3CRTA

Structural characterization of an engineered allosteric protein
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
214
structure length
214
Chain Sequence
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGCEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase class-mu 26 kDa isozyme
publication title Using affinity chromatography to engineer and characterize pH-dependent protein switches.
pubmed doi rcsb
source organism Schistosoma japonicum
molecule tags Transferase
total genus 70
structure length 214
sequence length 214
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2008-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3crtA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3crtA01
3EE2A 2GSSA 1GUKA 3TJBA 1K0DA 1YEPA 1O6JA 2L57A 4XRAA 2G0FA 4KA0A 2FD3A 2VLVA 2H6YA 5ELAA 4IJ3A 3APQA 2YPMA 3HHVA 2FA4A 1TRUA 2C0GA 1EGRA 4MPGA 3E3EA 1FB0A 4E8EA 3D21A 2L6DA 3DRNA 1XBSA 3GMFA 4XS4A 3KEBA 3UARA 5ENUA 1AQWA 4MF5A 1U87A 2XBQA 2C0DA 4JRRA 4L0WA 1MTCA 4ZL7A 3IDVA 4USSA 5B6MA 1XFLA 2DBCA 2MYGA 4XCSA 1DUGA 4CDOA 2ON7A 5ELGA 3TDGA 2RUFA 3QOUA 2LTKA 3UIWA 1TI3A 3M0FA 2CZ3A 1JZRA 1ZOFA 3FZAA 4WBRD 1GLPA 2F51A 5IIZA 1H4OA 3HDCA 2DMMA 4LA1A 3LORA 1IYHA 2E2GA 4E8HA 4KSMA 1FVKA 4XRDA 1EZKA 1VF1A 4I2UA 4ECJA 1SKWB 3APSA 1WJKA 1GTUA 2JSZA 2PERA 8GSSA 1KBNA 1PD21 3F4RA 3GSTA 4NAXA 1X0RA 2OA7A 1R5AA 3HJOA 1PRXA 5HFKA 2OKAA 5F06A 4K0GA 3FEUA 2FY6A 2VOCA 2QC7A 3IK7A 2LS5A 4PXOA 5JCWA 5AN1A 2R4VA 3NOFA 1X9WB 4RQXA 3MAKA 4DEJA 3CSIA 1THXA 5E4WA 2VIMA 5H5QA 2LV3A 2DLXA 3E9JB 1N8JA 4ZB6A 2R5GA 4ISDA 4KAEA 2B5YA 3IBHA 4JE1A 3LXZA 4LLRA 3BCKA 3DYRA 1B4PA 1NHYA 1OAZA 3H4KA 1XWBA 2VO4A 3ZIVA 5ECNB 2RUEA 1V57A 2H1DA 3TOUA 3IHQA 2I1UA 4N11A 4EE0A 4BWSA 4I8BA 1T1VA 1U88A 5CRGA 2YNXA 4XS1A 4QL9A 2IN3A 1ON4A 1S3AA 1GTBA 1K0CA 3QFAC 1PX6A 3ZRDA 1X9SB 3ZZXA 4IKHA 1X9MB 4YQUA 4O5RA 3TKPA 5EL8A 1S3DA 2DJ2A 1TTZA 1M9AA 3ZFBA 2GZYA 2GVPA 2FWGA 2H76A 1MDJA 2LSTA 2CZ2A 2HRFA 1YJ6A 1Q4JA 5HR3A 1FVJA 1TDIA 4F2IA 3ZITA 4WKWA 3TJFA 3MDKA 2B3SA 4TXOB 1EP7A 3NZNA 4L0UA 3DWVA 1WIKA 4FQUA 5D9XA 4ML1A 20GSA 2NPBA 3F3RA 2K9FA 3KMOA 1KTEA 3LGCA 2B5EA 1W4VA 3ZYWA 1PKWA 1O85A 3GA4A 5G5FA 1NSWA 2FLSA 4AJ7A 2YZUA 2IMEA 3CBUA 5GSSA 1XZOA 1DE1A 1MD4A 3TB2A 1FB6A 3VURA 4OD7A 5HFIA 4NHWA 2FUG2 1XW5A 2H6XA 3FZ5A 1M2AA 2CX4A 4ZB8A 2L5OA 4V2NA 5LD0A 2H19A 3LJRA 2DMLA 4I6XA 3TKSC 5DVBA 4TR3A 1JLWA 6GSSA 2E7PA 3M9JA 1TRVA 2K8VA 4FH8A 2B1LA 4N30A 4GLTA 1Z3EA 4GSNA 5DCHA 2L4CA 3F4TA 9GSSA 3KD0A 1U3IA 2IL3A 2WCIA 3F63A 1A2LA 5AIVA 4J2FA 2B7JA 1WPIA 3ERGA 1TKDB 3TJJA 3DEXA 1SJZA 5CREA 3ERFA 2HI7A 4IQAA 4TXOA 5DQYA 4GF0A 4EC0A 3HJPA 2WS2A 4F82A 1AQXA 2K6VA 2WGRA 5ABRA 3BCIA 2DIYA 2R2JA 2KOKA 2XC2A 1FW1A 1EEMA 2H73A 2JZTA 4WBJA 1A2MA 1MD3A 1XOAA 2VCZA 2EC4A 1GNEA 2VAFA 3RPPA 4G9HA 1PSQA 3L9UA 3RAZA 1SK1A 4V1Ap 3KMNA 3C71A 3HZ4A 1SKRB 2OACA 4QL7A 2H30A 3ISOA 4P3YB 4EL1A 1Z6MA 2MZCA 4Z7XA 1USBA 1F9MA 2D2ZA 2IMDA 4PTSA 3EVIA 5HR2A 1C72A 1Z7RA 3O76A 2FA8A 2ZUPA 4EVMA 4G19A 1T7PB 5CP1A 1O8WA 3U6VA 1XW6A 1THOA 1U3AA 3HY2A 5G31A 3TRPA 2PUKC 5F8BA 1OKTA 2UZ8A 4ACSA 4PNFA 3F6DA 5IOXA 3LSZA 4BA7A 4XS6A 2B5XA 2IMIA 1PL1A 4PGTA 3UMAA 3M3MA 4BVYB 2C3QA 2GT6A 2OE1A 3UEMA 3I6AA 5CRHA 2GQMA 4BPYA 3UJ1A 1YQ1A 1ERVA 4OFMA 4YQMA 3WYWA 3IE3A 2O7KA 1XCCA 2VL9A 1YY7A 4TW5A 4IELA 5D9WA 3QAVA 2RM6A 4MDCA 5ECLB 1EP8A 4K6XA 4KF9A 4PURA 2N5BA 4OCEA 5BMUA 1EWXA 3AY8A 2VCXA 1URMA 5GAPD 1OE8A 3P7XA 3H1NA 1A0FA 2OE0A 3GKMA 5EPFA 4L5LA 2LEGA 3GL5A 3FRCA 4PQIA 2PU9C 4F03A 3HA9A 3EU4A 3GX8A 4OMVA 1SYXA 3WT2A 2LKUA 2DC5A 1QGVA 1PGTA 2VM1A 4N0VA 2H8LA 2PVQA 2H71A 3LQ7A 4WR4A 3DVWA 2X8CA 1X5CA 2CVDA 2OJLA 1QK8A 1BYEA 3M8NA 4IS0A 2H70A 2A4VA 4BVYA 3W8SA 3LYKA 4NV5A 4KSOA 2HYXA 1JZWA 1ZZYA 2E2MA 3RDWA 2I3YA 1T3BA 1B48A 1ERUA 3ZMLA 2P31A 2VCQA 3H79A 4HUAA 1BJXA 4KNDA 3HJMA 3RBTA 3D0ZA 1U6TA 5J41A 2P0GA 4V2LA 2VL2A 1K3LA 1HYUA 1AW9A 5J3RA 1R7HA 3MSZA 2O89A 3TCOA 2CAQA 4G0IA 4KH7A 3CYNA 2H72A 2K18A 2X99A 4IP1A 4LL1B 4OWYA 4POKA 5CAXA 3C7MA 1O7UA 2GQLA 6GSVA 2EIRA 5EVOA 4GRFA 1K0OA 5KN2A 3HKRA 1J0FA 3L0HA 2VD0A 1GUHA 1AC1A 2GZPA 4IGJA 4TXVA 2V6KA 5ECMB 2DIZA 1UN2A 2YWNA 4N0ZA 3A2WA 3IR4A 4LMVA 3DIEA 2M46A 3LYPA 1ZYEA 3CMIA 1PX7A 2NBSA 1ZL9A 3MWHA 6GSYA 2PMTA 5IO0A 5A4VA 5GAND 4EF0A 4KCEA 4WR5A 11GSA 2OADA 3HVXA 1DE2A 2YN1A 3F6FA 3DMLA 1AAZA 2TIRA 2RM5A 3I9V2 3APOA 2H0IA 5DBQA 1XWGA 2LJKA 5KN0A 2CA8A 1RW1A 4POLA 2FNOA 3R2QA 4JU5A 1N2AA 3I69A 4MZBA 3C8EA 2HSNB 1FHEA 3UVHA 3W6GA 5IMVA 4QQ7A 2LRNA 3TJGA 3GUSA 2AAWA 18GSA 1ZYQB 1M7TA 2FWFA 2CT6A 3KH9A 1T8EB 4JBBA 1XWAA 2BJXA 5IQYA 3UL3A 3IPZA 2V41A 4MLYA 5ECOB 3VI5A 3VI7A 3DD3A 2RIIA 4XTSA 3D4MA 3FZ4A 3WGDA 1QMVA 4AJ8A 5AISA 1J9BA 2CAIA 1BQ7A 5J9BA 2JACA 1M0UA 1G6WA 1TRSA 4HEA2 4RI6A 4HS1A 2L6CA 4L5OA 2MMZA 3ED3A 2R3XA 1EGOA 4MA9A 2KLXA 3M9KA 3W8JA 2HT9A 1GTIA 3KTBA 3Q74A 1TOFA 3IXRA 4NMUA 5B6NA 1PL2A 2LJAA 4PNGA 1BAYA 3IC8A 1OC8A 1RQMA 1K0BA 2WRTA 4DSRA 5H5RA 3U5RE 3QD9A 1HNBA 2WULA 3CTFA 2KUCA 3H8QA 1QUWA 3ERWA 3E0UA 3ZTLA 1FAAA 1KNGA 1GSFA 3GKKA 3VPQA 2KHPA 2X64A 5CNWA 3EYTA 2DJ3A 4N10A 3QR6A 3O6TA 4POBA 2KP1A 2LQOA 4NV2A 4ZL9A 2JADA 5JWRB 1NHOA 1QXHA 5ECQB 5ECRB 4TKYA 1GH2A 1HQOA 3G9BA 2FWHA 5CO3A 4WEYA 1O73A 2F8FA 2C0FA 3TKSE 4MJCA 1ST9A 1QQ2A 2FCHA 2MMNA 1FOVA 5A4WA 3GH9A 3N5OA 4IHUA 5FHIA 1SJIA 4NXIA 3HYPA 2VM2A 3IAM2 3EC3A 3V1WA 5JCUA 1MEKA 2QGVA 3FZ9A 2C3TA 1K3YA 3TRXA 4PQHA 3FR6A 1FO5A 1Z9HA 2IPAA 3DVXA 3F4SA 3L9VA 2FGXA 2AV4A 2HNLA 3LWAA 2XHFA 5DCGA 2YV7A 3HVSA 3GRXA 3VLNA 1BG5A 4XIHA 1XOBA 2GZZA 4TN8A 4FIWA 4ECIA 4YAPA 3P8WA 1LJRA 4NWYA 4DSQA 1TJDA 5HR1A 2HSMA 5G1LA 3C1RA 2R6KA 3OR5A 4KDUA 3QPMA 4J56E 3KZQA 1VRSD 1SL0B 1PMTA 5J9CA 5IO2A 2CQ9A 2B1KA 3GKXA 4X43A 5C04A 3N9JA 2HRNA 4YH2A 2HE3A 2NTOA 2CVKA 2R37A 2IMFA 1GSQA 1G7EA 2HLSA 3HCZA 5D73A 2H1GA 2VLUA 4DSSB 4ECCA 3KTLA 1K3OA 3UBKA 1LBKA 4HU7A 1BX9A 4PQ1A 4HJMA 1ZCPA 4GCIA 3ZFLA 1YF0A 5C00A 5IMCA 5LNKe 4MZWA 2H01A 2O87A 4MK3A 3GKNA 6GSTA 3KJYA 2YOIA 2Z9SA 2NDOA 2XBIA 3A3TA 2C1YA 4RI7A 3WD6A 1VF2A 3QFBC 2VCWA 1AXDA 5HFGA 3G7YA 1R5PA 2J9HA 4WF4A 2XPDA 5J5NA 5DALB 4F9ZA 1WMJA 1XVQA 1T4YA 3FW2A 4KB3A 2VL2C 4HI7A 1AIUA 4HZ2A 3G7IA 4YQVA 5AIXA 1YEXA 16GSA 3TKSA 2I9HA 1PA3A 2OE3A 2MBTA 4I5QA 3KXOA 4K7OA 1XIYA 3D5JA 2E0QA 3ME7A 5IMDA 3GURA 1HD2A 4HDEA 4MCUA 4PUFC 2M80A 1ZMAA 4ZL8A 2C0EA 4HQSA 2ZNMA 3A5WA 4IQ1A 1SKSB 3M1GA 3WGEA 2IIYA 4D73B 2VLTA 4MH2A 4DSSA 6GSUA 1OVNA 1HNAA 1F3BA 1XXUA 4DVCA 3C1SA 5KEJA 4X0XA 3O3TA 4FYCA 3IRAA 3IA1A 1M99A 3H93A 2HXKA 2QKEA 3VWUA 1MDIA 5ECSA 3L4NA 3GYKA 4Q5FA 3F9UA 3HVVA 3EINA 2C80A 1Z6NA 4GSTA 1SD9A 5KN1A 4K1FA 4LL4B 3PH9A 2DJ1A 5DALA 14GSA 3SBCA 5INYA 2REMA 2YV9A 5ECHB 2F3MA 2LRCA 3KIJA 4ECBA 1EEJA 2YJ7A 3D22A 1IYIA 2P5QA 2V6OA 5D96A 4MMMA 1JZOA 2GS3A 4ZB9A 4O92A 3FYGA 1S3CA 3TRQA 2PPTA 1K0MA 5COHA 1GSEA 3GTUB 2H66A 1SYRA 2O85A 2ZCTA 3IV4A 3WT1A 3I43A 4D73A 5L71A 3PGTA 1XVWA 4KDYA 2CX3A 3L78A 1O81A 1K0AA 4MH3A 4EKZA 3P90A 1B9YC 5FT3A 1ZGNA 1SK0A 3QDNA 2GSRA 4POMA 5JWOB 4MF7A 4AJ6A 1YZXA 1M2BA 2JZSA 3TUEA 1GWCA 2JZRA 3BOAA 4K8MA 3QCPA 4JZQA 4Q5QA 5GZZB 1R26A 2DJKA 3F3QA 3IC4A 3MNGA 3ZLPA 4X1UA 1BEDA 1YF1A 3EWLA 4IVFA 2JU5A 2V1MA 1YDKA 1F6MC 4ZIJA 3PR8A 3HXSA 3TKQA 4EUYA 3DKSA 1XWCA 4G10A 4TVEA 1NW2A 1SL1B 2GSQA 1WOUA 4KGIA 3RPNA 2GT5A 1H75A 2VD1A 5GSTA 3J7Yb 1O8XA 5D9VA 2WFCA 2LNSA 4GSSA 5A5KA 4V1Ag 2VCVA 1A23A 3GTUA 2A2SA 3VK9A 4TR4A 1JFUA 3ZL5A 4K7IA 4ZBAA 1Z5YE 1GL8A 4JR4A 1E6BA 4G0KA 4FYUA 2ALBA 1EV4A 5HQPA 1UVZA 5FWGA 3WGXA 1GLQA 6GSXA 2H0GA 2TRXA 4OFTA 4BL7A 2HZFA 5CRWA 1DBYA 2YWOA 1EOGA 4ID0A 3TGZA 1GP1A 2LNTA 4IBPA 3G7JA 2H74A 4V2MA 4MF6A 2FHEA 6GSWA 4YAVA 1MDKA 3LFLA 1NM3A 5G5EA 1RK4A 1JHBA 3VWXA 3QAGA 5JCGA 5CRDA 3RHBA 1G6YA 1TK0B 2RLIA 4XHMA 2CVBA 4ULXA 2HFDA 1TXXA 3FR3A 1Z7PA 1Y6EA 4IJIA 1ML6A 3IK9A 1G7OA 1XW9A 2WZ9A 2DJJA 5D93A 1F37A 1GRXA 1TU8A 1VF3A 2TRCP 3IOSA 3EU3A 1R4WA 4I2TA 1CQHA 4MPFA 4K9ZA 4RUVA 4F0CA 2QSIA 3KH7A 1Q98A 22GSA 2AJQB 3FY7A 4EDYA 1HNCA 4PX1A 4GXZA 1J08A 2KP2A 3GNJA 2K8SA 3ME8A 3Q18A 3ZVJD 2YWIA 1TRWA 2F9SA 4Q5RA 4TRXA 2HSHA 1PQNA 1GUMA 2LRTA 3S9FA 1ACVA 5D9TA 4OFNA 10GSA 3LXTA 1YKAA 5LCZA 1B8XA 2N5FA 1JZDA 3HD5A 2YCDA 3PPUA 1ABAA 1ERWA 2O8VB 2LQQA 2GGTA 3TJKA 2M72A 1GSDA 4GQCA 1WE0A 5DJLA 2H1AA 2AYTA 4K7NA 2OBIA 3GSSA 2V2GA 1SENA 4KCAA 4HQZA 4JEDA 1GNWA 5IPHA 1SK2A 3A2XA 4CHSA 3KP8A 2IMKA 1XWKA 2HSMB 3UAPA 5AGYA 5IPGA 1OC9B 3FHKA 2L4QA 12GSA 2C4JA 5E59A 4ZBDA 4IW9A 3IAS2 4K2DA 4OCFA 3KGKA 4IP6A 1TU7A 4KE3A 3GHAA 2I4AA 4EDZA 2HRAA 4FYBA 1AQVA 2PWJA 4F0BA 4BVXB 1UC7A 1KEBA 13GSA 3F8UA 2FWEA 3P2AA 2B6MA 4KW6A 3CRUA 3VWWA 4CW9A 1Y25A 3VPTA 2YJHA 4NPBA 1PKZA 1OYJA 1EV9A 2HSYA 1X5DA 1GSYA 5G30A 2MBSA 4Q5NA 4JR6A 3CTGA 2HQTA 2ON5A 3K8NA 3QAWA 4ZILA 3NIVA 3L9SA 5B8AA 1ERTA 4K0NA 1A2JA 2YZHA 2I81A 4WETA 3KCMA 1WP0A 2HRKB 2MMAA 1OC9A 2JSYA 2AB6A 2MMOA 2AUVA 3D6IA 1E2YA 3TOTA 1FG4A 3UBLA 4OO4A 3DXBA 1A24A 2VCTA 1V58A 4G2EA 1ILOA 3QMXA 4ML6A 3SWLA 2PGTA 2H1BA 3CSHA 2YP6A 17GSA 2DSAA 2WJUA 4KDXA 1LU4A 2X8GA 5G2ZA 4MJAA 2N5AA 4BVXA 2CV4A 3EMPA 1X5EA 5DJMA 4IN0A 4HU9A 5IMAA 2V32A 2PVOC 4EXJA 3UVTA 2GQKA 4PUAA 4HJ2A 2VUPA 4O7HA 3A2VA 4FO5A 3EMXA 3D4TA 3GX0A 1TP9A 1V98A 2GLRA 1SL2B 1GSUA 1M9BA 1UA5A 5DAKB 5ECPB 3ZIJA 3CSJA 2H0HA 5B7CA 5DQSA 4OO5A 2HRKA 5HR0A 2HZEB 2VL3A 5DDLA 3Q19A 2IWTA 2F8AA 1W89A 2YANA 1V2AA 2JL4A 3Q6OA 5ECIB 1F2EA 1DSBA 3VWVA 2NVLA 3EURA 2WB9A 5IMZA 1TK5B 2H75A 3GH6A 1TI1A 2C3NA 1T4ZA 1GTAA 4BWQA 1OKDA 2IFQB 1G0TA 2IJYA 3GFKA 2A2RA 2J23A 3ZMKA 1EOHA 5KN3A 2BMXA 3GV1A 4HZ4A 3C73A 5ID2B 1SJ6A 3DGQA 4KX4A 19GSA 4MZCA 4GQFA 2WDUA 2GDRA 5IOWA 1YKCA 2PN8A 4ILFA 5JWQB 1A8LA 4J57E 1GSSA 2LUSA 2X8HA 4WXTA 5IM9A 1OE7A 1WWJA 3CRTA 4TR1B 5D8IA 4GTUA 4L8EA 5DAKA 1T00A 4MJEA 2GSTA 4NHZA 4ZBBA 3LG6A 1SU9A 3GN3A 1A8YA 2HZEA 4G0LA 3GIXA 7GSSA 3R3EA 1OC3A 4MJBA 2ES7A 2GTUA 4MABA 1CQGA 1QFNA 1V9WA 3TKRA 2L5LA 3LEFA 1V40A 1WRYA 3ZREA 1F3AA 3HZ8A 3FKFA 2L59A 2EIQA 4O32A 2IFQA 2AHEA 4AF2A 4TR0A 2LJRA 4RQRA 3US3A 3UOMA 1TK8B 3J7Yk 5G1KA 1GULA 1VGLA 4AGSA 4HOJA 3FK8A 5ID2A 1B4QA 1M2DA 5H5SA 5B8BA 1AUCA 4XS4B 1VF4A 4I97A 4ZXGA 1JLVA 5J4UA 2BTOT 4EO3A 2G2QA 2YWMA 4MP4A 2B7KA 1K0NA 3GL3A 3RHCA 3KP9A 5F07A 2OBKA 3VFIA 4H86A 1A0RP 4BL7B 2P5RA 4TR1A 3BJ5A 3JCML 1PN9A 4GWRA 4WF5A 2PBJA 1I5GA 1I9DA 2EIOA 5CYYA 3FR9A 5ECKB 3F0IA 2DJ0A 5F05A 3ZVJA 2XPEA 5IMFA 2H6ZA 3BBYA 1SD8A 3PINA 4LMWA 4KUNA 4TOPA 5EY6A 3KM6A 2C8UA 1XPVA 1TW9A 3BD2A 5F0GA 3CXGA 5A4UA 1B9XC
