2HQTA

Crystal structures of the interacting domains from yeast glutamyl-trna synthetase and trna aminoacylation and nuclear export cofactor arc1p reveal a novel function for an old fold
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
118
structure length
115
Chain Sequence
SDLVTKFESLIYPVSFTKEQSAQAAQWESVLKSGQIQPHLDQLNLVLRDNTFIVSTLYPTSTDVHVFEVALPLIKDLVASSKDVKSTYTTYRHILRWIDYMQNLLEVSSTDKLEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GU4 nucleic-binding protein 1
publication title Structures of the interacting domains from yeast glutamyl-tRNA synthetase and tRNA-aminoacylation and nuclear-export cofactor Arc1p reveal a novel function for an old fold.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Biosynthetic protein, rna binding
total genus 37
structure length 115
sequence length 118
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T
ec nomenclature
pdb deposition date 2006-07-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2hqtA00
1M9AA 2UZ8A 4PURA 4PTSA 5F0GA 4Q5RA 18GSA 1KBNA 4RI7A 4IS0A 3QAWA 3ZFLA 3CBUA 2GTUA 1PX6A 2IMKA 6GSWA 3KXOA 1XW5A 4MPFA 5BMUA 1PD21 3UBLA 5D9TA 3KMOA 3QAVA 1PKWA 2X64A 3H1NA 1BYEA 1GSEA 4OMVA 2D2ZA 4NAXA 3RBTA 2WS2A 3ERFA 1K0BA 4ZB6A 3CRTA 3WD6A 2WDUA 1VF3A 4LMVA 3IC8A 2YV9A 2HQTA 3ERGA 3GTUB 4Q5FA 2HRKA 4IGJA 2GSQA 1ZGNA 5GSTA 4N0VA 9GSSA 3ZMKA 3KM6A 3N5OA 1K3OA 5AGYA 4BL7B 5ECKB 3KTLA 6GSSA 1B8XA 2PVQA 2C3NA 3LXTA 4KDYA 1HNAA 3P90A 5ECNB 2LJRA 4YH2A 3FY7A 1U88A 1IYHA 2VCWA 1GTIA 1U3IA 1MTCA 1G7OA 1AQWA 5G5FA 4J2FA 6GSXA 4ISDA 2CVDA 1B48A 4ECBA 2CA8A 1GWCA 5JCWA 5EY6A 6GSYA 5DJLA 2OADA 5FHIA 4PXOA 5JCUA 2AHEA 2PMTA 1GUKA 4HOJA 2PBJA 4IELA 1A0FA 2PERA 3DGQA 2R4VA 3Q19A 4EC0A 4PNGA 1IYIA 4Q5NA 4GSNA 1V40A 3LYPA 5ECSA 3LQ7A 2NTOA 4E8EA 4MDCA 5J4UA 3O76A 3P8WA 3VPTA 3AY8A 1EV9A 1Z9HA 1GSDA 3F63A 4O92A 1Q4JA 1PMTA 4EXJA 5A4UA 4IW9A 1EOHA 5DAKA 4IJIA 1FHEA 6GSTA 22GSA 4KH7A 2IL3A 3FR6A 4EDZA 3D0ZA 2YV7A 2N5FA 5AN1A 1GULA 3ISOA 1GNWA 3I69A 4NHWA 5DALB 1GSFA 4KDXA 4GF0A 1BG5A 7GSSA 4ZBAA 4YQVA 3EE2A 1GLQA 1VF1A 3FRCA 1K3LA 3M0FA 1YQ1A 2VCQA 1ML6A 5DCGA 4G19A 1TDIA 3CSJA 1JLWA 5HFKA 2AB6A 2VD0A 3SWLA 1GUMA 3LFLA 2VO4A 3G7JA 5J5NA 1OE8A 2HSMB 1PX7A 5FWGA 1M0UA 4YQMA 2HNLA 4TOPA 4PX1A 4BVYB 4KSMA 4L5LA 1TU8A 3CRUA 1GLPA 4ID0A 2R6KA 1K0DA 3C8EA 1GTUA 1XWKA 2A2SA 5F05A 1AQXA 2J9HA 1BX9A 1OKTA 1MD3A 3VURA 2WRTA 1EOGA 10GSA 2IMIA 5ECPB 3GSTA 3ZMLA 2VCXA 13GSA 4IQ1A 5D9VA 1K3YA 5IQYA 2VCZA 4ECIA 4OFMA 3CSHA 4NHZA 3FR9A 4DEJA 1GUHA 5LD0A 1AXDA 2YCDA 3GX0A 4FQUA 6GSVA 2VD1A 3FR3A 1K0AA 2HSNB 3EINA 4ZXGA 2FHEA 4PGTA 2GSTA 5F8BA 4HI7A 3KJYA 4KGIA 1AW9A 4F0CA 11GSA 4HZ2A 2R3XA 5KEJA 3TOTA 2WJUA 4KX4A 1TW9A 5A5KA 3G7IA 2HRKB 5D9WA 1USBA 4YAVA 5EL8A 4I97A 3GURA 4HJ2A 5ECOB 2HRAA 1K0CA 5ELAA 1F3BA 14GSA 1NHYA 4MF7A 3IE3A 2OA7A 3VPQA 5GZZB 4G0KA 3NIVA 5AIVA 1K0MA 3IK9A 4YAPA 3WYWA 1RK4A 1MD4A 4OFNA 1OE7A 3DD3A 20GSA 4G0LA 1GSUA 1JZRA 1HNCA 2VCTA 1JLVA 3F6DA 4IBPA 5ECMB 4IVFA 1VF2A 4GSTA 5ECLB 5ECHB 3UAPA 3MAKA 1GSSA 3CSIA 4K0NA 2FNOA 4JEDA 4JBBA 2GDRA 3M1GA 4PQHA 4GSSA 1M9BA 3VI5A 2CAIA 3HJOA 2VCVA 4O7HA 4E8HA 4BVXA 4EE0A 3GSSA 4GTUA 16GSA 4KAEA 3LSZA 4ECJA 3LYKA 5EVOA 1PN9A 3VI7A 5D9XA 4AGSA 3M3MA 2CZ2A 2DSAA 2CZ3A 4GLTA 3IBHA 2C4JA 1V2AA 3BBYA 5DAKB 4MPGA 4ECCA 3IK7A 3N9JA 4ZBBA 3R3EA 4RI6A 4F0BA 2R5GA 3GH6A 3LG6A 3TGZA 4KF9A 5A4VA 3PPUA 3GTUA 1AQVA 1PL2A 4MP4A 4F03A 4L8EA 3M8NA 3UBKA 1DUGA 1FW1A 5AIXA 3Q18A 4IKHA 5ELGA 3LXZA 3KMNA 19GSA 4QQ7A 4BL7A 2CAQA 4MF5A 2DC5A 1N2AA 5ECIB 5ECRB 3UARA 3ZFBA 1Y6EA 