4MDCA

Crystal structure of glutathione s-transferase from sinorhizobium meliloti 1021, nysgrc target 021389
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
231
structure length
231
Chain Sequence
SMPTLYHHPMSPASRFVRLILSEYGYQTELSEEQPWENRRDFLTLNPAGTLPVYVDDSMRALCGATIISEYLDETSGIMKRDRRLLAEDPFQRAEIRRLTEWFLQKMEADVTRPLVRERIFKLQMTPDQGGGAPDSKILRTSRSNIRQHMKYLSWLAGSRPWLAGDRISYGDLAAAAAISVLDYLGEIDWSDAPTAKEWYQRLKSRPSFRPLLAERVRGVTPVSHYADLDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Putative glutathione S-transferase
publication title Crystal structure of glutathione S-transferase from Sinorhizobium meliloti 1021
rcsb
source organism Sinorhizobium meliloti
total genus 83
structure length 231
sequence length 231
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2013-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4mdcA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4mdcA01
1ST9A 3QDNA 2CAQA 3IR4A 1BEDA 2VCTA 1HNBA 5D9WA 5D96A 1AQVA 4I6XA 2EIQA 2DIZA 4GF0A 2H6XA 1ERUA 1OKTA 2IL3A 1O81A 1GSQA 5D73A 4KAEA 1VF3A 1SJZA 3QD9A 5EY6A 4G19A 3GHAA 5HR1A 2MBSA 1F37A 5ECMB 4KSMA 1GH2A 1SU9A 1Z6MA 4WEYA 3H4KA 4MZWA 1YY7A 2CAIA 1XOAA 4RQRA 1V57A 3EC3A 1U6TA 4N30A 3TJJA 3FYGA 1WE0A 4ZL9A 1ML6A 1BYEA 2GZZA 4RQXA 1MTCA 4JRRA 2EIRA 1UVZA 6GSVA 5JWOB 3BCIA 1JFUA 3UIWA 3I9V2 3CTGA 3IAM2 4F03A 3Q6OA 1Y25A 1A0RP 2VCXA 2F8AA 2FCHA 3UAPA 2A4VA 1AQWA 1FAAA 1WIKA 2YWIA 3A2VA 3RDWA 3F9UA 4E8EA 4ECCA 3F6DA 1TTZA 2B5YA 1I9DA 3FZAA 1FVJA 4JEDA 1YEXA 3A2XA 1J9BA 4JR4A 4KNDA 1FO5A 2FWHA 2HSHA 2B1LA 2VL2C 1AIUA 2HYXA 4BWQA 1M9AA 5HFKA 3TUEA 3ZTLA 2H19A 4POMA 3FY7A 1F2EA 4AF2A 3CSJA 2D2ZA 3IPZA 2I4AA 2VCWA 1MDIA 2VL2A 1O8WA 5ECIB 2H0HA 3HKRA 4G10A 2DJ0A 2ALBA 4HQSA 2IMFA 2JACA 2VCQA 2P5RA 2PERA 3GURA 4OFNA 2NPBA 1GLQA 2DSAA 3HXSA 3ZFBA 2HE3A 1ON4A 1Z9HA 2FHEA 4ACSA 1Z6NA 6GSYA 1GSUA 4I8BA 1A0FA 4PXOA 2GT6A 1Z7RA 5ECKB 1XPVA 4JE1A 2PWJA 4EDZA 2UZ8A 2E7PA 3EU4A 3IXRA 4AJ8A 5JWRB 2LRNA 2QKEA 4G0LA 5B7CA 3P7XA 1GTAA 3WD6A 5FT3A 1PA3A 2PBJA 1BAYA 2KLXA 4WBRD 1QXHA 1JZDA 4PQHA 4EXJA 3TCOA 3LGCA 3HDCA 1SL2B 3VWVA 1FOVA 2OE1A 4FYBA 1X9MB 1MD3A 3ME8A 2HI7A 1OC9B 1VRSD 3LJRA 2G0FA 4DVCA 4IGJA 5JCUA 5IO2A 2NVLA 2L4QA 2DMMA 4CDOA 5GAND 3RPPA 1XFLA 2OADA 1X5EA 2RLIA 1V2AA 2GDRA 3GMFA 2VL9A 4IVFA 4KDYA 2C0DA 1XWAA 4K7IA 1CQHA 4KW6A 4HZ2A 3EURA 4IQ1A 2F9SA 4N0ZA 3UARA 2CA8A 2OA7A 3G7YA 5A4VA 1OAZA 1Z3EA 3DKSA 2YZUA 3GX0A 2LRTA 2V6KA 5J3RA 1GRXA 2LJRA 4V2LA 2EC4A 4ZILA 4GQCA 4F9ZA 4PGTA 4NHWA 1I5GA 4EUYA 2DJ2A 2ES7A 4OWYA 2V41A 4IKHA 5DCHA 3CMIA 3VI5A 1TRSA 3J7Yb 4HU7A 4DSSB 1JZOA 3DIEA 2LNTA 1OC9A 1GULA 2HRKB 2B5XA 1PGTA 4F0BA 4JZQA 1K0CA 4G9HA 3RPNA 4IP6A 2H8LA 4YQMA 2WDUA 5ENUA 3ERGA 4I97A 3C73A 4MJEA 4IS0A 5ECPB 1M2DA 3CRUA 2JSZA 2REMA 4G2EA 3KGKA 5HR3A 4V1Ap 1T4ZA 2YWOA 4MK3A 1VGLA 4EKZA 2AAWA 4O5RA 4MH3A 2I1UA 2X99A 1URMA 1S3AA 4QL9A 3HY2A 2C4JA 1H4OA 1AAZA 3O76A 3F8UA 1BG5A 5IMFA 4CW9A 3ZITA 1LJRA 2MZCA 4DSSA 1JLWA 2N5AA 3VI7A 2N5FA 4HJMA 3LSZA 1ERWA 1TK5B 2HRKA 3A2WA 1SK2A 1EOGA 1ERTA 4YAVA 4NXIA 2R4VA 1T3BA 1T1VA 1B8XA 2WFCA 2IWTA 4WXTA 4LL4B 3KCMA 4K1FA 5BMUA 1THXA 5INYA 5D93A 4MF6A 3L9SA 3OR5A 1M9BA 1O73A 5CRWA 3DMLA 4IW9A 2YWMA 1GLPA 1QFNA 3KH9A 2LS5A 4MF7A 3D22A 1NM3A 1PL1A 3UBLA 1XWCA 2LQQA 1TK0B 1U87A 1ZMAA 2J9HA 4POBA 3LYPA 5A5KA 1A2JA 2K18A 1NW2A 1JHBA 1AUCA 3D21A 1K0DA 12GSA 4DEJA 4F0CA 2NBSA 2NTOA 2GSRA 1XZOA 3IV4A 3GYKA 5ECHB 2GSQA 4ECIA 1B9YC 2WB9A 4LMWA 1T7PB 1XW9A 5ECOB 1SENA 3C1RA 4L0WA 2OE3A 1FW1A 1EWXA 2RIIA 2WULA 5CAXA 3EE2A 2KP1A 1J0FA 3KXOA 1YDKA 3VWWA 3APSA 2AHEA 4ZL7A 1XVWA 4PQ1A 3PR8A 4WETA 3NOFA 1VF4A 3I6AA 1X9SB 4K6XA 3EWLA 2HLSA 3FZ5A 1U3IA 4MZBA 2VL3A 2VM2A 3UEMA 1A2MA 5KN1A 1TRUA 3M9KA 1PSQA 3M0FA 3S9FA 5LNKe 3ERWA 3KD0A 1Q4JA 1XW6A 3LXTA 1PD21 3GUSA 2OE0A 4LMVA 3TOTA 3KZQA 1AXDA 3GFKA 2X8HA 5ELAA 1ZOFA 1OC8A 3DYRA 5CNWA 2IN3A 1TU8A 5C04A 5G30A 2WCIA 3G9BA 1TI1A 2VD0A 2GLRA 5F07A 3VK9A 1A8LA 1G7EA 4HQZA 2FUG2 3UOMA 10GSA 1LU4A 2V2GA 5ABRA 5DBQA 4XS4B 2LKUA 1W89A 3F3RA 2MBTA 2GQMA 3N5OA 2AB6A 4LA1A 4ZL8A 3F0IA 3WGDA 5LD0A 3HZ8A 3WGXA 4TRXA 4NV5A 1PKZA 1YJ6A 5AISA 1TJDA 3LWAA 3D0ZA 2HRFA 5IO0A 1V98A 1A2LA 2LUSA 4XS6A 2VO4A 2H0IA 4EO3A 3IK7A 1MDJA 3HVVA 2HT9A 1YKAA 1M0UA 3BD2A 2HQTA 1USBA 4ZBAA 4P3YB 4N10A 1M2AA 1S3DA 2XBQA 1Z7PA 2B7JA 2C3QA 5IMCA 1M2BA 2JZSA 2M80A 1X5CA 5H5QA 2H0GA 3TKSC 4MMMA 4ID0A 4XS4A 2MYGA 1ZZYA 2O89A 1SL0B 5JWQB 1EGOA 1GTIA 4MPFA 4RUVA 5F05A 3TKSA 4PTSA 4KE3A 5IMAA 3TDGA 2HSNB 3L9VA 3M1GA 1H75A 2XHFA 4MCUA 3IAS2 1Z5YE 5G1KA 2YZHA 2E0QA 2L5OA 2HRNA 2DJJA 4NWYA 2AJQB 1XWBA 2QGVA 2YNXA 4FIWA 3IC8A 4F2IA 5IMZA 2GGTA 2VLUA 2OACA 4PNGA 3W8SA 2YOIA 2XPEA 1UN2A 2PU9C 2V1MA 2TRCP 3IK9A 3Q18A 2CVBA 3IA1A 2FWEA 1TXXA 2L6DA 5G5FA 1YF0A 1EV9A 1XWKA 2FA8A 3FKFA 3TRPA 4L5OA 3H79A 3ZIJA 1TDIA 1BX9A 3TJBA 4WKWA 1RW1A 1BQ7A 5AIVA 2DJKA 2CQ9A 4ILFA 1SJIA 4NPBA 2HZEB 3TJKA 4TXVA 2LSTA 2B5EA 3GSSA 3VFIA 2WZ9A 3KMOA 4YAPA 4YQVA 3GKXA 1JZRA 2LV3A 2NDOA 5KN3A 2B1KA 1MDKA 1FB6A 2H1GA 1XBSA 2L5LA 5IPGA 2R5GA 4IJ3A 1G6YA 3UMAA 3WYWA 4KCAA 3HJPA 3LFLA 1R26A 2YJ7A 1T8EB 4KB3A 4ULXA 3TKQA 1GTUA 4K8MA 1TP9A 1V9WA 2VIMA 5H5SA 1XIYA 3KEBA 3DD3A 2C3TA 1HQOA 4BVXB 3CSHA 1KEBA 3US3A 2DMLA 1AC1A 2CX4A 1FB0A 2PN8A 4TR4A 4L8EA 2VCZA 1NHOA 1TW9A 2GQKA 2HZEA 3DGQA 1XXUA 2OKAA 3EMPA 3H93A 5J9CA 1HNAA 4HOJA 4HUAA 3TOUA 3F63A 2JU5A 4MJCA 4TR1B 3K8NA 3JCML 4BPYA 4X1UA 5FWGA 5GAPD 2XPDA 3W8JA 2G2QA 1GL8A 1K0BA 1GSFA 5DDLA 1VF1A 1PMTA 5CREA 2BTOT 1SJ6A 3GKKA 4EF0A 3APQA 1G7OA 2GZPA 2CZ3A 1SK0A 3O6TA 4BVXA 6GSTA 3H1NA 3FEUA 1THOA 2XC2A 2N5BA 3HJMA 4J2FA 3ZMKA 4IN0A 3RBTA 4HI7A 2ON7A 3EMXA 4O7HA 4GTUA 1OE8A 4ZB6A 3GL3A 3ZYWA 4XRAA 4OO5A 2A2SA 3CSIA 3R3EA 2C0FA 1R4WA 2H1BA 4TR1A 5G31A 1SKWB 4OFTA 1QUWA 3PPUA 2R6KA 2O87A 3F6FA 1EP8A 2RM5A 5DJMA 1X5DA 1C72A 2GSSA 1WWJA 4K7OA 4KUNA 4KDXA 5AGYA 2BMXA 4OCEA 4KH7A 2PVOC 2YV9A 2HNLA 4ISDA 1MD4A 4JU5A 2HSMB 1GSYA 3HVXA 3D4MA 2ON5A 3VWUA 4K2DA 2KP2A 1B4QA 4MABA 3D6IA 4HEA2 4LLRA 2JL4A 1QGVA 3QMXA 3F3QA 3KP9A 2K8SA 5CO3A 4IJIA 1A23A 3P90A 3PINA 4QQ7A 3MWHA 1J08A 2WGRA 1PQNA 3FW2A 3ZIVA 4QL7A 1WJKA 3QAGA 3MNGA 2H6ZA 3ZVJD 5D8IA 5IQYA 2WS2A 3APOA 3F4RA 3WT2A 5H5RA 4L5LA 19GSA 4PQIA 2DLXA 4AJ6A 3QPMA 3BJ5A 1SKRB 3SBCA 2HSMA 2FWGA 5EL8A 3TJGA 1RK4A 4YH2A 2WJUA 2HFDA 1R5PA 5F06A 3W6GA 1UA5A 5LCZA 4PUFC 3CBUA 3KJYA 2K9FA 4XS1A 1Q98A 1ZYEA 1PL2A 2QSIA 4TR3A 2O8VB 8GSSA 2CX3A 3GH6A 4L0UA 5L71A 4AGSA 4E8HA 1KNGA 2KOKA 4MPGA 3ZRDA 4FYCA 3HJOA 1WRYA 7GSSA 3I43A 2MMOA 5J9BA 4GSNA 5IIZA 1R5AA 1ZL9A 1GUKA 4EVMA 2GT5A 2RUEA 3HYPA 2ZCTA 3N9JA 5DCGA 5E4WA 3C1SA 3NZNA 4TKYA 1SYXA 1RQMA 4OCFA 1TK8B 3ZZXA 3LEFA 5A4UA 3IC4A 1XW5A 4PX1A 3CXGA 2MMZA 5COHA 4TVEA 3KTBA 4MDCA 5A4WA 4X0XA 5IOWA 3J7Yk 2FA4A 1DUGA 2B3SA 1S3CA 2H71A 1A24A 5ELGA 5B6NA 4HJ2A 1EEMA 4MZCA 4WR5A 3U5RE 2J23A 3E9JB 2GQLA 1OE7A 4KSOA 2TRXA 1GUMA 5ID2B 1SK1A 2B7KA 3EINA 1GTBA 1K3YA 4BWSA 4NHZA 4ZIJA 5JCWA 1K3OA 5ECNB 3EU3A 3A3TA 4FYUA 3RHCA 2VAFA 3QFAC 4K7NA 2C8UA 5KEJA 2R37A 4I5QA 3EYTA 1PN9A 2YPMA 4MP4A 2YWNA 3TRXA 4WF4A 2JZRA 3LG6A 4MJBA 18GSA 4POLA 1XWGA 1AQXA 2HSYA 2JADA 4J56E 2YP6A 4G0IA 5F8BA 3CTFA 1K3LA 1SD9A 3UJ1A 1GNWA 2H01A 3VURA 1ZCPA 4H86A 3L78A 3IDVA 5ID2A 3FR3A 5EVOA 5AIXA 3G7JA 5J4UA 2R3XA 5ECLB 1EV4A 3GIXA 3PH9A 3VPQA 2L57A 4GCIA 1A8YA 1M99A 1HYUA 3HZ4A 1G6WA 14GSA 3GKNA 1B9XC 2AUVA 1EEJA 2CV4A 1IYIA 4K0NA 4LL1B 3KM6A 4AJ7A 5HQPA 3KP8A 3LORA 16GSA 2BJXA 1K0NA 4KCEA 2F3MA 4TOPA 4N0VA 5GSTA 5G2ZA 1PRXA 4O92A 4MF5A 4OO4A 1K0AA 4NMUA 1GSEA 3M8NA 5KN0A 1JLVA 1ABAA 2XBIA 1IYHA 3DVWA 2DC5A 1MEKA 2H1DA 2VLTA 1BJXA 2FNOA 1WP0A 3TKPA 2IPAA 2L4CA 4G0KA 1OVNA 3VLNA 3ME7A 1U88A 2LRCA 4XIHA 3SWLA 1UC7A 1EP7A 4PURA 4ECJA 4IELA 1GSDA 4ECBA 4D73B 1DE2A 4FO5A 3NIVA 3WGEA 5HR0A 2QC7A 1N2AA 1X9WB 2C0GA 3UVTA 5CYYA 2CZ2A 3ERFA 2H76A 2PGTA 4KDUA 1SD8A 2FLSA 5CRDA 3QOUA 1PX7A 3Q74A 3G7IA 3GX8A 2ZNMA 2LEGA 3C71A 3I69A 3F4TA 3P8WA 1ZGNA 1FHEA 4HDEA 4ZB8A 4Q5RA 3GNJA 5DQYA 2F51A 4HS1A 5D9VA 5D9XA 1PX6A 3UBKA 3UL3A 4V2NA 3HA9A 1XVQA 3ISOA 1ERVA 2GZYA 5DVBA 4WR4A 1O7UA 11GSA 4TR0A 1YQ1A 2H70A 2CT6A 2FWFA 2HZFA 2H30A 4GXZA 1WOUA 4D73A 5HFGA 3TRQA 4JBBA 1FVKA 5IM9A 4N11A 1ZYQB 3IOSA 2O85A 3TKSE 1O8XA 2M72A 3MDKA 2FY6A 4Z7XA 4ZXGA 3QFBC 4IQAA 3DRNA 5DQSA 2L59A 3KTLA 2JSYA 2M46A 1JZWA 4OMVA 1DSBA 1F3BA 3A5WA 3DVXA 1YZXA 1LBKA 1HD2A 5GSSA 1B48A 5IMDA 3EVIA 1B4PA 3IE3A 2PPTA 4FH8A 3DXBA 2CVDA 5CRGA 3E0UA 4YQUA 1F9MA 1TOFA 4JR6A 3ZFLA 4DSRA 1GNEA 4ML1A 3F4SA 1GSSA 3M3MA 2C1YA 3ZLPA 3IRAA 3ZVJA 2HXKA 3DWVA 3QCPA 3CYNA 4GLTA 3BCKA 1NSWA 1OKDA 4XTSA 2H72A 1M7TA 1O6JA 4HU9A 1KBNA 3GV1A 1O85A 4TW5A 1K0OA 4USSA 1V58A 4V2MA 2B6MA 3P2AA 2I3YA 2K8VA 5ECRB 1XCCA 4K9ZA 2IFQB 1F3AA 3Q19A 4KX4A 2X8GA 2FGXA 5CP1A 2LNSA 1ACVA 17GSA 3GH9A 9GSSA 2IMDA 2CVKA 1ILOA 3FR6A 1DBYA 2YCDA 4OFMA 2P31A 13GSA 4GSSA 1NHYA 2DJ3A 4IP1A 3ED3A 4IBPA 2I81A 2AV4A 1W4VA 2GVPA 3MAKA 4XRDA 6GSUA 1TU7A 4DSQA 3UVHA 5FHIA 3VPTA 1SL1B 4PUAA 2X8CA 1XOBA 3FK8A 3HVSA 3E3EA 2KUCA 3GA4A 3FZ9A 1E6BA 3L4NA 4ZBBA 2O7KA 5ECQB 3IHQA 4F82A 1YKCA 1YF1A 5B6MA 1TRWA 2Z9SA 5GZZB 1R7HA 2OBIA 20GSA 5B8BA 3C8EA 3PGTA 2IFQA 2YANA 3FR9A 4RI7A 4HZ4A 1GUHA 4GWRA 5E59A 5DALB 4BL7B 3C7MA 2LQOA 1HNCA 1SYRA 5DAKB 1E2YA 5IMVA 5B8AA 5AN1A 3TB2A 3TGZA 4KGIA 2KHPA 2GSTA 3HCZA 2E2GA 3R2QA 4IHUA 2E2MA 4POKA 3FZ4A 3IBHA 4Q5FA 1QQ2A 3GTUB 2YV7A 3ZL5A 3U6VA 2V32A 4MA9A 3ZREA 1KTEA 4FQUA 5J41A 2GS3A 1EOHA 3HD5A 3MSZA 4EC0A 4XHMA 4KA0A 2OBKA 2LJKA 3FHKA 3AY8A 1X0RA 2H73A 1GWCA 3QR6A 4Q5NA 1V40A 2K6VA 2FD3A 3KH7A 2VLVA 1VF2A 3LYKA 3WT1A 3O3TA 5CRHA 2JZTA 5DALA 4KF9A 2DJ1A 1Y6EA 4BL7A 3V1WA 4MH2A 1TKDB 5EPFA 4I2UA 3LQ7A 4CHSA 3HHVA 5DAKA 3L0HA 2IJYA 2VUPA 3BOAA 4EE0A 3FRCA 3QAVA 2LJAA 1K0MA 6GSWA 3GN3A 3D5JA 2OJLA 2GTUA 4J57E 4K0GA 3L9UA 4TXOB 4BA7A 4GRFA 3KIJA 3VWXA 4O32A 6GSSA 3GTUA 2EIOA 2YN1A 1N8JA 2I9HA 2RM6A 5JCGA 3BBYA 5G1LA 1PKWA 3CRTA 1GP1A 4MLYA 4EL1A 2IMEA 2HRAA 2TIRA 5DJLA 2VCVA 2MMNA 4WBJA 5D9TA 5G5EA 5F0GA 1QK8A 1OC3A 3DEXA 2P5QA 5IOXA 3TJFA 4RI6A 1T4YA 1WMJA 2H1AA 2H74A 4BVYB 1G0TA 2IIYA 2X64A 1U3AA 2LTKA 3LXZA 4OD7A 2V6OA 4MJAA 2A2RA 2VM1A 4V1Ag 4NV2A 3M9JA 2PMTA 1TI3A 2AYTA 2DBCA 4GSTA 3H8QA 2F8FA 1EZKA 2RUFA 1T00A 4TXOA 4ZB9A 2C3NA 22GSA 2H75A 1SKSB 2ZUPA 5C00A 1OYJA 2WRTA 4XCSA 2MMAA 4TN8A 1WPIA 1AW9A 2R2JA 4EDYA 2VD1A 2C80A 2P0GA 1CQGA 3KMNA 4NAXA 3ZMLA 5HFIA 2PVQA 4BVYA 5HR2A 1TRVA 3RHBA 5KN2A 4X43A 4ML6A 6GSXA 3RAZA 2H66A 1QMVA 4I2TA 3GL5A 2C0EA 2IMIA 4PNFA 4WF5A 3TKRA 3QAWA 1DE1A 2DIYA 5J5NA 2YJHA 2IMKA 2PUKC 4GQFA 4ZBDA 1FG4A 1YEPA 2H6YA 2L6CA 2VOCA 3D4TA 3GKMA 4Q5QA 3GSTA 5IPHA 1EGRA 3GRXA 5ECSA 1F6MC
