4MDCA

Crystal structure of glutathione s-transferase from sinorhizobium meliloti 1021, nysgrc target 021389
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
231
structure length
231
Chain Sequence
b'SMPTLYHHPMSPASRFVRLILSEYGYQTELSEEQPWENRRDFLTLNPAGTLPVYVDDSMRALCGATIISEYLDETSGIMKRDRRLLAEDPFQRAEIRRLTEWFLQKMEADVTRPLVRERIFKLQMTPDQGGGAPDSKILRTSRSNIRQHMKYLSWLAGSRPWLAGDRISYGDLAAAAAISVLDYLGEIDWSDAPTAKEWYQRLKSRPSFRPLLAERVRGVTPVSHYADLDF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative glutathione S-transferase
publication title Crystal structure of glutathione S-transferase from Sinorhizobium meliloti 1021
rcsb
source organism Sinorhizobium meliloti
molecule tags Transferase
total genus 83
structure length 231
sequence length 231
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2013-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4mdcA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4mdcA01
1U3IA 2X8HA 3QFBC 1NHOA 2H66A 3GL3A 3TKPA 3TJBA 1OKTA 2OBIA 2DJ0A 3A3TA 1PL2A 5G5FA 2EIQA 5ABRA 1Z5YE 4GSTA 1JZWA 4KE3A 3ISOA 2YANA 3IV4A 2CX3A 2V41A 4Q5NA 2A4VA 5A4VA 2VCTA 2GQLA 4GWRA 1M2BA 4ZB8A 1MD4A 4L5LA 2I4AA 3M8NA 4ZIJA 1GSSA 4OFTA 4QQ7A 3GA4A 4TR4A 1UVZA 4XRDA 1CQHA 5B8BA 1Z7PA 2LQOA 1X9WB 2AB6A 3IE3A 1TOFA 1GL8A 3Q18A 1THOA 2CZ3A 1TJDA 3F0IA 1H4OA 5ECKB 3GFKA 3HZ4A 2KLXA 4N10A 2HLSA 2H0IA 2GSQA 4XIHA 4MK3A 1SKSB 1ML6A 3P2AA 3QAGA 3WD6A 1T4YA 2R6KA 4L0UA 2DSAA 1WMJA 5LCZA 4BA7A 3JCML 2DJ1A 5ECPB 1XFLA 4ML6A 5E59A 4PQHA 3GL5A 4RI6A 1MDJA 3GURA 22GSA 2O7KA 5ECLB 3KGKA 5DQYA 2LJKA 4WXTA 2LNTA 1K3OA 2E7PA 3C7MA 1QMVA 5F06A 5JWRB 4F2IA 1M9BA 4HJ2A 3TJGA 3L0HA 3GYKA 2GT6A 1MDKA 2LEGA 4BL7A 3LFLA 2XHFA 1PSQA 4POMA 1QGVA 2HE3A 1U88A 4OCFA 1Z6NA 1K0NA 2X8CA 4JR4A 3E0UA 2WZ9A 3LJRA 1F6MC 4IGJA 1F2EA 4PTSA 2O89A 1M2DA 2E2MA 4TXOA 1U87A 3QR6A 4KSOA 1ERVA 4MJAA 1ERTA 1A0FA 7GSSA 4KSMA 2H1BA 1VF4A 3DYRA 4G9HA 2HI7A 3EURA 3RBTA 4TR3A 3C1SA 5DQSA 1EP7A 4J56E 4K0GA 4K7IA 5G1LA 1USBA 1JZDA 5F07A 4IVFA 1SD8A 1G7EA 1TTZA 1AW9A 2VLTA 3DEXA 3V1WA 1CQGA 3TRPA 1A2JA 3P90A 1ST9A 3ZL5A 2L57A 3C71A 4PURA 1RW1A 4K1FA 3C8EA 3H8QA 3LORA 5D8IA 5DAKB 4K6XA 2J9HA 4DSSA 4EKZA 1DBYA 3KP8A 3RPPA 2YP6A 1FAAA 3L78A 2C80A 2CAIA 3LYKA 4HU7A 2GSRA 3KM6A 3UOMA 1OKDA 3R2QA 4AJ7A 1TK5B 2IIYA 1R5AA 4HEA2 3L9UA 1GSUA 1NM3A 3F4RA 2G2QA 5ECIB 2GT5A 2CV4A 3EMPA 5A5KA 4RQXA 2P0GA 5HFGA 1EEJA 4EO3A 5CREA 3GH9A 4JR6A 2PWJA 4ML1A 1FB0A 1IYHA 4HOJA 4TOPA 3KMNA 2HSHA 4N11A 1THXA 3LG6A 1SK2A 2PVOC 3G9BA 1ACVA 3PPUA 3CTGA 3VWUA 2DIYA 5J9CA 1Q4JA 3IR4A 3IAS2 3TOUA 2OBKA 1Y25A 3LWAA 1NHYA 4NMUA 1KTEA 2VM2A 2JACA 1GSEA 3UVTA 2F8FA 4JBBA 1ZYEA 4LL1B 2PMTA 3ZITA 1G0TA 2B5EA 4BVYB 4KGIA 1M9AA 2HSMB 3KD0A 2OKAA 3ZYWA 1WRYA 5ID2A 1UA5A 3HHVA 1O7UA 1TK0B 4OO4A 3WT2A 4K7OA 2WJUA 2IFQB 3CSJA 2XBIA 1EGOA 1PKWA 2RUFA 5LNKe 4L8EA 2DMLA 4XCSA 1IYIA 2H19A 2XBQA 1ILOA 4GCIA 4WEYA 1EGRA 3FY7A 4IBPA 3NOFA 1TDIA 4IELA 1K0CA 2PERA 5AIXA 4L0WA 1B48A 3EE2A 3ZREA 2K8VA 4MABA 3DD3A 1A8LA 2FA8A 4BVXA 1AAZA 4EC0A 4JU5A 3TDGA 4MZBA 3M9KA 3G7JA 2N5AA 5GZZB 5D73A 3MNGA 2OE0A 2DC5A 20GSA 1ZYQB 4ZL8A 1YF1A 1GTIA 3ZIJA 3CMIA 2VOCA 4ECJA 1XIYA 4XHMA 5IQYA 2WB9A 3KTBA 1X5CA 4TXVA 3WYWA 1FW1A 4I6XA 2ON7A 3A2VA 4ZBDA 1YJ6A 3D0ZA 3IRAA 5LD0A 3IPZA 4FIWA 3GTUA 4AJ6A 1AQWA 1BAYA 4O92A 4KF9A 1GLQA 2VLUA 4K8MA 3D22A 1I5GA 1EZKA 2PU9C 1QFNA 3U5RE 1YEXA 1PGTA 5CYYA 4N30A 1EOGA 1GTAA 2B1KA 2RLIA 3BCIA 1M99A 3ZTLA 5GSSA 4OWYA 4MJCA 4N0ZA 2ON5A 3N5OA 2C0GA 5AN1A 1I9DA 5AGYA 3DXBA 2R37A 3GUSA 3KXOA 1XBSA 2H6YA 1LJRA 1WPIA 1XWBA 3IBHA 1G7OA 3EYTA 2LNSA 2FGXA 1QXHA 2ZCTA 4V2LA 1PL1A 3BD2A 3IOSA 4WF5A 1GULA 3F3RA 4E8EA 3UL3A 3F4TA 2R2JA 2I81A 5IMZA 2C3QA 1NSWA 2PUKC 2HZEA 9GSSA 4TRXA 2CVDA 1JZOA 2MMOA 2ZNMA 4GQCA 3R3EA 4NHWA 1O73A 5DALB 4XS1A 5EY6A 2F8AA 4GF0A 5FT3A 1ERUA 2CVKA 1R26A 3G7YA 2FLSA 4NHZA 1Y6EA 3LXZA 3RAZA 4KDUA 1XWGA 1O8WA 3FZ5A 1QK8A 1O6JA 4K9ZA 2VCXA 3MDKA 4AGSA 2LV3A 5IOWA 1AIUA 5GAPD 1VF3A 1RK4A 5AISA 4RQRA 3TJFA 5EVOA 3A2XA 1SKWB 1WP0A 3TB2A 2VL2A 1FVKA 3APSA 2DJ3A 5J41A 1SJ6A 4ULXA 5B6NA 6GSXA 2VL9A 1MTCA 4WETA 1A2LA 1YKAA 3K8NA 2F51A 3U6VA 5B7CA 1ERWA 4GTUA 5GSTA 1X5EA 2HT9A 4OCEA 3FZ9A 3O76A 5G5EA 1XWCA 3EU4A 4LL4B 5JWQB 4I2TA 4G0IA 1OYJA 3GKMA 5ECOB 1YDKA 1SL1B 1TW9A 1TI1A 2HQTA 1WIKA 3W6GA 2GSSA 1GLPA 2YZHA 3GX0A 2YOIA 5JCUA 1N8JA 4ZXGA 2XC2A 3A5WA 1T4ZA 5CRGA 2VLVA 1N2AA 3ZLPA 1HNCA 4TXOB 1K3YA 4MF5A 3UBKA 2GZZA 4IP6A 1BJXA 2R5GA 1GP1A 2REMA 1F37A 1S3DA 2IPAA 5C04A 5IPGA 2R4VA 3LQ7A 4YAPA 1JLVA 6GSVA 2H01A 2OACA 4V2NA 1S3AA 3O3TA 3TKQA 3IK7A 1GUMA 4MPFA 1SJIA 1K0OA 1OC9B 5ENUA 4PGTA 3GSSA 2CQ9A 2V6KA 3QFAC 3I69A 4JZQA 4WKWA 1SYRA 18GSA 1YF0A 4G19A 5IMFA 4MJBA 4XS6A 3GHAA 2H75A 2D2ZA 1TP9A 3KH7A 2C0FA 1JHBA 3CSIA 2B5YA 3UIWA 2NTOA 2B5XA 1E2YA 2AV4A 4KDXA 5AIVA 2DMMA 3TGZA 2FWEA 3SBCA 3TUEA 1GNEA 4KAEA 4ZB9A 3TKRA 3DMLA 4NPBA 4ZL7A 4POLA 2PN8A 3VI7A 1K0BA 2YWIA 2JSZA 4PQ1A 1GSYA 2WCIA 4YAVA 2B6MA 1DSBA 1BYEA 4EDZA 4FYCA 4PNFA 2HSYA 3UEMA 4PUAA 2DJ2A 1AQXA 3RPNA 4HJMA 1ZL9A 1GH2A 1XW5A 1OE7A 4I8BA 2F9SA 3EU3A 3HVSA 3DGQA 3GV1A 1F3BA 3UMAA 2N5FA 1UC7A 4GXZA 3F9UA 3ZMLA 4Q5QA 1WWJA 4X43A 4MDCA 2V1MA 3WGEA 3VPQA 1YEPA 4V1Ag 1W4VA 1JFUA 1R7HA 2WRTA 1A24A 4MF6A 2WGRA 1M2AA 3US3A 4KDYA 1V57A 2HFDA 2BJXA 1GTUA 1XW9A 3ERGA 2DJJA 4JE1A 1MD3A 2GDRA 2CA8A 5ELGA 4MF7A 4Q5RA 1T00A 5DDLA 2AYTA 2IMFA 1G6WA 3RHCA 4TR1B 5D9VA 2FWHA 1PRXA 4O5RA 4BWQA 1J0FA 3LXTA 4GSNA 6GSSA 1X9MB 2WS2A 2P31A 5CAXA 1SD9A 2AHEA 3KJYA 2GLRA 1K3LA 3IDVA 1T8EB 3H4KA 3VURA 3F63A 1TU8A 4IJ3A 3VI5A 4IS0A 2ES7A 1EP8A 1XXUA 2B3SA 3EWLA 5ECHB 5H5SA 2H70A 5ELAA 4NXIA 1SL2B 1A8YA 3TKSA 1OC3A 1T1VA 3ZMKA 2IN3A 2K18A 2KP2A 5D96A 3GRXA 2HRKB 1BX9A 2PBJA 3G7IA 3UARA 5HFKA 5CRHA 1EV9A 1FVJA 8GSSA 3VWWA 2OA7A 3ZIVA 3L9SA 4PUFC 6GSWA 2MBTA 1G6YA 2J23A 2PPTA 4K2DA 2LJRA 3GTUB 3L9VA 2L5OA 1ABAA 3W8JA 3KCMA 4D73A 5H5QA 2AJQB 2LRTA 3ZVJD 19GSA 2LRNA 5ECSA 3VPTA 2K8SA 4CW9A 4DSRA 4HQZA 3GKKA 3EMXA 4KCAA 2MYGA 4XRAA 5D9TA 4GRFA 5C00A 2MMZA 4J2FA 3CRTA 1F9MA 2YNXA 2FUG2 3IHQA 2IMIA 1FO5A 1MEKA 2X99A 1Z9HA 3H93A 2GSTA 4HZ2A 5DAKA 1XWKA 2IL3A 5KEJA 2H6ZA 2H76A 5G2ZA 5D9WA 4EL1A 3IXRA 1K0AA 5CO3A 2KHPA 1GUKA 3QDNA 2HSNB 2K6VA 1GSDA 2L6CA 3W8SA 4HZ4A 1Z7RA 3HYPA 2YWNA 5FHIA 2WULA 5D93A 2FCHA 4EE0A 3GNJA 5ECRB 4KB3A 3AY8A 3Q19A 3M3MA 3QAVA 2X64A 4ECIA 2DIZA 1O8XA 1YZXA 3DWVA 4GLTA 1TRSA 1J08A 5CRWA 4HUAA 3D4TA 4CHSA 3N9JA 1XVWA 3UAPA 2FA4A 5HR0A 2YZUA 1DUGA 1V2AA 2KUCA 3S9FA 4EVMA 4MLYA 2K9FA 3HDCA 1YY7A 2TRXA 4XS4B 5INYA 4KCEA 4ECCA 1GSFA 3F6FA 4QL7A 2PVQA 4KX4A 4OFMA 2QSIA 2JL4A 3HJOA 1S3CA 2C3TA 2JZSA 2GZPA 3VWXA 2RUEA 1XOAA 1J9BA 4BVYA 4MZWA 4LMVA 2HSMA 2YV9A 2H73A 1JLWA 1SKRB 5KN1A 4HQSA 2EIRA 1TRWA 1F3AA 2IFQA 2RIIA 4D73B 5IMAA 2E0QA 12GSA 2R3XA 4WR4A 2NDOA 3PINA 4LA1A 4MMMA 1NW2A 3IAM2 2LJAA 3FR6A 1VF2A 5J4UA 4HU9A 2YJHA 5IOXA 1SL0B 1EV4A 2B7KA 1PD21 3FRCA 2V2GA 2RM6A 3PGTA 5ECMB 4IW9A 3C1RA 4MH3A 1K0MA 2JADA 2QKEA 4I97A 4E8HA 2X8GA 4GQFA 3TJJA 1YKCA 3DRNA 4MJEA 2A2SA 5J9BA 4I5QA 4OO5A 5JCGA 2FHEA 2IMDA 4FH8A 4PXOA 4V2MA 3H79A 5KN3A 1XZOA 4HI7A 1PQNA 5A4WA 2P5RA 1ZZYA 2KOKA 1A2MA 2H72A 4AJ8A 5DBQA 2MMAA 1X9SB 3BJ5A 3FR3A 2O87A 4TW5A 2VCZA 4TVEA 2GGTA 3KMOA 1B8XA 2C8UA 2NBSA 3CTFA 2GQMA 2IMKA 3GN3A 3EC3A 4FYUA 2HYXA 1B9XC 3EVIA 1R4WA 1TI3A 3QAWA 3ZFLA 2XPDA 2H1AA 3GKXA 1QUWA 3WT1A 4EF0A 2M80A 4KH7A 2NPBA 1SK1A 3FZAA 4X1UA 4WF4A 4ZILA 5ECQB 5CRDA 4ECBA 2H71A 1EWXA 2V32A 1O85A 3ED3A 5G1KA 4P3YB 5HR1A 3FK8A 4BL7B 3ERFA 4YQUA 3HD5A 1GUHA 2B7JA 3ZZXA 3CBUA 1ZGNA 2LS5A 1WJKA 2C4JA 3D6IA 5HR3A 5JWOB 5COHA 3NIVA 1GNWA 1VF1A 5FWGA 3P7XA 4ISDA 2A2RA 3RDWA 2VL3A 6GSUA 2OJLA 3CRUA 3TKSE 3IA1A 2CX4A 5DALA 3F8UA 4ID0A 4Z7XA 1PA3A 4NWYA 4NV5A 5E4WA 3CXGA 3LYPA 1VGLA 3GH6A 2HXKA 1A23A 2VIMA 3HJMA 3LEFA 3TJKA 3M0FA 3BCKA 3F6DA 2JSYA 4IQ1A 2EIOA 3A2WA 2WDUA 3TOTA 3KZQA 1GWCA 3ERWA 3HA9A 4EUYA 1Z3EA 4IKHA 1XVQA 2C1YA 3TRXA 4KNDA 3Q6OA 3GMFA 1HD2A 4DSSB 1HYUA 1O81A 2VCQA 1T3BA 3C73A 1V98A 1OVNA 3NZNA 3HVVA 2LSTA 3QOUA 5J3RA 2VAFA 2HRAA 3F3QA 3WGXA 2OE3A 4OMVA 4Q5FA 1U6TA 4WBJA 1TXXA 1RQMA 2VO4A 3VK9A 2CZ2A 2MBSA 1TKDB 5B8AA 4ACSA 3BBYA 3FW2A 4FQUA 2TIRA 4USSA 4F03A 1JZRA 2YN1A 3FKFA 1PKZA 3HJPA 3CYNA 3CSHA 4MCUA 5EPFA 2UZ8A 1AUCA 3D5JA 1PN9A 4MP4A 1HNBA 2MMNA 2NVLA 4OD7A 3L4NA 4G0LA 2GTUA 2FWFA 1FHEA 1PX6A 3RHBA 1M0UA 4TKYA 3VFIA 2VD0A 3APQA 1XPVA 5DJLA 6GSYA 3GKNA 2LUSA 4PQIA 4NAXA 2YPMA 1M7TA 5D9XA 2V6OA 2H6XA 4WBRD 1TRUA 5A4UA 4G10A 2C3NA 1SU9A 4X0XA 3TCOA 4F0BA 2JU5A 1E6BA 1TK8B 1HQOA 2L5LA 4JRRA 4RI7A 4IJIA 5DCGA 5HQPA 1KBNA 4YH2A 4GSSA 4F0CA 2L6DA 1BQ7A 3HXSA 1SK0A 4BWSA 1R5PA 2O85A 5ID2B 4QL9A 1B4QA 4MA9A 3DIEA 2E2GA 1OC9A 4TN8A 5F8BA 3M9JA 2DJKA 1BG5A 1V40A 4CDOA 3E9JB 2VCVA 4G2EA 1A0RP 5HR2A 4F9ZA 2DLXA 2JZRA 3I9V2 2C0DA 3ZRDA 5H5RA 3Q74A 3UJ1A 4F82A 1XCCA 2B1LA 16GSA 3UBLA 2CVBA 4BVXB 1X0RA 4MZCA 2ALBA 2M46A 2GS3A 4YQMA 4LMWA 3HY2A 1OC8A 2VL2C 3MSZA 4J57E 4O32A 4FO5A 1GRXA 4KUNA 1KEBA 4K7NA 1Q98A 4O7HA 2XPEA 4DEJA 4HS1A 2H30A 3OR5A 3DVXA 1T7PB 4L5OA 2LQQA 2H8LA 3KTLA 2OE1A 4JEDA 4OFNA 1TRVA 3J7Yb 2KP1A 3FYGA 5CNWA 2L59A 3KIJA 1U3AA 2GQKA 1MDIA 3QD9A 3KEBA 5IMVA 3QCPA 5GAND 3P8WA 3PR8A 3ZFBA 3ME7A 4H86A 5CP1A 3QPMA 17GSA 2ZUPA 1LBKA 1XW6A 1PMTA 1X5DA 1PX7A 2LTKA 4XTSA 1W89A 2H74A 5KN2A 1OE8A 3M1GA 2LKUA 3IK9A 5ECNB 2I9HA 5B6MA 5IO2A 3DKSA 1FB6A 5IMCA 4AF2A 1B9YC 5IMDA 5J5NA 1C72A 4KA0A 4TR1A 1WE0A 2MZCA 2L4QA 4IN0A 2GVPA 1ZCPA 2GZYA 5G31A 2IMEA 2CAQA 2HZEB 4MPGA 5L71A 5KN0A 1DE1A 3GIXA 2AUVA 3APOA 2VD1A 4YQVA 3FZ4A 3F4SA 3GX8A 1HNAA 2YJ7A 4PNGA 13GSA 2YWOA 2BMXA 1SJZA 4K0NA 2HRNA 11GSA 2DBCA 5F05A 4FYBA 3HKRA 4WR5A 3PH9A 2HRKA 1BEDA 4DVCA 2BTOT 1GTBA 4POBA 3KH9A 6GSTA 2H1GA 3J7Yk 4POKA 3VLNA 3BOAA 1XWAA 2JZTA 2HZFA 2RM5A 3D4MA 1DE2A 1ZMAA 3FEUA 1SENA 5EL8A 3FHKA 1XOBA 2I1UA 3HZ8A 3FR9A 1FOVA 1Z6MA 3O6TA 4G0KA 2TRCP 1V9WA 5G30A 4ZBAA 4IP1A 3LSZA 2H1DA 2IJYA 1SYXA 2OADA 2AAWA 2YCDA 1LU4A 2VUPA 1TU7A 4NV2A 1OAZA 2LRCA 1EOHA 2FY6A 3KP9A 5IIZA 3TRQA 3WGDA 4RUVA 3IC8A 1GSQA 3MAKA 2IWTA 2M72A 3H1NA 1YQ1A 3I6AA 4KW6A 2VCWA 4EXJA 1ZOFA 1QQ2A 3UVHA 2FD3A 4ILFA 14GSA 3I43A 4DSQA 1V58A 2I3YA 4IHUA 2HNLA 2O8VB 2F3MA 3HVXA 2N5BA 2YV7A 4ZBBA 4BPYA 3LGCA 1AC1A 5DVBA 3HCZA 2QC7A 1ON4A 1WOUA 2HRFA 4ZL9A 2Z9SA 4EDYA 1KNGA 4LLRA 5IPHA 1AQVA 2H0GA 4N0VA 3SWLA 1B4PA 3IC4A 3MWHA 4HDEA 5JCWA 2PGTA 4I2UA 1K0DA 5DCHA 4XS4A 2QGVA 1URMA 2EC4A 2FWGA 4PX1A 2G0FA 3GSTA 5HFIA 4TR0A 5IM9A 3TKSC 5F0GA 3DVWA 3ZVJA 1H75A 3VWVA 1UN2A 4ZB6A 2H0HA 2P5QA 5IO0A 1VRSD 1EEMA 5BMUA 3E3EA 2VM1A 2C0EA 2FNOA 2YWMA 3D21A 4IQAA 2L4CA 5DJMA 10GSA 1AXDA 4MH2A 4V1Ap 2CT6A 3QMXA 3ME8A 2WFCA 1FG4A 3EINA
