3VWXA

Structural analysis of an epsilon-class glutathione s-transferase from housefly, musca domestica
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
218
structure length
218
Chain Sequence
KLVLYGIDPSPPVRACLLTLKALNLPFEYKVVNLFAKEHLSEEYLKKNPQHTVPTLEEDGHLIWDSHAIMAYLVSKYGKDDSLYPKDLLKRAVVDQRMYFEAGVLFQGGLRNITAPLFFRNQTQIPQHQIDSIVESYGFLESFLKNNKYMAGDHLTIADFSIVTSVTSLVAFAEIDQSKFPKLSAWLKSLQSLPFYEEANGAGAKQLVAMVKSKNLTI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione s-transferase 6B
publication title Structural analysis of an epsilon-class glutathione transferase from housefly, Musca domestica
pubmed doi rcsb
source organism Musca domestica
total genus 83
structure length 218
sequence length 218
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2012-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3vwxA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3vwxA01
2WS2A 3EU3A 4NMUA 2HYXA 2FWFA 1TRWA 1MD3A 4WBJA 4OFTA 5FWGA 5DAKA 2B5YA 3G7JA 4HJ2A 4NXIA 1Z9HA 2YOIA 5C00A 2C3TA 4CW9A 4WF4A 2FA4A 1M2BA 5GAND 3S9FA 5G5EA 1XWGA 4TR4A 4OFNA 4QL7A 3M8NA 4ECJA 1OC9A 4IP1A 3M9JA 1AW9A 1GTUA 2DJ1A 1U3IA 2RLIA 2HLSA 1T4ZA 2ZNMA 2MMOA 2GVPA 1GSUA 1H75A 3FZ9A 1OVNA 4DVCA 1G7EA 3A2XA 3HJMA 3C1RA 3D6IA 5COHA 8GSSA 1GSSA 2H73A 3ZIVA 5H5QA 4WR4A 1GUKA 4EF0A 1AQVA 2BTOT 16GSA 2H19A 4WKWA 4PUAA 2I9HA 2LRNA 4USSA 1YKAA 2K6VA 1SJZA 2HRFA 3KCMA 3LYKA 2OA7A 3GTUB 5ID2B 3US3A 2F8FA 1MDJA 1OE8A 1ST9A 3WGEA 3GUSA 4YQUA 1C72A 2AV4A 4FH8A 4IJ3A 4MZWA 1PGTA 4PQIA 2H70A 19GSA 1GTBA 2FD3A 6GSXA 1Z6MA 2PPTA 3U5RE 5IM9A 3ZYWA 2X8HA 2E2GA 5HR1A 3FZAA 3GKKA 4PTSA 1SJ6A 1X0RA 5ECOB 2MMAA 2VL2C 1N8JA 2MMNA 4KSOA 3W8SA 2TRXA 5A4VA 2OKAA 4HU9A 3E9JB 3M1GA 3RDWA 1MDKA 1XWKA 1V57A 4K8MA 4MJEA 3ZMLA 1ML6A 3RHCA 3TUEA 1YDKA 2DJ2A 5DDLA 3CSJA 1PSQA 2Z9SA 2XBIA 1BX9A 2DSAA 2HFDA 1YJ6A 5HR3A 1MD4A 2N5FA 1ILOA 5KN2A 2A2SA 3EYTA 4OCEA 3LGCA 3TKSA 1J9BA 1BYEA 2IPAA 3A2WA 4X0XA 4G2EA 1ZL9A 3IK7A 4JZQA 3DEXA 4NHWA 1XW5A 2C8UA 5CRDA 5CNWA 2DC5A 5CP1A 1A8LA 1G7OA 4HQZA 4ECCA 3IAM2 4KA0A 1I5GA 2CVBA 1HYUA 2LRCA 5CYYA 4ACSA 1PQNA 1ZZYA 4AJ6A 4XS4B 3KMNA 4XIHA 4MF7A 3GKXA 4OFMA 4MCUA 3TDGA 2GSTA 5ECIB 3GX8A 4GRFA 2RIIA 2H30A 4EVMA 5IMCA 4F2IA 3R2QA 4IGJA 1JFUA 4BVYA 1LU4A 2JSYA 3TJJA 3WYWA 2OACA 2PVOC 3TOTA 3UBKA 1BJXA 2VLUA 4DSSA 1K0OA 3Q74A 1V2AA 2VM2A 3IAS2 4J56E 4GSSA 3F8UA 6GSTA 2A4VA 1F3AA 1XCCA 3LG6A 2OE0A 2HZFA 1FO5A 5KN0A 1GH2A 3J7Yb 1VF4A 3KTBA 1RK4A 2AJQB 1ERUA 2VD0A 2BJXA 3KGKA 1TK0B 4TR0A 1AQWA 3MAKA 4N10A 4ZB9A 3D5JA 1XOBA 3UVHA 3ZIJA 5GAPD 4Q5RA 3EINA 2OBKA 2C80A 4NWYA 1TU7A 3N9JA 3VWXA 3NZNA 2VCZA 1TW9A 4LL1B 4K2DA 2YZHA 4QL9A 5DALB 3KJYA 2CQ9A 1WOUA 4PUFC 2HSMB 4I8BA 4D73A 4TRXA 5GZZB 3SBCA 4FQUA 2VL2A 1YY7A 5ECKB 2L5LA 1XWBA 1ZOFA 5EVOA 1AXDA 2DJ0A 3BCIA 3D22A 5DJLA 4Q5NA 5B8AA 1JZOA 5H5RA 3HZ4A 3CTGA 2LNTA 3PINA 2N5BA 4POMA 2LJAA 1T8EB 1GSFA 1OKDA 3IHQA 3GX0A 3H4KA 4G10A 4GF0A 1SK0A 4ZIJA 3QCPA 2YWMA 3ERWA 3FR3A 1CQHA 2H0HA 1TKDB 4IN0A 2H6ZA 4KF9A 2LQQA 3ED3A 4NPBA 3DWVA 1ZYEA 20GSA 1B48A 1EP7A 2ZCTA 6GSWA 1GLPA 3CRTA 3GHAA 2IMFA 1TK8B 5DQSA 3HYPA 1DSBA 4EDZA 1K3LA 1A2JA 2WCIA 3FRCA 1IYHA 3DMLA 3KP8A 2RUEA 2I3YA 5H5SA 2C4JA 3IOSA 5ABRA 2O87A 1GUHA 1F3BA 3D4TA 4JE1A 2H76A 4L5OA 2RM5A 3I9V2 4IS0A 2LTKA 4I6XA 1EOHA 3KM6A 1GWCA 2PGTA 3GL3A 3UOMA 2LEGA 6GSVA 3Q18A 1GLQA 3Q19A 1PN9A 4F0BA 3ISOA 1SJIA 3GL5A 3HJOA 4ZBAA 1JLWA 1U87A 5DVBA 1PX7A 4PXOA 1X9WB 1TU8A 3A2VA 1B9XC 3Q6OA 4HUAA 4KCEA 3F9UA 1SL2B 2L6CA 4OMVA 1OE7A 1Q4JA 1XVWA 2VO4A 3GTUA 3F4TA 1YEXA 5IIZA 5ID2A 5B6NA 2ZUPA 1TOFA 4YQVA 4POLA 1XZOA 3KH7A 4J57E 2KOKA 3KH9A 2QSIA 5JCUA 2HZEB 4LA1A 2PN8A 1PL1A 2KP2A 2V6OA 3GSTA 3IBHA 1WMJA 5B8BA 4GWRA 1K0DA 4KNDA 1T4YA 3VURA 2B7KA 2KP1A 5AISA 2F51A 2HRKA 5ELGA 3QFAC 3P8WA 3DGQA 4WBRD 1SYXA 2VLVA 1VGLA 2H0IA 3ERGA 2XPEA 1TK5B 4AJ7A 1XWCA 18GSA 3IA1A 5CO3A 2NBSA 5A5KA 2HQTA 3TKSC 1K3YA 2GSSA 5J9BA 1OAZA 4FIWA 4BWQA 2M46A 4JU5A 3VWWA 2DIYA 4IKHA 1FOVA 1V58A 4XRDA 2OADA 4ML1A 4V1Ag 2PERA 2YZUA 4ZILA 2R2JA 1ERVA 3DYRA 3H1NA 5G5FA 4ZL9A 2R6KA 5IMZA 4ZB8A 1J08A 3LXTA 1A2LA 2O7KA 3TJBA 1USBA 1WIKA 1S3AA 1Z5YE 1KEBA 3VPQA 2X8GA 4KB3A 2NDOA 2PUKC 3WD6A 4EC0A 4NV5A 3C7MA 4RI7A 1XVQA 4Z7XA 4XS4A 1YZXA 4MPGA 4G9HA 4MH2A 1PMTA 4AJ8A 4MP4A 3HHVA 2FLSA 1THOA 2YJ7A 1GTAA 1HNAA 1BEDA 4K7NA 3BOAA 4DSQA 13GSA 5G2ZA 1TI1A 4K7OA 3EWLA 2IJYA 3VWVA 3LWAA 3VI7A 1XWAA 4MPFA 1EEJA 4ZL8A 3TRQA 2GQKA 2CVKA 2R4VA 1GTIA 3O76A 3DD3A 2XPDA 2DMLA 1UC7A 3CMIA 1O8WA 1A0FA 3FK8A 5A4WA 4MH3A 1KNGA 2L57A 3OR5A 4TOPA 1DE2A 3FKFA 4PX1A 2I81A 4O7HA 2FWEA 4XCSA 1F9MA 4TR1B 2DJKA 2AB6A 2RM6A 3WT2A 1MTCA 4LLRA 2V32A 3KEBA 2BMXA 2V2GA 2VD1A 3H79A 4MLYA 2CX3A 3L78A 1XW9A 3ZLPA 1ZYQB 2YWOA 4HZ2A 2IMEA 2G2QA 1DE1A 2VCQA 3TB2A 1E2YA 4IVFA 4KSMA 2GZZA 3TKPA 4GQFA 2MZCA 1Z7PA 1PKWA 1T00A 1B8XA 3ZFLA 1URMA 5IMDA 5FT3A 3FY7A 2HSMA 4K6XA 4FYUA 3E3EA 5G30A 10GSA 3K8NA 2MBSA 2PVQA 4P3YB 2WB9A 5A4UA 1A2MA 2CX4A 2NVLA 4IP6A 1FB0A 5J3RA 2H8LA 3ERFA 1T7PB 3FYGA 1AIUA 2PU9C 2H0GA 3LJRA 2HRAA 2C0GA 3C8EA 2FGXA 4ECIA 5JWRB 2A2RA 2JACA 1GSQA 2LV3A 1FVJA 1LJRA 5FHIA 2V41A 2V6KA 5ECRB 4MZCA 4POKA 1BQ7A 2B1LA 1YKCA 4L8EA 1EP8A 4G0IA 3GKNA 1YEPA 6GSYA 2LNSA 5CRWA 4NHZA 3HVVA 5HFGA 4BA7A 2TRCP 4RI6A 2MYGA 1SL1B 4ZB6A 2C1YA 3FR9A 3EU4A 2IWTA 12GSA 5AN1A 1R7HA 5GSSA 1V40A 1EEMA 2IFQB 3IC8A 2K18A 2D2ZA 3ZZXA 4I2TA 3GFKA 3DKSA 4HQSA 4MJCA 4GLTA 1F6MC 2K8SA 1Q98A 9GSSA 5D73A 3FZ5A 4MMMA 4JBBA 3VLNA 3UEMA 2YWIA 3ZREA 4WR5A 3CSHA 2P0GA 2CT6A 1GULA 1T3BA 1SK2A 4JEDA 4EUYA 3C73A 1YQ1A 4YAPA 2VLTA 4EE0A 4F0CA 4H86A 5ECNB 1QFNA 2REMA 3R3EA 4GCIA 4GSNA 1JZDA 1EV9A 3TKSE 5IQYA 3HCZA 1OC3A 3PH9A 1TRVA 2JZSA 3DVWA 5J9CA 1K0BA 4QQ7A 2R3XA 1THXA 2CV4A 2J9HA 5DBQA 3W6GA 4TXVA 4TR3A 5ECMB 4YAVA 2P31A 3HVXA 3EC3A 3QPMA 3UMAA 3P90A 4PNFA 3GYKA 2VOCA 2HZEA 2OE1A 4IHUA 5CAXA 2CZ3A 2E0QA 1VF2A 3N5OA 5ECLB 2B1KA 2FWGA 2VCXA 2VUPA 1U6TA 4IW9A 1KBNA 2QKEA 1B4PA 2VCVA 3IE3A 4LL4B 3P2AA 5ENUA 1V9WA 1GSEA 3NOFA 3QAGA 3VI5A 5DJMA 2CA8A 4Q5FA 1ABAA 1S3CA 3DXBA 5HR0A 2R5GA 2DJJA 2OBIA 1MEKA 2GT6A 2L4QA 4MDCA 3UVTA 4E8HA 3GURA 2FUG2 3ZL5A 3L0HA 1G0TA 1GSDA 5EL8A 3TKQA 3QR6A 1F2EA 3CXGA 4RUVA 3VFIA 3ME8A 3CBUA 4G0KA 3F6FA 5F0GA 2V1MA 3ZITA 3MDKA 5B6MA 3CSIA 1HNBA 2LJKA 2YV9A 4YH2A 3KIJA 2XHFA 2CZ2A 3F4RA 1AAZA 5G1KA 3LEFA 2LQOA 2JZTA 4TN8A 2GZPA 4I2UA 1AC1A 2H71A 1GL8A 4HJMA 3GKMA 5D9TA 1Z7RA 1E6BA 2H66A 3RAZA 1EGOA 3AY8A 5IO0A 3C1SA 3GIXA 5HFIA 4MJBA 3J7Yk 1UN2A 1OKTA 1HQOA 4IQ1A 1XW6A 4V2MA 4L0UA 1B9YC 4HI7A 1DBYA 4JR6A 4XS1A 5G1LA 5IO2A 1ZGNA 3F4SA 1M9AA 5IMAA 4POBA 5G31A 1XXUA 4ML6A 1O81A 4HS1A 4ULXA 2MMZA 1HD2A 4GSTA 2GGTA 2VAFA 3UIWA 3LYPA 1YF0A 4KDYA 2GT5A 4MZBA 1SKWB 4K1FA 4XS6A 3ZTLA 3I6AA 3IC4A 3LORA 5ECSA 4HDEA 2GTUA 3BD2A 2L59A 2JZRA 4ILFA 1M99A 3FR6A 3O6TA 2YN1A 4I5QA 5J41A 1SK1A 5IMFA 1WP0A 4TXOB 2P5QA 2B5XA 4HEA2 1UA5A 4TR1A 2OE3A 4EKZA 2QGVA 4LMVA 4O32A 5JWQB 2YANA 4PURA 2AYTA 3NIVA 3ZMKA 5D8IA 3EMXA 4ECBA 1WWJA 2C0FA 1SKRB 3TGZA 5KEJA 4EXJA 3TJFA 2AUVA 4PQHA 3GSSA 2IIYA 5J4UA 2I1UA 1TP9A 3GH6A 5ELAA 5BMUA 3BBYA 5ECPB 1FW1A 2FNOA 5D93A 2C3NA 1QGVA 4DSRA 3FW2A 3PGTA 4D73B 1N2AA 4K9ZA 3RBTA 3VK9A 5D9WA 3RPNA 1TDIA 5J5NA 3F0IA 4L0WA 2WDUA 1QUWA 4DEJA 4ZL7A 1B4QA 3QD9A 3FEUA 3QDNA 1U3AA 2YPMA 1VF3A 2WJUA 1R4WA 2H74A 3UL3A 3M0FA 3RHBA 3TRXA 1LBKA 2LS5A 1F37A 3TKRA 3TOUA 2HXKA 1JHBA 2DJ3A 4N0VA 1M9BA 1MDIA 2LUSA 4NAXA 2VCTA 4E8EA 1O73A 2E7PA 2H1DA 2IL3A 5F05A 2CVDA 2FCHA 5IOXA 1SD8A 1K0NA 1GSYA 3GH9A 1K0AA 3HZ8A 2I4AA 1O8XA 1PL2A 1TRUA 2H1BA 1G6YA 1TI3A 2KLXA 4JRRA 1DUGA 4FYBA 4KX4A 3GV1A 4BL7B 4OO5A 4O92A 1RW1A 3HDCA 4ZXGA 2HE3A 2WRTA 4IBPA 4IJIA 3ZRDA 2L4CA 3SWLA 5DCGA 3IR4A 2WFCA 5B7CA 2H6YA 2IFQA 5CRHA 1KTEA 2LKUA 5D9VA 1R5PA 1XBSA 4YQMA 5EPFA 2QC7A 2PBJA 5JCGA 2VCWA 4Q5QA 2LSTA 3M3MA 3F3QA 5CRGA 3BJ5A 5E4WA 4LMWA 3HD5A 4RQXA 2H75A 4BPYA 5INYA 1O85A 3TCOA 5L71A 2ES7A 3L9VA 3D4MA 2PMTA 1SU9A 4GTUA 1QK8A 5LD0A 5HR2A 2GQMA 2YJHA 3H8QA 2B6MA 17GSA 2YWNA 3G7YA 5DCHA 1X9SB 4EDYA 3A5WA 3E0UA 4PGTA 4L5LA 4BVXB 3HJPA 3VPTA 2DMMA 3GRXA 3KD0A 2E2MA 1RQMA 3L9UA 1FHEA 1Z3EA 1GRXA 4ISDA 5IOWA 2F9SA 5AIVA 5F07A 2YCDA 3KTLA 2HRKB 5DALA 3D0ZA 1EWXA 1S3DA 3QAWA 4V2NA 5IPHA 2OJLA 5AIXA 2UZ8A 2CAQA 4ZBDA 3LSZA 4F9ZA 1TTZA 1X5EA 2PWJA 1R5AA 1UVZA 2O85A 2GQLA 3APSA 1VRSD 2M80A 2GSQA 2JL4A 3F6DA 1A24A 3FHKA 2IMDA 3HKRA 1ZCPA 1FVKA 1ACVA 1V98A 2KHPA 3UJ1A 1NHYA 2GLRA 1GNWA 22GSA 2WULA 2LRTA 2FWHA 3CYNA 2EIRA 1K0MA 3PPUA 2GS3A 3ZVJD 2N5AA 2JADA 2H01A 4N11A 3BCKA 2O89A 3KXOA 5DAKB 1O6JA 2K8VA 1BG5A 1SL0B 2F3MA 1QQ2A 4JR4A 5F8BA 1A8YA 4K0NA 4XTSA 2HSNB 1R26A 1SENA 4FO5A 1H4OA 2C0DA 4HU7A 1PX6A 1OC9B 3LQ7A 1XOAA 4G0LA 3WGXA 2NPBA 2KUCA 4KDUA 3GNJA 1X9MB 3IV4A 2O8VB 1VF1A 1AQXA 1OYJA 2HSYA 1W4VA 1SKSB 4KAEA 1TXXA 3EURA 4V2LA 3F3RA 2YNXA 3G9BA 3TJGA 3HY2A 1WE0A 1IYIA 2M72A 2F8AA 3LFLA 3DRNA 5DQYA 2L6DA 4OO4A 4WETA 5CREA 2DIZA 3G7IA 3APOA 4WF5A 1WJKA 4MABA 3L9SA 3V1WA 4J2FA 5IPGA 2ALBA 1TRSA 4ID0A 3RPPA 1QXHA 1Y6EA 4GQCA 3ZVJA 3HVSA 2X8CA 5ECQB 2X64A 2HNLA 1G6WA 1FG4A 1WRYA 1A23A 3QMXA 3TJKA 5KN3A 4OCFA 4KE3A 2L5OA 5ECHB 4NV2A 2VL3A 2R37A 3EVIA 3I43A 1SYRA 3IPZA 4X1UA 4TXOA 1W89A 5HQPA 3P7XA 5JCWA 2ON5A 1YF1A 5HFKA 1K3OA 5D9XA 1ERWA 4MA9A 3QAVA 2AAWA 4N30A 4BWSA 1ON4A 3MNGA 2MBTA 5LNKe 2HRNA 1PRXA 1ZMAA 3TRPA 2IN3A 3O3TA 2B7JA 1CQGA 4MF5A 4G19A 1J0FA 2HI7A 1XPVA 3IRAA 1EZKA 2B5EA 2AHEA 14GSA 4V1Ap 2FA8A 4KDXA 3VWUA 1GP1A 1X5DA 11GSA 2J23A 3M9KA 2HT9A 3KP9A 4F82A 1QMVA 3F63A 1M7TA 3W8JA 2P5RA 3ME7A 3IK9A 4MK3A 1GUMA 1I9DA 1Z6NA 4WEYA 4KUNA 5F06A 3EE2A 4GXZA 2G0FA 4EO3A 1JLVA 3KMOA 4OD7A 3APQA 1A0RP 1NHOA 3I69A 2IMIA 5IMVA 2VIMA 4IELA 1ERTA 2RUFA 3LXZA 3D21A 5EY6A 3H93A 3A3TA 2XBQA 4KH7A 4O5RA 1Y25A 3UARA 1PD21 3C71A 1K0CA 2VL9A 2CAIA 1PKZA 5GSTA 3QFBC 4N0ZA 3WGDA 2B3SA 3L4NA 1FB6A 3CRUA 1XFLA 1TJDA 2VM1A 3UBLA 3IXRA 4BVYB 1NW2A 4BL7A 3JCML 4EL1A 1U88A 1NSWA 3DIEA 2EIQA 4KCAA 1AUCA 5JWOB 4WXTA 2DBCA 2XC2A 2JSZA 2K9FA 1XIYA 1WPIA 4KGIA 4F03A 4DSSB 4IQAA 1EV4A 4RQRA 4MJAA 2EC4A 3U6VA 2H72A 2EIOA 3HA9A 6GSSA 3IDVA 2FHEA 1JZRA 4HZ4A 1X5CA 1HNCA 5AGYA 2FY6A 4HOJA 5E59A 1PA3A 4TVEA 3FZ4A 2H1GA 3KZQA 4PQ1A 4MF6A 3WT1A 1JZWA 1OC8A 4I97A 2C3QA 1BAYA 5C04A 1SD9A 2HSHA 3QOUA 2GZYA 4KW6A 1FAAA 2YP6A 5LCZA 2JU5A 3PR8A 1T1VA 1M0UA 4TKYA 3DVXA 5D96A 2WZ9A 4OWYA 3MWHA 4XHMA 4TW5A 4XRAA 4BVXA 1GNEA 2X99A 4K7IA 2WGRA 5KN1A 3GN3A 2GSRA 1EOGA 3GMFA 4X43A 4AF2A 2GDRA 3HXSA 4CHSA 4PNGA 1EGRA 4ZBBA 1NM3A 2H6XA 4K0GA 1M2DA 2NTOA 2C0EA 4FYCA 6GSUA 3UAPA 3GA4A 2H1AA 7GSSA 2TIRA 1M2AA 3CTFA 2ON7A 4AGSA 2DLXA 3ZFBA 4CDOA 2IMKA 3EMPA 2LJRA 2YV7A 3MSZA 1O7UA