chains in the Genus database with same CATH superfamily
1ST9A 3QDNA 2CAQA 3IR4A 1BEDA 2VCTA 1HNBA 5D9WA 5D96A 1M3JA 1AQVA 4I6XA 2EIQA 2DIZA 4GF0A 2H6XA 1ERUA 1OKTA 2IL3A 1O81A 1GSQA 5D73A 4KAEA 1VF3A 1SJZA 3QD9A 5EY6A 4G19A 3GHAA 5HR1A 2MBSA 1F37A 5ECMB 4KSMA 1GH2A 1SU9A 1Z6MA 4WEYA 3H4KA 4MZWA 4E68A 1YY7A 2CAIA 1XOAA 2R0GA 4RQRA 1V57A 3EC3A 1U6TA 4N30A 3TJJA 3FYGA 1WE0A 4ZL9A 1ML6A 1BYEA 2GZZA 4RQXA 1MTCA 4AKIA 4JRRA 2EIRA 1UVZA 6GSVA 5JWOB 3BCIA 1JFUA 3UIWA 1XG8A 3I9V2 3CTGA 3IAM2 4F03A 3Q6OA 1Y25A 1Y1UA 1A0RP 2VCXA 2F8AA 2FCHA 3UAPA 2A4VA 1AQWA 1FAAA 1WIKA 2YWIA 3A2VA 3RDWA 3F9UA 4E8EA 4ECCA 3F6DA 1ZYPA 1SVOA 1TTZA 2B5YA 1I9DA 3FZAA 4AI6A 1FVJA 4JEDA 1YEXA 3A2XA 1J9BA 4JR4A 4KNDA 1FO5A 2FWHA 2HSHA 2B1LA 2VL2C 1AIUA 2HYXA 4BWQA 1M9AA 5HFKA 3TUEA 3ZTLA 2H19A 4POMA 3FY7A 1F2EA 4O5QA 4AF2A 3CSJA 2D2ZA 3IPZA 2VKZG 2I4AA 2VCWA 1MDIA 2VL2A 1O8WA 5ECIB 2H0HA 3HKRA 4G10A 2DJ0A 2ALBA 4HQSA 2IMFA 2JACA 2VCQA 2P5RA 2PERA 3GURA 4OFNA 2NPBA 1GLQA 2DSAA 3HXSA 3ZFBA 2HE3A 1ON4A 3IHGA 1Z9HA 4O5UA 2FHEA 4ACSA 1Z6NA 6GSYA 1GSUA 1A0FA 4PXOA 4I8BA 2GT6A 1Z7RA 5ECKB 1XPVA 4JE1A 2PWJA 4EDZA 2UZ8A 2E7PA 3EU4A 3IXRA 4AJ8A 5JWRB 2LRNA 2QKEA 4G0LA 5B7CA 3P7XA 1GTAA 3WD6A 5FT3A 2PBJA 1PA3A 1BAYA 2KLXA 4WBRD 1QXHA 1JZDA 4PQHA 4EXJA 3TCOA 3LGCA 3HDCA 1SL2B 3VWVA 1FOVA 2OE1A 4FYBA 1X9MB 1MD3A 3ME8A 2HI7A 1OC9B 1VRSD 3LJRA 2G0FA 4DVCA 4IGJA 5JCUA 5IO2A 2NVLA 2L4QA 2DMMA 4CDOA 5GAND 3RPPA 1XFLA 4Z2RA 2OADA 1X5EA 2RLIA 1V2AA 2GDRA 3GMFA 2VL9A 4IVFA 4KDYA 2C0DA 1XWAA 4K7IA 1CQHA 4KW6A 2QA2A 4HZ2A 3EURA 4IQ1A 2F9SA 4N0ZA 3UARA 2CA8A 2OA7A 3G7YA 5A4VA 1OAZA 1Z3EA 3DKSA 2YZUA 3GX0A 2LRTA 2V6KA 5J3RA 1GRXA 2LJRA 4V2LA 2EC4A 4ZILA 4GQCA 4F9ZA 4PGTA 4NHWA 1I5GA 4EUYA 2DJ2A 2ES7A 4OWYA 2V41A 4IKHA 5DCHA 3CMIA 3VI5A 1TRSA 3J7Yb 4HU7A 4DSSB 1JZOA 3DIEA 2LNTA 1OC9A 1GULA 2HRKB 2B5XA 1PGTA 4F0BA 4JZQA 1K0CA 4G9HA 3RPNA 4IP6A 2H8LA 4YQMA 2WDUA 5ENUA 3ERGA 4I97A 3C73A 4MJEA 4IS0A 5ECPB 1M2DA 3CRUA 2JSZA 2REMA 4G2EA 3KGKA 5HR3A 4V1Ap 5BMUB 1T4ZA 2YWOA 4MK3A 1VGLA 4EKZA 2AAWA 3FMWA 3CQFA 4O5RA 4MH3A 2I1UA 2X99A 1URMA 1S3AA 2WW1A 4QL9A 3HY2A 2C4JA 2X4AA 1H4OA 1AAZA 5J47A 3O76A 3F8UA 1BG5A 5IMFA 3A5IA 4CW9A 3ZITA 1LJRA 2MZCA 4DSSA 1JLWA 2N5AA 3VI7A 2N5FA 4HJMA 3LSZA 1ERWA 1TK5B 2HRKA 3A2WA 1SK2A 1EOGA 1ERTA 4YAVA 4NXIA 2R4VA 1T3BA 1T1VA 1B8XA 2WFCA 2IWTA 4WXTA 4LL4B 3KCMA 4K1FA 5BMUA 1THXA 5INYA 5D93A 4MF6A 3L9SA 3OR5A 1M9BA 1O73A 5CRWA 3DMLA 4IW9A 2YWMA 1GLPA 1QFNA 3KH9A 2LS5A 4MF7A 3D22A 1NM3A 1PL1A 3UBLA 1XWCA 2LQQA 1TK0B 1U87A 1ZMAA 2J9HA 4POBA 3LYPA 5A5KA 1A2JA 2K18A 1NW2A 1JHBA 1AUCA 3D21A 1K0DA 12GSA 4DEJA 4F0CA 2NBSA 2NTOA 2GSRA 1XZOA 3IV4A 3GYKA 2H1LA 5ECHB 2GSQA 4ECIA 1B9YC 2WB9A 4LMWA 1T7PB 1XW9A 5ECOB 1SENA 3C1RA 4L0WA 2OE3A 1FW1A 1EWXA 2RIIA 4AKGA 2WULA 5CAXA 3EE2A 2KP1A 1J0FA 3KXOA 1YDKA 3VWWA 4X4JA 3APSA 2AHEA 4ZL7A 1XVWA 4PQ1A 3PR8A 4WETA 3NOFA 4K2XA 1VF4A 3I6AA 1X9SB 4K6XA 3EWLA 2HLSA 3FZ5A 1U3IA 4MZBA 2VL3A 2A4HA 2VM2A 3UEMA 1YEWC 1A2MA 5KN1A 1TRUA 3M9KA 1PSQA 3M0FA 3S9FA 5LNKe 3RFRC 3ERWA 3KD0A 1Q4JA 1XW6A 3LXTA 1PD21 1BF5A 3GUSA 2OE0A 4LMVA 3TOTA 3KZQA 1AXDA 3GFKA 2X8HA 5ELAA 2R0CA 1ZOFA 1OC8A 3DYRA 5CNWA 2IN3A 1TU8A 5C04A 5G30A 2WCIA 3G9BA 2O3EA 1TI1A 4Z2TA 2WW0A 2VD0A 2GLRA 2EFCA 1M3IA 5F07A 3VK9A 1A8LA 1G7EA 4HQZA 2FUG2 3UOMA 10GSA 1LU4A 2V2GA 5ABRA 5DBQA 4XS4B 2LKUA 1W89A 3F3RA 2MBTA 2GQMA 3N5OA 2AB6A 4LA1A 4ZL8A 1PFOA 3F0IA 3WGDA 5LD0A 3HZ8A 3WGXA 4TRXA 4NV5A 1PKZA 5J4YA 1YJ6A 4YKFA 5AISA 1TJDA 3LWAA 3D0ZA 2HRFA 5IO0A 1V98A 1A2LA 2LUSA 4K5RA 4XS6A 2VO4A 2H0IA 4EO3A 3IK7A 1MDJA 3HVVA 5KOXA 2HT9A 1YKAA 1M0UA 3BD2A 2HQTA 1USBA 4ZBAA 4P3YB 4N10A 1M2AA 1S3DA 2XBQA 1Z7PA 2B7JA 2C3QA 5IMCA 1M2BA 2JZSA 2M80A 1X5CA 5H5QA 2H0GA 1TXUA 3TKSC 4MMMA 4ID0A 4XS4A 2MYGA 1ZZYA 2O89A 1SL0B 5JWQB 1EGOA 1GTIA 4MPFA 4RUVA 5F05A 3TKSA 4PTSA 4KE3A 5IMAA 3TDGA 2HSNB 3L9VA 3M1GA 2A2PA 1H75A 2XHFA 4MCUA 2EFHA 3IAS2 1Z5YE 5G1KA 2YZHA 2E0QA 2L5OA 2HRNA 4AKXB 2DJJA 4NWYA 2AJQB 1XWBA 2QGVA 2YNXA 4FIWA 3IC8A 4F2IA 5IMZA 2GGTA 2VLUA 2OACA 4PNGA 3W8SA 2YOIA 2XPEA 1UN2A 2PU9C 2V1MA 2TRCP 3IK9A 3Q18A 2CVBA 3IA1A 2FWEA 1TXXA 2L6DA 5G5FA 1YF0A 1EV9A 1XWKA 2FA8A 3FKFA 3TRPA 4L5OA 3H79A 4G01A 2WVYA 3ZIJA 1TDIA 1BX9A 3TJBA 3CHXC 4WKWA 1RW1A 1BQ7A 4PHZC 5AIVA 2DJKA 2HSNA 2CQ9A 4ILFA 1SJIA 4NPBA 2HZEB 3TJKA 4TXVA 2LSTA 2B5EA 3GSSA 3VFIA 2WZ9A 3KMOA 4YAPA 4YQVA 3GKXA 1JZRA 2LV3A 2NDOA 1SVLA 5KN3A 2B1KA 1MDKA 1FB6A 2H1GA 1XBSA 2L5LA 5IPGA 2R5GA 4IJ3A 1G6YA 3LW9A 3UMAA 2O36A 3WYWA 4KCAA 3HJPA 3LFLA 1R26A 2YJ7A 1T8EB 4KB3A 4ULXA 3TKQA 1GTUA 4K8MA 1TP9A 1V9WA 2VIMA 5H5SA 1XIYA 3MYDA 3KEBA 3DD3A 2C3TA 1HQOA 4BVXB 3CSHA 1KEBA 3US3A 2DMLA 1AC1A 2CX4A 1FB0A 2PN8A 1YVLA 4TR4A 4L8EA 2VCZA 1NHOA 1TW9A 2GQKA 2HZEA 3DGQA 1XXUA 2OKAA 3EMPA 3H93A 5J9CA 1HNAA 4HOJA 4HUAA 3TOUA 3F63A 2JU5A 4MJCA 4TR1B 3K8NA 3JCML 4BPYA 4X1UA 5FWGA 5GAPD 2XPDA 3W8JA 1N25A 2G2QA 1GL8A 1K0BA 1GSFA 5DDLA 1VF1A 1PMTA 5CREA 2BTOT 1SJ6A 3GKKA 1PN0A 4EF0A 3APQA 1G7OA 2GZPA 2CZ3A 1SK0A 3O6TA 4BVXA 6GSTA 3H1NA 3FEUA 1THOA 2XC2A 2N5BA 3HJMA 4J2FA 3ZMKA 4IN0A 3RBTA 4HI7A 2ON7A 3EMXA 4O7HA 4GTUA 1OE8A 4ZB6A 3GL3A 3ZYWA 4XRAA 4OO5A 2A2SA 3R3EA 3CSIA 2C0FA 1R4WA 2H1BA 4TR1A 5G31A 1SKWB 4OFTA 5KOWA 1QUWA 3PPUA 2R6KA 2O87A 3F6FA 1EP8A 2RM5A 5DJMA 1X5DA 1C72A 2GSSA 1WWJA 4K7OA 4KUNA 4KDXA 5AGYA 2BMXA 4OCEA 4KH7A 2PVOC 2YV9A 2HNLA 4ISDA 2WVXB 1MD4A 4JU5A 2HSMB 1GSYA 3HVXA 3D4MA 2ON5A 3VWUA 4K2DA 2KP2A 1B4QA 4MABA 3D6IA 4HEA2 4LLRA 2JL4A 1QGVA 3QMXA 3F3QA 3KP9A 2K8SA 5CO3A 4FXYP 3EPTA 4IJIA 1A23A 3P90A 3PINA 4QQ7A 3MWHA 1J08A 2WGRA 5J4VA 1PQNA 3FW2A 3ZIVA 4QL7A 1WJKA 3QAGA 3MNGA 2H6ZA 3ZVJD 5D8IA 5IQYA 2WS2A 3APOA 3F4RA 3WT2A 5H5RA 2EFEA 4L5LA 19GSA 4PQIA 2DLXA 4AJ6A 3QPMA 3BJ5A 1SKRB 3SBCA 2WVXA 2HSMA 2FWGA 5EL8A 3TJGA 1RK4A 4YH2A 2WJUA 2HFDA 1R5PA 5F06A 3W6GA 1UA5A 5LCZA 4PUFC 3CBUA 3KJYA 2K9FA 4XS1A 1Q98A 1ZYEA 1PL2A 2QSIA 4TR3A 2O8VB 8GSSA 2CX3A 3GH6A 4L0UA 2EFDA 5L71A 4AGSA 4E8HA 1KNGA 2KOKA 4MPGA 3ZRDA 4FYCA 4CY8A 3HJOA 1WRYA 7GSSA 3I43A 2MMOA 5J9BA 4GSNA 5IIZA 1R5AA 4EIPA 1ZL9A 1GUKA 4GDFA 4EVMA 2GT5A 2RUEA 3HYPA 2ZCTA 3N9JA 5DCGA 5E4WA 3C1SA 3HVNA 3NZNA 4TKYA 1SYXA 1RQMA 4OCFA 1TK8B 3ZZXA 3LEFA 5A4UA 3IC4A 1XW5A 4PX1A 3CXGA 2MMZA 5COHA 4TVEA 3KTBA 4MDCA 5A4WA 4X0XA 3RGBC 5IOWA 3J7Yk 2FA4A 1DUGA 2B3SA 1S3CA 2H71A 1A24A 5ELGA 5B6NA 4HJ2A 2DKHA 1EEMA 4MZCA 4WR5A 2R0PA 3U5RE 2J23A 3E9JB 2GQLA 5BRTA 1OE7A 4KSOA 2TRXA 1GUMA 5ID2B 1SK1A 2B7KA 3EINA 1GTBA 1K3YA 4BWSA 4NHZA 4ZIJA 5JCWA 1K3OA 5ECNB 3EU3A 3A3TA 4FYUA 3RHCA 2VAFA 3CWGA 2DKIA 3QFAC 4K7NA 2C8UA 4PI2C 2X49A 5KEJA 2R37A 4I5QA 3EYTA 2WVZA 1PN9A 2YPMA 4MP4A 2YWNA 3TRXA 4EIQA 4WF4A 2JZRA 3LG6A 4MJBA 18GSA 4POLA 1XWGA 1AQXA 2HSYA 2JADA 4J56E 2YP6A 4G0IA 5F8BA 3CTFA 1K3LA 1SD9A 3UJ1A 1GNWA 2H01A 3VURA 1ZCPA 4H86A 3L78A 3IDVA 5ID2A 3FR3A 5EVOA 5AIXA 3G7JA 5J4UA 2R3XA 5ECLB 1EV4A 3GIXA 3PH9A 3VPQA 2L57A 4GCIA 1A8YA 1M99A 1HYUA 3HZ4A 1G6WA 14GSA 3GKNA 1B9XC 2AUVA 1EEJA 2CV4A 1IYIA 4K0NA 4LL1B 3KM6A 4AJ7A 5HQPA 3KP8A 3LORA 16GSA 2BJXA 1K0NA 4KCEA 2F3MA 4TOPA 4N0VA 5GSTA 5G2ZA 1PRXA 4O92A 4MF5A 4OO4A 1K0AA 4NMUA 1GSEA 3M8NA 5KN0A 1JLVA 5A5HA 1ABAA 2XBIA 1IYHA 4PI0C 3DVWA 2DC5A 1MEKA 2H1DA 4YKGA 1BG1A 2VLTA 1BJXA 2FNOA 1WP0A 3TKPA 2IPAA 2L4CA 4G0KA 1OVNA 3VLNA 3ME7A 1U88A 2LRCA 4XIHA 3SWLA 1UC7A 1EP7A 4PURA 4ECJA 4IELA 1GSDA 4ECBA 4D73B 1DE2A 4FO5A 3NIVA 3WGEA 5HR0A 2QC7A 1N2AA 1X9WB 2C0GA 3UVTA 5CYYA 2CZ2A 3ERFA 2H76A 2PGTA 4KDUA 1SD8A 2FLSA 5CRDA 3QOUA 1PX7A 3Q74A 3G7IA 3GX8A 2ZNMA 2LEGA 3C71A 1FOHA 2OT3A 3I69A 3F4TA 3P8WA 1ZGNA 1FHEA 4HDEA 4ZB8A 4Q5RA 3GNJA 5DQYA 2F51A 4HS1A 5D9VA 5D9XA 1PX6A 3UBKA 3UL3A 4V2NA 3HA9A 1XVQA 3ISOA 1ERVA 2GZYA 5DVBA 4WR4A 1O7UA 11GSA 4TR0A 1YQ1A 2H70A 2CT6A 2FWFA 2HZFA 2H30A 4GXZA 1WOUA 4D73A 5HFGA 3TRQA 4JBBA 1FVKA 5IM9A 4N11A 1ZYQB 3IOSA 2O85A 1ZYNA 3TKSE 1O8XA 2M72A 3MDKA 2FY6A 4Z7XA 4ZXGA 3QFBC 4AKHA 4IQAA 3DRNA 5DQSA 2L59A 3KTLA 2JSYA 2M46A 1JZWA 4OMVA 1DSBA 1F3BA 3A5WA 3DVXA 1YZXA 1LBKA 1HD2A 3HMJG 5GSSA 1B48A 5IMDA 3EVIA 4W66A 1B4PA 3IE3A 2PPTA 4FH8A 3DXBA 2CVDA 5CRGA 4Z2UA 3E0UA 4YQUA 1F9MA 1TOFA 4JR6A 3ZFLA 4DSRA 1GNEA 4ML1A 3F4SA 1GSSA 3M3MA 2C1YA 3ZLPA 3IRAA 3ZVJA 2HXKA 3DWVA 5A34B 3QCPA 3CYNA 4GLTA 3BCKA 1NSWA 1OKDA 4XTSA 2H72A 1M7TA 1O6JA 4HU9A 4QMKA 1KBNA 3GV1A 1O85A 4TW5A 1K0OA 4USSA 1V58A 4V2MA 2B6MA 3P2AA 2I3YA 2K8VA 5ECRB 1XCCA 4K9ZA 2IFQB 1F3AA 3Q19A 4KX4A 2X8GA 2UV8G 5J40A 2FGXA 5CP1A 2LNSA 1ACVA 17GSA 3GH9A 9GSSA 4A5PA 2IMDA 2CVKA 1ILOA 2O5VA 3FR6A 1DBYA 2YCDA 4OFMA 2P31A 13GSA 4GSSA 1NHYA 2DJ3A 4IP1A 3ED3A 4IBPA 2I81A 2AV4A 1W4VA 2GVPA 3MAKA 4XRDA 4K5SA 6GSUA 1TU7A 4DSQA 3UVHA 