chains in the Genus database with same CATH superfamily
1U3IA 4PI0C 2X8HA 3QFBC 1NHOA 2H66A 3GL3A 3TKPA 3TJBA 1OKTA 2OBIA 2DJ0A 3A3TA 1PL2A 5G5FA 2EIQA 5ABRA 1Z5YE 4GSTA 1JZWA 4KE3A 3ISOA 2YANA 3IV4A 2CX3A 1Y1UA 2V41A 4Q5NA 2A4VA 5A4VA 2VCTA 2GQLA 4GWRA 1M2BA 4MNNA 4ZB8A 1MD4A 4L5LA 2I4AA 3M8NA 4ZIJA 1GSSA 4OFTA 4QQ7A 3GA4A 4TR4A 1UVZA 4XRDA 1CQHA 5B8BA 1Z7PA 2LQOA 1X9WB 2AB6A 3IE3A 1TOFA 1GL8A 5A1NB 3Q18A 4Z2RA 1THOA 2CZ3A 1TJDA 3F0IA 3MYDA 1H4OA 5ECKB 3GFKA 3HZ4A 2KLXA 4N10A 2HLSA 4X4JA 2H0IA 2GSQA 4XIHA 4MK3A 1SKSB 1ML6A 3P2AA 3QAGA 1TXUA 2QA1A 3WD6A 1T4YA 2R6KA 4L0UA 2DSAA 1WMJA 5LCZA 4BA7A 3JCML 2DJ1A 1I1IP 5ECPB 1XFLA 4ML6A 5E59A 4PQHA 3GL5A 4RI6A 1MDJA 3GURA 22GSA 2O7KA 5ECLB 3KGKA 5DQYA 2LJKA 4WXTA 2LNTA 1K3OA 2E7PA 3C7MA 1QMVA 5F06A 5JWRB 4F2IA 1M9BA 4HJ2A 3TJGA 3L0HA 5A34B 3GYKA 2GT6A 1MDKA 2LEGA 4BL7A 3LFLA 2XHFA 1PSQA 4POMA 1QGVA 2HE3A 1U88A 4OCFA 1Z6NA 1K0NA 2X8CA 4JR4A 3E0UA 2WZ9A 3LJRA 1M3IA 1F6MC 4IGJA 1F2EA 4PTSA 2O89A 1M2DA 2E2MA 4TXOA 1U87A 3QR6A 4KSOA 1ERVA 4MJAA 1ERTA 1A0FA 7GSSA 4KSMA 2H1BA 1VF4A 3DYRA 4G9HA 2HI7A 3EURA 3RBTA 4TR3A 3C1SA 5DQSA 1EP7A 4J56E 4K0GA 4K7IA 5G1LA 1USBA 1JZDA 5F07A 4IVFA 1SD8A 1G7EA 1TTZA 1AW9A 2VLTA 3DEXA 3V1WA 1CQGA 3TRPA 1A2JA 3P90A 1ST9A 3ZL5A 2L57A 3C71A 4PURA 1RW1A 4K1FA 3C8EA 3H8QA 3LORA 5D8IA 5DAKB 4K6XA 2J9HA 4DSSA 4EKZA 3RFRC 1DBYA 3KP8A 3RPPA 2YP6A 1FAAA 1S3RA 3L78A 2C80A 2CAIA 3LYKA 4HU7A 2GSRA 3KM6A 3UOMA 1OKDA 3R2QA 4AJ7A 1TK5B 2IIYA 1R5AA 4HEA2 3L9UA 2WVXB 1GSUA 1NM3A 3F4RA 2G2QA 5ECIB 2R0PA 2GT5A 2CV4A 3EMPA 5A5KA 4RQXA 2P0GA 5HFGA 1EEJA 4EO3A 5CREA 3GH9A 4JR6A 2PWJA 4ML1A 1FB0A 1IYHA 4HOJA 4TOPA 3KMNA 2HSHA 4N11A 1THXA 3LG6A 1SK2A 2PVOC 3G9BA 1ACVA 2OT3A 3PPUA 3CTGA 3VWUA 2DIYA 5J9CA 1Q4JA 3IR4A 3IAS2 3TOUA 3LW9A 2OBKA 1Y25A 3LWAA 1NHYA 4NMUA 1KTEA 2VM2A 2JACA 1GSEA 3UVTA 2F8FA 4JBBA 1ZYEA 4LL1B 2PMTA 3ZITA 1G0TA 2B5EA 4BVYB 4KGIA 1M9AA 4G01A 2HSMB 3KD0A 2OKAA 3ZYWA 1WRYA 5ID2A 1UA5A 3HHVA 1O7UA 1TK0B 4OO4A 3WT2A 3A5IA 4K7OA 2WJUA 2IFQB 3CSJA 2XBIA 1EGOA 1PKWA 2RUFA 5LNKe 4L8EA 2DMLA 4XCSA 1IYIA 2H19A 2XBQA 1ILOA 4GCIA 4WEYA 1EGRA 3FY7A 4IBPA 3NOFA 1TDIA 4IELA 1K0CA 2PERA 5AIXA 4L0WA 1B48A 3EE2A 3ZREA 2K8VA 4MABA 3DD3A 1A8LA 2FA8A 4BVXA 1AAZA 4EC0A 4JU5A 3TDGA 4MZBA 4CY8A 1YVLA 3M9KA 3G7JA 2N5AA 5GZZB 5D73A 3MNGA 2OE0A 2DC5A 20GSA 1ZYQB 4ZL8A 1YF1A 1GTIA 3ZIJA 3CMIA 2VOCA 4ECJA 2WW0A 1XIYA 4XHMA 5IQYA 2WB9A 3KTBA 1X5CA 4TXVA 3WYWA 1FW1A 4I6XA 2ON7A 3A2VA 4ZBDA 1YJ6A 3D0ZA 3IRAA 5LD0A 3IPZA 4FIWA 3GTUA 4AJ6A 1AQWA 1BAYA 4O92A 4KF9A 1GLQA 2VLUA 4K8MA 3D22A 1I5GA 1EZKA 2PU9C 1QFNA 3U5RE 1YEXA 1PGTA 5CYYA 4N30A 1EOGA 1GTAA 2B1KA 2RLIA 3BCIA 4EIQA 1M99A 3ZTLA 5GSSA 4OWYA 4MJCA 4N0ZA 2ON5A 3N5OA 2C0GA 5AN1A 1I9DA 5AGYA 3DXBA 2R37A 3GUSA 3KXOA 1XBSA 2H6YA 1LJRA 1WPIA 1XWBA 3IBHA 1G7OA 3EYTA 2LNSA 4Z2TA 2FGXA 1QXHA 2EFHA 2ZCTA 4V2LA 1PL1A 3BD2A 3IOSA 4WF5A 1GULA 3F3RA 4E8EA 3UL3A 3F4TA 2R2JA 2I81A 5IMZA 2C3QA 1NSWA 2PUKC 2HZEA 9GSSA 4TRXA 2CVDA 1JZOA 2MMOA 2ZNMA 4GQCA 3R3EA 4NHWA 1O73A 5DALB 4K5SA 4XS1A 5EY6A 2F8AA 4GF0A 5FT3A 1ERUA 2CVKA 1R26A 1BG1A 3G7YA 2FLSA 4NHZA 1Y6EA 3LXZA 3RAZA 4KDUA 1XWGA 1BF5A 1O8WA 3FZ5A 1QK8A 1O6JA 4K9ZA 2VCXA 3MDKA 3FMWA 4AGSA 2LV3A 5IOWA 1AIUA 2H1LA 5GAPD 1VF3A 1RK4A 5AISA 4RQRA 3TJFA 5EVOA 3A2XA 5A5HA 5BRTA 1SKWB 1WP0A 3TB2A 2VL2A 1FVKA 3APSA 2DJ3A 5J41A 1SJ6A 4ULXA 5B6NA 6GSXA 1SVOA 2VL9A 1MTCA 4WETA 1A2LA 1YKAA 5J4VA 3K8NA 2F51A 3U6VA 5B7CA 1ERWA 4GTUA 5GSTA 1X5EA 2HT9A 4OCEA 2WVZA 3FZ9A 3O76A 5G5EA 1XWCA 4YKFA 2X49A 3EU4A 4LL4B 5JWQB 4I2TA 4G0IA 1OYJA 3GKMA 5ECOB 1YDKA 1SL1B 1TW9A 1TI1A 2HQTA 1WIKA 3W6GA 2GSSA 1GLPA 2YZHA 3GX0A 2YOIA 5JCUA 1N8JA 4ZXGA 2XC2A 3A5WA 1T4ZA 4FXYP 5CRGA 2VLVA 1N2AA 3TU3B 3ZLPA 1HNCA 4TXOB 1K3YA 4MF5A 3UBKA 2GZZA 4IP6A 1BJXA 2R5GA 1GP1A 2REMA 1N25A 1F37A 1S3DA 2IPAA 5C04A 5IPGA 2R4VA 3LQ7A 4YAPA 1JLVA 6GSVA 2H01A 2OACA 4V2NA 1S3AA 3O3TA 3TKQA 3IK7A 1GUMA 4MPFA 1SJIA 1K0OA 1OC9B 5ENUA 4PGTA 3GSSA 2CQ9A 2V6KA 3QFAC 2EFCA 3I69A 4JZQA 4WKWA 1SYRA 18GSA 1YF0A 4G19A 5IMFA 4MJBA 4XS6A 3GHAA 2H75A 3HVNA 2D2ZA 1TP9A 3KH7A 2C0FA 1JHBA 3CSIA 2B5YA 3UIWA 2NTOA 2B5XA 4GDFA 1E2YA 2AV4A 4KDXA 5AIVA 2DMMA 3TGZA 2FWEA 3SBCA 3TUEA 1GNEA 4KAEA 4ZB9A 2EFEA 3TKRA 3DMLA 4NPBA 4ZL7A 4POLA 4AKIA 2PN8A 3VI7A 1K0BA 2YWIA 2JSZA 4PQ1A 1GSYA 2WCIA 4YAVA 2B6MA 1DSBA 1BYEA 4EDZA 4FYCA 4PNFA 2HSYA 3UEMA 4PUAA 2DJ2A 1AQXA 3RPNA 4HJMA 1ZL9A 1GH2A 1XW5A 1OE7A 4I8BA 2F9SA 3EU3A 3HVSA 3DGQA 3GV1A 1F3BA 3UMAA 2N5FA 1UC7A 4GXZA 3F9UA 4E68A 3ZMLA 4Q5QA 1SVMA 1WWJA 4X43A 4MDCA 2V1MA 5A1NA 3WGEA 3VPQA 1YEPA 4V1Ag 1W4VA 1JFUA 1R7HA 2WRTA 1A24A 4MF6A 2WGRA 1M2AA 3US3A 4KDYA 1V57A 2HFDA 2WW2A 1GTUA 1XW9A 2BJXA 3ERGA 2DJJA 4JE1A 1MD3A 2GDRA 2CA8A 5ELGA 4MF7A 4Q5RA 1T00A 5DDLA 2AYTA 4AI6A 2IMFA 1G6WA 3RHCA 4TR1B 5D9VA 2FWHA 1PRXA 4O5RA 4BWQA 1J0FA 3LXTA 4GSNA 6GSSA 1X9MB 2WS2A 2P31A 5CAXA 1SD9A 2AHEA 3KJYA 2GLRA 1K3LA 3IDVA 1T8EB 3H4KA 3VURA 3F63A 1TU8A 4IJ3A 3VI5A 4IS0A 2ES7A 1EP8A 1XXUA 2B3SA 3EWLA 5ECHB 5H5SA 2H70A 5ELAA 4NXIA 1SL2B 1A8YA 3TKSA 1OC3A 1T1VA 3ZMKA 5A34A 2IN3A 2K18A 2KP2A 5D96A 3GRXA 2HRKB 1BX9A 2PBJA 3G7IA 3UARA 5HFKA 5CRHA 1PFOA 1EV9A 1FVJA 8GSSA 3VWWA 2OA7A 3ZIVA 3L9SA 4PUFC 6GSWA 2MBTA 1G6YA 2J23A 2PPTA 4K2DA 2LJRA 3GTUB 3L9VA 2L5OA 1ABAA 3W8JA 3KCMA 4D73A 5H5QA 2AJQB 5J40A 2LRTA 3ZVJD 19GSA 2LRNA 5ECSA 3VPTA 2K8SA 4CW9A 4DSRA 4HQZA 3GKKA 3EMXA 4KCAA 2MYGA 4XRAA 5D9TA 1M3JA 4GRFA 5C00A 2MMZA 4J2FA 3CRTA 1F9MA 2YNXA 2DKIA 2FUG2 3IHQA 2IMIA 1FO5A 1MEKA 2WW3A 2A2PA 2X99A 1YEWC 1Z9HA 3H93A 2GSTA 4HZ2A 5DAKA 1XWKA 2IL3A 5KEJA 2H6ZA 2H76A 5G2ZA 5D9WA 4EL1A 3IXRA 1K0AA 5CO3A 2KHPA 1GUKA 3QDNA 2HSNB 2K6VA 1GSDA 2L6CA 3W8SA 4HZ4A 1Z7RA 3HYPA 2YWNA 2WVXA 5FHIA 2VKZG 2WULA 5D93A 2FCHA 4EE0A 3GNJA 5ECRB 4KB3A 3AY8A 3Q19A 3M3MA 3QAVA 2X64A 4ECIA 2DIZA 1O8XA 1YZXA 3DWVA 4GLTA 1TRSA 2R0CA 1J08A 5CRWA 4HUAA 3D4TA 4CHSA 3N9JA 2UV8G 1XVWA 3UAPA 2FA4A 5HR0A 2YZUA 1DUGA 1V2AA 2KUCA 3S9FA 4EVMA 4MLYA 2K9FA 3HDCA 1YY7A 2TRXA 4XS4B 2DKHA 5INYA 4KCEA 4ECCA 1GSFA 3F6FA 4QL7A 2PVQA 4KX4A 4OFMA 2QSIA 2JL4A 3HJOA 1S3CA 2C3TA 4AKGA 2JZSA 2GZPA 3VWXA 5BMUB 2RUEA 1XOAA 1J9BA 4BVYA 4MZWA 4LMVA 4K2XA 2HSMA 2YV9A 2EFDA 2H73A 1JLWA 1SKRB 5KN1A 4Z2UA 4HQSA 2EIRA 1TRWA 1F3AA 2IFQA 2RIIA 4D73B 5IMAA 2E0QA 12GSA 2R3XA 4WR4A 2NDOA 3PINA 4LA1A 4MMMA 1NW2A 3IAM2 2LJAA 3FR6A 1VF2A 5J4UA 4HU9A 2YJHA 5IOXA 1SL0B 1EV4A 2B7KA 1PD21 3FRCA 2V2GA 2RM6A 3PGTA 5ECMB 4IW9A 3C1RA 4MH3A 1K0MA 2JADA 2QKEA 4I97A 4E8HA 2X8GA 4GQFA 3TJJA 1YKCA 3DRNA 4MJEA 2A2SA 3HMJG 5J9BA 4I5QA 4OO5A 5JCGA 4YKGA 2FHEA 2IMDA 4PXOA 4FH8A 4V2MA 3H79A 5KN3A 1XZOA 4HI7A 1PQNA 5A4WA 2P5RA 1ZZYA 2KOKA 1A2MA 2H72A 4AJ8A 5DBQA 2MMAA 1X9SB 3BJ5A 3FR3A 2O87A 4TW5A 2VCZA 4TVEA 2GGTA 3KMOA 1B8XA 2C8UA 2NBSA 3CTFA 2GQMA 2IMKA 2O5VA 3GN3A 3EC3A 4FYUA 2HYXA 1B9XC 3EVIA 1R4WA 1TI3A 3QAWA 3ZFLA 2XPDA 2H1AA 3GKXA 1QUWA 3WT1A 4EF0A 2M80A 4KH7A 2NPBA 1SK1A 3FZAA 4X1UA 4WF4A 4ZILA 5ECQB 5KOXA 5CRDA 4ECBA 2H71A 1EWXA 2V32A 1O85A 3ED3A 5G1KA 4P3YB 5HR1A 3FK8A 4BL7B 3ERFA 4YQUA 3HD5A 2WW1A 1GUHA 2B7JA 3ZZXA 3CBUA 1ZGNA 2LS5A 1WJKA 2C4JA 3D6IA 5HR3A 5JWOB 5COHA 3NIVA 1GNWA 1VF1A 5FWGA 3P7XA 4ISDA 2A2RA 3RDWA 2VL3A 6GSUA 2OJLA 4N3ZA 3CRUA 3TKSE 3IA1A 2CX4A 5DALA 3F8UA 4ID0A 4Z7XA 1PA3A 4HSCX 4NWYA 4NV5A 5E4WA 3CXGA 3LYPA 1VGLA 3GH6A 2HXKA 1A23A 2VIMA 3HJMA 3LEFA 3TJKA 3M0FA 3BCKA 3F6DA 2JSYA 4IQ1A 2EIOA 3A2WA 2WDUA 3TOTA 3KZQA 1GWCA 3ERWA 3HA9A 4EUYA 1Z3EA 4IKHA 1XVQA 2C1YA 3TRXA 4KNDA 3Q6OA 3GMFA 1HD2A 4DSSB 1HYUA 1O81A 2VCQA 1T3BA 3C73A 1V98A 1OVNA 2QA2A 3NZNA 3HVVA 2LSTA 3QOUA 5J3RA 2VAFA 2HRAA 3F3QA 3WGXA 2OE3A 4OMVA 4Q5FA 1U6TA 4WBJA 1TXXA 1RQMA 2VO4A 3VK9A 2CZ2A 2MBSA 1TKDB 5B8AA 4ACSA 3BBYA 3FW2A 4FQUA 2TIRA 4USSA 4F03A 1JZRA 3HJPA 2YN1A 1PKZA 3FKFA 3CYNA 3CSHA 4MCUA 5EPFA 2UZ8A 1AUCA 2O36A 3D5JA 1PN9A 4MP4A 1HNBA 2MMNA 2NVLA 4OD7A 3L4NA 4G0LA 2GTUA 2WZSA 1FHEA 2FWFA 1PX6A 3RHBA 1M0UA 4TKYA 3VFIA 3IHGA 2VD0A 3APQA 1XPVA 5DJLA 6GSYA 3GKNA 2LUSA 4PQIA 4NAXA 4PI2C 2YPMA 1M7TA 5D9XA 2V6OA 2H6XA 4WBRD 1TRUA 5A4UA 4K5RA 4G10A 2C3NA 1SU9A 4X0XA 1FOHA 3TCOA 4F0BA 2JU5A 1E6BA 1TK8B 1HQOA 2L5LA 4JRRA 4RI7A 4IJIA 4O5UA 5DCGA 5HQPA 1KBNA 4YH2A 4GSSA 4F0CA 2L6DA 1BQ7A 3HXSA 1SK0A 4BWSA 1R5PA 2O85A 5ID2B 4QL9A 1B4QA 4MA9A 3DIEA 2E2GA 1OC9A 4BIKA 4TN8A 1ZYNA 5F8BA 3M9JA 2DJKA 1BG5A 1V40A 4CDOA 3E9JB 2VCVA 4G2EA 1A0RP 5HR2A 4F9ZA 2DLXA 2JZRA 3I9V2 2C0DA 3ZRDA 5H5RA 3Q74A 3MIXA 3UJ1A 4F82A 1XCCA 2B1LA 16GSA 3UBLA 2CVBA 4BVXB 1X0RA 4MZCA 2ALBA 2M46A 2GS3A 4YQMA 4LMWA 3HY2A 1OC8A 2VL2C 3MSZA 4J57E 4O32A 4FO5A 1GRXA 4KUNA 1KEBA 4K7NA 1Q98A 4O7HA 2O3EA 2XPEA 