4IQAA 4OWYA 2C0EA 2QGVA 4LL4B 1MD3A 1NHOA 5DAKB 3EINA 2YOIA 4NPBA 1ERVA 4TR0A 4TRXA 2F3MA 1DUGA 4EDZA 1DE1A 4KE3A 5KN3A 5LNKe 5JCUA 3TKPA 4GSNA 4L8EA 5F06A 2A2RA 3VWWA 3EWLA 4V2MA 1GRXA 2LKUA 7GSSA 1WWJA 3UBLA 3KZQA 4BL7A 2HI7A 3BJ5A 4HS1A 4JR4A 1EGRA 3FZAA 5DALB 5H5SA 4F03A 3QD9A 3VI5A 1J08A 3TKQA 1JZWA 4NXIA 2C3TA 3H79A 3QR6A 4MH2A 1DBYA 1S3AA 1TOFA 3GN3A 2H0HA 5ID2B 2IMIA 3VI7A 2H72A 2GZYA 1FOVA 5J9BA 3SWLA 2RUEA 3IE3A 2C0GA 5G5EA 3NZNA 4AJ6A 3CSJA 3G7IA 3GSTA 3HA9A 5IMZA 4POMA 3RPPA 3HD5A 3W8SA 1XCCA 2JU5A 5HR3A 4K7NA 1AIUA 4MK3A 2GTUA 1K3LA 3PPUA 1VF2A 1Y6EA 3FK8A 1U88A 2OE1A 1QFNA 4KUNA 3GRXA 2I1UA 1FVJA 2ZNMA 2GLRA 4K1FA 3UOMA 4ZIJA 3LQ7A 1Q98A 5ECOB 2IFQB 2RM5A 1XXUA 3TRQA 1JFUA 3SBCA 5GAPD 5HR2A 5AIXA 3GKXA 2GT5A 1NSWA 4GRFA 1EOGA 5CYYA 2XPEA 1MDJA 3QAWA 4FYBA 2LJRA 4OCFA 1YY7A 1UVZA 2VL2A 3FY7A 1AUCA 3KMOA 1MTCA 4YQMA 2B6MA 1T3BA 2E7PA 3I43A 3PINA 1U6TA 2K18A 5COHA 4JR6A 1KEBA 3O76A 1V57A 5C04A 8GSSA 2VL9A 2GSRA 1SK2A 4MF6A 3MNGA 2HRNA 4OMVA 1G7EA 3UMAA 3TGZA 1T00A 3DYRA 4HQZA 3S9FA 1G7OA 4EUYA 20GSA 2CA8A 3ZLPA 4HI7A 1SENA 2VLTA 2FNOA 2XPDA 3APOA 4HZ4A 1LBKA 2EIOA 1QMVA 1BEDA 5J5NA 4OFMA 3KH9A 2GSQA 3F3QA 3F4RA 4KDUA 1GTIA 3TKSC 4I2TA 1Z5YE 3I6AA 1X9WB 4XCSA 2UZ8A 2KOKA 2I4AA 2C3NA 5B6MA 4FH8A 4O5RA 6GSSA 3RHCA 1YKCA 3HDCA 1PGTA 3EVIA 4ZB9A 1CQGA 4PTSA 2H1GA 3CTFA 3DEXA 4NWYA 2QC7A 1V2AA 3FR3A 5JWQB 2MBSA 5F05A 2PWJA 5DAKA 1ABAA 1V98A 3L9SA 3RHBA 4P3YB 3F0IA 2DJJA 4HU7A 3C8EA 1BQ7A 4GXZA 5IO2A 4WBRD 2DIYA 1ILOA 1OC9B 4IHUA 1C72A 4HJMA 2GSTA 4MH3A 1E2YA 1H75A 2K8VA 1PQNA 4KW6A 3HHVA 1I5GA 1BYEA 4MJCA 3VPQA 5ECPB 6GSYA 5D8IA 5DALA 3DGQA 1ZYEA 2NBSA 2HRFA 4HEA2 2YCDA 4WR5A 2KLXA 2VUPA 4O7HA 5DCGA 1F3BA 3IAM2 4DSSB 1BX9A 13GSA 1O85A 3L0HA 4G10A 1BAYA 4F0CA
chains in the Genus database with same CATH superfamily
4J56E 5ID2A 4ZB8A 4E68A 1KNGA 3D6IA 1K0OA 2WZSA 5IMCA 4L5OA 1AAZA 4TXVA 3A5IA 4CDOA 3GA4A 5HFGA 3LYPA 1PD21 4ZBDA 5CRDA 1LJRA 5EY6A 1GL8A 1N8JA 2WW2A 3ZVJA 3VLNA 3CRUA 4L0UA 1AQWA 4EXJA 1VRSD 4EKZA 2CAIA 4XRAA 2K8SA 3N5OA 1ZL9A 1XG8A 4AI6A 1JZRA 4TW5A 1PKZA 4AJ8A 5CP1A 4HQSA 2H1AA 2B5EA 4F2IA 3GMFA 5LCZA 2HSHA 4ZILA 1AC1A 2PPTA 4CY6A 5FWGA 5J47A 4NMUA 5JWRB 3ZIJA 2AHEA 2QA1A 3FKFA 2V1MA 5ENUA 3Q74A 2LS5A 1ACVA 4MDCA 2FY6A 3APQA 4E8EA 3GYKA 1EV4A 1A24A 4K7IA 4MABA 3GNJA 4WXTA 2D2ZA 3FRCA 2WVXA 3C73A 2WS2A 3LFLA 2YP6A 2H73A 1W89A 2KUCA 4Z2RA 3CYNA 2IIYA 1X9SB 4N0ZA 1PL1A 1QUWA 1SKWB 2E2MA 4MZBA 4EIPA 1PMTA 1U87A 1F9MA 4ECJA 2CAQA 2QKEA 4K2XA 1DE2A 3QPMA 3CXGA 3EPTA 2AYTA 2IMFA 3H8QA 3K8NA 5A4WA 2H66A 3E3EA 4MA9A 2C80A 4EF0A 3GUSA 1YQ1A 2X64A 3FZ9A 3M8NA 4QL7A 2M80A 2LRCA 2VM2A 3QAGA 2PMTA 2EC4A 1SL2B 5AISA 4KNDA 4AGSA 1AXDA 2N5BA 2L5LA 2LRNA 2O85A 1GSDA 3CMIA 2GS3A 1M9BA 1SKRB 4MJEA 4X0XA 1K0CA 1AQXA 4G0IA 1OYJA 3IBHA 3EYTA 1O7UA 1OC9A 5GAND 5IPGA 1TKDB 1VF4A 2K6VA 2LV3A 3R3EA 2OKAA 2CV4A 2Z9SA 5ELAA 4JBBA 1RW1A 4FQUA 2HZFA 4Q5QA 4F0BA 4H86A 2VM1A 1GWCA 4PI0C 5ECMB 4DVCA 1Y1UA 2HNLA 2FWEA 4QQ7A 4N10A 1UA5A 2JZSA 1SVMA 1UC7A 3LXZA 2IPAA 5ECQB 2O87A 1R4WA 3UVHA 1ST9A 1KBNA 2VCQA 5A1NA 4BVXB 3GV1A 3GTUB 1PFOA 4TKYA 2V32A 4DSSA 4LMWA 4IELA 4GSTA 5ECSA 1TK5B 3FMWA 5IIZA 1FB0A 3ZITA 4IKHA 1N2AA 2VIMA 4HOJA 3KTBA 3UL3A 3EU4A 3RGBC 3D4TA 3HJMA 2DBCA 4IJIA 2R6KA 2FHEA 4K9ZA 1EP8A 3BOAA 2FA4A 2R2JA 3KCMA 4ECIA 4RI7A 2L4CA 5IMDA 4BWQA 2BMXA 2IJYA 3PGTA 5G5FA 5DVBA 5CRWA 4IP6A 10GSA 4K8MA 5DBQA 1XBSA 4AKGA 1CQHA 1M3IA 1SU9A 2H76A 3IDVA 3TB2A 3M0FA 1QQ2A 2L6DA 3WT1A 3WYWA 1F3AA 5A5HA 2HXKA 2VCVA 2NPBA 1WE0A 5B7CA 2L6CA 2VL2C 1GLPA 3IV4A 1XOAA 4IJ3A 1XZOA 1NM3A 1IYHA 3CTGA 4XTSA 2EFCA 1JLWA 3D22A 22GSA 5IMVA 5ECKB 2A2SA 3QDNA 4USSA 1PRXA 3L9VA 3ZL5A 1I9DA 1VF3A 2HZEB 2X8GA 1XPVA 5F0GA 1PX7A 11GSA 1A23A 2YWNA 1THXA 3DRNA 5B6NA 1M7TA 4YAPA 1K0DA 2HSMB 1R7HA 2HT9A 3IA1A 5D96A 4O92A 1G6WA 1N25A 2NDOA 2YZUA 2H71A 2WJUA 1XIYA 1EWXA 4FO5A 4IQ1A 1S3RA 2LTKA 2NTOA 4BWSA 5DQYA 1A2MA 1TRVA 4OO5A 3QAVA 4HU9A 1PN0A 4GWRA 4PNGA 4YAVA 1SK0A 4I6XA 2H75A 1Z7RA 2YV7A 3TJKA 2I81A 4X1UA 2HLSA 3LEFA 1XWGA 1YEXA 5FHIA 4A5PA 5CAXA 4XHMA 2QSIA 2PVQA 1V58A 4V1Ap 2B5XA 3W6GA 5BMUB 2LNTA 2DJ0A 3IHGA 2P31A 1USBA 3H1NA 2JL4A 2OA7A 5IPHA 4MPFA 2R0CA 4PI2C 1OKDA 5G1LA 4NHZA 1XWAA 3ISOA 5ECIB 4L5LA 4JRRA 3LXTA 3P90A 3LYKA 2WRTA 3MWHA 3E0UA 2OT3A 4W66A 2DMMA 4GDFA 19GSA 1SKSB 4FYCA 4BVXA 2HRKB 1MD4A 2O3EA 2B7KA 3GTUA 4CW9A 6GSWA 2H30A 2C1YA 5ECLB 1MDKA 5G1KA 5D73A 4ULXA 2EIQA 2FCHA 4YQUA 5IQYA 3IOSA 1OVNA 6GSUA 3TRXA 2GGTA 1Q4JA 3HVNA 2H1BA 3LJRA 3EMPA 3KM6A 3FR6A 5J41A 3M9KA 3TKSE 5DJMA 4G2EA 3VWUA 3APSA 5J9CA 3Q19A 1Z3EA 5HR0A 3MAKA 3C71A 1KTEA 2CT6A 4GLTA 1SYXA 5IMFA 1WP0A 2JSYA 3L78A 1BG5A 3I9V2 4KDYA 1YKAA 3GKNA 1OKTA 2C3QA 2L59A 4YKFA 4OD7A 2B1LA 3DKSA 4ZB7A 2H6YA 5KN2A 2LJKA 4G01A 1ZYPA 2N5FA 2XHFA 5IOWA 2IN3A 2VO4A 2CVDA 4WF4A 2LJAA 3MSZA 3L4NA 2PN8A 2DJ1A 2DC5A 2REMA 3DVWA 1YVLA 1OE8A 3US3A 4BVYB 1EP7A 1K0MA 4LA1A 4JE1A 1K0AA 3WGDA 3IHQA 4OFNA 1J9BA 1FB6A 3WGXA 5J40A 3HYPA 2GT6A 4LL1B 1XWCA 2O5VA 2WULA 3TJBA 3F4TA 5C00A 4I97A 3GKKA 3KMNA 3M3MA 4TOPA 5H5RA 3P7XA 3V1WA 5GSTA 2X8CA 5J4YA 3DMLA 2CVKA 1BJXA 1JZDA 4WF5A 2HSNB 1TU8A 3QCPA 4MF7A 1H4OA 3ZTLA 2C8UA 2DJ3A 5DQSA 3CSIA 1FHEA 2DKIA 2HSMA 4DSQA 2VCXA 2B1KA 3IC8A 3ZREA 2JSZA 4WKWA 1NHYA 3ZFLA 3Q18A 1Z6MA 4LMVA 5CRGA 4Z2UA 4KAEA 3DIEA 2FA8A 5ELGA 4PX1A 1F2EA 2GZPA 2P5QA 4XIHA 1T7PB 2X8HA 3IPZA 3J7Yk 1BF5A 4XRDA 2XC2A 3RPNA 3DWVA 2DSAA 4KF9A 1EEMA 1GTBA 5D93A 3FYGA 1X5DA 3TJGA 3HJPA 1THOA 3P8WA 1GNWA 5HFKA 4POBA 1WOUA 3IRAA 2DLXA 4PGTA 2WCIA 1SJZA 2H70A 5BMUA 4OO4A 4BA7A 4NHWA 2NVLA 3CHXC 5KEJA 2F51A 2VLUA 1QGVA 2IFQA 1SL1B 1ZGNA 4G19A 5LD0A 1T8EB 2BJXA 2C0DA 5H5QA 2IWTA 3D0ZA 2OACA 2VCWA 2HRKA 1F37A 2OE3A 4OCEA 1JHBA 4IP1A 3HVXA 2O8VB 3ME8A 1GULA 3O3TA 4MF5A 3FZ5A 1AQVA 4POLA 5F07A 1LU4A 1Z7PA 2H19A 3PH9A 1TI3A 4WR4A 3UARA 1M2AA 2PVOC 3PR8A 3AY8A 4N30A 5G31A 3QFBC 4N11A 5D9TA 3GFKA 4FXYP 1EV9A 4O32A 3KH7A 4KX4A 5L71A 3DXBA 4ECCA 4ISDA 2YJHA 2MYGA 4JEDA 2RUFA 4V2NA 4KCAA 3ERGA 1EOHA 4EL1A 2C0FA 3NIVA 1YJ6A 1YF1A 4E8HA 5JWOB 3I69A 4V2LA 4TN8A 1HYUA 1Y25A 4EIQA 3ZZXA 3GIXA 3LWAA 5E59A 1ERWA 2GQLA 3G9BA 4ZL7A 1EGOA 4RUVA 4Q5FA 3DD3A 4BVYA 4TR1B 1GUHA 3F6DA 3G7JA 3KXOA 2LSTA 1XVQA 3OR5A 2N5AA 4NV2A 1PL2A 2GZZA 4MPGA 1I1IP 2OADA 1X0RA 2KP1A 4ILFA 2CZ2A 2OE0A 3WT2A 2LEGA 2YJ7A 1G0TA 2BTOT 1OAZA 4PXOA 2HYXA 3HY2A 2G0FA 4KB3A 3A2XA 3IR4A 4JZQA 4Q5NA 4KCEA 4KSMA 5KN1A 2H6XA 5DCHA 3HCZA 4LLRA 1U3IA 3D5JA 4PQIA 3QMXA 2VL3A 1BG1A 1R5AA 1O8XA 3A2WA 6GSVA 1SD8A 5ABRA 1T1VA 3VWXA 2J9HA 4F82A 3G7YA 1TRSA 2LUSA 3IXRA 1OC3A 1YZXA 4MZWA 3GHAA 5CNWA 1M2DA 1X5CA 2AJQB 1TJDA 4ZL9A 4EDYA 1OC8A 2TIRA 5E4WA 2IMKA 1HNBA 4MLYA 2VD0A 5EL8A 5IOXA 1R5PA 1DSBA 5JCWA 2B5YA 5DDLA 1ZCPA 5INYA 2DMLA 2LQOA 2O89A 3EURA 2OBKA 2R37A 3QFAC 5HR1A 4ZXGA 1B8XA 1GLQA 1M99A 5DJLA 2H8LA 3BCKA 1M0UA 2GQKA 2V41A 2VLVA 3F3RA 4HUAA 4TR4A 1B9YC 12GSA 4RI6A 4CHSA 3H93A 3KEBA 2XBQA 3IK7A 1GSFA 3VK9A 3RAZA 4TR3A 2VKZG 3TKRA 4PQ1A 3GX0A 3A2VA 3KJYA 1TTZA 3ED3A 4ZB6A 4EC0A 5GSSA 1PX6A 2VAFA 2L5OA 3UEMA 2X99A 1ERUA 3UIWA 2MZCA 5J3RA 4V1Ag 3KP9A 2E0QA 2PUKC 4MCUA 5CRHA 1WIKA 2DIZA 1SL0B 3C1RA 4IBPA 2HSYA 3HVSA 5ECRB 2WZ9A 4KDXA 1TRUA 1Z9HA 2HQTA 2H6ZA 1PN9A 4CY8A 2CQ9A 5KOXA 1ERTA 1XOBA 2WVZA 3GH6A 2DJKA 2FGXA 4ID0A 5BRTA 1FAAA 2QA2A 3TDGA 9GSSA 4DSRA 2CX3A 4YH2A 5CO3A 2OBIA 3HXSA 5A4VA 3UAPA 3D4MA 1HD2A 3GL3A 2KHPA 2LNSA 5FT3A 1QXHA 2H1LA 1J0FA 3CBUA 1B4PA 4ZL8A 4EO3A 1O81A 1A8YA 1TP9A 5HQPA 4KGIA 5CREA 2VD1A 3F4SA 2WW1A 3TCOA 3LORA 1XFLA 3VURA 1ZYNA 4KSOA 4TR1A 4WBJA 4J2FA 1R26A 3U5RE 2X49A 1NW2A 1PKWA 2VOCA 3CRTA 2ALBA 2ZCTA 1RQMA 1A8LA 4Z7XA 1FW1A 3BD2A 1WRYA 2ZUPA 2MBTA 4XS4B 1HNCA 1GTAA 4OFTA 2CX4A 1A0FA 4MJAA 2YWOA 3D21A 3M9JA 4PNFA 14GSA 3EE2A 3GURA 1HNAA 6GSXA 2GQMA 2B3SA 1ZYQB 1TXXA 4I5QA 3ZFBA 4GSSA 2XBIA 4I8BA 4NAXA 3FHKA 4MZCA 3VWVA 1X9MB 1X5EA 4YQVA 5GZZB 3MYDA 4X43A 1GUKA 2VCTA 3KD0A 2WB9A 1XWKA 2L4QA 3GX8A 3N9JA 3EC3A 2RIIA 2F8FA 5J4UA 4TXOB 4D73B 2WFCA 2CZ3A 1PA3A 4HZ2A 4AKIA 2IMEA 3E9JB 3RFRC 1OE7A 1TK8B 3IAS2 4IS0A 3ERWA 1SK1A 1FVKA 5ECNB 2R0PA 2MMOA 3GH9A 1GSQA 1VGLA 2C4JA 2JZRA 5KN0A 2LRTA 2M46A 1GSYA 2YN1A 1EZKA 2YWIA 1GSSA 4EE0A 2ES7A 3U6VA 4K5RA 3TOUA 1RK4A 3ZMKA 1ZMAA 4K6XA 5IO0A 5A5KA 5G30A 16GSA 2OJLA 17GSA 1UN2A 3HJOA 4MNNA 2ON5A 2GDRA 4GCIA 4XS6A 4O5UA 1G6YA 2MMZA 2AAWA 4ML1A 3C7MA 3KP8A 2ON7A 4PQHA 1FO5A 3VPTA 3GSSA 1O8WA 3BCIA 2AV4A 1U3AA 3CWGA 3UVTA 2HZEA 3A5WA 1S4BP 2M72A 1T4ZA 2HFDA 1VF1A 3MIXA 1TI1A 1M2BA 5B8AA 1K3OA 1ML6A 2F8AA 3H4KA 1V9WA 