5FHIA 5A34A 3VPTA 1SL1B 4PUAA 2X8CA 1XOBA 3FK8A 3HVSA 3E3EA 2KUCA 3GA4A 3FZ9A 1E6BA 3L4NA 4ZBBA 2O7KA 5ECQB 3IHQA 4F82A 1YKCA 1YF1A 4N3ZA 5B6MA 1TRWA 2Z9SA 5GZZB 1R7HA 2OBIA 20GSA 5B8BA 3C8EA 3PGTA 2IFQA 2YANA 3FR9A 4RI7A 4HZ4A 1GUHA 4GWRA 5E59A 5DALB 4BL7B 3C7MA 2LQOA 1S4BP 1HNCA 1SYRA 3TU3B 5DAKB 1E2YA 5IMVA 5B8AA 5AN1A 3TB2A 3TGZA 4KGIA 2KHPA 2GSTA 3HCZA 2E2GA 3R2QA 4IHUA 2E2MA 4POKA 3FZ4A 3IBHA 4Q5FA 1QQ2A 3GTUB 2YV7A 3ZL5A 3U6VA 2V32A 4MA9A 3ZREA 1KTEA 4FQUA 5J41A 2GS3A 1S3RA 1I1IP 1EOHA 4BIKA 3HD5A 3MSZA 4EC0A 4XHMA 4KA0A 3MIXA 2OBKA 2LJKA 3FHKA 3AY8A 1X0RA 2H73A 1GWCA 3QR6A 4Q5NA 1V40A 2K6VA 2FD3A 3KH7A 2VLVA 1VF2A 3LYKA 3WT1A 3O3TA 5CRHA 2JZTA 5DALA 4KF9A 2DJ1A 1Y6EA 4BL7A 3V1WA 4MH2A 1TKDB 5EPFA 4I2UA 3LQ7A 4CHSA 3HHVA 5DAKA 3L0HA 2IJYA 2VUPA 3BOAA 4EE0A 4ZB7A 4ICYA 3FRCA 3QAVA 2LJAA 1K0MA 6GSWA 5A1NB 3GN3A 3D5JA 2OJLA 2GTUA 4J57E 4K0GA 3L9UA 4TXOB 4BA7A 4GRFA 3KIJA 3VWXA 4O32A 6GSSA 3GTUA 2EIOA 2YN1A 1N8JA 2I9HA 2RM6A 5JCGA 3BBYA 5G1LA 1PKWA 2WW3A 3CRTA 1GP1A 4MLYA 4EL1A 2QA1A 2IMEA 2HRAA 2TIRA 5DJLA 2VCVA 2MMNA 4WBJA 5D9TA 5G5EA 5F0GA 1QK8A 1OC3A 3DEXA 2P5QA 5IOXA 3TJFA 4RI6A 1T4YA 1SVMA 1WMJA 2H1AA 2H74A 4BVYB 1G0TA 2IIYA 4MNNA 2X64A 1U3AA 2LTKA 3LXZA 4OD7A 2V6OA 4MJAA 2A2RA 2VM1A 4V1Ag 4NV2A 3M9JA 2PMTA 1TI3A 2AYTA 2DBCA 5A1NA 4GSTA 3H8QA 2F8FA 1EZKA 2RUFA 4HSCX 1T00A 4TXOA 4ZB9A 2C3NA 22GSA 2H75A 1SKSB 2ZUPA 5C00A 1OYJA 2WRTA 4XCSA 2MMAA 4TN8A 1WPIA 2WW2A 1AW9A 2R2JA 4EDYA 4CY6A 2VD1A 2C80A 2WZSA 2P0GA 1CQGA 3KMNA 4NAXA 3ZMLA 5HFIA 2PVQA 4BVYA 5HR2A 1TRVA 3RHBA 5KN2A 4X43A 4ML6A 6GSXA 3RAZA 5A5HB 2H66A 1QMVA 4I2TA 3GL5A 2C0EA 2IMIA 4PNFA 4WF5A 3TKRA 3QAWA 1DE1A 2DIYA 5J5NA 2YJHA 2IMKA 2PUKC 4GQFA 4ZBDA 1FG4A 1YEPA 2H6YA 2L6CA 2VOCA 3D4TA 3GKMA 4Q5QA 3GSTA 5IPHA 1EGRA 3GRXA 5ECSA 1F6MC
chains in the Genus database with same CATH topology
1ST9A 3QDNA 2CAQA 3IR4A 1BEDA 2VCTA 1HNBA 5D9WA 5D96A 1AQVA 4I6XA 2EIQA 2DIZA 4GF0A 2H6XA 1ERUA 1OKTA 2IL3A 1O81A 1GSQA 5D73A 4KAEA 1VF3A 1SJZA 3QD9A 5EY6A 4G19A 3GHAA 5HR1A 2MBSA 1F37A 5ECMB 4KSMA 1GH2A 1SU9A 1Z6MA 4WEYA 3H4KA 4MZWA 4E68A 1YY7A 2CAIA 1XOAA 2R0GA 4RQRA 1V57A 3EC3A 1U6TA 4N30A 3TJJA 3FYGA 1WE0A 4ZL9A 1ML6A 1BYEA 2GZZA 4RQXA 1MTCA 4AKIA 4JRRA 2EIRA 1UVZA 6GSVA 5JWOB 3BCIA 1JFUA 3UIWA 3I9V2 3CTGA 3IAM2 4F03A 3Q6OA 1Y25A 1Y1UA 1A0RP 2VCXA 2F8AA 2FCHA 3UAPA 2A4VA 1AQWA 1FAAA 1WIKA 2YWIA 3A2VA 3RDWA 3F9UA 4E8EA 4ECCA 3F6DA 1ZYPA 1SVOA 1TTZA 2B5YA 1I9DA 3FZAA 4AI6A 1FVJA 4JEDA 1YEXA 3A2XA 1J9BA 4JR4A 4KNDA 1FO5A 2FWHA 2HSHA 2B1LA 2VL2C 1AIUA 2HYXA 4BWQA 1M9AA 5HFKA 3TUEA 3ZTLA 2H19A 4POMA 3FY7A 1F2EA 4O5QA 4AF2A 3CSJA 2D2ZA 3IPZA 2VKZG 2I4AA 2VCWA 1MDIA 2VL2A 1O8WA 5ECIB 2H0HA 3HKRA 4G10A 2DJ0A 2ALBA 4HQSA 2IMFA 2JACA 2VCQA 2P5RA 2PERA 3GURA 4OFNA 2NPBA 1GLQA 2DSAA 3HXSA 3ZFBA 2HE3A 1ON4A 3IHGA 1Z9HA 4O5UA 2FHEA 4ACSA 1Z6NA 6GSYA 1GSUA 1A0FA 4PXOA 4I8BA 2GT6A 1Z7RA 5ECKB 1XPVA 4JE1A 2PWJA 4EDZA 2UZ8A 2E7PA 3EU4A 3IXRA 4AJ8A 5JWRB 2LRNA 2QKEA 4G0LA 5B7CA 3P7XA 1GTAA 3WD6A 5FT3A 2PBJA 1PA3A 1BAYA 2KLXA 4WBRD 1QXHA 1JZDA 4PQHA 4EXJA 3TCOA 3LGCA 3HDCA 1SL2B 3VWVA 1FOVA 2OE1A 4FYBA 1X9MB 1MD3A 3ME8A 2HI7A 1OC9B 1VRSD 3LJRA 2G0FA 4DVCA 4IGJA 5JCUA 5IO2A 2NVLA 2L4QA 2DMMA 4CDOA 5GAND 3RPPA 1XFLA 4Z2RA 2OADA 1X5EA 2RLIA 1V2AA 2GDRA 3GMFA 2VL9A 4IVFA 4KDYA 2C0DA 1XWAA 4K7IA 1CQHA 4KW6A 2QA2A 4HZ2A 3EURA 4IQ1A 2F9SA 4N0ZA 3UARA 2CA8A 2OA7A 3G7YA 5A4VA 1OAZA 1Z3EA 3DKSA 2YZUA 3GX0A 2LRTA 2V6KA 5J3RA 1GRXA 2LJRA 4V2LA 2EC4A 4ZILA 4GQCA 4F9ZA 4PGTA 4NHWA 1I5GA 4EUYA 2DJ2A 2ES7A 4OWYA 2V41A 4IKHA 5DCHA 3CMIA 3VI5A 1TRSA 3J7Yb 4HU7A 4DSSB 1JZOA 3DIEA 2LNTA 1OC9A 1GULA 2HRKB 2B5XA 1PGTA 4F0BA 4JZQA 1K0CA 4G9HA 3RPNA 4IP6A 2H8LA 4YQMA 2WDUA 5ENUA 3ERGA 4I97A 3C73A 4MJEA 4IS0A 5ECPB 1M2DA 3CRUA 2JSZA 2REMA 4G2EA 3KGKA 5HR3A 4V1Ap 5BMUB 1T4ZA 2YWOA 4MK3A 1VGLA 4EKZA 2AAWA 3FMWA 4O5RA 4MH3A 2I1UA 2X99A 1URMA 1S3AA 4QL9A 3HY2A 2C4JA 2X4AA 1H4OA 1AAZA 5J47A 3O76A 3F8UA 1BG5A 5IMFA 3A5IA 4CW9A 3ZITA 1LJRA 2MZCA 4DSSA 1JLWA 2N5AA 3VI7A 2N5FA 4HJMA 3LSZA 1ERWA 1TK5B 2HRKA 3A2WA 1SK2A 1EOGA 1ERTA 4YAVA 4NXIA 2R4VA 1T3BA 1T1VA 1B8XA 2WFCA 2IWTA 4WXTA 4LL4B 3KCMA 4K1FA 5BMUA 1THXA 5INYA 5D93A 4MF6A 3L9SA 3OR5A 1M9BA 1O73A 5CRWA 3DMLA 4IW9A 2YWMA 1GLPA 1QFNA 3KH9A 2LS5A 4MF7A 3D22A 1NM3A 1PL1A 3UBLA 1XWCA 2LQQA 1TK0B 1U87A 1ZMAA 2J9HA 4POBA 3LYPA 5A5KA 1A2JA 2K18A 1NW2A 1JHBA 1AUCA 3D21A 1K0DA 12GSA 4DEJA 4F0CA 2NBSA 2NTOA 2GSRA 1XZOA 3IV4A 3GYKA 2H1LA 5ECHB 2GSQA 4ECIA 1B9YC 2WB9A 4LMWA 1T7PB 1XW9A 5ECOB 1SENA 3C1RA 4L0WA 2OE3A 1FW1A 1EWXA 2RIIA 4AKGA 2WULA 5CAXA 3EE2A 2KP1A 1J0FA 3KXOA 1YDKA 3VWWA 4X4JA 3APSA 2AHEA 4ZL7A 1XVWA 4PQ1A 3PR8A 4WETA 3NOFA 4K2XA 1VF4A 3I6AA 1X9SB 4K6XA 3EWLA 2HLSA 3FZ5A 1U3IA 4MZBA 2VL3A 2A4HA 2VM2A 3UEMA 1A2MA 5KN1A 1TRUA 3M9KA 1PSQA 3M0FA 3S9FA 5LNKe 3ERWA 3KD0A 1Q4JA 1XW6A 3LXTA 1PD21 1BF5A 3GUSA 2OE0A 4LMVA 3TOTA 3KZQA 1AXDA 3GFKA 2X8HA 5ELAA 2R0CA 1ZOFA 1OC8A 3DYRA 5CNWA 2IN3A 1TU8A 5C04A 5G30A 2WCIA 3G9BA 1TI1A 4Z2TA 2VD0A 2GLRA 2EFCA 5F07A 3VK9A 1A8LA 1G7EA 4HQZA 2FUG2 3UOMA 10GSA 1LU4A 2V2GA 5ABRA 5DBQA 4XS4B 2LKUA 1W89A 3F3RA 2MBTA 2GQMA 3N5OA 2AB6A 4LA1A 4ZL8A 3F0IA 3WGDA 5LD0A 3HZ8A 3WGXA 4TRXA 4NV5A 1PKZA 5J4YA 1YJ6A 4YKFA 5AISA 1TJDA 3LWAA 3D0ZA 2HRFA 5IO0A 1V98A 1A2LA 2LUSA 4K5RA 4XS6A 2VO4A 2H0IA 4EO3A 3IK7A 1MDJA 3HVVA 5KOXA 2HT9A 1YKAA 1M0UA 3BD2A 2HQTA 1USBA 4ZBAA 4P3YB 4N10A 1M2AA 1S3DA 2XBQA 1Z7PA 2B7JA 2C3QA 5IMCA 1M2BA 2JZSA 2M80A 1X5CA 5H5QA 2H0GA 1TXUA 3TKSC 4MMMA 4ID0A 4XS4A 2MYGA 1ZZYA 2O89A 1SL0B 5JWQB 1EGOA 1GTIA 4MPFA 4RUVA 5F05A 3TKSA 4PTSA 4KE3A 5IMAA 3TDGA 2HSNB 3L9VA 3M1GA 2A2PA 1H75A 2XHFA 4MCUA 2EFHA 3IAS2 1Z5YE 5G1KA 2YZHA 2E0QA 2L5OA 2HRNA 4AKXB 2DJJA 4NWYA 2AJQB 1XWBA 2QGVA 2YNXA 4FIWA 3IC8A 4F2IA 5IMZA 2GGTA 2VLUA 2OACA 4PNGA 3W8SA 2YOIA 2XPEA 1UN2A 2PU9C 2V1MA 2TRCP 3IK9A 3Q18A 2CVBA 3IA1A 2FWEA 1TXXA 2L6DA 5G5FA 1YF0A 1EV9A 1XWKA 2FA8A 3FKFA 3TRPA 4L5OA 3H79A 4G01A 3ZIJA 1TDIA 1BX9A 3TJBA 4WKWA 1RW1A 1BQ7A 5AIVA 2DJKA 2HSNA 2CQ9A 4ILFA 1SJIA 4NPBA 2HZEB 3TJKA 4TXVA 2LSTA 2B5EA 3GSSA 3VFIA 2WZ9A 3KMOA 4YAPA 4YQVA 3GKXA 1JZRA 2LV3A 2NDOA 1SVLA 5KN3A 2B1KA 1MDKA 1FB6A 2H1GA 1XBSA 2L5LA 5IPGA 2R5GA 4IJ3A 1G6YA 3LW9A 3UMAA 3WYWA 4KCAA 3HJPA 3LFLA 1R26A 2YJ7A 1T8EB 4KB3A 4ULXA 3TKQA 1GTUA 4K8MA 1TP9A 1V9WA 2VIMA 5H5SA 1XIYA 3MYDA 3KEBA 3DD3A 2C3TA 1HQOA 4BVXB 3CSHA 1KEBA 3US3A 2DMLA 1AC1A 2CX4A 1FB0A 2PN8A 1YVLA 4TR4A 4L8EA 2VCZA 1NHOA 1TW9A 2GQKA 2HZEA 3DGQA 1XXUA 2OKAA 3EMPA 3H93A 5J9CA 1HNAA 4HOJA 4HUAA 3TOUA 3F63A 2JU5A 4MJCA 4TR1B 3K8NA 3JCML 4BPYA 4X1UA 5FWGA 5GAPD 2XPDA 3W8JA 1N25A 2G2QA 1GL8A 1K0BA 1GSFA 5DDLA 1VF1A 1PMTA 5CREA 2BTOT 1SJ6A 3GKKA 1PN0A 4EF0A 3APQA 1G7OA 2GZPA 2CZ3A 1SK0A 3O6TA 4BVXA 6GSTA 3H1NA 3FEUA 1THOA 2XC2A 2N5BA 3HJMA 4J2FA 3ZMKA 4IN0A 3RBTA 4HI7A 2ON7A 3EMXA 4O7HA 4GTUA 1OE8A 4ZB6A 3GL3A 3ZYWA 4XRAA 4OO5A 2A2SA 3R3EA 3CSIA 2C0FA 1R4WA 2H1BA 4TR1A 5G31A 1SKWB 4OFTA 5KOWA 1QUWA 3PPUA 2R6KA 2O87A 3F6FA 1EP8A 2RM5A 5DJMA 1X5DA 1C72A 2GSSA 1WWJA 4K7OA 4KUNA 4KDXA 5AGYA 2BMXA 4OCEA 4KH7A 2PVOC 2YV9A 2HNLA 4ISDA 1MD4A 4JU5A 2HSMB 1GSYA 3HVXA 3D4MA 2ON5A 3VWUA 4K2DA 2KP2A 1B4QA 4MABA 3D6IA 4HEA2 4LLRA 2JL4A 1QGVA 3QMXA 3F3QA 3KP9A 2K8SA 5CO3A 3EPTA 4IJIA 1A23A 3P90A 3PINA 4QQ7A 3MWHA 1J08A 2WGRA 5J4VA 1PQNA 3FW2A 3ZIVA 4QL7A 1WJKA 3QAGA 3MNGA 2H6ZA 3ZVJD 5D8IA 5IQYA 2WS2A 3APOA 3F4RA 3WT2A 5H5RA 2EFEA 4L5LA 19GSA 4PQIA 2DLXA 4AJ6A 3QPMA 3BJ5A 1SKRB 3SBCA 2HSMA 2FWGA 5EL8A 3TJGA 1RK4A 4YH2A 2WJUA 2HFDA 1R5PA 5F06A 3W6GA 1UA5A 5LCZA 4PUFC 3CBUA 3KJYA 2K9FA 4XS1A 1Q98A 1ZYEA 1PL2A 2QSIA 4TR3A 2O8VB 8GSSA 2CX3A 3GH6A 4L0UA 2EFDA 5L71A 4AGSA 4E8HA 1KNGA 2KOKA 4MPGA 3ZRDA 4FYCA 4CY8A 3HJOA 1WRYA 7GSSA 3I43A 2MMOA 5J9BA 4GSNA 5IIZA 1R5AA 4EIPA 1ZL9A 1GUKA 4GDFA 4EVMA 2GT5A 2RUEA 3HYPA 2ZCTA 3N9JA 5DCGA 5E4WA 3C1SA 3NZNA 4TKYA 1SYXA 1RQMA 4OCFA 1TK8B 3ZZXA 3LEFA 5A4UA 3IC4A 1XW5A 4PX1A 3CXGA 2MMZA 5COHA 4TVEA 3KTBA 4MDCA 5A4WA 4X0XA 5IOWA 3J7Yk 2FA4A 1DUGA 2B3SA 1S3CA 2H71A 1A24A 5ELGA 5B6NA 4HJ2A 2DKHA 1EEMA 4MZCA 4WR5A 2R0PA 3U5RE 2J23A 3E9JB 2GQLA 5BRTA 1OE7A 4KSOA 2TRXA 1GUMA 5ID2B 1SK1A 2B7KA 3EINA 1GTBA 1K3YA 4BWSA 4NHZA 4ZIJA 5JCWA 1K3OA 5ECNB 3EU3A 3A3TA 4FYUA 3RHCA 2VAFA 3CWGA 2DKIA 3QFAC 4K7NA 2C8UA 2X49A 5KEJA 2R37A 4I5QA 3EYTA 1PN9A 2YPMA 4MP4A 2YWNA 3TRXA 4EIQA 4WF4A 2JZRA 3LG6A 4MJBA 18GSA 4POLA 1XWGA 1AQXA 2HSYA 2JADA 4J56E 2YP6A 4G0IA 5F8BA 3CTFA 1K3LA 1SD9A 3UJ1A 1GNWA 2H01A 3VURA 1ZCPA 4H86A 3L78A 3IDVA 5ID2A 3FR3A 5EVOA 5AIXA 3G7JA 5J4UA 2R3XA 5ECLB 1EV4A 3GIXA 3PH9A 3VPQA 2L57A 4GCIA 1A8YA 1M99A 1HYUA 3HZ4A 1G6WA 14GSA 3GKNA 1B9XC 2AUVA 1EEJA 2CV4A 1IYIA 4K0NA 4LL1B 3KM6A 4AJ7A 5HQPA 3KP8A 3LORA 16GSA 2BJXA 1K0NA 4KCEA 2F3MA 4TOPA 4N0VA 5GSTA 5G2ZA 1PRXA 4O92A 4MF5A 4OO4A 1K0AA 4NMUA 1GSEA 3M8NA 5KN0A 1JLVA 5A5HA 1ABAA 2XBIA 1IYHA 3DVWA 2DC5A 1MEKA 2H1DA 4YKGA 1BG1A 2VLTA 1BJXA 2FNOA 1WP0A 3TKPA 2IPAA 2L4CA 4G0KA 1OVNA 3VLNA 3ME7A 1U88A 2LRCA 4XIHA 3SWLA 1UC7A 1EP7A 4PURA 4ECJA 4IELA 1GSDA 4ECBA 4D73B 1DE2A 4FO5A 3NIVA 3WGEA 5HR0A 2QC7A 1N2AA 1X9WB 2C0GA 3UVTA 5CYYA 2CZ2A 3ERFA 2H76A 2PGTA 4KDUA 1SD8A 2FLSA 5CRDA 3QOUA 1PX7A 3Q74A 3G7IA 3GX8A 2ZNMA 2LEGA 3C71A 1FOHA 2OT3A 3I69A 3F4TA 3P8WA 1ZGNA 1FHEA 4HDEA 4ZB8A 4Q5RA 3GNJA 5DQYA 2F51A 4HS1A 5D9VA 5D9XA 1PX6A 3UBKA 3UL3A 4V2NA 3HA9A 1XVQA 3ISOA 1ERVA 2GZYA 5DVBA 4WR4A 1O7UA 11GSA 4TR0A 1YQ1A 2H70A 2CT6A 2FWFA 2HZFA 2H30A 4GXZA 1WOUA 4D73A 5HFGA 3TRQA 4JBBA 1FVKA 5IM9A 4N11A 1ZYQB 3IOSA 2O85A 1ZYNA 3TKSE 1O8XA 2M72A 3MDKA 2FY6A 4Z7XA 4ZXGA 3QFBC 4AKHA 4IQAA 3DRNA 5DQSA 2L59A 3KTLA 2JSYA 2M46A 