chains in the Genus database with same CATH superfamily
2WS2A 3EU3A 4NMUA 2HYXA 2FWFA 1TRWA 1MD3A 4WBJA 4OFTA 5FWGA 5DAKA 2B5YA 3G7JA 4HJ2A 4NXIA 1Z9HA 2YOIA 5C00A 2C3TA 4CW9A 4WF4A 2FA4A 1M2BA 5GAND 3S9FA 2O36A 5G5EA 1XWGA 4TR4A 4OFNA 4QL7A 3M8NA 4PHZC 4ECJA 1OC9A 4IP1A 3M9JA 1AW9A 4K2XA 1GTUA 2DJ1A 1U3IA 2RLIA 2HLSA 1T4ZA 2ZNMA 2MMOA 2GVPA 1GSUA 1H75A 3FZ9A 1OVNA 4DVCA 1G7EA 3A2XA 3HJMA 3C1RA 3D6IA 5COHA 8GSSA 1GSSA 2H73A 4X4JA 5H5QA 3ZIVA 1SVLA 4WR4A 4MNNA 1GUKA 4EF0A 1AQVA 2BTOT 16GSA 2H19A 4WKWA 4PUAA 2I9HA 2LRNA 4USSA 1YKAA 2K6VA 1SJZA 2HRFA 3KCMA 3LYKA 2OA7A 3GTUB 5ID2B 3US3A 2F8FA 1MDJA 1OE8A 1ST9A 3WGEA 3GUSA 4YQUA 1C72A 2AV4A 4FH8A 1FOHA 4IJ3A 4MZWA 1PGTA 4PQIA 2H70A 2H1LA 19GSA 1GTBA 2FD3A 6GSXA 1Z6MA 2PPTA 3U5RE 5IM9A 3ZYWA 2X8HA 2E2GA 5HR1A 3FZAA 3GKKA 4PTSA 1SJ6A 1X0RA 5ECOB 2MMAA 3MIXA 2WVXB 2VL2C 1N8JA 4AKXB 4GDFA 2MMNA 4KSOA 3W8SA 5J4YA 2TRXA 5A4VA 2OKAA 4HU9A 3E9JB 3M1GA 3RDWA 1MDKA 1XWKA 1V57A 4K8MA 4MJEA 3ZMLA 1ML6A 3RHCA 1Y1UA 1YDKA 3TUEA 2DJ2A 5DDLA 3CSJA 1PSQA 2Z9SA 2XBIA 1BX9A 2DSAA 2HFDA 1YJ6A 5HR3A 1MD4A 4EIPA 2N5FA 1ILOA 5KN2A 2A2SA 3EYTA 4OCEA 3LGCA 3TKSA 1J9BA 1BYEA 2IPAA 3A2WA 4QMKA 4X0XA 4G2EA 1ZL9A 3IK7A 4JZQA 2A2PA 3DEXA 4NHWA 1XW5A 2C8UA 5CRDA 5CNWA 2DC5A 5CP1A 1A8LA 1G7OA 4HQZA 4ECCA 3IAM2 4KA0A 1I5GA 2CVBA 1HYUA 2LRCA 5CYYA 4ACSA 1PQNA 1ZZYA 4AJ6A 4XS4B 3KMNA 4XIHA 4MF7A 3GKXA 4OFMA 4MCUA 3TDGA 2GSTA 5ECIB 3GX8A 4GRFA 2RIIA 2H30A 4EVMA 5IMCA 4F2IA 3R2QA 4IGJA 1JFUA 4BVYA 1LU4A 2JSYA 3TJJA 3WYWA 2OACA 2PVOC 3TOTA 3UBKA 1BJXA 2VLUA 4DSSA 1K0OA 3Q74A 1V2AA 1SVMA 2VM2A 3IAS2 4J56E 4GSSA 3F8UA 6GSTA 2A4VA 1F3AA 1XCCA 3LG6A 2OE0A 2HZFA 1FO5A 5KN0A 1GH2A 3J7Yb 1VF4A 3KTBA 1RK4A 2AJQB 1ERUA 2VD0A 2BJXA 3KGKA 1TK0B 4TR0A 1AQWA 2O3EA 3MAKA 4N10A 4ZB9A 3D5JA 1XOBA 3UVHA 3ZIJA 5GAPD 4Q5RA 3EINA 2OBKA 2C80A 4NWYA 1TU7A 3N9JA 3VWXA 3NZNA 2VCZA 1TW9A 4LL1B 4K2DA 2YZHA 4QL9A 1BG1A 5DALB 3KJYA 2CQ9A 1WOUA 4PUFC 2HSMB 4I8BA 4D73A 4TRXA 5GZZB 3SBCA 4FQUA 2VL2A 1YY7A 5ECKB 1YVLA 2L5LA 1XWBA 1ZOFA 5EVOA 1AXDA 2DJ0A 3BCIA 3D22A 5DJLA 4Q5NA 5B8AA 1JZOA 5H5RA 3HZ4A 3CTGA 2LNTA 3PINA 2N5BA 4POMA 2LJAA 1T8EB 1GSFA 1OKDA 3IHQA 3GX0A 3H4KA 4G10A 4GF0A 1SK0A 4ZIJA 3QCPA 1N25A 2YWMA 3ERWA 3FR3A 1CQHA 2H0HA 1TKDB 4IN0A 2H6ZA 4KF9A 2LQQA 3ED3A 4NPBA 3DWVA 1ZYEA 20GSA 1B48A 1EP7A 2ZCTA 6GSWA 1GLPA 3CRTA 3GHAA 2IMFA 1TK8B 5DQSA 3HYPA 3EPTA 1DSBA 4EDZA 1K3LA 1A2JA 2WCIA 3FRCA 1IYHA 3DMLA 3KP8A 2RUEA 2I3YA 5H5SA 2C4JA 3IOSA 5ABRA 2O87A 4EIQA 1GUHA 1F3BA 3D4TA 4JE1A 2H76A 4L5OA 2RM5A 3I9V2 4IS0A 2LTKA 4I6XA 1EOHA 3KM6A 1GWCA 2PGTA 3GL3A 3UOMA 2LEGA 4K5RA 6GSVA 3Q18A 1GLQA 3Q19A 1PN9A 4F0BA 3ISOA 1SJIA 3GL5A 3HJOA 4ZBAA 1JLWA 1U87A 5DVBA 1PX7A 4PXOA 1X9WB 1TU8A 3A2VA 1B9XC 3Q6OA 4HUAA 4KCEA 3F9UA 1SL2B 2L6CA 4OMVA 1OE7A 1Q4JA 1XVWA 2VO4A 3GTUA 3F4TA 1YEXA 5IIZA 5ID2A 5B6NA 2ZUPA 1TOFA 4YQVA 4POLA 1XZOA 3KH7A 4J57E 2KOKA 3KH9A 2QSIA 5JCUA 2HZEB 3LW9A 2PN8A 4LA1A 1PL1A 2KP2A 2V6OA 3GSTA 3IBHA 4YKFA 1WMJA 5B8BA 4GWRA 1K0DA 4KNDA 1T4YA 3VURA 4AKHA 2B7KA 2KP1A 5BRTA 3HMJG 5AISA 2F51A 2HRKA 5ELGA 3QFAC 3P8WA 3DGQA 4WBRD 1SYXA 2VLVA 1VGLA 2H0IA 3ERGA 2XPEA 4CY8A 1TK5B 4AJ7A 1XWCA 2VKZG 18GSA 1S3RA 3IA1A 5CO3A 2NBSA 5A5KA 2HQTA 3TKSC 1K3YA 2GSSA 5J9BA 1OAZA 4FIWA 4BWQA 2M46A 4JU5A 3VWWA 2DIYA 4IKHA 1FOVA 1V58A 4XRDA 2OADA 4ML1A 4V1Ag 2OT3A 2PERA 2YZUA 4ZILA 2R2JA 1ERVA 4PI0C 5J40A 3DYRA 1BF5A 3H1NA 5G5FA 4ZL9A 2R6KA 5IMZA 4ZB8A 1J08A 4AI6A 3LXTA 5A34B 1A2LA 2O7KA 3TJBA 1USBA 1WIKA 2HSNA 1S3AA 1Z5YE 1KEBA 3VPQA 2X8GA 4KB3A 2X49A 2R0GA 2NDOA 2PUKC 3WD6A 4EC0A 4NV5A 3C7MA 4RI7A 4Z2RA 1XVQA 4Z7XA 4XS4A 1YZXA 4MPGA 4G9HA 4MH2A 1PMTA 4AJ8A 4MP4A 3HHVA 2FLSA 1THOA 2YJ7A 1GTAA 1HNAA 1BEDA 4K7NA 3BOAA 4Z2TA 1SVOA 4DSQA 13GSA 5G2ZA 1TI1A 4K7OA 3EWLA 2IJYA 3VWVA 3LWAA 3VI7A 4AKIA 1XWAA 4MPFA 1EEJA 4ZL8A 3TRQA 2GQKA 2CVKA 2R4VA 1GTIA 3O76A 3DD3A 2XPDA 2DMLA 1UC7A 3CMIA 1O8WA 1A0FA 3FK8A 5A4WA 4MH3A 1KNGA 2L57A 3OR5A 4TOPA 1DE2A 3FKFA 4PX1A 2I81A 3CQFA 5KOWA 4O7HA 2FWEA 4XCSA 1F9MA 4TR1B 2DJKA 2AB6A 2RM6A 3WT2A 1MTCA 2EFHA 4LLRA 2V32A 3KEBA 2BMXA 2V2GA 2VD1A 1I1IP 3H79A 4MLYA 2CX3A 3L78A 1XW9A 4K5SA 3ZLPA 1M3IA 1ZYQB 2YWOA 5BMUB 4HZ2A 2IMEA 2G2QA 1DE1A 2VCQA 3TB2A 1E2YA 4IVFA 4KSMA 2GZZA 3TKPA 4GQFA 2MZCA 4O5QA 2WVZA 1Z7PA 1PKWA 1T00A 1B8XA 3ZFLA 1URMA 5IMDA 5FT3A 3FY7A 2HSMA 4K6XA 4FYUA 3E3EA 5G30A 10GSA 3K8NA 2MBSA 2PVQA 4P3YB 2EFEA 2WB9A 5A4UA 1A2MA 2CX4A 2NVLA 4IP6A 1FB0A 5J3RA 2H8LA 3ERFA 1T7PB 3FYGA 1AIUA 2PU9C 2H0GA 3LJRA 2HRAA 2C0GA 3C8EA 2FGXA 1ZYPA 4ECIA 5JWRB 2A2RA 2JACA 1GSQA 2LV3A 4ICYA 1FVJA 1LJRA 5FHIA 1XG8A 2V41A 2V6KA 5ECRB 4MZCA 4POKA 1BQ7A 2B1LA 1YKCA 4L8EA 1EP8A 4G0IA 3GKNA 1YEPA 6GSYA 2LNSA 5CRWA 4NHZA 3HVVA 5HFGA 4BA7A 2TRCP 4RI6A 2MYGA 1SL1B 4ZB6A 2C1YA 3FR9A 3EU4A 2IWTA 12GSA 5AN1A 1R7HA 5GSSA 1V40A 1EEMA 2IFQB 3IC8A 2K18A 2D2ZA 4N3ZA 5A5HB 3ZZXA 4I2TA 3GFKA 3DKSA 4HQSA 4MJCA 4GLTA 1F6MC 2QA1A 2K8SA 1Q98A 9GSSA 5D73A 2WW2A 3FZ5A 4MMMA 4JBBA 3VLNA 3UEMA 2YWIA 3ZREA 4WR5A 3CSHA 2P0GA 2CT6A 1GULA 2DKIA 1T3BA 1SK2A 4JEDA 4EUYA 3C73A 1YQ1A 4YAPA 2VLTA 4EE0A 4F0CA 4H86A 5ECNB 1QFNA 2REMA 3R3EA 4GCIA 4GSNA 1JZDA 1EV9A 3TKSE 5IQYA 3HCZA 2EFDA 1OC3A 2DKHA 3PH9A 1TRVA 2JZSA 3DVWA 5J9CA 1K0BA 4QQ7A 2R3XA 1THXA 2CV4A 2J9HA 3CWGA 5DBQA 3W6GA 4TXVA 4TR3A 5ECMB 4YAVA 2P31A 3HVXA 3EC3A 3QPMA 3UMAA 3P90A 4PNFA 3GYKA 2VOCA 2HZEA 2OE1A 4IHUA 5CAXA 2CZ3A 2E0QA 1VF2A 3N5OA 5ECLB 2B1KA 2FWGA 2VCXA 2VUPA 1U6TA 4IW9A 1KBNA 2QKEA 1B4PA 2VCVA 3IE3A 4LL4B 3P2AA 5ENUA 1V9WA 1GSEA 3NOFA 3QAGA 3VI5A 5DJMA 2CA8A 4Q5FA 1ABAA 1S3CA 3DXBA 5HR0A 2R5GA 2DJJA 2OBIA 1MEKA 2GT6A 2L4QA 4MDCA 3UVTA 4E8HA 3GURA 2FUG2 3ZL5A 3L0HA 1G0TA 4G01A 1GSDA 5EL8A 3TKQA 4PI2C 3QR6A 1F2EA 3CXGA 4RUVA 3VFIA 3ME8A 3CBUA 4G0KA 3F6FA 5F0GA 2V1MA 3ZITA 3MDKA 5B6MA 1S4BP 3CSIA 1HNBA 2LJKA 3RFRC 2YV9A 4YH2A 3KIJA 2XHFA 2CZ2A 3F4RA 1AAZA 5G1KA 2WVYA 3LEFA 5A34A 2LQOA 2JZTA 4TN8A 2GZPA 4I2UA 1AC1A 2H71A 1GL8A 4HJMA 3GKMA 5D9TA 1Z7RA 1E6BA 2H66A 3RAZA 1EGOA 3AY8A 5IO0A 3C1SA 3GIXA 5HFIA 2WW0A 4MJBA 3J7Yk 1UN2A 1OKTA 1HQOA 4IQ1A 1XW6A 4V2MA 4L0UA 1ZYNA 1B9YC 4HI7A 1DBYA 4JR6A 4XS1A 5G1LA 5IO2A 1ZGNA 3F4SA 1M9AA 5IMAA 4POBA 5G31A 1XXUA 4ML6A 1O81A 4HS1A 4ZB7A 4ULXA 4AKGA 2MMZA 1HD2A 1M3JA 4GSTA 2GGTA 4O5UA 2VAFA 3UIWA 3LYPA 1YF0A 3CHXC 4KDYA 2GT5A 4MZBA 1SKWB 4K1FA 4XS6A 3ZTLA 3I6AA 3IC4A 3LORA 5ECSA 4HDEA 2GTUA 3BD2A 2L59A 2JZRA 4ILFA 1M99A 3FR6A 3O6TA 2YN1A 4I5QA 5J41A 1SK1A 5IMFA 1WP0A 4TXOB 2P5QA 2QA2A 2B5XA 2O5VA 4HEA2 1UA5A 4TR1A 2OE3A 4EKZA 2QGVA 4LMVA 4O32A 5JWQB 4YKGA 2YANA 4PURA 2AYTA 3NIVA 3ZMKA 5D8IA 3EMXA 4ECBA 1WWJA 2C0FA 1SKRB 3TGZA 5KEJA 4EXJA 3TJFA 2AUVA 4PQHA 3GSSA 2IIYA 2WVXA 5J4UA 2I1UA 1TP9A 3GH6A 5ELAA 5BMUA 3BBYA 5ECPB 1FW1A 2FNOA 5D93A 2C3NA 1QGVA 4DSRA 3FW2A 3PGTA 4D73B 1N2AA 4K9ZA 3RBTA 3VK9A 5D9WA 3RPNA 1TDIA 5J5NA 3F0IA 5A1NB 4L0WA 2WDUA 1QUWA 4DEJA 4ZL7A 1B4QA 3QD9A 3FEUA 3QDNA 1U3AA 2YPMA 1VF3A 2WJUA 1R4WA 2H74A 3UL3A 3M0FA 3RHBA 3TRXA 1LBKA 2LS5A 1F37A 3TKRA 3TOUA 2HXKA 1JHBA 2DJ3A 4N0VA 1M9BA 1MDIA 2LUSA 4NAXA 2VCTA 4E8EA 1O73A 2E7PA 2H1DA 2IL3A 5F05A 2CVDA 2FCHA 5IOXA 1SD8A 1K0NA 1GSYA 3GH9A 1K0AA 3HZ8A 2I4AA 1O8XA 1TRUA 1PL2A 2H1BA 1G6YA 1TI3A 2KLXA 4JRRA 1DUGA 4FYBA 4KX4A 3GV1A 4BL7B 4OO5A 4O92A 1RW1A 3HDCA 4ZXGA 2HE3A 2WRTA 4IBPA 4IJIA 3ZRDA 2L4CA 5J47A 3SWLA 5DCGA 3IR4A 2WFCA 5B7CA 2H6YA 2IFQA 5CRHA 1KTEA 2LKUA 5D9VA 1R5PA 1XBSA 4YQMA 5EPFA 4Z2UA 5A5HA 2QC7A 2PBJA 5JCGA 2VCWA 4Q5QA 2LSTA 3M3MA 3F3QA 5CRGA 3BJ5A 5E4WA 4LMWA 3HD5A 4RQXA 2H75A 4BPYA 5INYA 1O85A 3TCOA 5L71A 2ES7A 3L9VA 3D4MA 2UV8G 2PMTA 1SU9A 4GTUA 1QK8A 5LD0A 5HR2A 2GQMA 2YJHA 3H8QA 2B6MA 17GSA 2YWNA 3G7YA 5DCHA 1X9SB 4EDYA 3A5WA 3E0UA 4PGTA 4L5LA 4BVXB 3HJPA 3MYDA 3VPTA 2DMMA 3GRXA 3KD0A 2E2MA 1RQMA 3L9UA 1FHEA 1Z3EA 1GRXA 4ISDA 5IOWA 3A5IA 2F9SA 5AIVA 5F07A 2YCDA 3KTLA 2HRKB 5DALA 3D0ZA 1EWXA 1S3DA 3QAWA 4V2NA 5IPHA 2OJLA 5AIXA 2UZ8A 2CAQA 4ZBDA 3LSZA 4F9ZA 1TTZA 1X5EA 2PWJA 1R5AA 1UVZA 2O85A 2GQLA 3APSA 1VRSD 2M80A 2GSQA 2JL4A 3F6DA 1A24A 3FHKA 2IMDA 3HKRA 1ZCPA 1FVKA 1ACVA 1V98A 2KHPA 3UJ1A 1NHYA 2GLRA 1GNWA 22GSA 2WULA 3FMWA 2LRTA 2FWHA 3CYNA 2EIRA 1K0MA 1PN0A 3PPUA 2GS3A 3ZVJD 2N5AA 2JADA 2H01A 4N11A 3BCKA 2O89A 3KXOA 5DAKB 1O6JA 2K8VA 1BG5A 1SL0B 2F3MA 1QQ2A 4JR4A 4HSCX 5F8BA 1A8YA 4K0NA 4XTSA 2HSNB 1R26A 1SENA 4FO5A 1H4OA 2C0DA 4HU7A 1PX6A 1OC9B 3LQ7A 1XOAA 4G0LA 3WGXA 2NPBA 2KUCA 4KDUA 3GNJA 1X9MB 3IV4A 2O8VB 1VF1A 1AQXA 1OYJA 2HSYA 1W4VA 1SKSB 4KAEA 2R0CA 1TXXA 3EURA 4FXYP 4V2LA 3F3RA 2YNXA 3G9BA 2R0PA 3TJGA 3HY2A 1WE0A 1IYIA 2M72A 2F8AA 2A4HA 3LFLA 3DRNA 5DQYA 2L6DA 4OO4A 3IHGA 4WETA 5CREA 4A5PA 2DIZA 3G7IA 3APOA 4WF5A 