3IK7A

Human glutathione transferase a4-4 with gsdhn
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
221
structure length
221
Chain Sequence
AARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase A4
publication title Substrate specificity combined with stereopromiscuity in glutathione transferase A4-4-dependent metabolism of 4-hydroxynonenal.
pubmed doi rcsb
source organism Homo sapiens
total genus 77
structure length 221
sequence length 221
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2009-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3ik7A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3ik7A01
1VGLA 3QAGA 1K0DA 1V58A 2LJAA 3VWUA 3APSA 1ACVA 3FK8A 3GL3A 1THOA 2B1LA 2EIRA 3EU4A 4IHUA 4TOPA 1FHEA 4MP4A 5LNKe 4MABA 3FRCA 2LNSA 5D9VA 4EDYA 4IVFA 4K0GA 4OWYA 1FOVA 5IQYA 1RW1A 4XTSA 2LS5A 3KM6A 3TOUA 4F9ZA 1M2BA 3HZ8A 4O32A 2JSZA 4KE3A 4DVCA 2GGTA 3GV1A 1JZRA 4MLYA 2N5FA 4BL7B 4N10A 1MDKA 1TK0B 4G2EA 2C0FA 2HI7A 2C3NA 2L4CA 3HCZA 2IWTA 1BG5A 4F82A 1YJ6A 1O73A 5D93A 3IBHA 4XIHA 2HRFA 1SD8A 1DSBA 1SJ6A 4POLA 2MMNA 3KGKA 2H19A 2HQTA 3V1WA 2VIMA 1G7OA 2L5LA 2VLUA 3C8EA 3TJJA 1MDIA 1ZL9A 2RIIA 2V32A 5IMAA 2BMXA 2PWJA 4PXOA 3BD2A 1PD21 1A2JA 5JCUA 4PNGA 2OBIA 1I9DA 4IBPA 2B7KA 2PERA 3UJ1A 2DJ1A 2LRCA 2GZYA 4X43A 4ACSA 4KDXA 1Z6MA 1SU9A 2LJKA 1TRUA 1GSDA 3K8NA 5ECLB 1OC9B 1HD2A 3D21A 2IFQA 4K6XA 3KJYA 1ERVA 5KN0A 2OADA 3UL3A 3QD9A 5H5QA 5D73A 1XWGA 2YWNA 2H1BA 2B7JA 3GN3A 4BA7A 1FB6A 4GCIA 3HVSA 3ZZXA 2WULA 4YQUA 4MF5A 5B8AA 4FO5A 1GSEA 3LWAA 3LXZA 1HNAA 5CRWA 1T3BA 2VCZA 2IPAA 3HJPA 4HZ2A 3PH9A 2VL9A 2KLXA 3D5JA 4IQAA 3W8JA 4BVXB 3C1RA 2A4VA 5EVOA 3TKSA 1YEPA 2G2QA 2H71A 5IMZA 2DJ2A 5GSTA 4MH2A 2M80A 3WT1A 2RUEA 3UBKA 2H0HA 5DALB 2MYGA 1YEXA 3TRPA 4ZILA 3DKSA 4IJ3A 2GZPA 1Z9HA 4ZB9A 2IIYA 3D4MA 2I9HA 1RQMA 1WPIA 1BYEA 3LXTA 3VURA 2H70A 1T00A 4AF2A 1R5AA 2R4VA 1ZOFA 4MPFA 3EU3A 1AXDA 3LYKA 1J08A 4HU9A 2H74A 4DEJA 3DD3A 3TJFA 2I3YA 14GSA 4EKZA 6GSUA 4JR4A 3F3QA 2AHEA 4TW5A 4GWRA 4IN0A 1A8LA 2H6XA 4XS4A 1B4PA 2PMTA 3ME7A 5J9CA 4ZB8A 4MJBA 2GS3A 2H8LA 2P31A 2YPMA 4MDCA 3VWXA 1U3IA 2OE0A 1THXA 4KDUA 3D6IA 5ABRA 4E8EA 4WR5A 3RAZA 11GSA 1FB0A 3GKKA 5IO2A 2F8AA 2VLVA 4G9HA 1W4VA 5DQYA 2V41A 3DXBA 2C0DA 4FYUA 2OBKA 5D96A 3TKPA 2MMOA 1PN9A 1ABAA 4I97A 4USSA 5IPGA 1U87A 2E7PA 4G10A 3LSZA 3ZMKA 1MDJA 4EXJA 2DBCA 2GSSA 5HR2A 5D9TA 6GSTA 1GTAA 2PBJA 1FVKA 1SK1A 5JCWA 3RPNA 2MMAA 3GL5A 3GH9A 4K0NA 3TKQA 3L9UA 1K0OA 4ID0A 1MD3A 1AC1A 2RM6A 4FYCA 2AAWA 2VM1A 2FY6A 1R26A 1TTZA 5KN3A 4NHWA 2R5GA 3H4KA 3C73A 2VD1A 2QKEA 2WJUA 4I5QA 1DE1A 4OFMA 4I2UA 3QFBC 3EINA 5HR0A 4ILFA 1V2AA 3TRXA 1K3YA 2E0QA 1GLQA 5ECRB 2P5QA 3F63A 5CREA 2CVKA 2CVBA 4HDEA 2FCHA 3O6TA 5EY6A 2FA8A 5CP1A 4WBRD 2IL3A 3HKRA 3PR8A 3GUSA 2GQKA 1PKZA 1BEDA 2VCQA 3TJBA 4DSQA 4BVYA 1SENA 1T8EB 2WCIA 3F4RA 1GTUA 2E2GA 3ERWA 3L9VA 3LQ7A 4IJIA 1PKWA 2HSMB 2IMDA 5COHA 2KP1A 4X1UA 2XHFA 2CV4A 5IMVA 5ID2A 2F8FA 3EYTA 2HE3A 1LJRA 1GH2A 2A2RA 3W8SA 6GSXA 2YWOA 4YQVA 1DE2A 4MJEA 4O5RA 3M9JA 3C71A 3G7YA 2WB9A 3FZ4A 1SKRB 3GTUB 1MD4A 1QQ2A 4OO5A 2CAQA 3KMNA 1WE0A 2V1MA 3ZMLA 3VWVA 1TU8A 2TIRA 4EO3A 1Y25A 4MMMA 1XWBA 1LU4A 2OE3A 9GSSA 3CBUA 1M9BA 20GSA 3A2WA 2YOIA 4KH7A 4KA0A 1EOGA 5F05A 2FWFA 5B6NA 2CAIA 2YV7A 2XC2A 4QL9A 2LSTA 1JLVA 4YH2A 3CSHA 3NIVA 5G1LA 2HZEA 3IC8A 5DQSA 3H93A 2R3XA 4MK3A 1SK2A 4IQ1A 3OR5A 18GSA 1UC7A 4KB3A 2P5RA 2NTOA 4HOJA 2K8SA 2A2SA 2B1KA 3VPQA 3I6AA 4YQMA 3KH7A 1Z6NA 4TN8A 4V2NA 3QAVA 2FA4A 5CNWA 2YWIA 1X5EA 5ENUA 2WS2A 4ECBA 1A24A 1X5DA 3H1NA 3FR6A 1EZKA 3C7MA 2HRKB 5DAKB 1KEBA 4K7NA 1M2DA 5ECKB 4NWYA 4JR6A 3GURA 3BCIA 1GUHA 5GSSA 4ZL9A 3FYGA 2L4QA 1NHYA 3M1GA 4GQCA 2LV3A 4V2MA 5ELAA 3FHKA 1RK4A 4Q5NA 4G0IA 5ECQB 4OD7A 4V1Ap 5AGYA 2JZSA 1M0UA 2HFDA 2H66A 1T7PB 1YKCA 1HNCA 5CO3A 4P3YB 4KDYA 1XWAA 4WF4A 3EVIA 4PNFA 1JFUA 1N8JA 3Q74A 5B6MA 1S3DA 2KUCA 4LA1A 1ZGNA 2F9SA 2JACA 2HNLA 5ECMB 2VL2A 1NSWA 3IK7A 1PL1A 5DCGA 1MEKA 4PGTA 1ST9A 3UBLA 5ECPB 1TKDB 4EDZA 1GP1A 3TOTA 3DVXA 2H30A 4TRXA 1MTCA 2LKUA 4ISDA 3GKXA 4N0ZA 4EVMA 1A0RP 4JE1A 4MZWA 4TR1A 5JWOB 2BTOT 2VD0A 2FWGA 2XPDA 2ZUPA 2X64A 4L0WA 4HUAA 1QFNA 1EV4A 4CDOA 22GSA 7GSSA 1ZYEA 1GSYA 4AJ6A 4K8MA 4OMVA 3CRTA 3IAM2 2JZTA 3NZNA 2VL2C 3E0UA 2GSTA 4MCUA 2YZUA 3WT2A 1SL1B 2K18A 2KP2A 4ECJA 1UVZA 1ON4A 5A4WA 4TXOB 3A3TA 1ZMAA 2OACA 2KOKA 4ULXA 1R7HA 2GVPA 2H1AA 5IO0A 1F9MA 3IC4A 1O7UA 2DSAA 5G5EA 1U6TA 2GT5A 1SKWB 4POKA 3KD0A 5LD0A 2QSIA 2GQMA 2HXKA 4KSMA 4OCFA 3SWLA 3GRXA 1WJKA 1EP7A 3ZYWA 3ISOA 2F3MA 5A4VA 1Z3EA 3O76A 3VLNA 1Z7RA 5GAPD 1XPVA 4D73A 2LRNA 1TW9A 3TJGA 3HJOA 1M99A 3KIJA 3KEBA 1ILOA 3LFLA 1J9BA 4PUFC 1GRXA 2J9HA 3I43A 2VUPA 2YP6A 4N30A 3IPZA 2H6YA 3FW2A 1TRVA 3NOFA 2L59A 4GSNA 1PX6A 1XBSA 1URMA 3ZREA 2H0IA 1QMVA 3CXGA 5E4WA 3RHBA 2IMEA 3EE2A 3A2VA 4MZCA 4OFNA 3P7XA 2CA8A 4HS1A 1AW9A 1VF2A 5HFGA 5EL8A 2OE1A 1K0MA 1A2LA 4TR0A 4ZBAA 4L5OA 2Z9SA 2VCXA 2L6CA 4MJAA 3F3RA 4G0LA 3FY7A 2ES7A 1OKDA 4KW6A 4NV2A 2IMIA 1GWCA 5L71A 3IHQA 1VRSD 2PPTA 1EP8A 2TRCP 3HJMA 2L5OA 5CRHA 2WZ9A 2YANA 3WYWA 1WWJA 1J0FA 3SBCA 2EC4A 2O89A 1GSQA 1Z5YE 2VAFA 4HU7A 4XRAA 4F03A 4KNDA 4KX4A 4PQIA 4LLRA 3ZVJA 2G0FA 12GSA 1WOUA 4GSTA 4LL4B 2FGXA 1XVWA 3LYPA 2HZFA 5IOXA 3L78A 4LMVA 2VLTA 5B7CA 3ZRDA 3F4TA 4J56E 1FO5A 5HFKA 3HZ4A 4ZB6A 1T1VA 3TKSC 1X9SB 3J7Yk 3P90A 1WMJA 3LEFA 2H1DA 4MZBA 2PN8A 1WIKA 5CYYA 4ML6A 4TR4A 4FIWA 2XBQA 4GXZA 1V98A 1B4QA 1PA3A 1NM3A 2JL4A 5ELGA 4E8HA 5IIZA 1HNBA 1GSUA 2DJKA 4I2TA 2FWEA 1AQXA 2V6OA 2LRTA 3L9SA 2GT6A 3ZIJA 3DEXA 2CX3A 3ED3A 2CZ2A 3UEMA 3QMXA 1GNWA 3QR6A 4OCEA 3ZL5A 1ZZYA 1TU7A 4RI6A 1S3AA 4J2FA 4IW9A 1FG4A 3DWVA 4GRFA 6GSSA 2YJ7A 4KCAA 2AB6A 4GLTA 4NPBA 3ZFLA 4L0UA 4G19A 4Q5QA 2NBSA 5HQPA 5IMCA 5INYA 2CZ3A 4K7OA 4YAVA 3GHAA 4NV5A 5J9BA 4X0XA 3IOSA 2CT6A 1GSFA 2OA7A 2HRNA 4KUNA 3PPUA 1U3AA 4XS1A 2C8UA 2DIZA 1M7TA 2M72A 1O6JA 2CQ9A 5J4UA 4I6XA 1HQOA 2IFQB 4IKHA 2LUSA 2EIQA 2LQOA 3LJRA 3KMOA 2NVLA 3GNJA 1GTBA 2K8VA 1YY7A 1EGRA 5J41A 2IMFA 1XFLA 4BWSA 3GX0A 1QK8A 2RM5A 1EEMA 5IOWA 2WDUA 2NPBA 5F8BA 1GTIA 3R3EA 1K0CA 3P2AA 5H5RA 5A4UA 3ZVJD 2WFCA 2E2MA 2DJJA 2LTKA 5AISA 4IP6A 5JWRB 1SK0A 3HYPA 4YAPA 1YF0A 4MA9A 1EEJA 3F6FA 1G6WA 3VFIA 4RUVA 2F51A 5G1KA 1XW9A 3LG6A 3PINA 3FZAA 1B9XC 1JLWA 5FWGA 4BL7A 4F0BA 1GSSA 4KCEA 2VO4A 3CTFA 1XW6A 3D0ZA 1ERTA 3TKRA 4PURA 3DRNA 4K1FA 1TK5B 2YWMA 2B5EA 1T4YA 2V6KA 5CRDA 2ZCTA 2HSNB 1PGTA 2B6MA 2DMLA 4K2DA 5H5SA 2R2JA 3MAKA 3MSZA 4FH8A 3DYRA 2J23A 13GSA 2OJLA 2GSRA 5JWQB 2LQQA 1A8YA 2I1UA 1Z7PA 1BX9A 3G9BA 1SKSB 4DSSA 1X0RA 1H4OA 4XS4B 3D22A 3KH9A 3APOA 3TKSE 3BOAA 3VWWA 5G31A 5AIXA 5IMFA 2L57A 4POBA 2C3TA 1TRSA 1B48A 3G7IA 5IMDA 4TVEA 4OFTA 1T4ZA 1OE7A 4KSOA 3GMFA 3N9JA 3QPMA 3IK9A 2IJYA 3BCKA 2MMZA 2B5XA 1K0BA 1G6YA 3U6VA 1F37A 3TB2A 1O81A 3UVTA 3P8WA 4HZ4A 1SL0B 1OE8A 4HI7A 3WGEA 2RUFA 2H6ZA 1A23A 1FW1A 4BWQA 3EMXA 3RDWA 1VF3A 3Q18A 1OYJA 2YN1A 1WP0A 1ERUA 5KEJA 1GL8A 5DCHA 5HR3A 2H76A 3TGZA 2JZRA 1X5CA 3APQA 2C0EA 4XHMA 2ON7A 3UMAA 4JBBA 2EIOA 6GSYA 2GSQA 2DJ3A 3KP8A 3QDNA 1JZWA 1XOBA 3TJKA 3JCML 4BVXA 4V2LA 3F0IA 2X8CA 2DJ0A 1PL2A 3VK9A 2GZZA 1V9WA 3M9KA 8GSSA 1F3AA 3AY8A 4N11A 2H75A 3I9V2 2LJRA 5DALA 4N0VA 1NW2A 3FZ5A 3A2XA 2H0GA 3F4SA 4I8BA 1YDKA 4WR4A 1CQHA 2VCTA 6GSVA 3DGQA 1BQ7A 2K9FA 2KHPA 2ALBA 3KTBA 2GDRA 1G7EA 1PX7A 2DLXA 4JRRA 2IN3A 3CSIA 1R5PA 1AQWA 2B5YA 2HYXA 5F06A 1GNEA 1TJDA 3ZLPA 2BJXA 1TOFA 1EWXA 4BVYB 1X9MB 3IR4A 4WXTA 1V40A 4IELA 1UN2A 2O7KA 1BAYA 3WD6A 4EF0A 3A5WA 2MZCA 1XWKA 3L0HA 5ID2B 5DBQA 2N5AA 1TDIA 1SJZA 2LNTA 1U88A 5DVBA 2FD3A 4PTSA 1KNGA 5CRGA 5DDLA 1XIYA 4NMUA 5F0GA 2HRAA 4HJ2A 5JCGA 2H01A 5B8BA 2HSHA 3FR9A 4RQRA 4KF9A 1K0AA 3HVXA 3GSTA 4MJCA 1R4WA 1JHBA 1G0TA 4DSRA 1YF1A 2PVQA 2WRTA 1UA5A 4QQ7A 4Q5RA 4K9ZA 4NAXA 4TXVA 4DSSB 3R2QA 4NXIA 4GF0A 3HHVA 5AN1A 3N5OA 5FT3A 1KBNA 5F07A 3ZITA 1DUGA 2HZEB 2M46A 4XRDA 2L6DA 4TR3A 3MNGA 5FHIA 1FVJA 5C00A 1OC8A 3UIWA 5IM9A 2VCWA 3Q6OA 3ERFA 2LEGA 5ECSA 1XCCA 3TUEA 3M0FA 3GKNA 1OKTA 3RPPA 1QUWA 3ME8A 3UAPA 4QL7A 1H75A 2YV9A 1YKAA 19GSA 1CQGA 3BBYA 1IYHA 5ECIB 4WF5A 4JZQA 2HT9A 3KTLA 3TDGA 1KTEA 2X8GA 1TK8B 2C80A 3WGXA 3D4TA 1A2MA 3IAS2 4AJ7A 2DIYA 3HA9A 4V1Ag 1ZYQB 3ERGA 4XS6A 3ZTLA 1V57A 2RLIA 5D8IA 3EC3A 1XOAA 3HY2A 2HSMA 1QGVA 4GQFA 1EOHA 2FHEA 1OC3A 2O85A 2PUKC 5G5FA 1ML6A 1SL2B 4IP1A 1F6MC 1N2AA 4H86A 4HEA2 2YJHA 1K3LA 2YNXA 2C0GA 1GUMA 4FQUA 1XWCA 2VOCA 4F2IA 2C4JA 1SYXA 2C1YA 3DVWA 3GFKA 2JADA 3GTUA 1YQ1A 5HFIA 5J3RA 4MPGA 3LORA 16GSA 2X8HA 2FUG2 5IPHA 3FZ9A 4ML1A 4O92A 5ECNB 4CW9A 2YZHA 3E3EA 4XCSA 3C1SA 4AGSA 4ZIJA 4ZBDA 3GYKA 4TR1B 4EUYA 4PQHA 2P0GA 4ECCA 2ON5A 3QFAC 4HJMA 2FLSA 1JZDA 1Q4JA 3ZFBA 1O8WA 3IDVA 1LBKA 4EC0A 10GSA 5A5KA 5J5NA 2N5BA 4L5LA 1S3CA 1GUKA 4EE0A 3GX8A 1Q98A 5EPFA 3EURA 1GULA 5AIVA 2QGVA 1DBYA 3E9JB 3DIEA 3HDCA 1XW5A 2IMKA 5ECHB 2ZNMA 2R6KA 3US3A 2XBIA 3H79A 2O87A 3GA4A 5GZZB 3IV4A 3WGDA 1OVNA 3RBTA 1SD9A 4MF6A 3HXSA 5KN2A 2HRKA 5DAKA 5KN1A 4Q5FA 2H1GA 4D73B 5C04A 2WGRA 3CYNA 2FNOA 1W89A 4LL1B 1O85A 3CTGA 1GLPA 2GTUA 1USBA 3BJ5A 4KGIA 5DJLA 4BPYA 2AV4A 1Y6EA 3J7Yb 3VPTA 4IS0A 2GQLA 4PUAA 2CVDA 2FWHA 2C3QA 3MWHA 1A0FA 1AIUA 4MF7A 3IE3A 1B8XA 1F2EA 2OKAA 2JU5A 3G7JA 4ZXGA 2PGTA 4FYBA 3M8NA 3MDKA 1M2AA 3FKFA 5D9XA 2JSYA 4TKYA 5E59A 1E2YA 1BJXA 2XPEA 2I4AA 3HVVA 2HLSA 3TRQA 17GSA 1O8XA 1VF1A 4F0CA 1YZXA 3GIXA 4OO4A 3H8QA 1X9WB 2NDOA 4JU5A 5D9WA 2MBSA 4PX1A 2HSYA 4HQSA 5DJMA 1JZOA 3KCMA 2V2GA 4MH3A 1XXUA 3O3TA 4L8EA 1C72A 2VCVA 1ERWA 1OAZA 4O7HA 2VM2A 3U5RE 3EWLA 3FEUA 1FAAA 1XVQA 3ZIVA 1TP9A 4JEDA 4TXOA 1NHOA 3W6GA 1HYUA 1ZCPA 5CAXA 3KZQA 2PU9C 5BMUA 1WRYA 4POMA 4ZL8A 4ECIA 1IYIA 1TI3A 2X99A 3M3MA 3GH6A 2CX4A 3CSJA 3TCOA 4G0KA 3CMIA 3UOMA 3KXOA 5ECOB 4J57E 5GAND 1SJIA 3F8UA 1SYRA 2DC5A 3F9UA 4GSSA 3VI5A 3UARA 4NHZA 2TRXA 1OC9A 1TRWA 4KAEA 1QXHA 1I5GA 5G30A 1EGOA 4IGJA 2AUVA 2B3SA 3PGTA 4ZL7A 4WKWA 3EMPA 4Z7XA 2MBTA 3RHCA 5G2ZA 4EL1A 2YCDA 1EV9A 3IA1A 4WETA 3QAWA 1TXXA 1XZOA 1PRXA 3IXRA 3F6DA 2UZ8A 3FR3A 3L4NA 4GTUA 3KP9A 2AJQB 2REMA 1AQVA 3CRUA 1K3OA 1F3BA 4K7IA 6GSWA 1PQNA 1K0NA 2I81A 4RQXA 2O8VB 2R37A 4RI7A 3HD5A 1VF4A 5LCZA 1PMTA 4CHSA 2QC7A 3GSSA 3QOUA 5HR1A 3GKMA 4WEYA 1M9AA 3Q19A 2PVOC 3IRAA 2AYTA 1AAZA 4WBJA 3QCPA 4HQZA 3I69A 3S9FA 1TI1A 2DMMA 3LGCA 3DMLA 3VI7A 2K6VA 2VL3A 2H72A 1PSQA 2GLRA 3UVHA 4LMWA 4PQ1A 1B9YC 4ZBBA 4AJ8A 1AUCA 1E6BA 2H73A 2D2ZA