chains in the Genus database with same CATH superfamily
3EE2A 2GSSA 1GUKA 1I1IP 2WVXB 4K2XA 3TJBA 1K0DA 1YEPA 1O6JA 2L57A 1N25A 4XRAA 2G0FA 4KA0A 2FD3A 2VLVA 2H6YA 5ELAA 4IJ3A 3APQA 2YPMA 3HHVA 2FA4A 1TRUA 2C0GA 3IHGA 1EGRA 4MPGA 3E3EA 1FB0A 4E8EA 3D21A 2L6DA 3DRNA 1XBSA 3GMFA 4XS4A 3KEBA 3UARA 5ENUA 1AQWA 4MF5A 1U87A 2XBQA 2C0DA 4JRRA 4L0WA 1MTCA 4ZL7A 3IDVA 4USSA 1SVMA 5B6MA 1XFLA 2DBCA 2WVZA 2MYGA 4XCSA 1DUGA 4CDOA 2ON7A 5ELGA 3TDGA 2RUFA 3QOUA 2LTKA 3UIWA 1TI3A 3M0FA 2CZ3A 1JZRA 1ZOFA 3FZAA 4WBRD 1GLPA 2F51A 5IIZA 1H4OA 3HDCA 2DMMA 4LA1A 3LORA 1IYHA 2E2GA 2WVXA 4E8HA 4KSMA 1FVKA 4XRDA 1EZKA 1VF1A 4I2UA 4ECJA 1SKWB 3APSA 1WJKA 1GTUA 4YKFA 2JSZA 2PERA 8GSSA 2X4AA 1KBNA 1PD21 3F4RA 3GSTA 4NAXA 5A1NB 1X0RA 2OA7A 1R5AA 2EFCA 3HJOA 1PRXA 5HFKA 2OKAA 5F06A 4K0GA 3FEUA 2FY6A 2VOCA 4PI2C 2QC7A 3IK7A 2LS5A 4PXOA 2QA1A 5JCWA 5AN1A 2R4VA 3NOFA 1X9WB 4RQXA 3MAKA 4DEJA 3CSIA 1THXA 5E4WA 2VIMA 5H5QA 2LV3A 2EFEA 2DLXA 3E9JB 1N8JA 4ZB6A 2R5GA 4ISDA 4KAEA 2B5YA 3IBHA 4JE1A 3LXZA 4LLRA 3BCKA 3DYRA 1B4PA 1NHYA 1OAZA 3H4KA 1XWBA 2VO4A 3ZIVA 2HSNA 5ECNB 2RUEA 1V57A 2H1DA 3TOUA 3IHQA 2I1UA 4N11A 4EE0A 4BWSA 4I8BA 1T1VA 1U88A 4AI6A 5CRGA 2YNXA 4XS1A 5A1NA 4QL9A 2IN3A 1ON4A 1S3AA 1GTBA 1K0CA 3QFAC 1PX6A 3ZRDA 1X9SB 3ZZXA 1M3JA 4G01A 4IKHA 1X9MB 4YQUA 4O5RA 1BF5A 3TKPA 5EL8A 1S3DA 3RFRC 2DJ2A 5KOXA 1TTZA 1M9AA 3ZFBA 2GZYA 2GVPA 2FWGA 2H76A 1MDJA 2LSTA 2CZ2A 2HRFA 1YJ6A 1Q4JA 5HR3A 1FVJA 1TDIA 4F2IA 3ZITA 4WKWA 4CY6A 3TJFA 3MDKA 2O36A 2B3SA 1EP7A 4TXOB 4A5PA 3NZNA 4L0UA 3DWVA 1WIKA 4FQUA 5D9XA 4ML1A 20GSA 4PI0C 2NPBA 3F3RA 2K9FA 3KMOA 1KTEA 3LGCA 2B5EA 1W4VA 3ZYWA 1PKWA 1O85A 3GA4A 5G5FA 1NSWA 2FLSA 4AJ7A 2YZUA 2IMEA 3CBUA 5GSSA 1XZOA 1DE1A 1MD4A 3TB2A 1FB6A 3VURA 2EFDA 4OD7A 5HFIA 4NHWA 2FUG2 1XW5A 2H6XA 3FZ5A 1M2AA 2CX4A 4ZB8A 2L5OA 4V2NA 5LD0A 4X4JA 2H19A 3LJRA 3CQFA 2DMLA 4I6XA 3TKSC 5DVBA 4TR3A 1JLWA 6GSSA 2E7PA 3M9JA 1TRVA 2K8VA 4FH8A 2B1LA 4N30A 4GLTA 1Z3EA 4BIKA 4GSNA 5DCHA 2L4CA 3F4TA 9GSSA 3KD0A 1U3IA 2IL3A 2WCIA 3F63A 1A2LA 5AIVA 4J2FA 2B7JA 1WPIA 3ERGA 1TKDB 3TJJA 3DEXA 1SJZA 5CREA 3ERFA 2HI7A 4IQAA 4TXOA 5DQYA 4GF0A 4EC0A 3HJPA 2WS2A 4F82A 1AQXA 2DKIA 2K6VA 2WGRA 5ABRA 3BCIA 2DIYA 2R2JA 2KOKA 2XC2A 1FW1A 2WVYA 1EEMA 2H73A 2JZTA 4WBJA 1A2MA 2WW1A 1MD3A 1XOAA 2VCZA 5BMUB 2EC4A 1GNEA 2VAFA 3RPPA 4G9HA 1PSQA 3L9UA 3RAZA 1SK1A 4V1Ap 3KMNA 3C71A 3HZ4A 1SKRB 2OACA 4QL7A 2H30A 3ISOA 4P3YB 4EL1A 1Z6MA 2MZCA 4Z7XA 1USBA 1F9MA 2D2ZA 2IMDA 4PTSA 3EVIA 5HR2A 1C72A 1Z7RA 3O76A 2FA8A 2ZUPA 4EVMA 4G19A 1T7PB 5CP1A 1O8WA 3U6VA 1XW6A 1THOA 1U3AA 3HY2A 5G31A 3TRPA 2PUKC 5F8BA 1OKTA 2UZ8A 4ACSA 4PNFA 3F6DA 5IOXA 3LSZA 4BA7A 4XS6A 2B5XA 2IMIA 1PL1A 4PGTA 3UMAA 3M3MA 4BVYB 2C3QA 2GT6A 2OE1A 4K5SA 3UEMA 3I6AA 5CRHA 2GQMA 4BPYA 3UJ1A 1YQ1A 1ERVA 4OFMA 4YQMA 3WYWA 3IE3A 2O7KA 1XCCA 2VL9A 1YY7A 4TW5A 4IELA 5D9WA 3QAVA 2RM6A 4MDCA 5ECLB 1EP8A 4K6XA 4KF9A 4PURA 2N5BA 4OCEA 5BMUA 1EWXA 3AY8A 2VCXA 1URMA 5GAPD 1OE8A 3P7XA 3H1NA 1A0FA 2OE0A 3GKMA 5EPFA 4L5LA 2LEGA 3GL5A 3FRCA 4PQIA 2PU9C 2R0CA 4F03A 5J4VA 3HA9A 3EU4A 3GX8A 4OMVA 1SYXA 3LW9A 3WT2A 2LKUA 2DC5A 1QGVA 1PGTA 2VM1A 4N0VA 2H8LA 2PVQA 2H71A 3LQ7A 4WR4A 3DVWA 2X8CA 1X5CA 2CVDA 2OJLA 1QK8A 1BYEA 3M8NA 4IS0A 2H70A 2A4VA 4BVYA 3W8SA 3LYKA 4FXYP 4NV5A 4KSOA 2HYXA 1JZWA 1ZZYA 2E2MA 3RDWA 2I3YA 1T3BA 1B48A 1ERUA 3ZMLA 4YKGA 2P31A 2VCQA 3H79A 4HUAA 1BJXA 4KNDA 3HJMA 3RBTA 3D0ZA 1U6TA 5J41A 2P0GA 4O5QA 4V2LA 2VL2A 1K3LA 1HYUA 1AW9A 5J3RA 1R7HA 3MSZA 2O89A 3TCOA 2CAQA 4G0IA 4KH7A 3CYNA 2H72A 2K18A 2X99A 4IP1A 4LL1B 4OWYA 4POKA 5CAXA 2WW0A 3C7MA 1O7UA 2GQLA 6GSVA 2EIRA 5EVOA 4GRFA 1K0OA 5KN2A 3HKRA 1J0FA 3L0HA 2VD0A 1GUHA 1AC1A 1S3RA 4EIQA 2GZPA 4IGJA 4TXVA 2V6KA 5ECMB 2DIZA 1UN2A 2YWNA 4N0ZA 3A2WA 3IR4A 4LMVA 4AKXB 3DIEA 2M46A 3LYPA 1ZYEA 3CMIA 1PX7A 2NBSA 1ZL9A 3MWHA 2VKZG 6GSYA 2PMTA 5IO0A 5A4VA 5GAND 4EF0A 4KCEA 4WR5A 11GSA 2OADA 3HVXA 1DE2A 3MIXA 2YN1A 3F6FA 3DMLA 1AAZA 2TIRA 5A5HA 2RM5A 3I9V2 3APOA 2H0IA 5DBQA 1XWGA 2LJKA 5KN0A 4K5RA 2CA8A 1RW1A 4POLA 2FNOA 3R2QA 4JU5A 1N2AA 3I69A 4MZBA 3C8EA 2HSNB 4ZB7A 3A5IA 1FHEA 3UVHA 3W6GA 5IMVA 4QQ7A 2LRNA 3TJGA 3GUSA 2AAWA 18GSA 1ZYQB 1M7TA 2FWFA 2CT6A 3KH9A 1T8EB 4JBBA 1XWAA 2BJXA 5IQYA 3UL3A 3IPZA 2V41A 4MLYA 2DKHA 5ECOB 3VI5A 3VI7A 3DD3A 2RIIA 3FMWA 4XTSA 3D4MA 3FZ4A 3WGDA 1QMVA 4AJ8A 5AISA 1J9BA 2CAIA 1BQ7A 5J9BA 4CY8A 1TXUA 2JACA 1M0UA 1G6WA 1TRSA 4HEA2 4RI6A 4HS1A 2L6CA 4L5OA 2MMZA 3ED3A 2R3XA 1EGOA 4MA9A 2KLXA 1PFOA 3M9KA 3W8JA 2HT9A 1GTIA 3KTBA 3Q74A 1TOFA 3IXRA 4NMUA 5B6NA 1PL2A 2LJAA 4PNGA 1BAYA 3IC8A 1OC8A 1RQMA 1K0BA 2WRTA 4DSRA 5H5RA 3U5RE 3QD9A 1HNBA 2WULA 3CTFA 2KUCA 3H8QA 1QUWA 3ERWA 3E0UA 3ZTLA 1FAAA 1KNGA 1GSFA 4HSCX 3GKKA 3VPQA 2KHPA 2X64A 5CNWA 3EYTA 2DJ3A 4N10A 1ZYPA 3QR6A 3O6TA 4POBA 2KP1A 2LQOA 4NV2A 4ZL9A 2JADA 5JWRB 1NHOA 1QXHA 5ECQB 5ECRB 4TKYA 1GH2A 1HQOA 3G9BA 2FWHA 5CO3A 4WEYA 1O73A 2F8FA 2C0FA 3TKSE 4MJCA 1ST9A 1QQ2A 2FCHA 5J47A 2MMNA 1FOVA 5A4WA 3GH9A 3N5OA 4IHUA 5FHIA 1SJIA 4NXIA 3HYPA 2VM2A 3IAM2 3EC3A 2QA2A 3V1WA 5JCUA 1MEKA 2QGVA 3FZ9A 2C3TA 1K3YA 3TRXA 4PQHA 3FR6A 1FO5A 1Z9HA 2IPAA 3DVXA 3F4SA 3L9VA 2FGXA 2AV4A 2HNLA 2R0PA 3LWAA 2XHFA 5DCGA 2YV7A 3HVSA 3GRXA 3VLNA 1BG5A 2A4HA 4XIHA 1XOBA 2GZZA 4TN8A 4FIWA 4ECIA 4YAPA 3P8WA 1LJRA 3CWGA 4NWYA 4DSQA 1TJDA 5HR1A 2HSMA 5G1LA 3C1RA 2R6KA 3OR5A 4KDUA 4N3ZA 3QPMA 4J56E 3KZQA 1VRSD 1SL0B 1PMTA 5J9CA 5IO2A 2CQ9A 2B1KA 3GKXA 4X43A 5C04A 3N9JA 2HRNA 4YH2A 2HE3A 2NTOA 2CVKA 3HVNA 2R37A 2IMFA 1GSQA 1G7EA 2HLSA 3HCZA 5D73A 2H1GA 2VLUA 4DSSB 4ECCA 3KTLA 1K3OA 3UBKA 1LBKA 4HU7A 1BX9A 4PQ1A 4HJMA 1ZCPA 4GCIA 3ZFLA 1YF0A 5C00A 5IMCA 5LNKe 4MZWA 4MNNA 2H01A 2O87A 4MK3A 3GKNA 6GSTA 3KJYA 2YOIA 2Z9SA 2NDOA 2XBIA 2O5VA 3A3TA 2C1YA 4RI7A 3WD6A 1VF2A 3QFBC 2VCWA 1AXDA 5HFGA 3G7YA 1R5PA 2J9HA 4WF4A 2XPDA 5J5NA 5DALB 4F9ZA 1WMJA 1XVQA 1T4YA 3FW2A 4KB3A 2VL2C 4HI7A 1AIUA 4HZ2A 3G7IA 4YQVA 5AIXA 1YEXA 16GSA 3TKSA 2I9HA 1PA3A 2OE3A 2MBTA 4I5QA 3KXOA 4K7OA 1XIYA 3D5JA 2E0QA 3ME7A 5IMDA 3GURA 1HD2A 4HDEA 4MCUA 4PUFC 2M80A 1ZMAA 4ZL8A 2C0EA 4HQSA 2ZNMA 3A5WA 4IQ1A 1SKSB 3M1GA 3WGEA 2IIYA 4D73B 2VLTA 4MH2A 4DSSA 6GSUA 1OVNA 1HNAA 1F3BA 5J4YA 1XXUA 5BRTA 4DVCA 3C1SA 5KEJA 4X0XA 3O3TA 4FYCA 3IRAA 3IA1A 1M99A 3H93A 2HXKA 2QKEA 3VWUA 1MDIA 5ECSA 3L4NA 3GYKA 4Q5FA 3F9UA 3HVVA 3EINA 4EIPA 4PHZC 2C80A 1Z6NA 4GSTA 1SD9A 5KN1A 4K1FA 4LL4B 3PH9A 2DJ1A 3HMJG 5DALA 14GSA 3SBCA 5INYA 2REMA 2YV9A 5ECHB 2F3MA 2LRCA 1SVOA 3KIJA 4ECBA 1EEJA 3EPTA 1M3IA 2YJ7A 3D22A 1IYIA 2P5QA 2V6OA 5D96A 4MMMA 1JZOA 2GS3A 4ZB9A 4O92A 3FYGA 1S3CA 3TRQA 2PPTA 1K0MA 5COHA 1GSEA 3GTUB 2H66A 1SYRA 3RGBC 2O85A 2ZCTA 3IV4A 5A5HB 3WT1A 3I43A 4D73A 5L71A 3PGTA 1XVWA 4KDYA 2CX3A 3L78A 1O81A 1K0AA 2EFHA 4MH3A 4EKZA 3P90A 1B9YC 5FT3A 1ZGNA 1SK0A 3QDNA 2GSRA 4POMA 5JWOB 4MF7A 4AJ6A 1YZXA 1M2BA 2JZSA 3TUEA 1GWCA 2JZRA 3BOAA 4K8MA 3QCPA 4JZQA 4Q5QA 5GZZB 1R26A 2DJKA 3F3QA 3IC4A 3MNGA 3ZLPA 4X1UA 1BEDA 1YF1A 3EWLA 4IVFA 2JU5A 4AKHA 2V1MA 1YDKA 1F6MC 5A34B 4ZIJA 3PR8A 3HXSA 2OT3A 3TKQA 4EUYA 3DKSA 1XWCA 4G10A 4TVEA 1NW2A 1XG8A 1SL1B 2GSQA 1WOUA 4Z2TA 4KGIA 3RPNA 4AKGA 2GT5A 1H75A 2VD1A 5GSTA 3J7Yb 1O8XA 1YEWC 5D9VA 2WFCA 2LNSA 4GSSA 5A5KA 4V1Ag 2VCVA 1A23A 3GTUA 2A2SA 3VK9A 4TR4A 1JFUA 3ZL5A 4E68A 4K7IA 4ZBAA 1Z5YE 1GL8A 4JR4A 1E6BA 4G0KA 2O3EA 4FYUA 2ALBA 1BG1A 1EV4A 5HQPA 1UVZA 4GDFA 5FWGA 3WGXA 1GLQA 6GSXA 2H0GA 2TRXA 4OFTA 4BL7A 2HZFA 5CRWA 1DBYA 2YWOA 1EOGA 4ID0A 3TGZA 1GP1A 2LNTA 4IBPA 3G7JA 2H74A 4V2MA 4MF6A 2FHEA 6GSWA 4YAVA 5A34A 1MDKA 3LFLA 1NM3A 5G5EA 1RK4A 1JHBA 3VWXA 3QAGA 5JCGA 5CRDA 3RHBA 1G6YA 1TK0B 2RLIA 4XHMA 2CVBA 4ULXA 2HFDA 1TXXA 3FR3A 1Z7PA 1Y6EA 4IJIA 1ML6A 3IK9A 1G7OA 1XW9A 2WZ9A 2DJJA 5D93A 1F37A 1GRXA 1TU8A 1VF3A 2TRCP 3IOSA 3EU3A 1R4WA 4I2TA 1CQHA 4MPFA 4AKIA 4K9ZA 4RUVA 4F0CA 2QSIA 3KH7A 1Q98A 22GSA 2AJQB 3FY7A 4EDYA 1HNCA 4PX1A 1FOHA 4GXZA 1J08A 2KP2A 3GNJA 2K8SA 3ME8A 3Q18A 3ZVJD 2YWIA 1TRWA 2F9SA 4Q5RA 4TRXA 2HSHA 1PQNA 1GUMA 3CHXC 2LRTA 3S9FA 1ACVA 5D9TA 4OFNA 10GSA 3LXTA 1YKAA 5LCZA 1B8XA 2N5FA 1JZDA 3HD5A 2YCDA 3PPUA 1ABAA 1ERWA 2O8VB 2LQQA 2GGTA 3TJKA 2M72A 1GSDA 4QMKA 4GQCA 1WE0A 5DJLA 2H1AA 2AYTA 4K7NA 2OBIA 3GSSA 2V2GA 1SENA 4KCAA 4HQZA 4JEDA 1GNWA 5IPHA 1SK2A 3A2XA 4CHSA 3KP8A 2IMKA 1XWKA 2HSMB 3UAPA 5AGYA 5IPGA 1OC9B 3FHKA 2L4QA 12GSA 2C4JA 5E59A 4ZBDA 1S4BP 4IW9A 3IAS2 4K2DA 4OCFA 2X49A 3KGKA 4IP6A 1TU7A 4KE3A 3GHAA 2I4AA 4EDZA 2HRAA 4FYBA 1AQVA 2PWJA 4F0BA 4BVXB 1UC7A 1KEBA 13GSA 3F8UA 2FWEA 3P2AA 2B6MA 4KW6A 1PN0A 3CRUA 3VWWA 4CW9A 1Y25A 3VPTA 4W66A 2YJHA 4NPBA 1PKZA 1OYJA 1EV9A 2WW3A 2HSYA 1X5DA 1GSYA 5G30A 2MBSA 4Q5NA 4JR6A 3CTGA 2HQTA 2ON5A 3K8NA 3QAWA 4ZILA 3NIVA 3L9SA 5B8AA 1ERTA 4K0NA 1A2JA 2YZHA 2I81A 4WETA 3KCMA 1WP0A 2HRKB 2MMAA 1OC9A 2JSYA 2AB6A 2MMOA 2AUVA 3D6IA 1E2YA 3TOTA 