1WJKA 4MABA 3L9SA 3V1WA 4J2FA 5IPGA 2ALBA 1TRSA 4ID0A 3RPPA 1QXHA 1Y6EA 4GQCA 3ZVJA 3HVNA 3HVSA 2X8CA 5ECQB 2X64A 2HNLA 1G6WA 1FG4A 1WRYA 1A23A 3QMXA 3TJKA 5KN3A 4OCFA 4KE3A 2L5OA 5ECHB 4NV2A 5KOXA 2VL3A 2R37A 3EVIA 3I43A 4E68A 1SYRA 3IPZA 4X1UA 4TXOA 1W89A 5HQPA 3P7XA 5JCWA 2ON5A 1YF1A 5HFKA 1K3OA 5D9XA 1ERWA 4MA9A 3QAVA 2AAWA 4N30A 4BWSA 1ON4A 3MNGA 2MBTA 5LNKe 2HRNA 1PRXA 1ZMAA 3TRPA 2IN3A 3O3TA 2B7JA 1CQGA 4MF5A 4G19A 1J0FA 2HI7A 1XPVA 3IRAA 1EZKA 2B5EA 2AHEA 14GSA 4V1Ap 2FA8A 4KDXA 3VWUA 5A1NA 1GP1A 1X5DA 11GSA 2J23A 3M9KA 2HT9A 3KP9A 4F82A 1QMVA 3F63A 1M7TA 2WW1A 3W8JA 2P5RA 3ME7A 3IK9A 4MK3A 1GUMA 1I9DA 1Z6NA 4WEYA 4KUNA 5F06A 1TXUA 3EE2A 4GXZA 2G0FA 4EO3A 1JLVA 3KMOA 4OD7A 3APQA 1PFOA 1YEWC 1A0RP 1NHOA 3I69A 2IMIA 5IMVA 2VIMA 4IELA 1ERTA 2RUFA 3LXZA 3D21A 5EY6A 3H93A 3A3TA 2XBQA 4KH7A 4O5RA 1Y25A 3UARA 1PD21 3C71A 1K0CA 2VL9A 2CAIA 1PKZA 5GSTA 3QFBC 4N0ZA 3WGDA 2B3SA 3L4NA 2WW3A 1FB6A 3CRUA 1XFLA 1TJDA 2X4AA 2VM1A 3UBLA 3IXRA 4BVYB 1NW2A 4BL7A 3JCML 4EL1A 1U88A 1NSWA 3DIEA 2EIQA 4KCAA 1AUCA 5JWOB 4WXTA 2DBCA 2XC2A 2JSZA 2K9FA 1XIYA 1WPIA 4KGIA 4F03A 4DSSB 4IQAA 1EV4A 4RQRA 4MJAA 2EC4A 3U6VA 2H72A 2EIOA 3HA9A 6GSSA 3RGBC 3IDVA 2FHEA 1JZRA 4HZ4A 1X5CA 1HNCA 5AGYA 2FY6A 4HOJA 5E59A 1PA3A 4TVEA 3FZ4A 2H1GA 3KZQA 4PQ1A 4MF6A 3WT1A 1JZWA 1OC8A 4I97A 2C3QA 1BAYA 5C04A 1SD9A 2HSHA 3QOUA 2GZYA 4KW6A 3TU3B 1FAAA 2YP6A 5LCZA 2JU5A 3PR8A 1T1VA 1M0UA 4TKYA 3DVXA 2EFCA 5D96A 2WZ9A 4OWYA 3MWHA 4XHMA 4TW5A 4XRAA 4BVXA 1GNEA 2X99A 4K7IA 2WGRA 5KN1A 3GN3A 2GSRA 1EOGA 3GMFA 2WZSA 4X43A 4AF2A 2GDRA 3HXSA 4CHSA 4PNGA 1EGRA 4ZBBA 1NM3A 2H6XA 4W66A 5J4VA 4K0GA 1M2DA 4CY6A 2NTOA 2C0EA 4FYCA 6GSUA 3UAPA 3GA4A 2H1AA 7GSSA 2TIRA 1M2AA 3CTFA 2ON7A 4AGSA 2DLXA 3ZFBA 4CDOA 2IMKA 3EMPA 2LJRA 2YV7A 4BIKA 3MSZA 1O7UA
chains in the Genus database with same CATH topology
2WS2A 3EU3A 4NMUA 2HYXA 2FWFA 1TRWA 1MD3A 4WBJA 4OFTA 5FWGA 5DAKA 2B5YA 3G7JA 4HJ2A 4NXIA 1Z9HA 2YOIA 5C00A 2C3TA 4CW9A 4WF4A 2FA4A 1M2BA 5GAND 3S9FA 5G5EA 1XWGA 4TR4A 4OFNA 4QL7A 3M8NA 4ECJA 1OC9A 4IP1A 3M9JA 1AW9A 4K2XA 1GTUA 2DJ1A 1U3IA 2RLIA 2HLSA 1T4ZA 2ZNMA 2MMOA 2GVPA 1GSUA 1H75A 3FZ9A 1OVNA 4DVCA 1G7EA 3A2XA 3HJMA 3C1RA 3D6IA 5COHA 8GSSA 1GSSA 2H73A 4X4JA 5H5QA 3ZIVA 1SVLA 4WR4A 4MNNA 1GUKA 4EF0A 1AQVA 2BTOT 16GSA 2H19A 4WKWA 4PUAA 2I9HA 2LRNA 4USSA 1YKAA 2K6VA 1SJZA 2HRFA 3KCMA 3LYKA 2OA7A 3GTUB 5ID2B 3US3A 2F8FA 1MDJA 1OE8A 1ST9A 3WGEA 3GUSA 4YQUA 1C72A 2AV4A 4FH8A 1FOHA 4IJ3A 4MZWA 1PGTA 4PQIA 2H70A 2H1LA 19GSA 1GTBA 2FD3A 6GSXA 1Z6MA 2PPTA 3U5RE 5IM9A 3ZYWA 2X8HA 2E2GA 5HR1A 3FZAA 3GKKA 4PTSA 1SJ6A 1X0RA 5ECOB 2MMAA 3MIXA 2VL2C 1N8JA 4AKXB 4GDFA 2MMNA 4KSOA 3W8SA 5J4YA 2TRXA 5A4VA 2OKAA 4HU9A 3E9JB 3M1GA 3RDWA 1MDKA 1XWKA 1V57A 4K8MA 4MJEA 3ZMLA 1ML6A 3RHCA 1Y1UA 1YDKA 3TUEA 2DJ2A 5DDLA 3CSJA 1PSQA 2Z9SA 2XBIA 1BX9A 2DSAA 2HFDA 1YJ6A 5HR3A 1MD4A 4EIPA 2N5FA 1ILOA 5KN2A 2A2SA 3EYTA 4OCEA 3LGCA 3TKSA 1J9BA 1BYEA 2IPAA 3A2WA 4QMKA 4X0XA 4G2EA 1ZL9A 3IK7A 4JZQA 2A2PA 3DEXA 4NHWA 1XW5A 2C8UA 5CRDA 5CNWA 2DC5A 5CP1A 1A8LA 1G7OA 4HQZA 4ECCA 3IAM2 4KA0A 1I5GA 2CVBA 1HYUA 2LRCA 5CYYA 4ACSA 1PQNA 1ZZYA 4AJ6A 4XS4B 3KMNA 4XIHA 4MF7A 3GKXA 4OFMA 4MCUA 3TDGA 2GSTA 5ECIB 3GX8A 4GRFA 2RIIA 2H30A 4EVMA 5IMCA 4F2IA 3R2QA 4IGJA 1JFUA 4BVYA 1LU4A 2JSYA 3TJJA 3WYWA 2OACA 2PVOC 3TOTA 3UBKA 1BJXA 2VLUA 4DSSA 1K0OA 3Q74A 1V2AA 1SVMA 2VM2A 3IAS2 4J56E 4GSSA 3F8UA 6GSTA 2A4VA 1F3AA 1XCCA 3LG6A 2OE0A 2HZFA 1FO5A 5KN0A 1GH2A 3J7Yb 1VF4A 3KTBA 1RK4A 2AJQB 1ERUA 2VD0A 2BJXA 3KGKA 1TK0B 4TR0A 1AQWA 3MAKA 4N10A 4ZB9A 3D5JA 1XOBA 3UVHA 3ZIJA 5GAPD 4Q5RA 3EINA 2OBKA 2C80A 4NWYA 1TU7A 3N9JA 3VWXA 3NZNA 2VCZA 1TW9A 4LL1B 4K2DA 2YZHA 4QL9A 1BG1A 5DALB 3KJYA 2CQ9A 1WOUA 4PUFC 2HSMB 4I8BA 4D73A 4TRXA 5GZZB 3SBCA 4FQUA 2VL2A 1YY7A 5ECKB 1YVLA 2L5LA 1XWBA 1ZOFA 5EVOA 1AXDA 2DJ0A 3BCIA 3D22A 5DJLA 4Q5NA 5B8AA 1JZOA 5H5RA 3HZ4A 3CTGA 2LNTA 3PINA 2N5BA 4POMA 2LJAA 1T8EB 1GSFA 1OKDA 3IHQA 3GX0A 3H4KA 4G10A 4GF0A 1SK0A 4ZIJA 3QCPA 1N25A 2YWMA 3ERWA 3FR3A 1CQHA 2H0HA 1TKDB 4IN0A 2H6ZA 4KF9A 2LQQA 3ED3A 4NPBA 3DWVA 1ZYEA 20GSA 1B48A 1EP7A 2ZCTA 6GSWA 1GLPA 3CRTA 3GHAA 2IMFA 1TK8B 5DQSA 3HYPA 3EPTA 1DSBA 4EDZA 1K3LA 1A2JA 2WCIA 3FRCA 1IYHA 3DMLA 3KP8A 2RUEA 2I3YA 5H5SA 2C4JA 3IOSA 5ABRA 2O87A 4EIQA 1GUHA 1F3BA 3D4TA 4JE1A 2H76A 4L5OA 2RM5A 3I9V2 4IS0A 2LTKA 4I6XA 1EOHA 3KM6A 1GWCA 2PGTA 3GL3A 3UOMA 2LEGA 4K5RA 6GSVA 3Q18A 1GLQA 3Q19A 1PN9A 4F0BA 3ISOA 1SJIA 3GL5A 3HJOA 4ZBAA 1JLWA 1U87A 5DVBA 1PX7A 4PXOA 1X9WB 1TU8A 3A2VA 1B9XC 3Q6OA 4HUAA 4KCEA 3F9UA 1SL2B 2L6CA 4OMVA 1OE7A 1Q4JA 1XVWA 2VO4A 3GTUA 3F4TA 1YEXA 5IIZA 5ID2A 5B6NA 2ZUPA 1TOFA 4YQVA 4POLA 1XZOA 3KH7A 4J57E 2KOKA 3KH9A 2QSIA 5JCUA 2HZEB 3LW9A 2PN8A 4LA1A 1PL1A 2KP2A 2V6OA 3GSTA 3IBHA 4YKFA 1WMJA 5B8BA 4GWRA 1K0DA 4KNDA 1T4YA 3VURA 4AKHA 2B7KA 2KP1A 5BRTA 3HMJG 5AISA 2F51A 2HRKA 5ELGA 3QFAC 3P8WA 3DGQA 4WBRD 1SYXA 2VLVA 1VGLA 2H0IA 3ERGA 2XPEA 4CY8A 1TK5B 4AJ7A 1XWCA 2VKZG 18GSA 3IA1A 5CO3A 2NBSA 5A5KA 2HQTA 3TKSC 1K3YA 2GSSA 5J9BA 1OAZA 4FIWA 4BWQA 2M46A 4JU5A 3VWWA 2DIYA 4IKHA 1FOVA 1V58A 4XRDA 2OADA 4ML1A 4V1Ag 2OT3A 2PERA 2YZUA 4ZILA 2R2JA 1ERVA 5J40A 3DYRA 1BF5A 3H1NA 5G5FA 4ZL9A 2R6KA 5IMZA 4ZB8A 1J08A 4AI6A 3LXTA 5A34B 1A2LA 2O7KA 3TJBA 1USBA 1WIKA 2HSNA 1S3AA 1Z5YE 1KEBA 3VPQA 2X8GA 4KB3A 2X49A 2R0GA 2NDOA 2PUKC 3WD6A 4EC0A 4NV5A 3C7MA 4RI7A 4Z2RA 1XVQA 4Z7XA 4XS4A 1YZXA 4MPGA 4G9HA 4MH2A 1PMTA 4AJ8A 4MP4A 3HHVA 2FLSA 1THOA 2YJ7A 1GTAA 1HNAA 1BEDA 4K7NA 3BOAA 4Z2TA 1SVOA 4DSQA 13GSA 5G2ZA 1TI1A 4K7OA 3EWLA 2IJYA 3VWVA 3LWAA 3VI7A 4AKIA 1XWAA 4MPFA 1EEJA 4ZL8A 3TRQA 2GQKA 2CVKA 2R4VA 1GTIA 3O76A 3DD3A 2XPDA 2DMLA 1UC7A 3CMIA 1O8WA 1A0FA 3FK8A 5A4WA 4MH3A 1KNGA 2L57A 3OR5A 4TOPA 1DE2A 3FKFA 4PX1A 2I81A 5KOWA 4O7HA 2FWEA 4XCSA 1F9MA 4TR1B 2DJKA 2AB6A 2RM6A 3WT2A 1MTCA 2EFHA 4LLRA 2V32A 3KEBA 2BMXA 2V2GA 2VD1A 3H79A 4MLYA 2CX3A 3L78A 1XW9A 4K5SA 3ZLPA 1ZYQB 2YWOA 5BMUB 4HZ2A 2IMEA 2G2QA 1DE1A 2VCQA 3TB2A 1E2YA 4IVFA 4KSMA 2GZZA 3TKPA 4GQFA 2MZCA 4O5QA 1Z7PA 1PKWA 1T00A 1B8XA 3ZFLA 1URMA 5IMDA 5FT3A 3FY7A 2HSMA 4K6XA 4FYUA 3E3EA 5G30A 10GSA 3K8NA 2MBSA 2PVQA 4P3YB 2EFEA 2WB9A 5A4UA 1A2MA 2CX4A 2NVLA 4IP6A 1FB0A 5J3RA 2H8LA 3ERFA 1T7PB 3FYGA 1AIUA 2PU9C 2H0GA 3LJRA 2HRAA 2C0GA 3C8EA 2FGXA 1ZYPA 4ECIA 5JWRB 2A2RA 2JACA 1GSQA 2LV3A 4ICYA 1FVJA 1LJRA 5FHIA 2V41A 2V6KA 5ECRB 4MZCA 4POKA 1BQ7A 2B1LA 1YKCA 4L8EA 1EP8A 4G0IA 3GKNA 1YEPA 6GSYA 2LNSA 5CRWA 4NHZA 3HVVA 5HFGA 4BA7A 2TRCP 4RI6A 2MYGA 1SL1B 4ZB6A 2C1YA 3FR9A 3EU4A 2IWTA 12GSA 5AN1A 1R7HA 5GSSA 1V40A 1EEMA 2IFQB 3IC8A 2K18A 2D2ZA 4N3ZA 5A5HB 3ZZXA 4I2TA 3GFKA 3DKSA 4HQSA 4MJCA 4GLTA 1F6MC 2QA1A 2K8SA 1Q98A 9GSSA 5D73A 3FZ5A 4MMMA 4JBBA 3VLNA 3UEMA 2YWIA 3ZREA 4WR5A 3CSHA 2P0GA 2CT6A 1GULA 2DKIA 1T3BA 1SK2A 4JEDA 4EUYA 3C73A 1YQ1A 4YAPA 2VLTA 4EE0A 4F0CA 4H86A 5ECNB 1QFNA 2REMA 3R3EA 4GCIA 4GSNA 1JZDA 1EV9A 3TKSE 5IQYA 3HCZA 2EFDA 1OC3A 2DKHA 3PH9A 1TRVA 2JZSA 3DVWA 5J9CA 1K0BA 4QQ7A 2R3XA 1THXA 2CV4A 2J9HA 3CWGA 5DBQA 3W6GA 4TXVA 4TR3A 5ECMB 4YAVA 2P31A 3HVXA 3EC3A 3QPMA 3UMAA 3P90A 4PNFA 3GYKA 2VOCA 2HZEA 2OE1A 4IHUA 5CAXA 2CZ3A 2E0QA 1VF2A 3N5OA 5ECLB 2B1KA 2FWGA 2VCXA 2VUPA 1U6TA 4IW9A 1KBNA 2QKEA 1B4PA 2VCVA 3IE3A 4LL4B 3P2AA 5ENUA 1V9WA 1GSEA 3NOFA 3QAGA 3VI5A 5DJMA 2CA8A 4Q5FA 1ABAA 1S3CA 3DXBA 5HR0A 2R5GA 2DJJA 2OBIA 1MEKA 2GT6A 2L4QA 4MDCA 3UVTA 4E8HA 3GURA 2FUG2 3ZL5A 3L0HA 1G0TA 4G01A 1GSDA 5EL8A 3TKQA 3QR6A 1F2EA 3CXGA 4RUVA 3VFIA 3ME8A 3CBUA 4G0KA 3F6FA 5F0GA 2V1MA 3ZITA 3MDKA 5B6MA 3CSIA 1HNBA 2LJKA 2YV9A 4YH2A 3KIJA 2XHFA 2CZ2A 3F4RA 1AAZA 5G1KA 3LEFA 5A34A 2LQOA 2JZTA 4TN8A 2GZPA 4I2UA 1AC1A 2H71A 1GL8A 4HJMA 3GKMA 5D9TA 1Z7RA 1E6BA 2H66A 3RAZA 1EGOA 3AY8A 5IO0A 3C1SA 3GIXA 5HFIA 4MJBA 3J7Yk 1UN2A 1OKTA 1HQOA 4IQ1A 1XW6A 4V2MA 4L0UA 1ZYNA 1B9YC 4HI7A 1DBYA 4JR6A 4XS1A 5G1LA 5IO2A 1ZGNA 3F4SA 1M9AA 5IMAA 4POBA 5G31A 1XXUA 4ML6A 1O81A 4HS1A 4ZB7A 4ULXA 4AKGA 2MMZA 1HD2A 4GSTA 2GGTA 4O5UA 2VAFA 3UIWA 3LYPA 1YF0A 4KDYA 2GT5A 4MZBA 1SKWB 4K1FA 4XS6A 3ZTLA 3I6AA 3IC4A 3LORA 5ECSA 4HDEA 2GTUA 3BD2A 2L59A 2JZRA 4ILFA 1M99A 3FR6A 3O6TA 2YN1A 4I5QA 5J41A 1SK1A 5IMFA 1WP0A 4TXOB 2P5QA 2QA2A 2B5XA 2O5VA 4HEA2 1UA5A 4TR1A 2OE3A 4EKZA 2QGVA 4LMVA 4O32A 5JWQB 4YKGA 2YANA 4PURA 2AYTA 3NIVA 3ZMKA 5D8IA 3EMXA 4ECBA 1WWJA 2C0FA 1SKRB 3TGZA 5KEJA 4EXJA 3TJFA 2AUVA 4PQHA 3GSSA 2IIYA 5J4UA 2I1UA 1TP9A 3GH6A 5ELAA 5BMUA 3BBYA 5ECPB 1FW1A 2FNOA 5D93A 2C3NA 1QGVA 4DSRA 3FW2A 3PGTA 4D73B 1N2AA 4K9ZA 3RBTA 3VK9A 5D9WA 3RPNA 1TDIA 5J5NA 3F0IA 5A1NB 4L0WA 2WDUA 1QUWA 4DEJA 4ZL7A 1B4QA 3QD9A 3FEUA 3QDNA 1U3AA 2YPMA 1VF3A 2WJUA 1R4WA 2H74A 3UL3A 3M0FA 3RHBA 3TRXA 1LBKA 2LS5A 1F37A 3TKRA 3TOUA 2HXKA 1JHBA 2DJ3A 4N0VA 1M9BA 1MDIA 2LUSA 4NAXA 2VCTA 4E8EA 1O73A 2E7PA 2H1DA 2IL3A 5F05A 2CVDA 2FCHA 5IOXA 1SD8A 1K0NA 1GSYA 3GH9A 1K0AA 3HZ8A 2I4AA 1O8XA 1TRUA 1PL2A 2H1BA 1G6YA 1TI3A 2KLXA 4JRRA 1DUGA 4FYBA 4KX4A 3GV1A 4BL7B 4OO5A 4O92A 1RW1A 3HDCA 4ZXGA 2HE3A 2WRTA 4IBPA 4IJIA 3ZRDA 2L4CA 5J47A 3SWLA 5DCGA 3IR4A 2WFCA 5B7CA 2H6YA 2IFQA 5CRHA 1KTEA 2LKUA 5D9VA 1R5PA 1XBSA 4YQMA 5EPFA 4Z2UA 5A5HA 2QC7A 2PBJA 5JCGA 2VCWA 4Q5QA 2LSTA 3M3MA 3F3QA 5CRGA 3BJ5A 5E4WA 4LMWA 3HD5A 4RQXA 2H75A 4BPYA 5INYA 1O85A 3TCOA 5L71A 2ES7A 3L9VA 3D4MA 2UV8G 2PMTA 1SU9A 4GTUA 1QK8A 5LD0A 5HR2A 2GQMA 2YJHA 3H8QA 2B6MA 17GSA 2YWNA 3G7YA 5DCHA 1X9SB 4EDYA 3A5WA 3E0UA 4PGTA 4L5LA 4BVXB 3HJPA 3MYDA 3VPTA 2DMMA 3GRXA 3KD0A 2E2MA 1RQMA 3L9UA 1FHEA 1Z3EA 1GRXA 4ISDA 5IOWA 3A5IA 2F9SA 5AIVA 5F07A 2YCDA 3KTLA 2HRKB 5DALA 3D0ZA 1EWXA 1S3DA 3QAWA 4V2NA 5IPHA 2OJLA 5AIXA 2UZ8A 2CAQA 4ZBDA 3LSZA 4F9ZA 1TTZA 