chains in the Genus database with same CATH superfamily
1BG1A 1VGLA 3QAGA 1K0DA 1V58A 2LJAA 3VWUA 3APSA 1ACVA 3FK8A 3GL3A 1THOA 2B1LA 1SVLA 2EIRA 3EU4A 4IHUA 4TOPA 1FHEA 4MP4A 5LNKe 4MABA 3FRCA 2LNSA 5D9VA 4EDYA 4IVFA 4K0GA 4OWYA 1FOVA 5IQYA 1RW1A 4XTSA 2LS5A 3KM6A 3TOUA 4F9ZA 1M2BA 3HZ8A 4O32A 2JSZA 4KE3A 4DVCA 2GGTA 3GV1A 1JZRA 2DKIA 4MLYA 2N5FA 4BL7B 4N10A 1MDKA 1TK0B 2HI7A 2C0FA 2L4CA 2C3NA 4G2EA 3HCZA 2WZSA 2IWTA 1BG5A 4F82A 1YJ6A 1O73A 5D93A 2X49A 3IBHA 4XIHA 2HRFA 1SD8A 1DSBA 1SJ6A 4GDFA 2MMNA 4POLA 3KGKA 2H19A 2HQTA 5A34B 3V1WA 2VIMA 1G7OA 2L5LA 2VLUA 3C8EA 3TJJA 1MDIA 1ZL9A 2RIIA 2V32A 5IMAA 5A5HB 2BMXA 2PWJA 4PXOA 3BD2A 1PD21 1A2JA 5JCUA 4PNGA 2OBIA 1I9DA 4IBPA 4PHZC 2B7KA 2PERA 3UJ1A 2DJ1A 2LRCA 2GZYA 4X43A 4ACSA 4KDXA 1Z6MA 3RFRC 1SU9A 2LJKA 1TRUA 1GSDA 3K8NA 4X4JA 5ECLB 1OC9B 1HD2A 3D21A 2IFQA 4K6XA 3KJYA 1ERVA 5KN0A 2OADA 3UL3A 3QD9A 5H5QA 5D73A 1XWGA 2YWNA 2H1BA 2B7JA 3GN3A 4BA7A 1N25A 4PI0C 1FB6A 4GCIA 3HVSA 3ZZXA 2WULA 4YQUA 4MF5A 5B8AA 4FO5A 1GSEA 3LWAA 3LXZA 1HNAA 5CRWA 1T3BA 2VCZA 2IPAA 3HJPA 4HZ2A 3PH9A 2VL9A 3HMJG 2KLXA 3D5JA 4IQAA 3W8JA 4BVXB 3C1RA 2A4VA 5EVOA 3TKSA 1YEPA 2G2QA 2H71A 5IMZA 2DJ2A 5GSTA 4MH2A 2M80A 3WT1A 2RUEA 3UBKA 2H0HA 5DALB 2MYGA 1YEXA 4K5SA 3TRPA 4ZILA 3DKSA 4IJ3A 2HSNA 2GZPA 1Z9HA 4ZB9A 2IIYA 3D4MA 2I9HA 1RQMA 1WPIA 1BYEA 3LXTA 3VURA 2H70A 3TU3B 1T00A 4AF2A 1R5AA 2R4VA 5A1NB 2WVXB 1ZOFA 4MPFA 3EU3A 1AXDA 1ZYPA 3LYKA 1J08A 4HU9A 2H74A 4DEJA 3DD3A 3TJFA 2I3YA 14GSA 4EKZA 6GSUA 4JR4A 3F3QA 2AHEA 4TW5A 4GWRA 4IN0A 1A8LA 2H6XA 4XS4A 1B4PA 2PMTA 3ME7A 5J9CA 4ZB8A 4MJBA 2GS3A 2H8LA 2P31A 2YPMA 4MDCA 3VWXA 1U3IA 2OE0A 1THXA 4KDUA 3D6IA 5ABRA 4E8EA 4WR5A 3RAZA 11GSA 1FB0A 3GKKA 5IO2A 2F8AA 2VLVA 4G9HA 1W4VA 5DQYA 2V41A 3DXBA 2C0DA 4FYUA 1SVMA 2OBKA 5D96A 3TKPA 2MMOA 1PN9A 1ABAA 2A4HA 4I97A 4USSA 4BIKA 5IPGA 1U87A 4PI2C 2E7PA 4G10A 3LSZA 3ZMKA 1MDJA 4EXJA 2DBCA 2GSSA 5HR2A 5D9TA 4AKHA 6GSTA 1GTAA 2PBJA 1FVKA 1SK1A 5JCWA 3RPNA 2MMAA 3GL5A 3GH9A 4K0NA 3TKQA 3L9UA 1K0OA 4ID0A 4CY6A 1MD3A 1AC1A 2RM6A 4FYCA 2AAWA 2VM1A 2FY6A 1R26A 4YKFA 1TTZA 5KN3A 4NHWA 2R5GA 3H4KA 3C73A 2VD1A 2QKEA 2WJUA 4I5QA 1DE1A 4OFMA 4I2UA 3QFBC 3EINA 5HR0A 4ILFA 1V2AA 3TRXA 1K3YA 2E0QA 1GLQA 1Y1UA 5ECRB 2P5QA 3A5IA 3F63A 5CREA 2CVKA 2CVBA 4HDEA 2FCHA 4K5RA 3O6TA 5EY6A 2FA8A 5CP1A 4WBRD 2IL3A 3HKRA 3PR8A 3GUSA 2GQKA 1PKZA 1BEDA 2VCQA 2WW1A 3TJBA 4DSQA 4BVYA 1SENA 1T8EB 2WCIA 3F4RA 1GTUA 2E2GA 3ERWA 3L9VA 3LQ7A 4IJIA 1PKWA 2HSMB 4ZB7A 2IMDA 5COHA 2KP1A 4Z2UA 4X1UA 2XHFA 2CV4A 5IMVA 5ID2A 2F8FA 3EYTA 2HE3A 1LJRA 1GH2A 2A2RA 3W8SA 6GSXA 2YWOA 4YQVA 1DE2A 4MJEA 4O5RA 3M9JA 3C71A 3G7YA 2WB9A 3FZ4A 1SKRB 3GTUB 1MD4A 1QQ2A 4OO5A 2CAQA 3KMNA 1WE0A 2V1MA 3ZMLA 3VWVA 2EFHA 1TU8A 2TIRA 4EO3A 2R0PA 2R0CA 4EIPA 1Y25A 4MMMA 1XWBA 1LU4A 2OE3A 9GSSA 3CBUA 2O5VA 1M9BA 20GSA 3A2WA 2YOIA 4KH7A 3CWGA 4KA0A 1EOGA 5F05A 2FWFA 5B6NA 2CAIA 2YV7A 2XC2A 4QL9A 2LSTA 1JLVA 2EFEA 4YH2A 3CSHA 3NIVA 5G1LA 2HZEA 3IC8A 5DQSA 3H93A 2R3XA 4MK3A 1SK2A 4IQ1A 3OR5A 18GSA 1UC7A 4KB3A 2P5RA 2NTOA 4HOJA 2K8SA 2A2SA 2B1KA 3VPQA 3I6AA 4YQMA 3KH7A 1Z6NA 4TN8A 4V2NA 4K2XA 3QAVA 2FA4A 5CNWA 2YWIA 1X5EA 5J40A 5ENUA 2WS2A 4ECBA 1A24A 1X5DA 3H1NA 3FR6A 1EZKA 3C7MA 2HRKB 5DAKB 1KEBA 4K7NA 1M2DA 5ECKB 4NWYA 4JR6A 3GURA 3BCIA 1GUHA 5GSSA 4ZL9A 3FYGA 2L4QA 1NHYA 3M1GA 4GQCA 2LV3A 4V2MA 5ELAA 3FHKA 1RK4A 4Q5NA 4G0IA 5ECQB 4OD7A 4V1Ap 2EFCA 5AGYA 2JZSA 1M0UA 2HFDA 2H66A 1T7PB 1YKCA 1HNCA 5CO3A 4P3YB 4KDYA 1XWAA 4WF4A 3EVIA 4PNFA 4W66A 1JFUA 1N8JA 3Q74A 5B6MA 1S3DA 2KUCA 4LA1A 1ZGNA 2F9SA 2JACA 2HNLA 5ECMB 2VL2A 1NSWA 3IK7A 5J4YA 1PL1A 5DCGA 1MEKA 4PGTA 1ST9A 3UBLA 5ECPB 1TKDB 4EDZA 1GP1A 3TOTA 3DVXA 2H30A 4TRXA 1MTCA 2LKUA 4ISDA 3GKXA 4N0ZA 4EVMA 1A0RP 4JE1A 4MZWA 4TR1A 5JWOB 2BTOT 5BRTA 2VD0A 2FWGA 2DKHA 2XPDA 2X64A 2ZUPA 4L0WA 4HUAA 1QFNA 1EV4A 4CDOA 22GSA 7GSSA 1ZYEA 1GSYA 4AJ6A 4K8MA 4CY8A 4OMVA 3CRTA 3IAM2 2JZTA 3NZNA 2VL2C 3E0UA 2GSTA 4MCUA 4EIQA 2YZUA 3WT2A 1SL1B 2K18A 2KP2A 4ECJA 4FXYP 1UVZA 1SVOA 1ON4A 5A4WA 4TXOB 3A3TA 1ZMAA 2OACA 2KOKA 4ULXA 1R7HA 2GVPA 2H1AA 5IO0A 1F9MA 5BMUB 3IC4A 1O7UA 2DSAA 3CHXC 5G5EA 1U6TA 2GT5A 1SKWB 4POKA 3KD0A 5LD0A 2H1LA 2QSIA 2GQMA 2HXKA 4KSMA 4OCFA 3SWLA 3GRXA 1WJKA 1EP7A 3ZYWA 3ISOA 2F3MA 5A4VA 1Z3EA 3O76A 3VLNA 1Z7RA 5GAPD 1XPVA 4D73A 2LRNA 1TW9A 3TJGA 3HJOA 1M99A 4O5UA 3KIJA 3KEBA 1ILOA 3LFLA 1J9BA 4PUFC 4A5PA 1GRXA 2J9HA 3I43A 2VUPA 2YP6A 4N30A 3IPZA 2H6YA 3FW2A 1TRVA 3NOFA 2L59A 4GSNA 1PX6A 1XBSA 1URMA 3ZREA 2H0IA 1QMVA 3CXGA 5E4WA 3RHBA 2IMEA 3EE2A 3A2VA 4MZCA 4OFNA 3P7XA 2CA8A 4HS1A 1AW9A 3LW9A 1VF2A 5HFGA 5EL8A 2OE1A 1K0MA 1A2LA 4TR0A 4ZBAA 5KOWA 4L5OA 2Z9SA 2VCXA 2L6CA 4MJAA 3F3RA 4G0LA 3FY7A 2ES7A 1OKDA 4KW6A 4NV2A 2IMIA 1GWCA 1S4BP 5L71A 3IHQA 1VRSD 2PPTA 1EP8A 2TRCP 3HJMA 2L5OA 5CRHA 2WZ9A 2YANA 3WYWA 1WWJA 1J0FA 3SBCA 2EC4A 2O89A 1GSQA 1Z5YE 2VAFA 4HU7A 4XRAA 4F03A 4KNDA 4KX4A 4PQIA 3IHGA 4LLRA 3ZVJA 2G0FA 12GSA 1WOUA 4GSTA 4LL4B 2FGXA 1XVWA 3LYPA 2HZFA 5IOXA 4AKXB 3L78A 4LMVA 2VLTA 5B7CA 3ZRDA 3F4TA 4J56E 1FO5A 5HFKA 3HZ4A 4ZB6A 1T1VA 3TKSC 1X9SB 3J7Yk 3P90A 1WMJA 4HSCX 3LEFA 2H1DA 4MZBA 2PN8A 1WIKA 5CYYA 4ML6A 4TR4A 2WVZA 4FIWA 2XBQA 4AI6A 4GXZA 1V98A 1B4QA 1PA3A 1NM3A 2JL4A 5ELGA 2OT3A 4E8HA 5IIZA 1HNBA 1GSUA 2DJKA 4I2TA 2FWEA 1AQXA 2V6OA 2LRTA 3L9SA 2GT6A 3ZIJA 3DEXA 2CX3A 3ED3A 2CZ2A 3UEMA 3QMXA 1GNWA 3QR6A 4OCEA 3ZL5A 2QA1A 2WW3A 1TU7A 1ZZYA 4RI6A 1S3AA 4J2FA 4IW9A 1FG4A 3DWVA 4GRFA 6GSSA 2YJ7A 4KCAA 2AB6A 4GLTA 4NPBA 3ZFLA 4L0UA 4G19A 4Q5QA 2NBSA 5HQPA 5IMCA 5INYA 2CZ3A 4K7OA 4YAVA 3GHAA 4NV5A 4ICYA 5J9BA 4X0XA 3IOSA 2CT6A 1GSFA 2OA7A 2HRNA 4KUNA 3PPUA 1U3AA 4XS1A 4YKGA 2C8UA 2DIZA 1M7TA 2M72A 1O6JA 2CQ9A 5J4UA 4I6XA 1HQOA 4Z2RA 2IFQB 4IKHA 2LUSA 2EIQA 2LQOA 3LJRA 3KMOA 2NVLA 3GNJA 1GTBA 1YVLA 2K8VA 4G01A 1YY7A 1EGRA 5J41A 2IMFA 1XFLA 4BWSA 3GX0A 1QK8A 2RM5A 1EEMA 5IOWA 2WDUA 2NPBA 5F8BA 1GTIA 3R3EA 1K0CA 5KOXA 3P2AA 5H5RA 5A4UA 3ZVJD 2WFCA 2E2MA 2DJJA 2LTKA 5AISA 4IP6A 5JWRB 1SK0A 3HYPA 4YAPA 1YF0A 4MA9A 1FOHA 1EEJA 3F6FA 1G6WA 3VFIA 4RUVA 2F51A 5G1KA 1XW9A 3LG6A 3PINA 3FZAA 1B9XC 1JLWA 5FWGA 4BL7A 4F0BA 1GSSA 4KCEA 2VO4A 3CTFA 1XW6A 3D0ZA 1ERTA 3TKRA 1I1IP 4PURA 3DRNA 4K1FA 1TK5B 3CQFA 2YWMA 2B5EA 1T4YA 2V6KA 5CRDA 2ZCTA 2HSNB 1PGTA 1PFOA 5A34A 2B6MA 2DMLA 4K2DA 5H5SA 2R2JA 3MAKA 3MSZA 4FH8A 3DYRA 2J23A 1M3JA 13GSA 2OJLA 2GSRA 5JWQB 2LQQA 1A8YA 2I1UA 1Z7PA 5A5HA 1BX9A 2O3EA 3G9BA 1YEWC 1SKSB 4DSSA 1X0RA 1H4OA 4XS4B 3D22A 3KH9A 3APOA 3TKSE 3BOAA 3VWWA 1S3RA 5G31A 5AIXA 5IMFA 2L57A 4POBA 2C3TA 1TRSA 1B48A 3G7IA 5IMDA 4TVEA 3MYDA 4OFTA 1T4ZA 1OE7A 4KSOA 5J47A 3GMFA 3N9JA 3QPMA 3IK9A 2IJYA 3BCKA 2MMZA 2B5XA 1K0BA 1G6YA 3U6VA 1F37A 3TB2A 1O81A 3UVTA 2VKZG 3P8WA 4HZ4A 1SL0B 1OE8A 4HI7A 3WGEA 2RUFA 2H6ZA 1A23A 4MNNA 1FW1A 4BWQA 3EMXA 3RDWA 1VF3A 3Q18A 1OYJA 2YN1A 1WP0A 1ERUA 5KEJA 1GL8A 5DCHA 5HR3A 2H76A 3TGZA 2JZRA 1X5CA 3APQA 2C0EA 4XHMA 2ON7A 3UMAA 4JBBA 2EIOA 6GSYA 2GSQA 2DJ3A 3KP8A 3QDNA 3RGBC 1JZWA 1XOBA 3TJKA 3JCML 4BVXA 4V2LA 3F0IA 2R0GA 2X8CA 2DJ0A 1PL2A 3VK9A 2GZZA 1V9WA 3M9KA 8GSSA 1F3AA 3AY8A 4N11A 2H75A 3I9V2 2LJRA 5DALA 4N0VA 1NW2A 3FZ5A 3A2XA 2H0GA 3F4SA 4I8BA 1YDKA 4WR4A 1CQHA 2VCTA 6GSVA 3DGQA 1BQ7A 2K9FA 5A1NA 2KHPA 2ALBA 3KTBA 2WVXA 2GDRA 1G7EA 1PX7A 2DLXA 4JRRA 2IN3A 3CSIA 1R5PA 1AQWA 2B5YA 2HYXA 5F06A 1GNEA 1TJDA 3ZLPA 2BJXA 1TOFA 1EWXA 4BVYB 1X9MB 3IR4A 4WXTA 1TXUA 1V40A 4IELA 1UN2A 2O7KA 1BAYA 3WD6A 4EF0A 3A5WA 2MZCA 2WW2A 1XWKA 3L0HA 5ID2B 5DBQA 2N5AA 1TDIA 1SJZA 2LNTA 1U88A 5DVBA 2FD3A 4PTSA 1KNGA 5CRGA 5DDLA 1XIYA 4NMUA 5F0GA 2HRAA 4HJ2A 5JCGA 2H01A 5B8BA 2HSHA 3FR9A 4RQRA 4KF9A 1K0AA 3HVXA 3GSTA 4MJCA 1R4WA 3MIXA 1JHBA 1G0TA 4DSRA 1YF1A 2PVQA 2WRTA 1UA5A 4QQ7A 4Q5RA 4K9ZA 2A2PA 4NAXA 4TXVA 4DSSB 3R2QA 4NXIA 1BF5A 4GF0A 3HHVA 5AN1A 3N5OA 5FT3A 1KBNA 5F07A 3ZITA 1DUGA 2HZEB 2M46A 4XRDA 2L6DA 4TR3A 5FHIA 3MNGA 1FVJA 5C00A 1OC8A 3UIWA 5IM9A 2VCWA 3Q6OA 3ERFA 2LEGA 5ECSA 1XCCA 3TUEA 3M0FA 3GKNA 1OKTA 3RPPA 1QUWA 3ME8A 3UAPA 4QL7A 1H75A 2YV9A 1YKAA 19GSA 1CQGA 3BBYA 1IYHA 5ECIB 4WF5A 4JZQA 5J4VA 2HT9A 3KTLA 3TDGA 1KTEA 2X8GA 1TK8B 2C80A 3WGXA 3D4TA 1A2MA 3IAS2 4AJ7A 2DIYA 3HA9A 4V1Ag 1ZYQB 3ERGA 4XS6A 3ZTLA 1V57A 2RLIA 5D8IA 3EC3A 1XOAA 3HY2A 2HSMA 1QGVA 4GQFA 1EOHA 2FHEA 1OC3A 2O85A 4E68A 2PUKC 5G5FA 1ML6A 1SL2B 4IP1A 1F6MC 4Z2TA 1N2AA 4H86A 4HEA2 2YJHA 1K3LA 2YNXA 2C0GA 4N3ZA 1GUMA 4FQUA 1XWCA 2VOCA 4F2IA 2C4JA 1SYXA 2C1YA 3DVWA 3GFKA 2JADA 3GTUA 1YQ1A 5HFIA 5J3RA 3FMWA 4MPGA 3LORA 16GSA 2X8HA 2FUG2 5IPHA 1ZYNA 3FZ9A 4ML1A 4O92A 5ECNB 4CW9A 2YZHA 3E3EA 4XCSA 3C1SA 4AGSA 4ZIJA 4ZBDA 3GYKA 2WW0A 4TR1B 4EUYA 4PQHA 2P0GA 4ECCA 2ON5A 3QFAC 4HJMA 2FLSA 1JZDA 1Q4JA 3ZFBA 1O8WA 3IDVA 1LBKA 4EC0A 10GSA 5A5KA 3HVNA 5J5NA 2N5BA 3EPTA 4L5LA 1S3CA 1GUKA 4EE0A 3GX8A 1Q98A 5EPFA 3EURA 1GULA 5AIVA 2QGVA 1DBYA 3E9JB 3DIEA 3HDCA 1XW5A 2IMKA 