3VWXA

Structural analysis of an epsilon-class glutathione s-transferase from housefly, musca domestica
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
218
structure length
218
Chain Sequence
b'KLVLYGIDPSPPVRACLLTLKALNLPFEYKVVNLFAKEHLSEEYLKKNPQHTVPTLEEDGHLIWDSHAIMAYLVSKYGKDDSLYPKDLLKRAVVDQRMYFEAGVLFQGGLRNITAPLFFRNQTQIPQHQIDSIVESYGFLESFLKNNKYMAGDHLTIADFSIVTSVTSLVAFAEIDQSKFPKLSAWLKSLQSLPFYEEANGAGAKQLVAMVKSKNLTI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione s-transferase 6B
publication title Structural analysis of an epsilon-class glutathione transferase from housefly, Musca domestica
pubmed doi rcsb
source organism Musca domestica
molecule tags Transferase
total genus 83
structure length 218
sequence length 218
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2012-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3vwxA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3vwxA01
3DKSA 2B7JA 4O7HA 1FO5A 5ENUA 4O32A 4POKA 1G7EA 2YWOA 1XXUA 3UOMA 5FT3A 4ECCA 1T3BA 2DJ3A 4WKWA 1EP7A 1DUGA 4MF5A 4D73B 2XC2A 3A3TA 3IAS2 3IC4A 2YZUA 1QMVA 3QMXA 3F0IA 1E2YA 1UVZA 5DQSA 3PGTA 3FZAA 1WIKA 4IHUA 4LMWA 1UA5A 1K3LA 1BX9A 5GSTA 2H0GA 3HKRA 1O73A 2L6DA 4G19A 5EPFA 2NTOA 2HSMA 3GL3A 3CRTA 1SJZA 3P2AA 5CP1A 4H86A 1VF1A 5B8AA 5J9CA 4Q5NA 2V32A 3MNGA 4ZBDA 1AQXA 1XVQA 2DJ0A 4KW6A 3F4RA 2YCDA 3A2WA 2IL3A 3IBHA 2RUFA 2FY6A 3IR4A 1VGLA 2VCXA 1EZKA 4JBBA 2OACA 2O85A 1DBYA 1Z9HA 2HXKA 3G7YA 2LSTA 3VURA 1VF4A 6GSYA 3IK9A 2QGVA 1GLQA 3D4TA 1AUCA 3S9FA 1H75A 4OD7A 1F3BA 5COHA 1GSQA 4GTUA 3WYWA 3QR6A 2GSRA 5HFGA 1XBSA 2CZ2A 1T00A 2RLIA 2YP6A 3D21A 1X9MB 1GH2A 4BVXA 3N9JA 3CTGA 5IMAA 2V1MA 2H74A 3WGEA 2CV4A 1YKCA 2TRXA 4RUVA 3D4MA 2H76A 1XVWA 3F63A 3MSZA 3CSHA 1W4VA 5BMUA 4HU9A 3H79A 2LNTA 2LJKA 2WJUA 4NV2A 4KB3A 2C0DA 1K0BA 20GSA 2K8SA 3L9UA 5HQPA 5J3RA 3TJJA 1A0FA 3DEXA 1O7UA 4X1UA 4HEA2 4OO5A 1B9YC 5B6MA 3MDKA 4ACSA 4EDYA 3CYNA 6GSVA 4BVYA 3D22A 2NBSA 5AN1A 3IRAA 4ZB9A 1A8YA 3WD6A 5DQYA 4K9ZA 1EEMA 4GSTA 5J9BA 3UL3A 2EIOA 2GGTA 4DSSB 3I43A 2CZ3A 4ZL9A 5G1KA 1PGTA 3KGKA 3SWLA 3U6VA 4IVFA 3ED3A 1G6WA 22GSA 4KH7A 2K6VA 1YF0A 3VK9A 4ZB6A 5ECQB 4NV5A 3EC3A 4MZWA 1FB6A 3FZ5A 1OC8A 3TJFA 4QL7A 5ECOB 4HJ2A 2ZCTA 2I3YA 1X0RA 4BL7A 4HI7A 2MZCA 3HJMA 2FNOA 5C00A 5EVOA 4KNDA 2HE3A 1FHEA 5KN0A 4IW9A 4F82A 1GTUA 2H71A 5ABRA 4NAXA 1SKWB 3GUSA 1XW5A 2RM5A 4WR5A 1T4ZA 2JACA 1FB0A 2BTOT 3KMOA 5KEJA 1PL2A 3CRUA 3HVVA 2XBQA 3MWHA 1PKWA 4L0WA 2L57A 3GH9A 1BEDA 3IDVA 4I2TA 3ZZXA 1ZGNA 4TRXA 4MJCA 3LGCA 4MA9A 4ID0A 1XOBA 1MD3A 3IAM2 4NHWA 5IIZA 4G0KA 4JEDA 4MABA 1GUHA 3F3RA 4LA1A 2R37A 4TW5A 5CAXA 1J9BA 3KP8A 3O3TA 1RK4A 4Q5QA 4LMVA 6GSUA 4FYUA 4ZIJA 1OC9A 3E3EA 4IKHA 5IQYA 2GZYA 2YPMA 7GSSA 3RPNA 2LKUA 1BAYA 5CNWA 5E4WA 4MCUA 3G7IA 3LYPA 2CVKA 2DIZA 3VFIA 4HUAA 3TKRA 2H1BA 3VPQA 1GTIA 2R6KA 4KDYA 4I6XA 4V1Ap 2GS3A 1F6MC 1M9BA 2LQQA 3FZ9A 2CVDA 1YQ1A 4GSSA 2WCIA 4MJBA 1XFLA 1XWCA 4FO5A 3KMNA 1FAAA 1AQWA 2VAFA 2DJJA 3E0UA 3VI5A 5H5SA 2CVBA 5H5QA 3C71A 5DCGA 2VO4A 3KJYA 1AQVA 1U3AA 1EWXA 1PRXA 4MPFA 4GSNA 2CX3A 3ISOA 3APSA 4AJ7A 2WDUA 1GSYA 3F6DA 2L5LA 3RDWA 1TI3A 4P3YB 1CQGA 1E6BA 2EC4A 1WMJA 5G1LA 3TKSE 3KTLA 1USBA 1BJXA 4V1Ag 2WRTA 3GV1A 5B6NA 3TRQA 5ECLB 3DGQA 2C80A 2VIMA 1R4WA 4HU7A 1SK0A 2MMOA 2WB9A 1SENA 4WEYA 2X8HA 5D93A 3JCML 3F4SA 3TJGA 1ERVA 4E8EA 4G2EA 5IO0A 1ML6A 1PSQA 1GULA 2ZUPA 1QUWA 2E7PA 3F4TA 1Y25A 1K3YA 4NPBA 13GSA 1ZL9A 2YJ7A 4AJ8A 1JLWA 4CDOA 3GSTA 3EINA 2C8UA 4F03A 2XHFA 3GURA 1OVNA 2YNXA 2R5GA 2F3MA 4KDXA 5ELGA 2M46A 1FVJA 2F9SA 1V2AA 3J7Yk 1JFUA 2C0EA 2LRCA 1OE7A 1Z3EA 2CAIA 3QAGA 2B7KA 3APQA 3UAPA 5INYA 2VOCA 1TOFA 4I2UA 3BJ5A 3DVWA 4EXJA 3LXZA 2QSIA 3GYKA 3QPMA 4E8HA 3RAZA 2X8GA 2HSHA 3TRXA 3V1WA 2F51A 1TK8B 3KXOA 1T1VA 5IMVA 1FG4A 3ZMKA 2PGTA 1DE2A 1ERTA 5D73A 1ON4A 5F06A 2MMAA 2H19A 3BD2A 4ML1A 2HLSA 3D6IA 4PTSA 5LD0A 1PMTA 3DMLA 3HZ4A 3GSSA 3UVTA 1MDJA 3G9BA 2I1UA 1XWBA 4TR1B 5HR1A 1R5AA 1B4PA 4IN0A 4JZQA 3L0HA 4PNGA 3U5RE 5A4WA 2H0HA 2IN3A 3F6FA 2WZ9A 4KCAA 3TB2A 2YWIA 4DSRA 2HRKA 4FQUA 3TGZA 2IIYA 2GQMA 1ZYQB 2VLTA 4K6XA 1AXDA 2DMLA 1FVKA 2FD3A 1YEXA 2IPAA 1W89A 1OKDA 2IWTA 2VLVA 3H93A 4PGTA 4Z7XA 1BG5A 1EEJA 3GH6A 4EC0A 1X9SB 2UZ8A 2MYGA 3KIJA 3ZIJA 3P8WA 4GRFA 5DALA 2IFQB 3EMPA 4MP4A 4TKYA 2HZEA 4BWQA 2E2GA 5ECKB 4FH8A 3KH9A 2PERA 5AIXA 3OR5A 1V57A 2VL9A 2PVOC 1HNAA 3L78A 3RPPA 1SK2A 2PU9C 1IYIA 3O76A 4OCFA 1QGVA 1R7HA 4IS0A 2VCTA 5G30A 2H1GA 4IJ3A 3PR8A 3IPZA 3MAKA 3HVXA 1ERWA 1V40A 1OAZA 3GTUA 1PX6A 2GT5A 4IELA 1RW1A 2DLXA 4GLTA 5JWQB 2YOIA 3LXTA 2OKAA 3GMFA 1G0TA 4K0NA 4IJIA 3ERWA 4K0GA 2PVQA 1YZXA 3E9JB 1TW9A 1I5GA 5DAKA 1VF2A 2LQOA 1YKAA 4G9HA 2FGXA 2G0FA 2CX4A 1SJ6A 2KP2A 2GLRA 1YJ6A 4WETA 3RHBA 4K7NA 1NM3A 3O6TA 1F3AA 1M2BA 1SYRA 1NSWA 2IMEA 3M0FA 2H6XA 4YH2A 2I4AA 4N11A 4MZCA 2TIRA 2DJKA 1OE8A 12GSA 4RI7A 2VCVA 4LL1B 3C73A 3R3EA 2H75A 3KZQA 4PUAA 4KGIA 5ID2A 2VD0A 4MDCA 2AHEA 1JLVA 5IPHA 4OFNA 2LV3A 1F37A 4F2IA 4YQUA 2H1DA 1AW9A 2FHEA 1EV4A 3DXBA 2AB6A 2K18A 4L5OA 2C3QA 4KA0A 1U6TA 4WXTA 1O8WA 4KDUA 2GVPA 3W8SA 4XHMA 3ME8A 4XS4B 3H4KA 2VCWA 2H70A 3QFBC 2VCZA 3KTBA 1LJRA 5JCGA 1A23A 4JE1A 4YAVA 1S3DA 2H66A 4N10A 17GSA 2P5QA 3QFAC 1N8JA 4WR4A 1K0MA 3GKXA 5IMDA 10GSA 5GAND 1EP8A 5ECMB 5IM9A 4HOJA 3IK7A 4K7OA 4HZ2A 1A2LA 3I9V2 3FW2A 1UC7A 5HFIA 3ZFLA 1B8XA 4L0UA 2REMA 1U3IA 1THXA 1TU7A 2JSYA 4V2NA 2OE3A 2GT6A 1XOAA 4CW9A 4EKZA 5D9TA 2HRAA 1EOHA 1JZDA 1NW2A 2YWMA 2B3SA 2ZNMA 3GA4A 1O8XA 2J23A 2HRFA 3A2XA 4MMMA 5FWGA 5G31A 5KN2A 4PQ1A 3EU3A 1SJIA 2A2RA 1V58A 1URMA 1TK5B 2HSMB 2H73A 1AC1A 1YF1A 1S3AA 1GLPA 2FA4A 2P0GA 5FHIA 1O81A 1Q4JA 1GRXA 2LRNA 4FYBA 2VCQA 1OYJA 4G0LA 2LJRA 2DC5A 1PD21 3TOUA 4PQIA 3LJRA 2QC7A 1Z7PA 4GF0A 1SU9A 3H1NA 2YV9A 3GL5A 3C8EA 1ZOFA 3TCOA 5JWRB 5C04A 4TOPA 3QDNA 4X0XA 5ECSA 3BCIA 5EY6A 4O92A 3QAWA 4MLYA 1XWAA 4ML6A 3I6AA 1GUKA 2HYXA 2VD1A 1HQOA 4GQFA 1GSUA 4RQRA 4XTSA 3LYKA 2KLXA 3VWVA 3LWAA 2OE0A 4ECBA 3F9UA 1KEBA 1M9AA 4MPGA 2M72A 2R3XA 4L8EA 2KHPA 2E0QA 1EV9A 2H6YA 1MDIA 4PURA 2NVLA 3WGDA 5JWOB 2DBCA 4BVXB 3NIVA 2GZZA 1J0FA 2P31A 2AJQB 3KP9A 5IMCA 5GZZB 1RQMA 4QQ7A 5D9WA 1ILOA 2YJHA 1GTBA 2A4VA 2VL2A 3NOFA 2R4VA 1M0UA 5AISA 4GQCA 2O7KA 4IP6A 2KOKA 4ZBBA 2JADA 4J56E 3GIXA 3P90A 3RBTA 5DDLA 1NHOA 2JL4A 4TXOA 3TKSA 1KTEA 2F8FA 2BMXA 2KP1A 1BQ7A 1LBKA 4TVEA 4BVYB 3ZITA 2JSZA 4HS1A 5F0GA 1Z5YE 2OE1A 3HZ8A 2PMTA 4F9ZA 4AJ6A 3VI7A 1SYXA 3FEUA 4ILFA 2AUVA 1JZRA 4FYCA 3LSZA 4ZBAA 1O6JA 3PINA 4X43A 4MJEA 4XS6A 4K8MA 1K3OA 3ZIVA 5IMFA 2O8VB 4TN8A 3Q6OA 5EL8A 5B8BA 3EURA 1KNGA 1THOA 2LNSA 3GFKA 1GSDA 2B5XA 1M2AA 4I8BA 5ECNB 3P7XA 2OBIA 4BL7B 3C1RA 1R26A 4QL9A 5L71A 3L4NA 1PN9A 2IFQA 1SL2B 2FCHA 1SL1B 3UEMA 3LORA 1N2AA 4RQXA 4D73A 2OADA 1GSEA 1TI1A 3HHVA 6GSWA 2IMFA 5CREA 14GSA 5E59A 5A4VA 1WWJA 2XPEA 2FWHA 4POMA 3FR9A 3W8JA 11GSA 4ZXGA 1ZMAA 2K8VA 4K1FA 2X64A 2PN8A 1WOUA 4J57E 4IP1A 2ON7A 2PBJA 4AGSA 3ZVJA 3KM6A 2HZFA 3ZREA 3TKPA 1F9MA 1PKZA 2DJ1A 4ULXA 1ZYEA 1TRVA 2XBIA 1K0AA 2B5EA 2C0GA 5J4UA 1TDIA 4PQHA 5ELAA 3WT1A 4KUNA 2PPTA 1V98A 1Z6MA 2B1KA 1OC9B 3VWUA 4G0IA 3CBUA 4BPYA 4ECIA 2G2QA 4I97A 3M3MA 4IBPA 4V2LA 2FWFA 2P5RA 3K8NA 2LUSA 1HNBA 1JZOA 1K0OA 5AGYA 2DJ2A 2O87A 3HXSA 1WE0A 1U87A 2FWEA 4OMVA 4GCIA 2AYTA 4V2MA 3TRPA 4LL4B 3HD5A 3QD9A 3ZFBA 1H4OA 3GX0A 1TXXA 1O85A 1M7TA 4HQZA 3C1SA 1AAZA 2CA8A 3BCKA 2V6OA 2GSSA 4XCSA 2HSYA 2PUKC 3EYTA 2N5AA 2YV7A 2VUPA 1GTAA 4TXVA 2R2JA 3FHKA 1SK1A 3J7Yb 3CMIA 2MBTA 1X5EA 3DWVA 2ES7A 2CAQA 1I9DA 5JCWA 1MDKA 4MH2A 4JRRA 4TR3A 4YAPA 3EVIA 3IOSA 3HCZA 3F3QA 4ZL8A 5D96A 1X5CA 3UVHA 4NXIA 2YN1A 5HR3A 1GNEA 3AY8A 3DVXA 3FK8A 2RM6A 1B4QA 4IGJA 5ECIB 3VWXA 18GSA 2O89A 3CSIA 4GXZA 3UJ1A 4EDZA 3QAVA 1A2MA 1Q98A 5CO3A 1TP9A 1C72A 2C1YA 1ABAA 5F05A 3H8QA 4DSSA 4F0BA 3F8UA 4O5RA 1SKSB 1T8EB 2GQKA 1X9WB 1QK8A 5DCHA 2H8LA 1K0CA 1T7PB 2K9FA 4KAEA 5DVBA 2LRTA 3IV4A 2VM2A 5B7CA 4HJMA 1PQNA 3FRCA 4EE0A 3VPTA 1GUMA 3QCPA 2F8AA 3M8NA 3DRNA 4AF2A 4OWYA 3L9VA 4YQVA 2X8CA 4HQSA 2OBKA 3HY2A 4OO4A 1A2JA 3A5WA 4JR4A 3FKFA 3GKKA 4MZBA 4DSQA 5HFKA 4USSA 4G10A 2RUEA 4POBA 2TRCP 4ZB8A 3FR6A 3Q74A 4WBRD 3GNJA 2DIYA 3CSJA 4HDEA 4JU5A 1GWCA 4K7IA 1XZOA 1YY7A 5DBQA 2L4QA 4XIHA 1HYUA 2DSAA 2B1LA 2BJXA 4EO3A 5HR0A 1GSSA 1M99A 2FUG2 2IJYA 3US3A 2NPBA 5AIVA 1SKRB 3FY7A 4CHSA 3KEBA 5DJLA 2MMNA 1DE1A 2HFDA 2HRKB 1Y6EA 1PX7A 2KUCA 2C3TA 3KCMA 1WP0A 2IMKA 3GKNA 1VRSD 2D2ZA 4WF4A 2Z9SA 2JZSA 1TTZA 4MF6A 5KN1A 1GSFA 1XW6A 2WS2A 4N0ZA 1ACVA 4KX4A 3KH7A 4XRAA 4Q5RA 5ECPB 1EGOA 5J41A 3M9KA 1A8LA 5DALB 2FWGA 1F2EA 1Z7RA 2HZEB 1XWKA 5IOXA 3I69A 3GX8A 4WF5A 3ZMLA 2GSTA 1MTCA 3UARA 19GSA 4F0CA 2WFCA 6GSXA 1MD4A 1TRWA 1OC3A 4KSOA 2FLSA 3TUEA 3UIWA 2AAWA 3TKQA 3Q19A 1K0DA 4EF0A 2H01A 2YANA 3GTUB 2NDOA 2JU5A 2CT6A 2JZTA 2L6CA 2MMZA 3DIEA 4DVCA 5G5FA 2ALBA 1V9WA 3L9SA 3UBKA 2V41A 5F8BA 1A0RP 3PH9A 1X5DA 1GP1A 3VWWA 1B48A 5DAKB 2IMDA 4EVMA 1OKTA 3M1GA 4KE3A 3BOAA 3TJKA 5IOWA 1PL1A 4PXOA 2EIQA 5G2ZA 3LEFA 4TR4A 2FA8A 2H0IA 5CRDA 4KCEA 4IQ1A 5DJMA 4KSMA 6GSTA 1TRUA 4ECJA 2GQLA 2C4JA 4XRDA 3DD3A 1HNCA 2N5BA 2B5YA 1FOVA 3HA9A 2WGRA 1U88A 3N5OA 5ID2B 2GZPA 2HSNB 5A5KA 2I81A 1AIUA 3R2QA 2AV4A 3IE3A 5H5RA 1NHYA 3NZNA 4BWSA 4NMUA 2H30A 3GRXA 1IYHA 4JR6A 3QOUA 4IQAA 2OA7A 1XIYA 2YZHA 3TOTA 1XPVA 1ST9A 1SD8A 1G6YA 3Q18A 3ERFA 3DYRA 3FZ4A 1YDKA 3HJPA 2MBSA 1VF3A 3ZRDA 1R5PA 4YQMA 3IA1A 3ZL5A 3ZLPA 1TJDA 4MJAA 1HD2A 2OJLA 5J5NA 4NHZA 1WRYA 1S3CA 2ON5A 1SD9A 2L4CA 4MK3A 2H6ZA 3GHAA 4I5QA 3CTFA 2HI7A 3M9JA 1WPIA 3IC8A 2B6MA 4BA7A 1BYEA 3RHCA 5IO2A 4OFTA 3C7MA 5F07A 1XCCA 5HR2A 2EIRA 4TR1A 3ME7A 2QKEA 5LCZA 1JZWA 3EWLA 1UN2A 1YEPA 3D5JA 4MF7A 1XWGA 3ZTLA 3HYPA 2IMIA 1ZZYA 1M2DA 2E2MA 2LS5A 3LG6A 1T4YA 3ZVJD 3HDCA 4EL1A 5IMZA 2LTKA 3IXRA 2L5OA 1KBNA 4HZ4A 5D8IA 1DSBA 3GKMA 2C0FA 3EMXA 5JCUA 3CXGA 3VLNA 2M80A 3APOA 2XPDA 3BBYA 3WT2A 4NWYA 4N0VA 1MEKA 2LEGA 5ECHB 3LQ7A 1TKDB 1ZCPA 3GN3A 1EGRA 1A24A 1FW1A 2HRNA 1ERUA 3TJBA 5LNKe 1GNWA 3SBCA 3ERGA 2PWJA 2RIIA 1J08A 4Q5FA 1G7OA 4ZILA 1Z6NA 1TU8A 1B9XC 3UMAA 4J2FA 2A2SA 2H1AA 2HQTA 4EUYA 2VM1A 1K0NA 2JZRA 2GDRA 1SL0B 1GL8A 4MH3A 1CQHA 3A2VA 2L59A 3EU4A 4N30A 5G5EA 8GSSA 1QQ2A 3HJOA 5IPGA 2VL2C 3LFLA 1QXHA 3G7JA 2LJAA 4LLRA 3KD0A 3EE2A 9GSSA 4ISDA 2H72A 3TKSC 4PX1A 6GSSA 2N5FA 5CRGA 2CQ9A 1QFNA 3FYGA 4XS1A 4PNFA 4OFMA 5GAPD 3FR3A 4TR0A 2GTUA 2C3NA 4K2DA 3IHQA 3TDGA 4RI6A 1XW9A 5CYYA 2V2GA 3UBLA 5ECRB 4DEJA 2WULA 2YWNA 4TXOB 4L5LA 1JHBA 5A4UA 5CRHA 4FIWA 2HT9A 1WJKA 1LU4A 4KF9A 3ZYWA 16GSA 2J9HA 2DMMA 4PUFC 2X99A 5CRWA 5D9VA 4OCEA 2V6KA 5KN3A 2GSQA 3WGXA 5D9XA 1TK0B 2HNLA 1EOGA 1TRSA 3HVSA 2VLUA 4POLA 3W6GA 4XS4A 5GSSA 4GWRA 2I9HA 3PPUA 3D0ZA 2VL3A 1PA3A 4WBJA 4ZL7A
