2HQTA

Crystal structures of the interacting domains from yeast glutamyl-trna synthetase and trna aminoacylation and nuclear export cofactor arc1p reveal a novel function for an old fold
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
118
structure length
115
Chain Sequence
b'SDLVTKFESLIYPVSFTKEQSAQAAQWESVLKSGQIQPHLDQLNLVLRDNTFIVSTLYPTSTDVHVFEVALPLIKDLVASSKDVKSTYTTYRHILRWIDYMQNLLEVSSTDKLEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GU4 nucleic-binding protein 1
publication title Structures of the interacting domains from yeast glutamyl-tRNA synthetase and tRNA-aminoacylation and nuclear-export cofactor Arc1p reveal a novel function for an old fold.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Biosynthetic protein, rna binding
total genus 37
structure length 115
sequence length 118
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T
ec nomenclature
pdb deposition date 2006-07-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2hqtA00
4PNFA 3UAPA 2N5FA 3G7JA 4J2FA 2HSMB 3W8SA 5ECMB 4GTUA 4L8EA 2IL3A 4BL7B 1K3LA 4G0LA 1GWCA 4G10A 1OE8A 4K0GA 3WD6A 4MPFA 6GSSA 3N5OA 1C72A 4F0BA 1ZGNA 5A4WA 1JZRA 2HSMA 4OFTA 1DUGA 1EEMA 4PGTA 3PPUA 4ZBBA 5BMUA 4JBBA 2JL4A 2YCDA 1U88A 3IK9A 3D0ZA 3GH6A 1EOHA 1PL1A 2D2ZA 2WDUA 3IE3A 1ML6A 4NHWA 2J9HA 2C3TA 2CAQA 3SWLA 1VF2A 3LQ7A 5EL8A 5DAKB 1YY7A 4KX4A 1LBKA 1RK4A 2C3NA 3HKRA 3LYPA 4EC0A 4E8HA 3GSTA 2F3MA 1BG5A 4RI6A 16GSA 4WR4A 5DAKA 3IC8A 1TDIA 2WS2A 3DGQA 5F05A 1XWGA 5G5FA 1G7OA 2R6KA 1GTAA 4K0NA 5DJMA 4ZBDA 5J5NA 2ON5A 4Q5QA 1VF1A 4BVXA 1GUKA 1M9BA 4RI7A 4IQ1A 4TOPA 19GSA 4ECBA 3LFLA 5AGYA 5F07A 1USBA 2F8FA 4MF6A 3GTUB 3KTLA 2YV7A 4YQUA 4ECJA 2OACA 2VCXA 2CAIA 3VURA 2VD0A 2AHEA 5AIXA 14GSA 18GSA 11GSA 1FHEA 2PVQA 1XW5A 1AQXA 3U6VA 3VPQA 5GSSA 3GTUA 2HSNB 1UA5A 4G19A 1XW6A 5LCZA 3PR8A 3GSSA 1PMTA 3L0HA 2C4JA 3LYKA 4Q5FA 1GNEA 1JLVA 2VCVA 4PTSA 1M99A 5DDLA 3LJRA 3UBLA 1GSDA 1PN9A 2HRKB 2GSSA 5DJLA 7GSSA 3Q19A 3FR9A 1GULA 5ECOB 3HJMA 5ECIB 3AY8A 20GSA 1JLWA 1MTCA 4GSNA 4KSMA 2OADA 5ECLB 2HRKA 2DSAA 1EOGA 4YQVA 13GSA 3QAVA 1OYJA 12GSA 3F63A 1R5AA 5D9WA 1PA3A 1Q4JA 3M1GA 1YJ6A 3GUSA 1AQWA 4KDYA 1PD21 1BAYA 2WB9A 3O3TA 1M9AA 4GLTA 4MZWA 1OE7A 3FRCA 5AIVA 1G6WA 4KAEA 1VF3A 4EDYA 1GUMA 3RBTA 1GLQA 1PX7A 2YV9A 4G0KA 5D9XA 1AW9A 2VCWA 5JCUA 2PGTA 1HNAA 5ECKB 3CBUA 3TOTA 1EV4A 1GSUA 5ECSA 5HFKA 4PURA 4BVYB 3IK7A 4ZB9A 4MPGA 1GSFA 4YAVA 5F8BA 2VO4A 1A0FA 4LMVA 2GTUA 4L5LA 5J4UA 2V6KA 4IGJA 1N2AA 2DC5A 3HJOA 4BVXB 6GSTA 3UARA 3MDKA 4BVYA 3NIVA 3KMOA 5ELAA 3ISOA 4F03A 1V2AA 8GSSA 5J41A 3FR6A 1GSSA 5EVOA 4NAXA 1LJRA 3MAKA 3F6FA 4LMWA 1TW9A 4MF5A 3I6AA 4ISDA 1B4PA 3KJYA 1YQ1A 2PERA 22GSA 4IKHA 4MDCA 3H1NA 4GF0A 3I69A 1K0AA 3EINA 3G7IA 4ZBAA 3TGZA 4AGSA 1TU7A 1FW1A 4QQ7A 5DQSA 2VCQA 2GSQA 3QAWA 5A4VA 2IMIA 5F0GA 2HRAA 4YH2A 1K0MA 3N9JA 2PBJA 4HZ2A 4GSTA 3QAGA 4F0CA 1B8XA 1GUHA 17GSA 2LJRA 3BBYA 2A2RA 3GURA 4IBPA 4IW9A 4E8EA 1K0OA 3ZMKA 4EDZA 2CZ2A 3ERGA 2HNLA 4NHZA 1IYIA 2C3QA 3IBHA 2R4VA 1KBNA 3PGTA 1K0BA 5LD0A 3ERFA 4WR5A 1YDKA 4OFNA 3VPTA 9GSSA 3VK9A 3Q74A 4PNGA 1G6YA 4KGIA 4IJIA 4EE0A 2VD1A 5AN1A 3TOUA 4PUAA 2PMTA 4PQHA 6GSYA 5FWGA 2WRTA 3ZMLA 5AISA 4MF7A 3CRTA 1HNCA 3P90A 3LXZA 1PKZA 2UZ8A 1HNBA 1YKCA 3ZFBA 3KMNA 1XWKA 1PX6A 2AAWA 3C8EA 5DALA 4O7HA 2FNOA 3R2QA 4ACSA 1EV9A 4IVFA 2R5GA 3LXTA 4ECIA 2GDRA 3P8WA 2VCTA 1BX9A 1E6BA 3UVHA 5KEJA 1MD4A 1NHYA 5EY6A 1AQVA 3M0FA 3KM6A 1GTBA 4GSSA 5D9VA 2HQTA 1HQOA 1OKTA 1Z9HA 5ECHB 1GTIA 4PX1A 3EE2A 4ZXGA 3IR4A 3KXOA 4YAPA 4N0VA 2CZ3A 4ID0A 3WYWA 3O76A 