4BPYA 3P2AA 3KGKA 4QL9A 2MMAA 2PERA 2WDUA 3FW2A 4K0NA 3TJJA 4ACSA 1JZOA 3KTLA 4ML6A 4NV5A 1URMA 2A4VA 2H0IA 2YV9A 2G2QA 3QOUA 2YZHA 4FYUA 2FWFA 1GTUA 1GNEA 4IN0A 2FLSA 1B9XC 1SJIA 2GVPA 1GH2A 2CVBA 4K0GA 4AF2A 3EU3A 4X4JA 5EPFA 4AKHA 3R2QA 1E6BA 2RLIA 3LSZA 1QK8A 5F8BA 1XVWA 1XWBA 5IMAA 2F9SA 4WETA 4N3ZA 3TKSA 3DVXA 2YPMA 4PUAA 3TOTA 2YANA 4MP4A 1WPIA 3L9UA 1MEKA 1GSUA 2KP2A 2EFDA 4XS4A 4G9HA 2MMNA 4QMKA 1SD9A 1TRWA 3C1SA 1B48A 2A4HA 2J23A 3A3TA 2K9FA 3F8UA 3F6FA 2YNXA 2R3XA 2RM6A 1K0BA 2I3YA 2V2GA 3O6TA 3F63A 2TRXA 3KIJA 4L0WA 4HJ2A 3TRPA 3MDKA 2AUVA 2L57A 5A5HB 4MMMA 2FWGA 4O5QA 3FZ4A 4RQRA 3F9UA 3HMJG 1AW9A 4FIWA 1TXUA 1F6MC 4GQCA 5AN1A 3WD6A 4IVFA 4XS1A 2FUG2 4N0VA 1ON4A 2O7KA 1ZZYA 1ZOFA 5D9VA 3M1GA 4TXOA 4D73A 1K0NA 2P0GA 1M9AA 1A2LA 2P5RA 2EFEA 5HFIA 4BL7B 3J7Yb 6GSTA 5B8BA 1B4QA 4YKGA 5A4UA 3ZRDA 4ECBA 4IGJA 5A34B 5ECHB 3TJFA 3ZIVA 3LGCA 4AKXB 2AB6A 2HE3A 3FEUA 2TRCP 1XW9A 2PBJA 5EVOA 4I2UA 2H0GA 3UBKA 1HQOA 3EMXA 2FD3A 3FR9A 2GSSA 3HKRA 2H01A 4F9ZA 2JACA 4PUFC 3ZMLA 1WJKA 4IW9A 2B7JA 3UJ1A 1FG4A 2HRAA 3WGEA 4HDEA 2DJ2A 1TK0B 4K2DA 1MDIA 4ZBBA 2YWMA 1YEWC 4MJBA 4ZBAA 1M3JA 3RDWA 1A0RP 1TW9A 1S3DA 1O73A 5IM9A 4G0LA 3HVVA 1TU7A 1XW6A 2I9HA 2FWHA 3RBTA 2HSNA 2WGRA 1GSEA 3IK9A 1IYIA 2EIRA 4J57E 3VFIA 2E2GA 4GF0A 3Q6OA 1WMJA 2PU9C 4GTUA 5AGYA 1K3YA 1GP1A 3HZ4A 4GQFA 1EEJA 2IMDA 3BBYA 4Q5RA 4TVEA 2VCZA 5D9WA 3TUEA 5D9XA 1YF0A 2V6OA 18GSA 2H74A 4G0KA 1SJ6A 3JCML 4WEYA 4KA0A 2R5GA 4DEJA 3IC4A 2JZTA 2V6KA 4RQXA 5G2ZA 4K7OA 3ZYWA 3GKMA 3ZVJD 1O6JA 1GUMA 4PURA 2DKHA 2LQQA 1TDIA 2IL3A 3NOFA 5AIVA 4JU5A 2H1DA 1Z6NA 4POKA 3HZ8A 1XW5A 2R4VA 4AJ7A 3GL5A 1V40A 5JCGA 4EVMA 1S3CA 2PGTA 1SYRA 3W8JA 2WW0A 1W4VA 3ERFA 1A2JA 1YEPA 2JADA 1YDKA 3ME7A 3LW9A 1T4YA 1PSQA 3LG6A 1JLVA 3CSHA 4KH7A 4IQAA 4OWYA 2C0EA 2QGVA 4LL4B 1MD3A 1NHOA 5DAKB 3EINA 2YOIA 4NPBA 1ERVA 4TR0A 4TRXA 2F3MA 1DUGA 4EDZA 1DE1A 4KE3A 5KN3A 5LNKe 5JCUA 3TKPA 4GSNA 4L8EA 5F06A 2A2RA 3VWWA 1SVOA 3EWLA 4V2MA 1GRXA 2LKUA 7GSSA 1WWJA 3UBLA 3KZQA 4BL7A 2HI7A 3BJ5A 4HS1A 4JR4A 1EGRA 4ICYA 3FZAA 5DALB 5H5SA 4F03A 3QD9A 3VI5A 1J08A 3TKQA 5A34A 1JZWA 4NXIA 2C3TA 3H79A 3QR6A 4MH2A 1DBYA 1S3AA 1TOFA 3GN3A 4HSCX 2H0HA 5ID2B 2IMIA 3VI7A 2H72A 2GZYA 1FOVA 5J9BA 3SWLA 2RUEA 3TU3B 3IE3A 2C0GA 5G5EA 3NZNA 4AJ6A 3CSJA 3G7IA 3GSTA 3HA9A 5IMZA 4POMA 3RPPA 3HD5A 3W8SA 1XCCA 2JU5A 5HR3A 4K7NA 2WW3A 1AIUA 4MK3A 2GTUA 1K3LA 3PPUA 1VF2A 1Y6EA 3FK8A 1U88A 2OE1A 1QFNA 4KUNA 3GRXA 2I1UA 1FVJA 2ZNMA 2GLRA 4K1FA 3UOMA 4ZIJA 3LQ7A 1Q98A 5ECOB 2IFQB 2RM5A 1XXUA 3TRQA 1JFUA 3SBCA 5GAPD 5HR2A 5AIXA 3GKXA 2GT5A 1NSWA 4GRFA 1EOGA 5CYYA 2XPEA 1MDJA 3QAWA 4FYBA 2LJRA 4OCFA 1YY7A 1UVZA 2VL2A 3FY7A 1AUCA 2O36A 3KMOA 1MTCA 2WVXB 4YQMA 2B6MA 1T3BA 2E7PA 3I43A 3PINA 1U6TA 2K18A 5COHA 4JR6A 1KEBA 3O76A 1V57A 5C04A 8GSSA 2VL9A 2GSRA 1SK2A 3CQFA 4MF6A 3MNGA 2X4AA 2HRNA 5J4VA 4OMVA 1G7EA 3UMAA 3TGZA 1T00A 3DYRA 4HQZA 4Z2TA 1G7OA 4EUYA 20GSA 2CA8A 3ZLPA 3S9FA 4HI7A 1SENA 2VLTA 2FNOA 2XPDA 3APOA 4HZ4A 1LBKA 2EIOA 1QMVA 1BEDA 2R0GA 5J5NA 4OFMA 2GSQA 3KH9A 3F3QA 3F4RA 4KDUA 1GTIA 3TKSC 4I2TA 1Z5YE 3I6AA 1X9WB 4XCSA 2UZ8A 2UV8G 2KOKA 2I4AA 2C3NA 5B6MA 4FH8A 4O5RA 6GSSA 3RHCA 1YKCA 3HDCA 1PGTA 3EVIA 4ZB9A 1CQGA 4PTSA 2H1GA 3CTFA 3DEXA 4NWYA 2QC7A 1V2AA 3FR3A 5JWQB 2MBSA 5F05A 4PHZC 2PWJA 5DAKA 1ABAA 1V98A 2A2PA 3L9SA 3RHBA 4P3YB 2WVYA 3F0IA 2DJJA 4HU7A 3C8EA 4K5SA 1BQ7A 4GXZA 5IO2A 4WBRD 1FOHA 2DIYA 1ILOA 1OC9B 4IHUA 1C72A 4HJMA 2GSTA 4MH3A 1E2YA 1H75A 2K8VA 1PQNA 4KW6A 3HHVA 4BIKA 1I5GA 1BYEA 4MJCA 1SVLA 3VPQA 5ECPB 2EFHA 6GSYA 5D8IA 5DALA 3DGQA 1ZYEA 2NBSA 2HRFA 4HEA2 2YCDA 4WR5A 2KLXA 2VUPA 4O7HA 5DCGA 5A1NB 1F3BA 3IAM2 4DSSB 1BX9A 13GSA 1O85A 3L0HA 4G10A 5KOWA 1BAYA 4F0CA
chains in the Genus database with same CATH topology
4J56E 5ID2A 4ZB8A 4E68A 1KNGA 3D6IA 1K0OA 5IMCA 4L5OA 1AAZA 4TXVA 3A5IA 4CDOA 3GA4A 5HFGA 3LYPA 1PD21 4ZBDA 5CRDA 1LJRA 5EY6A 1GL8A 1N8JA 3ZVJA 3VLNA 3CRUA 4L0UA 1AQWA 4EXJA 1VRSD 4EKZA 2CAIA 4XRAA 2K8SA 3N5OA 1ZL9A 4AI6A 1JZRA 4TW5A 1PKZA 4AJ8A 5CP1A 4HQSA 2H1AA 2B5EA 4F2IA 3GMFA 5LCZA 2HSHA 4ZILA 1AC1A 2PPTA 4CY6A 5FWGA 5J47A 4NMUA 5JWRB 3ZIJA 2AHEA 2QA1A 3FKFA 2V1MA 5ENUA 3Q74A 2LS5A 1ACVA 4MDCA 2FY6A 3APQA 4E8EA 3GYKA 1EV4A 1A24A 4K7IA 4MABA 3GNJA 4WXTA 2D2ZA 3FRCA 3C73A 2WS2A 3LFLA 2YP6A 2H73A 1W89A 2KUCA 4Z2RA 3CYNA 2IIYA 1X9SB 4N0ZA 1PL1A 1QUWA 1SKWB 2E2MA 4MZBA 4EIPA 1PMTA 1U87A 1F9MA 4ECJA 2CAQA 2QKEA 4K2XA 1DE2A 3QPMA 3CXGA 3EPTA 2AYTA 2IMFA 3H8QA 3K8NA 5A4WA 2H66A 3E3EA 4MA9A 2C80A 4EF0A 3GUSA 1YQ1A 2X64A 3FZ9A 3M8NA 4QL7A 2M80A 2LRCA 2VM2A 3QAGA 2PMTA 2EC4A 1SL2B 5AISA 4KNDA 4AGSA 1AXDA 2N5BA 2L5LA 2LRNA 2O85A 1GSDA 3CMIA 2GS3A 1M9BA 1SKRB 4MJEA 4X0XA 1K0CA 1AQXA 4G0IA 1OYJA 3IBHA 3EYTA 1O7UA 1OC9A 5GAND 5IPGA 1TKDB 1VF4A 2K6VA 2LV3A 3R3EA 2OKAA 2CV4A 2Z9SA 5ELAA 4JBBA 1RW1A 4FQUA 2HZFA 4Q5QA 4F0BA 4H86A 2VM1A 1GWCA 5ECMB 4DVCA 1Y1UA 2HNLA 2FWEA 4QQ7A 4N10A 1UA5A 2JZSA 1SVMA 1UC7A 3LXZA 2IPAA 5ECQB 2O87A 1R4WA 3UVHA 1ST9A 1KBNA 2VCQA 5A1NA 4BVXB 3GV1A 3GTUB 4TKYA 2V32A 4DSSA 4LMWA 4IELA 4GSTA 5ECSA 1TK5B 3FMWA 5IIZA 1FB0A 3ZITA 4IKHA 1N2AA 2VIMA 4HOJA 3KTBA 3UL3A 3EU4A 3D4TA 3HJMA 2DBCA 4IJIA 2R6KA 2FHEA 4K9ZA 1EP8A 3BOAA 2FA4A 2R2JA 3KCMA 4ECIA 4RI7A 2L4CA 5IMDA 4BWQA 2BMXA 2IJYA 3PGTA 5G5FA 5DVBA 5CRWA 4IP6A 10GSA 4K8MA 5DBQA 1XBSA 4AKGA 1CQHA 1SU9A 2H76A 3IDVA 3TB2A 3M0FA 1QQ2A 2L6DA 3WT1A 3WYWA 1F3AA 5A5HA 2HXKA 2VCVA 2NPBA 1WE0A 5B7CA 2L6CA 2VL2C 1GLPA 3IV4A 1XOAA 4IJ3A 1XZOA 1NM3A 1IYHA 3CTGA 4XTSA 2EFCA 1JLWA 3D22A 22GSA 5IMVA 5ECKB 2A2SA 3QDNA 4USSA 1PRXA 3L9VA 3ZL5A 1I9DA 1VF3A 2HZEB 2X8GA 1XPVA 5F0GA 1PX7A 11GSA 1A23A 2YWNA 1THXA 3DRNA 5B6NA 1M7TA 4YAPA 1K0DA 2HSMB 1R7HA 2HT9A 3IA1A 5D96A 4O92A 1G6WA 1N25A 2NDOA 2YZUA 2H71A 2WJUA 1XIYA 1EWXA 4FO5A 4IQ1A 2LTKA 2NTOA 4BWSA 5DQYA 1A2MA 1TRVA 4OO5A 3QAVA 4HU9A 1PN0A 4GWRA 4PNGA 4YAVA 1SK0A 4I6XA 2H75A 1Z7RA 2YV7A 3TJKA 2I81A 4X1UA 2HLSA 3LEFA 1XWGA 1YEXA 5FHIA 4A5PA 5CAXA 4XHMA 2QSIA 2PVQA 1V58A 4V1Ap 2B5XA 3W6GA 5BMUB 2LNTA 2DJ0A 3IHGA 2P31A 1USBA 3H1NA 2JL4A 2OA7A 5IPHA 4MPFA 2R0CA 1OKDA 5G1LA 4NHZA 1XWAA 3ISOA 5ECIB 4L5LA 4JRRA 3LXTA 3P90A 3LYKA 2WRTA 3MWHA 3E0UA 2OT3A 4W66A 2DMMA 4GDFA 19GSA 1SKSB 4FYCA 4BVXA 2HRKB 1MD4A 2B7KA 3GTUA 4CW9A 6GSWA 2H30A 2C1YA 5ECLB 1MDKA 5G1KA 5D73A 4ULXA 2EIQA 2FCHA 4YQUA 5IQYA 3IOSA 1OVNA 6GSUA 3TRXA 2GGTA 1Q4JA 2H1BA 3LJRA 3EMPA 3KM6A 3FR6A 5J41A 3M9KA 3TKSE 5DJMA 4G2EA 3VWUA 3APSA 5J9CA 3Q19A 1Z3EA 5HR0A 3MAKA 3C71A 1KTEA 2CT6A 4GLTA 1SYXA 5IMFA 1WP0A 2JSYA 3L78A 1BG5A 3I9V2 4KDYA 1YKAA 3GKNA 1OKTA 2C3QA 2L59A 4YKFA 4OD7A 2B1LA 3DKSA 4ZB7A 2H6YA 5KN2A 2LJKA 4G01A 1ZYPA 2N5FA 2XHFA 5IOWA 2IN3A 2VO4A 2CVDA 4WF4A 2LJAA 3MSZA 3L4NA 2PN8A 2DJ1A 2DC5A 2REMA 3DVWA 1YVLA 1OE8A 3US3A 4BVYB 1EP7A 1K0MA 4LA1A 4JE1A 1K0AA 3WGDA 3IHQA 4OFNA 1J9BA 1FB6A 3WGXA 5J40A 3HYPA 2GT6A 4LL1B 1XWCA 2O5VA 2WULA 3TJBA 3F4TA 5C00A 4I97A 3GKKA 3KMNA 3M3MA 4TOPA 5H5RA 3P7XA 3V1WA 5GSTA 2X8CA 5J4YA 3DMLA 2CVKA 1BJXA 1JZDA 4WF5A 2HSNB 1TU8A 3QCPA 4MF7A 1H4OA 3ZTLA 2C8UA 2DJ3A 5DQSA 3CSIA 1FHEA 2DKIA 2HSMA 4DSQA 2VCXA 2B1KA 3IC8A 3ZREA 2JSZA 4WKWA 1NHYA 3ZFLA 3Q18A 1Z6MA 4LMVA 5CRGA 4Z2UA 4KAEA 3DIEA 2FA8A 5ELGA 4PX1A 1F2EA 2GZPA 2P5QA 4XIHA 1T7PB 2X8HA 3IPZA 3J7Yk 1BF5A 4XRDA 2XC2A 3RPNA 3DWVA 2DSAA 4KF9A 1EEMA 1GTBA 5D93A 3FYGA 1X5DA 3TJGA 3HJPA 1THOA 3P8WA 1GNWA 5HFKA 4POBA 1WOUA 3IRAA 2DLXA 4PGTA 2WCIA 1SJZA 2H70A 5BMUA 4OO4A 4BA7A 4NHWA 2NVLA 5KEJA 2F51A 2VLUA 1QGVA 2IFQA 1SL1B 1ZGNA 4G19A 5LD0A 1T8EB 2BJXA 2C0DA 5H5QA 2IWTA 3D0ZA 2OACA 2VCWA 2HRKA 1F37A 2OE3A 4OCEA 1JHBA 4IP1A 3HVXA 2O8VB 3ME8A 1GULA 3O3TA 4MF5A 3FZ5A 1AQVA 4POLA 5F07A 1LU4A 1Z7PA 2H19A 3PH9A 1TI3A 4WR4A 3UARA 1M2AA 2PVOC 3PR8A 3AY8A 4N30A 5G31A 3QFBC 4N11A 5D9TA 3GFKA 1EV9A 4O32A 3KH7A 4KX4A 5L71A 3DXBA 4ECCA 4ISDA 2YJHA 2MYGA 4JEDA 2RUFA 4V2NA 4KCAA 3ERGA 1EOHA 4EL1A 2C0FA 3NIVA 1YJ6A 1YF1A 4E8HA 5JWOB 3I69A 4V2LA 4TN8A 1HYUA 1Y25A 4EIQA 3ZZXA 3GIXA 3LWAA 5E59A 1ERWA 2GQLA 3G9BA 4ZL7A 1EGOA 4RUVA 4Q5FA 3DD3A 4BVYA 4TR1B 1GUHA 3F6DA 3G7JA 3KXOA 2LSTA 1XVQA 3OR5A 2N5AA 4NV2A 1PL2A 2GZZA 4MPGA 2OADA 1X0RA 2KP1A 4ILFA 2CZ2A 2OE0A 3WT2A 2LEGA 2YJ7A 1G0TA 2BTOT 1OAZA 4PXOA 2HYXA 3HY2A 2G0FA 4KB3A 3A2XA 3IR4A 4JZQA 4Q5NA 4KCEA 4KSMA 5KN1A 2H6XA 5DCHA 3HCZA 4LLRA 1U3IA 3D5JA 4PQIA 3QMXA 2VL3A 1BG1A 1R5AA 1O8XA 3A2WA 6GSVA 1SD8A 5ABRA 1T1VA 3VWXA 2J9HA 4F82A 3G7YA 1TRSA 2LUSA 3IXRA 1OC3A 1YZXA 4MZWA 3GHAA 5CNWA 1M2DA 1X5CA 2AJQB 1TJDA 4ZL9A 4EDYA 1OC8A 2TIRA 5E4WA 2IMKA 1HNBA 4MLYA 