5ECHB 2ZNMA 2R6KA 3US3A 2XBIA 4AKGA 3H79A 2O87A 3GA4A 5GZZB 3IV4A 3WGDA 1OVNA 3RBTA 1SD9A 4MF6A 3HXSA 5KN2A 2HRKA 2UV8G 5DAKA 5KN1A 4Q5FA 2H1GA 4D73B 5C04A 2WGRA 3CYNA 2FNOA 1W89A 4LL1B 1O85A 3CTGA 1GLPA 2GTUA 4QMKA 1USBA 3BJ5A 4KGIA 5DJLA 4BPYA 2AV4A 1Y6EA 3J7Yb 3VPTA 4IS0A 2GQLA 4PUAA 2CVDA 2FWHA 2C3QA 3MWHA 1A0FA 1AIUA 4MF7A 3IE3A 4O5QA 1B8XA 1F2EA 2OKAA 2JU5A 3G7JA 4ZXGA 2PGTA 4FYBA 3M8NA 3MDKA 1M2AA 3FKFA 5D9XA 2JSYA 4TKYA 5E59A 1E2YA 1BJXA 2XPEA 2I4AA 3HVVA 4AKIA 2HLSA 3TRQA 17GSA 1O8XA 1VF1A 4F0CA 1YZXA 3GIXA 4OO4A 3H8QA 1X9WB 2NDOA 4JU5A 5D9WA 2MBSA 4PX1A 2HSYA 4HQSA 5DJMA 1JZOA 3KCMA 2V2GA 4MH3A 1XXUA 3O3TA 4L8EA 1C72A 2VCVA 1ERWA 1OAZA 4O7HA 2VM2A 3U5RE 3EWLA 3FEUA 1FAAA 1XVQA 3ZIVA 1TP9A 4JEDA 4TXOA 1NHOA 3W6GA 1HYUA 1ZCPA 5CAXA 3KZQA 2PU9C 5BMUA 1WRYA 4POMA 4ZL8A 4ECIA 1IYIA 1TI3A 2X99A 3M3MA 3GH6A 2CX4A 1PN0A 3CSJA 3TCOA 4G0KA 3CMIA 3UOMA 3KXOA 5ECOB 4J57E 5GAND 1SJIA 3F8UA 1SYRA 2DC5A 3F9UA 4GSSA 3VI5A 3UARA 4NHZA 2TRXA 1OC9A 1TRWA 4KAEA 1QXHA 1I5GA 5G30A 1XG8A 1EGOA 4IGJA 2AUVA 2B3SA 3PGTA 4ZL7A 4WKWA 3EMPA 4Z7XA 2MBTA 3RHCA 5G2ZA 2X4AA 4EL1A 2YCDA 1EV9A 3IA1A 4WETA 3QAWA 1TXXA 1XZOA 1PRXA 3IXRA 3F6DA 2UZ8A 3FR3A 3L4NA 4GTUA 3KP9A 2AJQB 2REMA 1AQVA 3CRUA 1K3OA 1F3BA 4K7IA 6GSWA 1PQNA 1K0NA 2I81A 4RQXA 2O8VB 2R37A 4RI7A 3HD5A 1VF4A 5LCZA 1PMTA 4CHSA 2QC7A 3GSSA 3QOUA 5HR1A 3GKMA 4WEYA 1M9AA 3Q19A 2PVOC 3IRAA 2O36A 2AYTA 1AAZA 2EFDA 4WBJA 3QCPA 4HQZA 2WVYA 3I69A 3S9FA 1TI1A 2DMMA 3LGCA 2QA2A 3DMLA 3VI7A 2K6VA 1M3IA 2VL3A 2H72A 1PSQA 2GLRA 3UVHA 4LMWA 4PQ1A 1B9YC 4ZBBA 4AJ8A 1AUCA 1E6BA 2H73A 2D2ZA
chains in the Genus database with same CATH topology
1BG1A 1VGLA 3QAGA 1K0DA 1V58A 2LJAA 3VWUA 3APSA 1ACVA 3FK8A 3GL3A 1THOA 2B1LA 1SVLA 2EIRA 3EU4A 4IHUA 4TOPA 1FHEA 4MP4A 5LNKe 4MABA 3FRCA 2LNSA 5D9VA 4EDYA 4IVFA 4K0GA 4OWYA 1FOVA 5IQYA 1RW1A 4XTSA 2LS5A 3KM6A 3TOUA 4F9ZA 1M2BA 3HZ8A 4O32A 2JSZA 4KE3A 4DVCA 2GGTA 3GV1A 1JZRA 2DKIA 4MLYA 2N5FA 4BL7B 4N10A 1MDKA 1TK0B 2HI7A 2C0FA 2L4CA 2C3NA 4G2EA 3HCZA 2IWTA 1BG5A 4F82A 1YJ6A 1O73A 5D93A 2X49A 3IBHA 4XIHA 2HRFA 1SD8A 1DSBA 1SJ6A 4GDFA 2MMNA 4POLA 3KGKA 2H19A 2HQTA 5A34B 3V1WA 2VIMA 1G7OA 2L5LA 2VLUA 3C8EA 3TJJA 1MDIA 1ZL9A 2RIIA 2V32A 5IMAA 5A5HB 2BMXA 2PWJA 4PXOA 3BD2A 1PD21 1A2JA 5JCUA 4PNGA 2OBIA 1I9DA 4IBPA 2B7KA 2PERA 3UJ1A 2DJ1A 2LRCA 2GZYA 4X43A 4ACSA 4KDXA 1Z6MA 1SU9A 2LJKA 1TRUA 1GSDA 3K8NA 4X4JA 5ECLB 1OC9B 1HD2A 3D21A 2IFQA 4K6XA 3KJYA 1ERVA 5KN0A 2OADA 3UL3A 3QD9A 5H5QA 5D73A 1XWGA 2YWNA 2H1BA 2B7JA 3GN3A 4BA7A 1N25A 1FB6A 4GCIA 3HVSA 3ZZXA 2WULA 4YQUA 4MF5A 5B8AA 4FO5A 1GSEA 3LWAA 3LXZA 1HNAA 5CRWA 1T3BA 2VCZA 2IPAA 3HJPA 4HZ2A 3PH9A 2VL9A 3HMJG 2KLXA 3D5JA 4IQAA 3W8JA 4BVXB 3C1RA 2A4VA 5EVOA 3TKSA 1YEPA 2G2QA 2H71A 5IMZA 2DJ2A 5GSTA 4MH2A 2M80A 3WT1A 2RUEA 3UBKA 2H0HA 5DALB 2MYGA 1YEXA 4K5SA 3TRPA 4ZILA 3DKSA 4IJ3A 2HSNA 2GZPA 1Z9HA 4ZB9A 2IIYA 3D4MA 2I9HA 1RQMA 1WPIA 1BYEA 3LXTA 3VURA 2H70A 3TU3B 1T00A 4AF2A 1R5AA 2R4VA 5A1NB 1ZOFA 4MPFA 3EU3A 1AXDA 1ZYPA 3LYKA 1J08A 4HU9A 2H74A 4DEJA 3DD3A 3TJFA 2I3YA 14GSA 4EKZA 6GSUA 4JR4A 3F3QA 2AHEA 4TW5A 4GWRA 4IN0A 1A8LA 2H6XA 4XS4A 1B4PA 2PMTA 3ME7A 5J9CA 4ZB8A 4MJBA 2GS3A 2H8LA 2P31A 2YPMA 4MDCA 3VWXA 1U3IA 2OE0A 1THXA 4KDUA 3D6IA 5ABRA 4E8EA 4WR5A 3RAZA 11GSA 1FB0A 3GKKA 5IO2A 2F8AA 2VLVA 4G9HA 1W4VA 5DQYA 2V41A 3DXBA 2C0DA 4FYUA 1SVMA 2OBKA 5D96A 3TKPA 2MMOA 1PN9A 1ABAA 2A4HA 4I97A 4USSA 5IPGA 1U87A 2E7PA 4G10A 3LSZA 3ZMKA 1MDJA 4EXJA 2DBCA 2GSSA 5HR2A 5D9TA 4AKHA 6GSTA 1GTAA 2PBJA 1FVKA 1SK1A 5JCWA 3RPNA 2MMAA 3GL5A 3GH9A 4K0NA 3TKQA 3L9UA 1K0OA 4ID0A 4CY6A 1MD3A 1AC1A 2RM6A 4FYCA 2AAWA 2VM1A 2FY6A 1R26A 4YKFA 1TTZA 5KN3A 4NHWA 2R5GA 3H4KA 3C73A 2VD1A 2QKEA 2WJUA 4I5QA 1DE1A 4OFMA 4I2UA 3QFBC 3EINA 5HR0A 4ILFA 1V2AA 3TRXA 1K3YA 2E0QA 1GLQA 1Y1UA 5ECRB 2P5QA 3A5IA 3F63A 5CREA 2CVKA 2CVBA 4HDEA 2FCHA 4K5RA 3O6TA 5EY6A 2FA8A 5CP1A 4WBRD 2IL3A 3HKRA 3PR8A 3GUSA 2GQKA 1PKZA 1BEDA 2VCQA 3TJBA 4DSQA 4BVYA 1SENA 1T8EB 2WCIA 3F4RA 1GTUA 2E2GA 3ERWA 3L9VA 3LQ7A 4IJIA 1PKWA 2HSMB 4ZB7A 2IMDA 5COHA 2KP1A 4Z2UA 4X1UA 2XHFA 2CV4A 5IMVA 5ID2A 2F8FA 3EYTA 2HE3A 1LJRA 1GH2A 2A2RA 3W8SA 6GSXA 2YWOA 4YQVA 1DE2A 4MJEA 4O5RA 3M9JA 3C71A 3G7YA 2WB9A 3FZ4A 1SKRB 3GTUB 1MD4A 1QQ2A 4OO5A 2CAQA 3KMNA 1WE0A 2V1MA 3ZMLA 3VWVA 2EFHA 1TU8A 2TIRA 4EO3A 2R0PA 2R0CA 4EIPA 1Y25A 4MMMA 1XWBA 1LU4A 2OE3A 9GSSA 3CBUA 2O5VA 1M9BA 20GSA 3A2WA 2YOIA 4KH7A 3CWGA 4KA0A 1EOGA 5F05A 2FWFA 5B6NA 2CAIA 2YV7A 2XC2A 4QL9A 2LSTA 1JLVA 2EFEA 4YH2A 3CSHA 3NIVA 5G1LA 2HZEA 3IC8A 5DQSA 3H93A 2R3XA 4MK3A 1SK2A 4IQ1A 3OR5A 18GSA 1UC7A 4KB3A 2P5RA 2NTOA 4HOJA 2K8SA 2A2SA 2B1KA 3VPQA 3I6AA 4YQMA 3KH7A 1Z6NA 4TN8A 4V2NA 4K2XA 3QAVA 2FA4A 5CNWA 2YWIA 1X5EA 5J40A 5ENUA 2WS2A 4ECBA 1A24A 1X5DA 3H1NA 3FR6A 1EZKA 3C7MA 2HRKB 5DAKB 1KEBA 4K7NA 1M2DA 5ECKB 4NWYA 4JR6A 3GURA 3BCIA 1GUHA 5GSSA 4ZL9A 3FYGA 2L4QA 1NHYA 3M1GA 4GQCA 2LV3A 4V2MA 5ELAA 3FHKA 1RK4A 4Q5NA 4G0IA 5ECQB 4OD7A 4V1Ap 2EFCA 5AGYA 2JZSA 1M0UA 2HFDA 2H66A 1T7PB 1YKCA 1HNCA 5CO3A 4P3YB 4KDYA 1XWAA 4WF4A 3EVIA 4PNFA 4W66A 1JFUA 1N8JA 3Q74A 5B6MA 1S3DA 2KUCA 4LA1A 1ZGNA 2F9SA 2JACA 2HNLA 5ECMB 2VL2A 1NSWA 3IK7A 5J4YA 1PL1A 5DCGA 1MEKA 4PGTA 1ST9A 3UBLA 5ECPB 1TKDB 4EDZA 1GP1A 3TOTA 3DVXA 2H30A 4TRXA 1MTCA 2LKUA 4ISDA 3GKXA 4N0ZA 4EVMA 1A0RP 4JE1A 4MZWA 4TR1A 5JWOB 2BTOT 5BRTA 2VD0A 2FWGA 2DKHA 2XPDA 2X64A 2ZUPA 4L0WA 4HUAA 1QFNA 1EV4A 4CDOA 22GSA 7GSSA 1ZYEA 1GSYA 4AJ6A 4K8MA 4CY8A 4OMVA 3CRTA 3IAM2 2JZTA 3NZNA 2VL2C 3E0UA 2GSTA 4MCUA 4EIQA 2YZUA 3WT2A 1SL1B 2K18A 2KP2A 4ECJA 1UVZA 1SVOA 1ON4A 5A4WA 4TXOB 3A3TA 1ZMAA 2OACA 2KOKA 4ULXA 1R7HA 2GVPA 2H1AA 5IO0A 1F9MA 5BMUB 3IC4A 1O7UA 2DSAA 5G5EA 1U6TA 2GT5A 1SKWB 4POKA 3KD0A 5LD0A 2H1LA 2QSIA 2GQMA 2HXKA 4KSMA 4OCFA 3SWLA 3GRXA 1WJKA 1EP7A 3ZYWA 3ISOA 2F3MA 5A4VA 1Z3EA 3O76A 3VLNA 1Z7RA 5GAPD 1XPVA 4D73A 2LRNA 1TW9A 3TJGA 3HJOA 1M99A 4O5UA 3KIJA 3KEBA 1ILOA 3LFLA 1J9BA 4PUFC 4A5PA 1GRXA 2J9HA 3I43A 2VUPA 2YP6A 4N30A 3IPZA 2H6YA 3FW2A 1TRVA 3NOFA 2L59A 4GSNA 1PX6A 1XBSA 1URMA 3ZREA 2H0IA 1QMVA 3CXGA 5E4WA 3RHBA 2IMEA 3EE2A 3A2VA 4MZCA 4OFNA 3P7XA 2CA8A 4HS1A 1AW9A 3LW9A 1VF2A 5HFGA 5EL8A 2OE1A 1K0MA 1A2LA 4TR0A 4ZBAA 5KOWA 4L5OA 2Z9SA 2VCXA 2L6CA 4MJAA 3F3RA 4G0LA 3FY7A 2ES7A 1OKDA 4KW6A 4NV2A 2IMIA 1GWCA 5L71A 3IHQA 1VRSD 2PPTA 1EP8A 2TRCP 3HJMA 2L5OA 5CRHA 2WZ9A 2YANA 3WYWA 1WWJA 1J0FA 3SBCA 2EC4A 2O89A 1GSQA 1Z5YE 2VAFA 4HU7A 4XRAA 4F03A 4KNDA 4KX4A 4PQIA 3IHGA 4LLRA 3ZVJA 2G0FA 12GSA 1WOUA 4GSTA 4LL4B 2FGXA 1XVWA 3LYPA 2HZFA 5IOXA 4AKXB 3L78A 4LMVA 2VLTA 5B7CA 3ZRDA 3F4TA 4J56E 1FO5A 5HFKA 3HZ4A 4ZB6A 1T1VA 3TKSC 1X9SB 3J7Yk 3P90A 1WMJA 3LEFA 2H1DA 4MZBA 2PN8A 1WIKA 5CYYA 4ML6A 4TR4A 4FIWA 2XBQA 4AI6A 4GXZA 1V98A 1B4QA 1PA3A 1NM3A 2JL4A 5ELGA 2OT3A 4E8HA 5IIZA 1HNBA 1GSUA 2DJKA 4I2TA 2FWEA 1AQXA 2V6OA 2LRTA 3L9SA 2GT6A 3ZIJA 3DEXA 2CX3A 3ED3A 2CZ2A 3UEMA 3QMXA 1GNWA 3QR6A 4OCEA 3ZL5A 2QA1A 1ZZYA 1TU7A 4RI6A 1S3AA 4J2FA 4IW9A 1FG4A 3DWVA 4GRFA 6GSSA 2YJ7A 4KCAA 2AB6A 4GLTA 4NPBA 3ZFLA 4L0UA 4G19A 4Q5QA 2NBSA 5HQPA 5IMCA 5INYA 2CZ3A 4K7OA 4YAVA 3GHAA 4NV5A 4ICYA 5J9BA 4X0XA 3IOSA 2CT6A 1GSFA 2OA7A 2HRNA 4KUNA 3PPUA 1U3AA 4XS1A 4YKGA 2C8UA 2DIZA 1M7TA 2M72A 1O6JA 2CQ9A 5J4UA 4I6XA 1HQOA 4Z2RA 2IFQB 4IKHA 2LUSA 2EIQA 2LQOA 3LJRA 3KMOA 2NVLA 3GNJA 1GTBA 1YVLA 2K8VA 4G01A 1YY7A 1EGRA 5J41A 2IMFA 1XFLA 4BWSA 3GX0A 1QK8A 2RM5A 1EEMA 5IOWA 2WDUA 2NPBA 5F8BA 1GTIA 3R3EA 1K0CA 5KOXA 3P2AA 5H5RA 5A4UA 3ZVJD 2WFCA 2E2MA 2DJJA 2LTKA 5AISA 4IP6A 5JWRB 1SK0A 3HYPA 4YAPA 1YF0A 4MA9A 1FOHA 1EEJA 3F6FA 1G6WA 3VFIA 4RUVA 2F51A 5G1KA 1XW9A 3LG6A 3PINA 3FZAA 1B9XC 1JLWA 5FWGA 4BL7A 4F0BA 1GSSA 4KCEA 2VO4A 3CTFA 1XW6A 3D0ZA 1ERTA 3TKRA 4PURA 3DRNA 4K1FA 1TK5B 2YWMA 2B5EA 1T4YA 2V6KA 5CRDA 2ZCTA 2HSNB 1PGTA 5A34A 2B6MA 2DMLA 4K2DA 5H5SA 2R2JA 3MAKA 3MSZA 4FH8A 3DYRA 2J23A 13GSA 2OJLA 2GSRA 5JWQB 2LQQA 1A8YA 2I1UA 1Z7PA 5A5HA 1BX9A 3G9BA 1SKSB 4DSSA 1X0RA 1H4OA 4XS4B 3D22A 3KH9A 3APOA 3TKSE 3BOAA 3VWWA 5G31A 5AIXA 5IMFA 2L57A 4POBA 2C3TA 1TRSA 1B48A 3G7IA 5IMDA 4TVEA 3MYDA 4OFTA 1T4ZA 1OE7A 4KSOA 5J47A 3GMFA 3N9JA 3QPMA 3IK9A 2IJYA 3BCKA 2MMZA 2B5XA 1K0BA 1G6YA 3U6VA 1F37A 3TB2A 1O81A 3UVTA 2VKZG 3P8WA 4HZ4A 1SL0B 1OE8A 4HI7A 3WGEA 2RUFA 2H6ZA 1A23A 4MNNA 1FW1A 4BWQA 3EMXA 3RDWA 1VF3A 3Q18A 1OYJA 2YN1A 1WP0A 1ERUA 5KEJA 1GL8A 5DCHA 5HR3A 2H76A 3TGZA 2JZRA 1X5CA 3APQA 2C0EA 4XHMA 2ON7A 3UMAA 4JBBA 2EIOA 6GSYA 2GSQA 2DJ3A 3KP8A 3QDNA 1JZWA 1XOBA 3TJKA 3JCML 4BVXA 4V2LA 3F0IA 2R0GA 2X8CA 2DJ0A 1PL2A 3VK9A 2GZZA 1V9WA 3M9KA 8GSSA 1F3AA 3AY8A 4N11A 2H75A 3I9V2 2LJRA 5DALA 4N0VA 1NW2A 3FZ5A 3A2XA 2H0GA 3F4SA 4I8BA 1YDKA 4WR4A 1CQHA 2VCTA 6GSVA 3DGQA 1BQ7A 2K9FA 5A1NA 2KHPA 2ALBA 3KTBA 2GDRA 1G7EA 1PX7A 2DLXA 4JRRA 2IN3A 3CSIA 1R5PA 1AQWA 2B5YA 2HYXA 5F06A 1GNEA 1TJDA 3ZLPA 2BJXA 1TOFA 1EWXA 4BVYB 1X9MB 3IR4A 4WXTA 1TXUA 1V40A 4IELA 1UN2A 2O7KA 1BAYA 3WD6A 4EF0A 3A5WA 2MZCA 1XWKA 3L0HA 5ID2B 5DBQA 2N5AA 1TDIA 1SJZA 2LNTA 1U88A 5DVBA 2FD3A 4PTSA 1KNGA 5CRGA 5DDLA 1XIYA 4NMUA 5F0GA 2HRAA 4HJ2A 5JCGA 2H01A 5B8BA 2HSHA 3FR9A 4RQRA 4KF9A 1K0AA 3HVXA 3GSTA 4MJCA 1R4WA 3MIXA 1JHBA 1G0TA 4DSRA 1YF1A 2PVQA 2WRTA 1UA5A 4QQ7A 4Q5RA 4K9ZA 2A2PA 4NAXA 4TXVA 4DSSB 3R2QA 4NXIA 1BF5A 4GF0A 3HHVA 5AN1A 3N5OA 5FT3A 1KBNA 5F07A 3ZITA 1DUGA 2HZEB 2M46A 4XRDA 2L6DA 4TR3A 3MNGA 5FHIA 1FVJA 5C00A 1OC8A 3UIWA 5IM9A 2VCWA 3Q6OA 3ERFA 2LEGA 5ECSA 1XCCA 3TUEA 3M0FA 3GKNA 1OKTA 3RPPA 1QUWA 3ME8A 3UAPA 4QL7A 1H75A 2YV9A 1YKAA 19GSA 1CQGA 3BBYA 1IYHA 5ECIB 4WF5A 4JZQA 5J4VA 2HT9A 3KTLA 3TDGA 1KTEA 2X8GA 1TK8B 2C80A 3WGXA 3D4TA 1A2MA 