1X5EA 2PWJA 1R5AA 1UVZA 2O85A 2GQLA 3APSA 1VRSD 2M80A 2GSQA 2JL4A 3F6DA 1A24A 3FHKA 2IMDA 3HKRA 1ZCPA 1FVKA 1ACVA 1V98A 2KHPA 3UJ1A 1NHYA 2GLRA 1GNWA 22GSA 2WULA 3FMWA 2LRTA 2FWHA 3CYNA 2EIRA 1K0MA 1PN0A 3PPUA 2GS3A 3ZVJD 2N5AA 2JADA 2H01A 4N11A 3BCKA 2O89A 3KXOA 5DAKB 1O6JA 2K8VA 1BG5A 1SL0B 2F3MA 1QQ2A 4JR4A 5F8BA 1A8YA 4K0NA 4XTSA 2HSNB 1R26A 1SENA 4FO5A 1H4OA 2C0DA 4HU7A 1PX6A 1OC9B 3LQ7A 1XOAA 4G0LA 3WGXA 2NPBA 2KUCA 4KDUA 3GNJA 1X9MB 3IV4A 2O8VB 1VF1A 1AQXA 1OYJA 2HSYA 1W4VA 1SKSB 4KAEA 2R0CA 1TXXA 3EURA 4V2LA 3F3RA 2YNXA 3G9BA 2R0PA 3TJGA 3HY2A 1WE0A 1IYIA 2M72A 2F8AA 2A4HA 3LFLA 3DRNA 5DQYA 2L6DA 4OO4A 3IHGA 4WETA 5CREA 4A5PA 2DIZA 3G7IA 3APOA 4WF5A 1WJKA 4MABA 3L9SA 3V1WA 4J2FA 5IPGA 2ALBA 1TRSA 4ID0A 3RPPA 1QXHA 1Y6EA 4GQCA 3ZVJA 3HVSA 2X8CA 5ECQB 2X64A 2HNLA 1G6WA 1FG4A 1WRYA 1A23A 3QMXA 3TJKA 5KN3A 4OCFA 4KE3A 2L5OA 5ECHB 4NV2A 5KOXA 2VL3A 2R37A 3EVIA 3I43A 4E68A 1SYRA 3IPZA 4X1UA 4TXOA 1W89A 5HQPA 3P7XA 5JCWA 2ON5A 1YF1A 5HFKA 1K3OA 5D9XA 1ERWA 4MA9A 3QAVA 2AAWA 4N30A 4BWSA 1ON4A 3MNGA 2MBTA 5LNKe 2HRNA 1PRXA 1ZMAA 3TRPA 2IN3A 3O3TA 2B7JA 1CQGA 4MF5A 4G19A 1J0FA 2HI7A 1XPVA 3IRAA 1EZKA 2B5EA 2AHEA 14GSA 4V1Ap 2FA8A 4KDXA 3VWUA 5A1NA 1GP1A 1X5DA 11GSA 2J23A 3M9KA 2HT9A 3KP9A 4F82A 1QMVA 3F63A 1M7TA 3W8JA 2P5RA 3ME7A 3IK9A 4MK3A 1GUMA 1I9DA 1Z6NA 4WEYA 4KUNA 5F06A 1TXUA 3EE2A 4GXZA 2G0FA 4EO3A 1JLVA 3KMOA 4OD7A 3APQA 1A0RP 1NHOA 3I69A 2IMIA 5IMVA 2VIMA 4IELA 1ERTA 2RUFA 3LXZA 3D21A 5EY6A 3H93A 3A3TA 2XBQA 4KH7A 4O5RA 1Y25A 3UARA 1PD21 3C71A 1K0CA 2VL9A 2CAIA 1PKZA 5GSTA 3QFBC 4N0ZA 3WGDA 2B3SA 3L4NA 1FB6A 3CRUA 1XFLA 1TJDA 2X4AA 2VM1A 3UBLA 3IXRA 4BVYB 1NW2A 4BL7A 3JCML 4EL1A 1U88A 1NSWA 3DIEA 2EIQA 4KCAA 1AUCA 5JWOB 4WXTA 2DBCA 2XC2A 2JSZA 2K9FA 1XIYA 1WPIA 4KGIA 4F03A 4DSSB 4IQAA 1EV4A 4RQRA 4MJAA 2EC4A 3U6VA 2H72A 2EIOA 3HA9A 6GSSA 3IDVA 2FHEA 1JZRA 4HZ4A 1X5CA 1HNCA 5AGYA 2FY6A 4HOJA 5E59A 1PA3A 4TVEA 3FZ4A 2H1GA 3KZQA 4PQ1A 4MF6A 3WT1A 1JZWA 1OC8A 4I97A 2C3QA 1BAYA 5C04A 1SD9A 2HSHA 3QOUA 2GZYA 4KW6A 3TU3B 1FAAA 2YP6A 5LCZA 2JU5A 3PR8A 1T1VA 1M0UA 4TKYA 3DVXA 2EFCA 5D96A 2WZ9A 4OWYA 3MWHA 4XHMA 4TW5A 4XRAA 4BVXA 1GNEA 2X99A 4K7IA 2WGRA 5KN1A 3GN3A 2GSRA 1EOGA 3GMFA 4X43A 4AF2A 2GDRA 3HXSA 4CHSA 4PNGA 1EGRA 4ZBBA 1NM3A 2H6XA 4W66A 5J4VA 4K0GA 1M2DA 4CY6A 2NTOA 2C0EA 4FYCA 6GSUA 3UAPA 3GA4A 2H1AA 7GSSA 2TIRA 1M2AA 3CTFA 2ON7A 4AGSA 2DLXA 3ZFBA 4CDOA 2IMKA 3EMPA 2LJRA 2YV7A 3MSZA 1O7UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WS2 A;  3EU3 A;  4NMU A;  2HYX A;  2FWF A;  1TRW A;  1MD3 A;  4WBJ A;  4OFT A;  5FWG A;  5DAK A;  2B5Y A;  3G7J A;  4HJ2 A;  4NXI A;  1Z9H A;  2YOI A;  5C00 A;  2C3T A;  4CW9 A;  4WF4 A;  2FA4 A;  1M2B A;  5GAN D;  3S9F A;  5G5E A;  1XWG A;  4TR4 A;  4OFN A;  4QL7 A;  3M8N A;  4ECJ A;  1OC9 A;  4IP1 A;  3M9J A;  1AW9 A;  1GTU A;  2DJ1 A;  1U3I A;  2RLI A;  2HLS A;  1T4Z A;  2ZNM A;  2MMO A;  2GVP A;  1GSU A;  1H75 A;  3FZ9 A;  1OVN A;  4DVC A;  1G7E A;  3A2X A;  3HJM A;  3C1R A;  3D6I A;  5COH A;  8GSS A;  1GSS A;  2H73 A;  3ZIV A;  5H5Q A;  4WR4 A;  1GUK A;  4EF0 A;  1AQV A;  2BTO T;  16GS A;  2H19 A;  4WKW A;  4PUA A;  2I9H A;  2LRN A;  4USS A;  1YKA A;  2K6V A;  1SJZ A;  2HRF A;  3KCM A;  3LYK A;  2OA7 A;  3GTU B;  5ID2 B;  3US3 A;  2F8F A;  1MDJ A;  1OE8 A;  1ST9 A;  3WGE A;  3GUS A;  4YQU A;  1C72 A;  2AV4 A;  4FH8 A;  4IJ3 A;  4MZW A;  1PGT A;  4PQI A;  2H70 A;  19GS A;  1GTB A;  2FD3 A;  6GSX A;  1Z6M A;  2PPT A;  3U5R E;  5IM9 A;  3ZYW A;  2X8H A;  2E2G A;  5HR1 A;  3FZA A;  3GKK A;  4PTS A;  1SJ6 A;  1X0R A;  5ECO B;  2MMA A;  2VL2 C;  1N8J A;  2MMN A;  4KSO A;  3W8S A;  2TRX A;  5A4V A;  2OKA A;  4HU9 A;  3E9J B;  3M1G A;  3RDW A;  1MDK A;  1XWK A;  1V57 A;  4K8M A;  4MJE A;  3ZML A;  1ML6 A;  3RHC A;  3TUE A;  1YDK A;  2DJ2 A;  5DDL A;  3CSJ A;  1PSQ A;  2Z9S A;  2XBI A;  1BX9 A;  2DSA A;  2HFD A;  1YJ6 A;  5HR3 A;  1MD4 A;  2N5F A;  1ILO A;  5KN2 A;  2A2S A;  3EYT A;  4OCE A;  3LGC A;  3TKS A;  1J9B A;  1BYE A;  2IPA A;  3A2W A;  4X0X A;  4G2E A;  1ZL9 A;  3IK7 A;  4JZQ A;  3DEX A;  4NHW A;  1XW5 A;  2C8U A;  5CRD A;  5CNW A;  2DC5 A;  5CP1 A;  1A8L A;  1G7O A;  4HQZ A;  4ECC A;  3IAM 2;  4KA0 A;  1I5G A;  2CVB A;  1HYU A;  2LRC A;  5CYY A;  4ACS A;  1PQN A;  1ZZY A;  4AJ6 A;  4XS4 B;  3KMN A;  4XIH A;  4MF7 A;  3GKX A;  4OFM A;  4MCU A;  3TDG A;  2GST A;  5ECI B;  3GX8 A;  4GRF A;  2RII A;  2H30 A;  4EVM A;  5IMC A;  4F2I A;  3R2Q A;  4IGJ A;  1JFU A;  4BVY A;  1LU4 A;  2JSY A;  3TJJ A;  3WYW A;  2OAC A;  2PVO C;  3TOT A;  3UBK A;  1BJX A;  2VLU A;  4DSS A;  1K0O A;  3Q74 A;  1V2A A;  2VM2 A;  3IAS 2;  4J56 E;  4GSS A;  3F8U A;  6GST A;  2A4V A;  1F3A A;  1XCC A;  3LG6 A;  2OE0 A;  2HZF A;  1FO5 A;  5KN0 A;  1GH2 A;  3J7Y b;  1VF4 A;  3KTB A;  1RK4 A;  2AJQ B;  1ERU A;  2VD0 A;  2BJX A;  3KGK A;  1TK0 B;  4TR0 A;  1AQW A;  3MAK A;  4N10 A;  4ZB9 A;  3D5J A;  1XOB A;  3UVH A;  3ZIJ A;  5GAP D;  4Q5R A;  3EIN A;  2OBK A;  2C80 A;  4NWY A;  1TU7 A;  3N9J A;  3VWX A;  3NZN A;  2VCZ A;  1TW9 A;  4LL1 B;  4K2D A;  2YZH A;  4QL9 A;  5DAL B;  3KJY A;  2CQ9 A;  1WOU A;  4PUF C;  2HSM B;  4I8B A;  4D73 A;  4TRX A;  5GZZ B;  3SBC A;  4FQU A;  2VL2 A;  1YY7 A;  5ECK B;  2L5L A;  1XWB A;  1ZOF A;  5EVO A;  1AXD A;  2DJ0 A;  3BCI A;  3D22 A;  5DJL A;  4Q5N A;  5B8A A;  1JZO A;  5H5R A;  3HZ4 A;  3CTG A;  2LNT A;  3PIN A;  2N5B A;  4POM A;  2LJA A;  1T8E B;  1GSF A;  1OKD A;  3IHQ A;  3GX0 A;  3H4K A;  4G10 A;  4GF0 A;  1SK0 A;  4ZIJ A;  3QCP A;  2YWM A;  3ERW A;  3FR3 A;  1CQH A;  2H0H A;  1TKD B;  4IN0 A;  2H6Z A;  4KF9 A;  2LQQ A;  3ED3 A;  4NPB A;  3DWV A;  1ZYE A;  20GS A;  1B48 A;  1EP7 A;  2ZCT A;  6GSW A;  1GLP A;  3CRT A;  3GHA A;  2IMF A;  1TK8 B;  5DQS A;  3HYP A;  1DSB A;  4EDZ A;  1K3L A;  1A2J A;  2WCI A;  3FRC A;  1IYH A;  3DML A;  3KP8 A;  2RUE A;  2I3Y A;  5H5S A;  2C4J A;  3IOS A;  5ABR A;  2O87 A;  1GUH A;  1F3B A;  3D4T A;  4JE1 A;  2H76 A;  4L5O A;  2RM5 A;  3I9V 2;  4IS0 A;  2LTK A;  4I6X A;  1EOH A;  3KM6 A;  1GWC A;  2PGT A;  3GL3 A;  3UOM A;  2LEG A;  6GSV A;  3Q18 A;  1GLQ A;  3Q19 A;  1PN9 A;  4F0B A;  3ISO A;  1SJI A;  3GL5 A;  3HJO A;  4ZBA A;  1JLW A;  1U87 A;  5DVB A;  1PX7 A;  4PXO A;  1X9W B;  1TU8 A;  3A2V A;  1B9X C;  3Q6O A;  4HUA A;  4KCE A;  3F9U A;  1SL2 B;  2L6C A;  4OMV A;  1OE7 A;  1Q4J A;  1XVW A;  2VO4 A;  3GTU A;  3F4T A;  1YEX A;  5IIZ A;  5ID2 A;  5B6N A;  2ZUP A;  1TOF A;  4YQV A;  4POL A;  1XZO A;  3KH7 A;  4J57 E;  2KOK A;  3KH9 A;  2QSI A;  5JCU A;  2HZE B;  4LA1 A;  2PN8 A;  1PL1 A;  2KP2 A;  2V6O A;  3GST A;  3IBH A;  1WMJ A;  5B8B A;  4GWR A;  1K0D A;  4KND A;  1T4Y A;  3VUR A;  2B7K A;  2KP1 A;  5AIS A;  2F51 A;  2HRK A;  5ELG A;  3QFA C;  3P8W A;  3DGQ A;  4WBR D;  1SYX A;  2VLV A;  1VGL A;  2H0I A;  3ERG A;  2XPE A;  1TK5 B;  4AJ7 A;  1XWC A;  18GS A;  3IA1 A;  5CO3 A;  2NBS A;  5A5K A;  2HQT A;  3TKS C;  1K3Y A;  2GSS A;  5J9B A;  1OAZ A;  4FIW A;  4BWQ A;  2M46 A;  4JU5 A;  3VWW A;  2DIY A;  4IKH A;  1FOV A;  1V58 A;  4XRD A;  2OAD A;  4ML1 A;  4V1A g;  2PER A;  2YZU A;  4ZIL A;  2R2J A;  1ERV A;  3DYR A;  3H1N A;  5G5F A;  4ZL9 A;  2R6K A;  5IMZ A;  4ZB8 A;  1J08 A;  3LXT A;  1A2L A;  2O7K A;  3TJB A;  1USB A;  1WIK A;  1S3A A;  1Z5Y E;  1KEB A;  3VPQ A;  2X8G A;  4KB3 A;  2NDO A;  2PUK C;  3WD6 A;  4EC0 A;  4NV5 A;  3C7M A;  4RI7 A;  1XVQ A;  4Z7X A;  4XS4 A;  1YZX A;  4MPG A;  4G9H A;  4MH2 A;  1PMT A;  4AJ8 A;  4MP4 A;  3HHV A;  2FLS A;  1THO A;  2YJ7 A;  1GTA A;  1HNA A;  1BED A;  4K7N A;  3BOA A;  4DSQ A;  13GS A;  5G2Z A;  1TI1 A;  4K7O A;  3EWL A;  2IJY A;  3VWV A;  3LWA A;  3VI7 A;  1XWA A;  4MPF A;  1EEJ A;  4ZL8 A;  3TRQ A;  2GQK A;  2CVK A;  2R4V A;  1GTI A;  3O76 A;  3DD3 A;  2XPD A;  2DML A;  1UC7 A;  3CMI A;  1O8W A;  1A0F A;  3FK8 A;  5A4W A;  4MH3 A;  1KNG A;  2L57 A;  3OR5 A;  4TOP A;  1DE2 A;  3FKF A;  4PX1 A;  2I81 A;  4O7H A;  2FWE A;  4XCS A;  1F9M A;  4TR1 B;  2DJK A;  2AB6 A;  2RM6 A;  3WT2 A;  1MTC A;  4LLR A;  2V32 A;  3KEB A;  2BMX A;  2V2G A;  2VD1 A;  3H79 A;  4MLY A;  2CX3 A;  3L78 A;  1XW9 A;  3ZLP A;  1ZYQ B;  2YWO A;  4HZ2 A;  2IME A;  2G2Q A;  1DE1 A;  2VCQ A;  3TB2 A;  1E2Y A;  4IVF A;  4KSM A;  2GZZ A;  3TKP A;  4GQF A;  2MZC A;  1Z7P A;  1PKW A;  1T00 A;  1B8X A;  3ZFL A;  1URM A;  5IMD A;  5FT3 A;  3FY7 A;  2HSM A;  4K6X A;  4FYU A;  3E3E A;  5G30 A;  10GS A;  3K8N A;  2MBS A;  2PVQ A;  4P3Y B;  2WB9 A;  5A4U A;  1A2M A;  2CX4 A;  2NVL A;  4IP6 A;  1FB0 A;  5J3R A;  2H8L A;  3ERF A;  1T7P B;  3FYG A;  1AIU A;  2PU9 C;  2H0G A;  3LJR A;  2HRA A;  2C0G A;  3C8E A;  2FGX A;  4ECI A;  5JWR B;  2A2R A;  2JAC A;  1GSQ A;  2LV3 A;  1FVJ A;  1LJR A;  5FHI A;  2V41 A;  2V6K A;  5ECR B;  4MZC A;  4POK A;  1BQ7 A;  2B1L A;  1YKC A;  4L8E A;  1EP8 A;  4G0I A;  3GKN A;  1YEP A;  6GSY A;  2LNS A;  5CRW A;  4NHZ A;  3HVV A;  5HFG A;  4BA7 A;  2TRC P;  4RI6 A;  2MYG A;  1SL1 B;  4ZB6 A;  2C1Y A;  3FR9 A;  3EU4 A;  2IWT A;  12GS A;  5AN1 A;  1R7H A;  5GSS A;  1V40 A;  1EEM A;  2IFQ B;  3IC8 A;  2K18 A;  2D2Z A;  3ZZX A;  4I2T A;  3GFK A;  3DKS A;  4HQS A;  4MJC A;  4GLT A;  1F6M C;  2K8S A;  1Q98 A;  9GSS A;  5D73 A;  3FZ5 A;  4MMM A;  4JBB A;  3VLN A;  3UEM A;  2YWI A;  3ZRE A;  4WR5 A;  3CSH A;  2P0G A;  2CT6 A;  1GUL A;  1T3B A;  1SK2 A;  4JED A;  4EUY A;  3C73 A;  1YQ1 A;  4YAP A;  2VLT A;  4EE0 A;  4F0C A;  4H86 A;  5ECN B;  1QFN A;  2REM A;  3R3E A;  4GCI A;  4GSN A;  1JZD A;  1EV9 A;  3TKS E;  5IQY A;  3HCZ A;  1OC3 A;  3PH9 A;  1TRV A;  