2HQTA

Crystal structures of the interacting domains from yeast glutamyl-trna synthetase and trna aminoacylation and nuclear export cofactor arc1p reveal a novel function for an old fold
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
118
structure length
115
Chain Sequence
SDLVTKFESLIYPVSFTKEQSAQAAQWESVLKSGQIQPHLDQLNLVLRDNTFIVSTLYPTSTDVHVFEVALPLIKDLVASSKDVKSTYTTYRHILRWIDYMQNLLEVSSTDKLEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein, rna binding
molecule keywords GU4 nucleic-binding protein 1
publication title Structures of the interacting domains from yeast glutamyl-tRNA synthetase and tRNA-aminoacylation and nuclear-export cofactor Arc1p reveal a novel function for an old fold.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 37
structure length 115
sequence length 118
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T
ec nomenclature
pdb deposition date 2006-07-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2hqtA00
4YAPA 8GSSA 1K0NA 3FR9A 1GNEA 4O92A 1EV4A 2WJUA 2GLRA 3R2QA 4GF0A 3IBHA 3LSZA 4KDYA 4KGIA 3WYWA 1MD3A 1PD21 4G19A 4I97A 4G0LA 4GSNA 3ZFLA 2OA7A 4MZWA 4PX1A 3Q19A 1UA5A 4EDZA 4ZXGA 3CSJA 3LYPA 4NHWA 3UARA 4PUAA 4MK3A 5ECHB 2PVQA 1GSFA 5EVOA 4IVFA 1Q4JA 3I6AA 5ECRB 2IMKA 4ECCA 5ELAA 2FNOA 3UVHA 4GTUA 2R5GA 1PKWA 3HKRA 3M1GA 4MP4A 1Z9HA 5J41A 3MAKA 5F8BA 3LG6A 3QR6A 4ZB6A 1VF1A 2HSNB 3GX0A 4LMVA 2R4VA 1IYIA 4BVXB 4DEJA 4KX4A 4TOPA 3FY7A 5A5KA 1G7OA 1HQOA 1F2EA 3CRUA 5D73A 3ZMLA 1B8XA 2ON5A 3F63A 1PN9A 3QAGA 3C8EA 5G5FA 5ECQB 4G0KA 4MF6A 5D9TA 4BL7A 3GUSA 3UBKA 1K0MA 3PPUA 1K3OA 4QQ7A 1RK4A 2VCQA 1R5AA 3ERFA 4EDYA 6GSVA 1E6BA 2CZ2A 1GTIA 1BG5A 5ECNB 5DJMA 5LCZA 3P8WA 1K0DA 3ZFBA 1AQXA 18GSA 2OADA 4OFNA 2HNLA 3CSIA 3CSHA 4ZBBA 1HNAA 5DJLA 4KDUA 3DGQA 3EINA 4PQHA 1G6WA 1FHEA 1PX6A 2D2ZA 4ZB8A 4LMWA 5A4VA 5BMUA 4IGJA 1PGTA 5AGYA 1HNCA 4PXOA 2CVDA 1U88A 2PERA 3FR3A 6GSXA 5D9WA 5AISA 2X64A 1USBA 3PR8A 1YKCA 2HSMA 4MPFA 4O7HA 5JCWA 1KBNA 1GSYA 3SWLA 2UZ8A 4Q5RA 2VCXA 3ERGA 4JEDA 1K0CA 5B7CA 4PNGA 1XWKA 3KMOA 6GSYA 4JBBA 6GSUA 1M9AA 2VD0A 5EL8A 14GSA 4Q5QA 2C3NA 1GULA 3F6DA 2GSRA 3MDKA 4HZ4A 2NTOA 4HZ2A 3U6VA 4KH7A 4BL7B 4PNFA 2VD1A 2VCTA 3L0HA 2C4JA 2HQTA 2VCZA 1V40A 3O76A 3R3EA 4HJ2A 3TGZA 3GH6A 3LXTA 1Y6EA 4GLTA 1K0OA 2C3TA 3VI5A 1LJRA 1EOGA 1GLQA 3VPQA 1VF4A 20GSA 7GSSA 3GTUB 4YQUA 4USSA 3UAPA 1TU8A 2F8FA 3N5OA 5GZZB 3N9JA 1JZRA 1GSUA 1YQ1A 3KJYA 1GSDA 2GSQA 3GURA 6GSTA 2YCDA 1V2AA 5F06A 2N5FA 4YQMA 1N2AA 3IR4A 1BAYA 3BBYA 1PX7A 4ECIA 1BYEA 2AB6A 4IBPA 5ECOB 2WS2A 5FWGA 3GSTA 2R6KA 2HSMB 5G5EA 4E8EA 1YY7A 2ON7A 1JLWA 1JLVA 2WDUA 10GSA 4IJIA 4F0BA 4G10A 4BVYB 2JL4A 1XW6A 3HJOA 1K0BA 2F3MA 2CZ3A 3QAVA 5D9VA 3CRTA 4L5LA 3FR6A 4GSSA 4F03A 4NAXA 3Q18A 1F3AA 3LQ7A 2IL3A 5J5NA 2AAWA 3GTUA 1EOHA 4KF9A 3WD6A 4F0CA 2HRAA 2VO4A 3KM6A 1GTBA 5FT3A 4IKHA 4HI7A 5GSTA 2YV7A 4ZBAA 4JZQA 4GSTA 4EC0A 1G6YA 4OFMA 3LXZA 1OE7A 2PBJA 4KSMA 3QAWA 1GWCA 4YQVA 4AGSA 4IW9A 2HRKA 4PURA 3VLNA 1C72A 1GUKA 4EXJA 5ECSA 1M0UA 4KDXA 4ECBA 17GSA 5AN1A 1LBKA 2CA8A 4RI7A 1FW1A 4CHSA 3H1NA 4HOJA 4WR5A 1BX9A 1TW9A 4IELA 1VF3A 2FHEA 5DQSA 4BVYA 11GSA 4E8HA 4Q5FA 5IQYA 1GSSA 2C8UA 4ZB9A 4G9HA 2GSSA 1PMTA 1AQVA 5F05A 3LYKA 3UBLA 3ISOA 5F07A 4J2FA 1M99A 1A0FA 3I69A 5GSSA 2VCVA 1YDKA 3EE2A 3CBUA 3LFLA 2CAIA 1U3IA 1ZL9A 4K0NA 1IYHA 5ECKB 4YAVA 1PL1A 1TDIA 2DSAA 2C80A 3HJMA 5DAKA 4IQ1A 2A2RA 4ISDA 5KEJA 1EEMA 3KMNA 5DCGA 1ZGNA 3G7JA 4K0GA 3VURA 12GSA 4PTSA 2GTUA 4ECJA 1GUHA 3KTLA 3TOTA 3VI7A 3D0ZA 5D9XA 4EE0A 2DC5A 4L5OA 1ML6A 2IMIA 5EY6A 1GSEA 