1JZWA 4OMVA 1DSBA 1F3BA 3A5WA 3DVXA 1YZXA 1LBKA 1HD2A 3HMJG 5GSSA 1B48A 5IMDA 3EVIA 4W66A 1B4PA 3IE3A 2PPTA 4FH8A 3DXBA 2CVDA 5CRGA 4Z2UA 3E0UA 4YQUA 1F9MA 1TOFA 4JR6A 3ZFLA 4DSRA 1GNEA 4ML1A 3F4SA 1GSSA 3M3MA 2C1YA 3ZLPA 3IRAA 3ZVJA 2HXKA 3DWVA 5A34B 3QCPA 3CYNA 4GLTA 3BCKA 1NSWA 1OKDA 4XTSA 2H72A 1M7TA 1O6JA 4HU9A 4QMKA 1KBNA 3GV1A 1O85A 4TW5A 1K0OA 4USSA 1V58A 4V2MA 2B6MA 3P2AA 2I3YA 2K8VA 5ECRB 1XCCA 4K9ZA 2IFQB 1F3AA 3Q19A 4KX4A 2X8GA 2UV8G 5J40A 2FGXA 5CP1A 2LNSA 1ACVA 17GSA 3GH9A 9GSSA 4A5PA 2IMDA 2CVKA 1ILOA 2O5VA 3FR6A 1DBYA 2YCDA 4OFMA 2P31A 13GSA 4GSSA 1NHYA 2DJ3A 4IP1A 3ED3A 4IBPA 2I81A 2AV4A 1W4VA 2GVPA 3MAKA 4XRDA 4K5SA 6GSUA 1TU7A 4DSQA 3UVHA 5FHIA 5A34A 3VPTA 1SL1B 4PUAA 2X8CA 1XOBA 3FK8A 3HVSA 3E3EA 2KUCA 3GA4A 3FZ9A 1E6BA 3L4NA 4ZBBA 2O7KA 5ECQB 3IHQA 4F82A 1YKCA 1YF1A 4N3ZA 5B6MA 1TRWA 2Z9SA 5GZZB 1R7HA 2OBIA 20GSA 5B8BA 3C8EA 3PGTA 2IFQA 2YANA 3FR9A 4RI7A 4HZ4A 1GUHA 4GWRA 5E59A 5DALB 4BL7B 3C7MA 2LQOA 1HNCA 1SYRA 3TU3B 5DAKB 1E2YA 5IMVA 5B8AA 5AN1A 3TB2A 3TGZA 4KGIA 2KHPA 2GSTA 3HCZA 2E2GA 3R2QA 4IHUA 2E2MA 4POKA 3FZ4A 3IBHA 4Q5FA 1QQ2A 3GTUB 2YV7A 3ZL5A 3U6VA 2V32A 4MA9A 3ZREA 1KTEA 4FQUA 5J41A 2GS3A 1EOHA 3HD5A 3MSZA 4EC0A 4XHMA 4KA0A 3MIXA 2OBKA 2LJKA 3FHKA 3AY8A 1X0RA 2H73A 1GWCA 3QR6A 4Q5NA 1V40A 2K6VA 2FD3A 3KH7A 2VLVA 1VF2A 3LYKA 3WT1A 3O3TA 5CRHA 2JZTA 5DALA 4KF9A 2DJ1A 1Y6EA 4BL7A 3V1WA 4MH2A 1TKDB 5EPFA 4I2UA 3LQ7A 4CHSA 3HHVA 5DAKA 3L0HA 2IJYA 2VUPA 3BOAA 4EE0A 4ZB7A 4ICYA 3FRCA 3QAVA 2LJAA 1K0MA 6GSWA 5A1NB 3GN3A 3D5JA 2OJLA 2GTUA 4J57E 4K0GA 3L9UA 4TXOB 4BA7A 4GRFA 3KIJA 3VWXA 4O32A 6GSSA 3GTUA 2EIOA 2YN1A 1N8JA 2I9HA 2RM6A 5JCGA 3BBYA 5G1LA 1PKWA 3CRTA 1GP1A 4MLYA 4EL1A 2QA1A 2IMEA 2HRAA 2TIRA 5DJLA 2VCVA 2MMNA 4WBJA 5D9TA 5G5EA 5F0GA 1QK8A 1OC3A 3DEXA 2P5QA 5IOXA 3TJFA 4RI6A 1T4YA 1SVMA 1WMJA 2H1AA 2H74A 4BVYB 1G0TA 2IIYA 4MNNA 2X64A 1U3AA 2LTKA 3LXZA 4OD7A 2V6OA 4MJAA 2A2RA 2VM1A 4V1Ag 4NV2A 3M9JA 2PMTA 1TI3A 2AYTA 2DBCA 5A1NA 4GSTA 3H8QA 2F8FA 1EZKA 2RUFA 1T00A 4TXOA 4ZB9A 2C3NA 22GSA 2H75A 1SKSB 2ZUPA 5C00A 1OYJA 2WRTA 4XCSA 2MMAA 4TN8A 1WPIA 1AW9A 2R2JA 4EDYA 4CY6A 2VD1A 2C80A 2P0GA 1CQGA 3KMNA 4NAXA 3ZMLA 5HFIA 2PVQA 4BVYA 5HR2A 1TRVA 3RHBA 5KN2A 4X43A 4ML6A 6GSXA 3RAZA 5A5HB 2H66A 1QMVA 4I2TA 3GL5A 2C0EA 2IMIA 4PNFA 4WF5A 3TKRA 3QAWA 1DE1A 2DIYA 5J5NA 2YJHA 2IMKA 2PUKC 4GQFA 4ZBDA 1FG4A 1YEPA 2H6YA 2L6CA 2VOCA 3D4TA 3GKMA 4Q5QA 3GSTA 5IPHA 1EGRA 3GRXA 5ECSA 1F6MC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ST9 A;  3QDN A;  2CAQ A;  3IR4 A;  1BED A;  2VCT A;  1HNB A;  5D9W A;  5D96 A;  1AQV A;  4I6X A;  2EIQ A;  2DIZ A;  4GF0 A;  2H6X A;  1ERU A;  1OKT A;  2IL3 A;  1O81 A;  1GSQ A;  5D73 A;  4KAE A;  1VF3 A;  1SJZ A;  3QD9 A;  5EY6 A;  4G19 A;  3GHA A;  5HR1 A;  2MBS A;  1F37 A;  5ECM B;  4KSM A;  1GH2 A;  1SU9 A;  1Z6M A;  4WEY A;  3H4K A;  4MZW A;  1YY7 A;  2CAI A;  1XOA A;  4RQR A;  1V57 A;  3EC3 A;  1U6T A;  4N30 A;  3TJJ A;  3FYG A;  1WE0 A;  4ZL9 A;  1ML6 A;  1BYE A;  2GZZ A;  4RQX A;  1MTC A;  4JRR A;  2EIR A;  1UVZ A;  6GSV A;  5JWO B;  3BCI A;  1JFU A;  3UIW A;  3I9V 2;  3CTG A;  3IAM 2;  4F03 A;  3Q6O A;  1Y25 A;  1A0R P;  2VCX A;  2F8A A;  2FCH A;  3UAP A;  2A4V A;  1AQW A;  1FAA A;  1WIK A;  2YWI A;  3A2V A;  3RDW A;  3F9U A;  4E8E A;  4ECC A;  3F6D A;  1TTZ A;  2B5Y A;  1I9D A;  3FZA A;  1FVJ A;  4JED A;  1YEX A;  3A2X A;  1J9B A;  4JR4 A;  4KND A;  1FO5 A;  2FWH A;  2HSH A;  2B1L A;  2VL2 C;  1AIU A;  2HYX A;  4BWQ A;  1M9A A;  5HFK A;  3TUE A;  3ZTL A;  2H19 A;  4POM A;  3FY7 A;  1F2E A;  4AF2 A;  3CSJ A;  2D2Z A;  3IPZ A;  2I4A A;  2VCW A;  1MDI A;  2VL2 A;  1O8W A;  5ECI B;  2H0H A;  3HKR A;  4G10 A;  2DJ0 A;  2ALB A;  4HQS A;  2IMF A;  2JAC A;  2VCQ A;  2P5R A;  2PER A;  3GUR A;  4OFN A;  2NPB A;  1GLQ A;  2DSA A;  3HXS A;  3ZFB A;  2HE3 A;  1ON4 A;  1Z9H A;  2FHE A;  4ACS A;  1Z6N A;  6GSY A;  1GSU A;  4I8B A;  1A0F A;  4PXO A;  2GT6 A;  1Z7R A;  5ECK B;  1XPV A;  4JE1 A;  2PWJ A;  4EDZ A;  2UZ8 A;  2E7P A;  3EU4 A;  3IXR A;  4AJ8 A;  5JWR B;  2LRN A;  2QKE A;  4G0L A;  5B7C A;  3P7X A;  1GTA A;  3WD6 A;  5FT3 A;  1PA3 A;  2PBJ A;  1BAY A;  2KLX A;  4WBR D;  1QXH A;  1JZD A;  4PQH A;  4EXJ A;  3TCO A;  3LGC A;  3HDC A;  1SL2 B;  3VWV A;  1FOV A;  2OE1 A;  4FYB A;  1X9M B;  1MD3 A;  3ME8 A;  2HI7 A;  1OC9 B;  1VRS D;  3LJR A;  2G0F A;  4DVC A;  4IGJ A;  5JCU A;  5IO2 A;  2NVL A;  2L4Q A;  2DMM A;  4CDO A;  5GAN D;  3RPP A;  1XFL A;  2OAD A;  1X5E A;  2RLI A;  1V2A A;  2GDR A;  3GMF A;  2VL9 A;  4IVF A;  4KDY A;  2C0D A;  1XWA A;  4K7I A;  1CQH A;  4KW6 A;  4HZ2 A;  3EUR A;  4IQ1 A;  2F9S A;  4N0Z A;  3UAR A;  2CA8 A;  2OA7 A;  3G7Y A;  5A4V A;  1OAZ A;  1Z3E A;  3DKS A;  2YZU A;  3GX0 A;  2LRT A;  2V6K A;  5J3R A;  1GRX A;  2LJR A;  4V2L A;  2EC4 A;  4ZIL A;  4GQC A;  4F9Z A;  4PGT A;  4NHW A;  1I5G A;  4EUY A;  2DJ2 A;  2ES7 A;  4OWY A;  2V41 A;  4IKH A;  5DCH A;  3CMI A;  3VI5 A;  1TRS A;  3J7Y b;  4HU7 A;  4DSS B;  1JZO A;  3DIE A;  2LNT A;  1OC9 A;  1GUL A;  2HRK B;  2B5X A;  1PGT A;  4F0B A;  4JZQ A;  1K0C A;  4G9H A;  3RPN A;  4IP6 A;  2H8L A;  4YQM A;  2WDU A;  5ENU A;  3ERG A;  4I97 A;  3C73 A;  4MJE A;  4IS0 A;  5ECP B;  1M2D A;  3CRU A;  2JSZ A;  2REM A;  4G2E A;  3KGK A;  5HR3 A;  4V1A p;  1T4Z A;  2YWO A;  4MK3 A;  1VGL A;  4EKZ A;  2AAW A;  4O5R A;  4MH3 A;  2I1U A;  2X99 A;  1URM A;  1S3A A;  4QL9 A;  3HY2 A;  2C4J A;  1H4O A;  1AAZ A;  3O76 A;  3F8U A;  1BG5 A;  5IMF A;  4CW9 A;  3ZIT A;  1LJR A;  2MZC A;  4DSS A;  1JLW A;  2N5A A;  3VI7 A;  2N5F A;  4HJM A;  3LSZ A;  1ERW A;  1TK5 B;  2HRK A;  3A2W A;  1SK2 A;  1EOG A;  1ERT A;  4YAV A;  4NXI A;  2R4V A;  1T3B A;  1T1V A;  1B8X A;  2WFC A;  2IWT A;  4WXT A;  4LL4 B;  3KCM A;  4K1F A;  5BMU A;  1THX A;  5INY A;  5D93 A;  4MF6 A;  3L9S A;  3OR5 A;  1M9B A;  1O73 A;  5CRW A;  3DML A;  4IW9 A;  2YWM A;  1GLP A;  1QFN A;  3KH9 A;  2LS5 A;  4MF7 A;  3D22 A;  1NM3 A;  1PL1 A;  3UBL A;  1XWC A;  2LQQ A;  1TK0 B;  1U87 A;  1ZMA A;  2J9H A;  4POB A;  3LYP A;  5A5K A;  1A2J A;  2K18 A;  1NW2 A;  1JHB A;  1AUC A;  3D21 A;  1K0D A;  12GS A;  4DEJ A;  4F0C A;  2NBS A;  2NTO A;  2GSR A;  1XZO A;  3IV4 A;  3GYK A;  5ECH B;  2GSQ A;  4ECI A;  1B9Y C;  2WB9 A;  4LMW A;  1T7P B;  1XW9 A;  5ECO B;  1SEN A;  3C1R A;  4L0W A;  2OE3 A;  1FW1 A;  1EWX A;  2RII A;  2WUL A;  5CAX A;  3EE2 A;  2KP1 A;  1J0F A;  3KXO A;  1YDK A;  3VWW A;  3APS A;  2AHE A;  4ZL7 A;  1XVW A;  4PQ1 A;  3PR8 A;  4WET A;  3NOF A;  1VF4 A;  3I6A A;  1X9S B;  4K6X A;  3EWL A;  2HLS A;  3FZ5 A;  1U3I A;  4MZB A;  2VL3 A;  2VM2 A;  3UEM A;  1A2M A;  5KN1 A;  1TRU A;  3M9K A;  1PSQ A;  3M0F A;  3S9F A;  5LNK e;  3ERW A;  3KD0 A;  1Q4J A;  1XW6 A;  3LXT A;  1PD2 1;  3GUS A;  2OE0 A;  4LMV A;  3TOT A;  3KZQ A;  1AXD A;  3GFK A;  2X8H A;  5ELA A;  1ZOF A;  1OC8 A;  3DYR A;  5CNW A;  2IN3 A;  1TU8 A;  5C04 A;  5G30 A;  2WCI A;  3G9B A;  1TI1 A;  2VD0 A;  2GLR A;  5F07 A;  3VK9 A;  1A8L A;  1G7E A;  4HQZ A;  2FUG 2;  3UOM A;  10GS A;  1LU4 A;  2V2G A;  5ABR A;  5DBQ A;  4XS4 B;  2LKU A;  1W89 A;  3F3R A;  2MBT A;  2GQM A;  3N5O A;  2AB6 A;  4LA1 A;  4ZL8 A;  3F0I A;  3WGD A;  5LD0 A;  3HZ8 A;  3WGX A;  4TRX A;  4NV5 A;  1PKZ A;  1YJ6 A;  5AIS A;  1TJD A;  3LWA A;  3D0Z A;  2HRF A;  5IO0 A;  1V98 A;  1A2L A;  2LUS A;  4XS6 A;  2VO4 A;  2H0I A;  4EO3 A;  3IK7 A;  1MDJ A;  3HVV A;  2HT9 A;  1YKA A;  1M0U A;  3BD2 A;  2HQT A;  1USB A;  4ZBA A;  4P3Y B;  4N10 A;  1M2A A;  1S3D A;  2XBQ A;  1Z7P A;  2B7J A;  2C3Q A;  5IMC A;  1M2B A;  2JZS A;  2M80 A;  1X5C A;  5H5Q A;  2H0G A;  3TKS C;  4MMM A;  4ID0 A;  4XS4 A;  2MYG A;  1ZZY A;  2O89 A;  1SL0 B;  5JWQ B;  1EGO A;  1GTI A;  4MPF A;  4RUV A;  5F05 A;  3TKS A;  4PTS A;  4KE3 A;  5IMA A;  3TDG A;  2HSN B;  3L9V A;  3M1G A;  1H75 A;  2XHF A;  4MCU A;  3IAS 2;  1Z5Y E;  5G1K A;  2YZH A;  2E0Q A;  2L5O A;  2HRN A;  2DJJ A;  4NWY A;  2AJQ B;  1XWB A;  2QGV A;  2YNX A;  4FIW A;  3IC8 A;  4F2I A;  5IMZ A;  2GGT A;  2VLU A;  2OAC A;  4PNG A;  3W8S A;  2YOI A;  2XPE A;  1UN2 A;  2PU9 C;  2V1M A;  2TRC P;  3IK9 A;  3Q18 A;  2CVB A;  3IA1 A;  2FWE A;  1TXX A;  2L6D A;  5G5F A;  1YF0 A;  1EV9 A;  1XWK A;  2FA8 A;  3FKF A;  3TRP A;  4L5O A;  3H79 A;  3ZIJ A;  1TDI A;  1BX9 A;  3TJB A;  4WKW A;  1RW1 A;  1BQ7 A;  5AIV A;  2DJK A;  2CQ9 A;  4ILF A;  1SJI A;  4NPB A;  2HZE B;  3TJK A;  4TXV A;  2LST A;  2B5E A;  3GSS A;  3VFI A;  2WZ9 A;  3KMO A;  4YAP A;  4YQV A;  3GKX A;  1JZR A;  2LV3 A;  2NDO A;  5KN3 A;  2B1K A;  1MDK A;  1FB6 A;  2H1G A;  1XBS A;  2L5L A;  5IPG A;  2R5G A;  4IJ3 A;  1G6Y A;  3UMA A;  3WYW A;  4KCA A;  3HJP A;  3LFL A;  1R26 A;  2YJ7 A;  1T8E B;  4KB3 A;  4ULX A;  3TKQ A;  1GTU A;  4K8M A;  1TP9 A;  1V9W A;  2VIM A;  5H5S A;  1XIY A;  3KEB A;  3DD3 A;  2C3T A;  1HQO A;  4BVX B;  3CSH A;  1KEB A;  3US3 A;  2DML A;  1AC1 A;  2CX4 A;  1FB0 A;  2PN8 A;  4TR4 A;  4L8E A;  2VCZ A;  1NHO A;  1TW9 A;  2GQK A;  2HZE A;  3DGQ A;  1XXU A;  2OKA A;  3EMP A;  3H93 A;  5J9C A;  1HNA A;  4HOJ A;  4HUA A;  3TOU A;  3F63 A;  2JU5 A;  4MJC A;  4TR1 B;  3K8N A;  3JCM L;  4BPY A;  4X1U A;  5FWG A;  5GAP D;  2XPD A;  3W8J A;  2G2Q A;  1GL8 A;  1K0B A;  1GSF A;  5DDL A;  1VF1 A;  1PMT A;  5CRE A;  2BTO T;  1SJ6 A;  3GKK A;  4EF0 A;  3APQ A;  1G7O A;  2GZP A;  2CZ3 A;  1SK0 A;  3O6T A;  4BVX A;  6GST A;  3H1N A;  3FEU A;  1THO A;  2XC2 A;  2N5B A;  3HJM A;  4J2F A;  3ZMK A;  4IN0 A;  3RBT A;  4HI7 A;  2ON7 A;  3EMX A;  4O7H A;  4GTU A;  1OE8 A;  4ZB6 A;  3GL3 A;  3ZYW