chains in the Genus database with same CATH superfamily
3DKSA 2B7JA 4O7HA 1FO5A 5ENUA 4O32A 4POKA 1G7EA 2YWOA 1XXUA 4FXYP 3UOMA 5FT3A 4ECCA 1T3BA 2DJ3A 4WKWA 1EP7A 1M3JA 1DUGA 4MF5A 4D73B 2XC2A 3A3TA 4AKHA 3IAS2 3IC4A 2YZUA 1QMVA 3QMXA 3F0IA 1E2YA 1UVZA 2R0GA 5DQSA 3PGTA 3FZAA 1WIKA 4IHUA 4LMWA 1UA5A 1K3LA 1BX9A 5GSTA 2H0GA 3HKRA 1O73A 2L6DA 4G19A 5EPFA 2NTOA 2HSMA 3GL3A 3CRTA 1SJZA 3P2AA 5CP1A 4H86A 1VF1A 5B8AA 5J9CA 4Q5NA 2V32A 3MNGA 4ZBDA 1AQXA 1XVQA 2DJ0A 4KW6A 1PFOA 3F4RA 2YCDA 3A2WA 2IL3A 3IBHA 2RUFA 2FY6A 3IR4A 1VGLA 2VCXA 1EZKA 4JBBA 5A5HB 2OACA 2O85A 1DBYA 1Z9HA 2HXKA 3G7YA 2LSTA 3VURA 1VF4A 3IHGA 6GSYA 3IK9A 2QGVA 1GLQA 3D4TA 1AUCA 3S9FA 2X49A 1H75A 4OD7A 1F3BA 5COHA 1GSQA 4GTUA 3WYWA 3QR6A 2GSRA 5HFGA 1XBSA 4K2XA 2CZ2A 1T00A 2RLIA 2X4AA 2YP6A 3D21A 1X9MB 1GH2A 4BVXA 3N9JA 3CTGA 5IMAA 2V1MA 2H74A 3WGEA 2CV4A 1YKCA 2TRXA 4RUVA 3D4MA 2H76A 1XVWA 3F63A 3MSZA 3CSHA 1W4VA 5BMUA 4HU9A 3H79A 2LNTA 2LJKA 2WJUA 4NV2A 4KB3A 2C0DA 1K0BA 20GSA 2K8SA 3L9UA 5HQPA 2DKIA 5J3RA 3TJJA 1A0FA 3DEXA 1O7UA 4X1UA 4HEA2 4OO5A 1B9YC 5B6MA 3MDKA 4ACSA 4EDYA 3CYNA 6GSVA 4BVYA 3D22A 2NBSA 5AN1A 3IRAA 4ZB9A 1A8YA 2R0CA 4N3ZA 3WD6A 5DQYA 4K9ZA 1EEMA 4GSTA 5J9BA 3UL3A 2EIOA 2GGTA 4DSSB 3I43A 2CZ3A 4ZL9A 2WZSA 5G1KA 1PGTA 3KGKA 3SWLA 3U6VA 4IVFA 3ED3A 1G6WA 22GSA 4KH7A 2K6VA 1YF0A 3VK9A 4ZB6A 5ECQB 4NV5A 3EC3A 4MZWA 1FB6A 3FZ5A 1OC8A 2DKHA 3TJFA 4QL7A 5ECOB 2WW2A 4HJ2A 2ZCTA 2I3YA 1X0RA 4BL7A 4HI7A 2MZCA 1S3RA 3HJMA 2FNOA 5C00A 5EVOA 4KNDA 4CY6A 2HE3A 1FHEA 5KN0A 4IW9A 4F82A 4QMKA 3RFRC 1GTUA 2H71A 5ABRA 4NAXA 1SKWB 3GUSA 1XW5A 2RM5A 4WR5A 1T4ZA 2JACA 1FB0A 5A34B 2BTOT 3KMOA 5KEJA 1PL2A 3CRUA 3HVVA 2XBQA 3MWHA 1PKWA 4L0WA 2L57A 3GH9A 1BEDA 3IDVA 1BF5A 4I2TA 3ZZXA 1ZGNA 4TRXA 4MJCA 3LGCA 4MA9A 4ID0A 1XOBA 1MD3A 3IAM2 4NHWA 5IIZA 4G0KA 4JEDA 4MABA 1GUHA 3F3RA 4LA1A 4CY8A 2R37A 3A5IA 4TW5A 5CAXA 1J9BA 3KP8A 3O3TA 1RK4A 4Q5QA 4LMVA 6GSUA 4FYUA 4ZIJA 1OC9A 3E3EA 4IKHA 5IQYA 2GZYA 4E68A 2YPMA 7GSSA 3RPNA 2LKUA 1BAYA 5CNWA 5E4WA 4MCUA 3G7IA 3LYPA 2CVKA 2DIZA 3VFIA 4HUAA 3TKRA 2H1BA 3VPQA 1GTIA 2R6KA 4KDYA 4I6XA 4V1Ap 2GS3A 1F6MC 3FZ9A 1M9BA 2LQQA 2CVDA 1YQ1A 4GSSA 2WCIA 4MJBA 1XFLA 5KOWA 1XWCA 4FO5A 3KMNA 1FAAA 1AQWA 2VAFA 2DJJA 3E0UA 3VI5A 5H5SA 2CVBA 5H5QA 3C71A 5DCGA 2VO4A 3KJYA 1AQVA 4MNNA 1U3AA 1EWXA 1PRXA 2EFHA 4GSNA 4MPFA 2CX3A 3ISOA 3APSA 4AJ7A 2WDUA 5J4VA 1GSYA 3F6DA 2L5LA 3RDWA 1TI3A 4P3YB 1CQGA 1E6BA 2EC4A 1WMJA 5G1LA 3TKSE 3KTLA 1USBA 1BJXA 4V1Ag 2WRTA 3GV1A 5B6NA 3TRQA 5ECLB 2H1LA 3DGQA 2C80A 2VIMA 1R4WA 4HU7A 1SK0A 2MMOA 2WB9A 1SENA 4WEYA 2X8HA 5D93A 3JCML 3F4SA 3TJGA 1ERVA 4E8EA 4G2EA 5IO0A 1ML6A 1PSQA 1GULA 2ZUPA 1QUWA 2E7PA 3F4TA 1Y25A 1K3YA 4NPBA 13GSA 1ZL9A 2YJ7A 4AJ8A 1JLWA 4CDOA 3GSTA 3EINA 2C8UA 4F03A 2XHFA 3GURA 1OVNA 2YNXA 4HSCX 2R5GA 2F3MA 4KDXA 5ELGA 2M46A 1FVJA 2F9SA 1V2AA 3J7Yk 1JFUA 2C0EA 2LRCA 1OE7A 1Z3EA 2CAIA 3QAGA 2B7KA 3APQA 3UAPA 5INYA 2VOCA 1TOFA 4I2UA 3BJ5A 3DVWA 4EXJA 3LXZA 2QSIA 3GYKA 3QPMA 4E8HA 3RAZA 2X8GA 2HSHA 3TRXA 3V1WA 3HMJG 2F51A 1TK8B 3KXOA 1T1VA 5IMVA 1FG4A 3ZMKA 2PGTA 4YKGA 1DE2A 1ERTA 5D73A 1ON4A 5F06A 2MMAA 2H19A 3BD2A 4ML1A 2HLSA 3D6IA 4PTSA 5LD0A 1PMTA 3DMLA 3HZ4A 3GSSA 3UVTA 1MDJA 3G9BA 2I1UA 1XWBA 4TR1B 5HR1A 1R5AA 2EFCA 1B4PA 4IN0A 4EIQA 4JZQA 3L0HA 4PNGA 3U5RE 5A4WA 2H0HA 2IN3A 3F6FA 2WZ9A 2WVYA 4KCAA 3TB2A 2YWIA 4DSRA 2HRKA 2WVXA 4FQUA 3TGZA 2IIYA 2GQMA 3LW9A 1ZYQB 2VLTA 4K6XA 1AXDA 2DMLA 1FVKA 2FD3A 1YEXA 2IPAA 1W89A 1OKDA 2IWTA 2VLVA 3H93A 4PGTA 4Z7XA 1BG5A 1EEJA 3GH6A 4EC0A 1X9SB 2UZ8A 2MYGA 3KIJA 3ZIJA 3P8WA 4GRFA 5DALA 2IFQB 3EMPA 4MP4A 4TKYA 2HZEA 4BWQA 2E2GA 5ECKB 4FH8A 1TXUA 3KH9A 2PERA 5AIXA 3OR5A 1V57A 2VL9A 2PVOC 4A5PA 1HNAA 3L78A 3RPPA 1SK2A 2PU9C 2A2PA 1IYIA 3O76A 4OCFA 1QGVA 1R7HA 4IS0A 2VCTA 5G30A 2H1GA 4IJ3A 3PR8A 4ZB7A 3IPZA 3MAKA 3HVXA 1ERWA 1V40A 1OAZA 3GTUA 1PX6A 4G01A 2GT5A 4IELA 1RW1A 2DLXA 4GLTA 5JWQB 2YOIA 3LXTA 2OKAA 3GMFA 1G0TA 4K0NA 4IJIA 3ERWA 4K0GA 2PVQA 1YZXA 3E9JB 1TW9A 1I5GA 5DAKA 2QA1A 3MYDA 1VF2A 2LQOA 1YKAA 4G9HA 2FGXA 2G0FA 2CX4A 1SJ6A 2KP2A 2GLRA 1YJ6A 4WETA 3RHBA 4K7NA 1NM3A 3O6TA 1F3AA 1M2BA 1SYRA 1NSWA 2IMEA 3M0FA 5KOXA 2H6XA 4YH2A 2I4AA 4N11A 4MZCA 2TIRA 2DJKA 1OE8A 12GSA 4RI7A 2VCVA 4LL1B 3C73A 3R3EA 2H75A 3KZQA 4PUAA 4KGIA 5ID2A 2HSNA 2VD0A 4MDCA 2AHEA 1JLVA 5IPHA 4OFNA 2LV3A 1F37A 4F2IA 4YQUA 2H1DA 1AW9A 2WVZA 2FHEA 1EV4A 3DXBA 2AB6A 2K18A 4L5OA 2C3QA 4KA0A 1U6TA 4WXTA 1O8WA 4KDUA 2GVPA 3W8SA 4XHMA 3ME8A 4XS4B 3H4KA 2VCWA 2H70A 3QFBC 2VCZA 3KTBA 1LJRA 1YEWC 5JCGA 1A23A 4JE1A 4YAVA 1S3DA 2H66A 4N10A 17GSA 2P5QA 3QFAC 1N8JA 4WR4A 1K0MA 3GKXA 5IMDA 4K5RA 10GSA 5GAND 1EP8A 5ECMB 5IM9A 2O36A 4HOJA 3IK7A 4K7OA 4HZ2A 1A2LA 3I9V2 3FW2A 1UC7A 5HFIA 3ZFLA 1B8XA 4L0UA 2REMA 1U3IA 1THXA 1TU7A 2JSYA 4V2NA 2OE3A 1SVMA 5J47A 2GT6A 1XOAA 4CW9A 4EKZA 5D9TA 2HRAA 1EOHA 1JZDA 1NW2A 2YWMA 2B3SA 2ZNMA 3GA4A 1O8XA 2J23A 2HRFA 3A2XA 4MMMA 5FWGA 5G31A 5KN2A 4PQ1A 3EU3A 1SJIA 2A2RA 1V58A 1URMA 1TK5B 2HSMB 2H73A 1AC1A 1YF1A 1S3AA 1GLPA 2FA4A 2P0GA 5FHIA 1N25A 1O81A 1Q4JA 1GRXA 2LRNA 4FYBA 2VCQA 1OYJA 4G0LA 2LJRA 2DC5A 1PD21 3TOUA 4PQIA 3FMWA 3LJRA 2QC7A 1Z7PA 4GF0A 1SU9A 3H1NA 2YV9A 3GL5A 3C8EA 1ZOFA 3TCOA 5JWRB 5C04A 4TOPA 3QDNA 4X0XA 5ECSA 3BCIA 5EY6A 4O92A 3QAWA 4MLYA 1XWAA 4ML6A 3I6AA 1GUKA 2HYXA 2VD1A 1HQOA 4GQFA 1GSUA 4RQRA 4XTSA 3LYKA 2KLXA 3VWVA 3LWAA 2OE0A 4ECBA 1ZYPA 3F9UA 1KEBA 1M9AA 4MPGA 2M72A 2R3XA 4L8EA 2KHPA 2E0QA 1EV9A 2H6YA 1MDIA 4PURA 2NVLA 3WGDA 5JWOB 2DBCA 4BVXB 3NIVA 2O5VA 2GZZA 1J0FA 2P31A 2AJQB 3KP9A 5IMCA 5GZZB 1RQMA 4QQ7A 5D9WA 1ILOA 1GTBA 2A4VA 2YJHA 2VL2A 3NOFA 2R4VA 1M0UA 5AISA 5BMUB 4GQCA 2O7KA 4IP6A 2KOKA 4ZBBA 2JADA 4J56E 3GIXA 3P90A 3RBTA 5DDLA 1NHOA 2JL4A 4TXOA 3TKSA 1KTEA 3HVNA 2F8FA 2BMXA 2KP1A 1BQ7A 1LBKA 4TVEA 4BVYB 3ZITA 2JSZA 4HS1A 5F0GA 1Z5YE 2OE1A 3HZ8A 2PMTA 4F9ZA 4AJ6A 3VI7A 1SYXA 3FEUA 4ILFA 2AUVA 1JZRA 4FYCA 1PN0A 3LSZA 4ZBAA 1O6JA 5A1NA 4Z2UA 3PINA 4X43A 4MJEA 4XS6A 4K8MA 1K3OA 3ZIVA 5IMFA 2O8VB 4BIKA 4TN8A 3Q6OA 5EL8A 5B8BA 3EURA 1KNGA 1THOA 2LNSA 3GFKA 1GSDA 2B5XA 1M2AA 4I8BA 5ECNB 3P7XA 2OBIA 3C1RA 4BL7B 1BG1A 1R26A 4QL9A 5L71A 3L4NA 1PN9A 2IFQA 1SL2B 2FCHA 1SL1B 3UEMA 3LORA 1N2AA 4RQXA 4D73A 2OADA 1GSEA 1TI1A 3HHVA 6GSWA 2IMFA 4O5QA 5CREA 14GSA 5E59A 5A4VA 3CQFA 1WWJA 1S4BP 2XPEA 2FWHA 4POMA 3FR9A 3W8JA 11GSA 4ZXGA 1ZMAA 2K8VA 4K1FA 2X64A 2PN8A 1WOUA 4J57E 4IP1A 2ON7A 2PBJA 4AGSA 3ZVJA 3KM6A 2HZFA 3ZREA 3TKPA 1F9MA 1PKZA 2DJ1A 4ULXA 1ZYEA 1TRVA 2XBIA 1K0AA 2B5EA 2C0GA 5J4UA 1TDIA 4PQHA 5ELAA 3WT1A 4KUNA 2PPTA 1V98A 1Z6MA 2B1KA 1OC9B 3VWUA 4G0IA 3CBUA 4BPYA 4ECIA 2G2QA 4I97A 3M3MA 4IBPA 4V2LA 2FWFA 2P5RA 3K8NA 2LUSA 2EFEA 1HNBA 1JZOA 1K0OA 5AGYA 5A5HA 2DJ2A 2O87A 3HXSA 1WE0A 1U87A 2FWEA 4OMVA 4GCIA 2AYTA 4V2MA 3TRPA 4LL4B 3HD5A 3QD9A 2UV8G 3ZFBA 1H4OA 3GX0A 1TXXA 1O85A 1M7TA 4HQZA 3C1SA 1AAZA 2CA8A 3BCKA 2V6OA 2GSSA 4XCSA 2HSYA 2PUKC 3EYTA 2N5AA 2YV7A 2VUPA 1GTAA 4TXVA 2R2JA 3FHKA 1SK1A 3J7Yb 3CMIA 2OT3A 2MBTA 1X5EA 3DWVA 2ES7A 4PI0C 2CAQA 1I9DA 5JCWA 1MDKA 4MH2A 4JRRA 4TR3A 4YAPA 3EVIA 3IOSA 3HCZA 3F3QA 4ZL8A 5D96A 1SVLA 1X5CA 3UVHA 4NXIA 2YN1A 5HR3A 1GNEA 3AY8A 3DVXA 3FK8A 1FOHA 2RM6A 4YKFA 1B4QA 4IGJA 5ECIB 3VWXA 18GSA 2O89A 3CSIA 4GXZA 3UJ1A 3EPTA 4EDZA 3QAVA 1A2MA 1Q98A 5CO3A 1TP9A 1C72A 2C1YA 1ABAA 5F05A 3H8QA 4DSSA 4F0BA 3F8UA 4O5RA 1SKSB 1T8EB 2GQKA 1X9WB 1QK8A 5DCHA 2H8LA 1K0CA 1T7PB 2K9FA 4KAEA 5DVBA 2LRTA 3IV4A 2VM2A 5B7CA 4HJMA 2A4HA 1PQNA 3FRCA 3MIXA 4EE0A 3VPTA 1GUMA 3QCPA 2F8AA 3M8NA 3DRNA 4AF2A 4OWYA 3L9VA 4YQVA 2X8CA 4HQSA 2OBKA 3HY2A 4OO4A 1A2JA 3A5WA 4JR4A 3FKFA 3GKKA 4MZBA 4DSQA 5HFKA 4USSA 4G10A 2RUEA 4POBA 2TRCP 4ZB8A 3FR6A 3Q74A 4WBRD 3GNJA 2WW0A 2DIYA 3CSJA 4HDEA 4JU5A 1GWCA 4K7IA 1XZOA 5A34A 1YY7A 5DBQA 2L4QA 4XIHA 1HYUA 2DSAA 2B1LA 2BJXA 4EO3A 5HR0A 1GSSA 1M99A 2FUG2 2IJYA 3US3A 2NPBA 5AIVA 1SKRB 3FY7A 4CHSA 3KEBA 5DJLA 2MMNA 1DE1A 2HFDA 2HRKB 1Y6EA 1PX7A 2WVXB 2KUCA 2C3TA 3KCMA 4PI2C 1WP0A 2IMKA 3GKNA 1I1IP 1VRSD 2D2ZA 4WF4A 2Z9SA 2JZSA 1TTZA 4MF6A 5KN1A 1XG8A 1GSFA 1XW6A 2WS2A 4N0ZA 1ACVA 4KX4A 3KH7A 4XRAA 4Q5RA 5ECPB 1Y1UA 1EGOA 2WW1A 5J41A 3M9KA 1A8LA 5DALB 2FWGA 1F2EA 1Z7RA 2HZEB 1XWKA 3CWGA 5IOXA 3I69A 3GX8A 4WF5A 3ZMLA 2GSTA 1MTCA 3UARA 19GSA 4F0CA 5J40A 2WFCA 6GSXA 2O3EA 1MD4A 1TRWA 1OC3A 4KSOA 2FLSA 3TUEA 3UIWA 2AAWA 3TKQA 3Q19A 1K0DA 4EF0A 2H01A 2YANA 3GTUB 2NDOA 2JU5A 2CT6A 2JZTA 2L6CA 2MMZA 3DIEA 3CHXC 4DVCA 5G5FA 2ALBA 1V9WA 3L9SA 3UBKA 2V41A 5F8BA 1A0RP 3PH9A 2WW3A 1X5DA 1GP1A 3VWWA 1B48A 5DAKB 2IMDA 4EVMA 1OKTA 3M1GA 4KE3A 3BOAA 3TJKA 5IOWA 1PL1A 4PXOA 3RGBC 2EIQA 5G2ZA 3LEFA 4PHZC 4TR4A 2FA8A 2H0IA 5CRDA 