1OE8A 3M3MA 1MD4A 1EV9A 3W8SA 19GSA 3NIVA 4MF7A 5ECPB 2AHEA 3IK7A 1XWGA 1K0AA 3KXOA 4IS0A 4OMVA 3VK9A 1TU7A 3FYGA 5J4UA 2HRKB 1NHYA 5DDLA 1DUGA 3Q74A 1GTUA 5ECIB 3AY8A 1GTAA 5DALA 3O3TA 3GSSA 1U87A 2YV9A 4WR4A 1OYJA 2VCWA 3FRCA 4Q5NA 4KAEA 1F3BA 1YJ6A 2LJRA 4PGTA 5F0GA 4YH2A 5ELGA 22GSA 3M8NA 1GLPA 2GSTA 3IK9A 5LD0A 4L8EA 4RI6A 2R3XA 2CAQA 2OACA 4ID0A 2GDRA 4NHZA 3F6FA 3IC8A 1B4PA 3P90A 5DAKB 5FHIA 5A4WA 4N0VA 3PGTA 5A4UA 5HFKA 1GUMA 1GSQA 1PKZA 3LJRA 1AW9A 2C3QA 1B48A 4PQIA 3VWXA 3DD3A 4FQUA 2J9HA 1AXDA 1GNWA 5ECLB 1PL2A 4KE3A 4MDCA 9GSSA 1OKTA 4GCIA 4ACSA 3VPTA 3G7IA 5ECMB 4ZBDA 1AQWA 4MPGA 3RBTA 1K3LA 6GSSA 1XW5A 4OFTA 2A2SA 4IQAA 6GSWA 3IE3A 1HNBA 4G0IA 2WRTA 3ZMKA 3M0FA 4MF5A 5AIVA 2V6KA 5DALB 13GSA 1PA3A 1VF2A 4BVXA 1MTCA 3TOUA 2PGTA 2PMTA 5AIXA 1K3YA 2WB9A 1M9BA 5JCUA 16GSA
chains in the Genus database with same CATH superfamily
4YAPA 8GSSA 1K0NA 3FR9A 1GNEA 4O92A 1EV4A 2WJUA 1TXUA 2GLRA 3R2QA 4GF0A 3IBHA 3LSZA 3CWGA 4KDYA 4KGIA 3WYWA 1MD3A 1PD21 4G19A 4I97A 4G0LA 4GSNA 3ZFLA 2OA7A 4MZWA 4PX1A 2UV8G 3Q19A 1UA5A 4EDZA 4ZXGA 3CSJA 3LYPA 4NHWA 3UARA 4PUAA 4MK3A 5ECHB 2PVQA 1GSFA 5EVOA 4IVFA 1Q4JA 3I6AA 5ECRB 2IMKA 2WVZA 4ECCA 5ELAA 1YVLA 2FNOA 3UVHA 4GTUA 2R5GA 1PKWA 3HKRA 3M1GA 4MP4A 1Z9HA 5J41A 3MAKA 5F8BA 1YEWC 3LG6A 3QR6A 5A5HA 4ZB6A 1VF1A 2HSNB 3GX0A 4LMVA 2R4VA 4E68A 1IYIA 4BVXB 2WZSA 4KX4A 4DEJA 4TOPA 3FY7A 5A5KA 1G7OA 1HQOA 1F2EA 3CRUA 5D73A 1SVOA 3ZMLA 1B8XA 2ON5A 3F63A 1PN9A 3QAGA 3C8EA 5G5FA 5ECQB 4G0KA 4MF6A 5D9TA 4BL7A 3GUSA 3UBKA 1K0MA 3PPUA 1K3OA 4QQ7A 1RK4A 2VCQA 1R5AA 3ERFA 4EDYA 6GSVA 1E6BA 2CZ2A 1GTIA 1BG5A 1I1IP 5ECNB 5DJMA 5LCZA 3P8WA 1K0DA 3ZFBA 1AQXA 18GSA 2OADA 4OFNA 2HNLA 3CSIA 3CSHA 4ZBBA 1HNAA 5DJLA 4KDUA 3DGQA 3EINA 4PQHA 1G6WA 1FHEA 1PX6A 2D2ZA 4ZB8A 4LMWA 5A4VA 5BMUA 4IGJA 1PGTA 5AGYA 1HNCA 4PXOA 2CVDA 1U88A 2PERA 3FR3A 6GSXA 5D9WA 5AISA 2X64A 5A5HB 1USBA 3PR8A 1YKCA 2EFDA 2H1LA 2HSMA 4MPFA 4O7HA 1KBNA 5JCWA 1GSYA 3SWLA 2UZ8A 4Q5RA 2VCXA 3ERGA 4JEDA 1K0CA 5B7CA 4PNGA 1XWKA 3KMOA 6GSYA 4JBBA 6GSUA 2WW2A 1M9AA 2VD0A 5EL8A 14GSA 4Q5QA 2C3NA 1GULA 3F6DA 2GSRA 3MDKA 4HZ4A 2NTOA 4HZ2A 3U6VA 4KH7A 4BL7B 4PNFA 2VD1A 2VCTA 3L0HA 2C4JA 2HQTA 4AKHA 2VCZA 4AKGA 1V40A 3O76A 3R3EA 4HJ2A 3TGZA 3GH6A 3LXTA 1Y6EA 2OT3A 3RFRC 4GLTA 1K0OA 2C3TA 3VI5A 1LJRA 1EOGA 1GLQA 3VPQA 1VF4A 4FXYP 20GSA 7GSSA 3GTUB 4YQUA 4USSA 3UAPA 1TU8A 2F8FA 3N5OA 5GZZB 3N9JA 1JZRA 1GSUA 1YQ1A 3KJYA 3GURA 1GSDA 2GSQA 6GSTA 2YCDA 1V2AA 5F06A 2N5FA 4YQMA 5J47A 1N2AA 2O3EA 3IR4A 1BAYA 3BBYA 2O5VA 1PX7A 4ECIA 1BYEA 1S4BP 5BMUB 2AB6A 4IBPA 5ECOB 2WS2A 5FWGA 3GSTA 2R6KA 2HSMB 5G5EA 4E8EA 1YY7A 5J4VA 2ON7A 1JLWA 1N25A 1JLVA 2O36A 2WDUA 10GSA 4IJIA 4F0BA 4G10A 2EFCA 4BVYB 2JL4A 1XW6A 3HJOA 1K0BA 4AKIA 2F3MA 2CZ3A 3QAVA 5D9VA 3CRTA 4L5LA 3FR6A 4GSSA 4F03A 4NAXA 3Q18A 1F3AA 3LQ7A 2IL3A 5J5NA 2AAWA 3GTUA 1EOHA 4KF9A 3WD6A 4F0CA 2HRAA 2VO4A 3KM6A 1GTBA 5FT3A 4IKHA 4HI7A 5GSTA 2YV7A 4ZBAA 4PI2C 4JZQA 4GSTA 4EC0A 1G6YA 2WVYA 2WVXA 4OFMA 3LXZA 1OE7A 4GDFA 2PBJA 4KSMA 3TU3B 3QAWA 1GWCA 4YQVA 4AGSA 3RGBC 4IW9A 2HRKA 4PURA 2WW3A 1C72A 1GUKA 3VLNA 5ECSA 1M0UA 4EXJA 4KDXA 4ECBA 17GSA 5AN1A 1LBKA 2CA8A 4RI7A 1FW1A 4CHSA 1SVLA 3H1NA 4HOJA 4W66A 4WR5A 5A34A 1BX9A 1TW9A 4IELA 1VF3A 2FHEA 5DQSA 4BVYA 11GSA 4E8HA 4Q5FA 5IQYA 4ZB7A 1GSSA 2C8UA 4ZB9A 4G9HA 2GSSA 1PMTA 1AQVA 5F05A 3LYKA 3UBLA 3ISOA 5F07A 4J2FA 1M99A 1A0FA 3I69A 1Y1UA 5A1NA 2VCVA 5GSSA 1YDKA 3EE2A 3CBUA 3LFLA 2CAIA 1U3IA 4PI0C 1ZL9A 4K0NA 1IYHA 5ECKB 4YAVA 1PL1A 1TDIA 2DSAA 2C80A 3HJMA 5DAKA 4IQ1A 2A2RA 