1YKCA

Human glutathione s-transferase m2-2 (e.c.2.5.1.18) complexed with glutathione-disulfide
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
217
structure length
217
Chain Sequence
PMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVWGNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase Mu 2
publication title Selective Inhibitors of Prostaglandin Synthase activity of human glutathione S-transferase M2-2
rcsb
source organism Homo sapiens
total genus 78
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2005-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1ykcA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1ykcA01
5E4WA 1EZKA 4DVCA 2QGVA 5HFGA 3GH9A 4IW9A 1DUGA 1N8JA 2NDOA 3A2WA 5G1KA 2OA7A 3IXRA 5CP1A 4Q5QA 9GSSA 4ZXGA 3F3RA 2JADA 3APQA 5ID2A 2M72A 4F82A 5EY6A 1I9DA 2I4AA 2I3YA 4PTSA 5ECKB 2OACA 1WMJA 4AJ6A 4V1Ag 3WT1A 1K0DA 2M80A 2HZFA 2O89A 4HQZA 5J9BA 5ECPB 3TJBA 4Q5NA 4X43A 2B7KA 1MEKA 5G1LA 1EOGA 4MF5A 4JRRA 4HDEA 6GSTA 3L0HA 2IMIA 5J3RA 4KE3A 1TK0B 5ELAA 4JR6A 3IE3A 2H75A 4RQXA 4MJCA 3FZ9A 2H0IA 2DMMA 3GURA 1O85A 4MF7A 5CRDA 3DIEA 1AC1A 4FYBA 4CW9A 3LG6A 3J7Yb 2FWEA 1M2BA 3DVXA 5DAKA 4ACSA 3IV4A 3JCML 2TRCP 4KDXA 1O81A 3ZIVA 2C1YA 4MJAA 2YWNA 2H30A 2HE3A 3LQ7A 1TOFA 3APSA 4G2EA 5DVBA 1Z9HA 3D4MA 4J57E 1K0CA 4ZBBA 4NAXA 1PGTA 2LRTA 5AN1A 3UIWA 5IMVA 1VRSD 3OR5A 2KP2A 3I69A 1QGVA 3A5WA 2CVDA 1QQ2A 2JSZA 2CA8A 4Z7XA 1JLWA 1S3DA 3APOA 4XRDA 4ZB8A 1Q4JA 4KDUA 2VLUA 4HEA2 5EL8A 3L9SA 3C8EA 3G7YA 1V98A 2IPAA 2YNXA 3KMNA 4P3YB 1Q98A 4BVYA 1G7EA 3IK9A 4GXZA 2OKAA 2XHFA 2PGTA 3UJ1A 3HY2A 1A8LA 1GLQA 3FR3A 6GSYA 3RHCA 4DSSB 4YAVA 2YOIA 2ON7A 1AIUA 1MDIA 3PINA 5HR1A 3O76A 4OCEA 2PVQA 3M3MA 1PRXA 3W6GA 2WGRA 1XPVA 3D5JA 2RUFA 2MMZA 4GLTA 3KIJA 4G10A 1AAZA 6GSSA 3BCIA 4HU9A 1DE2A 2LKUA 3ERWA 5GAPD 2VL2C 3WYWA 1TJDA 3ZRDA 4TVEA 4QL9A 5CRHA 1XVQA 4MABA 3CXGA 3NZNA 2H6ZA 3TDGA 5HR2A 2CQ9A 2WCIA 1PQNA 2L57A 1R5PA 2K18A 3GX8A 1TRVA 2O87A 4ZL9A 2ZNMA 3AY8A 2TRXA 2H74A 3N9JA 1EWXA 3BJ5A 4ECIA 3E0UA 1ZCPA 1RW1A 2LS5A 3DMLA 4TR3A 1GSUA 3V1WA 2IMFA 4TR4A 2VL2A 1FO5A 1T4YA 4NV2A 3TJKA 4TN8A 5ENUA 3G9BA 3FK8A 1ERVA 5F8BA 2BTOT 4IN0A 4POKA 3UBLA 2LJKA 4X1UA 5ID2B 2R5GA 4USSA 3BOAA 5ECRB 5HQPA 4ZB6A 3F6FA 4K6XA 1A2LA 3HDCA 1O6JA 3DVWA 1FOVA 4ECCA 4J2FA 2B7JA 3LEFA 2F8FA 3IAS2 1F3AA 3CBUA 2KHPA 1M0UA 4K7NA 2VLTA 2GDRA 3FW2A 2H1AA 4MP4A 2K6VA 2BMXA 3IPZA 1FVJA 1KEBA 3ZFBA 2LQQA 2LRNA 1OE7A 2VCZA 4GSNA 5ECLB 5IMZA 2CX3A 1YEPA 4NMUA 2HNLA 3D21A 4GQFA 5DQYA 1BAYA 5DAKB 4N10A 1EEJA 3QOUA 3UVHA 3E3EA 2AJQB 3HVVA 2PMTA 2C0FA 5B8AA 1MD3A 2C3TA 3KM6A 1PSQA 4KB3A 2ZCTA 4K0GA 3KD0A 4MF6A 1T4ZA 3IC4A 1TK8B 2PERA 1SL0B 1GSEA 4EKZA 2M46A 1M2DA 4OFTA 3ZIJA 3IBHA 4XCSA 2DIZA 2JZTA 2B6MA 3HD5A 4BWSA 1DSBA 2FWGA 2PPTA 1PA3A 5A5KA 2WZ9A 1GH2A 4MH2A 5AISA 4GTUA 2WS2A 3ZTLA 2B1LA 5A4WA 2CV4A 3ED3A 3VPTA 2L4QA 1K3YA 4MH3A 4ZBAA 1WP0A 4BVYB 1Y25A 2FGXA 4MLYA 2EIRA 5D9WA 3EWLA 4POBA 3GL5A 4TR0A 1M7TA 2X8HA 4EXJA 1R7HA 4MZCA 1A2MA 2VCVA 2VM2A 2L5OA 4ML1A 1JZOA 1J08A 4HS1A 5ECIB 4FYCA 1HD2A 4IQ1A 1V58A 2XPDA 4LA1A 5ECQB 1OC8A 1Z5YE 2GVPA 2WULA 2H70A 3GL3A 4KX4A 4I5QA 1EEMA 2DJJA 4HQSA 2D2ZA 3H1NA 4F9ZA 3TUEA 2VM1A 2X99A 3ZMKA 3US3A 1HQOA 3QCPA 2DC5A 3TOUA 2VD1A 6GSVA 1PX7A 3KTLA 2HSMA 1HNAA 2YWOA 3DKSA 2V6OA 2H1BA 2IJYA 4WEYA 1DE1A 5F06A 1U87A 2YWIA 5HFIA 3QAVA 3QPMA 1EV4A 3CTFA 2RIIA 3H8QA 3P7XA 1URMA 2NTOA 1JLVA 4YAPA 2NBSA 17GSA 3IK7A 1F37A 2CZ2A 2VO4A 2LSTA 3RPNA 4JZQA 3HYPA 1DBYA 4HZ4A 4XS1A 5GZZB 1SYXA 1GSDA 4F2IA 5GAND 5F07A 4MPGA 1EOHA 1TI3A 4PXOA 1F9MA 3I43A 2E0QA 2CT6A 4IGJA 1CQHA 5JCWA 4HOJA 3QD9A 14GSA 3BD2A 1G6WA 3HJPA 5CYYA 4I6XA 3D0ZA 2N5AA 4WF5A 4V2LA 1X9SB 4AGSA 4GSSA 5DBQA 5FHIA 5ABRA 2P5QA 2FWFA 2G0FA 1K0NA 2X8CA 3D4TA 4HJ2A 3CSHA 4MMMA 4PUAA 3Q6OA 3EU4A 2IN3A 2VCTA 5KN1A 4HZ2A 2F8AA 3R3EA 4J56E 4BWQA 4NV5A 4XTSA 2V32A 4TXVA 2C0EA 4OWYA 18GSA 4I2UA 1OAZA 4LMWA 20GSA 3P90A 3FKFA 4WKWA 3LORA 5G5EA 2V1MA 3ZL5A 3GTUA 2KLXA 5J4UA 3WGEA 1OC3A 3S9FA 1AQVA 1XBSA 3H79A 4MZWA 4OFMA 5IM9A 1YKAA 5DDLA 2GTUA 1OKTA 2J23A 4MJEA 4LMVA 2KOKA 5IMCA 3LSZA 2GZPA 5CRWA 1WIKA 3DXBA 2CZ3A 4LLRA 2F51A 2ON5A 3Q74A 3MDKA 2VD0A 1AW9A 1EGOA 1BQ7A 5AIXA 3RDWA 2WFCA 2H72A 3UARA 4FIWA 4BVXA 3BCKA 3FR6A 3O3TA 1K0BA 3QAGA 1XW6A 3RPPA 5IOXA 5G5FA 4RUVA 5ECOB 3WD6A 1BJXA 2GT5A 4RI6A 4EUYA 2BJXA 2FD3A 1MDJA 4DSQA 3RAZA 2H8LA 2FLSA 3SWLA 2H6XA 1A23A 1H75A 2GQMA 3CYNA 1B4PA 4MJBA 3Q19A 5ECSA 1G7OA 3KH9A 5ECMB 19GSA 2MMAA 1ZL9A 5DALB 2CX4A 3TRPA 3EURA 2A2RA 4XS6A 1NM3A 1THOA 1U3AA 2L6DA 1GTAA 3VWWA 4WBJA 4LL4B 5H5SA 3VURA 2H66A 2VL9A 1FG4A 5B6NA 3ERFA 3ZLPA 5F0GA 1XWCA 1O73A 3ME7A 3UAPA 3FHKA 3F4SA 4F0CA 2WRTA 2HSMB 5LCZA 3HXSA 1R5AA 4AJ7A 2AUVA 3EU3A 2DJ1A 3U6VA 4HI7A 4KDYA 3F4TA 1SENA 3VFIA 4EVMA 1T7PB 4V2NA 5CNWA 1LU4A 1B9XC 1A0RP 1H4OA 2YZUA 2GSQA 1THXA 3HVSA 2LNTA 2GS3A 5DJMA 3IR4A 5B8BA 1SL1B 4F03A 3FRCA 4RQRA 4X0XA 2YP6A 1EP7A 2P0GA 4E8EA 5J5NA 1KNGA 1XOBA 4TKYA 3VI5A 3GFKA 5IMDA 3DYRA 3F9UA 2X64A 2HZEB 1FB6A 3M9KA 4OO5A 4XRAA 2V2GA 2R6KA 1SJZA 1RK4A 3WGXA 3SBCA 5HR3A 1NHOA 16GSA 4G0LA 4K0NA 3RBTA 2XC2A 3LYKA 4DEJA 2MYGA 2LTKA 1F2EA 4XIHA 3U5RE 1JZWA 3NOFA 4XHMA 3GX0A 1GNEA 1K3OA 10GSA 1MD4A 4KH7A 1G0TA 7GSSA 2OJLA 5JWRB 1B48A 4WBRD 3VK9A 1TXXA 2HSHA 3GTUB 4KUNA 1ZYEA 5CREA 1NW2A 2C8UA 2K8SA 2TIRA 2UZ8A 4ULXA 2YJ7A 2JL4A 3ISOA 2H1GA 1X5CA 1GSYA 1GL8A 5JCGA 1Z7PA 2A4VA 4PQ1A 1JZDA 4MA9A 2VCQA 3MAKA 1GUMA 4IP6A 3IA1A 5GSSA 1Z7RA 2DLXA 2XPEA 4IJIA 1BEDA 2GLRA 4BVXB 4K2DA 4KNDA 4MPFA 4TOPA 4K7OA 5AIVA 1ZMAA 4FYUA 4L5OA 3GKNA 1LBKA 4WR5A 1NHYA 2B5EA 4JR4A 5BMUA 2HI7A 2H19A 3A3TA 4ZBDA 1O8XA 3M9JA 4OMVA 3EVIA 1GTIA 4I97A 4QL7A 1ZYQB 2H6YA 5FWGA 5DCHA 3RHBA 5JWQB 3M1GA 2B5YA 2H71A 3D22A 3KH7A 4I8BA 1SK2A 2YWMA 1GUKA 1O7UA 5AGYA 3TKPA 4PQIA 3DGQA 2GZZA 2IMDA 5KN0A 2GZYA 3R2QA 3GNJA 3LYPA 4DSRA 1GTBA 2DJ2A 1E2YA 2HRNA 4YQUA 2REMA 5D8IA 1V40A 2H0GA 1TU7A 3L78A 1GUHA 1VF4A 3FZ5A 3TKRA 2DMLA 3CSJA 1SK0A 1XIYA 4EF0A 1K3LA 1WRYA 4CDOA 2FUG2 3IOSA 3GH6A 3TJJA 1GSSA 1TK5B 4ZIJA 1J9BA 4K1FA 4Q5FA 3TKSE 3GHAA 4XS4A 5CAXA 4RI7A 2A2SA 3HVXA 2F3MA 2HXKA 3TKQA 1OE8A 3W8SA 1TP9A 2LUSA 3GYKA 2CAQA 1PL2A 5DALA 2EIQA 3F63A 3ZYWA 3IC8A 5COHA 2V41A 4JE1A 1E6BA 4KSMA 4V2MA 2OBIA 2I1UA 2AYTA 3ME8A 3UBKA 1AQWA 2R2JA 2RLIA 3GA4A 2C3NA 4ISDA 1SJIA 4KF9A 2DJ0A 2LQOA 1SD8A 3UVTA 2QC7A 4HU7A 2DBCA 4PQHA 4ZL7A 5DQSA 2HRKA 2B1KA 1F6MC 1ON4A 1TKDB 5CO3A 5D9XA 3GRXA 3VI7A 2QSIA 3KEBA 1UN2A 1XFLA 3TJFA 4BA7A 4KA0A 1V2AA 1V9WA 1F3BA 4OO4A 2VL3A 1JHBA 3K8NA 3TOTA 3LXTA 2F9SA 3VPQA 4BL7A 2GSSA 5H5QA 1U3IA 11GSA 2KUCA 2PN8A 4L0UA 3VWVA 1FB0A 2VAFA 4NXIA 3HKRA 3KMOA 1K0OA 2C0DA 3L9VA 2ES7A 2HSYA 3D6IA 3ZVJD 5D93A 4POLA 3TCOA 3FR9A 2L59A 2CVKA 2YJHA 2ALBA 4N30A 2RUEA 3ZITA 1U88A 5ELGA 1SU9A 5L71A 4WETA 1XWAA 1ZZYA 5J9CA 1X5EA 2HZEA 1M9AA 2IFQA 3DD3A 4PNGA 2ZUPA 1MTCA 3KTBA 4NPBA 2GQKA 3E9JB 2R37A 4K9ZA 2QKEA 4ILFA 2EC4A 5LD0A 2VIMA 3VWXA 2HLSA 1XZOA 1M99A 2B5XA 13GSA 2AB6A 4NHWA 2LEGA 2LJAA 3DRNA 2FHEA 1A0FA 1AXDA 1ERTA 1SYRA 5C04A 2IWTA 2HRFA 3QR6A 2OADA 3TB2A 2DJKA 5G2ZA 3H93A 3O6TA 4TR1A 4IQAA 4QQ7A 2YANA 2FA8A 2R3XA 4IJ3A 2K8VA 2K9FA 2HSNB 2I81A 2CAIA 2AV4A 4AJ8A 5IOWA 3FY7A 1PD21 2FA4A 3EC3A 1YF0A 2IL3A 2FNOA 1XVWA 5IO0A 2OE1A 4FQUA 2IMEA 2YV9A 1SKRB 1TRWA 1TU8A 2JACA 3CRTA 3KP9A 4BPYA 1R26A 5ECHB 1IYHA 2OE3A 5FT3A 1W4VA 3IDVA 4L5LA 1QUWA 2JZSA 4XS4B 2FWHA 1ZOFA 3HA9A 2P31A 2O8VB 4K8MA 4TRXA 2O85A 2HYXA 5F05A 5IPGA 2GSRA 3ZREA 2GGTA 4HUAA 4OFNA 1T00A 3WT2A 1MDKA 1OC9A 3IAM2 1XW9A 1SKSB 3GUSA 2PBJA 1IYIA 4O92A 4LL1B 4PNFA 3LFLA 3L9UA 4MDCA 5JWOB 2DSAA 4G0KA 1GRXA 2HFDA 2C3QA 1SKWB 2YCDA 2MMNA 4JBBA 4D73A 3QFBC 1R4WA 1BG5A 8GSSA 3TGZA 4G19A 1AQXA 4CHSA 2YPMA 2WB9A 4EDYA 4H86A 2R4VA 2L4CA 3A2XA 1XW5A 1EGRA 2VCWA 1SJ6A 1WWJA 1GNWA 4FO5A 2LNSA 2HRKB 1AUCA 4GSTA 3MNGA 2XBQA 3WGDA 2CVBA 1Z6MA 3FYGA 3I9V2 2C80A 5IO2A 1PL1A 3F0IA 4ZB9A 3F8UA 1YDKA 1XWGA 3C1SA 3UL3A 4BL7B 3QFAC 5G30A 2FY6A 4L8EA 4V1Ap 1T3BA 2VCXA 2EIOA 4YH2A 1ERUA 2Z9SA 5A4UA 1GLPA 2AAWA 1QMVA 2E2MA 2LJRA 3GKMA 1UVZA 1JZRA 3IRAA 3TKSC 1LJRA 3KP8A 3VLNA 2H01A 2PUKC 3W8JA 1FW1A 4E8HA 3HZ4A 4MCUA 4JU5A 2OE0A 5B7CA 4IBPA 2H0HA 1T1VA 3HJMA 1UC7A 5B6MA 3ERGA 1WJKA 4KSOA 1I5GA 2IFQB 1OVNA 5H5RA 1HYUA 4ID0A 1ERWA 3A2VA 1WE0A 5GSTA 3ZMLA 1BX9A 1YY7A 3GSSA 1O8WA 1HNBA 4POMA 3F6DA 4KCEA 2YV7A 4GRFA 3TRXA 3J7Yk 4PUFC 5G31A 4TXOA 1K0MA 1ST9A 3TKSA 2G2QA 1HNCA 3PGTA 2KP1A 1QFNA 2E7PA 2X8GA 2GT6A 1OKDA 1VF1A 3PPUA 1ACVA 4KW6A 3QAWA 3GSTA 1QK8A 2MMOA 3EMXA 3MWHA 1TRSA 1X9MB 2P5RA 4IP1A 4TR1B 2N5FA 1ABAA 1B9YC 3DEXA 1V57A 4IVFA 2WDUA 3PR8A 3HHVA 2PU9C 1PMTA 1BYEA 5IIZA 4GF0A 1TTZA 1Z3EA 2JZRA 3FZ4A 2LV3A 1VF3A 2NVLA 5IPHA 1A24A 4FH8A 1W89A 2FCHA 4GWRA 4PX1A 3UEMA 4OCFA 1PX6A 5HR0A 2C4JA 5DJLA 3GV1A 1UA5A 1YQ1A 1XWBA 2XBIA 1ZGNA 5J41A 3F3QA 4L0WA 4G0IA 3LWAA 3KGKA 4GQCA 2VOCA 3CMIA 1USBA 3NIVA 2WJUA 3KXOA 1T8EB 5JCUA 3H4KA 4TW5A 4GCIA 1VGLA 3TJGA 4EDZA 2DIYA 1X5DA 1J0FA 3HCZA 3G7IA 4ECBA 1YKCA 4O7HA 1TI1A 5INYA 1OC9B 4EO3A 5DCGA 6GSUA 5E59A 3N5OA 5CRGA 1XWKA 2RM6A 4ECJA 1A8YA 1K0AA 1TW9A 22GSA 1XOAA 1OYJA 3C7MA 3HZ8A 1XXUA 4D73B 2O7KA 5D9VA 3CSIA 4K7IA 3MSZA 1KTEA 3LXZA 1FVKA 4MK3A 4YQMA 3C71A 5KN2A 3FZAA 2V6KA 1RQMA 3QMXA 1YEXA 4ZILA 4IKHA 1GSQA 1KBNA 3GIXA 3TRQA 4F0BA 4IHUA 5ECNB 5D9TA 2VUPA 3LGCA 5C00A 1EP8A 2H73A 1SD9A 4KGIA 1FHEA 5HFKA 1TRUA 1GULA 1GSFA 5KN3A 5KEJA 1C72A 1XCCA 3ZZXA 2H76A 3EYTA 1U6TA 1JFUA 3ZFLA 2L6CA 2GSTA 1G6YA 1GTUA 3UMAA 4EL1A 4N11A 5LNKe 5EPFA 3EE2A 1PKZA 4N0ZA 1PN9A 2MZCA 5IMFA 1SK1A 4YQVA 3PH9A 3Q18A 1A2JA 2C0GA 1M2AA 4AF2A 1ILOA 4WXTA 2YN1A 3EMPA 3EINA 2AHEA 12GSA 1M9BA 2RM5A 1S3AA 1SL2B 3CRUA 3LJRA 1B8XA 1N2AA 3BBYA 3HJOA 2N5BA 1FAAA 4JEDA 1X9WB 3M0FA 3KJYA 4KCAA 6GSXA 2MBSA 3GN3A 2I9HA 3ZVJA 2PVOC 2VLVA 3KCMA 1EV9A 1Z6NA 4ZL8A 4TXOB 3G7JA 4O5RA 4IELA 2HT9A 4KAEA 1X0RA 6GSWA 3FEUA 5IMAA 3F4RA 1TDIA 3CTGA 4ML6A 3GMFA 2MBTA 2L5LA 3VWUA 3L4NA 1CQGA 3I6AA 5D73A 4DSSA 5A4VA 3DWVA 3GKKA 2HRAA 2PWJA 4EE0A 2JU5A 4MZBA 4WR4A 2B3SA 1QXHA 2E2GA 3C1RA 1WPIA 1Y6EA 5IQYA 4OD7A 2YZHA 1VF2A 1WOUA 3KZQA 2J9HA 2OBKA 1ML6A 1PKWA 4PURA 3C73A 2HQTA 4G9HA 4PGTA 3M8NA 3IHQA 5D96A 2IMKA 1S3CA 1B4QA 1NSWA 2JSYA 1YF1A 2LRCA 3P8WA 4HJMA 4EC0A 4I2TA 2GQLA 3GKXA 4NHZA 3QDNA 2NPBA 1GWCA 4N0VA 4WF4A 3P2AA 2IIYA 1YJ6A 4Q5RA 1YZXA 3UOMA 4O32A 1GP1A 2DJ3A 4IS0A 4NWYA 2H1DA 5EVOA