4KCEA 4IQ1A 5DJMA 4KSMA 6GSTA 1TRUA 4ECJA 2GQLA 4GDFA 2C4JA 4XRDA 3DD3A 1HNCA 2N5BA 2B5YA 1FOVA 3HA9A 2WGRA 1U88A 3N5OA 5ID2B 2GZPA 4AKGA 2HSNB 5A5KA 2I81A 1AIUA 3R2QA 2AV4A 3IE3A 5H5RA 1NHYA 3NZNA 4X4JA 4BWSA 4NMUA 2H30A 3GRXA 1IYHA 4JR6A 3QOUA 4IQAA 2OA7A 1XIYA 2YZHA 3TOTA 1XPVA 4K5SA 1ST9A 1SD8A 1G6YA 3Q18A 3ERFA 3DYRA 3FZ4A 1YDKA 3HJPA 2MBSA 1VF3A 3ZRDA 1R5PA 4YQMA 4AKIA 3IA1A 3ZL5A 3ZLPA 1TJDA 4MJAA 1HD2A 2OJLA 4Z2RA 5J5NA 4NHZA 1WRYA 1S3CA 2ON5A 1SD9A 2L4CA 4MK3A 2H6ZA 3GHAA 4I5QA 3CTFA 2HI7A 3M9JA 1WPIA 3IC8A 2B6MA 4BA7A 1BYEA 3RHCA 5IO2A 4OFTA 4ICYA 3C7MA 5F07A 1XCCA 5HR2A 2EIRA 4TR1A 3ME7A 4W66A 2QKEA 5LCZA 1JZWA 3EWLA 1UN2A 1YEPA 3D5JA 4MF7A 1XWGA 3ZTLA 3HYPA 2IMIA 1ZZYA 1M2DA 2E2MA 2LS5A 3LG6A 1SVOA 5J4YA 1T4YA 3ZVJD 3HDCA 4EL1A 5IMZA 2LTKA 3IXRA 2L5OA 1KBNA 4HZ4A 5D8IA 1DSBA 3GKMA 2C0FA 3EMXA 5JCUA 3CXGA 3VLNA 2M80A 3APOA 2XPDA 3BBYA 3WT2A 4NWYA 4N0VA 1MEKA 2LEGA 5ECHB 3LQ7A 1TKDB 1ZCPA 3GN3A 1EGRA 1A24A 1FW1A 2HRNA 1ERUA 3TJBA 5LNKe 1GNWA 3SBCA 3ERGA 2PWJA 2RIIA 1J08A 4Q5FA 1G7OA 4ZILA 1Z6NA 1TU8A 1B9XC 3UMAA 4J2FA 2A2SA 2H1AA 2HQTA 4EUYA 2VM1A 1K0NA 2JZRA 2GDRA 1SL0B 1GL8A 4MH3A 1CQHA 3A2VA 2L59A 3EU4A 4N30A 5G5EA 8GSSA 1QQ2A 3HJOA 5IPGA 2VL2C 3LFLA 1QXHA 3G7JA 2LJAA 4LLRA 1ZYNA 3KD0A 3EE2A 9GSSA 4ISDA 2R0PA 2H72A 3TKSC 4PX1A 6GSSA 2N5FA 1M3IA 5CRGA 2CQ9A 1QFNA 3FYGA 4XS1A 2QA2A 4PNFA 4OFMA 5GAPD 3FR3A 4TR0A 2GTUA 2C3NA 4K2DA 3IHQA 3TDGA 4RI6A 1XW9A 5CYYA 2V2GA 3UBLA 5ECRB 4DEJA 2WULA 2YWNA 4TXOB 1YVLA 4Z2TA 3TU3B 4L5LA 1JHBA 5BRTA 5A4UA 5CRHA 4FIWA 2HT9A 1WJKA 1LU4A 4KF9A 3ZYWA 16GSA 2J9HA 4AI6A 2DMMA 4PUFC 4O5UA 2X99A 5CRWA 4AKXB 5D9VA 4OCEA 2V6KA 5KN3A 2GSQA 3WGXA 5D9XA 1TK0B 4EIPA 2HNLA 1EOGA 1TRSA 5A1NB 3HVSA 2VLUA 2VKZG 4POLA 3W6GA 2EFDA 4XS4A 5GSSA 4GWRA 2I9HA 3PPUA 3D0ZA 2VL3A 1PA3A 4WBJA 4ZL7A
chains in the Genus database with same CATH topology
3DKSA 2B7JA 4O7HA 1FO5A 5ENUA 4O32A 4POKA 1G7EA 2YWOA 1XXUA 3UOMA 5FT3A 4ECCA 1T3BA 2DJ3A 4WKWA 1EP7A 1DUGA 4MF5A 4D73B 2XC2A 3A3TA 4AKHA 3IAS2 3IC4A 2YZUA 1QMVA 3QMXA 3F0IA 1E2YA 1UVZA 2R0GA 5DQSA 3PGTA 3FZAA 1WIKA 4IHUA 4LMWA 1UA5A 1K3LA 1BX9A 5GSTA 2H0GA 3HKRA 1O73A 2L6DA 4G19A 5EPFA 2NTOA 2HSMA 3GL3A 3CRTA 1SJZA 3P2AA 5CP1A 4H86A 1VF1A 5B8AA 5J9CA 4Q5NA 2V32A 3MNGA 4ZBDA 1AQXA 1XVQA 2DJ0A 4KW6A 3F4RA 2YCDA 3A2WA 2IL3A 3IBHA 2RUFA 2FY6A 3IR4A 1VGLA 2VCXA 1EZKA 4JBBA 5A5HB 2OACA 2O85A 1DBYA 1Z9HA 2HXKA 3G7YA 2LSTA 3VURA 1VF4A 3IHGA 6GSYA 3IK9A 2QGVA 1GLQA 3D4TA 1AUCA 3S9FA 2X49A 1H75A 4OD7A 1F3BA 5COHA 1GSQA 4GTUA 3WYWA 3QR6A 2GSRA 5HFGA 1XBSA 4K2XA 2CZ2A 1T00A 2RLIA 2X4AA 2YP6A 3D21A 1X9MB 1GH2A 4BVXA 3N9JA 3CTGA 5IMAA 2V1MA 2H74A 3WGEA 2CV4A 1YKCA 2TRXA 4RUVA 3D4MA 2H76A 1XVWA 3F63A 3MSZA 3CSHA 1W4VA 5BMUA 4HU9A 3H79A 2LNTA 2LJKA 2WJUA 4NV2A 4KB3A 2C0DA 1K0BA 20GSA 2K8SA 3L9UA 5HQPA 2DKIA 5J3RA 3TJJA 1A0FA 3DEXA 1O7UA 4X1UA 4HEA2 4OO5A 1B9YC 5B6MA 3MDKA 4ACSA 4EDYA 3CYNA 6GSVA 4BVYA 3D22A 2NBSA 5AN1A 3IRAA 4ZB9A 1A8YA 2R0CA 4N3ZA 3WD6A 5DQYA 4K9ZA 1EEMA 4GSTA 5J9BA 3UL3A 2EIOA 2GGTA 4DSSB 3I43A 2CZ3A 4ZL9A 5G1KA 1PGTA 3KGKA 3SWLA 3U6VA 4IVFA 3ED3A 1G6WA 22GSA 4KH7A 2K6VA 1YF0A 3VK9A 4ZB6A 5ECQB 4NV5A 3EC3A 4MZWA 1FB6A 3FZ5A 1OC8A 2DKHA 3TJFA 4QL7A 5ECOB 4HJ2A 2ZCTA 2I3YA 1X0RA 4BL7A 4HI7A 2MZCA 3HJMA 2FNOA 5C00A 5EVOA 4KNDA 4CY6A 2HE3A 1FHEA 5KN0A 4IW9A 4F82A 4QMKA 1GTUA 2H71A 5ABRA 4NAXA 1SKWB 3GUSA 1XW5A 2RM5A 4WR5A 1T4ZA 2JACA 1FB0A 5A34B 2BTOT 3KMOA 5KEJA 1PL2A 3CRUA 3HVVA 2XBQA 3MWHA 1PKWA 4L0WA 2L57A 3GH9A 1BEDA 3IDVA 1BF5A 4I2TA 3ZZXA 1ZGNA 4TRXA 4MJCA 3LGCA 4MA9A 4ID0A 1XOBA 1MD3A 3IAM2 4NHWA 5IIZA 4G0KA 4JEDA 4MABA 1GUHA 3F3RA 4LA1A 4CY8A 2R37A 3A5IA 4TW5A 5CAXA 1J9BA 3KP8A 3O3TA 1RK4A 4Q5QA 4LMVA 6GSUA 4FYUA 4ZIJA 1OC9A 3E3EA 4IKHA 5IQYA 2GZYA 4E68A 2YPMA 7GSSA 3RPNA 2LKUA 1BAYA 5CNWA 5E4WA 4MCUA 3G7IA 3LYPA 2CVKA 2DIZA 3VFIA 4HUAA 3TKRA 2H1BA 3VPQA 1GTIA 2R6KA 4KDYA 4I6XA 4V1Ap 2GS3A 1F6MC 3FZ9A 1M9BA 2LQQA 2CVDA 1YQ1A 4GSSA 2WCIA 4MJBA 1XFLA 5KOWA 1XWCA 4FO5A 3KMNA 1FAAA 1AQWA 2VAFA 2DJJA 3E0UA 3VI5A 5H5SA 2CVBA 5H5QA 3C71A 5DCGA 2VO4A 3KJYA 1AQVA 4MNNA 1U3AA 1EWXA 1PRXA 2EFHA 4GSNA 4MPFA 2CX3A 3ISOA 3APSA 4AJ7A 2WDUA 5J4VA 1GSYA 3F6DA 2L5LA 3RDWA 1TI3A 4P3YB 1CQGA 1E6BA 2EC4A 1WMJA 5G1LA 3TKSE 3KTLA 1USBA 1BJXA 4V1Ag 2WRTA 3GV1A 5B6NA 3TRQA 5ECLB 2H1LA 3DGQA 2C80A 2VIMA 1R4WA 4HU7A 1SK0A 2MMOA 2WB9A 1SENA 4WEYA 2X8HA 5D93A 3JCML 3F4SA 3TJGA 1ERVA 4E8EA 4G2EA 5IO0A 1ML6A 1PSQA 1GULA 2ZUPA 1QUWA 2E7PA 3F4TA 1Y25A 1K3YA 4NPBA 13GSA 1ZL9A 2YJ7A 4AJ8A 1JLWA 4CDOA 3GSTA 3EINA 2C8UA 4F03A 2XHFA 3GURA 1OVNA 2YNXA 2R5GA 2F3MA 4KDXA 5ELGA 2M46A 1FVJA 2F9SA 1V2AA 3J7Yk 1JFUA 2C0EA 2LRCA 1OE7A 1Z3EA 2CAIA 3QAGA 2B7KA 3APQA 3UAPA 5INYA 2VOCA 1TOFA 4I2UA 3BJ5A 3DVWA 4EXJA 3LXZA 2QSIA 3GYKA 3QPMA 4E8HA 3RAZA 2X8GA 2HSHA 3TRXA 3V1WA 3HMJG 2F51A 1TK8B 3KXOA 1T1VA 5IMVA 1FG4A 3ZMKA 2PGTA 4YKGA 1DE2A 1ERTA 5D73A 1ON4A 5F06A 2MMAA 2H19A 3BD2A 4ML1A 2HLSA 3D6IA 4PTSA 5LD0A 1PMTA 3DMLA 3HZ4A 3GSSA 3UVTA 1MDJA 3G9BA 2I1UA 1XWBA 4TR1B 5HR1A 1R5AA 2EFCA 1B4PA 4IN0A 4EIQA 4JZQA 3L0HA 4PNGA 3U5RE 5A4WA 2H0HA 2IN3A 3F6FA 2WZ9A 4KCAA 3TB2A 2YWIA 4DSRA 2HRKA 4FQUA 3TGZA 2IIYA 2GQMA 3LW9A 1ZYQB 2VLTA 4K6XA 1AXDA 2DMLA 1FVKA 2FD3A 1YEXA 2IPAA 1W89A 1OKDA 2IWTA 2VLVA 3H93A 4PGTA 4Z7XA 1BG5A 1EEJA 3GH6A 4EC0A 1X9SB 2UZ8A 2MYGA 3KIJA 3ZIJA 3P8WA 4GRFA 5DALA 2IFQB 3EMPA 4MP4A 4TKYA 2HZEA 4BWQA 2E2GA 5ECKB 4FH8A 1TXUA 3KH9A 2PERA 5AIXA 3OR5A 1V57A 2VL9A 2PVOC 4A5PA 1HNAA 3L78A 3RPPA 1SK2A 2PU9C 2A2PA 1IYIA 3O76A 4OCFA 1QGVA 1R7HA 4IS0A 2VCTA 5G30A 2H1GA 4IJ3A 3PR8A 4ZB7A 3IPZA 3MAKA 3HVXA 1ERWA 1V40A 1OAZA 3GTUA 1PX6A 4G01A 2GT5A 4IELA 1RW1A 2DLXA 4GLTA 5JWQB 2YOIA 3LXTA 2OKAA 3GMFA 1G0TA 4K0NA 4IJIA 3ERWA 4K0GA 2PVQA 1YZXA 3E9JB 1TW9A 1I5GA 5DAKA 2QA1A 3MYDA 1VF2A 2LQOA 1YKAA 4G9HA 2FGXA 2G0FA 2CX4A 1SJ6A 2KP2A 2GLRA 1YJ6A 4WETA 3RHBA 4K7NA 1NM3A 3O6TA 1F3AA 1M2BA 1SYRA 1NSWA 2IMEA 3M0FA 5KOXA 2H6XA 4YH2A 2I4AA 4N11A 4MZCA 2TIRA 2DJKA 1OE8A 12GSA 4RI7A 2VCVA 4LL1B 3C73A 3R3EA 2H75A 3KZQA 4PUAA 4KGIA 5ID2A 2HSNA 2VD0A 4MDCA 2AHEA 1JLVA 5IPHA 4OFNA 2LV3A 1F37A 4F2IA 4YQUA 2H1DA 1AW9A 2FHEA 1EV4A 3DXBA 2AB6A 2K18A 4L5OA 2C3QA 4KA0A 1U6TA 4WXTA 1O8WA 4KDUA 2GVPA 3W8SA 4XHMA 3ME8A 4XS4B 3H4KA 2VCWA 2H70A 3QFBC 2VCZA 3KTBA 1LJRA 5JCGA 1A23A 4JE1A 4YAVA 1S3DA 2H66A 4N10A 17GSA 2P5QA 3QFAC 1N8JA 4WR4A 1K0MA 3GKXA 5IMDA 4K5RA 10GSA 5GAND 1EP8A 5ECMB 5IM9A 4HOJA 3IK7A 4K7OA 4HZ2A 1A2LA 3I9V2 3FW2A 1UC7A 5HFIA 3ZFLA 1B8XA 4L0UA 2REMA 1U3IA 1THXA 1TU7A 2JSYA 4V2NA 2OE3A 1SVMA 5J47A 2GT6A 1XOAA 4CW9A 4EKZA 5D9TA 2HRAA 1EOHA 1JZDA 1NW2A 2YWMA 2B3SA 2ZNMA 3GA4A 1O8XA 2J23A 2HRFA 3A2XA 4MMMA 5FWGA 5G31A 5KN2A 4PQ1A 3EU3A 1SJIA 2A2RA 1V58A 1URMA 1TK5B 2HSMB 2H73A 1AC1A 1YF1A 1S3AA 1GLPA 2FA4A 2P0GA 5FHIA 1N25A 1O81A 1Q4JA 1GRXA 2LRNA 4FYBA 2VCQA 1OYJA 4G0LA 2LJRA 2DC5A 1PD21 3TOUA 4PQIA 3FMWA 3LJRA 2QC7A 1Z7PA 4GF0A 1SU9A 3H1NA 2YV9A 3GL5A 3C8EA 1ZOFA 3TCOA 5JWRB 5C04A 4TOPA 3QDNA 4X0XA 5ECSA 3BCIA 5EY6A 4O92A 3QAWA 4MLYA 1XWAA 4ML6A 3I6AA 1GUKA 2HYXA 2VD1A 1HQOA 4GQFA 1GSUA 4RQRA 4XTSA 3LYKA 2KLXA 3VWVA 3LWAA 2OE0A 4ECBA 1ZYPA 3F9UA 1KEBA 1M9AA 4MPGA 2M72A 2R3XA 4L8EA 2KHPA 2E0QA 1EV9A 2H6YA 1MDIA 4PURA 2NVLA 3WGDA 5JWOB 2DBCA 4BVXB 3NIVA 2O5VA 2GZZA 1J0FA 2P31A 2AJQB 3KP9A 5IMCA 5GZZB 1RQMA 4QQ7A 5D9WA 1ILOA 1GTBA 2A4VA 2YJHA 3NOFA 2VL2A 2R4VA 1M0UA 5AISA 5BMUB 4GQCA 2O7KA 4IP6A 2KOKA 4ZBBA 2JADA 4J56E 3GIXA 3P90A 3RBTA 5DDLA 1NHOA 2JL4A 4TXOA 3TKSA 1KTEA 2F8FA 2BMXA 2KP1A 1BQ7A 1LBKA 4TVEA 4BVYB 3ZITA 2JSZA 4HS1A 5F0GA 1Z5YE 2OE1A 3HZ8A 2PMTA 4F9ZA 4AJ6A 3VI7A 1SYXA 3FEUA 4ILFA 2AUVA 1JZRA 4FYCA 1PN0A 3LSZA 4ZBAA 1O6JA 5A1NA 4Z2UA 3PINA 4X43A 4MJEA 4XS6A 4K8MA 1K3OA 3ZIVA 5IMFA 2O8VB 4TN8A 3Q6OA 5EL8A 5B8BA 3EURA 1KNGA 1THOA 2LNSA 3GFKA 1GSDA 2B5XA 1M2AA 4I8BA 5ECNB 3P7XA 2OBIA 3C1RA 4BL7B 1BG1A 1R26A 4QL9A 5L71A 3L4NA 1PN9A 2IFQA 1SL2B 2FCHA 1SL1B 3UEMA 3LORA 1N2AA 4RQXA 4D73A 2OADA 1GSEA 1TI1A 3HHVA 6GSWA 2IMFA 4O5QA 5CREA 14GSA 5E59A 5A4VA 1WWJA 2XPEA 2FWHA 4POMA 3FR9A 3W8JA 11GSA 4ZXGA 1ZMAA 2K8VA 4K1FA 2X64A 2PN8A 1WOUA 4J57E 4IP1A 2ON7A 2PBJA 4AGSA 3ZVJA 3KM6A 2HZFA 3ZREA 3TKPA 1F9MA 1PKZA 2DJ1A 4ULXA 1ZYEA 1TRVA 2XBIA 1K0AA 2B5EA 2C0GA 5J4UA 1TDIA 4PQHA 5ELAA 3WT1A 4KUNA 2PPTA 1V98A 1Z6MA 2B1KA 1OC9B 3VWUA 4G0IA 3CBUA 4BPYA 4ECIA 2G2QA 4I97A 3M3MA 4IBPA 4V2LA 2FWFA 2P5RA 3K8NA 2LUSA 2EFEA 1HNBA 1JZOA 1K0OA 5AGYA 5A5HA 2DJ2A 2O87A 3HXSA 1WE0A 1U87A 2FWEA 4OMVA 4GCIA 2AYTA 4V2MA 3TRPA 4LL4B 3HD5A 3QD9A 2UV8G 3ZFBA 1H4OA 3GX0A 1TXXA 1O85A 1M7TA 4HQZA 3C1SA 1AAZA 2CA8A 3BCKA 2V6OA 2GSSA 4XCSA 2HSYA 2PUKC 3EYTA 2N5AA 2YV7A 2VUPA 1GTAA 4TXVA 2R2JA 3FHKA 1SK1A 3J7Yb 3CMIA 2OT3A 2MBTA 1X5EA 3DWVA 2ES7A 2CAQA 1I9DA 5JCWA 1MDKA 4MH2A 4JRRA 4TR3A 4YAPA 3EVIA 3IOSA 3HCZA 3F3QA 4ZL8A 5D96A 1SVLA 1X5CA 3UVHA 4NXIA 2YN1A 5HR3A 1GNEA 3AY8A 3DVXA 3FK8A 1FOHA 2RM6A 4YKFA 1B4QA 4IGJA 5ECIB 3VWXA 18GSA 2O89A 3CSIA 4GXZA 3UJ1A 3EPTA 4EDZA 3QAVA 1A2MA 1Q98A 5CO3A 1TP9A 1C72A 2C1YA 1ABAA 5F05A 3H8QA 4DSSA 4F0BA 3F8UA 4O5RA 1SKSB 1T8EB 2GQKA 1X9WB 1QK8A 5DCHA 2H8LA 1K0CA 1T7PB 2K9FA 4KAEA 5DVBA 2LRTA 3IV4A 2VM2A 5B7CA 4HJMA 2A4HA 1PQNA 3FRCA 3MIXA 4EE0A 3VPTA 1GUMA 3QCPA 2F8AA 3M8NA 3DRNA 4AF2A 4OWYA 3L9VA 4YQVA 2X8CA 4HQSA 2OBKA 3HY2A 4OO4A 1A2JA 3A5WA 4JR4A 3FKFA 3GKKA 4MZBA 4DSQA 5HFKA 4USSA 4G10A 2RUEA 4POBA 2TRCP 4ZB8A 3FR6A 3Q74A 4WBRD 3GNJA 2DIYA 3CSJA 4HDEA 4JU5A 1GWCA 4K7IA 1XZOA 5A34A 1YY7A 5DBQA 2L4QA 4XIHA 1HYUA 2DSAA 2B1LA 2BJXA 4EO3A 5HR0A 1GSSA 1M99A 2FUG2 2IJYA 3US3A 2NPBA 5AIVA 1SKRB 3FY7A 4CHSA 3KEBA 5DJLA 2MMNA 1DE1A 2HFDA 2HRKB 1Y6EA 1PX7A 