3R2QA 1PKZA 2C80A 1BAYA 4MK3A 6GSUA 4WR4A 3W8SA 4K0GA 1YJ6A 4WR5A 2A2RA 3F6FA 3LJRA 4JZQA 5J41A 5F07A 1GSYA 1GNEA 4CHSA 1TU7A 4G10A 5D73A 3TOUA 3HKRA 1M99A 4ZB9A 2C8UA 3QAGA 1VF4A 2V6KA 8GSSA 4USSA 4LMWA 4HZ4A 1F3AA 3PGTA 3VLNA 3GUSA 1G6YA 4YQUA 4PUAA 4G9HA 5AISA 3QR6A 4G0IA 1HQOA 2ON5A 2PGTA 2F8FA 3UVHA 1XW6A 4ZB8A 3I6AA 3U6VA 5DDLA 4Q5QA 4ZBDA 1F2EA 2GSSA 4ACSA 1U87A 3L0HA 4MF6A 1B4PA 4PNFA 17GSA 1EV4A 5DALA 3VK9A 1K0NA 5A4WA 12GSA 5F06A 1C72A 5ECQB 5LCZA 4EDYA 1ZL9A 4PQIA 1K0OA 3O3TA 1PL1A 1PA3A 5GSSA 4MZWA 5FT3A 1R5AA 3HJMA 1EEMA 1OYJA 1LBKA 2WB9A 4IQAA 5B7CA 2F3MA 1YDKA 2JL4A 4KE3A 4OFTA 5G5EA 2HSMA 3PR8A 1GTBA 1YY7A 1UA5A 3Q74A 2ON7A 1E6BA 1PGTA 4BVYA 2AAWA 1YKCA 3FYGA 2C3TA 1GTAA 3VWXA 2C3QA 1XWGA 3IR4A 2OACA 5DJMA 1LJRA 2GSRA 2GLRA 1GSQA 1G6WA 4L5OA 4BVXB 1HNBA 4KDUA 5DQSA 3MDKA 4GCIA
chains in the Genus database with same CATH superfamily
1M9AA 2UZ8A 4PURA 4PTSA 5F0GA 4Q5RA 18GSA 1KBNA 4RI7A 4IS0A 3QAWA 2O3EA 3ZFLA 3CBUA 2GTUA 1PX6A 2IMKA 6GSWA 3KXOA 1XW5A 4MPFA 5BMUA 1PD21 3UBLA 5D9TA 3KMOA 3QAVA 2HSNA 1PKWA 2X64A 5J40A 3H1NA 1BYEA 1GSEA 4OMVA 2D2ZA 4NAXA 3RBTA 2O36A 2WS2A 3ERFA 1K0BA 4ZB6A 3CRTA 3WD6A 2WDUA 1VF3A 4LMVA 2EFEA 3IC8A 2YV9A 2HQTA 3ERGA 3GTUB 4Q5FA 4AKXB 2HRKA 2OT3A 4IGJA 2GSQA 1ZGNA 5GSTA 4N0VA 9GSSA 3ZMKA 3KM6A 3N5OA 1K3OA 5AGYA 4BL7B 5ECKB 1SVMA 3KTLA 6GSSA 1B8XA 5J4VA 2PVQA 2C3NA 2WVYA 2H1LA 2WW0A 3LXTA 4KDYA 1HNAA 3P90A 5ECNB 2LJRA 2WZSA 4YH2A 3FY7A 1U88A 4GDFA 1IYHA 2VCWA 1GTIA 1U3IA 1MTCA 1G7OA 1AQWA 3CHXC 5G5FA 1SVOA 4J2FA 3TU3B 6GSXA 4ISDA 2CVDA 1B48A 4ECBA 2CA8A 1GWCA 5JCWA 5EY6A 6GSYA 5DJLA 2OADA 5FHIA 4PXOA 5JCUA 2AHEA 2PMTA 1GUKA 4HOJA 2PBJA 4IELA 4AKIA 2WW3A 1A0FA 2PERA 3DGQA 2R4VA 3Q19A 4EC0A 4PNGA 1IYIA 4Q5NA 4GSNA 1V40A 3LYPA 5ECSA 3LQ7A 2NTOA 4E8EA 4MDCA 5J4UA 3O76A 3P8WA 3VPTA 3AY8A 1EV9A 4PHZC 1Z9HA 1GSDA 3F63A 4O92A 1Q4JA 1PMTA 4EXJA 5A4UA 4IW9A 1EOHA 5DAKA 4IJIA 1FHEA 6GSTA 22GSA 4KH7A 2IL3A 3FR6A 4EDZA 3D0ZA 2YV7A 2N5FA 5AN1A 1GULA 3ISOA 1GNWA 3I69A 4NHWA 4QMKA 1GSFA 5DALB 4KDXA 4GF0A 1BG5A 7GSSA 4ZBAA 4YQVA 3EE2A 1GLQA 1VF1A 3FRCA 1K3LA 3M0FA 1Y1UA 1YQ1A 2VCQA 1ML6A 5DCGA 4G19A 1TDIA 3CSJA 1JLWA 5HFKA 2AB6A 2VD0A 3SWLA 1GUMA 3LFLA 2VO4A 3G7JA 5J5NA 1OE8A 2HSMB 1PX7A 4ZB7A 5FWGA 1M0UA 4YQMA 2HNLA 4TOPA 4PX1A 4BVYB 4KSMA 4L5LA 1TU8A 3CRUA 1GLPA 4ID0A 2R6KA 1K0DA 3C8EA 1GTUA 1XWKA 2A2SA 5F05A 5A1NA 1AQXA 4PI0C 2J9HA 5A5HB 1BX9A 1OKTA 1MD3A 3VURA 2WRTA 1EOGA 10GSA 2IMIA 5ECPB 3GSTA 3ZMLA 2VCXA 13GSA 4IQ1A 5D9VA 1K3YA 4G01A 5IQYA 2VCZA 4ECIA 4OFMA 3CSHA 4NHZA 3FR9A 4DEJA 1GUHA 5LD0A 1AXDA 5BMUB 2YCDA 3GX0A 4FQUA 6GSVA 1YEWC 2VD1A 3FR3A 1K0AA 2HSNB 2WVXA 1TXUA 3EINA 4ZXGA 2FHEA 4PGTA 2GSTA 5F8BA 5A1NB 4HI7A 3KJYA 4KGIA 1AW9A 5A34A 4F0CA 11GSA 4HZ2A 2R3XA 5KEJA 3TOTA 2WJUA 4KX4A 1TW9A 5A5KA 3G7IA 2HRKB 5D9WA 3RFRC 1USBA 4YAVA 5EL8A 4I97A 3GURA 4HJ2A 5ECOB 1S4BP 2HRAA 1K0CA 5ELAA 1F3BA 14GSA 1NHYA 4MF7A 3IE3A 2OA7A 3VPQA 5GZZB 4G0KA 3NIVA 5AIVA 1K0MA 3IK9A 4YAPA 3WYWA 1RK4A 1MD4A 4OFNA 2WVZA 1OE7A 3DD3A 4PI2C 20GSA 4G0LA 1GSUA 1JZRA 1HNCA 2VCTA 1JLVA 3F6DA 4IBPA 5ECMB 4IVFA 1VF2A 4GSTA 5ECLB 5ECHB 3UAPA 3MAKA 1GSSA 3CSIA 4K0NA 2FNOA 4JEDA 4JBBA 2GDRA 3M1GA 4PQHA 4GSSA 1M9BA 3VI5A 2CAIA 3HJOA 2VCVA 4O7HA 4E8HA 4BVXA 4EE0A 3GSSA 4GTUA 4N3ZA 16GSA 4KAEA 3LSZA 4ECJA 3LYKA 5EVOA 1PN9A 3VI7A 4AKGA 4E68A 5D9XA 4AGSA 3RGBC 3M3MA 2CZ2A 2DSAA 1BG1A 2CZ3A 4GLTA 3IBHA 2C4JA 1V2AA 3BBYA 5DAKB 4MPGA 4ECCA 3IK7A 3N9JA 4ZBBA 3R3EA 5J47A 4RI6A 4F0BA 2R5GA 3GH6A 3LG6A 2VKZG 3TGZA 4KF9A 1SVLA 5A4VA 3PPUA 3GTUA 2WW1A 