chains in the Genus database with same CATH superfamily
5E4WA 1EZKA 4DVCA 2QGVA 5HFGA 2EFDA 3GH9A 4IW9A 1DUGA 1N8JA 2NDOA 3A2WA 5G1KA 2OA7A 3IXRA 5CP1A 4Q5QA 9GSSA 4ZXGA 3F3RA 2JADA 5A34A 3APQA 5ID2A 2O36A 2M72A 4F82A 5EY6A 1I9DA 2I4AA 2I3YA 4PTSA 4Z2TA 5ECKB 2OACA 1WMJA 4AJ6A 4V1Ag 3WT1A 1K0DA 2M80A 2HZFA 2O89A 4HQZA 5J9BA 5ECPB 3TJBA 4Q5NA 4X43A 4PHZC 2WVXA 2B7KA 1MEKA 5G1LA 1EOGA 4MF5A 4JRRA 4HDEA 6GSTA 3L0HA 2IMIA 5J3RA 4KE3A 1TK0B 5ELAA 4JR6A 3IE3A 2H75A 4RQXA 4MJCA 3FZ9A 2H0IA 2DMMA 3GURA 1O85A 4MF7A 5CRDA 3DIEA 1AC1A 4FYBA 4CW9A 3LG6A 3J7Yb 2EFEA 2FWEA 1M2BA 3DVXA 5DAKA 4ACSA 3IV4A 3JCML 2TRCP 4KDXA 1O81A 3ZIVA 2C1YA 4MJAA 2YWNA 2H30A 2HE3A 3LQ7A 1TOFA 3APSA 4G2EA 5DVBA 1Z9HA 3D4MA 4J57E 1K0CA 4ZBBA 4NAXA 1PGTA 2LRTA 5AN1A 3UIWA 5IMVA 1VRSD 3OR5A 2KP2A 3I69A 1QGVA 3A5WA 2CVDA 1QQ2A 2JSZA 2CA8A 4Z7XA 1JLWA 1S3DA 4AKIA 3APOA 4XRDA 4ZB8A 1Q4JA 4KDUA 2VLUA 4HEA2 5EL8A 3L9SA 3C8EA 4AKGA 3G7YA 1V98A 4YKGA 2IPAA 2YNXA 3KMNA 5J4VA 4P3YB 1Q98A 4BVYA 1G7EA 3IK9A 4GXZA 2OKAA 2XHFA 2PGTA 3UJ1A 3HY2A 1A8LA 1GLQA 3FR3A 6GSYA 3RHCA 4DSSB 4YAVA 2YOIA 2ON7A 1AIUA 1MDIA 3PINA 5HR1A 3O76A 4OCEA 2PVQA 4W66A 3M3MA 1PRXA 3W6GA 2WGRA 1XPVA 1PFOA 3D5JA 2RUFA 2MMZA 4GLTA 3KIJA 4G10A 1AAZA 6GSSA 3BCIA 4HU9A 1DE2A 2LKUA 3ERWA 5GAPD 2VL2C 3WYWA 1TJDA 3ZRDA 4TVEA 4QL9A 5CRHA 1XVQA 4MABA 3CXGA 3NZNA 2H6ZA 3TDGA 5HR2A 2CQ9A 2WCIA 1PQNA 4PI2C 2L57A 1R5PA 2K18A 3GX8A 1TRVA 2O87A 4ZL9A 2ZNMA 3AY8A 2TRXA 2H74A 5A1NA 1M3JA 3N9JA 1EWXA 3BJ5A 3IHGA 4ECIA 3E0UA 1ZCPA 1RW1A 2LS5A 3DMLA 3FMWA 4TR3A 1GSUA 3V1WA 2IMFA 4TR4A 2VL2A 1FO5A 1T4YA 4NV2A 3TJKA 4TN8A 5ENUA 3G9BA 3FK8A 1ERVA 5F8BA 2BTOT 4IN0A 4POKA 3UBLA 2LJKA 4X1UA 5A34B 5ID2B 2R5GA 4USSA 3BOAA 5ECRB 5HQPA 4ZB6A 3F6FA 4K6XA 1A2LA 3HDCA 1O6JA 3DVWA 1FOVA 4ECCA 4J2FA 2B7JA 3LEFA 2F8FA 3IAS2 1F3AA 3CBUA 2KHPA 1M0UA 4K7NA 4Z2UA 2VLTA 2GDRA 4ICYA 3FW2A 2H1AA 4MP4A 2K6VA 2BMXA 3IPZA 1FVJA 1YVLA 4K5SA 4GDFA 1KEBA 3ZFBA 2LQQA 2LRNA 1OE7A 2VCZA 4GSNA 5ECLB 5IMZA 2CX3A 1YEPA 4NMUA 2HNLA 3D21A 4GQFA 5DQYA 1BAYA 5DAKB 4N10A 1EEJA 3QOUA 3UVHA 3E3EA 2AJQB 3HVVA 2PMTA 2C0FA 5B8AA 1MD3A 2C3TA 3KM6A 1PSQA 4KB3A 2ZCTA 4K0GA 3KD0A 4MF6A 1T4ZA 3IC4A 1TK8B 2PERA 1SL0B 1GSEA 4EKZA 2M46A 1M2DA 4OFTA 3ZIJA 3IBHA 4XCSA 2DIZA 2JZTA 2B6MA 3HD5A 4BWSA 1DSBA 2FWGA 2PPTA 2DKIA 1PA3A 5A5KA 2WZ9A 1GH2A 4MH2A 5AISA 4GTUA 2WS2A 3ZTLA 2B1LA 5A4WA 2CV4A 3ED3A 4O5QA 3VPTA 2L4QA 1K3YA 4MH3A 4ZBAA 1WP0A 4BVYB 1Y25A 2FGXA 4MLYA 2EIRA 5D9WA 3EWLA 4POBA 3GL5A 4TR0A 1M7TA 2X8HA 4EXJA 1R7HA 4MZCA 1A2MA 2VCVA 1SVLA 2L5OA 2VM2A 4ML1A 1JZOA 1J08A 4HS1A 5ECIB 4FYCA 1HD2A 4IQ1A 1V58A 2XPDA 4LA1A 5ECQB 1OC8A 1Z5YE 2GVPA 2WULA 2H70A 3GL3A 4KX4A 4I5QA 1EEMA 2DJJA 4HQSA 2D2ZA 3H1NA 4F9ZA 3TUEA 2VM1A 2X99A 3ZMKA 3US3A 1HQOA 4AKHA 3QCPA 2DC5A 3TOUA 2VD1A 6GSVA 1PX7A 3A5IA 4ZB7A 3KTLA 2HSMA 1HNAA 2YWOA 3DKSA 2V6OA 2H1BA 2IJYA 4WEYA 1DE1A 5F06A 1U87A 2YWIA 5HFIA 3QAVA 3QPMA 1EV4A 3CTFA 2RIIA 3H8QA 3P7XA 1URMA 2NTOA 1JLVA 4YAPA 2NBSA 17GSA 5A1NB 3IK7A 1F37A 2CZ2A 2VO4A 2X4AA 2LSTA 3RPNA 4JZQA 3HYPA 1DBYA 4HZ4A 4XS1A 5GZZB 1SYXA 1GSDA 4F2IA 5GAND 5F07A 4MPGA 1EOHA 1TI3A 4PXOA 1F9MA 1PN0A 3I43A 2E0QA 2CT6A 4IGJA 1CQHA 5JCWA 4HOJA 3QD9A 14GSA 2EFHA 3BD2A 1G6WA 3HJPA 5CYYA 4I6XA 3D0ZA 2N5AA 4WF5A 4V2LA 1X9SB 4AGSA 4GSSA 5DBQA 5FHIA 5ABRA 3RGBC 2P5QA 3CHXC 2FWFA 2G0FA 1K0NA 2X8CA 2WW3A 3D4TA 4HJ2A 3CSHA 4MMMA 4PUAA 3Q6OA 3EU4A 2IN3A 2VCTA 2R0PA 5KN1A 4HZ2A 2F8AA 3R3EA 4J56E 4BWQA 4NV5A 4XTSA 2V32A 4TXVA 2C0EA 4OWYA 18GSA 4I2UA 1OAZA 4LMWA 20GSA 3P90A 3FKFA 4WKWA 3LORA 5G5EA 2V1MA 3ZL5A 3GTUA 3HVNA 2KLXA 5J4UA 3WGEA 1OC3A 3S9FA 1AQVA 1XBSA 3H79A 2A4HA 4MZWA 4OFMA 5IM9A 1YKAA 5DDLA 2GTUA 1OKTA 2J23A 4MJEA 4LMVA 2KOKA 5IMCA 3LSZA 2GZPA 5CRWA 1WIKA 3DXBA 2CZ3A 4LLRA 2F51A 2ON5A 4O5UA 3Q74A 3MDKA 2VD0A 1AW9A 1EGOA 1BQ7A 5AIXA 3RDWA 2WFCA 2H72A 3UARA 4FIWA 4BVXA 3BCKA 5A5HA 3FR6A 3O3TA 1K0BA 3QAGA 1XW6A 3RPPA 5IOXA 5G5FA 4RUVA 5ECOB 1FOHA 3WD6A 1BJXA 2GT5A 4RI6A 4EUYA 2BJXA 2FD3A 1MDJA 4DSQA 3RAZA 2H8LA 2FLSA 3SWLA 2H6XA 1A23A 1H75A 2GQMA 3CYNA 1B4PA 4MJBA 3Q19A 5ECSA 1G7OA 3KH9A 5ECMB 19GSA 2MMAA 1ZL9A 5DALB 2CX4A 1SVMA 3TRPA 3EURA 2A2RA 4CY6A 4XS6A 1NM3A 1THOA 1U3AA 2L6DA 1GTAA 3VWWA 4WBJA 5KOWA 4LL4B 1I1IP 5H5SA 3VURA 2H66A 2VL9A 1FG4A 5B6NA 3ERFA 3ZLPA 5F0GA 1XWCA 1O73A 3ME7A 3UAPA 3FHKA 3F4SA 4F0CA 2WRTA 2HSMB 5LCZA 3HXSA 1R5AA 4AJ7A 2H1LA 2AUVA 3EU3A 2DJ1A 3U6VA 4EIQA 4HI7A 4KDYA 3F4TA 1SENA 3VFIA 4EVMA 1T7PB 4V2NA 5CNWA 4MNNA 1LU4A 1B9XC 1A0RP 1H4OA 2YZUA 2GSQA 1THXA 3HVSA 2LNTA 2GS3A 5DJMA 3IR4A 5B8BA 1SL1B 4F03A 3FRCA 4RQRA 4X0XA 2YP6A 1M3IA 1EP7A 2P0GA 4E8EA 5J5NA 1KNGA 1XOBA 4TKYA 3VI5A 3GFKA 5IMDA 3DYRA 3F9UA 2X64A 2HZEB 1FB6A 3M9KA 4OO5A 4XRAA 2V2GA 2R6KA 1SJZA 1RK4A 3WGXA 3SBCA 5HR3A 1NHOA 16GSA 4G0LA 4K0NA 3RBTA 2XC2A 3LYKA 4DEJA 2MYGA 2LTKA 1F2EA 4XIHA 3U5RE 1JZWA 3NOFA 4XHMA 3GX0A 1GNEA 1K3OA 10GSA 1MD4A 4KH7A 1G0TA 7GSSA 2OJLA 5JWRB 1B48A 4WBRD 3VK9A 3MIXA 1TXXA 2HSHA 3GTUB 4KUNA 1ZYEA 5CREA 1NW2A 2C8UA 2K8SA 2TIRA 2UZ8A 4ULXA 5J4YA 2YJ7A 2JL4A 3ISOA 2H1GA 1X5CA 1GSYA 1GL8A 5JCGA 1Z7PA 2A4VA 4PQ1A 1JZDA 4MA9A 2VCQA 3MAKA 1GUMA 4IP6A 3IA1A 5GSSA 2VKZG 1Z7RA 2DLXA 2XPEA 4IJIA 1BEDA 2GLRA 4BVXB 4K2DA 4KNDA 4MPFA 4TOPA 5A5HB 4K7OA 5AIVA 1ZMAA 4FYUA 4L5OA 3GKNA 1LBKA 4WR5A 1NHYA 2WW1A 2B5EA 4JR4A 5BMUA 2HI7A 2H19A 3A3TA 4ZBDA 1O8XA 3M9JA 1TXUA 4OMVA 3EVIA 1GTIA 4I97A 4QL7A 1ZYQB 2H6YA 5FWGA 5DCHA 3RHBA 5JWQB 3M1GA 2B5YA 2H71A 3D22A 2UV8G 3KH7A 4I8BA 1SK2A 2YWMA 1GUKA 1O7UA 5AGYA 3TKPA 4PQIA 3DGQA 2GZZA 2IMDA 5KN0A 2GZYA 3R2QA 3GNJA 2HSNA 3LYPA 4DSRA 1S3RA 1GTBA 2DJ2A 1E2YA 2HRNA 4YQUA 2REMA 5D8IA 1V40A 2H0GA 1TU7A 3L78A 1GUHA 1VF4A 3FZ5A 3TKRA 2DMLA 3CSJA 1SK0A 2WZSA 1XIYA 4EF0A 1K3LA 1WRYA 4CDOA 3HMJG 2WVZA 2FUG2 4G01A 3IOSA 3GH6A 3TJJA 1GSSA 3LW9A 1TK5B 4ZIJA 1J9BA 4K1FA 4Q5FA 3TKSE 3GHAA 4XS4A 5CAXA 4RI7A 2A2SA 3HVXA 2F3MA 2HXKA 3TKQA 1OE8A 3W8SA 1TP9A 2LUSA 3GYKA 2CAQA 1PL2A 3MYDA 5DALA 2EIQA 3F63A 3ZYWA 3IC8A 5COHA 2V41A 4JE1A 1E6BA 4KSMA 4X4JA 4V2MA 2OBIA 2I1UA 2AYTA 3ME8A 3UBKA 1AQWA 2R2JA 2RLIA 3GA4A 2C3NA 4ISDA 1SJIA 4KF9A 2DJ0A 2LQOA 1SD8A 3UVTA 2QC7A 4A5PA 4HU7A 2DBCA 4PQHA 4ZL7A 5DQSA 2HRKA 2B1KA 1F6MC 1ON4A 1TKDB 5CO3A 5D9XA 3GRXA 3VI7A 2QSIA 3KEBA 1UN2A 1XFLA 3TJFA 4BA7A 4KA0A 1V2AA 1V9WA 1F3BA 4OO4A 2VL3A 1JHBA 2QA2A 3K8NA 3TOTA 3LXTA 2F9SA 3VPQA 4BL7A 2GSSA 5H5QA 1U3IA 11GSA 2KUCA 2PN8A 4L0UA 3VWVA 1FB0A 2VAFA 4NXIA 3HKRA 3KMOA 1K0OA 2C0DA 3L9VA 2ES7A 4N3ZA 2HSYA 3D6IA 3ZVJD 5D93A 4POLA 3TCOA 3FR9A 2L59A 2CVKA 2YJHA 2ALBA 4N30A 2RUEA 3ZITA 1BG1A 1U88A 5ELGA 1SU9A 5L71A 4QMKA 4WETA 1XWAA 1ZZYA 5J9CA 1X5EA 2HZEA 3CQFA 1M9AA 1ZYPA 2IFQA 3DD3A 4PNGA 2ZUPA 1MTCA 3KTBA 4NPBA 2GQKA 3E9JB 4YKFA 2A2PA 2O5VA 2R37A 2DKHA 4K9ZA 2QKEA 4ILFA 2EC4A 5LD0A 1S4BP 2VIMA 3VWXA 2HLSA 1XZOA 1M99A 2B5XA 13GSA 2AB6A 5BMUB 4NHWA 2LEGA 2WW0A 2LJAA 3DRNA 2FHEA 1A0FA 1AXDA 1ERTA 1SYRA 5C04A 2IWTA 3EPTA 2HRFA 3QR6A 2OADA 3TB2A 2DJKA 5G2ZA 3H93A 3O6TA 2QA1A 4TR1A 4IQAA 4QQ7A 2YANA 2FA8A 2R3XA 4IJ3A 2K8VA 2X49A 2K9FA 2HSNB 2I81A 2CAIA 2AV4A 4AJ8A 5IOWA 3FY7A 1PD21 2FA4A 3EC3A 1YF0A 2IL3A 2FNOA 1XVWA 5IO0A 2OE1A 4FQUA 5J47A 2IMEA 2YV9A 1SKRB 1TRWA 1TU8A 2JACA 3CRTA 3KP9A 4BPYA 1R26A 5ECHB 2R0GA 1IYHA 2OE3A 4CY8A 5FT3A 1W4VA 3IDVA 4L5LA 1QUWA 2JZSA 4XS4B 2FWHA 4K5RA 1ZOFA 3HA9A 2P31A 2O8VB 4K8MA 4TRXA 2O85A 2HYXA 5F05A 5IPGA 2GSRA 3ZREA 2GGTA 4HUAA 4OFNA 1T00A 3WT2A 4AI6A 1MDKA 1OC9A 3IAM2 1XW9A 1SKSB 3GUSA 2PBJA 1IYIA 4O92A 4LL1B 4PNFA 3LFLA 3L9UA 4MDCA 5JWOB 2DSAA 4G0KA 1GRXA 2HFDA 2C3QA 1SKWB 2YCDA 2MMNA 4JBBA 4D73A 3QFBC 1R4WA 1BG5A 8GSSA 3TGZA 4G19A 1AQXA 4CHSA 2YPMA 2WB9A 4EDYA 4H86A 2R4VA 2L4CA 3A2XA 1XW5A 1EGRA 2VCWA 1SJ6A 1WWJA 3CWGA 1GNWA 4FO5A 2LNSA 2HRKB 1AUCA 4GSTA 2XBQA 3MNGA 3WGDA 2CVBA 1Z6MA 3FYGA 3I9V2 2C80A 5IO2A 1PL1A 3F0IA 4ZB9A 3F8UA 1YDKA 1XWGA 3C1SA 1YEWC 5KOXA 3UL3A 4BL7B 3QFAC 5G30A 2FY6A 4L8EA 4V1Ap 1T3BA 2VCXA 2EIOA 4YH2A 1ERUA 4AKXB 2Z9SA 5A4UA 1GLPA 2AAWA 1QMVA 2E2MA 2LJRA 3GKMA 4K2XA 1UVZA 3TU3B 1JZRA 3IRAA 3TKSC 1LJRA 3KP8A 3VLNA 2H01A 2PUKC 3W8JA 1FW1A 4E8HA 3HZ4A 4MCUA 4JU5A 2OE0A 5B7CA 4IBPA 2H0HA 1T1VA 3HJMA 1UC7A 5B6MA 3ERGA 4Z2RA 1WJKA 4KSOA 1I5GA 2IFQB 1OVNA 5H5RA 1XG8A 1HYUA 4ID0A 1ERWA 3A2VA 1WE0A 5GSTA 3ZMLA 4FXYP 1BX9A 1YY7A 3GSSA 1O8WA 1HNBA 4POMA 3F6DA 4KCEA 2YV7A 4GRFA 3TRXA 3J7Yk 4PUFC 5G31A 4TXOA 1K0MA 1ST9A 3TKSA 2G2QA 1HNCA 3PGTA 2KP1A 1QFNA 2E7PA 2X8GA 2GT6A 1OKDA 1VF1A 3PPUA 1ACVA 4KW6A 3QAWA 3GSTA 1QK8A 2R0CA 2MMOA 3EMXA 3MWHA 1TRSA 4HSCX 2P5RA 1X9MB 4IP1A 4TR1B 2N5FA 1ABAA 1B9YC 3DEXA 1V57A 4IVFA 2WDUA 3PR8A 3HHVA 2PU9C 1PMTA 1BYEA 5IIZA 4GF0A 1TTZA 1Z3EA 2JZRA 3FZ4A 2LV3A 1VF3A 2NVLA 5IPHA 1A24A 4FH8A 2O3EA 1W89A 2FCHA 4GWRA 4PX1A 3UEMA 4OCFA 1PX6A 5HR0A 2C4JA 5DJLA 3GV1A 1UA5A 1YQ1A 1XWBA 2XBIA 1ZGNA 5J41A 3F3QA 4L0WA 4G0IA 3LWAA 