2KUCA 2C3TA 3KCMA 1WP0A 2IMKA 3GKNA 1VRSD 2D2ZA 4WF4A 2Z9SA 2JZSA 1TTZA 4MF6A 5KN1A 1GSFA 1XW6A 2WS2A 4N0ZA 1ACVA 4KX4A 3KH7A 4XRAA 4Q5RA 5ECPB 1Y1UA 1EGOA 5J41A 3M9KA 1A8LA 5DALB 2FWGA 1F2EA 1Z7RA 2HZEB 1XWKA 3CWGA 5IOXA 3I69A 3GX8A 4WF5A 3ZMLA 2GSTA 1MTCA 3UARA 19GSA 4F0CA 5J40A 2WFCA 6GSXA 1MD4A 1TRWA 1OC3A 4KSOA 2FLSA 3TUEA 3UIWA 2AAWA 3TKQA 3Q19A 1K0DA 4EF0A 2H01A 2YANA 3GTUB 2NDOA 2JU5A 2CT6A 2JZTA 2L6CA 2MMZA 3DIEA 4DVCA 5G5FA 2ALBA 1V9WA 3L9SA 3UBKA 2V41A 5F8BA 1A0RP 3PH9A 1X5DA 1GP1A 3VWWA 1B48A 5DAKB 2IMDA 4EVMA 1OKTA 3M1GA 4KE3A 3BOAA 3TJKA 5IOWA 1PL1A 4PXOA 2EIQA 5G2ZA 3LEFA 4TR4A 2FA8A 2H0IA 5CRDA 4KCEA 4IQ1A 5DJMA 4KSMA 6GSTA 1TRUA 4ECJA 2GQLA 4GDFA 2C4JA 4XRDA 3DD3A 1HNCA 2N5BA 2B5YA 1FOVA 3HA9A 2WGRA 1U88A 3N5OA 5ID2B 2GZPA 4AKGA 2HSNB 5A5KA 2I81A 1AIUA 3R2QA 2AV4A 3IE3A 5H5RA 1NHYA 3NZNA 4X4JA 4BWSA 4NMUA 2H30A 3GRXA 1IYHA 4JR6A 3QOUA 4IQAA 2OA7A 1XIYA 2YZHA 3TOTA 1XPVA 4K5SA 1ST9A 1SD8A 1G6YA 3Q18A 3ERFA 3DYRA 3FZ4A 1YDKA 3HJPA 2MBSA 1VF3A 3ZRDA 1R5PA 4YQMA 4AKIA 3IA1A 3ZL5A 3ZLPA 1TJDA 4MJAA 1HD2A 2OJLA 4Z2RA 5J5NA 4NHZA 1WRYA 1S3CA 2ON5A 1SD9A 2L4CA 4MK3A 2H6ZA 3GHAA 4I5QA 3CTFA 2HI7A 3M9JA 1WPIA 3IC8A 2B6MA 4BA7A 1BYEA 3RHCA 5IO2A 4OFTA 4ICYA 3C7MA 5F07A 1XCCA 5HR2A 2EIRA 4TR1A 3ME7A 4W66A 2QKEA 5LCZA 1JZWA 3EWLA 1UN2A 1YEPA 3D5JA 4MF7A 1XWGA 3ZTLA 3HYPA 2IMIA 1ZZYA 1M2DA 2E2MA 2LS5A 3LG6A 1SVOA 5J4YA 1T4YA 3ZVJD 3HDCA 4EL1A 5IMZA 2LTKA 3IXRA 2L5OA 1KBNA 4HZ4A 5D8IA 1DSBA 3GKMA 2C0FA 3EMXA 5JCUA 3CXGA 3VLNA 2M80A 3APOA 2XPDA 3BBYA 3WT2A 4NWYA 4N0VA 1MEKA 2LEGA 5ECHB 3LQ7A 1TKDB 1ZCPA 3GN3A 1EGRA 1A24A 1FW1A 2HRNA 1ERUA 3TJBA 5LNKe 1GNWA 3SBCA 3ERGA 2PWJA 2RIIA 1J08A 4Q5FA 1G7OA 4ZILA 1Z6NA 1TU8A 1B9XC 3UMAA 4J2FA 2A2SA 2H1AA 2HQTA 4EUYA 2VM1A 1K0NA 2JZRA 2GDRA 1SL0B 1GL8A 4MH3A 1CQHA 3A2VA 2L59A 3EU4A 4N30A 5G5EA 8GSSA 1QQ2A 3HJOA 5IPGA 2VL2C 3LFLA 1QXHA 3G7JA 2LJAA 4LLRA 1ZYNA 3KD0A 3EE2A 9GSSA 4ISDA 2R0PA 2H72A 3TKSC 4PX1A 6GSSA 2N5FA 5CRGA 2CQ9A 1QFNA 3FYGA 4XS1A 2QA2A 4PNFA 4OFMA 5GAPD 3FR3A 4TR0A 2GTUA 2C3NA 4K2DA 3IHQA 3TDGA 4RI6A 1XW9A 5CYYA 2V2GA 3UBLA 5ECRB 4DEJA 2WULA 2YWNA 4TXOB 1YVLA 4Z2TA 3TU3B 4L5LA 1JHBA 5BRTA 5A4UA 5CRHA 4FIWA 2HT9A 1WJKA 1LU4A 4KF9A 3ZYWA 16GSA 2J9HA 4AI6A 2DMMA 4PUFC 4O5UA 2X99A 5CRWA 4AKXB 5D9VA 4OCEA 2V6KA 5KN3A 2GSQA 3WGXA 5D9XA 1TK0B 4EIPA 2HNLA 1EOGA 1TRSA 5A1NB 3HVSA 2VLUA 2VKZG 4POLA 3W6GA 2EFDA 4XS4A 5GSSA 4GWRA 2I9HA 3PPUA 3D0ZA 2VL3A 1PA3A 4WBJA 4ZL7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DKS A;  2B7J A;  4O7H A;  1FO5 A;  5ENU A;  4O32 A;  4POK A;  1G7E A;  2YWO A;  1XXU A;  3UOM A;  5FT3 A;  4ECC A;  1T3B A;  2DJ3 A;  4WKW A;  1EP7 A;  1DUG A;  4MF5 A;  4D73 B;  2XC2 A;  3A3T A;  3IAS 2;  3IC4 A;  2YZU A;  1QMV A;  3QMX A;  3F0I A;  1E2Y A;  1UVZ A;  5DQS A;  3PGT A;  3FZA A;  1WIK A;  4IHU A;  4LMW A;  1UA5 A;  1K3L A;  1BX9 A;  5GST A;  2H0G A;  3HKR A;  1O73 A;  2L6D A;  4G19 A;  5EPF A;  2NTO A;  2HSM A;  3GL3 A;  3CRT A;  1SJZ A;  3P2A A;  5CP1 A;  4H86 A;  1VF1 A;  5B8A A;  5J9C A;  4Q5N A;  2V32 A;  3MNG A;  4ZBD A;  1AQX A;  1XVQ A;  2DJ0 A;  4KW6 A;  3F4R A;  2YCD A;  3A2W A;  2IL3 A;  3IBH A;  2RUF A;  2FY6 A;  3IR4 A;  1VGL A;  2VCX A;  1EZK A;  4JBB A;  2OAC A;  2O85 A;  1DBY A;  1Z9H A;  2HXK A;  3G7Y A;  2LST A;  3VUR A;  1VF4 A;  6GSY A;  3IK9 A;  2QGV A;  1GLQ A;  3D4T A;  1AUC A;  3S9F A;  1H75 A;  4OD7 A;  1F3B A;  5COH A;  1GSQ A;  4GTU A;  3WYW A;  3QR6 A;  2GSR A;  5HFG A;  1XBS A;  2CZ2 A;  1T00 A;  2RLI A;  2YP6 A;  3D21 A;  1X9M B;  1GH2 A;  4BVX A;  3N9J A;  3CTG A;  5IMA A;  2V1M A;  2H74 A;  3WGE A;  2CV4 A;  1YKC A;  2TRX A;  4RUV A;  3D4M A;  2H76 A;  1XVW A;  3F63 A;  3MSZ A;  3CSH A;  1W4V A;  5BMU A;  4HU9 A;  3H79 A;  2LNT A;  2LJK A;  2WJU A;  4NV2 A;  4KB3 A;  2C0D A;  1K0B A;  20GS A;  2K8S A;  3L9U A;  5HQP A;  5J3R A;  3TJJ A;  1A0F A;  3DEX A;  1O7U A;  4X1U A;  4HEA 2;  4OO5 A;  1B9Y C;  5B6M A;  3MDK A;  4ACS A;  4EDY A;  3CYN A;  6GSV A;  4BVY A;  3D22 A;  2NBS A;  5AN1 A;  3IRA A;  4ZB9 A;  1A8Y A;  3WD6 A;  5DQY A;  4K9Z A;  1EEM A;  4GST A;  5J9B A;  3UL3 A;  2EIO A;  2GGT A;  4DSS B;  3I43 A;  2CZ3 A;  4ZL9 A;  5G1K A;  1PGT A;  3KGK A;  3SWL A;  3U6V A;  4IVF A;  3ED3 A;  1G6W A;  22GS A;  4KH7 A;  2K6V A;  1YF0 A;  3VK9 A;  4ZB6 A;  5ECQ B;  4NV5 A;  3EC3 A;  4MZW A;  1FB6 A;  3FZ5 A;  1OC8 A;  3TJF A;  4QL7 A;  5ECO B;  4HJ2 A;  2ZCT A;  2I3Y A;  1X0R A;  4BL7 A;  4HI7 A;  2MZC A;  3HJM A;  2FNO A;  5C00 A;  5EVO A;  4KND A;  2HE3 A;  1FHE A;  5KN0 A;  4IW9 A;  4F82 A;  1GTU A;  2H71 A;  5ABR A;  4NAX A;  1SKW B;  3GUS A;  1XW5 A;  2RM5 A;  4WR5 A;  1T4Z A;  2JAC A;  1FB0 A;  2BTO T;  3KMO A;  5KEJ A;  1PL2 A;  3CRU A;  3HVV A;  2XBQ A;  3MWH A;  1PKW A;  4L0W A;  2L57 A;  3GH9 A;  1BED A;  3IDV A;  4I2T A;  3ZZX A;  1ZGN A;  4TRX A;  4MJC A;  3LGC A;  4MA9 A;  4ID0 A;  1XOB A;  1MD3 A;  3IAM 2;  4NHW A;  5IIZ A;  4G0K A;  4JED A;  4MAB A;  1GUH A;  3F3R A;  4LA1 A;  2R37 A;  4TW5 A;  5CAX A;  1J9B A;  3KP8 A;  3O3T A;  1RK4 A;  4Q5Q A;  4LMV A;  6GSU A;  4FYU A;  4ZIJ A;  1OC9 A;  3E3E A;  4IKH A;  5IQY A;  2GZY A;  2YPM A;  7GSS A;  3RPN A;  2LKU A;  1BAY A;  5CNW A;  5E4W A;  4MCU A;  3G7I A;  3LYP A;  2CVK A;  2DIZ A;  3VFI A;  4HUA A;  3TKR A;  2H1B A;  3VPQ A;  1GTI A;  2R6K A;  4KDY A;  4I6X A;  4V1A p;  2GS3 A;  1F6M C;  1M9B A;  2LQQ A;  3FZ9 A;  2CVD A;  1YQ1 A;  4GSS A;  2WCI A;  4MJB A;  1XFL A;  1XWC A;  4FO5 A;  3KMN A;  1FAA A;  1AQW A;  2VAF A;  2DJJ A;  3E0U A;  3VI5 A;  5H5S A;  2CVB A;  5H5Q A;  3C71 A;  5DCG A;  2VO4 A;  3KJY A;  1AQV A;  1U3A A;  1EWX A;  1PRX A;  4MPF A;  4GSN A;  2CX3 A;  3ISO A;  3APS A;  4AJ7 A;  2WDU A;  1GSY A;  3F6D A;  2L5L A;  3RDW A;  1TI3 A;  4P3Y B;  1CQG A;  1E6B A;  2EC4 A;  1WMJ A;  5G1L A;  3TKS E;  3KTL A;  1USB A;  1BJX A;  4V1A g;  2WRT A;  3GV1 A;  5B6N A;  3TRQ A;  5ECL B;  3DGQ A;  2C80 A;  2VIM A;  1R4W A;  4HU7 A;  1SK0 A;  2MMO A;  2WB9 A;  1SEN A;  4WEY A;  2X8H A;  5D93 A;  3JCM L;  3F4S A;  3TJG A;  1ERV A;  4E8E A;  4G2E A;  5IO0 A;  1ML6 A;  1PSQ A;  1GUL A;  2ZUP A;  1QUW A;  2E7P A;  3F4T A;  1Y25 A;  1K3Y A;  4NPB A;  13GS A;  1ZL9 A;  2YJ7 A;  4AJ8 A;  1JLW A;  4CDO A;  3GST A;  3EIN A;  2C8U A;  4F03 A;  2XHF A;  3GUR A;  1OVN A;  2YNX A;  2R5G A;  2F3M A;  4KDX A;  5ELG A;  2M46 A;  1FVJ A;  2F9S A;  1V2A A;  3J7Y k;  1JFU A;  2C0E A;  2LRC A;  1OE7 A;  1Z3E A;  2CAI A;  3QAG A;  2B7K A;  3APQ A;  3UAP A;  5INY A;  2VOC A;  1TOF A;  4I2U A;  3BJ5 A;  3DVW A;  4EXJ A;  3LXZ A;  2QSI A;  3GYK A;  3QPM A;  4E8H A;  3RAZ A;  2X8G A;  2HSH A;  3TRX A;  3V1W A;  2F51 A;  1TK8 B;  3KXO A;  1T1V A;  5IMV A;  1FG4 A;  3ZMK A;  2PGT A;  1DE2 A;  1ERT A;  5D73 A;  1ON4 A;  5F06 A;  2MMA A;  2H19 A;  3BD2 A;  4ML1 A;  2HLS A;  3D6I A;  4PTS A;  5LD0 A;  1PMT A;  3DML A;  3HZ4 A;  3GSS A;  3UVT A;  1MDJ A;  3G9B A;  2I1U A;  1XWB A;  4TR1 B;  5HR1 A;  1R5A A;  1B4P A;  4IN0 A;  4JZQ A;  3L0H A;  4PNG A;  3U5R E;  5A4W A;  2H0H A;  2IN3 A;  3F6F A;  2WZ9 A;  4KCA A;  3TB2 A;  2YWI A;  4DSR A;  2HRK A;  4FQU A;  3TGZ A;  2IIY A;  2GQM A;  1ZYQ B;  2VLT A;  4K6X A;  1AXD A;  2DML A;  1FVK A;  2FD3 A;  1YEX A;  2IPA A;  1W89 A;  1OKD A;  2IWT A;  2VLV A;  3H93 A;  4PGT A;  4Z7X A;  1BG5 A;  1EEJ A;  3GH6 A;  4EC0 A;  1X9S B;  2UZ8 A;  2MYG A;  3KIJ A;  3ZIJ A;  3P8W A;  4GRF A;  5DAL A;  2IFQ B;  3EMP A;  4MP4 A;  4TKY A;  2HZE A;  4BWQ A;  2E2G A;  5ECK B;  4FH8 A;  3KH9 A;  2PER A;  5AIX A;  3OR5 A;  1V57 A;  2VL9 A;  2PVO C;  1HNA A;  3L78 A;  3RPP A;  1SK2 A;  2PU9 C;  1IYI A;  3O76 A;  4OCF A;  1QGV A;  1R7H A;  4IS0 A;  2VCT A;  5G30 A;  2H1G A;  4IJ3 A;  3PR8 A;  3IPZ A;  3MAK A;  3HVX A;  1ERW A;  1V40 A;  1OAZ A;  3GTU A;  1PX6 A;  2GT5 A;  4IEL A;  1RW1 A;  2DLX A;  4GLT A;  5JWQ B;  2YOI A;  3LXT A;  2OKA A;  3GMF A;  1G0T A;  4K0N A;  4IJI A;  3ERW A;  4K0G A;  2PVQ A;  1YZX A;  3E9J B;  1TW9 A;  1I5G A;  5DAK A;  1VF2 A;  2LQO A;  1YKA A;  4G9H A;  2FGX A;  2G0F A;  2CX4 A;  1SJ6 A;  2KP2 A;  2GLR A;  1YJ6 A;  4WET A;  3RHB A;  4K7N A;  1NM3 A;  3O6T A;  1F3A A;  1M2B A;  1SYR A;  1NSW A;  2IME A;  3M0F A;  2H6X A;  4YH2 A;  2I4A A;  4N11 A;  4MZC A;  2TIR A;  2DJK A;  1OE8 A;  12GS A;  4RI7 A;  2VCV A;  4LL1 B;  3C73 A;  3R3E A;  2H75 A;  3KZQ A;  4PUA A;  4KGI A;  5ID2 A;  2VD0 A;  4MDC A;  2AHE A;  1JLV A;  5IPH A;  4OFN A;  2LV3 A;  1F37 A;  4F2I A;  4YQU A;  2H1D A;  1AW9 A;  2FHE A;  1EV4 A;  3DXB A;  2AB6 A;  2K18 A;  4L5O A;  2C3Q A;  4KA0 A;  1U6T A;  4WXT A;  1O8W A;  4KDU A;  2GVP A;  3W8S A;  4XHM A;  3ME8 A;  4XS4 B;  3H4K A;  2VCW A;  2H70 A;  3QFB C;  2VCZ A;  3KTB A;  1LJR A;  5JCG A;  1A23 A;  4JE1 A;  4YAV A;  1S3D A;  2H66 A;  4N10 A;  17GS A;  2P5Q A;  3QFA C;  1N8J A;  4WR4 A;  1K0M A;  3GKX A;  5IMD A;  10GS A;  5GAN D;  1EP8 A;  5ECM B;  5IM9 A;  4HOJ A;  3IK7 A;  4K7O A;  4HZ2 A;  1A2L A;  3I9V 2;  3FW2 A;  1UC7 A;  5HFI A;  3ZFL A;  1B8X A;  4L0U A;  2REM A;  1U3I A;  1THX A;  1TU7 A;  2JSY A;  4V2N A;  2OE3 A;  2GT6 A;  1XOA A;  4CW9 A;  4EKZ A;  5D9T A;  2HRA A;  1EOH A;  1JZD A;  1NW2 A;  2YWM A;  2B3S A;  2ZNM A;  3GA4 A;  1O8X A;  2J23 A;  2HRF A;  3A2X A;  4MMM A;  5FWG A;  5G31 A;  5KN2 A;  4PQ1 A;  3EU3 A;  1SJI A;  2A2R A;  1V58 A;  1URM A;  1TK5 B;  2HSM B;  2H73 A;  1AC1 A;  1YF1 A;  1S3A A;  1GLP A;  2FA4 A;  2P0G A;  5FHI A;  1O81 A;  1Q4J A;  1GRX A;  2LRN A;  4FYB A;  2VCQ A;  1OYJ A;  4G0L A;  2LJR A;  2DC5 A;  1PD2 1;  3TOU A;  4PQI