1M0UA 4ZB6A 4BL7A 4DEJA 4O92A 1V40A 2WJUA 4I97A 4FQUA 4KH7A 3CRUA 4YQMA 2R3XA 2VCZA 4HJ2A 1F2EA 4CHSA 2AB6A 4HZ4A 1TU8A 3FR3A 1GNWA 1GSEA 4Q5NA 2OA7A 5FHIA 1F3BA 4L5OA 3VLNA 3CSJA 1U3IA 4PXOA 3FYGA 5ECPB 2C80A 3Q18A 2CA8A 3LSZA 5GSTA 5A4UA 4HOJA 5A5KA 1K3OA 5F06A 4G0IA 4G9HA 1GTUA 4KF9A 4IQAA 4USSA 4OMVA 1K0DA 3VI5A 2GSRA 5JCWA 2CVDA 2GSTA 3M8NA 3CSIA 1F3AA 4PQIA 5GZZB 4MP4A 3F6DA 1GLPA 4JZQA 3ZFLA 4IELA 4ECCA 2IMKA 2NTOA 1Y6EA 5ELGA 5IQYA 4OFMA 1PGTA 4JEDA 1K0NA 2A2SA 3FY7A 1U87A 6GSXA 1GSQA 2FHEA 1ZL9A 5B7CA 1K0CA 1PL2A 3VI7A 4Q5RA 1VF4A 3LG6A 1B48A 3R3EA 3CSHA 3GX0A 4EXJA 5D9TA 10GSA 1IYHA 4ZB8A 6GSWA 4HI7A 1K3YA 5DALB 5ECQB 2C8UA 5ECRB 2GLRA 1BYEA 5ECNB 2ON7A 1GSYA 6GSUA 5D73A 4KDUA 1AXDA 4KE3A 3UBKA 2X64A 4IS0A 4MK3A 3VWXA 1PKWA 1MD3A 3QR6A 5FT3A 3M3MA 4GCIA 3DD3A 5DCGA 6GSVA 4KDXA 5G5EA
chains in the Genus database with same CATH superfamily
4PNFA 3UAPA 3RFRC 2N5FA 3G7JA 4J2FA 3TU3B 2HSMB 3W8SA 5ECMB 4GTUA 4L8EA 2IL3A 4BL7B 1K3LA 4G0LA 1GWCA 4G10A 1OE8A 4K0GA 3WD6A 4MPFA 6GSSA 3N5OA 5J4VA 4AKHA 1C72A 4F0BA 1ZGNA 5A4WA 1JZRA 2HSMA 4OFTA 1DUGA 1EEMA 4PGTA 3PPUA 4GDFA 2WVYA 4ZBBA 5BMUA 4JBBA 2JL4A 2YCDA 1U88A 3IK9A 3D0ZA 3GH6A 1EOHA 1PL1A 3IE3A 2D2ZA 2WDUA 1ML6A 2WW0A 2J9HA 4NHWA 2C3TA 2CAQA 3SWLA 1VF2A 3LQ7A 5EL8A 5DAKB 1YY7A 4KX4A 1LBKA 1RK4A 2C3NA 3HKRA 3LYPA 4EC0A 4E8HA 3GSTA 2F3MA 1BG5A 1YEWC 4RI6A 16GSA 4WR4A 5DAKA 4PI0C 3IC8A 1TDIA 2WS2A 3DGQA 5F05A 1XWGA 5G5FA 1G7OA 2R6KA 1GTAA 4K0NA 5DJMA 4ZBDA 5J5NA 5J40A 2ON5A 4Q5QA 1VF1A 4BVXA 1GUKA 1M9BA 4RI7A 4IQ1A 4TOPA 19GSA 4ECBA 3LFLA 5AGYA 5F07A 1Y1UA 1USBA 1SVLA 2F8FA 4MF6A 3GTUB 3KTLA 2YV7A 4YQUA 4ECJA 2OACA 2VCXA 2CAIA 3VURA 2VD0A 2AHEA 5AIXA 14GSA 18GSA 11GSA 1FHEA 2PVQA 1XW5A 1AQXA 3U6VA 3VPQA 5GSSA 3GTUA 2HSNB 1UA5A 4G19A 1XW6A 5LCZA 3PR8A 3GSSA 1PMTA 3L0HA 2C4JA 3LYKA 4Q5FA 1GNEA 1JLVA 2VCVA 4PTSA 1M99A 5DDLA 3LJRA 3UBLA 1GSDA 1PN9A 2HRKB 2GSSA 5DJLA 7GSSA 3Q19A 3FR9A 1YVLA 1GULA 5ECOB 5J47A 3HJMA 5ECIB 3AY8A 20GSA 1JLWA 1MTCA 4GSNA 4KSMA 2OADA 5ECLB 2HRKA 2DSAA 1EOGA 4YQVA 13GSA 3QAVA 1OYJA 12GSA 3F63A 2EFHA 1R5AA 4W66A 5D9WA 1PA3A 1Q4JA 3M1GA 5BMUB 1YJ6A 3GUSA 1AQWA 4KDYA 1PD21 1BAYA 2WB9A 3O3TA 1M9AA 4GLTA 4MZWA 1OE7A 3FRCA 5AIVA 1G6WA 4KAEA 1VF3A 2UV8G 1GUMA 4EDYA 2EFDA 3RBTA 4PHZC 1GLQA 1PX7A 2YV9A 4G0KA 5D9XA 1AW9A 2VCWA 5JCUA 2PGTA 1HNAA 5ECKB 3CBUA 3TOTA 1EV4A 1GSUA 2EFEA 5ECSA 5HFKA 4PURA 4BVYB 3IK7A 4ZB9A 4MPGA 1GSFA 4YAVA 5F8BA 2VO4A 1A0FA 4LMVA 2GTUA 4L5LA 5J4UA 2V6KA 4IGJA 1N2AA 2DC5A 3HJOA 4BVXB 6GSTA 3UARA 3MDKA 4BVYA 3NIVA 3KMOA 5ELAA 4AKGA 3ISOA 4F03A 1V2AA 8GSSA 5J41A 3FR6A 1GSSA 5EVOA 4NAXA 1LJRA 3F6FA 3MAKA 4LMWA 1TW9A 4MF5A 3I6AA 5A34B 4ISDA 1B4PA 3KJYA 1YQ1A 1SVMA 2PERA 22GSA 4IKHA 4MDCA 3H1NA 2WVXB 4GF0A 3I69A 1K0AA 3EINA 3G7IA 4ZBAA 3TGZA 4AGSA 4N3ZA 1TU7A 1FW1A 4QQ7A 5DQSA 5A34A 1SVOA 2VCQA 2GSQA 3QAWA 5A4VA 2IMIA 3CHXC 5F0GA 2HRAA 4YH2A 2WVXA 4E68A 1K0MA 3N9JA 2PBJA 2VKZG 4GSTA 3QAGA 4HZ2A 4F0CA 1B8XA 1GUHA 17GSA 2LJRA 3BBYA 2A2RA 1TXUA 3GURA 4IBPA 4IW9A 4E8EA 1K0OA 3ZMKA 4EDZA 2WZSA 2CZ2A 3ERGA 2HNLA 4NHZA 1IYIA 2C3QA 3IBHA 1BF5A 2R4VA 1KBNA 3PGTA 1K0BA 5LD0A 3ERFA 4WR5A 2WW2A 1YDKA 4OFNA 3VPTA 9GSSA 3VK9A 4G01A 2O3EA 3Q74A 4PNGA 1G6YA 4KGIA 4IJIA 4EE0A 2VD1A 5AN1A 3TOUA 4PUAA 5A5HB 2PMTA 4PQHA 6GSYA 5FWGA 2WRTA 3ZMLA 5AISA 4MF7A 3CRTA 1HNCA 3P90A 3LXZA 1PKZA 2UZ8A 1HNBA 1YKCA 3ZFBA 3KMNA 1XWKA 1PX6A 2AAWA 3C8EA 5DALA 4O7HA 2FNOA 3R2QA 5J4YA 5A5HA 4ACSA 1N25A 1EV9A 4IVFA 2R5GA 3LXTA 4ECIA 4QMKA 2GDRA 3P8WA 2VCTA 1BX9A 4PI2C 1E6BA 3UVHA 5KEJA 