2VD0A 5EL8A 5IOXA 1R5PA 1DSBA 5JCWA 2B5YA 5DDLA 1ZCPA 5INYA 2DMLA 2LQOA 2O89A 3EURA 2OBKA 2R37A 3QFAC 5HR1A 4ZXGA 1B8XA 1GLQA 1M99A 5DJLA 2H8LA 3BCKA 1M0UA 2GQKA 2V41A 2VLVA 3F3RA 4HUAA 4TR4A 1B9YC 12GSA 4RI6A 4CHSA 3H93A 3KEBA 2XBQA 3IK7A 1GSFA 3VK9A 3RAZA 4TR3A 2VKZG 3TKRA 4PQ1A 3GX0A 3A2VA 3KJYA 1TTZA 3ED3A 4ZB6A 4EC0A 5GSSA 1PX6A 2VAFA 2L5OA 3UEMA 2X99A 1ERUA 3UIWA 2MZCA 5J3RA 4V1Ag 3KP9A 2E0QA 2PUKC 4MCUA 5CRHA 1WIKA 2DIZA 1SL0B 3C1RA 4IBPA 2HSYA 3HVSA 5ECRB 2WZ9A 4KDXA 1TRUA 1Z9HA 2HQTA 2H6ZA 1PN9A 4CY8A 2CQ9A 5KOXA 1ERTA 1XOBA 3GH6A 2DJKA 2FGXA 4ID0A 5BRTA 1FAAA 2QA2A 3TDGA 9GSSA 4DSRA 2CX3A 4YH2A 5CO3A 2OBIA 3HXSA 5A4VA 3UAPA 3D4MA 1HD2A 3GL3A 2KHPA 2LNSA 5FT3A 1QXHA 2H1LA 1J0FA 3CBUA 1B4PA 4ZL8A 4EO3A 1O81A 1A8YA 1TP9A 5HQPA 4KGIA 5CREA 2VD1A 3F4SA 3TCOA 3LORA 1XFLA 3VURA 1ZYNA 4KSOA 4TR1A 4WBJA 4J2FA 1R26A 3U5RE 2X49A 1NW2A 1PKWA 2VOCA 3CRTA 2ALBA 2ZCTA 1RQMA 1A8LA 4Z7XA 1FW1A 3BD2A 1WRYA 2ZUPA 2MBTA 4XS4B 1HNCA 1GTAA 4OFTA 2CX4A 1A0FA 4MJAA 2YWOA 3D21A 3M9JA 4PNFA 14GSA 3EE2A 3GURA 1HNAA 6GSXA 2GQMA 2B3SA 1ZYQB 1TXXA 4I5QA 3ZFBA 4GSSA 2XBIA 4I8BA 4NAXA 3FHKA 4MZCA 3VWVA 1X9MB 1X5EA 4YQVA 5GZZB 3MYDA 4X43A 1GUKA 2VCTA 3KD0A 2WB9A 1XWKA 2L4QA 3GX8A 3N9JA 3EC3A 2RIIA 2F8FA 5J4UA 4TXOB 4D73B 2WFCA 2CZ3A 1PA3A 4HZ2A 4AKIA 2IMEA 3E9JB 1OE7A 1TK8B 3IAS2 4IS0A 3ERWA 1SK1A 1FVKA 5ECNB 2R0PA 2MMOA 3GH9A 1GSQA 1VGLA 2C4JA 2JZRA 5KN0A 2LRTA 2M46A 1GSYA 2YN1A 1EZKA 2YWIA 1GSSA 4EE0A 2ES7A 3U6VA 4K5RA 3TOUA 1RK4A 3ZMKA 1ZMAA 4K6XA 5IO0A 5A5KA 5G30A 16GSA 2OJLA 17GSA 1UN2A 3HJOA 4MNNA 2ON5A 2GDRA 4GCIA 4XS6A 4O5UA 1G6YA 2MMZA 2AAWA 4ML1A 3C7MA 3KP8A 2ON7A 4PQHA 1FO5A 3VPTA 3GSSA 1O8WA 3BCIA 2AV4A 1U3AA 3CWGA 3UVTA 2HZEA 3A5WA 2M72A 1T4ZA 2HFDA 1VF1A 3MIXA 1TI1A 1M2BA 5B8AA 1K3OA 1ML6A 2F8AA 3H4KA 1V9WA 4BPYA 3P2AA 3KGKA 4QL9A 2MMAA 2PERA 2WDUA 3FW2A 4K0NA 3TJJA 4ACSA 1JZOA 3KTLA 4ML6A 4NV5A 1URMA 2A4VA 2H0IA 2YV9A 2G2QA 3QOUA 2YZHA 4FYUA 2FWFA 1GTUA 1GNEA 4IN0A 2FLSA 1B9XC 1SJIA 2GVPA 1GH2A 2CVBA 4K0GA 4AF2A 3EU3A 4X4JA 5EPFA 4AKHA 3R2QA 1E6BA 2RLIA 3LSZA 1QK8A 5F8BA 1XVWA 1XWBA 5IMAA 2F9SA 4WETA 4N3ZA 3TKSA 3DVXA 2YPMA 4PUAA 3TOTA 2YANA 4MP4A 1WPIA 3L9UA 1MEKA 1GSUA 2KP2A 2EFDA 4XS4A 4G9HA 2MMNA 4QMKA 1SD9A 1TRWA 3C1SA 1B48A 2A4HA 2J23A 3A3TA 2K9FA 3F8UA 3F6FA 2YNXA 2R3XA 2RM6A 1K0BA 2I3YA 2V2GA 3O6TA 3F63A 2TRXA 3KIJA 4L0WA 4HJ2A 3TRPA 3MDKA 2AUVA 2L57A 5A5HB 4MMMA 2FWGA 4O5QA 3FZ4A 4RQRA 3F9UA 3HMJG 1AW9A 4FIWA 1TXUA 1F6MC 4GQCA 5AN1A 3WD6A 4IVFA 4XS1A 2FUG2 4N0VA 1ON4A 2O7KA 1ZZYA 1ZOFA 5D9VA 3M1GA 4TXOA 4D73A 1K0NA 2P0GA 1M9AA 1A2LA 2P5RA 2EFEA 5HFIA 4BL7B 3J7Yb 6GSTA 5B8BA 1B4QA 4YKGA 5A4UA 3ZRDA 4ECBA 4IGJA 5A34B 5ECHB 3TJFA 3ZIVA 3LGCA 4AKXB 2AB6A 2HE3A 3FEUA 2TRCP 1XW9A 2PBJA 5EVOA 4I2UA 2H0GA 3UBKA 1HQOA 3EMXA 2FD3A 3FR9A 2GSSA 3HKRA 2H01A 4F9ZA 2JACA 4PUFC 3ZMLA 1WJKA 4IW9A 2B7JA 3UJ1A 1FG4A 2HRAA 3WGEA 4HDEA 2DJ2A 1TK0B 4K2DA 1MDIA 4ZBBA 2YWMA 4MJBA 4ZBAA 3RDWA 1A0RP 1TW9A 1S3DA 1O73A 5IM9A 4G0LA 3HVVA 1TU7A 1XW6A 2I9HA 2FWHA 3RBTA 2HSNA 2WGRA 1GSEA 3IK9A 1IYIA 2EIRA 4J57E 3VFIA 2E2GA 4GF0A 3Q6OA 1WMJA 2PU9C 4GTUA 5AGYA 1K3YA 1GP1A 3HZ4A 4GQFA 1EEJA 2IMDA 3BBYA 4Q5RA 4TVEA 2VCZA 5D9WA 3TUEA 5D9XA 1YF0A 2V6OA 18GSA 2H74A 4G0KA 1SJ6A 3JCML 4WEYA 4KA0A 2R5GA 4DEJA 3IC4A 2JZTA 2V6KA 4RQXA 5G2ZA 4K7OA 3ZYWA 3GKMA 3ZVJD 1O6JA 1GUMA 4PURA 2DKHA 2LQQA 1TDIA 2IL3A 3NOFA 5AIVA 4JU5A 2H1DA 1Z6NA 4POKA 3HZ8A 1XW5A 2R4VA 4AJ7A 3GL5A 1V40A 5JCGA 4EVMA 1S3CA 2PGTA 1SYRA 3W8JA 1W4VA 3ERFA 1A2JA 1YEPA 2JADA 1YDKA 3ME7A 3LW9A 1T4YA 1PSQA 3LG6A 1JLVA 3CSHA 4KH7A 4IQAA 4OWYA 2C0EA 2QGVA 4LL4B 1MD3A 1NHOA 5DAKB 3EINA 2YOIA 4NPBA 1ERVA 4TR0A 4TRXA 2F3MA 1DUGA 4EDZA 1DE1A 4KE3A 5KN3A 5LNKe 5JCUA 3TKPA 4GSNA 4L8EA 5F06A 2A2RA 3VWWA 1SVOA 3EWLA 4V2MA 1GRXA 2LKUA 7GSSA 1WWJA 3UBLA 3KZQA 4BL7A 2HI7A 3BJ5A 4HS1A 4JR4A 1EGRA 4ICYA 3FZAA 5DALB 5H5SA 4F03A 3QD9A 3VI5A 1J08A 3TKQA 5A34A 1JZWA 4NXIA 2C3TA 3H79A 3QR6A 4MH2A 1DBYA 1S3AA 1TOFA 3GN3A 2H0HA 5ID2B 2IMIA 3VI7A 2H72A 2GZYA 1FOVA 5J9BA 3SWLA 2RUEA 3TU3B 3IE3A 2C0GA 5G5EA 3NZNA 4AJ6A 3CSJA 3G7IA 3GSTA 3HA9A 5IMZA 4POMA 3RPPA 3HD5A 3W8SA 1XCCA 2JU5A 5HR3A 4K7NA 1AIUA 4MK3A 2GTUA 1K3LA 3PPUA 1VF2A 1Y6EA 3FK8A 1U88A 2OE1A 1QFNA 4KUNA 3GRXA 2I1UA 1FVJA 2ZNMA 2GLRA 4K1FA 3UOMA 4ZIJA 3LQ7A 1Q98A 5ECOB 2IFQB 2RM5A 1XXUA 3TRQA 1JFUA 3SBCA 5GAPD 5HR2A 5AIXA 3GKXA 2GT5A 1NSWA 4GRFA 1EOGA 5CYYA 2XPEA 1MDJA 3QAWA 4FYBA 2LJRA 4OCFA 1YY7A 1UVZA 2VL2A 3FY7A 1AUCA 3KMOA 1MTCA 4YQMA 2B6MA 1T3BA 2E7PA 3I43A 3PINA 1U6TA 2K18A 5COHA 4JR6A 1KEBA 3O76A 1V57A 5C04A 8GSSA 2VL9A 2GSRA 1SK2A 4MF6A 3MNGA 2X4AA 2HRNA 5J4VA 4OMVA 1G7EA 3UMAA 3TGZA 1T00A 3DYRA 4HQZA 4Z2TA 1G7OA 4EUYA 20GSA 2CA8A 3ZLPA 3S9FA 4HI7A 1SENA 2VLTA 2FNOA 2XPDA 3APOA 4HZ4A 1LBKA 2EIOA 1QMVA 1BEDA 2R0GA 5J5NA 4OFMA 3KH9A 2GSQA 3F3QA 3F4RA 4KDUA 1GTIA 3TKSC 4I2TA 1Z5YE 3I6AA 1X9WB 4XCSA 2UZ8A 2UV8G 2KOKA 2I4AA 2C3NA 5B6MA 4FH8A 4O5RA 6GSSA 3RHCA 1YKCA 3HDCA 1PGTA 3EVIA 4ZB9A 1CQGA 4PTSA 2H1GA 3CTFA 3DEXA 4NWYA 2QC7A 1V2AA 3FR3A 5JWQB 2MBSA 5F05A 2PWJA 5DAKA 1ABAA 1V98A 2A2PA 3L9SA 3RHBA 4P3YB 3F0IA 2DJJA 4HU7A 3C8EA 4K5SA 1BQ7A 4GXZA 5IO2A 4WBRD 1FOHA 2DIYA 1ILOA 1OC9B 4IHUA 1C72A 4HJMA 2GSTA 4MH3A 1E2YA 1H75A 2K8VA 1PQNA 4KW6A 3HHVA 1I5GA 1BYEA 4MJCA 1SVLA 3VPQA 5ECPB 2EFHA 6GSYA 5D8IA 5DALA 3DGQA 1ZYEA 2NBSA 2HRFA 4HEA2 2YCDA 4WR5A 2KLXA 2VUPA 4O7HA 5DCGA 5A1NB 1F3BA 3IAM2 4DSSB 1BX9A 13GSA 1O85A 3L0HA 4G10A 5KOWA 1BAYA 4F0CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J56 E;  5ID2 A;  4ZB8 A;  1KNG A;  3D6I A;  1K0O A;  5IMC A;  4L5O A;  1AAZ A;  4TXV A;  4CDO A;  3GA4 A;  5HFG A;  3LYP A;  1PD2 1;  4ZBD A;  5CRD A;  1LJR A;  5EY6 A;  1GL8 A;  1N8J A;  3ZVJ A;  3VLN A;  3CRU A;  4L0U A;  1AQW A;  4EXJ A;  1VRS D;  4EKZ A;  2CAI A;  4XRA A;  2K8S A;  3N5O A;  1ZL9 A;  1JZR A;  4TW5 A;  1PKZ A;  4AJ8 A;  5CP1 A;  4HQS A;  2H1A A;  2B5E A;  4F2I A;  3GMF A;  5LCZ A;  2HSH A;  4ZIL A;  1AC1 A;  2PPT A;  5FWG A;  4NMU A;  5JWR B;  3ZIJ A;  2AHE A;  3FKF A;  2V1M A;  5ENU A;  3Q74 A;  2LS5 A;  1ACV A;  4MDC A;  2FY6 A;  3APQ A;  4E8E A;  3GYK A;  1EV4 A;  1A24 A;  4K7I A;  4MAB A;  3GNJ A;  4WXT A;  2D2Z A;  3FRC A;  3C73 A;  2WS2 A;  3LFL A;  2YP6 A;  2H73 A;  1W89 A;  2KUC A;  3CYN A;  2IIY A;  1X9S B;  4N0Z A;  1PL1 A;  1QUW A;  1SKW B;  2E2M A;  4MZB A;  1PMT A;  1U87 A;  1F9M A;  4ECJ A;  2CAQ A;  2QKE A;  1DE2 A;  3QPM A;  3CXG A;  2AYT A;  2IMF A;  3H8Q A;  3K8N A;  5A4W A;  2H66 A;  3E3E A;  4MA9 A;  2C80 A;  4EF0 A;  3GUS A;  1YQ1 A;  2X64 A;  3FZ9 A;  3M8N A;  4QL7 A;  2M80 A;  2LRC A;  2VM2 A;  3QAG A;  2PMT A;  2EC4 A;  1SL2 B;  5AIS A;  4KND A;  4AGS A;  1AXD A;  2N5B A;  2L5L A;  2LRN A;  2O85 A;  1GSD A;  3CMI A;  2GS3 A;  1M9B A;  1SKR B;  4MJE A;  4X0X A;  1K0C A;  1AQX A;  4G0I A;  1OYJ A;  3IBH A;  3EYT A;  1O7U A;  1OC9 A;  5GAN D;  5IPG A;  1TKD B;  1VF4 A;  2K6V A;  2LV3 A;  3R3E A;  2OKA A;  2CV4 A;  2Z9S A;  5ELA A;  4JBB A;  1RW1 A;  4FQU A;  2HZF A;  4Q5Q A;  4F0B A;  4H86 A;  2VM1 A;  1GWC A;  5ECM B;  4DVC A;  2HNL A;  2FWE A;  4QQ7 A;  4N10 A;  1UA5 A;  2JZS A;  1UC7 A;  3LXZ A;  2IPA A;  5ECQ B;  2O87 A;  1R4W A;  3UVH A;  1ST9 A;  1KBN A;  2VCQ A;  4BVX B;  3GV1 A;  3GTU B;  4TKY A;  2V32 A;  4DSS A;  4LMW A;  4IEL A;  4GST A;  5ECS A;  1TK5 B;  5IIZ A;  1FB0 A;  3ZIT A;  4IKH A;  1N2A A;  2VIM A;  4HOJ A;  3KTB A;  3UL3 A;  3EU4 A;  3D4T A;  3HJM A;  2DBC A;  4IJI A;  2R6K A;  2FHE A;  4K9Z A;  1EP8 A;  3BOA A;  2FA4 A;  2R2J A;  3KCM A;  4ECI A;  4RI7 A;  2L4C A;  5IMD A;  4BWQ A;  2BMX A;  2IJY A;  3PGT A;  5G5F A;  5DVB A;  5CRW A;  4IP6 A;  10GS A;  4K8M A;  5DBQ A;  1XBS A;  1CQH A;  1SU9 A;  2H76 A;  3IDV A;  3TB2 A;  3M0F A;  1QQ2 A;  2L6D A;  3WT1 A;  3WYW A;  1F3A A;  2HXK A;  2VCV A;  2NPB A;  1WE0 A;  5B7C A;  2L6C A;  2VL2 C;  1GLP A;  3IV4 A;  1XOA A;  4IJ3 A;  1XZO A;  1NM3 A;  1IYH A;  3CTG A;  4XTS A;  1JLW A;  3D22 A;  22GS A;  5IMV A;  5ECK B;  2A2S A;  3QDN A;  4USS A;  1PRX A;  3L9V A;  3ZL5 A;  1I9D A;  1VF3 A;  2HZE B;  2X8G A;  1XPV A;  5F0G A;  1PX7 A;  11GS A;  1A23 A;  2YWN A;  1THX A;  3DRN A;  5B6N A;  1M7T A;  4YAP A;  1K0D A;  2HSM B;  1R7H A;  2HT9 A;  3IA1 A;  5D96 A;  4O92 A;  1G6W A;  2NDO A;  2YZU A;  2H71 A;  2WJU A;  1XIY A;  4FO5 A;  1EWX A;  4IQ1 A;  2LTK A;  2NTO A;  4BWS A;  5DQY A;  1A2M A;  1TRV A;  4OO5 A;  3QAV A;  4HU9 A;  4GWR A;  4PNG A;  4YAV A;  4I6X A;  1SK0 A;  2H75 A;  1Z7R A;  