1FG4A 3MYDA 3UBLA 4OO4A 3DXBA 1A24A 2VCTA 4ICYA 1V58A 4G2EA 1ILOA 3QMXA 4ML6A 3SWLA 1Y1UA 2PGTA 2H1BA 3CSHA 2YP6A 17GSA 2DSAA 2WJUA 3TU3B 4KDXA 1LU4A 2X8GA 5G2ZA 4MJAA 2N5AA 4BVXA 2CV4A 3EMPA 1X5EA 5DJMA 4IN0A 4HU9A 5IMAA 2R0GA 2V32A 2H1LA 2PVOC 4EXJA 3UVTA 2GQKA 4PUAA 4HJ2A 2VUPA 4O7HA 3A2VA 4FO5A 3EMXA 3D4TA 3GX0A 1TP9A 1V98A 2GLRA 1SL2B 1GSUA 1M9BA 1UA5A 5DAKB 5ECPB 3ZIJA 3CSJA 2H0HA 5B7CA 2A2PA 5DQSA 4OO5A 2HRKA 5HR0A 2HZEB 2VL3A 5DDLA 3Q19A 2IWTA 2F8AA 1W89A 2YANA 1V2AA 2JL4A 3Q6OA 5ECIB 1F2EA 1YVLA 1DSBA 3VWVA 2NVLA 3EURA 2WB9A 5IMZA 1TK5B 2H75A 3GH6A 1TI1A 2C3NA 1T4ZA 1GTAA 4BWQA 1OKDA 2IFQB 1G0TA 2IJYA 3GFKA 2A2RA 2J23A 3ZMKA 2WW2A 1EOHA 5KN3A 2BMXA 3GV1A 4HZ4A 3C73A 5ID2B 1SJ6A 3DGQA 4KX4A 19GSA 4MZCA 4GQFA 4Z2UA 2WDUA 2GDRA 5IOWA 5J40A 1YKCA 2PN8A 4ILFA 5JWQB 1A8LA 4J57E 1GSSA 2LUSA 2X8HA 4WXTA 5IM9A 1OE7A 1WWJA 3CRTA 4TR1B 5D8IA 4GTUA 4Z2RA 4L8EA 5DAKA 1T00A 4MJEA 2GSTA 4NHZA 4ZBBA 3LG6A 1SU9A 3GN3A 1A8YA 2HZEA 4G0LA 3GIXA 7GSSA 3R3EA 1OC3A 4MJBA 2ES7A 5KOWA 2GTUA 4MABA 1CQGA 1QFNA 1V9WA 3TKRA 2L5LA 3LEFA 1V40A 1WRYA 3ZREA 1F3AA 3HZ8A 3FKFA 2L59A 2EIQA 4O32A 2IFQA 2AHEA 4AF2A 2UV8G 2LJRA 4TR0A 4RQRA 3US3A 3UOMA 1TK8B 3J7Yk 5G1KA 1GULA 1VGLA 4AGSA 4HOJA 3FK8A 5ID2A 1B4QA 1M2DA 5H5SA 5B8BA 1AUCA 4XS4B 1VF4A 4I97A 4ZXGA 1JLVA 5J4UA 2BTOT 1ZYNA 4EO3A 2G2QA 2YWMA 4MP4A 2B7KA 1K0NA 3GL3A 3RHCA 3KP9A 5F07A 2OBKA 3VFIA 4H86A 1A0RP 4BL7B 2P5RA 4TR1A 3BJ5A 3JCML 1PN9A 4GWRA 4WF5A 2PBJA 1I5GA 1I9DA 2EIOA 5CYYA 3FR9A 5ECKB 3F0IA 2DJ0A 5F05A 3ZVJA 2XPEA 5IMFA 2H6ZA 3BBYA 1SD8A 3PINA 4LMWA 4KUNA 4TOPA 5EY6A 3KM6A 2C8UA 2WZSA 1XPVA 1TW9A 3BD2A 5F0GA 3CXGA 1SVLA 5A4UA 1B9XC 4O5UA
chains in the Genus database with same CATH topology
3EE2A 2GSSA 1GUKA 4K2XA 3TJBA 1K0DA 1YEPA 1O6JA 2L57A 1N25A 4XRAA 2G0FA 4KA0A 2FD3A 2VLVA 2H6YA 5ELAA 4IJ3A 3APQA 2YPMA 3HHVA 2FA4A 1TRUA 2C0GA 3IHGA 1EGRA 4MPGA 3E3EA 1FB0A 4E8EA 3D21A 2L6DA 3DRNA 1XBSA 3GMFA 4XS4A 3KEBA 3UARA 5ENUA 1AQWA 4MF5A 1U87A 2XBQA 2C0DA 4JRRA 4L0WA 1MTCA 4ZL7A 3IDVA 4USSA 1SVMA 5B6MA 1XFLA 2DBCA 2MYGA 4XCSA 1DUGA 4CDOA 2ON7A 5ELGA 3TDGA 2RUFA 3QOUA 2LTKA 3UIWA 1TI3A 3M0FA 2CZ3A 1JZRA 1ZOFA 3FZAA 4WBRD 1GLPA 2F51A 5IIZA 1H4OA 3HDCA 2DMMA 4LA1A 3LORA 1IYHA 2E2GA 4E8HA 4KSMA 1FVKA 4XRDA 1EZKA 1VF1A 4I2UA 4ECJA 1SKWB 3APSA 1WJKA 1GTUA 4YKFA 2JSZA 2PERA 8GSSA 2X4AA 1KBNA 1PD21 3F4RA 3GSTA 4NAXA 5A1NB 1X0RA 2OA7A 1R5AA 2EFCA 3HJOA 1PRXA 5HFKA 2OKAA 5F06A 4K0GA 3FEUA 2FY6A 2VOCA 2QC7A 3IK7A 2LS5A 4PXOA 2QA1A 5JCWA 5AN1A 2R4VA 3NOFA 1X9WB 4RQXA 3MAKA 4DEJA 3CSIA 1THXA 5E4WA 2VIMA 5H5QA 2LV3A 2EFEA 2DLXA 3E9JB 1N8JA 4ZB6A 2R5GA 4ISDA 4KAEA 2B5YA 3IBHA 4JE1A 3LXZA 4LLRA 3BCKA 3DYRA 1B4PA 1NHYA 1OAZA 3H4KA 1XWBA 2VO4A 3ZIVA 2HSNA 5ECNB 2RUEA 1V57A 2H1DA 3TOUA 3IHQA 2I1UA 4N11A 4EE0A 4BWSA 4I8BA 1T1VA 1U88A 4AI6A 5CRGA 2YNXA 4XS1A 5A1NA 4QL9A 2IN3A 1ON4A 1S3AA 1GTBA 1K0CA 3QFAC 1PX6A 3ZRDA 1X9SB 3ZZXA 4G01A 4IKHA 1X9MB 4YQUA 4O5RA 1BF5A 3TKPA 5EL8A 1S3DA 2DJ2A 5KOXA 1TTZA 1M9AA 3ZFBA 2GZYA 2GVPA 2FWGA 2H76A 1MDJA 2LSTA 2CZ2A 2HRFA 1YJ6A 1Q4JA 5HR3A 1FVJA 1TDIA 4F2IA 3ZITA 4WKWA 4CY6A 3TJFA 3MDKA 2B3SA 4TXOB 1EP7A 4A5PA 3NZNA 4L0UA 3DWVA 1WIKA 4FQUA 5D9XA 4ML1A 20GSA 2NPBA 3F3RA 2K9FA 3KMOA 1KTEA 3LGCA 2B5EA 1W4VA 3ZYWA 1PKWA 1O85A 3GA4A 5G5FA 1NSWA 2FLSA 4AJ7A 2YZUA 2IMEA 3CBUA 5GSSA 1XZOA 1DE1A 1MD4A 3TB2A 1FB6A 3VURA 2EFDA 4OD7A 5HFIA 4NHWA 2FUG2 1XW5A 2H6XA 3FZ5A 1M2AA 2CX4A 4ZB8A 2L5OA 4V2NA 5LD0A 4X4JA 2H19A 3LJRA 2DMLA 4I6XA 3TKSC 5DVBA 4TR3A 1JLWA 6GSSA 2E7PA 3M9JA 1TRVA 2K8VA 4FH8A 2B1LA 4N30A 4GLTA 1Z3EA 4GSNA 5DCHA 2L4CA 3F4TA 9GSSA 3KD0A 1U3IA 2IL3A 2WCIA 3F63A 1A2LA 5AIVA 4J2FA 2B7JA 1WPIA 3ERGA 1TKDB 3TJJA 3DEXA 1SJZA 5CREA 3ERFA 2HI7A 4IQAA 4TXOA 5DQYA 4GF0A 4EC0A 3HJPA 2WS2A 4F82A 1AQXA 2DKIA 2K6VA 2WGRA 5ABRA 3BCIA 2DIYA 2R2JA 2KOKA 2XC2A 1FW1A 1EEMA 2H73A 2JZTA 4WBJA 1A2MA 1MD3A 1XOAA 2VCZA 5BMUB 2EC4A 1GNEA 2VAFA 3RPPA 4G9HA 1PSQA 3L9UA 3RAZA 1SK1A 4V1Ap 3KMNA 3C71A 3HZ4A 1SKRB 2OACA 4QL7A 2H30A 3ISOA 4P3YB 4EL1A 1Z6MA 2MZCA 4Z7XA 1USBA 1F9MA 2D2ZA 2IMDA 4PTSA 3EVIA 5HR2A 1C72A 1Z7RA 3O76A 2FA8A 2ZUPA 4EVMA 4G19A 1T7PB 5CP1A 1O8WA 3U6VA 1XW6A 1THOA 1U3AA 3HY2A 5G31A 3TRPA 2PUKC 5F8BA 1OKTA 2UZ8A 4ACSA 4PNFA 3F6DA 5IOXA 3LSZA 4BA7A 4XS6A 2B5XA 2IMIA 1PL1A 4PGTA 3UMAA 3M3MA 4BVYB 2C3QA 2GT6A 2OE1A 4K5SA 3UEMA 3I6AA 5CRHA 2GQMA 4BPYA 3UJ1A 1YQ1A 1ERVA 4OFMA 4YQMA 3WYWA 3IE3A 2O7KA 1XCCA 2VL9A 1YY7A 4TW5A 4IELA 5D9WA 3QAVA 2RM6A 4MDCA 5ECLB 1EP8A 4K6XA 4KF9A 4PURA 2N5BA 4OCEA 5BMUA 1EWXA 3AY8A 2VCXA 1URMA 5GAPD 1OE8A 3P7XA 3H1NA 1A0FA 2OE0A 3GKMA 5EPFA 4L5LA 2LEGA 3GL5A 3FRCA 4PQIA 2PU9C 2R0CA 4F03A 5J4VA 3HA9A 3EU4A 3GX8A 4OMVA 1SYXA 3LW9A 3WT2A 2LKUA 2DC5A 1QGVA 1PGTA 2VM1A 4N0VA 2H8LA 2PVQA 2H71A 3LQ7A 4WR4A 3DVWA 2X8CA 1X5CA 2CVDA 2OJLA 1QK8A 1BYEA 3M8NA 4IS0A 2H70A 2A4VA 4BVYA 3W8SA 3LYKA 4NV5A 4KSOA 2HYXA 1JZWA 1ZZYA 2E2MA 3RDWA 2I3YA 1T3BA 1B48A 1ERUA 3ZMLA 4YKGA 2P31A 2VCQA 3H79A 4HUAA 1BJXA 4KNDA 3HJMA 3RBTA 3D0ZA 1U6TA 5J41A 2P0GA 4O5QA 4V2LA 2VL2A 1K3LA 1HYUA 1AW9A 5J3RA 1R7HA 3MSZA 2O89A 3TCOA 2CAQA 4G0IA 4KH7A 3CYNA 2H72A 2K18A 2X99A 4IP1A 4LL1B 4OWYA 4POKA 5CAXA 3C7MA 1O7UA 2GQLA 6GSVA 2EIRA 5EVOA 4GRFA 1K0OA 5KN2A 3HKRA 1J0FA 3L0HA 2VD0A 1GUHA 1AC1A 4EIQA 2GZPA 4IGJA 4TXVA 2V6KA 5ECMB 2DIZA 1UN2A 2YWNA 4N0ZA 3A2WA 3IR4A 4LMVA 4AKXB 3DIEA 2M46A 3LYPA 1ZYEA 3CMIA 1PX7A 2NBSA 1ZL9A 3MWHA 2VKZG 6GSYA 2PMTA 5IO0A 5A4VA 5GAND 4EF0A 4KCEA 4WR5A 11GSA 2OADA 3HVXA 1DE2A 3MIXA 2YN1A 3F6FA 3DMLA 1AAZA 2TIRA 5A5HA 2RM5A 3I9V2 3APOA 2H0IA 5DBQA 1XWGA 2LJKA 5KN0A 4K5RA 2CA8A 1RW1A 4POLA 2FNOA 3R2QA 4JU5A 1N2AA 3I69A 4MZBA 3C8EA 2HSNB 4ZB7A 3A5IA 1FHEA 3UVHA 3W6GA 5IMVA 4QQ7A 2LRNA 3TJGA 3GUSA 2AAWA 18GSA 1ZYQB 1M7TA 2FWFA 2CT6A 3KH9A 1T8EB 4JBBA 1XWAA 2BJXA 5IQYA 3UL3A 3IPZA 2V41A 4MLYA 2DKHA 5ECOB 3VI5A 3VI7A 3DD3A 2RIIA 3FMWA 4XTSA 3D4MA 3FZ4A 3WGDA 1QMVA 4AJ8A 5AISA 1J9BA 2CAIA 1BQ7A 5J9BA 4CY8A 1TXUA 2JACA 1M0UA 1G6WA 1TRSA 4HEA2 4RI6A 4HS1A 2L6CA 4L5OA 2MMZA 3ED3A 2R3XA 1EGOA 4MA9A 2KLXA 3M9KA 3W8JA 2HT9A 1GTIA 3KTBA 3Q74A 1TOFA 3IXRA 4NMUA 5B6NA 1PL2A 2LJAA 4PNGA 1BAYA 3IC8A 1OC8A 1RQMA 1K0BA 2WRTA 4DSRA 5H5RA 3U5RE 3QD9A 1HNBA 2WULA 3CTFA 2KUCA 3H8QA 1QUWA 3ERWA 3E0UA 3ZTLA 1FAAA 1KNGA 1GSFA 3GKKA 3VPQA 2KHPA 2X64A 5CNWA 3EYTA 2DJ3A 4N10A 1ZYPA 3QR6A 3O6TA 4POBA 2KP1A 2LQOA 4NV2A 4ZL9A 2JADA 5JWRB 1NHOA 1QXHA 5ECQB 5ECRB 4TKYA 1GH2A 1HQOA 3G9BA 2FWHA 5CO3A 4WEYA 1O73A 2F8FA 2C0FA 3TKSE 4MJCA 1ST9A 1QQ2A 2FCHA 5J47A 2MMNA 1FOVA 5A4WA 3GH9A 3N5OA 4IHUA 5FHIA 1SJIA 4NXIA 3HYPA 2VM2A 3IAM2 3EC3A 2QA2A 3V1WA 5JCUA 1MEKA 2QGVA 3FZ9A 2C3TA 1K3YA 3TRXA 4PQHA 3FR6A 1FO5A 1Z9HA 2IPAA 3DVXA 3F4SA 3L9VA 2FGXA 2AV4A 2HNLA 2R0PA 3LWAA 2XHFA 5DCGA 2YV7A 3HVSA 3GRXA 3VLNA 1BG5A 2A4HA 4XIHA 1XOBA 2GZZA 4TN8A 4FIWA 4ECIA 4YAPA 3P8WA 1LJRA 3CWGA 4NWYA 4DSQA 1TJDA 5HR1A 2HSMA 5G1LA 3C1RA 2R6KA 3OR5A 4KDUA 4N3ZA 3QPMA 4J56E 3KZQA 1VRSD 1SL0B 1PMTA 5J9CA 5IO2A 2CQ9A 2B1KA 3GKXA 4X43A 5C04A 3N9JA 2HRNA 4YH2A 2HE3A 2NTOA 2CVKA 2R37A 2IMFA 1GSQA 1G7EA 2HLSA 3HCZA 5D73A 2H1GA 2VLUA 4DSSB 4ECCA 3KTLA 1K3OA 3UBKA 1LBKA 4HU7A 1BX9A 4PQ1A 4HJMA 1ZCPA 4GCIA 3ZFLA 1YF0A 5C00A 5IMCA 5LNKe 4MZWA 4MNNA 2H01A 2O87A 4MK3A 3GKNA 6GSTA 3KJYA 2YOIA 2Z9SA 2NDOA 2XBIA 2O5VA 3A3TA 2C1YA 4RI7A 3WD6A 1VF2A 3QFBC 2VCWA 1AXDA 5HFGA 3G7YA 1R5PA 2J9HA 4WF4A 2XPDA 5J5NA 5DALB 4F9ZA 1WMJA 1XVQA 1T4YA 3FW2A 4KB3A 2VL2C 4HI7A 1AIUA 4HZ2A 3G7IA 4YQVA 5AIXA 1YEXA 16GSA 3TKSA 2I9HA 1PA3A 2OE3A 2MBTA 4I5QA 3KXOA 4K7OA 1XIYA 3D5JA 2E0QA 3ME7A 5IMDA 3GURA 1HD2A 4HDEA 4MCUA 4PUFC 2M80A 1ZMAA 4ZL8A 2C0EA 4HQSA 2ZNMA 3A5WA 4IQ1A 1SKSB 3M1GA 3WGEA 2IIYA 4D73B 2VLTA 4MH2A 4DSSA 6GSUA 1OVNA 1HNAA 1F3BA 5J4YA 1XXUA 5BRTA 4DVCA 3C1SA 5KEJA 4X0XA 3O3TA 4FYCA 3IRAA 3IA1A 1M99A 3H93A 2HXKA 2QKEA 3VWUA 1MDIA 5ECSA 3L4NA 3GYKA 4Q5FA 3F9UA 3HVVA 3EINA 4EIPA 2C80A 1Z6NA 4GSTA 1SD9A 5KN1A 4K1FA 4LL4B 3PH9A 2DJ1A 3HMJG 5DALA 14GSA 3SBCA 5INYA 2REMA 2YV9A 5ECHB 2F3MA 2LRCA 1SVOA 3KIJA 4ECBA 1EEJA 3EPTA 2YJ7A 3D22A 1IYIA 2P5QA 2V6OA 5D96A 4MMMA 1JZOA 2GS3A 4ZB9A 4O92A 3FYGA 1S3CA 3TRQA 2PPTA 1K0MA 5COHA 1GSEA 3GTUB 2H66A 1SYRA 2O85A 2ZCTA 3IV4A 5A5HB 3WT1A 3I43A 4D73A 5L71A 3PGTA 1XVWA 4KDYA 2CX3A 3L78A 1O81A 1K0AA 2EFHA 4MH3A 4EKZA 3P90A 1B9YC 5FT3A 1ZGNA 1SK0A 3QDNA 2GSRA 4POMA 5JWOB 4MF7A 4AJ6A 1YZXA 1M2BA 2JZSA 3TUEA 1GWCA 2JZRA 3BOAA 4K8MA 3QCPA 4JZQA 4Q5QA 5GZZB 1R26A 2DJKA 3F3QA 3IC4A 3MNGA 3ZLPA 4X1UA 1BEDA 1YF1A 3EWLA 4IVFA 2JU5A 4AKHA 2V1MA 1YDKA 1F6MC 5A34B 4ZIJA 3PR8A 3HXSA 2OT3A 3TKQA 4EUYA 3DKSA 1XWCA 4G10A 4TVEA 1NW2A 1SL1B 2GSQA 1WOUA 4Z2TA 4KGIA 3RPNA 4AKGA 2GT5A 1H75A 2VD1A 5GSTA 3J7Yb 1O8XA 5D9VA 2WFCA 2LNSA 4GSSA 5A5KA 4V1Ag 2VCVA 1A23A 3GTUA 2A2SA 3VK9A 4TR4A 1JFUA 3ZL5A 4E68A 4K7IA 4ZBAA 1Z5YE 1GL8A 4JR4A 1E6BA 4G0KA 4FYUA 2ALBA 1BG1A 1EV4A 5HQPA 1UVZA 4GDFA 5FWGA 3WGXA 1GLQA 6GSXA 2H0GA 2TRXA 4OFTA 4BL7A 2HZFA 5CRWA 1DBYA 2YWOA 1EOGA 4ID0A 3TGZA 1GP1A 2LNTA 4IBPA 3G7JA 2H74A 4V2MA 4MF6A 2FHEA 6GSWA 4YAVA 5A34A 1MDKA 3LFLA 1NM3A 5G5EA 1RK4A 1JHBA 3VWXA 3QAGA 5JCGA 5CRDA 3RHBA 1G6YA 1TK0B 2RLIA 4XHMA 2CVBA 4ULXA 2HFDA 1TXXA 3FR3A 1Z7PA 1Y6EA 4IJIA 1ML6A 3IK9A 1G7OA 1XW9A 2WZ9A 2DJJA 5D93A 1F37A 1GRXA 1TU8A 1VF3A 2TRCP 3IOSA 3EU3A 1R4WA 4I2TA 1CQHA 4MPFA 4AKIA 4K9ZA 4RUVA 4F0CA 2QSIA 3KH7A 1Q98A 22GSA 2AJQB 3FY7A 4EDYA 1HNCA 4PX1A 1FOHA 4GXZA 1J08A 2KP2A 3GNJA 2K8SA 3ME8A 3Q18A 3ZVJD 2YWIA 1TRWA 2F9SA 4Q5RA 4TRXA 2HSHA 1PQNA 1GUMA 2LRTA 3S9FA 1ACVA 5D9TA 4OFNA 10GSA 3LXTA 1YKAA 5LCZA 1B8XA 2N5FA 1JZDA 3HD5A 2YCDA 3PPUA 1ABAA 1ERWA 2O8VB 2LQQA 2GGTA 