4DEJA 4HS1A 2H30A 2X4AA 3OR5A 3DVXA 1T7PB 4L5OA 2LQQA 2H8LA 3KTLA 2OE1A 4JEDA 4OFNA 1TRVA 3J7Yb 2KP1A 3FYGA 5CNWA 2A4HA 5J4YA 2L59A 3KIJA 1U3AA 2GQKA 1MDIA 3QD9A 3KEBA 5IMVA 3QCPA 5GAND 3P8WA 3PR8A 3ZFBA 3ME7A 4H86A 5CP1A 3QPMA 17GSA 2ZUPA 1LBKA 1XW6A 1PMTA 1X5DA 1PX7A 2LTKA 4XTSA 1W89A 2H74A 5KN2A 1OE8A 3M1GA 2LKUA 3IK9A 5ECNB 2I9HA 1XG8A 5B6MA 5IO2A 3DKSA 1FB6A 5IMCA 4AF2A 1B9YC 5IMDA 5J5NA 2R0GA 1C72A 4KA0A 4TR1A 1WE0A 2MZCA 2L4QA 4IN0A 2GVPA 1ZCPA 2GZYA 5G31A 4ICYA 2IMEA 2CAQA 2HZEB 4MPGA 5L71A 5KN0A 1DE1A 3GIXA 2AUVA 3APOA 2VD1A 4YQVA 3FZ4A 3F4SA 3GX8A 1HNAA 2YJ7A 3RGBC 4PNGA 13GSA 2YWOA 5J47A 2BMXA 1SJZA 4K0NA 2HRNA 11GSA 2DBCA 5F05A 4FYBA 3HKRA 4WR5A 3PH9A 2HRKA 1BEDA 4DVCA 2BTOT 1GTBA 4POBA 3KH9A 6GSTA 2H1GA 5KOWA 3J7Yk 4POKA 3VLNA 3BOAA 1XWAA 2JZTA 2HZFA 2RM5A 3D4MA 1DE2A 1ZMAA 5A5HB 3FEUA 1SENA 5EL8A 3FHKA 1XOBA 2I1UA 3HZ8A 3FR9A 1FOVA 1Z6MA 3O6TA 4G0KA 4CY6A 2TRCP 1V9WA 5G30A 4ZBAA 4IP1A 4O5QA 3LSZA 2H1DA 2IJYA 1SYXA 2OADA 2AAWA 2YCDA 1LU4A 2VUPA 1TU7A 4NV2A 2WVYA 1OAZA 2LRCA 1EOHA 2FY6A 3KP9A 5IIZA 3TRQA 3EPTA 3WGDA 4RUVA 3IC8A 1GSQA 3CQFA 3MAKA 2IWTA 2M72A 3H1NA 4QMKA 1YQ1A 3I6AA 4KW6A 2VCWA 4EXJA 1ZOFA 2HSNA 1QQ2A 3UVHA 2FD3A 4ILFA 14GSA 3I43A 4DSQA 1V58A 2I3YA 4IHUA 2HNLA 2O8VB 3CWGA 2F3MA 3HVXA 2N5BA 2YV7A 4ZBBA 4BPYA 3LGCA 1AC1A 4AKHA 5DVBA 3HCZA 2QC7A 1ON4A 1WOUA 1PN0A 2HRFA 4ZL9A 2Z9SA 4EDYA 1KNGA 4LLRA 5IPHA 4ZB7A 1AQVA 2H0GA 4N0VA 3SWLA 1B4PA 3IC4A 3MWHA 4HDEA 5JCWA 2PGTA 4I2UA 1K0DA 5DCHA 4XS4A 2QGVA 1URMA 2EC4A 2FWGA 4PX1A 2G0FA 4A5PA 3GSTA 5HFIA 3CHXC 4TR0A 5IM9A 3TKSC 4EIPA 5F0GA 3DVWA 3ZVJA 1H75A 3VWVA 1UN2A 4ZB6A 2H0HA 2P5QA 1ZYPA 5IO0A 1S4BP 1VRSD 1EEMA 5BMUA 4PHZC 3E3EA 2VM1A 2C0EA 2FNOA 2YWMA 3D21A 4IQAA 4W66A 2L4CA 5DJMA 10GSA 1AXDA 1SVLA 4MH2A 4V1Ap 2CT6A 3QMXA 3ME8A 2WFCA 1FG4A 4AKXB 3EINA
chains in the Genus database with same CATH topology
1U3IA 2X8HA 3QFBC 1NHOA 2H66A 3GL3A 3TKPA 3TJBA 1OKTA 2OBIA 2DJ0A 3A3TA 1PL2A 5G5FA 2EIQA 5ABRA 1Z5YE 4GSTA 1JZWA 4KE3A 3ISOA 2YANA 3IV4A 2CX3A 1Y1UA 2V41A 4Q5NA 2A4VA 5A4VA 2VCTA 2GQLA 4GWRA 1M2BA 4MNNA 4ZB8A 1MD4A 4L5LA 2I4AA 3M8NA 4ZIJA 1GSSA 4OFTA 4QQ7A 3GA4A 4TR4A 1UVZA 4XRDA 1CQHA 5B8BA 1Z7PA 2LQOA 1X9WB 2AB6A 3IE3A 1TOFA 1GL8A 5A1NB 3Q18A 4Z2RA 1THOA 2CZ3A 1TJDA 3F0IA 3MYDA 1H4OA 5ECKB 3GFKA 3HZ4A 2KLXA 4N10A 2HLSA 4X4JA 2H0IA 2GSQA 4XIHA 4MK3A 1SKSB 1ML6A 3P2AA 3QAGA 1TXUA 2QA1A 3WD6A 1T4YA 2R6KA 4L0UA 2DSAA 1WMJA 5LCZA 4BA7A 3JCML 2DJ1A 5ECPB 1XFLA 4ML6A 5E59A 4PQHA 3GL5A 4RI6A 1MDJA 3GURA 22GSA 2O7KA 5ECLB 3KGKA 5DQYA 2LJKA 4WXTA 2LNTA 1K3OA 2E7PA 3C7MA 1QMVA 5F06A 5JWRB 4F2IA 1M9BA 4HJ2A 3TJGA 3L0HA 5A34B 3GYKA 2GT6A 1MDKA 2LEGA 4BL7A 3LFLA 2XHFA 1PSQA 4POMA 1QGVA 2HE3A 1U88A 4OCFA 1Z6NA 1K0NA 2X8CA 4JR4A 3E0UA 2WZ9A 3LJRA 1F6MC 4IGJA 1F2EA 4PTSA 2O89A 1M2DA 2E2MA 4TXOA 1U87A 3QR6A 4KSOA 1ERVA 4MJAA 1ERTA 1A0FA 7GSSA 4KSMA 2H1BA 1VF4A 3DYRA 4G9HA 2HI7A 3EURA 3RBTA 4TR3A 3C1SA 5DQSA 1EP7A 4J56E 4K0GA 4K7IA 5G1LA 1USBA 1JZDA 5F07A 4IVFA 1SD8A 1G7EA 1TTZA 1AW9A 2VLTA 3DEXA 3V1WA 1CQGA 3TRPA 1A2JA 3P90A 1ST9A 3ZL5A 2L57A 3C71A 4PURA 1RW1A 4K1FA 3C8EA 3H8QA 3LORA 5D8IA 5DAKB 4K6XA 2J9HA 4DSSA 4EKZA 1DBYA 3KP8A 3RPPA 2YP6A 1FAAA 3L78A 2C80A 2CAIA 3LYKA 4HU7A 2GSRA 3KM6A 3UOMA 1OKDA 3R2QA 4AJ7A 1TK5B 2IIYA 1R5AA 4HEA2 3L9UA 1GSUA 1NM3A 3F4RA 2G2QA 5ECIB 2R0PA 2GT5A 2CV4A 3EMPA 5A5KA 4RQXA 2P0GA 5HFGA 1EEJA 4EO3A 5CREA 3GH9A 4JR6A 2PWJA 4ML1A 1FB0A 1IYHA 4HOJA 4TOPA 3KMNA 2HSHA 4N11A 1THXA 3LG6A 1SK2A 2PVOC 3G9BA 1ACVA 2OT3A 3PPUA 3CTGA 3VWUA 2DIYA 5J9CA 1Q4JA 3IR4A 3IAS2 3TOUA 3LW9A 2OBKA 1Y25A 3LWAA 1NHYA 4NMUA 1KTEA 2VM2A 2JACA 1GSEA 3UVTA 2F8FA 4JBBA 1ZYEA 4LL1B 2PMTA 3ZITA 1G0TA 2B5EA 4BVYB 4KGIA 1M9AA 4G01A 2HSMB 3KD0A 2OKAA 3ZYWA 1WRYA 5ID2A 1UA5A 3HHVA 1O7UA 1TK0B 4OO4A 3WT2A 3A5IA 4K7OA 2WJUA 2IFQB 3CSJA 2XBIA 1EGOA 1PKWA 2RUFA 5LNKe 4L8EA 2DMLA 4XCSA 1IYIA 2H19A 2XBQA 1ILOA 4GCIA 4WEYA 1EGRA 3FY7A 4IBPA 3NOFA 1TDIA 4IELA 1K0CA 2PERA 5AIXA 4L0WA 1B48A 3EE2A 3ZREA 2K8VA 4MABA 3DD3A 1A8LA 2FA8A 4BVXA 1AAZA 4EC0A 4JU5A 3TDGA 4MZBA 4CY8A 1YVLA 3M9KA 3G7JA 2N5AA 5GZZB 5D73A 3MNGA 2OE0A 2DC5A 20GSA 1ZYQB 4ZL8A 1YF1A 1GTIA 3ZIJA 3CMIA 2VOCA 4ECJA 1XIYA 4XHMA 5IQYA 2WB9A 3KTBA 1X5CA 4TXVA 3WYWA 1FW1A 4I6XA 2ON7A 3A2VA 4ZBDA 1YJ6A 3D0ZA 3IRAA 5LD0A 3IPZA 4FIWA 3GTUA 4AJ6A 1AQWA 1BAYA 4O92A 4KF9A 1GLQA 2VLUA 4K8MA 3D22A 1I5GA 1EZKA 2PU9C 1QFNA 3U5RE 1YEXA 1PGTA 5CYYA 4N30A 1EOGA 1GTAA 2B1KA 2RLIA 3BCIA 4EIQA 1M99A 3ZTLA 5GSSA 4OWYA 4MJCA 4N0ZA 2ON5A 3N5OA 2C0GA 5AN1A 1I9DA 5AGYA 3DXBA 2R37A 3GUSA 3KXOA 1XBSA 2H6YA 1LJRA 1WPIA 1XWBA 3IBHA 1G7OA 3EYTA 2LNSA 4Z2TA 2FGXA 1QXHA 2EFHA 2ZCTA 4V2LA 1PL1A 3BD2A 3IOSA 4WF5A 1GULA 3F3RA 4E8EA 3UL3A 3F4TA 2R2JA 2I81A 5IMZA 2C3QA 1NSWA 2PUKC 2HZEA 9GSSA 4TRXA 2CVDA 1JZOA 2MMOA 2ZNMA 4GQCA 3R3EA 4NHWA 1O73A 5DALB 4K5SA 4XS1A 5EY6A 2F8AA 4GF0A 5FT3A 1ERUA 2CVKA 1R26A 1BG1A 3G7YA 2FLSA 4NHZA 1Y6EA 3LXZA 3RAZA 4KDUA 1XWGA 1BF5A 1O8WA 3FZ5A 1QK8A 1O6JA 4K9ZA 2VCXA 3MDKA 3FMWA 4AGSA 2LV3A 5IOWA 1AIUA 2H1LA 5GAPD 1VF3A 1RK4A 5AISA 4RQRA 3TJFA 5EVOA 3A2XA 5A5HA 5BRTA 1SKWB 1WP0A 3TB2A 2VL2A 1FVKA 3APSA 2DJ3A 5J41A 1SJ6A 4ULXA 5B6NA 6GSXA 1SVOA 2VL9A 1MTCA 4WETA 1A2LA 1YKAA 5J4VA 3K8NA 2F51A 3U6VA 5B7CA 1ERWA 4GTUA 5GSTA 1X5EA 2HT9A 4OCEA 3FZ9A 3O76A 5G5EA 1XWCA 4YKFA 2X49A 3EU4A 4LL4B 5JWQB 4I2TA 4G0IA 1OYJA 3GKMA 5ECOB 1YDKA 1SL1B 1TW9A 1TI1A 2HQTA 1WIKA 3W6GA 2GSSA 1GLPA 2YZHA 3GX0A 2YOIA 5JCUA 1N8JA 4ZXGA 2XC2A 3A5WA 1T4ZA 5CRGA 2VLVA 1N2AA 3TU3B 3ZLPA 1HNCA 4TXOB 1K3YA 4MF5A 3UBKA 2GZZA 4IP6A 1BJXA 2R5GA 1GP1A 2REMA 1N25A 1F37A 1S3DA 2IPAA 5C04A 5IPGA 2R4VA 3LQ7A 4YAPA 1JLVA 6GSVA 2H01A 2OACA 4V2NA 1S3AA 3O3TA 3TKQA 3IK7A 1GUMA 4MPFA 1SJIA 1K0OA 1OC9B 5ENUA 4PGTA 3GSSA 2CQ9A 2V6KA 3QFAC 2EFCA 3I69A 4JZQA 4WKWA 1SYRA 18GSA 1YF0A 4G19A 5IMFA 4MJBA 4XS6A 3GHAA 2H75A 2D2ZA 1TP9A 3KH7A 2C0FA 1JHBA 3CSIA 2B5YA 3UIWA 2NTOA 2B5XA 4GDFA 1E2YA 2AV4A 4KDXA 5AIVA 2DMMA 3TGZA 2FWEA 3SBCA 3TUEA 1GNEA 4KAEA 4ZB9A 2EFEA 3TKRA 3DMLA 4NPBA 4ZL7A 4POLA 4AKIA 2PN8A 3VI7A 1K0BA 2YWIA 2JSZA 4PQ1A 1GSYA 2WCIA 4YAVA 2B6MA 1DSBA 1BYEA 4EDZA 4FYCA 4PNFA 2HSYA 3UEMA 4PUAA 2DJ2A 1AQXA 3RPNA 4HJMA 1ZL9A 1GH2A 1XW5A 1OE7A 4I8BA 2F9SA 3EU3A 3HVSA 3DGQA 3GV1A 1F3BA 3UMAA 2N5FA 1UC7A 4GXZA 3F9UA 4E68A 3ZMLA 4Q5QA 1SVMA 1WWJA 4X43A 4MDCA 2V1MA 5A1NA 3WGEA 3VPQA 1YEPA 4V1Ag 1W4VA 1JFUA 1R7HA 2WRTA 1A24A 4MF6A 2WGRA 1M2AA 3US3A 4KDYA 1V57A 2HFDA 2BJXA 1GTUA 1XW9A 3ERGA 2DJJA 4JE1A 1MD3A 2GDRA 2CA8A 5ELGA 4MF7A 4Q5RA 1T00A 5DDLA 2AYTA 4AI6A 2IMFA 1G6WA 3RHCA 4TR1B 5D9VA 2FWHA 1PRXA 4O5RA 4BWQA 1J0FA 3LXTA 4GSNA 6GSSA 1X9MB 2WS2A 2P31A 5CAXA 1SD9A 2AHEA 3KJYA 2GLRA 1K3LA 3IDVA 1T8EB 3H4KA 3VURA 3F63A 1TU8A 4IJ3A 3VI5A 4IS0A 2ES7A 1EP8A 1XXUA 2B3SA 3EWLA 5ECHB 5H5SA 2H70A 5ELAA 4NXIA 1SL2B 1A8YA 3TKSA 1OC3A 1T1VA 3ZMKA 5A34A 2IN3A 2K18A 2KP2A 5D96A 3GRXA 2HRKB 1BX9A 2PBJA 3G7IA 3UARA 5HFKA 5CRHA 1EV9A 1FVJA 8GSSA 3VWWA 2OA7A 3ZIVA 3L9SA 4PUFC 6GSWA 2MBTA 1G6YA 2J23A 2PPTA 4K2DA 2LJRA 3GTUB 3L9VA 2L5OA 1ABAA 3W8JA 3KCMA 4D73A 5H5QA 2AJQB 5J40A 2LRTA 3ZVJD 19GSA 2LRNA 5ECSA 3VPTA 2K8SA 4CW9A 4DSRA 4HQZA 3GKKA 3EMXA 4KCAA 2MYGA 4XRAA 5D9TA 4GRFA 5C00A 2MMZA 4J2FA 3CRTA 1F9MA 2YNXA 2DKIA 2FUG2 3IHQA 2IMIA 1FO5A 1MEKA 2A2PA 2X99A 1Z9HA 3H93A 2GSTA 4HZ2A 5DAKA 1XWKA 2IL3A 5KEJA 2H6ZA 2H76A 5G2ZA 5D9WA 4EL1A 3IXRA 1K0AA 5CO3A 2KHPA 1GUKA 3QDNA 2HSNB 2K6VA 1GSDA 2L6CA 3W8SA 4HZ4A 1Z7RA 3HYPA 2YWNA 5FHIA 2VKZG 2WULA 5D93A 2FCHA 4EE0A 3GNJA 5ECRB 4KB3A 3AY8A 3Q19A 3M3MA 3QAVA 2X64A 4ECIA 2DIZA 1O8XA 1YZXA 3DWVA 4GLTA 1TRSA 2R0CA 1J08A 5CRWA 4HUAA 3D4TA 4CHSA 3N9JA 2UV8G 1XVWA 3UAPA 2FA4A 5HR0A 2YZUA 1DUGA 1V2AA 2KUCA 3S9FA 4EVMA 4MLYA 2K9FA 3HDCA 1YY7A 2TRXA 4XS4B 2DKHA 5INYA 4KCEA 4ECCA 1GSFA 3F6FA 4QL7A 2PVQA 4KX4A 4OFMA 2QSIA 2JL4A 3HJOA 1S3CA 2C3TA 4AKGA 2JZSA 2GZPA 3VWXA 5BMUB 2RUEA 1XOAA 1J9BA 4BVYA 4MZWA 4LMVA 4K2XA 2HSMA 2YV9A 2EFDA 2H73A 1JLWA 1SKRB 5KN1A 4Z2UA 4HQSA 2EIRA 1TRWA 1F3AA 2IFQA 2RIIA 4D73B 5IMAA 2E0QA 12GSA 2R3XA 4WR4A 2NDOA 3PINA 4LA1A 4MMMA 1NW2A 3IAM2 2LJAA 3FR6A 1VF2A 5J4UA 4HU9A 2YJHA 5IOXA 1SL0B 1EV4A 2B7KA 1PD21 3FRCA 2V2GA 2RM6A 3PGTA 5ECMB 4IW9A 3C1RA 4MH3A 1K0MA 2JADA 2QKEA 4I97A 4E8HA 2X8GA 4GQFA 3TJJA 1YKCA 3DRNA 4MJEA 2A2SA 3HMJG 5J9BA 4I5QA 4OO5A 5JCGA 4YKGA 2FHEA 2IMDA 4PXOA 4FH8A 4V2MA 3H79A 5KN3A 1XZOA 4HI7A 1PQNA 5A4WA 2P5RA 1ZZYA 2KOKA 1A2MA 2H72A 4AJ8A 5DBQA 2MMAA 1X9SB 3BJ5A 3FR3A 2O87A 4TW5A 2VCZA 4TVEA 2GGTA 3KMOA 1B8XA 2C8UA 2NBSA 3CTFA 2GQMA 2IMKA 2O5VA 3GN3A 3EC3A 4FYUA 2HYXA 1B9XC 3EVIA 1R4WA 1TI3A 3QAWA 3ZFLA 2XPDA 2H1AA 3GKXA 1QUWA 3WT1A 4EF0A 2M80A 4KH7A 2NPBA 1SK1A 3FZAA 4X1UA 4WF4A 4ZILA 5ECQB 5KOXA 5CRDA 4ECBA 2H71A 1EWXA 2V32A 1O85A 3ED3A 5G1KA 4P3YB 5HR1A 3FK8A 4BL7B 3ERFA 4YQUA 3HD5A 1GUHA 2B7JA 3ZZXA 3CBUA 1ZGNA 2LS5A 1WJKA 2C4JA 3D6IA 5HR3A 5JWOB 5COHA 3NIVA 1GNWA 1VF1A 5FWGA 3P7XA 4ISDA 2A2RA 3RDWA 2VL3A 6GSUA 2OJLA 4N3ZA 3CRUA 3TKSE 3IA1A 2CX4A 5DALA 3F8UA 4ID0A 4Z7XA 1PA3A 4NWYA 4NV5A 5E4WA 3CXGA 3LYPA 1VGLA 3GH6A 2HXKA 1A23A 2VIMA 3HJMA 3LEFA 3TJKA 3M0FA 3BCKA 3F6DA 2JSYA 4IQ1A 2EIOA 3A2WA 2WDUA 3TOTA 3KZQA 1GWCA 3ERWA 3HA9A 4EUYA 1Z3EA 4IKHA 1XVQA 2C1YA 3TRXA 4KNDA 3Q6OA 3GMFA 1HD2A 4DSSB 1HYUA 1O81A 2VCQA 1T3BA 3C73A 1V98A 1OVNA 2QA2A 3NZNA 3HVVA 2LSTA 3QOUA 5J3RA 2VAFA 2HRAA 3F3QA 3WGXA 2OE3A 4OMVA 4Q5FA 1U6TA 4WBJA 1TXXA 1RQMA 2VO4A 3VK9A 2CZ2A 2MBSA 1TKDB 5B8AA 4ACSA 3BBYA 3FW2A 4FQUA 2TIRA 4USSA 4F03A 1JZRA 2YN1A 3FKFA 1PKZA 3HJPA 3CYNA 3CSHA 4MCUA 5EPFA 2UZ8A 1AUCA 3D5JA 1PN9A 4MP4A 1HNBA 2MMNA 2NVLA 4OD7A 3L4NA 4G0LA 2GTUA 2FWFA 1FHEA 1PX6A 3RHBA 