2JZS A;  3DVW A;  5J9C A;  1K0B A;  4QQ7 A;  2R3X A;  1THX A;  2CV4 A;  2J9H A;  5DBQ A;  3W6G A;  4TXV A;  4TR3 A;  5ECM B;  4YAV A;  2P31 A;  3HVX A;  3EC3 A;  3QPM A;  3UMA A;  3P90 A;  4PNF A;  3GYK A;  2VOC A;  2HZE A;  2OE1 A;  4IHU A;  5CAX A;  2CZ3 A;  2E0Q A;  1VF2 A;  3N5O A;  5ECL B;  2B1K A;  2FWG A;  2VCX A;  2VUP A;  1U6T A;  4IW9 A;  1KBN A;  2QKE A;  1B4P A;  2VCV A;  3IE3 A;  4LL4 B;  3P2A A;  5ENU A;  1V9W A;  1GSE A;  3NOF A;  3QAG A;  3VI5 A;  5DJM A;  2CA8 A;  4Q5F A;  1ABA A;  1S3C A;  3DXB A;  5HR0 A;  2R5G A;  2DJJ A;  2OBI A;  1MEK A;  2GT6 A;  2L4Q A;  4MDC A;  3UVT A;  4E8H A;  3GUR A;  2FUG 2;  3ZL5 A;  3L0H A;  1G0T A;  1GSD A;  5EL8 A;  3TKQ A;  3QR6 A;  1F2E A;  3CXG A;  4RUV A;  3VFI A;  3ME8 A;  3CBU A;  4G0K A;  3F6F A;  5F0G A;  2V1M A;  3ZIT A;  3MDK A;  5B6M A;  3CSI A;  1HNB A;  2LJK A;  2YV9 A;  4YH2 A;  3KIJ A;  2XHF A;  2CZ2 A;  3F4R A;  1AAZ A;  5G1K A;  3LEF A;  2LQO A;  2JZT A;  4TN8 A;  2GZP A;  4I2U A;  1AC1 A;  2H71 A;  1GL8 A;  4HJM A;  3GKM A;  5D9T A;  1Z7R A;  1E6B A;  2H66 A;  3RAZ A;  1EGO A;  3AY8 A;  5IO0 A;  3C1S A;  3GIX A;  5HFI A;  4MJB A;  3J7Y k;  1UN2 A;  1OKT A;  1HQO A;  4IQ1 A;  1XW6 A;  4V2M A;  4L0U A;  1B9Y C;  4HI7 A;  1DBY A;  4JR6 A;  4XS1 A;  5G1L A;  5IO2 A;  1ZGN A;  3F4S A;  1M9A A;  5IMA A;  4POB A;  5G31 A;  1XXU A;  4ML6 A;  1O81 A;  4HS1 A;  4ULX A;  2MMZ A;  1HD2 A;  4GST A;  2GGT A;  2VAF A;  3UIW A;  3LYP A;  1YF0 A;  4KDY A;  2GT5 A;  4MZB A;  1SKW B;  4K1F A;  4XS6 A;  3ZTL A;  3I6A A;  3IC4 A;  3LOR A;  5ECS A;  4HDE A;  2GTU A;  3BD2 A;  2L59 A;  2JZR A;  4ILF A;  1M99 A;  3FR6 A;  3O6T A;  2YN1 A;  4I5Q A;  5J41 A;  1SK1 A;  5IMF A;  1WP0 A;  4TXO B;  2P5Q A;  2B5X A;  4HEA 2;  1UA5 A;  4TR1 A;  2OE3 A;  4EKZ A;  2QGV A;  4LMV A;  4O32 A;  5JWQ B;  2YAN A;  4PUR A;  2AYT A;  3NIV A;  3ZMK A;  5D8I A;  3EMX A;  4ECB A;  1WWJ A;  2C0F A;  1SKR B;  3TGZ A;  5KEJ A;  4EXJ A;  3TJF A;  2AUV A;  4PQH A;  3GSS A;  2IIY A;  5J4U A;  2I1U A;  1TP9 A;  3GH6 A;  5ELA A;  5BMU A;  3BBY A;  5ECP B;  1FW1 A;  2FNO A;  5D93 A;  2C3N A;  1QGV A;  4DSR A;  3FW2 A;  3PGT A;  4D73 B;  1N2A A;  4K9Z A;  3RBT A;  3VK9 A;  5D9W A;  3RPN A;  1TDI A;  5J5N A;  3F0I A;  4L0W A;  2WDU A;  1QUW A;  4DEJ A;  4ZL7 A;  1B4Q A;  3QD9 A;  3FEU A;  3QDN A;  1U3A A;  2YPM A;  1VF3 A;  2WJU A;  1R4W A;  2H74 A;  3UL3 A;  3M0F A;  3RHB A;  3TRX A;  1LBK A;  2LS5 A;  1F37 A;  3TKR A;  3TOU A;  2HXK A;  1JHB A;  2DJ3 A;  4N0V A;  1M9B A;  1MDI A;  2LUS A;  4NAX A;  2VCT A;  4E8E A;  1O73 A;  2E7P A;  2H1D A;  2IL3 A;  5F05 A;  2CVD A;  2FCH A;  5IOX A;  1SD8 A;  1K0N A;  1GSY A;  3GH9 A;  1K0A A;  3HZ8 A;  2I4A A;  1O8X A;  1PL2 A;  1TRU A;  2H1B A;  1G6Y A;  1TI3 A;  2KLX A;  4JRR A;  1DUG A;  4FYB A;  4KX4 A;  3GV1 A;  4BL7 B;  4OO5 A;  4O92 A;  1RW1 A;  3HDC A;  4ZXG A;  2HE3 A;  2WRT A;  4IBP A;  4IJI A;  3ZRD A;  2L4C A;  3SWL A;  5DCG A;  3IR4 A;  2WFC A;  5B7C A;  2H6Y A;  2IFQ A;  5CRH A;  1KTE A;  2LKU A;  5D9V A;  1R5P A;  1XBS A;  4YQM A;  5EPF A;  2QC7 A;  2PBJ A;  5JCG A;  2VCW A;  4Q5Q A;  2LST A;  3M3M A;  3F3Q A;  5CRG A;  3BJ5 A;  5E4W A;  4LMW A;  3HD5 A;  4RQX A;  2H75 A;  4BPY A;  5INY A;  1O85 A;  3TCO A;  5L71 A;  2ES7 A;  3L9V A;  3D4M A;  2PMT A;  1SU9 A;  4GTU A;  1QK8 A;  5LD0 A;  5HR2 A;  2GQM A;  2YJH A;  3H8Q A;  2B6M A;  17GS A;  2YWN A;  3G7Y A;  5DCH A;  1X9S B;  4EDY A;  3A5W A;  3E0U A;  4PGT A;  4L5L A;  4BVX B;  3HJP A;  3VPT A;  2DMM A;  3GRX A;  3KD0 A;  2E2M A;  1RQM A;  3L9U A;  1FHE A;  1Z3E A;  1GRX A;  4ISD A;  5IOW A;  2F9S A;  5AIV A;  5F07 A;  2YCD A;  3KTL A;  2HRK B;  5DAL A;  3D0Z A;  1EWX A;  1S3D A;  3QAW A;  4V2N A;  5IPH A;  2OJL A;  5AIX A;  2UZ8 A;  2CAQ A;  4ZBD A;  3LSZ A;  4F9Z A;  1TTZ A;  1X5E A;  2PWJ A;  1R5A A;  1UVZ A;  2O85 A;  2GQL A;  3APS A;  1VRS D;  2M80 A;  2GSQ A;  2JL4 A;  3F6D A;  1A24 A;  3FHK A;  2IMD A;  3HKR A;  1ZCP A;  1FVK A;  1ACV A;  1V98 A;  2KHP A;  3UJ1 A;  1NHY A;  2GLR A;  1GNW A;  22GS A;  2WUL A;  2LRT A;  2FWH A;  3CYN A;  2EIR A;  1K0M A;  3PPU A;  2GS3 A;  3ZVJ D;  2N5A A;  2JAD A;  2H01 A;  4N11 A;  3BCK A;  2O89 A;  3KXO A;  5DAK B;  1O6J A;  2K8V A;  1BG5 A;  1SL0 B;  2F3M A;  1QQ2 A;  4JR4 A;  5F8B A;  1A8Y A;  4K0N A;  4XTS A;  2HSN B;  1R26 A;  1SEN A;  4FO5 A;  1H4O A;  2C0D A;  4HU7 A;  1PX6 A;  1OC9 B;  3LQ7 A;  1XOA A;  4G0L A;  3WGX A;  2NPB A;  2KUC A;  4KDU A;  3GNJ A;  1X9M B;  3IV4 A;  2O8V B;  1VF1 A;  1AQX A;  1OYJ A;  2HSY A;  1W4V A;  1SKS B;  4KAE A;  1TXX A;  3EUR A;  4V2L A;  3F3R A;  2YNX A;  3G9B A;  3TJG A;  3HY2 A;  1WE0 A;  1IYI A;  2M72 A;  2F8A A;  3LFL A;  3DRN A;  5DQY A;  2L6D A;  4OO4 A;  4WET A;  5CRE A;  2DIZ A;  3G7I A;  3APO A;  4WF5 A;  1WJK A;  4MAB A;  3L9S A;  3V1W A;  4J2F A;  5IPG A;  2ALB A;  1TRS A;  4ID0 A;  3RPP A;  1QXH A;  1Y6E A;  4GQC A;  3ZVJ A;  3HVS A;  2X8C A;  5ECQ B;  2X64 A;  2HNL A;  1G6W A;  1FG4 A;  1WRY A;  1A23 A;  3QMX A;  3TJK A;  5KN3 A;  4OCF A;  4KE3 A;  2L5O A;  5ECH B;  4NV2 A;  2VL3 A;  2R37 A;  3EVI A;  3I43 A;  1SYR A;  3IPZ A;  4X1U A;  4TXO A;  1W89 A;  5HQP A;  3P7X A;  5JCW A;  2ON5 A;  1YF1 A;  5HFK A;  1K3O A;  5D9X A;  1ERW A;  4MA9 A;  3QAV A;  2AAW A;  4N30 A;  4BWS A;  1ON4 A;  3MNG A;  2MBT A;  5LNK e;  2HRN A;  1PRX A;  1ZMA A;  3TRP A;  2IN3 A;  3O3T A;  2B7J A;  1CQG A;  4MF5 A;  4G19 A;  1J0F A;  2HI7 A;  1XPV A;  3IRA A;  1EZK A;  2B5E A;  2AHE A;  14GS A;  4V1A p;  2FA8 A;  4KDX A;  3VWU A;  1GP1 A;  1X5D A;  11GS A;  2J23 A;  3M9K A;  2HT9 A;  3KP9 A;  4F82 A;  1QMV A;  3F63 A;  1M7T A;  3W8J A;  2P5R A;  3ME7 A;  3IK9 A;  4MK3 A;  1GUM A;  1I9D A;  1Z6N A;  4WEY A;  4KUN A;  5F06 A;  3EE2 A;  4GXZ A;  2G0F A;  4EO3 A;  1JLV A;  3KMO A;  4OD7 A;  3APQ A;  1A0R P;  1NHO A;  3I69 A;  2IMI A;  5IMV A;  2VIM A;  4IEL A;  1ERT A;  2RUF A;  3LXZ A;  3D21 A;  5EY6 A;  3H93 A;  3A3T A;  2XBQ A;  4KH7 A;  4O5R A;  1Y25 A;  3UAR A;  1PD2 1;  3C71 A;  1K0C A;  2VL9 A;  2CAI A;  1PKZ A;  5GST A;  3QFB C;  4N0Z A;  3WGD A;  2B3S A;  3L4N A;  1FB6 A;  3CRU A;  1XFL A;  1TJD A;  2VM1 A;  3UBL A;  3IXR A;  4BVY B;  1NW2 A;  4BL7 A;  3JCM L;  4EL1 A;  1U88 A;  1NSW A;  3DIE A;  2EIQ A;  4KCA A;  1AUC A;  5JWO B;  4WXT A;  2DBC A;  2XC2 A;  2JSZ A;  2K9F A;  1XIY A;  1WPI A;  4KGI A;  4F03 A;  4DSS B;  4IQA A;  1EV4 A;  4RQR A;  4MJA A;  2EC4 A;  3U6V A;  2H72 A;  2EIO A;  3HA9 A;  6GSS A;  3IDV A;  2FHE A;  1JZR A;  4HZ4 A;  1X5C A;  1HNC A;  5AGY A;  2FY6 A;  4HOJ A;  5E59 A;  1PA3 A;  4TVE A;  3FZ4 A;  2H1G A;  3KZQ A;  4PQ1 A;  4MF6 A;  3WT1 A;  1JZW A;  1OC8 A;  4I97 A;  2C3Q A;  1BAY A;  5C04 A;  1SD9 A;  2HSH A;  3QOU A;  2GZY A;  4KW6 A;  1FAA A;  2YP6 A;  5LCZ A;  2JU5 A;  3PR8 A;  1T1V A;  1M0U A;  4TKY A;  3DVX A;  5D96 A;  2WZ9 A;  4OWY A;  3MWH A;  4XHM A;  4TW5 A;  4XRA A;  4BVX A;  1GNE A;  2X99 A;  4K7I A;  2WGR A;  5KN1 A;  3GN3 A;  2GSR A;  1EOG A;  3GMF A;  4X43 A;  4AF2 A;  2GDR A;  3HXS A;  4CHS A;  4PNG A;  1EGR A;  4ZBB A;  1NM3 A;  2H6X A;  4K0G A;  1M2D A;  2NTO A;  2C0E A;  4FYC A;  6GSU A;  3UAP A;  3GA4 A;  2H1A A;  7GSS A;  2TIR A;  1M2A A;  3CTF A;  2ON7 A;  4AGS A;  2DLX A;  3ZFB A;  4CDO A;  2IMK A;  3EMP A;  2LJR A;  2YV7 A;  3MSZ A;  1O7U A; 
#chains in the Genus database with same CATH topology
 2WS2 A;  3EU3 A;  4NMU A;  2HYX A;  2FWF A;  1TRW A;  1MD3 A;  4WBJ A;  4OFT A;  5FWG A;  5DAK A;  2B5Y A;  3G7J A;  4HJ2 A;  4NXI A;  1Z9H A;  2YOI A;  5C00 A;  2C3T A;  4CW9 A;  4WF4 A;  2FA4 A;  1M2B A;  5GAN D;  3S9F A;  2O36 A;  5G5E A;  1XWG A;  4TR4 A;  4OFN A;  4QL7 A;  3M8N A;  4PHZ C;  4ECJ A;  1OC9 A;  4IP1 A;  3M9J A;  1AW9 A;  4K2X A;  1GTU A;  2DJ1 A;  1U3I A;  2RLI A;  2HLS A;  1T4Z A;  2ZNM A;  2MMO A;  2GVP A;  1GSU A;  1H75 A;  3FZ9 A;  1OVN A;  4DVC A;  1G7E A;  3A2X A;  3HJM A;  3C1R A;  3D6I A;  5COH A;  8GSS A;  1GSS A;  2H73 A;  4X4J A;  5H5Q A;  3ZIV A;  1SVL A;  4WR4 A;  4MNN A;  1GUK A;  4EF0 A;  1AQV A;  2BTO T;  16GS A;  2H19 A;  4WKW A;  4PUA A;  2I9H A;  2LRN A;  4USS A;  1YKA A;  2K6V A;  1SJZ A;  2HRF A;  3KCM A;  3LYK A;  2OA7 A;  3GTU B;  5ID2 B;  3US3 A;  2F8F A;  1MDJ A;  1OE8 A;  1ST9 A;  3WGE A;  3GUS A;  4YQU A;  1C72 A;  2AV4 A;  4FH8 A;  1FOH A;  4IJ3 A;  4MZW A;  1PGT A;  4PQI A;  2H70 A;  2H1L A;  19GS A;  1GTB A;  2FD3 A;  6GSX A;  1Z6M A;  2PPT A;  3U5R E;  5IM9 A;  3ZYW A;  2X8H A;  2E2G A;  5HR1 A;  3FZA A;  3GKK A;  4PTS A;  1SJ6 A;  1X0R A;  5ECO B;  2MMA A;  3MIX A;  2WVX B;  2VL2 C;  1N8J A;  4AKX B;  4GDF A;  2MMN A;  4KSO A;  3W8S A;  5J4Y A;  2TRX A;  5A4V A;  2OKA A;  4HU9 A;  3E9J B;  3M1G A;  3RDW A;  1MDK A;  1XWK A;  1V57 A;  4K8M A;  4MJE A;  3ZML A;  1ML6 A;  3RHC A;  1Y1U A;  1YDK A;  3TUE A;  2DJ2 A;  5DDL A;  3CSJ A;  1PSQ A;  2Z9S A;  2XBI A;  1BX9 A;  2DSA A;  2HFD A;  1YJ6 A;  5HR3 A;  1MD4 A;  4EIP A;  2N5F A;  1ILO A;  5KN2 A;  2A2S A;  3EYT A;  4OCE A;  3LGC A;  3TKS A;  1J9B A;  1BYE A;  2IPA A;  3A2W A;  4QMK A;  4X0X A;  4G2E A;  1ZL9 A;  3IK7 A;  4JZQ A;  2A2P A;  3DEX A;  4NHW A;  1XW5 A;  2C8U A;  5CRD A;  5CNW A;  2DC5 A;  5CP1 A;  1A8L A;  1G7O A;  4HQZ A;  4ECC A;  3IAM 2;  4KA0 A;  1I5G A;  2CVB A;  1HYU A;  2LRC A;  5CYY A;  4ACS A;  1PQN A;  1ZZY A;  4AJ6 A;  4XS4 B;  3KMN A;  4XIH A;  4MF7 A;  3GKX A;  4OFM A;  4MCU A;  3TDG A;  2GST A;  5ECI B;  3GX8 A;  4GRF A;  2RII A;  2H30 A;  4EVM A;  5IMC A;  4F2I A;  3R2Q A;  4IGJ A;  1JFU A;  4BVY A;  1LU4 A;  