3TJKA 2M72A 1GSDA 4QMKA 4GQCA 1WE0A 5DJLA 2H1AA 2AYTA 4K7NA 2OBIA 3GSSA 2V2GA 1SENA 4KCAA 4HQZA 4JEDA 1GNWA 5IPHA 1SK2A 3A2XA 4CHSA 3KP8A 2IMKA 1XWKA 2HSMB 3UAPA 5AGYA 5IPGA 1OC9B 3FHKA 2L4QA 12GSA 2C4JA 5E59A 4ZBDA 4IW9A 3IAS2 4K2DA 4OCFA 2X49A 3KGKA 4IP6A 1TU7A 4KE3A 3GHAA 2I4AA 4EDZA 2HRAA 4FYBA 1AQVA 2PWJA 4F0BA 4BVXB 1UC7A 1KEBA 13GSA 3F8UA 2FWEA 3P2AA 2B6MA 4KW6A 1PN0A 3CRUA 3VWWA 4CW9A 1Y25A 3VPTA 4W66A 2YJHA 4NPBA 1PKZA 1OYJA 1EV9A 2HSYA 1X5DA 1GSYA 5G30A 2MBSA 4Q5NA 4JR6A 3CTGA 2HQTA 2ON5A 3K8NA 3QAWA 4ZILA 3NIVA 3L9SA 5B8AA 1ERTA 4K0NA 1A2JA 2YZHA 2I81A 4WETA 3KCMA 1WP0A 2HRKB 2MMAA 1OC9A 2JSYA 2AB6A 2MMOA 2AUVA 3D6IA 1E2YA 3TOTA 1FG4A 3MYDA 3UBLA 4OO4A 3DXBA 1A24A 2VCTA 4ICYA 1V58A 4G2EA 1ILOA 3QMXA 4ML6A 3SWLA 1Y1UA 2PGTA 2H1BA 3CSHA 2YP6A 17GSA 2DSAA 2WJUA 3TU3B 4KDXA 1LU4A 2X8GA 5G2ZA 4MJAA 2N5AA 4BVXA 2CV4A 3EMPA 1X5EA 5DJMA 4IN0A 4HU9A 5IMAA 2R0GA 2V32A 2H1LA 2PVOC 4EXJA 3UVTA 2GQKA 4PUAA 4HJ2A 2VUPA 4O7HA 3A2VA 4FO5A 3EMXA 3D4TA 3GX0A 1TP9A 1V98A 2GLRA 1SL2B 1GSUA 1M9BA 1UA5A 5DAKB 5ECPB 3ZIJA 3CSJA 2H0HA 5B7CA 2A2PA 5DQSA 4OO5A 2HRKA 5HR0A 2HZEB 2VL3A 5DDLA 3Q19A 2IWTA 2F8AA 1W89A 2YANA 1V2AA 2JL4A 3Q6OA 5ECIB 1F2EA 1YVLA 1DSBA 3VWVA 2NVLA 3EURA 2WB9A 5IMZA 1TK5B 2H75A 3GH6A 1TI1A 2C3NA 1T4ZA 1GTAA 4BWQA 1OKDA 2IFQB 1G0TA 2IJYA 3GFKA 2A2RA 2J23A 3ZMKA 1EOHA 5KN3A 2BMXA 3GV1A 4HZ4A 3C73A 5ID2B 1SJ6A 3DGQA 4KX4A 19GSA 4MZCA 4GQFA 4Z2UA 2WDUA 2GDRA 5IOWA 5J40A 1YKCA 2PN8A 4ILFA 5JWQB 1A8LA 4J57E 1GSSA 2LUSA 2X8HA 4WXTA 5IM9A 1OE7A 1WWJA 3CRTA 4TR1B 5D8IA 4GTUA 4Z2RA 4L8EA 5DAKA 1T00A 4MJEA 2GSTA 4NHZA 4ZBBA 3LG6A 1SU9A 3GN3A 1A8YA 2HZEA 4G0LA 3GIXA 7GSSA 3R3EA 1OC3A 4MJBA 2ES7A 5KOWA 2GTUA 4MABA 1CQGA 1QFNA 1V9WA 3TKRA 2L5LA 3LEFA 1V40A 1WRYA 3ZREA 1F3AA 3HZ8A 3FKFA 2L59A 2EIQA 4O32A 2IFQA 2AHEA 4AF2A 2UV8G 2LJRA 4TR0A 4RQRA 3US3A 3UOMA 1TK8B 3J7Yk 5G1KA 1GULA 1VGLA 4AGSA 4HOJA 3FK8A 5ID2A 1B4QA 1M2DA 5H5SA 5B8BA 1AUCA 4XS4B 1VF4A 4I97A 4ZXGA 1JLVA 5J4UA 2BTOT 1ZYNA 4EO3A 2G2QA 2YWMA 4MP4A 2B7KA 1K0NA 3GL3A 3RHCA 3KP9A 5F07A 2OBKA 3VFIA 4H86A 1A0RP 4BL7B 2P5RA 4TR1A 3BJ5A 3JCML 1PN9A 4GWRA 4WF5A 2PBJA 1I5GA 1I9DA 2EIOA 5CYYA 3FR9A 5ECKB 3F0IA 2DJ0A 5F05A 3ZVJA 2XPEA 5IMFA 2H6ZA 3BBYA 1SD8A 3PINA 4LMWA 4KUNA 4TOPA 5EY6A 3KM6A 2C8UA 1XPVA 1TW9A 3BD2A 5F0GA 3CXGA 1SVLA 5A4UA 1B9XC 4O5UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EE2 A;  2GSS A;  1GUK A;  3TJB A;  1K0D A;  1YEP A;  1O6J A;  2L57 A;  4XRA A;  2G0F A;  4KA0 A;  2FD3 A;  2VLV A;  2H6Y A;  5ELA A;  4IJ3 A;  3APQ A;  2YPM A;  3HHV A;  2FA4 A;  1TRU A;  2C0G A;  1EGR A;  4MPG A;  3E3E A;  1FB0 A;  4E8E A;  3D21 A;  2L6D A;  3DRN A;  1XBS A;  3GMF A;  4XS4 A;  3KEB A;  3UAR A;  5ENU A;  1AQW A;  4MF5 A;  1U87 A;  2XBQ A;  2C0D A;  4JRR A;  4L0W A;  1MTC A;  4ZL7 A;  3IDV A;  4USS A;  5B6M A;  1XFL A;  2DBC A;  2MYG A;  4XCS A;  1DUG A;  4CDO A;  2ON7 A;  5ELG A;  3TDG A;  2RUF A;  3QOU A;  2LTK A;  3UIW A;  1TI3 A;  3M0F A;  2CZ3 A;  1JZR A;  1ZOF A;  3FZA A;  4WBR D;  1GLP A;  2F51 A;  5IIZ A;  1H4O A;  3HDC A;  2DMM A;  4LA1 A;  3LOR A;  1IYH A;  2E2G A;  4E8H A;  4KSM A;  1FVK A;  4XRD A;  1EZK A;  1VF1 A;  4I2U A;  4ECJ A;  1SKW B;  3APS A;  1WJK A;  1GTU A;  2JSZ A;  2PER A;  8GSS A;  1KBN A;  1PD2 1;  3F4R A;  3GST A;  4NAX A;  1X0R A;  2OA7 A;  1R5A A;  3HJO A;  1PRX A;  5HFK A;  2OKA A;  5F06 A;  4K0G A;  3FEU A;  2FY6 A;  2VOC A;  2QC7 A;  3IK7 A;  2LS5 A;  4PXO A;  5JCW A;  5AN1 A;  2R4V A;  3NOF A;  1X9W B;  4RQX A;  3MAK A;  4DEJ A;  3CSI A;  1THX A;  5E4W A;  2VIM A;  5H5Q A;  2LV3 A;  2DLX A;  3E9J B;  1N8J A;  4ZB6 A;  2R5G A;  4ISD A;  4KAE A;  2B5Y A;  3IBH A;  4JE1 A;  3LXZ A;  4LLR A;  3BCK A;  3DYR A;  1B4P A;  1NHY A;  1OAZ A;  3H4K A;  1XWB A;  2VO4 A;  3ZIV A;  5ECN B;  2RUE A;  1V57 A;  2H1D A;  3TOU A;  3IHQ A;  2I1U A;  4N11 A;  4EE0 A;  4BWS A;  4I8B A;  1T1V A;  1U88 A;  5CRG A;  2YNX A;  4XS1 A;  4QL9 A;  2IN3 A;  1ON4 A;  1S3A A;  1GTB A;  1K0C A;  3QFA C;  1PX6 A;  3ZRD A;  1X9S B;  3ZZX A;  4IKH A;  1X9M B;  4YQU A;  4O5R A;  3TKP A;  5EL8 A;  1S3D A;  2DJ2 A;  1TTZ A;  1M9A A;  3ZFB A;  2GZY A;  2GVP A;  2FWG A;  2H76 A;  1MDJ A;  2LST A;  2CZ2 A;  2HRF A;  1YJ6 A;  1Q4J A;  5HR3 A;  1FVJ A;  1TDI A;  4F2I A;  3ZIT A;  4WKW A;  3TJF A;  3MDK A;  2B3S A;  4TXO B;  1EP7 A;  3NZN A;  4L0U A;  3DWV A;  1WIK A;  4FQU A;  5D9X A;  4ML1 A;  20GS A;  2NPB A;  3F3R A;  2K9F A;  3KMO A;  1KTE A;  3LGC A;  2B5E A;  1W4V A;  3ZYW A;  1PKW A;  1O85 A;  3GA4 A;  5G5F A;  1NSW A;  2FLS A;  4AJ7 A;  2YZU A;  2IME A;  3CBU A;  5GSS A;  1XZO A;  1DE1 A;  1MD4 A;  3TB2 A;  1FB6 A;  3VUR A;  4OD7 A;  5HFI A;  4NHW A;  2FUG 2;  1XW5 A;  2H6X A;  3FZ5 A;  1M2A A;  2CX4 A;  4ZB8 A;  2L5O A;  4V2N A;  5LD0 A;  2H19 A;  3LJR A;  2DML A;  4I6X A;  3TKS C;  5DVB A;  4TR3 A;  1JLW A;  6GSS A;  2E7P A;  3M9J A;  1TRV A;  2K8V A;  4FH8 A;  2B1L A;  4N30 A;  4GLT A;  1Z3E A;  4GSN A;  5DCH A;  2L4C A;  3F4T A;  9GSS A;  3KD0 A;  1U3I A;  2IL3 A;  2WCI A;  3F63 A;  1A2L A;  5AIV A;  4J2F A;  2B7J A;  1WPI A;  3ERG A;  1TKD B;  3TJJ A;  3DEX A;  1SJZ A;  5CRE A;  3ERF A;  2HI7 A;  4IQA A;  4TXO A;  5DQY A;  4GF0 A;  4EC0 A;  3HJP A;  2WS2 A;  4F82 A;  1AQX A;  2K6V A;  2WGR A;  5ABR A;  3BCI A;  2DIY A;  2R2J A;  2KOK A;  2XC2 A;  1FW1 A;  1EEM A;  2H73 A;  2JZT A;  4WBJ A;  1A2M A;  1MD3 A;  1XOA A;  2VCZ A;  2EC4 A;  1GNE A;  2VAF A;  3RPP A;  4G9H A;  1PSQ A;  3L9U A;  3RAZ A;  1SK1 A;  4V1A p;  3KMN A;  3C71 A;  3HZ4 A;  1SKR B;  2OAC A;  4QL7 A;  2H30 A;  3ISO A;  4P3Y B;  4EL1 A;  1Z6M A;  2MZC A;  4Z7X A;  1USB A;  1F9M A;  2D2Z A;  2IMD A;  4PTS A;  3EVI A;  5HR2 A;  1C72 A;  1Z7R A;  3O76 A;  2FA8 A;  2ZUP A;  4EVM A;  4G19 A;  1T7P B;  5CP1 A;  1O8W A;  3U6V A;  1XW6 A;  1THO A;  1U3A A;  3HY2 A;  5G31 A;  3TRP A;  2PUK C;  5F8B A;  1OKT A;  2UZ8 A;  4ACS A;  4PNF A;  3F6D A;  5IOX A;  3LSZ A;  4BA7 A;  4XS6 A;  2B5X A;  2IMI A;  1PL1 A;  4PGT A;  3UMA A;  3M3M A;  4BVY B;  2C3Q A;  2GT6 A;  2OE1 A;  3UEM A;  3I6A A;  5CRH A;  2GQM A;  4BPY A;  3UJ1 A;  1YQ1 A;  1ERV A;  4OFM A;  4YQM A;  3WYW A;  3IE3 A;  2O7K A;  1XCC A;  2VL9 A;  1YY7 A;  4TW5 A;  4IEL A;  5D9W A;  3QAV A;  2RM6 A;  4MDC A;  5ECL B;  1EP8 A;  4K6X A;  4KF9 A;  4PUR A;  2N5B A;  4OCE A;  5BMU A;  1EWX A;  3AY8 A;  2VCX A;  1URM A;  5GAP D;  1OE8 A;  3P7X A;  3H1N A;  1A0F A;  2OE0 A;  3GKM A;  5EPF A;  4L5L A;  2LEG A;  3GL5 A;  3FRC A;  4PQI A;  2PU9 C;  4F03 A;  3HA9 A;  3EU4 A;  3GX8 A;  4OMV A;  1SYX A;  3WT2 A;  2LKU A;  2DC5 A;  1QGV A;  1PGT A;  2VM1 A;  4N0V A;  2H8L A;  2PVQ A;  2H71 A;  3LQ7 A;  4WR4 A;  3DVW A;  2X8C A;  1X5C A;  2CVD A;  2OJL A;  1QK8 A;  1BYE A;  3M8N A;  4IS0 A;  2H70 A;  2A4V A;  4BVY A;  3W8S A;  3LYK A;  4NV5 A;  4KSO A;  2HYX A;  1JZW A;  1ZZY A;  2E2M A;  3RDW A;  2I3Y A;  1T3B A;  1B48 A;  1ERU A;  3ZML A;  2P31 A;  2VCQ A;  3H79 A;  4HUA A;  1BJX A;  4KND A;  3HJM A;  3RBT A;  3D0Z A;  1U6T A;  5J41 A;  2P0G A;  4V2L A;  2VL2 A;  1K3L A;  1HYU A;  1AW9 A;  5J3R A;  1R7H A;  3MSZ A;  2O89 A;  3TCO A;  2CAQ A;  4G0I A;  4KH7 A;  3CYN A;  2H72 A;  2K18 A;  2X99 A;  4IP1 A;  4LL1 B;  4OWY A;  4POK A;  5CAX A;  3C7M A;  1O7U A;  2GQL A;  6GSV A;  2EIR A;  5EVO A;  4GRF A;  1K0O A;  5KN2 A;  3HKR A;  1J0F A;  3L0H A;  2VD0 A;  1GUH A;  1AC1 A;  2GZP A;  4IGJ A;  4TXV A;  2V6K A;  5ECM B;  2DIZ A;  1UN2 A;  2YWN A;  4N0Z A;  3A2W A;  3IR4 A;  4LMV A;  3DIE A;  2M46 A;  3LYP A;  1ZYE A;  3CMI A;  1PX7 A;  2NBS A;  1ZL9 A;  3MWH A;  6GSY A;  2PMT A;  5IO0 A;  5A4V A;  5GAN D;  4EF0 A;  4KCE A;  4WR5 A;  11GS A;  2OAD A;  3HVX A;  1DE2 A;  2YN1 A;  3F6F A;  3DML A;  1AAZ A;  2TIR A;  2RM5 A;  3I9V 2;  3APO A;  2H0I A;  5DBQ A;  1XWG A;  2LJK A;  5KN0 A;  2CA8 A;  1RW1 A;  4POL A;  2FNO A;  3R2Q A;  4JU5 A;  1N2A A;  3I69 A;  4MZB A;  3C8E A;  2HSN B;  1FHE A;  3UVH A;  3W6G A;  5IMV A;  4QQ7 A;  2LRN A;  3TJG A;  3GUS A;  2AAW A;  18GS A;  1ZYQ B;  1M7T A;  2FWF A;  2CT6 A;  3KH9 A;  1T8E B;  4JBB A;  1XWA A;  2BJX A;  5IQY A;  3UL3 A;  3IPZ A;  2V41 A;  4MLY A;  5ECO B;  3VI5 A;  3VI7 A;  3DD3 A;  2RII A;  4XTS A;  3D4M A;  3FZ4 A;  3WGD A;  1QMV A;  4AJ8 A;  5AIS A;  1J9B A;  2CAI A;  1BQ7 A;  5J9B A;  2JAC A;  1M0U A;  1G6W A;  1TRS A;  4HEA 2;  4RI6 A;  4HS1 A;  2L6C A;  4L5O A;  2MMZ A;  3ED3 A;  2R3X A;  1EGO A;  4MA9 A;  2KLX A;  3M9K A;  3W8J A;  2HT9 A;  1GTI A;  3KTB A;  3Q74 A;  1TOF A;  3IXR A;  4NMU A;  5B6N A;  1PL2 A;  2LJA A;  4PNG A;  1BAY A;  3IC8 A;  1OC8 A;  1RQM A;  1K0B A;  2WRT A;  4DSR A;  5H5R A;  3U5R E;  3QD9 A;  1HNB A;  2WUL A;  3CTF A;  2KUC A;  3H8Q A;  1QUW A;  3ERW A;  3E0U A;  3ZTL A;  1FAA A;  1KNG A;  1GSF A;  3GKK A;  3VPQ A;  2KHP A;  2X64 A;  5CNW A;  3EYT A;  2DJ3 A;  4N10 A;  3QR6 A;  3O6T A;  4POB A;  2KP1 A;  2LQO A;  4NV2 A;  4ZL9 A;  2JAD A;  5JWR B;  1NHO A;  1QXH A;  5ECQ B;  5ECR B;  4TKY A;  1GH2 A;  1HQO A;  3G9B A;  2FWH A;  5CO3 A;  4WEY A;  1O73 A;  2F8F A;  2C0F A;  3TKS E;  4MJC A;  1ST9 A;  1QQ2 A;  2FCH A;  2MMN A;  1FOV A;  5A4W A;  3GH9 A;  3N5O A;  4IHU A;  5FHI A;  1SJI A;  4NXI A;  3HYP A;  2VM2 A;  3IAM 2;  3EC3 A;  3V1W A;  5JCU A;  1MEK A;  2QGV A;  3FZ9 A;  2C3T A;  1K3Y A;  3TRX A;  4PQH A;  3FR6 A;  1FO5 A;  1Z9H A;  2IPA A;  3DVX A;  3F4S A;  3L9V A;  2FGX A;  2AV4 A;  2HNL A;  3LWA A;  2XHF A;  5DCG A;  2YV7 A;  3HVS A;  3GRX A;  3VLN A;  1BG5 A;  4XIH A;  1XOB A;  2GZZ A;  4TN8 A;  4FIW A;  