1MD4A 1NHYA 5EY6A 1AQVA 3M0FA 3KM6A 1GTBA 4GSSA 5D9VA 2HQTA 1HQOA 1OKTA 1Z9HA 5ECHB 1GTIA 4PX1A 3EE2A 4ZXGA 3IR4A 3KXOA 2WVZA 4YAPA 4N0VA 2CZ3A 4ID0A 3WYWA 3O76A 1M0UA 4ZB6A 4BL7A 4DEJA 4O92A 1V40A 2WJUA 4I97A 4FQUA 2OT3A 4KH7A 3CRUA 4YQMA 2R3XA 2VCZA 4HJ2A 1F2EA 4CHSA 2AB6A 4HZ4A 1TU8A 3FR3A 4FXYP 1GNWA 1GSEA 4Q5NA 2OA7A 5FHIA 1F3BA 4L5OA 3VLNA 3CSJA 1U3IA 4PXOA 3FYGA 5ECPB 2C80A 3CWGA 3Q18A 2CA8A 3LSZA 5GSTA 5A1NB 5A4UA 4HOJA 1I1IP 5A5KA 1K3OA 5F06A 2WW1A 4G0IA 4G9HA 1GTUA 4KF9A 4IQAA 2EFCA 4USSA 4OMVA 1K0DA 3VI5A 2GSRA 5JCWA 1S4BP 4ZB7A 2CVDA 2O36A 2GSTA 3M8NA 3CSIA 1F3AA 4AKXB 3RGBC 4PQIA 5A1NA 5GZZB 4MP4A 3F6DA 1GLPA 4JZQA 3ZFLA 4IELA 4ECCA 2IMKA 2NTOA 1Y6EA 5ELGA 5IQYA 4OFMA 1PGTA 4JEDA 1K0NA 2A2SA 3FY7A 1U87A 6GSXA 1GSQA 2FHEA 1ZL9A 5B7CA 1K0CA 1PL2A 3VI7A 4Q5RA 1VF4A 3LG6A 1B48A 3R3EA 3CSHA 3GX0A 4EXJA 5D9TA 10GSA 1IYHA 4ZB8A 6GSWA 4HI7A 1K3YA 5DALB 5ECQB 4AKIA 2C8UA 5ECRB 4AI6A 2H1LA 2GLRA 1BYEA 5ECNB 2ON7A 2HSNA 2O5VA 1GSYA 6GSUA 5D73A 3HMJG 4KDUA 1AXDA 4KE3A 3UBKA 2X64A 4IS0A 4MK3A 3VWXA 1PKWA 1MD3A 3QR6A 5FT3A 2WW3A 1BG1A 3M3MA 4GCIA 3DD3A 5DCGA 6GSVA 4KDXA 5G5EA
chains in the Genus database with same CATH topology
4PNFA 3UAPA 2N5FA 3G7JA 4J2FA 3TU3B 2HSMB 3W8SA 5ECMB 4GTUA 4L8EA 2IL3A 4BL7B 1K3LA 4G0LA 1GWCA 4G10A 1OE8A 4K0GA 3WD6A 4MPFA 6GSSA 3N5OA 5J4VA 4AKHA 1C72A 4F0BA 1ZGNA 5A4WA 1JZRA 2HSMA 4OFTA 1DUGA 1EEMA 4PGTA 3PPUA 4GDFA 4ZBBA 5BMUA 4JBBA 2JL4A 2YCDA 1U88A 3IK9A 3D0ZA 3GH6A 1EOHA 1PL1A 2D2ZA 2WDUA 3IE3A 1ML6A 4NHWA 2J9HA 2C3TA 2CAQA 3SWLA 1VF2A 3LQ7A 5EL8A 5DAKB 1YY7A 4KX4A 1LBKA 1RK4A 2C3NA 3HKRA 3LYPA 4EC0A 4E8HA 3GSTA 2F3MA 1BG5A 4RI6A 16GSA 4WR4A 5DAKA 3IC8A 1TDIA 2WS2A 3DGQA 5F05A 1XWGA 5G5FA 1G7OA 2R6KA 1GTAA 4K0NA 5DJMA 4ZBDA 5J5NA 5J40A 2ON5A 4Q5QA 1VF1A 4BVXA 1GUKA 1M9BA 4RI7A 4IQ1A 4TOPA 19GSA 4ECBA 3LFLA 5AGYA 5F07A 1Y1UA 1USBA 1SVLA 2F8FA 4MF6A 3GTUB 3KTLA 2YV7A 4YQUA 4ECJA 2OACA 2VCXA 2CAIA 3VURA 2VD0A 2AHEA 5AIXA 14GSA 18GSA 11GSA 1FHEA 2PVQA 1XW5A 1AQXA 3U6VA 3VPQA 5GSSA 3GTUA 2HSNB 1UA5A 4G19A 1XW6A 5LCZA 3PR8A 3GSSA 1PMTA 3L0HA 2C4JA 3LYKA 4Q5FA 1GNEA 1JLVA 2VCVA 4PTSA 1M99A 5DDLA 3LJRA 3UBLA 1GSDA 1PN9A 2HRKB 2GSSA 5DJLA 7GSSA 3Q19A 3FR9A 1YVLA 1GULA 5ECOB 5J47A 3HJMA 5ECIB 3AY8A 20GSA 1JLWA 1MTCA 4GSNA 4KSMA 2OADA 5ECLB 2HRKA 2DSAA 1EOGA 4YQVA 13GSA 3QAVA 1OYJA 12GSA 3F63A 2EFHA 1R5AA 4W66A 5D9WA 1PA3A 1Q4JA 3M1GA 5BMUB 1YJ6A 3GUSA 1AQWA 4KDYA 1PD21 1BAYA 2WB9A 3O3TA 1M9AA 4GLTA 4MZWA 1OE7A 3FRCA 5AIVA 1G6WA 4KAEA 1VF3A 2UV8G 1GUMA 4EDYA 2EFDA 3RBTA 1GLQA 1PX7A 2YV9A 4G0KA 5D9XA 1AW9A 2VCWA 5JCUA 2PGTA 1HNAA 5ECKB 3CBUA 3TOTA 1EV4A 1GSUA 2EFEA 5ECSA 5HFKA 4PURA 4BVYB 3IK7A 4ZB9A 4MPGA 1GSFA 4YAVA 5F8BA 2VO4A 1A0FA 4LMVA 2GTUA 4L5LA 5J4UA 2V6KA 4IGJA 1N2AA 2DC5A 3HJOA 4BVXB 6GSTA 3UARA 3MDKA 4BVYA 3NIVA 3KMOA 5ELAA 4AKGA 3ISOA 4F03A 1V2AA 8GSSA 5J41A 3FR6A 1GSSA 5EVOA 4NAXA 1LJRA 3MAKA 3F6FA 4LMWA 1TW9A 4MF5A 3I6AA 5A34B 4ISDA 1B4PA 3KJYA 1YQ1A 1SVMA 2PERA 22GSA 4IKHA 4MDCA 3H1NA 4GF0A 3I69A 1K0AA 3EINA 3G7IA 4ZBAA 3TGZA 4AGSA 4N3ZA 1TU7A 1FW1A 4QQ7A 5DQSA 5A34A 1SVOA 2VCQA 2GSQA 3QAWA 5A4VA 2IMIA 5F0GA 2HRAA 4YH2A 4E68A 1K0MA 3N9JA 2PBJA 2VKZG 4GSTA 3QAGA 4HZ2A 4F0CA 1B8XA 1GUHA 17GSA 2LJRA 3BBYA 2A2RA 1TXUA 3GURA 4IBPA 4IW9A 4E8EA 1K0OA 3ZMKA 4EDZA 2CZ2A 3ERGA 2HNLA 4NHZA 1IYIA 2C3QA 3IBHA 1BF5A 2R4VA 1KBNA 3PGTA 1K0BA 5LD0A 3ERFA 4WR5A 1YDKA 4OFNA 3VPTA 9GSSA 3VK9A 4G01A 3Q74A 4PNGA 1G6YA 4KGIA 4IJIA 4EE0A 2VD1A 5AN1A 3TOUA 4PUAA 5A5HB 2PMTA 4PQHA 6GSYA 5FWGA 2WRTA 3ZMLA 5AISA 4MF7A 3CRTA 1HNCA 