1M0UA 4TKYA 3VFIA 3IHGA 2VD0A 3APQA 1XPVA 5DJLA 6GSYA 3GKNA 2LUSA 4PQIA 4NAXA 2YPMA 1M7TA 5D9XA 2V6OA 2H6XA 4WBRD 1TRUA 5A4UA 4K5RA 4G10A 2C3NA 1SU9A 4X0XA 1FOHA 3TCOA 4F0BA 2JU5A 1E6BA 1TK8B 1HQOA 2L5LA 4JRRA 4RI7A 4IJIA 4O5UA 5DCGA 5HQPA 1KBNA 4YH2A 4GSSA 4F0CA 2L6DA 1BQ7A 3HXSA 1SK0A 4BWSA 1R5PA 2O85A 5ID2B 4QL9A 1B4QA 4MA9A 3DIEA 2E2GA 1OC9A 4TN8A 1ZYNA 5F8BA 3M9JA 2DJKA 1BG5A 1V40A 4CDOA 3E9JB 2VCVA 4G2EA 1A0RP 5HR2A 4F9ZA 2DLXA 2JZRA 3I9V2 2C0DA 3ZRDA 5H5RA 3Q74A 3MIXA 3UJ1A 4F82A 1XCCA 2B1LA 16GSA 3UBLA 2CVBA 4BVXB 1X0RA 4MZCA 2ALBA 2M46A 2GS3A 4YQMA 4LMWA 3HY2A 1OC8A 2VL2C 3MSZA 4J57E 4O32A 4FO5A 1GRXA 4KUNA 1KEBA 4K7NA 1Q98A 4O7HA 2XPEA 4DEJA 4HS1A 2H30A 2X4AA 3OR5A 3DVXA 1T7PB 4L5OA 2LQQA 2H8LA 3KTLA 2OE1A 4JEDA 4OFNA 1TRVA 3J7Yb 2KP1A 3FYGA 5CNWA 2A4HA 5J4YA 2L59A 3KIJA 1U3AA 2GQKA 1MDIA 3QD9A 3KEBA 5IMVA 3QCPA 5GAND 3P8WA 3PR8A 3ZFBA 3ME7A 4H86A 5CP1A 3QPMA 17GSA 2ZUPA 1LBKA 1XW6A 1PMTA 1X5DA 1PX7A 2LTKA 4XTSA 1W89A 2H74A 5KN2A 1OE8A 3M1GA 2LKUA 3IK9A 5ECNB 2I9HA 5B6MA 5IO2A 3DKSA 1FB6A 5IMCA 4AF2A 1B9YC 5IMDA 5J5NA 2R0GA 1C72A 4KA0A 4TR1A 1WE0A 2MZCA 2L4QA 4IN0A 2GVPA 1ZCPA 2GZYA 5G31A 4ICYA 2IMEA 2CAQA 2HZEB 4MPGA 5L71A 5KN0A 1DE1A 3GIXA 2AUVA 3APOA 2VD1A 4YQVA 3FZ4A 3F4SA 3GX8A 1HNAA 2YJ7A 4PNGA 13GSA 2YWOA 5J47A 2BMXA 1SJZA 4K0NA 2HRNA 11GSA 2DBCA 5F05A 4FYBA 3HKRA 4WR5A 3PH9A 2HRKA 1BEDA 4DVCA 2BTOT 1GTBA 4POBA 3KH9A 6GSTA 2H1GA 5KOWA 3J7Yk 4POKA 3VLNA 3BOAA 1XWAA 2JZTA 2HZFA 2RM5A 3D4MA 1DE2A 1ZMAA 5A5HB 3FEUA 1SENA 5EL8A 3FHKA 1XOBA 2I1UA 3HZ8A 3FR9A 1FOVA 1Z6MA 3O6TA 4G0KA 4CY6A 2TRCP 1V9WA 5G30A 4ZBAA 4IP1A 4O5QA 3LSZA 2H1DA 2IJYA 1SYXA 2OADA 2AAWA 2YCDA 1LU4A 2VUPA 1TU7A 4NV2A 1OAZA 2LRCA 1EOHA 2FY6A 3KP9A 5IIZA 3TRQA 3EPTA 3WGDA 4RUVA 3IC8A 1GSQA 3MAKA 2IWTA 2M72A 3H1NA 4QMKA 1YQ1A 3I6AA 4KW6A 2VCWA 4EXJA 1ZOFA 2HSNA 1QQ2A 3UVHA 2FD3A 4ILFA 14GSA 3I43A 4DSQA 1V58A 2I3YA 4IHUA 2HNLA 2O8VB 3CWGA 2F3MA 3HVXA 2N5BA 2YV7A 4ZBBA 4BPYA 3LGCA 1AC1A 4AKHA 5DVBA 3HCZA 2QC7A 1ON4A 1WOUA 1PN0A 2HRFA 4ZL9A 2Z9SA 4EDYA 1KNGA 4LLRA 5IPHA 4ZB7A 1AQVA 2H0GA 4N0VA 3SWLA 1B4PA 3IC4A 3MWHA 4HDEA 5JCWA 2PGTA 4I2UA 1K0DA 5DCHA 4XS4A 2QGVA 1URMA 2EC4A 2FWGA 4PX1A 2G0FA 4A5PA 3GSTA 5HFIA 4TR0A 5IM9A 3TKSC 4EIPA 5F0GA 3DVWA 3ZVJA 1H75A 3VWVA 1UN2A 4ZB6A 2H0HA 2P5QA 1ZYPA 5IO0A 1VRSD 1EEMA 5BMUA 3E3EA 2VM1A 2C0EA 2FNOA 2YWMA 3D21A 4IQAA 4W66A 2L4CA 5DJMA 10GSA 1AXDA 1SVLA 4MH2A 4V1Ap 2CT6A 3QMXA 3ME8A 2WFCA 1FG4A 4AKXB 3EINA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U3I A;  2X8H A;  3QFB C;  1NHO A;  2H66 A;  3GL3 A;  3TKP A;  3TJB A;  1OKT A;  2OBI A;  2DJ0 A;  3A3T A;  1PL2 A;  5G5F A;  2EIQ A;  5ABR A;  1Z5Y E;  4GST A;  1JZW A;  4KE3 A;  3ISO A;  2YAN A;  3IV4 A;  2CX3 A;  2V41 A;  4Q5N A;  2A4V A;  5A4V A;  2VCT A;  2GQL A;  4GWR A;  1M2B A;  4ZB8 A;  1MD4 A;  4L5L A;  2I4A A;  3M8N A;  4ZIJ A;  1GSS A;  4OFT A;  4QQ7 A;  3GA4 A;  4TR4 A;  1UVZ A;  4XRD A;  1CQH A;  5B8B A;  1Z7P A;  2LQO A;  1X9W B;  2AB6 A;  3IE3 A;  1TOF A;  1GL8 A;  3Q18 A;  1THO A;  2CZ3 A;  1TJD A;  3F0I A;  1H4O A;  5ECK B;  3GFK A;  3HZ4 A;  2KLX A;  4N10 A;  2HLS A;  2H0I A;  2GSQ A;  4XIH A;  4MK3 A;  1SKS B;  1ML6 A;  3P2A A;  3QAG A;  3WD6 A;  1T4Y A;  2R6K A;  4L0U A;  2DSA A;  1WMJ A;  5LCZ A;  4BA7 A;  3JCM L;  2DJ1 A;  5ECP B;  1XFL A;  4ML6 A;  5E59 A;  4PQH A;  3GL5 A;  4RI6 A;  1MDJ A;  3GUR A;  22GS A;  2O7K A;  5ECL B;  3KGK A;  5DQY A;  2LJK A;  4WXT A;  2LNT A;  1K3O A;  2E7P A;  3C7M A;  1QMV A;  5F06 A;  5JWR B;  4F2I A;  1M9B A;  4HJ2 A;  3TJG A;  3L0H A;  3GYK A;  2GT6 A;  1MDK A;  2LEG A;  4BL7 A;  3LFL A;  2XHF A;  1PSQ A;  4POM A;  1QGV A;  2HE3 A;  1U88 A;  4OCF A;  1Z6N A;  1K0N A;  2X8C A;  4JR4 A;  3E0U A;  2WZ9 A;  3LJR A;  1F6M C;  4IGJ A;  1F2E A;  4PTS A;  2O89 A;  1M2D A;  2E2M A;  4TXO A;  1U87 A;  3QR6 A;  4KSO A;  1ERV A;  4MJA A;  1ERT A;  1A0F A;  7GSS A;  4KSM A;  2H1B A;  1VF4 A;  3DYR A;  4G9H A;  2HI7 A;  3EUR A;  3RBT A;  4TR3 A;  3C1S A;  5DQS A;  1EP7 A;  4J56 E;  4K0G A;  4K7I A;  5G1L A;  1USB A;  1JZD A;  5F07 A;  4IVF A;  1SD8 A;  1G7E A;  1TTZ A;  1AW9 A;  2VLT A;  3DEX A;  3V1W A;  1CQG A;  3TRP A;  1A2J A;  3P90 A;  1ST9 A;  3ZL5 A;  2L57 A;  3C71 A;  4PUR A;  1RW1 A;  4K1F A;  3C8E A;  3H8Q A;  3LOR A;  5D8I A;  5DAK B;  4K6X A;  2J9H A;  4DSS A;  4EKZ A;  1DBY A;  3KP8 A;  3RPP A;  2YP6 A;  1FAA A;  3L78 A;  2C80 A;  2CAI A;  3LYK A;  4HU7 A;  2GSR A;  3KM6 A;  3UOM A;  1OKD A;  3R2Q A;  4AJ7 A;  1TK5 B;  2IIY A;  1R5A A;  4HEA 2;  3L9U A;  1GSU A;  1NM3 A;  3F4R A;  2G2Q A;  5ECI B;  2GT5 A;  2CV4 A;  3EMP A;  5A5K A;  4RQX A;  2P0G A;  5HFG A;  1EEJ A;  4EO3 A;  5CRE A;  3GH9 A;  4JR6 A;  2PWJ A;  4ML1 A;  1FB0 A;  1IYH A;  4HOJ A;  4TOP A;  3KMN A;  2HSH A;  4N11 A;  1THX A;  3LG6 A;  1SK2 A;  2PVO C;  3G9B A;  1ACV A;  3PPU A;  3CTG A;  3VWU A;  2DIY A;  5J9C A;  1Q4J A;  3IR4 A;  3IAS 2;  3TOU A;  2OBK A;  1Y25 A;  3LWA A;  1NHY A;  4NMU A;  1KTE A;  2VM2 A;  2JAC A;  1GSE A;  3UVT A;  2F8F A;  4JBB A;  1ZYE A;  4LL1 B;  2PMT A;  3ZIT A;  1G0T A;  2B5E A;  4BVY B;  4KGI A;  1M9A A;  2HSM B;  3KD0 A;  2OKA A;  3ZYW A;  1WRY A;  5ID2 A;  1UA5 A;  3HHV A;  1O7U A;  1TK0 B;  4OO4 A;  3WT2 A;  4K7O A;  2WJU A;  2IFQ B;  3CSJ A;  2XBI A;  1EGO A;  1PKW A;  2RUF A;  5LNK e;  4L8E A;  2DML A;  4XCS A;  1IYI A;  2H19 A;  2XBQ A;  1ILO A;  4GCI A;  4WEY A;  1EGR A;  3FY7 A;  4IBP A;  3NOF A;  1TDI A;  4IEL A;  1K0C A;  2PER A;  5AIX A;  4L0W A;  1B48 A;  3EE2 A;  3ZRE A;  2K8V A;  4MAB A;  3DD3 A;  1A8L A;  2FA8 A;  4BVX A;  1AAZ A;  4EC0 A;  4JU5 A;  3TDG A;  4MZB A;  3M9K A;  3G7J A;  2N5A A;  5GZZ B;  5D73 A;  3MNG A;  2OE0 A;  2DC5 A;  20GS A;  1ZYQ B;  4ZL8 A;  1YF1 A;  1GTI A;  3ZIJ A;  3CMI A;  2VOC A;  4ECJ A;  1XIY A;  4XHM A;  5IQY A;  2WB9 A;  3KTB A;  1X5C A;  4TXV A;  3WYW A;  1FW1 A;  4I6X A;  2ON7 A;  3A2V A;  4ZBD A;  1YJ6 A;  3D0Z A;  3IRA A;  5LD0 A;  3IPZ A;  4FIW A;  3GTU A;  4AJ6 A;  1AQW A;  1BAY A;  4O92 A;  4KF9 A;  1GLQ A;  2VLU A;  4K8M A;  3D22 A;  1I5G A;  1EZK A;  2PU9 C;  1QFN A;  3U5R E;  1YEX A;  1PGT A;  5CYY A;  4N30 A;  1EOG A;  1GTA A;  2B1K A;  2RLI A;  3BCI A;  1M99 A;  3ZTL A;  5GSS A;  4OWY A;  4MJC A;  4N0Z A;  2ON5 A;  3N5O A;  2C0G A;  5AN1 A;  1I9D A;  5AGY A;  3DXB A;  2R37 A;  3GUS A;  3KXO A;  1XBS A;  2H6Y A;  1LJR A;  1WPI A;  1XWB A;  3IBH A;  1G7O A;  3EYT A;  2LNS A;  2FGX A;  1QXH A;  2ZCT A;  4V2L A;  1PL1 A;  3BD2 A;  3IOS A;  4WF5 A;  1GUL A;  3F3R A;  4E8E A;  3UL3 A;  3F4T A;  2R2J A;  2I81 A;  5IMZ A;  2C3Q A;  1NSW A;  2PUK C;  2HZE A;  9GSS A;  4TRX A;  2CVD A;  1JZO A;  2MMO A;  2ZNM A;  4GQC A;  3R3E A;  4NHW A;  1O73 A;  5DAL B;  4XS1 A;  5EY6 A;  2F8A A;  4GF0 A;  5FT3 A;  1ERU A;  2CVK A;  1R26 A;  3G7Y A;  2FLS A;  4NHZ A;  1Y6E A;  3LXZ A;  3RAZ A;  4KDU A;  1XWG A;  1O8W A;  3FZ5 A;  1QK8 A;  1O6J A;  4K9Z A;  2VCX A;  3MDK A;  4AGS A;  2LV3 A;  5IOW A;  1AIU A;  5GAP D;  1VF3 A;  1RK4 A;  5AIS A;  4RQR A;  3TJF A;  5EVO A;  3A2X A;  1SKW B;  1WP0 A;  3TB2 A;  2VL2 A;  1FVK A;  3APS A;  2DJ3 A;  5J41 A;  1SJ6 A;  4ULX A;  5B6N A;  6GSX A;  2VL9 A;  1MTC A;  4WET A;  1A2L A;  1YKA A;  3K8N A;  2F51 A;  3U6V A;  5B7C A;  1ERW A;  4GTU A;  5GST A;  1X5E A;  2HT9 A;  4OCE A;  3FZ9 A;  3O76 A;  5G5E A;  1XWC A;  3EU4 A;  4LL4 B;  5JWQ B;  4I2T A;  4G0I A;  1OYJ A;  3GKM A;  5ECO B;  1YDK A;  1SL1 B;  1TW9 A;  1TI1 A;  2HQT A;  1WIK A;  3W6G A;  2GSS A;  1GLP A;  2YZH A;  3GX0 A;  2YOI A;  5JCU A;  1N8J A;  4ZXG A;  2XC2 A;  3A5W A;  1T4Z A;  5CRG A;  2VLV A;  1N2A A;  3ZLP A;  1HNC A;  4TXO B;  1K3Y A;  4MF5 A;  3UBK A;  2GZZ A;  4IP6 A;  1BJX A;  2R5G A;  1GP1 A;  2REM A;  1F37 A;  1S3D A;  2IPA A;  5C04 A;  5IPG A;  2R4V A;  3LQ7 A;  4YAP A;  1JLV A;  6GSV A;  2H01 A;  2OAC A;  4V2N A;  1S3A A;  3O3T A;  3TKQ A;  3IK7 A;  1GUM A;  4MPF A;  1SJI A;  1K0O A;  1OC9 B;  5ENU A;  4PGT A;  3GSS A;  2CQ9 A;  2V6K A;  3QFA C;  3I69 A;  4JZQ A;  4WKW A;  1SYR A;  18GS A;  1YF0 A;  4G19 A;  5IMF A;  4MJB A;  4XS6 A;  3GHA A;  2H75 A;  2D2Z A;  1TP9 A;  3KH7 A;  2C0F A;  1JHB A;  3CSI A;  2B5Y A;  3UIW A;  2NTO A;  2B5X A;  1E2Y A;  2AV4 A;  4KDX A;  5AIV A;  2DMM A;  3TGZ A;  2FWE A;  3SBC A;  3TUE A;  1GNE A;  4KAE A;  4ZB9 A;  3TKR A;  3DML A;  4NPB A;  4ZL7 A;  4POL A;  2PN8 A;  3VI7 A;  1K0B A;  2YWI A;  2JSZ A;  4PQ1 A;  1GSY A;  2WCI A;  4YAV A;  2B6M A;  1DSB A;  1BYE A;  4EDZ A;  4FYC A;  4PNF A;  2HSY A;  3UEM A;  4PUA A;  2DJ2 A;  1AQX A;  3RPN A;  4HJM A;  1ZL9 A;  1GH2 A;  1XW5 A;  1OE7 A;  4I8B A;  2F9S A;  3EU3 A;  3HVS A;  3DGQ A;  3GV1 A;  1F3B A;  3UMA A;  2N5F A;  1UC7 A;  4GXZ A;  3F9U A;  3ZML A;  4Q5Q A;  1WWJ A;  4X43 A;  4MDC A;  2V1M A;  3WGE A;  3VPQ A;  1YEP A;  4V1A g;  1W4V A;  1JFU A;  1R7H A;  2WRT A;  1A24 A;  4MF6 A;  2WGR A;  1M2A A;  3US3 A;  4KDY A;  1V57 A;  2HFD A;  2BJX A;  1GTU A;  1XW9 A;  3ERG A;  2DJJ A;  4JE1 A;  1MD3 A;  2GDR A;  2CA8 A;  5ELG A;  4MF7 A;  4Q5R A;  1T00 A;  5DDL A;  2AYT A;  2IMF A;  1G6W A;  3RHC A;  4TR1 B;  5D9V A;  2FWH A;  1PRX A;  4O5R A;  4BWQ A;  1J0F A;  3LXT A;  4GSN A;  6GSS A;  1X9M B;  2WS2 A;  2P31 A;  5CAX A;  1SD9 A;  2AHE A;  3KJY A;  2GLR A;  1K3L A;  3IDV A;  1T8E B;  3H4K A;  3VUR A;  3F63 A;  1TU8 A;  4IJ3 A;  3VI5 A;  4IS0 A;  2ES7 A;  1EP8 A;  1XXU A;  2B3S A;  3EWL A;  5ECH B;  5H5S A;  2H70 A;  5ELA A;  4NXI A;  1SL2 B;  1A8Y A;  3TKS A;  1OC3 A;  1T1V A;  3ZMK A;  2IN3 A;  2K18 A;  2KP2 A;  5D96 A;  