3KGKA 4GQCA 2VOCA 1N25A 3CMIA 1USBA 3NIVA 2WJUA 3KXOA 5BRTA 1T8EB 5JCUA 3H4KA 4TW5A 4GCIA 1VGLA 3TJGA 2WVXB 4EDZA 2DIYA 1SVOA 1X5DA 3HCZA 1J0FA 3G7IA 4ECBA 1YKCA 4O7HA 1TI1A 5INYA 1OC9B 4EO3A 5DCGA 6GSUA 5E59A 3RFRC 3N5OA 5CRGA 1XWKA 2RM6A 4ECJA 1A8YA 1K0AA 1TW9A 22GSA 2EFCA 1XOAA 1OYJA 3C7MA 3HZ8A 1XXUA 4D73B 2O7KA 5D9VA 3CSIA 4K7IA 3MSZA 1KTEA 3LXZA 1FVKA 4MK3A 4YQMA 3C71A 5KN2A 3FZAA 2V6KA 1RQMA 3QMXA 1YEXA 4ZILA 4IKHA 1GSQA 1KBNA 3GIXA 3TRQA 4F0BA 4IHUA 5ECNB 5D9TA 2WVYA 2VUPA 3LGCA 5C00A 1EP8A 1ZYNA 2H73A 1SD9A 4KGIA 1FHEA 5HFKA 1TRUA 1GULA 1GSFA 5KN3A 5KEJA 1C72A 1XCCA 3ZZXA 2H76A 4PI0C 3EYTA 1U6TA 1JFUA 3ZFLA 2L6CA 2GSTA 1G6YA 1GTUA 3UMAA 4EL1A 4N11A 5LNKe 5EPFA 3EE2A 1PKZA 4N0ZA 1PN9A 2MZCA 5IMFA 1SK1A 4YQVA 3PH9A 3Q18A 1A2JA 2C0GA 1M2AA 4AF2A 1ILOA 4WXTA 2YN1A 3EMPA 3EINA 2AHEA 12GSA 1M9BA 2RM5A 1S3AA 1SL2B 3CRUA 5J40A 3LJRA 1B8XA 1N2AA 3BBYA 3HJOA 2N5BA 1Y1UA 1FAAA 4JEDA 1X9WB 3M0FA 3KJYA 4KCAA 6GSXA 2MBSA 3GN3A 2I9HA 3ZVJA 2WW2A 2PVOC 2VLVA 3KCMA 1EV9A 1Z6NA 4ZL8A 4TXOB 3G7JA 4O5RA 4IELA 2HT9A 4KAEA 1X0RA 6GSWA 3FEUA 5IMAA 3F4RA 1TDIA 3CTGA 4ML6A 3GMFA 2MBTA 2L5LA 3VWUA 3L4NA 1CQGA 3I6AA 5D73A 4DSSA 5A4VA 3DWVA 3GKKA 2HRAA 4EIPA 2PWJA 4EE0A 2JU5A 4MZBA 4WR4A 2B3SA 1QXHA 2E2GA 3C1RA 1WPIA 1Y6EA 5IQYA 4OD7A 2YZHA 4E68A 1VF2A 1BF5A 1WOUA 3KZQA 2J9HA 2OBKA 1ML6A 1PKWA 4PURA 3C73A 2HQTA 4G9HA 4PGTA 3M8NA 3IHQA 5D96A 2IMKA 1S3CA 1B4QA 1NSWA 2JSYA 1YF1A 2LRCA 3P8WA 4HJMA 2OT3A 4EC0A 4I2TA 2GQLA 3GKXA 4NHZA 3QDNA 2NPBA 1GWCA 4N0VA 4WF4A 2IIYA 1YJ6A 3P2AA 4Q5RA 1YZXA 3UOMA 4O32A 1GP1A 2DJ3A 4IS0A 4NWYA 2H1DA 5EVOA 4BIKA
chains in the Genus database with same CATH topology
5E4WA 1EZKA 4DVCA 2QGVA 5HFGA 2EFDA 3GH9A 4IW9A 1DUGA 1N8JA 2NDOA 3A2WA 5G1KA 2OA7A 3IXRA 5CP1A 4Q5QA 9GSSA 4ZXGA 3F3RA 2JADA 5A34A 3APQA 5ID2A 2M72A 4F82A 5EY6A 1I9DA 2I4AA 2I3YA 4PTSA 4Z2TA 5ECKB 2OACA 1WMJA 4AJ6A 4V1Ag 3WT1A 1K0DA 2M80A 2HZFA 2O89A 4HQZA 5J9BA 5ECPB 3TJBA 4Q5NA 4X43A 2B7KA 1MEKA 5G1LA 1EOGA 4MF5A 4JRRA 4HDEA 6GSTA 3L0HA 2IMIA 5J3RA 4KE3A 1TK0B 5ELAA 4JR6A 3IE3A 2H75A 4RQXA 4MJCA 3FZ9A 2H0IA 2DMMA 3GURA 1O85A 4MF7A 5CRDA 3DIEA 1AC1A 4FYBA 4CW9A 3LG6A 3J7Yb 2EFEA 2FWEA 1M2BA 3DVXA 5DAKA 4ACSA 3IV4A 3JCML 2TRCP 4KDXA 1O81A 3ZIVA 2C1YA 4MJAA 2YWNA 2H30A 2HE3A 3LQ7A 1TOFA 3APSA 4G2EA 5DVBA 1Z9HA 3D4MA 4J57E 1K0CA 4ZBBA 4NAXA 1PGTA 2LRTA 5AN1A 3UIWA 5IMVA 1VRSD 3OR5A 2KP2A 3I69A 1QGVA 3A5WA 2CVDA 1QQ2A 2JSZA 2CA8A 4Z7XA 1JLWA 1S3DA 4AKIA 3APOA 4XRDA 4ZB8A 1Q4JA 4KDUA 2VLUA 4HEA2 5EL8A 3L9SA 3C8EA 4AKGA 3G7YA 1V98A 4YKGA 2IPAA 2YNXA 3KMNA 5J4VA 4P3YB 1Q98A 4BVYA 1G7EA 3IK9A 4GXZA 2OKAA 2XHFA 2PGTA 3UJ1A 3HY2A 1A8LA 1GLQA 3FR3A 6GSYA 3RHCA 4DSSB 4YAVA 2YOIA 2ON7A 1AIUA 1MDIA 3PINA 5HR1A 3O76A 4OCEA 2PVQA 4W66A 3M3MA 1PRXA 3W6GA 2WGRA 1XPVA 3D5JA 2RUFA 2MMZA 4GLTA 3KIJA 4G10A 1AAZA 6GSSA 3BCIA 4HU9A 1DE2A 2LKUA 3ERWA 5GAPD 2VL2C 3WYWA 1TJDA 3ZRDA 4TVEA 4QL9A 5CRHA 1XVQA 4MABA 3CXGA 3NZNA 2H6ZA 3TDGA 5HR2A 2CQ9A 2WCIA 1PQNA 2L57A 1R5PA 2K18A 3GX8A 1TRVA 2O87A 4ZL9A 2ZNMA 3AY8A 2TRXA 2H74A 5A1NA 3N9JA 1EWXA 3BJ5A 3IHGA 4ECIA 3E0UA 1ZCPA 1RW1A 2LS5A 3DMLA 3FMWA 4TR3A 1GSUA 3V1WA 2IMFA 4TR4A 2VL2A 1FO5A 1T4YA 4NV2A 3TJKA 4TN8A 5ENUA 3G9BA 3FK8A 1ERVA 5F8BA 2BTOT 4IN0A 4POKA 3UBLA 2LJKA 4X1UA 5A34B 5ID2B 2R5GA 4USSA 3BOAA 5ECRB 5HQPA 4ZB6A 3F6FA 4K6XA 1A2LA 3HDCA 1O6JA 3DVWA 1FOVA 4ECCA 4J2FA 2B7JA 3LEFA 2F8FA 3IAS2 1F3AA 3CBUA 2KHPA 1M0UA 4K7NA 4Z2UA 2VLTA 2GDRA 4ICYA 3FW2A 2H1AA 4MP4A 2K6VA 2BMXA 3IPZA 1FVJA 1YVLA 4K5SA 4GDFA 1KEBA 3ZFBA 2LQQA 2LRNA 1OE7A 2VCZA 4GSNA 5ECLB 5IMZA 2CX3A 1YEPA 4NMUA 2HNLA 3D21A 4GQFA 5DQYA 1BAYA 5DAKB 4N10A 1EEJA 3QOUA 3UVHA 3E3EA 2AJQB 3HVVA 2PMTA 2C0FA 5B8AA 1MD3A 2C3TA 3KM6A 1PSQA 4KB3A 2ZCTA 4K0GA 3KD0A 4MF6A 1T4ZA 3IC4A 1TK8B 2PERA 1SL0B 1GSEA 4EKZA 2M46A 1M2DA 4OFTA 3ZIJA 3IBHA 4XCSA 2DIZA 2JZTA 2B6MA 3HD5A 4BWSA 1DSBA 2FWGA 2PPTA 2DKIA 1PA3A 5A5KA 2WZ9A 1GH2A 4MH2A 5AISA 4GTUA 2WS2A 3ZTLA 2B1LA 5A4WA 2CV4A 3ED3A 4O5QA 3VPTA 2L4QA 1K3YA 4MH3A 4ZBAA 1WP0A 4BVYB 1Y25A 2FGXA 4MLYA 2EIRA 5D9WA 3EWLA 4POBA 3GL5A 4TR0A 1M7TA 2X8HA 4EXJA 1R7HA 4MZCA 1A2MA 2VCVA 1SVLA 2L5OA 2VM2A 4ML1A 1JZOA 1J08A 4HS1A 5ECIB 4FYCA 1HD2A 4IQ1A 1V58A 2XPDA 4LA1A 5ECQB 1OC8A 1Z5YE 2GVPA 2WULA 2H70A 3GL3A 4KX4A 4I5QA 1EEMA 2DJJA 4HQSA 2D2ZA 3H1NA 4F9ZA 3TUEA 2VM1A 2X99A 3ZMKA 3US3A 1HQOA 4AKHA 3QCPA 2DC5A 3TOUA 2VD1A 6GSVA 1PX7A 3A5IA 4ZB7A 3KTLA 2HSMA 1HNAA 2YWOA 3DKSA 2V6OA 2H1BA 2IJYA 4WEYA 1DE1A 5F06A 1U87A 2YWIA 5HFIA 3QAVA 3QPMA 1EV4A 3CTFA 2RIIA 3H8QA 3P7XA 1URMA 2NTOA 1JLVA 4YAPA 2NBSA 17GSA 5A1NB 3IK7A 1F37A 2CZ2A 2VO4A 2X4AA 2LSTA 3RPNA 4JZQA 3HYPA 1DBYA 4HZ4A 4XS1A 5GZZB 1SYXA 1GSDA 4F2IA 5GAND 5F07A 4MPGA 1EOHA 1TI3A 4PXOA 1F9MA 1PN0A 3I43A 2E0QA 2CT6A 4IGJA 1CQHA 5JCWA 4HOJA 3QD9A 14GSA 2EFHA 3BD2A 1G6WA 3HJPA 5CYYA 4I6XA 3D0ZA 2N5AA 4WF5A 4V2LA 1X9SB 4AGSA 4GSSA 5DBQA 5FHIA 5ABRA 2P5QA 2FWFA 2G0FA 1K0NA 2X8CA 3D4TA 4HJ2A 3CSHA 4MMMA 4PUAA 3Q6OA 3EU4A 2IN3A 2VCTA 2R0PA 5KN1A 4HZ2A 2F8AA 3R3EA 4J56E 4BWQA 4NV5A 4XTSA 2V32A 4TXVA 2C0EA 4OWYA 18GSA 4I2UA 1OAZA 4LMWA 20GSA 3P90A 3FKFA 4WKWA 3LORA 5G5EA 2V1MA 3ZL5A 3GTUA 2KLXA 5J4UA 3WGEA 1OC3A 3S9FA 1AQVA 1XBSA 3H79A 2A4HA 4MZWA 4OFMA 5IM9A 1YKAA 5DDLA 2GTUA 1OKTA 2J23A 4MJEA 4LMVA 2KOKA 5IMCA 3LSZA 2GZPA 5CRWA 1WIKA 3DXBA 2CZ3A 4LLRA 2F51A 2ON5A 4O5UA 3Q74A 3MDKA 2VD0A 1AW9A 1EGOA 1BQ7A 5AIXA 3RDWA 2WFCA 2H72A 3UARA 4FIWA 4BVXA 3BCKA 5A5HA 3FR6A 3O3TA 1K0BA 3QAGA 1XW6A 3RPPA 5IOXA 5G5FA 4RUVA 5ECOB 1FOHA 3WD6A 1BJXA 2GT5A 4RI6A 4EUYA 2BJXA 2FD3A 1MDJA 4DSQA 3RAZA 2H8LA 2FLSA 3SWLA 2H6XA 1A23A 1H75A 2GQMA 3CYNA 1B4PA 4MJBA 3Q19A 5ECSA 1G7OA 3KH9A 5ECMB 19GSA 2MMAA 1ZL9A 5DALB 2CX4A 1SVMA 3TRPA 3EURA 2A2RA 4CY6A 4XS6A 1NM3A 1THOA 1U3AA 2L6DA 1GTAA 3VWWA 4WBJA 5KOWA 4LL4B 5H5SA 3VURA 2H66A 2VL9A 1FG4A 5B6NA 3ERFA 3ZLPA 5F0GA 1XWCA 1O73A 3ME7A 3UAPA 3FHKA 3F4SA 4F0CA 2WRTA 2HSMB 5LCZA 3HXSA 1R5AA 4AJ7A 2H1LA 2AUVA 3EU3A 2DJ1A 3U6VA 4EIQA 4HI7A 4KDYA 3F4TA 1SENA 3VFIA 4EVMA 1T7PB 4V2NA 5CNWA 4MNNA 1LU4A 1B9XC 1A0RP 1H4OA 2YZUA 2GSQA 1THXA 3HVSA 2LNTA 2GS3A 5DJMA 3IR4A 5B8BA 1SL1B 4F03A 3FRCA 4RQRA 4X0XA 2YP6A 1EP7A 2P0GA 4E8EA 5J5NA 1KNGA 1XOBA 4TKYA 3VI5A 3GFKA 5IMDA 3DYRA 3F9UA 2X64A 2HZEB 1FB6A 3M9KA 4OO5A 4XRAA 2V2GA 2R6KA 1SJZA 1RK4A 3WGXA 3SBCA 5HR3A 1NHOA 16GSA 4G0LA 4K0NA 3RBTA 2XC2A 3LYKA 4DEJA 2MYGA 2LTKA 1F2EA 4XIHA 3U5RE 1JZWA 3NOFA 4XHMA 3GX0A 1GNEA 1K3OA 10GSA 1MD4A 4KH7A 1G0TA 7GSSA 2OJLA 5JWRB 1B48A 4WBRD 3VK9A 3MIXA 1TXXA 2HSHA 3GTUB 4KUNA 1ZYEA 5CREA 1NW2A 2C8UA 2K8SA 2TIRA 2UZ8A 4ULXA 5J4YA 2YJ7A 2JL4A 3ISOA 2H1GA 1X5CA 1GSYA 1GL8A 5JCGA 1Z7PA 2A4VA 4PQ1A 1JZDA 4MA9A 2VCQA 3MAKA 1GUMA 4IP6A 3IA1A 5GSSA 2VKZG 1Z7RA 2DLXA 2XPEA 4IJIA 1BEDA 2GLRA 4BVXB 4K2DA 4KNDA 4MPFA 4TOPA 5A5HB 4K7OA 5AIVA 1ZMAA 4FYUA 4L5OA 3GKNA 1LBKA 4WR5A 1NHYA 2B5EA 4JR4A 5BMUA 2HI7A 2H19A 3A3TA 4ZBDA 1O8XA 3M9JA 1TXUA 4OMVA 3EVIA 1GTIA 4I97A 4QL7A 1ZYQB 2H6YA 5FWGA 5DCHA 3RHBA 5JWQB 3M1GA 2B5YA 2H71A 3D22A 2UV8G 3KH7A 4I8BA 1SK2A 2YWMA 1GUKA 1O7UA 5AGYA 3TKPA 4PQIA 3DGQA 2GZZA 2IMDA 5KN0A 2GZYA 3R2QA 3GNJA 2HSNA 3LYPA 4DSRA 1GTBA 2DJ2A 1E2YA 2HRNA 4YQUA 2REMA 5D8IA 1V40A 2H0GA 1TU7A 3L78A 1GUHA 1VF4A 3FZ5A 3TKRA 2DMLA 3CSJA 1SK0A 1XIYA 4EF0A 1K3LA 1WRYA 4CDOA 3HMJG 2FUG2 4G01A 3IOSA 3GH6A 3TJJA 1GSSA 3LW9A 1TK5B 4ZIJA 1J9BA 4K1FA 4Q5FA 3TKSE 3GHAA 4XS4A 5CAXA 4RI7A 2A2SA 3HVXA 2F3MA 2HXKA 3TKQA 1OE8A 3W8SA 1TP9A 2LUSA 3GYKA 2CAQA 1PL2A 3MYDA 5DALA 2EIQA 3F63A 3ZYWA 3IC8A 5COHA 2V41A 4JE1A 1E6BA 4KSMA 4X4JA 4V2MA 2OBIA 2I1UA 2AYTA 3ME8A 3UBKA 1AQWA 2R2JA 2RLIA 3GA4A 2C3NA 4ISDA 1SJIA 4KF9A 2DJ0A 2LQOA 1SD8A 3UVTA 2QC7A 4A5PA 4HU7A 2DBCA 4PQHA 4ZL7A 5DQSA 2HRKA 2B1KA 1F6MC 1ON4A 1TKDB 5CO3A 5D9XA 3GRXA 3VI7A 2QSIA 3KEBA 1UN2A 1XFLA 3TJFA 4BA7A 4KA0A 1V2AA 1V9WA 1F3BA 4OO4A 2VL3A 1JHBA 2QA2A 3K8NA 3TOTA 3LXTA 2F9SA 3VPQA 4BL7A 2GSSA 5H5QA 1U3IA 11GSA 2KUCA 2PN8A 4L0UA 3VWVA 1FB0A 2VAFA 4NXIA 3HKRA 3KMOA 1K0OA 2C0DA 3L9VA 2ES7A 4N3ZA 2HSYA 3D6IA 3ZVJD 5D93A 4POLA 3TCOA 3FR9A 2L59A 2CVKA 2YJHA 2ALBA 4N30A 2RUEA 3ZITA 1BG1A 1U88A 5ELGA 1SU9A 5L71A 4QMKA 4WETA 1XWAA 1ZZYA 5J9CA 1X5EA 2HZEA 1M9AA 1ZYPA 2IFQA 3DD3A 4PNGA 2ZUPA 1MTCA 3KTBA 4NPBA 2GQKA 3E9JB 4YKFA 2A2PA 2O5VA 2R37A 2DKHA 4K9ZA 2QKEA 4ILFA 2EC4A 5LD0A 2VIMA 3VWXA 2HLSA 1XZOA 1M99A 2B5XA 13GSA 2AB6A 5BMUB 4NHWA 2LEGA 2LJAA 3DRNA 2FHEA 1A0FA 1AXDA 1ERTA 1SYRA 5C04A 2IWTA 3EPTA 2HRFA 3QR6A 2OADA 3TB2A 2DJKA 5G2ZA 3H93A 3O6TA 2QA1A 4TR1A 4IQAA 4QQ7A 2YANA 2FA8A 2R3XA 4IJ3A 2K8VA 2X49A 2K9FA 2HSNB 2I81A 2CAIA 2AV4A 4AJ8A 5IOWA 3FY7A 1PD21 2FA4A 3EC3A 1YF0A 2IL3A 2FNOA 1XVWA 5IO0A 2OE1A 4FQUA 5J47A 2IMEA 2YV9A 1SKRB 1TRWA 1TU8A 2JACA 3CRTA 3KP9A 4BPYA 1R26A 5ECHB 2R0GA 1IYHA 2OE3A 4CY8A 5FT3A 1W4VA 3IDVA 4L5LA 1QUWA 2JZSA 4XS4B 2FWHA 4K5RA 1ZOFA 3HA9A 2P31A 2O8VB 4K8MA 4TRXA 2O85A 2HYXA 5F05A 5IPGA 2GSRA 3ZREA 2GGTA 4HUAA 4OFNA 1T00A 3WT2A 4AI6A 1MDKA 1OC9A 3IAM2 1XW9A 1SKSB 3GUSA 2PBJA 1IYIA 4O92A 4LL1B 4PNFA 3LFLA 3L9UA 4MDCA 5JWOB 2DSAA 4G0KA 1GRXA 2HFDA 2C3QA 1SKWB 2YCDA 2MMNA 4JBBA 4D73A 3QFBC 1R4WA 1BG5A 8GSSA 3TGZA 4G19A 1AQXA 4CHSA 2YPMA 2WB9A 4EDYA 4H86A 2R4VA 2L4CA 3A2XA 1XW5A 1EGRA 2VCWA 1SJ6A 1WWJA 3CWGA 1GNWA 4FO5A 2LNSA 2HRKB 1AUCA 4GSTA 3MNGA 2XBQA 3WGDA 2CVBA 1Z6MA 3FYGA 3I9V2 2C80A 5IO2A 1PL1A 3F0IA 4ZB9A 3F8UA 1YDKA 1XWGA 3C1SA 5KOXA 3UL3A 4BL7B 3QFAC 5G30A 2FY6A 4L8EA 4V1Ap 1T3BA 2VCXA 2EIOA 4YH2A 1ERUA 4AKXB 2Z9SA 5A4UA 1GLPA 2AAWA 1QMVA 2E2MA 2LJRA 3GKMA 4K2XA 1UVZA 3TU3B 1JZRA 3IRAA 3TKSC 1LJRA 3KP8A 3VLNA 2H01A 2PUKC 3W8JA 1FW1A 4E8HA 