2YV7 A;  3TJK A;  2I81 A;  4X1U A;  2HLS A;  3LEF A;  1XWG A;  1YEX A;  5FHI A;  5CAX A;  4XHM A;  2QSI A;  2PVQ A;  1V58 A;  4V1A p;  2B5X A;  3W6G A;  2LNT A;  2DJ0 A;  2P31 A;  1USB A;  3H1N A;  2JL4 A;  2OA7 A;  5IPH A;  4MPF A;  1OKD A;  5G1L A;  4NHZ A;  1XWA A;  3ISO A;  5ECI B;  4L5L A;  4JRR A;  3LXT A;  3P90 A;  3LYK A;  2WRT A;  3MWH A;  3E0U A;  2DMM A;  19GS A;  1SKS B;  4FYC A;  4BVX A;  2HRK B;  1MD4 A;  2B7K A;  3GTU A;  4CW9 A;  6GSW A;  2H30 A;  2C1Y A;  5ECL B;  1MDK A;  5G1K A;  5D73 A;  4ULX A;  2EIQ A;  2FCH A;  4YQU A;  5IQY A;  3IOS A;  1OVN A;  6GSU A;  3TRX A;  2GGT A;  1Q4J A;  2H1B A;  3LJR A;  3EMP A;  3KM6 A;  3FR6 A;  5J41 A;  3M9K A;  3TKS E;  5DJM A;  4G2E A;  3VWU A;  3APS A;  5J9C A;  3Q19 A;  1Z3E A;  5HR0 A;  3MAK A;  3C71 A;  1KTE A;  2CT6 A;  4GLT A;  1SYX A;  5IMF A;  1WP0 A;  2JSY A;  3L78 A;  1BG5 A;  3I9V 2;  4KDY A;  1YKA A;  3GKN A;  1OKT A;  2C3Q A;  2L59 A;  4OD7 A;  2B1L A;  3DKS A;  2H6Y A;  5KN2 A;  2LJK A;  2N5F A;  2XHF A;  5IOW A;  2IN3 A;  2VO4 A;  2CVD A;  4WF4 A;  2LJA A;  3MSZ A;  3L4N A;  2PN8 A;  2DJ1 A;  2DC5 A;  2REM A;  3DVW A;  1OE8 A;  3US3 A;  4BVY B;  1EP7 A;  1K0M A;  4LA1 A;  4JE1 A;  1K0A A;  3WGD A;  3IHQ A;  4OFN A;  1J9B A;  1FB6 A;  3WGX A;  3HYP A;  2GT6 A;  4LL1 B;  1XWC A;  2WUL A;  3TJB A;  3F4T A;  5C00 A;  4I97 A;  3GKK A;  3KMN A;  3M3M A;  4TOP A;  5H5R A;  3P7X A;  3V1W A;  5GST A;  2X8C A;  3DML A;  2CVK A;  1BJX A;  1JZD A;  4WF5 A;  2HSN B;  1TU8 A;  3QCP A;  4MF7 A;  1H4O A;  3ZTL A;  2C8U A;  2DJ3 A;  5DQS A;  3CSI A;  1FHE A;  2HSM A;  4DSQ A;  2VCX A;  2B1K A;  3IC8 A;  3ZRE A;  2JSZ A;  4WKW A;  1NHY A;  3ZFL A;  3Q18 A;  1Z6M A;  4LMV A;  5CRG A;  4KAE A;  3DIE A;  2FA8 A;  5ELG A;  4PX1 A;  1F2E A;  2GZP A;  2P5Q A;  4XIH A;  1T7P B;  2X8H A;  3IPZ A;  3J7Y k;  4XRD A;  2XC2 A;  3RPN A;  3DWV A;  2DSA A;  4KF9 A;  1EEM A;  1GTB A;  5D93 A;  3FYG A;  1X5D A;  3TJG A;  3HJP A;  1THO A;  3P8W A;  1GNW A;  5HFK A;  4POB A;  1WOU A;  3IRA A;  2DLX A;  4PGT A;  2WCI A;  1SJZ A;  2H70 A;  5BMU A;  4OO4 A;  4BA7 A;  4NHW A;  2NVL A;  5KEJ A;  2F51 A;  2VLU A;  1QGV A;  2IFQ A;  1SL1 B;  1ZGN A;  4G19 A;  5LD0 A;  1T8E B;  2BJX A;  2C0D A;  5H5Q A;  2IWT A;  3D0Z A;  2OAC A;  2VCW A;  2HRK A;  1F37 A;  2OE3 A;  4OCE A;  1JHB A;  4IP1 A;  3HVX A;  2O8V B;  3ME8 A;  1GUL A;  3O3T A;  4MF5 A;  3FZ5 A;  1AQV A;  4POL A;  5F07 A;  1LU4 A;  1Z7P A;  2H19 A;  3PH9 A;  1TI3 A;  4WR4 A;  3UAR A;  1M2A A;  2PVO C;  3PR8 A;  3AY8 A;  4N30 A;  5G31 A;  3QFB C;  4N11 A;  5D9T A;  3GFK A;  1EV9 A;  4O32 A;  3KH7 A;  4KX4 A;  5L71 A;  3DXB A;  4ECC A;  4ISD A;  2YJH A;  2MYG A;  4JED A;  2RUF A;  4V2N A;  4KCA A;  3ERG A;  1EOH A;  4EL1 A;  2C0F A;  3NIV A;  1YJ6 A;  1YF1 A;  4E8H A;  5JWO B;  3I69 A;  4V2L A;  4TN8 A;  1HYU A;  1Y25 A;  3ZZX A;  3GIX A;  3LWA A;  5E59 A;  1ERW A;  2GQL A;  3G9B A;  4ZL7 A;  1EGO A;  4RUV A;  4Q5F A;  3DD3 A;  4BVY A;  4TR1 B;  1GUH A;  3F6D A;  3G7J A;  3KXO A;  2LST A;  1XVQ A;  3OR5 A;  2N5A A;  4NV2 A;  1PL2 A;  2GZZ A;  4MPG A;  2OAD A;  1X0R A;  2KP1 A;  4ILF A;  2CZ2 A;  2OE0 A;  3WT2 A;  2LEG A;  2YJ7 A;  1G0T A;  2BTO T;  1OAZ A;  4PXO A;  2HYX A;  3HY2 A;  2G0F A;  4KB3 A;  3A2X A;  3IR4 A;  4JZQ A;  4Q5N A;  4KCE A;  4KSM A;  5KN1 A;  2H6X A;  5DCH A;  3HCZ A;  4LLR A;  1U3I A;  3D5J A;  4PQI A;  3QMX A;  2VL3 A;  1R5A A;  1O8X A;  3A2W A;  6GSV A;  1SD8 A;  5ABR A;  1T1V A;  3VWX A;  2J9H A;  4F82 A;  3G7Y A;  1TRS A;  2LUS A;  3IXR A;  1OC3 A;  1YZX A;  4MZW A;  3GHA A;  5CNW A;  1M2D A;  1X5C A;  2AJQ B;  1TJD A;  4ZL9 A;  4EDY A;  1OC8 A;  2TIR A;  5E4W A;  2IMK A;  1HNB A;  4MLY A;  2VD0 A;  5EL8 A;  5IOX A;  1R5P A;  1DSB A;  5JCW A;  2B5Y A;  5DDL A;  1ZCP A;  5INY A;  2DML A;  2LQO A;  2O89 A;  3EUR A;  2OBK A;  2R37 A;  3QFA C;  5HR1 A;  4ZXG A;  1B8X A;  1GLQ A;  1M99 A;  5DJL A;  2H8L A;  3BCK A;  1M0U A;  2GQK A;  2V41 A;  2VLV A;  3F3R A;  4HUA A;  4TR4 A;  1B9Y C;  12GS A;  4RI6 A;  4CHS A;  3H93 A;  3KEB A;  2XBQ A;  3IK7 A;  1GSF A;  3VK9 A;  3RAZ A;  4TR3 A;  3TKR A;  4PQ1 A;  3GX0 A;  3A2V A;  3KJY A;  1TTZ A;  3ED3 A;  4ZB6 A;  4EC0 A;  5GSS A;  1PX6 A;  2VAF A;  2L5O A;  3UEM A;  2X99 A;  1ERU A;  3UIW A;  2MZC A;  5J3R A;  4V1A g;  3KP9 A;  2E0Q A;  2PUK C;  4MCU A;  5CRH A;  1WIK A;  2DIZ A;  1SL0 B;  3C1R A;  4IBP A;  2HSY A;  3HVS A;  5ECR B;  2WZ9 A;  4KDX A;  1TRU A;  1Z9H A;  2HQT A;  2H6Z A;  1PN9 A;  2CQ9 A;  1ERT A;  1XOB A;  3GH6 A;  2DJK A;  2FGX A;  4ID0 A;  1FAA A;  3TDG A;  9GSS A;  4DSR A;  2CX3 A;  4YH2 A;  5CO3 A;  2OBI A;  3HXS A;  5A4V A;  3UAP A;  3D4M A;  1HD2 A;  3GL3 A;  2KHP A;  2LNS A;  5FT3 A;  1QXH A;  1J0F A;  3CBU A;  1B4P A;  4ZL8 A;  4EO3 A;  1O81 A;  1A8Y A;  1TP9 A;  5HQP A;  4KGI A;  5CRE A;  2VD1 A;  3F4S A;  3TCO A;  3LOR A;  1XFL A;  3VUR A;  4KSO A;  4TR1 A;  4WBJ A;  4J2F A;  1R26 A;  3U5R E;  1NW2 A;  1PKW A;  2VOC A;  3CRT A;  2ALB A;  2ZCT A;  1RQM A;  1A8L A;  4Z7X A;  1FW1 A;  3BD2 A;  1WRY A;  2ZUP A;  2MBT A;  4XS4 B;  1HNC A;  1GTA A;  4OFT A;  2CX4 A;  1A0F A;  4MJA A;  2YWO A;  3D21 A;  3M9J A;  4PNF A;  14GS A;  3EE2 A;  3GUR A;  1HNA A;  6GSX A;  2GQM A;  2B3S A;  1ZYQ B;  1TXX A;  4I5Q A;  3ZFB A;  4GSS A;  4I8B A;  2XBI A;  4NAX A;  3FHK A;  4MZC A;  3VWV A;  1X9M B;  1X5E A;  4YQV A;  5GZZ B;  4X43 A;  1GUK A;  2VCT A;  3KD0 A;  2WB9 A;  1XWK A;  2L4Q A;  3GX8 A;  3N9J A;  3EC3 A;  2RII A;  2F8F A;  5J4U A;  4TXO B;  4D73 B;  2WFC A;  2CZ3 A;  1PA3 A;  4HZ2 A;  2IME A;  3E9J B;  1OE7 A;  1TK8 B;  3IAS 2;  4IS0 A;  3ERW A;  1SK1 A;  1FVK A;  5ECN B;  2MMO A;  3GH9 A;  1GSQ A;  1VGL A;  2C4J A;  2JZR A;  5KN0 A;  2LRT A;  2M46 A;  1GSY A;  2YN1 A;  1EZK A;  2YWI A;  1GSS A;  4EE0 A;  2ES7 A;  3U6V A;  3TOU A;  1RK4 A;  3ZMK A;  1ZMA A;  4K6X A;  5IO0 A;  5A5K A;  5G30 A;  16GS A;  2OJL A;  17GS A;  1UN2 A;  3HJO A;  2ON5 A;  2GDR A;  4GCI A;  4XS6 A;  1G6Y A;  2MMZ A;  2AAW A;  4ML1 A;  3C7M A;  3KP8 A;  2ON7 A;  4PQH A;  1FO5 A;  3VPT A;  3GSS A;  1O8W A;  3BCI A;  2AV4 A;  1U3A A;  3UVT A;  2HZE A;  3A5W A;  2M72 A;  1T4Z A;  2HFD A;  1VF1 A;  1TI1 A;  1M2B A;  5B8A A;  1K3O A;  1ML6 A;  2F8A A;  3H4K A;  1V9W A;  4BPY A;  3P2A A;  3KGK A;  4QL9 A;  2MMA A;  2PER A;  2WDU A;  3FW2 A;  4K0N A;  3TJJ A;  4ACS A;  1JZO A;  3KTL A;  4ML6 A;  4NV5 A;  1URM A;  2A4V A;  2H0I A;  2YV9 A;  2G2Q A;  3QOU A;  2YZH A;  4FYU A;  2FWF A;  1GTU A;  1GNE A;  4IN0 A;  2FLS A;  1B9X C;  1SJI A;  2GVP A;  1GH2 A;  2CVB A;  4K0G A;  4AF2 A;  3EU3 A;  5EPF A;  3R2Q A;  1E6B A;  2RLI A;  3LSZ A;  1QK8 A;  5F8B A;  1XVW A;  1XWB A;  5IMA A;  2F9S A;  4WET A;  3TKS A;  3DVX A;  2YPM A;  4PUA A;  3TOT A;  2YAN A;  4MP4 A;  1WPI A;  3L9U A;  1MEK A;  1GSU A;  2KP2 A;  4XS4 A;  4G9H A;  2MMN A;  1SD9 A;  1TRW A;  3C1S A;  1B48 A;  2J23 A;  3A3T A;  2K9F A;  3F8U A;  3F6F A;  2YNX A;  2R3X A;  2RM6 A;  1K0B A;  2I3Y A;  2V2G A;  3O6T A;  3F63 A;  2TRX A;  3KIJ A;  4L0W A;  4HJ2 A;  3TRP A;  3MDK A;  2AUV A;  2L57 A;  4MMM A;  2FWG A;  3FZ4 A;  4RQR A;  3F9U A;  1AW9 A;  4FIW A;  1F6M C;  4GQC A;  5AN1 A;  3WD6 A;  4IVF A;  4XS1 A;  2FUG 2;  4N0V A;  1ON4 A;  2O7K A;  1ZZY A;  1ZOF A;  5D9V A;  3M1G A;  4TXO A;  4D73 A;  1K0N A;  2P0G A;  1M9A A;  1A2L A;  2P5R A;  5HFI A;  4BL7 B;  3J7Y b;  6GST A;  5B8B A;  1B4Q A;  5A4U A;  3ZRD A;  4ECB A;  4IGJ A;  5ECH B;  3TJF A;  3ZIV A;  3LGC A;  2AB6 A;  2HE3 A;  3FEU A;  2TRC P;  1XW9 A;  2PBJ A;  5EVO A;  4I2U A;  2H0G A;  3UBK A;  1HQO A;  3EMX A;  2FD3 A;  3FR9 A;  2GSS A;  3HKR A;  2H01 A;  4F9Z A;  2JAC A;  4PUF C;  3ZML A;  1WJK A;  4IW9 A;  2B7J A;  3UJ1 A;  1FG4 A;  2HRA A;  3WGE A;  4HDE A;  2DJ2 A;  1TK0 B;  4K2D A;  1MDI A;  4ZBB A;  2YWM A;  4MJB A;  4ZBA A;  3RDW A;  1A0R P;  1TW9 A;  1S3D A;  1O73 A;  5IM9 A;  4G0L A;  3HVV A;  1TU7 A;  1XW6 A;  2I9H A;  2FWH A;  3RBT A;  2WGR A;  1GSE A;  3IK9 A;  1IYI A;  2EIR A;  4J57 E;  3VFI A;  2E2G A;  4GF0 A;  3Q6O A;  1WMJ A;  2PU9 C;  4GTU A;  5AGY A;  1K3Y A;  1GP1 A;  3HZ4 A;  4GQF A;  1EEJ A;  2IMD A;  3BBY A;  4Q5R A;  4TVE A;  2VCZ A;  5D9W A;  3TUE A;  5D9X A;  1YF0 A;  2V6O A;  18GS A;  2H74 A;  4G0K A;  1SJ6 A;  3JCM L;  4WEY A;  4KA0 A;  2R5G A;  4DEJ A;  3IC4 A;  2JZT A;  2V6K A;  4RQX A;  5G2Z A;  4K7O A;  3ZYW A;  3GKM A;  3ZVJ D;  1O6J A;  1GUM A;  4PUR A;  2LQQ A;  1TDI