3CRTA

Structural characterization of an engineered allosteric protein
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
214
structure length
214
Chain Sequence
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGCEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase class-mu 26 kDa isozyme
publication title Using affinity chromatography to engineer and characterize pH-dependent protein switches.
pubmed doi rcsb
source organism Schistosoma japonicum
total genus 70
structure length 214
sequence length 214
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2008-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3crtA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3crtA01
4ZL9A 1Y6EA 2ALBA 1XWBA 2X99A 3RDWA 2CT6A 2GSRA 4GSTA 3VK9A 2CVKA 2L59A 4ECIA 5CRWA 3TRQA 2C8UA 2L4CA 1GWCA 4LL4B 1DBYA 5G30A 3CSIA 3D0ZA 2R4VA 2GDRA 2X8HA 3UIWA 3C71A 1UVZA 2AYTA 4I5QA 1AIUA 4HQSA 2VM1A 1N8JA 3TJBA 1J9BA 3F4RA 7GSSA 2HZFA 1B8XA 2VLUA 2FA4A 3QDNA 2PWJA 5INYA 1HNBA 5GAND 2WRTA 4OFNA 5DQSA 3LG6A 3D21A 2C4JA 1YZXA 5CRHA 5C00A 1PX6A 10GSA 4XS4A 1A8YA 1QFNA 2HZEA 4ZB9A 3N5OA 2H72A 2QGVA 1QXHA 1AAZA 1MEKA 5L71A 3TGZA 5ID2A 2GS3A 2NVLA 3EINA 4KSOA 3LXTA 2V2GA 3GHAA 2MZCA 1VF1A 3LYPA 5HFKA 2LS5A 4HZ4A 3GKNA 4MJAA 2HNLA 5ELGA 2IN3A 4KDYA 1ERWA 1JLWA 1JZDA 1MDJA 3HZ4A 5IOWA 2WCIA 4HI7A 3C1SA 5F0GA 3Q18A 2E2GA 2H1BA 1X9WB 2KP1A 2LTKA 5B6NA 5DCGA 1A0RP 4BVXA 3DIEA 2MYGA 3ZLPA 3O3TA 3GA4A 3VI5A 5CP1A 5DAKB 2RUFA 5CAXA 3PPUA 2H0HA 4GRFA 3DWVA 1G7OA 4GCIA 3US3A 4GQFA 1X5EA 3H79A 2HRAA 4IS0A 3KJYA 3CSHA 1NHOA 5BMUA 1ZOFA 1XBSA 3ZIJA 5KN0A 6GSYA 3M9JA 4WKWA 2K6VA 1PKZA 4YH2A 1VRSD 1R7HA 3LQ7A 3HKRA 5DJMA 2H19A 5D9TA 3VPTA 5F06A 5HR0A 1A24A 3D6IA 3UOMA 2RIIA 3FR9A 2YN1A 1GNWA 2OBIA 5AN1A 1TJDA 3QFAC 1AQXA 1JZRA 1M99A 1EOHA 5IQYA 1WPIA 4KNDA 1T00A 4K7OA 3FR3A 1OYJA 3F63A 3EVIA 1GSEA 3GURA 3MSZA 2KUCA 4NHZA 1X0RA 2N5BA 2QSIA 18GSA 2MBSA 3IK9A 3SWLA 3A3TA 1NM3A 2HRNA 4K2DA 2YWNA 1O85A 2M46A 2F8FA 3WT1A 4I2UA 3P2AA 5GSTA 2IFQA 5C04A 1FVJA 4N11A 4XS4B 3BJ5A 4IHUA 1ILOA 4JZQA 2HZEB 1K3LA 4PUAA 1JZWA 4EDYA 5ID2B 4QL9A 1T1VA 5H5SA 3QAVA 1RW1A 1V2AA 3ZFLA 5G2ZA 2G2QA 4IELA 4G10A 1PGTA 1B48A 4IJ3A 4YAVA 1A23A 3HDCA 13GSA 1QK8A 2YCDA 2L5OA 4DSQA 1TK8B 2L5LA 1OKTA 5HFGA 4RI7A 3M8NA 4OFTA 2HSYA 2R2JA 2IMFA 3QFBC 2F8AA 2NPBA 3VWWA 2F3MA 1EEMA 2L4QA 1R4WA 4PTSA 4K7IA 2MMOA 3TRXA 1TRSA 2GZPA 1PN9A 3ERWA 3KCMA 4N0ZA 1K0BA 4TN8A 1GSDA 3Q6OA 2BTOT 4JRRA 5ECOB 3IC8A 3GH6A 3TJGA 1M2AA 3N9JA 4D73A 4OO4A 2YJHA 2V6KA 4QQ7A 1SK2A 3WD6A 2XHFA 2CZ2A 2AAWA 1MD4A 3FR6A 4V2NA 2VCTA 2IL3A 3GH9A 3F3RA 4N0VA 3GIXA 2H66A 1J08A 1G6YA 1WMJA 1X5CA 4XTSA 2V41A 3O6TA 2TRCP 3PINA 4XRDA 3IC4A 5IMCA 2N5AA 2GZZA 5D73A 3S9FA 4CW9A 3CRTA 2VCVA 2AB6A 1M9BA 2L6DA 4GSNA 3IV4A 3PH9A 2AJQB 9GSSA 5IIZA 3FZAA 4NV2A 3PR8A 3GYKA 3LJRA 4OO5A 4IP6A 4TXVA 1EV9A 3CTFA 2H76A 2YNXA 4HEA2 5ECKB 1PKWA 5HFIA 2OACA 2KLXA 2FA8A 5DBQA 1B9YC 1SU9A 3E9JB 4YAPA 3CRUA 2GSTA 4KSMA 3RAZA 1W89A 3KEBA 2FGXA 4GXZA 1Z9HA 4ACSA 1XW6A 1GNEA 2GGTA 2H6XA 3F8UA 3EYTA 4TKYA 1X9MB 4IJIA 3EMXA 3EU3A 2FWGA 4KX4A 8GSSA 1E2YA 2L57A 4FQUA 2JZTA 3VPQA 1YY7A 4L5LA 1R26A 4MLYA 3UVTA 2H1GA 1HNCA 4ECBA 1FG4A 4L0UA 2VL2A 2B5EA 4AJ8A 3Q74A 1JLVA 2K8SA 2XC2A 3KH9A 3OR5A 4YQVA 1T4YA 4LL1B 1PD21 1G6WA 3P8WA 1PSQA 2TIRA 3TUEA 3E0UA 3IK7A 1K0CA 2NBSA 2C3NA 2CQ9A 5CREA 1MDIA 5IPHA 3ZVJA 3G7YA 5IOXA 4WF5A 4TXOA 2DMLA 3CSJA 2M72A 4Q5NA 2IMEA 2OA7A 1VF3A 2GT6A 2PVOC 3FEUA 1KEBA 1XFLA 4JBBA 4L8EA 3IA1A 3RHBA 4OMVA 4AJ7A 1GULA 3ME7A 4RQRA 4D73B 2GVPA 5CYYA 4MPFA 3H8QA 4K1FA 4XHMA 1AW9A 2H74A 2P5RA 4ZB6A 2R6KA 2FUG2 1SYRA 3HVXA 2FWHA 1DUGA 3QAGA 5FHIA 1A8LA 4K0GA 3UJ1A 5J5NA 2HRFA 1WRYA 2ZUPA 3DVWA 2RM5A 4LMWA 4TR0A 3L0HA 1XZOA 2PPTA 2OE0A 1ST9A 4GF0A 3M1GA 5JWOB 4ID0A 2E0QA 1GP1A 1OC3A 5H5QA 4Q5QA 6GSVA 4HUAA 3GSSA 2DIYA 2LJAA 3V1WA 4IP1A 3UL3A 3F3QA 5DAKA 1O6JA 3FYGA 4AGSA 3F6DA 2LQQA 2OBKA 2VLVA 1J0FA 2RLIA 5B7CA 1GL8A 1ERVA 4WR5A 1Z7PA 2P5QA 4MCUA 3H4KA 4ZBAA 3FRCA 1K0DA 2IPAA 4MH3A 4TVEA 4CDOA 2YV9A 4ZL8A 1AQWA 3APOA 2CAQA 4K9ZA 2I9HA 2NDOA 1Y25A 2DIZA 2WJUA 3IR4A 4G19A 5B6MA 1YDKA 4TR4A 1VF2A 4PURA 1ZGNA 2DMMA 2VL2C 3FK8A 1ML6A 3F6FA 1TKDB 4TXOB 4ISDA 1IYIA 3IAS2 1TP9A 3ZZXA 2DJJA 1T7PB 3FZ5A 1ON4A 3RPPA 4MMMA 3UVHA 3FZ9A 2F9SA 2N5FA 3ERFA 2C0DA 3WT2A 2DJ2A 2YJ7A 5DVBA 2H8LA 3QCPA 3EWLA 1OAZA 3C1RA 2O85A 2IWTA 4BWSA 2DLXA 5JCWA 16GSA 4KAEA 3BCKA 1URMA 3ISOA 3M0FA 1DE2A 2PU9C 3IOSA 1O81A 2HSMA 5AISA 1K0MA 1GLQA 4HJ2A 3ZTLA 1PQNA 5B8BA 2A2RA 2BJXA 2VLTA 5DQYA 1O73A 1OE8A 2AHEA 1U6TA 3AY8A 4X0XA 2DJ3A 2O87A 5IO2A 4F9ZA 4V1Ag 1TK0B 1YEXA 1TI1A 3H93A 5HR1A 3C8EA 2HFDA 3KXOA 1BQ7A 2H1AA 3ZMKA 1EZKA 2LEGA 2LNSA 4EUYA 1MDKA 1Q98A 3R2QA 3R3EA 11GSA 5ECMB 3UBKA 3NZNA 4WF4A 3HD5A 3A2WA 2EIOA 1EWXA 2B5XA 2GSQA 2EIRA 3GX0A 4HU9A 2WZ9A 1MTCA 2ES7A 1BEDA 4OCFA 4PUFC 3WYWA 5COHA 4BL7A 1N2AA 1I9DA 2E2MA 4MZBA 4I97A 1LU4A 5EPFA 2H1DA 3M3MA 1R5PA 1ERUA 3L4NA 2IJYA 4G9HA 1TRVA 3DGQA 3I69A 3Q19A 4KE3A 4FYUA 1GSYA 4ZL7A 2I81A 4V2LA 1XOAA 4MDCA 4PXOA 4G0IA 2LJRA 4MP4A 1Z6MA 5ELAA 4G2EA 2H75A 5ECSA 3RPNA 4K0NA 4F0CA 2C0GA 1SL1B 1T3BA 3GNJA 3TJFA 1WWJA 1O8WA 2MMZA 1G7EA 4AJ6A 1WIKA 4MJBA 1YF1A 2DJ0A 3IXRA 5G1LA 3DXBA 4MJEA 3TOUA 1CQGA 2OKAA 2GSSA 3MAKA 2HYXA 4DVCA 3L78A 4E8EA 3KTBA 2ON5A 4IGJA 2H6ZA 2QC7A 4EC0A 2Z9SA 4IW9A 1FVKA 3EURA 3W6GA 2PVQA 2HSMB 2D2ZA 2KHPA 3LEFA 3H1NA 1XW9A 1YJ6A 2H70A 1ZYQB 2NTOA 1SENA 5A4UA 5B8AA 2JSYA 2KOKA 2PMTA 3HJOA 1F9MA 5ECQB 1FB0A 4GSSA 6GSTA 1ABAA 1NW2A 1OC8A 1XIYA 2P31A 4IN0A 5AIVA 2R3XA 2HE3A 4ZIJA 4Z7XA 5AIXA 4BVYA 2H73A 3F4TA 2PGTA 3WGEA 3TJJA 6GSWA 4X1UA 3IRAA 4O92A 4ZBDA 2JZRA 2VIMA 1TXXA 4KCAA 3MDKA 2FLSA 5LD0A 4BL7B 3KZQA 1B9XC 4RQXA 5ECHB 2O8VB 3UAPA 1HD2A 1GTAA 1XXUA 3D4MA 3O76A 4BA7A 4JEDA 2B7JA 4E8HA 4IQ1A 5A5KA 1O7UA 22GSA 2YWOA 1LBKA 2VCZA 1WE0A 2FNOA 2CVDA 4BWQA 4MF6A 1F3BA 3TKSA 3SBCA 3JCML 1I5GA 1U3IA 3C7MA 1PRXA 1BX9A 2R37A 3BD2A 2K9FA 3G9BA 1KNGA 5DJLA 1WP0A 3HY2A 3TOTA 2H30A 1TU8A 4V1Ap 1GTUA 5ECIB 1S3AA 4HZ2A 5GSSA 3L9UA 5D9VA 1B4PA 4KF9A 1A0FA 1THXA 4KA0A 4LLRA 4JE1A 4MPGA 2O89A 2XPEA 1PX7A 1JZOA 3GL5A 2V6OA 5ECLB 4POBA 5ENUA 1BJXA 3P7XA 4ECJA 2LNTA 1M2DA 2JU5A 19GSA 1SD8A 2EIQA 4G0LA 5IMFA 1SJIA 3LGCA 2ZCTA 3KP9A 3VWVA 1EP7A 3ZL5A 3K8NA 2VL3A 2G0FA 1JFUA 1SD9A 2REMA 4QL7A 1PL1A 3QAWA 3GKKA 4ILFA 4GTUA 4KH7A 4BVYB 4EVMA 1YQ1A 3EE2A 1SJ6A 3EU4A 3HVSA 2QKEA 2JADA 3DVXA 2PERA 4XCSA 2OE1A 2DBCA 4X43A 3EC3A 2PUKC 1FO5A 4PQIA 3ZREA 2VM2A 4O5RA 4POLA 4ZB8A 2B6MA 1XVQA 1K0NA 3F4SA 2B3SA 5IMZA 2A4VA 1EV4A 4KUNA 1HNAA 4J56E 5G5FA 1GSFA 3J7Yb 2C0EA 4XIHA 2FCHA 3DEXA 1WOUA 4KCEA 4WR4A 4EE0A 3HJPA 1GUMA 4NMUA 2LUSA 1K3OA 4I6XA 2OJLA 4NAXA 3LFLA 1Z3EA 3I9V2 4O7HA 1F3AA 3A2VA 4BPYA 1Q4JA 2WDUA 3ZRDA 1H75A 1F2EA 1K0OA 3C73A 1B4QA 1ZCPA 1C72A 5G5EA 3TKSC 4V2MA 2FD3A 2K8VA 1LJRA 2IMIA 5GAPD 5ECPB 4EKZA 5ECRB 3NOFA 3GKMA 5CNWA 3QR6A 3DYRA 3NIVA 2C1YA 4ZXGA 3CYNA 4HS1A 1OVNA 4KDUA 5G31A 1EGOA 2XBQA 3HVVA 3KGKA 3GKXA 2YWMA 3GSTA 1DSBA 1GRXA 1V57A 1XVWA 3GRXA 4ULXA 1G0TA 3IHQA 4LA1A 1USBA 1KBNA 6GSUA 5CRGA 2CZ3A 2EC4A 1FHEA 2O7KA 1TW9A 3I43A 6GSXA 2AV4A 3BBYA 1GUKA 2TRXA 2CAIA 1MD3A 2JZSA 4FH8A 1S3CA 4I2TA 1EGRA 3ERGA 2GQKA 4FIWA 4K8MA 1ZYEA 3QMXA 1A2LA 3TKRA 3KTLA 4K6XA 4XRAA 4OWYA 2WB9A 3VFIA 1V9WA 1SKRB 1GH2A 1QQ2A 1SK1A 1GLPA 5J4UA 4XS1A 3ED3A 2CA8A 5IMVA 2VCWA 1GTIA 4PNGA 4PQHA 4RI6A 2RM6A 1XPVA 5D8IA 4FO5A 1U3AA 4ZBBA 4NWYA 3KP8A 4PNFA 1TOFA 1GSSA 2HRKA 2F51A 4POMA 3VI7A 4MJCA 2VCQA 1XW5A 3F9UA 1AC1A 1PMTA 2MMAA 3CMIA 3APQA 2B1LA 1GTBA 4P3YB 3HJMA 2GZYA 2HQTA 1M0UA 2OADA 1T4ZA 4POKA 3FW2A 5G1KA 3D5JA 1TRUA 2C80A 5DALA 1S3DA 3TKQA 5D9WA 3FY7A 1F6MC 2RUEA 3TJKA 1M2BA 3LWAA 4TOPA 3DKSA 2C3QA 2CX4A 4TR3A 3CTGA 1OC9A 4ZILA 3KD0A 5CO3A 4F82A 4PX1A 1KTEA 4IQAA 3IPZA 1BAYA 3P90A 3VWUA 1V40A 2LKUA 1DE1A 4N10A 2A2SA 5F05A 3ZITA 2C3TA 2I3YA 3HZ8A 4JR6A 4HU7A 2VAFA 3RBTA 4TW5A 2HLSA 4FYBA 2B7KA 2VUPA 3FZ4A 2HT9A 5KN2A 3WGDA 5DDLA 3M9KA 3ME8A 3FKFA 4TR1A 2H6YA 1TRWA 1NSWA 4HJMA 2IMKA 2MBTA 5CRDA 3UEMA 4ECCA 1FAAA 3L9VA 1W4VA 3J7Yk 3VURA 3CBUA 3DD3A 2LQOA 1A2MA 1OKDA 4HOJA 2H0IA 2YANA 3U6VA 2V32A 5E59A 3CXGA 1TDIA 2GTUA 3I6AA 5IPGA 2ZNMA 2M80A 1FOVA 1XWAA 2YOIA 5HR2A 5EY6A 5DCHA 3IBHA 2JSZA 3KMNA 4GLTA 2WS2A 4WETA 3GMFA 4F2IA 4FYCA 1VGLA 4J2FA 3QOUA 4KB3A 17GSA 1U88A 5LCZA 1SK0A 1RK4A 4EDZA 1M9AA 4WXTA 2HSNB 4NHWA 2X64A 3DRNA 3MNGA 4DEJA 2FY6A 2HRKB 5J3RA 5FT3A 4MABA 4F03A 1AUCA 2XBIA 4LMVA 4MF7A 4IKHA 5HQPA 1FB6A 4L5OA 3TRPA 5A4WA 3KM6A 1GSQA 3LSZA 2HXKA 1CQHA 5J9BA 1Z7RA 4H86A 1YEPA 2VCXA 2MMNA 4XS6A 3KIJA 1V98A 4G0KA 5DALB 1OE7A 4PQ1A 2LV3A 1SKWB 3RHCA 2DC5A 2VO4A 1JHBA 2GQMA 1OC9B 4OCEA 3G7IA 4EXJA 3PGTA 3W8JA 1BYEA 4OFMA 2DSAA 1ZZYA 1K0AA 3GTUA 4Q5FA 1IYHA 3ZIVA 2DJKA 1XOBA 5F8BA 3W8SA 2H71A 2FHEA 5E4WA 4BVXB 1TI3A 5H5RA 4TRXA 1XWCA 2CV4A 3HXSA 2BMXA 2X8GA 4TR1B 3A2XA 5EVOA 4WBRD 4HQZA 1UA5A 3LYKA 3TKSE 1ERTA 4EL1A 1XWKA 3HA9A 2YP6A 5GZZB 1ZL9A 3EMPA 4RUVA 3ZFBA 1UC7A 1O8XA 3U5RE 4MF5A 2PBJA 3HHVA 2YZHA 1PL2A 3L9SA 4EF0A 4WEYA 1TU7A 4KW6A 4NPBA 3IAM2 4MK3A 4MZWA 1QMVA 2B1KA 3G7JA 5LNKe 3A5WA 2HSHA 2H0GA 5KN3A 2I4AA 1BG5A 5ABRA 1TK5B 2FWFA 5FWGA 3E3EA 4DSRA 1SYXA 5F07A 1X5DA 4DSSA 2WGRA 1SL2B 3IE3A 2ON7A 2L6CA 2PN8A 4PGTA 4YQUA 2IFQB 4IBPA 3KH7A 1SJZA 4O32A 2DJ1A 5AGYA 4AF2A 1U87A 4JU5A 3UBLA 5A4VA 3HCZA 1SKSB 2JACA 1YKCA 2VL9A 4NV5A 4WBJA 3QPMA 4KGIA 1E6BA 2KP2A 4MZCA 2I1UA 4N30A 1XCCA 1ZMAA 3GN3A 3TCOA 1YKAA 4K7NA 1QGVA 2YZUA 2LSTA 4IVFA 5IMDA 3HYPA 2GQLA 2WFCA 2E7PA 2B5YA 3IDVA 2CVBA 2LRTA 5IO0A 1F37A 1UN2A 4MA9A 1M7TA 3GTUB 1R5AA 5D9XA 5IMAA 2YPMA 4OD7A 2GT5A 1Z5YE 2C0FA 3GV1A 3DMLA 5JWRB 4USSA 5JCGA 3F0IA 4GWRA 4YQMA 12GSA 2J9HA 14GSA 1H4OA 2P0GA 4CHSA 1X9SB 1AQVA 1GUHA 4MH2A 5JCUA 2LJKA 2WULA 4Q5RA 2YWIA 2GLRA 3MWHA 2K18A 2LRNA 1PA3A 2VD1A 2X8CA 3GFKA 3QD9A 2XPDA 2V1MA 5KEJA 1VF4A 4ML1A 1EEJA 3D4TA 3VLNA 1YF0A 1QUWA 3GL3A 3BCIA 2AUVA 4I8BA 4GQCA 2R5GA 2LRCA 3LORA 5HR3A 1XWGA 5EL8A 3ZMLA 1K3YA 1Z6NA 3ZVJD 3GUSA 4NXIA 5D93A 3KMOA 1NHYA 4HDEA 1WJKA 3TDGA 2CX3A 1T8EB 2H01A 2VD0A 5D96A 4JR4A 2VOCA 5ECNB 3UARA 4EO3A 3UMAA 6GSSA 4F0BA 3TKPA 2JL4A 2FWEA 1HQOA 2HI7A 5KN1A 3WGXA 3LXZA 1TTZA 4DSSB 1SL0B 1THOA 1V58A 1RQMA 3ZYWA 5J41A 5J9CA 4KDXA 2IIYA 5IM9A 1HYUA 1GSUA 1EP8A 5JWQB 3TB2A 2YV7A 1A2JA 3GX8A 4L0WA 1ACVA 3VWXA 2J23A 20GSA 4J57E 2IMDA 1EOGA 4ML6A 1FW1A 3D22A 2OE3A 3BOAA 1AXDA 2UZ8A 3FHKA 3APSA
