3IK7A

Human glutathione transferase a4-4 with gsdhn
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
221
structure length
221
Chain Sequence
AARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate specificity combined with stereopromiscuity in glutathione transferase A4-4-dependent metabolism of 4-hydroxynonenal.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Glutathione S-transferase A4
total genus 77
structure length 221
sequence length 221
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2009-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3ik7A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3ik7A01
1GH2A 1ACVA 4BVXA 4F2IA 4MK3A 4LMVA 1XWKA 3KM6A 2FA8A 1GLPA 1G6WA 1GSUA 2F51A 1VGLA 3FK8A 5J5NA 5LD0A 2CZ2A 1BAYA 3GKMA 4G0LA 1A24A 4OD7A 1Z7PA 2OA7A 2V1MA 4L0UA 1SENA 4TXVA 1UC7A 1QK8A 2K8VA 2RUEA 4POBA 3VFIA 1K0MA 1MDJA 5H5RA 3R3EA 3G7JA 4E8EA 4KNDA 4KW6A 3FHKA 1GSEA 3M0FA 4ECJA 1OE7A 1ERVA 1OC9B 5F07A 3SWLA 1BEDA 2V2GA 3TKRA 4IBPA 3LWAA 5JCGA 3U6VA 1M9BA 1OAZA 2DJ3A 2PVOC 2H74A 4NV2A 4JRRA 2UZ8A 2AHEA 4NXIA 2VL2A 4EL1A 2O89A 3UMAA 4MLYA 2JSZA 3QFBC 1TJDA 4AGSA 2FD3A 2IFQB 4QQ7A 5H5SA 1B9YC 4FYUA 3DKSA 2DBCA 4KGIA 4TR4A 2XC2A 4AJ6A 4PQHA 5ECMB 1MD3A 1QMVA 4TXOA 4N0ZA 2N5BA 3P7XA 3KD0A 5DJLA 2H73A 3LG6A 3GH6A 3DD3A 1FVKA 5F06A 3H4KA 2R5GA 3FZ9A 1K0NA 2HRKA 1I9DA 1TRSA 3GL3A 1QFNA 5GAND 3KTBA 2B7KA 2E0QA 1JZRA 3WGDA 2L57A 5J9BA 3EINA 2DJ1A 4I2TA 3QAGA 3KP9A 4ECIA 1O73A 3HZ4A 6GSSA 1J9BA 1SD9A 2NDOA 2CVKA 3EMXA 4LL4B 5DCGA 3IA1A 2J9HA 4WR5A 2F3MA 4JR6A 4D73B 1A8LA 6GSVA 2FWHA 3IRAA 3DMLA 4ZL7A 3ZYWA 5DALB 1PKZA 3GRXA 3TJFA 2H1GA 2VCZA 2FWFA 2L6DA 2MZCA 4HDEA 4TVEA 4HI7A 3GX0A 5DAKA 4NMUA 3FR9A 1JLVA 3J7Yk 1NHOA 1TU7A 5IPHA 2X8HA 2FNOA 2QGVA 3RHBA 3APOA 3F3RA 2A4VA 4DSSA 3WGXA 5B6NA 1GTBA 1YF1A 3A2XA 3TKSE 1GLQA 1LBKA 4NAXA 5D9TA 4MABA 5A5KA 3QD9A 1ZYEA 2LUSA 1NSWA 