1AQVA 1PL2A 4MP4A 4F03A 4L8EA 3M8NA 3UBKA 1DUGA 1FW1A 5AIXA 3Q18A 4IKHA 5ELGA 3LXZA 3KMNA 19GSA 4QQ7A 4BL7A 2CAQA 4MF5A 2DC5A 1N2AA 5ECIB 5ECRB 3UARA 3ZFBA 1Y6EA 3R2QA 1PKZA 2C80A 5J4YA 1BAYA 4MK3A 6GSUA 4WR4A 3W8SA 2EFCA 4K0GA 1YJ6A 4WR5A 2A2RA 3F6FA 3LJRA 4JZQA 5J41A 5F07A 1GSYA 1GNEA 4CHSA 1TU7A 2WW2A 4G10A 5D73A 3CWGA 3TOUA 3HKRA 1M99A 4ZB9A 2C8UA 3QAGA 1VF4A 2V6KA 8GSSA 4USSA 4FXYP 4LMWA 4HZ4A 1F3AA 3PGTA 3VLNA 3GUSA 2EFHA 1G6YA 4YQUA 4PUAA 4G9HA 2WVXB 5AISA 3QR6A 4G0IA 1HQOA 2UV8G 2ON5A 2PGTA 5A34B 1YVLA 2F8FA 3UVHA 1XW6A 4ZB8A 3I6AA 4W66A 3U6VA 5DDLA 4Q5QA 4ZBDA 1F2EA 2GSSA 4ACSA 1U87A 3L0HA 4MF6A 1B4PA 1I1IP 4AI6A 4PNFA 17GSA 1EV4A 1N25A 3HMJG 2EFDA 5DALA 3VK9A 1K0NA 5A4WA 12GSA 5F06A 1C72A 5ECQB 5LCZA 4EDYA 1ZL9A 4PQIA 1K0OA 3O3TA 4AKHA 1PL1A 1PA3A 5GSSA 4MZWA 5FT3A 1R5AA 2O5VA 1BF5A 3HJMA 1EEMA 1OYJA 1LBKA 2WB9A 4IQAA 5B7CA 2F3MA 1YDKA 2JL4A 4KE3A 4OFTA 5G5EA 2HSMA 3PR8A 1GTBA 1YY7A 1UA5A 3Q74A 2ON7A 1E6BA 1PGTA 4BVYA 2AAWA 1YKCA 3FYGA 2C3TA 1GTAA 3VWXA 2C3QA 1XWGA 3IR4A 2OACA 5A5HA 5DJMA 1LJRA 2GSRA 2GLRA 1GSQA 1G6WA 4L5OA 4BVXB 1HNBA 4KDUA 5DQSA 3MDKA 4GCIA
chains in the Genus database with same CATH topology
1M9AA 2UZ8A 4PURA 4PTSA 5F0GA 4Q5RA 18GSA 1KBNA 4RI7A 4IS0A 3QAWA 3ZFLA 3CBUA 2GTUA 1PX6A 2IMKA 6GSWA 3KXOA 1XW5A 4MPFA 5BMUA 1PD21 3UBLA 5D9TA 3KMOA 3QAVA 2HSNA 1PKWA 2X64A 5J40A 3H1NA 1BYEA 1GSEA 4OMVA 2D2ZA 4NAXA 3RBTA 2WS2A 3ERFA 1K0BA 4ZB6A 3CRTA 3WD6A 2WDUA 1VF3A 4LMVA 2EFEA 3IC8A 2YV9A 2HQTA 3ERGA 3GTUB 4Q5FA 4AKXB 2HRKA 2OT3A 4IGJA 2GSQA 1ZGNA 5GSTA 4N0VA 9GSSA 3ZMKA 3KM6A 3N5OA 1K3OA 5AGYA 4BL7B 5ECKB 1SVMA 3KTLA 6GSSA 1B8XA 5J4VA 2PVQA 2C3NA 2H1LA 3LXTA 4KDYA 1HNAA 3P90A 5ECNB 2LJRA 4YH2A 3FY7A 1U88A 4GDFA 1IYHA 2VCWA 1GTIA 1U3IA 1MTCA 1G7OA 1AQWA 5G5FA 1SVOA 4J2FA 3TU3B 6GSXA 4ISDA 2CVDA 1B48A 4ECBA 2CA8A 1GWCA 5JCWA 5EY6A 6GSYA 5DJLA 2OADA 5FHIA 4PXOA 5JCUA 2AHEA 2PMTA 1GUKA 4HOJA 2PBJA 4IELA 4AKIA 1A0FA 2PERA 3DGQA 2R4VA 3Q19A 4EC0A 4PNGA 1IYIA 4Q5NA 4GSNA 1V40A 3LYPA 5ECSA 3LQ7A 2NTOA 4E8EA 4MDCA 5J4UA 3O76A 3P8WA 3VPTA 3AY8A 1EV9A 1Z9HA 1GSDA 3F63A 4O92A 1Q4JA 1PMTA 4EXJA 5A4UA 4IW9A 1EOHA 5DAKA 4IJIA 1FHEA 6GSTA 22GSA 4KH7A 2IL3A 3FR6A 4EDZA 3D0ZA 2YV7A 2N5FA 5AN1A 1GULA 3ISOA 1GNWA 3I69A 4NHWA 4QMKA 1GSFA 5DALB 4KDXA 4GF0A 1BG5A 7GSSA 4ZBAA 4YQVA 3EE2A 1GLQA 1VF1A 3FRCA 1K3LA 3M0FA 1Y1UA 1YQ1A 2VCQA 1ML6A 5DCGA 4G19A 1TDIA 3CSJA 1JLWA 5HFKA 2AB6A 2VD0A 3SWLA 1GUMA 3LFLA 2VO4A 3G7JA 5J5NA 1OE8A 2HSMB 1PX7A 4ZB7A 5FWGA 1M0UA 4YQMA 2HNLA 4TOPA 4PX1A 4BVYB 4KSMA 4L5LA 1TU8A 3CRUA 1GLPA 4ID0A 2R6KA 1K0DA 3C8EA 1GTUA 1XWKA 2A2SA 5F05A 5A1NA 1AQXA 5A5HB 2J9HA 1BX9A 1OKTA 1MD3A 3VURA 2WRTA 1EOGA 10GSA 2IMIA 5ECPB 3GSTA 3ZMLA 2VCXA 13GSA 4IQ1A 5D9VA 1K3YA 4G01A 5IQYA 2VCZA 4ECIA 4OFMA 3CSHA 4NHZA 3FR9A 4DEJA 1GUHA 5LD0A 1AXDA 5BMUB 2YCDA 3GX0A 4FQUA 6GSVA 2VD1A 3FR3A 1K0AA 2HSNB 1TXUA 3EINA 4ZXGA 2FHEA 4PGTA 2GSTA 5F8BA 5A1NB 4HI7A 3KJYA 4KGIA 1AW9A 5A34A 4F0CA 11GSA 4HZ2A 2R3XA 5KEJA 3TOTA 2WJUA 4KX4A 1TW9A 5A5KA 3G7IA 2HRKB 5D9WA 1USBA 4YAVA 5EL8A 4I97A 3GURA 4HJ2A 5ECOB 2HRAA 1K0CA 5ELAA 1F3BA 14GSA 1NHYA 4MF7A 3IE3A 2OA7A 3VPQA 5GZZB 4G0KA 3NIVA 5AIVA 1K0MA 3IK9A 4YAPA 3WYWA 1RK4A 1MD4A 4OFNA 1OE7A 3DD3A 20GSA 4G0LA 1GSUA 1JZRA 1HNCA 2VCTA 1JLVA 3F6DA 4IBPA 5ECMB 4IVFA 1VF2A 4GSTA 5ECLB 5ECHB 3UAPA 3MAKA 1GSSA 3CSIA 4K0NA 2FNOA 4JEDA 4JBBA 2GDRA 3M1GA 4PQHA 4GSSA 1M9BA 3VI5A 2CAIA 3HJOA 2VCVA 4O7HA 4E8HA 4BVXA 4EE0A 3GSSA 4GTUA 4N3ZA 16GSA 4KAEA 3LSZA 4ECJA 3LYKA 5EVOA 1PN9A 3VI7A 4AKGA 4E68A 5D9XA 4AGSA 