chains in the Genus database with same CATH superfamily
4ZL9A 1Y6EA 2ALBA 1XWBA 2X99A 3RDWA 2CT6A 2GSRA 4GSTA 3VK9A 1I1IP 2CVKA 2L59A 3CWGA 4ECIA 2X49A 5CRWA 3TRQA 2C8UA 2L4CA 2WVXB 1GWCA 1SVMA 4LL4B 1DBYA 5G30A 3CSIA 1SVLA 3D0ZA 2R4VA 2GDRA 2X8HA 3UIWA 3C71A 1UVZA 2AYTA 4I5QA 1AIUA 4HQSA 2VM1A 1N8JA 3TJBA 1J9BA 3F4RA 7GSSA 2HZFA 1B8XA 2VLUA 2FA4A 3QDNA 2PWJA 5INYA 1HNBA 5GAND 2WRTA 4OFNA 5DQSA 3LG6A 3D21A 2C4JA 1YZXA 5CRHA 5C00A 1PX6A 10GSA 4XS4A 1A8YA 1QFNA 2HZEA 4ZB9A 3N5OA 2H72A 2QGVA 1QXHA 1AAZA 1MEKA 5L71A 3TGZA 5ID2A 2GS3A 2NVLA 3EINA 4KSOA 3LXTA 2V2GA 3GHAA 2MZCA 1VF1A 3LYPA 5HFKA 2LS5A 4HZ4A 3GKNA 4MJAA 2HNLA 5ELGA 2IN3A 4KDYA 1ERWA 1JLWA 1JZDA 1MDJA 3HZ4A 5IOWA 2WCIA 4HI7A 3C1SA 5F0GA 3Q18A 2E2GA 2H1BA 1X9WB 2KP1A 2LTKA 5B6NA 5DCGA 1A0RP 4BVXA 3DIEA 2MYGA 3ZLPA 3O3TA 3GA4A 3VI5A 5CP1A 5DAKB 2RUFA 5CAXA 3PPUA 2H0HA 4GRFA 3DWVA 1G7OA 4GCIA 3US3A 4GQFA 1X5EA 2DKIA 3MIXA 3H79A 2HRAA 4IS0A 3KJYA 5A1NB 3CSHA 1NHOA 5BMUA 1ZOFA 1XBSA 3ZIJA 5KN0A 6GSYA 3M9JA 4WKWA 2K6VA 1PKZA 4YH2A 1VRSD 1R7HA 3LQ7A 3HKRA 5DJMA 2H19A 5D9TA 3VPTA 5F06A 5HR0A 1A24A 3D6IA 3UOMA 2RIIA 3FR9A 2YN1A 1GNWA 2OBIA 5AN1A 1TJDA 1AQXA 1JZRA 1M99A 3QFAC 1EOHA 5IQYA 1WPIA 4KNDA 5J47A 1T00A 4K7OA 3FR3A 1OYJA 3F63A 3EVIA 1GSEA 3GURA 3MSZA 2KUCA 4NHZA 1X0RA 2N5BA 2QSIA 18GSA 2MBSA 3IK9A 3SWLA 3A3TA 1NM3A 2HRNA 4K2DA 2YWNA 1O85A 2M46A 2F8FA 3WT1A 4I2UA 3P2AA 5GSTA 2IFQA 5C04A 1FVJA 4N11A 4XS4B 3BJ5A 4IHUA 1ILOA 4JZQA 2HZEB 1K3LA 4PUAA 1JZWA 4EDYA 5ID2B 4QL9A 1T1VA 5H5SA 3QAVA 1RW1A 1V2AA 3ZFLA 5G2ZA 2G2QA 4IELA 4G10A 1PGTA 1B48A 4IJ3A 4YAVA 1A23A 3HDCA 13GSA 1QK8A 2YCDA 2L5OA 4DSQA 1TK8B 2L5LA 1OKTA 5HFGA 4RI7A 3M8NA 4OFTA 2HSYA 2R2JA 2IMFA 3QFBC 2F8AA 2NPBA 3VWWA 2F3MA 1EEMA 2L4QA 1R4WA 1BG1A 4PTSA 4K7IA 1M3JA 2MMOA 3TRXA 4YKFA 1TRSA 2GZPA 1PN9A 3ERWA 3KCMA 4N0ZA 1M3IA 1K0BA 4TN8A 1GSDA 1N25A 3Q6OA 2BTOT 4JRRA 5ECOB 3IC8A 3GH6A 3TJGA 1M2AA 3N9JA 4D73A 4OO4A 2YJHA 4PHZC 2V6KA 4QQ7A 1SK2A 3WD6A 2XHFA 2CZ2A 2AAWA 4A5PA 1MD4A 3FR6A 4V2NA 2VCTA 4E68A 2IL3A 3GH9A 3F3RA 4N0VA 1S4BP 3GIXA 2H66A 1J08A 1G6YA 1WMJA 1X5CA 4XTSA 2V41A 3O6TA 2TRCP 3PINA 4XRDA 1YVLA 3IC4A 5IMCA 2N5AA 1ZYNA 2GZZA 5D73A 3S9FA 4CW9A 3CRTA 2VCVA 2AB6A 1M9BA 2L6DA 4GSNA 3IV4A 3PH9A 2AJQB 9GSSA 5IIZA 4X4JA 3FZAA 4NV2A 3PR8A 3GYKA 3LJRA 4OO5A 4IP6A 4TXVA 1EV9A 3CTFA 2H76A 2YNXA 4HEA2 5ECKB 1PKWA 5HFIA 2OACA 2KLXA 2FA8A 5DBQA 1B9YC 1SU9A 3E9JB 4YAPA 3CRUA 2GSTA 4KSMA 3RAZA 1W89A 2WW3A 3KEBA 2FGXA 4GXZA 1Z9HA 4ACSA 1XW6A 1GNEA 2GGTA 2H6XA 3F8UA 3EYTA 4TKYA 1X9MB 4IJIA 4HSCX 3EMXA 3EU3A 2FWGA 2R0GA 4KX4A 8GSSA 1E2YA 2L57A 4FQUA 2JZTA 3VPQA 1YY7A 4L5LA 1R26A 4MLYA 3UVTA 2H1GA 1HNCA 4ECBA 1FG4A 4L0UA 2VL2A 5KOXA 2B5EA 4AJ8A 3Q74A 1JLVA 2K8SA 2XC2A 3KH9A 3OR5A 4YQVA 1T4YA 4LL1B 1PD21 1G6WA 3P8WA 1PSQA 2TIRA 3TUEA 3E0UA 3IK7A 4G01A 1K0CA 2NBSA 1Y1UA 2C3NA 2CQ9A 5CREA 1MDIA 5IPHA 3ZVJA 3G7YA 5IOXA 4WF5A 4TXOA 2DMLA 3CSJA 2M72A 4Q5NA 2IMEA 2OA7A 1VF3A 2GT6A 2PVOC 3FEUA 1KEBA 1XFLA 2EFDA 4JBBA 4L8EA 3IA1A 3RHBA 4OMVA 4AJ7A 4FXYP 1GULA 3ME7A 2O36A 4RQRA 4D73B 2GVPA 5CYYA 4MPFA 3H8QA 1PFOA 4K1FA 4XHMA 1AW9A 2H74A 2P5RA 4ZB6A 2R6KA 2FUG2 1SYRA 3HVXA 2FWHA 1DUGA 3QAGA 5FHIA 1A8LA 4K0GA 3UJ1A 5J5NA 2HRFA 1WRYA 2ZUPA 3CHXC 3DVWA 2RM5A 2EFCA 4LMWA 4TR0A 3L0HA 1XZOA 2PPTA 2OE0A 1ST9A 4GF0A 3M1GA 5JWOB 4ID0A 2E0QA 1GP1A 3IHGA 1OC3A 5H5QA 4Q5QA 6GSVA 4HUAA 3GSSA 1ZYPA 2DIYA 2LJAA 3V1WA 4IP1A 3UL3A 3F3QA 5DAKA 1O6JA 3FYGA 4AGSA 3F6DA 2LQQA 2OBKA 2VLVA 4PI0C 1J0FA 2EFHA 2RLIA 5B7CA 1GL8A 1ERVA 4WR5A 2OT3A 1Z7PA 2P5QA 4MCUA 3H4KA 4ZBAA 3FMWA 3FRCA 1K0DA 2IPAA 4MH3A 4TVEA 4CDOA 2YV9A 4ZL8A 1AQWA 3APOA 2CAQA 4K9ZA 2I9HA 2NDOA 1Y25A 2DIZA 2WJUA 3IR4A 4G19A 2WW0A 5B6MA 1YDKA 4TR4A 1VF2A 4PURA 2R0CA 1ZGNA 2DMMA 2VL2C 3FK8A 1ML6A 3F6FA 1TKDB 4TXOB 4ISDA 1IYIA 3IAS2 1TP9A 1S3RA 3ZZXA 2WW2A 2DJJA 1T7PB 3FZ5A 1ON4A 3RPPA 4MMMA 3UVHA 3FZ9A 2F9SA 2N5FA 3ERFA 2C0DA 3WT2A 2DJ2A 2YJ7A 5DVBA 2H8LA 3QCPA 3EWLA 1OAZA 1XG8A 3C1RA 2O85A 2IWTA 4BWSA 2DLXA 5JCWA 16GSA 4KAEA 3BCKA 3MYDA 1URMA 3ISOA 3M0FA 1DE2A 2PU9C 3IOSA 1O81A 2HSMA 5AISA 1K0MA 1GLQA 4HJ2A 3ZTLA 1PQNA 5B8BA 2A2RA 2BJXA 2VLTA 5DQYA 1O73A 1OE8A 2AHEA 1U6TA 3AY8A 4X0XA 2DJ3A 2O87A 5IO2A 4F9ZA 4V1Ag 1TK0B 1YEXA 1BF5A 4CY6A 1TI1A 3H93A 5HR1A 3C8EA 2HFDA 3KXOA 1BQ7A 2H1AA 3ZMKA 1EZKA 2LEGA 3CQFA 2LNSA 4EUYA 1MDKA 1Q98A 3R2QA 3R3EA 11GSA 5ECMB 3UBKA 3NZNA 4WF4A 3HD5A 3A2WA 2EIOA 1EWXA 2B5XA 2GSQA 2QA1A 2EIRA 3GX0A 4HU9A 2WZ9A 1MTCA 4AKXB 1BEDA 2ES7A 4OCFA 4PUFC 3WYWA 5COHA 4BL7A 1N2AA 1I9DA 2E2MA 4MZBA 4I97A 1LU4A 5EPFA 2H1DA 3M3MA 1R5PA 1ERUA 3L4NA 2IJYA 4G9HA 1TRVA 3DGQA 3I69A 3Q19A 4KE3A 4FYUA 1GSYA 4ZL7A 2I81A 4V2LA 1XOAA 4MDCA 4PXOA 2LJRA 4G0IA 4MP4A 1Z6MA 5ELAA 4G2EA 2H75A 5ECSA 3RPNA 4O5QA 4K0NA 4F0CA 2C0GA 1SL1B 4AKIA 1T3BA 3GNJA 3TJFA 1WWJA 1O8WA 2MMZA 1G7EA 4AJ6A 1WIKA 4MJBA 1YF1A 2DJ0A 3IXRA 5G1LA 3DXBA 4MJEA 3TOUA 1CQGA 2OKAA 2GSSA 3MAKA 2HYXA 4DVCA 3L78A 4E8EA 3KTBA 2ON5A 4IGJA 2H6ZA 2QC7A 4EC0A 2Z9SA 4IW9A 1FVKA 3EURA 3W6GA 2PVQA 2HSMB 2D2ZA 2KHPA 3LEFA 2WZSA 3H1NA 1YJ6A 1XW9A 2H70A 1ZYQB 2NTOA 1SENA 5A4UA 5B8AA 2JSYA 2KOKA 2PMTA 3HJOA 1F9MA 5ECQB 1FB0A 4GSSA 6GSTA 1ABAA 1NW2A 1OC8A 1XIYA 2P31A 4IN0A 5AIVA 2R3XA 2HE3A 4ZIJA 4Z7XA 5AIXA 4BVYA 2H73A 3F4TA 2PGTA 3WGEA 3TJJA 6GSWA 4X1UA 3IRAA 4O92A 4ZBDA 2JZRA 2VIMA 1TXXA 4KCAA 3MDKA 2FLSA 5LD0A 4BL7B 3KZQA 1B9XC 2WW1A 5ECHB 4RQXA 2O8VB 3UAPA 1HD2A 1GTAA 1XXUA 3D4MA 2WVYA 3O76A 4BA7A 4JEDA 1YEWC 2B7JA 4E8HA 4IQ1A 5A5KA 1O7UA 22GSA 2YWOA 1LBKA 2VCZA 1WE0A 2FNOA 2CVDA 4BWQA 4MF6A 1F3BA 3TKSA 3SBCA 3JCML 1I5GA 4Z2RA 4EIPA 1U3IA 3C7MA 1PRXA 1BX9A 2R37A 3BD2A 2K9FA 3G9BA 1KNGA 5DJLA 1WP0A 3HY2A 3TOTA 2H30A 1SVOA 1TU8A 4V1Ap 1GTUA 5ECIB 2O5VA 1S3AA 4HZ2A 5GSSA 3L9UA 5D9VA 1B4PA 4KF9A 1A0FA 1THXA 4KA0A 4LLRA 4JE1A 4MPGA 2O89A 2XPEA 1PX7A 1JZOA 3GL5A 2V6OA 5ECLB 4POBA 5ENUA 1BJXA 3P7XA 4ECJA 2LNTA 1M2DA 2JU5A 19GSA 1SD8A 2EIQA 4G0LA 5IMFA 1SJIA 3LGCA 2ZCTA 3KP9A 3VWVA 1EP7A 3ZL5A 3K8NA 2VL3A 2G0FA 1JFUA 1SD9A 2REMA 4QL7A 1PL1A 3QAWA 3GKKA 4ILFA 4GTUA 4KH7A 4BVYB 4EVMA 1YQ1A 4YKGA 2WVZA 3EE2A 1SJ6A 3EU4A 3HVSA 2QKEA 2JADA 3DVXA 2PERA 4XCSA 2OE1A 2DBCA 4X43A 3EC3A 2PUKC 1FO5A 4PQIA 3ZREA 2VM2A 4O5RA 4POLA 4ZB8A 2B6MA 1XVQA 1K0NA 3F4SA 2B3SA 5IMZA 2A4VA 1EV4A 4KUNA 1HNAA 4J56E 5G5FA 1GSFA 3J7Yb 2C0EA 2X4AA 4XIHA 2FCHA 3DEXA 1WOUA 4KCEA 4WR4A 4EE0A 3HJPA 1GUMA 4NMUA 4PI2C 4Z2UA 2LUSA 1K3OA 4I6XA 2OJLA 2VKZG 4NAXA 5J40A 3LFLA 4ZB7A 1Z3EA 3I9V2 4O7HA 1F3AA 3A2VA 4BPYA 1Q4JA 2WDUA 3ZRDA 3A5IA 1H75A 1F2EA 1K0OA 3C73A 1B4QA 1ZCPA 1C72A 5G5EA 3TKSC 4V2MA 2FD3A 2K8VA 1LJRA 2IMIA 5GAPD 5ECPB 4EKZA 5ECRB 3NOFA 3GKMA 5CNWA 3QR6A 3DYRA 2R0PA 3NIVA 2C1YA 4O5UA 4ZXGA 3CYNA 4HS1A 1OVNA 4KDUA 5G31A 1EGOA 3RFRC 2XBQA 3HVVA 3KGKA 3GKXA 2YWMA 3GSTA 1DSBA 4GDFA 1GRXA 1V57A 1XVWA 3GRXA 4ULXA 1G0TA 3IHQA 4LA1A 1USBA 1KBNA 6GSUA 5CRGA 2CZ3A 2EC4A 1FHEA 2O7KA 5BRTA 1TW9A 3I43A 6GSXA 2EFEA 2AV4A 3BBYA 4N3ZA 1GUKA 2TRXA 2CAIA 1MD3A 2JZSA 4FH8A 1S3CA 4I2TA 2H1LA 1EGRA 3ERGA 2GQKA 4FIWA 4K8MA 1ZYEA 3QMXA 1A2LA 3TKRA 3KTLA 4K6XA 4XRAA 4OWYA 2WB9A 3VFIA 1V9WA 2O3EA 1SKRB 1GH2A 1QQ2A 5A5HA 1SK1A 1GLPA 5J4UA 4XS1A 3ED3A 2CA8A 5IMVA 2VCWA 1GTIA 1TXUA 4PNGA 4PQHA 4RI6A 2RM6A 1XPVA 5D8IA 4FO5A 1U3AA 4ZBBA 4NWYA 2HSNA 3KP8A 4PNFA 4K2XA 1TOFA 1GSSA 2HRKA 2F51A 5A34B 4POMA 3VI7A 4MJCA 2VCQA 1XW5A 3F9UA 1AC1A 1PMTA 2MMAA 3CMIA 2A2PA 3APQA 3RGBC 2B1LA 1GTBA 4P3YB 3HJMA 2GZYA 2HQTA 1M0UA 2OADA 1T4ZA 4POKA 3FW2A 5G1KA 3D5JA 1TRUA 2C80A 5DALA 1S3DA 3TKQA 5D9WA 3FY7A 1F6MC 2RUEA 3TJKA 1M2BA 3LWAA 4TOPA 3DKSA 2C3QA 2CX4A 4TR3A 3CTGA 1OC9A 4ZILA 3KD0A 5CO3A 4F82A 4PX1A 1KTEA 4IQAA 3IPZA 4EIQA 3HVNA 1BAYA 3P90A 3VWUA 1V40A 2LKUA 1DE1A 4N10A 2A2SA 5F05A 3ZITA 2C3TA 2I3YA 3HZ8A 4JR6A 4HU7A 2VAFA 4MNNA 3RBTA 4TW5A 2HLSA 4FYBA 2B7KA 2VUPA 3FZ4A 2HT9A 5KN2A 3WGDA 5DDLA 3M9KA 3ME8A 3FKFA 4TR1A 2H6YA 1TRWA 1NSWA 4HJMA 4QMKA 3LW9A 2IMKA 2MBTA 5CRDA 3UEMA 4ECCA 1FAAA 3L9VA 1W4VA 4Z2TA 3J7Yk 3VURA 3CBUA 3DD3A 2A4HA 2LQOA 1A2MA 1OKDA 4HOJA 2H0IA 2YANA 3U6VA 2V32A 5E59A 3CXGA 1TDIA 2GTUA 5A5HB 3I6AA 5IPGA 2ZNMA 4K5RA 2M80A 1FOVA 3EPTA 1XWAA 2YOIA 5HR2A 5EY6A 5DCHA 3IBHA 2JSZA 3KMNA 4GLTA 2WS2A 4WETA 3GMFA 4F2IA 4FYCA 1VGLA 4J2FA 3QOUA 4KB3A 17GSA 1U88A 5LCZA 1SK0A 1RK4A 4EDZA 1M9AA 4WXTA 2HSNB 4NHWA 2X64A 3DRNA 3MNGA 4DEJA 2FY6A 2HRKB 5J3RA 5FT3A 4MABA 4F03A 1AUCA 2XBIA 4LMVA 4MF7A 4IKHA 5HQPA 1FB6A 4L5OA 3TRPA 1PN0A 5A4WA 3KM6A 1GSQA 3LSZA 2HXKA 1CQHA 5J9BA 1Z7RA 4H86A 1YEPA 2VCXA 2MMNA 4XS6A 3KIJA 1V98A 4G0KA 5DALB 1OE7A 4PQ1A 5J4VA 2LV3A 1SKWB 3RHCA 2DC5A 2VO4A 1JHBA 2GQMA 1OC9B 4OCEA 3G7IA 4EXJA 3PGTA 3W8JA 1BYEA 4OFMA 2DSAA 1ZZYA 1K0AA 3GTUA 4Q5FA 1IYHA 3ZIVA 2DJKA 1XOBA 5F8BA 3W8SA 2H71A 2FHEA 5E4WA 4BVXB 1TI3A 5H5RA 3HMJG 4TRXA 1XWCA 2CV4A 3HXSA 2BMXA 2X8GA 