4ECI A;  4YAP A;  3P8W A;  1LJR A;  4NWY A;  4DSQ A;  1TJD A;  5HR1 A;  2HSM A;  5G1L A;  3C1R A;  2R6K A;  3OR5 A;  4KDU A;  3QPM A;  4J56 E;  3KZQ A;  1VRS D;  1SL0 B;  1PMT A;  5J9C A;  5IO2 A;  2CQ9 A;  2B1K A;  3GKX A;  4X43 A;  5C04 A;  3N9J A;  2HRN A;  4YH2 A;  2HE3 A;  2NTO A;  2CVK A;  2R37 A;  2IMF A;  1GSQ A;  1G7E A;  2HLS A;  3HCZ A;  5D73 A;  2H1G A;  2VLU A;  4DSS B;  4ECC A;  3KTL A;  1K3O A;  3UBK A;  1LBK A;  4HU7 A;  1BX9 A;  4PQ1 A;  4HJM A;  1ZCP A;  4GCI A;  3ZFL A;  1YF0 A;  5C00 A;  5IMC A;  5LNK e;  4MZW A;  2H01 A;  2O87 A;  4MK3 A;  3GKN A;  6GST A;  3KJY A;  2YOI A;  2Z9S A;  2NDO A;  2XBI A;  3A3T A;  2C1Y A;  4RI7 A;  3WD6 A;  1VF2 A;  3QFB C;  2VCW A;  1AXD A;  5HFG A;  3G7Y A;  1R5P A;  2J9H A;  4WF4 A;  2XPD A;  5J5N A;  5DAL B;  4F9Z A;  1WMJ A;  1XVQ A;  1T4Y A;  3FW2 A;  4KB3 A;  2VL2 C;  4HI7 A;  1AIU A;  4HZ2 A;  3G7I A;  4YQV A;  5AIX A;  1YEX A;  16GS A;  3TKS A;  2I9H A;  1PA3 A;  2OE3 A;  2MBT A;  4I5Q A;  3KXO A;  4K7O A;  1XIY A;  3D5J A;  2E0Q A;  3ME7 A;  5IMD A;  3GUR A;  1HD2 A;  4HDE A;  4MCU A;  4PUF C;  2M80 A;  1ZMA A;  4ZL8 A;  2C0E A;  4HQS A;  2ZNM A;  3A5W A;  4IQ1 A;  1SKS B;  3M1G A;  3WGE A;  2IIY A;  4D73 B;  2VLT A;  4MH2 A;  4DSS A;  6GSU A;  1OVN A;  1HNA A;  1F3B A;  1XXU A;  4DVC A;  3C1S A;  5KEJ A;  4X0X A;  3O3T A;  4FYC A;  3IRA A;  3IA1 A;  1M99 A;  3H93 A;  2HXK A;  2QKE A;  3VWU A;  1MDI A;  5ECS A;  3L4N A;  3GYK A;  4Q5F A;  3F9U A;  3HVV A;  3EIN A;  2C80 A;  1Z6N A;  4GST A;  1SD9 A;  5KN1 A;  4K1F A;  4LL4 B;  3PH9 A;  2DJ1 A;  5DAL A;  14GS A;  3SBC A;  5INY A;  2REM A;  2YV9 A;  5ECH B;  2F3M A;  2LRC A;  3KIJ A;  4ECB A;  1EEJ A;  2YJ7 A;  3D22 A;  1IYI A;  2P5Q A;  2V6O A;  5D96 A;  4MMM A;  1JZO A;  2GS3 A;  4ZB9 A;  4O92 A;  3FYG A;  1S3C A;  3TRQ A;  2PPT A;  1K0M A;  5COH A;  1GSE A;  3GTU B;  2H66 A;  1SYR A;  2O85 A;  2ZCT A;  3IV4 A;  3WT1 A;  3I43 A;  4D73 A;  5L71 A;  3PGT A;  1XVW A;  4KDY A;  2CX3 A;  3L78 A;  1O81 A;  1K0A A;  4MH3 A;  4EKZ A;  3P90 A;  1B9Y C;  5FT3 A;  1ZGN A;  1SK0 A;  3QDN A;  2GSR A;  4POM A;  5JWO B;  4MF7 A;  4AJ6 A;  1YZX A;  1M2B A;  2JZS A;  3TUE A;  1GWC A;  2JZR A;  3BOA A;  4K8M A;  3QCP A;  4JZQ A;  4Q5Q A;  5GZZ B;  1R26 A;  2DJK A;  3F3Q A;  3IC4 A;  3MNG A;  3ZLP A;  4X1U A;  1BED A;  1YF1 A;  3EWL A;  4IVF A;  2JU5 A;  2V1M A;  1YDK A;  1F6M C;  4ZIJ A;  3PR8 A;  3HXS A;  3TKQ A;  4EUY A;  3DKS A;  1XWC A;  4G10 A;  4TVE A;  1NW2 A;  1SL1 B;  2GSQ A;  1WOU A;  4KGI A;  3RPN A;  2GT5 A;  1H75 A;  2VD1 A;  5GST A;  3J7Y b;  1O8X A;  5D9V A;  2WFC A;  2LNS A;  4GSS A;  5A5K A;  4V1A g;  2VCV A;  1A23 A;  3GTU A;  2A2S A;  3VK9 A;  4TR4 A;  1JFU A;  3ZL5 A;  4K7I A;  4ZBA A;  1Z5Y E;  1GL8 A;  4JR4 A;  1E6B A;  4G0K A;  4FYU A;  2ALB A;  1EV4 A;  5HQP A;  1UVZ A;  5FWG A;  3WGX A;  1GLQ A;  6GSX A;  2H0G A;  2TRX A;  4OFT A;  4BL7 A;  2HZF A;  5CRW A;  1DBY A;  2YWO A;  1EOG A;  4ID0 A;  3TGZ A;  1GP1 A;  2LNT A;  4IBP A;  3G7J A;  2H74 A;  4V2M A;  4MF6 A;  2FHE A;  6GSW A;  4YAV A;  1MDK A;  3LFL A;  1NM3 A;  5G5E A;  1RK4 A;  1JHB A;  3VWX A;  3QAG A;  5JCG A;  5CRD A;  3RHB A;  1G6Y A;  1TK0 B;  2RLI A;  4XHM A;  2CVB A;  4ULX A;  2HFD A;  1TXX A;  3FR3 A;  1Z7P A;  1Y6E A;  4IJI A;  1ML6 A;  3IK9 A;  1G7O A;  1XW9 A;  2WZ9 A;  2DJJ A;  5D93 A;  1F37 A;  1GRX A;  1TU8 A;  1VF3 A;  2TRC P;  3IOS A;  3EU3 A;  1R4W A;  4I2T A;  1CQH A;  4MPF A;  4K9Z A;  4RUV A;  4F0C A;  2QSI A;  3KH7 A;  1Q98 A;  22GS A;  2AJQ B;  3FY7 A;  4EDY A;  1HNC A;  4PX1 A;  4GXZ A;  1J08 A;  2KP2 A;  3GNJ A;  2K8S A;  3ME8 A;  3Q18 A;  3ZVJ D;  2YWI A;  1TRW A;  2F9S A;  4Q5R A;  4TRX A;  2HSH A;  1PQN A;  1GUM A;  2LRT A;  3S9F A;  1ACV A;  5D9T A;  4OFN A;  10GS A;  3LXT A;  1YKA A;  5LCZ A;  1B8X A;  2N5F A;  1JZD A;  3HD5 A;  2YCD A;  3PPU A;  1ABA A;  1ERW A;  2O8V B;  2LQQ A;  2GGT A;  3TJK A;  2M72 A;  1GSD A;  4GQC A;  1WE0 A;  5DJL A;  2H1A A;  2AYT A;  4K7N A;  2OBI A;  3GSS A;  2V2G A;  1SEN A;  4KCA A;  4HQZ A;  4JED A;  1GNW A;  5IPH A;  1SK2 A;  3A2X A;  4CHS A;  3KP8 A;  2IMK A;  1XWK A;  2HSM B;  3UAP A;  5AGY A;  5IPG A;  1OC9 B;  3FHK A;  2L4Q A;  12GS A;  2C4J A;  5E59 A;  4ZBD A;  4IW9 A;  3IAS 2;  4K2D A;  4OCF A;  3KGK A;  4IP6 A;  1TU7 A;  4KE3 A;  3GHA A;  2I4A A;  4EDZ A;  2HRA A;  4FYB A;  1AQV A;  2PWJ A;  4F0B A;  4BVX B;  1UC7 A;  1KEB A;  13GS A;  3F8U A;  2FWE A;  3P2A A;  2B6M A;  4KW6 A;  3CRU A;  3VWW A;  4CW9 A;  1Y25 A;  3VPT A;  2YJH A;  4NPB A;  1PKZ A;  1OYJ A;  1EV9 A;  2HSY A;  1X5D A;  1GSY A;  5G30 A;  2MBS A;  4Q5N A;  4JR6 A;  3CTG A;  2HQT A;  2ON5 A;  3K8N A;  3QAW A;  4ZIL A;  3NIV A;  3L9S A;  5B8A A;  1ERT A;  4K0N A;  1A2J A;  2YZH A;  2I81 A;  4WET A;  3KCM A;  1WP0 A;  2HRK B;  2MMA A;  1OC9 A;  2JSY A;  2AB6 A;  2MMO A;  2AUV A;  3D6I A;  1E2Y A;  3TOT A;  1FG4 A;  3UBL A;  4OO4 A;  3DXB A;  1A24 A;  2VCT A;  1V58 A;  4G2E A;  1ILO A;  3QMX A;  4ML6 A;  3SWL A;  2PGT A;  2H1B A;  3CSH A;  2YP6 A;  17GS A;  2DSA A;  2WJU A;  4KDX A;  1LU4 A;  2X8G A;  5G2Z A;  4MJA A;  2N5A A;  4BVX A;  2CV4 A;  3EMP A;  1X5E A;  5DJM A;  4IN0 A;  4HU9 A;  5IMA A;  2V32 A;  2PVO C;  4EXJ A;  3UVT A;  2GQK A;  4PUA A;  4HJ2 A;  2VUP A;  4O7H A;  3A2V A;  4FO5 A;  3EMX A;  3D4T A;  3GX0 A;  1TP9 A;  1V98 A;  2GLR A;  1SL2 B;  1GSU A;  1M9B A;  1UA5 A;  5DAK B;  5ECP B;  3ZIJ A;  3CSJ A;  2H0H A;  5B7C A;  5DQS A;  4OO5 A;  2HRK A;  5HR0 A;  2HZE B;  2VL3 A;  5DDL A;  3Q19 A;  2IWT A;  2F8A A;  1W89 A;  2YAN A;  1V2A A;  2JL4 A;  3Q6O A;  5ECI B;  1F2E A;  1DSB A;  3VWV A;  2NVL A;  3EUR A;  2WB9 A;  5IMZ A;  1TK5 B;  2H75 A;  3GH6 A;  1TI1 A;  2C3N A;  1T4Z A;  1GTA A;  4BWQ A;  1OKD A;  2IFQ B;  1G0T A;  2IJY A;  3GFK A;  2A2R A;  2J23 A;  3ZMK A;  1EOH A;  5KN3 A;  2BMX A;  3GV1 A;  4HZ4 A;  3C73 A;  5ID2 B;  1SJ6 A;  3DGQ A;  4KX4 A;  19GS A;  4MZC A;  4GQF A;  2WDU A;  2GDR A;  5IOW A;  1YKC A;  2PN8 A;  4ILF A;  5JWQ B;  1A8L A;  4J57 E;  1GSS A;  2LUS A;  2X8H A;  4WXT A;  5IM9 A;  1OE7 A;  1WWJ A;  3CRT A;  4TR1 B;  5D8I A;  4GTU A;  4L8E A;  5DAK A;  1T00 A;  4MJE A;  2GST A;  4NHZ A;  4ZBB A;  3LG6 A;  1SU9 A;  3GN3 A;  1A8Y A;  2HZE A;  4G0L A;  3GIX A;  7GSS A;  3R3E A;  1OC3 A;  4MJB A;  2ES7 A;  2GTU A;  4MAB A;  1CQG A;  1QFN A;  1V9W A;  3TKR A;  2L5L A;  3LEF A;  1V40 A;  1WRY A;  3ZRE A;  1F3A A;  3HZ8 A;  3FKF A;  2L59 A;  2EIQ A;  4O32 A;  2IFQ A;  2AHE A;  4AF2 A;  4TR0 A;  2LJR A;  4RQR A;  3US3 A;  3UOM A;  1TK8 B;  3J7Y k;  5G1K A;  1GUL A;  1VGL A;  4AGS A;  4HOJ A;  3FK8 A;  5ID2 A;  1B4Q A;  1M2D A;  5H5S A;  5B8B A;  1AUC A;  4XS4 B;  1VF4 A;  4I97 A;  4ZXG A;  1JLV A;  5J4U A;  2BTO T;  4EO3 A;  2G2Q A;  2YWM A;  4MP4 A;  2B7K A;  1K0N A;  3GL3 A;  3RHC A;  3KP9 A;  5F07 A;  2OBK A;  3VFI A;  4H86 A;  1A0R P;  4BL7 B;  2P5R A;  4TR1 A;  3BJ5 A;  3JCM L;  1PN9 A;  4GWR A;  4WF5 A;  2PBJ A;  1I5G A;  1I9D A;  2EIO A;  5CYY A;  3FR9 A;  5ECK B;  3F0I A;  2DJ0 A;  5F05 A;  3ZVJ A;  2XPE A;  5IMF A;  2H6Z A;  3BBY A;  1SD8 A;  3PIN A;  4LMW A;  4KUN A;  4TOP A;  5EY6 A;  3KM6 A;  2C8U A;  1XPV A;  1TW9 A;  3BD2 A;  5F0G A;  3CXG A;  5A4U A;  1B9X C; 
#chains in the Genus database with same CATH topology
 3EE2 A;  2GSS A;  1GUK A;  1I1I P;  2WVX B;  4K2X A;  3TJB A;  1K0D A;  1YEP A;  1O6J A;  2L57 A;  1N25 A;  4XRA A;  2G0F A;  4KA0 A;  2FD3 A;  2VLV A;  2H6Y A;  5ELA A;  4IJ3 A;  3APQ A;  2YPM A;  3HHV A;  2FA4 A;  1TRU A;  2C0G A;  3IHG A;  1EGR A;  4MPG A;  3E3E A;  1FB0 A;  4E8E A;  3D21 A;  2L6D A;  3DRN A;  1XBS A;  3GMF A;  4XS4 A;  3KEB A;  3UAR A;  5ENU A;  1AQW A;  4MF5 A;  1U87 A;  2XBQ A;  2C0D A;  4JRR A;  4L0W A;  1MTC A;  4ZL7 A;  3IDV A;  4USS A;  1SVM A;  5B6M A;  1XFL A;  2DBC A;  2WVZ A;  2MYG A;  4XCS A;  1DUG A;  4CDO A;  2ON7 A;  5ELG A;  3TDG A;  2RUF A;  3QOU A;  2LTK A;  3UIW A;  1TI3 A;  3M0F A;  2CZ3 A;  1JZR A;  1ZOF A;  3FZA A;  4WBR D;  1GLP A;  2F51 A;  5IIZ A;  1H4O A;  3HDC A;  2DMM A;  4LA1 A;  3LOR A;  1IYH A;  2E2G A;  2WVX A;  4E8H A;  4KSM A;  1FVK A;  4XRD A;  1EZK A;  1VF1 A;  4I2U A;  4ECJ A;  1SKW B;  3APS A;  1WJK A;  1GTU A;  4YKF A;  2JSZ A;  2PER A;  8GSS A;  2X4A A;  1KBN A;  1PD2 1;  3F4R A;  3GST A;  4NAX A;  5A1N B;  1X0R A;  2OA7 A;  1R5A A;  2EFC A;  3HJO A;  1PRX A;  5HFK A;  2OKA A;  5F06 A;  4K0G A;  3FEU A;  2FY6 A;  2VOC A;  4PI2 C;  2QC7 A;  3IK7 A;  2LS5 A;  4PXO A;  2QA1 A;  5JCW A;  5AN1 A;  2R4V A;  3NOF A;  1X9W B;  4RQX A;  3MAK A;  4DEJ A;  3CSI A;  1THX A;  5E4W A;  2VIM A;  5H5Q A;  2LV3 A;  2EFE A;  2DLX A;  3E9J B;  1N8J A;  4ZB6 A;  2R5G A;  4ISD A;  4KAE A;  2B5Y A;  3IBH A;  4JE1 A;  3LXZ A;  4LLR A;  3BCK A;  3DYR A;  1B4P A;  1NHY A;  1OAZ A;  3H4K A;  1XWB A;  2VO4 A;  3ZIV A;  2HSN A;  5ECN B;  2RUE A;  1V57 A;  2H1D A;  3TOU A;  3IHQ A;  2I1U A;  4N11 A;  4EE0 A;  4BWS A;  4I8B A;  1T1V A;  1U88 A;  4AI6 A;  5CRG A;  2YNX A;  4XS1 A;  5A1N A;  4QL9 A;  2IN3 A;  1ON4 A;  1S3A A;  1GTB A;  1K0C A;  3QFA C;  1PX6 A;  3ZRD A;  1X9S B;  3ZZX A;  1M3J A;  4G01 A;  4IKH A;  1X9M B;  4YQU A;  4O5R A;  1BF5 A;  3TKP A;  5EL8 A;  1S3D A;  3RFR C;  2DJ2 A;  5KOX A;  1TTZ A;  1M9A A;  3ZFB A;  2GZY A;  2GVP A;  2FWG A;  2H76 A;  1MDJ A;  2LST A;  2CZ2 A;  2HRF A;  1YJ6 A;  1Q4J A;  5HR3 A;  1FVJ A;  1TDI A;  4F2I A;  3ZIT A;  4WKW A;  4CY6 A;  3TJF A;  3MDK A;  2O36 A;  2B3S A;  1EP7 A;  4TXO B;  4A5P A;  3NZN A;  4L0U A;  3DWV A;  