3HZ4A 4MCUA 4JU5A 2OE0A 5B7CA 4IBPA 2H0HA 1T1VA 3HJMA 1UC7A 5B6MA 3ERGA 4Z2RA 1WJKA 4KSOA 1I5GA 2IFQB 1OVNA 5H5RA 1HYUA 4ID0A 1ERWA 3A2VA 1WE0A 5GSTA 3ZMLA 1BX9A 1YY7A 3GSSA 1O8WA 1HNBA 4POMA 3F6DA 4KCEA 2YV7A 4GRFA 3TRXA 3J7Yk 4PUFC 5G31A 4TXOA 1K0MA 1ST9A 3TKSA 2G2QA 1HNCA 3PGTA 2KP1A 1QFNA 2E7PA 2X8GA 2GT6A 1OKDA 1VF1A 3PPUA 1ACVA 4KW6A 3QAWA 3GSTA 1QK8A 2R0CA 2MMOA 3EMXA 3MWHA 1TRSA 1X9MB 2P5RA 4IP1A 4TR1B 2N5FA 1ABAA 1B9YC 3DEXA 1V57A 4IVFA 2WDUA 3PR8A 3HHVA 2PU9C 1PMTA 1BYEA 5IIZA 4GF0A 1TTZA 1Z3EA 2JZRA 3FZ4A 2LV3A 1VF3A 2NVLA 5IPHA 1A24A 4FH8A 1W89A 2FCHA 4GWRA 4PX1A 3UEMA 4OCFA 1PX6A 5HR0A 2C4JA 5DJLA 3GV1A 1UA5A 1YQ1A 1XWBA 2XBIA 1ZGNA 5J41A 3F3QA 4L0WA 4G0IA 3LWAA 3KGKA 4GQCA 2VOCA 1N25A 3CMIA 1USBA 3NIVA 2WJUA 3KXOA 5BRTA 1T8EB 5JCUA 3H4KA 4TW5A 4GCIA 1VGLA 3TJGA 4EDZA 2DIYA 1SVOA 1X5DA 3HCZA 1J0FA 3G7IA 4ECBA 1YKCA 4O7HA 1TI1A 5INYA 1OC9B 4EO3A 5DCGA 6GSUA 5E59A 3N5OA 5CRGA 1XWKA 2RM6A 4ECJA 1A8YA 1K0AA 1TW9A 22GSA 2EFCA 1XOAA 1OYJA 3C7MA 3HZ8A 1XXUA 4D73B 2O7KA 5D9VA 3CSIA 4K7IA 3MSZA 1KTEA 3LXZA 1FVKA 4MK3A 4YQMA 3C71A 5KN2A 3FZAA 2V6KA 1RQMA 3QMXA 1YEXA 4ZILA 4IKHA 1GSQA 1KBNA 3GIXA 3TRQA 4F0BA 4IHUA 5ECNB 5D9TA 2VUPA 3LGCA 5C00A 1EP8A 1ZYNA 2H73A 1SD9A 4KGIA 1FHEA 5HFKA 1TRUA 1GULA 1GSFA 5KN3A 5KEJA 1C72A 1XCCA 3ZZXA 2H76A 3EYTA 1U6TA 1JFUA 3ZFLA 2L6CA 2GSTA 1G6YA 1GTUA 3UMAA 4EL1A 4N11A 5LNKe 5EPFA 3EE2A 1PKZA 4N0ZA 1PN9A 2MZCA 5IMFA 1SK1A 4YQVA 3PH9A 3Q18A 1A2JA 2C0GA 1M2AA 4AF2A 1ILOA 4WXTA 2YN1A 3EMPA 3EINA 2AHEA 12GSA 1M9BA 2RM5A 1S3AA 1SL2B 3CRUA 5J40A 3LJRA 1B8XA 1N2AA 3BBYA 3HJOA 2N5BA 1Y1UA 1FAAA 4JEDA 1X9WB 3M0FA 3KJYA 4KCAA 6GSXA 2MBSA 3GN3A 2I9HA 3ZVJA 2PVOC 2VLVA 3KCMA 1EV9A 1Z6NA 4ZL8A 4TXOB 3G7JA 4O5RA 4IELA 2HT9A 4KAEA 1X0RA 6GSWA 3FEUA 5IMAA 3F4RA 1TDIA 3CTGA 4ML6A 3GMFA 2MBTA 2L5LA 3VWUA 3L4NA 1CQGA 3I6AA 5D73A 4DSSA 5A4VA 3DWVA 3GKKA 2HRAA 4EIPA 2PWJA 4EE0A 2JU5A 4MZBA 4WR4A 2B3SA 1QXHA 2E2GA 3C1RA 1WPIA 1Y6EA 5IQYA 4OD7A 2YZHA 4E68A 1VF2A 1BF5A 1WOUA 3KZQA 2J9HA 2OBKA 1ML6A 1PKWA 4PURA 3C73A 2HQTA 4G9HA 4PGTA 3M8NA 3IHQA 5D96A 2IMKA 1S3CA 1B4QA 1NSWA 2JSYA 1YF1A 2LRCA 3P8WA 4HJMA 2OT3A 4EC0A 4I2TA 2GQLA 3GKXA 4NHZA 3QDNA 2NPBA 1GWCA 4N0VA 4WF4A 2IIYA 1YJ6A 3P2AA 4Q5RA 1YZXA 3UOMA 4O32A 1GP1A 2DJ3A 4IS0A 4NWYA 2H1DA 5EVOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E4W A;  1EZK A;  4DVC A;  2QGV A;  5HFG A;  3GH9 A;  4IW9 A;  1DUG A;  1N8J A;  2NDO A;  3A2W A;  5G1K A;  2OA7 A;  3IXR A;  5CP1 A;  4Q5Q A;  9GSS A;  4ZXG A;  3F3R A;  2JAD A;  3APQ A;  5ID2 A;  2M72 A;  4F82 A;  5EY6 A;  1I9D A;  2I4A A;  2I3Y A;  4PTS A;  5ECK B;  2OAC A;  1WMJ A;  4AJ6 A;  4V1A g;  3WT1 A;  1K0D A;  2M80 A;  2HZF A;  2O89 A;  4HQZ A;  5J9B A;  5ECP B;  3TJB A;  4Q5N A;  4X43 A;  2B7K A;  1MEK A;  5G1L A;  1EOG A;  4MF5 A;  4JRR A;  4HDE A;  6GST A;  3L0H A;  2IMI A;  5J3R A;  4KE3 A;  1TK0 B;  5ELA A;  4JR6 A;  3IE3 A;  2H75 A;  4RQX A;  4MJC A;  3FZ9 A;  2H0I A;  2DMM A;  3GUR A;  1O85 A;  4MF7 A;  5CRD A;  3DIE A;  1AC1 A;  4FYB A;  4CW9 A;  3LG6 A;  3J7Y b;  2FWE A;  1M2B A;  3DVX A;  5DAK A;  4ACS A;  3IV4 A;  3JCM L;  2TRC P;  4KDX A;  1O81 A;  3ZIV A;  2C1Y A;  4MJA A;  2YWN A;  2H30 A;  2HE3 A;  3LQ7 A;  1TOF A;  3APS A;  4G2E A;  5DVB A;  1Z9H A;  3D4M A;  4J57 E;  1K0C A;  4ZBB A;  4NAX A;  1PGT A;  2LRT A;  5AN1 A;  3UIW A;  5IMV A;  1VRS D;  3OR5 A;  2KP2 A;  3I69 A;  1QGV A;  3A5W A;  2CVD A;  1QQ2 A;  2JSZ A;  2CA8 A;  4Z7X A;  1JLW A;  1S3D A;  3APO A;  4XRD A;  4ZB8 A;  1Q4J A;  4KDU A;  2VLU A;  4HEA 2;  5EL8 A;  3L9S A;  3C8E A;  3G7Y A;  1V98 A;  2IPA A;  2YNX A;  3KMN A;  4P3Y B;  1Q98 A;  4BVY A;  1G7E A;  3IK9 A;  4GXZ A;  2OKA A;  2XHF A;  2PGT A;  3UJ1 A;  3HY2 A;  1A8L A;  1GLQ A;  3FR3 A;  6GSY A;  3RHC A;  4DSS B;  4YAV A;  2YOI A;  2ON7 A;  1AIU A;  1MDI A;  3PIN A;  5HR1 A;  3O76 A;  4OCE A;  2PVQ A;  3M3M A;  1PRX A;  3W6G A;  2WGR A;  1XPV A;  3D5J A;  2RUF A;  2MMZ A;  4GLT A;  3KIJ A;  4G10 A;  1AAZ A;  6GSS A;  3BCI A;  4HU9 A;  1DE2 A;  2LKU A;  3ERW A;  5GAP D;  2VL2 C;  3WYW A;  1TJD A;  3ZRD A;  4TVE A;  4QL9 A;  5CRH A;  1XVQ A;  4MAB A;  3CXG A;  3NZN A;  2H6Z A;  3TDG A;  5HR2 A;  2CQ9 A;  2WCI A;  1PQN A;  2L57 A;  1R5P A;  2K18 A;  3GX8 A;  1TRV A;  2O87 A;  4ZL9 A;  2ZNM A;  3AY8 A;  2TRX A;  2H74 A;  3N9J A;  1EWX A;  3BJ5 A;  4ECI A;  3E0U A;  1ZCP A;  1RW1 A;  2LS5 A;  3DML A;  4TR3 A;  1GSU A;  3V1W A;  2IMF A;  4TR4 A;  2VL2 A;  1FO5 A;  1T4Y A;  4NV2 A;  3TJK A;  4TN8 A;  5ENU A;  3G9B A;  3FK8 A;  1ERV A;  5F8B A;  2BTO T;  4IN0 A;  4POK A;  3UBL A;  2LJK A;  4X1U A;  5ID2 B;  2R5G A;  4USS A;  3BOA A;  5ECR B;  5HQP A;  4ZB6 A;  3F6F A;  4K6X A;  1A2L A;  3HDC A;  1O6J A;  3DVW A;  1FOV A;  4ECC A;  4J2F A;  2B7J A;  3LEF A;  2F8F A;  3IAS 2;  1F3A A;  3CBU A;  2KHP A;  1M0U A;  4K7N A;  2VLT A;  2GDR A;  3FW2 A;  2H1A A;  4MP4 A;  2K6V A;  2BMX A;  3IPZ A;  1FVJ A;  1KEB A;  3ZFB A;  2LQQ A;  2LRN A;  1OE7 A;  2VCZ A;  4GSN A;  5ECL B;  5IMZ A;  2CX3 A;  1YEP A;  4NMU A;  2HNL A;  3D21 A;  4GQF A;  5DQY A;  1BAY A;  5DAK B;  4N10 A;  1EEJ A;  3QOU A;  3UVH A;  3E3E A;  2AJQ B;  3HVV A;  2PMT A;  2C0F A;  5B8A A;  1MD3 A;  2C3T A;  3KM6 A;  1PSQ A;  4KB3 A;  2ZCT A;  4K0G A;  3KD0 A;  4MF6 A;  1T4Z A;  3IC4 A;  1TK8 B;  2PER A;  1SL0 B;  1GSE A;  4EKZ A;  2M46 A;  1M2D A;  4OFT A;  3ZIJ A;  3IBH A;  4XCS A;  2DIZ A;  2JZT A;  2B6M A;  3HD5 A;  4BWS A;  1DSB A;  2FWG A;  2PPT A;  1PA3 A;  5A5K A;  2WZ9 A;  1GH2 A;  4MH2 A;  5AIS A;  4GTU A;  2WS2 A;  3ZTL A;  2B1L A;  5A4W A;  2CV4 A;  3ED3 A;  3VPT A;  2L4Q A;  1K3Y A;  4MH3 A;  4ZBA A;  1WP0 A;  4BVY B;  1Y25 A;  2FGX A;  4MLY A;  2EIR A;  5D9W A;  3EWL A;  4POB A;  3GL5 A;  4TR0 A;  1M7T A;  2X8H A;  4EXJ A;  1R7H A;  4MZC A;  1A2M A;  2VCV A;  2VM2 A;  2L5O A;  4ML1 A;  1JZO A;  1J08 A;  4HS1 A;  5ECI B;  4FYC A;  1HD2 A;  4IQ1 A;  1V58 A;  2XPD A;  4LA1 A;  5ECQ B;  1OC8 A;  1Z5Y E;  2GVP A;  2WUL A;  2H70 A;  3GL3 A;  4KX4 A;  4I5Q A;  1EEM A;  2DJJ A;  4HQS A;  2D2Z A;  3H1N A;  4F9Z A;  3TUE A;  2VM1 A;  2X99 A;  3ZMK A;  3US3 A;  1HQO A;  3QCP A;  2DC5 A;  3TOU A;  2VD1 A;  6GSV A;  1PX7 A;  3KTL A;  2HSM A;  1HNA A;  2YWO A;  3DKS A;  2V6O A;  2H1B A;  2IJY A;  4WEY A;  1DE1 A;  5F06 A;  1U87 A;  2YWI A;  5HFI A;  3QAV A;  3QPM A;  1EV4 A;  3CTF A;  2RII A;  3H8Q A;  3P7X A;  1URM A;  2NTO A;  1JLV A;  4YAP A;  2NBS A;  17GS A;  3IK7 A;  1F37 A;  2CZ2 A;  2VO4 A;  2LST A;  3RPN A;  4JZQ A;  3HYP A;  1DBY A;  4HZ4 A;  4XS1 A;  5GZZ B;  1SYX A;  1GSD A;  4F2I A;  5GAN D;  5F07 A;  4MPG A;  1EOH A;  1TI3 A;  4PXO A;  1F9M A;  3I43 A;  2E0Q A;  2CT6 A;  4IGJ A;  1CQH A;  5JCW A;  4HOJ A;  3QD9 A;  14GS A;  3BD2 A;  1G6W A;  3HJP A;  5CYY A;  4I6X A;  3D0Z A;  2N5A A;  4WF5 A;  4V2L A;  1X9S B;  4AGS A;  4GSS A;  5DBQ A;  5FHI A;  5ABR A;  2P5Q A;  2FWF A;  2G0F A;  1K0N A;  2X8C A;  3D4T A;  4HJ2 A;  3CSH A;  4MMM A;  4PUA A;  3Q6O A;  3EU4 A;  2IN3 A;  2VCT A;  5KN1 A;  4HZ2 A;  2F8A A;  3R3E A;  4J56 E;  4BWQ A;  4NV5 A;  4XTS A;  2V32 A;  4TXV A;  2C0E A;  4OWY A;  18GS A;  4I2U A;  1OAZ A;  4LMW A;  20GS A;  3P90 A;  3FKF A;  4WKW A;  3LOR A;  5G5E A;  2V1M A;  3ZL5 A;  3GTU A;  2KLX A;  5J4U A;  3WGE A;  1OC3 A;  3S9F A;  1AQV A;  1XBS A;  3H79 A;  4MZW A;  4OFM A;  5IM9 A;  1YKA A;  5DDL A;  2GTU A;  1OKT A;  2J23 A;  4MJE A;  4LMV A;  2KOK A;  5IMC A;  3LSZ A;  2GZP A;  5CRW A;  1WIK A;  3DXB A;  2CZ3 A;  4LLR A;  2F51 A;  2ON5 A;  3Q74 A;  3MDK A;  2VD0 A;  1AW9 A;  1EGO A;  1BQ7 A;  5AIX A;  3RDW A;  2WFC A;  2H72 A;  3UAR A;  4FIW A;  4BVX A;  3BCK A;  3FR6 A;  3O3T A;  1K0B A;  3QAG A;  1XW6 A;  3RPP A;  5IOX A;  5G5F A;  4RUV A;  5ECO B;  3WD6 A;  1BJX A;  2GT5 A;  4RI6 A;  4EUY A;  2BJX A;  2FD3 A;  1MDJ A;  4DSQ A;  3RAZ A;  2H8L A;  2FLS A;  3SWL A;  2H6X A;  1A23 A;  1H75 A;  2GQM A;  3CYN A;  1B4P A;  4MJB A;  3Q19 A;  5ECS A;  1G7O A;  3KH9 A;  5ECM B;  19GS A;  2MMA A;  1ZL9 A;  5DAL B;  2CX4 A;  3TRP A;  3EUR A;  2A2R A;  4XS6 A;  1NM3 A;  1THO A;  1U3A A;  2L6D A;  1GTA A;  3VWW A;  4WBJ A;  4LL4 B;  5H5S A;  3VUR A;  2H66 A;  2VL9 A;  1FG4 A;  5B6N A;  3ERF A;  3ZLP A;  5F0G A;  1XWC A;  1O73 A;  3ME7 A;  3UAP A;  3FHK A;  3F4S A;  4F0C A;  2WRT A;  2HSM B;  5LCZ A;  3HXS A;  1R5A A;  4AJ7 A;  2AUV A;  3EU3 A;  2DJ1 A;  3U6V A;  4HI7 A;  4KDY A;  3F4T A;  1SEN A;  3VFI A;  4EVM A;  1T7P B;  4V2N A;  5CNW A;  1LU4 A;  1B9X C;  1A0R P;  1H4O A;  2YZU A;  2GSQ A;  1THX A;  3HVS A;  2LNT A;  2GS3 A;  5DJM A;  3IR4 A;  5B8B A;  1SL1 B;  4F03 A;  3FRC A;  4RQR A;  4X0X A;  2YP6 A;  1EP7 A;  2P0G A;  4E8E A;  5J5N A;  1KNG A;  1XOB A;  4TKY A;  3VI5 A;  3GFK A;  5IMD A;  3DYR A;  3F9U A;  2X64 A;  2HZE B;  1FB6 A;  3M9K A;  4OO5 A;  4XRA A;  2V2G A;  2R6K A;  1SJZ A;  1RK4 A;  3WGX A;  3SBC A;  5HR3 A;  1NHO A;  16GS A;  4G0L A;  4K0N A;  3RBT A;  2XC2 A;  3LYK A;  4DEJ A;  2MYG A;  2LTK A;  1F2E A;  4XIH A;  3U5R E;  1JZW A;  3NOF A;  4XHM A;  3GX0 A;  1GNE A;  1K3O A;  10GS A;  1MD4 A;  4KH7 A;  1G0T A;  7GSS A;  2OJL A;  5JWR B;  1B48 A;  4WBR D;  3VK9 A;  1TXX A;  2HSH A;  3GTU B;  4KUN A;  1ZYE A;  5CRE A;  1NW2 A;  2C8U A;  2K8S A;  2TIR A;  2UZ8 A;  4ULX A;  2YJ7 A;  2JL4 A;  3ISO A;  2H1G A;  1X5C A;  1GSY A;  1GL8 A;  5JCG A;  1Z7P A;  2A4V A;  4PQ1 A;  1JZD A;  4MA9 A;  2VCQ A;  3MAK A;  1GUM A;  4IP6 A;  3IA1 A;  5GSS A;  1Z7R A;  2DLX A;  2XPE A;  4IJI A;  1BED A;  2GLR A;  4BVX B;  