4TR1B 3A2XA 5EVOA 4WBRD 4HQZA 1UA5A 3LYKA 3TKSE 1ERTA 4EL1A 1XWKA 3HA9A 2YP6A 5GZZB 1ZL9A 5BMUB 3EMPA 4RUVA 3ZFBA 1UC7A 1O8XA 3U5RE 4MF5A 2PBJA 3HHVA 2YZHA 1PL2A 2QA2A 3L9SA 4EF0A 4WEYA 1TU7A 4KW6A 4NPBA 3IAM2 4MK3A 4MZWA 1QMVA 2B1KA 3G7JA 5LNKe 3A5WA 2HSHA 2H0GA 5KN3A 2I4AA 1BG5A 5ABRA 1TK5B 2FWFA 5FWGA 3E3EA 4DSRA 1SYXA 5F07A 1X5DA 4DSSA 2WGRA 1SL2B 3IE3A 2ON7A 2L6CA 2PN8A 4PGTA 4YQUA 2IFQB 4IBPA 3KH7A 1SJZA 4O32A 2DJ1A 2UV8G 5AGYA 4AF2A 1U87A 3UBLA 5A4VA 3HCZA 4JU5A 1SKSB 2JACA 1YKCA 2VL9A 4NV5A 4WBJA 3QPMA 4KGIA 1E6BA 2KP2A 4MZCA 2I1UA 4N30A 1XCCA 1ZMAA 3GN3A 3TCOA 1YKAA 4K7NA 1QGVA 2YZUA 2LSTA 4IVFA 5IMDA 3HYPA 2GQLA 2WFCA 2WVXA 2E7PA 4ICYA 2B5YA 3IDVA 2CVBA 2LRTA 5IO0A 1F37A 1UN2A 4MA9A 1M7TA 4K5SA 3GTUB 1R5AA 5D9XA 5IMAA 2YPMA 2DKHA 4OD7A 2GT5A 4AKHA 1Z5YE 2C0FA 3GV1A 3DMLA 5JWRB 4USSA 5JCGA 3F0IA 4GWRA 4YQMA 12GSA 5A34A 2J9HA 14GSA 1H4OA 2P0GA 4CHSA 1X9SB 1AQVA 1GUHA 4MH2A 5JCUA 2LJKA 2WULA 4Q5RA 2YWIA 2GLRA 3MWHA 2K18A 2LRNA 1PA3A 2VD1A 2X8CA 3GFKA 5KOWA 3QD9A 2XPDA 2V1MA 5KEJA 1VF4A 4ML1A 1EEJA 3D4TA 3VLNA 1YF0A 1QUWA 3GL3A 3BCIA 2AUVA 4I8BA 4GQCA 2R5GA 2LRCA 3LORA 5HR3A 1XWGA 5EL8A 3ZMLA 1K3YA 1Z6NA 3ZVJD 3GUSA 4NXIA 5D93A 3KMOA 1NHYA 4HDEA 1WJKA 3TDGA 2CX3A 1T8EB 2H01A 2VD0A 5D96A 4JR4A 5J4YA 2VOCA 5ECNB 3UARA 3TU3B 4EO3A 3UMAA 6GSSA 4F0BA 4AI6A 3TKPA 2JL4A 2FWEA 1HQOA 2HI7A 5KN1A 3WGXA 3LXZA 1FOHA 1TTZA 4DSSB 1SL0B 1THOA 1V58A 1RQMA 3ZYWA 5J41A 5J9CA 4KDXA 4W66A 2IIYA 5IM9A 1HYUA 1GSUA 4AKGA 1EP8A 5JWQB 3TB2A 2YV7A 5A1NA 1A2JA 3GX8A 4L0WA 1ACVA 3VWXA 2J23A 20GSA 4CY8A 4J57E 2IMDA 1EOGA 4ML6A 1FW1A 3D22A 2OE3A 3BOAA 1AXDA 2UZ8A 3FHKA 3APSA 4BIKA
chains in the Genus database with same CATH topology
4ZL9A 1Y6EA 2ALBA 1XWBA 2X99A 3RDWA 2CT6A 2GSRA 4GSTA 3VK9A 2CVKA 2L59A 3CWGA 4ECIA 2X49A 5CRWA 3TRQA 2C8UA 2L4CA 1GWCA 1SVMA 4LL4B 1DBYA 5G30A 3CSIA 1SVLA 3D0ZA 2R4VA 2GDRA 2X8HA 3UIWA 3C71A 1UVZA 2AYTA 4I5QA 1AIUA 4HQSA 2VM1A 1N8JA 3TJBA 1J9BA 3F4RA 7GSSA 2HZFA 1B8XA 2VLUA 2FA4A 3QDNA 2PWJA 5INYA 1HNBA 5GAND 2WRTA 4OFNA 5DQSA 3LG6A 3D21A 2C4JA 1YZXA 5CRHA 5C00A 1PX6A 10GSA 4XS4A 1A8YA 1QFNA 2HZEA 4ZB9A 3N5OA 2H72A 2QGVA 1QXHA 1AAZA 1MEKA 5L71A 3TGZA 5ID2A 2GS3A 2NVLA 3EINA 4KSOA 3LXTA 2V2GA 3GHAA 2MZCA 1VF1A 3LYPA 5HFKA 2LS5A 4HZ4A 3GKNA 4MJAA 2HNLA 5ELGA 2IN3A 4KDYA 1ERWA 1JLWA 1JZDA 1MDJA 3HZ4A 5IOWA 2WCIA 4HI7A 3C1SA 5F0GA 3Q18A 2E2GA 2H1BA 1X9WB 2KP1A 2LTKA 5B6NA 5DCGA 1A0RP 4BVXA 3DIEA 2MYGA 3ZLPA 3O3TA 3GA4A 3VI5A 5CP1A 5DAKB 2RUFA 5CAXA 3PPUA 2H0HA 4GRFA 3DWVA 1G7OA 4GCIA 3US3A 4GQFA 1X5EA 2DKIA 3MIXA 3H79A 2HRAA 4IS0A 3KJYA 5A1NB 3CSHA 1NHOA 5BMUA 1ZOFA 1XBSA 3ZIJA 5KN0A 6GSYA 3M9JA 4WKWA 2K6VA 1PKZA 4YH2A 1VRSD 1R7HA 3LQ7A 3HKRA 5DJMA 2H19A 5D9TA 3VPTA 5F06A 5HR0A 1A24A 3D6IA 3UOMA 2RIIA 3FR9A 2YN1A 1GNWA 2OBIA 5AN1A 1TJDA 1AQXA 1JZRA 1M99A 3QFAC 1EOHA 5IQYA 1WPIA 4KNDA 5J47A 1T00A 4K7OA 3FR3A 1OYJA 3F63A 3EVIA 1GSEA 3GURA 3MSZA 2KUCA 4NHZA 1X0RA 2N5BA 2QSIA 18GSA 2MBSA 3IK9A 3SWLA 3A3TA 1NM3A 2HRNA 4K2DA 2YWNA 1O85A 2M46A 2F8FA 3WT1A 4I2UA 3P2AA 5GSTA 2IFQA 5C04A 1FVJA 4N11A 4XS4B 3BJ5A 4IHUA 1ILOA 4JZQA 2HZEB 1K3LA 4PUAA 1JZWA 4EDYA 5ID2B 4QL9A 1T1VA 5H5SA 3QAVA 1RW1A 1V2AA 3ZFLA 5G2ZA 2G2QA 4IELA 4G10A 1PGTA 1B48A 4IJ3A 4YAVA 1A23A 3HDCA 13GSA 1QK8A 2YCDA 2L5OA 4DSQA 1TK8B 2L5LA 1OKTA 5HFGA 4RI7A 3M8NA 4OFTA 2HSYA 2R2JA 2IMFA 3QFBC 2F8AA 2NPBA 3VWWA 2F3MA 1EEMA 2L4QA 1R4WA 1BG1A 4PTSA 4K7IA 2MMOA 3TRXA 4YKFA 1TRSA 2GZPA 1PN9A 3ERWA 3KCMA 4N0ZA 1K0BA 4TN8A 1GSDA 1N25A 3Q6OA 2BTOT 4JRRA 5ECOB 3IC8A 3GH6A 3TJGA 1M2AA 3N9JA 4D73A 4OO4A 2YJHA 2V6KA 4QQ7A 1SK2A 3WD6A 2XHFA 2CZ2A 2AAWA 4A5PA 1MD4A 3FR6A 4V2NA 2VCTA 4E68A 2IL3A 3GH9A 3F3RA 4N0VA 3GIXA 2H66A 1J08A 1G6YA 1WMJA 1X5CA 4XTSA 2V41A 3O6TA 2TRCP 3PINA 4XRDA 1YVLA 3IC4A 5IMCA 2N5AA 1ZYNA 2GZZA 5D73A 3S9FA 4CW9A 3CRTA 2VCVA 2AB6A 1M9BA 2L6DA 4GSNA 3IV4A 3PH9A 2AJQB 9GSSA 5IIZA 4X4JA 3FZAA 4NV2A 3PR8A 3GYKA 3LJRA 4OO5A 4IP6A 4TXVA 1EV9A 3CTFA 2H76A 2YNXA 4HEA2 5ECKB 1PKWA 5HFIA 2OACA 2KLXA 2FA8A 5DBQA 1B9YC 1SU9A 3E9JB 4YAPA 3CRUA 2GSTA 4KSMA 3RAZA 1W89A 3KEBA 2FGXA 4GXZA 1Z9HA 4ACSA 1XW6A 1GNEA 2GGTA 2H6XA 3F8UA 3EYTA 4TKYA 1X9MB 4IJIA 3EMXA 3EU3A 2FWGA 2R0GA 4KX4A 8GSSA 1E2YA 2L57A 4FQUA 2JZTA 3VPQA 1YY7A 4L5LA 1R26A 4MLYA 3UVTA 2H1GA 1HNCA 4ECBA 1FG4A 4L0UA 2VL2A 5KOXA 2B5EA 4AJ8A 3Q74A 1JLVA 2K8SA 2XC2A 3KH9A 3OR5A 4YQVA 1T4YA 4LL1B 1PD21 1G6WA 3P8WA 1PSQA 2TIRA 3TUEA 3E0UA 3IK7A 4G01A 1K0CA 2NBSA 1Y1UA 2C3NA 2CQ9A 5CREA 1MDIA 5IPHA 3ZVJA 3G7YA 5IOXA 4WF5A 4TXOA 2DMLA 3CSJA 2M72A 4Q5NA 2IMEA 2OA7A 1VF3A 2GT6A 2PVOC 3FEUA 1KEBA 1XFLA 2EFDA 4JBBA 4L8EA 3IA1A 3RHBA 4OMVA 4AJ7A 1GULA 3ME7A 4RQRA 4D73B 2GVPA 5CYYA 4MPFA 3H8QA 4K1FA 4XHMA 1AW9A 2H74A 2P5RA 4ZB6A 2R6KA 2FUG2 1SYRA 3HVXA 2FWHA 1DUGA 3QAGA 5FHIA 1A8LA 4K0GA 3UJ1A 5J5NA 2HRFA 1WRYA 2ZUPA 3DVWA 2RM5A 2EFCA 4LMWA 4TR0A 3L0HA 1XZOA 2PPTA 2OE0A 1ST9A 4GF0A 3M1GA 5JWOB 4ID0A 2E0QA 1GP1A 3IHGA 1OC3A 5H5QA 4Q5QA 6GSVA 4HUAA 3GSSA 1ZYPA 2DIYA 2LJAA 3V1WA 4IP1A 3UL3A 3F3QA 5DAKA 1O6JA 3FYGA 4AGSA 3F6DA 2LQQA 2OBKA 2VLVA 1J0FA 2EFHA 2RLIA 5B7CA 1GL8A 1ERVA 4WR5A 2OT3A 1Z7PA 2P5QA 4MCUA 3H4KA 4ZBAA 3FMWA 3FRCA 1K0DA 2IPAA 4MH3A 4TVEA 4CDOA 2YV9A 4ZL8A 1AQWA 3APOA 2CAQA 4K9ZA 2I9HA 2NDOA 1Y25A 2DIZA 2WJUA 3IR4A 4G19A 5B6MA 1YDKA 4TR4A 1VF2A 4PURA 2R0CA 1ZGNA 2DMMA 2VL2C 3FK8A 1ML6A 3F6FA 1TKDB 4TXOB 4ISDA 1IYIA 3IAS2 1TP9A 3ZZXA 2DJJA 1T7PB 3FZ5A 1ON4A 3RPPA 4MMMA 3UVHA 3FZ9A 2F9SA 2N5FA 3ERFA 2C0DA 3WT2A 2DJ2A 2YJ7A 5DVBA 2H8LA 3QCPA 3EWLA 1OAZA 3C1RA 2O85A 2IWTA 4BWSA 2DLXA 5JCWA 16GSA 4KAEA 3BCKA 3MYDA 1URMA 3ISOA 3M0FA 1DE2A 2PU9C 3IOSA 1O81A 2HSMA 5AISA 1K0MA 1GLQA 4HJ2A 3ZTLA 1PQNA 5B8BA 2A2RA 2BJXA 2VLTA 5DQYA 1O73A 1OE8A 2AHEA 1U6TA 3AY8A 4X0XA 2DJ3A 2O87A 5IO2A 4F9ZA 4V1Ag 1TK0B 1YEXA 1BF5A 4CY6A 1TI1A 3H93A 5HR1A 3C8EA 2HFDA 3KXOA 1BQ7A 2H1AA 3ZMKA 1EZKA 2LEGA 2LNSA 4EUYA 1MDKA 1Q98A 3R2QA 3R3EA 11GSA 5ECMB 3UBKA 3NZNA 4WF4A 3HD5A 3A2WA 2EIOA 1EWXA 2B5XA 2GSQA 2QA1A 2EIRA 3GX0A 4HU9A 2WZ9A 1MTCA 4AKXB 1BEDA 2ES7A 4OCFA 4PUFC 3WYWA 5COHA 4BL7A 1N2AA 1I9DA 2E2MA 4MZBA 4I97A 1LU4A 5EPFA 2H1DA 3M3MA 1R5PA 1ERUA 3L4NA 2IJYA 4G9HA 1TRVA 3DGQA 3I69A 3Q19A 4KE3A 4FYUA 1GSYA 4ZL7A 2I81A 4V2LA 1XOAA 4MDCA 4PXOA 2LJRA 4G0IA 4MP4A 1Z6MA 5ELAA 4G2EA 2H75A 5ECSA 3RPNA 4O5QA 4K0NA 4F0CA 2C0GA 1SL1B 4AKIA 1T3BA 3GNJA 3TJFA 1WWJA 1O8WA 2MMZA 1G7EA 4AJ6A 1WIKA 4MJBA 1YF1A 2DJ0A 3IXRA 5G1LA 3DXBA 4MJEA 3TOUA 1CQGA 2OKAA 2GSSA 3MAKA 2HYXA 4DVCA 3L78A 4E8EA 3KTBA 2ON5A 4IGJA 2H6ZA 2QC7A 4EC0A 2Z9SA 4IW9A 1FVKA 3EURA 3W6GA 2PVQA 2HSMB 2D2ZA 2KHPA 3LEFA 3H1NA 1XW9A 1YJ6A 2H70A 1ZYQB 2NTOA 1SENA 5A4UA 5B8AA 2JSYA 2KOKA 2PMTA 3HJOA 1F9MA 5ECQB 1FB0A 4GSSA 6GSTA 1ABAA 1NW2A 1OC8A 1XIYA 2P31A 4IN0A 5AIVA 2R3XA 2HE3A 4ZIJA 4Z7XA 5AIXA 4BVYA 2H73A 3F4TA 2PGTA 3WGEA 3TJJA 6GSWA 4X1UA 3IRAA 4O92A 4ZBDA 2JZRA 2VIMA 1TXXA 4KCAA 3MDKA 2FLSA 5LD0A 4BL7B 3KZQA 1B9XC 4RQXA 5ECHB 2O8VB 3UAPA 1HD2A 1GTAA 1XXUA 3D4MA 3O76A 4BA7A 4JEDA 2B7JA 4E8HA 4IQ1A 5A5KA 1O7UA 22GSA 2YWOA 1LBKA 2VCZA 1WE0A 2FNOA 2CVDA 4BWQA 4MF6A 1F3BA 3TKSA 3SBCA 3JCML 1I5GA 4Z2RA 4EIPA 1U3IA 3C7MA 1PRXA 1BX9A 2R37A 3BD2A 2K9FA 3G9BA 1KNGA 5DJLA 1WP0A 3HY2A 3TOTA 2H30A 1SVOA 1TU8A 4V1Ap 1GTUA 5ECIB 2O5VA 1S3AA 4HZ2A 5GSSA 3L9UA 5D9VA 1B4PA 4KF9A 1A0FA 1THXA 4KA0A 4LLRA 4JE1A 4MPGA 2O89A 2XPEA 1PX7A 1JZOA 3GL5A 2V6OA 5ECLB 4POBA 5ENUA 1BJXA 3P7XA 4ECJA 2LNTA 1M2DA 2JU5A 19GSA 1SD8A 2EIQA 4G0LA 5IMFA 1SJIA 3LGCA 2ZCTA 3KP9A 3VWVA 1EP7A 3ZL5A 3K8NA 2VL3A 2G0FA 1JFUA 1SD9A 2REMA 4QL7A 1PL1A 3QAWA 3GKKA 4ILFA 4GTUA 4KH7A 4BVYB 4EVMA 1YQ1A 4YKGA 3EE2A 1SJ6A 3EU4A 3HVSA 2QKEA 2JADA 3DVXA 2PERA 4XCSA 2OE1A 2DBCA 4X43A 3EC3A 2PUKC 1FO5A 4PQIA 3ZREA 2VM2A 4O5RA 4POLA 4ZB8A 2B6MA 1XVQA 1K0NA 3F4SA 2B3SA 5IMZA 2A4VA 1EV4A 4KUNA 1HNAA 4J56E 5G5FA 1GSFA 3J7Yb 2C0EA 2X4AA 4XIHA 2FCHA 3DEXA 1WOUA 4KCEA 4WR4A 4EE0A 3HJPA 1GUMA 4NMUA 4Z2UA 2LUSA 1K3OA 4I6XA 2OJLA 2VKZG 4NAXA 5J40A 3LFLA 4ZB7A 1Z3EA 3I9V2 4O7HA 1F3AA 3A2VA 4BPYA 1Q4JA 2WDUA 3ZRDA 3A5IA 1H75A 1F2EA 1K0OA 3C73A 1B4QA 1ZCPA 1C72A 5G5EA 3TKSC 4V2MA 2FD3A 2K8VA 1LJRA 2IMIA 5GAPD 5ECPB 4EKZA 5ECRB 3NOFA 3GKMA 5CNWA 3QR6A 3DYRA 2R0PA 3NIVA 2C1YA 4O5UA 4ZXGA 3CYNA 4HS1A 1OVNA 4KDUA 5G31A 1EGOA 2XBQA 3HVVA 3KGKA 3GKXA 2YWMA 3GSTA 1DSBA 4GDFA 1GRXA 1V57A 1XVWA 3GRXA 4ULXA 1G0TA 3IHQA 4LA1A 1USBA 1KBNA 6GSUA 5CRGA 2CZ3A 2EC4A 1FHEA 2O7KA 5BRTA 1TW9A 3I43A 6GSXA 2EFEA 2AV4A 3BBYA 4N3ZA 1GUKA 2TRXA 2CAIA 1MD3A 2JZSA 4FH8A 1S3CA 4I2TA 2H1LA 1EGRA 3ERGA 2GQKA 4FIWA 4K8MA 1ZYEA 3QMXA 1A2LA 3TKRA 3KTLA 4K6XA 4XRAA 4OWYA 2WB9A 3VFIA 1V9WA 1SKRB 1GH2A 1QQ2A 5A5HA 1SK1A 1GLPA 5J4UA 4XS1A 3ED3A 2CA8A 5IMVA 2VCWA 1GTIA 1TXUA 4PNGA 4PQHA 4RI6A 2RM6A 1XPVA 5D8IA 4FO5A 1U3AA 4ZBBA 4NWYA 2HSNA 3KP8A 4PNFA 4K2XA 1TOFA 1GSSA 2HRKA 2F51A 5A34B 4POMA 3VI7A 4MJCA 2VCQA 1XW5A 3F9UA 1AC1A 1PMTA 2MMAA 3CMIA 2A2PA 3APQA 2B1LA 1GTBA 4P3YB 3HJMA 2GZYA 2HQTA 1M0UA 2OADA 1T4ZA 4POKA 3FW2A 5G1KA 3D5JA 1TRUA 2C80A 5DALA 1S3DA 3TKQA 5D9WA 3FY7A 1F6MC 2RUEA 3TJKA 1M2BA 3LWAA 4TOPA 3DKSA 2C3QA 2CX4A 4TR3A 3CTGA 1OC9A 4ZILA 3KD0A 5CO3A 4F82A 4PX1A 1KTEA 4IQAA 3IPZA 4EIQA 1BAYA 3P90A 3VWUA 1V40A 2LKUA 1DE1A 4N10A 2A2SA 5F05A 3ZITA 2C3TA 2I3YA 3HZ8A 4JR6A 4HU7A 2VAFA 4MNNA 3RBTA 4TW5A 2HLSA 4FYBA 2B7KA 2VUPA 3FZ4A 2HT9A 5KN2A 3WGDA 5DDLA 3M9KA 3ME8A 3FKFA 4TR1A 2H6YA 1TRWA 1NSWA 4HJMA 4QMKA 3LW9A 2IMKA 2MBTA 5CRDA 3UEMA 4ECCA 1FAAA 3L9VA 1W4VA 4Z2TA 3J7Yk 3VURA 3CBUA 3DD3A 2A4HA 2LQOA 1A2MA 1OKDA 4HOJA 2H0IA 2YANA 3U6VA 2V32A 5E59A 3CXGA 1TDIA 2GTUA 5A5HB 3I6AA 5IPGA 2ZNMA 4K5RA 2M80A 