3P90A 3LXZA 1PKZA 2UZ8A 1HNBA 1YKCA 3ZFBA 3KMNA 1XWKA 1PX6A 2AAWA 3C8EA 5DALA 4O7HA 2FNOA 3R2QA 5J4YA 5A5HA 4ACSA 1N25A 1EV9A 4IVFA 2R5GA 3LXTA 4ECIA 4QMKA 2GDRA 3P8WA 2VCTA 1BX9A 1E6BA 3UVHA 5KEJA 1MD4A 1NHYA 5EY6A 1AQVA 3M0FA 3KM6A 1GTBA 4GSSA 5D9VA 2HQTA 1HQOA 1OKTA 1Z9HA 5ECHB 1GTIA 4PX1A 3EE2A 4ZXGA 3IR4A 3KXOA 4YAPA 4N0VA 2CZ3A 4ID0A 3WYWA 3O76A 1M0UA 4ZB6A 4BL7A 4DEJA 4O92A 1V40A 2WJUA 4I97A 4FQUA 2OT3A 4KH7A 3CRUA 4YQMA 2R3XA 2VCZA 4HJ2A 1F2EA 4CHSA 2AB6A 4HZ4A 1TU8A 3FR3A 1GNWA 1GSEA 4Q5NA 2OA7A 5FHIA 1F3BA 4L5OA 3VLNA 3CSJA 1U3IA 4PXOA 3FYGA 5ECPB 2C80A 3CWGA 3Q18A 2CA8A 3LSZA 5GSTA 5A1NB 5A4UA 4HOJA 5A5KA 1K3OA 5F06A 4G0IA 4G9HA 1GTUA 4KF9A 4IQAA 2EFCA 4USSA 4OMVA 1K0DA 3VI5A 2GSRA 5JCWA 4ZB7A 2CVDA 2GSTA 3M8NA 3CSIA 1F3AA 4AKXB 4PQIA 5A1NA 5GZZB 4MP4A 3F6DA 1GLPA 4JZQA 3ZFLA 4IELA 4ECCA 2IMKA 2NTOA 1Y6EA 5ELGA 5IQYA 4OFMA 1PGTA 4JEDA 1K0NA 2A2SA 3FY7A 1U87A 6GSXA 1GSQA 2FHEA 1ZL9A 5B7CA 1K0CA 1PL2A 3VI7A 4Q5RA 1VF4A 3LG6A 1B48A 3R3EA 3CSHA 3GX0A 4EXJA 5D9TA 10GSA 1IYHA 4ZB8A 6GSWA 4HI7A 1K3YA 5DALB 5ECQB 4AKIA 2C8UA 5ECRB 4AI6A 2H1LA 2GLRA 1BYEA 5ECNB 2ON7A 2HSNA 2O5VA 1GSYA 6GSUA 5D73A 3HMJG 4KDUA 1AXDA 4KE3A 3UBKA 2X64A 4IS0A 4MK3A 3VWXA 1PKWA 1MD3A 3QR6A 5FT3A 1BG1A 3M3MA 4GCIA 3DD3A 5DCGA 6GSVA 4KDXA 5G5EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PNF A;  3UAP A;  2N5F A;  3G7J A;  4J2F A;  2HSM B;  3W8S A;  5ECM B;  4GTU A;  4L8E A;  2IL3 A;  4BL7 B;  1K3L A;  4G0L A;  1GWC A;  4G10 A;  1OE8 A;  4K0G A;  3WD6 A;  4MPF A;  6GSS A;  3N5O A;  1C72 A;  4F0B A;  1ZGN A;  5A4W A;  1JZR A;  2HSM A;  4OFT A;  1DUG A;  1EEM A;  4PGT A;  3PPU A;  4ZBB A;  5BMU A;  4JBB A;  2JL4 A;  2YCD A;  1U88 A;  3IK9 A;  3D0Z A;  3GH6 A;  1EOH A;  1PL1 A;  2D2Z A;  2WDU A;  3IE3 A;  1ML6 A;  4NHW A;  2J9H A;  2C3T A;  2CAQ A;  3SWL A;  1VF2 A;  3LQ7 A;  5EL8 A;  5DAK B;  1YY7 A;  4KX4 A;  1LBK A;  1RK4 A;  2C3N A;  3HKR A;  3LYP A;  4EC0 A;  4E8H A;  3GST A;  2F3M A;  1BG5 A;  4RI6 A;  16GS A;  4WR4 A;  5DAK A;  3IC8 A;  1TDI A;  2WS2 A;  3DGQ A;  5F05 A;  1XWG A;  5G5F A;  1G7O A;  2R6K A;  1GTA A;  4K0N A;  5DJM A;  4ZBD A;  5J5N A;  2ON5 A;  4Q5Q A;  1VF1 A;  4BVX A;  1GUK A;  1M9B A;  4RI7 A;  4IQ1 A;  4TOP A;  19GS A;  4ECB A;  3LFL A;  5AGY A;  5F07 A;  1USB A;  2F8F A;  4MF6 A;  3GTU B;  3KTL A;  2YV7 A;  4YQU A;  4ECJ A;  2OAC A;  2VCX A;  2CAI A;  3VUR A;  2VD0 A;  2AHE A;  5AIX A;  14GS A;  18GS A;  11GS A;  1FHE A;  2PVQ A;  1XW5 A;  1AQX A;  3U6V A;  3VPQ A;  5GSS A;  3GTU A;  2HSN B;  1UA5 A;  4G19 A;  1XW6 A;  5LCZ A;  3PR8 A;  3GSS A;  1PMT A;  3L0H A;  2C4J A;  3LYK A;  4Q5F A;  1GNE A;  1JLV A;  2VCV A;  4PTS A;  1M99 A;  5DDL A;  3LJR A;  3UBL A;  1GSD A;  1PN9 A;  2HRK B;  2GSS A;  5DJL A;  7GSS A;  3Q19 A;  3FR9 A;  1GUL A;  5ECO B;  3HJM A;  5ECI B;  3AY8 A;  20GS A;  1JLW A;  1MTC A;  4GSN A;  4KSM A;  2OAD A;  5ECL B;  2HRK A;  2DSA A;  1EOG A;  4YQV A;  13GS A;  3QAV A;  1OYJ A;  12GS A;  3F63 A;  1R5A A;  5D9W A;  1PA3 A;  1Q4J A;  3M1G A;  1YJ6 A;  3GUS A;  1AQW A;  4KDY A;  1PD2 1;  1BAY A;  2WB9 A;  3O3T A;  1M9A A;  4GLT A;  4MZW A;  1OE7 A;  3FRC A;  5AIV A;  1G6W A;  4KAE A;  1VF3 A;  4EDY A;  1GUM A;  3RBT A;  1GLQ A;  1PX7 A;  2YV9 A;  4G0K A;  5D9X A;  1AW9 A;  2VCW A;  5JCU A;  2PGT A;  1HNA A;  5ECK B;  3CBU A;  3TOT A;  1EV4 A;  1GSU A;  5ECS A;  5HFK A;  4PUR A;  4BVY B;  3IK7 A;  4ZB9 A;  4MPG A;  1GSF A;  4YAV A;  5F8B A;  2VO4 A;  1A0F A;  4LMV A;  2GTU A;  4L5L A;  5J4U A;  2V6K A;  4IGJ A;  1N2A A;  2DC5 A;  3HJO A;  4BVX B;  6GST A;  3UAR A;  3MDK A;  4BVY A;  3NIV A;  3KMO A;  5ELA A;  3ISO A;  4F03 A;  1V2A A;  8GSS A;  5J41 A;  3FR6 A;  1GSS A;  5EVO A;  4NAX A;  1LJR A;  3MAK A;  3F6F A;  4LMW A;  1TW9 A;  4MF5 A;  3I6A A;  4ISD A;  1B4P A;  3KJY A;  1YQ1 A;  2PER A;  22GS A;  4IKH A;  4MDC A;  3H1N A;  4GF0 A;  3I69 A;  1K0A A;  3EIN A;  3G7I A;  4ZBA A;  3TGZ A;  4AGS A;  1TU7 A;  1FW1 A;  4QQ7 A;  5DQS A;  2VCQ A;  2GSQ A;  3QAW A;  5A4V A;  2IMI A;  5F0G A;  2HRA A;  4YH2 A;  1K0M A;  3N9J A;  2PBJ A;  4HZ2 A;  4GST A;  3QAG A;  4F0C A;  1B8X A;  1GUH A;  17GS A;  2LJR A;  3BBY A;  2A2R A;  3GUR A;  4IBP A;  4IW9 A;  4E8E A;  1K0O A;  3ZMK A;  4EDZ A;  2CZ2 A;  3ERG A;  2HNL A;  4NHZ A;  1IYI A;  2C3Q A;  3IBH A;  2R4V A;  1KBN A;  3PGT A;  1K0B A;  5LD0 A;  3ERF A;  4WR5 A;  1YDK A;  4OFN A;  3VPT A;  9GSS A;  3VK9 A;  3Q74 A;  4PNG A;  1G6Y A;  4KGI A;  4IJI A;  4EE0 A;  2VD1 A;  5AN1 A;  3TOU A;  4PUA A;  2PMT A;  4PQH A;  6GSY A;  5FWG A;  2WRT A;  3ZML A;  5AIS A;  4MF7 A;  3CRT A;  1HNC A;  3P90 A;  3LXZ A;  1PKZ A;  2UZ8 A;  1HNB A;  1YKC A;  3ZFB A;  3KMN A;  1XWK A;  1PX6 A;  2AAW A;  3C8E A;  5DAL A;  4O7H A;  2FNO A;  3R2Q A;  4ACS A;  1EV9 A;  4IVF A;  2R5G A;  3LXT A;  4ECI A;  2GDR A;  3P8W A;  2VCT A;  1BX9 A;  1E6B A;  3UVH A;  5KEJ A;  1MD4 A;  1NHY A;  5EY6 A;  1AQV A;  3M0F A;  3KM6 A;  1GTB A;  4GSS A;  5D9V A;  2HQT A;  1HQO A;  1OKT A;  1Z9H A;  5ECH B;  1GTI A;  4PX1 A;  3EE2 A;  4ZXG A;  3IR4 A;  3KXO A;  4YAP A;  4N0V A;  2CZ3 A;  4ID0 A;  3WYW A;  3O76 A;  1M0U A;  4ZB6 A;  4BL7 A;  4DEJ A;  4O92 A;  1V40 A;  2WJU A;  4I97 A;  4FQU A;  4KH7 A;  3CRU A;  4YQM A;  2R3X A;  2VCZ A;  4HJ2 A;  1F2E A;  4CHS A;  2AB6 A;  4HZ4 A;  1TU8 A;  3FR3 A;  1GNW A;  1GSE A;  4Q5N A;  2OA7 A;  5FHI A;  1F3B A;  4L5O A;  3VLN A;  3CSJ A;  1U3I A;  4PXO A;  3FYG A;  5ECP B;  2C80 A;  3Q18 A;  2CA8 A;  3LSZ A;  5GST A;  5A4U A;  4HOJ A;  5A5K A;  1K3O A;  5F06 A;  4G0I A;  4G9H A;  1GTU A;  4KF9 A;  4IQA A;  4USS A;  4OMV A;  1K0D A;  3VI5 A;  2GSR A;  5JCW A;  2CVD A;  2GST A;  3M8N A;  3CSI A;  1F3A A;  4PQI A;  5GZZ B;  4MP4 A;  3F6D A;  1GLP A;  4JZQ A;  3ZFL A;  4IEL A;  4ECC A;  2IMK A;  2NTO A;  1Y6E A;  5ELG A;  5IQY A;  4OFM A;  1PGT A;  4JED A;  1K0N A;  2A2S A;  3FY7 A;  1U87 A;  6GSX A;  1GSQ A;  2FHE A;  1ZL9 A;  5B7C A;  1K0C A;  1PL2 A;  3VI7 A;  4Q5R A;  1VF4 A;  3LG6 A;  1B48 A;  3R3E A;  3CSH A;  3GX0 A;  4EXJ A;  5D9T A;  10GS A;  1IYH A;  4ZB8 A;  6GSW A;  4HI7 A;  1K3Y A;  5DAL B;  5ECQ B;  2C8U A;  5ECR B;  2GLR A;  1BYE A;  5ECN B;  2ON7 A;  1GSY A;  6GSU A;  5D73 A;  4KDU A;  1AXD A;  4KE3 A;  3UBK A;  2X64 A;  4IS0 A;  4MK3 A;  3VWX A;  1PKW A;  1MD3 A;  3QR6 A;  5FT3 A;  3M3M A;  4GCI A;  3DD3 A;  5DCG A;  6GSV A;  4KDX A;  5G5E A; 
#chains in the Genus database with same CATH topology
 4PNF A;  3UAP A;  3RFR C;  2N5F A;  3G7J A;  4J2F A;  3TU3 B;  2HSM B;  3W8S A;  5ECM B;  4GTU A;  4L8E A;  2IL3 A;  4BL7 B;  1K3L A;  4G0L A;  1GWC A;  4G10 A;  1OE8 A;  4K0G A;  3WD6 A;  4MPF A;  6GSS A;  3N5O A;  5J4V A;  4AKH A;  1C72 A;  4F0B A;  1ZGN A;  5A4W A;  1JZR A;  2HSM A;  4OFT A;  1DUG A;  1EEM A;  4PGT A;  3PPU A;  4GDF A;  2WVY A;  4ZBB A;  5BMU A;  4JBB A;  2JL4 A;  2YCD A;  1U88 A;  3IK9 A;  3D0Z A;  3GH6 A;  1EOH A;  1PL1 A;  3IE3 A;  2D2Z A;  2WDU A;  1ML6 A;  2WW0 A;  2J9H A;  4NHW A;  2C3T A;  2CAQ A;  3SWL A;  1VF2 A;  3LQ7 A;  5EL8 A;  5DAK B;  1YY7 A;  4KX4 A;  1LBK