3IAS2 4AJ7A 2DIYA 3HA9A 4V1Ag 1ZYQB 3ERGA 4XS6A 3ZTLA 1V57A 2RLIA 5D8IA 3EC3A 1XOAA 3HY2A 2HSMA 1QGVA 4GQFA 1EOHA 2FHEA 1OC3A 2O85A 4E68A 2PUKC 5G5FA 1ML6A 1SL2B 4IP1A 1F6MC 4Z2TA 1N2AA 4H86A 4HEA2 2YJHA 1K3LA 2YNXA 2C0GA 4N3ZA 1GUMA 4FQUA 1XWCA 2VOCA 4F2IA 2C4JA 1SYXA 2C1YA 3DVWA 3GFKA 2JADA 3GTUA 1YQ1A 5HFIA 5J3RA 3FMWA 4MPGA 3LORA 16GSA 2X8HA 2FUG2 5IPHA 1ZYNA 3FZ9A 4ML1A 4O92A 5ECNB 4CW9A 2YZHA 3E3EA 4XCSA 3C1SA 4AGSA 4ZIJA 4ZBDA 3GYKA 4TR1B 4EUYA 4PQHA 2P0GA 4ECCA 2ON5A 3QFAC 4HJMA 2FLSA 1JZDA 1Q4JA 3ZFBA 1O8WA 3IDVA 1LBKA 4EC0A 10GSA 5A5KA 5J5NA 2N5BA 3EPTA 4L5LA 1S3CA 1GUKA 4EE0A 3GX8A 1Q98A 5EPFA 3EURA 1GULA 5AIVA 2QGVA 1DBYA 3E9JB 3DIEA 3HDCA 1XW5A 2IMKA 5ECHB 2ZNMA 2R6KA 3US3A 2XBIA 4AKGA 3H79A 2O87A 3GA4A 5GZZB 3IV4A 3WGDA 1OVNA 3RBTA 1SD9A 4MF6A 3HXSA 5KN2A 2HRKA 2UV8G 5DAKA 5KN1A 4Q5FA 2H1GA 4D73B 5C04A 2WGRA 3CYNA 2FNOA 1W89A 4LL1B 1O85A 3CTGA 1GLPA 2GTUA 4QMKA 1USBA 3BJ5A 4KGIA 5DJLA 4BPYA 2AV4A 1Y6EA 3J7Yb 3VPTA 4IS0A 2GQLA 4PUAA 2CVDA 2FWHA 2C3QA 3MWHA 1A0FA 1AIUA 4MF7A 3IE3A 4O5QA 1B8XA 1F2EA 2OKAA 2JU5A 3G7JA 4ZXGA 2PGTA 4FYBA 3M8NA 3MDKA 1M2AA 3FKFA 5D9XA 2JSYA 4TKYA 5E59A 1E2YA 1BJXA 2XPEA 2I4AA 3HVVA 4AKIA 2HLSA 3TRQA 17GSA 1O8XA 1VF1A 4F0CA 1YZXA 3GIXA 4OO4A 3H8QA 1X9WB 2NDOA 4JU5A 5D9WA 2MBSA 4PX1A 2HSYA 4HQSA 5DJMA 1JZOA 3KCMA 2V2GA 4MH3A 1XXUA 3O3TA 4L8EA 1C72A 2VCVA 1ERWA 1OAZA 4O7HA 2VM2A 3U5RE 3EWLA 3FEUA 1FAAA 1XVQA 3ZIVA 1TP9A 4JEDA 4TXOA 1NHOA 3W6GA 1HYUA 1ZCPA 5CAXA 3KZQA 2PU9C 5BMUA 1WRYA 4POMA 4ZL8A 4ECIA 1IYIA 1TI3A 2X99A 3M3MA 3GH6A 2CX4A 1PN0A 3CSJA 3TCOA 4G0KA 3CMIA 3UOMA 3KXOA 5ECOB 4J57E 5GAND 1SJIA 3F8UA 1SYRA 2DC5A 3F9UA 4GSSA 3VI5A 3UARA 4NHZA 2TRXA 1OC9A 1TRWA 4KAEA 1QXHA 1I5GA 5G30A 1EGOA 4IGJA 2AUVA 2B3SA 3PGTA 4ZL7A 4WKWA 3EMPA 4Z7XA 2MBTA 3RHCA 5G2ZA 2X4AA 4EL1A 2YCDA 1EV9A 3IA1A 4WETA 3QAWA 1TXXA 1XZOA 1PRXA 3IXRA 3F6DA 2UZ8A 3FR3A 3L4NA 4GTUA 3KP9A 2AJQB 2REMA 1AQVA 3CRUA 1K3OA 1F3BA 4K7IA 6GSWA 1PQNA 1K0NA 2I81A 4RQXA 2O8VB 2R37A 4RI7A 3HD5A 1VF4A 5LCZA 1PMTA 4CHSA 2QC7A 3GSSA 3QOUA 5HR1A 3GKMA 4WEYA 1M9AA 3Q19A 2PVOC 3IRAA 2AYTA 1AAZA 2EFDA 4WBJA 3QCPA 4HQZA 3I69A 3S9FA 1TI1A 2DMMA 3LGCA 2QA2A 3DMLA 3VI7A 2K6VA 2VL3A 2H72A 1PSQA 2GLRA 3UVHA 4LMWA 4PQ1A 1B9YC 4ZBBA 4AJ8A 1AUCA 1E6BA 2H73A 2D2ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VGL A;  3QAG A;  1K0D A;  1V58 A;  2LJA A;  3VWU A;  3APS A;  1ACV A;  3FK8 A;  3GL3 A;  1THO A;  2B1L A;  2EIR A;  3EU4 A;  4IHU A;  4TOP A;  1FHE A;  4MP4 A;  5LNK e;  4MAB A;  3FRC A;  2LNS A;  5D9V A;  4EDY A;  4IVF A;  4K0G A;  4OWY A;  1FOV A;  5IQY A;  1RW1 A;  4XTS A;  2LS5 A;  3KM6 A;  3TOU A;  4F9Z A;  1M2B A;  3HZ8 A;  4O32 A;  2JSZ A;  4KE3 A;  4DVC A;  2GGT A;  3GV1 A;  1JZR A;  4MLY A;  2N5F A;  4BL7 B;  4N10 A;  1MDK A;  1TK0 B;  4G2E A;  2C0F A;  2HI7 A;  2C3N A;  2L4C A;  3HCZ A;  2IWT A;  1BG5 A;  4F82 A;  1YJ6 A;  1O73 A;  5D93 A;  3IBH A;  4XIH A;  2HRF A;  1SD8 A;  1DSB A;  1SJ6 A;  4POL A;  2MMN A;  3KGK A;  2H19 A;  2HQT A;  3V1W A;  2VIM A;  1G7O A;  2L5L A;  2VLU A;  3C8E A;  3TJJ A;  1MDI A;  1ZL9 A;  2RII A;  2V32 A;  5IMA A;  2BMX A;  2PWJ A;  4PXO A;  3BD2 A;  1PD2 1;  1A2J A;  5JCU A;  4PNG A;  2OBI A;  1I9D A;  4IBP A;  2B7K A;  2PER A;  3UJ1 A;  2DJ1 A;  2LRC A;  2GZY A;  4X43 A;  4ACS A;  4KDX A;  1Z6M A;  1SU9 A;  2LJK A;  1TRU A;  1GSD A;  3K8N A;  5ECL B;  1OC9 B;  1HD2 A;  3D21 A;  2IFQ A;  4K6X A;  3KJY A;  1ERV A;  5KN0 A;  2OAD A;  3UL3 A;  3QD9 A;  5H5Q A;  5D73 A;  1XWG A;  2YWN A;  2H1B A;  2B7J A;  3GN3 A;  4BA7 A;  1FB6 A;  4GCI A;  3HVS A;  3ZZX A;  2WUL A;  4YQU A;  4MF5 A;  5B8A A;  4FO5 A;  1GSE A;  3LWA A;  3LXZ A;  1HNA A;  5CRW A;  1T3B A;  2VCZ A;  2IPA A;  3HJP A;  4HZ2 A;  3PH9 A;  2VL9 A;  2KLX A;  3D5J A;  4IQA A;  3W8J A;  4BVX B;  3C1R A;  2A4V A;  5EVO A;  3TKS A;  1YEP A;  2G2Q A;  2H71 A;  5IMZ A;  2DJ2 A;  5GST A;  4MH2 A;  2M80 A;  3WT1 A;  2RUE A;  3UBK A;  2H0H A;  5DAL B;  2MYG A;  1YEX A;  3TRP A;  4ZIL A;  3DKS A;  4IJ3 A;  2GZP A;  1Z9H A;  4ZB9 A;  2IIY A;  3D4M A;  2I9H A;  1RQM A;  1WPI A;  1BYE A;  3LXT A;  3VUR A;  2H70 A;  1T00 A;  4AF2 A;  1R5A A;  2R4V A;  1ZOF A;  4MPF A;  3EU3 A;  1AXD A;  3LYK A;  1J08 A;  4HU9 A;  2H74 A;  4DEJ A;  3DD3 A;  3TJF A;  2I3Y A;  14GS A;  4EKZ A;  6GSU A;  4JR4 A;  3F3Q A;  2AHE A;  4TW5 A;  4GWR A;  4IN0 A;  1A8L A;  2H6X A;  4XS4 A;  1B4P A;  2PMT A;  3ME7 A;  5J9C A;  4ZB8 A;  4MJB A;  2GS3 A;  2H8L A;  2P31 A;  2YPM A;  4MDC A;  3VWX A;  1U3I A;  2OE0 A;  1THX A;  4KDU A;  3D6I A;  5ABR A;  4E8E A;  4WR5 A;  3RAZ A;  11GS A;  1FB0 A;  3GKK A;  5IO2 A;  2F8A A;  2VLV A;  4G9H A;  1W4V A;  5DQY A;  2V41 A;  3DXB A;  2C0D A;  4FYU A;  2OBK A;  5D96 A;  3TKP A;  2MMO A;  1PN9 A;  1ABA A;  4I97 A;  4USS A;  5IPG A;  1U87 A;  2E7P A;  4G10 A;  3LSZ A;  3ZMK A;  1MDJ A;  4EXJ A;  2DBC A;  2GSS A;  5HR2 A;  5D9T A;  6GST A;  1GTA A;  2PBJ A;  1FVK A;  1SK1 A;  5JCW A;  3RPN A;  2MMA A;  3GL5 A;  3GH9 A;  4K0N A;  3TKQ A;  3L9U A;  1K0O A;  4ID0 A;  1MD3 A;  1AC1 A;  2RM6 A;  4FYC A;  2AAW A;  2VM1 A;  2FY6 A;  1R26 A;  1TTZ A;  5KN3 A;  4NHW A;  2R5G A;  3H4K A;  3C73 A;  2VD1 A;  2QKE A;  2WJU A;  4I5Q A;  1DE1 A;  4OFM A;  4I2U A;  3QFB C;  3EIN A;  5HR0 A;  4ILF A;  1V2A A;  3TRX A;  1K3Y A;  2E0Q A;  1GLQ A;  5ECR B;  2P5Q A;  3F63 A;  5CRE A;  2CVK A;  2CVB A;  4HDE A;  2FCH A;  3O6T A;  5EY6 A;  2FA8 A;  5CP1 A;  4WBR D;  2IL3 A;  3HKR A;  3PR8 A;  3GUS A;  2GQK A;  1PKZ A;  1BED A;  2VCQ A;  3TJB A;  4DSQ A;  4BVY A;  1SEN A;  1T8E B;  2WCI A;  3F4R A;  1GTU A;  2E2G A;  3ERW A;  3L9V A;  3LQ7 A;  4IJI A;  1PKW A;  2HSM B;  2IMD A;  5COH A;  2KP1 A;  4X1U A;  2XHF A;  2CV4 A;  5IMV A;  5ID2 A;  2F8F A;  3EYT A;  2HE3 A;  1LJR A;  1GH2 A;  2A2R A;  3W8S A;  6GSX A;  2YWO A;  4YQV A;  1DE2 A;  4MJE A;  4O5R A;  3M9J A;  3C71 A;  3G7Y A;  2WB9 A;  3FZ4 A;  1SKR B;  3GTU B;  1MD4 A;  1QQ2 A;  4OO5 A;  2CAQ A;  3KMN A;  1WE0 A;  2V1M A;  3ZML A;  3VWV A;  1TU8 A;  2TIR A;  4EO3 A;  1Y25 A;  4MMM A;  1XWB A;  1LU4 A;  2OE3 A;  9GSS A;  3CBU A;  1M9B A;  20GS A;  3A2W A;  2YOI A;  4KH7 A;  4KA0 A;  1EOG A;  5F05 A;  2FWF A;  5B6N A;  2CAI A;  2YV7 A;  2XC2 A;  4QL9 A;  2LST A;  1JLV A;  4YH2 A;  3CSH A;  3NIV A;  5G1L A;  2HZE A;  3IC8 A;  5DQS A;  3H93 A;  2R3X A;  4MK3 A;  1SK2 A;  4IQ1 A;  3OR5 A;  18GS A;  1UC7 A;  4KB3 A;  2P5R A;  2NTO A;  4HOJ A;  2K8S A;  2A2S A;  2B1K A;  3VPQ A;  3I6A A;  4YQM A;  3KH7 A;  1Z6N A;  4TN8 A;  4V2N A;  3QAV A;  2FA4 A;  5CNW A;  2YWI A;  1X5E A;  5ENU A;  2WS2 A;  4ECB A;  1A24 A;  1X5D A;  3H1N A;  3FR6 A;  1EZK A;  3C7M A;  2HRK B;  5DAK B;  1KEB A;  4K7N A;  1M2D A;  5ECK B;  4NWY A;  4JR6 A;  3GUR A;  3BCI A;  1GUH A;  5GSS A;  4ZL9 A;  3FYG A;  2L4Q A;  1NHY A;  3M1G A;  4GQC A;  2LV3 A;  4V2M A;  5ELA A;  3FHK A;  1RK4 A;  4Q5N A;  4G0I A;  5ECQ B;  4OD7 A;  4V1A p;  5AGY A;  2JZS A;  1M0U A;  2HFD A;  2H66 A;  1T7P B;  1YKC A;  1HNC A;  5CO3 A;  4P3Y B;  4KDY A;  1XWA A;  4WF4 A;  3EVI A;  4PNF A;  1JFU A;  1N8J A;  3Q74 A;  5B6M A;  1S3D A;  2KUC A;  4LA1 A;  1ZGN A;  2F9S A;  2JAC A;  2HNL A;  5ECM B;  2VL2 A;  1NSW A;  3IK7 A;  1PL1 A;  5DCG A;  1MEK A;  4PGT A;  1ST9 A;  3UBL A;  5ECP B;  1TKD B;  4EDZ A;  1GP1 A;  3TOT A;  3DVX A;  2H30 A;  4TRX A;  1MTC A;  2LKU A;  4ISD A;  3GKX A;  4N0Z A;  4EVM A;  1A0R P;  4JE1 A;  4MZW A;  4TR1 A;  5JWO B;  2BTO T;  2VD0 A;  2FWG A;  2XPD A;  2ZUP A;  2X64 A;  4L0W A;  4HUA A;  1QFN A;  1EV4 A;  4CDO A;  22GS A;  7GSS A;  1ZYE A;  1GSY A;  4AJ6 A;  4K8M A;  4OMV A;  3CRT A;  3IAM 2;  2JZT A;  3NZN A;  2VL2 C;  3E0U A;  2GST A;  4MCU A;  2YZU A;  3WT2 A;  1SL1 B;  2K18 A;  2KP2 A;  4ECJ A;  1UVZ A;  1ON4 A;  5A4W A;  4TXO B;  3A3T A;  1ZMA A;  2OAC A;  2KOK A;  4ULX A;  1R7H A;  2GVP A;  2H1A A;  5IO0 A;  1F9M A;  3IC4 A;  1O7U A;  2DSA A;  5G5E A;  1U6T A;  2GT5 A;  1SKW B;  4POK A;  3KD0 A;  5LD0 A;  2QSI A;  2GQM A;  2HXK A;  4KSM A;  4OCF A;  3SWL A;  3GRX A;  1WJK A;  1EP7 A;  3ZYW A;  3ISO A;  2F3M A;  5A4V A;  1Z3E A;  3O76 A;  3VLN A;  1Z7R A;  5GAP D;  1XPV A;  4D73 A;  2LRN A;  1TW9 A;  3TJG A;  3HJO A;  1M99 A;  3KIJ A;  3KEB A;  1ILO A;  3LFL A;  1J9B A;  4PUF C;  1GRX A;  2J9H A;  3I43 A;  2VUP A;  2YP6 A;  4N30 A;  3IPZ A;  2H6Y A;  3FW2 A;  1TRV A;  3NOF A;  2L59 A;  4GSN A;  1PX6 A;  1XBS A;  1URM A;  3ZRE A;  2H0I A;  1QMV A;  3CXG A;  5E4W A;  3RHB A;  2IME A;  3EE2 A;  3A2V A;  4MZC A;  4OFN A;  3P7X A;  2CA8 A;  4HS1 A;  1AW9 A;  1VF2 A;  5HFG A;  5EL8 A;  2OE1 A;  1K0M A;  1A2L A;  4TR0 A;  4ZBA A;  4L5O A;  2Z9S A;  2VCX A;  2L6C A;  4MJA A;  3F3R A;  4G0L A;  3FY7 A;  2ES7 A;  1OKD A;  4KW6 A;  4NV2 A;  2IMI A;  1GWC A;  5L71 A;  3IHQ A;  1VRS D;  2PPT A;  1EP8 A;  2TRC P;  3HJM A;  2L5O A;  5CRH A;  2WZ9 A;  2YAN A;  3WYW A;  1WWJ A;  1J0F A;  3SBC A;  2EC4 A;  2O89 A;  1GSQ A;  1Z5Y E;  2VAF A;  4HU7 A;  4XRA A;  4F03 A;  4KND A;  4KX4 A;  4PQI A;  4LLR A;  3ZVJ A;  2G0F A;  12GS A;  1WOU A;  4GST A;  4LL4 B;  2FGX A;  1XVW A;  3LYP A;  2HZF A;  5IOX A;  3L78 A;  4LMV A;  2VLT A;  5B7C A;  3ZRD A;  3F4T A;  4J56 E;  1FO5 A;  5HFK A;  3HZ4 A;  4ZB6 A;  1T1V A;  3TKS C;  1X9S B;  3J7Y k;  3P90 A;  1WMJ A;  3LEF A;  2H1D A;  4MZB A;  2PN8 A;  1WIK A;  5CYY A;  4ML6 A;  4TR4 A;  4FIW A;  2XBQ A;  4GXZ A;  1V98 A;  1B4Q A;  1PA3 A;  1NM3 A;  2JL4 A;  5ELG A;  4E8H A;  5IIZ A;  1HNB A;  1GSU A;  2DJK A;  4I2T A;  2FWE A;  1AQX A;  