A;  4XRA A;  4OO5 A;  2A2S A;  3CSI A;  3R3E A;  2C0F A;  1R4W A;  2H1B A;  4TR1 A;  5G31 A;  1SKW B;  4OFT A;  1QUW A;  3PPU A;  2R6K A;  2O87 A;  3F6F A;  1EP8 A;  2RM5 A;  5DJM A;  1X5D A;  1C72 A;  2GSS A;  1WWJ A;  4K7O A;  4KUN A;  4KDX A;  5AGY A;  2BMX A;  4OCE A;  4KH7 A;  2PVO C;  2YV9 A;  2HNL A;  4ISD A;  1MD4 A;  4JU5 A;  2HSM B;  1GSY A;  3HVX A;  3D4M A;  2ON5 A;  3VWU A;  4K2D A;  2KP2 A;  1B4Q A;  4MAB A;  3D6I A;  4HEA 2;  4LLR A;  2JL4 A;  1QGV A;  3QMX A;  3F3Q A;  3KP9 A;  2K8S A;  5CO3 A;  4IJI A;  1A23 A;  3P90 A;  3PIN A;  4QQ7 A;  3MWH A;  1J08 A;  2WGR A;  1PQN A;  3FW2 A;  3ZIV A;  4QL7 A;  1WJK A;  3QAG A;  3MNG A;  2H6Z A;  3ZVJ D;  5D8I A;  5IQY A;  2WS2 A;  3APO A;  3F4R A;  3WT2 A;  5H5R A;  4L5L A;  19GS A;  4PQI A;  2DLX A;  4AJ6 A;  3QPM A;  3BJ5 A;  1SKR B;  3SBC A;  2HSM A;  2FWG A;  5EL8 A;  3TJG A;  1RK4 A;  4YH2 A;  2WJU A;  2HFD A;  1R5P A;  5F06 A;  3W6G A;  1UA5 A;  5LCZ A;  4PUF C;  3CBU A;  3KJY A;  2K9F A;  4XS1 A;  1Q98 A;  1ZYE A;  1PL2 A;  2QSI A;  4TR3 A;  2O8V B;  8GSS A;  2CX3 A;  3GH6 A;  4L0U A;  5L71 A;  4AGS A;  4E8H A;  1KNG A;  2KOK A;  4MPG A;  3ZRD A;  4FYC A;  3HJO A;  1WRY A;  7GSS A;  3I43 A;  2MMO A;  5J9B A;  4GSN A;  5IIZ A;  1R5A A;  1ZL9 A;  1GUK A;  4EVM A;  2GT5 A;  2RUE A;  3HYP A;  2ZCT A;  3N9J A;  5DCG A;  5E4W A;  3C1S A;  3NZN A;  4TKY A;  1SYX A;  1RQM A;  4OCF A;  1TK8 B;  3ZZX A;  3LEF A;  5A4U A;  3IC4 A;  1XW5 A;  4PX1 A;  3CXG A;  2MMZ A;  5COH A;  4TVE A;  3KTB A;  4MDC A;  5A4W A;  4X0X A;  5IOW A;  3J7Y k;  2FA4 A;  1DUG A;  2B3S A;  1S3C A;  2H71 A;  1A24 A;  5ELG A;  5B6N A;  4HJ2 A;  1EEM A;  4MZC A;  4WR5 A;  3U5R E;  2J23 A;  3E9J B;  2GQL A;  1OE7 A;  4KSO A;  2TRX A;  1GUM A;  5ID2 B;  1SK1 A;  2B7K A;  3EIN A;  1GTB A;  1K3Y A;  4BWS A;  4NHZ A;  4ZIJ A;  5JCW A;  1K3O A;  5ECN B;  3EU3 A;  3A3T A;  4FYU A;  3RHC A;  2VAF A;  3QFA C;  4K7N A;  2C8U A;  5KEJ A;  2R37 A;  4I5Q A;  3EYT A;  1PN9 A;  2YPM A;  4MP4 A;  2YWN A;  3TRX A;  4WF4 A;  2JZR A;  3LG6 A;  4MJB A;  18GS A;  4POL A;  1XWG A;  1AQX A;  2HSY A;  2JAD A;  4J56 E;  2YP6 A;  4G0I A;  5F8B A;  3CTF A;  1K3L A;  1SD9 A;  3UJ1 A;  1GNW A;  2H01 A;  3VUR A;  1ZCP A;  4H86 A;  3L78 A;  3IDV A;  5ID2 A;  3FR3 A;  5EVO A;  5AIX A;  3G7J A;  5J4U A;  2R3X A;  5ECL B;  1EV4 A;  3GIX A;  3PH9 A;  3VPQ A;  2L57 A;  4GCI A;  1A8Y A;  1M99 A;  1HYU A;  3HZ4 A;  1G6W A;  14GS A;  3GKN A;  1B9X C;  2AUV A;  1EEJ A;  2CV4 A;  1IYI A;  4K0N A;  4LL1 B;  3KM6 A;  4AJ7 A;  5HQP A;  3KP8 A;  3LOR A;  16GS A;  2BJX A;  1K0N A;  4KCE A;  2F3M A;  4TOP A;  4N0V A;  5GST A;  5G2Z A;  1PRX A;  4O92 A;  4MF5 A;  4OO4 A;  1K0A A;  4NMU A;  1GSE A;  3M8N A;  5KN0 A;  1JLV A;  1ABA A;  2XBI A;  1IYH A;  3DVW A;  2DC5 A;  1MEK A;  2H1D A;  2VLT A;  1BJX A;  2FNO A;  1WP0 A;  3TKP A;  2IPA A;  2L4C A;  4G0K A;  1OVN A;  3VLN A;  3ME7 A;  1U88 A;  2LRC A;  4XIH A;  3SWL A;  1UC7 A;  1EP7 A;  4PUR A;  4ECJ A;  4IEL A;  1GSD A;  4ECB A;  4D73 B;  1DE2 A;  4FO5 A;  3NIV A;  3WGE A;  5HR0 A;  2QC7 A;  1N2A A;  1X9W B;  2C0G A;  3UVT A;  5CYY A;  2CZ2 A;  3ERF A;  2H76 A;  2PGT A;  4KDU A;  1SD8 A;  2FLS A;  5CRD A;  3QOU A;  1PX7 A;  3Q74 A;  3G7I A;  3GX8 A;  2ZNM A;  2LEG A;  3C71 A;  3I69 A;  3F4T A;  3P8W A;  1ZGN A;  1FHE A;  4HDE A;  4ZB8 A;  4Q5R A;  3GNJ A;  5DQY A;  2F51 A;  4HS1 A;  5D9V A;  5D9X A;  1PX6 A;  3UBK A;  3UL3 A;  4V2N A;  3HA9 A;  1XVQ A;  3ISO A;  1ERV A;  2GZY A;  5DVB A;  4WR4 A;  1O7U A;  11GS A;  4TR0 A;  1YQ1 A;  2H70 A;  2CT6 A;  2FWF A;  2HZF A;  2H30 A;  4GXZ A;  1WOU A;  4D73 A;  5HFG A;  3TRQ A;  4JBB A;  1FVK A;  5IM9 A;  4N11 A;  1ZYQ B;  3IOS A;  2O85 A;  3TKS E;  1O8X A;  2M72 A;  3MDK A;  2FY6 A;  4Z7X A;  4ZXG A;  3QFB C;  4IQA A;  3DRN A;  5DQS A;  2L59 A;  3KTL A;  2JSY A;  2M46 A;  1JZW A;  4OMV A;  1DSB A;  1F3B A;  3A5W A;  3DVX A;  1YZX A;  1LBK A;  1HD2 A;  5GSS A;  1B48 A;  5IMD A;  3EVI A;  1B4P A;  3IE3 A;  2PPT A;  4FH8 A;  3DXB A;  2CVD A;  5CRG A;  3E0U A;  4YQU A;  1F9M A;  1TOF A;  4JR6 A;  3ZFL A;  4DSR A;  1GNE A;  4ML1 A;  3F4S A;  1GSS A;  3M3M A;  2C1Y A;  3ZLP A;  3IRA A;  3ZVJ A;  2HXK A;  3DWV A;  3QCP A;  3CYN A;  4GLT A;  3BCK A;  1NSW A;  1OKD A;  4XTS A;  2H72 A;  1M7T A;  1O6J A;  4HU9 A;  1KBN A;  3GV1 A;  1O85 A;  4TW5 A;  1K0O A;  4USS A;  1V58 A;  4V2M A;  2B6M A;  3P2A A;  2I3Y A;  2K8V A;  5ECR B;  1XCC A;  4K9Z A;  2IFQ B;  1F3A A;  3Q19 A;  4KX4 A;  2X8G A;  2FGX A;  5CP1 A;  2LNS A;  1ACV A;  17GS A;  3GH9 A;  9GSS A;  2IMD A;  2CVK A;  1ILO A;  3FR6 A;  1DBY A;  2YCD A;  4OFM A;  2P31 A;  13GS A;  4GSS A;  1NHY A;  2DJ3 A;  4IP1 A;  3ED3 A;  4IBP A;  2I81 A;  2AV4 A;  1W4V A;  2GVP A;  3MAK A;  4XRD A;  6GSU A;  1TU7 A;  4DSQ A;  3UVH A;  5FHI A;  3VPT A;  1SL1 B;  4PUA A;  2X8C A;  1XOB A;  3FK8 A;  3HVS A;  3E3E A;  2KUC A;  3GA4 A;  3FZ9 A;  1E6B A;  3L4N A;  4ZBB A;  2O7K A;  5ECQ B;  3IHQ A;  4F82 A;  1YKC A;  1YF1 A;  5B6M A;  1TRW A;  2Z9S A;  5GZZ B;  1R7H A;  2OBI A;  20GS A;  5B8B A;  3C8E A;  3PGT A;  2IFQ A;  2YAN A;  3FR9 A;  4RI7 A;  4HZ4 A;  1GUH A;  4GWR A;  5E59 A;  5DAL B;  4BL7 B;  3C7M A;  2LQO A;  1HNC A;  1SYR A;  5DAK B;  1E2Y A;  5IMV A;  5B8A A;  5AN1 A;  3TB2 A;  3TGZ A;  4KGI A;  2KHP A;  2GST A;  3HCZ A;  2E2G A;  3R2Q A;  4IHU A;  2E2M A;  4POK A;  3FZ4 A;  3IBH A;  4Q5F A;  1QQ2 A;  3GTU B;  2YV7 A;  3ZL5 A;  3U6V A;  2V32 A;  4MA9 A;  3ZRE A;  1KTE A;  4FQU A;  5J41 A;  2GS3 A;  1EOH A;  3HD5 A;  3MSZ A;  4EC0 A;  4XHM A;  4KA0 A;  2OBK A;  2LJK A;  3FHK A;  3AY8 A;  1X0R A;  2H73 A;  1GWC A;  3QR6 A;  4Q5N A;  1V40 A;  2K6V A;  2FD3 A;  3KH7 A;  2VLV A;  1VF2 A;  3LYK A;  3WT1 A;  3O3T A;  5CRH A;  2JZT A;  5DAL A;  4KF9 A;  2DJ1 A;  1Y6E A;  4BL7 A;  3V1W A;  4MH2 A;  1TKD B;  5EPF A;  4I2U A;  3LQ7 A;  4CHS A;  3HHV A;  5DAK A;  3L0H A;  2IJY A;  2VUP A;  3BOA A;  4EE0 A;  3FRC A;  3QAV A;  2LJA A;  1K0M A;  6GSW A;  3GN3 A;  3D5J A;  2OJL A;  2GTU A;  4J57 E;  4K0G A;  3L9U A;  4TXO B;  4BA7 A;  4GRF A;  3KIJ A;  3VWX A;  4O32 A;  6GSS A;  3GTU A;  2EIO A;  2YN1 A;  1N8J A;  2I9H A;  2RM6 A;  5JCG A;  3BBY A;  5G1L A;  1PKW A;  3CRT A;  1GP1 A;  4MLY A;  4EL1 A;  2IME A;  2HRA A;  2TIR A;  5DJL A;  2VCV A;  2MMN A;  4WBJ A;  5D9T A;  5G5E A;  5F0G A;  1QK8 A;  1OC3 A;  3DEX A;  2P5Q A;  5IOX A;  3TJF A;  4RI6 A;  1T4Y A;  1WMJ A;  2H1A A;  2H74 A;  4BVY B;  1G0T A;  2IIY A;  2X64 A;  1U3A A;  2LTK A;  3LXZ A;  4OD7 A;  2V6O A;  4MJA A;  2A2R A;  2VM1 A;  4V1A g;  4NV2 A;  3M9J A;  2PMT A;  1TI3 A;  2AYT A;  2DBC A;  4GST A;  3H8Q A;  2F8F A;  1EZK A;  2RUF A;  1T00 A;  4TXO A;  4ZB9 A;  2C3N A;  22GS A;  2H75 A;  1SKS B;  2ZUP A;  5C00 A;  1OYJ A;  2WRT A;  4XCS A;  2MMA A;  4TN8 A;  1WPI A;  1AW9 A;  2R2J A;  4EDY A;  2VD1 A;  2C80 A;  2P0G A;  1CQG A;  3KMN A;  4NAX A;  3ZML A;  5HFI A;  2PVQ A;  4BVY A;  5HR2 A;  1TRV A;  3RHB A;  5KN2 A;  4X43 A;  4ML6 A;  6GSX A;  3RAZ A;  2H66 A;  1QMV A;  4I2T A;  3GL5 A;  2C0E A;  2IMI A;  4PNF A;  4WF5 A;  3TKR A;  3QAW A;  1DE1 A;  2DIY A;  5J5N A;  2YJH A;  2IMK A;  2PUK C;  4GQF A;  4ZBD A;  1FG4 A;  1YEP A;  2H6Y A;  2L6C A;  2VOC A;  3D4T A;  3GKM A;  4Q5Q A;  3GST A;  5IPH A;  1EGR A;  3GRX A;  5ECS A;  1F6M C; 
#chains in the Genus database with same CATH topology
 1ST9 A;  3QDN A;  2CAQ A;  3IR4 A;  1BED A;  2VCT A;  1HNB A;  5D9W A;  5D96 A;  1M3J A;  1AQV A;  4I6X A;  2EIQ A;  2DIZ A;  4GF0 A;  2H6X A;  1ERU A;  1OKT A;  2IL3 A;  1O81 A;  1GSQ A;  5D73 A;  4KAE A;  1VF3 A;  1SJZ A;  3QD9 A;  5EY6 A;  4G19 A;  3GHA A;  5HR1 A;  2MBS A;  1F37 A;  5ECM B;  4KSM A;  1GH2 A;  1SU9 A;  1Z6M A;  4WEY A;  3H4K A;  4MZW A;  4E68 A;  1YY7 A;  2CAI A;  1XOA A;  2R0G A;  4RQR A;  1V57 A;  3EC3 A;  1U6T A;  4N30 A;  3TJJ A;  3FYG A;  1WE0 A;  4ZL9 A;  1ML6 A;  1BYE A;  2GZZ A;  4RQX A;  1MTC A;  4AKI A;  4JRR A;  2EIR A;  1UVZ A;  6GSV A;  5JWO B;  3BCI A;  1JFU A;  3UIW A;  1XG8 A;  3I9V 2;  3CTG A;  3IAM 2;  4F03 A;  3Q6O A;  1Y25 A;  1Y1U A;  1A0R P;  2VCX A;  2F8A A;  2FCH A;  3UAP A;  2A4V A;  1AQW A;  1FAA A;  1WIK A;  2YWI A;  3A2V A;  3RDW A;  3F9U A;  4E8E A;  4ECC A;  3F6D A;  1ZYP A;  1SVO A;  1TTZ A;  2B5Y A;  1I9D A;  3FZA A;  4AI6 A;  1FVJ A;  4JED A;  1YEX A;  3A2X A;  1J9B A;  4JR4 A;  4KND A;  1FO5 A;  2FWH A;  2HSH A;  2B1L A;  2VL2 C;  1AIU A;  2HYX A;  4BWQ A;  1M9A A;  5HFK A;  3TUE A;  3ZTL A;  2H19 A;  4POM A;  3FY7 A;  1F2E A;  4O5Q A;  4AF2 A;  3CSJ A;  2D2Z A;  3IPZ A;  2VKZ G;  2I4A A;  2VCW A;  1MDI A;  2VL2 A;  1O8W A;  5ECI B;  2H0H A;  3HKR A;  4G10 A;  2DJ0 A;  2ALB A;  4HQS A;  2IMF A;  2JAC A;  2VCQ A;  2P5R A;  2PER A;  3GUR A;  4OFN A;  2NPB A;  1GLQ A;  2DSA A;  3HXS A;  3ZFB A;  2HE3 A;  1ON4 A;  3IHG A;  1Z9H A;  4O5U A;  2FHE A;  4ACS A;  1Z6N A;  6GSY A;  1GSU A;  1A0F A;  4PXO A;  4I8B A;  2GT6 A;  1Z7R A;  5ECK B;  1XPV A;  4JE1 A;  2PWJ A;  4EDZ A;  2UZ8 A;  2E7P A;  3EU4 A;  3IXR A;  4AJ8 A;  5JWR B;  2LRN A;  2QKE A;  4G0L A;  5B7C A;  3P7X A;  1GTA A;  3WD6 A;  5FT3 A;  2PBJ A;  1PA3 A;  1BAY A;  2KLX A;  4WBR D;  1QXH A;  1JZD A;  4PQH A;  4EXJ A;  3TCO A;  3LGC A;  3HDC A;  1SL2 B;  3VWV A;  1FOV A;  2OE1 A;  4FYB A;  1X9M B;  1MD3 A;  3ME8 A;  2HI7 A;  1OC9 B;  1VRS D;  3LJR A;  2G0F A;  4DVC A;  4IGJ A;  5JCU A;  5IO2 A;  2NVL A;  2L4Q A;  2DMM A;  4CDO A;  5GAN D;  3RPP A;  1XFL A;  4Z2R A;  2OAD A;  1X5E A;  2RLI A;  1V2A A;  2GDR A;  3GMF A;  2VL9 