3M3MA 2CZ2A 2DSAA 1BG1A 2CZ3A 4GLTA 3IBHA 2C4JA 1V2AA 3BBYA 5DAKB 4MPGA 4ECCA 3IK7A 3N9JA 4ZBBA 3R3EA 5J47A 4RI6A 4F0BA 2R5GA 3GH6A 3LG6A 2VKZG 3TGZA 4KF9A 1SVLA 5A4VA 3PPUA 3GTUA 1AQVA 1PL2A 4MP4A 4F03A 4L8EA 3M8NA 3UBKA 1DUGA 1FW1A 5AIXA 3Q18A 4IKHA 5ELGA 3LXZA 3KMNA 19GSA 4QQ7A 4BL7A 2CAQA 4MF5A 2DC5A 1N2AA 5ECIB 5ECRB 3UARA 3ZFBA 1Y6EA 3R2QA 1PKZA 2C80A 5J4YA 1BAYA 4MK3A 6GSUA 4WR4A 3W8SA 2EFCA 4K0GA 1YJ6A 4WR5A 2A2RA 3F6FA 3LJRA 4JZQA 5J41A 5F07A 1GSYA 1GNEA 4CHSA 1TU7A 4G10A 5D73A 3CWGA 3TOUA 3HKRA 1M99A 4ZB9A 2C8UA 3QAGA 1VF4A 2V6KA 8GSSA 4USSA 4LMWA 4HZ4A 1F3AA 3PGTA 3VLNA 3GUSA 2EFHA 1G6YA 4YQUA 4PUAA 4G9HA 5AISA 3QR6A 4G0IA 1HQOA 2UV8G 2ON5A 2PGTA 5A34B 1YVLA 2F8FA 3UVHA 1XW6A 4ZB8A 3I6AA 4W66A 3U6VA 5DDLA 4Q5QA 4ZBDA 1F2EA 2GSSA 4ACSA 1U87A 3L0HA 4MF6A 1B4PA 4AI6A 4PNFA 17GSA 1EV4A 1N25A 3HMJG 2EFDA 5DALA 3VK9A 1K0NA 5A4WA 12GSA 5F06A 1C72A 5ECQB 5LCZA 4EDYA 1ZL9A 4PQIA 1K0OA 3O3TA 4AKHA 1PL1A 1PA3A 5GSSA 4MZWA 5FT3A 1R5AA 2O5VA 1BF5A 3HJMA 1EEMA 1OYJA 1LBKA 2WB9A 4IQAA 5B7CA 2F3MA 1YDKA 2JL4A 4KE3A 4OFTA 5G5EA 2HSMA 3PR8A 1GTBA 1YY7A 1UA5A 3Q74A 2ON7A 1E6BA 1PGTA 4BVYA 2AAWA 1YKCA 3FYGA 2C3TA 1GTAA 3VWXA 2C3QA 1XWGA 3IR4A 2OACA 5A5HA 5DJMA 1LJRA 2GSRA 2GLRA 1GSQA 1G6WA 4L5OA 4BVXB 1HNBA 4KDUA 5DQSA 3MDKA 4GCIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M9A A;  2UZ8 A;  4PUR A;  4PTS A;  5F0G A;  4Q5R A;  18GS A;  1KBN A;  4RI7 A;  4IS0 A;  3QAW A;  3ZFL A;  3CBU A;  2GTU A;  1PX6 A;  2IMK A;  6GSW A;  3KXO A;  1XW5 A;  4MPF A;  5BMU A;  1PD2 1;  3UBL A;  5D9T A;  3KMO A;  3QAV A;  1PKW A;  2X64 A;  3H1N A;  1BYE A;  1GSE A;  4OMV A;  2D2Z A;  4NAX A;  3RBT A;  2WS2 A;  3ERF A;  1K0B A;  4ZB6 A;  3CRT A;  3WD6 A;  2WDU A;  1VF3 A;  4LMV A;  3IC8 A;  2YV9 A;  2HQT A;  3ERG A;  3GTU B;  4Q5F A;  2HRK A;  4IGJ A;  2GSQ A;  1ZGN A;  5GST A;  4N0V A;  9GSS A;  3ZMK A;  3KM6 A;  3N5O A;  1K3O A;  5AGY A;  4BL7 B;  5ECK B;  3KTL A;  6GSS A;  1B8X A;  2PVQ A;  2C3N A;  3LXT A;  4KDY A;  1HNA A;  3P90 A;  5ECN B;  2LJR A;  4YH2 A;  3FY7 A;  1U88 A;  1IYH A;  2VCW A;  1GTI A;  1U3I A;  1MTC A;  1G7O A;  1AQW A;  5G5F A;  4J2F A;  6GSX A;  4ISD A;  2CVD A;  1B48 A;  4ECB A;  2CA8 A;  1GWC A;  5JCW A;  5EY6 A;  6GSY A;  5DJL A;  2OAD A;  5FHI A;  4PXO A;  5JCU A;  2AHE A;  2PMT A;  1GUK A;  4HOJ A;  2PBJ A;  4IEL A;  1A0F A;  2PER A;  3DGQ A;  2R4V A;  3Q19 A;  4EC0 A;  4PNG A;  1IYI A;  4Q5N A;  4GSN A;  1V40 A;  3LYP A;  5ECS A;  3LQ7 A;  2NTO A;  4E8E A;  4MDC A;  5J4U A;  3O76 A;  3P8W A;  3VPT A;  3AY8 A;  1EV9 A;  1Z9H A;  1GSD A;  3F63 A;  4O92 A;  1Q4J A;  1PMT A;  4EXJ A;  5A4U A;  4IW9 A;  1EOH A;  5DAK A;  4IJI A;  1FHE A;  6GST A;  22GS A;  4KH7 A;  2IL3 A;  3FR6 A;  4EDZ A;  3D0Z A;  2YV7 A;  2N5F A;  5AN1 A;  1GUL A;  3ISO A;  1GNW A;  3I69 A;  4NHW A;  5DAL B;  1GSF A;  4KDX A;  4GF0 A;  1BG5 A;  7GSS A;  4ZBA A;  4YQV A;  3EE2 A;  1GLQ A;  1VF1 A;  3FRC A;  1K3L A;  3M0F A;  1YQ1 A;  2VCQ A;  1ML6 A;  5DCG A;  4G19 A;  1TDI A;  3CSJ A;  1JLW A;  5HFK A;  2AB6 A;  2VD0 A;  3SWL A;  1GUM A;  3LFL A;  2VO4 A;  3G7J A;  5J5N A;  1OE8 A;  2HSM B;  1PX7 A;  5FWG A;  1M0U A;  4YQM A;  2HNL A;  4TOP A;  4PX1 A;  4BVY B;  4KSM A;  4L5L A;  1TU8 A;  3CRU A;  1GLP A;  4ID0 A;  2R6K A;  1K0D A;  3C8E A;  1GTU A;  1XWK A;  2A2S A;  5F05 A;  1AQX A;  2J9H A;  1BX9 A;  1OKT A;  1MD3 A;  3VUR A;  2WRT A;  1EOG A;  10GS A;  2IMI A;  5ECP B;  3GST A;  3ZML A;  2VCX A;  13GS A;  4IQ1 A;  5D9V A;  1K3Y A;  5IQY A;  2VCZ A;  4ECI