1WIK A;  4FQU A;  5D9X A;  4ML1 A;  20GS A;  4PI0 C;  2NPB A;  3F3R A;  2K9F A;  3KMO A;  1KTE A;  3LGC A;  2B5E A;  1W4V A;  3ZYW A;  1PKW A;  1O85 A;  3GA4 A;  5G5F A;  1NSW A;  2FLS A;  4AJ7 A;  2YZU A;  2IME A;  3CBU A;  5GSS A;  1XZO A;  1DE1 A;  1MD4 A;  3TB2 A;  1FB6 A;  3VUR A;  2EFD A;  4OD7 A;  5HFI A;  4NHW A;  2FUG 2;  1XW5 A;  2H6X A;  3FZ5 A;  1M2A A;  2CX4 A;  4ZB8 A;  2L5O A;  4V2N A;  5LD0 A;  4X4J A;  2H19 A;  3LJR A;  3CQF A;  2DML A;  4I6X A;  3TKS C;  5DVB A;  4TR3 A;  1JLW A;  6GSS A;  2E7P A;  3M9J A;  1TRV A;  2K8V A;  4FH8 A;  2B1L A;  4N30 A;  4GLT A;  1Z3E A;  4BIK A;  4GSN A;  5DCH A;  2L4C A;  3F4T A;  9GSS A;  3KD0 A;  1U3I A;  2IL3 A;  2WCI A;  3F63 A;  1A2L A;  5AIV A;  4J2F A;  2B7J A;  1WPI A;  3ERG A;  1TKD B;  3TJJ A;  3DEX A;  1SJZ A;  5CRE A;  3ERF A;  2HI7 A;  4IQA A;  4TXO A;  5DQY A;  4GF0 A;  4EC0 A;  3HJP A;  2WS2 A;  4F82 A;  1AQX A;  2DKI A;  2K6V A;  2WGR A;  5ABR A;  3BCI A;  2DIY A;  2R2J A;  2KOK A;  2XC2 A;  1FW1 A;  2WVY A;  1EEM A;  2H73 A;  2JZT A;  4WBJ A;  1A2M A;  2WW1 A;  1MD3 A;  1XOA A;  2VCZ A;  5BMU B;  2EC4 A;  1GNE A;  2VAF A;  3RPP A;  4G9H A;  1PSQ A;  3L9U A;  3RAZ A;  1SK1 A;  4V1A p;  3KMN A;  3C71 A;  3HZ4 A;  1SKR B;  2OAC A;  4QL7 A;  2H30 A;  3ISO A;  4P3Y B;  4EL1 A;  1Z6M A;  2MZC A;  4Z7X A;  1USB A;  1F9M A;  2D2Z A;  2IMD A;  4PTS A;  3EVI A;  5HR2 A;  1C72 A;  1Z7R A;  3O76 A;  2FA8 A;  2ZUP A;  4EVM A;  4G19 A;  1T7P B;  5CP1 A;  1O8W A;  3U6V A;  1XW6 A;  1THO A;  1U3A A;  3HY2 A;  5G31 A;  3TRP A;  2PUK C;  5F8B A;  1OKT A;  2UZ8 A;  4ACS A;  4PNF A;  3F6D A;  5IOX A;  3LSZ A;  4BA7 A;  4XS6 A;  2B5X A;  2IMI A;  1PL1 A;  4PGT A;  3UMA A;  3M3M A;  4BVY B;  2C3Q A;  2GT6 A;  2OE1 A;  4K5S A;  3UEM A;  3I6A A;  5CRH A;  2GQM A;  4BPY A;  3UJ1 A;  1YQ1 A;  1ERV A;  4OFM A;  4YQM A;  3WYW A;  3IE3 A;  2O7K A;  1XCC A;  2VL9 A;  1YY7 A;  4TW5 A;  4IEL A;  5D9W A;  3QAV A;  2RM6 A;  4MDC A;  5ECL B;  1EP8 A;  4K6X A;  4KF9 A;  4PUR A;  2N5B A;  4OCE A;  5BMU A;  1EWX A;  3AY8 A;  2VCX A;  1URM A;  5GAP D;  1OE8 A;  3P7X A;  3H1N A;  1A0F A;  2OE0 A;  3GKM A;  5EPF A;  4L5L A;  2LEG A;  3GL5 A;  3FRC A;  4PQI A;  2PU9 C;  2R0C A;  4F03 A;  5J4V A;  3HA9 A;  3EU4 A;  3GX8 A;  4OMV A;  1SYX A;  3LW9 A;  3WT2 A;  2LKU A;  2DC5 A;  1QGV A;  1PGT A;  2VM1 A;  4N0V A;  2H8L A;  2PVQ A;  2H71 A;  3LQ7 A;  4WR4 A;  3DVW A;  2X8C A;  1X5C A;  2CVD A;  2OJL A;  1QK8 A;  1BYE A;  3M8N A;  4IS0 A;  2H70 A;  2A4V A;  4BVY A;  3W8S A;  3LYK A;  4FXY P;  4NV5 A;  4KSO A;  2HYX A;  1JZW A;  1ZZY A;  2E2M A;  3RDW A;  2I3Y A;  1T3B A;  1B48 A;  1ERU A;  3ZML A;  4YKG A;  2P31 A;  2VCQ A;  3H79 A;  4HUA A;  1BJX A;  4KND A;  3HJM A;  3RBT A;  3D0Z A;  1U6T A;  5J41 A;  2P0G A;  4O5Q A;  4V2L A;  2VL2 A;  1K3L A;  1HYU A;  1AW9 A;  5J3R A;  1R7H A;  3MSZ A;  2O89 A;  3TCO A;  2CAQ A;  4G0I A;  4KH7 A;  3CYN A;  2H72 A;  2K18 A;  2X99 A;  4IP1 A;  4LL1 B;  4OWY A;  4POK A;  5CAX A;  2WW0 A;  3C7M A;  1O7U A;  2GQL A;  6GSV A;  2EIR A;  5EVO A;  4GRF A;  1K0O A;  5KN2 A;  3HKR A;  1J0F A;  3L0H A;  2VD0 A;  1GUH A;  1AC1 A;  1S3R A;  4EIQ A;  2GZP A;  4IGJ A;  4TXV A;  2V6K A;  5ECM B;  2DIZ A;  1UN2 A;  2YWN A;  4N0Z A;  3A2W A;  3IR4 A;  4LMV A;  4AKX B;  3DIE A;  2M46 A;  3LYP A;  1ZYE A;  3CMI A;  1PX7 A;  2NBS A;  1ZL9 A;  3MWH A;  2VKZ G;  6GSY A;  2PMT A;  5IO0 A;  5A4V A;  5GAN D;  4EF0 A;  4KCE A;  4WR5 A;  11GS A;  2OAD A;  3HVX A;  1DE2 A;  3MIX A;  2YN1 A;  3F6F A;  3DML A;  1AAZ A;  2TIR A;  5A5H A;  2RM5 A;  3I9V 2;  3APO A;  2H0I A;  5DBQ A;  1XWG A;  2LJK A;  5KN0 A;  4K5R A;  2CA8 A;  1RW1 A;  4POL A;  2FNO A;  3R2Q A;  4JU5 A;  1N2A A;  3I69 A;  4MZB A;  3C8E A;  2HSN B;  4ZB7 A;  3A5I A;  1FHE A;  3UVH A;  3W6G A;  5IMV A;  4QQ7 A;  2LRN A;  3TJG A;  3GUS A;  2AAW A;  18GS A;  1ZYQ B;  1M7T A;  2FWF A;  2CT6 A;  3KH9 A;  1T8E B;  4JBB A;  1XWA A;  2BJX A;  5IQY A;  3UL3 A;  3IPZ A;  2V41 A;  4MLY A;  2DKH A;  5ECO B;  3VI5 A;  3VI7 A;  3DD3 A;  2RII A;  3FMW A;  4XTS A;  3D4M A;  3FZ4 A;  3WGD A;  1QMV A;  4AJ8 A;  5AIS A;  1J9B A;  2CAI A;  1BQ7 A;  5J9B A;  4CY8 A;  1TXU A;  2JAC A;  1M0U A;  1G6W A;  1TRS A;  4HEA 2;  4RI6 A;  4HS1 A;  2L6C A;  4L5O A;  2MMZ A;  3ED3 A;  2R3X A;  1EGO A;  4MA9 A;  2KLX A;  1PFO A;  3M9K A;  3W8J A;  2HT9 A;  1GTI A;  3KTB A;  3Q74 A;  1TOF A;  3IXR A;  4NMU A;  5B6N A;  1PL2 A;  2LJA A;  4PNG A;  1BAY A;  3IC8 A;  1OC8 A;  1RQM A;  1K0B A;  2WRT A;  4DSR A;  5H5R A;  3U5R E;  3QD9 A;  1HNB A;  2WUL A;  3CTF A;  2KUC A;  3H8Q A;  1QUW A;  3ERW A;  3E0U A;  3ZTL A;  1FAA A;  1KNG A;  1GSF A;  4HSC X;  3GKK A;  3VPQ A;  2KHP A;  2X64 A;  5CNW A;  3EYT A;  2DJ3 A;  4N10 A;  1ZYP A;  3QR6 A;  3O6T A;  4POB A;  2KP1 A;  2LQO A;  4NV2 A;  4ZL9 A;  2JAD A;  5JWR B;  1NHO A;  1QXH A;  5ECQ B;  5ECR B;  4TKY A;  1GH2 A;  1HQO A;  3G9B A;  2FWH A;  5CO3 A;  4WEY A;  1O73 A;  2F8F A;  2C0F A;  3TKS E;  4MJC A;  1ST9 A;  1QQ2 A;  2FCH A;  5J47 A;  2MMN A;  1FOV A;  5A4W A;  3GH9 A;  3N5O A;  4IHU A;  5FHI A;  1SJI A;  4NXI A;  3HYP A;  2VM2 A;  3IAM 2;  3EC3 A;  2QA2 A;  3V1W A;  5JCU A;  1MEK A;  2QGV A;  3FZ9 A;  2C3T A;  1K3Y A;  3TRX A;  4PQH A;  3FR6 A;  1FO5 A;  1Z9H A;  2IPA A;  3DVX A;  3F4S A;  3L9V A;  2FGX A;  2AV4 A;  2HNL A;  2R0P A;  3LWA A;  2XHF A;  5DCG A;  2YV7 A;  3HVS A;  3GRX A;  3VLN A;  1BG5 A;  2A4H A;  4XIH A;  1XOB A;  2GZZ A;  4TN8 A;  4FIW A;  4ECI A;  4YAP A;  3P8W A;  1LJR A;  3CWG A;  4NWY A;  4DSQ A;  1TJD A;  5HR1 A;  2HSM A;  5G1L A;  3C1R A;  2R6K A;  3OR5 A;  4KDU A;  4N3Z A;  3QPM A;  4J56 E;  3KZQ A;  1VRS D;  1SL0 B;  1PMT A;  5J9C A;  5IO2 A;  2CQ9 A;  2B1K A;  3GKX A;  4X43 A;  5C04 A;  3N9J A;  2HRN A;  4YH2 A;  2HE3 A;  2NTO A;  2CVK A;  3HVN A;  2R37 A;  2IMF A;  1GSQ A;  1G7E A;  2HLS A;  3HCZ A;  5D73 A;  2H1G A;  2VLU A;  4DSS B;  4ECC A;  3KTL A;  1K3O A;  3UBK A;  1LBK A;  4HU7 A;  1BX9 A;  4PQ1 A;  4HJM A;  1ZCP A;  4GCI A;  3ZFL A;  1YF0 A;  5C00 A;  5IMC A;  5LNK e;  4MZW A;  4MNN A;  2H01 A;  2O87 A;  4MK3 A;  3GKN A;  6GST A;  3KJY A;  2YOI A;  2Z9S A;  2NDO A;  2XBI A;  2O5V A;  3A3T A;  2C1Y A;  4RI7 A;  3WD6 A;  1VF2 A;  3QFB C;  2VCW A;  1AXD A;  5HFG A;  3G7Y A;  1R5P A;  2J9H A;  4WF4 A;  2XPD A;  5J5N A;  5DAL B;  4F9Z A;  1WMJ A;  1XVQ A;  1T4Y A;  3FW2 A;  4KB3 A;  2VL2 C;  4HI7 A;  1AIU A;  4HZ2 A;  3G7I A;  4YQV A;  5AIX A;  1YEX A;  16GS A;  3TKS A;  2I9H A;  1PA3 A;  2OE3 A;  2MBT A;  4I5Q A;  3KXO A;  4K7O A;  1XIY A;  3D5J A;  2E0Q A;  3ME7 A;  5IMD A;  3GUR A;  1HD2 A;  4HDE A;  4MCU A;  4PUF C;  2M80 A;  1ZMA A;  4ZL8 A;  2C0E A;  4HQS A;  2ZNM A;  3A5W A;  4IQ1 A;  1SKS B;  3M1G A;  3WGE A;  2IIY A;  4D73 B;  2VLT A;  4MH2 A;  4DSS A;  6GSU A;  1OVN A;  1HNA A;  1F3B A;  5J4Y A;  1XXU A;  5BRT A;  4DVC A;  3C1S A;  5KEJ A;  4X0X A;  3O3T A;  4FYC A;  3IRA A;  3IA1 A;  1M99 A;  3H93 A;  2HXK A;  2QKE A;  3VWU A;  1MDI A;  5ECS A;  3L4N A;  3GYK A;  4Q5F A;  3F9U A;  3HVV A;  3EIN A;  4EIP A;  4PHZ C;  2C80 A;  1Z6N A;  4GST A;  1SD9 A;  5KN1 A;  4K1F A;  4LL4 B;  3PH9 A;  2DJ1 A;  3HMJ G;  5DAL A;  14GS A;  3SBC A;  5INY A;  2REM A;  2YV9 A;  5ECH B;  2F3M A;  2LRC A;  1SVO A;  3KIJ A;  4ECB A;  1EEJ A;  3EPT A;  1M3I A;  2YJ7 A;  3D22 A;  1IYI A;  2P5Q A;  2V6O A;  5D96 A;  4MMM A;  1JZO A;  2GS3 A;  4ZB9 A;  4O92 A;  3FYG A;  1S3C A;  3TRQ A;  2PPT A;  1K0M A;  5COH A;  1GSE A;  3GTU B;  2H66 A;  1SYR A;  3RGB C;  2O85 A;  2ZCT A;  3IV4 A;  5A5H B;  3WT1 A;  3I43 A;  4D73 A;  5L71 A;  3PGT A;  1XVW A;  4KDY A;  2CX3 A;  3L78 A;  1O81 A;  1K0A A;  2EFH A;  4MH3 A;  4EKZ A;  3P90 A;  1B9Y C;  5FT3 A;  1ZGN A;  1SK0 A;  3QDN A;  2GSR A;  4POM A;  5JWO B;  4MF7 A;  4AJ6 A;  1YZX A;  1M2B A;  2JZS A;  3TUE A;  1GWC A;  2JZR A;  3BOA A;  4K8M A;  3QCP A;  4JZQ A;  4Q5Q A;  5GZZ B;  1R26 A;  2DJK A;  3F3Q A;  3IC4 A;  3MNG A;  3ZLP A;  4X1U A;  1BED A;  1YF1 A;  3EWL A;  4IVF A;  2JU5 A;  4AKH A;  2V1M A;  1YDK A;  1F6M C;  5A34 B;  4ZIJ A;  3PR8 A;  3HXS A;  2OT3 A;  3TKQ A;  4EUY A;  3DKS A;  1XWC A;  4G10 A;  4TVE A;  1NW2 A;  1XG8 A;  1SL1 B;  2GSQ A;  1WOU A;  4Z2T A;  4KGI A;  3RPN A;  4AKG A;  2GT5 A;  1H75 A;  2VD1 A;  5GST A;  3J7Y b;  1O8X A;  1YEW C;  5D9V A;  2WFC A;  2LNS A;  4GSS A;  5A5K A;  4V1A g;  2VCV A;  1A23 A;  3GTU A;  2A2S A;  3VK9 A;  4TR4 A;  1JFU A;  3ZL5 A;  4E68 A;  4K7I A;  4ZBA A;  1Z5Y E;  1GL8 A;  4JR4 A;  1E6B A;  4G0K A;  2O3E A;  4FYU A;  2ALB A;  1BG1 A;  1EV4 A;  5HQP A;  1UVZ A;  4GDF A;  5FWG A;  3WGX A;  1GLQ A;  6GSX A;  2H0G A;  2TRX A;  4OFT A;  4BL7 A;  2HZF A;  5CRW A;  1DBY A;  2YWO A;  1EOG A;  4ID0 A;  3TGZ A;  1GP1 A;  2LNT A;  4IBP A;  3G7J A;  2H74 A;  4V2M A;  4MF6 A;  2FHE A;  6GSW A;  4YAV A;  5A34 A;  1MDK A;  3LFL A;  1NM3 A;  5G5E A;  1RK4 A;  1JHB A;  3VWX A;  3QAG A;  5JCG A;  5CRD A;  3RHB A;  1G6Y A;  1TK0 B;  2RLI A;  4XHM A;  2CVB A;  4ULX A;  2HFD A;  1TXX A;  3FR3 A;  1Z7P A;  1Y6E A;  4IJI A;  1ML6 A;  3IK9 A;  1G7O A;  1XW9 A;  2WZ9 A;  2DJJ A;  5D93 A;  1F37 A;  1GRX A;  1TU8 A;  1VF3 A;  2TRC P;  3IOS A;  3EU3 A;  1R4W A;  4I2T A;  1CQH A;  4MPF A;  4AKI A;  4K9Z A;  4RUV A;  4F0C A;  2QSI A;  3KH7 A;  1Q98 A;  22GS A;  2AJQ B;  3FY7 A;  4EDY A;  1HNC A;  4PX1 A;  1FOH A;  4GXZ A;  1J08 A;  2KP2 A;  3GNJ A;  2K8S A;  3ME8 A;  3Q18 A;  3ZVJ D;  2YWI A;  1TRW A;  2F9S A;  4Q5R A;  4TRX A;  2HSH A;  1PQN A;  1GUM A;  3CHX