2JSY A;  3TJJ A;  3WYW A;  2OAC A;  2PVO C;  3TOT A;  3UBK A;  1BJX A;  2VLU A;  4DSS A;  1K0O A;  3Q74 A;  1V2A A;  1SVM A;  2VM2 A;  3IAS 2;  4J56 E;  4GSS A;  3F8U A;  6GST A;  2A4V A;  1F3A A;  1XCC A;  3LG6 A;  2OE0 A;  2HZF A;  1FO5 A;  5KN0 A;  1GH2 A;  3J7Y b;  1VF4 A;  3KTB A;  1RK4 A;  2AJQ B;  1ERU A;  2VD0 A;  2BJX A;  3KGK A;  1TK0 B;  4TR0 A;  1AQW A;  2O3E A;  3MAK A;  4N10 A;  4ZB9 A;  3D5J A;  1XOB A;  3UVH A;  3ZIJ A;  5GAP D;  4Q5R A;  3EIN A;  2OBK A;  2C80 A;  4NWY A;  1TU7 A;  3N9J A;  3VWX A;  3NZN A;  2VCZ A;  1TW9 A;  4LL1 B;  4K2D A;  2YZH A;  4QL9 A;  1BG1 A;  5DAL B;  3KJY A;  2CQ9 A;  1WOU A;  4PUF C;  2HSM B;  4I8B A;  4D73 A;  4TRX A;  5GZZ B;  3SBC A;  4FQU A;  2VL2 A;  1YY7 A;  5ECK B;  1YVL A;  2L5L A;  1XWB A;  1ZOF A;  5EVO A;  1AXD A;  2DJ0 A;  3BCI A;  3D22 A;  5DJL A;  4Q5N A;  5B8A A;  1JZO A;  5H5R A;  3HZ4 A;  3CTG A;  2LNT A;  3PIN A;  2N5B A;  4POM A;  2LJA A;  1T8E B;  1GSF A;  1OKD A;  3IHQ A;  3GX0 A;  3H4K A;  4G10 A;  4GF0 A;  1SK0 A;  4ZIJ A;  3QCP A;  1N25 A;  2YWM A;  3ERW A;  3FR3 A;  1CQH A;  2H0H A;  1TKD B;  4IN0 A;  2H6Z A;  4KF9 A;  2LQQ A;  3ED3 A;  4NPB A;  3DWV A;  1ZYE A;  20GS A;  1B48 A;  1EP7 A;  2ZCT A;  6GSW A;  1GLP A;  3CRT A;  3GHA A;  2IMF A;  1TK8 B;  5DQS A;  3HYP A;  3EPT A;  1DSB A;  4EDZ A;  1K3L A;  1A2J A;  2WCI A;  3FRC A;  1IYH A;  3DML A;  3KP8 A;  2RUE A;  2I3Y A;  5H5S A;  2C4J A;  3IOS A;  5ABR A;  2O87 A;  4EIQ A;  1GUH A;  1F3B A;  3D4T A;  4JE1 A;  2H76 A;  4L5O A;  2RM5 A;  3I9V 2;  4IS0 A;  2LTK A;  4I6X A;  1EOH A;  3KM6 A;  1GWC A;  2PGT A;  3GL3 A;  3UOM A;  2LEG A;  4K5R A;  6GSV A;  3Q18 A;  1GLQ A;  3Q19 A;  1PN9 A;  4F0B A;  3ISO A;  1SJI A;  3GL5 A;  3HJO A;  4ZBA A;  1JLW A;  1U87 A;  5DVB A;  1PX7 A;  4PXO A;  1X9W B;  1TU8 A;  3A2V A;  1B9X C;  3Q6O A;  4HUA A;  4KCE A;  3F9U A;  1SL2 B;  2L6C A;  4OMV A;  1OE7 A;  1Q4J A;  1XVW A;  2VO4 A;  3GTU A;  3F4T A;  1YEX A;  5IIZ A;  5ID2 A;  5B6N A;  2ZUP A;  1TOF A;  4YQV A;  4POL A;  1XZO A;  3KH7 A;  4J57 E;  2KOK A;  3KH9 A;  2QSI A;  5JCU A;  2HZE B;  3LW9 A;  2PN8 A;  4LA1 A;  1PL1 A;  2KP2 A;  2V6O A;  3GST A;  3IBH A;  4YKF A;  1WMJ A;  5B8B A;  4GWR A;  1K0D A;  4KND A;  1T4Y A;  3VUR A;  4AKH A;  2B7K A;  2KP1 A;  5BRT A;  3HMJ G;  5AIS A;  2F51 A;  2HRK A;  5ELG A;  3QFA C;  3P8W A;  3DGQ A;  4WBR D;  1SYX A;  2VLV A;  1VGL A;  2H0I A;  3ERG A;  2XPE A;  4CY8 A;  1TK5 B;  4AJ7 A;  1XWC A;  2VKZ G;  18GS A;  1S3R A;  3IA1 A;  5CO3 A;  2NBS A;  5A5K A;  2HQT A;  3TKS C;  1K3Y A;  2GSS A;  5J9B A;  1OAZ A;  4FIW A;  4BWQ A;  2M46 A;  4JU5 A;  3VWW A;  2DIY A;  4IKH A;  1FOV A;  1V58 A;  4XRD A;  2OAD A;  4ML1 A;  4V1A g;  2OT3 A;  2PER A;  2YZU A;  4ZIL A;  2R2J A;  1ERV A;  4PI0 C;  5J40 A;  3DYR A;  1BF5 A;  3H1N A;  5G5F A;  4ZL9 A;  2R6K A;  5IMZ A;  4ZB8 A;  1J08 A;  4AI6 A;  3LXT A;  5A34 B;  1A2L A;  2O7K A;  3TJB A;  1USB A;  1WIK A;  2HSN A;  1S3A A;  1Z5Y E;  1KEB A;  3VPQ A;  2X8G A;  4KB3 A;  2X49 A;  2R0G A;  2NDO A;  2PUK C;  3WD6 A;  4EC0 A;  4NV5 A;  3C7M A;  4RI7 A;  4Z2R A;  1XVQ A;  4Z7X A;  4XS4 A;  1YZX A;  4MPG A;  4G9H A;  4MH2 A;  1PMT A;  4AJ8 A;  4MP4 A;  3HHV A;  2FLS A;  1THO A;  2YJ7 A;  1GTA A;  1HNA A;  1BED A;  4K7N A;  3BOA A;  4Z2T A;  1SVO A;  4DSQ A;  13GS A;  5G2Z A;  1TI1 A;  4K7O A;  3EWL A;  2IJY A;  3VWV A;  3LWA A;  3VI7 A;  4AKI A;  1XWA A;  4MPF A;  1EEJ A;  4ZL8 A;  3TRQ A;  2GQK A;  2CVK A;  2R4V A;  1GTI A;  3O76 A;  3DD3 A;  2XPD A;  2DML A;  1UC7 A;  3CMI A;  1O8W A;  1A0F A;  3FK8 A;  5A4W A;  4MH3 A;  1KNG A;  2L57 A;  3OR5 A;  4TOP A;  1DE2 A;  3FKF A;  4PX1 A;  2I81 A;  3CQF A;  5KOW A;  4O7H A;  2FWE A;  4XCS A;  1F9M A;  4TR1 B;  2DJK A;  2AB6 A;  2RM6 A;  3WT2 A;  1MTC A;  2EFH A;  4LLR A;  2V32 A;  3KEB A;  2BMX A;  2V2G A;  2VD1 A;  1I1I P;  3H79 A;  4MLY A;  2CX3 A;  3L78 A;  1XW9 A;  4K5S A;  3ZLP A;  1M3I A;  1ZYQ B;  2YWO A;  5BMU B;  4HZ2 A;  2IME A;  2G2Q A;  1DE1 A;  2VCQ A;  3TB2 A;  1E2Y A;  4IVF A;  4KSM A;  2GZZ A;  3TKP A;  4GQF A;  2MZC A;  4O5Q A;  2WVZ A;  1Z7P A;  1PKW A;  1T00 A;  1B8X A;  3ZFL A;  1URM A;  5IMD A;  5FT3 A;  3FY7 A;  2HSM A;  4K6X A;  4FYU A;  3E3E A;  5G30 A;  10GS A;  3K8N A;  2MBS A;  2PVQ A;  4P3Y B;  2EFE A;  2WB9 A;  5A4U A;  1A2M A;  2CX4 A;  2NVL A;  4IP6 A;  1FB0 A;  5J3R A;  2H8L A;  3ERF A;  1T7P B;  3FYG A;  1AIU A;  2PU9 C;  2H0G A;  3LJR A;  2HRA A;  2C0G A;  3C8E A;  2FGX A;  1ZYP A;  4ECI A;  5JWR B;  2A2R A;  2JAC A;  1GSQ A;  2LV3 A;  4ICY A;  1FVJ A;  1LJR A;  5FHI A;  1XG8 A;  2V41 A;  2V6K A;  5ECR B;  4MZC A;  4POK A;  1BQ7 A;  2B1L A;  1YKC A;  4L8E A;  1EP8 A;  4G0I A;  3GKN A;  1YEP A;  6GSY A;  2LNS A;  5CRW A;  4NHZ A;  3HVV A;  5HFG A;  4BA7 A;  2TRC P;  4RI6 A;  2MYG A;  1SL1 B;  4ZB6 A;  2C1Y A;  3FR9 A;  3EU4 A;  2IWT A;  12GS A;  5AN1 A;  1R7H A;  5GSS A;  1V40 A;  1EEM A;  2IFQ B;  3IC8 A;  2K18 A;  2D2Z A;  4N3Z A;  5A5H B;  3ZZX A;  4I2T A;  3GFK A;  3DKS A;  4HQS A;  4MJC A;  4GLT A;  1F6M C;  2QA1 A;  2K8S A;  1Q98 A;  9GSS A;  5D73 A;  2WW2 A;  3FZ5 A;  4MMM A;  4JBB A;  3VLN A;  3UEM A;  2YWI A;  3ZRE A;  4WR5 A;  3CSH A;  2P0G A;  2CT6 A;  1GUL A;  2DKI A;  1T3B A;  1SK2 A;  4JED A;  4EUY A;  3C73 A;  1YQ1 A;  4YAP A;  2VLT A;  4EE0 A;  4F0C A;  4H86 A;  5ECN B;  1QFN A;  2REM A;  3R3E A;  4GCI A;  4GSN A;  1JZD A;  1EV9 A;  3TKS E;  5IQY A;  3HCZ A;  2EFD A;  1OC3 A;  2DKH A;  3PH9 A;  1TRV A;  2JZS A;  3DVW A;  5J9C A;  1K0B A;  4QQ7 A;  2R3X A;  1THX A;  2CV4 A;  2J9H A;  3CWG A;  5DBQ A;  3W6G A;  4TXV A;  4TR3 A;  5ECM B;  4YAV A;  2P31 A;  3HVX A;  3EC3 A;  3QPM A;  3UMA A;  3P90 A;  4PNF A;  3GYK A;  2VOC A;  2HZE A;  2OE1 A;  4IHU A;  5CAX A;  2CZ3 A;  2E0Q A;  1VF2 A;  3N5O A;  5ECL B;  2B1K A;  2FWG A;  2VCX A;  2VUP A;  1U6T A;  4IW9 A;  1KBN A;  2QKE A;  1B4P A;  2VCV A;  3IE3 A;  4LL4 B;  3P2A A;  5ENU A;  1V9W A;  1GSE A;  3NOF A;  3QAG A;  3VI5 A;  5DJM A;  2CA8 A;  4Q5F A;  1ABA A;  1S3C A;  3DXB A;  5HR0 A;  2R5G A;  2DJJ A;  2OBI A;  1MEK A;  2GT6 A;  2L4Q A;  4MDC A;  3UVT A;  4E8H A;  3GUR A;  2FUG 2;  3ZL5 A;  3L0H A;  1G0T A;  4G01 A;  1GSD A;  5EL8 A;  3TKQ A;  4PI2 C;  3QR6 A;  1F2E A;  3CXG A;  4RUV A;  3VFI A;  3ME8 A;  3CBU A;  4G0K A;  3F6F A;  5F0G A;  2V1M A;  3ZIT A;  3MDK A;  5B6M A;  1S4B P;  3CSI A;  1HNB A;  2LJK A;  3RFR C;  2YV9 A;  4YH2 A;  3KIJ A;  2XHF A;  2CZ2 A;  3F4R A;  1AAZ A;  5G1K A;  2WVY A;  3LEF A;  5A34 A;  2LQO A;  2JZT A;  4TN8 A;  2GZP A;  4I2U A;  1AC1 A;  2H71 A;  1GL8 A;  4HJM A;  3GKM A;  5D9T A;  1Z7R A;  1E6B A;  2H66 A;  3RAZ A;  1EGO A;  3AY8 A;  5IO0 A;  3C1S A;  3GIX A;  5HFI A;  2WW0 A;  4MJB A;  3J7Y k;  1UN2 A;  1OKT A;  1HQO A;  4IQ1 A;  1XW6 A;  4V2M A;  4L0U A;  1ZYN A;  1B9Y C;  4HI7 A;  1DBY A;  4JR6 A;  4XS1 A;  5G1L A;  5IO2 A;  1ZGN A;  3F4S A;  1M9A A;  5IMA A;  4POB A;  5G31 A;  1XXU A;  4ML6 A;  1O81 A;  4HS1 A;  4ZB7 A;  4ULX A;  4AKG A;  2MMZ A;  1HD2 A;  1M3J A;  4GST A;  2GGT A;  4O5U A;  2VAF A;  3UIW A;  3LYP A;  1YF0 A;  3CHX C;  4KDY A;  2GT5 A;  4MZB A;  1SKW B;  4K1F A;  4XS6 A;  3ZTL A;  3I6A A;  3IC4 A;  3LOR A;  5ECS A;  4HDE A;  2GTU A;  3BD2 A;  2L59 A;  2JZR A;  4ILF A;  1M99 A;  3FR6 A;  3O6T A;  2YN1 A;  4I5Q A;  5J41 A;  1SK1 A;  5IMF A;  1WP0 A;  4TXO B;  2P5Q A;  2QA2 A;  2B5X A;  2O5V A;  4HEA 2;  1UA5 A;  4TR1 A;  2OE3 A;  4EKZ A;  2QGV A;  4LMV A;  4O32 A;  5JWQ B;  4YKG A;  2YAN A;  4PUR A;  2AYT A;  3NIV A;  3ZMK A;  5D8I A;  3EMX A;  4ECB A;  1WWJ A;  2C0F A;  1SKR B;  3TGZ A;  5KEJ A;  4EXJ A;  3TJF A;  2AUV A;  4PQH A;  3GSS A;  2IIY A;  2WVX A;  5J4U A;  2I1U A;  1TP9 A;  3GH6 A;  5ELA A;  5BMU A;  3BBY A;  5ECP B;  1FW1 A;  2FNO A;  5D93 A;  2C3N A;  1QGV A;  4DSR A;  3FW2 A;  3PGT A;  4D73 B;  1N2A A;  4K9Z A;  3RBT A;  3VK9 A;  5D9W A;  3RPN A;  1TDI A;  5J5N A;  3F0I A;  5A1N B;  4L0W A;  2WDU A;  1QUW A;  4DEJ A;  4ZL7 A;  1B4Q A;  3QD9 A;  3FEU A;  3QDN A;  1U3A A;  2YPM A;  1VF3 A;  2WJU A;  1R4W A;  2H74 A;  3UL3 A;  3M0F A;  3RHB A;  3TRX A;  1LBK A;  2LS5 A;  1F37 A;  3TKR A;  3TOU A;  2HXK A;  1JHB A;  2DJ3 A;  4N0V A;  1M9B A;  1MDI A;  2LUS A;  4NAX A;  2VCT A;  4E8E A;  1O73 A;  2E7P A;  2H1D A;  2IL3 A;  5F05 A;  2CVD A;  2FCH A;  5IOX A;  1SD8 A;  1K0N A;  1GSY A;  3GH9 A;  1K0A A;  3HZ8 A;  2I4A A;  1O8X A;  1TRU A;  1PL2 A;  2H1B A;  1G6Y A;  1TI3 A;  2KLX A;  4JRR A;  1DUG A;  4FYB A;  4KX4 A;  3GV1 A;  4BL7 B;  4OO5 A;  4O92 A;  1RW1 A;  3HDC A;  4ZXG A;  2HE3 A;  2WRT A;  4IBP A;  4IJI A;  3ZRD A;  2L4C A;  5J47 A;  3SWL A;  5DCG A;  3IR4 A;  2WFC A;  5B7C A;  2H6Y A;  2IFQ A;  5CRH A;  1KTE A;  2LKU A;  5D9V A;  1R5P A;  1XBS A;  4YQM A;  5EPF A;  4Z2U A;  5A5H A;  2QC7 A;  2PBJ A;  5JCG A;  2VCW A;  4Q5Q A;  2LST A;  3M3M A;  3F3Q A;  5CRG A;  3BJ5 A;  5E4W A;  4LMW A;  3HD5 A;  4RQX A;  2H75 A;  4BPY A;  5INY A;  1O85 A;  3TCO A;  5L71 A;  2ES7 A;  3L9V A;  3D4M A;  2UV8 G;  2PMT A;  1SU9 A;  4GTU A;  1QK8 A;  5LD0 A;  5HR2 A;  2GQM A;  2YJH A;  3H8Q A;  2B6M A;  17GS A;  2YWN A;  3G7Y A;  5DCH A;  1X9S B;  4EDY A;  3A5W A;  3E0U A;  4PGT A;  4L5L A;  4BVX B;  3HJP A;  3MYD A;  3VPT A;  2DMM A;  3GRX A;  3KD0 A;  2E2M A;  1RQM A;  3L9U A;  1FHE A;  1Z3E A;  1GRX A;  4ISD A;  5IOW A;  3A5I A;  2F9S A;  5AIV A;  5F07 A;  2YCD A;  3KTL A;  2HRK B;  5DAL A;  3D0Z A;  1EWX A;  1S3D A;  3QAW A;  4V2N A;  5IPH A;  2OJL A;  5AIX A;  2UZ8 A;  2CAQ A;  4ZBD A;  3LSZ A;  