3LGCA 1B4PA 4K0GA 1DUGA 2PVQA 1SJZA 2YPMA 5CYYA 3LYPA 1RW1A 2DSAA 2HSHA 3F4SA 3ZL5A 1SKWB 1ZL9A 1T3BA 3VWUA 4V1Ap 1KBNA 1SJ6A 2L4CA 1V2AA 2WCIA 4PNGA 4WR4A 4IVFA 4BL7B 2VL2C 3APSA 4IQAA 3LXTA 2EC4A 1XFLA 5DALA 3MDKA 3TKQA 2C4JA 2PWJA 2Z9SA 12GSA 1F3AA 2HRAA 1ST9A 1TRUA 1WOUA 3RBTA 4GF0A 2B1LA 1H4OA 1S3AA 4OCFA 3GNJA 5HR2A 5ID2A 2IFQA 1AQVA 5LCZA 4IHUA 3R2QA 5E59A 1N2AA 4J2FA 5ECOB 2IMDA 3UVHA 5ABRA 2FHEA 1A2JA 2HYXA 3IXRA 4TRXA 1ZZYA 1O6JA 3EURA 1OVNA 4KCEA 1FAAA 3H8QA 1XPVA 2G2QA 3DIEA 3UOMA 3GUSA 3TB2A 3IDVA 1B8XA 5B8BA 4J56E 4MH3A 2N5AA 1GUMA 2ES7A 18GSA 3F9UA 1PA3A 4WXTA 1KNGA 2HSYA 4G10A 2O85A 3D6IA 5HR0A 1GSQA 2DJJA 2LJAA 2G0FA 1A23A 1X9MB 2RM6A 1JLWA 2YWNA 2B5EA 3GURA 3W8JA 2HT9A 2F8FA 2GS3A 5ID2B 5DAKB 5EPFA 4HU7A 1JZDA 1AC1A 2H0GA 4O92A 3TKSA 2NBSA 1OC8A 1WE0A 4WF4A 5HFGA 1V58A 1IYIA 3TOUA 4ISDA 1X5CA 2O7KA 1URMA 1HD2A 4MF7A 2YN1A 2IIYA 2H6YA 2GSQA 5F05A 1GRXA 3HCZA 2YZHA 2LRNA 5ECLB 4OO5A 3NOFA 4ZB6A 2C0EA 1FW1A 4CW9A 1GSSA 1FO5A 2H76A 1UN2A 4KB3A 4ML1A 1OE8A 3A2WA 1R7HA 2K8SA 4X43A 1XZOA 5IMVA 5IM9A 1PX6A 20GSA 1Z3EA 5AIVA 2E2MA 1KTEA 3H93A 3ZREA 2YCDA 3NZNA 2H72A 2JL4A 5GSTA 1GNWA 1EGRA 3C73A 1T8EB 3M3MA 2H1DA 4PTSA 1PL2A 3DVWA 4ZB8A 5AIXA 1YZXA 4XS1A 1SL1B 1FVJA 2RM5A 3IOSA 3A3TA 2RIIA 3EYTA 2X8CA 2YZUA 3KMOA 2OE1A 2C8UA 2I3YA 2LRCA 1T4ZA 2ZNMA 1YJ6A 3DEXA 2H70A 1R4WA 2HI7A 1JFUA 3WGEA 3OR5A 5D8IA 4EKZA 2J23A 2K6VA 1PX7A 5GAPD 2CX4A 1SK2A 4BVYA 5A4VA 1Z9HA 3ZTLA 3M9KA 2HNLA 5IMZA 2GSTA 2CVDA 2X99A 3VWWA 4HJ2A 2H0IA 2A2SA 5DVBA 4EDYA 3Q19A 4NV5A 1TP9A 1SKRB 3KH9A 1BG5A 3G7YA 3I9V2 1VF4A 4DEJA 4IJ3A 4GTUA 1E6BA 4USSA 4HZ4A 1EP8A 1THOA 5ECKB 4DSRA 2C80A 3TRXA 3UBKA 2I1UA 4JR4A 4MH2A 3KGKA 4XCSA 1WPIA 5DCHA 2R37A 2DJKA 1YDKA 1BX9A 4MDCA 3KIJA 4IP6A 1EV9A 1Z6MA 3IC8A 1C72A 3AY8A 2VOCA 2BJXA 1G7OA 4N30A 2FUG2 3PPUA 1THXA 3UARA 2DIYA 2XHFA 5ECHB 4TKYA 1X5DA 3FRCA 4ILFA 2CV4A 3WT1A 