1FOVA 3EPTA 1XWAA 2YOIA 5HR2A 5EY6A 5DCHA 3IBHA 2JSZA 3KMNA 4GLTA 2WS2A 4WETA 3GMFA 4F2IA 4FYCA 1VGLA 4J2FA 3QOUA 4KB3A 17GSA 1U88A 5LCZA 1SK0A 1RK4A 4EDZA 1M9AA 4WXTA 2HSNB 4NHWA 2X64A 3DRNA 3MNGA 4DEJA 2FY6A 2HRKB 5J3RA 5FT3A 4MABA 4F03A 1AUCA 2XBIA 4LMVA 4MF7A 4IKHA 5HQPA 1FB6A 4L5OA 3TRPA 1PN0A 5A4WA 3KM6A 1GSQA 3LSZA 2HXKA 1CQHA 5J9BA 1Z7RA 4H86A 1YEPA 2VCXA 2MMNA 4XS6A 3KIJA 1V98A 4G0KA 5DALB 1OE7A 4PQ1A 5J4VA 2LV3A 1SKWB 3RHCA 2DC5A 2VO4A 1JHBA 2GQMA 1OC9B 4OCEA 3G7IA 4EXJA 3PGTA 3W8JA 1BYEA 4OFMA 2DSAA 1ZZYA 1K0AA 3GTUA 4Q5FA 1IYHA 3ZIVA 2DJKA 1XOBA 5F8BA 3W8SA 2H71A 2FHEA 5E4WA 4BVXB 1TI3A 5H5RA 3HMJG 4TRXA 1XWCA 2CV4A 3HXSA 2BMXA 2X8GA 4TR1B 3A2XA 5EVOA 4WBRD 4HQZA 1UA5A 3LYKA 3TKSE 1ERTA 4EL1A 1XWKA 3HA9A 2YP6A 5GZZB 1ZL9A 5BMUB 3EMPA 4RUVA 3ZFBA 1UC7A 1O8XA 3U5RE 4MF5A 2PBJA 3HHVA 2YZHA 1PL2A 2QA2A 3L9SA 4EF0A 4WEYA 1TU7A 4KW6A 4NPBA 3IAM2 4MK3A 4MZWA 1QMVA 2B1KA 3G7JA 5LNKe 3A5WA 2HSHA 2H0GA 5KN3A 2I4AA 1BG5A 5ABRA 1TK5B 2FWFA 5FWGA 3E3EA 4DSRA 1SYXA 5F07A 1X5DA 4DSSA 2WGRA 1SL2B 3IE3A 2ON7A 2L6CA 2PN8A 4PGTA 4YQUA 2IFQB 4IBPA 3KH7A 1SJZA 4O32A 2DJ1A 2UV8G 5AGYA 4AF2A 1U87A 3UBLA 5A4VA 3HCZA 4JU5A 1SKSB 2JACA 1YKCA 2VL9A 4NV5A 4WBJA 3QPMA 4KGIA 1E6BA 2KP2A 4MZCA 2I1UA 4N30A 1XCCA 1ZMAA 3GN3A 3TCOA 1YKAA 4K7NA 1QGVA 2YZUA 2LSTA 4IVFA 5IMDA 3HYPA 2GQLA 2WFCA 2E7PA 4ICYA 2B5YA 3IDVA 2CVBA 2LRTA 5IO0A 1F37A 1UN2A 4MA9A 1M7TA 4K5SA 3GTUB 1R5AA 5D9XA 5IMAA 2YPMA 2DKHA 4OD7A 2GT5A 4AKHA 1Z5YE 2C0FA 3GV1A 3DMLA 5JWRB 4USSA 5JCGA 3F0IA 4GWRA 4YQMA 12GSA 5A34A 2J9HA 14GSA 1H4OA 2P0GA 4CHSA 1X9SB 1AQVA 1GUHA 4MH2A 5JCUA 2LJKA 2WULA 4Q5RA 2YWIA 2GLRA 3MWHA 2K18A 2LRNA 1PA3A 2VD1A 2X8CA 3GFKA 5KOWA 3QD9A 2XPDA 2V1MA 5KEJA 1VF4A 4ML1A 1EEJA 3D4TA 3VLNA 1YF0A 1QUWA 3GL3A 3BCIA 2AUVA 4I8BA 4GQCA 2R5GA 2LRCA 3LORA 5HR3A 1XWGA 5EL8A 3ZMLA 1K3YA 1Z6NA 3ZVJD 3GUSA 4NXIA 5D93A 3KMOA 1NHYA 4HDEA 1WJKA 3TDGA 2CX3A 1T8EB 2H01A 2VD0A 5D96A 4JR4A 5J4YA 2VOCA 5ECNB 3UARA 3TU3B 4EO3A 3UMAA 6GSSA 4F0BA 4AI6A 3TKPA 2JL4A 2FWEA 1HQOA 2HI7A 5KN1A 3WGXA 3LXZA 1FOHA 1TTZA 4DSSB 1SL0B 1THOA 1V58A 1RQMA 3ZYWA 5J41A 5J9CA 4KDXA 4W66A 2IIYA 5IM9A 1HYUA 1GSUA 4AKGA 1EP8A 5JWQB 3TB2A 2YV7A 5A1NA 1A2JA 3GX8A 4L0WA 1ACVA 3VWXA 2J23A 20GSA 4CY8A 4J57E 2IMDA 1EOGA 4ML6A 1FW1A 3D22A 2OE3A 3BOAA 1AXDA 2UZ8A 3FHKA 3APSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZL9 A;  1Y6E A;  2ALB A;  1XWB A;  2X99 A;  3RDW A;  2CT6 A;  2GSR A;  4GST A;  3VK9 A;  2CVK A;  2L59 A;  4ECI A;  5CRW A;  3TRQ A;  2C8U A;  2L4C A;  1GWC A;  4LL4 B;  1DBY A;  5G30 A;  3CSI A;  3D0Z A;  2R4V A;  2GDR A;  2X8H A;  3UIW A;  3C71 A;  1UVZ A;  2AYT A;  4I5Q A;  1AIU A;  4HQS A;  2VM1 A;  1N8J A;  3TJB A;  1J9B A;  3F4R A;  7GSS A;  2HZF A;  1B8X A;  2VLU A;  2FA4 A;  3QDN A;  2PWJ A;  5INY A;  1HNB A;  5GAN D;  2WRT A;  4OFN A;  5DQS A;  3LG6 A;  3D21 A;  2C4J A;  1YZX A;  5CRH A;  5C00 A;  1PX6 A;  10GS A;  4XS4 A;  1A8Y A;  1QFN A;  2HZE A;  4ZB9 A;  3N5O A;  2H72 A;  2QGV A;  1QXH A;  1AAZ A;  1MEK A;  5L71 A;  3TGZ A;  5ID2 A;  2GS3 A;  2NVL A;  3EIN A;  4KSO A;  3LXT A;  2V2G A;  3GHA A;  2MZC A;  1VF1 A;  3LYP A;  5HFK A;  2LS5 A;  4HZ4 A;  3GKN A;  4MJA A;  2HNL A;  5ELG A;  2IN3 A;  4KDY A;  1ERW A;  1JLW A;  1JZD A;  1MDJ A;  3HZ4 A;  5IOW A;  2WCI A;  4HI7 A;  3C1S A;  5F0G A;  3Q18 A;  2E2G A;  2H1B A;  1X9W B;  2KP1 A;  2LTK A;  5B6N A;  5DCG A;  1A0R P;  4BVX A;  3DIE A;  2MYG A;  3ZLP A;  3O3T A;  3GA4 A;  3VI5 A;  5CP1 A;  5DAK B;  2RUF A;  5CAX A;  3PPU A;  2H0H A;  4GRF A;  3DWV A;  1G7O A;  4GCI A;  3US3 A;  4GQF A;  1X5E A;  3H79 A;  2HRA A;  4IS0 A;  3KJY A;  3CSH A;  1NHO A;  5BMU A;  1ZOF A;  1XBS A;  3ZIJ A;  5KN0 A;  6GSY A;  3M9J A;  4WKW A;  2K6V A;  1PKZ A;  4YH2 A;  1VRS D;  1R7H A;  3LQ7 A;  3HKR A;  5DJM A;  2H19 A;  5D9T A;  3VPT A;  5F06 A;  5HR0 A;  1A24 A;  3D6I A;  3UOM A;  2RII A;  3FR9 A;  2YN1 A;  1GNW A;  2OBI A;  5AN1 A;  1TJD A;  3QFA C;  1AQX A;  1JZR A;  1M99 A;  1EOH A;  5IQY A;  1WPI A;  4KND A;  1T00 A;  4K7O A;  3FR3 A;  1OYJ A;  3F63 A;  3EVI A;  1GSE A;  3GUR A;  3MSZ A;  2KUC A;  4NHZ A;  1X0R A;  2N5B A;  2QSI A;  18GS A;  2MBS A;  3IK9 A;  3SWL A;  3A3T A;  1NM3 A;  2HRN A;  4K2D A;  2YWN A;  1O85 A;  2M46 A;  2F8F A;  3WT1 A;  4I2U A;  3P2A A;  5GST A;  2IFQ A;  5C04 A;  1FVJ A;  4N11 A;  4XS4 B;  3BJ5 A;  4IHU A;  1ILO A;  4JZQ A;  2HZE B;  1K3L A;  4PUA A;  1JZW A;  4EDY A;  5ID2 B;  4QL9 A;  1T1V A;  5H5S A;  3QAV A;  1RW1 A;  1V2A A;  3ZFL A;  5G2Z A;  2G2Q A;  4IEL A;  4G10 A;  1PGT A;  1B48 A;  4IJ3 A;  4YAV A;  1A23 A;  3HDC A;  13GS A;  1QK8 A;  2YCD A;  2L5O A;  4DSQ A;  1TK8 B;  2L5L A;  1OKT A;  5HFG A;  4RI7 A;  3M8N A;  4OFT A;  2HSY A;  2R2J A;  2IMF A;  3QFB C;  2F8A A;  2NPB A;  3VWW A;  2F3M A;  1EEM A;  2L4Q A;  1R4W A;  4PTS A;  4K7I A;  2MMO A;  3TRX A;  1TRS A;  2GZP A;  1PN9 A;  3ERW A;  3KCM A;  4N0Z A;  1K0B A;  4TN8 A;  1GSD A;  3Q6O A;  2BTO T;  4JRR A;  5ECO B;  3IC8 A;  3GH6 A;  3TJG A;  1M2A A;  3N9J A;  4D73 A;  4OO4 A;  2YJH A;  2V6K A;  4QQ7 A;  1SK2 A;  3WD6 A;  2XHF A;  2CZ2 A;  2AAW A;  1MD4 A;  3FR6 A;  4V2N A;  2VCT A;  2IL3 A;  3GH9 A;  3F3R A;  4N0V A;  3GIX A;  2H66 A;  1J08 A;  1G6Y A;  1WMJ A;  1X5C A;  4XTS A;  2V41 A;  3O6T A;  2TRC P;  3PIN A;  4XRD A;  3IC4 A;  5IMC A;  2N5A A;  2GZZ A;  5D73 A;  3S9F A;  4CW9 A;  3CRT A;  2VCV A;  2AB6 A;  1M9B A;  2L6D A;  4GSN A;  3IV4 A;  3PH9 A;  2AJQ B;  9GSS A;  5IIZ A;  3FZA A;  4NV2 A;  3PR8 A;  3GYK A;  3LJR A;  4OO5 A;  4IP6 A;  4TXV A;  1EV9 A;  3CTF A;  2H76 A;  2YNX A;  4HEA 2;  5ECK B;  1PKW A;  5HFI A;  2OAC A;  2KLX A;  2FA8 A;  5DBQ A;  1B9Y C;  1SU9 A;  3E9J B;  4YAP A;  3CRU A;  2GST A;  4KSM A;  3RAZ A;  1W89 A;  3KEB A;  2FGX A;  4GXZ A;  1Z9H A;  4ACS A;  1XW6 A;  1GNE A;  2GGT A;  2H6X A;  3F8U A;  3EYT A;  4TKY A;  1X9M B;  4IJI A;  3EMX A;  3EU3 A;  2FWG A;  4KX4 A;  8GSS A;  1E2Y A;  2L57 A;  4FQU A;  2JZT A;  3VPQ A;  1YY7 A;  4L5L A;  1R26 A;  4MLY A;  3UVT A;  2H1G A;  1HNC A;  4ECB A;  1FG4 A;  4L0U A;  2VL2 A;  2B5E A;  4AJ8 A;  3Q74 A;  1JLV A;  2K8S A;  2XC2 A;  3KH9 A;  3OR5 A;  4YQV A;  1T4Y A;  4LL1 B;  1PD2 1;  1G6W A;  3P8W A;  1PSQ A;  2TIR A;  3TUE A;  3E0U A;  3IK7 A;  1K0C A;  2NBS A;  2C3N A;  2CQ9 A;  5CRE A;  1MDI A;  5IPH A;  3ZVJ A;  3G7Y A;  5IOX A;  4WF5 A;  4TXO A;  2DML A;  3CSJ A;  2M72 A;  4Q5N A;  2IME A;  2OA7 A;  1VF3 A;  2GT6 A;  2PVO C;  3FEU A;  1KEB A;  1XFL A;  4JBB A;  4L8E A;  3IA1 A;  3RHB A;  4OMV A;  4AJ7 A;  1GUL A;  3ME7 A;  4RQR A;  4D73 B;  2GVP A;  5CYY A;  4MPF A;  3H8Q A;  4K1F A;  4XHM A;  1AW9 A;  2H74 A;  2P5R A;  4ZB6 A;  2R6K A;  2FUG 2;  1SYR A;  3HVX A;  2FWH A;  1DUG A;  3QAG A;  5FHI A;  1A8L A;  4K0G A;  3UJ1 A;  5J5N A;  2HRF A;  1WRY A;  2ZUP A;  3DVW A;  2RM5 A;  4LMW A;  4TR0 A;  3L0H A;  1XZO A;  2PPT A;  2OE0 A;  1ST9 A;  4GF0 A;  3M1G A;  5JWO B;  4ID0 A;  2E0Q A;  1GP1 A;  1OC3 A;  5H5Q A;  4Q5Q A;  6GSV A;  4HUA A;  3GSS A;  2DIY A;  2LJA A;  3V1W A;  4IP1 A;  3UL3 A;  3F3Q A;  5DAK A;  1O6J A;  3FYG A;  4AGS A;  3F6D A;  2LQQ A;  2OBK A;  2VLV A;  1J0F A;  2RLI A;  5B7C A;  1GL8 A;  1ERV A;  4WR5 A;  1Z7P A;  2P5Q A;  4MCU A;  3H4K A;  4ZBA A;  3FRC A;  1K0D A;  2IPA A;  4MH3 A;  4TVE A;  4CDO A;  2YV9 A;  4ZL8 A;  1AQW A;  3APO A;  2CAQ A;  4K9Z A;  2I9H A;  2NDO A;  1Y25 A;  2DIZ A;  2WJU A;  3IR4 A;  4G19 A;  5B6M A;  1YDK A;  4TR4 A;  1VF2 A;  4PUR A;  1ZGN A;  2DMM A;  2VL2 C;  3FK8 A;  1ML6 A;  3F6F A;  1TKD B;  4TXO B;  4ISD A;  1IYI A;  3IAS 2;  1TP9 A;  3ZZX A;  2DJJ A;  1T7P B;  3FZ5 A;  1ON4 A;  3RPP A;  4MMM A;  3UVH A;  3FZ9 A;  2F9S A;  2N5F A;  3ERF A;  2C0D A;  3WT2 A;  2DJ2 A;  2YJ7 A;  5DVB A;  2H8L A;  3QCP A;  3EWL A;  1OAZ A;  3C1R A;  2O85 A;  2IWT A;  4BWS A;  2DLX A;  5JCW A;  16GS A;  4KAE A;  3BCK A;  1URM A;  3ISO A;  3M0F A;  1DE2 A;  2PU9 C;  3IOS A;  1O81 A;  2HSM A;  5AIS A;  1K0M A;  1GLQ A;  4HJ2 A;  3ZTL A;  1PQN A;  5B8B A;  2A2R A;  2BJX A;  2VLT A;  5DQY A;  1O73 A;  1OE8 A;  2AHE A;  1U6T A;  3AY8 A;  4X0X A;  2DJ3 A;  2O87 A;  5IO2 A;  4F9Z A;  4V1A g;  1TK0 B;  1YEX A;  1TI1 A;  3H93 A;  5HR1 A;  3C8E A;  2HFD A;  3KXO A;  1BQ7 A;  2H1A A;  3ZMK A;  1EZK A;  2LEG A;  2LNS A;  4EUY A;  1MDK A;  1Q98 A;  3R2Q A;  3R3E A;  11GS A;  5ECM B;  3UBK A;  3NZN A;  4WF4 A;  3HD5 A;  3A2W A;  2EIO A;  1EWX A;  2B5X A;  2GSQ A;  2EIR A;  3GX0 A;  4HU9 A;  2WZ9 A;  1MTC A;  2ES7 A;  1BED A;  4OCF A;  4PUF C;  3WYW A;  5COH A;  4BL7 A;  1N2A A;  1I9D A;  2E2M A;  4MZB A;  4I97 A;  1LU4 A;  5EPF A;  2H1D A;  3M3M A;  1R5P A;  1ERU A;  3L4N A;  2IJY A;  4G9H A;  1TRV A;  3DGQ A;  3I69 A;  3Q19 A;  4KE3 A;  4FYU A;  1GSY A;  4ZL7 A;  2I81 A;  4V2L A;  1XOA A;  4MDC A;  4PXO A;  4G0I A;  2LJR A;  4MP4 A;  1Z6M A;  5ELA A;  4G2E A;  2H75 A;  5ECS A;  3RPN A;  4K0N A;  4F0C A;  2C0G A;  1SL1 B;  1T3B A;  3GNJ A;  3TJF A;  1WWJ A;  1O8W A;  2MMZ A;  1G7E A;  4AJ6 A;  1WIK A;  4MJB A;  1YF1 A;  2DJ0 A;  3IXR A;  5G1L A;  3DXB A;  4MJE A;  3TOU A;  1CQG A;  2OKA A;  2GSS A;  3MAK A;  2HYX A;  4DVC A;  3L78 A;  4E8E A;  3KTB A;  2ON5 A;  4IGJ A;  2H6Z A;  2QC7 A;  4EC0 A;  2Z9S A;  4IW9 A;  1FVK A;  3EUR A;  3W6G A;  2PVQ A;  2HSM B;  2D2Z A;  2KHP A;  3LEF A;  3H1N A;  1XW9 A;  1YJ6 A;  2H70 A;  1ZYQ B;  2NTO A;  1SEN A;  5A4U A;  5B8A A;  2JSY A;  2KOK A;  2PMT A;  3HJO A;  1F9M A;  5ECQ B;  1FB0 A;  4GSS A;  6GST A;  1ABA A;  1NW2 A;  1OC8 A;  1XIY A;  2P31 