A;  1RK4 A;  2C3N A;  3HKR A;  3LYP A;  4EC0 A;  4E8H A;  3GST A;  2F3M A;  1BG5 A;  1YEW C;  4RI6 A;  16GS A;  4WR4 A;  5DAK A;  4PI0 C;  3IC8 A;  1TDI A;  2WS2 A;  3DGQ A;  5F05 A;  1XWG A;  5G5F A;  1G7O A;  2R6K A;  1GTA A;  4K0N A;  5DJM A;  4ZBD A;  5J5N A;  5J40 A;  2ON5 A;  4Q5Q A;  1VF1 A;  4BVX A;  1GUK A;  1M9B A;  4RI7 A;  4IQ1 A;  4TOP A;  19GS A;  4ECB A;  3LFL A;  5AGY A;  5F07 A;  1Y1U A;  1USB A;  1SVL A;  2F8F A;  4MF6 A;  3GTU B;  3KTL A;  2YV7 A;  4YQU A;  4ECJ A;  2OAC A;  2VCX A;  2CAI A;  3VUR A;  2VD0 A;  2AHE A;  5AIX A;  14GS A;  18GS A;  11GS A;  1FHE A;  2PVQ A;  1XW5 A;  1AQX A;  3U6V A;  3VPQ A;  5GSS A;  3GTU A;  2HSN B;  1UA5 A;  4G19 A;  1XW6 A;  5LCZ A;  3PR8 A;  3GSS A;  1PMT A;  3L0H A;  2C4J A;  3LYK A;  4Q5F A;  1GNE A;  1JLV A;  2VCV A;  4PTS A;  1M99 A;  5DDL A;  3LJR A;  3UBL A;  1GSD A;  1PN9 A;  2HRK B;  2GSS A;  5DJL A;  7GSS A;  3Q19 A;  3FR9 A;  1YVL A;  1GUL A;  5ECO B;  5J47 A;  3HJM A;  5ECI B;  3AY8 A;  20GS A;  1JLW A;  1MTC A;  4GSN A;  4KSM A;  2OAD A;  5ECL B;  2HRK A;  2DSA A;  1EOG A;  4YQV A;  13GS A;  3QAV A;  1OYJ A;  12GS A;  3F63 A;  2EFH A;  1R5A A;  4W66 A;  5D9W A;  1PA3 A;  1Q4J A;  3M1G A;  5BMU B;  1YJ6 A;  3GUS A;  1AQW A;  4KDY A;  1PD2 1;  1BAY A;  2WB9 A;  3O3T A;  1M9A A;  4GLT A;  4MZW A;  1OE7 A;  3FRC A;  5AIV A;  1G6W A;  4KAE A;  1VF3 A;  2UV8 G;  1GUM A;  4EDY A;  2EFD A;  3RBT A;  4PHZ C;  1GLQ A;  1PX7 A;  2YV9 A;  4G0K A;  5D9X A;  1AW9 A;  2VCW A;  5JCU A;  2PGT A;  1HNA A;  5ECK B;  3CBU A;  3TOT A;  1EV4 A;  1GSU A;  2EFE A;  5ECS A;  5HFK A;  4PUR A;  4BVY B;  3IK7 A;  4ZB9 A;  4MPG A;  1GSF A;  4YAV A;  5F8B A;  2VO4 A;  1A0F A;  4LMV A;  2GTU A;  4L5L A;  5J4U A;  2V6K A;  4IGJ A;  1N2A A;  2DC5 A;  3HJO A;  4BVX B;  6GST A;  3UAR A;  3MDK A;  4BVY A;  3NIV A;  3KMO A;  5ELA A;  4AKG A;  3ISO A;  4F03 A;  1V2A A;  8GSS A;  5J41 A;  3FR6 A;  1GSS A;  5EVO A;  4NAX A;  1LJR A;  3F6F A;  3MAK A;  4LMW A;  1TW9 A;  4MF5 A;  3I6A A;  5A34 B;  4ISD A;  1B4P A;  3KJY A;  1YQ1 A;  1SVM A;  2PER A;  22GS A;  4IKH A;  4MDC A;  3H1N A;  2WVX B;  4GF0 A;  3I69 A;  1K0A A;  3EIN A;  3G7I A;  4ZBA A;  3TGZ A;  4AGS A;  4N3Z A;  1TU7 A;  1FW1 A;  4QQ7 A;  5DQS A;  5A34 A;  1SVO A;  2VCQ A;  2GSQ A;  3QAW A;  5A4V A;  2IMI A;  3CHX C;  5F0G A;  2HRA A;  4YH2 A;  2WVX A;  4E68 A;  1K0M A;  3N9J A;  2PBJ A;  2VKZ G;  4GST A;  3QAG A;  4HZ2 A;  4F0C A;  1B8X A;  1GUH A;  17GS A;  2LJR A;  3BBY A;  2A2R A;  1TXU A;  3GUR A;  4IBP A;  4IW9 A;  4E8E A;  1K0O A;  3ZMK A;  4EDZ A;  2WZS A;  2CZ2 A;  3ERG A;  2HNL A;  4NHZ A;  1IYI A;  2C3Q A;  3IBH A;  1BF5 A;  2R4V A;  1KBN A;  3PGT A;  1K0B A;  5LD0 A;  3ERF A;  4WR5 A;  2WW2 A;  1YDK A;  4OFN A;  3VPT A;  9GSS A;  3VK9 A;  4G01 A;  2O3E A;  3Q74 A;  4PNG A;  1G6Y A;  4KGI A;  4IJI A;  4EE0 A;  2VD1 A;  5AN1 A;  3TOU A;  4PUA A;  5A5H B;  2PMT A;  4PQH A;  6GSY A;  5FWG A;  2WRT A;  3ZML A;  5AIS A;  4MF7 A;  3CRT A;  1HNC A;  3P90 A;  3LXZ A;  1PKZ A;  2UZ8 A;  1HNB A;  1YKC A;  3ZFB A;  3KMN A;  1XWK A;  1PX6 A;  2AAW A;  3C8E A;  5DAL A;  4O7H A;  2FNO A;  3R2Q A;  5J4Y A;  5A5H A;  4ACS A;  1N25 A;  1EV9 A;  4IVF A;  2R5G A;  3LXT A;  4ECI A;  4QMK A;  2GDR A;  3P8W A;  2VCT A;  1BX9 A;  4PI2 C;  1E6B A;  3UVH A;  5KEJ A;  1MD4 A;  1NHY A;  5EY6 A;  1AQV A;  3M0F A;  3KM6 A;  1GTB A;  4GSS A;  5D9V A;  2HQT A;  1HQO A;  1OKT A;  1Z9H A;  5ECH B;  1GTI A;  4PX1 A;  3EE2 A;  4ZXG A;  3IR4 A;  3KXO A;  2WVZ A;  4YAP A;  