4GQCA 3M1GA 4AJ7A 3IPZA 2PPTA 4K7OA 5A4WA 2FGXA 1EEMA 2H75A 3DGQA 1GTAA 3NIVA 1Z7RA 1XIYA 3W6GA 2OBKA 3H1NA 5AGYA 2JSYA 3KZQA 1ERTA 3VPQA 1A2MA 2YWIA 2WRTA 1NM3A 1O8XA 1Z5YE 1GULA 1UA5A 3FR3A 2MMZA 5G30A 4PGTA 4EVMA 2GSSA 2XBIA 3M9JA 2PGTA 3L9UA 1TOFA 3ERWA 1DBYA 1R26A 2H66A 3ERGA 1M2AA 6GSUA 5HR1A 17GSA 3F6DA 5G2ZA 5HQPA 2V6OA 5IMDA 5JCUA 1SK1A 1YEPA 4G0IA 2C3TA 4ZL8A 4TR1A 4IKHA 1G0TA 5KN1A 4TN8A 1MEKA 4BWQA 1TI3A 3RHCA 2ZCTA 2CT6A 1XWCA 4O5RA 2H01A 4OCEA 1X9SB 4RI6A 8GSSA 2NPBA 1IYHA 5G5FA 4FO5A 3IAS2 2MMAA 2IPAA 2B6MA 4BVXB 3HYPA 1FOVA 1ERWA 4BWSA 2OE3A 1K0DA 1B9XC 2E7PA 1SL2B 5D96A 1WP0A 3G9BA 3PINA 3CSIA 3CRUA 2H71A 4MA9A 2B7JA 1ZMAA 3CSJA 2HSNB 4GQFA 2GQMA 2OBIA 4PQIA 2VD0A 5D9WA 1JHBA 3DRNA 4ZBAA 2X8GA 1ON4A 4HEA2 2GSRA 5G5EA 2JZSA 2YNXA 1K3YA 2EIQA 1USBA 3C8EA 1T00A 1WMJA 4KDUA 3LJRA 2VL9A 2ON5A 1A8YA 4XS4A 1J08A 3JCML 3VLNA 2KLXA 2LV3A 2GT6A 4TOPA 1M7TA 2PN8A 4F03A 1W89A 4V2LA 3CSHA 3FYGA 1QQ2A 6GSTA 2K9FA 3EMPA 2HSMB 1NHYA 3IBHA 1BQ7A 2LS5A 5J41A 3P2AA 4ZL9A 3GKXA 1TRWA 4PXOA 3FKFA 1GTIA 10GSA 1PSQA 3D21A 2TIRA 1AXDA 3D5JA 3HA9A 1YKAA 4POKA 5CO3A 2QKEA 1EOGA 4XRDA 4LLRA 1U3IA 3WYWA 4BL7A 1AAZA 2YWMA 2OE0A 5IOWA 3WD6A 5IQYA 1LU4A 1SK0A 2D2ZA 3ZMKA 5DQYA 1GUHA 22GSA 1K0OA 2VCWA 4GCIA 1M9AA 3KTLA 3U5RE 5A4UA 1F9MA 2P5RA 3HKRA 2CZ3A 3M8NA 4O32A 3GFKA 2DC5A 4MJEA 4OFNA 3ZFBA 3FEUA 4DSSB 3PR8A 5GZZB 1AIUA 4F9ZA 1G7EA 3F0IA 2AJQB 2HZFA 1PD21 2OJLA 2LQQA 4K1FA 4DSQA 3QMXA 1XVQA 4HUAA 2HXKA 3VPTA 2A2RA 14GSA 3TKPA 3HDCA 3BCIA 3GV1A 5CREA 5G31A 1CQGA 4KA0A 3TJJA 6GSXA 2C1YA 2KP1A 3K8NA 3LFLA 3TDGA 5CRDA 1FB6A 3ME8A 4YAPA 2WGRA 3KJYA 3DWVA 2HSMA 4NHWA 5IO0A 2JADA 1TTZA 3UIWA 1YKCA 2B5YA 4CDOA 1W4VA 1BJXA 4ACSA 4MZWA 1AW9A 3LXZA 4D73A 4L5LA 1SD8A 3ZZXA 5GSSA 2VCXA 4PURA 5J3RA 4RUVA 1V40A 3F63A 16GSA 3MNGA 3FY7A 1WRYA 4FH8A 4KF9A 5EL8A 2L6CA 4PQ1A 5INYA 4GXZA 2FLSA 1J0FA 3HJOA 4TW5A 3HD5A 