A;  4OFM A;  3CSH A;  4NHZ A;  3FR9 A;  4DEJ A;  1GUH A;  5LD0 A;  1AXD A;  2YCD A;  3GX0 A;  4FQU A;  6GSV A;  2VD1 A;  3FR3 A;  1K0A A;  2HSN B;  3EIN A;  4ZXG A;  2FHE A;  4PGT A;  2GST A;  5F8B A;  4HI7 A;  3KJY A;  4KGI A;  1AW9 A;  4F0C A;  11GS A;  4HZ2 A;  2R3X A;  5KEJ A;  3TOT A;  2WJU A;  4KX4 A;  1TW9 A;  5A5K A;  3G7I A;  2HRK B;  5D9W A;  1USB A;  4YAV A;  5EL8 A;  4I97 A;  3GUR A;  4HJ2 A;  5ECO B;  2HRA A;  1K0C A;  5ELA A;  1F3B A;  14GS A;  1NHY A;  4MF7 A;  3IE3 A;  2OA7 A;  3VPQ A;  5GZZ B;  4G0K A;  3NIV A;  5AIV A;  1K0M A;  3IK9 A;  4YAP A;  3WYW A;  1RK4 A;  1MD4 A;  4OFN A;  1OE7 A;  3DD3 A;  20GS A;  4G0L A;  1GSU A;  1JZR A;  1HNC A;  2VCT A;  1JLV A;  3F6D A;  4IBP A;  5ECM B;  4IVF A;  1VF2 A;  4GST A;  5ECL B;  5ECH B;  3UAP A;  3MAK A;  1GSS A;  3CSI A;  4K0N A;  2FNO A;  4JED A;  4JBB A;  2GDR A;  3M1G A;  4PQH A;  4GSS A;  1M9B A;  3VI5 A;  2CAI A;  3HJO A;  2VCV A;  4O7H A;  4E8H A;  4BVX A;  4EE0 A;  3GSS A;  4GTU A;  16GS A;  4KAE A;  3LSZ A;  4ECJ A;  3LYK A;  5EVO A;  1PN9 A;  3VI7 A;  5D9X A;  4AGS A;  3M3M A;  2CZ2 A;  2DSA A;  2CZ3 A;  4GLT A;  3IBH A;  2C4J A;  1V2A A;  3BBY A;  5DAK B;  4MPG A;  4ECC A;  3IK7 A;  3N9J A;  4ZBB A;  3R3E A;  4RI6 A;  4F0B A;  2R5G A;  3GH6 A;  3LG6 A;  3TGZ A;  4KF9 A;  5A4V A;  3PPU A;  3GTU A;  1AQV A;  1PL2 A;  4MP4 A;  4F03 A;  4L8E A;  3M8N A;  3UBK A;  1DUG A;  1FW1 A;  5AIX A;  3Q18 A;  4IKH A;  5ELG A;  3LXZ A;  3KMN A;  19GS A;  4QQ7 A;  4BL7 A;  2CAQ A;  4MF5 A;  2DC5 A;  1N2A A;  5ECI B;  5ECR B;  3UAR A;  3ZFB A;  1Y6E A;  3R2Q A;  1PKZ A;  2C80 A;  1BAY A;  4MK3 A;  6GSU A;  4WR4 A;  3W8S A;  4K0G A;  1YJ6 A;  4WR5 A;  2A2R A;  3F6F A;  3LJR A;  4JZQ A;  5J41 A;  5F07 A;  1GSY A;  1GNE A;  4CHS A;  1TU7 A;  4G10 A;  5D73 A;  3TOU A;  3HKR A;  1M99 A;  4ZB9 A;  2C8U A;  3QAG A;  1VF4 A;  2V6K A;  8GSS A;  4USS A;  4LMW A;  4HZ4 A;  1F3A A;  3PGT A;  3VLN A;  3GUS A;  1G6Y A;  4YQU A;  4PUA A;  4G9H A;  5AIS A;  3QR6 A;  4G0I A;  1HQO A;  2ON5 A;  2PGT A;  2F8F A;  3UVH A;  1XW6 A;  4ZB8 A;  3I6A A;  3U6V A;  5DDL A;  4Q5Q A;  4ZBD A;  1F2E A;  2GSS A;  4ACS A;  1U87 A;  3L0H A;  4MF6 A;  1B4P A;  4PNF A;  17GS A;  1EV4 A;  5DAL A;  3VK9 A;  1K0N A;  5A4W A;  12GS A;  5F06 A;  1C72 A;  5ECQ B;  5LCZ A;  4EDY A;  1ZL9 A;  4PQI A;  1K0O A;  3O3T A;  1PL1 A;  1PA3 A;  5GSS A;  4MZW A;  5FT3 A;  1R5A A;  3HJM A;  1EEM A;  1OYJ A;  1LBK A;  2WB9 A;  4IQA A;  5B7C A;  2F3M A;  1YDK A;  2JL4 A;  4KE3 A;  4OFT A;  5G5E A;  2HSM A;  3PR8 A;  1GTB A;  1YY7 A;  1UA5 A;  3Q74 A;  2ON7 A;  1E6B A;  1PGT A;  4BVY A;  2AAW A;  1YKC A;  3FYG A;  2C3T A;  1GTA A;  3VWX A;  2C3Q A;  1XWG A;  3IR4 A;  2OAC A;  5DJM A;  1LJR A;  2GSR A;  2GLR A;  1GSQ A;  1G6W A;  4L5O A;  4BVX B;  1HNB A;  4KDU A;  5DQS A;  3MDK A;  4GCI A; 
#chains in the Genus database with same CATH topology
 1M9A A;  2UZ8 A;  4PUR A;  4PTS A;  5F0G A;  4Q5R A;  18GS A;  1KBN A;  4RI7 A;  4IS0 A;  3QAW A;  2O3E A;  3ZFL A;  3CBU A;  2GTU A;  1PX6 A;  2IMK A;  6GSW A;  3KXO A;  1XW5 A;  4MPF A;  5BMU A;  1PD2 1;  3UBL A;  5D9T A;  3KMO A;  3QAV A;  2HSN A;  1PKW A;  2X64 A;  5J40 A;  3H1N A;  1BYE A;  1GSE A;  4OMV A;  2D2Z A;  4NAX A;  3RBT A;  2O36 A;  2WS2 A;  3ERF A;  1K0B A;  4ZB6 A;  3CRT A;  3WD6 A;  2WDU A;  1VF3 A;  4LMV A;  2EFE A;  3IC8 A;  2YV9 A;  2HQT A;  3ERG A;  3GTU B;  4Q5F A;  4AKX B;  2HRK A;  2OT3 A;  4IGJ A;  2GSQ A;  1ZGN A;  5GST A;  4N0V A;  9GSS A;  3ZMK A;  3KM6 A;  3N5O A;  