A;  4IVF A;  4KDY A;  2C0D A;  1XWA A;  4K7I A;  1CQH A;  4KW6 A;  2QA2 A;  4HZ2 A;  3EUR A;  4IQ1 A;  2F9S A;  4N0Z A;  3UAR A;  2CA8 A;  2OA7 A;  3G7Y A;  5A4V A;  1OAZ A;  1Z3E A;  3DKS A;  2YZU A;  3GX0 A;  2LRT A;  2V6K A;  5J3R A;  1GRX A;  2LJR A;  4V2L A;  2EC4 A;  4ZIL A;  4GQC A;  4F9Z A;  4PGT A;  4NHW A;  1I5G A;  4EUY A;  2DJ2 A;  2ES7 A;  4OWY A;  2V41 A;  4IKH A;  5DCH A;  3CMI A;  3VI5 A;  1TRS A;  3J7Y b;  4HU7 A;  4DSS B;  1JZO A;  3DIE A;  2LNT A;  1OC9 A;  1GUL A;  2HRK B;  2B5X A;  1PGT A;  4F0B A;  4JZQ A;  1K0C A;  4G9H A;  3RPN A;  4IP6 A;  2H8L A;  4YQM A;  2WDU A;  5ENU A;  3ERG A;  4I97 A;  3C73 A;  4MJE A;  4IS0 A;  5ECP B;  1M2D A;  3CRU A;  2JSZ A;  2REM A;  4G2E A;  3KGK A;  5HR3 A;  4V1A p;  5BMU B;  1T4Z A;  2YWO A;  4MK3 A;  1VGL A;  4EKZ A;  2AAW A;  3FMW A;  3CQF A;  4O5R A;  4MH3 A;  2I1U A;  2X99 A;  1URM A;  1S3A A;  2WW1 A;  4QL9 A;  3HY2 A;  2C4J A;  2X4A A;  1H4O A;  1AAZ A;  5J47 A;  3O76 A;  3F8U A;  1BG5 A;  5IMF A;  3A5I A;  4CW9 A;  3ZIT A;  1LJR A;  2MZC A;  4DSS A;  1JLW A;  2N5A A;  3VI7 A;  2N5F A;  4HJM A;  3LSZ A;  1ERW A;  1TK5 B;  2HRK A;  3A2W A;  1SK2 A;  1EOG A;  1ERT A;  4YAV A;  4NXI A;  2R4V A;  1T3B A;  1T1V A;  1B8X A;  2WFC A;  2IWT A;  4WXT A;  4LL4 B;  3KCM A;  4K1F A;  5BMU A;  1THX A;  5INY A;  5D93 A;  4MF6 A;  3L9S A;  3OR5 A;  1M9B A;  1O73 A;  5CRW A;  3DML A;  4IW9 A;  2YWM A;  1GLP A;  1QFN A;  3KH9 A;  2LS5 A;  4MF7 A;  3D22 A;  1NM3 A;  1PL1 A;  3UBL A;  1XWC A;  2LQQ A;  1TK0 B;  1U87 A;  1ZMA A;  2J9H A;  4POB A;  3LYP A;  5A5K A;  1A2J A;  2K18 A;  1NW2 A;  1JHB A;  1AUC A;  3D21 A;  1K0D A;  12GS A;  4DEJ A;  4F0C A;  2NBS A;  2NTO A;  2GSR A;  1XZO A;  3IV4 A;  3GYK A;  2H1L A;  5ECH B;  2GSQ A;  4ECI A;  1B9Y C;  2WB9 A;  4LMW A;  1T7P B;  1XW9 A;  5ECO B;  1SEN A;  3C1R A;  4L0W A;  2OE3 A;  1FW1 A;  1EWX A;  2RII A;  4AKG A;  2WUL A;  5CAX A;  3EE2 A;  2KP1 A;  1J0F A;  3KXO A;  1YDK A;  3VWW A;  4X4J A;  3APS A;  2AHE A;  4ZL7 A;  1XVW A;  4PQ1 A;  3PR8 A;  4WET A;  3NOF A;  4K2X A;  1VF4 A;  3I6A A;  1X9S B;  4K6X A;  3EWL A;  2HLS A;  3FZ5 A;  1U3I A;  4MZB A;  2VL3 A;  2A4H A;  2VM2 A;  3UEM A;  1YEW C;  1A2M A;  5KN1 A;  1TRU A;  3M9K A;  1PSQ A;  3M0F A;  3S9F A;  5LNK e;  3RFR C;  3ERW A;  3KD0 A;  1Q4J A;  1XW6 A;  3LXT A;  1PD2 1;  1BF5 A;  3GUS A;  2OE0 A;  4LMV A;  3TOT A;  3KZQ A;  1AXD A;  3GFK A;  2X8H A;  5ELA A;  2R0C A;  1ZOF A;  1OC8 A;  3DYR A;  5CNW A;  2IN3 A;  1TU8 A;  5C04 A;  5G30 A;  2WCI A;  3G9B A;  2O3E A;  1TI1 A;  4Z2T A;  2WW0 A;  2VD0 A;  2GLR A;  2EFC A;  1M3I A;  5F07 A;  3VK9 A;  1A8L A;  1G7E A;  4HQZ A;  2FUG 2;  3UOM A;  10GS A;  1LU4 A;  2V2G A;  5ABR A;  5DBQ A;  4XS4 B;  2LKU A;  1W89 A;  3F3R A;  2MBT A;  2GQM A;  3N5O A;  2AB6 A;  4LA1 A;  4ZL8 A;  1PFO A;  3F0I A;  3WGD A;  5LD0 A;  3HZ8 A;  3WGX A;  4TRX A;  4NV5 A;  1PKZ A;  5J4Y A;  1YJ6 A;  4YKF A;  5AIS A;  1TJD A;  3LWA A;  3D0Z A;  2HRF A;  5IO0 A;  1V98 A;  1A2L A;  2LUS A;  4K5R A;  4XS6 A;  2VO4 A;  2H0I A;  4EO3 A;  3IK7 A;  1MDJ A;  3HVV A;  5KOX A;  2HT9 A;  1YKA A;  1M0U A;  3BD2 A;  2HQT A;  1USB A;  4ZBA A;  4P3Y B;  4N10 A;  1M2A A;  1S3D A;  2XBQ A;  1Z7P A;  2B7J A;  2C3Q A;  5IMC A;  1M2B A;  2JZS A;  2M80 A;  1X5C A;  5H5Q A;  2H0G A;  1TXU A;  3TKS C;  4MMM A;  4ID0 A;  4XS4 A;  2MYG A;  1ZZY A;  2O89 A;  1SL0 B;  5JWQ B;  1EGO A;  1GTI A;  4MPF A;  4RUV A;  5F05 A;  3TKS A;  4PTS A;  4KE3 A;  5IMA A;  3TDG A;  2HSN B;  3L9V A;  3M1G A;  2A2P A;  1H75 A;  2XHF A;  4MCU A;  2EFH A;  3IAS 2;  1Z5Y E;  5G1K A;  2YZH A;  2E0Q A;  2L5O A;  2HRN A;  4AKX B;  2DJJ A;  4NWY A;  2AJQ B;  1XWB A;  2QGV A;  2YNX A;  4FIW A;  3IC8 A;  4F2I A;  5IMZ A;  2GGT A;  2VLU A;  2OAC A;  4PNG A;  3W8S A;  2YOI A;  2XPE A;  1UN2 A;  2PU9 C;  2V1M A;  2TRC P;  3IK9 A;  3Q18 A;  2CVB A;  3IA1 A;  2FWE A;  1TXX A;  2L6D A;  5G5F A;  1YF0 A;  1EV9 A;  1XWK A;  2FA8 A;  3FKF A;  3TRP A;  4L5O A;  3H79 A;  4G01 A;  2WVY A;  3ZIJ A;  1TDI A;  1BX9 A;  3TJB A;  3CHX C;  4WKW A;  1RW1 A;  1BQ7 A;  4PHZ C;  5AIV A;  2DJK A;  2HSN A;  2CQ9 A;  4ILF A;  1SJI A;  4NPB A;  2HZE B;  3TJK A;  4TXV A;  2LST A;  2B5E A;  3GSS A;  3VFI A;  2WZ9 A;  3KMO A;  4YAP A;  4YQV A;  3GKX A;  1JZR A;  2LV3 A;  2NDO A;  1SVL A;  5KN3 A;  2B1K A;  1MDK A;  1FB6 A;  2H1G A;  1XBS A;  2L5L A;  5IPG A;  2R5G A;  4IJ3 A;  1G6Y A;  3LW9 A;  3UMA A;  2O36 A;  3WYW A;  4KCA A;  3HJP A;  3LFL A;  1R26 A;  2YJ7 A;  1T8E B;  4KB3 A;  4ULX A;  3TKQ A;  1GTU A;  4K8M A;  1TP9 A;  1V9W A;  2VIM A;  5H5S A;  1XIY A;  3MYD A;  3KEB A;  3DD3 A;  2C3T A;  1HQO A;  4BVX B;  3CSH A;  1KEB A;  3US3 A;  2DML A;  1AC1 A;  2CX4 A;  1FB0 A;  2PN8 A;  1YVL A;  4TR4 A;  4L8E A;  2VCZ A;  1NHO A;  1TW9 A;  2GQK A;  2HZE A;  3DGQ A;  1XXU A;  2OKA A;  3EMP A;  3H93 A;  5J9C A;  1HNA A;  4HOJ A;  4HUA A;  3TOU A;  3F63 A;  2JU5 A;  4MJC A;  4TR1 B;  3K8N A;  3JCM L;  4BPY A;  4X1U A;  5FWG A;  5GAP D;  2XPD A;  3W8J A;  1N25 A;  2G2Q A;  1GL8 A;  1K0B A;  1GSF A;  5DDL A;  1VF1 A;  1PMT A;  5CRE A;  2BTO T;  1SJ6 A;  3GKK A;  1PN0 A;  4EF0 A;  3APQ A;  1G7O A;  2GZP A;  2CZ3 A;  1SK0 A;  3O6T A;  4BVX A;  6GST A;  3H1N A;  3FEU A;  1THO A;  2XC2 A;  2N5B A;  3HJM A;  4J2F A;  3ZMK A;  4IN0 A;  3RBT A;  4HI7 A;  2ON7 A;  3EMX A;  4O7H A;  4GTU A;  1OE8 A;  4ZB6 A;  3GL3 A;  3ZYW A;  4XRA A;  4OO5 A;  2A2S A;  3R3E A;  3CSI A;  2C0F A;  1R4W A;  2H1B A;  4TR1 A;  5G31 A;  1SKW B;  4OFT A;  5KOW A;  1QUW A;  3PPU A;  2R6K A;  2O87 A;  3F6F A;  1EP8 A;  2RM5 A;  5DJM A;  1X5D A;  1C72 A;  2GSS A;  1WWJ A;  4K7O A;  4KUN A;  4KDX A;  5AGY A;  2BMX A;  4OCE A;  4KH7 A;  2PVO C;  2YV9 A;  2HNL A;  4ISD A;  2WVX B;  1MD4 A;  4JU5 A;  2HSM B;  1GSY A;  3HVX A;  3D4M A;  2ON5 A;  3VWU A;  4K2D A;  2KP2 A;  1B4Q A;  4MAB A;  3D6I A;  4HEA 2;  4LLR A;  2JL4 A;  1QGV A;  3QMX A;  3F3Q A;  3KP9 A;  2K8S A;  5CO3 A;  4FXY P;  3EPT A;  4IJI A;  1A23 A;  3P90 A;  3PIN A;  4QQ7 A;  3MWH A;  1J08 A;  2WGR A;  5J4V A;  1PQN A;  3FW2 A;  3ZIV A;  4QL7 A;  1WJK A;  3QAG A;  3MNG A;  2H6Z A;  3ZVJ D;  5D8I A;  5IQY A;  2WS2 A;  3APO A;  3F4R A;  3WT2 A;  5H5R A;  2EFE A;  4L5L A;  19GS A;  4PQI A;  2DLX A;  4AJ6 A;  3QPM A;  3BJ5 A;  1SKR B;  3SBC A;  2WVX A;  2HSM A;  2FWG A;  5EL8 A;  3TJG A;  1RK4 A;  4YH2 A;  2WJU A;  2HFD A;  1R5P A;  5F06 A;  3W6G A;  1UA5 A;  5LCZ A;  4PUF C;  3CBU A;  3KJY A;  2K9F A;  4XS1 A;  1Q98 A;  1ZYE A;  1PL2 A;  2QSI A;  4TR3 A;  2O8V B;  8GSS A;  2CX3 A;  3GH6 A;  4L0U A;  2EFD A;  5L71 A;  4AGS A;  4E8H A;  1KNG A;  2KOK A;  4MPG A;  3ZRD A;  4FYC A;  4CY8 A;  3HJO A;  1WRY A;  7GSS A;  3I43 A;  2MMO A;  5J9B A;  4GSN A;  5IIZ A;  1R5A A;  4EIP A;  1ZL9 A;  1GUK A;  4GDF A;  4EVM A;  2GT5 A;  2RUE A;  3HYP A;  2ZCT A;  3N9J A;  5DCG A;  5E4W A;  3C1S A;  3HVN A;  3NZN A;  4TKY A;  1SYX A;  1RQM A;  4OCF A;  1TK8 B;  3ZZX A;  3LEF A;  5A4U A;  3IC4 A;  1XW5 A;  4PX1 A;  3CXG A;  2MMZ A;  5COH A;  4TVE A;  3KTB A;  4MDC A;  5A4W A;  4X0X A;  3RGB C;  5IOW A;  3J7Y k;  2FA4 A;  1DUG A;  2B3S A;  1S3C A;  2H71 A;  1A24 A;  5ELG A;  5B6N A;  4HJ2 A;  2DKH A;  1EEM A;  4MZC A;  4WR5 A;  2R0P A;  3U5R E;  2J23 A;  3E9J B;  2GQL A;  5BRT A;  1OE7 A;  4KSO A;  2TRX A;  1GUM A;  5ID2 B;  1SK1 A;  2B7K A;  3EIN A;  1GTB A;  1K3Y A;  4BWS A;  4NHZ A;  4ZIJ A;  5JCW A;  1K3O A;  5ECN B;  3EU3 A;  3A3T A;  4FYU A;  3RHC A;  2VAF A;  3CWG A;  2DKI A;  3QFA C;  4K7N A;  2C8U A;  4PI2 C;  2X49 A;  5KEJ A;  2R37 A;  4I5Q A;  3EYT A;  2WVZ A;  1PN9 A;  2YPM A;  4MP4 A;  2YWN A;  3TRX A;  4EIQ A;  4WF4 A;  2JZR A;  3LG6 A;  4MJB A;  18GS A;  4POL A;  1XWG A;  1AQX A;  2HSY A;  2JAD A;  4J56 E;  2YP6 A;  4G0I A;  5F8B A;  3CTF A;  1K3L A;  1SD9 A;  3UJ1 A;  1GNW A;  2H01 A;  3VUR A;  1ZCP A;  4H86 A;  3L78 A;  3IDV A;  5ID2 A;  3FR3 A;  5EVO A;  5AIX A;  3G7J A;  5J4U A;  2R3X A;  5ECL B;  1EV4 A;  3GIX A;  3PH9 A;  3VPQ A;  2L57 A;  4GCI A;  1A8Y A;  1M99 A;  1HYU A;  3HZ4 A;  1G6W A;  14GS A;  3GKN A;  1B9X C;  2AUV A;  1EEJ A;  2CV4 A;  1IYI A;  4K0N A;  4LL1 B;  3KM6 A;  4AJ7 A;  5HQP A;  3KP8 A;  3LOR A;  16GS A;  2BJX A;  1K0N A;  4KCE A;  2F3M A;  4TOP A;  4N0V A;  5GST A;  5G2Z A;  1PRX A;  4O92 A;  4MF5 A;  4OO4 A;  1K0A A;  4NMU A;  1GSE A;  3M8N A;  5KN0 A;  1JLV A;  5A5H A;  1ABA A;  2XBI A;  1IYH A;  4PI0 C;  3DVW A;  2DC5 A;  1MEK A;  2H1D A;  4YKG A;  1BG1 A;  2VLT A;  1BJX A;  2FNO A;  1WP0 A;  3TKP A;  2IPA A;  2L4C A;  4G0K A;  1OVN A;  3VLN A;  3ME7 A;  1U88 A;  2LRC A;  4XIH A;  3SWL A;  1UC7 A;  1EP7 A;  4PUR A;  4ECJ A;  4IEL A;  1GSD A;  4ECB A;  4D73 B;  1DE2 A;  4FO5 A;  3NIV A;  3WGE A;  5HR0 A;  2QC7 A;  1N2A A;  1X9W B;  2C0G A;  3UVT A;  5CYY A;  2CZ2 A;  3ERF A;  2H76 A;  2PGT A;  4KDU A;  1SD8 A;  2FLS A;  5CRD A;  3QOU A;  1PX7 A;  3Q74 A;  3G7I A;  3GX8 A;  2ZNM A;  2LEG A;  3C71 A;  1FOH A;  2OT3 A;  3I69 A;  3F4T A;  3P8W A;  1ZGN A;  1FHE A;  4HDE A;  4ZB8 A;  4Q5R A;  3GNJ A;  5DQY A;  2F51 A;  4HS1 A;  5D9V A;  5D9X A;  1PX6 A;  3UBK A;  3UL3 A;  4V2N A;  3HA9 A;  1XVQ A;  3ISO A;  1ERV A;  2GZY A;  5DVB A;  4WR4 A;  1O7U A;  11GS A;  4TR0 A;  1YQ1 A;  2H70 A;  2CT6 A;  2FWF A;  2HZF A;  2H30 A;  4GXZ A;  1WOU A;  4D73 A;  5HFG A;  3TRQ A;  4JBB A;  1FVK A;  5IM9 A;  4N11 A;  1ZYQ B;  3IOS A;  2O85 A;  1ZYN A;  3TKS E;  1O8X A;  2M72 A;  3MDK A;  2FY6 A;  4Z7X A;  4ZXG A;  3QFB C;  4AKH A;  4IQA A;  3DRN A;  5DQS A;  2L59 A;  