A;  3LJR A;  2QC7 A;  1Z7P A;  4GF0 A;  1SU9 A;  3H1N A;  2YV9 A;  3GL5 A;  3C8E A;  1ZOF A;  3TCO A;  5JWR B;  5C04 A;  4TOP A;  3QDN A;  4X0X A;  5ECS A;  3BCI A;  5EY6 A;  4O92 A;  3QAW A;  4MLY A;  1XWA A;  4ML6 A;  3I6A A;  1GUK A;  2HYX A;  2VD1 A;  1HQO A;  4GQF A;  1GSU A;  4RQR A;  4XTS A;  3LYK A;  2KLX A;  3VWV A;  3LWA A;  2OE0 A;  4ECB A;  3F9U A;  1KEB A;  1M9A A;  4MPG A;  2M72 A;  2R3X A;  4L8E A;  2KHP A;  2E0Q A;  1EV9 A;  2H6Y A;  1MDI A;  4PUR A;  2NVL A;  3WGD A;  5JWO B;  2DBC A;  4BVX B;  3NIV A;  2GZZ A;  1J0F A;  2P31 A;  2AJQ B;  3KP9 A;  5IMC A;  5GZZ B;  1RQM A;  4QQ7 A;  5D9W A;  1ILO A;  2YJH A;  1GTB A;  2A4V A;  2VL2 A;  3NOF A;  2R4V A;  1M0U A;  5AIS A;  4GQC A;  2O7K A;  4IP6 A;  2KOK A;  4ZBB A;  2JAD A;  4J56 E;  3GIX A;  3P90 A;  3RBT A;  5DDL A;  1NHO A;  2JL4 A;  4TXO A;  3TKS A;  1KTE A;  2F8F A;  2BMX A;  2KP1 A;  1BQ7 A;  1LBK A;  4TVE A;  4BVY B;  3ZIT A;  2JSZ A;  4HS1 A;  5F0G A;  1Z5Y E;  2OE1 A;  3HZ8 A;  2PMT A;  4F9Z A;  4AJ6 A;  3VI7 A;  1SYX A;  3FEU A;  4ILF A;  2AUV A;  1JZR A;  4FYC A;  3LSZ A;  4ZBA A;  1O6J A;  3PIN A;  4X43 A;  4MJE A;  4XS6 A;  4K8M A;  1K3O A;  3ZIV A;  5IMF A;  2O8V B;  4TN8 A;  3Q6O A;  5EL8 A;  5B8B A;  3EUR A;  1KNG A;  1THO A;  2LNS A;  3GFK A;  1GSD A;  2B5X A;  1M2A A;  4I8B A;  5ECN B;  3P7X A;  2OBI A;  4BL7 B;  3C1R A;  1R26 A;  4QL9 A;  5L71 A;  3L4N A;  1PN9 A;  2IFQ A;  1SL2 B;  2FCH A;  1SL1 B;  3UEM A;  3LOR A;  1N2A A;  4RQX A;  4D73 A;  2OAD A;  1GSE A;  1TI1 A;  3HHV A;  6GSW A;  2IMF A;  5CRE A;  14GS A;  5E59 A;  5A4V A;  1WWJ A;  2XPE A;  2FWH A;  4POM A;  3FR9 A;  3W8J A;  11GS A;  4ZXG A;  1ZMA A;  2K8V A;  4K1F A;  2X64 A;  2PN8 A;  1WOU A;  4J57 E;  4IP1 A;  2ON7 A;  2PBJ A;  4AGS A;  3ZVJ A;  3KM6 A;  2HZF A;  3ZRE A;  3TKP A;  1F9M A;  1PKZ A;  2DJ1 A;  4ULX A;  1ZYE A;  1TRV A;  2XBI A;  1K0A A;  2B5E A;  2C0G A;  5J4U A;  1TDI A;  4PQH A;  5ELA A;  3WT1 A;  4KUN A;  2PPT A;  1V98 A;  1Z6M A;  2B1K A;  1OC9 B;  3VWU A;  4G0I A;  3CBU A;  4BPY A;  4ECI A;  2G2Q A;  4I97 A;  3M3M A;  4IBP A;  4V2L A;  2FWF A;  2P5R A;  3K8N A;  2LUS A;  1HNB A;  1JZO A;  1K0O A;  5AGY A;  2DJ2 A;  2O87 A;  3HXS A;  1WE0 A;  1U87 A;  2FWE A;  4OMV A;  4GCI A;  2AYT A;  4V2M A;  3TRP A;  4LL4 B;  3HD5 A;  3QD9 A;  3ZFB A;  1H4O A;  3GX0 A;  1TXX A;  1O85 A;  1M7T A;  4HQZ A;  3C1S A;  1AAZ A;  2CA8 A;  3BCK A;  2V6O A;  2GSS A;  4XCS A;  2HSY A;  2PUK C;  3EYT A;  2N5A A;  2YV7 A;  2VUP A;  1GTA A;  4TXV A;  2R2J A;  3FHK A;  1SK1 A;  3J7Y b;  3CMI A;  2MBT A;  1X5E A;  3DWV A;  2ES7 A;  2CAQ A;  1I9D A;  5JCW A;  1MDK A;  4MH2 A;  4JRR A;  4TR3 A;  4YAP A;  3EVI A;  3IOS A;  3HCZ A;  3F3Q A;  4ZL8 A;  5D96 A;  1X5C A;  3UVH A;  4NXI A;  2YN1 A;  5HR3 A;  1GNE A;  3AY8 A;  3DVX A;  3FK8 A;  2RM6 A;  1B4Q A;  4IGJ A;  5ECI B;  3VWX A;  18GS A;  2O89 A;  3CSI A;  4GXZ A;  3UJ1 A;  4EDZ A;  3QAV A;  1A2M A;  1Q98 A;  5CO3 A;  1TP9 A;  1C72 A;  2C1Y A;  1ABA A;  5F05 A;  3H8Q A;  4DSS A;  4F0B A;  3F8U A;  4O5R A;  1SKS B;  1T8E B;  2GQK A;  1X9W B;  1QK8 A;  5DCH A;  2H8L A;  1K0C A;  1T7P B;  2K9F A;  4KAE A;  5DVB A;  2LRT A;  3IV4 A;  2VM2 A;  5B7C A;  4HJM A;  1PQN A;  3FRC A;  4EE0 A;  3VPT A;  1GUM A;  3QCP A;  2F8A A;  3M8N A;  3DRN A;  4AF2 A;  4OWY A;  3L9V A;  4YQV A;  2X8C A;  4HQS A;  2OBK A;  3HY2 A;  4OO4 A;  1A2J A;  3A5W A;  4JR4 A;  3FKF A;  3GKK A;  4MZB A;  4DSQ A;  5HFK A;  4USS A;  4G10 A;  2RUE A;  4POB A;  2TRC P;  4ZB8 A;  3FR6 A;  3Q74 A;  4WBR D;  3GNJ A;  2DIY A;  3CSJ A;  4HDE A;  4JU5 A;  1GWC A;  4K7I A;  1XZO A;  1YY7 A;  5DBQ A;  2L4Q A;  4XIH A;  1HYU A;  2DSA A;  2B1L A;  2BJX A;  4EO3 A;  5HR0 A;  1GSS A;  1M99 A;  2FUG 2;  2IJY A;  3US3 A;  2NPB A;  5AIV A;  1SKR B;  3FY7 A;  4CHS A;  3KEB A;  5DJL A;  2MMN A;  1DE1 A;  2HFD A;  2HRK B;  1Y6E A;  1PX7 A;  2KUC A;  2C3T A;  3KCM A;  1WP0 A;  2IMK A;  3GKN A;  1VRS D;  2D2Z A;  4WF4 A;  2Z9S A;  2JZS A;  1TTZ A;  4MF6 A;  5KN1 A;  1GSF A;  1XW6 A;  2WS2 A;  4N0Z A;  1ACV A;  4KX4 A;  3KH7 A;  4XRA A;  4Q5R A;  5ECP B;  1EGO A;  5J41 A;  3M9K A;  1A8L A;  5DAL B;  2FWG A;  1F2E A;  1Z7R A;  2HZE B;  1XWK A;  5IOX A;  3I69 A;  3GX8 A;  4WF5 A;  3ZML A;  2GST A;  1MTC A;  3UAR A;  19GS A;  4F0C A;  2WFC A;  6GSX A;  1MD4 A;  1TRW A;  1OC3 A;  4KSO A;  2FLS A;  3TUE A;  3UIW A;  2AAW A;  3TKQ A;  3Q19 A;  1K0D A;  4EF0 A;  2H01 A;  2YAN A;  3GTU B;  2NDO A;  2JU5 A;  2CT6 A;  2JZT A;  2L6C A;  2MMZ A;  3DIE A;  4DVC A;  5G5F A;  2ALB A;  1V9W A;  3L9S A;  3UBK A;  2V41 A;  5F8B A;  1A0R P;  3PH9 A;  1X5D A;  1GP1 A;  3VWW A;  1B48 A;  5DAK B;  2IMD A;  4EVM A;  1OKT A;  3M1G A;  4KE3 A;  3BOA A;  3TJK A;  5IOW A;  1PL1 A;  4PXO A;  2EIQ A;  5G2Z A;  3LEF A;  4TR4 A;  2FA8 A;  2H0I A;  5CRD A;  4KCE A;  4IQ1 A;  5DJM A;  4KSM A;  6GST A;  1TRU A;  4ECJ A;  2GQL A;  2C4J A;  4XRD A;  3DD3 A;  1HNC A;  2N5B A;  2B5Y A;  1FOV A;  3HA9 A;  2WGR A;  1U88 A;  3N5O A;  5ID2 B;  2GZP A;  2HSN B;  5A5K A;  2I81 A;  1AIU A;  3R2Q A;  2AV4 A;  3IE3 A;  5H5R A;  1NHY A;  3NZN A;  4BWS A;  4NMU A;  2H30 A;  3GRX A;  1IYH A;  4JR6 A;  3QOU A;  4IQA A;  2OA7 A;  1XIY A;  2YZH A;  3TOT A;  1XPV A;  1ST9 A;  1SD8 A;  1G6Y A;  3Q18 A;  3ERF A;  3DYR A;  3FZ4 A;  1YDK A;  3HJP A;  2MBS A;  1VF3 A;  3ZRD A;  1R5P A;  4YQM A;  3IA1 A;  3ZL5 A;  3ZLP A;  1TJD A;  4MJA A;  1HD2 A;  2OJL A;  5J5N A;  4NHZ A;  1WRY A;  1S3C A;  2ON5 A;  1SD9 A;  2L4C A;  4MK3 A;  2H6Z A;  3GHA A;  4I5Q A;  3CTF A;  2HI7 A;  3M9J A;  1WPI A;  3IC8 A;  2B6M A;  4BA7 A;  1BYE A;  3RHC A;  5IO2 A;  4OFT A;  3C7M A;  5F07 A;  1XCC A;  5HR2 A;  2EIR A;  4TR1 A;  3ME7 A;  2QKE A;  5LCZ A;  1JZW A;  3EWL A;  1UN2 A;  1YEP A;  3D5J A;  4MF7 A;  1XWG A;  3ZTL A;  3HYP A;  2IMI A;  1ZZY A;  1M2D A;  2E2M A;  2LS5 A;  3LG6 A;  1T4Y A;  3ZVJ D;  3HDC A;  4EL1 A;  5IMZ A;  2LTK A;  3IXR A;  2L5O A;  1KBN A;  4HZ4 A;  5D8I A;  1DSB A;  3GKM A;  2C0F A;  3EMX A;  5JCU A;  3CXG A;  3VLN A;  2M80 A;  3APO A;  2XPD A;  3BBY A;  3WT2 A;  4NWY A;  4N0V A;  1MEK A;  2LEG A;  5ECH B;  3LQ7 A;  1TKD B;  1ZCP A;  3GN3 A;  1EGR A;  1A24 A;  1FW1 A;  2HRN A;  1ERU A;  3TJB A;  5LNK e;  1GNW A;  3SBC A;  3ERG A;  2PWJ A;  2RII A;  1J08 A;  4Q5F A;  1G7O A;  4ZIL A;  1Z6N A;  1TU8 A;  1B9X C;  3UMA A;  4J2F A;  2A2S A;  2H1A A;  2HQT A;  4EUY A;  2VM1 A;  1K0N A;  2JZR A;  2GDR A;  1SL0 B;  1GL8 A;  4MH3 A;  1CQH A;  3A2V A;  2L59 A;  3EU4 A;  4N30 A;  5G5E A;  8GSS A;  1QQ2 A;  3HJO A;  5IPG A;  2VL2 C;  3LFL A;  1QXH A;  3G7J A;  2LJA A;  4LLR A;  3KD0 A;  3EE2 A;  9GSS A;  4ISD A;  2H72 A;  3TKS C;  4PX1 A;  6GSS A;  2N5F A;  5CRG A;  2CQ9 A;  1QFN A;  3FYG A;  4XS1 A;  4PNF A;  4OFM A;  5GAP D;  3FR3 A;  4TR0 A;  2GTU A;  2C3N A;  4K2D A;  3IHQ A;  3TDG A;  4RI6 A;  1XW9 A;  5CYY A;  2V2G A;  3UBL A;  5ECR B;  4DEJ A;  2WUL A;  2YWN A;  4TXO B;  4L5L A;  1JHB A;  5A4U A;  5CRH A;  4FIW A;  2HT9 A;  1WJK A;  1LU4 A;  4KF9 A;  3ZYW A;  16GS A;  2J9H A;  2DMM A;  4PUF C;  2X99 A;  5CRW A;  5D9V A;  4OCE A;  2V6K A;  5KN3 A;  2GSQ A;  3WGX A;  5D9X A;  1TK0 B;  2HNL A;  1EOG A;  1TRS A;  3HVS A;  2VLU A;  4POL A;  3W6G A;  4XS4 A;  5GSS A;  4GWR A;  2I9H A;  3PPU A;  3D0Z A;  2VL3 A;  1PA3 A;  4WBJ A;  4ZL7 A; 
#chains in the Genus database with same CATH topology
 3DKS A;  2B7J A;  4O7H A;  1FO5 A;  5ENU A;  4O32 A;  4POK A;  1G7E A;  2YWO A;  1XXU A;  4FXY P;  3UOM A;  5FT3 A;  4ECC A;  1T3B A;  2DJ3 A;  4WKW A;  1EP7 A;  1M3J A;  1DUG A;  4MF5 A;  4D73 B;  2XC2 A;  3A3T A;  4AKH A;  3IAS 2;  3IC4 A;  2YZU A;  1QMV A;  3QMX A;  3F0I A;  1E2Y A;  1UVZ A;  2R0G A;  5DQS A;  3PGT A;  3FZA A;  1WIK A;  4IHU A;  4LMW A;  1UA5 A;  1K3L A;  1BX9 A;  5GST A;  2H0G A;  3HKR A;  1O73 A;  2L6D A;  4G19 A;  5EPF A;  2NTO A;  2HSM A;  3GL3 A;  3CRT A;  1SJZ A;  3P2A A;  5CP1 A;  4H86 A;  1VF1 A;  5B8A A;  5J9C A;  4Q5N A;  2V32 A;  3MNG A;  4ZBD A;  1AQX A;  1XVQ A;  2DJ0 A;  4KW6 A;  1PFO A;  3F4R A;  2YCD A;  3A2W A;  2IL3 A;  3IBH A;  2RUF A;  2FY6 A;  3IR4 A;  1VGL A;  2VCX A;  1EZK A;  4JBB A;  5A5H B;  2OAC A;  2O85 A;  1DBY A;  1Z9H A;  2HXK A;  3G7Y A;  2LST A;  3VUR A;  1VF4 A;  3IHG A;  6GSY A;  3IK9 A;  2QGV A;  1GLQ A;  3D4T A;  1AUC A;  3S9F A;  2X49 A;  1H75 A;  4OD7 A;  1F3B A;  5COH A;  1GSQ A;  4GTU A;  3WYW A;  3QR6 A;  2GSR A;  5HFG A;  1XBS A;  4K2X A;  2CZ2 A;  1T00 A;  2RLI A;  2X4A A;  2YP6 A;  3D21 A;  1X9M B;  1GH2 A;  4BVX A;  3N9J A;  3CTG A;  5IMA A;  2V1M A;  2H74 A;  3WGE A;  2CV4 A;  1YKC A;  2TRX A;  4RUV A;  3D4M A;  2H76 A;  1XVW A;  3F63 A;  3MSZ A;  3CSH A;  1W4V A;  5BMU A;  4HU9 A;  3H79 A;  2LNT A;  2LJK A;  2WJU A;  4NV2 A;  4KB3 A;  2C0D A;  1K0B A;  20GS A;  2K8S A;  3L9U A;  5HQP A;  2DKI A;  5J3R A;  3TJJ A;  1A0F A;  3DEX A;  1O7U A;  4X1U A;  4HEA 2;  4OO5 A;  1B9Y C;  5B6M A;  3MDK A;  4ACS A;  4EDY A;  3CYN A;  6GSV A;  4BVY A;  3D22 A;  2NBS A;  5AN1 A;  3IRA A;  4ZB9 A;  1A8Y A;  2R0C A;  4N3Z A;  3WD6 A;  5DQY A;  4K9Z A;  1EEM A;  4GST A;  5J9B A;  3UL3 A;  2EIO A;  2GGT A;  4DSS B;  3I43 A;  2CZ3 A;  4ZL9 A;  2WZS A;  5G1K A;  1PGT A;  3KGK A;  3SWL A;  3U6V A;  4IVF A;  3ED3 A;  1G6W A;  22GS A;  4KH7 A;  2K6V A;  1YF0 A;  3VK9 A;  4ZB6 A;  5ECQ B;  4NV5 A;  3EC3 A;  4MZW A;  1FB6 A;  3FZ5 A;  1OC8 A;  2DKH A;  3TJF A;  4QL7 A;  5ECO B;  2WW2 A;  4HJ2 A;  2ZCT A;  2I3Y A;  1X0R A;  4BL7 A;  4HI7 A;  2MZC A;  1S3R A;  3HJM A;  2FNO A;  5C00 A;  