4K2D A;  4KND A;  4MPF A;  4TOP A;  4K7O A;  5AIV A;  1ZMA A;  4FYU A;  4L5O A;  3GKN A;  1LBK A;  4WR5 A;  1NHY A;  2B5E A;  4JR4 A;  5BMU A;  2HI7 A;  2H19 A;  3A3T A;  4ZBD A;  1O8X A;  3M9J A;  4OMV A;  3EVI A;  1GTI A;  4I97 A;  4QL7 A;  1ZYQ B;  2H6Y A;  5FWG A;  5DCH A;  3RHB A;  5JWQ B;  3M1G A;  2B5Y A;  2H71 A;  3D22 A;  3KH7 A;  4I8B A;  1SK2 A;  2YWM A;  1GUK A;  1O7U A;  5AGY A;  3TKP A;  4PQI A;  3DGQ A;  2GZZ A;  2IMD A;  5KN0 A;  2GZY A;  3R2Q A;  3GNJ A;  3LYP A;  4DSR A;  1GTB A;  2DJ2 A;  1E2Y A;  2HRN A;  4YQU A;  2REM A;  5D8I A;  1V40 A;  2H0G A;  1TU7 A;  3L78 A;  1GUH A;  1VF4 A;  3FZ5 A;  3TKR A;  2DML A;  3CSJ A;  1SK0 A;  1XIY A;  4EF0 A;  1K3L A;  1WRY A;  4CDO A;  2FUG 2;  3IOS A;  3GH6 A;  3TJJ A;  1GSS A;  1TK5 B;  4ZIJ A;  1J9B A;  4K1F A;  4Q5F A;  3TKS E;  3GHA A;  4XS4 A;  5CAX A;  4RI7 A;  2A2S A;  3HVX A;  2F3M A;  2HXK A;  3TKQ A;  1OE8 A;  3W8S A;  1TP9 A;  2LUS A;  3GYK A;  2CAQ A;  1PL2 A;  5DAL A;  2EIQ A;  3F63 A;  3ZYW A;  3IC8 A;  5COH A;  2V41 A;  4JE1 A;  1E6B A;  4KSM A;  4V2M A;  2OBI A;  2I1U A;  2AYT A;  3ME8 A;  3UBK A;  1AQW A;  2R2J A;  2RLI A;  3GA4 A;  2C3N A;  4ISD A;  1SJI A;  4KF9 A;  2DJ0 A;  2LQO A;  1SD8 A;  3UVT A;  2QC7 A;  4HU7 A;  2DBC A;  4PQH A;  4ZL7 A;  5DQS A;  2HRK A;  2B1K A;  1F6M C;  1ON4 A;  1TKD B;  5CO3 A;  5D9X A;  3GRX A;  3VI7 A;  2QSI A;  3KEB A;  1UN2 A;  1XFL A;  3TJF A;  4BA7 A;  4KA0 A;  1V2A A;  1V9W A;  1F3B A;  4OO4 A;  2VL3 A;  1JHB A;  3K8N A;  3TOT A;  3LXT A;  2F9S A;  3VPQ A;  4BL7 A;  2GSS A;  5H5Q A;  1U3I A;  11GS A;  2KUC A;  2PN8 A;  4L0U A;  3VWV A;  1FB0 A;  2VAF A;  4NXI A;  3HKR A;  3KMO A;  1K0O A;  2C0D A;  3L9V A;  2ES7 A;  2HSY A;  3D6I A;  3ZVJ D;  5D93 A;  4POL A;  3TCO A;  3FR9 A;  2L59 A;  2CVK A;  2YJH A;  2ALB A;  4N30 A;  2RUE A;  3ZIT A;  1U88 A;  5ELG A;  1SU9 A;  5L71 A;  4WET A;  1XWA A;  1ZZY A;  5J9C A;  1X5E A;  2HZE A;  1M9A A;  2IFQ A;  3DD3 A;  4PNG A;  2ZUP A;  1MTC A;  3KTB A;  4NPB A;  2GQK A;  3E9J B;  2R37 A;  4K9Z A;  2QKE A;  4ILF A;  2EC4 A;  5LD0 A;  2VIM A;  3VWX A;  2HLS A;  1XZO A;  1M99 A;  2B5X A;  13GS A;  2AB6 A;  4NHW A;  2LEG A;  2LJA A;  3DRN A;  2FHE A;  1A0F A;  1AXD A;  1ERT A;  1SYR A;  5C04 A;  2IWT A;  2HRF A;  3QR6 A;  2OAD A;  3TB2 A;  2DJK A;  5G2Z A;  3H93 A;  3O6T A;  4TR1 A;  4IQA A;  4QQ7 A;  2YAN A;  2FA8 A;  2R3X A;  4IJ3 A;  2K8V A;  2K9F A;  2HSN B;  2I81 A;  2CAI A;  2AV4 A;  4AJ8 A;  5IOW A;  3FY7 A;  1PD2 1;  2FA4 A;  3EC3 A;  1YF0 A;  2IL3 A;  2FNO A;  1XVW A;  5IO0 A;  2OE1 A;  4FQU A;  2IME A;  2YV9 A;  1SKR B;  1TRW A;  1TU8 A;  2JAC A;  3CRT A;  3KP9 A;  4BPY A;  1R26 A;  5ECH B;  1IYH A;  2OE3 A;  5FT3 A;  1W4V A;  3IDV A;  4L5L A;  1QUW A;  2JZS A;  4XS4 B;  2FWH A;  1ZOF A;  3HA9 A;  2P31 A;  2O8V B;  4K8M A;  4TRX A;  2O85 A;  2HYX A;  5F05 A;  5IPG A;  2GSR A;  3ZRE A;  2GGT A;  4HUA A;  4OFN A;  1T00 A;  3WT2 A;  1MDK A;  1OC9 A;  3IAM 2;  1XW9 A;  1SKS B;  3GUS A;  2PBJ A;  1IYI A;  4O92 A;  4LL1 B;  4PNF A;  3LFL A;  3L9U A;  4MDC A;  5JWO B;  2DSA A;  4G0K A;  1GRX A;  2HFD A;  2C3Q A;  1SKW B;  2YCD A;  2MMN A;  4JBB A;  4D73 A;  3QFB C;  1R4W A;  1BG5 A;  8GSS A;  3TGZ A;  4G19 A;  1AQX A;  4CHS A;  2YPM A;  2WB9 A;  4EDY A;  4H86 A;  2R4V A;  2L4C A;  3A2X A;  1XW5 A;  1EGR A;  2VCW A;  1SJ6 A;  1WWJ A;  1GNW A;  4FO5 A;  2LNS A;  2HRK B;  1AUC A;  4GST A;  3MNG A;  2XBQ A;  3WGD A;  2CVB A;  1Z6M A;  3FYG A;  3I9V 2;  2C80 A;  5IO2 A;  1PL1 A;  3F0I A;  4ZB9 A;  3F8U A;  1YDK A;  1XWG A;  3C1S A;  3UL3 A;  4BL7 B;  3QFA C;  5G30 A;  2FY6 A;  4L8E A;  4V1A p;  1T3B A;  2VCX A;  2EIO A;  4YH2 A;  1ERU A;  2Z9S A;  5A4U A;  1GLP A;  2AAW A;  1QMV A;  2E2M A;  2LJR A;  3GKM A;  1UVZ A;  1JZR A;  3IRA A;  3TKS C;  1LJR A;  3KP8 A;  3VLN A;  2H01 A;  2PUK C;  3W8J A;  1FW1 A;  4E8H A;  3HZ4 A;  4MCU A;  4JU5 A;  2OE0 A;  5B7C A;  4IBP A;  2H0H A;  1T1V A;  3HJM A;  1UC7 A;  5B6M A;  3ERG A;  1WJK A;  4KSO A;  1I5G A;  2IFQ B;  1OVN A;  5H5R A;  1HYU A;  4ID0 A;  1ERW A;  3A2V A;  1WE0 A;  5GST A;  3ZML A;  1BX9 A;  1YY7 A;  3GSS A;  1O8W A;  1HNB A;  4POM A;  3F6D A;  4KCE A;  2YV7 A;  4GRF A;  3TRX A;  3J7Y k;  4PUF C;  5G31 A;  4TXO A;  1K0M A;  1ST9 A;  3TKS A;  2G2Q A;  1HNC A;  3PGT A;  2KP1 A;  1QFN A;  2E7P A;  2X8G A;  2GT6 A;  1OKD A;  1VF1 A;  3PPU A;  1ACV A;  4KW6 A;  3QAW A;  3GST A;  1QK8 A;  2MMO A;  3EMX A;  3MWH A;  1TRS A;  1X9M B;  2P5R A;  4IP1 A;  4TR1 B;  2N5F A;  1ABA A;  1B9Y C;  3DEX A;  1V57 A;  4IVF A;  2WDU A;  3PR8 A;  3HHV A;  2PU9 C;  1PMT A;  1BYE A;  5IIZ A;  4GF0 A;  1TTZ A;  1Z3E A;  2JZR A;  3FZ4 A;  2LV3 A;  1VF3 A;  2NVL A;  5IPH A;  1A24 A;  4FH8 A;  1W89 A;  2FCH A;  4GWR A;  4PX1 A;  3UEM A;  4OCF A;  1PX6 A;  5HR0 A;  2C4J A;  5DJL A;  3GV1 A;  1UA5 A;  1YQ1 A;  1XWB A;  2XBI A;  1ZGN A;  5J41 A;  3F3Q A;  4L0W A;  4G0I A;  3LWA A;  3KGK A;  4GQC A;  2VOC A;  3CMI A;  1USB A;  3NIV A;  2WJU A;  3KXO A;  1T8E B;  5JCU A;  3H4K A;  4TW5 A;  4GCI A;  1VGL A;  3TJG A;  4EDZ A;  2DIY A;  1X5D A;  1J0F A;  3HCZ A;  3G7I A;  4ECB A;  1YKC A;  4O7H A;  1TI1 A;  5INY A;  1OC9 B;  4EO3 A;  5DCG A;  6GSU A;  5E59 A;  3N5O A;  5CRG A;  1XWK A;  2RM6 A;  4ECJ A;  1A8Y A;  1K0A A;  1TW9 A;  22GS A;  1XOA A;  1OYJ A;  3C7M A;  3HZ8 A;  1XXU A;  4D73 B;  2O7K A;  5D9V A;  3CSI A;  4K7I A;  3MSZ A;  1KTE A;  3LXZ A;  1FVK A;  4MK3 A;  4YQM A;  3C71 A;  5KN2 A;  3FZA A;  2V6K A;  1RQM A;  3QMX A;  1YEX A;  4ZIL A;  4IKH A;  1GSQ A;  1KBN A;  3GIX A;  3TRQ A;  4F0B A;  4IHU A;  5ECN B;  5D9T A;  2VUP A;  3LGC A;  5C00 A;  1EP8 A;  2H73 A;  1SD9 A;  4KGI A;  1FHE A;  5HFK A;  1TRU A;  1GUL A;  1GSF A;  5KN3 A;  5KEJ A;  1C72 A;  1XCC A;  3ZZX A;  2H76 A;  3EYT A;  1U6T A;  1JFU A;  3ZFL A;  2L6C A;  2GST A;  1G6Y A;  1GTU A;  3UMA A;  4EL1 A;  4N11 A;  5LNK e;  5EPF A;  3EE2 A;  1PKZ A;  4N0Z A;  1PN9 A;  2MZC A;  5IMF A;  1SK1 A;  4YQV A;  3PH9 A;  3Q18 A;  1A2J A;  2C0G A;  1M2A A;  4AF2 A;  1ILO A;  4WXT A;  2YN1 A;  3EMP A;  3EIN A;  2AHE A;  12GS A;  1M9B A;  2RM5 A;  1S3A A;  1SL2 B;  3CRU A;  3LJR A;  1B8X A;  1N2A A;  3BBY A;  3HJO A;  2N5B A;  1FAA A;  4JED A;  1X9W B;  3M0F A;  3KJY A;  4KCA A;  6GSX A;  2MBS A;  3GN3 A;  2I9H A;  3ZVJ A;  2PVO C;  2VLV A;  3KCM A;  1EV9 A;  1Z6N A;  4ZL8 A;  4TXO B;  3G7J A;  4O5R A;  4IEL A;  2HT9 A;  4KAE A;  1X0R A;  6GSW A;  3FEU A;  5IMA A;  3F4R A;  1TDI A;  3CTG A;  4ML6 A;  3GMF A;  2MBT A;  2L5L A;  3VWU A;  3L4N A;  1CQG A;  3I6A A;  5D73 A;  4DSS A;  5A4V A;  3DWV A;  3GKK A;  2HRA A;  2PWJ A;  4EE0 A;  2JU5 A;  4MZB A;  4WR4 A;  2B3S A;  1QXH A;  2E2G A;  3C1R A;  1WPI A;  1Y6E A;  5IQY A;  4OD7 A;  2YZH A;  1VF2 A;  1WOU A;  3KZQ A;  2J9H A;  2OBK A;  1ML6 A;  1PKW A;  4PUR A;  3C73 A;  2HQT A;  4G9H A;  4PGT A;  3M8N A;  3IHQ A;  5D96 A;  2IMK A;  1S3C A;  1B4Q A;  1NSW A;  2JSY A;  1YF1 A;  2LRC A;  3P8W A;  4HJM A;  4EC0 A;  4I2T A;  2GQL A;  3GKX A;  4NHZ A;  3QDN A;  2NPB A;  1GWC A;  4N0V A;  4WF4 A;  3P2A A;  2IIY A;  1YJ6 A;  4Q5R A;  1YZX A;  3UOM A;  4O32 A;  1GP1 A;  2DJ3 A;  4IS0 A;  4NWY A;  2H1D A;  5EVO A; 
#chains in the Genus database with same CATH topology
 5E4W A;  1EZK A;  4DVC A;  2QGV A;  5HFG A;  2EFD A;  3GH9 A;  4IW9 A;  1DUG A;  1N8J A;  2NDO A;  3A2W A;  5G1K A;  2OA7 A;  3IXR A;  5CP1 A;  4Q5Q A;  9GSS A;  4ZXG A;  3F3R A;  2JAD A;  5A34 A;  3APQ A;  5ID2 A;  2O36 A;  2M72 A;  4F82 A;  5EY6 A;  1I9D A;  2I4A A;  2I3Y A;  4PTS A;  4Z2T A;  5ECK B;  2OAC A;  1WMJ A;  4AJ6 A;  4V1A g;  3WT1 A;  1K0D A;  2M80 A;  2HZF A;  2O89 A;  4HQZ A;  5J9B A;  5ECP B;  3TJB A;  4Q5N A;  4X43 A;  4PHZ C;  2WVX A;  2B7K A;  1MEK A;  5G1L A;  1EOG A;  4MF5 A;  4JRR A;  4HDE A;  6GST A;  3L0H A;  2IMI A;  5J3R A;  4KE3 A;  1TK0 B;  5ELA A;  4JR6 A;  3IE3 A;  2H75 A;  4RQX A;  4MJC A;  3FZ9 A;  2H0I A;  2DMM A;  3GUR A;  1O85 A;  4MF7 A;  5CRD A;  3DIE A;  1AC1 A;  4FYB A;  4CW9 A;  3LG6 A;  3J7Y b;  2EFE A;  2FWE A;  1M2B A;  3DVX A;  5DAK A;  4ACS A;  3IV4 A;  3JCM L;  2TRC P;  4KDX A;  1O81 A;  3ZIV A;  2C1Y A;  4MJA A;  2YWN A;  2H30 A;  2HE3 A;  3LQ7 A;  1TOF A;  3APS A;  4G2E A;  5DVB A;  1Z9H A;  3D4M A;  4J57 E;  1K0C A;  4ZBB A;  4NAX A;  1PGT A;  2LRT A;  5AN1 A;  3UIW A;  5IMV A;  1VRS D;  3OR5 A;  2KP2 A;  3I69 A;  1QGV A;  3A5W A;  2CVD A;  1QQ2 A;  2JSZ A;  2CA8 A;  4Z7X A;  1JLW A;  1S3D A;  4AKI A;  3APO A;  4XRD A;  4ZB8 A;  1Q4J A;  4KDU A;  2VLU A;  4HEA 2;  5EL8 A;  3L9S A;  3C8E A;  4AKG A;  3G7Y A;  1V98 A;  4YKG A;  2IPA A;  2YNX A;  3KMN A;  5J4V A;  4P3Y B;  1Q98 A;  4BVY A;  1G7E A;  3IK9 A;  4GXZ A;  2OKA A;  2XHF A;  2PGT A;  3UJ1 A;  3HY2 A;  1A8L A;  1GLQ A;  3FR3 A;  6GSY A;  3RHC A;  4DSS B;  4YAV A;  2YOI A;  2ON7 A;  1AIU A;  1MDI A;  3PIN A;  5HR1 A;  3O76 A;  4OCE A;  2PVQ A;  4W66 A;  3M3M A;  1PRX A;  3W6G A;  2WGR A;  1XPV A;  1PFO A;  3D5J A;  2RUF A;  2MMZ A;  4GLT A;  3KIJ A;  4G10 A;  1AAZ A;  6GSS A;  3BCI A;  4HU9 A;  1DE2 A;  2LKU A;  3ERW A;  5GAP D;  2VL2 C;  3WYW A;  1TJD A;  3ZRD A;  4TVE A;  4QL9 A;  5CRH A;  1XVQ A;  4MAB A;  3CXG A;  3NZN A;  2H6Z A;  3TDG A;  5HR2 A;  2CQ9 A;  2WCI A;  1PQN A;  4PI2 C;  2L57 A;  1R5P A;  2K18 A;  3GX8 A;  1TRV A;  2O87 A;  4ZL9 A;  2ZNM A;  3AY8 A;  2TRX A;  2H74 A;  5A1N A;  1M3J A;  3N9J A;  1EWX A;  3BJ5 A;  3IHG A;  4ECI A;  3E0U A;  1ZCP A;  1RW1 A;  2LS5 A;  3DML A;  3FMW A;  4TR3 A;  1GSU A;  