3KTL A;  2JSY A;  2M46 A;  1JZW A;  4OMV A;  1DSB A;  1F3B A;  3A5W A;  3DVX A;  1YZX A;  1LBK A;  1HD2 A;  3HMJ G;  5GSS A;  1B48 A;  5IMD A;  3EVI A;  4W66 A;  1B4P A;  3IE3 A;  2PPT A;  4FH8 A;  3DXB A;  2CVD A;  5CRG A;  4Z2U A;  3E0U A;  4YQU A;  1F9M A;  1TOF A;  4JR6 A;  3ZFL A;  4DSR A;  1GNE A;  4ML1 A;  3F4S A;  1GSS A;  3M3M A;  2C1Y A;  3ZLP A;  3IRA A;  3ZVJ A;  2HXK A;  3DWV A;  5A34 B;  3QCP A;  3CYN A;  4GLT A;  3BCK A;  1NSW A;  1OKD A;  4XTS A;  2H72 A;  1M7T A;  1O6J A;  4HU9 A;  4QMK A;  1KBN A;  3GV1 A;  1O85 A;  4TW5 A;  1K0O A;  4USS A;  1V58 A;  4V2M A;  2B6M A;  3P2A A;  2I3Y A;  2K8V A;  5ECR B;  1XCC A;  4K9Z A;  2IFQ B;  1F3A A;  3Q19 A;  4KX4 A;  2X8G A;  2UV8 G;  5J40 A;  2FGX A;  5CP1 A;  2LNS A;  1ACV A;  17GS A;  3GH9 A;  9GSS A;  4A5P A;  2IMD A;  2CVK A;  1ILO A;  2O5V A;  3FR6 A;  1DBY A;  2YCD A;  4OFM A;  2P31 A;  13GS A;  4GSS A;  1NHY A;  2DJ3 A;  4IP1 A;  3ED3 A;  4IBP A;  2I81 A;  2AV4 A;  1W4V A;  2GVP A;  3MAK A;  4XRD A;  4K5S A;  6GSU A;  1TU7 A;  4DSQ A;  3UVH A;  5FHI A;  5A34 A;  3VPT A;  1SL1 B;  4PUA A;  2X8C A;  1XOB A;  3FK8 A;  3HVS A;  3E3E A;  2KUC A;  3GA4 A;  3FZ9 A;  1E6B A;  3L4N A;  4ZBB A;  2O7K A;  5ECQ B;  3IHQ A;  4F82 A;  1YKC A;  1YF1 A;  4N3Z A;  5B6M A;  1TRW A;  2Z9S A;  5GZZ B;  1R7H A;  2OBI A;  20GS A;  5B8B A;  3C8E A;  3PGT A;  2IFQ A;  2YAN A;  3FR9 A;  4RI7 A;  4HZ4 A;  1GUH A;  4GWR A;  5E59 A;  5DAL B;  4BL7 B;  3C7M A;  2LQO A;  1S4B P;  1HNC A;  1SYR A;  3TU3 B;  5DAK B;  1E2Y A;  5IMV A;  5B8A A;  5AN1 A;  3TB2 A;  3TGZ A;  4KGI A;  2KHP A;  2GST A;  3HCZ A;  2E2G A;  3R2Q A;  4IHU A;  2E2M A;  4POK A;  3FZ4 A;  3IBH A;  4Q5F A;  1QQ2 A;  3GTU B;  2YV7 A;  3ZL5 A;  3U6V A;  2V32 A;  4MA9 A;  3ZRE A;  1KTE A;  4FQU A;  5J41 A;  2GS3 A;  1S3R A;  1I1I P;  1EOH A;  4BIK A;  3HD5 A;  3MSZ A;  4EC0 A;  4XHM A;  4KA0 A;  3MIX A;  2OBK A;  2LJK A;  3FHK A;  3AY8 A;  1X0R A;  2H73 A;  1GWC A;  3QR6 A;  4Q5N A;  1V40 A;  2K6V A;  2FD3 A;  3KH7 A;  2VLV A;  1VF2 A;  3LYK A;  3WT1 A;  3O3T A;  5CRH A;  2JZT A;  5DAL A;  4KF9 A;  2DJ1 A;  1Y6E A;  4BL7 A;  3V1W A;  4MH2 A;  1TKD B;  5EPF A;  4I2U A;  3LQ7 A;  4CHS A;  3HHV A;  5DAK A;  3L0H A;  2IJY A;  2VUP A;  3BOA A;  4EE0 A;  4ZB7 A;  4ICY A;  3FRC A;  3QAV A;  2LJA A;  1K0M A;  6GSW A;  5A1N B;  3GN3 A;  3D5J A;  2OJL A;  2GTU A;  4J57 E;  4K0G A;  3L9U A;  4TXO B;  4BA7 A;  4GRF A;  3KIJ A;  3VWX A;  4O32 A;  6GSS A;  3GTU A;  2EIO A;  2YN1 A;  1N8J A;  2I9H A;  2RM6 A;  5JCG A;  3BBY A;  5G1L A;  1PKW A;  2WW3 A;  3CRT A;  1GP1 A;  4MLY A;  4EL1 A;  2QA1 A;  2IME A;  2HRA A;  2TIR A;  5DJL A;  2VCV A;  2MMN A;  4WBJ A;  5D9T A;  5G5E A;  5F0G A;  1QK8 A;  1OC3 A;  3DEX A;  2P5Q A;  5IOX A;  3TJF A;  4RI6 A;  1T4Y A;  1SVM A;  1WMJ A;  2H1A A;  2H74 A;  4BVY B;  1G0T A;  2IIY A;  4MNN A;  2X64 A;  1U3A A;  2LTK A;  3LXZ A;  4OD7 A;  2V6O A;  4MJA A;  2A2R A;  2VM1 A;  4V1A g;  4NV2 A;  3M9J A;  2PMT A;  1TI3 A;  2AYT A;  2DBC A;  5A1N A;  4GST A;  3H8Q A;  2F8F A;  1EZK A;  2RUF A;  4HSC X;  1T00 A;  4TXO A;  4ZB9 A;  2C3N A;  22GS A;  2H75 A;  1SKS B;  2ZUP A;  5C00 A;  1OYJ A;  2WRT A;  4XCS A;  2MMA A;  4TN8 A;  1WPI A;  2WW2 A;  1AW9 A;  2R2J A;  4EDY A;  4CY6 A;  2VD1 A;  2C80 A;  2WZS A;  2P0G A;  1CQG A;  3KMN A;  4NAX A;  3ZML A;  5HFI A;  2PVQ A;  4BVY A;  5HR2 A;  1TRV A;  3RHB A;  5KN2 A;  4X43 A;  4ML6 A;  6GSX A;  3RAZ A;  5A5H B;  2H66 A;  1QMV A;  4I2T A;  3GL5 A;  2C0E A;  2IMI A;  4PNF A;  4WF5 A;  3TKR A;  3QAW A;  1DE1 A;  2DIY A;  5J5N A;  2YJH A;  2IMK A;  2PUK C;  4GQF A;  4ZBD A;  1FG4 A;  1YEP A;  2H6Y A;  2L6C A;  2VOC A;  3D4T A;  3GKM A;  4Q5Q A;  3GST A;  5IPH A;  1EGR A;  3GRX A;  5ECS A;  1F6M C; 
#chains in the Genus database with same CATH homology
 1ST9 A;  3QDN A;  2CAQ A;  3IR4 A;  1BED A;  2VCT A;  1HNB A;  5D9W A;  5D96 A;  1AQV A;  4I6X A;  2EIQ A;  2DIZ A;  4GF0 A;  2H6X A;  1ERU A;  1OKT A;  2IL3 A;  1O81 A;  1GSQ A;  5D73 A;  4KAE A;  1VF3 A;  1SJZ A;  3QD9 A;  5EY6 A;  4G19 A;  3GHA A;  5HR1 A;  2MBS A;  1F37 A;  5ECM B;  4KSM A;  1GH2 A;  1SU9 A;  1Z6M A;  4WEY A;  3H4K A;  4MZW A;  4E68 A;  1YY7 A;  2CAI A;  1XOA A;  2R0G A;  4RQR A;  1V57 A;  3EC3 A;  1U6T A;  4N30 A;  3TJJ A;  3FYG A;  1WE0 A;  4ZL9 A;  1ML6 A;  1BYE A;  2GZZ A;  4RQX A;  1MTC A;  4AKI A;  4JRR A;  2EIR A;  1UVZ A;  6GSV A;  5JWO B;  3BCI A;  1JFU A;  3UIW A;  3I9V 2;  3CTG A;  3IAM 2;  4F03 A;  3Q6O A;  1Y25 A;  1Y1U A;  1A0R P;  2VCX A;  2F8A A;  2FCH A;  3UAP A;  2A4V A;  1AQW A;  1FAA A;  1WIK A;  2YWI A;  3A2V A;  3RDW A;  3F9U A;  4E8E A;  4ECC A;  3F6D A;  1ZYP A;  1SVO A;  1TTZ A;  2B5Y A;  1I9D A;  3FZA A;  4AI6 A;  1FVJ A;  4JED A;  1YEX A;  3A2X A;  1J9B A;  4JR4 A;  4KND A;  1FO5 A;  2FWH A;  2HSH A;  2B1L A;  2VL2 C;  1AIU A;  2HYX A;  4BWQ A;  1M9A A;  5HFK A;  3TUE A;  3ZTL A;  2H19 A;  4POM A;  3FY7 A;  1F2E A;  4O5Q A;  4AF2 A;  3CSJ A;  2D2Z A;  3IPZ A;  2VKZ G;  2I4A A;  2VCW A;  1MDI A;  2VL2 A;  1O8W A;  5ECI B;  2H0H A;  3HKR A;  4G10 A;  2DJ0 A;  2ALB A;  4HQS A;  2IMF A;  2JAC A;  2VCQ A;  2P5R A;  2PER A;  3GUR A;  4OFN A;  2NPB A;  1GLQ A;  2DSA A;  3HXS A;  3ZFB A;  2HE3 A;  1ON4 A;  3IHG A;  1Z9H A;  4O5U A;  2FHE A;  4ACS A;  1Z6N A;  6GSY A;  1GSU A;  1A0F A;  4PXO A;  4I8B A;  2GT6 A;  1Z7R A;  5ECK B;  1XPV A;  4JE1 A;  2PWJ A;  4EDZ A;  2UZ8 A;  2E7P A;  3EU4 A;  3IXR A;  4AJ8 A;  5JWR B;  2LRN A;  2QKE A;  4G0L A;  5B7C A;  3P7X A;  1GTA A;  3WD6 A;  5FT3 A;  2PBJ A;  1PA3 A;  1BAY A;  2KLX A;  4WBR D;  1QXH A;  1JZD A;  4PQH A;  4EXJ A;  3TCO A;  3LGC A;  3HDC A;  1SL2 B;  3VWV A;  1FOV A;  2OE1 A;  4FYB A;  1X9M B;  1MD3 A;  3ME8 A;  2HI7 A;  1OC9 B;  1VRS D;  3LJR A;  2G0F A;  4DVC A;  4IGJ A;  5JCU A;  5IO2 A;  2NVL A;  2L4Q A;  2DMM A;  4CDO A;  5GAN D;  3RPP A;  1XFL A;  4Z2R A;  2OAD A;  1X5E A;  2RLI A;  1V2A A;  2GDR A;  3GMF A;  2VL9 A;  4IVF A;  4KDY A;  2C0D A;  1XWA A;  4K7I A;  1CQH A;  4KW6 A;  2QA2 A;  4HZ2 A;  3EUR A;  4IQ1 A;  2F9S A;  4N0Z A;  3UAR A;  2CA8 A;  2OA7 A;  3G7Y A;  5A4V A;  1OAZ A;  1Z3E A;  3DKS A;  2YZU A;  3GX0 A;  2LRT A;  2V6K A;  5J3R A;  1GRX A;  2LJR A;  4V2L A;  2EC4 A;  4ZIL A;  4GQC A;  4F9Z A;  4PGT A;  4NHW A;  1I5G A;  4EUY A;  2DJ2 A;  2ES7 A;  4OWY A;  2V41 A;  4IKH A;  5DCH A;  3CMI A;  3VI5 A;  1TRS A;  3J7Y b;  4HU7 A;  4DSS B;  1JZO A;  3DIE A;  2LNT A;  1OC9 A;  1GUL A;  2HRK B;  2B5X A;  1PGT A;  4F0B A;  4JZQ A;  1K0C A;  4G9H A;  3RPN A;  4IP6 A;  2H8L A;  4YQM A;  2WDU A;  5ENU A;  3ERG A;  4I97 A;  3C73 A;  4MJE A;  4IS0 A;  5ECP B;  1M2D A;  3CRU A;  2JSZ A;  2REM A;  4G2E A;  3KGK A;  5HR3 A;  4V1A p;  5BMU B;  1T4Z A;  2YWO A;  4MK3 A;  1VGL A;  4EKZ A;  2AAW A;  3FMW A;  4O5R A;  4MH3 A;  2I1U A;  2X99 A;  1URM A;  1S3A A;  4QL9 A;  3HY2 A;  2C4J A;  2X4A A;  1H4O A;  1AAZ A;  5J47 A;  3O76 A;  3F8U A;  1BG5 A;  5IMF A;  3A5I A;  4CW9 A;  3ZIT A;  1LJR A;  2MZC A;  4DSS A;  1JLW A;  2N5A A;  3VI7 A;  2N5F A;  4HJM A;  3LSZ A;  1ERW A;  1TK5 B;  2HRK A;  3A2W A;  1SK2 A;  1EOG A;  1ERT A;  4YAV A;  4NXI A;  2R4V A;  1T3B A;  1T1V A;  1B8X A;  2WFC A;  2IWT A;  4WXT A;  4LL4 B;  3KCM A;  4K1F A;  5BMU A;  1THX A;  5INY A;  5D93 A;  4MF6 A;  3L9S A;  3OR5 A;  1M9B A;  1O73 A;  5CRW A;  3DML A;  4IW9 A;  2YWM A;  1GLP A;  1QFN A;  3KH9 A;  2LS5 A;  4MF7 A;  3D22 A;  1NM3 A;  1PL1 A;  3UBL A;  1XWC A;  2LQQ A;  1TK0 B;  1U87 A;  1ZMA A;  2J9H A;  4POB A;  3LYP A;  5A5K A;  1A2J A;  2K18 A;  1NW2 A;  1JHB A;  1AUC A;  3D21 A;  1K0D A;  12GS A;  4DEJ A;  4F0C A;  2NBS A;  2NTO A;  2GSR A;  1XZO A;  3IV4 A;  3GYK A;  2H1L A;  5ECH B;  2GSQ A;  4ECI A;  1B9Y C;  2WB9 A;  4LMW A;  1T7P B;  1XW9 A;  5ECO B;  1SEN A;  3C1R A;  4L0W A;  2OE3 A;  1FW1 A;  1EWX A;  2RII A;  4AKG A;  2WUL A;  5CAX A;  3EE2 A;  2KP1 A;  1J0F A;  3KXO A;  1YDK A;  3VWW A;  4X4J A;  3APS A;  2AHE A;  4ZL7 A;  1XVW A;  4PQ1 A;  3PR8 A;  4WET A;  3NOF A;  4K2X A;  1VF4 A;  3I6A A;  1X9S B;  4K6X A;  3EWL A;  2HLS A;  3FZ5 A;  1U3I A;  4MZB A;  2VL3 A;  2A4H A;  2VM2 A;  3UEM A;  1A2M A;  5KN1 A;  1TRU A;  3M9K A;  1PSQ A;  3M0F A;  3S9F A;  5LNK e;  3ERW A;  3KD0 A;  1Q4J A;  1XW6 A;  3LXT A;  1PD2 1;  1BF5 A;  3GUS A;  2OE0 A;  4LMV A;  3TOT A;  3KZQ A;  1AXD A;  3GFK A;  2X8H A;  5ELA A;  2R0C A;  1ZOF A;  1OC8 A;  3DYR A;  5CNW A;  2IN3 A;  1TU8 A;  5C04 A;  5G30 A;  2WCI A;  3G9B A;  1TI1 A;  4Z2T A;  2VD0 A;  2GLR A;  2EFC A;  5F07 A;  3VK9 A;  1A8L A;  1G7E A;  4HQZ A;  2FUG 2;  3UOM A;  10GS A;  1LU4 A;  2V2G A;  5ABR A;  5DBQ A;  4XS4 B;  2LKU A;  1W89 A;  3F3R A;  2MBT A;  2GQM A;  3N5O A;  2AB6 A;  4LA1 A;  4ZL8 A;  3F0I A;  3WGD A;  5LD0 A;  3HZ8 A;  3WGX A;  4TRX A;  4NV5 A;  1PKZ A;  5J4Y A;  1YJ6 A;  4YKF A;  5AIS A;  1TJD A;  3LWA A;  3D0Z A;  2HRF A;  5IO0 A;  1V98 A;  1A2L A;  2LUS A;  4K5R A;  4XS6 A;  2VO4 A;  2H0I A;  4EO3 A;  3IK7 A;  1MDJ A;  3HVV A;  5KOX A;  2HT9 A;  1YKA A;  1M0U A;  3BD2 A;  2HQT A;  1USB A;  4ZBA A;  4P3Y B;  4N10 A;  1M2A A;  1S3D A;  2XBQ A;  1Z7P A;  2B7J A;  2C3Q A;  5IMC A;  1M2B A;  2JZS A;  2M80 A;  1X5C A;  5H5Q A;  2H0G A;  1TXU A;  3TKS C;  4MMM A;  4ID0 A;  4XS4 A;  2MYG A;  1ZZY A;  2O89 A;  1SL0 B;  5JWQ B;  1EGO A;  1GTI A;  4MPF A;  4RUV A;  5F05 A;  3TKS A;  4PTS A;  4KE3 A;  5IMA A;  3TDG A;  2HSN B;  3L9V A;  3M1G A;  2A2P A;  1H75 A;  2XHF A;  4MCU A;  2EFH A;  3IAS 2;  1Z5Y E;  5G1K A;  2YZH A;  2E0Q A;  2L5O A;  