5IIZA 3EE2A 4F0CA 3EC3A 3GKNA 1YQ1A 5ECIB 2VUPA 11GSA 4IN0A 4BA7A 2GQLA 2N5FA 3GTUA 3HJMA 4K6XA 1DE2A 1S3DA 3G7IA 2VIMA 1O81A 2C0DA 3ZMLA 3L9SA 4IQ1A 5B8AA 1GWCA 1LJRA 3D22A 3P90A 2HZEA 1XOAA 2GT5A 1AQXA 2RLIA 2LTKA 3QAWA 5LNKe 4MF6A 2YJHA 1OYJA 3LQ7A 4OMVA 3L0HA 2HFDA 1MD4A 2M80A 2PERA 4JBBA 5ECPB 4WBRD 2DIZA 5IOXA 2KHPA 4I6XA 1PGTA 1GSDA 3PH9A 4ZBDA 3GX8A 2AV4A 3VURA 1JZOA 3GTUB 3UBLA 3IR4A 3IHQA 5CRWA 2V41A 3GIXA 1QXHA 3EVIA 3F3QA 1K3OA 5HFIA 4XS4B 3C1RA 4FYBA 2EIOA 1HNBA 2AB6A 3GSSA 3BOAA 2C3QA 2TRCP 2R4VA 3MAKA 4F82A 5B6MA 4PUAA 1RQMA 4EF0A 5L71A 2YOIA 4KE3A 4X0XA 4GSSA 1FB0A 1AUCA 4WETA 2VL3A 2JZTA 2AYTA 1AQWA 2GTUA 4EUYA 4K0NA 3EU3A 2M46A 4G19A 4MJCA 4Q5QA 5H5QA 3ZRDA 4XTSA 1SU9A 1O7UA 4WKWA 4V2NA 2C0FA 1YEXA 1H75A 3I69A 2WULA 3IK9A 3MSZA 3ZIVA 4FYCA 1XBSA 4I5QA 3C1SA 2WS2A 4HQSA 3C71A 1SYXA 4GSNA 5JCWA 4FQUA 1TK5B 1WWJA 4K7IA 5G1LA 5J4UA 2HQTA 1GSYA 3EU4A 4L5OA 3DXBA 4PNFA 3VI7A 2LJRA 3GSTA 1ZYQB 5KN2A 3QCPA 3O6TA 5ECRB 3F4TA 4KH7A 2GQKA 2HE3A 3CTFA 3ED3A 2DMLA 4KCAA 3GKKA 5DQSA 2IMIA 3KXOA 3TJGA 2GZPA 1DE1A 1F6MC 2TRXA 9GSSA 1R5PA 1K3LA 3KEBA 3CYNA 4EXJA 4MJBA 1ERUA 2L59A 3TUEA 2MBSA 5IMCA 1EZKA 2VLUA 2MMOA 3CRTA 4KAEA 4I97A 4AF2A 1Y6EA 4XIHA 2IJYA 2VLVA 1M99A 5COHA 3Q18A 2YP6A 2GVPA 5JWQB 5HFKA 1G6YA 1VF1A 6GSYA 3ZFLA 2LSTA 3E0UA 4ID0A 1MDKA 1CQHA 1WJKA 2KOKA 2LKUA 4V2MA 1TI1A 1X9WB 4PUFC 2OKAA 3HVSA 2H19A 3GH9A 5EVOA 3QR6A 3UAPA 4LA1A 1A0RP 3CXGA 4ECCA 5C00A 2YWOA 1EGOA 1SKSB 4EO3A 4XRAA 4QL7A 4AJ8A 1TDIA 1XWAA 3TRPA 1TXXA 2L4QA 4J57E 2H30A 4NPBA 4P3YB 5FHIA 2XPDA 2B5XA 1YY7A 4HZ2A 1TK8B 3QFAC 1M2DA 4ML6A 2DJ0A 3SBCA 1XW6A 3QAVA 2H0HA 3HZ8A 3FW2A 3DVXA 1BYEA 3PGTA 2MBTA 2NTOA 4XHMA 1QUWA 3QDNA 4YQUA 4JU5A 4G0KA 2O8VB 1X0RA 5CRHA 5DJMA 4ZXGA 3A5WA 4TR0A 2LEGA 3Q6OA 1TU8A 3F4RA 2IMEA 1DSBA 3US3A 4JEDA 1ZGNA 3E9JB 5ELGA 1WIKA 3BCKA 4MP4A 4ZIJA 2P0GA 4L0WA 3GHAA 2CX3A 5CRGA 3ZVJA 2PU9C 