4F9Z A;  1TTZ A;  1X5E A;  2PWJ A;  1R5A A;  1UVZ A;  2O85 A;  2GQL A;  3APS A;  1VRS D;  2M80 A;  2GSQ A;  2JL4 A;  3F6D A;  1A24 A;  3FHK A;  2IMD A;  3HKR A;  1ZCP A;  1FVK A;  1ACV A;  1V98 A;  2KHP A;  3UJ1 A;  1NHY A;  2GLR A;  1GNW A;  22GS A;  2WUL A;  3FMW A;  2LRT A;  2FWH A;  3CYN A;  2EIR A;  1K0M A;  1PN0 A;  3PPU A;  2GS3 A;  3ZVJ D;  2N5A A;  2JAD A;  2H01 A;  4N11 A;  3BCK A;  2O89 A;  3KXO A;  5DAK B;  1O6J A;  2K8V A;  1BG5 A;  1SL0 B;  2F3M A;  1QQ2 A;  4JR4 A;  4HSC X;  5F8B A;  1A8Y A;  4K0N A;  4XTS A;  2HSN B;  1R26 A;  1SEN A;  4FO5 A;  1H4O A;  2C0D A;  4HU7 A;  1PX6 A;  1OC9 B;  3LQ7 A;  1XOA A;  4G0L A;  3WGX A;  2NPB A;  2KUC A;  4KDU A;  3GNJ A;  1X9M B;  3IV4 A;  2O8V B;  1VF1 A;  1AQX A;  1OYJ A;  2HSY A;  1W4V A;  1SKS B;  4KAE A;  2R0C A;  1TXX A;  3EUR A;  4FXY P;  4V2L A;  3F3R A;  2YNX A;  3G9B A;  2R0P A;  3TJG A;  3HY2 A;  1WE0 A;  1IYI A;  2M72 A;  2F8A A;  2A4H A;  3LFL A;  3DRN A;  5DQY A;  2L6D A;  4OO4 A;  3IHG A;  4WET A;  5CRE A;  4A5P A;  2DIZ A;  3G7I A;  3APO A;  4WF5 A;  1WJK A;  4MAB A;  3L9S A;  3V1W A;  4J2F A;  5IPG A;  2ALB A;  1TRS A;  4ID0 A;  3RPP A;  1QXH A;  1Y6E A;  4GQC A;  3ZVJ A;  3HVN A;  3HVS A;  2X8C A;  5ECQ B;  2X64 A;  2HNL A;  1G6W A;  1FG4 A;  1WRY A;  1A23 A;  3QMX A;  3TJK A;  5KN3 A;  4OCF A;  4KE3 A;  2L5O A;  5ECH B;  4NV2 A;  5KOX A;  2VL3 A;  2R37 A;  3EVI A;  3I43 A;  4E68 A;  1SYR A;  3IPZ A;  4X1U A;  4TXO A;  1W89 A;  5HQP A;  3P7X A;  5JCW A;  2ON5 A;  1YF1 A;  5HFK A;  1K3O A;  5D9X A;  1ERW A;  4MA9 A;  3QAV A;  2AAW A;  4N30 A;  4BWS A;  1ON4 A;  3MNG A;  2MBT A;  5LNK e;  2HRN A;  1PRX A;  1ZMA A;  3TRP A;  2IN3 A;  3O3T A;  2B7J A;  1CQG A;  4MF5 A;  4G19 A;  1J0F A;  2HI7 A;  1XPV A;  3IRA A;  1EZK A;  2B5E A;  2AHE A;  14GS A;  4V1A p;  2FA8 A;  4KDX A;  3VWU A;  5A1N A;  1GP1 A;  1X5D A;  11GS A;  2J23 A;  3M9K A;  2HT9 A;  3KP9 A;  4F82 A;  1QMV A;  3F63 A;  1M7T A;  2WW1 A;  3W8J A;  2P5R A;  3ME7 A;  3IK9 A;  4MK3 A;  1GUM A;  1I9D A;  1Z6N A;  4WEY A;  4KUN A;  5F06 A;  1TXU A;  3EE2 A;  4GXZ A;  2G0F A;  4EO3 A;  1JLV A;  3KMO A;  4OD7 A;  3APQ A;  1PFO A;  1YEW C;  1A0R P;  1NHO A;  3I69 A;  2IMI A;  5IMV A;  2VIM A;  4IEL A;  1ERT A;  2RUF A;  3LXZ A;  3D21 A;  5EY6 A;  3H93 A;  3A3T A;  2XBQ A;  4KH7 A;  4O5R A;  1Y25 A;  3UAR A;  1PD2 1;  3C71 A;  1K0C A;  2VL9 A;  2CAI A;  1PKZ A;  5GST A;  3QFB C;  4N0Z A;  3WGD A;  2B3S A;  3L4N A;  2WW3 A;  1FB6 A;  3CRU A;  1XFL A;  1TJD A;  2X4A A;  2VM1 A;  3UBL A;  3IXR A;  4BVY B;  1NW2 A;  4BL7 A;  3JCM L;  4EL1 A;  1U88 A;  1NSW A;  3DIE A;  2EIQ A;  4KCA A;  1AUC A;  5JWO B;  4WXT A;  2DBC A;  2XC2 A;  2JSZ A;  2K9F A;  1XIY A;  1WPI A;  4KGI A;  4F03 A;  4DSS B;  4IQA A;  1EV4 A;  4RQR A;  4MJA A;  2EC4 A;  3U6V A;  2H72 A;  2EIO A;  3HA9 A;  6GSS A;  3RGB C;  3IDV A;  2FHE A;  1JZR A;  4HZ4 A;  1X5C A;  1HNC A;  5AGY A;  2FY6 A;  4HOJ A;  5E59 A;  1PA3 A;  4TVE A;  3FZ4 A;  2H1G A;  3KZQ A;  4PQ1 A;  4MF6 A;  3WT1 A;  1JZW A;  1OC8 A;  4I97 A;  2C3Q A;  1BAY A;  5C04 A;  1SD9 A;  2HSH A;  3QOU A;  2GZY A;  4KW6 A;  3TU3 B;  1FAA A;  2YP6 A;  5LCZ A;  2JU5 A;  3PR8 A;  1T1V A;  1M0U A;  4TKY A;  3DVX A;  2EFC A;  5D96 A;  2WZ9 A;  4OWY A;  3MWH A;  4XHM A;  4TW5 A;  4XRA A;  4BVX A;  1GNE A;  2X99 A;  4K7I A;  2WGR A;  5KN1 A;  3GN3 A;  2GSR A;  1EOG A;  3GMF A;  2WZS A;  4X43 A;  4AF2 A;  2GDR A;  3HXS A;  4CHS A;  4PNG A;  1EGR A;  4ZBB A;  1NM3 A;  2H6X A;  4W66 A;  5J4V A;  4K0G A;  1M2D A;  4CY6 A;  2NTO A;  2C0E A;  4FYC A;  6GSU A;  3UAP A;  3GA4 A;  2H1A A;  7GSS A;  2TIR A;  1M2A A;  3CTF A;  2ON7 A;  4AGS A;  2DLX A;  3ZFB A;  4CDO A;  2IMK A;  3EMP A;  2LJR A;  2YV7 A;  4BIK A;  3MSZ A;  1O7U A; 
#chains in the Genus database with same CATH homology
 2WS2 A;  3EU3 A;  4NMU A;  2HYX A;  2FWF A;  1TRW A;  1MD3 A;  4WBJ A;  4OFT A;  5FWG A;  5DAK A;  2B5Y A;  3G7J A;  4HJ2 A;  4NXI A;  1Z9H A;  2YOI A;  5C00 A;  2C3T A;  4CW9 A;  4WF4 A;  2FA4 A;  1M2B A;  5GAN D;  3S9F A;  5G5E A;  1XWG A;  4TR4 A;  4OFN A;  4QL7 A;  3M8N A;  4ECJ A;  1OC9 A;  4IP1 A;  3M9J A;  1AW9 A;  4K2X A;  1GTU A;  2DJ1 A;  1U3I A;  2RLI A;  2HLS A;  1T4Z A;  2ZNM A;  2MMO A;  2GVP A;  1GSU A;  1H75 A;  3FZ9 A;  1OVN A;  4DVC A;  1G7E A;  3A2X A;  3HJM A;  3C1R A;  3D6I A;  5COH A;  8GSS A;  1GSS A;  2H73 A;  4X4J A;  5H5Q A;  3ZIV A;  1SVL A;  4WR4 A;  4MNN A;  1GUK A;  4EF0 A;  1AQV A;  2BTO T;  16GS A;  2H19 A;  4WKW A;  4PUA A;  2I9H A;  2LRN A;  4USS A;  1YKA A;  2K6V A;  1SJZ A;  2HRF A;  3KCM A;  3LYK A;  2OA7 A;  3GTU B;  5ID2 B;  3US3 A;  2F8F A;  1MDJ A;  1OE8 A;  1ST9 A;  3WGE A;  3GUS A;  4YQU A;  1C72 A;  2AV4 A;  4FH8 A;  1FOH A;  4IJ3 A;  4MZW A;  1PGT A;  4PQI A;  2H70 A;  2H1L A;  19GS A;  1GTB A;  2FD3 A;  6GSX A;  1Z6M A;  2PPT A;  3U5R E;  5IM9 A;  3ZYW A;  2X8H A;  2E2G A;  5HR1 A;  3FZA A;  3GKK A;  4PTS A;  1SJ6 A;  1X0R A;  5ECO B;  2MMA A;  3MIX A;  2VL2 C;  1N8J A;  4AKX B;  4GDF A;  2MMN A;  4KSO A;  3W8S A;  5J4Y A;  2TRX A;  5A4V A;  2OKA A;  4HU9 A;  3E9J B;  3M1G A;  3RDW A;  1MDK A;  1XWK A;  1V57 A;  4K8M A;  4MJE A;  3ZML A;  1ML6 A;  3RHC A;  1Y1U A;  1YDK A;  3TUE A;  2DJ2 A;  5DDL A;  3CSJ A;  1PSQ A;  2Z9S A;  2XBI A;  1BX9 A;  2DSA A;  2HFD A;  1YJ6 A;  5HR3 A;  1MD4 A;  4EIP A;  2N5F A;  1ILO A;  5KN2 A;  2A2S A;  3EYT A;  4OCE A;  3LGC A;  3TKS A;  1J9B A;  1BYE A;  2IPA A;  3A2W A;  4QMK A;  4X0X A;  4G2E A;  1ZL9 A;  3IK7 A;  4JZQ A;  2A2P A;  3DEX A;  4NHW A;  1XW5 A;  2C8U A;  5CRD A;  5CNW A;  2DC5 A;  5CP1 A;  1A8L A;  1G7O A;  4HQZ A;  4ECC A;  3IAM 2;  4KA0 A;  1I5G A;  2CVB A;  1HYU A;  2LRC A;  5CYY A;  4ACS A;  1PQN A;  1ZZY A;  4AJ6 A;  4XS4 B;  3KMN A;  4XIH A;  4MF7 A;  3GKX A;  4OFM A;  4MCU A;  3TDG A;  2GST A;  5ECI B;  3GX8 A;  4GRF A;  2RII A;  2H30 A;  4EVM A;  5IMC A;  4F2I A;  3R2Q A;  4IGJ A;  1JFU A;  4BVY A;  1LU4 A;  2JSY A;  3TJJ A;  3WYW A;  2OAC A;  2PVO C;  3TOT A;  3UBK A;  1BJX A;  2VLU A;  4DSS A;  1K0O A;  3Q74 A;  1V2A A;  1SVM A;  2VM2 A;  3IAS 2;  4J56 E;  4GSS A;  3F8U A;  6GST A;  2A4V A;  1F3A A;  1XCC A;  3LG6 A;  2OE0 A;  2HZF A;  1FO5 A;  5KN0 A;  1GH2 A;  3J7Y b;  1VF4 A;  3KTB A;  1RK4 A;  2AJQ B;  1ERU A;  2VD0 A;  2BJX A;  3KGK A;  1TK0 B;  4TR0 A;  1AQW A;  3MAK A;  4N10 A;  4ZB9 A;  3D5J A;  1XOB A;  3UVH A;  3ZIJ A;  5GAP D;  4Q5R A;  3EIN A;  2OBK A;  2C80 A;  4NWY A;  1TU7 A;  3N9J A;  3VWX A;  3NZN A;  2VCZ A;  1TW9 A;  4LL1 B;  4K2D A;  2YZH A;  4QL9 A;  1BG1 A;  5DAL B;  3KJY A;  2CQ9 A;  1WOU A;  4PUF C;  2HSM B;  4I8B A;  4D73 A;  4TRX A;  5GZZ B;  3SBC A;  4FQU A;  2VL2 A;  1YY7 A;  5ECK B;  1YVL A;  2L5L A;  1XWB A;  1ZOF A;  5EVO A;  1AXD A;  2DJ0 A;  3BCI A;  3D22 A;  5DJL A;  4Q5N A;  5B8A A;  1JZO A;  5H5R A;  3HZ4 A;  3CTG A;  2LNT A;  3PIN A;  2N5B A;  4POM A;  2LJA A;  1T8E B;  1GSF A;  1OKD A;  3IHQ A;  3GX0 A;  3H4K A;  4G10 A;  4GF0 A;  1SK0 A;  4ZIJ A;  3QCP A;  1N25 A;  2YWM A;  3ERW A;  3FR3 A;  1CQH A;  2H0H A;  1TKD B;  4IN0 A;  2H6Z A;  4KF9 A;  2LQQ A;  3ED3 A;  4NPB A;  3DWV A;  1ZYE A;  20GS A;  1B48 A;  1EP7 A;  2ZCT A;  6GSW A;  1GLP A;  3CRT A;  3GHA A;  2IMF A;  1TK8 B;  5DQS A;  3HYP A;  3EPT A;  1DSB A;  4EDZ A;  1K3L A;  1A2J A;  2WCI A;  3FRC A;  1IYH A;  3DML A;  3KP8 A;  2RUE A;  2I3Y A;  5H5S A;  2C4J A;  3IOS A;  5ABR A;  2O87 A;  4EIQ A;  1GUH A;  1F3B A;  3D4T A;  4JE1 A;  2H76 A;  4L5O A;  2RM5 A;  3I9V 2;  4IS0 A;  2LTK A;  4I6X A;  1EOH A;  3KM6 A;  1GWC A;  2PGT A;  3GL3 A;  3UOM A;  2LEG A;  4K5R A;  6GSV A;  3Q18 A;  1GLQ A;  3Q19 A;  1PN9 A;  4F0B A;  3ISO A;  1SJI A;  3GL5 A;  3HJO A;  4ZBA A;  1JLW A;  1U87 A;  5DVB A;  1PX7 A;  4PXO A;  1X9W B;  1TU8 A;  3A2V A;  1B9X C;  3Q6O A;  4HUA A;  4KCE A;  3F9U A;  1SL2 B;  2L6C A;  4OMV A;  1OE7 A;  1Q4J A;  1XVW A;  2VO4 A;  3GTU A;  3F4T A;  1YEX A;  5IIZ A;  5ID2 A;  5B6N A;  2ZUP A;  1TOF A;  4YQV A;  4POL A;  1XZO A;  3KH7 A;  4J57 E;  2KOK A;  3KH9 A;  2QSI A;  5JCU A;  2HZE B;  3LW9 A;  2PN8 A;  4LA1 A;  1PL1 A;  2KP2 A;  2V6O A;  3GST A;  3IBH A;  4YKF A;  1WMJ A;  5B8B A;  4GWR A;  1K0D A;  4KND A;  1T4Y A;  3VUR A;  4AKH A;  2B7K A;  2KP1 A;  5BRT A;  3HMJ G;  5AIS A;  2F51 A;  2HRK A;  5ELG A;  3QFA C;  3P8W A;  3DGQ A;  4WBR D;  1SYX A;  2VLV A;  1VGL A;  2H0I A;  3ERG A;  2XPE A;  4CY8 A;  1TK5 B;  4AJ7 A;  1XWC A;  2VKZ G;  18GS A;  3IA1 A;  5CO3 A;  2NBS A;  5A5K A;  2HQT A;  3TKS C;  1K3Y A;  2GSS A;  5J9B A;  1OAZ A;  4FIW A;  4BWQ A;  2M46 A;  4JU5 A;  3VWW A;  2DIY A;  4IKH A;  1FOV A;  1V58 A;  4XRD A;  2OAD A;  4ML1 A;  4V1A g;  2OT3 A;  2PER A;  2YZU A;  4ZIL A;  2R2J A;  1ERV A;  5J40 A;  3DYR A;  1BF5 A;  3H1N A;  5G5F A;  4ZL9 A;  2R6K A;  5IMZ A;  4ZB8 A;  1J08 A;  4AI6 A;  3LXT A;  5A34 B;  1A2L A;  2O7K A;  3TJB A;  1USB A;  1WIK A;  2HSN A;  1S3A A;  1Z5Y E;  1KEB A;  3VPQ A;  2X8G A;  4KB3 A;  2X49 A;  2R0G A;  2NDO A;  2PUK C;  3WD6 A;  4EC0 A;  4NV5 A;  3C7M A;  4RI7 A;  4Z2R A;  1XVQ A;  4Z7X A;  4XS4 A;  1YZX A;  4MPG A;  4G9H A;  4MH2 A;  1PMT A;  4AJ8 A;  4MP4 A;  3HHV A;  2FLS A;  1THO A;  2YJ7 A;  1GTA A;  1HNA A;  1BED A;  4K7N A;  3BOA A;  4Z2T A;  1SVO A;  4DSQ A;  13GS A;  5G2Z A;  1TI1 A;  4K7O A;  3EWL A;  2IJY A;  3VWV A;  3LWA A;  3VI7 A;  4AKI A;  1XWA A;  4MPF A;  1EEJ A;  4ZL8 A;  3TRQ A;  2GQK A;  2CVK A;  2R4V A;  1GTI A;  3O76 A;  3DD3 A;  2XPD A;  2DML A;  1UC7 A;  3CMI A;  1O8W A;  1A0F A;  3FK8 A;  5A4W