1K3O A;  5AGY A;  4BL7 B;  5ECK B;  1SVM A;  3KTL A;  6GSS A;  1B8X A;  5J4V A;  2PVQ A;  2C3N A;  2WVY A;  2H1L A;  2WW0 A;  3LXT A;  4KDY A;  1HNA A;  3P90 A;  5ECN B;  2LJR A;  2WZS A;  4YH2 A;  3FY7 A;  1U88 A;  4GDF A;  1IYH A;  2VCW A;  1GTI A;  1U3I A;  1MTC A;  1G7O A;  1AQW A;  3CHX C;  5G5F A;  1SVO A;  4J2F A;  3TU3 B;  6GSX A;  4ISD A;  2CVD A;  1B48 A;  4ECB A;  2CA8 A;  1GWC A;  5JCW A;  5EY6 A;  6GSY A;  5DJL A;  2OAD A;  5FHI A;  4PXO A;  5JCU A;  2AHE A;  2PMT A;  1GUK A;  4HOJ A;  2PBJ A;  4IEL A;  4AKI A;  2WW3 A;  1A0F A;  2PER A;  3DGQ A;  2R4V A;  3Q19 A;  4EC0 A;  4PNG A;  1IYI A;  4Q5N A;  4GSN A;  1V40 A;  3LYP A;  5ECS A;  3LQ7 A;  2NTO A;  4E8E A;  4MDC A;  5J4U A;  3O76 A;  3P8W A;  3VPT A;  3AY8 A;  1EV9 A;  4PHZ C;  1Z9H A;  1GSD A;  3F63 A;  4O92 A;  1Q4J A;  1PMT A;  4EXJ A;  5A4U A;  4IW9 A;  1EOH A;  5DAK A;  4IJI A;  1FHE A;  6GST A;  22GS A;  4KH7 A;  2IL3 A;  3FR6 A;  4EDZ A;  3D0Z A;  2YV7 A;  2N5F A;  5AN1 A;  1GUL A;  3ISO A;  1GNW A;  3I69 A;  4NHW A;  4QMK A;  1GSF A;  5DAL B;  4KDX A;  4GF0 A;  1BG5 A;  7GSS A;  4ZBA A;  4YQV A;  3EE2 A;  1GLQ A;  1VF1 A;  3FRC A;  1K3L A;  3M0F A;  1Y1U A;  1YQ1 A;  2VCQ A;  1ML6 A;  5DCG A;  4G19 A;  1TDI A;  3CSJ A;  1JLW A;  5HFK A;  2AB6 A;  2VD0 A;  3SWL A;  1GUM A;  3LFL A;  2VO4 A;  3G7J A;  5J5N A;  1OE8 A;  2HSM B;  1PX7 A;  4ZB7 A;  5FWG A;  1M0U A;  4YQM A;  2HNL A;  4TOP A;  4PX1 A;  4BVY B;  4KSM A;  4L5L A;  1TU8 A;  3CRU A;  1GLP A;  4ID0 A;  2R6K A;  1K0D A;  3C8E A;  1GTU A;  1XWK A;  2A2S A;  5F05 A;  5A1N A;  1AQX A;  4PI0 C;  2J9H A;  5A5H B;  1BX9 A;  1OKT A;  1MD3 A;  3VUR A;  2WRT A;  1EOG A;  10GS A;  2IMI A;  5ECP B;  3GST A;  3ZML A;  2VCX A;  13GS A;  4IQ1 A;  5D9V A;  1K3Y A;  4G01 A;  5IQY A;  2VCZ A;  4ECI A;  4OFM A;  3CSH A;  4NHZ A;  3FR9 A;  4DEJ A;  1GUH A;  5LD0 A;  1AXD A;  5BMU B;  2YCD A;  3GX0 A;  4FQU A;  6GSV A;  1YEW C;  2VD1 A;  3FR3 A;  1K0A A;  2HSN B;  2WVX A;  1TXU A;  3EIN A;  4ZXG A;  2FHE A;  4PGT A;  2GST A;  5F8B A;  5A1N B;  4HI7 A;  3KJY A;  4KGI A;  1AW9 A;  5A34 A;  4F0C A;  11GS A;  4HZ2 A;  2R3X A;  5KEJ A;  3TOT A;  2WJU A;  4KX4 A;  1TW9 A;  5A5K A;  3G7I A;  2HRK B;  5D9W A;  3RFR C;  1USB A;  4YAV A;  5EL8 A;  4I97 A;  3GUR A;  4HJ2 A;  5ECO B;  1S4B P;  2HRA A;  1K0C A;  5ELA A;  1F3B A;  14GS A;  1NHY A;  4MF7 A;  3IE3 A;  2OA7 A;  3VPQ A;  5GZZ B;  4G0K A;  3NIV A;  5AIV A;  1K0M A;  3IK9 A;  4YAP A;  3WYW A;  1RK4 A;  1MD4 A;  4OFN A;  2WVZ A;  1OE7 A;  3DD3 A;  4PI2 C;  20GS A;  4G0L A;  1GSU A;  1JZR A;  1HNC A;  2VCT A;  1JLV A;  3F6D A;  4IBP A;  5ECM B;  4IVF A;  1VF2 A;  4GST A;  5ECL B;  5ECH B;  3UAP A;  3MAK A;  1GSS A;  3CSI A;  4K0N A;  2FNO A;  4JED A;  4JBB A;  2GDR A;  3M1G A;  4PQH A;  4GSS A;  1M9B A;  3VI5 A;  2CAI A;  3HJO A;  2VCV A;  4O7H A;  4E8H A;  4BVX A;  4EE0 A;  3GSS A;  4GTU A;  4N3Z A;  16GS A;  4KAE A;  3LSZ A;  4ECJ A;  3LYK A;  5EVO A;  1PN9 A;  3VI7 A;  4AKG A;  4E68 A;  5D9X A;  4AGS A;  3RGB C;  3M3M A;  2CZ2 A;  2DSA A;  1BG1 A;  2CZ3 A;  4GLT A;  3IBH A;  2C4J A;  1V2A A;  3BBY A;  5DAK B;  4MPG A;  4ECC A;  3IK7 A;  3N9J A;  4ZBB A;  3R3E A;  5J47 A;  4RI6 A;  4F0B A;  2R5G A;  3GH6 A;  3LG6 A;  2VKZ G;  3TGZ A;  4KF9 A;  1SVL A;  5A4V A;  3PPU A;  3GTU A;  2WW1 A;  1AQV A;  1PL2 A;  4MP4 A;  4F03 A;  4L8E A;  3M8N A;  3UBK A;  1DUG A;  1FW1 A;  5AIX A;  3Q18 A;  4IKH A;  5ELG A;  3LXZ A;  3KMN A;  19GS A;  4QQ7 A;  4BL7 A;  2CAQ A;  4MF5 A;  2DC5 A;  