4ISDA 5KEJA 1EEMA 3KMNA 5DCGA 1ZGNA 3G7JA 4K0GA 3VURA 12GSA 4PTSA 2GTUA 4ECJA 1GUHA 3KTLA 3TOTA 3VI7A 3D0ZA 5D9XA 4EE0A 2DC5A 4L5OA 1ML6A 2IMIA 2WVXB 5EY6A 1GSEA 1OE8A 3M3MA 1MD4A 1EV9A 3W8SA 19GSA 3NIVA 4MF7A 5ECPB 2AHEA 3IK7A 1XWGA 1BF5A 1K0AA 3KXOA 4IS0A 4OMVA 3VK9A 1TU7A 3FYGA 5J4UA 2HRKB 1NHYA 5DDLA 1DUGA 3Q74A 1GTUA 5ECIB 3AY8A 1GTAA 4PHZC 5DALA 1BG1A 3O3TA 3GSSA 1U87A 5A34B 2YV9A 4WR4A 1OYJA 2VCWA 3FRCA 4Q5NA 4KAEA 1F3BA 1YJ6A 2LJRA 4PGTA 5F0GA 4AI6A 5J40A 1SVMA 4YH2A 4AKXB 5ELGA 22GSA 3M8NA 1GLPA 2GSTA 3IK9A 5LD0A 5A1NB 4L8EA 4RI6A 2R3XA 2CAQA 2OACA 4ID0A 2VKZG 2GDRA 4NHZA 3F6FA 3IC8A 1B4PA 5J4YA 3P90A 2EFEA 5DAKB 5FHIA 4G01A 5A4WA 4N0VA 3PGTA 5A4UA 5HFKA 1GUMA 1GSQA 1PKZA 3LJRA 1AW9A 2C3QA 1B48A 4PQIA 3VWXA 3DD3A 4FQUA 2J9HA 1AXDA 1GNWA 5ECLB 1PL2A 4KE3A 4MDCA 9GSSA 1OKTA 4GCIA 4ACSA 2EFHA 3VPTA 3G7IA 5ECMB 4ZBDA 1AQWA 4MPGA 2WW1A 3RBTA 1K3LA 6GSSA 1XW5A 4OFTA 4N3ZA 2A2SA 4IQAA 6GSWA 2HSNA 3IE3A 1HNBA 4G0IA 2WRTA 3ZMKA 3M0FA 4MF5A 5AIVA 2V6KA 4QMKA 5DALB 13GSA 1PA3A 2WW0A 1VF2A 4BVXA 1MTCA 3TOUA 2PGTA 3HMJG 2PMTA 5AIXA 1K3YA 2WB9A 1M9BA 5JCUA 16GSA 3CHXC
chains in the Genus database with same CATH topology
4YAPA 8GSSA 1K0NA 3FR9A 1GNEA 4O92A 1EV4A 2WJUA 1TXUA 2GLRA 3R2QA 4GF0A 3IBHA 3LSZA 3CWGA 4KDYA 4KGIA 3WYWA 1MD3A 1PD21 4G19A 4I97A 4G0LA 4GSNA 3ZFLA 2OA7A 4MZWA 4PX1A 2UV8G 3Q19A 1UA5A 4EDZA 4ZXGA 3CSJA 3LYPA 4NHWA 3UARA 4PUAA 4MK3A 5ECHB 2PVQA 1GSFA 5EVOA 4IVFA 1Q4JA 3I6AA 5ECRB 2IMKA 4ECCA 5ELAA 1YVLA 2FNOA 3UVHA 4GTUA 2R5GA 1PKWA 3HKRA 3M1GA 4MP4A 1Z9HA 5J41A 3MAKA 5F8BA 3LG6A 3QR6A 5A5HA 4ZB6A 1VF1A 2HSNB 3GX0A 4LMVA 2R4VA 4E68A 1IYIA 4BVXB 4DEJA 4KX4A 4TOPA 3FY7A 5A5KA 1G7OA 1HQOA 1F2EA 3CRUA 5D73A 1SVOA 3ZMLA 1B8XA 2ON5A 3F63A 1PN9A 3QAGA 3C8EA 5G5FA 5ECQB 4G0KA 4MF6A 5D9TA 4BL7A 3GUSA 3UBKA 1K0MA 3PPUA 1K3OA 4QQ7A 1RK4A 2VCQA 1R5AA 3ERFA 4EDYA 6GSVA 1E6BA 2CZ2A 1GTIA 1BG5A 5ECNB 5DJMA 5LCZA 3P8WA 1K0DA 3ZFBA 1AQXA 18GSA 2OADA 4OFNA 2HNLA 3CSIA 3CSHA 4ZBBA 1HNAA 5DJLA 4KDUA 3DGQA 3EINA 4PQHA 1G6WA 1FHEA 1PX6A 2D2ZA 4ZB8A 4LMWA 5A4VA 5BMUA 4IGJA 1PGTA 5AGYA 1HNCA 4PXOA 2CVDA 1U88A 2PERA 3FR3A 6GSXA 5D9WA 5AISA 2X64A 5A5HB 1USBA 3PR8A 1YKCA 2EFDA 2H1LA 2HSMA 4MPFA 4O7HA 1KBNA 5JCWA 1GSYA 3SWLA 2UZ8A 4Q5RA 2VCXA 3ERGA 4JEDA 1K0CA 5B7CA 4PNGA 1XWKA 3KMOA 6GSYA 4JBBA 6GSUA 1M9AA 2VD0A 5EL8A 14GSA 4Q5QA 2C3NA 1GULA 3F6DA 2GSRA 3MDKA 4HZ4A 2NTOA 4HZ2A 3U6VA 4KH7A 4BL7B 4PNFA 2VD1A 2VCTA 3L0HA 2C4JA 2HQTA 4AKHA 2VCZA 4AKGA 1V40A 3O76A 3R3EA 4HJ2A 3TGZA 3GH6A 3LXTA 1Y6EA 2OT3A 4GLTA 1K0OA 2C3TA 3VI5A 1LJRA 1EOGA 1GLQA 3VPQA 1VF4A 20GSA 7GSSA 3GTUB 4YQUA 4USSA 3UAPA 1TU8A 2F8FA 3N5OA 5GZZB 3N9JA 1JZRA 1GSUA 1YQ1A 3KJYA 1GSDA 2GSQA 3GURA 6GSTA 2YCDA 1V2AA 5F06A 2N5FA 4YQMA 5J47A 1N2AA 3IR4A 1BAYA 3BBYA 2O5VA 1PX7A 4ECIA 1BYEA 5BMUB 2AB6A 4IBPA 5ECOB 2WS2A 5FWGA 3GSTA 2R6KA 2HSMB 5G5EA 4E8EA 1YY7A 5J4VA 2ON7A 1JLWA 1N25A 1JLVA 2WDUA 10GSA 4IJIA 4F0BA 4G10A 2EFCA 4BVYB 2JL4A 1XW6A 3HJOA 1K0BA 4AKIA 2F3MA 2CZ3A 3QAVA 5D9VA 3CRTA 4L5LA 3FR6A 4GSSA 4F03A 4NAXA 3Q18A 1F3AA 3LQ7A 2IL3A 5J5NA 2AAWA 3GTUA 1EOHA 4KF9A 3WD6A 4F0CA 2HRAA 2VO4A 3KM6A 1GTBA 5FT3A 4IKHA 4HI7A 5GSTA 2YV7A 4ZBAA 4JZQA 4GSTA 4EC0A 1G6YA 4OFMA 3LXZA 1OE7A 4GDFA 2PBJA 4KSMA 3TU3B 3QAWA 1GWCA 4YQVA 4AGSA 4IW9A 2HRKA 4PURA 3VLNA 1C72A 1GUKA 4EXJA 5ECSA 1M0UA 4KDXA 4ECBA 17GSA 5AN1A 1LBKA 2CA8A 4RI7A 1FW1A 4CHSA 1SVLA 3H1NA 4HOJA 4W66A 4WR5A 5A34A 1BX9A 1TW9A 4IELA 1VF3A 2FHEA 5DQSA 4BVYA 11GSA 4E8HA 4Q5FA 5IQYA 4ZB7A 1GSSA 2C8UA 4ZB9A 4G9HA 2GSSA 1PMTA 1AQVA 5F05A 3LYKA 3UBLA 3ISOA 5F07A 4J2FA 1M99A 1A0FA 3I69A 1Y1UA 5A1NA 2VCVA 5GSSA 1YDKA 3EE2A 3CBUA 3LFLA 2CAIA 1U3IA 1ZL9A 4K0NA 1IYHA 5ECKB 4YAVA 1PL1A 1TDIA 2DSAA 2C80A 3HJMA 5DAKA 4IQ1A 2A2RA 4ISDA 5KEJA 1EEMA 3KMNA 5DCGA 1ZGNA 3G7JA 4K0GA 3VURA 12GSA 4PTSA 2GTUA 4ECJA 1GUHA 3KTLA 3TOTA 3VI7A 3D0ZA 5D9XA 4EE0A 2DC5A 4L5OA 1ML6A 2IMIA 5EY6A 1GSEA 1OE8A 3M3MA 1MD4A 1EV9A 3W8SA 19GSA 3NIVA 4MF7A 5ECPB 2AHEA 3IK7A 1XWGA 1BF5A 1K0AA 3KXOA 4IS0A 4OMVA 3VK9A 1TU7A 3FYGA 5J4UA 2HRKB 1NHYA 5DDLA 1DUGA 3Q74A 1GTUA 5ECIB 3AY8A 1GTAA 5DALA 1BG1A 3O3TA 3GSSA 1U87A 5A34B 2YV9A 4WR4A 1OYJA 2VCWA 3FRCA 4Q5NA 4KAEA 1F3BA 1YJ6A 2LJRA 4PGTA 5F0GA 4AI6A 5J40A 1SVMA 4YH2A 4AKXB 5ELGA 22GSA 3M8NA 1GLPA 2GSTA 3IK9A 5LD0A 5A1NB 4L8EA 4RI6A 2R3XA 2CAQA 2OACA 4ID0A 2VKZG 2GDRA 4NHZA 3F6FA 3IC8A 1B4PA 5J4YA 3P90A 2EFEA 5DAKB 5FHIA 4G01A 5A4WA 4N0VA 3PGTA 5A4UA 5HFKA 1GUMA 1GSQA 1PKZA 3LJRA 1AW9A 2C3QA 1B48A 4PQIA 3VWXA 3DD3A 4FQUA 2J9HA 1AXDA 1GNWA 5ECLB 1PL2A 4KE3A 4MDCA 9GSSA 1OKTA 4GCIA 4ACSA 2EFHA 3VPTA 3G7IA 5ECMB 4ZBDA 1AQWA 4MPGA 3RBTA 1K3LA 6GSSA 1XW5A 4OFTA 4N3ZA 2A2SA 4IQAA 6GSWA 2HSNA 3IE3A 1HNBA 4G0IA 2WRTA 3ZMKA 3M0FA 4MF5A 5AIVA 2V6KA 4QMKA 5DALB 13GSA 1PA3A 1VF2A 4BVXA 1MTCA 3TOUA 2PGTA 3HMJG 2PMTA 5AIXA 1K3YA 2WB9A 1M9BA 5JCUA 16GSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YAP A;  8GSS A;  1K0N A;  3FR9 A;  1GNE A;  4O92 A;  1EV4 A;  2WJU A;  2GLR A;  3R2Q A;  4GF0 A;  3IBH A;  3LSZ A;  4KDY A;  4KGI A;  3WYW A;  1MD3 A;  1PD2 1;  4G19 A;  4I97 A;  4G0L A;  4GSN A;  3ZFL A;  2OA7 A;  4MZW A;  4PX1 A;  3Q19 A;  1UA5 A;  4EDZ A;  4ZXG A;  3CSJ A;  3LYP A;  4NHW A;  3UAR A;  4PUA A;  4MK3 A;  5ECH B;  2PVQ A;  1GSF A;  5EVO A;  4IVF A;  1Q4J A;  3I6A A;  5ECR B;  2IMK A;  4ECC A;  5ELA A;  2FNO A;  3UVH A;  4GTU A;  2R5G A;  1PKW A;  3HKR A;  3M1G A;  4MP4 A;  1Z9H A;  5J41 A;  3MAK A;  5F8B A;  3LG6 A;  3QR6 A;  4ZB6 A;  1VF1 A;  2HSN B;  3GX0 A;  4LMV A;  2R4V A;  1IYI A;  4BVX B;  4DEJ A;  4KX4 A;  4TOP A;  3FY7 A;  5A5K A;  1G7O A;  1HQO A;  1F2E A;  3CRU A;  5D73 A;  3ZML A;  1B8X A;  2ON5 A;  3F63 A;  1PN9 A;  3QAG A;  3C8E A;  5G5F A;  5ECQ B;  4G0K A;  4MF6 A;  5D9T A;  4BL7 A;  3GUS A;  3UBK A;  1K0M A;  3PPU A;  1K3O A;  4QQ7 A;  1RK4 A;  2VCQ A;  1R5A A;  3ERF A;  4EDY A;  6GSV A;  1E6B A;  2CZ2 A;  1GTI A;  1BG5 A;  5ECN B;  5DJM A;  5LCZ A;  3P8W A;  1K0D A;  3ZFB A;  1AQX A;  18GS A;  2OAD A;  4OFN A;  2HNL A;  3CSI A;  3CSH A;  4ZBB A;  1HNA A;  5DJL A;  4KDU A;  3DGQ A;  3EIN A;  4PQH A;  1G6W A;  1FHE A;  1PX6 A;  2D2Z A;  4ZB8 A;  4LMW A;  5A4V A;  5BMU A;  4IGJ A;  1PGT A;  5AGY A;  1HNC A;  4PXO A;  2CVD A;  1U88 A;  2PER A;  3FR3 A;  6GSX A;  5D9W A;  5AIS A;  2X64 A;  1USB A;  3PR8 A;  1YKC A;  2HSM A;  4MPF A;  4O7H A;  5JCW A;  1KBN A;  1GSY A;  3SWL A;  2UZ8 A;  4Q5R A;  2VCX A;  3ERG A;  4JED A;  1K0C A;  5B7C A;  4PNG A;  1XWK A;  3KMO A;  6GSY A;  4JBB A;  6GSU A;  1M9A A;  2VD0 A;  5EL8 A;  14GS A;  4Q5Q A;  2C3N A;  1GUL A;  3F6D A;  2GSR A;  3MDK A;  4HZ4 A;  2NTO A;  4HZ2 A;  3U6V A;  4KH7 A;  4BL7 B;  4PNF A;  2VD1 A;  2VCT A;  3L0H A;  2C4J A;  2HQT A;  2VCZ A;  1V40 A;  3O76 A;  3R3E A;  4HJ2 A;  3TGZ A;  3GH6 A;  3LXT A;  1Y6E A;  4GLT A;  1K0O A;  2C3T A;  3VI5 A;  1LJR A;  1EOG A;  1GLQ A;  3VPQ A;  1VF4 A;  20GS A;  7GSS A;  3GTU B;  4YQU A;  4USS A;  3UAP A;  1TU8 A;  2F8F A;  3N5O A;  5GZZ B;  3N9J A;  1JZR A;  1GSU A;  1YQ1 A;  3KJY A;  1GSD A;  2GSQ A;  3GUR A;  6GST A;  2YCD A;  1V2A A;  5F06 A;  