2V6O A;  2LRT A;  3L9S A;  2GT6 A;  3ZIJ A;  3DEX A;  2CX3 A;  3ED3 A;  2CZ2 A;  3UEM A;  3QMX A;  1GNW A;  3QR6 A;  4OCE A;  3ZL5 A;  1ZZY A;  1TU7 A;  4RI6 A;  1S3A A;  4J2F A;  4IW9 A;  1FG4 A;  3DWV A;  4GRF A;  6GSS A;  2YJ7 A;  4KCA A;  2AB6 A;  4GLT A;  4NPB A;  3ZFL A;  4L0U A;  4G19 A;  4Q5Q A;  2NBS A;  5HQP A;  5IMC A;  5INY A;  2CZ3 A;  4K7O A;  4YAV A;  3GHA A;  4NV5 A;  5J9B A;  4X0X A;  3IOS A;  2CT6 A;  1GSF A;  2OA7 A;  2HRN A;  4KUN A;  3PPU A;  1U3A A;  4XS1 A;  2C8U A;  2DIZ A;  1M7T A;  2M72 A;  1O6J A;  2CQ9 A;  5J4U A;  4I6X A;  1HQO A;  2IFQ B;  4IKH A;  2LUS A;  2EIQ A;  2LQO A;  3LJR A;  3KMO A;  2NVL A;  3GNJ A;  1GTB A;  2K8V A;  1YY7 A;  1EGR A;  5J41 A;  2IMF A;  1XFL A;  4BWS A;  3GX0 A;  1QK8 A;  2RM5 A;  1EEM A;  5IOW A;  2WDU A;  2NPB A;  5F8B A;  1GTI A;  3R3E A;  1K0C A;  3P2A A;  5H5R A;  5A4U A;  3ZVJ D;  2WFC A;  2E2M A;  2DJJ A;  2LTK A;  5AIS A;  4IP6 A;  5JWR B;  1SK0 A;  3HYP A;  4YAP A;  1YF0 A;  4MA9 A;  1EEJ A;  3F6F A;  1G6W A;  3VFI A;  4RUV A;  2F51 A;  5G1K A;  1XW9 A;  3LG6 A;  3PIN A;  3FZA A;  1B9X C;  1JLW A;  5FWG A;  4BL7 A;  4F0B A;  1GSS A;  4KCE A;  2VO4 A;  3CTF A;  1XW6 A;  3D0Z A;  1ERT A;  3TKR A;  4PUR A;  3DRN A;  4K1F A;  1TK5 B;  2YWM A;  2B5E A;  1T4Y A;  2V6K A;  5CRD A;  2ZCT A;  2HSN B;  1PGT A;  2B6M A;  2DML A;  4K2D A;  5H5S A;  2R2J A;  3MAK A;  3MSZ A;  4FH8 A;  3DYR A;  2J23 A;  13GS A;  2OJL A;  2GSR A;  5JWQ B;  2LQQ A;  1A8Y A;  2I1U A;  1Z7P A;  1BX9 A;  3G9B A;  1SKS B;  4DSS A;  1X0R A;  1H4O A;  4XS4 B;  3D22 A;  3KH9 A;  3APO A;  3TKS E;  3BOA A;  3VWW A;  5G31 A;  5AIX A;  5IMF A;  2L57 A;  4POB A;  2C3T A;  1TRS A;  1B48 A;  3G7I A;  5IMD A;  4TVE A;  4OFT A;  1T4Z A;  1OE7 A;  4KSO A;  3GMF A;  3N9J A;  3QPM A;  3IK9 A;  2IJY A;  3BCK A;  2MMZ A;  2B5X A;  1K0B A;  1G6Y A;  3U6V A;  1F37 A;  3TB2 A;  1O81 A;  3UVT A;  3P8W A;  4HZ4 A;  1SL0 B;  1OE8 A;  4HI7 A;  3WGE A;  2RUF A;  2H6Z A;  1A23 A;  1FW1 A;  4BWQ A;  3EMX A;  3RDW A;  1VF3 A;  3Q18 A;  1OYJ A;  2YN1 A;  1WP0 A;  1ERU A;  5KEJ A;  1GL8 A;  5DCH A;  5HR3 A;  2H76 A;  3TGZ A;  2JZR A;  1X5C A;  3APQ A;  2C0E A;  4XHM A;  2ON7 A;  3UMA A;  4JBB A;  2EIO A;  6GSY A;  2GSQ A;  2DJ3 A;  3KP8 A;  3QDN A;  1JZW A;  1XOB A;  3TJK A;  3JCM L;  4BVX A;  4V2L A;  3F0I A;  2X8C A;  2DJ0 A;  1PL2 A;  3VK9 A;  2GZZ A;  1V9W A;  3M9K A;  8GSS A;  1F3A A;  3AY8 A;  4N11 A;  2H75 A;  3I9V 2;  2LJR A;  5DAL A;  4N0V A;  1NW2 A;  3FZ5 A;  3A2X A;  2H0G A;  3F4S A;  4I8B A;  1YDK A;  4WR4 A;  1CQH A;  2VCT A;  6GSV A;  3DGQ A;  1BQ7 A;  2K9F A;  2KHP A;  2ALB A;  3KTB A;  2GDR A;  1G7E A;  1PX7 A;  2DLX A;  4JRR A;  2IN3 A;  3CSI A;  1R5P A;  1AQW A;  2B5Y A;  2HYX A;  5F06 A;  1GNE A;  1TJD A;  3ZLP A;  2BJX A;  1TOF A;  1EWX A;  4BVY B;  1X9M B;  3IR4 A;  4WXT A;  1V40 A;  4IEL A;  1UN2 A;  2O7K A;  1BAY A;  3WD6 A;  4EF0 A;  3A5W A;  2MZC A;  1XWK A;  3L0H A;  5ID2 B;  5DBQ A;  2N5A A;  1TDI A;  1SJZ A;  2LNT A;  1U88 A;  5DVB A;  2FD3 A;  4PTS A;  1KNG A;  5CRG A;  5DDL A;  1XIY A;  4NMU A;  5F0G A;  2HRA A;  4HJ2 A;  5JCG A;  2H01 A;  5B8B A;  2HSH A;  3FR9 A;  4RQR A;  4KF9 A;  1K0A A;  3HVX A;  3GST A;  4MJC A;  1R4W A;  1JHB A;  1G0T A;  4DSR A;  1YF1 A;  2PVQ A;  2WRT A;  1UA5 A;  4QQ7 A;  4Q5R A;  4K9Z A;  4NAX A;  4TXV A;  4DSS B;  3R2Q A;  4NXI A;  4GF0 A;  3HHV A;  5AN1 A;  3N5O A;  5FT3 A;  1KBN A;  5F07 A;  3ZIT A;  1DUG A;  2HZE B;  2M46 A;  4XRD A;  2L6D A;  4TR3 A;  3MNG A;  5FHI A;  1FVJ A;  5C00 A;  1OC8 A;  3UIW A;  5IM9 A;  2VCW A;  3Q6O A;  3ERF A;  2LEG A;  5ECS A;  1XCC A;  3TUE A;  3M0F A;  3GKN A;  1OKT A;  3RPP A;  1QUW A;  3ME8 A;  3UAP A;  4QL7 A;  1H75 A;  2YV9 A;  1YKA A;  19GS A;  1CQG A;  3BBY A;  1IYH A;  5ECI B;  4WF5 A;  4JZQ A;  2HT9 A;  3KTL A;  3TDG A;  1KTE A;  2X8G A;  1TK8 B;  2C80 A;  3WGX A;  3D4T A;  1A2M A;  3IAS 2;  4AJ7 A;  2DIY A;  3HA9 A;  4V1A g;  1ZYQ B;  3ERG A;  4XS6 A;  3ZTL A;  1V57 A;  2RLI A;  5D8I A;  3EC3 A;  1XOA A;  3HY2 A;  2HSM A;  1QGV A;  4GQF A;  1EOH A;  2FHE A;  1OC3 A;  2O85 A;  2PUK C;  5G5F A;  1ML6 A;  1SL2 B;  4IP1 A;  1F6M C;  1N2A A;  4H86 A;  4HEA 2;  2YJH A;  1K3L A;  2YNX A;  2C0G A;  1GUM A;  4FQU A;  1XWC A;  2VOC A;  4F2I A;  2C4J A;  1SYX A;  2C1Y A;  3DVW A;  3GFK A;  2JAD A;  3GTU A;  1YQ1 A;  5HFI A;  5J3R A;  4MPG A;  3LOR A;  16GS A;  2X8H A;  2FUG 2;  5IPH A;  3FZ9 A;  4ML1 A;  4O92 A;  5ECN B;  4CW9 A;  2YZH A;  3E3E A;  4XCS A;  3C1S A;  4AGS A;  4ZIJ A;  4ZBD A;  3GYK A;  4TR1 B;  4EUY A;  4PQH A;  2P0G A;  4ECC A;  2ON5 A;  3QFA C;  4HJM A;  2FLS A;  1JZD A;  1Q4J A;  3ZFB A;  1O8W A;  3IDV A;  1LBK A;  4EC0 A;  10GS A;  5A5K A;  5J5N A;  2N5B A;  4L5L A;  1S3C A;  1GUK A;  4EE0 A;  3GX8 A;  1Q98 A;  5EPF A;  3EUR A;  1GUL A;  5AIV A;  2QGV A;  1DBY A;  3E9J B;  3DIE A;  3HDC A;  1XW5 A;  2IMK A;  5ECH B;  2ZNM A;  2R6K A;  3US3 A;  2XBI A;  3H79 A;  2O87 A;  3GA4 A;  5GZZ B;  3IV4 A;  3WGD A;  1OVN A;  3RBT A;  1SD9 A;  4MF6 A;  3HXS A;  5KN2 A;  2HRK A;  5DAK A;  5KN1 A;  4Q5F A;  2H1G A;  4D73 B;  5C04 A;  2WGR A;  3CYN A;  2FNO A;  1W89 A;  4LL1 B;  1O85 A;  3CTG A;  1GLP A;  2GTU A;  1USB A;  3BJ5 A;  4KGI A;  5DJL A;  4BPY A;  2AV4 A;  1Y6E A;  3J7Y b;  3VPT A;  4IS0 A;  2GQL A;  4PUA A;  2CVD A;  2FWH A;  2C3Q A;  3MWH A;  1A0F A;  1AIU A;  4MF7 A;  3IE3 A;  1B8X A;  1F2E A;  2OKA A;  2JU5 A;  3G7J A;  4ZXG A;  2PGT A;  4FYB A;  3M8N A;  3MDK A;  1M2A A;  3FKF A;  5D9X A;  2JSY A;  4TKY A;  5E59 A;  1E2Y A;  1BJX A;  2XPE A;  2I4A A;  3HVV A;  2HLS A;  3TRQ A;  17GS A;  1O8X A;  1VF1 A;  4F0C A;  1YZX A;  3GIX A;  4OO4 A;  3H8Q A;  1X9W B;  2NDO A;  4JU5 A;  5D9W A;  2MBS A;  4PX1 A;  2HSY A;  4HQS A;  5DJM A;  1JZO A;  3KCM A;  2V2G A;  4MH3 A;  1XXU A;  3O3T A;  4L8E A;  1C72 A;  2VCV A;  1ERW A;  1OAZ A;  4O7H A;  2VM2 A;  3U5R E;  3EWL A;  3FEU A;  1FAA A;  1XVQ A;  3ZIV A;  1TP9 A;  4JED A;  4TXO A;  1NHO A;  3W6G A;  1HYU A;  1ZCP A;  5CAX A;  3KZQ A;  2PU9 C;  5BMU A;  1WRY A;  4POM A;  4ZL8 A;  4ECI A;  1IYI A;  1TI3 A;  2X99 A;  3M3M A;  3GH6 A;  2CX4 A;  3CSJ A;  3TCO A;  4G0K A;  3CMI A;  3UOM A;  3KXO A;  5ECO B;  4J57 E;  5GAN D;  1SJI A;  3F8U A;  1SYR A;  2DC5 A;  3F9U A;  4GSS A;  3VI5 A;  3UAR A;  4NHZ A;  2TRX A;  1OC9 A;  1TRW A;  4KAE A;  1QXH A;  1I5G A;  5G30 A;  1EGO A;  4IGJ A;  2AUV A;  2B3S A;  3PGT A;  4ZL7 A;  4WKW A;  3EMP A;  4Z7X A;  2MBT A;  3RHC A;  5G2Z A;  4EL1 A;  2YCD A;  1EV9 A;  3IA1 A;  4WET A;  3QAW A;  1TXX A;  1XZO A;  1PRX A;  3IXR A;  3F6D A;  2UZ8 A;  3FR3 A;  3L4N A;  4GTU A;  3KP9 A;  2AJQ B;  2REM A;  1AQV A;  3CRU A;  1K3O A;  1F3B A;  4K7I A;  6GSW A;  1PQN A;  1K0N A;  2I81 A;  4RQX A;  2O8V B;  2R37 A;  4RI7 A;  3HD5 A;  1VF4 A;  5LCZ A;  1PMT A;  4CHS A;  2QC7 A;  3GSS A;  3QOU A;  5HR1 A;  3GKM A;  4WEY A;  1M9A A;  3Q19 A;  2PVO C;  3IRA A;  2AYT A;  1AAZ A;  4WBJ A;  3QCP A;  4HQZ A;  3I69 A;  3S9F A;  1TI1 A;  2DMM A;  3LGC A;  3DML A;  3VI7 A;  2K6V A;  2VL3 A;  2H72 A;  1PSQ A;  2GLR A;  3UVH A;  4LMW A;  4PQ1 A;  1B9Y C;  4ZBB A;  4AJ8 A;  1AUC A;  1E6B A;  2H73 A;  2D2Z A; 
#chains in the Genus database with same CATH topology
 1BG1 A;  1VGL A;  3QAG A;  1K0D A;  1V58 A;  2LJA A;  3VWU A;  3APS A;  1ACV A;  3FK8 A;  3GL3 A;  1THO A;  2B1L A;  1SVL A;  2EIR A;  3EU4 A;  4IHU A;  4TOP A;  1FHE A;  4MP4 A;  5LNK e;  4MAB A;  3FRC A;  2LNS A;  5D9V A;  4EDY A;  4IVF A;  4K0G A;  4OWY A;  1FOV A;  5IQY A;  1RW1 A;  4XTS A;  2LS5 A;  3KM6 A;  3TOU A;  4F9Z A;  1M2B A;  3HZ8 A;  4O32 A;  2JSZ A;  4KE3 A;  4DVC A;  2GGT A;  3GV1 A;  1JZR A;  2DKI A;  4MLY A;  2N5F A;  4BL7 B;  4N10 A;  1MDK A;  1TK0 B;  2HI7 A;  2C0F A;  2L4C A;  2C3N A;  4G2E A;  3HCZ A;  2WZS A;  2IWT A;  1BG5 A;  4F82 A;  1YJ6 A;  1O73 A;  5D93 A;  2X49 A;  3IBH A;  4XIH A;  2HRF A;  1SD8 A;  1DSB A;  1SJ6 A;  4GDF A;  2MMN A;  4POL A;  3KGK A;  2H19 A;  2HQT A;  5A34 B;  3V1W A;  2VIM A;  1G7O A;  2L5L A;  2VLU A;  3C8E A;  3TJJ A;  1MDI A;  1ZL9 A;  2RII A;  2V32 A;  5IMA A;  5A5H B;  2BMX A;  2PWJ A;  4PXO A;  3BD2 A;  1PD2 1;  1A2J A;  5JCU A;  4PNG A;  2OBI A;  1I9D A;  4IBP A;  4PHZ C;  2B7K A;  2PER A;  3UJ1 A;  2DJ1 A;  2LRC A;  2GZY A;  4X43 A;  4ACS A;  4KDX A;  1Z6M A;  3RFR C;  1SU9 A;  2LJK A;  1TRU A;  1GSD A;  3K8N A;  4X4J A;  5ECL B;  1OC9 B;  1HD2 A;  3D21 A;  2IFQ A;  4K6X A;  3KJY A;  1ERV A;  5KN0 A;  2OAD A;  3UL3 A;  3QD9 A;  5H5Q A;  5D73 A;  1XWG A;  2YWN A;  2H1B A;  2B7J A;  3GN3 A;  4BA7 A;  1N25 A;  4PI0 C;  1FB6 A;  4GCI A;  3HVS A;  3ZZX A;  2WUL A;  4YQU A;  4MF5 A;  5B8A A;  4FO5 A;  1GSE A;  3LWA A;  3LXZ A;  1HNA A;  5CRW A;  1T3B A;  2VCZ A;  2IPA A;  3HJP A;  4HZ2 A;  3PH9 A;  2VL9 A;  3HMJ G;  2KLX A;  3D5J A;  4IQA A;  3W8J A;  4BVX B;  3C1R A;  2A4V A;  5EVO A;  3TKS A;  1YEP A;  2G2Q A;  2H71 A;  5IMZ A;  2DJ2 A;  5GST A;  4MH2 A;  2M80 A;  3WT1 A;  2RUE A;  3UBK A;  2H0H A;  5DAL B;  2MYG A;  1YEX A;  4K5S A;  3TRP A;  4ZIL A;  3DKS A;  4IJ3 A;  2HSN A;  2GZP A;  1Z9H A;  4ZB9 A;  2IIY A;  3D4M A;  2I9H A;  1RQM A;  1WPI A;  1BYE A;  3LXT A;  3VUR A;  2H70 A;  3TU3 B;  1T00 A;  4AF2 A;  1R5A A;  2R4V A;  5A1N B;  2WVX B;  1ZOF A;  4MPF A;  3EU3 A;  1AXD A;  1ZYP A;  3LYK A;  1J08 A;  4HU9 A;  2H74 A;  4DEJ A;  3DD3 A;  3TJF A;  2I3Y A;  14GS A;  4EKZ A;  6GSU A;  4JR4 A;  3F3Q A;  2AHE A;  4TW5 A;  4GWR A;  4IN0 A;  1A8L A;  2H6X A;  4XS4 A;  1B4P