A;  4IN0 A;  5AIV A;  2R3X A;  2HE3 A;  4ZIJ A;  4Z7X A;  5AIX A;  4BVY A;  2H73 A;  3F4T A;  2PGT A;  3WGE A;  3TJJ A;  6GSW A;  4X1U A;  3IRA A;  4O92 A;  4ZBD A;  2JZR A;  2VIM A;  1TXX A;  4KCA A;  3MDK A;  2FLS A;  5LD0 A;  4BL7 B;  3KZQ A;  1B9X C;  4RQX A;  5ECH B;  2O8V B;  3UAP A;  1HD2 A;  1GTA A;  1XXU A;  3D4M A;  3O76 A;  4BA7 A;  4JED A;  2B7J A;  4E8H A;  4IQ1 A;  5A5K A;  1O7U A;  22GS A;  2YWO A;  1LBK A;  2VCZ A;  1WE0 A;  2FNO A;  2CVD A;  4BWQ A;  4MF6 A;  1F3B A;  3TKS A;  3SBC A;  3JCM L;  1I5G A;  1U3I A;  3C7M A;  1PRX A;  1BX9 A;  2R37 A;  3BD2 A;  2K9F A;  3G9B A;  1KNG A;  5DJL A;  1WP0 A;  3HY2 A;  3TOT A;  2H30 A;  1TU8 A;  4V1A p;  1GTU A;  5ECI B;  1S3A A;  4HZ2 A;  5GSS A;  3L9U A;  5D9V A;  1B4P A;  4KF9 A;  1A0F A;  1THX A;  4KA0 A;  4LLR A;  4JE1 A;  4MPG A;  2O89 A;  2XPE A;  1PX7 A;  1JZO A;  3GL5 A;  2V6O A;  5ECL B;  4POB A;  5ENU A;  1BJX A;  3P7X A;  4ECJ A;  2LNT A;  1M2D A;  2JU5 A;  19GS A;  1SD8 A;  2EIQ A;  4G0L A;  5IMF A;  1SJI A;  3LGC A;  2ZCT A;  3KP9 A;  3VWV A;  1EP7 A;  3ZL5 A;  3K8N A;  2VL3 A;  2G0F A;  1JFU A;  1SD9 A;  2REM A;  4QL7 A;  1PL1 A;  3QAW A;  3GKK A;  4ILF A;  4GTU A;  4KH7 A;  4BVY B;  4EVM A;  1YQ1 A;  3EE2 A;  1SJ6 A;  3EU4 A;  3HVS A;  2QKE A;  2JAD A;  3DVX A;  2PER A;  4XCS A;  2OE1 A;  2DBC A;  4X43 A;  3EC3 A;  2PUK C;  1FO5 A;  4PQI A;  3ZRE A;  2VM2 A;  4O5R A;  4POL A;  4ZB8 A;  2B6M A;  1XVQ A;  1K0N A;  3F4S A;  2B3S A;  5IMZ A;  2A4V A;  1EV4 A;  4KUN A;  1HNA A;  4J56 E;  5G5F A;  1GSF A;  3J7Y b;  2C0E A;  4XIH A;  2FCH A;  3DEX A;  1WOU A;  4KCE A;  4WR4 A;  4EE0 A;  3HJP A;  1GUM A;  4NMU A;  2LUS A;  1K3O A;  4I6X A;  2OJL A;  4NAX A;  3LFL A;  1Z3E A;  3I9V 2;  4O7H A;  1F3A A;  3A2V A;  4BPY A;  1Q4J A;  2WDU A;  3ZRD A;  1H75 A;  1F2E A;  1K0O A;  3C73 A;  1B4Q A;  1ZCP A;  1C72 A;  5G5E A;  3TKS C;  4V2M A;  2FD3 A;  2K8V A;  1LJR A;  2IMI A;  5GAP D;  5ECP B;  4EKZ A;  5ECR B;  3NOF A;  3GKM A;  5CNW A;  3QR6 A;  3DYR A;  3NIV A;  2C1Y A;  4ZXG A;  3CYN A;  4HS1 A;  1OVN A;  4KDU A;  5G31 A;  1EGO A;  2XBQ A;  3HVV A;  3KGK A;  3GKX A;  2YWM A;  3GST A;  1DSB A;  1GRX A;  1V57 A;  1XVW A;  3GRX A;  4ULX A;  1G0T A;  3IHQ A;  4LA1 A;  1USB A;  1KBN A;  6GSU A;  5CRG A;  2CZ3 A;  2EC4 A;  1FHE A;  2O7K A;  1TW9 A;  3I43 A;  6GSX A;  2AV4 A;  3BBY A;  1GUK A;  2TRX A;  2CAI A;  1MD3 A;  2JZS A;  4FH8 A;  1S3C A;  4I2T A;  1EGR A;  3ERG A;  2GQK A;  4FIW A;  4K8M A;  1ZYE A;  3QMX A;  1A2L A;  3TKR A;  3KTL A;  4K6X A;  4XRA A;  4OWY A;  2WB9 A;  3VFI A;  1V9W A;  1SKR B;  1GH2 A;  1QQ2 A;  1SK1 A;  1GLP A;  5J4U A;  4XS1 A;  3ED3 A;  2CA8 A;  5IMV A;  2VCW A;  1GTI A;  4PNG A;  4PQH A;  4RI6 A;  2RM6 A;  1XPV A;  5D8I A;  4FO5 A;  1U3A A;  4ZBB A;  4NWY A;  3KP8 A;  4PNF A;  1TOF A;  1GSS A;  2HRK A;  2F51 A;  4POM A;  3VI7 A;  4MJC A;  2VCQ A;  1XW5 A;  3F9U A;  1AC1 A;  1PMT A;  2MMA A;  3CMI A;  3APQ A;  2B1L A;  1GTB A;  4P3Y B;  3HJM A;  2GZY A;  2HQT A;  1M0U A;  2OAD A;  1T4Z A;  4POK A;  3FW2 A;  5G1K A;  3D5J A;  1TRU A;  2C80 A;  5DAL A;  1S3D A;  3TKQ A;  5D9W A;  3FY7 A;  1F6M C;  2RUE A;  3TJK A;  1M2B A;  3LWA A;  4TOP A;  3DKS A;  2C3Q A;  2CX4 A;  4TR3 A;  3CTG A;  1OC9 A;  4ZIL A;  3KD0 A;  5CO3 A;  4F82 A;  4PX1 A;  1KTE A;  4IQA A;  3IPZ A;  1BAY A;  3P90 A;  3VWU A;  1V40 A;  2LKU A;  1DE1 A;  4N10 A;  2A2S A;  5F05 A;  3ZIT A;  2C3T A;  2I3Y A;  3HZ8 A;  4JR6 A;  4HU7 A;  2VAF A;  3RBT A;  4TW5 A;  2HLS A;  4FYB A;  2B7K A;  2VUP A;  3FZ4 A;  2HT9 A;  5KN2 A;  3WGD A;  5DDL A;  3M9K A;  3ME8 A;  3FKF A;  4TR1 A;  2H6Y A;  1TRW A;  1NSW A;  4HJM A;  2IMK A;  2MBT A;  5CRD A;  3UEM A;  4ECC A;  1FAA A;  3L9V A;  1W4V A;  3J7Y k;  3VUR A;  3CBU A;  3DD3 A;  2LQO A;  1A2M A;  1OKD A;  4HOJ A;  2H0I A;  2YAN A;  3U6V A;  2V32 A;  5E59 A;  3CXG A;  1TDI A;  2GTU A;  3I6A A;  5IPG A;  2ZNM A;  2M80 A;  1FOV A;  1XWA A;  2YOI A;  5HR2 A;  5EY6 A;  5DCH A;  3IBH A;  2JSZ A;  3KMN A;  4GLT A;  2WS2 A;  4WET A;  3GMF A;  4F2I A;  4FYC A;  1VGL A;  4J2F A;  3QOU A;  4KB3 A;  17GS A;  1U88 A;  5LCZ A;  1SK0 A;  1RK4 A;  4EDZ A;  1M9A A;  4WXT A;  2HSN B;  4NHW A;  2X64 A;  3DRN A;  3MNG A;  4DEJ A;  2FY6 A;  2HRK B;  5J3R A;  5FT3 A;  4MAB A;  4F03 A;  1AUC A;  2XBI A;  4LMV A;  4MF7 A;  4IKH A;  5HQP A;  1FB6 A;  4L5O A;  3TRP A;  5A4W A;  3KM6 A;  1GSQ A;  3LSZ A;  2HXK A;  1CQH A;  5J9B A;  1Z7R A;  4H86 A;  1YEP A;  2VCX A;  2MMN A;  4XS6 A;  3KIJ A;  1V98 A;  4G0K A;  5DAL B;  1OE7 A;  4PQ1 A;  2LV3 A;  1SKW B;  3RHC A;  2DC5 A;  2VO4 A;  1JHB A;  2GQM A;  1OC9 B;  4OCE A;  3G7I A;  4EXJ A;  3PGT A;  3W8J A;  1BYE A;  4OFM A;  2DSA A;  1ZZY A;  1K0A A;  3GTU A;  4Q5F A;  1IYH A;  3ZIV A;  2DJK A;  1XOB A;  5F8B A;  3W8S A;  2H71 A;  2FHE A;  5E4W A;  4BVX B;  1TI3 A;  5H5R A;  4TRX A;  1XWC A;  2CV4 A;  3HXS A;  2BMX A;  2X8G A;  4TR1 B;  3A2X A;  5EVO A;  4WBR D;  4HQZ A;  1UA5 A;  3LYK A;  3TKS E;  1ERT A;  4EL1 A;  1XWK A;  3HA9 A;  2YP6 A;  5GZZ B;  1ZL9 A;  3EMP A;  4RUV A;  3ZFB A;  1UC7 A;  1O8X A;  3U5R E;  4MF5 A;  2PBJ A;  3HHV A;  2YZH A;  1PL2 A;  3L9S A;  4EF0 A;  4WEY A;  1TU7 A;  4KW6 A;  4NPB A;  3IAM 2;  4MK3 A;  4MZW A;  1QMV A;  2B1K A;  3G7J A;  5LNK e;  3A5W A;  2HSH A;  2H0G A;  5KN3 A;  2I4A A;  1BG5 A;  5ABR A;  1TK5 B;  2FWF A;  5FWG A;  3E3E A;  4DSR A;  1SYX A;  5F07 A;  1X5D A;  4DSS A;  2WGR A;  1SL2 B;  3IE3 A;  2ON7 A;  2L6C A;  2PN8 A;  4PGT A;  4YQU A;  2IFQ B;  4IBP A;  3KH7 A;  1SJZ A;  4O32 A;  2DJ1 A;  5AGY A;  4AF2 A;  1U87 A;  4JU5 A;  3UBL A;  5A4V A;  3HCZ A;  1SKS B;  2JAC A;  1YKC A;  2VL9 A;  4NV5 A;  4WBJ A;  3QPM A;  4KGI A;  1E6B A;  2KP2 A;  4MZC A;  2I1U A;  4N30 A;  1XCC A;  1ZMA A;  3GN3 A;  3TCO A;  1YKA A;  4K7N A;  1QGV A;  2YZU A;  2LST A;  4IVF A;  5IMD A;  3HYP A;  2GQL A;  2WFC A;  2E7P A;  2B5Y A;  3IDV A;  2CVB A;  2LRT A;  5IO0 A;  1F37 A;  1UN2 A;  4MA9 A;  1M7T A;  3GTU B;  1R5A A;  5D9X A;  5IMA A;  2YPM A;  4OD7 A;  2GT5 A;  1Z5Y E;  2C0F A;  3GV1 A;  3DML A;  5JWR B;  4USS A;  5JCG A;  3F0I A;  4GWR A;  4YQM A;  12GS A;  2J9H A;  14GS A;  1H4O A;  2P0G A;  4CHS A;  1X9S B;  1AQV A;  1GUH A;  4MH2 A;  5JCU A;  2LJK A;  2WUL A;  4Q5R A;  2YWI A;  2GLR A;  3MWH A;  2K18 A;  2LRN A;  1PA3 A;  2VD1 A;  2X8C A;  3GFK A;  3QD9 A;  2XPD A;  2V1M A;  5KEJ A;  1VF4 A;  4ML1 A;  1EEJ A;  3D4T A;  3VLN A;  1YF0 A;  1QUW A;  3GL3 A;  3BCI A;  2AUV A;  4I8B A;  4GQC A;  2R5G A;  2LRC A;  3LOR A;  5HR3 A;  1XWG A;  5EL8 A;  3ZML A;  1K3Y A;  1Z6N A;  3ZVJ D;  3GUS A;  4NXI A;  5D93 A;  3KMO A;  1NHY A;  4HDE A;  1WJK A;  3TDG A;  2CX3 A;  1T8E B;  2H01 A;  2VD0 A;  5D96 A;  4JR4 A;  2VOC A;  5ECN B;  3UAR A;  4EO3 A;  3UMA A;  6GSS A;  4F0B A;  3TKP A;  2JL4 A;  2FWE A;  1HQO A;  2HI7 A;  5KN1 A;  3WGX A;  3LXZ A;  1TTZ A;  4DSS B;  1SL0 B;  1THO A;  1V58 A;  1RQM A;  3ZYW A;  5J41 A;  5J9C A;  4KDX A;  2IIY A;  5IM9 A;  1HYU A;  1GSU A;  1EP8 A;  5JWQ B;  3TB2 A;  2YV7 A;  1A2J A;  3GX8 A;  4L0W A;  1ACV A;  3VWX A;  2J23 A;  20GS A;  4J57 E;  2IMD A;  1EOG A;  4ML6 A;  1FW1 A;  3D22 A;  2OE3 A;  3BOA A;  1AXD A;  2UZ8 A;  3FHK A;  3APS A; 
#chains in the Genus database with same CATH topology
 4ZL9 A;  1Y6E A;  2ALB A;  1XWB A;  2X99 A;  3RDW A;  2CT6 A;  2GSR A;  4GST A;  3VK9 A;  1I1I P;  2CVK A;  2L59 A;  3CWG A;  4ECI A;  2X49 A;  5CRW A;  3TRQ A;  2C8U A;  2L4C A;  2WVX B;  1GWC A;  1SVM A;  4LL4 B;  1DBY A;  5G30 A;  3CSI A;  1SVL A;  3D0Z A;  2R4V A;  2GDR A;  2X8H A;  3UIW A;  3C71 A;  1UVZ A;  2AYT A;  4I5Q A;  1AIU A;  4HQS A;  2VM1 A;  1N8J A;  3TJB A;  1J9B A;  3F4R A;  7GSS A;  2HZF A;  1B8X A;  2VLU A;  2FA4 A;  3QDN A;  2PWJ A;  5INY A;  1HNB A;  5GAN D;  2WRT A;  4OFN A;  5DQS A;  3LG6 A;  3D21 A;  2C4J A;  1YZX A;  5CRH A;  5C00 A;  1PX6 A;  10GS A;  4XS4 A;  1A8Y A;  1QFN A;  2HZE A;  4ZB9 A;  3N5O A;  2H72 A;  2QGV A;  1QXH A;  1AAZ A;  1MEK A;  5L71 A;  3TGZ A;  5ID2 A;  2GS3 A;  2NVL A;  3EIN A;  4KSO A;  3LXT A;  2V2G A;  3GHA A;  2MZC A;  1VF1 A;  3LYP A;  5HFK A;  2LS5 A;  4HZ4 A;  3GKN A;  4MJA A;  2HNL A;  5ELG A;  2IN3 A;  4KDY A;  1ERW A;  1JLW A;  1JZD A;  1MDJ A;  3HZ4 A;  5IOW A;  2WCI A;  4HI7 A;  3C1S A;  5F0G A;  3Q18 A;  2E2G A;  2H1B A;  1X9W B;  2KP1 A;  2LTK A;  5B6N A;  5DCG A;  1A0R P;  4BVX A;  3DIE A;  2MYG A;  3ZLP A;  3O3T A;  3GA4 A;  3VI5 A;  5CP1 A;  5DAK B;  2RUF A;  5CAX A;  3PPU A;  2H0H A;  4GRF A;  3DWV A;  1G7O A;  4GCI A;  3US3 A;  4GQF A;  1X5E A;  2DKI A;  3MIX A;  3H79 A;  2HRA A;  4IS0 A;  3KJY A;  5A1N B;  3CSH A;  1NHO A;  5BMU A;  1ZOF A;  1XBS A;  3ZIJ A;  5KN0 A;  6GSY A;  3M9J A;  4WKW A;  2K6V A;  1PKZ A;  4YH2 A;  1VRS D;  1R7H A;  3LQ7 A;  3HKR A;  5DJM A;  2H19 A;  5D9T A;  3VPT A;  5F06 A;  5HR0 A;  1A24 A;  3D6I A;  3UOM A;  2RII A;  3FR9 A;  2YN1 A;  1GNW A;  2OBI A;  5AN1 A;  1TJD A;  1AQX A;  1JZR A;  1M99 A;  3QFA C;  1EOH A;  5IQY A;  1WPI A;  4KND A;  5J47 A;  1T00 A;  4K7O A;  3FR3 A;  1OYJ A;  3F63 A;  3EVI A;  1GSE A;  3GUR A;  3MSZ A;  2KUC A;  4NHZ A;  1X0R A;  2N5B A;  2QSI A;  18GS A;  2MBS A;  3IK9 A;  3SWL A;  3A3T A;  1NM3 A;  2HRN A;  4K2D A;  2YWN A;  1O85 A;  2M46 A;  2F8F A;  3WT1 A;  4I2U A;  3P2A A;  5GST A;  2IFQ A;  5C04 A;  1FVJ A;  4N11 A;  4XS4 B;  3BJ5 A;  4IHU A;  1ILO A;  4JZQ A;  2HZE B;  1K3L A;  4PUA A;  1JZW A;  4EDY A;  5ID2 B;  4QL9 A;  1T1V A;  5H5S A;  3QAV A;  1RW1 A;  1V2A A;  3ZFL A;  