2N5F A;  4YQM A;  1N2A A;  3IR4 A;  1BAY A;  3BBY A;  1PX7 A;  4ECI A;  1BYE A;  2AB6 A;  4IBP A;  5ECO B;  2WS2 A;  5FWG A;  3GST A;  2R6K A;  2HSM B;  5G5E A;  4E8E A;  1YY7 A;  2ON7 A;  1JLW A;  1JLV A;  2WDU A;  10GS A;  4IJI A;  4F0B A;  4G10 A;  4BVY B;  2JL4 A;  1XW6 A;  3HJO A;  1K0B A;  2F3M A;  2CZ3 A;  3QAV A;  5D9V A;  3CRT A;  4L5L A;  3FR6 A;  4GSS A;  4F03 A;  4NAX A;  3Q18 A;  1F3A A;  3LQ7 A;  2IL3 A;  5J5N A;  2AAW A;  3GTU A;  1EOH A;  4KF9 A;  3WD6 A;  4F0C A;  2HRA A;  2VO4 A;  3KM6 A;  1GTB A;  5FT3 A;  4IKH A;  4HI7 A;  5GST A;  2YV7 A;  4ZBA A;  4JZQ A;  4GST A;  4EC0 A;  1G6Y A;  4OFM A;  3LXZ A;  1OE7 A;  2PBJ A;  4KSM A;  3QAW A;  1GWC A;  4YQV A;  4AGS A;  4IW9 A;  2HRK A;  4PUR A;  3VLN A;  1C72 A;  1GUK A;  4EXJ A;  5ECS A;  1M0U A;  4KDX A;  4ECB A;  17GS A;  5AN1 A;  1LBK A;  2CA8 A;  4RI7 A;  1FW1 A;  4CHS A;  3H1N A;  4HOJ A;  4WR5 A;  1BX9 A;  1TW9 A;  4IEL A;  1VF3 A;  2FHE A;  5DQS A;  4BVY A;  11GS A;  4E8H A;  4Q5F A;  5IQY A;  1GSS A;  2C8U A;  4ZB9 A;  4G9H A;  2GSS A;  1PMT A;  1AQV A;  5F05 A;  3LYK A;  3UBL A;  3ISO A;  5F07 A;  4J2F A;  1M99 A;  1A0F A;  3I69 A;  5GSS A;  2VCV A;  1YDK A;  3EE2 A;  3CBU A;  3LFL A;  2CAI A;  1U3I A;  1ZL9 A;  4K0N A;  1IYH A;  5ECK B;  4YAV A;  1PL1 A;  1TDI A;  2DSA A;  2C80 A;  3HJM A;  5DAK A;  4IQ1 A;  2A2R A;  4ISD A;  5KEJ A;  1EEM A;  3KMN A;  5DCG A;  1ZGN A;  3G7J A;  4K0G A;  3VUR A;  12GS A;  4PTS A;  2GTU A;  4ECJ A;  1GUH A;  3KTL A;  3TOT A;  3VI7 A;  3D0Z A;  5D9X A;  4EE0 A;  2DC5 A;  4L5O A;  1ML6 A;  2IMI A;  5EY6 A;  1GSE A;  1OE8 A;  3M3M A;  1MD4 A;  1EV9 A;  3W8S A;  19GS A;  3NIV A;  4MF7 A;  5ECP B;  2AHE A;  3IK7 A;  1XWG A;  1K0A A;  3KXO A;  4IS0 A;  4OMV A;  3VK9 A;  1TU7 A;  3FYG A;  5J4U A;  2HRK B;  1NHY A;  5DDL A;  1DUG A;  3Q74 A;  1GTU A;  5ECI B;  3AY8 A;  1GTA A;  5DAL A;  3O3T A;  3GSS A;  1U87 A;  2YV9 A;  4WR4 A;  1OYJ A;  2VCW A;  3FRC A;  4Q5N A;  4KAE A;  1F3B A;  1YJ6 A;  2LJR A;  4PGT A;  5F0G A;  4YH2 A;  5ELG A;  22GS A;  3M8N A;  1GLP A;  2GST A;  3IK9 A;  5LD0 A;  4L8E A;  4RI6 A;  2R3X A;  2CAQ A;  2OAC A;  4ID0 A;  2GDR A;  4NHZ A;  3F6F A;  3IC8 A;  1B4P A;  3P90 A;  5DAK B;  5FHI A;  5A4W A;  4N0V A;  3PGT A;  5A4U A;  5HFK A;  1GUM A;  1GSQ A;  1PKZ A;  3LJR A;  1AW9 A;  2C3Q A;  1B48 A;  4PQI A;  3VWX A;  3DD3 A;  4FQU A;  2J9H A;  1AXD A;  1GNW A;  5ECL B;  1PL2 A;  4KE3 A;  4MDC A;  9GSS A;  1OKT A;  4GCI A;  4ACS A;  3VPT A;  3G7I A;  5ECM B;  4ZBD A;  1AQW A;  4MPG A;  3RBT A;  1K3L A;  6GSS A;  1XW5 A;  4OFT A;  2A2S A;  4IQA A;  6GSW A;  3IE3 A;  1HNB A;  4G0I A;  2WRT A;  3ZMK A;  3M0F A;  4MF5 A;  5AIV A;  2V6K A;  5DAL B;  13GS A;  1PA3 A;  1VF2 A;  4BVX A;  1MTC A;  3TOU A;  2PGT A;  2PMT A;  5AIX A;  1K3Y A;  2WB9 A;  1M9B A;  5JCU A;  16GS A; 
#chains in the Genus database with same CATH topology
 4YAP A;  8GSS A;  1K0N A;  3FR9 A;  1GNE A;  4O92 A;  1EV4 A;  2WJU A;  1TXU A;  2GLR A;  3R2Q A;  4GF0 A;  3IBH A;  3LSZ A;  3CWG A;  4KDY A;  4KGI A;  3WYW A;  1MD3 A;  1PD2 1;  4G19 A;  4I97 A;  4G0L A;  4GSN A;  3ZFL A;  2OA7 A;  4MZW A;  4PX1 A;  2UV8 G;  3Q19 A;  1UA5 A;  4EDZ A;  4ZXG A;  3CSJ A;  3LYP A;  4NHW A;  3UAR A;  4PUA A;  4MK3 A;  5ECH B;  2PVQ A;  1GSF A;  5EVO A;  4IVF A;  1Q4J A;  3I6A A;  5ECR B;  2IMK A;  2WVZ A;  4ECC A;  5ELA A;  1YVL A;  2FNO A;  3UVH A;  4GTU A;  2R5G A;  1PKW A;  3HKR A;  3M1G A;  4MP4 A;  1Z9H A;  5J41 A;  3MAK A;  5F8B A;  1YEW C;  3LG6 A;  3QR6 A;  