3V1W A;  2IMF A;  4TR4 A;  2VL2 A;  1FO5 A;  1T4Y A;  4NV2 A;  3TJK A;  4TN8 A;  5ENU A;  3G9B A;  3FK8 A;  1ERV A;  5F8B A;  2BTO T;  4IN0 A;  4POK A;  3UBL A;  2LJK A;  4X1U A;  5A34 B;  5ID2 B;  2R5G A;  4USS A;  3BOA A;  5ECR B;  5HQP A;  4ZB6 A;  3F6F A;  4K6X A;  1A2L A;  3HDC A;  1O6J A;  3DVW A;  1FOV A;  4ECC A;  4J2F A;  2B7J A;  3LEF A;  2F8F A;  3IAS 2;  1F3A A;  3CBU A;  2KHP A;  1M0U A;  4K7N A;  4Z2U A;  2VLT A;  2GDR A;  4ICY A;  3FW2 A;  2H1A A;  4MP4 A;  2K6V A;  2BMX A;  3IPZ A;  1FVJ A;  1YVL A;  4K5S A;  4GDF A;  1KEB A;  3ZFB A;  2LQQ A;  2LRN A;  1OE7 A;  2VCZ A;  4GSN A;  5ECL B;  5IMZ A;  2CX3 A;  1YEP A;  4NMU A;  2HNL A;  3D21 A;  4GQF A;  5DQY A;  1BAY A;  5DAK B;  4N10 A;  1EEJ A;  3QOU A;  3UVH A;  3E3E A;  2AJQ B;  3HVV A;  2PMT A;  2C0F A;  5B8A A;  1MD3 A;  2C3T A;  3KM6 A;  1PSQ A;  4KB3 A;  2ZCT A;  4K0G A;  3KD0 A;  4MF6 A;  1T4Z A;  3IC4 A;  1TK8 B;  2PER A;  1SL0 B;  1GSE A;  4EKZ A;  2M46 A;  1M2D A;  4OFT A;  3ZIJ A;  3IBH A;  4XCS A;  2DIZ A;  2JZT A;  2B6M A;  3HD5 A;  4BWS A;  1DSB A;  2FWG A;  2PPT A;  2DKI A;  1PA3 A;  5A5K A;  2WZ9 A;  1GH2 A;  4MH2 A;  5AIS A;  4GTU A;  2WS2 A;  3ZTL A;  2B1L A;  5A4W A;  2CV4 A;  3ED3 A;  4O5Q A;  3VPT A;  2L4Q A;  1K3Y A;  4MH3 A;  4ZBA A;  1WP0 A;  4BVY B;  1Y25 A;  2FGX A;  4MLY A;  2EIR A;  5D9W A;  3EWL A;  4POB A;  3GL5 A;  4TR0 A;  1M7T A;  2X8H A;  4EXJ A;  1R7H A;  4MZC A;  1A2M A;  2VCV A;  1SVL A;  2L5O A;  2VM2 A;  4ML1 A;  1JZO A;  1J08 A;  4HS1 A;  5ECI B;  4FYC A;  1HD2 A;  4IQ1 A;  1V58 A;  2XPD A;  4LA1 A;  5ECQ B;  1OC8 A;  1Z5Y E;  2GVP A;  2WUL A;  2H70 A;  3GL3 A;  4KX4 A;  4I5Q A;  1EEM A;  2DJJ A;  4HQS A;  2D2Z A;  3H1N A;  4F9Z A;  3TUE A;  2VM1 A;  2X99 A;  3ZMK A;  3US3 A;  1HQO A;  4AKH A;  3QCP A;  2DC5 A;  3TOU A;  2VD1 A;  6GSV A;  1PX7 A;  3A5I A;  4ZB7 A;  3KTL A;  2HSM A;  1HNA A;  2YWO A;  3DKS A;  2V6O A;  2H1B A;  2IJY A;  4WEY A;  1DE1 A;  5F06 A;  1U87 A;  2YWI A;  5HFI A;  3QAV A;  3QPM A;  1EV4 A;  3CTF A;  2RII A;  3H8Q A;  3P7X A;  1URM A;  2NTO A;  1JLV A;  4YAP A;  2NBS A;  17GS A;  5A1N B;  3IK7 A;  1F37 A;  2CZ2 A;  2VO4 A;  2X4A A;  2LST A;  3RPN A;  4JZQ A;  3HYP A;  1DBY A;  4HZ4 A;  4XS1 A;  5GZZ B;  1SYX A;  1GSD A;  4F2I A;  5GAN D;  5F07 A;  4MPG A;  1EOH A;  1TI3 A;  4PXO A;  1F9M A;  1PN0 A;  3I43 A;  2E0Q A;  2CT6 A;  4IGJ A;  1CQH A;  5JCW A;  4HOJ A;  3QD9 A;  14GS A;  2EFH A;  3BD2 A;  1G6W A;  3HJP A;  5CYY A;  4I6X A;  3D0Z A;  2N5A A;  4WF5 A;  4V2L A;  1X9S B;  4AGS A;  4GSS A;  5DBQ A;  5FHI A;  5ABR A;  3RGB C;  2P5Q A;  3CHX C;  2FWF A;  2G0F A;  1K0N A;  2X8C A;  2WW3 A;  3D4T A;  4HJ2 A;  3CSH A;  4MMM A;  4PUA A;  3Q6O A;  3EU4 A;  2IN3 A;  2VCT A;  2R0P A;  5KN1 A;  4HZ2 A;  2F8A A;  3R3E A;  4J56 E;  4BWQ A;  4NV5 A;  4XTS A;  2V32 A;  4TXV A;  2C0E A;  4OWY A;  18GS A;  4I2U A;  1OAZ A;  4LMW A;  20GS A;  3P90 A;  3FKF A;  4WKW A;  3LOR A;  5G5E A;  2V1M A;  3ZL5 A;  3GTU A;  3HVN A;  2KLX A;  5J4U A;  3WGE A;  1OC3 A;  3S9F A;  1AQV A;  1XBS A;  3H79 A;  2A4H A;  4MZW A;  4OFM A;  5IM9 A;  1YKA A;  5DDL A;  2GTU A;  1OKT A;  2J23 A;  4MJE A;  4LMV A;  2KOK A;  5IMC A;  3LSZ A;  2GZP A;  5CRW A;  1WIK A;  3DXB A;  2CZ3 A;  4LLR A;  2F51 A;  2ON5 A;  4O5U A;  3Q74 A;  3MDK A;  2VD0 A;  1AW9 A;  1EGO A;  1BQ7 A;  5AIX A;  3RDW A;  2WFC A;  2H72 A;  3UAR A;  4FIW A;  4BVX A;  3BCK A;  5A5H A;  3FR6 A;  3O3T A;  1K0B A;  3QAG A;  1XW6 A;  3RPP A;  5IOX A;  5G5F A;  4RUV A;  5ECO B;  1FOH A;  3WD6 A;  1BJX A;  2GT5 A;  4RI6 A;  4EUY A;  2BJX A;  2FD3 A;  1MDJ A;  4DSQ A;  3RAZ A;  2H8L A;  2FLS A;  3SWL A;  2H6X A;  1A23 A;  1H75 A;  2GQM A;  3CYN A;  1B4P A;  4MJB A;  3Q19 A;  5ECS A;  1G7O A;  3KH9 A;  5ECM B;  19GS A;  2MMA A;  1ZL9 A;  5DAL B;  2CX4 A;  1SVM A;  3TRP A;  3EUR A;  2A2R A;  4CY6 A;  4XS6 A;  1NM3 A;  1THO A;  1U3A A;  2L6D A;  1GTA A;  3VWW A;  4WBJ A;  5KOW A;  4LL4 B;  1I1I P;  5H5S A;  3VUR A;  2H66 A;  2VL9 A;  1FG4 A;  5B6N A;  3ERF A;  3ZLP A;  5F0G A;  1XWC A;  1O73 A;  3ME7 A;  3UAP A;  3FHK A;  3F4S A;  4F0C A;  2WRT A;  2HSM B;  5LCZ A;  3HXS A;  1R5A A;  4AJ7 A;  2H1L A;  2AUV A;  3EU3 A;  2DJ1 A;  3U6V A;  4EIQ A;  4HI7 A;  4KDY A;  3F4T A;  1SEN A;  3VFI A;  4EVM A;  1T7P B;  4V2N A;  5CNW A;  4MNN A;  1LU4 A;  1B9X C;  1A0R P;  1H4O A;  2YZU A;  2GSQ A;  1THX A;  3HVS A;  2LNT A;  2GS3 A;  5DJM A;  3IR4 A;  5B8B A;  1SL1 B;  4F03 A;  3FRC A;  4RQR A;  4X0X A;  2YP6 A;  1M3I A;  1EP7 A;  2P0G A;  4E8E A;  5J5N A;  1KNG A;  1XOB A;  4TKY A;  3VI5 A;  3GFK A;  5IMD A;  3DYR A;  3F9U A;  2X64 A;  2HZE B;  1FB6 A;  3M9K A;  4OO5 A;  4XRA A;  2V2G A;  2R6K A;  1SJZ A;  1RK4 A;  3WGX A;  3SBC A;  5HR3 A;  1NHO A;  16GS A;  4G0L A;  4K0N A;  3RBT A;  2XC2 A;  3LYK A;  4DEJ A;  2MYG A;  2LTK A;  1F2E A;  4XIH A;  3U5R E;  1JZW A;  3NOF A;  4XHM A;  3GX0 A;  1GNE A;  1K3O A;  10GS A;  1MD4 A;  4KH7 A;  1G0T A;  7GSS A;  2OJL A;  5JWR B;  1B48 A;  4WBR D;  3VK9 A;  3MIX A;  1TXX A;  2HSH A;  3GTU B;  4KUN A;  1ZYE A;  5CRE A;  1NW2 A;  2C8U A;  2K8S A;  2TIR A;  2UZ8 A;  4ULX A;  5J4Y A;  2YJ7 A;  2JL4 A;  3ISO A;  2H1G A;  1X5C A;  1GSY A;  1GL8 A;  5JCG A;  1Z7P A;  2A4V A;  4PQ1 A;  1JZD A;  4MA9 A;  2VCQ A;  3MAK A;  1GUM A;  4IP6 A;  3IA1 A;  5GSS A;  2VKZ G;  1Z7R A;  2DLX A;  2XPE A;  4IJI A;  1BED A;  2GLR A;  4BVX B;  4K2D A;  4KND A;  4MPF A;  4TOP A;  5A5H B;  4K7O A;  5AIV A;  1ZMA A;  4FYU A;  4L5O A;  3GKN A;  1LBK A;  4WR5 A;  1NHY A;  2WW1 A;  2B5E A;  4JR4 A;  5BMU A;  2HI7 A;  2H19 A;  3A3T A;  4ZBD A;  1O8X A;  3M9J A;  1TXU A;  4OMV A;  3EVI A;  1GTI A;  4I97 A;  4QL7 A;  1ZYQ B;  2H6Y A;  5FWG A;  5DCH A;  3RHB A;  5JWQ B;  3M1G A;  2B5Y A;  2H71 A;  3D22 A;  2UV8 G;  3KH7 A;  4I8B A;  1SK2 A;  2YWM A;  1GUK A;  1O7U A;  5AGY A;  3TKP A;  4PQI A;  3DGQ A;  2GZZ A;  2IMD A;  5KN0 A;  2GZY A;  3R2Q A;  3GNJ A;  2HSN A;  3LYP A;  4DSR A;  1S3R A;  1GTB A;  2DJ2 A;  1E2Y A;  2HRN A;  4YQU A;  2REM A;  5D8I A;  1V40 A;  2H0G A;  1TU7 A;  3L78 A;  1GUH A;  1VF4 A;  3FZ5 A;  3TKR A;  2DML A;  3CSJ A;  1SK0 A;  2WZS A;  1XIY A;  4EF0 A;  1K3L A;  1WRY A;  4CDO A;  3HMJ G;  2WVZ A;  2FUG 2;  4G01 A;  3IOS A;  3GH6 A;  3TJJ A;  1GSS A;  3LW9 A;  1TK5 B;  4ZIJ A;  1J9B A;  4K1F A;  4Q5F A;  3TKS E;  3GHA A;  4XS4 A;  5CAX A;  4RI7 A;  2A2S A;  3HVX A;  2F3M A;  2HXK A;  3TKQ A;  1OE8 A;  3W8S A;  1TP9 A;  2LUS A;  3GYK A;  2CAQ A;  1PL2 A;  3MYD A;  5DAL A;  2EIQ A;  3F63 A;  3ZYW A;  3IC8 A;  5COH A;  2V41 A;  4JE1 A;  1E6B A;  4KSM A;  4X4J A;  4V2M A;  2OBI A;  2I1U A;  2AYT A;  3ME8 A;  3UBK A;  1AQW A;  2R2J A;  2RLI A;  3GA4 A;  2C3N A;  4ISD A;  1SJI A;  4KF9 A;  2DJ0 A;  2LQO A;  1SD8 A;  3UVT A;  2QC7 A;  4A5P A;  4HU7 A;  2DBC A;  4PQH A;  4ZL7 A;  5DQS A;  2HRK A;  2B1K A;  1F6M C;  1ON4 A;  1TKD B;  5CO3 A;  5D9X A;  3GRX A;  3VI7 A;  2QSI A;  3KEB A;  1UN2 A;  1XFL A;  3TJF A;  4BA7 A;  4KA0 A;  1V2A A;  1V9W A;  1F3B A;  4OO4 A;  2VL3 A;  1JHB A;  2QA2 A;  3K8N A;  3TOT A;  3LXT A;  2F9S A;  3VPQ A;  4BL7 A;  2GSS A;  5H5Q A;  1U3I A;  11GS A;  2KUC A;  2PN8 A;  4L0U A;  3VWV A;  1FB0 A;  2VAF A;  4NXI A;  3HKR A;  3KMO A;  1K0O A;  2C0D A;  3L9V A;  2ES7 A;  4N3Z A;  2HSY A;  3D6I A;  3ZVJ D;  5D93 A;  4POL A;  3TCO A;  3FR9 A;  2L59 A;  2CVK A;  2YJH A;  2ALB A;  4N30 A;  2RUE A;  3ZIT A;  1BG1 A;  1U88 A;  5ELG A;  1SU9 A;  5L71 A;  4QMK A;  4WET A;  1XWA A;  1ZZY A;  5J9C A;  1X5E A;  2HZE A;  3CQF A;  1M9A A;  1ZYP A;  2IFQ A;  3DD3 A;  4PNG A;  2ZUP A;  1MTC A;  3KTB A;  4NPB A;  2GQK A;  3E9J B;  4YKF A;  2A2P A;  2O5V A;  2R37 A;  2DKH A;  4K9Z A;  2QKE A;  4ILF A;  2EC4 A;  5LD0 A;  1S4B P;  2VIM A;  3VWX A;  2HLS A;  1XZO A;  1M99 A;  2B5X A;  13GS A;  2AB6 A;  5BMU B;  4NHW A;  2LEG A;  2WW0 A;  2LJA A;  3DRN A;  2FHE A;  1A0F A;  1AXD A;  1ERT A;  1SYR A;  5C04 A;  2IWT A;  3EPT A;  2HRF A;  3QR6 A;  2OAD A;  3TB2 A;  2DJK A;  5G2Z A;  3H93 A;  3O6T A;  2QA1 A;  4TR1 A;  4IQA A;  4QQ7 A;  2YAN A;  2FA8 A;  2R3X A;  4IJ3 A;  2K8V A;  2X49 A;  2K9F A;  2HSN B;  2I81 A;  2CAI A;  2AV4 A;  4AJ8 A;  5IOW A;  3FY7 A;  1PD2 1;  2FA4 A;  3EC3 A;  1YF0 A;  2IL3 A;  2FNO A;  1XVW A;  5IO0 A;  2OE1 A;  4FQU A;  5J47 A;  2IME A;  2YV9 A;  1SKR B;  1TRW A;  1TU8 A;  2JAC A;  3CRT A;  3KP9 A;  4BPY A;  1R26 A;  5ECH B;  2R0G A;  1IYH A;  2OE3 A;  4CY8 A;  5FT3 A;  1W4V A;  3IDV A;  4L5L A;  1QUW A;  2JZS A;  4XS4 B;  2FWH A;  4K5R A;  1ZOF A;  3HA9 A;  2P31 A;  2O8V B;  4K8M A;  4TRX A;  2O85 A;  2HYX A;  5F05 A;  5IPG A;  2GSR A;  3ZRE A;  2GGT A;  4HUA A;  4OFN A;  1T00 A;  3WT2 A;  4AI6 A;  1MDK A;  1OC9 A;  3IAM 2;  1XW9 A;  1SKS B;  3GUS A;  2PBJ A;  1IYI A;  4O92 A;  4LL1 B;  4PNF A;  3LFL A;  3L9U A;  4MDC A;  5JWO B;  2DSA A;  4G0K A;  1GRX A;  2HFD A;  2C3Q A;  1SKW B;  2YCD A;  2MMN A;  4JBB A;  4D73 A;  3QFB C;  1R4W A;  1BG5 A;  8GSS A;  3TGZ A;  4G19 A;  1AQX A;  4CHS A;  2YPM A;  2WB9 A;  4EDY A;  4H86 A;  2R4V A;  2L4C A;  3A2X A;  1XW5 A;  1EGR A;  2VCW A;  1SJ6 A;  1WWJ A;  3CWG A;  1GNW A;  4FO5 A;  2LNS A;  2HRK B;  1AUC A;  4GST A;  2XBQ A;  3MNG A;  3WGD A;  2CVB A;  1Z6M A;  3FYG A;  3I9V 2;  2C80 A;  5IO2 A;  1PL1 A;  3F0I A;  4ZB9 A;  3F8U A;  1YDK A;  1XWG A;  3C1S A;  1YEW C;  5KOX A;  3UL3 A;  4BL7 B;  3QFA C;  5G30 A;  2FY6 A;  4L8E A;  4V1A p;  1T3B A;  2VCX A;  2EIO A;  4YH2 A;  1ERU A;  4AKX B;  2Z9S A;  5A4U A;  1GLP