1N2A A;  5ECI B;  5ECR B;  3UAR A;  3ZFB A;  1Y6E A;  3R2Q A;  1PKZ A;  2C80 A;  5J4Y A;  1BAY A;  4MK3 A;  6GSU A;  4WR4 A;  3W8S A;  2EFC A;  4K0G A;  1YJ6 A;  4WR5 A;  2A2R A;  3F6F A;  3LJR A;  4JZQ A;  5J41 A;  5F07 A;  1GSY A;  1GNE A;  4CHS A;  1TU7 A;  2WW2 A;  4G10 A;  5D73 A;  3CWG A;  3TOU A;  3HKR A;  1M99 A;  4ZB9 A;  2C8U A;  3QAG A;  1VF4 A;  2V6K A;  8GSS A;  4USS A;  4FXY P;  4LMW A;  4HZ4 A;  1F3A A;  3PGT A;  3VLN A;  3GUS A;  2EFH A;  1G6Y A;  4YQU A;  4PUA A;  4G9H A;  2WVX B;  5AIS A;  3QR6 A;  4G0I A;  1HQO A;  2UV8 G;  2ON5 A;  2PGT A;  5A34 B;  1YVL A;  2F8F A;  3UVH A;  1XW6 A;  4ZB8 A;  3I6A A;  4W66 A;  3U6V A;  5DDL A;  4Q5Q A;  4ZBD A;  1F2E A;  2GSS A;  4ACS A;  1U87 A;  3L0H A;  4MF6 A;  1B4P A;  1I1I P;  4AI6 A;  4PNF A;  17GS A;  1EV4 A;  1N25 A;  3HMJ G;  2EFD A;  5DAL A;  3VK9 A;  1K0N A;  5A4W A;  12GS A;  5F06 A;  1C72 A;  5ECQ B;  5LCZ A;  4EDY A;  1ZL9 A;  4PQI A;  1K0O A;  3O3T A;  4AKH A;  1PL1 A;  1PA3 A;  5GSS A;  4MZW A;  5FT3 A;  1R5A A;  2O5V A;  1BF5 A;  3HJM A;  1EEM A;  1OYJ A;  1LBK A;  2WB9 A;  4IQA A;  5B7C A;  2F3M A;  1YDK A;  2JL4 A;  4KE3 A;  4OFT A;  5G5E A;  2HSM A;  3PR8 A;  1GTB A;  1YY7 A;  1UA5 A;  3Q74 A;  2ON7 A;  1E6B A;  1PGT A;  4BVY A;  2AAW A;  1YKC A;  3FYG A;  2C3T A;  1GTA A;  3VWX A;  2C3Q A;  1XWG A;  3IR4 A;  2OAC A;  5A5H A;  5DJM A;  1LJR A;  2GSR A;  2GLR A;  1GSQ A;  1G6W A;  4L5O A;  4BVX B;  1HNB A;  4KDU A;  5DQS A;  3MDK A;  4GCI A; 
#chains in the Genus database with same CATH homology
 1M9A A;  2UZ8 A;  4PUR A;  4PTS A;  5F0G A;  4Q5R A;  18GS A;  1KBN A;  4RI7 A;  4IS0 A;  3QAW A;  3ZFL A;  3CBU A;  2GTU A;  1PX6 A;  2IMK A;  6GSW A;  3KXO A;  1XW5 A;  4MPF A;  5BMU A;  1PD2 1;  3UBL A;  5D9T A;  3KMO A;  3QAV A;  2HSN A;  1PKW A;  2X64 A;  5J40 A;  3H1N A;  1BYE A;  1GSE A;  4OMV A;  2D2Z A;  4NAX A;  3RBT A;  2WS2 A;  3ERF A;  1K0B A;  4ZB6 A;  3CRT A;  3WD6 A;  2WDU A;  1VF3 A;  4LMV A;  2EFE A;  3IC8 A;  2YV9 A;  2HQT A;  3ERG A;  3GTU B;  4Q5F A;  4AKX B;  2HRK A;  2OT3 A;  4IGJ A;  2GSQ A;  1ZGN A;  5GST A;  4N0V A;  9GSS A;  3ZMK A;  3KM6 A;  3N5O A;  1K3O A;  5AGY A;  4BL7 B;  5ECK B;  1SVM A;  3KTL A;  6GSS A;  1B8X A;  5J4V A;  2PVQ A;  2C3N A;  2H1L A;  3LXT A;  4KDY A;  1HNA A;  3P90 A;  5ECN B;  2LJR A;  4YH2 A;  3FY7 A;  1U88 A;  4GDF A;  1IYH A;  2VCW A;  1GTI A;  1U3I A;  1MTC A;  1G7O A;  1AQW A;  5G5F A;  1SVO A;  4J2F A;  3TU3 B;  6GSX A;  4ISD A;  2CVD A;  1B48 A;  4ECB A;  2CA8 A;  1GWC A;  5JCW A;  5EY6 A;  6GSY A;  5DJL A;  2OAD A;  5FHI A;  4PXO A;  5JCU A;  2AHE A;  2PMT A;  1GUK A;  4HOJ A;  2PBJ A;  4IEL A;  4AKI A;  1A0F A;  2PER A;  3DGQ A;  2R4V A;  3Q19 A;  4EC0 A;  4PNG A;  1IYI A;  4Q5N A;  4GSN A;  1V40 A;  3LYP A;  5ECS A;  3LQ7 A;  2NTO A;  4E8E A;  4MDC A;  5J4U A;  3O76 A;  3P8W A;  3VPT A;  3AY8 A;  1EV9 A;  1Z9H A;  1GSD A;  3F63 A;  4O92 A;  1Q4J A;  1PMT A;  4EXJ A;  5A4U A;  4IW9 A;  1EOH A;  5DAK A;  4IJI A;  1FHE A;  6GST A;  22GS A;  4KH7 A;  2IL3 A;  3FR6 A;  4EDZ A;  3D0Z A;  2YV7 A;  2N5F A;  5AN1 A;  1GUL A;  3ISO A;  1GNW A;  3I69 A;  4NHW A;  4QMK A;  1GSF A;  5DAL B;  4KDX A;  4GF0 A;  1BG5 A;  7GSS A;  4ZBA A;  4YQV A;  3EE2 A;  1GLQ A;  1VF1 A;  3FRC A;  1K3L A;  3M0F A;  1Y1U A;  1YQ1 A;  2VCQ A;  1ML6 A;  5DCG A;  4G19 A;  1TDI A;  3CSJ A;  1JLW A;  5HFK A;  2AB6 A;  2VD0 A;  3SWL A;  1GUM A;  3LFL A;  2VO4 A;  3G7J A;  5J5N A;  1OE8 A;  2HSM B;  1PX7 A;  4ZB7 A;  5FWG A;  1M0U A;  4YQM A;  2HNL