3GRX A;  2HRK B;  1BX9 A;  2PBJ A;  3G7I A;  3UAR A;  5HFK A;  5CRH A;  1EV9 A;  1FVJ A;  8GSS A;  3VWW A;  2OA7 A;  3ZIV A;  3L9S A;  4PUF C;  6GSW A;  2MBT A;  1G6Y A;  2J23 A;  2PPT A;  4K2D A;  2LJR A;  3GTU B;  3L9V A;  2L5O A;  1ABA A;  3W8J A;  3KCM A;  4D73 A;  5H5Q A;  2AJQ B;  2LRT A;  3ZVJ D;  19GS A;  2LRN A;  5ECS A;  3VPT A;  2K8S A;  4CW9 A;  4DSR A;  4HQZ A;  3GKK A;  3EMX A;  4KCA A;  2MYG A;  4XRA A;  5D9T A;  4GRF A;  5C00 A;  2MMZ A;  4J2F A;  3CRT A;  1F9M A;  2YNX A;  2FUG 2;  3IHQ A;  2IMI A;  1FO5 A;  1MEK A;  2X99 A;  1Z9H A;  3H93 A;  2GST A;  4HZ2 A;  5DAK A;  1XWK A;  2IL3 A;  5KEJ A;  2H6Z A;  2H76 A;  5G2Z A;  5D9W A;  4EL1 A;  3IXR A;  1K0A A;  5CO3 A;  2KHP A;  1GUK A;  3QDN A;  2HSN B;  2K6V A;  1GSD A;  2L6C A;  3W8S A;  4HZ4 A;  1Z7R A;  3HYP A;  2YWN A;  5FHI A;  2WUL A;  5D93 A;  2FCH A;  4EE0 A;  3GNJ A;  5ECR B;  4KB3 A;  3AY8 A;  3Q19 A;  3M3M A;  3QAV A;  2X64 A;  4ECI A;  2DIZ A;  1O8X A;  1YZX A;  3DWV A;  4GLT A;  1TRS A;  1J08 A;  5CRW A;  4HUA A;  3D4T A;  4CHS A;  3N9J A;  1XVW A;  3UAP A;  2FA4 A;  5HR0 A;  2YZU A;  1DUG A;  1V2A A;  2KUC A;  3S9F A;  4EVM A;  4MLY A;  2K9F A;  3HDC A;  1YY7 A;  2TRX A;  4XS4 B;  5INY A;  4KCE A;  4ECC A;  1GSF A;  3F6F A;  4QL7 A;  2PVQ A;  4KX4 A;  4OFM A;  2QSI A;  2JL4 A;  3HJO A;  1S3C A;  2C3T A;  2JZS A;  2GZP A;  3VWX A;  2RUE A;  1XOA A;  1J9B A;  4BVY A;  4MZW A;  4LMV A;  2HSM A;  2YV9 A;  2H73 A;  1JLW A;  1SKR B;  5KN1 A;  4HQS A;  2EIR A;  1TRW A;  1F3A A;  2IFQ A;  2RII A;  4D73 B;  5IMA A;  2E0Q A;  12GS A;  2R3X A;  4WR4 A;  2NDO A;  3PIN A;  4LA1 A;  4MMM A;  1NW2 A;  3IAM 2;  2LJA A;  3FR6 A;  1VF2 A;  5J4U A;  4HU9 A;  2YJH A;  5IOX A;  1SL0 B;  1EV4 A;  2B7K A;  1PD2 1;  3FRC A;  2V2G A;  2RM6 A;  3PGT A;  5ECM B;  4IW9 A;  3C1R A;  4MH3 A;  1K0M A;  2JAD A;  2QKE A;  4I97 A;  4E8H A;  2X8G A;  4GQF A;  3TJJ A;  1YKC A;  3DRN A;  4MJE A;  2A2S A;  5J9B A;  4I5Q A;  4OO5 A;  5JCG A;  2FHE A;  2IMD A;  4FH8 A;  4PXO A;  4V2M A;  3H79 A;  5KN3 A;  1XZO A;  4HI7 A;  1PQN A;  5A4W A;  2P5R A;  1ZZY A;  2KOK A;  1A2M A;  2H72 A;  4AJ8 A;  5DBQ A;  2MMA A;  1X9S B;  3BJ5 A;  3FR3 A;  2O87 A;  4TW5 A;  2VCZ A;  4TVE A;  2GGT A;  3KMO A;  1B8X A;  2C8U A;  2NBS A;  3CTF A;  2GQM A;  2IMK A;  3GN3 A;  3EC3 A;  4FYU A;  2HYX A;  1B9X C;  3EVI A;  1R4W A;  1TI3 A;  3QAW A;  3ZFL A;  2XPD A;  2H1A A;  3GKX A;  1QUW A;  3WT1 A;  4EF0 A;  2M80 A;  4KH7 A;  2NPB A;  1SK1 A;  3FZA A;  4X1U A;  4WF4 A;  4ZIL A;  5ECQ B;  5CRD A;  4ECB A;  2H71 A;  1EWX A;  2V32 A;  1O85 A;  3ED3 A;  5G1K A;  4P3Y B;  5HR1 A;  3FK8 A;  4BL7 B;  3ERF A;  4YQU A;  3HD5 A;  1GUH A;  2B7J A;  3ZZX A;  3CBU A;  1ZGN A;  2LS5 A;  1WJK A;  2C4J A;  3D6I A;  5HR3 A;  5JWO B;  5COH A;  3NIV A;  1GNW A;  1VF1 A;  5FWG A;  3P7X A;  4ISD A;  2A2R A;  3RDW A;  2VL3 A;  6GSU A;  2OJL A;  3CRU A;  3TKS E;  3IA1 A;  2CX4 A;  5DAL A;  3F8U A;  4ID0 A;  4Z7X A;  1PA3 A;  4NWY A;  4NV5 A;  5E4W A;  3CXG A;  3LYP A;  1VGL A;  3GH6 A;  2HXK A;  1A23 A;  2VIM A;  3HJM A;  3LEF A;  3TJK A;  3M0F A;  3BCK A;  3F6D A;  2JSY A;  4IQ1 A;  2EIO A;  3A2W A;  2WDU A;  3TOT A;  3KZQ A;  1GWC A;  3ERW A;  3HA9 A;  4EUY A;  1Z3E A;  4IKH A;  1XVQ A;  2C1Y A;  3TRX A;  4KND A;  3Q6O A;  3GMF A;  1HD2 A;  4DSS B;  1HYU A;  1O81 A;  2VCQ A;  1T3B A;  3C73 A;  1V98 A;  1OVN A;  3NZN A;  3HVV A;  2LST A;  3QOU A;  5J3R A;  2VAF A;  2HRA A;  3F3Q A;  3WGX A;  2OE3 A;  4OMV A;  4Q5F A;  1U6T A;  4WBJ A;  1TXX A;  1RQM A;  2VO4 A;  3VK9 A;  2CZ2 A;  2MBS A;  1TKD B;  5B8A A;  4ACS A;  3BBY A;  3FW2 A;  4FQU A;  2TIR A;  4USS A;  4F03 A;  1JZR A;  2YN1 A;  3FKF A;  1PKZ A;  3HJP A;  3CYN A;  3CSH A;  4MCU A;  5EPF A;  2UZ8 A;  1AUC A;  3D5J A;  1PN9 A;  4MP4 A;  1HNB A;  2MMN A;  2NVL A;  4OD7 A;  3L4N A;  4G0L A;  2GTU A;  2FWF A;  1FHE A;  1PX6 A;  3RHB A;  1M0U A;  4TKY A;  3VFI A;  2VD0 A;  3APQ A;  1XPV A;  5DJL A;  6GSY A;  3GKN A;  2LUS A;  4PQI A;  4NAX A;  2YPM A;  1M7T A;  5D9X A;  2V6O A;  2H6X A;  4WBR D;  1TRU A;  5A4U A;  4G10 A;  2C3N A;  1SU9 A;  4X0X A;  3TCO A;  4F0B A;  2JU5 A;  1E6B A;  1TK8 B;  1HQO A;  2L5L A;  4JRR A;  4RI7 A;  4IJI A;  5DCG A;  5HQP A;  1KBN A;  4YH2 A;  4GSS A;  4F0C A;  2L6D A;  1BQ7 A;  3HXS A;  1SK0 A;  4BWS A;  1R5P A;  2O85 A;  5ID2 B;  4QL9 A;  1B4Q A;  4MA9 A;  3DIE A;  2E2G A;  1OC9 A;  4TN8 A;  5F8B A;  3M9J A;  2DJK A;  1BG5 A;  1V40 A;  4CDO A;  3E9J B;  2VCV A;  4G2E A;  1A0R P;  5HR2 A;  4F9Z A;  2DLX A;  2JZR A;  3I9V 2;  2C0D A;  3ZRD A;  5H5R A;  3Q74 A;  3UJ1 A;  4F82 A;  1XCC A;  2B1L A;  16GS A;  3UBL A;  2CVB A;  4BVX B;  1X0R A;  4MZC A;  2ALB A;  2M46 A;  2GS3 A;  4YQM A;  4LMW A;  3HY2 A;  1OC8 A;  2VL2 C;  3MSZ A;  4J57 E;  4O32 A;  4FO5 A;  1GRX A;  4KUN A;  1KEB A;  4K7N A;  1Q98 A;  4O7H A;  2XPE A;  4DEJ A;  4HS1 A;  2H30 A;  3OR5 A;  3DVX A;  1T7P B;  4L5O A;  2LQQ A;  2H8L A;  3KTL A;  2OE1 A;  4JED A;  4OFN A;  1TRV A;  3J7Y b;  2KP1 A;  3FYG A;  5CNW A;  2L59 A;  3KIJ A;  1U3A A;  2GQK A;  1MDI A;  3QD9 A;  3KEB A;  5IMV A;  3QCP A;  5GAN D;  3P8W A;  3PR8 A;  3ZFB A;  3ME7 A;  4H86 A;  5CP1 A;  3QPM A;  17GS A;  2ZUP A;  1LBK A;  1XW6 A;  1PMT A;  1X5D A;  1PX7 A;  2LTK A;  4XTS A;  1W89 A;  2H74 A;  5KN2 A;  1OE8 A;  3M1G A;  2LKU A;  3IK9 A;  5ECN B;  2I9H A;  5B6M A;  5IO2 A;  3DKS A;  1FB6 A;  5IMC A;  4AF2 A;  1B9Y C;  5IMD A;  5J5N A;  1C72 A;  4KA0 A;  4TR1 A;  1WE0 A;  2MZC A;  2L4Q A;  4IN0 A;  2GVP A;  1ZCP A;  2GZY A;  5G31 A;  2IME A;  2CAQ A;  2HZE B;  4MPG A;  5L71 A;  5KN0 A;  1DE1 A;  3GIX A;  2AUV A;  3APO A;  2VD1 A;  4YQV A;  3FZ4 A;  3F4S A;  3GX8 A;  1HNA A;  2YJ7 A;  4PNG A;  13GS A;  2YWO A;  2BMX A;  1SJZ A;  4K0N A;  2HRN A;  11GS A;  2DBC A;  5F05 A;  4FYB A;  3HKR A;  4WR5 A;  3PH9 A;  2HRK A;  1BED A;  4DVC A;  2BTO T;  1GTB A;  4POB A;  3KH9 A;  6GST A;  2H1G A;  3J7Y k;  4POK A;  3VLN A;  3BOA A;  1XWA A;  2JZT A;  2HZF A;  2RM5 A;  3D4M A;  1DE2 A;  1ZMA A;  3FEU A;  1SEN A;  5EL8 A;  3FHK A;  1XOB A;  2I1U A;  3HZ8 A;  3FR9 A;  1FOV A;  1Z6M A;  3O6T A;  4G0K A;  2TRC P;  1V9W A;  5G30 A;  4ZBA A;  4IP1 A;  3LSZ A;  2H1D A;  2IJY A;  1SYX A;  2OAD A;  2AAW A;  2YCD A;  1LU4 A;  2VUP A;  1TU7 A;  4NV2 A;  1OAZ A;  2LRC A;  1EOH A;  2FY6 A;  3KP9 A;  5IIZ A;  3TRQ A;  3WGD A;  4RUV A;  3IC8 A;  1GSQ A;  3MAK A;  2IWT A;  2M72 A;  3H1N A;  1YQ1 A;  3I6A A;  4KW6 A;  2VCW A;  4EXJ A;  1ZOF A;  1QQ2 A;  3UVH A;  2FD3 A;  4ILF A;  14GS A;  3I43 A;  4DSQ A;  1V58 A;  2I3Y A;  4IHU A;  2HNL A;  2O8V B;  2F3M A;  3HVX A;  2N5B A;  2YV7 A;  4ZBB A;  4BPY A;  3LGC A;  1AC1 A;  5DVB A;  3HCZ A;  2QC7 A;  1ON4 A;  1WOU A;  2HRF A;  4ZL9 A;  2Z9S A;  4EDY A;  1KNG A;  4LLR A;  5IPH A;  1AQV A;  2H0G A;  4N0V A;  3SWL A;  1B4P A;  3IC4 A;  3MWH A;  4HDE A;  5JCW A;  2PGT A;  4I2U A;  1K0D A;  5DCH A;  4XS4 A;  2QGV A;  1URM A;  2EC4 A;  2FWG A;  4PX1 A;  2G0F A;  3GST A;  5HFI A;  4TR0 A;  5IM9 A;  3TKS C;  5F0G A;  3DVW A;  3ZVJ A;  1H75 A;  3VWV A;  1UN2 A;  4ZB6 A;  2H0H A;  2P5Q A;  5IO0 A;  1VRS D;  1EEM A;  5BMU A;  3E3E A;  2VM1 A;  2C0E A;  2FNO A;  2YWM A;  3D21 A;  4IQA A;  2L4C A;  5DJM A;  10GS A;  1AXD A;  4MH2 A;  4V1A p;  2CT6 A;  3QMX A;  3ME8 A;  2WFC A;  1FG4 A;  3EIN A; 
#chains in the Genus database with same CATH topology
 1U3I A;  4PI0 C;  2X8H A;  3QFB C;  1NHO A;  2H66 A;  3GL3 A;  3TKP A;  3TJB A;  1OKT A;  2OBI A;  2DJ0 A;  3A3T A;  1PL2 A;  5G5F A;  2EIQ A;  5ABR A;  1Z5Y E;  4GST A;  1JZW A;  4KE3 A;  3ISO A;  2YAN A;  3IV4 A;  2CX3 A;  1Y1U A;  2V41 A;  4Q5N A;  2A4V A;  5A4V A;  2VCT A;  2GQL A;  4GWR A;  1M2B A;  4MNN A;  4ZB8 A;  1MD4 A;  4L5L A;  2I4A A;  3M8N A;  4ZIJ A;  1GSS A;  4OFT A;  4QQ7 A;  3GA4 A;  4TR4 A;  1UVZ A;  4XRD A;  1CQH A;  5B8B A;  1Z7P A;  2LQO A;  1X9W B;  2AB6 A;  3IE3 A;  1TOF A;  1GL8 A;  5A1N B;  3Q18 A;  4Z2R A;  1THO A;  2CZ3 A;  1TJD A;  3F0I A;  3MYD A;  1H4O A;  5ECK B;  3GFK A;  3HZ4 A;  2KLX A;  4N10 A;  2HLS A;  4X4J A;  2H0I A;  2GSQ A;  4XIH A;  4MK3 A;  1SKS B;  1ML6 A;  3P2A A;  3QAG A;  1TXU A;  2QA1 A;  3WD6 A;  1T4Y A;  2R6K A;  4L0U A;  2DSA A;  1WMJ A;  5LCZ A;  4BA7 A;  3JCM L;  2DJ1 A;  1I1I P;  5ECP B;  1XFL A;  4ML6 A;  5E59 A;  4PQH A;  3GL5 A;  4RI6 A;  1MDJ A;  3GUR A;  22GS A;  2O7K A;  5ECL B;  3KGK A;  5DQY A;  2LJK A;  4WXT A;  2LNT A;  1K3O A;  2E7P A;  3C7M A;  1QMV A;  5F06 A;  5JWR B;  4F2I A;  1M9B A;  4HJ2 A;  3TJG A;  3L0H A;  5A34 B;  3GYK A;  2GT6 A;  1MDK A;  2LEG A;  4BL7 A;  3LFL A;  2XHF A;  1PSQ A;  4POM A;  1QGV A;  2HE3 A;  1U88 A;  4OCF A;  1Z6N A;  1K0N A;  2X8C A;  4JR4 A;  3E0U A;  2WZ9 A;  3LJR A;  1M3I A;  1F6M C;  4IGJ A;  1F2E A;  4PTS A;  2O89 A;  1M2D A;  2E2M A;  4TXO A;  1U87 A;  3QR6 A;  4KSO A;  1ERV A;  4MJA A;  1ERT A;  1A0F A;  7GSS A;  4KSM A;  2H1B A;  1VF4 A;  3DYR A;  4G9H A;  2HI7 A;  3EUR A;  3RBT A;  4TR3 A;  3C1S A;  5DQS A;  1EP7 A;  4J56 E;  4K0G A;  4K7I A;  5G1L A;  1USB A;  1JZD A;  5F07 A;  4IVF A;  1SD8 A;  1G7E A;  1TTZ A;  1AW9 A;  2VLT A;  3DEX A;  3V1W A;  1CQG A;  3TRP A;  1A2J A;  3P90 A;  1ST9 A;  3ZL5 A;  2L57 A;  3C71 A;  4PUR A;  1RW1 A;  4K1F A;  3C8E A;  3H8Q A;  3LOR A;  5D8I A;  5DAK B;  4K6X A;  2J9H A;  4DSS A;  4EKZ A;  3RFR C;  1DBY A;  3KP8 A;  3RPP A;  2YP6 A;  1FAA A;  1S3R A;  3L78 A;  2C80 A;  2CAI A;  3LYK A;  4HU7 A;  2GSR A;  3KM6 A;  3UOM A;  1OKD A;  3R2Q A;  4AJ7 A;  1TK5 B;  2IIY A;  1R5A A;  4HEA 