5EVO A;  4KND A;  4CY6 A;  2HE3 A;  1FHE A;  5KN0 A;  4IW9 A;  4F82 A;  4QMK A;  3RFR C;  1GTU A;  2H71 A;  5ABR A;  4NAX A;  1SKW B;  3GUS A;  1XW5 A;  2RM5 A;  4WR5 A;  1T4Z A;  2JAC A;  1FB0 A;  5A34 B;  2BTO T;  3KMO A;  5KEJ A;  1PL2 A;  3CRU A;  3HVV A;  2XBQ A;  3MWH A;  1PKW A;  4L0W A;  2L57 A;  3GH9 A;  1BED A;  3IDV A;  1BF5 A;  4I2T A;  3ZZX A;  1ZGN A;  4TRX A;  4MJC A;  3LGC A;  4MA9 A;  4ID0 A;  1XOB A;  1MD3 A;  3IAM 2;  4NHW A;  5IIZ A;  4G0K A;  4JED A;  4MAB A;  1GUH A;  3F3R A;  4LA1 A;  4CY8 A;  2R37 A;  3A5I A;  4TW5 A;  5CAX A;  1J9B A;  3KP8 A;  3O3T A;  1RK4 A;  4Q5Q A;  4LMV A;  6GSU A;  4FYU A;  4ZIJ A;  1OC9 A;  3E3E A;  4IKH A;  5IQY A;  2GZY A;  4E68 A;  2YPM A;  7GSS A;  3RPN A;  2LKU A;  1BAY A;  5CNW A;  5E4W A;  4MCU A;  3G7I A;  3LYP A;  2CVK A;  2DIZ A;  3VFI A;  4HUA A;  3TKR A;  2H1B A;  3VPQ A;  1GTI A;  2R6K A;  4KDY A;  4I6X A;  4V1A p;  2GS3 A;  1F6M C;  3FZ9 A;  1M9B A;  2LQQ A;  2CVD A;  1YQ1 A;  4GSS A;  2WCI A;  4MJB A;  1XFL A;  5KOW A;  1XWC A;  4FO5 A;  3KMN A;  1FAA A;  1AQW A;  2VAF A;  2DJJ A;  3E0U A;  3VI5 A;  5H5S A;  2CVB A;  5H5Q A;  3C71 A;  5DCG A;  2VO4 A;  3KJY A;  1AQV A;  4MNN A;  1U3A A;  1EWX A;  1PRX A;  2EFH A;  4GSN A;  4MPF A;  2CX3 A;  3ISO A;  3APS A;  4AJ7 A;  2WDU A;  5J4V A;  1GSY A;  3F6D A;  2L5L A;  3RDW A;  1TI3 A;  4P3Y B;  1CQG A;  1E6B A;  2EC4 A;  1WMJ A;  5G1L A;  3TKS E;  3KTL A;  1USB A;  1BJX A;  4V1A g;  2WRT A;  3GV1 A;  5B6N A;  3TRQ A;  5ECL B;  2H1L A;  3DGQ A;  2C80 A;  2VIM A;  1R4W A;  4HU7 A;  1SK0 A;  2MMO A;  2WB9 A;  1SEN A;  4WEY A;  2X8H A;  5D93 A;  3JCM L;  3F4S A;  3TJG A;  1ERV A;  4E8E A;  4G2E A;  5IO0 A;  1ML6 A;  1PSQ A;  1GUL A;  2ZUP A;  1QUW A;  2E7P A;  3F4T A;  1Y25 A;  1K3Y A;  4NPB A;  13GS A;  1ZL9 A;  2YJ7 A;  4AJ8 A;  1JLW A;  4CDO A;  3GST A;  3EIN A;  2C8U A;  4F03 A;  2XHF A;  3GUR A;  1OVN A;  2YNX A;  4HSC X;  2R5G A;  2F3M A;  4KDX A;  5ELG A;  2M46 A;  1FVJ A;  2F9S A;  1V2A A;  3J7Y k;  1JFU A;  2C0E A;  2LRC A;  1OE7 A;  1Z3E A;  2CAI A;  3QAG A;  2B7K A;  3APQ A;  3UAP A;  5INY A;  2VOC A;  1TOF A;  4I2U A;  3BJ5 A;  3DVW A;  4EXJ A;  3LXZ A;  2QSI A;  3GYK A;  3QPM A;  4E8H A;  3RAZ A;  2X8G A;  2HSH A;  3TRX A;  3V1W A;  3HMJ G;  2F51 A;  1TK8 B;  3KXO A;  1T1V A;  5IMV A;  1FG4 A;  3ZMK A;  2PGT A;  4YKG A;  1DE2 A;  1ERT A;  5D73 A;  1ON4 A;  5F06 A;  2MMA A;  2H19 A;  3BD2 A;  4ML1 A;  2HLS A;  3D6I A;  4PTS A;  5LD0 A;  1PMT A;  3DML A;  3HZ4 A;  3GSS A;  3UVT A;  1MDJ A;  3G9B A;  2I1U A;  1XWB A;  4TR1 B;  5HR1 A;  1R5A A;  2EFC A;  1B4P A;  4IN0 A;  4EIQ A;  4JZQ A;  3L0H A;  4PNG A;  3U5R E;  5A4W A;  2H0H A;  2IN3 A;  3F6F A;  2WZ9 A;  2WVY A;  4KCA A;  3TB2 A;  2YWI A;  4DSR A;  2HRK A;  2WVX A;  4FQU A;  3TGZ A;  2IIY A;  2GQM A;  3LW9 A;  1ZYQ B;  2VLT A;  4K6X A;  1AXD A;  2DML A;  1FVK A;  2FD3 A;  1YEX A;  2IPA A;  1W89 A;  1OKD A;  2IWT A;  2VLV A;  3H93 A;  4PGT A;  4Z7X A;  1BG5 A;  1EEJ A;  3GH6 A;  4EC0 A;  1X9S B;  2UZ8 A;  2MYG A;  3KIJ A;  3ZIJ A;  3P8W A;  4GRF A;  5DAL A;  2IFQ B;  3EMP A;  4MP4 A;  4TKY A;  2HZE A;  4BWQ A;  2E2G A;  5ECK B;  4FH8 A;  1TXU A;  3KH9 A;  2PER A;  5AIX A;  3OR5 A;  1V57 A;  2VL9 A;  2PVO C;  4A5P A;  1HNA A;  3L78 A;  3RPP A;  1SK2 A;  2PU9 C;  2A2P A;  1IYI A;  3O76 A;  4OCF A;  1QGV A;  1R7H A;  4IS0 A;  2VCT A;  5G30 A;  2H1G A;  4IJ3 A;  3PR8 A;  4ZB7 A;  3IPZ A;  3MAK A;  3HVX A;  1ERW A;  1V40 A;  1OAZ A;  3GTU A;  1PX6 A;  4G01 A;  2GT5 A;  4IEL A;  1RW1 A;  2DLX A;  4GLT A;  5JWQ B;  2YOI A;  3LXT A;  2OKA A;  3GMF A;  1G0T A;  4K0N A;  4IJI A;  3ERW A;  4K0G A;  2PVQ A;  1YZX A;  3E9J B;  1TW9 A;  1I5G A;  5DAK A;  2QA1 A;  3MYD A;  1VF2 A;  2LQO A;  1YKA A;  4G9H A;  2FGX A;  2G0F A;  2CX4 A;  1SJ6 A;  2KP2 A;  2GLR A;  1YJ6 A;  4WET A;  3RHB A;  4K7N A;  1NM3 A;  3O6T A;  1F3A A;  1M2B A;  1SYR A;  1NSW A;  2IME A;  3M0F A;  5KOX A;  2H6X A;  4YH2 A;  2I4A A;  4N11 A;  4MZC A;  2TIR A;  2DJK A;  1OE8 A;  12GS A;  4RI7 A;  2VCV A;  4LL1 B;  3C73 A;  3R3E A;  2H75 A;  3KZQ A;  4PUA A;  4KGI A;  5ID2 A;  2HSN A;  2VD0 A;  4MDC A;  2AHE A;  1JLV A;  5IPH A;  4OFN A;  2LV3 A;  1F37 A;  4F2I A;  4YQU A;  2H1D A;  1AW9 A;  2WVZ A;  2FHE A;  1EV4 A;  3DXB A;  2AB6 A;  2K18 A;  4L5O A;  2C3Q A;  4KA0 A;  1U6T A;  4WXT A;  1O8W A;  4KDU A;  2GVP A;  3W8S A;  4XHM A;  3ME8 A;  4XS4 B;  3H4K A;  2VCW A;  2H70 A;  3QFB C;  2VCZ A;  3KTB A;  1LJR A;  1YEW C;  5JCG A;  1A23 A;  4JE1 A;  4YAV A;  1S3D A;  2H66 A;  4N10 A;  17GS A;  2P5Q A;  3QFA C;  1N8J A;  4WR4 A;  1K0M A;  3GKX A;  5IMD A;  4K5R A;  10GS A;  5GAN D;  1EP8 A;  5ECM B;  5IM9 A;  2O36 A;  4HOJ A;  3IK7 A;  4K7O A;  4HZ2 A;  1A2L A;  3I9V 2;  3FW2 A;  1UC7 A;  5HFI A;  3ZFL A;  1B8X A;  4L0U A;  2REM A;  1U3I A;  1THX A;  1TU7 A;  2JSY A;  4V2N A;  2OE3 A;  1SVM A;  5J47 A;  2GT6 A;  1XOA A;  4CW9 A;  4EKZ A;  5D9T A;  2HRA A;  1EOH A;  1JZD A;  1NW2 A;  2YWM A;  2B3S A;  2ZNM A;  3GA4 A;  1O8X A;  2J23 A;  2HRF A;  3A2X A;  4MMM A;  5FWG A;  5G31 A;  5KN2 A;  4PQ1 A;  3EU3 A;  1SJI A;  2A2R A;  1V58 A;  1URM A;  1TK5 B;  2HSM B;  2H73 A;  1AC1 A;  1YF1 A;  1S3A A;  1GLP A;  2FA4 A;  2P0G A;  5FHI A;  1N25 A;  1O81 A;  1Q4J A;  1GRX A;  2LRN A;  4FYB A;  2VCQ A;  1OYJ A;  4G0L A;  2LJR A;  2DC5 A;  1PD2 1;  3TOU A;  4PQI A;  3FMW A;  3LJR A;  2QC7 A;  1Z7P A;  4GF0 A;  1SU9 A;  3H1N A;  2YV9 A;  3GL5 A;  3C8E A;  1ZOF A;  3TCO A;  5JWR B;  5C04 A;  4TOP A;  3QDN A;  4X0X A;  5ECS A;  3BCI A;  5EY6 A;  4O92 A;  3QAW A;  4MLY A;  1XWA A;  4ML6 A;  3I6A A;  1GUK A;  2HYX A;  2VD1 A;  1HQO A;  4GQF A;  1GSU A;  4RQR A;  4XTS A;  3LYK A;  2KLX A;  3VWV A;  3LWA A;  2OE0 A;  4ECB A;  1ZYP A;  3F9U A;  1KEB A;  1M9A A;  4MPG A;  2M72 A;  2R3X A;  4L8E A;  2KHP A;  2E0Q A;  1EV9 A;  2H6Y A;  1MDI A;  4PUR A;  2NVL A;  3WGD A;  5JWO B;  2DBC A;  4BVX B;  3NIV A;  2O5V A;  2GZZ A;  1J0F A;  2P31 A;  2AJQ B;  3KP9 A;  5IMC A;  5GZZ B;  1RQM A;  4QQ7 A;  5D9W A;  1ILO A;  1GTB A;  2A4V A;  2YJH A;  2VL2 A;  3NOF A;  2R4V A;  1M0U A;  5AIS A;  5BMU B;  4GQC A;  2O7K A;  4IP6 A;  2KOK A;  4ZBB A;  2JAD A;  4J56 E;  3GIX A;  3P90 A;  3RBT A;  5DDL A;  1NHO A;  2JL4 A;  4TXO A;  3TKS A;  1KTE A;  3HVN A;  2F8F A;  2BMX A;  2KP1 A;  1BQ7 A;  1LBK A;  4TVE A;  4BVY B;  3ZIT A;  2JSZ A;  4HS1 A;  5F0G A;  1Z5Y E;  2OE1 A;  3HZ8 A;  2PMT A;  4F9Z A;  4AJ6 A;  3VI7 A;  1SYX A;  3FEU A;  4ILF A;  2AUV A;  1JZR A;  4FYC A;  1PN0 A;  3LSZ A;  4ZBA A;  1O6J A;  5A1N A;  4Z2U A;  3PIN A;  4X43 A;  4MJE A;  4XS6 A;  4K8M A;  1K3O A;  3ZIV A;  5IMF A;  2O8V B;  4BIK A;  4TN8 A;  3Q6O A;  5EL8 A;  5B8B A;  3EUR A;  1KNG A;  1THO A;  2LNS A;  3GFK A;  1GSD A;  2B5X A;  1M2A A;  4I8B A;  5ECN B;  3P7X A;  2OBI A;  3C1R A;  4BL7 B;  1BG1 A;  1R26 A;  4QL9 A;  5L71 A;  3L4N A;  1PN9 A;  2IFQ A;  1SL2 B;  2FCH A;  1SL1 B;  3UEM A;  3LOR A;  1N2A A;  4RQX A;  4D73 A;  2OAD A;  1GSE A;  1TI1 A;  3HHV A;  6GSW A;  2IMF A;  4O5Q A;  5CRE A;  14GS A;  5E59 A;  5A4V A;  3CQF A;  1WWJ A;  1S4B P;  2XPE A;  2FWH A;  4POM A;  3FR9 A;  3W8J A;  11GS A;  4ZXG A;  1ZMA A;  2K8V A;  4K1F A;  2X64 A;  2PN8 A;  1WOU A;  4J57 E;  4IP1 A;  2ON7 A;  2PBJ A;  4AGS A;  3ZVJ A;  3KM6 A;  2HZF A;  3ZRE A;  3TKP A;  1F9M A;  1PKZ A;  2DJ1 A;  4ULX A;  1ZYE A;  1TRV A;  2XBI A;  1K0A A;  2B5E A;  2C0G A;  5J4U A;  1TDI A;  4PQH A;  5ELA A;  3WT1 A;  4KUN A;  2PPT A;  1V98 A;  1Z6M A;  2B1K A;  1OC9 B;  3VWU A;  4G0I A;  3CBU A;  4BPY A;  4ECI A;  2G2Q A;  4I97 A;  3M3M A;  4IBP A;  4V2L A;  2FWF A;  2P5R A;  3K8N A;  2LUS A;  2EFE A;  1HNB A;  1JZO A;  1K0O A;  5AGY A;  5A5H A;  2DJ2 A;  2O87 A;  3HXS A;  1WE0 A;  1U87 A;  2FWE A;  4OMV A;  4GCI A;  2AYT A;  4V2M A;  3TRP A;  4LL4 B;  3HD5 A;  3QD9 A;  2UV8 G;  3ZFB A;  1H4O A;  3GX0 A;  1TXX A;  1O85 A;  1M7T A;  4HQZ A;  3C1S A;  1AAZ A;  2CA8 A;  3BCK A;  2V6O A;  2GSS A;  4XCS A;  2HSY A;  2PUK C;  3EYT A;  2N5A A;  2YV7 A;  2VUP A;  1GTA A;  4TXV A;  2R2J A;  3FHK A;  1SK1 A;  3J7Y b;  3CMI A;  2OT3 A;  2MBT A;  1X5E A;  3DWV A;  2ES7 A;  4PI0 C;  2CAQ A;  1I9D A;  5JCW A;  1MDK A;  4MH2 A;  4JRR A;  4TR3 A;  4YAP A;  3EVI A;  3IOS A;  3HCZ A;  3F3Q A;  4ZL8 A;  5D96 A;  1SVL A;  1X5C A;  3UVH A;  4NXI A;  2YN1 A;  5HR3 A;  1GNE A;  3AY8 A;  3DVX A;  3FK8 A;  1FOH A;  2RM6 A;  4YKF A;  1B4Q A;  4IGJ A;  5ECI B;  3VWX A;  18GS A;  2O89 A;  3CSI A;  4GXZ A;  3UJ1 A;  3EPT A;  4EDZ A;  3QAV A;  1A2M A;  1Q98 A;  5CO3 A;  1TP9 A;  1C72 A;  2C1Y A;  1ABA A;  5F05 A;  3H8Q A;  4DSS A;  4F0B A;  3F8U A;  4O5R A;  1SKS B;  1T8E B;  2GQK A;  1X9W B;  1QK8 A;  5DCH A;  2H8L A;  1K0C A;  1T7P B;  2K9F A;  4KAE A;  5DVB A;  2LRT A;  3IV4 A;  2VM2 A;  5B7C A;  4HJM A;  2A4H A;  1PQN A;  3FRC A;  3MIX A;  4EE0 A;  3VPT A;  1GUM A;  3QCP A;  2F8A A;  3M8N A;  3DRN A;  4AF2 A;  4OWY A;  3L9V A;  4YQV A;  2X8C A;  4HQS A;  2OBK A;  3HY2 A;  4OO4 A;  1A2J A;  3A5W A;  4JR4 A;  3FKF A;  3GKK A;  4MZB A;  4DSQ A;  5HFK A;  4USS A;  4G10 A;  2RUE A;  4POB A;  2TRC P;  4ZB8 A;  3FR6 A;  3Q74 A;  4WBR D;  3GNJ A;  2WW0 A;  2DIY A;  3CSJ A;  4HDE A;  4JU5 A;  1GWC A;  4K7I A;  1XZO A;  5A34 A;  1YY7 A;  5DBQ A;  2L4Q A;  4XIH A;  1HYU A;  2DSA A;  2B1L A;  2BJX A;  4EO3 A;  5HR0 A;  1GSS A;  1M99 A;  2FUG 2;  2IJY A;  3US3 A;  2NPB A;  5AIV A;  1SKR B;  3FY7 A;  4CHS A;  3KEB A;  5DJL A;  2MMN A;  1DE1 A;  2HFD A;  2HRK B;  1Y6E A;  1PX7 A;  2WVX B;  