A;  2AAW A;  1QMV A;  2E2M A;  2LJR A;  3GKM A;  4K2X A;  1UVZ A;  3TU3 B;  1JZR A;  3IRA A;  3TKS C;  1LJR A;  3KP8 A;  3VLN A;  2H01 A;  2PUK C;  3W8J A;  1FW1 A;  4E8H A;  3HZ4 A;  4MCU A;  4JU5 A;  2OE0 A;  5B7C A;  4IBP A;  2H0H A;  1T1V A;  3HJM A;  1UC7 A;  5B6M A;  3ERG A;  4Z2R A;  1WJK A;  4KSO A;  1I5G A;  2IFQ B;  1OVN A;  5H5R A;  1XG8 A;  1HYU A;  4ID0 A;  1ERW A;  3A2V A;  1WE0 A;  5GST A;  3ZML A;  4FXY P;  1BX9 A;  1YY7 A;  3GSS A;  1O8W A;  1HNB A;  4POM A;  3F6D A;  4KCE A;  2YV7 A;  4GRF A;  3TRX A;  3J7Y k;  4PUF C;  5G31 A;  4TXO A;  1K0M A;  1ST9 A;  3TKS A;  2G2Q A;  1HNC A;  3PGT A;  2KP1 A;  1QFN A;  2E7P A;  2X8G A;  2GT6 A;  1OKD A;  1VF1 A;  3PPU A;  1ACV A;  4KW6 A;  3QAW A;  3GST A;  1QK8 A;  2R0C A;  2MMO A;  3EMX A;  3MWH A;  1TRS A;  4HSC X;  2P5R A;  1X9M B;  4IP1 A;  4TR1 B;  2N5F A;  1ABA A;  1B9Y C;  3DEX A;  1V57 A;  4IVF A;  2WDU A;  3PR8 A;  3HHV A;  2PU9 C;  1PMT A;  1BYE A;  5IIZ A;  4GF0 A;  1TTZ A;  1Z3E A;  2JZR A;  3FZ4 A;  2LV3 A;  1VF3 A;  2NVL A;  5IPH A;  1A24 A;  4FH8 A;  2O3E A;  1W89 A;  2FCH A;  4GWR A;  4PX1 A;  3UEM A;  4OCF A;  1PX6 A;  5HR0 A;  2C4J A;  5DJL A;  3GV1 A;  1UA5 A;  1YQ1 A;  1XWB A;  2XBI A;  1ZGN A;  5J41 A;  3F3Q A;  4L0W A;  4G0I A;  3LWA A;  3KGK A;  4GQC A;  2VOC A;  1N25 A;  3CMI A;  1USB A;  3NIV A;  2WJU A;  3KXO A;  5BRT A;  1T8E B;  5JCU A;  3H4K A;  4TW5 A;  4GCI A;  1VGL A;  3TJG A;  2WVX B;  4EDZ A;  2DIY A;  1SVO A;  1X5D A;  3HCZ A;  1J0F A;  3G7I A;  4ECB A;  1YKC A;  4O7H A;  1TI1 A;  5INY A;  1OC9 B;  4EO3 A;  5DCG A;  6GSU A;  5E59 A;  3RFR C;  3N5O A;  5CRG A;  1XWK A;  2RM6 A;  4ECJ A;  1A8Y A;  1K0A A;  1TW9 A;  22GS A;  2EFC A;  1XOA A;  1OYJ A;  3C7M A;  3HZ8 A;  1XXU A;  4D73 B;  2O7K A;  5D9V A;  3CSI A;  4K7I A;  3MSZ A;  1KTE A;  3LXZ A;  1FVK A;  4MK3 A;  4YQM A;  3C71 A;  5KN2 A;  3FZA A;  2V6K A;  1RQM A;  3QMX A;  1YEX A;  4ZIL A;  4IKH A;  1GSQ A;  1KBN A;  3GIX A;  3TRQ A;  4F0B A;  4IHU A;  5ECN B;  5D9T A;  2WVY A;  2VUP A;  3LGC A;  5C00 A;  1EP8 A;  1ZYN A;  2H73 A;  1SD9 A;  4KGI A;  1FHE A;  5HFK A;  1TRU A;  1GUL A;  1GSF A;  5KN3 A;  5KEJ A;  1C72 A;  1XCC A;  3ZZX A;  2H76 A;  4PI0 C;  3EYT A;  1U6T A;  1JFU A;  3ZFL A;  2L6C A;  2GST A;  1G6Y A;  1GTU A;  3UMA A;  4EL1 A;  4N11 A;  5LNK e;  5EPF A;  3EE2 A;  1PKZ A;  4N0Z A;  1PN9 A;  2MZC A;  5IMF A;  1SK1 A;  4YQV A;  3PH9 A;  3Q18 A;  1A2J A;  2C0G A;  1M2A A;  4AF2 A;  1ILO A;  4WXT A;  2YN1 A;  3EMP A;  3EIN A;  2AHE A;  12GS A;  1M9B A;  2RM5 A;  1S3A A;  1SL2 B;  3CRU A;  5J40 A;  3LJR A;  1B8X A;  1N2A A;  3BBY A;  3HJO A;  2N5B A;  1Y1U A;  1FAA A;  4JED A;  1X9W B;  3M0F A;  3KJY A;  4KCA A;  6GSX A;  2MBS A;  3GN3 A;  2I9H A;  3ZVJ A;  2WW2 A;  2PVO C;  2VLV A;  3KCM A;  1EV9 A;  1Z6N A;  4ZL8 A;  4TXO B;  3G7J A;  4O5R A;  4IEL A;  2HT9 A;  4KAE A;  1X0R A;  6GSW A;  3FEU A;  5IMA A;  3F4R A;  1TDI A;  3CTG A;  4ML6 A;  3GMF A;  2MBT A;  2L5L A;  3VWU A;  3L4N A;  1CQG A;  3I6A A;  5D73 A;  4DSS A;  5A4V A;  3DWV A;  3GKK A;  2HRA A;  4EIP A;  2PWJ A;  4EE0 A;  2JU5 A;  4MZB A;  4WR4 A;  2B3S A;  1QXH A;  2E2G A;  3C1R A;  1WPI A;  1Y6E A;  5IQY A;  4OD7 A;  2YZH A;  4E68 A;  1VF2 A;  1BF5 A;  1WOU A;  3KZQ A;  2J9H A;  2OBK A;  1ML6 A;  1PKW A;  4PUR A;  3C73 A;  2HQT A;  4G9H A;  4PGT A;  3M8N A;  3IHQ A;  5D96 A;  2IMK A;  1S3C A;  1B4Q A;  1NSW A;  2JSY A;  1YF1 A;  2LRC A;  3P8W A;  4HJM A;  2OT3 A;  4EC0 A;  4I2T A;  2GQL A;  3GKX A;  4NHZ A;  3QDN A;  2NPB A;  1GWC A;  4N0V A;  4WF4 A;  2IIY A;  1YJ6 A;  3P2A A;  4Q5R A;  1YZX A;  3UOM A;  4O32 A;  1GP1 A;  2DJ3 A;  4IS0 A;  4NWY A;  2H1D A;  5EVO A;  4BIK A; 
#chains in the Genus database with same CATH homology
 5E4W A;  1EZK A;  4DVC A;  2QGV A;  5HFG A;  2EFD A;  3GH9 A;  4IW9 A;  1DUG A;  1N8J A;  2NDO A;  3A2W A;  5G1K A;  2OA7 A;  3IXR A;  5CP1 A;  4Q5Q A;  9GSS A;  4ZXG A;  3F3R A;  2JAD A;  5A34 A;  3APQ A;  5ID2 A;  2M72 A;  4F82 A;  5EY6 A;  1I9D A;  2I4A A;  2I3Y A;  4PTS A;  4Z2T A;  5ECK B;  2OAC A;  1WMJ A;  4AJ6 A;  4V1A g;  3WT1 A;  1K0D A;  2M80 A;  2HZF A;  2O89 A;  4HQZ A;  5J9B A;  5ECP B;  3TJB A;  4Q5N A;  4X43 A;  2B7K A;  1MEK A;  5G1L A;  1EOG A;  4MF5 A;  4JRR A;  4HDE A;  6GST A;  3L0H A;  2IMI A;  5J3R A;  4KE3 A;  1TK0 B;  5ELA A;  4JR6 A;  3IE3 A;  2H75 A;  4RQX A;  4MJC A;  3FZ9 A;  2H0I A;  2DMM A;  3GUR A;  1O85 A;  4MF7 A;  5CRD A;  3DIE A;  1AC1 A;  4FYB A;  4CW9 A;  3LG6 A;  3J7Y b;  2EFE A;  2FWE A;  1M2B A;  3DVX A;  5DAK A;  4ACS A;  3IV4 A;  3JCM L;  2TRC P;  4KDX A;  1O81 A;  3ZIV A;  2C1Y A;  4MJA A;  2YWN A;  2H30 A;  2HE3 A;  3LQ7 A;  1TOF A;  3APS A;  4G2E A;  5DVB A;  1Z9H A;  3D4M A;  4J57 E;  1K0C A;  4ZBB A;  4NAX A;  1PGT A;  2LRT A;  5AN1 A;  3UIW A;  5IMV A;  1VRS D;  3OR5 A;  2KP2 A;  3I69 A;  1QGV A;  3A5W A;  2CVD A;  1QQ2 A;  2JSZ A;  2CA8 A;  4Z7X A;  1JLW A;  1S3D A;  4AKI A;  3APO A;  4XRD A;  4ZB8 A;  1Q4J A;  4KDU A;  2VLU A;  4HEA 2;  5EL8 A;  3L9S A;  3C8E A;  4AKG A;  3G7Y A;  1V98 A;  4YKG A;  2IPA A;  2YNX A;  3KMN A;  5J4V A;  4P3Y B;  1Q98 A;  4BVY A;  1G7E A;  3IK9 A;  4GXZ A;  2OKA A;  2XHF A;  2PGT A;  3UJ1 A;  3HY2 A;  1A8L A;  1GLQ A;  3FR3 A;  6GSY A;  3RHC A;  4DSS B;  4YAV A;  2YOI A;  2ON7 A;  1AIU A;  1MDI A;  3PIN A;  5HR1 A;  3O76 A;  4OCE A;  2PVQ A;  4W66 A;  3M3M A;  1PRX A;  3W6G A;  2WGR A;  1XPV A;  3D5J A;  2RUF A;  2MMZ A;  4GLT A;  3KIJ A;  4G10 A;  1AAZ A;  6GSS A;  3BCI A;  4HU9 A;  1DE2 A;  2LKU A;  3ERW A;  5GAP D;  2VL2 C;  3WYW A;  1TJD A;  3ZRD A;  4TVE A;  4QL9 A;  5CRH A;  1XVQ A;  4MAB A;  3CXG A;  3NZN A;  2H6Z A;  3TDG A;  5HR2 A;  2CQ9 A;  2WCI A;  1PQN A;  2L57 A;  1R5P A;  2K18 A;  3GX8 A;  1TRV A;  2O87 A;  4ZL9 A;  2ZNM A;  3AY8 A;  2TRX A;  2H74 A;  5A1N A;  3N9J A;  1EWX A;  3BJ5 A;  3IHG A;  4ECI A;  3E0U A;  1ZCP A;  1RW1 A;  2LS5 A;  3DML A;  3FMW A;  4TR3 A;  1GSU A;  3V1W A;  2IMF A;  4TR4 A;  2VL2 A;  1FO5 A;  1T4Y A;  4NV2 A;  3TJK A;  4TN8 A;  5ENU A;  3G9B A;  3FK8 A;  1ERV A;  5F8B A;  2BTO T;  4IN0 A;  4POK A;  3UBL A;  2LJK A;  4X1U A;  5A34 B;  5ID2 B;  2R5G A;  4USS A;  3BOA A;  5ECR B;  5HQP A;  4ZB6 A;  3F6F A;  4K6X A;  1A2L A;  3HDC A;  1O6J A;  3DVW A;  1FOV A;  4ECC A;  4J2F A;  2B7J A;  3LEF A;  2F8F A;  3IAS 2;  1F3A A;  3CBU A;  2KHP A;  1M0U A;  4K7N A;  4Z2U A;  2VLT A;  2GDR A;  4ICY A;  3FW2 A;  2H1A A;  4MP4 A;  2K6V A;  2BMX A;  3IPZ A;  1FVJ A;  1YVL A;  4K5S A;  4GDF A;  1KEB A;  3ZFB A;  2LQQ A;  2LRN A;  1OE7 A;  2VCZ A;  4GSN A;  5ECL B;  5IMZ A;  2CX3 A;  1YEP A;  4NMU A;  2HNL A;  3D21 A;  4GQF A;  5DQY A;  1BAY A;  5DAK B;  4N10 A;  1EEJ A;  3QOU A;  3UVH A;  3E3E A;  2AJQ B;  3HVV A;  2PMT A;  2C0F A;  5B8A A;  1MD3 A;  2C3T A;  3KM6 A;  1PSQ A;  4KB3 A;  2ZCT A;  4K0G A;  3KD0 A;  4MF6 A;  1T4Z A;  3IC4 A;  1TK8 B;  2PER A;  1SL0 B;  1GSE A;  4EKZ A;  2M46 A;  1M2D A;  4OFT A;  3ZIJ A;  3IBH A;  4XCS A;  2DIZ A;  2JZT A;  2B6M A;  3HD5 A;  4BWS A;  1DSB A;  2FWG A;  2PPT A;  2DKI A;  1PA3 A;  5A5K A;  2WZ9 A;  1GH2 A;  4MH2 A;  5AIS A;  4GTU A;  2WS2 A;  3ZTL A;  2B1L A;  5A4W A;  2CV4 A;  3ED3 A;  4O5Q A;  3VPT A;  2L4Q A;  1K3Y A;  4MH3 A;  4ZBA A;  1WP0 A;  4BVY B;  1Y25 A;  2FGX A;  4MLY A;  2EIR A;  5D9W A;  3EWL A;  4POB A;  3GL5 A;  4TR0 A;  1M7T A;  2X8H A;  4EXJ A;  1R7H A;  4MZC A;  1A2M A;  2VCV A;  1SVL A;  2L5O A;  2VM2 A;  4ML1 A;  1JZO A;  1J08 A;  4HS1 A;  5ECI B;  4FYC A;  1HD2 A;  4IQ1 A;  1V58 A;  2XPD A;  4LA1 A;  5ECQ B;  1OC8 A;  1Z5Y E;  2GVP A;  2WUL A;  2H70 A;  3GL3 A;  4KX4 A;  4I5Q A;  1EEM A;  2DJJ A;  4HQS A;  2D2Z A;  3H1N A;  4F9Z A;  3TUE A;  2VM1 A;  2X99 A;  3ZMK A;  3US3 A;  1HQO A;  4AKH A;  3QCP A;  2DC5 A;  3TOU A;  2VD1 A;  6GSV A;  1PX7 A;  3A5I A;  4ZB7 A;  3KTL A;  2HSM A;  1HNA A;  2YWO A;  3DKS A;  2V6O A;  2H1B A;  2IJY A;  4WEY A;  1DE1 A;  5F06 A;  1U87 A;  2YWI A;  5HFI A;  3QAV A;  3QPM A;  1EV4 A;  3CTF A;  2RII A;  3H8Q A;  3P7X A;  1URM A;  2NTO A;  1JLV A;  4YAP A;  2NBS A;  17GS A;  5A1N B;  3IK7 A;  1F37 A;  2CZ2 A;  2VO4 A;  2X4A A;  2LST A;  3RPN A;  4JZQ A;  3HYP A;  1DBY A;  4HZ4 A;  4XS1 A;  5GZZ B;  1SYX A;  1GSD A;  4F2I A;  5GAN D;  5F07 A;  4MPG A;  1EOH A;  1TI3 A;  4PXO A;  1F9M A;  1PN0 A;  3I43 A;  2E0Q A;  2CT6 A;  4IGJ A;  1CQH A;  5JCW A;  4HOJ A;  3QD9 A;  14GS A;  2EFH A;  3BD2 A;  1G6W A;  3HJP A;  5CYY A;  4I6X A;  3D0Z A;  2N5A A;  4WF5 A;  4V2L A;  1X9S B;  4AGS A;  4GSS A;  5DBQ A;  5FHI A;  5ABR A;  2P5Q A;  2FWF A;  2G0F A;  1K0N A;  2X8C A;  3D4T A;  4HJ2 A;  3CSH A;  4MMM A;  4PUA A;  3Q6O A;  3EU4 A;  2IN3 A;  2VCT A;  2R0P A;  5KN1 A;  4HZ2 A;  2F8A A;  3R3E A;  4J56 E;  4BWQ A;  4NV5 A;  4XTS A;  2V32 A;  4TXV A;  2C0E A;  4OWY A;  18GS A;  4I2U A;  1OAZ A;  4LMW A;  20GS A;  3P90 A;  3FKF A;  4WKW A;  3LOR A;  5G5E A;  2V1M A;  3ZL5 A;  3GTU A;  2KLX A;  5J4U A;  3WGE A;  1OC3 A;  3S9F A;  1AQV A;  1XBS A;  3H79 A;  2A4H A;  4MZW A;  4OFM A;  5IM9 A;  1YKA A;  5DDL A;  2GTU A;  1OKT A;  2J23 A;  4MJE A;  4LMV A;  2KOK A;  5IMC A;  3LSZ A;  2GZP A;  5CRW A;  1WIK A;  3DXB A;  2CZ3 A;  4LLR A;  2F51 A;  2ON5 A;  4O5U A;  3Q74 A;  3MDK A;  2VD0 A;  1AW9 A;  1EGO A;  1BQ7 A;  5AIX A;  3RDW A;  2WFC A;  2H72 A;  3UAR A;  4FIW A;  4BVX A;  3BCK A;  5A5H A;  3FR6 A;  3O3T A;  1K0B A;  3QAG A;  1XW6 A;  3RPP A;  5IOX A;  5G5F A;  4RUV A;  5ECO B;  1FOH A;  3WD6 A;  1BJX A;  2GT5 A;  