2;  3L9U A;  2WVX B;  1GSU A;  1NM3 A;  3F4R A;  2G2Q A;  5ECI B;  2R0P A;  2GT5 A;  2CV4 A;  3EMP A;  5A5K A;  4RQX A;  2P0G A;  5HFG A;  1EEJ A;  4EO3 A;  5CRE A;  3GH9 A;  4JR6 A;  2PWJ A;  4ML1 A;  1FB0 A;  1IYH A;  4HOJ A;  4TOP A;  3KMN A;  2HSH A;  4N11 A;  1THX A;  3LG6 A;  1SK2 A;  2PVO C;  3G9B A;  1ACV A;  2OT3 A;  3PPU A;  3CTG A;  3VWU A;  2DIY A;  5J9C A;  1Q4J A;  3IR4 A;  3IAS 2;  3TOU A;  3LW9 A;  2OBK A;  1Y25 A;  3LWA A;  1NHY A;  4NMU A;  1KTE A;  2VM2 A;  2JAC A;  1GSE A;  3UVT A;  2F8F A;  4JBB A;  1ZYE A;  4LL1 B;  2PMT A;  3ZIT A;  1G0T A;  2B5E A;  4BVY B;  4KGI A;  1M9A A;  4G01 A;  2HSM B;  3KD0 A;  2OKA A;  3ZYW A;  1WRY A;  5ID2 A;  1UA5 A;  3HHV A;  1O7U A;  1TK0 B;  4OO4 A;  3WT2 A;  3A5I A;  4K7O A;  2WJU A;  2IFQ B;  3CSJ A;  2XBI A;  1EGO A;  1PKW A;  2RUF A;  5LNK e;  4L8E A;  2DML A;  4XCS A;  1IYI A;  2H19 A;  2XBQ A;  1ILO A;  4GCI A;  4WEY A;  1EGR A;  3FY7 A;  4IBP A;  3NOF A;  1TDI A;  4IEL A;  1K0C A;  2PER A;  5AIX A;  4L0W A;  1B48 A;  3EE2 A;  3ZRE A;  2K8V A;  4MAB A;  3DD3 A;  1A8L A;  2FA8 A;  4BVX A;  1AAZ A;  4EC0 A;  4JU5 A;  3TDG A;  4MZB A;  4CY8 A;  1YVL A;  3M9K A;  3G7J A;  2N5A A;  5GZZ B;  5D73 A;  3MNG A;  2OE0 A;  2DC5 A;  20GS A;  1ZYQ B;  4ZL8 A;  1YF1 A;  1GTI A;  3ZIJ A;  3CMI A;  2VOC A;  4ECJ A;  2WW0 A;  1XIY A;  4XHM A;  5IQY A;  2WB9 A;  3KTB A;  1X5C A;  4TXV A;  3WYW A;  1FW1 A;  4I6X A;  2ON7 A;  3A2V A;  4ZBD A;  1YJ6 A;  3D0Z A;  3IRA A;  5LD0 A;  3IPZ A;  4FIW A;  3GTU A;  4AJ6 A;  1AQW A;  1BAY A;  4O92 A;  4KF9 A;  1GLQ A;  2VLU A;  4K8M A;  3D22 A;  1I5G A;  1EZK A;  2PU9 C;  1QFN A;  3U5R E;  1YEX A;  1PGT A;  5CYY A;  4N30 A;  1EOG A;  1GTA A;  2B1K A;  2RLI A;  3BCI A;  4EIQ A;  1M99 A;  3ZTL A;  5GSS A;  4OWY A;  4MJC A;  4N0Z A;  2ON5 A;  3N5O A;  2C0G A;  5AN1 A;  1I9D A;  5AGY A;  3DXB A;  2R37 A;  3GUS A;  3KXO A;  1XBS A;  2H6Y A;  1LJR A;  1WPI A;  1XWB A;  3IBH A;  1G7O A;  3EYT A;  2LNS A;  4Z2T A;  2FGX A;  1QXH A;  2EFH A;  2ZCT A;  4V2L A;  1PL1 A;  3BD2 A;  3IOS A;  4WF5 A;  1GUL A;  3F3R A;  4E8E A;  3UL3 A;  3F4T A;  2R2J A;  2I81 A;  5IMZ A;  2C3Q A;  1NSW A;  2PUK C;  2HZE A;  9GSS A;  4TRX A;  2CVD A;  1JZO A;  2MMO A;  2ZNM A;  4GQC A;  3R3E A;  4NHW A;  1O73 A;  5DAL B;  4K5S A;  4XS1 A;  5EY6 A;  2F8A A;  4GF0 A;  5FT3 A;  1ERU A;  2CVK A;  1R26 A;  1BG1 A;  3G7Y A;  2FLS A;  4NHZ A;  1Y6E A;  3LXZ A;  3RAZ A;  4KDU A;  1XWG A;  1BF5 A;  1O8W A;  3FZ5 A;  1QK8 A;  1O6J A;  4K9Z A;  2VCX A;  3MDK A;  3FMW A;  4AGS A;  2LV3 A;  5IOW A;  1AIU A;  2H1L A;  5GAP D;  1VF3 A;  1RK4 A;  5AIS A;  4RQR A;  3TJF A;  5EVO A;  3A2X A;  5A5H A;  5BRT A;  1SKW B;  1WP0 A;  3TB2 A;  2VL2 A;  1FVK A;  3APS A;  2DJ3 A;  5J41 A;  1SJ6 A;  4ULX A;  5B6N A;  6GSX A;  1SVO A;  2VL9 A;  1MTC A;  4WET A;  1A2L A;  1YKA A;  5J4V A;  3K8N A;  2F51 A;  3U6V A;  5B7C A;  1ERW A;  4GTU A;  5GST A;  1X5E A;  2HT9 A;  4OCE A;  2WVZ A;  3FZ9 A;  3O76 A;  5G5E A;  1XWC A;  4YKF A;  2X49 A;  3EU4 A;  4LL4 B;  5JWQ B;  4I2T A;  4G0I A;  1OYJ A;  3GKM A;  5ECO B;  1YDK A;  1SL1 B;  1TW9 A;  1TI1 A;  2HQT A;  1WIK A;  3W6G A;  2GSS A;  1GLP A;  2YZH A;  3GX0 A;  2YOI A;  5JCU A;  1N8J A;  4ZXG A;  2XC2 A;  3A5W A;  1T4Z A;  4FXY P;  5CRG A;  2VLV A;  1N2A A;  3TU3 B;  3ZLP A;  1HNC A;  4TXO B;  1K3Y A;  4MF5 A;  3UBK A;  2GZZ A;  4IP6 A;  1BJX A;  2R5G A;  1GP1 A;  2REM A;  1N25 A;  1F37 A;  1S3D A;  2IPA A;  5C04 A;  5IPG A;  2R4V A;  3LQ7 A;  4YAP A;  1JLV A;  6GSV A;  2H01 A;  2OAC A;  4V2N A;  1S3A A;  3O3T A;  3TKQ A;  3IK7 A;  1GUM A;  4MPF A;  1SJI A;  1K0O A;  1OC9 B;  5ENU A;  4PGT A;  3GSS A;  2CQ9 A;  2V6K A;  3QFA C;  2EFC A;  3I69 A;  4JZQ A;  4WKW A;  1SYR A;  18GS A;  1YF0 A;  4G19 A;  5IMF A;  4MJB A;  4XS6 A;  3GHA A;  2H75 A;  3HVN A;  2D2Z A;  1TP9 A;  3KH7 A;  2C0F A;  1JHB A;  3CSI A;  2B5Y A;  3UIW A;  2NTO A;  2B5X A;  4GDF A;  1E2Y A;  2AV4 A;  4KDX A;  5AIV A;  2DMM A;  3TGZ A;  2FWE A;  3SBC A;  3TUE A;  1GNE A;  4KAE A;  4ZB9 A;  2EFE A;  3TKR A;  3DML A;  4NPB A;  4ZL7 A;  4POL A;  4AKI A;  2PN8 A;  3VI7 A;  1K0B A;  2YWI A;  2JSZ A;  4PQ1 A;  1GSY A;  2WCI A;  4YAV A;  2B6M A;  1DSB A;  1BYE A;  4EDZ A;  4FYC A;  4PNF A;  2HSY A;  3UEM A;  4PUA A;  2DJ2 A;  1AQX A;  3RPN A;  4HJM A;  1ZL9 A;  1GH2 A;  1XW5 A;  1OE7 A;  4I8B A;  2F9S A;  3EU3 A;  3HVS A;  3DGQ A;  3GV1 A;  1F3B A;  3UMA A;  2N5F A;  1UC7 A;  4GXZ A;  3F9U A;  4E68 A;  3ZML A;  4Q5Q A;  1SVM A;  1WWJ A;  4X43 A;  4MDC A;  2V1M A;  5A1N A;  3WGE A;  3VPQ A;  1YEP A;  4V1A g;  1W4V A;  1JFU A;  1R7H A;  2WRT A;  1A24 A;  4MF6 A;  2WGR A;  1M2A A;  3US3 A;  4KDY A;  1V57 A;  2HFD A;  2WW2 A;  1GTU A;  1XW9 A;  2BJX A;  3ERG A;  2DJJ A;  4JE1 A;  1MD3 A;  2GDR A;  2CA8 A;  5ELG A;  4MF7 A;  4Q5R A;  1T00 A;  5DDL A;  2AYT A;  4AI6 A;  2IMF A;  1G6W A;  3RHC A;  4TR1 B;  5D9V A;  2FWH A;  1PRX A;  4O5R A;  4BWQ A;  1J0F A;  3LXT A;  4GSN A;  6GSS A;  1X9M B;  2WS2 A;  2P31 A;  5CAX A;  1SD9 A;  2AHE A;  3KJY A;  2GLR A;  1K3L A;  3IDV A;  1T8E B;  3H4K A;  3VUR A;  3F63 A;  1TU8 A;  4IJ3 A;  3VI5 A;  4IS0 A;  2ES7 A;  1EP8 A;  1XXU A;  2B3S A;  3EWL A;  5ECH B;  5H5S A;  2H70 A;  5ELA A;  4NXI A;  1SL2 B;  1A8Y A;  3TKS A;  1OC3 A;  1T1V A;  3ZMK A;  5A34 A;  2IN3 A;  2K18 A;  2KP2 A;  5D96 A;  3GRX A;  2HRK B;  1BX9 A;  2PBJ A;  3G7I A;  3UAR A;  5HFK A;  5CRH A;  1PFO A;  1EV9 A;  1FVJ A;  8GSS A;  3VWW A;  2OA7 A;  3ZIV A;  3L9S A;  4PUF C;  6GSW A;  2MBT A;  1G6Y A;  2J23 A;  2PPT A;  4K2D A;  2LJR A;  3GTU B;  3L9V A;  2L5O A;  1ABA A;  3W8J A;  3KCM A;  4D73 A;  5H5Q A;  2AJQ B;  5J40 A;  2LRT A;  3ZVJ D;  19GS A;  2LRN A;  5ECS A;  3VPT A;  2K8S A;  4CW9 A;  4DSR A;  4HQZ A;  3GKK A;  3EMX A;  4KCA A;  2MYG A;  4XRA A;  5D9T A;  1M3J A;  4GRF A;  5C00 A;  2MMZ A;  4J2F A;  3CRT A;  1F9M A;  2YNX A;  2DKI A;  2FUG 2;  3IHQ A;  2IMI A;  1FO5 A;  1MEK A;  2WW3 A;  2A2P A;  2X99 A;  1YEW C;  1Z9H A;  3H93 A;  2GST A;  4HZ2 A;  5DAK A;  1XWK A;  2IL3 A;  5KEJ A;  2H6Z A;  2H76 A;  5G2Z A;  5D9W A;  4EL1 A;  3IXR A;  1K0A A;  5CO3 A;  2KHP A;  1GUK A;  3QDN A;  2HSN B;  2K6V A;  1GSD A;  2L6C A;  3W8S A;  4HZ4 A;  1Z7R A;  3HYP A;  2YWN A;  2WVX A;  5FHI A;  2VKZ G;  2WUL A;  5D93 A;  2FCH A;  4EE0 A;  3GNJ A;  5ECR B;  4KB3 A;  3AY8 A;  3Q19 A;  3M3M A;  3QAV A;  2X64 A;  4ECI A;  2DIZ A;  1O8X A;  1YZX A;  3DWV A;  4GLT A;  1TRS A;  2R0C A;  1J08 A;  5CRW A;  4HUA A;  3D4T A;  4CHS A;  3N9J A;  2UV8 G;  1XVW A;  3UAP A;  2FA4 A;  5HR0 A;  2YZU A;  1DUG A;  1V2A A;  2KUC A;  3S9F A;  4EVM A;  4MLY A;  2K9F A;  3HDC A;  1YY7 A;  2TRX A;  4XS4 B;  2DKH A;  5INY A;  4KCE A;  4ECC A;  1GSF A;  3F6F A;  4QL7 A;  2PVQ A;  4KX4 A;  4OFM A;  2QSI A;  2JL4 A;  3HJO A;  1S3C A;  2C3T A;  4AKG A;  2JZS A;  2GZP A;  3VWX A;  5BMU B;  2RUE A;  1XOA A;  1J9B A;  4BVY A;  4MZW A;  4LMV A;  4K2X A;  2HSM A;  2YV9 A;  2EFD A;  2H73 A;  1JLW A;  1SKR B;  5KN1 A;  4Z2U A;  4HQS A;  2EIR A;  1TRW A;  1F3A A;  2IFQ A;  2RII A;  4D73 B;  5IMA A;  2E0Q A;  12GS A;  2R3X A;  4WR4 A;  2NDO A;  3PIN A;  4LA1 A;  4MMM A;  1NW2 A;  3IAM 2;  2LJA A;  3FR6 A;  1VF2 A;  5J4U A;  4HU9 A;  2YJH A;  5IOX A;  1SL0 B;  1EV4 A;  2B7K A;  1PD2 1;  3FRC A;  2V2G A;  2RM6 A;  3PGT A;  5ECM B;  4IW9 A;  3C1R A;  4MH3 A;  1K0M A;  2JAD A;  2QKE A;  4I97 A;  4E8H A;  2X8G A;  4GQF A;  3TJJ A;  1YKC A;  3DRN A;  4MJE A;  2A2S A;  3HMJ G;  5J9B A;  4I5Q A;  4OO5 A;  5JCG A;  4YKG A;  2FHE A;  2IMD A;  4PXO A;  4FH8 A;  4V2M A;  3H79 A;  5KN3 A;  1XZO A;  4HI7 A;  1PQN A;  5A4W A;  2P5R A;  1ZZY A;  2KOK A;  1A2M A;  2H72 A;  4AJ8 A;  5DBQ A;  2MMA A;  1X9S B;  3BJ5 A;  3FR3 A;  2O87 A;  4TW5 A;  2VCZ A;  4TVE A;  2GGT A;  3KMO A;  1B8X A;  2C8U A;  2NBS A;  3CTF A;  2GQM A;  2IMK A;  2O5V A;  3GN3 A;  3EC3 A;  4FYU A;  2HYX A;  1B9X C;  3EVI A;  1R4W A;  1TI3 A;  3QAW A;  3ZFL A;  2XPD A;  2H1A A;  3GKX A;  1QUW A;  3WT1 A;  4EF0 A;  2M80 A;  4KH7 A;  2NPB A;  1SK1 A;  3FZA A;  4X1U A;  4WF4 A;  4ZIL A;  5ECQ B;  5KOX A;  5CRD A;  4ECB A;  2H71 A;  1EWX A;  2V32 A;  1O85 A;  3ED3 A;  5G1K A;  4P3Y B;  5HR1 A;  3FK8 A;  4BL7 B;  3ERF A;  4YQU A;  3HD5 A;  2WW1 A;  1GUH A;  2B7J A;  3ZZX A;  3CBU A;  1ZGN A;  2LS5 A;  1WJK A;  2C4J A;  3D6I A;  5HR3 A;  5JWO B;  5COH A;  3NIV A;  1GNW A;  1VF1 A;  5FWG A;  3P7X A;  4ISD A;  2A2R A;  3RDW A;  2VL3 A;  6GSU A;  2OJL A;  4N3Z A;  3CRU A;  3TKS E;  3IA1 A;  2CX4 A;  5DAL A;  3F8U A;  4ID0 A;  4Z7X A;  1PA3 A;  4HSC X;  4NWY A;  4NV5 A;  5E4W A;  3CXG A;  3LYP A;  1VGL A;  3GH6 A;  2HXK A;  1A23 A;  2VIM A;  3HJM A;  3LEF A;  3TJK A;  3M0F A;  3BCK A;  3F6D A;  2JSY A;  4IQ1 A;  2EIO A;  3A2W A;  2WDU A;  3TOT A;  3KZQ A;  1GWC A;  3ERW A;  3HA9 A;  4EUY A;  1Z3E A;  4IKH A;  1XVQ A;  2C1Y A;  3TRX A;  4KND A;  3Q6O A;  3GMF A;  1HD2 A;  4DSS B;  1HYU A;  1O81 A;  2VCQ A;  1T3B A;  3C73 A;  1V98 A;  1OVN A;  2QA2 A;  3NZN A;  3HVV A;  2LST A;  3QOU A;  5J3R A;  2VAF A;  2HRA A;  3F3Q A;  3WGX A;  2OE3 A;  4OMV A;  4Q5F A;  1U6T A;  4WBJ A;  1TXX A;  1RQM A;  2VO4 A;  3VK9 A;  2CZ2 A;  2MBS A;  1TKD B;  5B8A A;  4ACS A;  3BBY A;  3FW2 A;  4FQU A;  2TIR A;  4USS A;  4F03 A;  1JZR A;  3HJP A;  2YN1 A;  1PKZ A;  3FKF A;  3CYN A;  3CSH A;  4MCU A;  5EPF A;  2UZ8 A;  1AUC A;  2O36 A;  3D5J A;  1PN9 A;  4MP4 A;  1HNB A;  2MMN A;  2NVL A;  4OD7 A;  3L4N A;  4G0L A;  2GTU A;  2WZS A;  1FHE A;  2FWF A;  1PX6 A;  3RHB A;  1M0U A;  