A;  2IL3 A;  3NOF A;  5AIV A;  4JU5 A;  2H1D A;  1Z6N A;  4POK A;  3HZ8 A;  1XW5 A;  2R4V A;  4AJ7 A;  3GL5 A;  1V40 A;  5JCG A;  4EVM A;  1S3C A;  2PGT A;  1SYR A;  3W8J A;  1W4V A;  3ERF A;  1A2J A;  1YEP A;  2JAD A;  1YDK A;  3ME7 A;  1T4Y A;  1PSQ A;  3LG6 A;  1JLV A;  3CSH A;  4KH7 A;  4IQA A;  4OWY A;  2C0E A;  2QGV A;  4LL4 B;  1MD3 A;  1NHO A;  5DAK B;  3EIN A;  2YOI A;  4NPB A;  1ERV A;  4TR0 A;  4TRX A;  2F3M A;  1DUG A;  4EDZ A;  1DE1 A;  4KE3 A;  5KN3 A;  5LNK e;  5JCU A;  3TKP A;  4GSN A;  4L8E A;  5F06 A;  2A2R A;  3VWW A;  3EWL A;  4V2M A;  1GRX A;  2LKU A;  7GSS A;  1WWJ A;  3UBL A;  3KZQ A;  4BL7 A;  2HI7 A;  3BJ5 A;  4HS1 A;  4JR4 A;  1EGR A;  3FZA A;  5DAL B;  5H5S A;  4F03 A;  3QD9 A;  3VI5 A;  1J08 A;  3TKQ A;  1JZW A;  4NXI A;  2C3T A;  3H79 A;  3QR6 A;  4MH2 A;  1DBY A;  1S3A A;  1TOF A;  3GN3 A;  2H0H A;  5ID2 B;  2IMI A;  3VI7 A;  2H72 A;  2GZY A;  1FOV A;  5J9B A;  3SWL A;  2RUE A;  3IE3 A;  2C0G A;  5G5E A;  3NZN A;  4AJ6 A;  3CSJ A;  3G7I A;  3GST A;  3HA9 A;  5IMZ A;  4POM A;  3RPP A;  3HD5 A;  3W8S A;  1XCC A;  2JU5 A;  5HR3 A;  4K7N A;  1AIU A;  4MK3 A;  2GTU A;  1K3L A;  3PPU A;  1VF2 A;  1Y6E A;  3FK8 A;  1U88 A;  2OE1 A;  1QFN A;  4KUN A;  3GRX A;  2I1U A;  1FVJ A;  2ZNM A;  2GLR A;  4K1F A;  3UOM A;  4ZIJ A;  3LQ7 A;  1Q98 A;  5ECO B;  2IFQ B;  2RM5 A;  1XXU A;  3TRQ A;  1JFU A;  3SBC A;  5GAP D;  5HR2 A;  5AIX A;  3GKX A;  2GT5 A;  1NSW A;  4GRF A;  1EOG A;  5CYY A;  2XPE A;  1MDJ A;  3QAW A;  4FYB A;  2LJR A;  4OCF A;  1YY7 A;  1UVZ A;  2VL2 A;  3FY7 A;  1AUC A;  3KMO A;  1MTC A;  4YQM A;  2B6M A;  1T3B A;  2E7P A;  3I43 A;  3PIN A;  1U6T A;  2K18 A;  5COH A;  4JR6 A;  1KEB A;  3O76 A;  1V57 A;  5C04 A;  8GSS A;  2VL9 A;  2GSR A;  1SK2 A;  4MF6 A;  3MNG A;  2HRN A;  4OMV A;  1G7E A;  3UMA A;  3TGZ A;  1T00 A;  3DYR A;  4HQZ A;  3S9F A;  1G7O A;  4EUY A;  20GS A;  2CA8 A;  3ZLP A;  4HI7 A;  1SEN A;  2VLT A;  2FNO A;  2XPD A;  3APO A;  4HZ4 A;  1LBK A;  2EIO A;  1QMV A;  1BED A;  5J5N A;  4OFM A;  3KH9 A;  2GSQ A;  3F3Q A;  3F4R A;  4KDU A;  1GTI A;  3TKS C;  4I2T A;  1Z5Y E;  3I6A A;  1X9W B;  4XCS A;  2UZ8 A;  2KOK A;  2I4A A;  2C3N A;  5B6M A;  4FH8 A;  4O5R A;  6GSS A;  3RHC A;  1YKC A;  3HDC A;  1PGT A;  3EVI A;  4ZB9 A;  1CQG A;  4PTS A;  2H1G A;  3CTF A;  3DEX A;  4NWY A;  2QC7 A;  1V2A A;  3FR3 A;  5JWQ B;  2MBS A;  5F05 A;  2PWJ A;  5DAK A;  1ABA A;  1V98 A;  3L9S A;  3RHB A;  4P3Y B;  3F0I A;  2DJJ A;  4HU7 A;  3C8E A;  1BQ7 A;  4GXZ A;  5IO2 A;  4WBR D;  2DIY A;  1ILO A;  1OC9 B;  4IHU A;  1C72 A;  4HJM A;  2GST A;  4MH3 A;  1E2Y A;  1H75 A;  2K8V A;  1PQN A;  4KW6 A;  3HHV A;  1I5G A;  1BYE A;  4MJC A;  3VPQ A;  5ECP B;  6GSY A;  5D8I A;  5DAL A;  3DGQ A;  1ZYE A;  2NBS A;  2HRF A;  4HEA 2;  2YCD A;  4WR5 A;  2KLX A;  2VUP A;  4O7H A;  5DCG A;  1F3B A;  3IAM 2;  4DSS B;  1BX9 A;  13GS A;  1O85 A;  3L0H A;  4G10 A;  1BAY A;  4F0C A; 
#chains in the Genus database with same CATH topology
 4J56 E;  5ID2 A;  4ZB8 A;  4E68 A;  1KNG A;  3D6I A;  1K0O A;  2WZS A;  5IMC A;  4L5O A;  1AAZ A;  4TXV A;  3A5I A;  4CDO A;  3GA4 A;  5HFG A;  3LYP A;  1PD2 1;  4ZBD A;  5CRD A;  1LJR A;  5EY6 A;  1GL8 A;  1N8J A;  2WW2 A;  3ZVJ A;  3VLN A;  3CRU A;  4L0U A;  1AQW A;  4EXJ A;  1VRS D;  4EKZ A;  2CAI A;  4XRA A;  2K8S A;  3N5O A;  1ZL9 A;  1XG8 A;  4AI6 A;  1JZR A;  4TW5 A;  1PKZ A;  4AJ8 A;  5CP1 A;  4HQS A;  2H1A A;  2B5E A;  4F2I A;  3GMF A;  5LCZ A;  2HSH A;  4ZIL A;  1AC1 A;  2PPT A;  4CY6 A;  5FWG A;  5J47 A;  4NMU A;  5JWR B;  3ZIJ A;  2AHE A;  2QA1 A;  3FKF A;  2V1M A;  5ENU A;  3Q74 A;  2LS5 A;  1ACV A;  4MDC A;  2FY6 A;  3APQ A;  4E8E A;  3GYK A;  1EV4 A;  1A24 A;  4K7I A;  4MAB A;  3GNJ A;  4WXT A;  2D2Z A;  3FRC A;  2WVX A;  3C73 A;  2WS2 A;  3LFL A;  2YP6 A;  2H73 A;  1W89 A;  2KUC A;  4Z2R A;  3CYN A;  2IIY A;  1X9S B;  4N0Z A;  1PL1 A;  1QUW A;  1SKW B;  2E2M A;  4MZB A;  4EIP A;  1PMT A;  1U87 A;  1F9M A;  4ECJ A;  2CAQ A;  2QKE A;  4K2X A;  1DE2 A;  3QPM A;  3CXG A;  3EPT A;  2AYT A;  2IMF A;  3H8Q A;  3K8N A;  5A4W A;  2H66 A;  3E3E A;  4MA9 A;  2C80 A;  4EF0 A;  3GUS A;  1YQ1 A;  2X64 A;  3FZ9 A;  3M8N A;  4QL7 A;  2M80 A;  2LRC A;  2VM2 A;  3QAG A;  2PMT A;  2EC4 A;  1SL2 B;  5AIS A;  4KND A;  4AGS A;  1AXD A;  2N5B A;  2L5L A;  2LRN A;  2O85 A;  1GSD A;  3CMI A;  2GS3 A;  1M9B A;  1SKR B;  4MJE A;  4X0X A;  1K0C A;  1AQX A;  4G0I A;  1OYJ A;  3IBH A;  3EYT A;  1O7U A;  1OC9 A;  5GAN D;  5IPG A;  1TKD B;  1VF4 A;  2K6V A;  2LV3 A;  3R3E A;  2OKA A;  2CV4 A;  2Z9S A;  5ELA A;  4JBB A;  1RW1 A;  4FQU A;  2HZF A;  4Q5Q A;  4F0B A;  4H86 A;  2VM1 A;  1GWC A;  4PI0 C;  5ECM B;  4DVC A;  1Y1U A;  2HNL A;  2FWE A;  4QQ7 A;  4N10 A;  1UA5 A;  2JZS A;  1SVM A;  1UC7 A;  3LXZ A;  2IPA A;  5ECQ B;  2O87 A;  1R4W A;  3UVH A;  1ST9 A;  1KBN A;  2VCQ A;  5A1N A;  4BVX B;  3GV1 A;  3GTU B;  1PFO A;  4TKY A;  2V32 A;  4DSS A;  4LMW A;  4IEL A;  4GST A;  5ECS A;  1TK5 B;  3FMW A;  5IIZ A;  1FB0 A;  3ZIT A;  4IKH A;  1N2A A;  2VIM A;  4HOJ A;  3KTB A;  3UL3 A;  3EU4 A;  3RGB C;  3D4T A;  3HJM A;  2DBC A;  4IJI A;  2R6K A;  2FHE A;  4K9Z A;  1EP8 A;  3BOA A;  2FA4 A;  2R2J A;  3KCM A;  4ECI A;  4RI7 A;  2L4C A;  5IMD A;  4BWQ A;  2BMX A;  2IJY A;  3PGT A;  5G5F A;  5DVB A;  5CRW A;  4IP6 A;  10GS A;  4K8M A;  5DBQ A;  1XBS A;  4AKG A;  1CQH A;  1M3I A;  1SU9 A;  2H76 A;  3IDV A;  3TB2 A;  3M0F A;  1QQ2 A;  2L6D A;  3WT1 A;  3WYW A;  1F3A A;  5A5H A;  2HXK A;  2VCV A;  2NPB A;  1WE0 A;  5B7C A;  2L6C A;  2VL2 C;  1GLP A;  3IV4 A;  1XOA A;  4IJ3 A;  1XZO A;  1NM3 A;  1IYH A;  3CTG A;  4XTS A;  2EFC A;  1JLW A;  3D22 A;  22GS A;  5IMV A;  5ECK B;  2A2S A;  3QDN A;  4USS A;  1PRX A;  3L9V A;  3ZL5 A;  1I9D A;  1VF3 A;  2HZE B;  2X8G A;  1XPV A;  5F0G A;  1PX7 A;  11GS A;  1A23 A;  2YWN A;  1THX A;  3DRN A;  5B6N A;  1M7T A;  4YAP A;  1K0D A;  2HSM B;  1R7H A;  2HT9 A;  3IA1 A;  5D96 A;  4O92 A;  1G6W A;  1N25 A;  2NDO A;  2YZU A;  2H71 A;  2WJU A;  1XIY A;  1EWX A;  4FO5 A;  4IQ1 A;  1S3R A;  2LTK A;  2NTO A;  4BWS A;  5DQY A;  1A2M A;  1TRV A;  4OO5 A;  3QAV A;  4HU9 A;  1PN0 A;  4GWR A;  4PNG A;  4YAV A;  1SK0 A;  4I6X A;  2H75 A;  1Z7R A;  2YV7 A;  3TJK A;  2I81 A;  4X1U A;  2HLS A;  3LEF A;  1XWG A;  1YEX A;  5FHI A;  4A5P A;  5CAX A;  4XHM A;  2QSI A;  2PVQ A;  1V58 A;  4V1A p;  2B5X A;  3W6G A;  5BMU B;  2LNT A;  2DJ0 A;  3IHG A;  2P31 A;  1USB A;  3H1N A;  2JL4 A;  2OA7 A;  5IPH A;  4MPF A;  2R0C A;  4PI2 C;  1OKD A;  5G1L A;  4NHZ A;  1XWA A;  3ISO A;  5ECI B;  4L5L A;  4JRR A;  3LXT A;  3P90 A;  3LYK A;  2WRT A;  3MWH A;  3E0U A;  2OT3 A;  4W66 A;  2DMM A;  4GDF A;  19GS A;  1SKS B;  4FYC A;  4BVX A;  2HRK B;  1MD4 A;  2O3E A;  2B7K A;  3GTU A;  4CW9 A;  6GSW A;  2H30 A;  2C1Y A;  5ECL B;  1MDK A;  5G1K A;  5D73 A;  4ULX A;  2EIQ A;  2FCH A;  4YQU A;  5IQY A;  3IOS A;  1OVN A;  6GSU A;  3TRX A;  2GGT A;  1Q4J A;  3HVN A;  2H1B A;  3LJR A;  3EMP A;  3KM6 A;  3FR6 A;  5J41 A;  3M9K A;  3TKS E;  5DJM A;  4G2E A;  3VWU A;  3APS A;  5J9C A;  3Q19 A;  1Z3E A;  5HR0 A;  3MAK A;  3C71 A;  1KTE A;  2CT6 A;  4GLT A;  1SYX A;  5IMF A;  1WP0 A;  2JSY A;  3L78 A;  1BG5 A;  3I9V 2;  4KDY A;  1YKA A;  3GKN A;  1OKT A;  2C3Q A;  2L59 A;  4YKF A;  4OD7 A;  2B1L A;  3DKS A;  4ZB7 A;  2H6Y A;  5KN2 A;  2LJK A;  4G01 A;  1ZYP A;  2N5F A;  2XHF A;  5IOW A;  2IN3 A;  2VO4 A;  2CVD A;  4WF4 A;  2LJA A;  3MSZ A;  3L4N A;  2PN8 A;  2DJ1 A;  2DC5 A;  2REM A;  3DVW A;  1YVL A;  1OE8 A;  3US3 A;  4BVY B;  1EP7 A;  1K0M A;  4LA1 A;  4JE1 A;  1K0A A;  3WGD A;  3IHQ A;  4OFN A;  1J9B A;  1FB6 A;  3WGX A;  5J40 A;  3HYP A;  2GT6 A;  4LL1 B;  1XWC A;  2O5V A;  2WUL A;  3TJB A;  3F4T A;  5C00 A;  4I97 A;  3GKK A;  3KMN A;  3M3M A;  4TOP A;  5H5R A;  3P7X A;  3V1W A;  5GST A;  2X8C A;  5J4Y A;  3DML A;  2CVK A;  1BJX A;  1JZD A;  4WF5 A;  2HSN B;  1TU8 A;  3QCP A;  4MF7 A;  1H4O A;  3ZTL A;  2C8U A;  2DJ3 A;  5DQS A;  3CSI A;  1FHE A;  2DKI A;  2HSM A;  4DSQ A;  2VCX A;  2B1K A;  3IC8 A;  3ZRE A;  2JSZ A;  4WKW A;  1NHY A;  3ZFL A;  3Q18 A;  1Z6M A;  4LMV A;  5CRG A;  4Z2U A;  4KAE A;  3DIE A;  2FA8 A;  5ELG A;  4PX1 A;  1F2E A;  2GZP A;  2P5Q A;  4XIH A;  1T7P B;  2X8H A;  3IPZ A;  3J7Y k;  1BF5 A;  4XRD A;  2XC2 A;  3RPN A;  3DWV A;  2DSA A;  4KF9 A;  1EEM A;  1GTB A;  5D93 A;  3FYG A;  1X5D A;  3TJG A;  3HJP A;  1THO A;  3P8W A;  1GNW A;  