5G2Z A;  2G2Q A;  4IEL A;  4G10 A;  1PGT A;  1B48 A;  4IJ3 A;  4YAV A;  1A23 A;  3HDC A;  13GS A;  1QK8 A;  2YCD A;  2L5O A;  4DSQ A;  1TK8 B;  2L5L A;  1OKT A;  5HFG A;  4RI7 A;  3M8N A;  4OFT A;  2HSY A;  2R2J A;  2IMF A;  3QFB C;  2F8A A;  2NPB A;  3VWW A;  2F3M A;  1EEM A;  2L4Q A;  1R4W A;  1BG1 A;  4PTS A;  4K7I A;  1M3J A;  2MMO A;  3TRX A;  4YKF A;  1TRS A;  2GZP A;  1PN9 A;  3ERW A;  3KCM A;  4N0Z A;  1M3I A;  1K0B A;  4TN8 A;  1GSD A;  1N25 A;  3Q6O A;  2BTO T;  4JRR A;  5ECO B;  3IC8 A;  3GH6 A;  3TJG A;  1M2A A;  3N9J A;  4D73 A;  4OO4 A;  2YJH A;  4PHZ C;  2V6K A;  4QQ7 A;  1SK2 A;  3WD6 A;  2XHF A;  2CZ2 A;  2AAW A;  4A5P A;  1MD4 A;  3FR6 A;  4V2N A;  2VCT A;  4E68 A;  2IL3 A;  3GH9 A;  3F3R A;  4N0V A;  1S4B P;  3GIX A;  2H66 A;  1J08 A;  1G6Y A;  1WMJ A;  1X5C A;  4XTS A;  2V41 A;  3O6T A;  2TRC P;  3PIN A;  4XRD A;  1YVL A;  3IC4 A;  5IMC A;  2N5A A;  1ZYN A;  2GZZ A;  5D73 A;  3S9F A;  4CW9 A;  3CRT A;  2VCV A;  2AB6 A;  1M9B A;  2L6D A;  4GSN A;  3IV4 A;  3PH9 A;  2AJQ B;  9GSS A;  5IIZ A;  4X4J A;  3FZA A;  4NV2 A;  3PR8 A;  3GYK A;  3LJR A;  4OO5 A;  4IP6 A;  4TXV A;  1EV9 A;  3CTF A;  2H76 A;  2YNX A;  4HEA 2;  5ECK B;  1PKW A;  5HFI A;  2OAC A;  2KLX A;  2FA8 A;  5DBQ A;  1B9Y C;  1SU9 A;  3E9J B;  4YAP A;  3CRU A;  2GST A;  4KSM A;  3RAZ A;  1W89 A;  2WW3 A;  3KEB A;  2FGX A;  4GXZ A;  1Z9H A;  4ACS A;  1XW6 A;  1GNE A;  2GGT A;  2H6X A;  3F8U A;  3EYT A;  4TKY A;  1X9M B;  4IJI A;  4HSC X;  3EMX A;  3EU3 A;  2FWG A;  2R0G A;  4KX4 A;  8GSS A;  1E2Y A;  2L57 A;  4FQU A;  2JZT A;  3VPQ A;  1YY7 A;  4L5L A;  1R26 A;  4MLY A;  3UVT A;  2H1G A;  1HNC A;  4ECB A;  1FG4 A;  4L0U A;  2VL2 A;  5KOX A;  2B5E A;  4AJ8 A;  3Q74 A;  1JLV A;  2K8S A;  2XC2 A;  3KH9 A;  3OR5 A;  4YQV A;  1T4Y A;  4LL1 B;  1PD2 1;  1G6W A;  3P8W A;  1PSQ A;  2TIR A;  3TUE A;  3E0U A;  3IK7 A;  4G01 A;  1K0C A;  2NBS A;  1Y1U A;  2C3N A;  2CQ9 A;  5CRE A;  1MDI A;  5IPH A;  3ZVJ A;  3G7Y A;  5IOX A;  4WF5 A;  4TXO A;  2DML A;  3CSJ A;  2M72 A;  4Q5N A;  2IME A;  2OA7 A;  1VF3 A;  2GT6 A;  2PVO C;  3FEU A;  1KEB A;  1XFL A;  2EFD A;  4JBB A;  4L8E A;  3IA1 A;  3RHB A;  4OMV A;  4AJ7 A;  4FXY P;  1GUL A;  3ME7 A;  2O36 A;  4RQR A;  4D73 B;  2GVP A;  5CYY A;  4MPF A;  3H8Q A;  1PFO A;  4K1F A;  4XHM A;  1AW9 A;  2H74 A;  2P5R A;  4ZB6 A;  2R6K A;  2FUG 2;  1SYR A;  3HVX A;  2FWH A;  1DUG A;  3QAG A;  5FHI A;  1A8L A;  4K0G A;  3UJ1 A;  5J5N A;  2HRF A;  1WRY A;  2ZUP A;  3CHX C;  3DVW A;  2RM5 A;  2EFC A;  4LMW A;  4TR0 A;  3L0H A;  1XZO A;  2PPT A;  2OE0 A;  1ST9 A;  4GF0 A;  3M1G A;  5JWO B;  4ID0 A;  2E0Q A;  1GP1 A;  3IHG A;  1OC3 A;  5H5Q A;  4Q5Q A;  6GSV A;  4HUA A;  3GSS A;  1ZYP A;  2DIY A;  2LJA A;  3V1W A;  4IP1 A;  3UL3 A;  3F3Q A;  5DAK A;  1O6J A;  3FYG A;  4AGS A;  3F6D A;  2LQQ A;  2OBK A;  2VLV A;  4PI0 C;  1J0F A;  2EFH A;  2RLI A;  5B7C A;  1GL8 A;  1ERV A;  4WR5 A;  2OT3 A;  1Z7P A;  2P5Q A;  4MCU A;  3H4K A;  4ZBA A;  3FMW A;  3FRC A;  1K0D A;  2IPA A;  4MH3 A;  4TVE A;  4CDO A;  2YV9 A;  4ZL8 A;  1AQW A;  3APO A;  2CAQ A;  4K9Z A;  2I9H A;  2NDO A;  1Y25 A;  2DIZ A;  2WJU A;  3IR4 A;  4G19 A;  2WW0 A;  5B6M A;  1YDK A;  4TR4 A;  1VF2 A;  4PUR A;  2R0C A;  1ZGN A;  2DMM A;  2VL2 C;  3FK8 A;  1ML6 A;  3F6F A;  1TKD B;  4TXO B;  4ISD A;  1IYI A;  3IAS 2;  1TP9 A;  1S3R A;  3ZZX A;  2WW2 A;  2DJJ A;  1T7P B;  3FZ5 A;  1ON4 A;  3RPP A;  4MMM A;  3UVH A;  3FZ9 A;  2F9S A;  2N5F A;  3ERF A;  2C0D A;  3WT2 A;  2DJ2 A;  2YJ7 A;  5DVB A;  2H8L A;  3QCP A;  3EWL A;  1OAZ A;  1XG8 A;  3C1R A;  2O85 A;  2IWT A;  4BWS A;  2DLX A;  5JCW A;  16GS A;  4KAE A;  3BCK A;  3MYD A;  1URM A;  3ISO A;  3M0F A;  1DE2 A;  2PU9 C;  3IOS A;  1O81 A;  2HSM A;  5AIS A;  1K0M A;  1GLQ A;  4HJ2 A;  3ZTL A;  1PQN A;  5B8B A;  2A2R A;  2BJX A;  2VLT A;  5DQY A;  1O73 A;  1OE8 A;  2AHE A;  1U6T A;  3AY8 A;  4X0X A;  2DJ3 A;  2O87 A;  5IO2 A;  4F9Z A;  4V1A g;  1TK0 B;  1YEX A;  1BF5 A;  4CY6 A;  1TI1 A;  3H93 A;  5HR1 A;  3C8E A;  2HFD A;  3KXO A;  1BQ7 A;  2H1A A;  3ZMK A;  1EZK A;  2LEG A;  3CQF A;  2LNS A;  4EUY A;  1MDK A;  1Q98 A;  3R2Q A;  3R3E A;  11GS A;  5ECM B;  3UBK A;  3NZN A;  4WF4 A;  3HD5 A;  3A2W A;  2EIO A;  1EWX A;  2B5X A;  2GSQ A;  2QA1 A;  2EIR A;  3GX0 A;  4HU9 A;  2WZ9 A;  1MTC A;  4AKX B;  1BED A;  2ES7 A;  4OCF A;  4PUF C;  3WYW A;  5COH A;  4BL7 A;  1N2A A;  1I9D A;  2E2M A;  4MZB A;  4I97 A;  1LU4 A;  5EPF A;  2H1D A;  3M3M A;  1R5P A;  1ERU A;  3L4N A;  2IJY A;  4G9H A;  1TRV A;  3DGQ A;  3I69 A;  3Q19 A;  4KE3 A;  4FYU A;  1GSY A;  4ZL7 A;  2I81 A;  4V2L A;  1XOA A;  4MDC A;  4PXO A;  2LJR A;  4G0I A;  4MP4 A;  1Z6M A;  5ELA A;  4G2E A;  2H75 A;  5ECS A;  3RPN A;  4O5Q A;  4K0N A;  4F0C A;  2C0G A;  1SL1 B;  4AKI A;  1T3B A;  3GNJ A;  3TJF A;  1WWJ A;  1O8W A;  2MMZ A;  1G7E A;  4AJ6 A;  1WIK A;  4MJB A;  1YF1 A;  2DJ0 A;  3IXR A;  5G1L A;  3DXB A;  4MJE A;  3TOU A;  1CQG A;  2OKA A;  2GSS A;  3MAK A;  2HYX A;  4DVC A;  3L78 A;  4E8E A;  3KTB A;  2ON5 A;  4IGJ A;  2H6Z A;  2QC7 A;  4EC0 A;  2Z9S A;  4IW9 A;  1FVK A;  3EUR A;  3W6G A;  2PVQ A;  2HSM B;  2D2Z A;  2KHP A;  3LEF A;  2WZS A;  3H1N A;  1YJ6 A;  1XW9 A;  2H70 A;  1ZYQ B;  2NTO A;  1SEN A;  5A4U A;  5B8A A;  2JSY A;  2KOK A;  2PMT A;  3HJO A;  1F9M A;  5ECQ B;  1FB0 A;  4GSS A;  6GST A;  1ABA A;  1NW2 A;  1OC8 A;  1XIY A;  2P31 A;  4IN0 A;  5AIV A;  2R3X A;  2HE3 A;  4ZIJ A;  4Z7X A;  5AIX A;  4BVY A;  2H73 A;  3F4T A;  2PGT A;  3WGE A;  3TJJ A;  6GSW A;  4X1U A;  3IRA A;  4O92 A;  4ZBD A;  2JZR A;  2VIM A;  1TXX A;  4KCA A;  3MDK A;  2FLS A;  5LD0 A;  4BL7 B;  3KZQ A;  1B9X C;  2WW1 A;  5ECH B;  4RQX A;  2O8V B;  3UAP A;  1HD2 A;  1GTA A;  1XXU A;  3D4M A;  2WVY A;  3O76 A;  4BA7 A;  4JED A;  1YEW C;  2B7J A;  4E8H A;  4IQ1 A;  5A5K A;  1O7U A;  22GS A;  2YWO A;  1LBK A;  2VCZ A;  1WE0 A;  2FNO A;  2CVD A;  4BWQ A;  4MF6 A;  1F3B A;  3TKS A;  3SBC A;  3JCM L;  1I5G A;  4Z2R A;  4EIP A;  1U3I A;  3C7M A;  1PRX A;  1BX9 A;  2R37 A;  3BD2 A;  2K9F A;  3G9B A;  1KNG A;  5DJL A;  1WP0 A;  3HY2 A;  3TOT A;  2H30 A;  1SVO A;  1TU8 A;  4V1A p;  1GTU A;  5ECI B;  2O5V A;  1S3A A;  4HZ2 A;  5GSS A;  3L9U A;  5D9V A;  1B4P A;  4KF9 A;  1A0F A;  1THX A;  4KA0 A;  4LLR A;  4JE1 A;  4MPG A;  2O89 A;  2XPE A;  1PX7 A;  1JZO A;  3GL5 A;  2V6O A;  5ECL B;  4POB A;  5ENU A;  1BJX A;  3P7X A;  4ECJ A;  2LNT A;  1M2D A;  2JU5 A;  19GS A;  1SD8 A;  2EIQ A;  4G0L A;  5IMF A;  1SJI A;  3LGC A;  2ZCT A;  3KP9 A;  3VWV A;  1EP7 A;  3ZL5 A;  3K8N A;  2VL3 A;  2G0F A;  1JFU A;  1SD9 A;  2REM A;  4QL7 A;  1PL1 A;  3QAW A;  3GKK A;  4ILF A;  4GTU A;  4KH7 A;  4BVY B;  4EVM A;  1YQ1 A;  4YKG A;  2WVZ A;  3EE2 A;  1SJ6 A;  3EU4 A;  3HVS A;  2QKE A;  2JAD A;  3DVX A;  2PER A;  4XCS A;  2OE1 A;  2DBC A;  4X43 A;  3EC3 A;  2PUK C;  1FO5 A;  4PQI A;  3ZRE A;  2VM2 A;  4O5R A;  4POL A;  4ZB8 A;  2B6M A;  1XVQ A;  1K0N A;  3F4S A;  2B3S A;  5IMZ A;  2A4V A;  1EV4 A;  4KUN A;  1HNA A;  4J56 E;  5G5F A;  1GSF A;  3J7Y b;  2C0E A;  2X4A A;  4XIH A;  2FCH A;  3DEX A;  1WOU A;  4KCE A;  4WR4 A;  4EE0 A;  3HJP A;  1GUM A;  4NMU A;  4PI2 C;  4Z2U A;  2LUS A;  1K3O A;  4I6X A;  2OJL A;  2VKZ G;  4NAX A;  5J40 A;  3LFL A;  4ZB7 A;  1Z3E A;  3I9V 2;  4O7H A;  1F3A A;  3A2V A;  4BPY A;  1Q4J A;  2WDU A;  3ZRD A;  3A5I A;  1H75 A;  1F2E A;  1K0O A;  3C73 A;  1B4Q A;  1ZCP A;  1C72 A;  5G5E A;  3TKS C;  4V2M A;  2FD3 A;  2K8V A;  1LJR A;  2IMI A;  5GAP D;  5ECP B;  4EKZ A;  5ECR B;  3NOF A;  3GKM A;  5CNW A;  3QR6 A;  3DYR A;  2R0P A;  3NIV A;  2C1Y A;  4O5U A;  4ZXG A;  3CYN A;  4HS1 A;  1OVN A;  4KDU A;  5G31 A;  1EGO A;  3RFR C;  2XBQ A;  3HVV A;  3KGK A;  3GKX A;  2YWM A;  3GST A;  1DSB A;  4GDF A;  1GRX A;  1V57 A;  1XVW A;  3GRX A;  4ULX A;  1G0T A;  3IHQ A;  4LA1 A;  1USB A;  1KBN A;  6GSU A;  5CRG A;  2CZ3 A;  2EC4 A;  1FHE A;  2O7K A;  5BRT A;  1TW9 A;  3I43 A;  6GSX A;  2EFE A;  2AV4 A;  3BBY A;  4N3Z A;  1GUK A;  2TRX A;  2CAI A;  1MD3 A;  2JZS A;  4FH8 A;  1S3C A;  4I2T A;  2H1L A;  1EGR A;  3ERG A;  2GQK A;  4FIW A;  4K8M A;  1ZYE A;  3QMX A;  1A2L A;  3TKR A;  3KTL A;  4K6X A;  4XRA A;  4OWY A;  2WB9 A;  3VFI A;  1V9W A;  2O3E A;  1SKR B;  1GH2 A;  1QQ2 A;  5A5H A;  1SK1 A;  1GLP A;  5J4U A;  4XS1 A;  3ED3 A;  2CA8 A;  5IMV A;  2VCW A;  1GTI A;  1TXU A;  4PNG A;  4PQH A;  4RI6 A;  2RM6 A;  1XPV A;  5D8I A;  4FO5 A;  1U3A A;  4ZBB A;  4NWY A;  2HSN A;  3KP8 A;  4PNF A;  4K2X A;  1TOF A;  1GSS A;  2HRK A;  2F51 A;  5A34 B;  4POM A;  3VI7 A;  4MJC A;  2VCQ A;  1XW5 A;  3F9U A;  1AC1 A;  1PMT A;  2MMA A;  3CMI A;  2A2P A;  3APQ A;  3RGB C;  2B1L A;  1GTB A;  4P3Y B;  3HJM A;  2GZY A;  2HQT A;  1M0U A;  2OAD A;  1T4Z A;  4POK A;  3FW2 A;  5G1K A;  3D5J A;  1TRU A;  2C80 A;  5DAL A;  1S3D A;  3TKQ A;  5D9W A;  3FY7 A;  1F6M C;  2RUE A;  3TJK A;  1M2B A;  3LWA A;  4TOP A;  3DKS A;  2C3Q A;  2CX4 A;  4TR3 A;  3CTG A;  1OC9 A;  4ZIL A;  3KD0 A;  5CO3 A;  4F82 A;  4PX1 A;  1KTE A;  4IQA A;  3IPZ A;  4EIQ A;  3HVN A;  1BAY A;  3P90 A;  3VWU A;  1V40 A;  2LKU A;  1DE1 A;  4N10 A;  2A2S A;  5F05 A;  3ZIT A;  2C3T A;  2I3Y A;  3HZ8 A;  4JR6 A;  4HU7 A;  2VAF A;  4MNN A;  3RBT A;  4TW5 A;  2HLS A;  4FYB A;  2B7K A;  2VUP A;  3FZ4 A;  2HT9 A;  5KN2 A;  3WGD A;  5DDL A;  3M9K A;  3ME8 A;  3FKF A;  4TR1 A;  2H6Y A;  1TRW A;  1NSW A;  4HJM A;  4QMK A;  3LW9 A;  2IMK A;  2MBT A;  5CRD A;  3UEM A;  4ECC A;  1FAA A;  3L9V A;  1W4V A;  