C;  2LRT A;  3S9F A;  1ACV A;  5D9T A;  4OFN A;  10GS A;  3LXT A;  1YKA A;  5LCZ A;  1B8X A;  2N5F A;  1JZD A;  3HD5 A;  2YCD A;  3PPU A;  1ABA A;  1ERW A;  2O8V B;  2LQQ A;  2GGT A;  3TJK A;  2M72 A;  1GSD A;  4QMK A;  4GQC A;  1WE0 A;  5DJL A;  2H1A A;  2AYT A;  4K7N A;  2OBI A;  3GSS A;  2V2G A;  1SEN A;  4KCA A;  4HQZ A;  4JED A;  1GNW A;  5IPH A;  1SK2 A;  3A2X A;  4CHS A;  3KP8 A;  2IMK A;  1XWK A;  2HSM B;  3UAP A;  5AGY A;  5IPG A;  1OC9 B;  3FHK A;  2L4Q A;  12GS A;  2C4J A;  5E59 A;  4ZBD A;  1S4B P;  4IW9 A;  3IAS 2;  4K2D A;  4OCF A;  2X49 A;  3KGK A;  4IP6 A;  1TU7 A;  4KE3 A;  3GHA A;  2I4A A;  4EDZ A;  2HRA A;  4FYB A;  1AQV A;  2PWJ A;  4F0B A;  4BVX B;  1UC7 A;  1KEB A;  13GS A;  3F8U A;  2FWE A;  3P2A A;  2B6M A;  4KW6 A;  1PN0 A;  3CRU A;  3VWW A;  4CW9 A;  1Y25 A;  3VPT A;  4W66 A;  2YJH A;  4NPB A;  1PKZ A;  1OYJ A;  1EV9 A;  2WW3 A;  2HSY A;  1X5D A;  1GSY A;  5G30 A;  2MBS A;  4Q5N A;  4JR6 A;  3CTG A;  2HQT A;  2ON5 A;  3K8N A;  3QAW A;  4ZIL A;  3NIV A;  3L9S A;  5B8A A;  1ERT A;  4K0N A;  1A2J A;  2YZH A;  2I81 A;  4WET A;  3KCM A;  1WP0 A;  2HRK B;  2MMA A;  1OC9 A;  2JSY A;  2AB6 A;  2MMO A;  2AUV A;  3D6I A;  1E2Y A;  3TOT A;  1FG4 A;  3MYD A;  3UBL A;  4OO4 A;  3DXB A;  1A24 A;  2VCT A;  4ICY A;  1V58 A;  4G2E A;  1ILO A;  3QMX A;  4ML6 A;  3SWL A;  1Y1U A;  2PGT A;  2H1B A;  3CSH A;  2YP6 A;  17GS A;  2DSA A;  2WJU A;  3TU3 B;  4KDX A;  1LU4 A;  2X8G A;  5G2Z A;  4MJA A;  2N5A A;  4BVX A;  2CV4 A;  3EMP A;  1X5E A;  5DJM A;  4IN0 A;  4HU9 A;  5IMA A;  2R0G A;  2V32 A;  2H1L A;  2PVO C;  4EXJ A;  3UVT A;  2GQK A;  4PUA A;  4HJ2 A;  2VUP A;  4O7H A;  3A2V A;  4FO5 A;  3EMX A;  3D4T A;  3GX0 A;  1TP9 A;  1V98 A;  2GLR A;  1SL2 B;  1GSU A;  1M9B A;  1UA5 A;  5DAK B;  5ECP B;  3ZIJ A;  3CSJ A;  2H0H A;  5B7C A;  2A2P A;  5DQS A;  4OO5 A;  2HRK A;  5HR0 A;  2HZE B;  2VL3 A;  5DDL A;  3Q19 A;  2IWT A;  2F8A A;  1W89 A;  2YAN A;  1V2A A;  2JL4 A;  3Q6O A;  5ECI B;  1F2E A;  1YVL A;  1DSB A;  3VWV A;  2NVL A;  3EUR A;  2WB9 A;  5IMZ A;  1TK5 B;  2H75 A;  3GH6 A;  1TI1 A;  2C3N A;  1T4Z A;  1GTA A;  4BWQ A;  1OKD A;  2IFQ B;  1G0T A;  2IJY A;  3GFK A;  2A2R A;  2J23 A;  3ZMK A;  2WW2 A;  1EOH A;  5KN3 A;  2BMX A;  3GV1 A;  4HZ4 A;  3C73 A;  5ID2 B;  1SJ6 A;  3DGQ A;  4KX4 A;  19GS A;  4MZC A;  4GQF A;  4Z2U A;  2WDU A;  2GDR A;  5IOW A;  5J40 A;  1YKC A;  2PN8 A;  4ILF A;  5JWQ B;  1A8L A;  4J57 E;  1GSS A;  2LUS A;  2X8H A;  4WXT A;  5IM9 A;  1OE7 A;  1WWJ A;  3CRT A;  4TR1 B;  5D8I A;  4GTU A;  4Z2R A;  4L8E A;  5DAK A;  1T00 A;  4MJE A;  2GST A;  4NHZ A;  4ZBB A;  3LG6 A;  1SU9 A;  3GN3 A;  1A8Y A;  2HZE A;  4G0L A;  3GIX A;  7GSS A;  3R3E A;  1OC3 A;  4MJB A;  2ES7 A;  5KOW A;  2GTU A;  4MAB A;  1CQG A;  1QFN A;  1V9W A;  3TKR A;  2L5L A;  3LEF A;  1V40 A;  1WRY A;  3ZRE A;  1F3A A;  3HZ8 A;  3FKF A;  2L59 A;  2EIQ A;  4O32 A;  2IFQ A;  2AHE A;  4AF2 A;  2UV8 G;  2LJR A;  4TR0 A;  4RQR A;  3US3 A;  3UOM A;  1TK8 B;  3J7Y k;  5G1K A;  1GUL A;  1VGL A;  4AGS A;  4HOJ A;  3FK8 A;  5ID2 A;  1B4Q A;  1M2D A;  5H5S A;  5B8B A;  1AUC A;  4XS4 B;  1VF4 A;  4I97 A;  4ZXG A;  1JLV A;  5J4U A;  2BTO T;  1ZYN A;  4EO3 A;  2G2Q A;  2YWM A;  4MP4 A;  2B7K A;  1K0N A;  3GL3 A;  3RHC A;  3KP9 A;  5F07 A;  2OBK A;  3VFI A;  4H86 A;  1A0R P;  4BL7 B;  2P5R A;  4TR1 A;  3BJ5 A;  3JCM L;  1PN9 A;  4GWR A;  4WF5 A;  2PBJ A;  1I5G A;  1I9D A;  2EIO A;  5CYY A;  3FR9 A;  5ECK B;  3F0I A;  2DJ0 A;  5F05 A;  3ZVJ A;  2XPE A;  5IMF A;  2H6Z A;  3BBY A;  1SD8 A;  3PIN A;  4LMW A;  4KUN A;  4TOP A;  5EY6 A;  3KM6 A;  2C8U A;  2WZS A;  1XPV A;  1TW9 A;  3BD2 A;  5F0G A;  3CXG A;  1SVL A;  5A4U A;  1B9X C;  4O5U A; 
#chains in the Genus database with same CATH homology
 3EE2 A;  2GSS A;  1GUK A;  4K2X A;  3TJB A;  1K0D A;  1YEP A;  1O6J A;  2L57 A;  1N25 A;  4XRA A;  2G0F A;  4KA0 A;  2FD3 A;  2VLV A;  2H6Y A;  5ELA A;  4IJ3 A;  3APQ A;  2YPM A;  3HHV A;  2FA4 A;  1TRU A;  2C0G A;  3IHG A;  1EGR A;  4MPG A;  3E3E A;  1FB0 A;  4E8E A;  3D21 A;  2L6D A;  3DRN A;  1XBS A;  3GMF A;  4XS4 A;  3KEB A;  3UAR A;  5ENU A;  1AQW A;  4MF5 A;  1U87 A;  2XBQ A;  2C0D A;  4JRR A;  4L0W A;  1MTC A;  4ZL7 A;  3IDV A;  4USS A;  1SVM A;  5B6M A;  1XFL A;  2DBC A;  2MYG A;  4XCS A;  1DUG A;  4CDO A;  2ON7 A;  5ELG A;  3TDG A;  2RUF A;  3QOU A;  2LTK A;  3UIW A;  1TI3 A;  3M0F A;  2CZ3 A;  1JZR A;  1ZOF A;  3FZA A;  4WBR D;  1GLP A;  2F51 A;  5IIZ A;  1H4O A;  3HDC A;  2DMM A;  4LA1 A;  3LOR A;  1IYH A;  2E2G A;  4E8H A;  4KSM A;  1FVK A;  4XRD A;  1EZK A;  1VF1 A;  4I2U A;  4ECJ A;  1SKW B;  3APS A;  1WJK A;  1GTU A;  4YKF A;  2JSZ A;  2PER A;  8GSS A;  2X4A A;  1KBN A;  1PD2 1;  3F4R A;  3GST A;  4NAX A;  5A1N B;  1X0R A;  2OA7 A;  1R5A A;  2EFC A;  3HJO A;  1PRX A;  5HFK A;  2OKA A;  5F06 A;  4K0G A;  3FEU A;  2FY6 A;  2VOC A;  2QC7 A;  3IK7 A;  2LS5 A;  4PXO A;  2QA1 A;  5JCW A;  5AN1 A;  2R4V A;  3NOF A;  1X9W B;  4RQX A;  3MAK A;  4DEJ A;  3CSI A;  1THX A;  5E4W A;  2VIM A;  5H5Q A;  2LV3 A;  2EFE A;  2DLX A;  3E9J B;  1N8J A;  4ZB6 A;  2R5G A;  4ISD A;  4KAE A;  2B5Y A;  3IBH A;  4JE1 A;  3LXZ A;  4LLR A;  3BCK A;  3DYR A;  1B4P A;  1NHY A;  1OAZ A;  3H4K A;  1XWB A;  2VO4 A;  3ZIV A;  2HSN A;  5ECN B;  2RUE A;  1V57 A;  2H1D A;  3TOU A;  3IHQ A;  2I1U A;  4N11 A;  4EE0 A;  4BWS A;  4I8B A;  1T1V A;  1U88 A;  4AI6 A;  5CRG A;  2YNX A;  4XS1 A;  5A1N A;  4QL9 A;  2IN3 A;  1ON4 A;  1S3A A;  1GTB A;  1K0C A;  3QFA C;  1PX6 A;  3ZRD A;  1X9S B;  3ZZX A;  4G01 A;  4IKH A;  1X9M B;  4YQU A;  4O5R A;  1BF5 A;  3TKP A;  5EL8 A;  1S3D A;  2DJ2 A;  5KOX A;  1TTZ A;  1M9A A;  3ZFB A;  2GZY A;  2GVP A;  2FWG A;  2H76 A;  1MDJ A;  2LST A;  2CZ2 A;  2HRF A;  1YJ6 A;  1Q4J A;  5HR3 A;  1FVJ A;  1TDI A;  4F2I A;  3ZIT A;  4WKW A;  4CY6 A;  3TJF A;  3MDK A;  2B3S A;  4TXO B;  1EP7 A;  4A5P A;  3NZN A;  4L0U A;  3DWV A;  1WIK A;  4FQU A;  5D9X A;  4ML1 A;  20GS A;  2NPB A;  3F3R A;  2K9F A;  3KMO A;  1KTE A;  3LGC A;  2B5E A;  1W4V A;  3ZYW A;  1PKW A;  1O85 A;  3GA4 A;  5G5F A;  1NSW A;  2FLS A;  4AJ7 A;  2YZU A;  2IME A;  3CBU A;  5GSS A;  1XZO A;  1DE1 A;  1MD4 A;  3TB2 A;  1FB6 A;  3VUR A;  2EFD A;  4OD7 A;  5HFI A;  4NHW A;  2FUG 2;  1XW5 A;  2H6X A;  3FZ5 A;  1M2A A;  2CX4 A;  4ZB8 A;  2L5O A;  4V2N A;  5LD0 A;  4X4J A;  2H19 A;  3LJR A;  2DML A;  4I6X A;  3TKS C;  5DVB A;  4TR3 A;  1JLW A;  6GSS A;  2E7P A;  3M9J A;  1TRV A;  2K8V A;  4FH8 A;  2B1L A;  4N30 A;  4GLT A;  1Z3E A;  4GSN A;  5DCH A;  2L4C A;  3F4T A;  9GSS A;  3KD0 A;  1U3I A;  2IL3 A;  2WCI A;  3F63 A;  1A2L A;  5AIV A;  4J2F A;  2B7J A;  1WPI A;  3ERG A;  1TKD B;  3TJJ A;  3DEX A;  1SJZ A;  5CRE A;  3ERF A;  2HI7 A;  4IQA A;  4TXO A;  5DQY A;  4GF0 A;  4EC0 A;  3HJP A;  2WS2 A;  4F82 A;  1AQX A;  2DKI A;  2K6V A;  2WGR A;  5ABR A;  3BCI A;  2DIY A;  2R2J A;  2KOK A;  2XC2 A;  1FW1 A;  1EEM A;  2H73 A;  2JZT A;  4WBJ A;  1A2M A;  1MD3 A;  1XOA A;  2VCZ A;  5BMU B;  2EC4 A;  1GNE A;  2VAF A;  3RPP A;  4G9H A;  1PSQ A;  3L9U A;  3RAZ A;  1SK1 A;  4V1A p;  3KMN A;  3C71 A;  3HZ4 A;  1SKR B;  2OAC A;  4QL7 A;  2H30 A;  3ISO A;  4P3Y B;  4EL1 A;  1Z6M A;  2MZC A;  4Z7X A;  1USB A;  1F9M A;  2D2Z A;  2IMD A;  4PTS A;  3EVI A;  5HR2 A;  1C72 A;  1Z7R A;  3O76 A;  2FA8 A;  2ZUP A;  4EVM A;  4G19 A;  1T7P B;  5CP1 A;  1O8W A;  3U6V A;  1XW6 A;  1THO A;  1U3A A;  3HY2 A;  5G31 A;  3TRP A;  2PUK C;  5F8B A;  1OKT A;  2UZ8 A;  4ACS A;  4PNF A;  3F6D A;  5IOX A;  3LSZ A;  4BA7 A;  4XS6 A;  2B5X A;  2IMI A;  1PL1 A;  4PGT A;  3UMA A;  3M3M A;  4BVY B;  2C3Q A;  2GT6 A;  2OE1 A;  4K5S A;  3UEM A;  3I6A A;  5CRH A;  2GQM A;  4BPY A;  3UJ1 A;  1YQ1 A;  1ERV A;  4OFM A;  4YQM A;  3WYW A;  3IE3 A;  2O7K A;  1XCC A;  2VL9 A;  1YY7 A;  4TW5 A;  4IEL A;  5D9W A;  3QAV A;  2RM6 A;  4MDC A;  5ECL B;  1EP8 A;  4K6X A;  4KF9 A;  4PUR A;  2N5B A;  4OCE A;  5BMU A;  1EWX A;  3AY8 A;  2VCX A;  1URM A;  5GAP D;  1OE8 A;  3P7X A;  3H1N A;  1A0F A;  2OE0 A;  3GKM A;  5EPF A;  4L5L A;  2LEG A;  3GL5 A;  3FRC A;  4PQI A;  2PU9 C;  2R0C A;  4F03 A;  5J4V A;  3HA9 A;  3EU4 A;  3GX8 A;  4OMV A;  1SYX A;  3LW9 A;  3WT2 A;  2LKU A;  2DC5 A;  1QGV A;  1PGT A;  2VM1 A;  4N0V A;  2H8L A;  2PVQ A;  2H71 A;  3LQ7 A;  4WR4 A;  3DVW A;  2X8C A;  1X5C A;  2CVD A;  2OJL A;  1QK8 A;  1BYE A;  3M8N A;  4IS0 A;  2H70 A;  2A4V A;  4BVY A;  3W8S A;  3LYK A;  4NV5 A;  4KSO A;  2HYX A;  1JZW A;  1ZZY A;  2E2M A;  3RDW A;  2I3Y A;  1T3B A;  1B48 A;  1ERU A;  3ZML A;  4YKG A;  2P31 A;  2VCQ A;  3H79 A;  4HUA A;  1BJX A;  4KND A;  3HJM A;  3RBT A;  3D0Z A;  1U6T A;  5J41 A;  2P0G A;  4O5Q A;  4V2L A;  2VL2 A;  1K3L A;  1HYU A;  1AW9 A;  5J3R A;  1R7H A;  3MSZ A;  2O89 A;  3TCO A;  2CAQ A;  4G0I A;  4KH7 A;  3CYN A;  2H72 A;  2K18 A;  2X99 A;  4IP1 A;  4LL1 B;  4OWY A;  4POK A;  5CAX A;  3C7M A;  1O7U A;  2GQL A;  6GSV A;  2EIR A;  5EVO A;  4GRF A;  1K0O A;  5KN2 A;  3HKR A;  1J0F A;  3L0H A;  2VD0 A;  1GUH A;  1AC1 A;  4EIQ A;  2GZP A;  4IGJ A;  4TXV A;  2V6K A;  5ECM B;  2DIZ A;  1UN2 A;  2YWN A;  4N0Z A;  3A2W A;  3IR4 A;  4LMV A;  4AKX B;  3DIE A;  2M46 A;  3LYP A;  1ZYE A;  3CMI A;  1PX7 A;  2NBS A;  1ZL9 A;  3MWH A;  2VKZ G;  6GSY A;  2PMT A;  5IO0 A;  5A4V A;  5GAN D;  4EF0 A;  4KCE A;  4WR5 A;  11GS A;  2OAD A;  3HVX A;  1DE2 A;  3MIX A;  2YN1 A;  3F6F A;  3DML A;  1AAZ A;  2TIR A;  5A5H A;  2RM5 A;  3I9V 2;  3APO A;  2H0I A;  5DBQ A;  1XWG A;  2LJK A;  5KN0 A;  