4N0V A;  2CZ3 A;  4ID0 A;  3WYW A;  3O76 A;  1M0U A;  4ZB6 A;  4BL7 A;  4DEJ A;  4O92 A;  1V40 A;  2WJU A;  4I97 A;  4FQU A;  2OT3 A;  4KH7 A;  3CRU A;  4YQM A;  2R3X A;  2VCZ A;  4HJ2 A;  1F2E A;  4CHS A;  2AB6 A;  4HZ4 A;  1TU8 A;  3FR3 A;  4FXY P;  1GNW A;  1GSE A;  4Q5N A;  2OA7 A;  5FHI A;  1F3B A;  4L5O A;  3VLN A;  3CSJ A;  1U3I A;  4PXO A;  3FYG A;  5ECP B;  2C80 A;  3CWG A;  3Q18 A;  2CA8 A;  3LSZ A;  5GST A;  5A1N B;  5A4U A;  4HOJ A;  1I1I P;  5A5K A;  1K3O A;  5F06 A;  2WW1 A;  4G0I A;  4G9H A;  1GTU A;  4KF9 A;  4IQA A;  2EFC A;  4USS A;  4OMV A;  1K0D A;  3VI5 A;  2GSR A;  5JCW A;  1S4B P;  4ZB7 A;  2CVD A;  2O36 A;  2GST A;  3M8N A;  3CSI A;  1F3A A;  4AKX B;  3RGB C;  4PQI A;  5A1N A;  5GZZ B;  4MP4 A;  3F6D A;  1GLP A;  4JZQ A;  3ZFL A;  4IEL A;  4ECC A;  2IMK A;  2NTO A;  1Y6E A;  5ELG A;  5IQY A;  4OFM A;  1PGT A;  4JED A;  1K0N A;  2A2S A;  3FY7 A;  1U87 A;  6GSX A;  1GSQ A;  2FHE A;  1ZL9 A;  5B7C A;  1K0C A;  1PL2 A;  3VI7 A;  4Q5R A;  1VF4 A;  3LG6 A;  1B48 A;  3R3E A;  3CSH A;  3GX0 A;  4EXJ A;  5D9T A;  10GS A;  1IYH A;  4ZB8 A;  6GSW A;  4HI7 A;  1K3Y A;  5DAL B;  5ECQ B;  4AKI A;  2C8U A;  5ECR B;  4AI6 A;  2H1L A;  2GLR A;  1BYE A;  5ECN B;  2ON7 A;  2HSN A;  2O5V A;  1GSY A;  6GSU A;  5D73 A;  3HMJ G;  4KDU A;  1AXD A;  4KE3 A;  3UBK A;  2X64 A;  4IS0 A;  4MK3 A;  3VWX A;  1PKW A;  1MD3 A;  3QR6 A;  5FT3 A;  2WW3 A;  1BG1 A;  3M3M A;  4GCI A;  3DD3 A;  5DCG A;  6GSV A;  4KDX A;  5G5E A; 
#chains in the Genus database with same CATH homology
 4PNF A;  3UAP A;  2N5F A;  3G7J A;  4J2F A;  3TU3 B;  2HSM B;  3W8S A;  5ECM B;  4GTU A;  4L8E A;  2IL3 A;  4BL7 B;  1K3L A;  4G0L A;  1GWC A;  4G10 A;  1OE8 A;  4K0G A;  3WD6 A;  4MPF A;  6GSS A;  3N5O A;  5J4V A;  4AKH A;  1C72 A;  4F0B A;  1ZGN A;  5A4W A;  1JZR A;  2HSM A;  4OFT A;  1DUG A;  1EEM A;  4PGT A;  3PPU A;  4GDF A;  4ZBB A;  5BMU A;  4JBB A;  2JL4 A;  2YCD A;  1U88 A;  3IK9 A;  3D0Z A;  3GH6 A;  1EOH A;  1PL1 A;  2D2Z A;  2WDU A;  3IE3 A;  1ML6 A;  4NHW A;  2J9H A;  2C3T A;  2CAQ A;  3SWL A;  1VF2 A;  3LQ7 A;  5EL8 A;  5DAK B;  1YY7 A;  4KX4 A;  1LBK A;  1RK4 A;  2C3N A;  3HKR A;  3LYP A;  4EC0 A;  4E8H A;  3GST A;  2F3M A;  1BG5 A;  4RI6 A;  16GS A;  4WR4 A;  5DAK A;  3IC8 A;  1TDI A;  2WS2 A;  3DGQ A;  5F05 A;  1XWG A;  5G5F A;  1G7O A;  2R6K A;  1GTA A;  4K0N A;  5DJM A;  4ZBD A;  5J5N A;  5J40 A;  2ON5 A;  4Q5Q A;  1VF1 A;  4BVX A;  1GUK A;  1M9B A;  4RI7 A;  4IQ1 A;  4TOP A;  19GS A;  4ECB A;  3LFL A;  5AGY A;  5F07 A;  1Y1U A;  1USB A;  1SVL A;  2F8F A;  4MF6 A;  3GTU B;  3KTL A;  2YV7 A;  4YQU A;  4ECJ A;  2OAC A;  2VCX A;  2CAI A;  3VUR A;  2VD0 A;  2AHE A;  5AIX A;  14GS A;  18GS A;  11GS A;  1FHE A;  2PVQ A;  1XW5 A;  1AQX A;  3U6V A;  3VPQ A;  5GSS A;  3GTU A;  2HSN B;  1UA5 A;  4G19 A;  1XW6 A;  5LCZ A;  3PR8 A;  3GSS A;  1PMT A;  3L0H A;  2C4J A;  3LYK A;  4Q5F A;  1GNE A;  1JLV A;  2VCV A;  4PTS A;  1M99 A;  5DDL A;  3LJR A;  3UBL A;  1GSD A;  1PN9 A;  2HRK B;  2GSS A;  5DJL A;  7GSS A;  3Q19 A;  3FR9 A;  1YVL A;  1GUL A;  5ECO B;  5J47 A;  3HJM A;  5ECI B;  3AY8 A;  20GS A;  1JLW A;  1MTC A;  4GSN A;  4KSM A;  2OAD A;  5ECL B;  2HRK A;  2DSA A;  1EOG A;  4YQV A;  13GS A;  3QAV A;  1OYJ A;  12GS A;  3F63 A;  2EFH A;  1R5A A;  4W66 A;  5D9W A;  1PA3 A;  1Q4J A;  3M1G A;  5BMU B;  1YJ6 A;  3GUS A;  1AQW A;  4KDY A;  1PD2 1;  1BAY A;  2WB9 A;  3O3T A;  1M9A A;  4GLT A;  4MZW A;  1OE7 A;  3FRC A;  5AIV A;  1G6W A;  4KAE A;  1VF3 A;  2UV8 G;  1GUM