4TKY A;  3VFI A;  3IHG A;  2VD0 A;  3APQ A;  1XPV A;  5DJL A;  6GSY A;  3GKN A;  2LUS A;  4PQI A;  4NAX A;  4PI2 C;  2YPM A;  1M7T A;  5D9X A;  2V6O A;  2H6X A;  4WBR D;  1TRU A;  5A4U A;  4K5R A;  4G10 A;  2C3N A;  1SU9 A;  4X0X A;  1FOH A;  3TCO A;  4F0B A;  2JU5 A;  1E6B A;  1TK8 B;  1HQO A;  2L5L A;  4JRR A;  4RI7 A;  4IJI A;  4O5U A;  5DCG A;  5HQP A;  1KBN A;  4YH2 A;  4GSS A;  4F0C A;  2L6D A;  1BQ7 A;  3HXS A;  1SK0 A;  4BWS A;  1R5P A;  2O85 A;  5ID2 B;  4QL9 A;  1B4Q A;  4MA9 A;  3DIE A;  2E2G A;  1OC9 A;  4BIK A;  4TN8 A;  1ZYN A;  5F8B A;  3M9J A;  2DJK A;  1BG5 A;  1V40 A;  4CDO A;  3E9J B;  2VCV A;  4G2E A;  1A0R P;  5HR2 A;  4F9Z A;  2DLX A;  2JZR A;  3I9V 2;  2C0D A;  3ZRD A;  5H5R A;  3Q74 A;  3MIX A;  3UJ1 A;  4F82 A;  1XCC A;  2B1L A;  16GS A;  3UBL A;  2CVB A;  4BVX B;  1X0R A;  4MZC A;  2ALB A;  2M46 A;  2GS3 A;  4YQM A;  4LMW A;  3HY2 A;  1OC8 A;  2VL2 C;  3MSZ A;  4J57 E;  4O32 A;  4FO5 A;  1GRX A;  4KUN A;  1KEB A;  4K7N A;  1Q98 A;  4O7H A;  2O3E A;  2XPE A;  4DEJ A;  4HS1 A;  2H30 A;  2X4A A;  3OR5 A;  3DVX A;  1T7P B;  4L5O A;  2LQQ A;  2H8L A;  3KTL A;  2OE1 A;  4JED A;  4OFN A;  1TRV A;  3J7Y b;  2KP1 A;  3FYG A;  5CNW A;  2A4H A;  5J4Y A;  2L59 A;  3KIJ A;  1U3A A;  2GQK A;  1MDI A;  3QD9 A;  3KEB A;  5IMV A;  3QCP A;  5GAN D;  3P8W A;  3PR8 A;  3ZFB A;  3ME7 A;  4H86 A;  5CP1 A;  3QPM A;  17GS A;  2ZUP A;  1LBK A;  1XW6 A;  1PMT A;  1X5D A;  1PX7 A;  2LTK A;  4XTS A;  1W89 A;  2H74 A;  5KN2 A;  1OE8 A;  3M1G A;  2LKU A;  3IK9 A;  5ECN B;  2I9H A;  1XG8 A;  5B6M A;  5IO2 A;  3DKS A;  1FB6 A;  5IMC A;  4AF2 A;  1B9Y C;  5IMD A;  5J5N A;  2R0G A;  1C72 A;  4KA0 A;  4TR1 A;  1WE0 A;  2MZC A;  2L4Q A;  4IN0 A;  2GVP A;  1ZCP A;  2GZY A;  5G31 A;  4ICY A;  2IME A;  2CAQ A;  2HZE B;  4MPG A;  5L71 A;  5KN0 A;  1DE1 A;  3GIX A;  2AUV A;  3APO A;  2VD1 A;  4YQV A;  3FZ4 A;  3F4S A;  3GX8 A;  1HNA A;  2YJ7 A;  3RGB C;  4PNG A;  13GS A;  2YWO A;  5J47 A;  2BMX A;  1SJZ A;  4K0N A;  2HRN A;  11GS A;  2DBC A;  5F05 A;  4FYB A;  3HKR A;  4WR5 A;  3PH9 A;  2HRK A;  1BED A;  4DVC A;  2BTO T;  1GTB A;  4POB A;  3KH9 A;  6GST A;  2H1G A;  5KOW A;  3J7Y k;  4POK A;  3VLN A;  3BOA A;  1XWA A;  2JZT A;  2HZF A;  2RM5 A;  3D4M A;  1DE2 A;  1ZMA A;  5A5H B;  3FEU A;  1SEN A;  5EL8 A;  3FHK A;  1XOB A;  2I1U A;  3HZ8 A;  3FR9 A;  1FOV A;  1Z6M A;  3O6T A;  4G0K A;  4CY6 A;  2TRC P;  1V9W A;  5G30 A;  4ZBA A;  4IP1 A;  4O5Q A;  3LSZ A;  2H1D A;  2IJY A;  1SYX A;  2OAD A;  2AAW A;  2YCD A;  1LU4 A;  2VUP A;  1TU7 A;  4NV2 A;  2WVY A;  1OAZ A;  2LRC A;  1EOH A;  2FY6 A;  3KP9 A;  5IIZ A;  3TRQ A;  3EPT A;  3WGD A;  4RUV A;  3IC8 A;  1GSQ A;  3CQF A;  3MAK A;  2IWT A;  2M72 A;  3H1N A;  4QMK A;  1YQ1 A;  3I6A A;  4KW6 A;  2VCW A;  4EXJ A;  1ZOF A;  2HSN A;  1QQ2 A;  3UVH A;  2FD3 A;  4ILF A;  14GS A;  3I43 A;  4DSQ A;  1V58 A;  2I3Y A;  4IHU A;  2HNL A;  2O8V B;  3CWG A;  2F3M A;  3HVX A;  2N5B A;  2YV7 A;  4ZBB A;  4BPY A;  3LGC A;  1AC1 A;  4AKH A;  5DVB A;  3HCZ A;  2QC7 A;  1ON4 A;  1WOU A;  1PN0 A;  2HRF A;  4ZL9 A;  2Z9S A;  4EDY A;  1KNG A;  4LLR A;  5IPH A;  4ZB7 A;  1AQV A;  2H0G A;  4N0V A;  3SWL A;  1B4P A;  3IC4 A;  3MWH A;  4HDE A;  5JCW A;  2PGT A;  4I2U A;  1K0D A;  5DCH A;  4XS4 A;  2QGV A;  1URM A;  2EC4 A;  2FWG A;  4PX1 A;  2G0F A;  4A5P A;  3GST A;  5HFI A;  3CHX C;  4TR0 A;  5IM9 A;  3TKS C;  4EIP A;  5F0G A;  3DVW A;  3ZVJ A;  1H75 A;  3VWV A;  1UN2 A;  4ZB6 A;  2H0H A;  2P5Q A;  1ZYP A;  5IO0 A;  1S4B P;  1VRS D;  1EEM A;  5BMU A;  4PHZ C;  3E3E A;  2VM1 A;  2C0E A;  2FNO A;  2YWM A;  3D21 A;  4IQA A;  4W66 A;  2L4C A;  5DJM A;  10GS A;  1AXD A;  1SVL A;  4MH2 A;  4V1A p;  2CT6 A;  3QMX A;  3ME8 A;  2WFC A;  1FG4 A;  4AKX B;  3EIN A; 
#chains in the Genus database with same CATH homology
 1U3I A;  2X8H A;  3QFB C;  1NHO A;  2H66 A;  3GL3 A;  3TKP A;  3TJB A;  1OKT A;  2OBI A;  2DJ0 A;  3A3T A;  1PL2 A;  5G5F A;  2EIQ A;  5ABR A;  1Z5Y E;  4GST A;  1JZW A;  4KE3 A;  3ISO A;  2YAN A;  3IV4 A;  2CX3 A;  1Y1U A;  2V41 A;  4Q5N A;  2A4V A;  5A4V A;  2VCT A;  2GQL A;  4GWR A;  1M2B A;  4MNN A;  4ZB8 A;  1MD4 A;  4L5L A;  2I4A A;  3M8N A;  4ZIJ A;  1GSS A;  4OFT A;  4QQ7 A;  3GA4 A;  4TR4 A;  1UVZ A;  4XRD A;  1CQH A;  5B8B A;  1Z7P A;  2LQO A;  1X9W B;  2AB6 A;  3IE3 A;  1TOF A;  1GL8 A;  5A1N B;  3Q18 A;  4Z2R A;  1THO A;  2CZ3 A;  1TJD A;  3F0I A;  3MYD A;  1H4O A;  5ECK B;  3GFK A;  3HZ4 A;  2KLX A;  4N10 A;  2HLS A;  4X4J A;  2H0I A;  2GSQ A;  4XIH A;  4MK3 A;  1SKS B;  1ML6 A;  3P2A A;  3QAG A;  1TXU A;  2QA1 A;  3WD6 A;  1T4Y A;  2R6K A;  4L0U A;  2DSA A;  1WMJ A;  5LCZ A;  4BA7 A;  3JCM L;  2DJ1 A;  5ECP B;  1XFL A;  4ML6 A;  5E59 A;  4PQH A;  3GL5 A;  4RI6 A;  1MDJ A;  3GUR A;  22GS A;  2O7K A;  5ECL B;  3KGK A;  5DQY A;  2LJK A;  4WXT A;  2LNT A;  1K3O A;  2E7P A;  3C7M A;  1QMV A;  5F06 A;  5JWR B;  4F2I A;  1M9B A;  4HJ2 A;  3TJG A;  3L0H A;  5A34 B;  3GYK A;  2GT6 A;  1MDK A;  2LEG A;  4BL7 A;  3LFL A;  2XHF A;  1PSQ A;  4POM A;  1QGV A;  2HE3 A;  1U88 A;  4OCF A;  1Z6N A;  1K0N A;  2X8C A;  4JR4 A;  3E0U A;  2WZ9 A;  3LJR A;  1F6M C;  4IGJ A;  1F2E A;  4PTS A;  2O89 A;  1M2D A;  2E2M A;  4TXO A;  1U87 A;  3QR6 A;  4KSO A;  1ERV A;  4MJA A;  1ERT A;  1A0F A;  7GSS A;  4KSM A;  2H1B A;  1VF4 A;  3DYR A;  4G9H A;  2HI7 A;  3EUR A;  3RBT A;  4TR3 A;  3C1S A;  5DQS A;  1EP7 A;  4J56 E;  4K0G A;  4K7I A;  5G1L A;  1USB A;  1JZD A;  5F07 A;  4IVF A;  1SD8 A;  1G7E A;  1TTZ A;  1AW9 A;  2VLT A;  3DEX A;  3V1W A;  1CQG A;  3TRP A;  1A2J A;  3P90 A;  1ST9 A;  3ZL5 A;  2L57 A;  3C71 A;  4PUR A;  1RW1 A;  4K1F A;  3C8E A;  3H8Q A;  3LOR A;  5D8I A;  5DAK B;  4K6X A;  2J9H A;  4DSS A;  4EKZ A;  1DBY A;  3KP8 A;  3RPP A;  2YP6 A;  1FAA A;  3L78 A;  2C80 A;  2CAI A;  3LYK A;  4HU7 A;  2GSR A;  3KM6 A;  3UOM A;  1OKD A;  3R2Q A;  4AJ7 A;  1TK5 B;  2IIY A;  1R5A A;  4HEA 2;  3L9U A;  1GSU A;  1NM3 A;  3F4R A;  2G2Q A;  5ECI B;  2R0P A;  2GT5 A;  2CV4 A;  3EMP A;  5A5K A;  4RQX A;  2P0G A;  5HFG A;  1EEJ A;  4EO3 A;  5CRE A;  3GH9 A;  4JR6 A;  2PWJ A;  4ML1 A;  1FB0 A;  1IYH A;  4HOJ A;  4TOP A;  3KMN A;  2HSH A;  4N11 A;  1THX A;  3LG6 A;  1SK2 A;  2PVO C;  3G9B A;  1ACV A;  2OT3 A;  3PPU A;  3CTG A;  3VWU A;  2DIY A;  5J9C A;  1Q4J A;  3IR4 A;  3IAS 2;  3TOU A;  3LW9 A;  2OBK A;  1Y25 A;  3LWA A;  1NHY A;  4NMU A;  1KTE A;  2VM2 A;  2JAC A;  1GSE A;  3UVT A;  2F8F A;  4JBB A;  1ZYE A;  4LL1 B;  2PMT A;  3ZIT A;  1G0T A;  2B5E A;  4BVY B;  4KGI A;  1M9A A;  4G01 A;  2HSM B;  3KD0 A;  2OKA A;  3ZYW A;  1WRY A;  5ID2 A;  1UA5 A;  3HHV A;  1O7U A;  1TK0 B;  4OO4 A;  3WT2 A;  3A5I A;  4K7O A;  2WJU A;  2IFQ B;  3CSJ A;  2XBI A;  1EGO A;  1PKW A;  2RUF A;  5LNK e;  4L8E A;  2DML A;  4XCS A;  1IYI A;  2H19 A;  2XBQ A;  1ILO A;  4GCI A;  4WEY A;  1EGR A;  3FY7 A;  4IBP A;  3NOF A;  1TDI A;  4IEL A;  1K0C A;  2PER A;  5AIX A;  4L0W A;  1B48 A;  3EE2 A;  3ZRE A;  2K8V A;  4MAB A;  3DD3 A;  1A8L A;  2FA8 A;  4BVX A;  1AAZ A;  4EC0 A;  4JU5 A;  3TDG A;  4MZB A;  4CY8 A;  1YVL A;  3M9K A;  3G7J A;  2N5A A;  5GZZ B;  5D73 A;  3MNG A;  2OE0 A;  2DC5 A;  20GS A;  1ZYQ B;  4ZL8 A;  1YF1 A;  1GTI A;  3ZIJ A;  3CMI A;  2VOC A;  4ECJ A;  1XIY A;  4XHM A;  5IQY A;  2WB9 A;  3KTB A;  1X5C A;  4TXV A;  3WYW A;  1FW1 A;  4I6X A;  2ON7 A;  3A2V A;  4ZBD A;  1YJ6 A;  3D0Z A;  3IRA A;  5LD0 A;  3IPZ A;  4FIW A;  3GTU A;  4AJ6 A;  1AQW A;  1BAY A;  4O92 A;  4KF9 A;  1GLQ A;  2VLU A;  4K8M A;  3D22 A;  1I5G A;  1EZK A;  2PU9 C;  1QFN A;  3U5R E;  1YEX A;  1PGT A;  5CYY A;  4N30 A;  1EOG A;  1GTA A;  2B1K A;  2RLI A;  3BCI A;  4EIQ A;  1M99 A;  3ZTL A;  5GSS A;  4OWY A;  4MJC A;  4N0Z A;  2ON5 A;  3N5O A;  2C0G A;  5AN1 A;  1I9D A;  5AGY A;  3DXB A;  2R37 A;  3GUS A;  3KXO A;  1XBS A;  2H6Y A;  1LJR A;  1WPI A;  1XWB A;  3IBH A;  1G7O A;  3EYT A;  2LNS A;  4Z2T A;  2FGX A;  1QXH A;  2EFH A;  2ZCT A;  4V2L A;  1PL1 A;  3BD2 A;  3IOS A;  4WF5 A;  1GUL A;  3F3R A;  4E8E A;  3UL3 A;  3F4T A;  2R2J A;  2I81 A;  5IMZ A;  2C3Q A;  1NSW A;  2PUK C;  2HZE A;  9GSS A;  4TRX A;  2CVD A;  1JZO A;  2MMO A;  2ZNM A;  4GQC A;  3R3E A;  4NHW A;  1O73 A;  5DAL B;  4K5S A;  4XS1 A;  5EY6 A;  2F8A A;  4GF0 A;  5FT3 A;  1ERU A;  2CVK A;  1R26 A;  1BG1 A;  3G7Y A;  2FLS A;  4NHZ A;  1Y6E A;  3LXZ A;  3RAZ A;  4KDU A;  1XWG A;  1BF5 A;  1O8W A;  3FZ5 A;  1QK8 A;  1O6J A;  4K9Z A;  2VCX A;  3MDK A;  3FMW A;  4AGS A;  2LV3 A;  5IOW A;  1AIU A;  2H1L A;  5GAP D;  1VF3 A;  1RK4 A;  5AIS A;  4RQR A;  3TJF A;  5EVO A;  3A2X A;  5A5H A;  5BRT A;  1SKW B;  1WP0 A;  3TB2 A;  2VL2 A;  1FVK A;  3APS A;  2DJ3 A;  5J41 A;  1SJ6 A;  4ULX A;  5B6N A;  6GSX A;  1SVO A;  2VL9 A;  1MTC A;  4WET A;  1A2L A;  1YKA A;  5J4V A;  3K8N A;  2F51 A;  3U6V A;  5B7C A;  1ERW A;  4GTU A;  5GST A;  1X5E A;  2HT9 A;  4OCE A;  3FZ9 A;  3O76 A;  5G5E A;  1XWC A;  4YKF A;  2X49 A;  3EU4 A;  4LL4 B;  5JWQ B;  4I2T A;  4G0I A;  1OYJ A;  3GKM A;  5ECO B;  1YDK A;  1SL1 B;  1TW9 A;  1TI1 A;  2HQT A;  1WIK A;  3W6G A;  2GSS A;  1GLP A;  2YZH A;  3GX0 A;  2YOI A;  5JCU A;  1N8J A;  4ZXG A;  2XC2 A;  3A5W A;  1T4Z A;  5CRG A;  2VLV A;  1N2A A;  3TU3 B;  3ZLP A;  1HNC A;  4TXO B;  1K3Y A;  4MF5 A;  3UBK A;  2GZZ A;  4IP6 A;  1BJX A;  2R5G A;  1GP1 A;  2REM A;  1N25 A;  1F37 A;  1S3D A;  2IPA A;  5C04 A;  5IPG A;  2R4V A;  3LQ7 A;  4YAP A;  1JLV A;  6GSV A;  2H01 A;  2OAC A;  4V2N A;  1S3A A;  3O3T A;  3TKQ A;  3IK7 A;  1GUM A;  4MPF A;  1SJI A;  