A;  4TOP A;  4PX1 A;  4BVY B;  4KSM A;  4L5L A;  1TU8 A;  3CRU A;  1GLP A;  4ID0 A;  2R6K A;  1K0D A;  3C8E A;  1GTU A;  1XWK A;  2A2S A;  5F05 A;  5A1N A;  1AQX A;  5A5H B;  2J9H A;  1BX9 A;  1OKT A;  1MD3 A;  3VUR A;  2WRT A;  1EOG A;  10GS A;  2IMI A;  5ECP B;  3GST A;  3ZML A;  2VCX A;  13GS A;  4IQ1 A;  5D9V A;  1K3Y A;  4G01 A;  5IQY A;  2VCZ A;  4ECI A;  4OFM A;  3CSH A;  4NHZ A;  3FR9 A;  4DEJ A;  1GUH A;  5LD0 A;  1AXD A;  5BMU B;  2YCD A;  3GX0 A;  4FQU A;  6GSV A;  2VD1 A;  3FR3 A;  1K0A A;  2HSN B;  1TXU A;  3EIN A;  4ZXG A;  2FHE A;  4PGT A;  2GST A;  5F8B A;  5A1N B;  4HI7 A;  3KJY A;  4KGI A;  1AW9 A;  5A34 A;  4F0C A;  11GS A;  4HZ2 A;  2R3X A;  5KEJ A;  3TOT A;  2WJU A;  4KX4 A;  1TW9 A;  5A5K A;  3G7I A;  2HRK B;  5D9W A;  1USB A;  4YAV A;  5EL8 A;  4I97 A;  3GUR A;  4HJ2 A;  5ECO B;  2HRA A;  1K0C A;  5ELA A;  1F3B A;  14GS A;  1NHY A;  4MF7 A;  3IE3 A;  2OA7 A;  3VPQ A;  5GZZ B;  4G0K A;  3NIV A;  5AIV A;  1K0M A;  3IK9 A;  4YAP A;  3WYW A;  1RK4 A;  1MD4 A;  4OFN A;  1OE7 A;  3DD3 A;  20GS A;  4G0L A;  1GSU A;  1JZR A;  1HNC A;  2VCT A;  1JLV A;  3F6D A;  4IBP A;  5ECM B;  4IVF A;  1VF2 A;  4GST A;  5ECL B;  5ECH B;  3UAP A;  3MAK A;  1GSS A;  3CSI A;  4K0N A;  2FNO A;  4JED A;  4JBB A;  2GDR A;  3M1G A;  4PQH A;  4GSS A;  1M9B A;  3VI5 A;  2CAI A;  3HJO A;  2VCV A;  4O7H A;  4E8H A;  4BVX A;  4EE0 A;  3GSS A;  4GTU A;  4N3Z A;  16GS A;  4KAE A;  3LSZ A;  4ECJ A;  3LYK A;  5EVO A;  1PN9 A;  3VI7 A;  4AKG A;  4E68 A;  5D9X A;  4AGS A;  3M3M A;  2CZ2 A;  2DSA A;  1BG1 A;  2CZ3 A;  4GLT A;  3IBH A;  2C4J A;  1V2A A;  3BBY A;  5DAK B;  4MPG A;  4ECC A;  3IK7 A;  3N9J A;  4ZBB A;  3R3E A;  5J47 A;  4RI6 A;  4F0B A;  2R5G A;  3GH6 A;  3LG6 A;  2VKZ G;  3TGZ A;  4KF9 A;  1SVL A;  5A4V A;  3PPU A;  3GTU A;  1AQV A;  1PL2 A;  4MP4 A;  4F03 A;  4L8E A;  3M8N A;  3UBK A;  1DUG A;  1FW1 A;  5AIX A;  3Q18 A;  4IKH A;  5ELG A;  3LXZ A;  3KMN A;  19GS A;  4QQ7 A;  4BL7 A;  2CAQ A;  4MF5 A;  2DC5 A;  1N2A A;  5ECI B;  5ECR B;  3UAR A;  3ZFB A;  1Y6E A;  3R2Q A;  1PKZ A;  2C80 A;  5J4Y A;  1BAY A;  4MK3 A;  6GSU A;  4WR4 A;  3W8S A;  2EFC A;  4K0G A;  1YJ6 A;  4WR5 A;  2A2R A;  3F6F A;  3LJR A;  4JZQ A;  5J41 A;  5F07 A;  1GSY A;  1GNE A;  4CHS A;  1TU7 A;  4G10 A;  5D73 A;  3CWG A;  3TOU A;  3HKR A;  1M99 A;  4ZB9 A;  2C8U A;  3QAG A;  1VF4 A;  2V6K A;  8GSS A;  4USS A;  4LMW A;  4HZ4 A;  1F3A A;  3PGT A;  3VLN A;  3GUS A;  2EFH A;  1G6Y A;  4YQU A;  4PUA A;  4G9H A;  5AIS A;  3QR6 A;  4G0I A;  1HQO A;  2UV8 G;  2ON5 A;  2PGT A;  5A34 B;  1YVL A;  2F8F A;  3UVH A;  1XW6 A;  4ZB8 A;  3I6A A;  4W66 A;  3U6V A;  5DDL A;  4Q5Q A;  4ZBD A;  1F2E A;  2GSS A;  4ACS A;  1U87 A;  3L0H A;  4MF6 A;  1B4P A;  4AI6 A;  4PNF A;  17GS A;  1EV4 A;  1N25 A;  3HMJ G;  2EFD A;  5DAL A;  3VK9 A;  1K0N A;  5A4W A;  12GS A;  5F06 A;  1C72 A;  5ECQ B;  5LCZ A;  4EDY A;  1ZL9 A;  4PQI A;  1K0O A;  3O3T A;  4AKH A;  1PL1 A;  1PA3 A;  5GSS A;  4MZW A;  5FT3 A;  1R5A A;  2O5V A;  1BF5 A;  3HJM A;  1EEM A;  1OYJ A;  1LBK A;  2WB9 A;  4IQA A;  5B7C A;  2F3M A;  1YDK A;  2JL4 A;  4KE3 A;  4OFT A;  5G5E A;  2HSM A;  3PR8 A;  1GTB A;  1YY7 A;  1UA5 A;  3Q74 A;  2ON7 A;  1E6B A;  1PGT A;  4BVY A;  2AAW A;  1YKC A;  3FYG A;  2C3T A;  1GTA A;  3VWX A;  2C3Q A;  1XWG A;  3IR4 A;  2OAC A;  5A5H A;  5DJM A;  1LJR A;  2GSR A;  2GLR A;  1GSQ A;  1G6W A;  4L5O A;  4BVX B;  1HNB A;  4KDU A;  5DQS A;  3MDK A;  4GCI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...