A;  4EDY A;  2EFD A;  3RBT A;  1GLQ A;  1PX7 A;  2YV9 A;  4G0K A;  5D9X A;  1AW9 A;  2VCW A;  5JCU A;  2PGT A;  1HNA A;  5ECK B;  3CBU A;  3TOT A;  1EV4 A;  1GSU A;  2EFE A;  5ECS A;  5HFK A;  4PUR A;  4BVY B;  3IK7 A;  4ZB9 A;  4MPG A;  1GSF A;  4YAV A;  5F8B A;  2VO4 A;  1A0F A;  4LMV A;  2GTU A;  4L5L A;  5J4U A;  2V6K A;  4IGJ A;  1N2A A;  2DC5 A;  3HJO A;  4BVX B;  6GST A;  3UAR A;  3MDK A;  4BVY A;  3NIV A;  3KMO A;  5ELA A;  4AKG A;  3ISO A;  4F03 A;  1V2A A;  8GSS A;  5J41 A;  3FR6 A;  1GSS A;  5EVO A;  4NAX A;  1LJR A;  3MAK A;  3F6F A;  4LMW A;  1TW9 A;  4MF5 A;  3I6A A;  5A34 B;  4ISD A;  1B4P A;  3KJY A;  1YQ1 A;  1SVM A;  2PER A;  22GS A;  4IKH A;  4MDC A;  3H1N A;  4GF0 A;  3I69 A;  1K0A A;  3EIN A;  3G7I A;  4ZBA A;  3TGZ A;  4AGS A;  4N3Z A;  1TU7 A;  1FW1 A;  4QQ7 A;  5DQS A;  5A34 A;  1SVO A;  2VCQ A;  2GSQ A;  3QAW A;  5A4V A;  2IMI A;  5F0G A;  2HRA A;  4YH2 A;  4E68 A;  1K0M A;  3N9J A;  2PBJ A;  2VKZ G;  4GST A;  3QAG A;  4HZ2 A;  4F0C A;  1B8X A;  1GUH A;  17GS A;  2LJR A;  3BBY A;  2A2R A;  1TXU A;  3GUR A;  4IBP A;  4IW9 A;  4E8E A;  1K0O A;  3ZMK A;  4EDZ A;  2CZ2 A;  3ERG A;  2HNL A;  4NHZ A;  1IYI A;  2C3Q A;  3IBH A;  1BF5 A;  2R4V A;  1KBN A;  3PGT A;  1K0B A;  5LD0 A;  3ERF A;  4WR5 A;  1YDK A;  4OFN A;  3VPT A;  9GSS A;  3VK9 A;  4G01 A;  3Q74 A;  4PNG A;  1G6Y A;  4KGI A;  4IJI A;  4EE0 A;  2VD1 A;  5AN1 A;  3TOU A;  4PUA A;  5A5H B;  2PMT A;  4PQH A;  6GSY A;  5FWG A;  2WRT A;  3ZML A;  5AIS A;  4MF7 A;  3CRT A;  1HNC A;  3P90 A;  3LXZ A;  1PKZ A;  2UZ8 A;  1HNB A;  1YKC A;  3ZFB A;  3KMN A;  1XWK A;  1PX6 A;  2AAW A;  3C8E A;  5DAL A;  4O7H A;  2FNO A;  3R2Q A;  5J4Y A;  5A5H A;  4ACS A;  1N25 A;  1EV9 A;  4IVF A;  2R5G A;  3LXT A;  4ECI A;  4QMK A;  2GDR A;  3P8W A;  2VCT A;  1BX9 A;  1E6B A;  3UVH A;  5KEJ A;  1MD4 A;  1NHY A;  5EY6 A;  1AQV A;  3M0F A;  3KM6 A;  1GTB A;  4GSS A;  5D9V A;  2HQT A;  1HQO A;  1OKT A;  1Z9H A;  5ECH B;  1GTI A;  4PX1 A;  3EE2 A;  4ZXG A;  3IR4 A;  3KXO A;  4YAP A;  4N0V A;  2CZ3 A;  4ID0 A;  3WYW A;  3O76 A;  1M0U A;  4ZB6 A;  4BL7 A;  4DEJ A;  4O92 A;  1V40 A;  2WJU A;  4I97 A;  4FQU A;  2OT3 A;  4KH7 A;  3CRU A;  4YQM A;  2R3X A;  2VCZ A;  4HJ2 A;  1F2E A;  4CHS A;  2AB6 A;  4HZ4 A;  1TU8 A;  3FR3 A;  1GNW A;  1GSE A;  4Q5N A;  2OA7 A;  5FHI A;  1F3B A;  4L5O A;  3VLN A;  3CSJ A;  1U3I A;  4PXO A;  3FYG A;  5ECP B;  2C80 A;  3CWG A;  3Q18 A;  2CA8 A;  3LSZ A;  5GST A;  5A1N B;  5A4U A;  4HOJ A;  5A5K A;  1K3O A;  5F06 A;  4G0I A;  4G9H A;  1GTU A;  4KF9 A;  4IQA A;  2EFC A;  4USS A;  4OMV A;  1K0D A;  3VI5 A;  2GSR A;  5JCW A;  4ZB7 A;  2CVD A;  2GST A;  3M8N A;  3CSI A;  1F3A A;  4AKX B;  4PQI A;  5A1N A;  5GZZ B;  4MP4 A;  3F6D A;  1GLP A;  4JZQ A;  3ZFL A;  4IEL A;  4ECC A;  2IMK A;  2NTO A;  1Y6E A;  5ELG A;  5IQY A;  4OFM A;  1PGT A;  4JED A;  1K0N A;  2A2S A;  3FY7 A;  1U87 A;  6GSX A;  1GSQ A;  2FHE A;  1ZL9 A;  5B7C A;  1K0C A;  1PL2 A;  3VI7 A;  4Q5R A;  1VF4 A;  3LG6 A;  1B48 A;  3R3E A;  3CSH A;  3GX0 A;  4EXJ A;  5D9T A;  10GS A;  1IYH A;  4ZB8 A;  6GSW A;  4HI7 A;  1K3Y A;  5DAL B;  5ECQ B;  4AKI A;  2C8U A;  5ECR B;  4AI6 A;  2H1L A;  2GLR A;  1BYE A;  5ECN B;  2ON7 A;  2HSN A;  2O5V A;  1GSY A;  6GSU A;  5D73 A;  3HMJ G;  4KDU A;  1AXD A;  4KE3 A;  3UBK A;  2X64 A;  4IS0 A;  4MK3 A;  3VWX A;  1PKW A;  1MD3 A;  3QR6 A;  5FT3 A;  1BG1 A;  3M3M A;  4GCI A;  3DD3 A;  5DCG A;  6GSV A;  4KDX A;  5G5E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...