1K0O A;  1OC9 B;  5ENU A;  4PGT A;  3GSS A;  2CQ9 A;  2V6K A;  3QFA C;  2EFC A;  3I69 A;  4JZQ A;  4WKW A;  1SYR A;  18GS A;  1YF0 A;  4G19 A;  5IMF A;  4MJB A;  4XS6 A;  3GHA A;  2H75 A;  2D2Z A;  1TP9 A;  3KH7 A;  2C0F A;  1JHB A;  3CSI A;  2B5Y A;  3UIW A;  2NTO A;  2B5X A;  4GDF A;  1E2Y A;  2AV4 A;  4KDX A;  5AIV A;  2DMM A;  3TGZ A;  2FWE A;  3SBC A;  3TUE A;  1GNE A;  4KAE A;  4ZB9 A;  2EFE A;  3TKR A;  3DML A;  4NPB A;  4ZL7 A;  4POL A;  4AKI A;  2PN8 A;  3VI7 A;  1K0B A;  2YWI A;  2JSZ A;  4PQ1 A;  1GSY A;  2WCI A;  4YAV A;  2B6M A;  1DSB A;  1BYE A;  4EDZ A;  4FYC A;  4PNF A;  2HSY A;  3UEM A;  4PUA A;  2DJ2 A;  1AQX A;  3RPN A;  4HJM A;  1ZL9 A;  1GH2 A;  1XW5 A;  1OE7 A;  4I8B A;  2F9S A;  3EU3 A;  3HVS A;  3DGQ A;  3GV1 A;  1F3B A;  3UMA A;  2N5F A;  1UC7 A;  4GXZ A;  3F9U A;  4E68 A;  3ZML A;  4Q5Q A;  1SVM A;  1WWJ A;  4X43 A;  4MDC A;  2V1M A;  5A1N A;  3WGE A;  3VPQ A;  1YEP A;  4V1A g;  1W4V A;  1JFU A;  1R7H A;  2WRT A;  1A24 A;  4MF6 A;  2WGR A;  1M2A A;  3US3 A;  4KDY A;  1V57 A;  2HFD A;  2BJX A;  1GTU A;  1XW9 A;  3ERG A;  2DJJ A;  4JE1 A;  1MD3 A;  2GDR A;  2CA8 A;  5ELG A;  4MF7 A;  4Q5R A;  1T00 A;  5DDL A;  2AYT A;  4AI6 A;  2IMF A;  1G6W A;  3RHC A;  4TR1 B;  5D9V A;  2FWH A;  1PRX A;  4O5R A;  4BWQ A;  1J0F A;  3LXT A;  4GSN A;  6GSS A;  1X9M B;  2WS2 A;  2P31 A;  5CAX A;  1SD9 A;  2AHE A;  3KJY A;  2GLR A;  1K3L A;  3IDV A;  1T8E B;  3H4K A;  3VUR A;  3F63 A;  1TU8 A;  4IJ3 A;  3VI5 A;  4IS0 A;  2ES7 A;  1EP8 A;  1XXU A;  2B3S A;  3EWL A;  5ECH B;  5H5S A;  2H70 A;  5ELA A;  4NXI A;  1SL2 B;  1A8Y A;  3TKS A;  1OC3 A;  1T1V A;  3ZMK A;  5A34 A;  2IN3 A;  2K18 A;  2KP2 A;  5D96 A;  3GRX A;  2HRK B;  1BX9 A;  2PBJ A;  3G7I A;  3UAR A;  5HFK A;  5CRH A;  1EV9 A;  1FVJ A;  8GSS A;  3VWW A;  2OA7 A;  3ZIV A;  3L9S A;  4PUF C;  6GSW A;  2MBT A;  1G6Y A;  2J23 A;  2PPT A;  4K2D A;  2LJR A;  3GTU B;  3L9V A;  2L5O A;  1ABA A;  3W8J A;  3KCM A;  4D73 A;  5H5Q A;  2AJQ B;  5J40 A;  2LRT A;  3ZVJ D;  19GS A;  2LRN A;  5ECS A;  3VPT A;  2K8S A;  4CW9 A;  4DSR A;  4HQZ A;  3GKK A;  3EMX A;  4KCA A;  2MYG A;  4XRA A;  5D9T A;  4GRF A;  5C00 A;  2MMZ A;  4J2F A;  3CRT A;  1F9M A;  2YNX A;  2DKI A;  2FUG 2;  3IHQ A;  2IMI A;  1FO5 A;  1MEK A;  2A2P A;  2X99 A;  1Z9H A;  3H93 A;  2GST A;  4HZ2 A;  5DAK A;  1XWK A;  2IL3 A;  5KEJ A;  2H6Z A;  2H76 A;  5G2Z A;  5D9W A;  4EL1 A;  3IXR A;  1K0A A;  5CO3 A;  2KHP A;  1GUK A;  3QDN A;  2HSN B;  2K6V A;  1GSD A;  2L6C A;  3W8S A;  4HZ4 A;  1Z7R A;  3HYP A;  2YWN A;  5FHI A;  2VKZ G;  2WUL A;  5D93 A;  2FCH A;  4EE0 A;  3GNJ A;  5ECR B;  4KB3 A;  3AY8 A;  3Q19 A;  3M3M A;  3QAV A;  2X64 A;  4ECI A;  2DIZ A;  1O8X A;  1YZX A;  3DWV A;  4GLT A;  1TRS A;  2R0C A;  1J08 A;  5CRW A;  4HUA A;  3D4T A;  4CHS A;  3N9J A;  2UV8 G;  1XVW A;  3UAP A;  2FA4 A;  5HR0 A;  2YZU A;  1DUG A;  1V2A A;  2KUC A;  3S9F A;  4EVM A;  4MLY A;  2K9F A;  3HDC A;  1YY7 A;  2TRX A;  4XS4 B;  2DKH A;  5INY A;  4KCE A;  4ECC A;  1GSF A;  3F6F A;  4QL7 A;  2PVQ A;  4KX4 A;  4OFM A;  2QSI A;  2JL4 A;  3HJO A;  1S3C A;  2C3T A;  4AKG A;  2JZS A;  2GZP A;  3VWX A;  5BMU B;  2RUE A;  1XOA A;  1J9B A;  4BVY A;  4MZW A;  4LMV A;  4K2X A;  2HSM A;  2YV9 A;  2EFD A;  2H73 A;  1JLW A;  1SKR B;  5KN1 A;  4Z2U A;  4HQS A;  2EIR A;  1TRW A;  1F3A A;  2IFQ A;  2RII A;  4D73 B;  5IMA A;  2E0Q A;  12GS A;  2R3X A;  4WR4 A;  2NDO A;  3PIN A;  4LA1 A;  4MMM A;  1NW2 A;  3IAM 2;  2LJA A;  3FR6 A;  1VF2 A;  5J4U A;  4HU9 A;  2YJH A;  5IOX A;  1SL0 B;  1EV4 A;  2B7K A;  1PD2 1;  3FRC A;  2V2G A;  2RM6 A;  3PGT A;  5ECM B;  4IW9 A;  3C1R A;  4MH3 A;  1K0M A;  2JAD A;  2QKE A;  4I97 A;  4E8H A;  2X8G A;  4GQF A;  3TJJ A;  1YKC A;  3DRN A;  4MJE A;  2A2S A;  3HMJ G;  5J9B A;  4I5Q A;  4OO5 A;  5JCG A;  4YKG A;  2FHE A;  2IMD A;  4PXO A;  4FH8 A;  4V2M A;  3H79 A;  5KN3 A;  1XZO A;  4HI7 A;  1PQN A;  5A4W A;  2P5R A;  1ZZY A;  2KOK A;  1A2M A;  2H72 A;  4AJ8 A;  5DBQ A;  2MMA A;  1X9S B;  3BJ5 A;  3FR3 A;  2O87 A;  4TW5 A;  2VCZ A;  4TVE A;  2GGT A;  3KMO A;  1B8X A;  2C8U A;  2NBS A;  3CTF A;  2GQM A;  2IMK A;  2O5V A;  3GN3 A;  3EC3 A;  4FYU A;  2HYX A;  1B9X C;  3EVI A;  1R4W A;  1TI3 A;  3QAW A;  3ZFL A;  2XPD A;  2H1A A;  3GKX A;  1QUW A;  3WT1 A;  4EF0 A;  2M80 A;  4KH7 A;  2NPB A;  1SK1 A;  3FZA A;  4X1U A;  4WF4 A;  4ZIL A;  5ECQ B;  5KOX A;  5CRD A;  4ECB A;  2H71 A;  1EWX A;  2V32 A;  1O85 A;  3ED3 A;  5G1K A;  4P3Y B;  5HR1 A;  3FK8 A;  4BL7 B;  3ERF A;  4YQU A;  3HD5 A;  1GUH A;  2B7J A;  3ZZX A;  3CBU A;  1ZGN A;  2LS5 A;  1WJK A;  2C4J A;  3D6I A;  5HR3 A;  5JWO B;  5COH A;  3NIV A;  1GNW A;  1VF1 A;  5FWG A;  3P7X A;  4ISD A;  2A2R A;  3RDW A;  2VL3 A;  6GSU A;  2OJL A;  4N3Z A;  3CRU A;  3TKS E;  3IA1 A;  2CX4 A;  5DAL A;  3F8U A;  4ID0 A;  4Z7X A;  1PA3 A;  4NWY A;  4NV5 A;  5E4W A;  3CXG A;  3LYP A;  1VGL A;  3GH6 A;  2HXK A;  1A23 A;  2VIM A;  3HJM A;  3LEF A;  3TJK A;  3M0F A;  3BCK A;  3F6D A;  2JSY A;  4IQ1 A;  2EIO A;  3A2W A;  2WDU A;  3TOT A;  3KZQ A;  1GWC A;  3ERW A;  3HA9 A;  4EUY A;  1Z3E A;  4IKH A;  1XVQ A;  2C1Y A;  3TRX A;  4KND A;  3Q6O A;  3GMF A;  1HD2 A;  4DSS B;  1HYU A;  1O81 A;  2VCQ A;  1T3B A;  3C73 A;  1V98 A;  1OVN A;  2QA2 A;  3NZN A;  3HVV A;  2LST A;  3QOU A;  5J3R A;  2VAF A;  2HRA A;  3F3Q A;  3WGX A;  2OE3 A;  4OMV A;  4Q5F A;  1U6T A;  4WBJ A;  1TXX A;  1RQM A;  2VO4 A;  3VK9 A;  2CZ2 A;  2MBS A;  1TKD B;  5B8A A;  4ACS A;  3BBY A;  3FW2 A;  4FQU A;  2TIR A;  4USS A;  4F03 A;  1JZR A;  2YN1 A;  3FKF A;  1PKZ A;  3HJP A;  3CYN A;  3CSH A;  4MCU A;  5EPF A;  2UZ8 A;  1AUC A;  3D5J A;  1PN9 A;  4MP4 A;  1HNB A;  2MMN A;  2NVL A;  4OD7 A;  3L4N A;  4G0L A;  2GTU A;  2FWF A;  1FHE A;  1PX6 A;  3RHB A;  1M0U A;  4TKY A;  3VFI A;  3IHG A;  2VD0 A;  3APQ A;  1XPV A;  5DJL A;  6GSY A;  3GKN A;  2LUS A;  4PQI A;  4NAX A;  2YPM A;  1M7T A;  5D9X A;  2V6O A;  2H6X A;  4WBR D;  1TRU A;  5A4U A;  4K5R A;  4G10 A;  2C3N A;  1SU9 A;  4X0X A;  1FOH A;  3TCO A;  4F0B A;  2JU5 A;  1E6B A;  1TK8 B;  1HQO A;  2L5L A;  4JRR A;  4RI7 A;  4IJI A;  4O5U A;  5DCG A;  5HQP A;  1KBN A;  4YH2 A;  4GSS A;  4F0C A;  2L6D A;  1BQ7 A;  3HXS A;  1SK0 A;  4BWS A;  1R5P A;  2O85 A;  5ID2 B;  4QL9 A;  1B4Q A;  4MA9 A;  3DIE A;  2E2G A;  1OC9 A;  4TN8 A;  1ZYN A;  5F8B A;  3M9J A;  2DJK A;  1BG5 A;  1V40 A;  4CDO A;  3E9J B;  2VCV A;  4G2E A;  1A0R P;  5HR2 A;  4F9Z A;  2DLX A;  2JZR A;  3I9V 2;  2C0D A;  3ZRD A;  5H5R A;  3Q74 A;  3MIX A;  3UJ1 A;  4F82 A;  1XCC A;  2B1L A;  16GS A;  3UBL A;  2CVB A;  4BVX B;  1X0R A;  4MZC A;  2ALB A;  2M46 A;  2GS3 A;  4YQM A;  4LMW A;  3HY2 A;  1OC8 A;  2VL2 C;  3MSZ A;  4J57 E;  4O32 A;  4FO5 A;  1GRX A;  4KUN A;  1KEB A;  4K7N A;  1Q98 A;  4O7H A;  2XPE A;  4DEJ A;  4HS1 A;  2H30 A;  2X4A A;  3OR5 A;  3DVX A;  1T7P B;  4L5O A;  2LQQ A;  2H8L A;  3KTL A;  2OE1 A;  4JED A;  4OFN A;  1TRV A;  3J7Y b;  2KP1 A;  3FYG A;  5CNW A;  2A4H A;  5J4Y A;  2L59 A;  3KIJ A;  1U3A A;  2GQK A;  1MDI A;  3QD9 A;  3KEB A;  5IMV A;  3QCP A;  5GAN D;  3P8W A;  3PR8 A;  3ZFB A;  3ME7 A;  4H86 A;  5CP1 A;  3QPM A;  17GS A;  2ZUP A;  1LBK A;  1XW6 A;  1PMT A;  1X5D A;  1PX7 A;  2LTK A;  4XTS A;  1W89 A;  2H74 A;  5KN2 A;  1OE8 A;  3M1G A;  2LKU A;  3IK9 A;  5ECN B;  2I9H A;  5B6M A;  5IO2 A;  3DKS A;  1FB6 A;  5IMC A;  4AF2 A;  1B9Y C;  5IMD A;  5J5N A;  2R0G A;  1C72 A;  4KA0 A;  4TR1 A;  1WE0 A;  2MZC A;  2L4Q A;  4IN0 A;  2GVP A;  1ZCP A;  2GZY A;  5G31 A;  4ICY A;  2IME A;  2CAQ A;  2HZE B;  4MPG A;  5L71 A;  5KN0 A;  1DE1 A;  3GIX A;  2AUV A;  3APO A;  2VD1 A;  4YQV A;  3FZ4 A;  3F4S A;  3GX8 A;  1HNA A;  2YJ7 A;  4PNG A;  13GS A;  2YWO A;  5J47 A;  2BMX A;  1SJZ A;  4K0N A;  2HRN A;  11GS A;  2DBC A;  5F05 A;  4FYB A;  3HKR A;  4WR5 A;  3PH9 A;  2HRK A;  1BED A;  4DVC A;  2BTO T;  1GTB A;  4POB A;  3KH9 A;  6GST A;  2H1G A;  5KOW A;  3J7Y k;  4POK A;  3VLN A;  3BOA A;  1XWA A;  2JZT A;  2HZF A;  2RM5 A;  3D4M A;  1DE2 A;  1ZMA A;  5A5H B;  3FEU A;  1SEN A;  5EL8 A;  3FHK A;  1XOB A;  2I1U A;  3HZ8 A;  3FR9 A;  1FOV A;  1Z6M A;  3O6T A;  4G0K A;  4CY6 A;  2TRC P;  1V9W A;  5G30 A;  4ZBA A;  4IP1 A;  4O5Q A;  3LSZ A;  2H1D A;  2IJY A;  1SYX A;  2OAD A;  2AAW A;  2YCD A;  1LU4 A;  2VUP A;  1TU7 A;  4NV2 A;  1OAZ A;  2LRC A;  1EOH A;  2FY6 A;  3KP9 A;  5IIZ A;  3TRQ A;  3EPT A;  3WGD A;  4RUV A;  3IC8 A;  1GSQ A;  3MAK A;  2IWT A;  2M72 A;  3H1N A;  4QMK A;  1YQ1 A;  3I6A A;  4KW6 A;  2VCW A;  4EXJ A;  1ZOF A;  2HSN A;  1QQ2 A;  3UVH A;  2FD3 A;  4ILF A;  14GS A;  3I43 A;  4DSQ A;  1V58 A;  2I3Y A;  4IHU A;  2HNL A;  2O8V B;  3CWG A;  2F3M A;  3HVX A;  2N5B A;  2YV7 A;  4ZBB A;  4BPY A;  3LGC A;  1AC1 A;  4AKH A;  5DVB A;  3HCZ A;  2QC7 A;  1ON4 A;  1WOU A;  1PN0 A;  2HRF A;  4ZL9 A;  2Z9S A;  4EDY A;  1KNG A;  4LLR A;  5IPH A;  4ZB7 A;  1AQV A;  2H0G A;  4N0V A;  3SWL A;  1B4P A;  3IC4 A;  3MWH A;  4HDE A;  5JCW A;  2PGT A;  4I2U A;  1K0D A;  5DCH A;  4XS4 A;  2QGV A;  1URM A;  2EC4 A;  2FWG A;  4PX1 A;  2G0F A;  4A5P A;  3GST A;  5HFI A;  4TR0 A;  5IM9 A;  3TKS C;  4EIP A;  5F0G A;  3DVW A;  3ZVJ A;  1H75 A;  3VWV A;  1UN2 A;  4ZB6 A;  2H0H A;  2P5Q A;  1ZYP A;  5IO0 A;  1VRS D;  1EEM A;  5BMU A;  3E3E A;  2VM1 A;  2C0E A;  2FNO A;  2YWM A;  3D21 A;  4IQA A;  4W66 A;  2L4C A;  5DJM A;  10GS A;  1AXD A;  1SVL A;  4MH2 A;  4V1A p;  2CT6 A;  3QMX A;  3ME8 A;  2WFC A;  1FG4 A;  4AKX B;  3EIN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...