A;  2PMT A;  3ME7 A;  5J9C A;  4ZB8 A;  4MJB A;  2GS3 A;  2H8L A;  2P31 A;  2YPM A;  4MDC A;  3VWX A;  1U3I A;  2OE0 A;  1THX A;  4KDU A;  3D6I A;  5ABR A;  4E8E A;  4WR5 A;  3RAZ A;  11GS A;  1FB0 A;  3GKK A;  5IO2 A;  2F8A A;  2VLV A;  4G9H A;  1W4V A;  5DQY A;  2V41 A;  3DXB A;  2C0D A;  4FYU A;  1SVM A;  2OBK A;  5D96 A;  3TKP A;  2MMO A;  1PN9 A;  1ABA A;  2A4H A;  4I97 A;  4USS A;  4BIK A;  5IPG A;  1U87 A;  4PI2 C;  2E7P A;  4G10 A;  3LSZ A;  3ZMK A;  1MDJ A;  4EXJ A;  2DBC A;  2GSS A;  5HR2 A;  5D9T A;  4AKH A;  6GST A;  1GTA A;  2PBJ A;  1FVK A;  1SK1 A;  5JCW A;  3RPN A;  2MMA A;  3GL5 A;  3GH9 A;  4K0N A;  3TKQ A;  3L9U A;  1K0O A;  4ID0 A;  4CY6 A;  1MD3 A;  1AC1 A;  2RM6 A;  4FYC A;  2AAW A;  2VM1 A;  2FY6 A;  1R26 A;  4YKF A;  1TTZ A;  5KN3 A;  4NHW A;  2R5G A;  3H4K A;  3C73 A;  2VD1 A;  2QKE A;  2WJU A;  4I5Q A;  1DE1 A;  4OFM A;  4I2U A;  3QFB C;  3EIN A;  5HR0 A;  4ILF A;  1V2A A;  3TRX A;  1K3Y A;  2E0Q A;  1GLQ A;  1Y1U A;  5ECR B;  2P5Q A;  3A5I A;  3F63 A;  5CRE A;  2CVK A;  2CVB A;  4HDE A;  2FCH A;  4K5R A;  3O6T A;  5EY6 A;  2FA8 A;  5CP1 A;  4WBR D;  2IL3 A;  3HKR A;  3PR8 A;  3GUS A;  2GQK A;  1PKZ A;  1BED A;  2VCQ A;  2WW1 A;  3TJB A;  4DSQ A;  4BVY A;  1SEN A;  1T8E B;  2WCI A;  3F4R A;  1GTU A;  2E2G A;  3ERW A;  3L9V A;  3LQ7 A;  4IJI A;  1PKW A;  2HSM B;  4ZB7 A;  2IMD A;  5COH A;  2KP1 A;  4Z2U A;  4X1U A;  2XHF A;  2CV4 A;  5IMV A;  5ID2 A;  2F8F A;  3EYT A;  2HE3 A;  1LJR A;  1GH2 A;  2A2R A;  3W8S A;  6GSX A;  2YWO A;  4YQV A;  1DE2 A;  4MJE A;  4O5R A;  3M9J A;  3C71 A;  3G7Y A;  2WB9 A;  3FZ4 A;  1SKR B;  3GTU B;  1MD4 A;  1QQ2 A;  4OO5 A;  2CAQ A;  3KMN A;  1WE0 A;  2V1M A;  3ZML A;  3VWV A;  2EFH A;  1TU8 A;  2TIR A;  4EO3 A;  2R0P A;  2R0C A;  4EIP A;  1Y25 A;  4MMM A;  1XWB A;  1LU4 A;  2OE3 A;  9GSS A;  3CBU A;  2O5V A;  1M9B A;  20GS A;  3A2W A;  2YOI A;  4KH7 A;  3CWG A;  4KA0 A;  1EOG A;  5F05 A;  2FWF A;  5B6N A;  2CAI A;  2YV7 A;  2XC2 A;  4QL9 A;  2LST A;  1JLV A;  2EFE A;  4YH2 A;  3CSH A;  3NIV A;  5G1L A;  2HZE A;  3IC8 A;  5DQS A;  3H93 A;  2R3X A;  4MK3 A;  1SK2 A;  4IQ1 A;  3OR5 A;  18GS A;  1UC7 A;  4KB3 A;  2P5R A;  2NTO A;  4HOJ A;  2K8S A;  2A2S A;  2B1K A;  3VPQ A;  3I6A A;  4YQM A;  3KH7 A;  1Z6N A;  4TN8 A;  4V2N A;  4K2X A;  3QAV A;  2FA4 A;  5CNW A;  2YWI A;  1X5E A;  5J40 A;  5ENU A;  2WS2 A;  4ECB A;  1A24 A;  1X5D A;  3H1N A;  3FR6 A;  1EZK A;  3C7M A;  2HRK B;  5DAK B;  1KEB A;  4K7N A;  1M2D A;  5ECK B;  4NWY A;  4JR6 A;  3GUR A;  3BCI A;  1GUH A;  5GSS A;  4ZL9 A;  3FYG A;  2L4Q A;  1NHY A;  3M1G A;  4GQC A;  2LV3 A;  4V2M A;  5ELA A;  3FHK A;  1RK4 A;  4Q5N A;  4G0I A;  5ECQ B;  4OD7 A;  4V1A p;  2EFC A;  5AGY A;  2JZS A;  1M0U A;  2HFD A;  2H66 A;  1T7P B;  1YKC A;  1HNC A;  5CO3 A;  4P3Y B;  4KDY A;  1XWA A;  4WF4 A;  3EVI A;  4PNF A;  4W66 A;  1JFU A;  1N8J A;  3Q74 A;  5B6M A;  1S3D A;  2KUC A;  4LA1 A;  1ZGN A;  2F9S A;  2JAC A;  2HNL A;  5ECM B;  2VL2 A;  1NSW A;  3IK7 A;  5J4Y A;  1PL1 A;  5DCG A;  1MEK A;  4PGT A;  1ST9 A;  3UBL A;  5ECP B;  1TKD B;  4EDZ A;  1GP1 A;  3TOT A;  3DVX A;  2H30 A;  4TRX A;  1MTC A;  2LKU A;  4ISD A;  3GKX A;  4N0Z A;  4EVM A;  1A0R P;  4JE1 A;  4MZW A;  4TR1 A;  5JWO B;  2BTO T;  5BRT A;  2VD0 A;  2FWG A;  2DKH A;  2XPD A;  2X64 A;  2ZUP A;  4L0W A;  4HUA A;  1QFN A;  1EV4 A;  4CDO A;  22GS A;  7GSS A;  1ZYE A;  1GSY A;  4AJ6 A;  4K8M A;  4CY8 A;  4OMV A;  3CRT A;  3IAM 2;  2JZT A;  3NZN A;  2VL2 C;  3E0U A;  2GST A;  4MCU A;  4EIQ A;  2YZU A;  3WT2 A;  1SL1 B;  2K18 A;  2KP2 A;  4ECJ A;  4FXY P;  1UVZ A;  1SVO A;  1ON4 A;  5A4W A;  4TXO B;  3A3T A;  1ZMA A;  2OAC A;  2KOK A;  4ULX A;  1R7H A;  2GVP A;  2H1A A;  5IO0 A;  1F9M A;  5BMU B;  3IC4 A;  1O7U A;  2DSA A;  3CHX C;  5G5E A;  1U6T A;  2GT5 A;  1SKW B;  4POK A;  3KD0 A;  5LD0 A;  2H1L A;  2QSI A;  2GQM A;  2HXK A;  4KSM A;  4OCF A;  3SWL A;  3GRX A;  1WJK A;  1EP7 A;  3ZYW A;  3ISO A;  2F3M A;  5A4V A;  1Z3E A;  3O76 A;  3VLN A;  1Z7R A;  5GAP D;  1XPV A;  4D73 A;  2LRN A;  1TW9 A;  3TJG A;  3HJO A;  1M99 A;  4O5U A;  3KIJ A;  3KEB A;  1ILO A;  3LFL A;  1J9B A;  4PUF C;  4A5P A;  1GRX A;  2J9H A;  3I43 A;  2VUP A;  2YP6 A;  4N30 A;  3IPZ A;  2H6Y A;  3FW2 A;  1TRV A;  3NOF A;  2L59 A;  4GSN A;  1PX6 A;  1XBS A;  1URM A;  3ZRE A;  2H0I A;  1QMV A;  3CXG A;  5E4W A;  3RHB A;  2IME A;  3EE2 A;  3A2V A;  4MZC A;  4OFN A;  3P7X A;  2CA8 A;  4HS1 A;  1AW9 A;  3LW9 A;  1VF2 A;  5HFG A;  5EL8 A;  2OE1 A;  1K0M A;  1A2L A;  4TR0 A;  4ZBA A;  5KOW A;  4L5O A;  2Z9S A;  2VCX A;  2L6C A;  4MJA A;  3F3R A;  4G0L A;  3FY7 A;  2ES7 A;  1OKD A;  4KW6 A;  4NV2 A;  2IMI A;  1GWC A;  1S4B P;  5L71 A;  3IHQ A;  1VRS D;  2PPT A;  1EP8 A;  2TRC P;  3HJM A;  2L5O A;  5CRH A;  2WZ9 A;  2YAN A;  3WYW A;  1WWJ A;  1J0F A;  3SBC A;  2EC4 A;  2O89 A;  1GSQ A;  1Z5Y E;  2VAF A;  4HU7 A;  4XRA A;  4F03 A;  4KND A;  4KX4 A;  4PQI A;  3IHG A;  4LLR A;  3ZVJ A;  2G0F A;  12GS A;  1WOU A;  4GST A;  4LL4 B;  2FGX A;  1XVW A;  3LYP A;  2HZF A;  5IOX A;  4AKX B;  3L78 A;  4LMV A;  2VLT A;  5B7C A;  3ZRD A;  3F4T A;  4J56 E;  1FO5 A;  5HFK A;  3HZ4 A;  4ZB6 A;  1T1V A;  3TKS C;  1X9S B;  3J7Y k;  3P90 A;  1WMJ A;  4HSC X;  3LEF A;  2H1D A;  4MZB A;  2PN8 A;  1WIK A;  5CYY A;  4ML6 A;  4TR4 A;  2WVZ A;  4FIW A;  2XBQ A;  4AI6 A;  4GXZ A;  1V98 A;  1B4Q A;  1PA3 A;  1NM3 A;  2JL4 A;  5ELG A;  2OT3 A;  4E8H A;  5IIZ A;  1HNB A;  1GSU A;  2DJK A;  4I2T A;  2FWE A;  1AQX A;  2V6O A;  2LRT A;  3L9S A;  2GT6 A;  3ZIJ A;  3DEX A;  2CX3 A;  3ED3 A;  2CZ2 A;  3UEM A;  3QMX A;  1GNW A;  3QR6 A;  4OCE A;  3ZL5 A;  2QA1 A;  2WW3 A;  1TU7 A;  1ZZY A;  4RI6 A;  1S3A A;  4J2F A;  4IW9 A;  1FG4 A;  3DWV A;  4GRF A;  6GSS A;  2YJ7 A;  4KCA A;  2AB6 A;  4GLT A;  4NPB A;  3ZFL A;  4L0U A;  4G19 A;  4Q5Q A;  2NBS A;  5HQP A;  5IMC A;  5INY A;  2CZ3 A;  4K7O A;  4YAV A;  3GHA A;  4NV5 A;  4ICY A;  5J9B A;  4X0X A;  3IOS A;  2CT6 A;  1GSF A;  2OA7 A;  2HRN A;  4KUN A;  3PPU A;  1U3A A;  4XS1 A;  4YKG A;  2C8U A;  2DIZ A;  1M7T A;  2M72 A;  1O6J A;  2CQ9 A;  5J4U A;  4I6X A;  1HQO A;  4Z2R A;  2IFQ B;  4IKH A;  2LUS A;  2EIQ A;  2LQO A;  3LJR A;  3KMO A;  2NVL A;  3GNJ A;  1GTB A;  1YVL A;  2K8V A;  4G01 A;  1YY7 A;  1EGR A;  5J41 A;  2IMF A;  1XFL A;  4BWS A;  3GX0 A;  1QK8 A;  2RM5 A;  1EEM A;  5IOW A;  2WDU A;  2NPB A;  5F8B A;  1GTI A;  3R3E A;  1K0C A;  5KOX A;  3P2A A;  5H5R A;  5A4U A;  3ZVJ D;  2WFC A;  2E2M A;  2DJJ A;  2LTK A;  5AIS A;  4IP6 A;  5JWR B;  1SK0 A;  3HYP A;  4YAP A;  1YF0 A;  4MA9 A;  1FOH A;  1EEJ A;  3F6F A;  1G6W A;  3VFI A;  4RUV A;  2F51 A;  5G1K A;  1XW9 A;  3LG6 A;  3PIN A;  3FZA A;  1B9X C;  1JLW A;  5FWG A;  4BL7 A;  4F0B A;  1GSS A;  4KCE A;  2VO4 A;  3CTF A;  1XW6 A;  3D0Z A;  1ERT A;  3TKR A;  1I1I P;  4PUR A;  3DRN A;  4K1F A;  1TK5 B;  3CQF A;  2YWM A;  2B5E A;  1T4Y A;  2V6K A;  5CRD A;  2ZCT A;  2HSN B;  1PGT A;  1PFO A;  5A34 A;  2B6M A;  2DML A;  4K2D A;  5H5S A;  2R2J A;  3MAK A;  3MSZ A;  4FH8 A;  3DYR A;  2J23 A;  1M3J A;  13GS A;  2OJL A;  2GSR A;  5JWQ B;  2LQQ A;  1A8Y A;  2I1U A;  1Z7P A;  5A5H A;  1BX9 A;  2O3E A;  3G9B A;  1YEW C;  1SKS B;  4DSS A;  1X0R A;  1H4O A;  4XS4 B;  3D22 A;  3KH9 A;  3APO A;  3TKS E;  3BOA A;  3VWW A;  1S3R A;  5G31 A;  5AIX A;  5IMF A;  2L57 A;  4POB A;  2C3T A;  1TRS A;  1B48 A;  3G7I A;  5IMD A;  4TVE A;  3MYD A;  4OFT A;  1T4Z A;  1OE7 A;  4KSO A;  5J47 A;  3GMF A;  3N9J A;  3QPM A;  3IK9 A;  2IJY A;  3BCK A;  2MMZ A;  2B5X A;  1K0B A;  1G6Y A;  3U6V A;  1F37 A;  3TB2 A;  1O81 A;  3UVT A;  2VKZ G;  3P8W A;  4HZ4 A;  1SL0 B;  1OE8 A;  4HI7 A;  3WGE A;  2RUF A;  2H6Z A;  1A23 A;  4MNN A;  1FW1 A;  4BWQ A;  3EMX A;  3RDW A;  1VF3 A;  3Q18 A;  1OYJ A;  2YN1 A;  1WP0 A;  1ERU A;  5KEJ A;  1GL8 A;  5DCH A;  5HR3 A;  2H76 A;  3TGZ A;  2JZR A;  1X5C A;  3APQ A;  2C0E A;  4XHM A;  2ON7 A;  3UMA A;  4JBB A;  2EIO A;  6GSY A;  2GSQ A;  2DJ3 A;  3KP8 A;  3QDN A;  3RGB C;  1JZW A;  1XOB A;  3TJK A;  3JCM L;  4BVX A;  4V2L A;  3F0I A;  2R0G A;  2X8C A;  2DJ0 A;  1PL2 A;  3VK9 A;  2GZZ A;  1V9W A;  3M9K A;  8GSS A;  1F3A A;  3AY8 A;  4N11 A;  2H75 A;  3I9V 2;  2LJR A;  5DAL A;  4N0V A;  1NW2 A;  3FZ5 A;  3A2X A;  2H0G A;  3F4S A;  4I8B A;  1YDK A;  4WR4 A;  1CQH A;  2VCT A;  6GSV A;  3DGQ A;  1BQ7 A;  2K9F A;  5A1N A;  2KHP A;  2ALB A;  3KTB A;  2WVX A;  2GDR A;  1G7E A;  1PX7 A;  2DLX A;  4JRR A;  2IN3 A;  3CSI A;  1R5P A;  1AQW A;  2B5Y A;  2HYX A;  5F06 A;  1GNE A;  1TJD A;  3ZLP A;  2BJX A;  1TOF A;  1EWX A;  4BVY B;  1X9M B;  3IR4 A;  4WXT A;  1TXU A;  1V40 A;  4IEL A;  1UN2 A;  2O7K A;  1BAY A;  3WD6 A;  4EF0 A;  3A5W A;  2MZC A;  2WW2 A;  1XWK A;  3L0H A;  5ID2 B;  5DBQ A;  2N5A A;  1TDI A;  1SJZ A;  2LNT A;  1U88 A;  5DVB A;  2FD3 A;  4PTS A;  1KNG A;  5CRG A;  5DDL A;  1XIY A;  4NMU A;  5F0G A;  2HRA A;  4HJ2 A;  5JCG A;  2H01 A;  5B8B A;  2HSH A;  3FR9 A;  4RQR A;  4KF9 A;  1K0A A;  3HVX A;  3GST A;  4MJC A;  1R4W A;  3MIX A;  1JHB A;  1G0T A;  4DSR A;  1YF1 A;  2PVQ A;  2WRT A;  1UA5 A;  4QQ7 A;  4Q5R A;  4K9Z A;  2A2P A;  4NAX A;  4TXV A;  4DSS B;  3R2Q A;  4NXI A;  1BF5 A;  4GF0 A;  3HHV A;  5AN1 A;  3N5O A;  5FT3 A;  1KBN A;  5F07 A;  3ZIT A;  1DUG A;  2HZE B;  2M46 A;  4XRD A;  2L6D A;  4TR3 A;  5FHI A;  3MNG A;  1FVJ A;  5C00 A;  1OC8 A;  3UIW A;  5IM9 A;  2VCW A;  3Q6O A;  3ERF A;  2LEG A;  5ECS A;  1XCC A;  3TUE A;  3M0F A;  3GKN A;  1OKT A;  3RPP A;  