4Z2T A;  3J7Y k;  3VUR A;  3CBU A;  3DD3 A;  2A4H A;  2LQO A;  1A2M A;  1OKD A;  4HOJ A;  2H0I A;  2YAN A;  3U6V A;  2V32 A;  5E59 A;  3CXG A;  1TDI A;  2GTU A;  5A5H B;  3I6A A;  5IPG A;  2ZNM A;  4K5R A;  2M80 A;  1FOV A;  3EPT A;  1XWA A;  2YOI A;  5HR2 A;  5EY6 A;  5DCH A;  3IBH A;  2JSZ A;  3KMN A;  4GLT A;  2WS2 A;  4WET A;  3GMF A;  4F2I A;  4FYC A;  1VGL A;  4J2F A;  3QOU A;  4KB3 A;  17GS A;  1U88 A;  5LCZ A;  1SK0 A;  1RK4 A;  4EDZ A;  1M9A A;  4WXT A;  2HSN B;  4NHW A;  2X64 A;  3DRN A;  3MNG A;  4DEJ A;  2FY6 A;  2HRK B;  5J3R A;  5FT3 A;  4MAB A;  4F03 A;  1AUC A;  2XBI A;  4LMV A;  4MF7 A;  4IKH A;  5HQP A;  1FB6 A;  4L5O A;  3TRP A;  1PN0 A;  5A4W A;  3KM6 A;  1GSQ A;  3LSZ A;  2HXK A;  1CQH A;  5J9B A;  1Z7R A;  4H86 A;  1YEP A;  2VCX A;  2MMN A;  4XS6 A;  3KIJ A;  1V98 A;  4G0K A;  5DAL B;  1OE7 A;  4PQ1 A;  5J4V A;  2LV3 A;  1SKW B;  3RHC A;  2DC5 A;  2VO4 A;  1JHB A;  2GQM A;  1OC9 B;  4OCE A;  3G7I A;  4EXJ A;  3PGT A;  3W8J A;  1BYE A;  4OFM A;  2DSA A;  1ZZY A;  1K0A A;  3GTU A;  4Q5F A;  1IYH A;  3ZIV A;  2DJK A;  1XOB A;  5F8B A;  3W8S A;  2H71 A;  2FHE A;  5E4W A;  4BVX B;  1TI3 A;  5H5R A;  3HMJ G;  4TRX A;  1XWC A;  2CV4 A;  3HXS A;  2BMX A;  2X8G A;  4TR1 B;  3A2X A;  5EVO A;  4WBR D;  4HQZ A;  1UA5 A;  3LYK A;  3TKS E;  1ERT A;  4EL1 A;  1XWK A;  3HA9 A;  2YP6 A;  5GZZ B;  1ZL9 A;  5BMU B;  3EMP A;  4RUV A;  3ZFB A;  1UC7 A;  1O8X A;  3U5R E;  4MF5 A;  2PBJ A;  3HHV A;  2YZH A;  1PL2 A;  2QA2 A;  3L9S A;  4EF0 A;  4WEY A;  1TU7 A;  4KW6 A;  4NPB A;  3IAM 2;  4MK3 A;  4MZW A;  1QMV A;  2B1K A;  3G7J A;  5LNK e;  3A5W A;  2HSH A;  2H0G A;  5KN3 A;  2I4A A;  1BG5 A;  5ABR A;  1TK5 B;  2FWF A;  5FWG A;  3E3E A;  4DSR A;  1SYX A;  5F07 A;  1X5D A;  4DSS A;  2WGR A;  1SL2 B;  3IE3 A;  2ON7 A;  2L6C A;  2PN8 A;  4PGT A;  4YQU A;  2IFQ B;  4IBP A;  3KH7 A;  1SJZ A;  4O32 A;  2DJ1 A;  2UV8 G;  5AGY A;  4AF2 A;  1U87 A;  3UBL A;  5A4V A;  3HCZ A;  4JU5 A;  1SKS B;  2JAC A;  1YKC A;  2VL9 A;  4NV5 A;  4WBJ A;  3QPM A;  4KGI A;  1E6B A;  2KP2 A;  4MZC A;  2I1U A;  4N30 A;  1XCC A;  1ZMA A;  3GN3 A;  3TCO A;  1YKA A;  4K7N A;  1QGV A;  2YZU A;  2LST A;  4IVF A;  5IMD A;  3HYP A;  2GQL A;  2WFC A;  2WVX A;  2E7P A;  4ICY A;  2B5Y A;  3IDV A;  2CVB A;  2LRT A;  5IO0 A;  1F37 A;  1UN2 A;  4MA9 A;  1M7T A;  4K5S A;  3GTU B;  1R5A A;  5D9X A;  5IMA A;  2YPM A;  2DKH A;  4OD7 A;  2GT5 A;  4AKH A;  1Z5Y E;  2C0F A;  3GV1 A;  3DML A;  5JWR B;  4USS A;  5JCG A;  3F0I A;  4GWR A;  4YQM A;  12GS A;  5A34 A;  2J9H A;  14GS A;  1H4O A;  2P0G A;  4CHS A;  1X9S B;  1AQV A;  1GUH A;  4MH2 A;  5JCU A;  2LJK A;  2WUL A;  4Q5R A;  2YWI A;  2GLR A;  3MWH A;  2K18 A;  2LRN A;  1PA3 A;  2VD1 A;  2X8C A;  3GFK A;  5KOW A;  3QD9 A;  2XPD A;  2V1M A;  5KEJ A;  1VF4 A;  4ML1 A;  1EEJ A;  3D4T A;  3VLN A;  1YF0 A;  1QUW A;  3GL3 A;  3BCI A;  2AUV A;  4I8B A;  4GQC A;  2R5G A;  2LRC A;  3LOR A;  5HR3 A;  1XWG A;  5EL8 A;  3ZML A;  1K3Y A;  1Z6N A;  3ZVJ D;  3GUS A;  4NXI A;  5D93 A;  3KMO A;  1NHY A;  4HDE A;  1WJK A;  3TDG A;  2CX3 A;  1T8E B;  2H01 A;  2VD0 A;  5D96 A;  4JR4 A;  5J4Y A;  2VOC A;  5ECN B;  3UAR A;  3TU3 B;  4EO3 A;  3UMA A;  6GSS A;  4F0B A;  4AI6 A;  3TKP A;  2JL4 A;  2FWE A;  1HQO A;  2HI7 A;  5KN1 A;  3WGX A;  3LXZ A;  1FOH A;  1TTZ A;  4DSS B;  1SL0 B;  1THO A;  1V58 A;  1RQM A;  3ZYW A;  5J41 A;  5J9C A;  4KDX A;  4W66 A;  2IIY A;  5IM9 A;  1HYU A;  1GSU A;  4AKG A;  1EP8 A;  5JWQ B;  3TB2 A;  2YV7 A;  5A1N A;  1A2J A;  3GX8 A;  4L0W A;  1ACV A;  3VWX A;  2J23 A;  20GS A;  4CY8 A;  4J57 E;  2IMD A;  1EOG A;  4ML6 A;  1FW1 A;  3D22 A;  2OE3 A;  3BOA A;  1AXD A;  2UZ8 A;  3FHK A;  3APS A;  4BIK A; 
#chains in the Genus database with same CATH homology
 4ZL9 A;  1Y6E A;  2ALB A;  1XWB A;  2X99 A;  3RDW A;  2CT6 A;  2GSR A;  4GST A;  3VK9 A;  2CVK A;  2L59 A;  3CWG A;  4ECI A;  2X49 A;  5CRW A;  3TRQ A;  2C8U A;  2L4C A;  1GWC A;  1SVM A;  4LL4 B;  1DBY A;  5G30 A;  3CSI A;  1SVL A;  3D0Z A;  2R4V A;  2GDR A;  2X8H A;  3UIW A;  3C71 A;  1UVZ A;  2AYT A;  4I5Q A;  1AIU A;  4HQS A;  2VM1 A;  1N8J A;  3TJB A;  1J9B A;  3F4R A;  7GSS A;  2HZF A;  1B8X A;  2VLU A;  2FA4 A;  3QDN A;  2PWJ A;  5INY A;  1HNB A;  5GAN D;  2WRT A;  4OFN A;  5DQS A;  3LG6 A;  3D21 A;  2C4J A;  1YZX A;  5CRH A;  5C00 A;  1PX6 A;  10GS A;  4XS4 A;  1A8Y A;  1QFN A;  2HZE A;  4ZB9 A;  3N5O A;  2H72 A;  2QGV A;  1QXH A;  1AAZ A;  1MEK A;  5L71 A;  3TGZ A;  5ID2 A;  2GS3 A;  2NVL A;  3EIN A;  4KSO A;  3LXT A;  2V2G A;  3GHA A;  2MZC A;  1VF1 A;  3LYP A;  5HFK A;  2LS5 A;  4HZ4 A;  3GKN A;  4MJA A;  2HNL A;  5ELG A;  2IN3 A;  4KDY A;  1ERW A;  1JLW A;  1JZD A;  1MDJ A;  3HZ4 A;  5IOW A;  2WCI A;  4HI7 A;  3C1S A;  5F0G A;  3Q18 A;  2E2G A;  2H1B A;  1X9W B;  2KP1 A;  2LTK A;  5B6N A;  5DCG A;  1A0R P;  4BVX A;  3DIE A;  2MYG A;  3ZLP A;  3O3T A;  3GA4 A;  3VI5 A;  5CP1 A;  5DAK B;  2RUF A;  5CAX A;  3PPU A;  2H0H A;  4GRF A;  3DWV A;  1G7O A;  4GCI A;  3US3 A;  4GQF A;  1X5E A;  2DKI A;  3MIX A;  3H79 A;  2HRA A;  4IS0 A;  3KJY A;  5A1N B;  3CSH A;  1NHO A;  5BMU A;  1ZOF A;  1XBS A;  3ZIJ A;  5KN0 A;  6GSY A;  3M9J A;  4WKW A;  2K6V A;  1PKZ A;  4YH2 A;  1VRS D;  1R7H A;  3LQ7 A;  3HKR A;  5DJM A;  2H19 A;  5D9T A;  3VPT A;  5F06 A;  5HR0 A;  1A24 A;  3D6I A;  3UOM A;  2RII A;  3FR9 A;  2YN1 A;  1GNW A;  2OBI A;  5AN1 A;  1TJD A;  1AQX A;  1JZR A;  1M99 A;  3QFA C;  1EOH A;  5IQY A;  1WPI A;  4KND A;  5J47 A;  1T00 A;  4K7O A;  3FR3 A;  1OYJ A;  3F63 A;  3EVI A;  1GSE A;  3GUR A;  3MSZ A;  2KUC A;  4NHZ A;  1X0R A;  2N5B A;  2QSI A;  18GS A;  2MBS A;  3IK9 A;  3SWL A;  3A3T A;  1NM3 A;  2HRN A;  4K2D A;  2YWN A;  1O85 A;  2M46 A;  2F8F A;  3WT1 A;  4I2U A;  3P2A A;  5GST A;  2IFQ A;  5C04 A;  1FVJ A;  4N11 A;  4XS4 B;  3BJ5 A;  4IHU A;  1ILO A;  4JZQ A;  2HZE B;  1K3L A;  4PUA A;  1JZW A;  4EDY A;  5ID2 B;  4QL9 A;  1T1V A;  5H5S A;  3QAV A;  1RW1 A;  1V2A A;  3ZFL A;  5G2Z A;  2G2Q A;  4IEL A;  4G10 A;  1PGT A;  1B48 A;  4IJ3 A;  4YAV A;  1A23 A;  3HDC A;  13GS A;  1QK8 A;  2YCD A;  2L5O A;  4DSQ A;  1TK8 B;  2L5L A;  1OKT A;  5HFG A;  4RI7 A;  3M8N A;  4OFT A;  2HSY A;  2R2J A;  2IMF A;  3QFB C;  2F8A A;  2NPB A;  3VWW A;  2F3M A;  1EEM A;  2L4Q A;  1R4W A;  1BG1 A;  4PTS A;  4K7I A;  2MMO A;  3TRX A;  4YKF A;  1TRS A;  2GZP A;  1PN9 A;  3ERW A;  3KCM A;  4N0Z A;  1K0B A;  4TN8 A;  1GSD A;  1N25 A;  3Q6O A;  2BTO T;  4JRR A;  5ECO B;  3IC8 A;  3GH6 A;  3TJG A;  1M2A A;  3N9J A;  4D73 A;  4OO4 A;  2YJH A;  2V6K A;  4QQ7 A;  1SK2 A;  3WD6 A;  2XHF A;  2CZ2 A;  2AAW A;  4A5P A;  1MD4 A;  3FR6 A;  4V2N A;  2VCT A;  4E68 A;  2IL3 A;  3GH9 A;  3F3R A;  4N0V A;  3GIX A;  2H66 A;  1J08 A;  1G6Y A;  1WMJ A;  1X5C A;  4XTS A;  2V41 A;  3O6T A;  2TRC P;  3PIN A;  4XRD A;  1YVL A;  3IC4 A;  5IMC A;  2N5A A;  1ZYN A;  2GZZ A;  5D73 A;  3S9F A;  4CW9 A;  3CRT A;  2VCV A;  2AB6 A;  1M9B A;  2L6D A;  4GSN A;  3IV4 A;  3PH9 A;  2AJQ B;  9GSS A;  5IIZ A;  4X4J A;  3FZA A;  4NV2 A;  3PR8 A;  3GYK A;  3LJR A;  4OO5 A;  4IP6 A;  4TXV A;  1EV9 A;  3CTF A;  2H76 A;  2YNX A;  4HEA 2;  5ECK B;  1PKW A;  5HFI A;  2OAC A;  2KLX A;  2FA8 A;  5DBQ A;  1B9Y C;  1SU9 A;  3E9J B;  4YAP A;  3CRU A;  2GST A;  4KSM A;  3RAZ A;  1W89 A;  3KEB A;  2FGX A;  4GXZ A;  1Z9H A;  4ACS A;  1XW6 A;  1GNE A;  2GGT A;  2H6X A;  3F8U A;  3EYT A;  4TKY A;  1X9M B;  4IJI A;  3EMX A;  3EU3 A;  2FWG A;  2R0G A;  4KX4 A;  8GSS A;  1E2Y A;  2L57 A;  4FQU A;  2JZT A;  3VPQ A;  1YY7 A;  4L5L A;  1R26 A;  4MLY A;  3UVT A;  2H1G A;  1HNC A;  4ECB A;  1FG4 A;  4L0U A;  2VL2 A;  5KOX A;  2B5E A;  4AJ8 A;  3Q74 A;  1JLV A;  2K8S A;  2XC2 A;  3KH9 A;  3OR5 A;  4YQV A;  1T4Y A;  4LL1 B;  1PD2 1;  1G6W A;  3P8W A;  1PSQ A;  2TIR A;  3TUE A;  3E0U A;  3IK7 A;  4G01 A;  1K0C A;  2NBS A;  1Y1U A;  2C3N A;  2CQ9 A;  5CRE A;  1MDI A;  5IPH A;  3ZVJ A;  3G7Y A;  5IOX A;  4WF5 A;  4TXO A;  2DML A;  3CSJ A;  2M72 A;  4Q5N A;  2IME A;  2OA7 A;  1VF3 A;  2GT6 A;  2PVO C;  3FEU A;  1KEB A;  1XFL A;  2EFD A;  4JBB A;  4L8E A;  3IA1 A;  3RHB A;  4OMV A;  4AJ7 A;  1GUL A;  3ME7 A;  4RQR A;  4D73 B;  2GVP A;  5CYY A;  4MPF A;  3H8Q A;  4K1F A;  4XHM A;  1AW9 A;  2H74 A;  2P5R A;  4ZB6 A;  2R6K A;  2FUG 2;  1SYR A;  3HVX A;  2FWH A;  1DUG A;  3QAG A;  5FHI A;  1A8L A;  4K0G A;  3UJ1 A;  5J5N A;  2HRF A;  1WRY A;  2ZUP A;  3DVW A;  2RM5 A;  2EFC A;  4LMW A;  4TR0 A;  3L0H A;  1XZO A;  2PPT A;  2OE0 A;  1ST9 A;  4GF0 A;  3M1G A;  5JWO B;  4ID0 A;  2E0Q A;  1GP1 A;  3IHG A;  1OC3 A;  5H5Q A;  4Q5Q A;  6GSV A;  4HUA A;  3GSS A;  1ZYP A;  2DIY A;  2LJA A;  3V1W A;  4IP1 A;  3UL3 A;  3F3Q A;  5DAK A;  1O6J A;  3FYG A;  4AGS A;  3F6D A;  2LQQ A;  2OBK A;  2VLV A;  1J0F A;  2EFH A;  2RLI A;  5B7C A;  1GL8 A;  1ERV A;  4WR5 A;  2OT3 A;  1Z7P A;  2P5Q A;  4MCU A;  3H4K A;  4ZBA A;  3FMW A;  3FRC A;  1K0D A;  2IPA A;  4MH3 A;  4TVE A;  4CDO A;  2YV9 A;  4ZL8 A;  1AQW A;  3APO A;  2CAQ A;  4K9Z A;  2I9H A;  2NDO A;  1Y25 A;  2DIZ A;  2WJU A;  3IR4 A;  4G19 A;  5B6M A;  1YDK A;  4TR4 A;  1VF2 A;  4PUR A;  2R0C A;  1ZGN A;  2DMM A;  2VL2 C;  3FK8 A;  1ML6 A;  3F6F A;  1TKD B;  4TXO B;  4ISD A;  1IYI A;  3IAS 2;  1TP9 A;  3ZZX A;  2DJJ A;  1T7P B;  3FZ5 A;  1ON4 A;  3RPP A;  4MMM A;  3UVH A;  3FZ9 A;  2F9S A;  2N5F A;  3ERF A;  2C0D A;  3WT2 A;  2DJ2 A;  2YJ7 A;  5DVB A;  2H8L A;  3QCP A;  3EWL A;  1OAZ A;  3C1R A;  2O85 A;  2IWT A;  4BWS A;  2DLX A;  5JCW A;  16GS