5HFK A;  4POB A;  1WOU A;  3IRA A;  2DLX A;  4PGT A;  2WCI A;  1SJZ A;  2H70 A;  5BMU A;  4OO4 A;  4BA7 A;  4NHW A;  2NVL A;  3CHX C;  5KEJ A;  2F51 A;  2VLU A;  1QGV A;  2IFQ A;  1SL1 B;  1ZGN A;  4G19 A;  5LD0 A;  1T8E B;  2BJX A;  2C0D A;  5H5Q A;  2IWT A;  3D0Z A;  2OAC A;  2VCW A;  2HRK A;  1F37 A;  2OE3 A;  4OCE A;  1JHB A;  4IP1 A;  3HVX A;  2O8V B;  3ME8 A;  1GUL A;  3O3T A;  4MF5 A;  3FZ5 A;  1AQV A;  4POL A;  5F07 A;  1LU4 A;  1Z7P A;  2H19 A;  3PH9 A;  1TI3 A;  4WR4 A;  3UAR A;  1M2A A;  2PVO C;  3PR8 A;  3AY8 A;  4N30 A;  5G31 A;  3QFB C;  4N11 A;  5D9T A;  3GFK A;  4FXY P;  1EV9 A;  4O32 A;  3KH7 A;  4KX4 A;  5L71 A;  3DXB A;  4ECC A;  4ISD A;  2YJH A;  2MYG A;  4JED A;  2RUF A;  4V2N A;  4KCA A;  3ERG A;  1EOH A;  4EL1 A;  2C0F A;  3NIV A;  1YJ6 A;  1YF1 A;  4E8H A;  5JWO B;  3I69 A;  4V2L A;  4TN8 A;  1HYU A;  1Y25 A;  4EIQ A;  3ZZX A;  3GIX A;  3LWA A;  5E59 A;  1ERW A;  2GQL A;  3G9B A;  4ZL7 A;  1EGO A;  4RUV A;  4Q5F A;  3DD3 A;  4BVY A;  4TR1 B;  1GUH A;  3F6D A;  3G7J A;  3KXO A;  2LST A;  1XVQ A;  3OR5 A;  2N5A A;  4NV2 A;  1PL2 A;  2GZZ A;  4MPG A;  1I1I P;  2OAD A;  1X0R A;  2KP1 A;  4ILF A;  2CZ2 A;  2OE0 A;  3WT2 A;  2LEG A;  2YJ7 A;  1G0T A;  2BTO T;  1OAZ A;  4PXO A;  2HYX A;  3HY2 A;  2G0F A;  4KB3 A;  3A2X A;  3IR4 A;  4JZQ A;  4Q5N A;  4KCE A;  4KSM A;  5KN1 A;  2H6X A;  5DCH A;  3HCZ A;  4LLR A;  1U3I A;  3D5J A;  4PQI A;  3QMX A;  2VL3 A;  1BG1 A;  1R5A A;  1O8X A;  3A2W A;  6GSV A;  1SD8 A;  5ABR A;  1T1V A;  3VWX A;  2J9H A;  4F82 A;  3G7Y A;  1TRS A;  2LUS A;  3IXR A;  1OC3 A;  1YZX A;  4MZW A;  3GHA A;  5CNW A;  1M2D A;  1X5C A;  2AJQ B;  1TJD A;  4ZL9 A;  4EDY A;  1OC8 A;  2TIR A;  5E4W A;  2IMK A;  1HNB A;  4MLY A;  2VD0 A;  5EL8 A;  5IOX A;  1R5P A;  1DSB A;  5JCW A;  2B5Y A;  5DDL A;  1ZCP A;  5INY A;  2DML A;  2LQO A;  2O89 A;  3EUR A;  2OBK A;  2R37 A;  3QFA C;  5HR1 A;  4ZXG A;  1B8X A;  1GLQ A;  1M99 A;  5DJL A;  2H8L A;  3BCK A;  1M0U A;  2GQK A;  2V41 A;  2VLV A;  3F3R A;  4HUA A;  4TR4 A;  1B9Y C;  12GS A;  4RI6 A;  4CHS A;  3H93 A;  3KEB A;  2XBQ A;  3IK7 A;  1GSF A;  3VK9 A;  3RAZ A;  4TR3 A;  2VKZ G;  3TKR A;  4PQ1 A;  3GX0 A;  3A2V A;  3KJY A;  1TTZ A;  3ED3 A;  4ZB6 A;  4EC0 A;  5GSS A;  1PX6 A;  2VAF A;  2L5O A;  3UEM A;  2X99 A;  1ERU A;  3UIW A;  2MZC A;  5J3R A;  4V1A g;  3KP9 A;  2E0Q A;  2PUK C;  4MCU A;  5CRH A;  1WIK A;  2DIZ A;  1SL0 B;  3C1R A;  4IBP A;  2HSY A;  3HVS A;  5ECR B;  2WZ9 A;  4KDX A;  1TRU A;  1Z9H A;  2HQT A;  2H6Z A;  1PN9 A;  4CY8 A;  2CQ9 A;  5KOX A;  1ERT A;  1XOB A;  2WVZ A;  3GH6 A;  2DJK A;  2FGX A;  4ID0 A;  5BRT A;  1FAA A;  2QA2 A;  3TDG A;  9GSS A;  4DSR A;  2CX3 A;  4YH2 A;  5CO3 A;  2OBI A;  3HXS A;  5A4V A;  3UAP A;  3D4M A;  1HD2 A;  3GL3 A;  2KHP A;  2LNS A;  5FT3 A;  1QXH A;  2H1L A;  1J0F A;  3CBU A;  1B4P A;  4ZL8 A;  4EO3 A;  1O81 A;  1A8Y A;  1TP9 A;  5HQP A;  4KGI A;  5CRE A;  2VD1 A;  3F4S A;  2WW1 A;  3TCO A;  3LOR A;  1XFL A;  3VUR A;  1ZYN A;  4KSO A;  4TR1 A;  4WBJ A;  4J2F A;  1R26 A;  3U5R E;  2X49 A;  1NW2 A;  1PKW A;  2VOC A;  3CRT A;  2ALB A;  2ZCT A;  1RQM A;  1A8L A;  4Z7X A;  1FW1 A;  3BD2 A;  1WRY A;  2ZUP A;  2MBT A;  4XS4 B;  1HNC A;  1GTA A;  4OFT A;  2CX4 A;  1A0F A;  4MJA A;  2YWO A;  3D21 A;  3M9J A;  4PNF A;  14GS A;  3EE2 A;  3GUR A;  1HNA A;  6GSX A;  2GQM A;  2B3S A;  1ZYQ B;  1TXX A;  4I5Q A;  3ZFB A;  4GSS A;  2XBI A;  4I8B A;  4NAX A;  3FHK A;  4MZC A;  3VWV A;  1X9M B;  1X5E A;  4YQV A;  5GZZ B;  3MYD A;  4X43 A;  1GUK A;  2VCT A;  3KD0 A;  2WB9 A;  1XWK A;  2L4Q A;  3GX8 A;  3N9J A;  3EC3 A;  2RII A;  2F8F A;  5J4U A;  4TXO B;  4D73 B;  2WFC A;  2CZ3 A;  1PA3 A;  4HZ2 A;  4AKI A;  2IME A;  3E9J B;  3RFR C;  1OE7 A;  1TK8 B;  3IAS 2;  4IS0 A;  3ERW A;  1SK1 A;  1FVK A;  5ECN B;  2R0P A;  2MMO A;  3GH9 A;  1GSQ A;  1VGL A;  2C4J A;  2JZR A;  5KN0 A;  2LRT A;  2M46 A;  1GSY A;  2YN1 A;  1EZK A;  2YWI A;  1GSS A;  4EE0 A;  2ES7 A;  3U6V A;  4K5R A;  3TOU A;  1RK4 A;  3ZMK A;  1ZMA A;  4K6X A;  5IO0 A;  5A5K A;  5G30 A;  16GS A;  2OJL A;  17GS A;  1UN2 A;  3HJO A;  4MNN A;  2ON5 A;  2GDR A;  4GCI A;  4XS6 A;  4O5U A;  1G6Y A;  2MMZ A;  2AAW A;  4ML1 A;  3C7M A;  3KP8 A;  2ON7 A;  4PQH A;  1FO5 A;  3VPT A;  3GSS A;  1O8W A;  3BCI A;  2AV4 A;  1U3A A;  3CWG A;  3UVT A;  2HZE A;  3A5W A;  1S4B P;  2M72 A;  1T4Z A;  2HFD A;  1VF1 A;  3MIX A;  1TI1 A;  1M2B A;  5B8A A;  1K3O A;  1ML6 A;  2F8A A;  3H4K A;  1V9W A;  4BPY A;  3P2A A;  3KGK A;  4QL9 A;  2MMA A;  2PER A;  2WDU A;  3FW2 A;  4K0N A;  3TJJ A;  4ACS A;  1JZO A;  3KTL A;  4ML6 A;  4NV5 A;  1URM A;  2A4V A;  2H0I A;  2YV9 A;  2G2Q A;  3QOU A;  2YZH A;  4FYU A;  2FWF A;  1GTU A;  1GNE A;  4IN0 A;  2FLS A;  1B9X C;  1SJI A;  2GVP A;  1GH2 A;  2CVB A;  4K0G A;  4AF2 A;  3EU3 A;  4X4J A;  5EPF A;  4AKH A;  3R2Q A;  1E6B A;  2RLI A;  3LSZ A;  1QK8 A;  5F8B A;  1XVW A;  1XWB A;  5IMA A;  2F9S A;  4WET A;  4N3Z A;  3TKS A;  3DVX A;  2YPM A;  4PUA A;  3TOT A;  2YAN A;  4MP4 A;  1WPI A;  3L9U A;  1MEK A;  1GSU A;  2KP2 A;  2EFD A;  4XS4 A;  4G9H A;  2MMN A;  4QMK A;  1SD9 A;  1TRW A;  3C1S A;  1B48 A;  2A4H A;  2J23 A;  3A3T A;  2K9F A;  3F8U A;  3F6F A;  2YNX A;  2R3X A;  2RM6 A;  1K0B A;  2I3Y A;  2V2G A;  3O6T A;  3F63 A;  2TRX A;  3KIJ A;  4L0W A;  4HJ2 A;  3TRP A;  3MDK A;  2AUV A;  2L57 A;  5A5H B;  4MMM A;  2FWG A;  4O5Q A;  3FZ4 A;  4RQR A;  3F9U A;  3HMJ G;  1AW9 A;  4FIW A;  1TXU A;  1F6M C;  4GQC A;  5AN1 A;  3WD6 A;  4IVF A;  4XS1 A;  2FUG 2;  4N0V A;  1ON4 A;  2O7K A;  1ZZY A;  1ZOF A;  5D9V A;  3M1G A;  4TXO A;  4D73 A;  1K0N A;  2P0G A;  1M9A A;  1A2L A;  2P5R A;  2EFE A;  5HFI A;  4BL7 B;  3J7Y b;  6GST A;  5B8B A;  1B4Q A;  4YKG A;  5A4U A;  3ZRD A;  4ECB A;  4IGJ A;  5A34 B;  5ECH B;  3TJF A;  3ZIV A;  3LGC A;  4AKX B;  2AB6 A;  2HE3 A;  3FEU A;  2TRC P;  1XW9 A;  2PBJ A;  5EVO A;  4I2U A;  2H0G A;  3UBK A;  1HQO A;  3EMX A;  2FD3 A;  3FR9 A;  2GSS A;  3HKR A;  2H01 A;  4F9Z A;  2JAC A;  4PUF C;  3ZML A;  1WJK A;  4IW9 A;  2B7J A;  3UJ1 A;  1FG4 A;  2HRA A;  3WGE A;  4HDE A;  2DJ2 A;  1TK0 B;  4K2D A;  1MDI A;  4ZBB A;  2YWM A;  1YEW C;  4MJB A;  4ZBA A;  1M3J A;  3RDW A;  1A0R P;  1TW9 A;  1S3D A;  1O73 A;  5IM9 A;  4G0L A;  3HVV A;  1TU7 A;  1XW6 A;  2I9H A;  2FWH A;  3RBT A;  2HSN A;  2WGR A;  1GSE A;  3IK9 A;  1IYI A;  2EIR A;  4J57 E;  3VFI A;  2E2G A;  4GF0 A;  3Q6O A;  1WMJ A;  2PU9 C;  4GTU A;  5AGY A;  1K3Y A;  1GP1 A;  3HZ4 A;  4GQF A;  1EEJ A;  2IMD A;  3BBY A;  4Q5R A;  4TVE A;  2VCZ A;  5D9W A;  3TUE A;  5D9X A;  1YF0 A;  2V6O A;  18GS A;  2H74 A;  4G0K A;  1SJ6 A;  3JCM L;  4WEY A;  4KA0 A;  2R5G A;  4DEJ A;  3IC4 A;  2JZT A;  2V6K A;  4RQX A;  5G2Z A;  4K7O A;  3ZYW A;  3GKM A;  3ZVJ D;  1O6J A;  1GUM A;  4PUR A;  2DKH A;  2LQQ A;  1TDI A;  2IL3 A;  3NOF A;  5AIV A;  4JU5 A;  2H1D A;  1Z6N A;  4POK A;  3HZ8 A;  1XW5 A;  2R4V A;  4AJ7 A;  3GL5 A;  1V40 A;  5JCG A;  4EVM A;  1S3C A;  2PGT A;  1SYR A;  3W8J A;  2WW0 A;  1W4V A;  3ERF A;  1A2J A;  1YEP A;  2JAD A;  1YDK A;  3ME7 A;  3LW9 A;  1T4Y A;  1PSQ A;  3LG6 A;  1JLV A;  3CSH A;  4KH7 A;  4IQA A;  4OWY A;  2C0E A;  2QGV A;  4LL4 B;  1MD3 A;  1NHO A;  5DAK B;  3EIN A;  2YOI A;  4NPB A;  1ERV A;  4TR0 A;  4TRX A;  2F3M A;  1DUG A;  4EDZ A;  1DE1 A;  4KE3 A;  5KN3 A;  5LNK e;  5JCU A;  3TKP A;  4GSN A;  4L8E A;  5F06 A;  2A2R A;  3VWW A;  1SVO A;  3EWL A;  4V2M A;  1GRX A;  2LKU A;  7GSS A;  1WWJ A;  3UBL A;  3KZQ A;  4BL7 A;  2HI7 A;  3BJ5 A;  4HS1 A;  4JR4 A;  1EGR A;  4ICY A;  3FZA A;  5DAL B;  5H5S A;  4F03 A;  3QD9 A;  3VI5 A;  1J08 A;  3TKQ A;  5A34 A;  1JZW A;  4NXI A;  2C3T A;  3H79 A;  3QR6 A;  4MH2 A;  1DBY A;  1S3A A;  1TOF A;  3GN3 A;  4HSC X;  2H0H A;  5ID2 B;  2IMI A;  3VI7 A;  2H72 A;  2GZY A;  1FOV A;  5J9B A;  3SWL A;  2RUE A;  3TU3 B;  3IE3 A;  2C0G A;  5G5E A;  3NZN A;  4AJ6 A;  3CSJ A;  3G7I A;  3GST A;  3HA9 A;  5IMZ A;  4POM A;  3RPP A;  3HD5 A;  3W8S A;  1XCC A;  2JU5 A;  5HR3 A;  4K7N A;  2WW3 A;  1AIU A;  4MK3 A;  2GTU A;  1K3L A;  3PPU A;  1VF2 A;  1Y6E A;  3FK8 A;  1U88 A;  2OE1 A;  1QFN A;  4KUN A;  3GRX A;  2I1U A;  1FVJ A;  2ZNM A;  2GLR A;  4K1F A;  3UOM A;  4ZIJ A;  3LQ7 A;  1Q98 A;  5ECO B;  2IFQ B;  2RM5 A;  1XXU A;  3TRQ A;  1JFU A;  3SBC A;  5GAP D;  5HR2 A;  5AIX A;  3GKX A;  2GT5 A;  1NSW A;  4GRF A;  1EOG A;  5CYY A;  2XPE A;  1MDJ A;  3QAW A;  4FYB A;  2LJR