4RI6 A;  4EUY A;  2BJX A;  2FD3 A;  1MDJ A;  4DSQ A;  3RAZ A;  2H8L A;  2FLS A;  3SWL A;  2H6X A;  1A23 A;  1H75 A;  2GQM A;  3CYN A;  1B4P A;  4MJB A;  3Q19 A;  5ECS A;  1G7O A;  3KH9 A;  5ECM B;  19GS A;  2MMA A;  1ZL9 A;  5DAL B;  2CX4 A;  1SVM A;  3TRP A;  3EUR A;  2A2R A;  4CY6 A;  4XS6 A;  1NM3 A;  1THO A;  1U3A A;  2L6D A;  1GTA A;  3VWW A;  4WBJ A;  5KOW A;  4LL4 B;  5H5S A;  3VUR A;  2H66 A;  2VL9 A;  1FG4 A;  5B6N A;  3ERF A;  3ZLP A;  5F0G A;  1XWC A;  1O73 A;  3ME7 A;  3UAP A;  3FHK A;  3F4S A;  4F0C A;  2WRT A;  2HSM B;  5LCZ A;  3HXS A;  1R5A A;  4AJ7 A;  2H1L A;  2AUV A;  3EU3 A;  2DJ1 A;  3U6V A;  4EIQ A;  4HI7 A;  4KDY A;  3F4T A;  1SEN A;  3VFI A;  4EVM A;  1T7P B;  4V2N A;  5CNW A;  4MNN A;  1LU4 A;  1B9X C;  1A0R P;  1H4O A;  2YZU A;  2GSQ A;  1THX A;  3HVS A;  2LNT A;  2GS3 A;  5DJM A;  3IR4 A;  5B8B A;  1SL1 B;  4F03 A;  3FRC A;  4RQR A;  4X0X A;  2YP6 A;  1EP7 A;  2P0G A;  4E8E A;  5J5N A;  1KNG A;  1XOB A;  4TKY A;  3VI5 A;  3GFK A;  5IMD A;  3DYR A;  3F9U A;  2X64 A;  2HZE B;  1FB6 A;  3M9K A;  4OO5 A;  4XRA A;  2V2G A;  2R6K A;  1SJZ A;  1RK4 A;  3WGX A;  3SBC A;  5HR3 A;  1NHO A;  16GS A;  4G0L A;  4K0N A;  3RBT A;  2XC2 A;  3LYK A;  4DEJ A;  2MYG A;  2LTK A;  1F2E A;  4XIH A;  3U5R E;  1JZW A;  3NOF A;  4XHM A;  3GX0 A;  1GNE A;  1K3O A;  10GS A;  1MD4 A;  4KH7 A;  1G0T A;  7GSS A;  2OJL A;  5JWR B;  1B48 A;  4WBR D;  3VK9 A;  3MIX A;  1TXX A;  2HSH A;  3GTU B;  4KUN A;  1ZYE A;  5CRE A;  1NW2 A;  2C8U A;  2K8S A;  2TIR A;  2UZ8 A;  4ULX A;  5J4Y A;  2YJ7 A;  2JL4 A;  3ISO A;  2H1G A;  1X5C A;  1GSY A;  1GL8 A;  5JCG A;  1Z7P A;  2A4V A;  4PQ1 A;  1JZD A;  4MA9 A;  2VCQ A;  3MAK A;  1GUM A;  4IP6 A;  3IA1 A;  5GSS A;  2VKZ G;  1Z7R A;  2DLX A;  2XPE A;  4IJI A;  1BED A;  2GLR A;  4BVX B;  4K2D A;  4KND A;  4MPF A;  4TOP A;  5A5H B;  4K7O A;  5AIV A;  1ZMA A;  4FYU A;  4L5O A;  3GKN A;  1LBK A;  4WR5 A;  1NHY A;  2B5E A;  4JR4 A;  5BMU A;  2HI7 A;  2H19 A;  3A3T A;  4ZBD A;  1O8X A;  3M9J A;  1TXU A;  4OMV A;  3EVI A;  1GTI A;  4I97 A;  4QL7 A;  1ZYQ B;  2H6Y A;  5FWG A;  5DCH A;  3RHB A;  5JWQ B;  3M1G A;  2B5Y A;  2H71 A;  3D22 A;  2UV8 G;  3KH7 A;  4I8B A;  1SK2 A;  2YWM A;  1GUK A;  1O7U A;  5AGY A;  3TKP A;  4PQI A;  3DGQ A;  2GZZ A;  2IMD A;  5KN0 A;  2GZY A;  3R2Q A;  3GNJ A;  2HSN A;  3LYP A;  4DSR A;  1GTB A;  2DJ2 A;  1E2Y A;  2HRN A;  4YQU A;  2REM A;  5D8I A;  1V40 A;  2H0G A;  1TU7 A;  3L78 A;  1GUH A;  1VF4 A;  3FZ5 A;  3TKR A;  2DML A;  3CSJ A;  1SK0 A;  1XIY A;  4EF0 A;  1K3L A;  1WRY A;  4CDO A;  3HMJ G;  2FUG 2;  4G01 A;  3IOS A;  3GH6 A;  3TJJ A;  1GSS A;  3LW9 A;  1TK5 B;  4ZIJ A;  1J9B A;  4K1F A;  4Q5F A;  3TKS E;  3GHA A;  4XS4 A;  5CAX A;  4RI7 A;  2A2S A;  3HVX A;  2F3M A;  2HXK A;  3TKQ A;  1OE8 A;  3W8S A;  1TP9 A;  2LUS A;  3GYK A;  2CAQ A;  1PL2 A;  3MYD A;  5DAL A;  2EIQ A;  3F63 A;  3ZYW A;  3IC8 A;  5COH A;  2V41 A;  4JE1 A;  1E6B A;  4KSM A;  4X4J A;  4V2M A;  2OBI A;  2I1U A;  2AYT A;  3ME8 A;  3UBK A;  1AQW A;  2R2J A;  2RLI A;  3GA4 A;  2C3N A;  4ISD A;  1SJI A;  4KF9 A;  2DJ0 A;  2LQO A;  1SD8 A;  3UVT A;  2QC7 A;  4A5P A;  4HU7 A;  2DBC A;  4PQH A;  4ZL7 A;  5DQS A;  2HRK A;  2B1K A;  1F6M C;  1ON4 A;  1TKD B;  5CO3 A;  5D9X A;  3GRX A;  3VI7 A;  2QSI A;  3KEB A;  1UN2 A;  1XFL A;  3TJF A;  4BA7 A;  4KA0 A;  1V2A A;  1V9W A;  1F3B A;  4OO4 A;  2VL3 A;  1JHB A;  2QA2 A;  3K8N A;  3TOT A;  3LXT A;  2F9S A;  3VPQ A;  4BL7 A;  2GSS A;  5H5Q A;  1U3I A;  11GS A;  2KUC A;  2PN8 A;  4L0U A;  3VWV A;  1FB0 A;  2VAF A;  4NXI A;  3HKR A;  3KMO A;  1K0O A;  2C0D A;  3L9V A;  2ES7 A;  4N3Z A;  2HSY A;  3D6I A;  3ZVJ D;  5D93 A;  4POL A;  3TCO A;  3FR9 A;  2L59 A;  2CVK A;  2YJH A;  2ALB A;  4N30 A;  2RUE A;  3ZIT A;  1BG1 A;  1U88 A;  5ELG A;  1SU9 A;  5L71 A;  4QMK A;  4WET A;  1XWA A;  1ZZY A;  5J9C A;  1X5E A;  2HZE A;  1M9A A;  1ZYP A;  2IFQ A;  3DD3 A;  4PNG A;  2ZUP A;  1MTC A;  3KTB A;  4NPB A;  2GQK A;  3E9J B;  4YKF A;  2A2P A;  2O5V A;  2R37 A;  2DKH A;  4K9Z A;  2QKE A;  4ILF A;  2EC4 A;  5LD0 A;  2VIM A;  3VWX A;  2HLS A;  1XZO A;  1M99 A;  2B5X A;  13GS A;  2AB6 A;  5BMU B;  4NHW A;  2LEG A;  2LJA A;  3DRN A;  2FHE A;  1A0F A;  1AXD A;  1ERT A;  1SYR A;  5C04 A;  2IWT A;  3EPT A;  2HRF A;  3QR6 A;  2OAD A;  3TB2 A;  2DJK A;  5G2Z A;  3H93 A;  3O6T A;  2QA1 A;  4TR1 A;  4IQA A;  4QQ7 A;  2YAN A;  2FA8 A;  2R3X A;  4IJ3 A;  2K8V A;  2X49 A;  2K9F A;  2HSN B;  2I81 A;  2CAI A;  2AV4 A;  4AJ8 A;  5IOW A;  3FY7 A;  1PD2 1;  2FA4 A;  3EC3 A;  1YF0 A;  2IL3 A;  2FNO A;  1XVW A;  5IO0 A;  2OE1 A;  4FQU A;  5J47 A;  2IME A;  2YV9 A;  1SKR B;  1TRW A;  1TU8 A;  2JAC A;  3CRT A;  3KP9 A;  4BPY A;  1R26 A;  5ECH B;  2R0G A;  1IYH A;  2OE3 A;  4CY8 A;  5FT3 A;  1W4V A;  3IDV A;  4L5L A;  1QUW A;  2JZS A;  4XS4 B;  2FWH A;  4K5R A;  1ZOF A;  3HA9 A;  2P31 A;  2O8V B;  4K8M A;  4TRX A;  2O85 A;  2HYX A;  5F05 A;  5IPG A;  2GSR A;  3ZRE A;  2GGT A;  4HUA A;  4OFN A;  1T00 A;  3WT2 A;  4AI6 A;  1MDK A;  1OC9 A;  3IAM 2;  1XW9 A;  1SKS B;  3GUS A;  2PBJ A;  1IYI A;  4O92 A;  4LL1 B;  4PNF A;  3LFL A;  3L9U A;  4MDC A;  5JWO B;  2DSA A;  4G0K A;  1GRX A;  2HFD A;  2C3Q A;  1SKW B;  2YCD A;  2MMN A;  4JBB A;  4D73 A;  3QFB C;  1R4W A;  1BG5 A;  8GSS A;  3TGZ A;  4G19 A;  1AQX A;  4CHS A;  2YPM A;  2WB9 A;  4EDY A;  4H86 A;  2R4V A;  2L4C A;  3A2X A;  1XW5 A;  1EGR A;  2VCW A;  1SJ6 A;  1WWJ A;  3CWG A;  1GNW A;  4FO5 A;  2LNS A;  2HRK B;  1AUC A;  4GST A;  3MNG A;  2XBQ A;  3WGD A;  2CVB A;  1Z6M A;  3FYG A;  3I9V 2;  2C80 A;  5IO2 A;  1PL1 A;  3F0I A;  4ZB9 A;  3F8U A;  1YDK A;  1XWG A;  3C1S A;  5KOX A;  3UL3 A;  4BL7 B;  3QFA C;  5G30 A;  2FY6 A;  4L8E A;  4V1A p;  1T3B A;  2VCX A;  2EIO A;  4YH2 A;  1ERU A;  4AKX B;  2Z9S A;  5A4U A;  1GLP A;  2AAW A;  1QMV A;  2E2M A;  2LJR A;  3GKM A;  4K2X A;  1UVZ A;  3TU3 B;  1JZR A;  3IRA A;  3TKS C;  1LJR A;  3KP8 A;  3VLN A;  2H01 A;  2PUK C;  3W8J A;  1FW1 A;  4E8H A;  3HZ4 A;  4MCU A;  4JU5 A;  2OE0 A;  5B7C A;  4IBP A;  2H0H A;  1T1V A;  3HJM A;  1UC7 A;  5B6M A;  3ERG A;  4Z2R A;  1WJK A;  4KSO A;  1I5G A;  2IFQ B;  1OVN A;  5H5R A;  1HYU A;  4ID0 A;  1ERW A;  3A2V A;  1WE0 A;  5GST A;  3ZML A;  1BX9 A;  1YY7 A;  3GSS A;  1O8W A;  1HNB A;  4POM A;  3F6D A;  4KCE A;  2YV7 A;  4GRF A;  3TRX A;  3J7Y k;  4PUF C;  5G31 A;  4TXO A;  1K0M A;  1ST9 A;  3TKS A;  2G2Q A;  1HNC A;  3PGT A;  2KP1 A;  1QFN A;  2E7P A;  2X8G A;  2GT6 A;  1OKD A;  1VF1 A;  3PPU A;  1ACV A;  4KW6 A;  3QAW A;  3GST A;  1QK8 A;  2R0C A;  2MMO A;  3EMX A;  3MWH A;  1TRS A;  1X9M B;  2P5R A;  4IP1 A;  4TR1 B;  2N5F A;  1ABA A;  1B9Y C;  3DEX A;  1V57 A;  4IVF A;  2WDU A;  3PR8 A;  3HHV A;  2PU9 C;  1PMT A;  1BYE A;  5IIZ A;  4GF0 A;  1TTZ A;  1Z3E A;  2JZR A;  3FZ4 A;  2LV3 A;  1VF3 A;  2NVL A;  5IPH A;  1A24 A;  4FH8 A;  1W89 A;  2FCH A;  4GWR A;  4PX1 A;  3UEM A;  4OCF A;  1PX6 A;  5HR0 A;  2C4J A;  5DJL A;  3GV1 A;  1UA5 A;  1YQ1 A;  1XWB A;  2XBI A;  1ZGN A;  5J41 A;  3F3Q A;  4L0W A;  4G0I A;  3LWA A;  3KGK A;  4GQC A;  2VOC A;  1N25 A;  3CMI A;  1USB A;  3NIV A;  2WJU A;  3KXO A;  5BRT A;  1T8E B;  5JCU A;  3H4K A;  4TW5 A;  4GCI A;  1VGL A;  3TJG A;  4EDZ A;  2DIY A;  1SVO A;  1X5D A;  3HCZ A;  1J0F A;  3G7I A;  4ECB A;  1YKC A;  4O7H A;  1TI1 A;  5INY A;  1OC9 B;  4EO3 A;  5DCG A;  6GSU A;  5E59 A;  3N5O A;  5CRG A;  1XWK A;  2RM6 A;  4ECJ A;  1A8Y A;  1K0A A;  1TW9 A;  22GS A;  2EFC A;  1XOA A;  1OYJ A;  3C7M A;  3HZ8 A;  1XXU A;  4D73 B;  2O7K A;  5D9V A;  3CSI A;  4K7I A;  3MSZ A;  1KTE A;  3LXZ A;  1FVK A;  4MK3 A;  4YQM A;  3C71 A;  5KN2 A;  3FZA A;  2V6K A;  1RQM A;  3QMX A;  1YEX A;  4ZIL A;  4IKH A;  1GSQ A;  1KBN A;  3GIX A;  3TRQ A;  4F0B A;  4IHU A;  5ECN B;  5D9T A;  2VUP A;  3LGC A;  5C00 A;  1EP8 A;  1ZYN A;  2H73 A;  1SD9 A;  4KGI A;  1FHE A;  5HFK A;  1TRU A;  1GUL A;  1GSF A;  5KN3 A;  5KEJ A;  1C72 A;  1XCC A;  3ZZX A;  2H76 A;  3EYT A;  1U6T A;  1JFU A;  3ZFL A;  2L6C A;  2GST A;  1G6Y A;  1GTU A;  3UMA A;  4EL1 A;  4N11 A;  5LNK e;  5EPF A;  3EE2 A;  1PKZ A;  4N0Z A;  1PN9 A;  2MZC A;  5IMF A;  1SK1 A;  4YQV A;  3PH9 A;  3Q18 A;  1A2J A;  2C0G A;  1M2A A;  4AF2 A;  1ILO A;  4WXT A;  2YN1 A;  3EMP A;  3EIN A;  2AHE A;  12GS A;  1M9B A;  2RM5 A;  1S3A A;  1SL2 B;  3CRU A;  5J40 A;  3LJR A;  1B8X A;  1N2A A;  3BBY A;  3HJO A;  2N5B A;  1Y1U A;  1FAA A;  4JED A;  1X9W B;  3M0F A;  3KJY A;  4KCA A;  6GSX A;  2MBS A;  3GN3 A;  2I9H A;  3ZVJ A;  2PVO C;  2VLV A;  3KCM A;  1EV9 A;  1Z6N A;  4ZL8 A;  4TXO B;  3G7J A;  4O5R A;  4IEL A;  2HT9 A;  4KAE A;  1X0R A;  6GSW A;  3FEU A;  5IMA A;  3F4R A;  1TDI A;  3CTG A;  4ML6 A;  3GMF A;  2MBT A;  2L5L A;  3VWU A;  3L4N A;  1CQG A;  3I6A A;  5D73 A;  4DSS A;  5A4V A;  3DWV A;  3GKK A;  2HRA A;  4EIP A;  2PWJ A;  4EE0 A;  2JU5 A;  4MZB A;  4WR4 A;  2B3S A;  1QXH A;  2E2G A;  3C1R A;  1WPI A;  1Y6E A;  5IQY A;  4OD7 A;  2YZH A;  4E68 A;  1VF2 A;  1BF5 A;  1WOU A;  3KZQ A;  2J9H A;  2OBK A;  1ML6 A;  1PKW A;  4PUR A;  3C73 A;  2HQT A;  4G9H A;  4PGT A;  3M8N A;  3IHQ A;  5D96 A;  2IMK A;  1S3C A;  1B4Q A;  1NSW A;  2JSY A;  1YF1 A;  2LRC A;  3P8W A;  4HJM A;  2OT3 A;  4EC0 A;  4I2T A;  2GQL A;  3GKX A;  4NHZ A;  3QDN A;  2NPB A;  1GWC A;  4N0V A;  4WF4 A;  2IIY A;  1YJ6 A;  3P2A A;  4Q5R A;  1YZX A;  3UOM A;  4O32 A;  1GP1 A;  2DJ3 A;  4IS0 A;  4NWY A;  2H1D A;  5EVO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...