1QUW A;  3ME8 A;  3UAP A;  4QL7 A;  1H75 A;  2YV9 A;  1YKA A;  19GS A;  1CQG A;  3BBY A;  1IYH A;  5ECI B;  4WF5 A;  4JZQ A;  5J4V A;  2HT9 A;  3KTL A;  3TDG A;  1KTE A;  2X8G A;  1TK8 B;  2C80 A;  3WGX A;  3D4T A;  1A2M A;  3IAS 2;  4AJ7 A;  2DIY A;  3HA9 A;  4V1A g;  1ZYQ B;  3ERG A;  4XS6 A;  3ZTL A;  1V57 A;  2RLI A;  5D8I A;  3EC3 A;  1XOA A;  3HY2 A;  2HSM A;  1QGV A;  4GQF A;  1EOH A;  2FHE A;  1OC3 A;  2O85 A;  4E68 A;  2PUK C;  5G5F A;  1ML6 A;  1SL2 B;  4IP1 A;  1F6M C;  4Z2T A;  1N2A A;  4H86 A;  4HEA 2;  2YJH A;  1K3L A;  2YNX A;  2C0G A;  4N3Z A;  1GUM A;  4FQU A;  1XWC A;  2VOC A;  4F2I A;  2C4J A;  1SYX A;  2C1Y A;  3DVW A;  3GFK A;  2JAD A;  3GTU A;  1YQ1 A;  5HFI A;  5J3R A;  3FMW A;  4MPG A;  3LOR A;  16GS A;  2X8H A;  2FUG 2;  5IPH A;  1ZYN A;  3FZ9 A;  4ML1 A;  4O92 A;  5ECN B;  4CW9 A;  2YZH A;  3E3E A;  4XCS A;  3C1S A;  4AGS A;  4ZIJ A;  4ZBD A;  3GYK A;  2WW0 A;  4TR1 B;  4EUY A;  4PQH A;  2P0G A;  4ECC A;  2ON5 A;  3QFA C;  4HJM A;  2FLS A;  1JZD A;  1Q4J A;  3ZFB A;  1O8W A;  3IDV A;  1LBK A;  4EC0 A;  10GS A;  5A5K A;  3HVN A;  5J5N A;  2N5B A;  3EPT A;  4L5L A;  1S3C A;  1GUK A;  4EE0 A;  3GX8 A;  1Q98 A;  5EPF A;  3EUR A;  1GUL A;  5AIV A;  2QGV A;  1DBY A;  3E9J B;  3DIE A;  3HDC A;  1XW5 A;  2IMK A;  5ECH B;  2ZNM A;  2R6K A;  3US3 A;  2XBI A;  4AKG A;  3H79 A;  2O87 A;  3GA4 A;  5GZZ B;  3IV4 A;  3WGD A;  1OVN A;  3RBT A;  1SD9 A;  4MF6 A;  3HXS A;  5KN2 A;  2HRK A;  2UV8 G;  5DAK A;  5KN1 A;  4Q5F A;  2H1G A;  4D73 B;  5C04 A;  2WGR A;  3CYN A;  2FNO A;  1W89 A;  4LL1 B;  1O85 A;  3CTG A;  1GLP A;  2GTU A;  4QMK A;  1USB A;  3BJ5 A;  4KGI A;  5DJL A;  4BPY A;  2AV4 A;  1Y6E A;  3J7Y b;  3VPT A;  4IS0 A;  2GQL A;  4PUA A;  2CVD A;  2FWH A;  2C3Q A;  3MWH A;  1A0F A;  1AIU A;  4MF7 A;  3IE3 A;  4O5Q A;  1B8X A;  1F2E A;  2OKA A;  2JU5 A;  3G7J A;  4ZXG A;  2PGT A;  4FYB A;  3M8N A;  3MDK A;  1M2A A;  3FKF A;  5D9X A;  2JSY A;  4TKY A;  5E59 A;  1E2Y A;  1BJX A;  2XPE A;  2I4A A;  3HVV A;  4AKI A;  2HLS A;  3TRQ A;  17GS A;  1O8X A;  1VF1 A;  4F0C A;  1YZX A;  3GIX A;  4OO4 A;  3H8Q A;  1X9W B;  2NDO A;  4JU5 A;  5D9W A;  2MBS A;  4PX1 A;  2HSY A;  4HQS A;  5DJM A;  1JZO A;  3KCM A;  2V2G A;  4MH3 A;  1XXU A;  3O3T A;  4L8E A;  1C72 A;  2VCV A;  1ERW A;  1OAZ A;  4O7H A;  2VM2 A;  3U5R E;  3EWL A;  3FEU A;  1FAA A;  1XVQ A;  3ZIV A;  1TP9 A;  4JED A;  4TXO A;  1NHO A;  3W6G A;  1HYU A;  1ZCP A;  5CAX A;  3KZQ A;  2PU9 C;  5BMU A;  1WRY A;  4POM A;  4ZL8 A;  4ECI A;  1IYI A;  1TI3 A;  2X99 A;  3M3M A;  3GH6 A;  2CX4 A;  1PN0 A;  3CSJ A;  3TCO A;  4G0K A;  3CMI A;  3UOM A;  3KXO A;  5ECO B;  4J57 E;  5GAN D;  1SJI A;  3F8U A;  1SYR A;  2DC5 A;  3F9U A;  4GSS A;  3VI5 A;  3UAR A;  4NHZ A;  2TRX A;  1OC9 A;  1TRW A;  4KAE A;  1QXH A;  1I5G A;  5G30 A;  1XG8 A;  1EGO A;  4IGJ A;  2AUV A;  2B3S A;  3PGT A;  4ZL7 A;  4WKW A;  3EMP A;  4Z7X A;  2MBT A;  3RHC A;  5G2Z A;  2X4A A;  4EL1 A;  2YCD A;  1EV9 A;  3IA1 A;  4WET A;  3QAW A;  1TXX A;  1XZO A;  1PRX A;  3IXR A;  3F6D A;  2UZ8 A;  3FR3 A;  3L4N A;  4GTU A;  3KP9 A;  2AJQ B;  2REM A;  1AQV A;  3CRU A;  1K3O A;  1F3B A;  4K7I A;  6GSW A;  1PQN A;  1K0N A;  2I81 A;  4RQX A;  2O8V B;  2R37 A;  4RI7 A;  3HD5 A;  1VF4 A;  5LCZ A;  1PMT A;  4CHS A;  2QC7 A;  3GSS A;  3QOU A;  5HR1 A;  3GKM A;  4WEY A;  1M9A A;  3Q19 A;  2PVO C;  3IRA A;  2O36 A;  2AYT A;  1AAZ A;  2EFD A;  4WBJ A;  3QCP A;  4HQZ A;  2WVY A;  3I69 A;  3S9F A;  1TI1 A;  2DMM A;  3LGC A;  2QA2 A;  3DML A;  3VI7 A;  2K6V A;  1M3I A;  2VL3 A;  2H72 A;  1PSQ A;  2GLR A;  3UVH A;  4LMW A;  4PQ1 A;  1B9Y C;  4ZBB A;  4AJ8 A;  1AUC A;  1E6B A;  2H73 A;  2D2Z A; 
#chains in the Genus database with same CATH homology
 1BG1 A;  1VGL A;  3QAG A;  1K0D A;  1V58 A;  2LJA A;  3VWU A;  3APS A;  1ACV A;  3FK8 A;  3GL3 A;  1THO A;  2B1L A;  1SVL A;  2EIR A;  3EU4 A;  4IHU A;  4TOP A;  1FHE A;  4MP4 A;  5LNK e;  4MAB A;  3FRC A;  2LNS A;  5D9V A;  4EDY A;  4IVF A;  4K0G A;  4OWY A;  1FOV A;  5IQY A;  1RW1 A;  4XTS A;  2LS5 A;  3KM6 A;  3TOU A;  4F9Z A;  1M2B A;  3HZ8 A;  4O32 A;  2JSZ A;  4KE3 A;  4DVC A;  2GGT A;  3GV1 A;  1JZR A;  2DKI A;  4MLY A;  2N5F A;  4BL7 B;  4N10 A;  1MDK A;  1TK0 B;  2HI7 A;  2C0F A;  2L4C A;  2C3N A;  4G2E A;  3HCZ A;  2IWT A;  1BG5 A;  4F82 A;  1YJ6 A;  1O73 A;  5D93 A;  2X49 A;  3IBH A;  4XIH A;  2HRF A;  1SD8 A;  1DSB A;  1SJ6 A;  4GDF A;  2MMN A;  4POL A;  3KGK A;  2H19 A;  2HQT A;  5A34 B;  3V1W A;  2VIM A;  1G7O A;  2L5L A;  2VLU A;  3C8E A;  3TJJ A;  1MDI A;  1ZL9 A;  2RII A;  2V32 A;  5IMA A;  5A5H B;  2BMX A;  2PWJ A;  4PXO A;  3BD2 A;  1PD2 1;  1A2J A;  5JCU A;  4PNG A;  2OBI A;  1I9D A;  4IBP A;  2B7K A;  2PER A;  3UJ1 A;  2DJ1 A;  2LRC A;  2GZY A;  4X43 A;  4ACS A;  4KDX A;  1Z6M A;  1SU9 A;  2LJK A;  1TRU A;  1GSD A;  3K8N A;  4X4J A;  5ECL B;  1OC9 B;  1HD2 A;  3D21 A;  2IFQ A;  4K6X A;  3KJY A;  1ERV A;  5KN0 A;  2OAD A;  3UL3 A;  3QD9 A;  5H5Q A;  5D73 A;  1XWG A;  2YWN A;  2H1B A;  2B7J A;  3GN3 A;  4BA7 A;  1N25 A;  1FB6 A;  4GCI A;  3HVS A;  3ZZX A;  2WUL A;  4YQU A;  4MF5 A;  5B8A A;  4FO5 A;  1GSE A;  3LWA A;  3LXZ A;  1HNA A;  5CRW A;  1T3B A;  2VCZ A;  2IPA A;  3HJP A;  4HZ2 A;  3PH9 A;  2VL9 A;  3HMJ G;  2KLX A;  3D5J A;  4IQA A;  3W8J A;  4BVX B;  3C1R A;  2A4V A;  5EVO A;  3TKS A;  1YEP A;  2G2Q A;  2H71 A;  5IMZ A;  2DJ2 A;  5GST A;  4MH2 A;  2M80 A;  3WT1 A;  2RUE A;  3UBK A;  2H0H A;  5DAL B;  2MYG A;  1YEX A;  4K5S A;  3TRP A;  4ZIL A;  3DKS A;  4IJ3 A;  2HSN A;  2GZP A;  1Z9H A;  4ZB9 A;  2IIY A;  3D4M A;  2I9H A;  1RQM A;  1WPI A;  1BYE A;  3LXT A;  3VUR A;  2H70 A;  3TU3 B;  1T00 A;  4AF2 A;  1R5A A;  2R4V A;  5A1N B;  1ZOF A;  4MPF A;  3EU3 A;  1AXD A;  1ZYP A;  3LYK A;  1J08 A;  4HU9 A;  2H74 A;  4DEJ A;  3DD3 A;  3TJF A;  2I3Y A;  14GS A;  4EKZ A;  6GSU A;  4JR4 A;  3F3Q A;  2AHE A;  4TW5 A;  4GWR A;  4IN0 A;  1A8L A;  2H6X A;  4XS4 A;  1B4P A;  2PMT A;  3ME7 A;  5J9C A;  4ZB8 A;  4MJB A;  2GS3 A;  2H8L A;  2P31 A;  2YPM A;  4MDC A;  3VWX A;  1U3I A;  2OE0 A;  1THX A;  4KDU A;  3D6I A;  5ABR A;  4E8E A;  4WR5 A;  3RAZ A;  11GS A;  1FB0 A;  3GKK A;  5IO2 A;  2F8A A;  2VLV A;  4G9H A;  1W4V A;  5DQY A;  2V41 A;  3DXB A;  2C0D A;  4FYU A;  1SVM A;  2OBK A;  5D96 A;  3TKP A;  2MMO A;  1PN9 A;  1ABA A;  2A4H A;  4I97 A;  4USS A;  5IPG A;  1U87 A;  2E7P A;  4G10 A;  3LSZ A;  3ZMK A;  1MDJ A;  4EXJ A;  2DBC A;  2GSS A;  5HR2 A;  5D9T A;  4AKH A;  6GST A;  1GTA A;  2PBJ A;  1FVK A;  1SK1 A;  5JCW A;  3RPN A;  2MMA A;  3GL5 A;  3GH9 A;  4K0N A;  3TKQ A;  3L9U A;  1K0O A;  4ID0 A;  4CY6 A;  1MD3 A;  1AC1 A;  2RM6 A;  4FYC A;  2AAW A;  2VM1 A;  2FY6 A;  1R26 A;  4YKF A;  1TTZ A;  5KN3 A;  4NHW A;  2R5G A;  3H4K A;  3C73 A;  2VD1 A;  2QKE A;  2WJU A;  4I5Q A;  1DE1 A;  4OFM A;  4I2U A;  3QFB C;  3EIN A;  5HR0 A;  4ILF A;  1V2A A;  3TRX A;  1K3Y A;  2E0Q A;  1GLQ A;  1Y1U A;  5ECR B;  2P5Q A;  3A5I A;  3F63 A;  5CRE A;  2CVK A;  2CVB A;  4HDE A;  2FCH A;  4K5R A;  3O6T A;  5EY6 A;  2FA8 A;  5CP1 A;  4WBR D;  2IL3 A;  3HKR A;  3PR8 A;  3GUS A;  2GQK A;  1PKZ A;  1BED A;  2VCQ A;  3TJB A;  4DSQ A;  4BVY A;  1SEN A;  1T8E B;  2WCI A;  3F4R A;  1GTU A;  2E2G A;  3ERW A;  3L9V A;  3LQ7 A;  4IJI A;  1PKW A;  2HSM B;  4ZB7 A;  2IMD A;  5COH A;  2KP1 A;  4Z2U A;  4X1U A;  2XHF A;  2CV4 A;  5IMV A;  5ID2 A;  2F8F A;  3EYT A;  2HE3 A;  1LJR A;  1GH2 A;  2A2R A;  3W8S A;  6GSX A;  2YWO A;  4YQV A;  1DE2 A;  4MJE A;  4O5R A;  3M9J A;  3C71 A;  3G7Y A;  2WB9 A;  3FZ4 A;  1SKR B;  3GTU B;  1MD4 A;  1QQ2 A;  4OO5 A;  2CAQ A;  3KMN A;  1WE0 A;  2V1M A;  3ZML A;  3VWV A;  2EFH A;  1TU8 A;  2TIR A;  4EO3 A;  2R0P A;  2R0C A;  4EIP A;  1Y25 A;  4MMM A;  1XWB A;  1LU4 A;  2OE3 A;  9GSS A;  3CBU A;  2O5V A;  1M9B A;  20GS A;  3A2W A;  2YOI A;  4KH7 A;  3CWG A;  4KA0 A;  1EOG A;  5F05 A;  2FWF A;  5B6N A;  2CAI A;  2YV7 A;  2XC2 A;  4QL9 A;  2LST A;  1JLV A;  2EFE A;  4YH2 A;  3CSH A;  3NIV A;  5G1L A;  2HZE A;  3IC8 A;  5DQS A;  3H93 A;  2R3X A;  4MK3 A;  1SK2 A;  4IQ1 A;  3OR5 A;  18GS A;  1UC7 A;  4KB3 A;  2P5R A;  2NTO A;  4HOJ A;  2K8S A;  2A2S A;  2B1K A;  3VPQ A;  3I6A A;  4YQM A;  3KH7 A;  1Z6N A;  4TN8 A;  4V2N A;  4K2X A;  3QAV A;  2FA4 A;  5CNW A;  2YWI A;  1X5E A;  5J40 A;  5ENU A;  2WS2 A;  4ECB A;  1A24 A;  1X5D A;  3H1N A;  3FR6 A;  1EZK A;  3C7M A;  2HRK B;  5DAK B;  1KEB A;  4K7N A;  1M2D A;  5ECK B;  4NWY A;  4JR6 A;  3GUR A;  3BCI A;  1GUH A;  5GSS A;  4ZL9 A;  3FYG A;  2L4Q A;  1NHY A;  3M1G A;  4GQC A;  2LV3 A;  4V2M A;  5ELA A;  3FHK A;  1RK4 A;  4Q5N A;  4G0I A;  5ECQ B;  4OD7 A;  4V1A p;  2EFC A;  5AGY A;  2JZS A;  1M0U A;  2HFD A;  2H66 A;  1T7P B;  1YKC A;  1HNC A;  5CO3 A;  4P3Y B;  4KDY A;  1XWA A;  4WF4 A;  3EVI A;  4PNF A;  4W66 A;  1JFU A;  1N8J A;  3Q74 A;  5B6M A;  1S3D A;  2KUC A;  4LA1 A;  1ZGN A;  2F9S A;  2JAC A;  2HNL A;  5ECM B;  2VL2 A;  1NSW A;  3IK7 A;  5J4Y A;  1PL1 A;  5DCG A;  1MEK A;  4PGT A;  1ST9 A;  3UBL A;  5ECP B;  1TKD B;  4EDZ A;  1GP1 A;  3TOT A;  3DVX A;  2H30 A;  4TRX A;  1MTC A;  2LKU A;  4ISD A;  3GKX A;  4N0Z A;  4EVM A;  1A0R P;  4JE1 A;  4MZW A;  4TR1 A;  5JWO B;  2BTO T;  5BRT A;  2VD0 A;  2FWG A;  2DKH A;  2XPD A;  2X64 A;  2ZUP A;  4L0W A;  4HUA A;  1QFN A;  1EV4 A;  4CDO A;  22GS A;  7GSS A;  1ZYE A;  1GSY A;  4AJ6 A;  4K8M A;  4CY8 A;  4OMV A;  3CRT A;  3IAM 2;  2JZT A;  3NZN A;  2VL2 C;  3E0U A;  2GST A;  4MCU A;  4EIQ A;  