A;  4KAE A;  3BCK A;  3MYD A;  1URM A;  3ISO A;  3M0F A;  1DE2 A;  2PU9 C;  3IOS A;  1O81 A;  2HSM A;  5AIS A;  1K0M A;  1GLQ A;  4HJ2 A;  3ZTL A;  1PQN A;  5B8B A;  2A2R A;  2BJX A;  2VLT A;  5DQY A;  1O73 A;  1OE8 A;  2AHE A;  1U6T A;  3AY8 A;  4X0X A;  2DJ3 A;  2O87 A;  5IO2 A;  4F9Z A;  4V1A g;  1TK0 B;  1YEX A;  1BF5 A;  4CY6 A;  1TI1 A;  3H93 A;  5HR1 A;  3C8E A;  2HFD A;  3KXO A;  1BQ7 A;  2H1A A;  3ZMK A;  1EZK A;  2LEG A;  2LNS A;  4EUY A;  1MDK A;  1Q98 A;  3R2Q A;  3R3E A;  11GS A;  5ECM B;  3UBK A;  3NZN A;  4WF4 A;  3HD5 A;  3A2W A;  2EIO A;  1EWX A;  2B5X A;  2GSQ A;  2QA1 A;  2EIR A;  3GX0 A;  4HU9 A;  2WZ9 A;  1MTC A;  4AKX B;  1BED A;  2ES7 A;  4OCF A;  4PUF C;  3WYW A;  5COH A;  4BL7 A;  1N2A A;  1I9D A;  2E2M A;  4MZB A;  4I97 A;  1LU4 A;  5EPF A;  2H1D A;  3M3M A;  1R5P A;  1ERU A;  3L4N A;  2IJY A;  4G9H A;  1TRV A;  3DGQ A;  3I69 A;  3Q19 A;  4KE3 A;  4FYU A;  1GSY A;  4ZL7 A;  2I81 A;  4V2L A;  1XOA A;  4MDC A;  4PXO A;  2LJR A;  4G0I A;  4MP4 A;  1Z6M A;  5ELA A;  4G2E A;  2H75 A;  5ECS A;  3RPN A;  4O5Q A;  4K0N A;  4F0C A;  2C0G A;  1SL1 B;  4AKI A;  1T3B A;  3GNJ A;  3TJF A;  1WWJ A;  1O8W A;  2MMZ A;  1G7E A;  4AJ6 A;  1WIK A;  4MJB A;  1YF1 A;  2DJ0 A;  3IXR A;  5G1L A;  3DXB A;  4MJE A;  3TOU A;  1CQG A;  2OKA A;  2GSS A;  3MAK A;  2HYX A;  4DVC A;  3L78 A;  4E8E A;  3KTB A;  2ON5 A;  4IGJ A;  2H6Z A;  2QC7 A;  4EC0 A;  2Z9S A;  4IW9 A;  1FVK A;  3EUR A;  3W6G A;  2PVQ A;  2HSM B;  2D2Z A;  2KHP A;  3LEF A;  3H1N A;  1XW9 A;  1YJ6 A;  2H70 A;  1ZYQ B;  2NTO A;  1SEN A;  5A4U A;  5B8A A;  2JSY A;  2KOK A;  2PMT A;  3HJO A;  1F9M A;  5ECQ B;  1FB0 A;  4GSS A;  6GST A;  1ABA A;  1NW2 A;  1OC8 A;  1XIY A;  2P31 A;  4IN0 A;  5AIV A;  2R3X A;  2HE3 A;  4ZIJ A;  4Z7X A;  5AIX A;  4BVY A;  2H73 A;  3F4T A;  2PGT A;  3WGE A;  3TJJ A;  6GSW A;  4X1U A;  3IRA A;  4O92 A;  4ZBD A;  2JZR A;  2VIM A;  1TXX A;  4KCA A;  3MDK A;  2FLS A;  5LD0 A;  4BL7 B;  3KZQ A;  1B9X C;  4RQX A;  5ECH B;  2O8V B;  3UAP A;  1HD2 A;  1GTA A;  1XXU A;  3D4M A;  3O76 A;  4BA7 A;  4JED A;  2B7J A;  4E8H A;  4IQ1 A;  5A5K A;  1O7U A;  22GS A;  2YWO A;  1LBK A;  2VCZ A;  1WE0 A;  2FNO A;  2CVD A;  4BWQ A;  4MF6 A;  1F3B A;  3TKS A;  3SBC A;  3JCM L;  1I5G A;  4Z2R A;  4EIP A;  1U3I A;  3C7M A;  1PRX A;  1BX9 A;  2R37 A;  3BD2 A;  2K9F A;  3G9B A;  1KNG A;  5DJL A;  1WP0 A;  3HY2 A;  3TOT A;  2H30 A;  1SVO A;  1TU8 A;  4V1A p;  1GTU A;  5ECI B;  2O5V A;  1S3A A;  4HZ2 A;  5GSS A;  3L9U A;  5D9V A;  1B4P A;  4KF9 A;  1A0F A;  1THX A;  4KA0 A;  4LLR A;  4JE1 A;  4MPG A;  2O89 A;  2XPE A;  1PX7 A;  1JZO A;  3GL5 A;  2V6O A;  5ECL B;  4POB A;  5ENU A;  1BJX A;  3P7X A;  4ECJ A;  2LNT A;  1M2D A;  2JU5 A;  19GS A;  1SD8 A;  2EIQ A;  4G0L A;  5IMF A;  1SJI A;  3LGC A;  2ZCT A;  3KP9 A;  3VWV A;  1EP7 A;  3ZL5 A;  3K8N A;  2VL3 A;  2G0F A;  1JFU A;  1SD9 A;  2REM A;  4QL7 A;  1PL1 A;  3QAW A;  3GKK A;  4ILF A;  4GTU A;  4KH7 A;  4BVY B;  4EVM A;  1YQ1 A;  4YKG A;  3EE2 A;  1SJ6 A;  3EU4 A;  3HVS A;  2QKE A;  2JAD A;  3DVX A;  2PER A;  4XCS A;  2OE1 A;  2DBC A;  4X43 A;  3EC3 A;  2PUK C;  1FO5 A;  4PQI A;  3ZRE A;  2VM2 A;  4O5R A;  4POL A;  4ZB8 A;  2B6M A;  1XVQ A;  1K0N A;  3F4S A;  2B3S A;  5IMZ A;  2A4V A;  1EV4 A;  4KUN A;  1HNA A;  4J56 E;  5G5F A;  1GSF A;  3J7Y b;  2C0E A;  2X4A A;  4XIH A;  2FCH A;  3DEX A;  1WOU A;  4KCE A;  4WR4 A;  4EE0 A;  3HJP A;  1GUM A;  4NMU A;  4Z2U A;  2LUS A;  1K3O A;  4I6X A;  2OJL A;  2VKZ G;  4NAX A;  5J40 A;  3LFL A;  4ZB7 A;  1Z3E A;  3I9V 2;  4O7H A;  1F3A A;  3A2V A;  4BPY A;  1Q4J A;  2WDU A;  3ZRD A;  3A5I A;  1H75 A;  1F2E A;  1K0O A;  3C73 A;  1B4Q A;  1ZCP A;  1C72 A;  5G5E A;  3TKS C;  4V2M A;  2FD3 A;  2K8V A;  1LJR A;  2IMI A;  5GAP D;  5ECP B;  4EKZ A;  5ECR B;  3NOF A;  3GKM A;  5CNW A;  3QR6 A;  3DYR A;  2R0P A;  3NIV A;  2C1Y A;  4O5U A;  4ZXG A;  3CYN A;  4HS1 A;  1OVN A;  4KDU A;  5G31 A;  1EGO A;  2XBQ A;  3HVV A;  3KGK A;  3GKX A;  2YWM A;  3GST A;  1DSB A;  4GDF A;  1GRX A;  1V57 A;  1XVW A;  3GRX A;  4ULX A;  1G0T A;  3IHQ A;  4LA1 A;  1USB A;  1KBN A;  6GSU A;  5CRG A;  2CZ3 A;  2EC4 A;  1FHE A;  2O7K A;  5BRT A;  1TW9 A;  3I43 A;  6GSX A;  2EFE A;  2AV4 A;  3BBY A;  4N3Z A;  1GUK A;  2TRX A;  2CAI A;  1MD3 A;  2JZS A;  4FH8 A;  1S3C A;  4I2T A;  2H1L A;  1EGR A;  3ERG A;  2GQK A;  4FIW A;  4K8M A;  1ZYE A;  3QMX A;  1A2L A;  3TKR A;  3KTL A;  4K6X A;  4XRA A;  4OWY A;  2WB9 A;  3VFI A;  1V9W A;  1SKR B;  1GH2 A;  1QQ2 A;  5A5H A;  1SK1 A;  1GLP A;  5J4U A;  4XS1 A;  3ED3 A;  2CA8 A;  5IMV A;  2VCW A;  1GTI A;  1TXU A;  4PNG A;  4PQH A;  4RI6 A;  2RM6 A;  1XPV A;  5D8I A;  4FO5 A;  1U3A A;  4ZBB A;  4NWY A;  2HSN A;  3KP8 A;  4PNF A;  4K2X A;  1TOF A;  1GSS A;  2HRK A;  2F51 A;  5A34 B;  4POM A;  3VI7 A;  4MJC A;  2VCQ A;  1XW5 A;  3F9U A;  1AC1 A;  1PMT A;  2MMA A;  3CMI A;  2A2P A;  3APQ A;  2B1L A;  1GTB A;  4P3Y B;  3HJM A;  2GZY A;  2HQT A;  1M0U A;  2OAD A;  1T4Z A;  4POK A;  3FW2 A;  5G1K A;  3D5J A;  1TRU A;  2C80 A;  5DAL A;  1S3D A;  3TKQ A;  5D9W A;  3FY7 A;  1F6M C;  2RUE A;  3TJK A;  1M2B A;  3LWA A;  4TOP A;  3DKS A;  2C3Q A;  2CX4 A;  4TR3 A;  3CTG A;  1OC9 A;  4ZIL A;  3KD0 A;  5CO3 A;  4F82 A;  4PX1 A;  1KTE A;  4IQA A;  3IPZ A;  4EIQ A;  1BAY A;  3P90 A;  3VWU A;  1V40 A;  2LKU A;  1DE1 A;  4N10 A;  2A2S A;  5F05 A;  3ZIT A;  2C3T A;  2I3Y A;  3HZ8 A;  4JR6 A;  4HU7 A;  2VAF A;  4MNN A;  3RBT A;  4TW5 A;  2HLS A;  4FYB A;  2B7K A;  2VUP A;  3FZ4 A;  2HT9 A;  5KN2 A;  3WGD A;  5DDL A;  3M9K A;  3ME8 A;  3FKF A;  4TR1 A;  2H6Y A;  1TRW A;  1NSW A;  4HJM A;  4QMK A;  3LW9 A;  2IMK A;  2MBT A;  5CRD A;  3UEM A;  4ECC A;  1FAA A;  3L9V A;  1W4V A;  4Z2T A;  3J7Y k;  3VUR A;  3CBU A;  3DD3 A;  2A4H A;  2LQO A;  1A2M A;  1OKD A;  4HOJ A;  2H0I A;  2YAN A;  3U6V A;  2V32 A;  5E59 A;  3CXG A;  1TDI A;  2GTU A;  5A5H B;  3I6A A;  5IPG A;  2ZNM A;  4K5R A;  2M80 A;  1FOV A;  3EPT A;  1XWA A;  2YOI A;  5HR2 A;  5EY6 A;  5DCH A;  3IBH A;  2JSZ A;  3KMN A;  4GLT A;  2WS2 A;  4WET A;  3GMF A;  4F2I A;  4FYC A;  1VGL A;  4J2F A;  3QOU A;  4KB3 A;  17GS A;  1U88 A;  5LCZ A;  1SK0 A;  1RK4 A;  4EDZ A;  1M9A A;  4WXT A;  2HSN B;  4NHW A;  2X64 A;  3DRN A;  3MNG A;  4DEJ A;  2FY6 A;  2HRK B;  5J3R A;  5FT3 A;  4MAB A;  4F03 A;  1AUC A;  2XBI A;  4LMV A;  4MF7 A;  4IKH A;  5HQP A;  1FB6 A;  4L5O A;  3TRP A;  1PN0 A;  5A4W A;  3KM6 A;  1GSQ A;  3LSZ A;  2HXK A;  1CQH A;  5J9B A;  1Z7R A;  4H86 A;  1YEP A;  2VCX A;  2MMN A;  4XS6 A;  3KIJ A;  1V98 A;  4G0K A;  5DAL B;  1OE7 A;  4PQ1 A;  5J4V A;  2LV3 A;  1SKW B;  3RHC A;  2DC5 A;  2VO4 A;  1JHB A;  2GQM A;  1OC9 B;  4OCE A;  3G7I A;  4EXJ A;  3PGT A;  3W8J A;  1BYE A;  4OFM A;  2DSA A;  1ZZY A;  1K0A A;  3GTU A;  4Q5F A;  1IYH A;  3ZIV A;  2DJK A;  1XOB A;  5F8B A;  3W8S A;  2H71 A;  2FHE A;  5E4W A;  4BVX B;  1TI3 A;  5H5R A;  3HMJ G;  4TRX A;  1XWC A;  2CV4 A;  3HXS A;  2BMX A;  2X8G A;  4TR1 B;  3A2X A;  5EVO A;  4WBR D;  4HQZ A;  1UA5 A;  3LYK A;  3TKS E;  1ERT A;  4EL1 A;  1XWK A;  3HA9 A;  2YP6 A;  5GZZ B;  1ZL9 A;  5BMU B;  3EMP A;  4RUV A;  3ZFB A;  1UC7 A;  1O8X A;  3U5R E;  4MF5 A;  2PBJ A;  3HHV A;  2YZH A;  1PL2 A;  2QA2 A;  3L9S A;  4EF0 A;  4WEY A;  1TU7 A;  4KW6 A;  4NPB A;  3IAM 2;  4MK3 A;  4MZW A;  1QMV A;  2B1K A;  3G7J A;  5LNK e;  3A5W A;  2HSH A;  2H0G A;  5KN3 A;  2I4A A;  1BG5 A;  5ABR A;  1TK5 B;  2FWF A;  5FWG A;  3E3E A;  4DSR A;  1SYX A;  5F07 A;  1X5D A;  4DSS A;  2WGR A;  1SL2 B;  3IE3 A;  2ON7 A;  2L6C A;  2PN8 A;  4PGT A;  4YQU A;  2IFQ B;  4IBP A;  3KH7 A;  1SJZ A;  4O32 A;  2DJ1 A;  2UV8 G;  5AGY A;  4AF2 A;  1U87 A;  3UBL A;  5A4V A;  3HCZ A;  4JU5 A;  1SKS B;  2JAC A;  1YKC A;  2VL9 A;  4NV5 A;  4WBJ A;  3QPM A;  4KGI A;  1E6B A;  2KP2 A;  4MZC A;  2I1U A;  4N30 A;  1XCC A;  1ZMA A;  3GN3 A;  3TCO A;  1YKA A;  4K7N A;  1QGV A;  2YZU A;  2LST A;  4IVF A;  5IMD A;  3HYP A;  2GQL A;  2WFC A;  2E7P A;  4ICY A;  2B5Y A;  3IDV A;  2CVB A;  2LRT A;  5IO0 A;  1F37 A;  1UN2 A;  4MA9 A;  1M7T A;  4K5S A;  3GTU B;  1R5A A;  5D9X A;  5IMA A;  2YPM A;  2DKH A;  4OD7 A;  2GT5 A;  4AKH A;  1Z5Y E;  2C0F A;  3GV1 A;  3DML A;  5JWR B;  4USS A;  5JCG A;  3F0I A;  4GWR A;  4YQM A;  12GS A;  5A34 A;  2J9H A;  14GS A;  1H4O A;  2P0G A;  4CHS A;  1X9S B;  1AQV A;  1GUH A;  4MH2 A;  5JCU A;  2LJK A;  2WUL A;  4Q5R A;  2YWI A;  2GLR A;  3MWH A;  2K18 A;  2LRN A;  1PA3 A;  2VD1 A;  2X8C A;  3GFK A;  5KOW A;  3QD9 A;  2XPD A;  2V1M A;  5KEJ A;  1VF4 A;  4ML1 A;  1EEJ A;  3D4T A;  3VLN A;  1YF0 A;  1QUW A;  3GL3 A;  3BCI A;  2AUV A;  4I8B A;  4GQC A;  2R5G A;  2LRC A;  3LOR A;  5HR3 A;  1XWG A;  5EL8 A;  3ZML A;  1K3Y A;  1Z6N A;  3ZVJ D;  3GUS A;  4NXI A;  5D93 A;  3KMO A;  1NHY A;  4HDE A;  1WJK A;  3TDG A;  2CX3 A;  1T8E B;  2H01 A;  2VD0 A;  5D96 A;  4JR4 A;  5J4Y A;  2VOC A;  5ECN B;  3UAR A;  3TU3 B;  4EO3 A;  3UMA A;  6GSS A;  4F0B A;  4AI6 A;  3TKP A;  2JL4 A;  2FWE A;  1HQO A;  2HI7 A;  5KN1 A;  3WGX A;  3LXZ A;  1FOH A;  1TTZ A;  4DSS B;  1SL0 B;  1THO A;  1V58 A;  1RQM A;  3ZYW A;  5J41 A;  5J9C A;  4KDX A;  4W66 A;  2IIY A;  5IM9 A;  1HYU A;  1GSU A;  4AKG A;  1EP8 A;  5JWQ B;  3TB2 A;  2YV7 A;  5A1N A;  1A2J A;  3GX8 A;  4L0W A;  1ACV A;  3VWX A;  2J23 A;  20GS A;  4CY8 A;  4J57 E;  2IMD A;  1EOG A;  4ML6 A;  1FW1 A;  3D22 A;  2OE3 A;  3BOA A;  1AXD A;  2UZ8 A;  3FHK A;  3APS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...