5A5H A;  4ZB6 A;  1VF1 A;  2HSN B;  3GX0 A;  4LMV A;  2R4V A;  4E68 A;  1IYI A;  4BVX B;  2WZS A;  4KX4 A;  4DEJ A;  4TOP A;  3FY7 A;  5A5K A;  1G7O A;  1HQO A;  1F2E A;  3CRU A;  5D73 A;  1SVO A;  3ZML A;  1B8X A;  2ON5 A;  3F63 A;  1PN9 A;  3QAG A;  3C8E A;  5G5F A;  5ECQ B;  4G0K A;  4MF6 A;  5D9T A;  4BL7 A;  3GUS A;  3UBK A;  1K0M A;  3PPU A;  1K3O A;  4QQ7 A;  1RK4 A;  2VCQ A;  1R5A A;  3ERF A;  4EDY A;  6GSV A;  1E6B A;  2CZ2 A;  1GTI A;  1BG5 A;  1I1I P;  5ECN B;  5DJM A;  5LCZ A;  3P8W A;  1K0D A;  3ZFB A;  1AQX A;  18GS A;  2OAD A;  4OFN A;  2HNL A;  3CSI A;  3CSH A;  4ZBB A;  1HNA A;  5DJL A;  4KDU A;  3DGQ A;  3EIN A;  4PQH A;  1G6W A;  1FHE A;  1PX6 A;  2D2Z A;  4ZB8 A;  4LMW A;  5A4V A;  5BMU A;  4IGJ A;  1PGT A;  5AGY A;  1HNC A;  4PXO A;  2CVD A;  1U88 A;  2PER A;  3FR3 A;  6GSX A;  5D9W A;  5AIS A;  2X64 A;  5A5H B;  1USB A;  3PR8 A;  1YKC A;  2EFD A;  2H1L A;  2HSM A;  4MPF A;  4O7H A;  1KBN A;  5JCW A;  1GSY A;  3SWL A;  2UZ8 A;  4Q5R A;  2VCX A;  3ERG A;  4JED A;  1K0C A;  5B7C A;  4PNG A;  1XWK A;  3KMO A;  6GSY A;  4JBB A;  6GSU A;  2WW2 A;  1M9A A;  2VD0 A;  5EL8 A;  14GS A;  4Q5Q A;  2C3N A;  1GUL A;  3F6D A;  2GSR A;  3MDK A;  4HZ4 A;  2NTO A;  4HZ2 A;  3U6V A;  4KH7 A;  4BL7 B;  4PNF A;  2VD1 A;  2VCT A;  3L0H A;  2C4J A;  2HQT A;  4AKH A;  2VCZ A;  4AKG A;  1V40 A;  3O76 A;  3R3E A;  4HJ2 A;  3TGZ A;  3GH6 A;  3LXT A;  1Y6E A;  2OT3 A;  3RFR C;  4GLT A;  1K0O A;  2C3T A;  3VI5 A;  1LJR A;  1EOG A;  1GLQ A;  3VPQ A;  1VF4 A;  4FXY P;  20GS A;  7GSS A;  3GTU B;  4YQU A;  4USS A;  3UAP A;  1TU8 A;  2F8F A;  3N5O A;  5GZZ B;  3N9J A;  1JZR A;  1GSU A;  1YQ1 A;  3KJY A;  3GUR A;  1GSD A;  2GSQ A;  6GST A;  2YCD A;  1V2A A;  5F06 A;  2N5F A;  4YQM A;  5J47 A;  1N2A A;  2O3E A;  3IR4 A;  1BAY A;  3BBY A;  2O5V A;  1PX7 A;  4ECI A;  1BYE A;  1S4B P;  5BMU B;  2AB6 A;  4IBP A;  5ECO B;  2WS2 A;  5FWG A;  3GST A;  2R6K A;  2HSM B;  5G5E A;  4E8E A;  1YY7 A;  5J4V A;  2ON7 A;  1JLW A;  1N25 A;  1JLV A;  2O36 A;  2WDU A;  10GS A;  4IJI A;  4F0B A;  4G10 A;  2EFC A;  4BVY B;  2JL4 A;  1XW6 A;  3HJO A;  1K0B A;  4AKI A;  2F3M A;  2CZ3 A;  3QAV A;  5D9V A;  3CRT A;  4L5L A;  3FR6 A;  4GSS A;  4F03 A;  4NAX A;  3Q18 A;  1F3A A;  3LQ7 A;  2IL3 A;  5J5N A;  2AAW A;  3GTU A;  1EOH A;  4KF9 A;  3WD6 A;  4F0C A;  2HRA A;  2VO4 A;  3KM6 A;  1GTB A;  5FT3 A;  4IKH A;  4HI7 A;  5GST A;  2YV7 A;  4ZBA A;  4PI2 C;  4JZQ A;  4GST A;  4EC0 A;  1G6Y A;  2WVY A;  2WVX A;  4OFM A;  3LXZ A;  1OE7 A;  4GDF A;  2PBJ A;  4KSM A;  3TU3 B;  3QAW A;  1GWC A;  4YQV A;  4AGS A;  3RGB C;  4IW9 A;  2HRK A;  4PUR A;  2WW3 A;  1C72 A;  1GUK A;  3VLN A;  5ECS A;  1M0U A;  4EXJ A;  4KDX A;  4ECB A;  17GS A;  5AN1 A;  1LBK A;  2CA8 A;  4RI7 A;  1FW1 A;  4CHS A;  1SVL A;  3H1N A;  4HOJ A;  4W66 A;  4WR5 A;  5A34 A;  1BX9 A;  1TW9 A;  4IEL A;  1VF3 A;  2FHE A;  5DQS A;  4BVY A;  11GS A;  4E8H A;  4Q5F A;  5IQY A;  4ZB7 A;  1GSS A;  2C8U A;  4ZB9 A;  4G9H A;  2GSS A;  1PMT A;  1AQV A;  5F05 A;  3LYK A;  3UBL A;  3ISO A;  5F07 A;  4J2F A;  1M99 A;  1A0F A;  3I69 A;  1Y1U A;  5A1N A;  2VCV A;  5GSS A;  1YDK A;  3EE2 A;  3CBU A;  3LFL A;  2CAI A;  1U3I A;  4PI0 C;  1ZL9 A;  4K0N A;  1IYH A;  5ECK B;  4YAV A;  1PL1 A;  1TDI A;  2DSA A;  2C80 A;  3HJM A;  5DAK A;  4IQ1 A;  2A2R A;  4ISD A;  5KEJ A;  1EEM A;  3KMN A;  5DCG A;  1ZGN A;  3G7J A;  4K0G A;  3VUR A;  12GS A;  4PTS A;  2GTU A;  4ECJ A;  1GUH A;  3KTL A;  3TOT A;  3VI7 A;  3D0Z A;  5D9X A;  4EE0 A;  2DC5 