2YZU A;  3WT2 A;  1SL1 B;  2K18 A;  2KP2 A;  4ECJ A;  1UVZ A;  1SVO A;  1ON4 A;  5A4W A;  4TXO B;  3A3T A;  1ZMA A;  2OAC A;  2KOK A;  4ULX A;  1R7H A;  2GVP A;  2H1A A;  5IO0 A;  1F9M A;  5BMU B;  3IC4 A;  1O7U A;  2DSA A;  5G5E A;  1U6T A;  2GT5 A;  1SKW B;  4POK A;  3KD0 A;  5LD0 A;  2H1L A;  2QSI A;  2GQM A;  2HXK A;  4KSM A;  4OCF A;  3SWL A;  3GRX A;  1WJK A;  1EP7 A;  3ZYW A;  3ISO A;  2F3M A;  5A4V A;  1Z3E A;  3O76 A;  3VLN A;  1Z7R A;  5GAP D;  1XPV A;  4D73 A;  2LRN A;  1TW9 A;  3TJG A;  3HJO A;  1M99 A;  4O5U A;  3KIJ A;  3KEB A;  1ILO A;  3LFL A;  1J9B A;  4PUF C;  4A5P A;  1GRX A;  2J9H A;  3I43 A;  2VUP A;  2YP6 A;  4N30 A;  3IPZ A;  2H6Y A;  3FW2 A;  1TRV A;  3NOF A;  2L59 A;  4GSN A;  1PX6 A;  1XBS A;  1URM A;  3ZRE A;  2H0I A;  1QMV A;  3CXG A;  5E4W A;  3RHB A;  2IME A;  3EE2 A;  3A2V A;  4MZC A;  4OFN A;  3P7X A;  2CA8 A;  4HS1 A;  1AW9 A;  3LW9 A;  1VF2 A;  5HFG A;  5EL8 A;  2OE1 A;  1K0M A;  1A2L A;  4TR0 A;  4ZBA A;  5KOW A;  4L5O A;  2Z9S A;  2VCX A;  2L6C A;  4MJA A;  3F3R A;  4G0L A;  3FY7 A;  2ES7 A;  1OKD A;  4KW6 A;  4NV2 A;  2IMI A;  1GWC A;  5L71 A;  3IHQ A;  1VRS D;  2PPT A;  1EP8 A;  2TRC P;  3HJM A;  2L5O A;  5CRH A;  2WZ9 A;  2YAN A;  3WYW A;  1WWJ A;  1J0F A;  3SBC A;  2EC4 A;  2O89 A;  1GSQ A;  1Z5Y E;  2VAF A;  4HU7 A;  4XRA A;  4F03 A;  4KND A;  4KX4 A;  4PQI A;  3IHG A;  4LLR A;  3ZVJ A;  2G0F A;  12GS A;  1WOU A;  4GST A;  4LL4 B;  2FGX A;  1XVW A;  3LYP A;  2HZF A;  5IOX A;  4AKX B;  3L78 A;  4LMV A;  2VLT A;  5B7C A;  3ZRD A;  3F4T A;  4J56 E;  1FO5 A;  5HFK A;  3HZ4 A;  4ZB6 A;  1T1V A;  3TKS C;  1X9S B;  3J7Y k;  3P90 A;  1WMJ A;  3LEF A;  2H1D A;  4MZB A;  2PN8 A;  1WIK A;  5CYY A;  4ML6 A;  4TR4 A;  4FIW A;  2XBQ A;  4AI6 A;  4GXZ A;  1V98 A;  1B4Q A;  1PA3 A;  1NM3 A;  2JL4 A;  5ELG A;  2OT3 A;  4E8H A;  5IIZ A;  1HNB A;  1GSU A;  2DJK A;  4I2T A;  2FWE A;  1AQX A;  2V6O A;  2LRT A;  3L9S A;  2GT6 A;  3ZIJ A;  3DEX A;  2CX3 A;  3ED3 A;  2CZ2 A;  3UEM A;  3QMX A;  1GNW A;  3QR6 A;  4OCE A;  3ZL5 A;  2QA1 A;  1ZZY A;  1TU7 A;  4RI6 A;  1S3A A;  4J2F A;  4IW9 A;  1FG4 A;  3DWV A;  4GRF A;  6GSS A;  2YJ7 A;  4KCA A;  2AB6 A;  4GLT A;  4NPB A;  3ZFL A;  4L0U A;  4G19 A;  4Q5Q A;  2NBS A;  5HQP A;  5IMC A;  5INY A;  2CZ3 A;  4K7O A;  4YAV A;  3GHA A;  4NV5 A;  4ICY A;  5J9B A;  4X0X A;  3IOS A;  2CT6 A;  1GSF A;  2OA7 A;  2HRN A;  4KUN A;  3PPU A;  1U3A A;  4XS1 A;  4YKG A;  2C8U A;  2DIZ A;  1M7T A;  2M72 A;  1O6J A;  2CQ9 A;  5J4U A;  4I6X A;  1HQO A;  4Z2R A;  2IFQ B;  4IKH A;  2LUS A;  2EIQ A;  2LQO A;  3LJR A;  3KMO A;  2NVL A;  3GNJ A;  1GTB A;  1YVL A;  2K8V A;  4G01 A;  1YY7 A;  1EGR A;  5J41 A;  2IMF A;  1XFL A;  4BWS A;  3GX0 A;  1QK8 A;  2RM5 A;  1EEM A;  5IOW A;  2WDU A;  2NPB A;  5F8B A;  1GTI A;  3R3E A;  1K0C A;  5KOX A;  3P2A A;  5H5R A;  5A4U A;  3ZVJ D;  2WFC A;  2E2M A;  2DJJ A;  2LTK A;  5AIS A;  4IP6 A;  5JWR B;  1SK0 A;  3HYP A;  4YAP A;  1YF0 A;  4MA9 A;  1FOH A;  1EEJ A;  3F6F A;  1G6W A;  3VFI A;  4RUV A;  2F51 A;  5G1K A;  1XW9 A;  3LG6 A;  3PIN A;  3FZA A;  1B9X C;  1JLW A;  5FWG A;  4BL7 A;  4F0B A;  1GSS A;  4KCE A;  2VO4 A;  3CTF A;  1XW6 A;  3D0Z A;  1ERT A;  3TKR A;  4PUR A;  3DRN A;  4K1F A;  1TK5 B;  2YWM A;  2B5E A;  1T4Y A;  2V6K A;  5CRD A;  2ZCT A;  2HSN B;  1PGT A;  5A34 A;  2B6M A;  2DML A;  4K2D A;  5H5S A;  2R2J A;  3MAK A;  3MSZ A;  4FH8 A;  3DYR A;  2J23 A;  13GS A;  2OJL A;  2GSR A;  5JWQ B;  2LQQ A;  1A8Y A;  2I1U A;  1Z7P A;  5A5H A;  1BX9 A;  3G9B A;  1SKS B;  4DSS A;  1X0R A;  1H4O A;  4XS4 B;  3D22 A;  3KH9 A;  3APO A;  3TKS E;  3BOA A;  3VWW A;  5G31 A;  5AIX A;  5IMF A;  2L57 A;  4POB A;  2C3T A;  1TRS A;  1B48 A;  3G7I A;  5IMD A;  4TVE A;  3MYD A;  4OFT A;  1T4Z A;  1OE7 A;  4KSO A;  5J47 A;  3GMF A;  3N9J A;  3QPM A;  3IK9 A;  2IJY A;  3BCK A;  2MMZ A;  2B5X A;  1K0B A;  1G6Y A;  3U6V A;  1F37 A;  3TB2 A;  1O81 A;  3UVT A;  2VKZ G;  3P8W A;  4HZ4 A;  1SL0 B;  1OE8 A;  4HI7 A;  3WGE A;  2RUF A;  2H6Z A;  1A23 A;  4MNN A;  1FW1 A;  4BWQ A;  3EMX A;  3RDW A;  1VF3 A;  3Q18 A;  1OYJ A;  2YN1 A;  1WP0 A;  1ERU A;  5KEJ A;  1GL8 A;  5DCH A;  5HR3 A;  2H76 A;  3TGZ A;  2JZR A;  1X5C A;  3APQ A;  2C0E A;  4XHM A;  2ON7 A;  3UMA A;  4JBB A;  2EIO A;  6GSY A;  2GSQ A;  2DJ3 A;  3KP8 A;  3QDN A;  1JZW A;  1XOB A;  3TJK A;  3JCM L;  4BVX A;  4V2L A;  3F0I A;  2R0G A;  2X8C A;  2DJ0 A;  1PL2 A;  3VK9 A;  2GZZ A;  1V9W A;  3M9K A;  8GSS A;  1F3A A;  3AY8 A;  4N11 A;  2H75 A;  3I9V 2;  2LJR A;  5DAL A;  4N0V A;  1NW2 A;  3FZ5 A;  3A2X A;  2H0G A;  3F4S A;  4I8B A;  1YDK A;  4WR4 A;  1CQH A;  2VCT A;  6GSV A;  3DGQ A;  1BQ7 A;  2K9F A;  5A1N A;  2KHP A;  2ALB A;  3KTB A;  2GDR A;  1G7E A;  1PX7 A;  2DLX A;  4JRR A;  2IN3 A;  3CSI A;  1R5P A;  1AQW A;  2B5Y A;  2HYX A;  5F06 A;  1GNE A;  1TJD A;  3ZLP A;  2BJX A;  1TOF A;  1EWX A;  4BVY B;  1X9M B;  3IR4 A;  4WXT A;  1TXU A;  1V40 A;  4IEL A;  1UN2 A;  2O7K A;  1BAY A;  3WD6 A;  4EF0 A;  3A5W A;  2MZC A;  1XWK A;  3L0H A;  5ID2 B;  5DBQ A;  2N5A A;  1TDI A;  1SJZ A;  2LNT A;  1U88 A;  5DVB A;  2FD3 A;  4PTS A;  1KNG A;  5CRG A;  5DDL A;  1XIY A;  4NMU A;  5F0G A;  2HRA A;  4HJ2 A;  5JCG A;  2H01 A;  5B8B A;  2HSH A;  3FR9 A;  4RQR A;  4KF9 A;  1K0A A;  3HVX A;  3GST A;  4MJC A;  1R4W A;  3MIX A;  1JHB A;  1G0T A;  4DSR A;  1YF1 A;  2PVQ A;  2WRT A;  1UA5 A;  4QQ7 A;  4Q5R A;  4K9Z A;  2A2P A;  4NAX A;  4TXV A;  4DSS B;  3R2Q A;  4NXI A;  1BF5 A;  4GF0 A;  3HHV A;  5AN1 A;  3N5O A;  5FT3 A;  1KBN A;  5F07 A;  3ZIT A;  1DUG A;  2HZE B;  2M46 A;  4XRD A;  2L6D A;  4TR3 A;  3MNG A;  5FHI A;  1FVJ A;  5C00 A;  1OC8 A;  3UIW A;  5IM9 A;  2VCW A;  3Q6O A;  3ERF A;  2LEG A;  5ECS A;  1XCC A;  3TUE A;  3M0F A;  3GKN A;  1OKT A;  3RPP A;  1QUW A;  3ME8 A;  3UAP A;  4QL7 A;  1H75 A;  2YV9 A;  1YKA A;  19GS A;  1CQG A;  3BBY A;  1IYH A;  5ECI B;  4WF5 A;  4JZQ A;  5J4V A;  2HT9 A;  3KTL A;  3TDG A;  1KTE A;  2X8G A;  1TK8 B;  2C80 A;  3WGX A;  3D4T A;  1A2M A;  3IAS 2;  4AJ7 A;  2DIY A;  3HA9 A;  4V1A g;  1ZYQ B;  3ERG A;  4XS6 A;  3ZTL A;  1V57 A;  2RLI A;  5D8I A;  3EC3 A;  1XOA A;  3HY2 A;  2HSM A;  1QGV A;  4GQF A;  1EOH A;  2FHE A;  1OC3 A;  2O85 A;  4E68 A;  2PUK C;  5G5F A;  1ML6 A;  1SL2 B;  4IP1 A;  1F6M C;  4Z2T A;  1N2A A;  4H86 A;  4HEA 2;  2YJH A;  1K3L A;  2YNX A;  2C0G A;  4N3Z A;  1GUM A;  4FQU A;  1XWC A;  2VOC A;  4F2I A;  2C4J A;  1SYX A;  2C1Y A;  3DVW A;  3GFK A;  2JAD A;  3GTU A;  1YQ1 A;  5HFI A;  5J3R A;  3FMW A;  4MPG A;  3LOR A;  16GS A;  2X8H A;  2FUG 2;  5IPH A;  1ZYN A;  3FZ9 A;  4ML1 A;  4O92 A;  5ECN B;  4CW9 A;  2YZH A;  3E3E A;  4XCS A;  3C1S A;  4AGS A;  4ZIJ A;  4ZBD A;  3GYK A;  4TR1 B;  4EUY A;  4PQH A;  2P0G A;  4ECC A;  2ON5 A;  3QFA C;  4HJM A;  2FLS A;  1JZD A;  1Q4J A;  3ZFB A;  1O8W A;  3IDV A;  1LBK A;  4EC0 A;  10GS A;  5A5K A;  5J5N A;  2N5B A;  3EPT A;  4L5L A;  1S3C A;  1GUK A;  4EE0 A;  3GX8 A;  1Q98 A;  5EPF A;  3EUR A;  1GUL A;  5AIV A;  2QGV A;  1DBY A;  3E9J B;  3DIE A;  3HDC A;  1XW5 A;  2IMK A;  5ECH B;  2ZNM A;  2R6K A;  3US3 A;  2XBI A;  4AKG A;  3H79 A;  2O87 A;  3GA4 A;  5GZZ B;  3IV4 A;  3WGD A;  1OVN A;  3RBT A;  1SD9 A;  4MF6 A;  3HXS A;  5KN2 A;  2HRK A;  2UV8 G;  5DAK A;  5KN1 A;  4Q5F A;  2H1G A;  4D73 B;  5C04 A;  2WGR A;  3CYN A;  2FNO A;  1W89 A;  4LL1 B;  1O85 A;  3CTG A;  1GLP A;  2GTU A;  4QMK A;  1USB A;  3BJ5 A;  4KGI A;  5DJL A;  4BPY A;  2AV4 A;  1Y6E A;  3J7Y b;  3VPT A;  4IS0 A;  2GQL A;  4PUA A;  2CVD A;  2FWH A;  2C3Q A;  3MWH A;  1A0F A;  1AIU A;  4MF7 A;  3IE3 A;  4O5Q A;  1B8X A;  1F2E A;  2OKA A;  2JU5 A;  3G7J A;  4ZXG A;  2PGT A;  4FYB A;  3M8N A;  3MDK A;  1M2A A;  3FKF A;  5D9X A;  2JSY A;  4TKY A;  5E59 A;  1E2Y A;  1BJX A;  2XPE A;  2I4A A;  3HVV A;  4AKI A;  2HLS A;  3TRQ A;  17GS A;  1O8X A;  1VF1 A;  4F0C A;  1YZX A;  3GIX A;  4OO4 A;  3H8Q A;  1X9W B;  2NDO A;  4JU5 A;  5D9W A;  2MBS A;  4PX1 A;  2HSY A;  4HQS A;  5DJM A;  1JZO A;  3KCM A;  2V2G A;  4MH3 A;  1XXU A;  3O3T A;  4L8E A;  1C72 A;  2VCV A;  1ERW A;  1OAZ A;  4O7H A;  2VM2 A;  3U5R E;  3EWL A;  3FEU A;  1FAA A;  1XVQ A;  3ZIV A;  1TP9 A;  4JED A;  4TXO A;  1NHO A;  3W6G A;  1HYU A;  1ZCP A;  5CAX A;  3KZQ A;  2PU9 C;  5BMU A;  1WRY A;  4POM A;  4ZL8 A;  4ECI A;  1IYI A;  1TI3 A;  2X99 A;  3M3M A;  3GH6 A;  2CX4 A;  1PN0 A;  3CSJ A;  3TCO A;  4G0K A;  3CMI A;  3UOM A;  3KXO A;  5ECO B;  4J57 E;  5GAN D;  1SJI A;  3F8U A;  1SYR A;  2DC5 A;  3F9U A;  4GSS A;  3VI5 A;  3UAR A;  4NHZ A;  2TRX A;  1OC9 A;  1TRW A;  4KAE A;  1QXH A;  1I5G A;  5G30 A;  1EGO A;  4IGJ A;  2AUV A;  2B3S A;  3PGT A;  4ZL7 A;  4WKW A;  3EMP A;  4Z7X A;  2MBT A;  3RHC A;  5G2Z A;  2X4A A;  4EL1 A;  2YCD A;  1EV9 A;  3IA1 A;  4WET A;  3QAW A;  1TXX A;  1XZO A;  1PRX A;  3IXR A;  3F6D A;  2UZ8 A;  3FR3 A;  3L4N A;  4GTU A;  3KP9 A;  2AJQ B;  2REM A;  1AQV A;  3CRU A;  1K3O A;  1F3B A;  4K7I A;  6GSW A;  1PQN A;  1K0N A;  2I81 A;  4RQX A;  2O8V B;  2R37 A;  4RI7 A;  3HD5 A;  1VF4 A;  5LCZ A;  1PMT A;  4CHS A;  2QC7 A;  3GSS A;  3QOU A;  5HR1 A;  3GKM A;  4WEY A;  1M9A A;  3Q19 A;  2PVO C;  3IRA A;  2AYT A;  1AAZ A;  2EFD A;  4WBJ A;  3QCP A;  4HQZ A;  3I69 A;  3S9F A;  1TI1 A;  2DMM A;  3LGC A;  2QA2 A;  3DML A;  3VI7 A;  2K6V A;  2VL3 A;  2H72 A;  1PSQ A;  2GLR A;  3UVH A;  4LMW A;  4PQ1 A;  1B9Y C;  4ZBB A;  4AJ8 A;  1AUC A;  1E6B A;  2H73 A;  2D2Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...