2KUC A;  2C3T A;  3KCM A;  4PI2 C;  1WP0 A;  2IMK A;  3GKN A;  1I1I P;  1VRS D;  2D2Z A;  4WF4 A;  2Z9S A;  2JZS A;  1TTZ A;  4MF6 A;  5KN1 A;  1XG8 A;  1GSF A;  1XW6 A;  2WS2 A;  4N0Z A;  1ACV A;  4KX4 A;  3KH7 A;  4XRA A;  4Q5R A;  5ECP B;  1Y1U A;  1EGO A;  2WW1 A;  5J41 A;  3M9K A;  1A8L A;  5DAL B;  2FWG A;  1F2E A;  1Z7R A;  2HZE B;  1XWK A;  3CWG A;  5IOX A;  3I69 A;  3GX8 A;  4WF5 A;  3ZML A;  2GST A;  1MTC A;  3UAR A;  19GS A;  4F0C A;  5J40 A;  2WFC A;  6GSX A;  2O3E A;  1MD4 A;  1TRW A;  1OC3 A;  4KSO A;  2FLS A;  3TUE A;  3UIW A;  2AAW A;  3TKQ A;  3Q19 A;  1K0D A;  4EF0 A;  2H01 A;  2YAN A;  3GTU B;  2NDO A;  2JU5 A;  2CT6 A;  2JZT A;  2L6C A;  2MMZ A;  3DIE A;  3CHX C;  4DVC A;  5G5F A;  2ALB A;  1V9W A;  3L9S A;  3UBK A;  2V41 A;  5F8B A;  1A0R P;  3PH9 A;  2WW3 A;  1X5D A;  1GP1 A;  3VWW A;  1B48 A;  5DAK B;  2IMD A;  4EVM A;  1OKT A;  3M1G A;  4KE3 A;  3BOA A;  3TJK A;  5IOW A;  1PL1 A;  4PXO A;  3RGB C;  2EIQ A;  5G2Z A;  3LEF A;  4PHZ C;  4TR4 A;  2FA8 A;  2H0I A;  5CRD A;  4KCE A;  4IQ1 A;  5DJM A;  4KSM A;  6GST A;  1TRU A;  4ECJ A;  2GQL A;  4GDF A;  2C4J A;  4XRD A;  3DD3 A;  1HNC A;  2N5B A;  2B5Y A;  1FOV A;  3HA9 A;  2WGR A;  1U88 A;  3N5O A;  5ID2 B;  2GZP A;  4AKG A;  2HSN B;  5A5K A;  2I81 A;  1AIU A;  3R2Q A;  2AV4 A;  3IE3 A;  5H5R A;  1NHY A;  3NZN A;  4X4J A;  4BWS A;  4NMU A;  2H30 A;  3GRX A;  1IYH A;  4JR6 A;  3QOU A;  4IQA A;  2OA7 A;  1XIY A;  2YZH A;  3TOT A;  1XPV A;  4K5S A;  1ST9 A;  1SD8 A;  1G6Y A;  3Q18 A;  3ERF A;  3DYR A;  3FZ4 A;  1YDK A;  3HJP A;  2MBS A;  1VF3 A;  3ZRD A;  1R5P A;  4YQM A;  4AKI A;  3IA1 A;  3ZL5 A;  3ZLP A;  1TJD A;  4MJA A;  1HD2 A;  2OJL A;  4Z2R A;  5J5N A;  4NHZ A;  1WRY A;  1S3C A;  2ON5 A;  1SD9 A;  2L4C A;  4MK3 A;  2H6Z A;  3GHA A;  4I5Q A;  3CTF A;  2HI7 A;  3M9J A;  1WPI A;  3IC8 A;  2B6M A;  4BA7 A;  1BYE A;  3RHC A;  5IO2 A;  4OFT A;  4ICY A;  3C7M A;  5F07 A;  1XCC A;  5HR2 A;  2EIR A;  4TR1 A;  3ME7 A;  4W66 A;  2QKE A;  5LCZ A;  1JZW A;  3EWL A;  1UN2 A;  1YEP A;  3D5J A;  4MF7 A;  1XWG A;  3ZTL A;  3HYP A;  2IMI A;  1ZZY A;  1M2D A;  2E2M A;  2LS5 A;  3LG6 A;  1SVO A;  5J4Y A;  1T4Y A;  3ZVJ D;  3HDC A;  4EL1 A;  5IMZ A;  2LTK A;  3IXR A;  2L5O A;  1KBN A;  4HZ4 A;  5D8I A;  1DSB A;  3GKM A;  2C0F A;  3EMX A;  5JCU A;  3CXG A;  3VLN A;  2M80 A;  3APO A;  2XPD A;  3BBY A;  3WT2 A;  4NWY A;  4N0V A;  1MEK A;  2LEG A;  5ECH B;  3LQ7 A;  1TKD B;  1ZCP A;  3GN3 A;  1EGR A;  1A24 A;  1FW1 A;  2HRN A;  1ERU A;  3TJB A;  5LNK e;  1GNW A;  3SBC A;  3ERG A;  2PWJ A;  2RII A;  1J08 A;  4Q5F A;  1G7O A;  4ZIL A;  1Z6N A;  1TU8 A;  1B9X C;  3UMA A;  4J2F A;  2A2S A;  2H1A A;  2HQT A;  4EUY A;  2VM1 A;  1K0N A;  2JZR A;  2GDR A;  1SL0 B;  1GL8 A;  4MH3 A;  1CQH A;  3A2V A;  2L59 A;  3EU4 A;  4N30 A;  5G5E A;  8GSS A;  1QQ2 A;  3HJO A;  5IPG A;  2VL2 C;  3LFL A;  1QXH A;  3G7J A;  2LJA A;  4LLR A;  1ZYN A;  3KD0 A;  3EE2 A;  9GSS A;  4ISD A;  2R0P A;  2H72 A;  3TKS C;  4PX1 A;  6GSS A;  2N5F A;  1M3I A;  5CRG A;  2CQ9 A;  1QFN A;  3FYG A;  4XS1 A;  2QA2 A;  4PNF A;  4OFM A;  5GAP D;  3FR3 A;  4TR0 A;  2GTU A;  2C3N A;  4K2D A;  3IHQ A;  3TDG A;  4RI6 A;  1XW9 A;  5CYY A;  2V2G A;  3UBL A;  5ECR B;  4DEJ A;  2WUL A;  2YWN A;  4TXO B;  1YVL A;  4Z2T A;  3TU3 B;  4L5L A;  1JHB A;  5BRT A;  5A4U A;  5CRH A;  4FIW A;  2HT9 A;  1WJK A;  1LU4 A;  4KF9 A;  3ZYW A;  16GS A;  2J9H A;  4AI6 A;  2DMM A;  4PUF C;  4O5U A;  2X99 A;  5CRW A;  4AKX B;  5D9V A;  4OCE A;  2V6K A;  5KN3 A;  2GSQ A;  3WGX A;  5D9X A;  1TK0 B;  4EIP A;  2HNL A;  1EOG A;  1TRS A;  5A1N B;  3HVS A;  2VLU A;  2VKZ G;  4POL A;  3W6G A;  2EFD A;  4XS4 A;  5GSS A;  4GWR A;  2I9H A;  3PPU A;  3D0Z A;  2VL3 A;  1PA3 A;  4WBJ A;  4ZL7 A; 
#chains in the Genus database with same CATH homology
 3DKS A;  2B7J A;  4O7H A;  1FO5 A;  5ENU A;  4O32 A;  4POK A;  1G7E A;  2YWO A;  1XXU A;  3UOM A;  5FT3 A;  4ECC A;  1T3B A;  2DJ3 A;  4WKW A;  1EP7 A;  1DUG A;  4MF5 A;  4D73 B;  2XC2 A;  3A3T A;  4AKH A;  3IAS 2;  3IC4 A;  2YZU A;  1QMV A;  3QMX A;  3F0I A;  1E2Y A;  1UVZ A;  2R0G A;  5DQS A;  3PGT A;  3FZA A;  1WIK A;  4IHU A;  4LMW A;  1UA5 A;  1K3L A;  1BX9 A;  5GST A;  2H0G A;  3HKR A;  1O73 A;  2L6D A;  4G19 A;  5EPF A;  2NTO A;  2HSM A;  3GL3 A;  3CRT A;  1SJZ A;  3P2A A;  5CP1 A;  4H86 A;  1VF1 A;  5B8A A;  5J9C A;  4Q5N A;  2V32 A;  3MNG A;  4ZBD A;  1AQX A;  1XVQ A;  2DJ0 A;  4KW6 A;  3F4R A;  2YCD A;  3A2W A;  2IL3 A;  3IBH A;  2RUF A;  2FY6 A;  3IR4 A;  1VGL A;  2VCX A;  1EZK A;  4JBB A;  5A5H B;  2OAC A;  2O85 A;  1DBY A;  1Z9H A;  2HXK A;  3G7Y A;  2LST A;  3VUR A;  1VF4 A;  3IHG A;  6GSY A;  3IK9 A;  2QGV A;  1GLQ A;  3D4T A;  1AUC A;  3S9F A;  2X49 A;  1H75 A;  4OD7 A;  1F3B A;  5COH A;  1GSQ A;  4GTU A;  3WYW A;  3QR6 A;  2GSR A;  5HFG A;  1XBS A;  4K2X A;  2CZ2 A;  1T00 A;  2RLI A;  2X4A A;  2YP6 A;  3D21 A;  1X9M B;  1GH2 A;  4BVX A;  3N9J A;  3CTG A;  5IMA A;  2V1M A;  2H74 A;  3WGE A;  2CV4 A;  1YKC A;  2TRX A;  4RUV A;  3D4M A;  2H76 A;  1XVW A;  3F63 A;  3MSZ A;  3CSH A;  1W4V A;  5BMU A;  4HU9 A;  3H79 A;  2LNT A;  2LJK A;  2WJU A;  4NV2 A;  4KB3 A;  2C0D A;  1K0B A;  20GS A;  2K8S A;  3L9U A;  5HQP A;  2DKI A;  5J3R A;  3TJJ A;  1A0F A;  3DEX A;  1O7U A;  4X1U A;  4HEA 2;  4OO5 A;  1B9Y C;  5B6M A;  3MDK A;  4ACS A;  4EDY A;  3CYN A;  6GSV A;  4BVY A;  3D22 A;  2NBS A;  5AN1 A;  3IRA A;  4ZB9 A;  1A8Y A;  2R0C A;  4N3Z A;  3WD6 A;  5DQY A;  4K9Z A;  1EEM A;  4GST A;  5J9B A;  3UL3 A;  2EIO A;  2GGT A;  4DSS B;  3I43 A;  2CZ3 A;  4ZL9 A;  5G1K A;  1PGT A;  3KGK A;  3SWL A;  3U6V A;  4IVF A;  3ED3 A;  1G6W A;  22GS A;  4KH7 A;  2K6V A;  1YF0 A;  3VK9 A;  4ZB6 A;  5ECQ B;  4NV5 A;  3EC3 A;  4MZW A;  1FB6 A;  3FZ5 A;  1OC8 A;  2DKH A;  3TJF A;  4QL7 A;  5ECO B;  4HJ2 A;  2ZCT A;  2I3Y A;  1X0R A;  4BL7 A;  4HI7 A;  2MZC A;  3HJM A;  2FNO A;  5C00 A;  5EVO A;  4KND A;  4CY6 A;  2HE3 A;  1FHE A;  5KN0 A;  4IW9 A;  4F82 A;  4QMK A;  1GTU A;  2H71 A;  5ABR A;  4NAX A;  1SKW B;  3GUS A;  1XW5 A;  2RM5 A;  4WR5 A;  1T4Z A;  2JAC A;  1FB0 A;  5A34 B;  2BTO T;  3KMO A;  5KEJ A;  1PL2 A;  3CRU A;  3HVV A;  2XBQ A;  3MWH A;  1PKW A;  4L0W A;  2L57 A;  3GH9 A;  1BED A;  3IDV A;  1BF5 A;  4I2T A;  3ZZX A;  1ZGN A;  4TRX A;  4MJC A;  3LGC A;  4MA9 A;  4ID0 A;  1XOB A;  1MD3 A;  3IAM 2;  4NHW A;  5IIZ A;  4G0K A;  4JED A;  4MAB A;  1GUH A;  3F3R A;  4LA1 A;  4CY8 A;  2R37 A;  3A5I A;  4TW5 A;  5CAX A;  1J9B A;  3KP8 A;  3O3T A;  1RK4 A;  4Q5Q A;  4LMV A;  6GSU A;  4FYU A;  4ZIJ A;  1OC9 A;  3E3E A;  4IKH A;  5IQY A;  2GZY A;  4E68 A;  2YPM A;  7GSS A;  3RPN A;  2LKU A;  1BAY A;  5CNW A;  5E4W A;  4MCU A;  3G7I A;  3LYP A;  2CVK A;  2DIZ A;  3VFI A;  4HUA A;  3TKR A;  2H1B A;  3VPQ A;  1GTI A;  2R6K A;  4KDY A;  4I6X A;  4V1A p;  2GS3 A;  1F6M C;  3FZ9 A;  1M9B A;  2LQQ A;  2CVD A;  1YQ1 A;  4GSS A;  2WCI A;  4MJB A;  1XFL A;  5KOW A;  1XWC A;  4FO5 A;  3KMN A;  1FAA A;  1AQW A;  2VAF A;  2DJJ A;  3E0U A;  3VI5 A;  5H5S A;  2CVB A;  5H5Q A;  3C71 A;  5DCG A;  2VO4 A;  3KJY A;  1AQV A;  4MNN A;  1U3A A;  1EWX A;  1PRX A;  2EFH A;  4GSN A;  4MPF A;  2CX3 A;  3ISO A;  3APS A;  4AJ7 A;  2WDU A;  5J4V A;  1GSY A;  3F6D A;  2L5L A;  3RDW A;  1TI3 A;  4P3Y B;  1CQG A;  1E6B A;  2EC4 A;  1WMJ A;  5G1L A;  3TKS E;  3KTL A;  1USB A;  1BJX A;  4V1A g;  2WRT A;  3GV1 A;  5B6N A;  3TRQ A;  5ECL B;  2H1L A;  3DGQ A;  2C80 A;  2VIM A;  1R4W A;  4HU7 A;  1SK0 A;  2MMO A;  2WB9 A;  1SEN A;  4WEY A;  2X8H A;  5D93 A;  3JCM L;  3F4S A;  3TJG A;  1ERV A;  4E8E A;  4G2E A;  5IO0 A;  1ML6 A;  1PSQ A;  1GUL A;  2ZUP A;  1QUW A;  2E7P A;  3F4T A;  1Y25 A;  1K3Y A;  4NPB A;  13GS A;  1ZL9 A;  2YJ7 A;  4AJ8 A;  1JLW A;  4CDO A;  3GST A;  3EIN A;  2C8U A;  4F03 A;  2XHF A;  3GUR A;  1OVN A;  2YNX A;  2R5G A;  2F3M A;  4KDX A;  5ELG A;  2M46 A;  1FVJ A;  2F9S A;  1V2A A;  3J7Y k;  1JFU A;  2C0E A;  2LRC A;  1OE7 A;  1Z3E A;  2CAI A;  3QAG A;  2B7K A;  3APQ A;  3UAP A;  5INY A;  2VOC A;  1TOF A;  4I2U A;  3BJ5 A;  3DVW A;  4EXJ A;  3LXZ A;  2QSI A;  3GYK A;  3QPM A;  4E8H A;  3RAZ A;  2X8G A;  2HSH A;  3TRX A;  3V1W A;  3HMJ G;  2F51 A;  1TK8 B;  3KXO A;  1T1V A;  5IMV A;  1FG4 A;  3ZMK A;  2PGT A;  4YKG A;  1DE2 A;  1ERT A;  5D73 A;  1ON4 A;  5F06 A;  2MMA A;  2H19 A;  3BD2 A;  4ML1 A;  2HLS A;  3D6I A;  4PTS A;  5LD0 A;  1PMT A;  3DML A;  3HZ4 A;  3GSS A;  3UVT A;  1MDJ A;  3G9B A;  2I1U A;  1XWB A;  4TR1 B;  5HR1 A;  1R5A A;  2EFC A;  1B4P A;  4IN0 A;  4EIQ A;  4JZQ A;  3L0H A;  4PNG A;  3U5R E;  5A4W A;  2H0H A;  2IN3 A;  3F6F A;  2WZ9 A;  4KCA A;  3TB2 A;  2YWI A;  4DSR A;  2HRK A;  4FQU A;  3TGZ A;  2IIY A;  2GQM A;  3LW9 A;  1ZYQ B;  2VLT A;  4K6X A;  1AXD A;  2DML A;  1FVK A;  2FD3 A;  1YEX A;  2IPA A;  1W89 A;  1OKD A;  2IWT A;  2VLV A;  3H93 A;  4PGT A;  4Z7X A;  1BG5 A;  1EEJ A;  3GH6 A;  4EC0 A;  1X9S B;  2UZ8 A;  2MYG A;  3KIJ A;  3ZIJ A;  3P8W A;  4GRF A;  5DAL A;  2IFQ B;  3EMP A;  4MP4 A;  4TKY A;  2HZE A;  4BWQ A;  2E2G A;  5ECK B;  4FH8 A;  1TXU A;  3KH9 A;  2PER A;  5AIX A;  3OR5 A;  1V57 A;  2VL9 A;  2PVO C;  4A5P A;  1HNA A;  3L78 A;  3RPP A;  1SK2 A;  2PU9 C;  2A2P A;  1IYI A;  3O76 A;  4OCF A;  1QGV A;  1R7H A;  4IS0 A;  2VCT A;  5G30 A;  2H1G A;  4IJ3 A;  3PR8 A;  4ZB7 A;  3IPZ A;  3MAK A;  3HVX A;  1ERW A;  1V40 A;  1OAZ A;  3GTU A;  1PX6 A;  4G01 A;  2GT5 A;  4IEL A;  1RW1 A;  2DLX A;  4GLT A;  5JWQ B;  2YOI A;  3LXT A;  2OKA A;  3GMF A;  1G0T A;  4K0N A;  4IJI A;  3ERW A;  4K0G A;  2PVQ A;  1YZX A;  3E9J B;  1TW9 A;  1I5G A;  5DAK A;  2QA1 A;  3MYD A;  1VF2 A;  2LQO A;  1YKA A;  4G9H A;  2FGX A;  2G0F A;  2CX4 A;  1SJ6 A;  2KP2 A;  2GLR A;  1YJ6 A;  4WET A;  3RHB A;  4K7N A;  1NM3 A;  3O6T A;  1F3A A;  1M2B A;  1SYR A;  1NSW A;  2IME A;  3M0F A;  5KOX A;  2H6X A;  4YH2 A;  2I4A A;  4N11 A;  4MZC A;  2TIR A;  2DJK A;  1OE8 A;  12GS A;  4RI7 A;  2VCV A;  4LL1 B;  3C73 A;  3R3E A;  2H75 A;  3KZQ A;  4PUA A;  4KGI A;  5ID2 A;  2HSN A;  2VD0 A;  4MDC A;  2AHE A;  1JLV A;  5IPH A;  4OFN A;  2LV3 A;  1F37 A;  4F2I A;  4YQU A;  2H1D A;  1AW9 A;  2FHE A;  1EV4 A;  3DXB A;  2AB6 A;  2K18 A;  4L5O A;  2C3Q A;  4KA0 A;  1U6T A;  4WXT A;  1O8W A;  4KDU A;  2GVP A;  3W8S A;  4XHM A;  3ME8 A;  4XS4 B;  3H4K A;  2VCW A;  2H70 A;  3QFB C;  2VCZ A;  3KTB A;  1LJR A;  5JCG A;  1A23 A;  4JE1 A;  4YAV A;  1S3D A;  2H66 A;  4N10 A;  17GS A;  2P5Q A;  3QFA C;  1N8J A;  4WR4 A;  1K0M A;  3GKX A;  5IMD A;  4K5R A;  10GS A;  5GAN D;  1EP8 A;  5ECM B;  5IM9 A;  4HOJ A;  3IK7 A;  4K7O A;  4HZ2 A;  1A2L A;  3I9V 2;  3FW2 A;  1UC7 A;  5HFI A;  3ZFL A;  1B8X A;  4L0U A;  2REM A;  1U3I A;  1THX A;  1TU7 A;  2JSY A;  4V2N A;  2OE3 A;  1SVM A;  5J47 A;  2GT6 A;  1XOA A;  4CW9 A;  4EKZ A;  5D9T A;  2HRA A;  1EOH A;  1JZD A;  1NW2 A;  2YWM A;  2B3S A;  2ZNM A;  3GA4 A;  1O8X A;  2J23 A;  2HRF A;  3A2X A;  4MMM A;  5FWG A;  5G31 A;  5KN2 A;  4PQ1 A;  3EU3 A;  1SJI A;  2A2R A;  1V58 A;  1URM A;  1TK5 B;  2HSM B;  2H73 A;  1AC1 A;  1YF1 A;  1S3A A;  1GLP A;  2FA4 A;  2P0G A;  5FHI A;  1N25 A;  1O81 A;  1Q4J A;  1GRX A;  2LRN A;  4FYB A;  2VCQ A;  1OYJ A;  4G0L A;  2LJR A;  2DC5 A;  1PD2 1;  3TOU A;  4PQI A;  3FMW A;  3LJR A;  2QC7 A;  1Z7P A;  4GF0 A;  1SU9 A;  3H1N A;  2YV9 A;  3GL5 A;  3C8E A;  1ZOF A;  3TCO A;  5JWR B;  5C04 A;  4TOP A;  3QDN A;  4X0X A;  5ECS A;  3BCI A;  5EY6 A;  4O92 A;  3QAW A;  4MLY A;  1XWA A;  4ML6 A;  3I6A A;  1GUK A;  2HYX A;  2VD1 A;  1HQO A;  4GQF A;  1GSU A;  4RQR A;  4XTS A;  3LYK A;  2KLX A;  3VWV A;  3LWA A;  2OE0 A;  4ECB A;  1ZYP A;  3F9U A;  1KEB A;  1M9A A;  4MPG A;  2M72 A;  2R3X A;  4L8E A;  2KHP A;  2E0Q A;  1EV9 A;  2H6Y A;  1MDI A;  4PUR A;  2NVL A;  3WGD A;  5JWO B;  2DBC A;  4BVX B;  3NIV A;  2O5V A;  2GZZ A;  1J0F A;  2P31 A;  2AJQ B;  3KP9 A;  5IMC A;  5GZZ B;  1RQM A;  4QQ7 A;  5D9W A;  1ILO A;  1GTB A;  2A4V A;  2YJH A;  3NOF A;  2VL2 A;  2R4V A;  1M0U A;  5AIS A;  5BMU B;  4GQC A;  2O7K A;  4IP6 A;  2KOK A;  4ZBB A;  2JAD A;  4J56 E;  3GIX A;  3P90 A;  3RBT A;  5DDL A;  1NHO A;  2JL4 A;  4TXO A;  3TKS A;  1KTE A;  2F8F A;  2BMX A;  2KP1 A;  1BQ7 A;  1LBK A;  4TVE A;  4BVY B;  3ZIT A;  2JSZ A;  4HS1 A;  5F0G A;  1Z5Y E;  2OE1 A;  3HZ8 A;  2PMT A;  4F9Z A;  4AJ6 A;  3VI7 A;  1SYX A;  3FEU A;  4ILF A;  2AUV A;  1JZR A;  4FYC A;  1PN0 A;  3LSZ A;  4ZBA A;  1O6J A;  5A1N A;  4Z2U A;  3PIN A;  4X43 A;  4MJE A;  4XS6 A;  4K8M A;  1K3O A;  3ZIV A;  5IMF A;  2O8V B;  4TN8 A;  3Q6O A;  5EL8 A;  5B8B A;  3EUR A;  1KNG A;  1THO A;  2LNS A;  3GFK A;  1GSD A;  2B5X A;  1M2A A;  4I8B A;  5ECN B;  3P7X A;  2OBI A;  3C1R A;  4BL7 B;  1BG1 A;  1R26 A;  4QL9 A;  5L71 A;  3L4N A;  1PN9 A;  2IFQ A;  1SL2 B;  2FCH A;  1SL1 B;  3UEM A;  3LOR A;  1N2A A;  4RQX A;  4D73 A;  2OAD A;  1GSE A;  1TI1 A;  3HHV A;  6GSW A;  2IMF A;  4O5Q A;  5CRE A;  14GS A;  5E59 A;  5A4V A;  1WWJ A;  2XPE A;  2FWH A;  4POM A;  3FR9 A;  3W8J A;  11GS A;  4ZXG A;  1ZMA A;  2K8V A;  4K1F A;  2X64 A;  2PN8 A;  1WOU A;  4J57 E;  4IP1 A;  2ON7 A;  2PBJ A;  4AGS A;  3ZVJ A;  3KM6 A;  2HZF A;  3ZRE A;  3TKP A;  1F9M A;  1PKZ A;  2DJ1 A;  4ULX A;  1ZYE A;  1TRV A;  2XBI A;  1K0A A;  2B5E A;  2C0G A;  5J4U A;  1TDI A;  4PQH A;  5ELA A;  3WT1 A;  4KUN A;  2PPT A;  1V98 A;  1Z6M A;  2B1K A;  1OC9 B;  3VWU A;  4G0I A;  3CBU A;  4BPY A;  4ECI A;  2G2Q A;  4I97 A;  3M3M A;  4IBP A;  4V2L A;  2FWF A;  2P5R A;  3K8N A;  2LUS A;  2EFE A;  1HNB A;  1JZO A;  1K0O A;  5AGY A;  5A5H A;  2DJ2 A;  2O87 A;  3HXS A;  1WE0 A;  1U87 A;  2FWE A;  4OMV A;  4GCI A;  2AYT A;  4V2M A;  3TRP A;  4LL4 B;  3HD5 A;  3QD9 A;  2UV8 G;  3ZFB A;  1H4O A;  3GX0 A;  1TXX A;  1O85 A;  1M7T A;  4HQZ A;  3C1S A;  1AAZ A;  2CA8 A;  3BCK A;  2V6O A;  2GSS A;  4XCS A;  2HSY A;  2PUK C;  3EYT A;  2N5A A;  2YV7 A;  2VUP A;  1GTA A;  4TXV A;  2R2J A;  3FHK A;  1SK1 A;  3J7Y b;  3CMI A;  2OT3 A;  2MBT A;  1X5E A;  3DWV A;  2ES7 A;  2CAQ A;  1I9D A;  5JCW A;  1MDK A;  4MH2 A;  4JRR A;  4TR3 A;  4YAP A;  3EVI A;  3IOS A;  3HCZ A;  3F3Q A;  4ZL8 A;  5D96 A;  1SVL A;  1X5C A;  3UVH A;  4NXI A;  2YN1 A;  5HR3 A;  1GNE A;  3AY8 A;  3DVX A;  3FK8 A;  1FOH A;  2RM6 A;  4YKF A;  1B4Q A;  4IGJ A;  5ECI B;  3VWX A;  18GS A;  2O89 A;  3CSI A;  4GXZ A;  3UJ1 A;  3EPT A;  4EDZ A;  3QAV A;  1A2M A;  1Q98 A;  5CO3 A;  1TP9 A;  1C72 A;  2C1Y A;  1ABA A;  5F05 A;  3H8Q A;  4DSS A;  4F0B A;  3F8U A;  4O5R A;  1SKS B;  1T8E B;  2GQK A;  1X9W B;  1QK8 A;  5DCH A;  2H8L A;  1K0C A;  1T7P B;  2K9F A;  4KAE A;  5DVB A;  2LRT A;  3IV4 A;  2VM2 A;  5B7C A;  4HJM A;  2A4H A;  1PQN A;  3FRC A;  3MIX A;  4EE0 A;  3VPT A;  1GUM A;  3QCP A;  2F8A A;  3M8N A;  3DRN A;  4AF2 A;  4OWY A;  3L9V A;  4YQV A;  2X8C A;  4HQS A;  2OBK A;  3HY2 A;  4OO4 A;  1A2J A;  3A5W A;  4JR4 A;  3FKF A;  3GKK A;  4MZB A;  4DSQ A;  5HFK A;  4USS A;  4G10 A;  2RUE A;  4POB A;  2TRC P;  4ZB8 A;  3FR6 A;  3Q74 A;  4WBR D;  3GNJ A;  2DIY A;  3CSJ A;  4HDE A;  4JU5 A;  1GWC A;  4K7I A;  1XZO A;  5A34 A;  1YY7 A;  5DBQ A;  2L4Q A;  4XIH A;  1HYU A;  2DSA A;  2B1L A;  2BJX A;  4EO3 A;  5HR0 A;  1GSS A;  1M99 A;  2FUG 2;  2IJY A;  3US3 A;  2NPB A;  5AIV A;  1SKR B;  3FY7 A;  4CHS A;  3KEB A;  5DJL A;  2MMN A;  1DE1 A;  2HFD A;  2HRK B;  1Y6E A;  1PX7 A;  2KUC A;  2C3T A;  3KCM A;  1WP0 A;  2IMK A;  3GKN A;  1VRS D;  2D2Z A;  4WF4 A;  2Z9S A;  2JZS A;  1TTZ A;  4MF6 A;  5KN1 A;  1GSF A;  1XW6 A;  2WS2 A;  4N0Z A;  1ACV A;  4KX4 A;  3KH7 A;  4XRA A;  4Q5R A;  5ECP B;  1Y1U A;  1EGO A;  5J41 A;  3M9K A;  1A8L A;  5DAL B;  2FWG A;  1F2E A;  1Z7R A;  2HZE B;  1XWK A;  3CWG A;  5IOX A;  3I69 A;  3GX8 A;  4WF5 A;  3ZML A;  2GST A;  1MTC A;  3UAR A;  19GS A;  4F0C A;  5J40 A;  2WFC A;  6GSX A;  1MD4 A;  1TRW A;  1OC3 A;  4KSO A;  2FLS A;  3TUE A;  3UIW A;  2AAW A;  3TKQ A;  3Q19 A;  1K0D A;  4EF0 A;  2H01 A;  2YAN A;  3GTU B;  2NDO A;  2JU5 A;  2CT6 A;  2JZT A;  2L6C A;  2MMZ A;  3DIE A;  4DVC A;  5G5F A;  2ALB A;  1V9W A;  3L9S A;  3UBK A;  2V41 A;  5F8B A;  1A0R P;  3PH9 A;  1X5D A;  1GP1 A;  3VWW A;  1B48 A;  5DAK B;  2IMD A;  4EVM A;  1OKT A;  3M1G A;  4KE3 A;  3BOA A;  3TJK A;  5IOW A;  1PL1 A;  4PXO A;  2EIQ A;  5G2Z A;  3LEF A;  4TR4 A;  2FA8 A;  2H0I A;  5CRD A;  4KCE A;  4IQ1 A;  5DJM A;  4KSM A;  6GST A;  1TRU A;  4ECJ A;  2GQL A;  4GDF A;  2C4J A;  4XRD A;  3DD3 A;  1HNC A;  2N5B A;  2B5Y A;  1FOV A;  3HA9 A;  2WGR A;  1U88 A;  3N5O A;  5ID2 B;  2GZP A;  4AKG A;  2HSN B;  5A5K A;  2I81 A;  1AIU A;  3R2Q A;  2AV4 A;  3IE3 A;  5H5R A;  1NHY A;  3NZN A;  4X4J A;  4BWS A;  4NMU A;  2H30 A;  3GRX A;  1IYH A;  4JR6 A;  3QOU A;  4IQA A;  2OA7 A;  1XIY A;  2YZH A;  3TOT A;  1XPV A;  4K5S A;  1ST9 A;  1SD8 A;  1G6Y A;  3Q18 A;  3ERF A;  3DYR A;  3FZ4 A;  1YDK A;  3HJP A;  2MBS A;  1VF3 A;  3ZRD A;  1R5P A;  4YQM A;  4AKI A;  3IA1 A;  3ZL5 A;  3ZLP A;  1TJD A;  4MJA A;  1HD2 A;  2OJL A;  4Z2R A;  5J5N A;  4NHZ A;  1WRY A;  1S3C A;  2ON5 A;  1SD9 A;  2L4C A;  4MK3 A;  2H6Z A;  3GHA A;  4I5Q A;  3CTF A;  2HI7 A;  3M9J A;  1WPI A;  3IC8 A;  2B6M A;  4BA7 A;  1BYE A;  3RHC A;  5IO2 A;  4OFT A;  4ICY A;  3C7M A;  5F07 A;  1XCC A;  5HR2 A;  2EIR A;  4TR1 A;  3ME7 A;  4W66 A;  2QKE A;  5LCZ A;  1JZW A;  3EWL A;  1UN2 A;  1YEP A;  3D5J A;  4MF7 A;  1XWG A;  3ZTL A;  3HYP A;  2IMI A;  1ZZY A;  1M2D A;  2E2M A;  2LS5 A;  3LG6 A;  1SVO A;  5J4Y A;  1T4Y A;  3ZVJ D;  3HDC A;  4EL1 A;  5IMZ A;  2LTK A;  3IXR A;  2L5O A;  1KBN A;  4HZ4 A;  5D8I A;  1DSB A;  3GKM A;  2C0F A;  3EMX A;  5JCU A;  3CXG A;  3VLN A;  2M80 A;  3APO A;  2XPD A;  3BBY A;  3WT2 A;  4NWY A;  4N0V A;  1MEK A;  2LEG A;  5ECH B;  3LQ7 A;  1TKD B;  1ZCP A;  3GN3 A;  1EGR A;  1A24 A;  1FW1 A;  2HRN A;  1ERU A;  3TJB A;  5LNK e;  1GNW A;  3SBC A;  3ERG A;  2PWJ A;  2RII A;  1J08 A;  4Q5F A;  1G7O A;  4ZIL A;  1Z6N A;  1TU8 A;  1B9X C;  3UMA A;  4J2F A;  2A2S A;  2H1A A;  2HQT A;  4EUY A;  2VM1 A;  1K0N A;  2JZR A;  2GDR A;  1SL0 B;  1GL8 A;  4MH3 A;  1CQH A;  3A2V A;  2L59 A;  3EU4 A;  4N30 A;  5G5E A;  8GSS A;  1QQ2 A;  3HJO A;  5IPG A;  2VL2 C;  3LFL A;  1QXH A;  3G7J A;  2LJA A;  4LLR A;  1ZYN A;  3KD0 A;  3EE2 A;  9GSS A;  4ISD A;  2R0P A;  2H72 A;  3TKS C;  4PX1 A;  6GSS A;  2N5F A;  5CRG A;  2CQ9 A;  1QFN A;  3FYG A;  4XS1 A;  2QA2 A;  4PNF A;  4OFM A;  5GAP D;  3FR3 A;  4TR0 A;  2GTU A;  2C3N A;  4K2D A;  3IHQ A;  3TDG A;  4RI6 A;  1XW9 A;  5CYY A;  2V2G A;  3UBL A;  5ECR B;  4DEJ A;  2WUL A;  2YWN A;  4TXO B;  1YVL A;  4Z2T A;  3TU3 B;  4L5L A;  1JHB A;  5BRT A;  5A4U A;  5CRH A;  4FIW A;  2HT9 A;  1WJK A;  1LU4 A;  4KF9 A;  3ZYW A;  16GS A;  2J9H A;  4AI6 A;  2DMM A;  4PUF C;  4O5U A;  2X99 A;  5CRW A;  4AKX B;  5D9V A;  4OCE A;  2V6K A;  5KN3 A;  2GSQ A;  3WGX A;  5D9X A;  1TK0 B;  4EIP A;  2HNL A;  1EOG A;  1TRS A;  5A1N B;  3HVS A;  2VLU A;  2VKZ G;  4POL A;  3W6G A;  2EFD A;  4XS4 A;  5GSS A;  4GWR A;  2I9H A;  3PPU A;  3D0Z A;  2VL3 A;  1PA3 A;  4WBJ A;  4ZL7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...