A;  4L5O A;  1ML6 A;  2IMI A;  2WVX B;  5EY6 A;  1GSE A;  1OE8 A;  3M3M A;  1MD4 A;  1EV9 A;  3W8S A;  19GS A;  3NIV A;  4MF7 A;  5ECP B;  2AHE A;  3IK7 A;  1XWG A;  1BF5 A;  1K0A A;  3KXO A;  4IS0 A;  4OMV A;  3VK9 A;  1TU7 A;  3FYG A;  5J4U A;  2HRK B;  1NHY A;  5DDL A;  1DUG A;  3Q74 A;  1GTU A;  5ECI B;  3AY8 A;  1GTA A;  4PHZ C;  5DAL A;  1BG1 A;  3O3T A;  3GSS A;  1U87 A;  5A34 B;  2YV9 A;  4WR4 A;  1OYJ A;  2VCW A;  3FRC A;  4Q5N A;  4KAE A;  1F3B A;  1YJ6 A;  2LJR A;  4PGT A;  5F0G A;  4AI6 A;  5J40 A;  1SVM A;  4YH2 A;  4AKX B;  5ELG A;  22GS A;  3M8N A;  1GLP A;  2GST A;  3IK9 A;  5LD0 A;  5A1N B;  4L8E A;  4RI6 A;  2R3X A;  2CAQ A;  2OAC A;  4ID0 A;  2VKZ G;  2GDR A;  4NHZ A;  3F6F A;  3IC8 A;  1B4P A;  5J4Y A;  3P90 A;  2EFE A;  5DAK B;  5FHI A;  4G01 A;  5A4W A;  4N0V A;  3PGT A;  5A4U A;  5HFK A;  1GUM A;  1GSQ A;  1PKZ A;  3LJR A;  1AW9 A;  2C3Q A;  1B48 A;  4PQI A;  3VWX A;  3DD3 A;  4FQU A;  2J9H A;  1AXD A;  1GNW A;  5ECL B;  1PL2 A;  4KE3 A;  4MDC A;  9GSS A;  1OKT A;  4GCI A;  4ACS A;  2EFH A;  3VPT A;  3G7I A;  5ECM B;  4ZBD A;  1AQW A;  4MPG A;  2WW1 A;  3RBT A;  1K3L A;  6GSS A;  1XW5 A;  4OFT A;  4N3Z A;  2A2S A;  4IQA A;  6GSW A;  2HSN A;  3IE3 A;  1HNB A;  4G0I A;  2WRT A;  3ZMK A;  3M0F A;  4MF5 A;  5AIV A;  2V6K A;  4QMK A;  5DAL B;  13GS A;  1PA3 A;  2WW0 A;  1VF2 A;  4BVX A;  1MTC A;  3TOU A;  2PGT A;  3HMJ G;  2PMT A;  5AIX A;  1K3Y A;  2WB9 A;  1M9B A;  5JCU A;  16GS A;  3CHX C; 
#chains in the Genus database with same CATH homology
 4YAP A;  8GSS A;  1K0N A;  3FR9 A;  1GNE A;  4O92 A;  1EV4 A;  2WJU A;  1TXU A;  2GLR A;  3R2Q A;  4GF0 A;  3IBH A;  3LSZ A;  3CWG A;  4KDY A;  4KGI A;  3WYW A;  1MD3 A;  1PD2 1;  4G19 A;  4I97 A;  4G0L A;  4GSN A;  3ZFL A;  2OA7 A;  4MZW A;  4PX1 A;  2UV8 G;  3Q19 A;  1UA5 A;  4EDZ A;  4ZXG A;  3CSJ A;  3LYP A;  4NHW A;  3UAR A;  4PUA A;  4MK3 A;  5ECH B;  2PVQ A;  1GSF A;  5EVO A;  4IVF A;  1Q4J A;  3I6A A;  5ECR B;  2IMK A;  4ECC A;  5ELA A;  1YVL A;  2FNO A;  3UVH A;  4GTU A;  2R5G A;  1PKW A;  3HKR A;  3M1G A;  4MP4 A;  1Z9H A;  5J41 A;  3MAK A;  5F8B A;  3LG6 A;  3QR6 A;  5A5H A;  4ZB6 A;  1VF1 A;  2HSN B;  3GX0 A;  4LMV A;  2R4V A;  4E68 A;  1IYI A;  4BVX B;  4DEJ A;  4KX4 A;  4TOP A;  3FY7 A;  5A5K A;  1G7O A;  1HQO A;  1F2E A;  3CRU A;  5D73 A;  1SVO A;  3ZML A;  1B8X A;  2ON5 A;  3F63 A;  1PN9 A;  3QAG A;  3C8E A;  5G5F A;  5ECQ B;  4G0K A;  4MF6 A;  5D9T A;  4BL7 A;  3GUS A;  3UBK A;  1K0M A;  3PPU A;  1K3O A;  4QQ7 A;  1RK4 A;  2VCQ A;  1R5A A;  3ERF A;  4EDY A;  6GSV A;  1E6B A;  2CZ2 A;  1GTI A;  1BG5 A;  5ECN B;  5DJM A;  5LCZ A;  3P8W A;  1K0D A;  3ZFB A;  1AQX A;  18GS A;  2OAD A;  4OFN A;  2HNL A;  3CSI A;  3CSH A;  4ZBB A;  1HNA A;  5DJL A;  4KDU A;  3DGQ A;  3EIN A;  4PQH A;  1G6W A;  1FHE A;  1PX6 A;  2D2Z A;  4ZB8 A;  4LMW A;  5A4V A;  5BMU A;  4IGJ A;  1PGT A;  5AGY A;  1HNC A;  4PXO A;  2CVD A;  1U88 A;  2PER A;  3FR3 A;  6GSX A;  5D9W A;  5AIS A;  2X64 A;  5A5H B;  1USB A;  3PR8 A;  1YKC A;  2EFD A;  2H1L A;  2HSM A;  4MPF A;  4O7H A;  1KBN A;  5JCW A;  1GSY A;  3SWL A;  2UZ8 A;  4Q5R A;  2VCX A;  3ERG A;  4JED A;  1K0C A;  5B7C A;  4PNG A;  1XWK A;  3KMO A;  6GSY A;  4JBB A;  6GSU A;  1M9A A;  2VD0 A;  5EL8 A;  14GS A;  4Q5Q A;  2C3N A;  1GUL A;  3F6D A;  2GSR A;  3MDK A;  4HZ4 A;  2NTO A;  4HZ2 A;  3U6V A;  4KH7 A;  4BL7 B;  4PNF A;  2VD1 A;  2VCT A;  3L0H A;  2C4J A;  2HQT A;  4AKH A;  2VCZ A;  4AKG A;  1V40 A;  3O76 A;  3R3E A;  4HJ2 A;  3TGZ A;  3GH6 A;  3LXT A;  1Y6E A;  2OT3 A;  4GLT A;  1K0O A;  2C3T A;  3VI5 A;  1LJR A;  1EOG A;  1GLQ A;  3VPQ A;  1VF4 A;  20GS A;  7GSS A;  3GTU B;  4YQU A;  4USS A;  3UAP A;  1TU8 A;  2F8F A;  3N5O A;  5GZZ B;  3N9J A;  1JZR A;  1GSU A;  1YQ1 A;  3KJY A;  1GSD A;  2GSQ A;  3GUR A;  6GST A;  2YCD A;  1V2A A;  5F06 A;  2N5F A;  4YQM A;  5J47 A;  1N2A A;  3IR4 A;  1BAY A;  3BBY A;  2O5V A;  1PX7 A;  4ECI A;  1BYE A;  5BMU B;  2AB6 A;  4IBP A;  5ECO B;  2WS2 A;  5FWG A;  3GST A;  2R6K A;  2HSM B;  5G5E A;  4E8E A;  1YY7 A;  5J4V A;  2ON7 A;  1JLW A;  1N25 A;  1JLV A;  2WDU A;  10GS A;  4IJI A;  4F0B A;  4G10 A;  2EFC A;  4BVY B;  2JL4 A;  1XW6 A;  3HJO A;  1K0B A;  4AKI A;  2F3M A;  2CZ3 A;  3QAV A;  5D9V A;  3CRT A;  4L5L A;  3FR6 A;  4GSS A;  4F03 A;  4NAX A;  3Q18 A;  1F3A A;  3LQ7 A;  2IL3 A;  5J5N A;  2AAW A;  3GTU A;  1EOH A;  4KF9 A;  3WD6 A;  4F0C A;  2HRA A;  2VO4 A;  3KM6 A;  1GTB A;  5FT3 A;  4IKH A;  4HI7 A;  5GST A;  2YV7 A;  4ZBA A;  4JZQ A;  4GST A;  4EC0 A;  1G6Y A;  4OFM A;  3LXZ A;  1OE7 A;  4GDF A;  2PBJ A;  4KSM A;  3TU3 B;  3QAW A;  1GWC A;  4YQV A;  4AGS A;  4IW9 A;  2HRK A;  4PUR A;  3VLN A;  1C72 A;  1GUK A;  4EXJ A;  5ECS A;  1M0U A;  4KDX A;  4ECB A;  17GS A;  5AN1 A;  1LBK A;  2CA8 A;  4RI7 A;  1FW1 A;  4CHS A;  1SVL A;  3H1N A;  4HOJ A;  4W66 A;  4WR5 A;  5A34 A;  1BX9 A;  1TW9 A;  4IEL A;  1VF3 A;  2FHE A;  5DQS A;  4BVY A;  11GS A;  4E8H A;  4Q5F A;  5IQY A;  4ZB7 A;  1GSS A;  2C8U A;  4ZB9 A;  4G9H A;  2GSS A;  1PMT A;  1AQV A;  5F05 A;  3LYK A;  3UBL A;  3ISO A;  5F07 A;  4J2F A;  1M99 A;  1A0F A;  3I69 A;  1Y1U A;  5A1N A;  2VCV A;  5GSS A;  1YDK A;  3EE2 A;  3CBU A;  3LFL A;  2CAI A;  1U3I A;  1ZL9 A;  4K0N A;  1IYH A;  5ECK B;  4YAV A;  1PL1 A;  1TDI A;  2DSA A;  2C80 A;  3HJM A;  5DAK A;  4IQ1 A;  2A2R A;  4ISD A;  5KEJ A;  1EEM A;  3KMN A;  5DCG A;  1ZGN A;  3G7J A;  4K0G A;  3VUR A;  12GS A;  4PTS A;  2GTU A;  4ECJ A;  1GUH A;  3KTL A;  3TOT A;  3VI7 A;  3D0Z A;  5D9X A;  4EE0 A;  2DC5 A;  4L5O A;  1ML6 A;  2IMI A;  5EY6 A;  1GSE A;  1OE8 A;  3M3M A;  1MD4 A;  1EV9 A;  3W8S A;  19GS A;  3NIV A;  4MF7 A;  5ECP B;  2AHE A;  3IK7 A;  1XWG A;  1BF5 A;  1K0A A;  3KXO A;  4IS0 A;  4OMV A;  3VK9 A;  1TU7 A;  3FYG A;  5J4U A;  2HRK B;  1NHY A;  5DDL A;  1DUG A;  3Q74 A;  1GTU A;  5ECI B;  3AY8 A;  1GTA A;  5DAL A;  1BG1 A;  3O3T A;  3GSS A;  1U87 A;  5A34 B;  2YV9 A;  4WR4 A;  1OYJ A;  2VCW A;  3FRC A;  4Q5N A;  4KAE A;  1F3B A;  1YJ6 A;  2LJR A;  4PGT A;  5F0G A;  4AI6 A;  5J40 A;  1SVM A;  4YH2 A;  4AKX B;  5ELG A;  22GS A;  3M8N A;  1GLP A;  2GST A;  3IK9 A;  5LD0 A;  5A1N B;  4L8E A;  4RI6 A;  2R3X A;  2CAQ A;  2OAC A;  4ID0 A;  2VKZ G;  2GDR A;  4NHZ A;  3F6F A;  3IC8 A;  1B4P A;  5J4Y A;  3P90 A;  2EFE A;  5DAK B;  5FHI A;  4G01 A;  5A4W A;  4N0V A;  3PGT A;  5A4U A;  5HFK A;  1GUM A;  1GSQ A;  1PKZ A;  3LJR A;  1AW9 A;  2C3Q A;  1B48 A;  4PQI A;  3VWX A;  3DD3 A;  4FQU A;  2J9H A;  1AXD A;  1GNW A;  5ECL B;  1PL2 A;  4KE3 A;  4MDC A;  9GSS A;  1OKT A;  4GCI A;  4ACS A;  2EFH A;  3VPT A;  3G7I A;  5ECM B;  4ZBD A;  1AQW A;  4MPG A;  3RBT A;  1K3L A;  6GSS A;  1XW5 A;  4OFT A;  4N3Z A;  2A2S A;  4IQA A;  6GSW A;  2HSN A;  3IE3 A;  1HNB A;  4G0I A;  2WRT A;  3ZMK A;  3M0F A;  4MF5 A;  5AIV A;  2V6K A;  4QMK A;  5DAL B;  13GS A;  1PA3 A;  1VF2 A;  4BVX A;  1MTC A;  3TOU A;  2PGT A;  3HMJ G;  2PMT A;  5AIX A;  1K3Y A;  2WB9 A;  1M9B A;  5JCU A;  16GS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...