4K5R A;  2CA8 A;  1RW1 A;  4POL A;  2FNO A;  3R2Q A;  4JU5 A;  1N2A A;  3I69 A;  4MZB A;  3C8E A;  2HSN B;  4ZB7 A;  3A5I A;  1FHE A;  3UVH A;  3W6G A;  5IMV A;  4QQ7 A;  2LRN A;  3TJG A;  3GUS A;  2AAW A;  18GS A;  1ZYQ B;  1M7T A;  2FWF A;  2CT6 A;  3KH9 A;  1T8E B;  4JBB A;  1XWA A;  2BJX A;  5IQY A;  3UL3 A;  3IPZ A;  2V41 A;  4MLY A;  2DKH A;  5ECO B;  3VI5 A;  3VI7 A;  3DD3 A;  2RII A;  3FMW A;  4XTS A;  3D4M A;  3FZ4 A;  3WGD A;  1QMV A;  4AJ8 A;  5AIS A;  1J9B A;  2CAI A;  1BQ7 A;  5J9B A;  4CY8 A;  1TXU A;  2JAC A;  1M0U A;  1G6W A;  1TRS A;  4HEA 2;  4RI6 A;  4HS1 A;  2L6C A;  4L5O A;  2MMZ A;  3ED3 A;  2R3X A;  1EGO A;  4MA9 A;  2KLX A;  3M9K A;  3W8J A;  2HT9 A;  1GTI A;  3KTB A;  3Q74 A;  1TOF A;  3IXR A;  4NMU A;  5B6N A;  1PL2 A;  2LJA A;  4PNG A;  1BAY A;  3IC8 A;  1OC8 A;  1RQM A;  1K0B A;  2WRT A;  4DSR A;  5H5R A;  3U5R E;  3QD9 A;  1HNB A;  2WUL A;  3CTF A;  2KUC A;  3H8Q A;  1QUW A;  3ERW A;  3E0U A;  3ZTL A;  1FAA A;  1KNG A;  1GSF A;  3GKK A;  3VPQ A;  2KHP A;  2X64 A;  5CNW A;  3EYT A;  2DJ3 A;  4N10 A;  1ZYP A;  3QR6 A;  3O6T A;  4POB A;  2KP1 A;  2LQO A;  4NV2 A;  4ZL9 A;  2JAD A;  5JWR B;  1NHO A;  1QXH A;  5ECQ B;  5ECR B;  4TKY A;  1GH2 A;  1HQO A;  3G9B A;  2FWH A;  5CO3 A;  4WEY A;  1O73 A;  2F8F A;  2C0F A;  3TKS E;  4MJC A;  1ST9 A;  1QQ2 A;  2FCH A;  5J47 A;  2MMN A;  1FOV A;  5A4W A;  3GH9 A;  3N5O A;  4IHU A;  5FHI A;  1SJI A;  4NXI A;  3HYP A;  2VM2 A;  3IAM 2;  3EC3 A;  2QA2 A;  3V1W A;  5JCU A;  1MEK A;  2QGV A;  3FZ9 A;  2C3T A;  1K3Y A;  3TRX A;  4PQH A;  3FR6 A;  1FO5 A;  1Z9H A;  2IPA A;  3DVX A;  3F4S A;  3L9V A;  2FGX A;  2AV4 A;  2HNL A;  2R0P A;  3LWA A;  2XHF A;  5DCG A;  2YV7 A;  3HVS A;  3GRX A;  3VLN A;  1BG5 A;  2A4H A;  4XIH A;  1XOB A;  2GZZ A;  4TN8 A;  4FIW A;  4ECI A;  4YAP A;  3P8W A;  1LJR A;  3CWG A;  4NWY A;  4DSQ A;  1TJD A;  5HR1 A;  2HSM A;  5G1L A;  3C1R A;  2R6K A;  3OR5 A;  4KDU A;  4N3Z A;  3QPM A;  4J56 E;  3KZQ A;  1VRS D;  1SL0 B;  1PMT A;  5J9C A;  5IO2 A;  2CQ9 A;  2B1K A;  3GKX A;  4X43 A;  5C04 A;  3N9J A;  2HRN A;  4YH2 A;  2HE3 A;  2NTO A;  2CVK A;  2R37 A;  2IMF A;  1GSQ A;  1G7E A;  2HLS A;  3HCZ A;  5D73 A;  2H1G A;  2VLU A;  4DSS B;  4ECC A;  3KTL A;  1K3O A;  3UBK A;  1LBK A;  4HU7 A;  1BX9 A;  4PQ1 A;  4HJM A;  1ZCP A;  4GCI A;  3ZFL A;  1YF0 A;  5C00 A;  5IMC A;  5LNK e;  4MZW A;  4MNN A;  2H01 A;  2O87 A;  4MK3 A;  3GKN A;  6GST A;  3KJY A;  2YOI A;  2Z9S A;  2NDO A;  2XBI A;  2O5V A;  3A3T A;  2C1Y A;  4RI7 A;  3WD6 A;  1VF2 A;  3QFB C;  2VCW A;  1AXD A;  5HFG A;  3G7Y A;  1R5P A;  2J9H A;  4WF4 A;  2XPD A;  5J5N A;  5DAL B;  4F9Z A;  1WMJ A;  1XVQ A;  1T4Y A;  3FW2 A;  4KB3 A;  2VL2 C;  4HI7 A;  1AIU A;  4HZ2 A;  3G7I A;  4YQV A;  5AIX A;  1YEX A;  16GS A;  3TKS A;  2I9H A;  1PA3 A;  2OE3 A;  2MBT A;  4I5Q A;  3KXO A;  4K7O A;  1XIY A;  3D5J A;  2E0Q A;  3ME7 A;  5IMD A;  3GUR A;  1HD2 A;  4HDE A;  4MCU A;  4PUF C;  2M80 A;  1ZMA A;  4ZL8 A;  2C0E A;  4HQS A;  2ZNM A;  3A5W A;  4IQ1 A;  1SKS B;  3M1G A;  3WGE A;  2IIY A;  4D73 B;  2VLT A;  4MH2 A;  4DSS A;  6GSU A;  1OVN A;  1HNA A;  1F3B A;  5J4Y A;  1XXU A;  5BRT A;  4DVC A;  3C1S A;  5KEJ A;  4X0X A;  3O3T A;  4FYC A;  3IRA A;  3IA1 A;  1M99 A;  3H93 A;  2HXK A;  2QKE A;  3VWU A;  1MDI A;  5ECS A;  3L4N A;  3GYK A;  4Q5F A;  3F9U A;  3HVV A;  3EIN A;  4EIP A;  2C80 A;  1Z6N A;  4GST A;  1SD9 A;  5KN1 A;  4K1F A;  4LL4 B;  3PH9 A;  2DJ1 A;  3HMJ G;  5DAL A;  14GS A;  3SBC A;  5INY A;  2REM A;  2YV9 A;  5ECH B;  2F3M A;  2LRC A;  1SVO A;  3KIJ A;  4ECB A;  1EEJ A;  3EPT A;  2YJ7 A;  3D22 A;  1IYI A;  2P5Q A;  2V6O A;  5D96 A;  4MMM A;  1JZO A;  2GS3 A;  4ZB9 A;  4O92 A;  3FYG A;  1S3C A;  3TRQ A;  2PPT A;  1K0M A;  5COH A;  1GSE A;  3GTU B;  2H66 A;  1SYR A;  2O85 A;  2ZCT A;  3IV4 A;  5A5H B;  3WT1 A;  3I43 A;  4D73 A;  5L71 A;  3PGT A;  1XVW A;  4KDY A;  2CX3 A;  3L78 A;  1O81 A;  1K0A A;  2EFH A;  4MH3 A;  4EKZ A;  3P90 A;  1B9Y C;  5FT3 A;  1ZGN A;  1SK0 A;  3QDN A;  2GSR A;  4POM A;  5JWO B;  4MF7 A;  4AJ6 A;  1YZX A;  1M2B A;  2JZS A;  3TUE A;  1GWC A;  2JZR A;  3BOA A;  4K8M A;  3QCP A;  4JZQ A;  4Q5Q A;  5GZZ B;  1R26 A;  2DJK A;  3F3Q A;  3IC4 A;  3MNG A;  3ZLP A;  4X1U A;  1BED A;  1YF1 A;  3EWL A;  4IVF A;  2JU5 A;  4AKH A;  2V1M A;  1YDK A;  1F6M C;  5A34 B;  4ZIJ A;  3PR8 A;  3HXS A;  2OT3 A;  3TKQ A;  4EUY A;  3DKS A;  1XWC A;  4G10 A;  4TVE A;  1NW2 A;  1SL1 B;  2GSQ A;  1WOU A;  4Z2T A;  4KGI A;  3RPN A;  4AKG A;  2GT5 A;  1H75 A;  2VD1 A;  5GST A;  3J7Y b;  1O8X A;  5D9V A;  2WFC A;  2LNS A;  4GSS A;  5A5K A;  4V1A g;  2VCV A;  1A23 A;  3GTU A;  2A2S A;  3VK9 A;  4TR4 A;  1JFU A;  3ZL5 A;  4E68 A;  4K7I A;  4ZBA A;  1Z5Y E;  1GL8 A;  4JR4 A;  1E6B A;  4G0K A;  4FYU A;  2ALB A;  1BG1 A;  1EV4 A;  5HQP A;  1UVZ A;  4GDF A;  5FWG A;  3WGX A;  1GLQ A;  6GSX A;  2H0G A;  2TRX A;  4OFT A;  4BL7 A;  2HZF A;  5CRW A;  1DBY A;  2YWO A;  1EOG A;  4ID0 A;  3TGZ A;  1GP1 A;  2LNT A;  4IBP A;  3G7J A;  2H74 A;  4V2M A;  4MF6 A;  2FHE A;  6GSW A;  4YAV A;  5A34 A;  1MDK A;  3LFL A;  1NM3 A;  5G5E A;  1RK4 A;  1JHB A;  3VWX A;  3QAG A;  5JCG A;  5CRD A;  3RHB A;  1G6Y A;  1TK0 B;  2RLI A;  4XHM A;  2CVB A;  4ULX A;  2HFD A;  1TXX A;  3FR3 A;  1Z7P A;  1Y6E A;  4IJI A;  1ML6 A;  3IK9 A;  1G7O A;  1XW9 A;  2WZ9 A;  2DJJ A;  5D93 A;  1F37 A;  1GRX A;  1TU8 A;  1VF3 A;  2TRC P;  3IOS A;  3EU3 A;  1R4W A;  4I2T A;  1CQH A;  4MPF A;  4AKI A;  4K9Z A;  4RUV A;  4F0C A;  2QSI A;  3KH7 A;  1Q98 A;  22GS A;  2AJQ B;  3FY7 A;  4EDY A;  1HNC A;  4PX1 A;  1FOH A;  4GXZ A;  1J08 A;  2KP2 A;  3GNJ A;  2K8S A;  3ME8 A;  3Q18 A;  3ZVJ D;  2YWI A;  1TRW A;  2F9S A;  4Q5R A;  4TRX A;  2HSH A;  1PQN A;  1GUM A;  2LRT A;  3S9F A;  1ACV A;  5D9T A;  4OFN A;  10GS A;  3LXT A;  1YKA A;  5LCZ A;  1B8X A;  2N5F A;  1JZD A;  3HD5 A;  2YCD A;  3PPU A;  1ABA A;  1ERW A;  2O8V B;  2LQQ A;  2GGT A;  3TJK A;  2M72 A;  1GSD A;  4QMK A;  4GQC A;  1WE0 A;  5DJL A;  2H1A A;  2AYT A;  4K7N A;  2OBI A;  3GSS A;  2V2G A;  1SEN A;  4KCA A;  4HQZ A;  4JED A;  1GNW A;  5IPH A;  1SK2 A;  3A2X A;  4CHS A;  3KP8 A;  2IMK A;  1XWK A;  2HSM B;  3UAP A;  5AGY A;  5IPG A;  1OC9 B;  3FHK A;  2L4Q A;  12GS A;  2C4J A;  5E59 A;  4ZBD A;  4IW9 A;  3IAS 2;  4K2D A;  4OCF A;  2X49 A;  3KGK A;  4IP6 A;  1TU7 A;  4KE3 A;  3GHA A;  2I4A A;  4EDZ A;  2HRA A;  4FYB A;  1AQV A;  2PWJ A;  4F0B A;  4BVX B;  1UC7 A;  1KEB A;  13GS A;  3F8U A;  2FWE A;  3P2A A;  2B6M A;  4KW6 A;  1PN0 A;  3CRU A;  3VWW A;  4CW9 A;  1Y25 A;  3VPT A;  4W66 A;  2YJH A;  4NPB A;  1PKZ A;  1OYJ A;  1EV9 A;  2HSY A;  1X5D A;  1GSY A;  5G30 A;  2MBS A;  4Q5N A;  4JR6 A;  3CTG A;  2HQT A;  2ON5 A;  3K8N A;  3QAW A;  4ZIL A;  3NIV A;  3L9S A;  5B8A A;  1ERT A;  4K0N A;  1A2J A;  2YZH A;  2I81 A;  4WET A;  3KCM A;  1WP0 A;  2HRK B;  2MMA A;  1OC9 A;  2JSY A;  2AB6 A;  2MMO A;  2AUV A;  3D6I A;  1E2Y A;  3TOT A;  1FG4 A;  3MYD A;  3UBL A;  4OO4 A;  3DXB A;  1A24 A;  2VCT A;  4ICY A;  1V58 A;  4G2E A;  1ILO A;  3QMX A;  4ML6 A;  3SWL A;  1Y1U A;  2PGT A;  2H1B A;  3CSH A;  2YP6 A;  17GS A;  2DSA A;  2WJU A;  3TU3 B;  4KDX A;  1LU4 A;  2X8G A;  5G2Z A;  4MJA A;  2N5A A;  4BVX A;  2CV4 A;  3EMP A;  1X5E A;  5DJM A;  4IN0 A;  4HU9 A;  5IMA A;  2R0G A;  2V32 A;  2H1L A;  2PVO C;  4EXJ A;  3UVT A;  2GQK A;  4PUA A;  4HJ2 A;  2VUP A;  4O7H A;  3A2V A;  4FO5 A;  3EMX A;  3D4T A;  3GX0 A;  1TP9 A;  1V98 A;  2GLR A;  1SL2 B;  1GSU A;  1M9B A;  1UA5 A;  5DAK B;  5ECP B;  3ZIJ A;  3CSJ A;  2H0H A;  5B7C A;  2A2P A;  5DQS A;  4OO5 A;  2HRK A;  5HR0 A;  2HZE B;  2VL3 A;  5DDL A;  3Q19 A;  2IWT A;  2F8A A;  1W89 A;  2YAN A;  1V2A A;  2JL4 A;  3Q6O A;  5ECI B;  1F2E A;  1YVL A;  1DSB A;  3VWV A;  2NVL A;  3EUR A;  2WB9 A;  5IMZ A;  1TK5 B;  2H75 A;  3GH6 A;  1TI1 A;  2C3N A;  1T4Z A;  1GTA A;  4BWQ A;  1OKD A;  2IFQ B;  1G0T A;  2IJY A;  3GFK A;  2A2R A;  2J23 A;  3ZMK A;  1EOH A;  5KN3 A;  2BMX A;  3GV1 A;  4HZ4 A;  3C73 A;  5ID2 B;  1SJ6 A;  3DGQ A;  4KX4 A;  19GS A;  4MZC A;  4GQF A;  4Z2U A;  2WDU A;  2GDR A;  5IOW A;  5J40 A;  1YKC A;  2PN8 A;  4ILF A;  5JWQ B;  1A8L A;  4J57 E;  1GSS A;  2LUS A;  2X8H A;  4WXT A;  5IM9 A;  1OE7 A;  1WWJ A;  3CRT A;  4TR1 B;  5D8I A;  4GTU A;  4Z2R A;  4L8E A;  5DAK A;  1T00 A;  4MJE A;  2GST A;  4NHZ A;  4ZBB A;  3LG6 A;  1SU9 A;  3GN3 A;  1A8Y A;  2HZE A;  4G0L A;  3GIX A;  7GSS A;  3R3E A;  1OC3 A;  4MJB A;  2ES7 A;  5KOW A;  2GTU A;  4MAB A;  1CQG A;  1QFN A;  1V9W A;  3TKR A;  2L5L A;  3LEF A;  1V40 A;  1WRY A;  3ZRE A;  1F3A A;  3HZ8 A;  3FKF A;  2L59 A;  2EIQ A;  4O32 A;  2IFQ A;  2AHE A;  4AF2 A;  2UV8 G;  2LJR A;  4TR0 A;  4RQR A;  3US3 A;  3UOM A;  1TK8 B;  3J7Y k;  5G1K A;  1GUL A;  1VGL A;  4AGS A;  4HOJ A;  3FK8 A;  5ID2 A;  1B4Q A;  1M2D A;  5H5S A;  5B8B A;  1AUC A;  4XS4 B;  1VF4 A;  4I97 A;  4ZXG A;  1JLV A;  5J4U A;  2BTO T;  1ZYN A;  4EO3 A;  2G2Q A;  2YWM A;  4MP4 A;  2B7K A;  1K0N A;  3GL3 A;  3RHC A;  3KP9 A;  5F07 A;  2OBK A;  3VFI A;  4H86 A;  1A0R P;  4BL7 B;  2P5R A;  4TR1 A;  3BJ5 A;  3JCM L;  1PN9 A;  4GWR A;  4WF5 A;  2PBJ A;  1I5G A;  1I9D A;  2EIO A;  5CYY A;  3FR9 A;  5ECK B;  3F0I A;  2DJ0 A;  5F05 A;  3ZVJ A;  2XPE A;  5IMF A;  2H6Z A;  3BBY A;  1SD8 A;  3PIN A;  4LMW A;  4KUN A;  4TOP A;  5EY6 A;  3KM6 A;  2C8U A;  1XPV A;  1TW9 A;  3BD2 A;  5F0G A;  3CXG A;  1SVL A;  5A4U A;  1B9X C;  4O5U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...