A;  4OCF A;  1YY7 A;  1UVZ A;  2VL2 A;  3FY7 A;  1AUC A;  2O36 A;  3KMO A;  1MTC A;  2WVX B;  4YQM A;  2B6M A;  1T3B A;  2E7P A;  3I43 A;  3PIN A;  1U6T A;  2K18 A;  5COH A;  4JR6 A;  1KEB A;  3O76 A;  1V57 A;  5C04 A;  8GSS A;  2VL9 A;  2GSR A;  1SK2 A;  3CQF A;  4MF6 A;  3MNG A;  2X4A A;  2HRN A;  5J4V A;  4OMV A;  1G7E A;  3UMA A;  3TGZ A;  1T00 A;  3DYR A;  4HQZ A;  4Z2T A;  1G7O A;  4EUY A;  20GS A;  2CA8 A;  3ZLP A;  3S9F A;  4HI7 A;  1SEN A;  2VLT A;  2FNO A;  2XPD A;  3APO A;  4HZ4 A;  1LBK A;  2EIO A;  1QMV A;  1BED A;  2R0G A;  5J5N A;  4OFM A;  2GSQ A;  3KH9 A;  3F3Q A;  3F4R A;  4KDU A;  1GTI A;  3TKS C;  4I2T A;  1Z5Y E;  3I6A A;  1X9W B;  4XCS A;  2UZ8 A;  2UV8 G;  2KOK A;  2I4A A;  2C3N A;  5B6M A;  4FH8 A;  4O5R A;  6GSS A;  3RHC A;  1YKC A;  3HDC A;  1PGT A;  3EVI A;  4ZB9 A;  1CQG A;  4PTS A;  2H1G A;  3CTF A;  3DEX A;  4NWY A;  2QC7 A;  1V2A A;  3FR3 A;  5JWQ B;  2MBS A;  5F05 A;  4PHZ C;  2PWJ A;  5DAK A;  1ABA A;  1V98 A;  2A2P A;  3L9S A;  3RHB A;  4P3Y B;  2WVY A;  3F0I A;  2DJJ A;  4HU7 A;  3C8E A;  4K5S A;  1BQ7 A;  4GXZ A;  5IO2 A;  4WBR D;  1FOH A;  2DIY A;  1ILO A;  1OC9 B;  4IHU A;  1C72 A;  4HJM A;  2GST A;  4MH3 A;  1E2Y A;  1H75 A;  2K8V A;  1PQN A;  4KW6 A;  3HHV A;  4BIK A;  1I5G A;  1BYE A;  4MJC A;  1SVL A;  3VPQ A;  5ECP B;  2EFH A;  6GSY A;  5D8I A;  5DAL A;  3DGQ A;  1ZYE A;  2NBS A;  2HRF A;  4HEA 2;  2YCD A;  4WR5 A;  2KLX A;  2VUP A;  4O7H A;  5DCG A;  5A1N B;  1F3B A;  3IAM 2;  4DSS B;  1BX9 A;  13GS A;  1O85 A;  3L0H A;  4G10 A;  5KOW A;  1BAY A;  4F0C A; 
#chains in the Genus database with same CATH homology
 4J56 E;  5ID2 A;  4ZB8 A;  4E68 A;  1KNG A;  3D6I A;  1K0O A;  5IMC A;  4L5O A;  1AAZ A;  4TXV A;  3A5I A;  4CDO A;  3GA4 A;  5HFG A;  3LYP A;  1PD2 1;  4ZBD A;  5CRD A;  1LJR A;  5EY6 A;  1GL8 A;  1N8J A;  3ZVJ A;  3VLN A;  3CRU A;  4L0U A;  1AQW A;  4EXJ A;  1VRS D;  4EKZ A;  2CAI A;  4XRA A;  2K8S A;  3N5O A;  1ZL9 A;  4AI6 A;  1JZR A;  4TW5 A;  1PKZ A;  4AJ8 A;  5CP1 A;  4HQS A;  2H1A A;  2B5E A;  4F2I A;  3GMF A;  5LCZ A;  2HSH A;  4ZIL A;  1AC1 A;  2PPT A;  4CY6 A;  5FWG A;  5J47 A;  4NMU A;  5JWR B;  3ZIJ A;  2AHE A;  2QA1 A;  3FKF A;  2V1M A;  5ENU A;  3Q74 A;  2LS5 A;  1ACV A;  4MDC A;  2FY6 A;  3APQ A;  4E8E A;  3GYK A;  1EV4 A;  1A24 A;  4K7I A;  4MAB A;  3GNJ A;  4WXT A;  2D2Z A;  3FRC A;  3C73 A;  2WS2 A;  3LFL A;  2YP6 A;  2H73 A;  1W89 A;  2KUC A;  4Z2R A;  3CYN A;  2IIY A;  1X9S B;  4N0Z A;  1PL1 A;  1QUW A;  1SKW B;  2E2M A;  4MZB A;  4EIP A;  1PMT A;  1U87 A;  1F9M A;  4ECJ A;  2CAQ A;  2QKE A;  4K2X A;  1DE2 A;  3QPM A;  3CXG A;  3EPT A;  2AYT A;  2IMF A;  3H8Q A;  3K8N A;  5A4W A;  2H66 A;  3E3E A;  4MA9 A;  2C80 A;  4EF0 A;  3GUS A;  1YQ1 A;  2X64 A;  3FZ9 A;  3M8N A;  4QL7 A;  2M80 A;  2LRC A;  2VM2 A;  3QAG A;  2PMT A;  2EC4 A;  1SL2 B;  5AIS A;  4KND A;  4AGS A;  1AXD A;  2N5B A;  2L5L A;  2LRN A;  2O85 A;  1GSD A;  3CMI A;  2GS3 A;  1M9B A;  1SKR B;  4MJE A;  4X0X A;  1K0C A;  1AQX A;  4G0I A;  1OYJ A;  3IBH A;  3EYT A;  1O7U A;  1OC9 A;  5GAN D;  5IPG A;  1TKD B;  1VF4 A;  2K6V A;  2LV3 A;  3R3E A;  2OKA A;  2CV4 A;  2Z9S A;  5ELA A;  4JBB A;  1RW1 A;  4FQU A;  2HZF A;  4Q5Q A;  4F0B A;  4H86 A;  2VM1 A;  1GWC A;  5ECM B;  4DVC A;  1Y1U A;  2HNL A;  2FWE A;  4QQ7 A;  4N10 A;  1UA5 A;  2JZS A;  1SVM A;  1UC7 A;  3LXZ A;  2IPA A;  5ECQ B;  2O87 A;  1R4W A;  3UVH A;  1ST9 A;  1KBN A;  2VCQ A;  5A1N A;  4BVX B;  3GV1 A;  3GTU B;  4TKY A;  2V32 A;  4DSS A;  4LMW A;  4IEL A;  4GST A;  5ECS A;  1TK5 B;  3FMW A;  5IIZ A;  1FB0 A;  3ZIT A;  4IKH A;  1N2A A;  2VIM A;  4HOJ A;  3KTB A;  3UL3 A;  3EU4 A;  3D4T A;  3HJM A;  2DBC A;  4IJI A;  2R6K A;  2FHE A;  4K9Z A;  1EP8 A;  3BOA A;  2FA4 A;  2R2J A;  3KCM A;  4ECI A;  4RI7 A;  2L4C A;  5IMD A;  4BWQ A;  2BMX A;  2IJY A;  3PGT A;  5G5F A;  5DVB A;  5CRW A;  4IP6 A;  10GS A;  4K8M A;  5DBQ A;  1XBS A;  4AKG A;  1CQH A;  1SU9 A;  2H76 A;  3IDV A;  3TB2 A;  3M0F A;  1QQ2 A;  2L6D A;  3WT1 A;  3WYW A;  1F3A A;  5A5H A;  2HXK A;  2VCV A;  2NPB A;  1WE0 A;  5B7C A;  2L6C A;  2VL2 C;  1GLP A;  3IV4 A;  1XOA A;  4IJ3 A;  1XZO A;  1NM3 A;  1IYH A;  3CTG A;  4XTS A;  2EFC A;  1JLW A;  3D22 A;  22GS A;  5IMV A;  5ECK B;  2A2S A;  3QDN A;  4USS A;  1PRX A;  3L9V A;  3ZL5 A;  1I9D A;  1VF3 A;  2HZE B;  2X8G A;  1XPV A;  5F0G A;  1PX7 A;  11GS A;  1A23 A;  2YWN A;  1THX A;  3DRN A;  5B6N A;  1M7T A;  4YAP A;  1K0D A;  2HSM B;  1R7H A;  2HT9 A;  3IA1 A;  5D96 A;  4O92 A;  1G6W A;  1N25 A;  2NDO A;  2YZU A;  2H71 A;  2WJU A;  1XIY A;  1EWX A;  4FO5 A;  4IQ1 A;  2LTK A;  2NTO A;  4BWS A;  5DQY A;  1A2M A;  1TRV A;  4OO5 A;  3QAV A;  4HU9 A;  1PN0 A;  4GWR A;  4PNG A;  4YAV A;  1SK0 A;  4I6X A;  2H75 A;  1Z7R A;  2YV7 A;  3TJK A;  2I81 A;  4X1U A;  2HLS A;  3LEF A;  1XWG A;  1YEX A;  5FHI A;  4A5P A;  5CAX A;  4XHM A;  2QSI A;  2PVQ A;  1V58 A;  4V1A p;  2B5X A;  3W6G A;  5BMU B;  2LNT A;  2DJ0 A;  3IHG A;  2P31 A;  1USB A;  3H1N A;  2JL4 A;  2OA7 A;  5IPH A;  4MPF A;  2R0C A;  1OKD A;  5G1L A;  4NHZ A;  1XWA A;  3ISO A;  5ECI B;  4L5L A;  4JRR A;  3LXT A;  3P90 A;  3LYK A;  2WRT A;  3MWH A;  3E0U A;  2OT3 A;  4W66 A;  2DMM A;  4GDF A;  19GS A;  1SKS B;  4FYC A;  4BVX A;  2HRK B;  1MD4 A;  2B7K A;  3GTU A;  4CW9 A;  6GSW A;  2H30 A;  2C1Y A;  5ECL B;  1MDK A;  5G1K A;  5D73 A;  4ULX A;  2EIQ A;  2FCH A;  4YQU A;  5IQY A;  3IOS A;  1OVN A;  6GSU A;  3TRX A;  2GGT A;  1Q4J A;  2H1B A;  3LJR A;  3EMP A;  3KM6 A;  3FR6 A;  5J41 A;  3M9K A;  3TKS E;  5DJM A;  4G2E A;  3VWU A;  3APS A;  5J9C A;  3Q19 A;  1Z3E A;  5HR0 A;  3MAK A;  3C71 A;  1KTE A;  2CT6 A;  4GLT A;  1SYX A;  5IMF A;  1WP0 A;  2JSY A;  3L78 A;  1BG5 A;  3I9V 2;  4KDY A;  1YKA A;  3GKN A;  1OKT A;  2C3Q A;  2L59 A;  4YKF A;  4OD7 A;  2B1L A;  3DKS A;  4ZB7 A;  2H6Y A;  5KN2 A;  2LJK A;  4G01 A;  1ZYP A;  2N5F A;  2XHF A;  5IOW A;  2IN3 A;  2VO4 A;  2CVD A;  4WF4 A;  2LJA A;  3MSZ A;  3L4N A;  2PN8 A;  2DJ1 A;  2DC5 A;  2REM A;  3DVW A;  1YVL A;  1OE8 A;  3US3 A;  4BVY B;  1EP7 A;  1K0M A;  4LA1 A;  4JE1 A;  1K0A A;  3WGD A;  3IHQ A;  4OFN A;  1J9B A;  1FB6 A;  3WGX A;  5J40 A;  3HYP A;  2GT6 A;  4LL1 B;  1XWC A;  2O5V A;  2WUL A;  3TJB A;  3F4T A;  5C00 A;  4I97 A;  3GKK A;  3KMN A;  3M3M A;  4TOP A;  5H5R A;  3P7X A;  3V1W A;  5GST A;  2X8C A;  5J4Y A;  3DML A;  2CVK A;  1BJX A;  1JZD A;  4WF5 A;  2HSN B;  1TU8 A;  3QCP A;  4MF7 A;  1H4O A;  3ZTL A;  2C8U A;  2DJ3 A;  5DQS A;  3CSI A;  1FHE A;  2DKI A;  2HSM A;  4DSQ A;  2VCX A;  2B1K A;  3IC8 A;  3ZRE A;  2JSZ A;  4WKW A;  1NHY A;  3ZFL A;  3Q18 A;  1Z6M A;  4LMV A;  5CRG A;  4Z2U A;  4KAE A;  3DIE A;  2FA8 A;  5ELG A;  4PX1 A;  1F2E A;  2GZP A;  2P5Q A;  4XIH A;  1T7P B;  2X8H A;  3IPZ A;  3J7Y k;  1BF5 A;  4XRD A;  2XC2 A;  3RPN A;  3DWV A;  2DSA A;  4KF9 A;  1EEM A;  1GTB A;  5D93 A;  3FYG A;  1X5D A;  3TJG A;  3HJP A;  1THO A;  3P8W A;  1GNW A;  5HFK A;  4POB A;  1WOU A;  3IRA A;  2DLX A;  4PGT A;  2WCI A;  1SJZ A;  2H70 A;  5BMU A;  4OO4 A;  4BA7 A;  4NHW A;  2NVL A;  5KEJ A;  2F51 A;  2VLU A;  1QGV A;  2IFQ A;  1SL1 B;  1ZGN A;  4G19 A;  5LD0 A;  1T8E B;  2BJX A;  2C0D A;  5H5Q A;  2IWT A;  3D0Z A;  2OAC A;  2VCW A;  2HRK A;  1F37 A;  2OE3 A;  4OCE A;  1JHB A;  4IP1 A;  3HVX A;  2O8V B;  3ME8 A;  1GUL A;  3O3T A;  4MF5 A;  3FZ5 A;  1AQV A;  4POL A;  5F07 A;  1LU4 A;  1Z7P A;  2H19 A;  3PH9 A;  1TI3 A;  4WR4 A;  3UAR A;  1M2A A;  2PVO C;  3PR8 A;  3AY8 A;  4N30 A;  5G31 A;  3QFB C;  4N11 A;  5D9T A;  3GFK A;  1EV9 A;  4O32 A;  3KH7 A;  4KX4 A;  5L71 A;  3DXB A;  4ECC A;  4ISD A;  2YJH A;  2MYG A;  4JED A;  2RUF A;  4V2N A;  4KCA A;  3ERG A;  1EOH A;  4EL1 A;  2C0F A;  3NIV A;  1YJ6 A;  1YF1 A;  4E8H A;  5JWO B;  3I69 A;  4V2L A;  4TN8 A;  1HYU A;  1Y25 A;  4EIQ A;  3ZZX A;  3GIX A;  3LWA A;  5E59 A;  1ERW A;  2GQL A;  3G9B A;  4ZL7 A;  1EGO A;  4RUV A;  4Q5F A;  3DD3 A;  4BVY A;  4TR1 B;  1GUH A;  3F6D A;  3G7J A;  3KXO A;  2LST A;  1XVQ A;  3OR5 A;  2N5A A;  4NV2 A;  1PL2 A;  2GZZ A;  4MPG A;  2OAD A;  1X0R A;  2KP1 A;  4ILF A;  2CZ2 A;  2OE0 A;  3WT2 A;  2LEG A;  2YJ7 A;  1G0T A;  2BTO T;  1OAZ A;  4PXO A;  2HYX A;  3HY2 A;  2G0F A;  4KB3 A;  3A2X A;  3IR4 A;  4JZQ A;  4Q5N A;  4KCE A;  4KSM A;  5KN1 A;  2H6X A;  5DCH A;  3HCZ A;  4LLR A;  1U3I A;  3D5J A;  4PQI A;  3QMX A;  2VL3 A;  1BG1 A;  1R5A A;  1O8X A;  3A2W A;  6GSV A;  