A;  4MH3 A;  1KNG A;  2L57 A;  3OR5 A;  4TOP A;  1DE2 A;  3FKF A;  4PX1 A;  2I81 A;  5KOW A;  4O7H A;  2FWE A;  4XCS A;  1F9M A;  4TR1 B;  2DJK A;  2AB6 A;  2RM6 A;  3WT2 A;  1MTC A;  2EFH A;  4LLR A;  2V32 A;  3KEB A;  2BMX A;  2V2G A;  2VD1 A;  3H79 A;  4MLY A;  2CX3 A;  3L78 A;  1XW9 A;  4K5S A;  3ZLP A;  1ZYQ B;  2YWO A;  5BMU B;  4HZ2 A;  2IME A;  2G2Q A;  1DE1 A;  2VCQ A;  3TB2 A;  1E2Y A;  4IVF A;  4KSM A;  2GZZ A;  3TKP A;  4GQF A;  2MZC A;  4O5Q A;  1Z7P A;  1PKW A;  1T00 A;  1B8X A;  3ZFL A;  1URM A;  5IMD A;  5FT3 A;  3FY7 A;  2HSM A;  4K6X A;  4FYU A;  3E3E A;  5G30 A;  10GS A;  3K8N A;  2MBS A;  2PVQ A;  4P3Y B;  2EFE A;  2WB9 A;  5A4U A;  1A2M A;  2CX4 A;  2NVL A;  4IP6 A;  1FB0 A;  5J3R A;  2H8L A;  3ERF A;  1T7P B;  3FYG A;  1AIU A;  2PU9 C;  2H0G A;  3LJR A;  2HRA A;  2C0G A;  3C8E A;  2FGX A;  1ZYP A;  4ECI A;  5JWR B;  2A2R A;  2JAC A;  1GSQ A;  2LV3 A;  4ICY A;  1FVJ A;  1LJR A;  5FHI A;  2V41 A;  2V6K A;  5ECR B;  4MZC A;  4POK A;  1BQ7 A;  2B1L A;  1YKC A;  4L8E A;  1EP8 A;  4G0I A;  3GKN A;  1YEP A;  6GSY A;  2LNS A;  5CRW A;  4NHZ A;  3HVV A;  5HFG A;  4BA7 A;  2TRC P;  4RI6 A;  2MYG A;  1SL1 B;  4ZB6 A;  2C1Y A;  3FR9 A;  3EU4 A;  2IWT A;  12GS A;  5AN1 A;  1R7H A;  5GSS A;  1V40 A;  1EEM A;  2IFQ B;  3IC8 A;  2K18 A;  2D2Z A;  4N3Z A;  5A5H B;  3ZZX A;  4I2T A;  3GFK A;  3DKS A;  4HQS A;  4MJC A;  4GLT A;  1F6M C;  2QA1 A;  2K8S A;  1Q98 A;  9GSS A;  5D73 A;  3FZ5 A;  4MMM A;  4JBB A;  3VLN A;  3UEM A;  2YWI A;  3ZRE A;  4WR5 A;  3CSH A;  2P0G A;  2CT6 A;  1GUL A;  2DKI A;  1T3B A;  1SK2 A;  4JED A;  4EUY A;  3C73 A;  1YQ1 A;  4YAP A;  2VLT A;  4EE0 A;  4F0C A;  4H86 A;  5ECN B;  1QFN A;  2REM A;  3R3E A;  4GCI A;  4GSN A;  1JZD A;  1EV9 A;  3TKS E;  5IQY A;  3HCZ A;  2EFD A;  1OC3 A;  2DKH A;  3PH9 A;  1TRV A;  2JZS A;  3DVW A;  5J9C A;  1K0B A;  4QQ7 A;  2R3X A;  1THX A;  2CV4 A;  2J9H A;  3CWG A;  5DBQ A;  3W6G A;  4TXV A;  4TR3 A;  5ECM B;  4YAV A;  2P31 A;  3HVX A;  3EC3 A;  3QPM A;  3UMA A;  3P90 A;  4PNF A;  3GYK A;  2VOC A;  2HZE A;  2OE1 A;  4IHU A;  5CAX A;  2CZ3 A;  2E0Q A;  1VF2 A;  3N5O A;  5ECL B;  2B1K A;  2FWG A;  2VCX A;  2VUP A;  1U6T A;  4IW9 A;  1KBN A;  2QKE A;  1B4P A;  2VCV A;  3IE3 A;  4LL4 B;  3P2A A;  5ENU A;  1V9W A;  1GSE A;  3NOF A;  3QAG A;  3VI5 A;  5DJM A;  2CA8 A;  4Q5F A;  1ABA A;  1S3C A;  3DXB A;  5HR0 A;  2R5G A;  2DJJ A;  2OBI A;  1MEK A;  2GT6 A;  2L4Q A;  4MDC A;  3UVT A;  4E8H A;  3GUR A;  2FUG 2;  3ZL5 A;  3L0H A;  1G0T A;  4G01 A;  1GSD A;  5EL8 A;  3TKQ A;  3QR6 A;  1F2E A;  3CXG A;  4RUV A;  3VFI A;  3ME8 A;  3CBU A;  4G0K A;  3F6F A;  5F0G A;  2V1M A;  3ZIT A;  3MDK A;  5B6M A;  3CSI A;  1HNB A;  2LJK A;  2YV9 A;  4YH2 A;  3KIJ A;  2XHF A;  2CZ2 A;  3F4R A;  1AAZ A;  5G1K A;  3LEF A;  5A34 A;  2LQO A;  2JZT A;  4TN8 A;  2GZP A;  4I2U A;  1AC1 A;  2H71 A;  1GL8 A;  4HJM A;  3GKM A;  5D9T A;  1Z7R A;  1E6B A;  2H66 A;  3RAZ A;  1EGO A;  3AY8 A;  5IO0 A;  3C1S A;  3GIX A;  5HFI A;  4MJB A;  3J7Y k;  1UN2 A;  1OKT A;  1HQO A;  4IQ1 A;  1XW6 A;  4V2M A;  4L0U A;  1ZYN A;  1B9Y C;  4HI7 A;  1DBY A;  4JR6 A;  4XS1 A;  5G1L A;  5IO2 A;  1ZGN A;  3F4S A;  1M9A A;  5IMA A;  4POB A;  5G31 A;  1XXU A;  4ML6 A;  1O81 A;  4HS1 A;  4ZB7 A;  4ULX A;  4AKG A;  2MMZ A;  1HD2 A;  4GST A;  2GGT A;  4O5U A;  2VAF A;  3UIW A;  3LYP A;  1YF0 A;  4KDY A;  2GT5 A;  4MZB A;  1SKW B;  4K1F A;  4XS6 A;  3ZTL A;  3I6A A;  3IC4 A;  3LOR A;  5ECS A;  4HDE A;  2GTU A;  3BD2 A;  2L59 A;  2JZR A;  4ILF A;  1M99 A;  3FR6 A;  3O6T A;  2YN1 A;  4I5Q A;  5J41 A;  1SK1 A;  5IMF A;  1WP0 A;  4TXO B;  2P5Q A;  2QA2 A;  2B5X A;  2O5V A;  4HEA 2;  1UA5 A;  4TR1 A;  2OE3 A;  4EKZ A;  2QGV A;  4LMV A;  4O32 A;  5JWQ B;  4YKG A;  2YAN A;  4PUR A;  2AYT A;  3NIV A;  3ZMK A;  5D8I A;  3EMX A;  4ECB A;  1WWJ A;  2C0F A;  1SKR B;  3TGZ A;  5KEJ A;  4EXJ A;  3TJF A;  2AUV A;  4PQH A;  3GSS A;  2IIY A;  5J4U A;  2I1U A;  1TP9 A;  3GH6 A;  5ELA A;  5BMU A;  3BBY A;  5ECP B;  1FW1 A;  2FNO A;  5D93 A;  2C3N A;  1QGV A;  4DSR A;  3FW2 A;  3PGT A;  4D73 B;  1N2A A;  4K9Z A;  3RBT A;  3VK9 A;  5D9W A;  3RPN A;  1TDI A;  5J5N A;  3F0I A;  5A1N B;  4L0W A;  2WDU A;  1QUW A;  4DEJ A;  4ZL7 A;  1B4Q A;  3QD9 A;  3FEU A;  3QDN A;  1U3A A;  2YPM A;  1VF3 A;  2WJU A;  1R4W A;  2H74 A;  3UL3 A;  3M0F A;  3RHB A;  3TRX A;  1LBK A;  2LS5 A;  1F37 A;  3TKR A;  3TOU A;  2HXK A;  1JHB A;  2DJ3 A;  4N0V A;  1M9B A;  1MDI A;  2LUS A;  4NAX A;  2VCT A;  4E8E A;  1O73 A;  2E7P A;  2H1D A;  2IL3 A;  5F05 A;  2CVD A;  2FCH A;  5IOX A;  1SD8 A;  1K0N A;  1GSY A;  3GH9 A;  1K0A A;  3HZ8 A;  2I4A A;  1O8X A;  1TRU A;  1PL2 A;  2H1B A;  1G6Y A;  1TI3 A;  2KLX A;  4JRR A;  1DUG A;  4FYB A;  4KX4 A;  3GV1 A;  4BL7 B;  4OO5 A;  4O92 A;  1RW1 A;  3HDC A;  4ZXG A;  2HE3 A;  2WRT A;  4IBP A;  4IJI A;  3ZRD A;  2L4C A;  5J47 A;  3SWL A;  5DCG A;  3IR4 A;  2WFC A;  5B7C A;  2H6Y A;  2IFQ A;  5CRH A;  1KTE A;  2LKU A;  5D9V A;  1R5P A;  1XBS A;  4YQM A;  5EPF A;  4Z2U A;  5A5H A;  2QC7 A;  2PBJ A;  5JCG A;  2VCW A;  4Q5Q A;  2LST A;  3M3M A;  3F3Q A;  5CRG A;  3BJ5 A;  5E4W A;  4LMW A;  3HD5 A;  4RQX A;  2H75 A;  4BPY A;  5INY A;  1O85 A;  3TCO A;  5L71 A;  2ES7 A;  3L9V A;  3D4M A;  2UV8 G;  2PMT A;  1SU9 A;  4GTU A;  1QK8 A;  5LD0 A;  5HR2 A;  2GQM A;  2YJH A;  3H8Q A;  2B6M A;  17GS A;  2YWN A;  3G7Y A;  5DCH A;  1X9S B;  4EDY A;  3A5W A;  3E0U A;  4PGT A;  4L5L A;  4BVX B;  3HJP A;  3MYD A;  3VPT A;  2DMM A;  3GRX A;  3KD0 A;  2E2M A;  1RQM A;  3L9U A;  1FHE A;  1Z3E A;  1GRX A;  4ISD A;  5IOW A;  3A5I A;  2F9S A;  5AIV A;  5F07 A;  2YCD A;  3KTL A;  2HRK B;  5DAL A;  3D0Z A;  1EWX A;  1S3D A;  3QAW A;  4V2N A;  5IPH A;  2OJL A;  5AIX A;  2UZ8 A;  2CAQ A;  4ZBD A;  3LSZ A;  4F9Z A;  1TTZ A;  1X5E A;  2PWJ A;  1R5A A;  1UVZ A;  2O85 A;  2GQL A;  3APS A;  1VRS D;  2M80 A;  2GSQ A;  2JL4 A;  3F6D A;  1A24 A;  3FHK A;  2IMD A;  3HKR A;  1ZCP A;  1FVK A;  1ACV A;  1V98 A;  2KHP A;  3UJ1 A;  1NHY A;  2GLR A;  1GNW A;  22GS A;  2WUL A;  3FMW A;  2LRT A;  2FWH A;  3CYN A;  2EIR A;  1K0M A;  1PN0 A;  3PPU A;  2GS3 A;  3ZVJ D;  2N5A A;  2JAD A;  2H01 A;  4N11 A;  3BCK A;  2O89 A;  3KXO A;  5DAK B;  1O6J A;  2K8V A;  1BG5 A;  1SL0 B;  2F3M A;  1QQ2 A;  4JR4 A;  5F8B A;  1A8Y A;  4K0N A;  4XTS A;  2HSN B;  1R26 A;  1SEN A;  4FO5 A;  1H4O A;  2C0D A;  4HU7 A;  1PX6 A;  1OC9 B;  3LQ7 A;  1XOA A;  4G0L A;  3WGX A;  2NPB A;  2KUC A;  4KDU A;  3GNJ A;  1X9M B;  3IV4 A;  2O8V B;  1VF1 A;  1AQX A;  1OYJ A;  2HSY A;  1W4V A;  1SKS B;  4KAE A;  2R0C A;  1TXX A;  3EUR A;  4V2L A;  3F3R A;  2YNX A;  3G9B A;  2R0P A;  3TJG A;  3HY2 A;  1WE0 A;  1IYI A;  2M72 A;  2F8A A;  2A4H A;  3LFL A;  3DRN A;  5DQY A;  2L6D A;  4OO4 A;  3IHG A;  4WET A;  5CRE A;  4A5P A;  2DIZ A;  3G7I A;  3APO A;  4WF5 A;  1WJK A;  4MAB A;  3L9S A;  3V1W A;  4J2F A;  5IPG A;  2ALB A;  1TRS A;  4ID0 A;  3RPP A;  1QXH A;  1Y6E A;  4GQC A;  3ZVJ A;  3HVS A;  2X8C A;  5ECQ B;  2X64 A;  2HNL A;  1G6W A;  1FG4 A;  1WRY A;  1A23 A;  3QMX A;  3TJK A;  5KN3 A;  4OCF A;  4KE3 A;  2L5O A;  5ECH B;  4NV2 A;  5KOX A;  2VL3 A;  2R37 A;  3EVI A;  3I43 A;  4E68 A;  1SYR A;  3IPZ A;  4X1U A;  4TXO A;  1W89 A;  5HQP A;  3P7X A;  5JCW A;  2ON5 A;  1YF1 A;  5HFK A;  1K3O A;  5D9X A;  1ERW A;  4MA9 A;  3QAV A;  2AAW A;  4N30 A;  4BWS A;  1ON4 A;  3MNG A;  2MBT A;  5LNK e;  2HRN A;  1PRX A;  1ZMA A;  3TRP A;  2IN3 A;  3O3T A;  2B7J A;  1CQG A;  4MF5 A;  4G19 A;  1J0F A;  2HI7 A;  1XPV A;  3IRA A;  1EZK A;  2B5E A;  2AHE A;  14GS A;  4V1A p;  2FA8 A;  4KDX A;  3VWU A;  5A1N A;  1GP1 A;  1X5D A;  11GS A;  2J23 A;  3M9K A;  2HT9 A;  3KP9 A;  4F82 A;  1QMV A;  3F63 A;  1M7T A;  3W8J A;  2P5R A;  3ME7 A;  3IK9 A;  4MK3 A;  1GUM A;  1I9D A;  1Z6N A;  4WEY A;  4KUN A;  5F06 A;  1TXU A;  3EE2 A;  4GXZ A;  2G0F A;  4EO3 A;  1JLV A;  3KMO A;  4OD7 A;  3APQ A;  1A0R P;  1NHO A;  3I69 A;  2IMI A;  5IMV A;  2VIM A;  4IEL A;  1ERT A;  2RUF A;  3LXZ A;  3D21 A;  5EY6 A;  3H93 A;  3A3T A;  2XBQ A;  4KH7 A;  4O5R A;  1Y25 A;  3UAR A;  1PD2 1;  3C71 A;  1K0C A;  2VL9 A;  2CAI A;  1PKZ A;  5GST A;  3QFB C;  4N0Z A;  3WGD A;  2B3S A;  3L4N A;  1FB6 A;  3CRU A;  1XFL A;  1TJD A;  2X4A A;  2VM1 A;  3UBL A;  3IXR A;  4BVY B;  1NW2 A;  4BL7 A;  3JCM L;  4EL1 A;  1U88 A;  1NSW A;  3DIE A;  2EIQ A;  4KCA A;  1AUC A;  5JWO B;  4WXT A;  2DBC A;  2XC2 A;  2JSZ A;  2K9F A;  1XIY A;  1WPI A;  4KGI A;  4F03 A;  4DSS B;  4IQA A;  1EV4 A;  4RQR A;  4MJA A;  2EC4 A;  3U6V A;  2H72 A;  2EIO A;  3HA9 A;  6GSS A;  3IDV A;  2FHE A;  1JZR A;  4HZ4 A;  1X5C A;  1HNC A;  5AGY A;  2FY6 A;  4HOJ A;  5E59 A;  1PA3 A;  4TVE A;  3FZ4 A;  2H1G A;  3KZQ A;  4PQ1 A;  4MF6 A;  3WT1 A;  1JZW A;  1OC8 A;  4I97 A;  2C3Q A;  1BAY A;  5C04 A;  1SD9 A;  2HSH A;  3QOU A;  2GZY A;  4KW6 A;  3TU3 B;  1FAA A;  2YP6 A;  5LCZ A;  2JU5 A;  3PR8 A;  1T1V A;  1M0U A;  4TKY A;  3DVX A;  2EFC A;  5D96 A;  2WZ9 A;  4OWY A;  3MWH A;  4XHM A;  4TW5 A;  4XRA A;  4BVX A;  1GNE A;  2X99 A;  4K7I A;  2WGR A;  5KN1 A;  3GN3 A;  2GSR A;  1EOG A;  3GMF A;  4X43 A;  4AF2 A;  2GDR A;  3HXS A;  4CHS A;  4PNG A;  1EGR A;  4ZBB A;  1NM3 A;  2H6X A;  4W66 A;  5J4V A;  4K0G A;  1M2D A;  4CY6 A;  2NTO A;  2C0E A;  4FYC A;  6GSU A;  3UAP A;  3GA4 A;  2H1A A;  7GSS A;  2TIR A;  1M2A A;  3CTF A;  2ON7 A;  4AGS A;  2DLX A;  3ZFB A;  4CDO A;  2IMK A;  3EMP A;  2LJR A;  2YV7 A;  3MSZ A;  1O7U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...