2HRN A;  4AKX B;  2DJJ A;  4NWY A;  2AJQ B;  1XWB A;  2QGV A;  2YNX A;  4FIW A;  3IC8 A;  4F2I A;  5IMZ A;  2GGT A;  2VLU A;  2OAC A;  4PNG A;  3W8S A;  2YOI A;  2XPE A;  1UN2 A;  2PU9 C;  2V1M A;  2TRC P;  3IK9 A;  3Q18 A;  2CVB A;  3IA1 A;  2FWE A;  1TXX A;  2L6D A;  5G5F A;  1YF0 A;  1EV9 A;  1XWK A;  2FA8 A;  3FKF A;  3TRP A;  4L5O A;  3H79 A;  4G01 A;  3ZIJ A;  1TDI A;  1BX9 A;  3TJB A;  4WKW A;  1RW1 A;  1BQ7 A;  5AIV A;  2DJK A;  2HSN A;  2CQ9 A;  4ILF A;  1SJI A;  4NPB A;  2HZE B;  3TJK A;  4TXV A;  2LST A;  2B5E A;  3GSS A;  3VFI A;  2WZ9 A;  3KMO A;  4YAP A;  4YQV A;  3GKX A;  1JZR A;  2LV3 A;  2NDO A;  1SVL A;  5KN3 A;  2B1K A;  1MDK A;  1FB6 A;  2H1G A;  1XBS A;  2L5L A;  5IPG A;  2R5G A;  4IJ3 A;  1G6Y A;  3LW9 A;  3UMA A;  3WYW A;  4KCA A;  3HJP A;  3LFL A;  1R26 A;  2YJ7 A;  1T8E B;  4KB3 A;  4ULX A;  3TKQ A;  1GTU A;  4K8M A;  1TP9 A;  1V9W A;  2VIM A;  5H5S A;  1XIY A;  3MYD A;  3KEB A;  3DD3 A;  2C3T A;  1HQO A;  4BVX B;  3CSH A;  1KEB A;  3US3 A;  2DML A;  1AC1 A;  2CX4 A;  1FB0 A;  2PN8 A;  1YVL A;  4TR4 A;  4L8E A;  2VCZ A;  1NHO A;  1TW9 A;  2GQK A;  2HZE A;  3DGQ A;  1XXU A;  2OKA A;  3EMP A;  3H93 A;  5J9C A;  1HNA A;  4HOJ A;  4HUA A;  3TOU A;  3F63 A;  2JU5 A;  4MJC A;  4TR1 B;  3K8N A;  3JCM L;  4BPY A;  4X1U A;  5FWG A;  5GAP D;  2XPD A;  3W8J A;  1N25 A;  2G2Q A;  1GL8 A;  1K0B A;  1GSF A;  5DDL A;  1VF1 A;  1PMT A;  5CRE A;  2BTO T;  1SJ6 A;  3GKK A;  1PN0 A;  4EF0 A;  3APQ A;  1G7O A;  2GZP A;  2CZ3 A;  1SK0 A;  3O6T A;  4BVX A;  6GST A;  3H1N A;  3FEU A;  1THO A;  2XC2 A;  2N5B A;  3HJM A;  4J2F A;  3ZMK A;  4IN0 A;  3RBT A;  4HI7 A;  2ON7 A;  3EMX A;  4O7H A;  4GTU A;  1OE8 A;  4ZB6 A;  3GL3 A;  3ZYW A;  4XRA A;  4OO5 A;  2A2S A;  3R3E A;  3CSI A;  2C0F A;  1R4W A;  2H1B A;  4TR1 A;  5G31 A;  1SKW B;  4OFT A;  5KOW A;  1QUW A;  3PPU A;  2R6K A;  2O87 A;  3F6F A;  1EP8 A;  2RM5 A;  5DJM A;  1X5D A;  1C72 A;  2GSS A;  1WWJ A;  4K7O A;  4KUN A;  4KDX A;  5AGY A;  2BMX A;  4OCE A;  4KH7 A;  2PVO C;  2YV9 A;  2HNL A;  4ISD A;  1MD4 A;  4JU5 A;  2HSM B;  1GSY A;  3HVX A;  3D4M A;  2ON5 A;  3VWU A;  4K2D A;  2KP2 A;  1B4Q A;  4MAB A;  3D6I A;  4HEA 2;  4LLR A;  2JL4 A;  1QGV A;  3QMX A;  3F3Q A;  3KP9 A;  2K8S A;  5CO3 A;  3EPT A;  4IJI A;  1A23 A;  3P90 A;  3PIN A;  4QQ7 A;  3MWH A;  1J08 A;  2WGR A;  5J4V A;  1PQN A;  3FW2 A;  3ZIV A;  4QL7 A;  1WJK A;  3QAG A;  3MNG A;  2H6Z A;  3ZVJ D;  5D8I A;  5IQY A;  2WS2 A;  3APO A;  3F4R A;  3WT2 A;  5H5R A;  2EFE A;  4L5L A;  19GS A;  4PQI A;  2DLX A;  4AJ6 A;  3QPM A;  3BJ5 A;  1SKR B;  3SBC A;  2HSM A;  2FWG A;  5EL8 A;  3TJG A;  1RK4 A;  4YH2 A;  2WJU A;  2HFD A;  1R5P A;  5F06 A;  3W6G A;  1UA5 A;  5LCZ A;  4PUF C;  3CBU A;  3KJY A;  2K9F A;  4XS1 A;  1Q98 A;  1ZYE A;  1PL2 A;  2QSI A;  4TR3 A;  2O8V B;  8GSS A;  2CX3 A;  3GH6 A;  4L0U A;  2EFD A;  5L71 A;  4AGS A;  4E8H A;  1KNG A;  2KOK A;  4MPG A;  3ZRD A;  4FYC A;  4CY8 A;  3HJO A;  1WRY A;  7GSS A;  3I43 A;  2MMO A;  5J9B A;  4GSN A;  5IIZ A;  1R5A A;  4EIP A;  1ZL9 A;  1GUK A;  4GDF A;  4EVM A;  2GT5 A;  2RUE A;  3HYP A;  2ZCT A;  3N9J A;  5DCG A;  5E4W A;  3C1S A;  3NZN A;  4TKY A;  1SYX A;  1RQM A;  4OCF A;  1TK8 B;  3ZZX A;  3LEF A;  5A4U A;  3IC4 A;  1XW5 A;  4PX1 A;  3CXG A;  2MMZ A;  5COH A;  4TVE A;  3KTB A;  4MDC A;  5A4W A;  4X0X A;  5IOW A;  3J7Y k;  2FA4 A;  1DUG A;  2B3S A;  1S3C A;  2H71 A;  1A24 A;  5ELG A;  5B6N A;  4HJ2 A;  2DKH A;  1EEM A;  4MZC A;  4WR5 A;  2R0P A;  3U5R E;  2J23 A;  3E9J B;  2GQL A;  5BRT A;  1OE7 A;  4KSO A;  2TRX A;  1GUM A;  5ID2 B;  1SK1 A;  2B7K A;  3EIN A;  1GTB A;  1K3Y A;  4BWS A;  4NHZ A;  4ZIJ A;  5JCW A;  1K3O A;  5ECN B;  3EU3 A;  3A3T A;  4FYU A;  3RHC A;  2VAF A;  3CWG A;  2DKI A;  3QFA C;  4K7N A;  2C8U A;  2X49 A;  5KEJ A;  2R37 A;  4I5Q A;  3EYT A;  1PN9 A;  2YPM A;  4MP4 A;  2YWN A;  3TRX A;  4EIQ A;  4WF4 A;  2JZR A;  3LG6 A;  4MJB A;  18GS A;  4POL A;  1XWG A;  1AQX A;  2HSY A;  2JAD A;  4J56 E;  2YP6 A;  4G0I A;  5F8B A;  3CTF A;  1K3L A;  1SD9 A;  3UJ1 A;  1GNW A;  2H01 A;  3VUR A;  1ZCP A;  4H86 A;  3L78 A;  3IDV A;  5ID2 A;  3FR3 A;  5EVO A;  5AIX A;  3G7J A;  5J4U A;  2R3X A;  5ECL B;  1EV4 A;  3GIX A;  3PH9 A;  3VPQ A;  2L57 A;  4GCI A;  1A8Y A;  1M99 A;  1HYU A;  3HZ4 A;  1G6W A;  14GS A;  3GKN A;  1B9X C;  2AUV A;  1EEJ A;  2CV4 A;  1IYI A;  4K0N A;  4LL1 B;  3KM6 A;  4AJ7 A;  5HQP A;  3KP8 A;  3LOR A;  16GS A;  2BJX A;  1K0N A;  4KCE A;  2F3M A;  4TOP A;  4N0V A;  5GST A;  5G2Z A;  1PRX A;  4O92 A;  4MF5 A;  4OO4 A;  1K0A A;  4NMU A;  1GSE A;  3M8N A;  5KN0 A;  1JLV A;  5A5H A;  1ABA A;  2XBI A;  1IYH A;  3DVW A;  2DC5 A;  1MEK A;  2H1D A;  4YKG A;  1BG1 A;  2VLT A;  1BJX A;  2FNO A;  1WP0 A;  3TKP A;  2IPA A;  2L4C A;  4G0K A;  1OVN A;  3VLN A;  3ME7 A;  1U88 A;  2LRC A;  4XIH A;  3SWL A;  1UC7 A;  1EP7 A;  4PUR A;  4ECJ A;  4IEL A;  1GSD A;  4ECB A;  4D73 B;  1DE2 A;  4FO5 A;  3NIV A;  3WGE A;  5HR0 A;  2QC7 A;  1N2A A;  1X9W B;  2C0G A;  3UVT A;  5CYY A;  2CZ2 A;  3ERF A;  2H76 A;  2PGT A;  4KDU A;  1SD8 A;  2FLS A;  5CRD A;  3QOU A;  1PX7 A;  3Q74 A;  3G7I A;  3GX8 A;  2ZNM A;  2LEG A;  3C71 A;  1FOH A;  2OT3 A;  3I69 A;  3F4T A;  3P8W A;  1ZGN A;  1FHE A;  4HDE A;  4ZB8 A;  4Q5R A;  3GNJ A;  5DQY A;  2F51 A;  4HS1 A;  5D9V A;  5D9X A;  1PX6 A;  3UBK A;  3UL3 A;  4V2N A;  3HA9 A;  1XVQ A;  3ISO A;  1ERV A;  2GZY A;  5DVB A;  4WR4 A;  1O7U A;  11GS A;  4TR0 A;  1YQ1 A;  2H70 A;  2CT6 A;  2FWF A;  2HZF A;  2H30 A;  4GXZ A;  1WOU A;  4D73 A;  5HFG A;  3TRQ A;  4JBB A;  1FVK A;  5IM9 A;  4N11 A;  1ZYQ B;  3IOS A;  2O85 A;  1ZYN A;  3TKS E;  1O8X A;  2M72 A;  3MDK A;  2FY6 A;  4Z7X A;  4ZXG A;  3QFB C;  4AKH A;  4IQA A;  3DRN A;  5DQS A;  2L59 A;  3KTL A;  2JSY A;  2M46 A;  1JZW A;  4OMV A;  1DSB A;  1F3B A;  3A5W A;  3DVX A;  1YZX A;  1LBK A;  1HD2 A;  3HMJ G;  5GSS A;  1B48 A;  5IMD A;  3EVI A;  4W66 A;  1B4P A;  3IE3 A;  2PPT A;  4FH8 A;  3DXB A;  2CVD A;  5CRG A;  4Z2U A;  3E0U A;  4YQU A;  1F9M A;  1TOF A;  4JR6 A;  3ZFL A;  4DSR A;  1GNE A;  4ML1 A;  3F4S A;  1GSS A;  3M3M A;  2C1Y A;  3ZLP A;  3IRA A;  3ZVJ A;  2HXK A;  3DWV A;  5A34 B;  3QCP A;  3CYN A;  4GLT A;  3BCK A;  1NSW A;  1OKD A;  4XTS A;  2H72 A;  1M7T A;  1O6J A;  4HU9 A;  4QMK A;  1KBN A;  3GV1 A;  1O85 A;  4TW5 A;  1K0O A;  4USS A;  1V58 A;  4V2M A;  2B6M A;  3P2A A;  2I3Y A;  2K8V A;  5ECR B;  1XCC A;  4K9Z A;  2IFQ B;  1F3A A;  3Q19 A;  4KX4 A;  2X8G A;  2UV8 G;  5J40 A;  2FGX A;  5CP1 A;  2LNS A;  1ACV A;  17GS A;  3GH9 A;  9GSS A;  4A5P A;  2IMD A;  2CVK A;  1ILO A;  2O5V A;  3FR6 A;  1DBY A;  2YCD A;  4OFM A;  2P31 A;  13GS A;  4GSS A;  1NHY A;  2DJ3 A;  4IP1 A;  3ED3 A;  4IBP A;  2I81 A;  2AV4 A;  1W4V A;  2GVP A;  3MAK A;  4XRD A;  4K5S A;  6GSU A;  1TU7 A;  4DSQ A;  3UVH A;  5FHI A;  5A34 A;  3VPT A;  1SL1 B;  4PUA A;  2X8C A;  1XOB A;  3FK8 A;  3HVS A;  3E3E A;  2KUC A;  3GA4 A;  3FZ9 A;  1E6B A;  3L4N A;  4ZBB A;  2O7K A;  5ECQ B;  3IHQ A;  4F82 A;  1YKC A;  1YF1 A;  4N3Z A;  5B6M A;  1TRW A;  2Z9S A;  5GZZ B;  1R7H A;  2OBI A;  20GS A;  5B8B A;  3C8E A;  3PGT A;  2IFQ A;  2YAN A;  3FR9 A;  4RI7 A;  4HZ4 A;  1GUH A;  4GWR A;  5E59 A;  5DAL B;  4BL7 B;  3C7M A;  2LQO A;  1HNC A;  1SYR A;  3TU3 B;  5DAK B;  1E2Y A;  5IMV A;  5B8A A;  5AN1 A;  3TB2 A;  3TGZ A;  4KGI A;  2KHP A;  2GST A;  3HCZ A;  2E2G A;  3R2Q A;  4IHU A;  2E2M A;  4POK A;  3FZ4 A;  3IBH A;  4Q5F A;  1QQ2 A;  3GTU B;  2YV7 A;  3ZL5 A;  3U6V A;  2V32 A;  4MA9 A;  3ZRE A;  1KTE A;  4FQU A;  5J41 A;  2GS3 A;  1EOH A;  3HD5 A;  3MSZ A;  4EC0 A;  4XHM A;  4KA0 A;  3MIX A;  2OBK A;  2LJK A;  3FHK A;  3AY8 A;  1X0R A;  2H73 A;  1GWC A;  3QR6 A;  4Q5N A;  1V40 A;  2K6V A;  2FD3 A;  3KH7 A;  2VLV A;  1VF2 A;  3LYK A;  3WT1 A;  3O3T A;  5CRH A;  2JZT A;  5DAL A;  4KF9 A;  2DJ1 A;  1Y6E A;  4BL7 A;  3V1W A;  4MH2 A;  1TKD B;  5EPF A;  4I2U A;  3LQ7 A;  4CHS A;  3HHV A;  5DAK A;  3L0H A;  2IJY A;  2VUP A;  3BOA A;  4EE0 A;  4ZB7 A;  4ICY A;  3FRC A;  3QAV A;  2LJA A;  1K0M A;  6GSW A;  5A1N B;  3GN3 A;  3D5J A;  2OJL A;  2GTU A;  4J57 E;  4K0G A;  3L9U A;  4TXO B;  4BA7 A;  4GRF A;  3KIJ A;  3VWX A;  4O32 A;  6GSS A;  3GTU A;  2EIO A;  2YN1 A;  1N8J A;  2I9H A;  2RM6 A;  5JCG A;  3BBY A;  5G1L A;  1PKW A;  3CRT A;  1GP1 A;  4MLY A;  4EL1 A;  2QA1 A;  2IME A;  2HRA A;  2TIR A;  5DJL A;  2VCV A;  2MMN A;  4WBJ A;  5D9T A;  5G5E A;  5F0G A;  1QK8 A;  1OC3 A;  3DEX A;  2P5Q A;  5IOX A;  3TJF A;  4RI6 A;  1T4Y A;  1SVM A;  1WMJ A;  2H1A A;  2H74 A;  4BVY B;  1G0T A;  2IIY A;  4MNN A;  2X64 A;  1U3A A;  2LTK A;  3LXZ A;  4OD7 A;  2V6O A;  4MJA A;  2A2R A;  2VM1 A;  4V1A g;  4NV2 A;  3M9J A;  2PMT A;  1TI3 A;  2AYT A;  2DBC A;  5A1N A;  4GST A;  3H8Q A;  2F8F A;  1EZK A;  2RUF A;  1T00 A;  4TXO A;  4ZB9 A;  2C3N A;  22GS A;  2H75 A;  1SKS B;  2ZUP A;  5C00 A;  1OYJ A;  2WRT A;  4XCS A;  2MMA A;  4TN8 A;  1WPI A;  1AW9 A;  2R2J A;  4EDY A;  4CY6 A;  2VD1 A;  2C80 A;  2P0G A;  1CQG A;  3KMN A;  4NAX A;  3ZML A;  5HFI A;  2PVQ A;  4BVY A;  5HR2 A;  1TRV A;  3RHB A;  5KN2 A;  4X43 A;  4ML6 A;  6GSX A;  3RAZ A;  5A5H B;  2H66 A;  1QMV A;  4I2T A;  3GL5 A;  2C0E A;  2IMI A;  4PNF A;  4WF5 A;  3TKR A;  3QAW A;  1DE1 A;  2DIY A;  5J5N A;  2YJH A;  2IMK A;  2PUK C;  4GQF A;  4ZBD A;  1FG4 A;  1YEP A;  2H6Y A;  2L6C A;  2VOC A;  3D4T A;  3GKM A;  4Q5Q A;  3GST A;  5IPH A;  1EGR A;  3GRX A;  5ECS A;  1F6M C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...