1SD8 A;  5ABR A;  1T1V A;  3VWX A;  2J9H A;  4F82 A;  3G7Y A;  1TRS A;  2LUS A;  3IXR A;  1OC3 A;  1YZX A;  4MZW A;  3GHA A;  5CNW A;  1M2D A;  1X5C A;  2AJQ B;  1TJD A;  4ZL9 A;  4EDY A;  1OC8 A;  2TIR A;  5E4W A;  2IMK A;  1HNB A;  4MLY A;  2VD0 A;  5EL8 A;  5IOX A;  1R5P A;  1DSB A;  5JCW A;  2B5Y A;  5DDL A;  1ZCP A;  5INY A;  2DML A;  2LQO A;  2O89 A;  3EUR A;  2OBK A;  2R37 A;  3QFA C;  5HR1 A;  4ZXG A;  1B8X A;  1GLQ A;  1M99 A;  5DJL A;  2H8L A;  3BCK A;  1M0U A;  2GQK A;  2V41 A;  2VLV A;  3F3R A;  4HUA A;  4TR4 A;  1B9Y C;  12GS A;  4RI6 A;  4CHS A;  3H93 A;  3KEB A;  2XBQ A;  3IK7 A;  1GSF A;  3VK9 A;  3RAZ A;  4TR3 A;  2VKZ G;  3TKR A;  4PQ1 A;  3GX0 A;  3A2V A;  3KJY A;  1TTZ A;  3ED3 A;  4ZB6 A;  4EC0 A;  5GSS A;  1PX6 A;  2VAF A;  2L5O A;  3UEM A;  2X99 A;  1ERU A;  3UIW A;  2MZC A;  5J3R A;  4V1A g;  3KP9 A;  2E0Q A;  2PUK C;  4MCU A;  5CRH A;  1WIK A;  2DIZ A;  1SL0 B;  3C1R A;  4IBP A;  2HSY A;  3HVS A;  5ECR B;  2WZ9 A;  4KDX A;  1TRU A;  1Z9H A;  2HQT A;  2H6Z A;  1PN9 A;  4CY8 A;  2CQ9 A;  5KOX A;  1ERT A;  1XOB A;  3GH6 A;  2DJK A;  2FGX A;  4ID0 A;  5BRT A;  1FAA A;  2QA2 A;  3TDG A;  9GSS A;  4DSR A;  2CX3 A;  4YH2 A;  5CO3 A;  2OBI A;  3HXS A;  5A4V A;  3UAP A;  3D4M A;  1HD2 A;  3GL3 A;  2KHP A;  2LNS A;  5FT3 A;  1QXH A;  2H1L A;  1J0F A;  3CBU A;  1B4P A;  4ZL8 A;  4EO3 A;  1O81 A;  1A8Y A;  1TP9 A;  5HQP A;  4KGI A;  5CRE A;  2VD1 A;  3F4S A;  3TCO A;  3LOR A;  1XFL A;  3VUR A;  1ZYN A;  4KSO A;  4TR1 A;  4WBJ A;  4J2F A;  1R26 A;  3U5R E;  2X49 A;  1NW2 A;  1PKW A;  2VOC A;  3CRT A;  2ALB A;  2ZCT A;  1RQM A;  1A8L A;  4Z7X A;  1FW1 A;  3BD2 A;  1WRY A;  2ZUP A;  2MBT A;  4XS4 B;  1HNC A;  1GTA A;  4OFT A;  2CX4 A;  1A0F A;  4MJA A;  2YWO A;  3D21 A;  3M9J A;  4PNF A;  14GS A;  3EE2 A;  3GUR A;  1HNA A;  6GSX A;  2GQM A;  2B3S A;  1ZYQ B;  1TXX A;  4I5Q A;  3ZFB A;  4GSS A;  2XBI A;  4I8B A;  4NAX A;  3FHK A;  4MZC A;  3VWV A;  1X9M B;  1X5E A;  4YQV A;  5GZZ B;  3MYD A;  4X43 A;  1GUK A;  2VCT A;  3KD0 A;  2WB9 A;  1XWK A;  2L4Q A;  3GX8 A;  3N9J A;  3EC3 A;  2RII A;  2F8F A;  5J4U A;  4TXO B;  4D73 B;  2WFC A;  2CZ3 A;  1PA3 A;  4HZ2 A;  4AKI A;  2IME A;  3E9J B;  1OE7 A;  1TK8 B;  3IAS 2;  4IS0 A;  3ERW A;  1SK1 A;  1FVK A;  5ECN B;  2R0P A;  2MMO A;  3GH9 A;  1GSQ A;  1VGL A;  2C4J A;  2JZR A;  5KN0 A;  2LRT A;  2M46 A;  1GSY A;  2YN1 A;  1EZK A;  2YWI A;  1GSS A;  4EE0 A;  2ES7 A;  3U6V A;  4K5R A;  3TOU A;  1RK4 A;  3ZMK A;  1ZMA A;  4K6X A;  5IO0 A;  5A5K A;  5G30 A;  16GS A;  2OJL A;  17GS A;  1UN2 A;  3HJO A;  4MNN A;  2ON5 A;  2GDR A;  4GCI A;  4XS6 A;  4O5U A;  1G6Y A;  2MMZ A;  2AAW A;  4ML1 A;  3C7M A;  3KP8 A;  2ON7 A;  4PQH A;  1FO5 A;  3VPT A;  3GSS A;  1O8W A;  3BCI A;  2AV4 A;  1U3A A;  3CWG A;  3UVT A;  2HZE A;  3A5W A;  2M72 A;  1T4Z A;  2HFD A;  1VF1 A;  3MIX A;  1TI1 A;  1M2B A;  5B8A A;  1K3O A;  1ML6 A;  2F8A A;  3H4K A;  1V9W A;  4BPY A;  3P2A A;  3KGK A;  4QL9 A;  2MMA A;  2PER A;  2WDU A;  3FW2 A;  4K0N A;  3TJJ A;  4ACS A;  1JZO A;  3KTL A;  4ML6 A;  4NV5 A;  1URM A;  2A4V A;  2H0I A;  2YV9 A;  2G2Q A;  3QOU A;  2YZH A;  4FYU A;  2FWF A;  1GTU A;  1GNE A;  4IN0 A;  2FLS A;  1B9X C;  1SJI A;  2GVP A;  1GH2 A;  2CVB A;  4K0G A;  4AF2 A;  3EU3 A;  4X4J A;  5EPF A;  4AKH A;  3R2Q A;  1E6B A;  2RLI A;  3LSZ A;  1QK8 A;  5F8B A;  1XVW A;  1XWB A;  5IMA A;  2F9S A;  4WET A;  4N3Z A;  3TKS A;  3DVX A;  2YPM A;  4PUA A;  3TOT A;  2YAN A;  4MP4 A;  1WPI A;  3L9U A;  1MEK A;  1GSU A;  2KP2 A;  2EFD A;  4XS4 A;  4G9H A;  2MMN A;  4QMK A;  1SD9 A;  1TRW A;  3C1S A;  1B48 A;  2A4H A;  2J23 A;  3A3T A;  2K9F A;  3F8U A;  3F6F A;  2YNX A;  2R3X A;  2RM6 A;  1K0B A;  2I3Y A;  2V2G A;  3O6T A;  3F63 A;  2TRX A;  3KIJ A;  4L0W A;  4HJ2 A;  3TRP A;  3MDK A;  2AUV A;  2L57 A;  5A5H B;  4MMM A;  2FWG A;  4O5Q A;  3FZ4 A;  4RQR A;  3F9U A;  3HMJ G;  1AW9 A;  4FIW A;  1TXU A;  1F6M C;  4GQC A;  5AN1 A;  3WD6 A;  4IVF A;  4XS1 A;  2FUG 2;  4N0V A;  1ON4 A;  2O7K A;  1ZZY A;  1ZOF A;  5D9V A;  3M1G A;  4TXO A;  4D73 A;  1K0N A;  2P0G A;  1M9A A;  1A2L A;  2P5R A;  2EFE A;  5HFI A;  4BL7 B;  3J7Y b;  6GST A;  5B8B A;  1B4Q A;  4YKG A;  5A4U A;  3ZRD A;  4ECB A;  4IGJ A;  5A34 B;  5ECH B;  3TJF A;  3ZIV A;  3LGC A;  4AKX B;  2AB6 A;  2HE3 A;  3FEU A;  2TRC P;  1XW9 A;  2PBJ A;  5EVO A;  4I2U A;  2H0G A;  3UBK A;  1HQO A;  3EMX A;  2FD3 A;  3FR9 A;  2GSS A;  3HKR A;  2H01 A;  4F9Z A;  2JAC A;  4PUF C;  3ZML A;  1WJK A;  4IW9 A;  2B7J A;  3UJ1 A;  1FG4 A;  2HRA A;  3WGE A;  4HDE A;  2DJ2 A;  1TK0 B;  4K2D A;  1MDI A;  4ZBB A;  2YWM A;  4MJB A;  4ZBA A;  3RDW A;  1A0R P;  1TW9 A;  1S3D A;  1O73 A;  5IM9 A;  4G0L A;  3HVV A;  1TU7 A;  1XW6 A;  2I9H A;  2FWH A;  3RBT A;  2HSN A;  2WGR A;  1GSE A;  3IK9 A;  1IYI A;  2EIR A;  4J57 E;  3VFI A;  2E2G A;  4GF0 A;  3Q6O A;  1WMJ A;  2PU9 C;  4GTU A;  5AGY A;  1K3Y A;  1GP1 A;  3HZ4 A;  4GQF A;  1EEJ A;  2IMD A;  3BBY A;  4Q5R A;  4TVE A;  2VCZ A;  5D9W A;  3TUE A;  5D9X A;  1YF0 A;  2V6O A;  18GS A;  2H74 A;  4G0K A;  1SJ6 A;  3JCM L;  4WEY A;  4KA0 A;  2R5G A;  4DEJ A;  3IC4 A;  2JZT A;  2V6K A;  4RQX A;  5G2Z A;  4K7O A;  3ZYW A;  3GKM A;  3ZVJ D;  1O6J A;  1GUM A;  4PUR A;  2DKH A;  2LQQ A;  1TDI A;  2IL3 A;  3NOF A;  5AIV A;  4JU5 A;  2H1D A;  1Z6N A;  4POK A;  3HZ8 A;  1XW5 A;  2R4V A;  4AJ7 A;  3GL5 A;  1V40 A;  5JCG A;  4EVM A;  1S3C A;  2PGT A;  1SYR A;  3W8J A;  1W4V A;  3ERF A;  1A2J A;  1YEP A;  2JAD A;  1YDK A;  3ME7 A;  3LW9 A;  1T4Y A;  1PSQ A;  3LG6 A;  1JLV A;  3CSH A;  4KH7 A;  4IQA A;  4OWY A;  2C0E A;  2QGV A;  4LL4 B;  1MD3 A;  1NHO A;  5DAK B;  3EIN A;  2YOI A;  4NPB A;  1ERV A;  4TR0 A;  4TRX A;  2F3M A;  1DUG A;  4EDZ A;  1DE1 A;  4KE3 A;  5KN3 A;  5LNK e;  5JCU A;  3TKP A;  4GSN A;  4L8E A;  5F06 A;  2A2R A;  3VWW A;  1SVO A;  3EWL A;  4V2M A;  1GRX A;  2LKU A;  7GSS A;  1WWJ A;  3UBL A;  3KZQ A;  4BL7 A;  2HI7 A;  3BJ5 A;  4HS1 A;  4JR4 A;  1EGR A;  4ICY A;  3FZA A;  5DAL B;  5H5S A;  4F03 A;  3QD9 A;  3VI5 A;  1J08 A;  3TKQ A;  5A34 A;  1JZW A;  4NXI A;  2C3T A;  3H79 A;  3QR6 A;  4MH2 A;  1DBY A;  1S3A A;  1TOF A;  3GN3 A;  2H0H A;  5ID2 B;  2IMI A;  3VI7 A;  2H72 A;  2GZY A;  1FOV A;  5J9B A;  3SWL A;  2RUE A;  3TU3 B;  3IE3 A;  2C0G A;  5G5E A;  3NZN A;  4AJ6 A;  3CSJ A;  3G7I A;  3GST A;  3HA9 A;  5IMZ A;  4POM A;  3RPP A;  3HD5 A;  3W8S A;  1XCC A;  2JU5 A;  5HR3 A;  4K7N A;  1AIU A;  4MK3 A;  2GTU A;  1K3L A;  3PPU A;  1VF2 A;  1Y6E A;  3FK8 A;  1U88 A;  2OE1 A;  1QFN A;  4KUN A;  3GRX A;  2I1U A;  1FVJ A;  2ZNM A;  2GLR A;  4K1F A;  3UOM A;  4ZIJ A;  3LQ7 A;  1Q98 A;  5ECO B;  2IFQ B;  2RM5 A;  1XXU A;  3TRQ A;  1JFU A;  3SBC A;  5GAP D;  5HR2 A;  5AIX A;  3GKX A;  2GT5 A;  1NSW A;  4GRF A;  1EOG A;  5CYY A;  2XPE A;  1MDJ A;  3QAW A;  4FYB A;  2LJR A;  4OCF A;  1YY7 A;  1UVZ A;  2VL2 A;  3FY7 A;  1AUC A;  3KMO A;  1MTC A;  4YQM A;  2B6M A;  1T3B A;  2E7P A;  3I43 A;  3PIN A;  1U6T A;  2K18 A;  5COH A;  4JR6 A;  1KEB A;  3O76 A;  1V57 A;  5C04 A;  8GSS A;  2VL9 A;  2GSR A;  1SK2 A;  4MF6 A;  3MNG A;  2X4A A;  2HRN A;  5J4V A;  4OMV A;  1G7E A;  3UMA A;  3TGZ A;  1T00 A;  3DYR A;  4HQZ A;  4Z2T A;  1G7O A;  4EUY A;  20GS A;  2CA8 A;  3ZLP A;  3S9F A;  4HI7 A;  1SEN A;  2VLT A;  2FNO A;  2XPD A;  3APO A;  4HZ4 A;  1LBK A;  2EIO A;  1QMV A;  1BED A;  2R0G A;  5J5N A;  4OFM A;  3KH9 A;  2GSQ A;  3F3Q A;  3F4R A;  4KDU A;  1GTI A;  3TKS C;  4I2T A;  1Z5Y E;  3I6A A;  1X9W B;  4XCS A;  2UZ8 A;  2UV8 G;  2KOK A;  2I4A A;  2C3N A;  5B6M A;  4FH8 A;  4O5R A;  6GSS A;  3RHC A;  1YKC A;  3HDC A;  1PGT A;  3EVI A;  4ZB9 A;  1CQG A;  4PTS A;  2H1G A;  3CTF A;  3DEX A;  4NWY A;  2QC7 A;  1V2A A;  3FR3 A;  5JWQ B;  2MBS A;  5F05 A;  2PWJ A;  5DAK A;  1ABA A;  1V98 A;  2A2P A;  3L9S A;  3RHB A;  4P3Y B;  3F0I A;  2DJJ A;  4HU7 A;  3C8E A;  4K5S A;  1BQ7 A;  4GXZ A;  5IO2 A;  4WBR D;  1FOH A;  2DIY A;  1ILO A;  1OC9 B;  4IHU A;  1C72 A;  4HJM A;  2GST A;  4MH3 A;  1E2Y A;  1H75 A;  2K8V A;  1PQN A;  4KW6 A;  3HHV A;  1I5G A;  1BYE A;  4MJC A;  1SVL A;  3VPQ A;  5ECP B;  2EFH A;  6GSY A;  5D8I A;  5DAL A;  3DGQ A;  1ZYE A;  2NBS A;  2HRF A;  4HEA 2;  2YCD A;  4WR5 A;  2KLX A;  2VUP A;  4O7H A;  5DCG A;  5A1N B;  1F3B A;  3IAM 2;  4DSS B;  1BX9 A;  13GS A;  1O85 A;  3L0H A;  4G10 A;  5KOW A;  1BAY A;  4F0C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...