4YQVA 3BBYA 1V9WA 3KH7A 3HJPA 1XCCA 1XWBA 3GN3A 1XOBA 2WZ9A 3C7MA 2VD1A 1MDIA 2GGTA 4Q5RA 3TOTA 4G2EA 2B1KA 5ENUA 1VF3A 3VWXA 4H86A 1TK0B 4IS0A 2LNSA 4Q5FA 2REMA 4KUNA 3ZVJD 3UEMA 3EWLA 1M2BA 3D0ZA 2VM2A 2IMKA 2F9SA 4K2DA 1EP7A 4WEYA 2XBQA 4ECBA 4RQRA 1ABAA 2HLSA 3GA4A 2I4AA 4MJAA 2VCTA 5D73A 4EE0A 4MZBA 3GMFA 2WDUA 5D9XA 5KN3A 2AAWA 1Y25A 4TR1B 2R3XA 2YV7A 1R5AA 4N10A 4FIWA 3TRQA 1PRXA 4Z7XA 1U3AA 2CVBA 4LL1B 1E2YA 1O85A 1QGVA 2GLRA 5D9VA 3CTGA 1V98A 1I5GA 4G9HA 3KP8A 2BTOT 1Q98A 3V1WA 3LYKA 2V32A 4O7HA 3DYRA 2H1BA 1ILOA 3S9FA 3L4NA 1OC3A 2KP2A 3HHVA 3VK9A 1RK4A 4OFTA 1Q4JA 2ZUPA 1KEBA 4ZB9A 3L78A 2CAQA 3HVVA 1XXUA 4IP1A 3IC4A 4F0BA 4GSTA 2DMMA 1V57A 3BJ5A 2F8AA 2C0GA 4L8EA 1XW5A 4V1Ag 2I81A 2P31A 3H79A 3O3TA 3TGZA 3E3EA 4KDXA 4JE1A 1F37A 3CMIA 1A0FA 2HRKB 4WF5A 1U88A 4HOJA 4MPGA 2VO4A 5ECQB 3N9JA 3QOUA 3N5OA 1MTCA 3WT2A 4OWYA 4X1UA 1GP1A 5CNWA 2VCVA 2H1AA 3ME7A 4RI7A 2L5LA 5D93A 3RPNA 1S3CA 5IMFA 2IL3A 5CAXA 3ERFA 3FZ5A 5BMUA 2H6ZA 1T1VA 1UVZA 1GTUA 3CBUA 3TKSC 2VCQA 4KSOA 1O8WA 5F0GA 3TJKA 1SYRA 1U6TA 5ELAA 4PX1A 4EDZA 2ALBA 3A2VA 1EEJA 4WBJA 4MZCA 1OC9A 2FWEA 2LQOA 5JWRB 2DJ2A 1FHEA 1TKDB 3ZIJA 4N11A 1HNCA 1PKWA 2GZYA 3FR6A 2IN3A 1JZWA 2JZRA 3QPMA 2VM1A 3RAZA 1GSFA 4JZQA 3HXSA 4YQMA 3GYKA 1XWGA 4OO4A 2IMFA 2FY6A 2YV9A 2HRNA 4ULXA 1GNEA 2AUVA 3Q74A 5KEJA 4TR3A 2YANA 2LNTA 1B48A 4Q5NA 4IJIA 5EY6A 4NWYA 4POMA 1OKTA 3TJBA 2NVLA 2VAFA 1TW9A 2QC7A 1OKDA 3D4TA 2CA8A 1GUKA 1SL0B 1F3BA 2OADA 4MF5A 2JACA 2C3NA 1HQOA 5AISA 1HNAA 5IO2A 2WFCA 1B4QA 1ZOFA 5ECNB 1PQNA 5FWGA 3D4MA 2PUKC 1EWXA 4KDYA 1K0BA 5B7CA 4YH2A 3VI5A 2VLTA 5DBQA 5CP1A 2HZEB 2CAIA 3UVTA 1ML6A 3P8WA 5DDLA 2FA4A 2H6XA 5AN1A 1XVWA 2X64A 3F8UA 4POLA 2BMXA 3FZ4A 4NHZA 2FCHA 3I6AA 6GSWA 4QL9A 5JWOB 1NW2A 5KN0A 2GZZA 3TCOA 3F6FA 2IWTA 3IAM2 2R6KA 5G1KA 3J7Yb 2DLXA 2E2GA 1PL1A 3VWVA 3LSZA 4RQXA 4I8BA 2LJKA 2V6KA 4DVCA 2PBJA 2RUFA 7GSSA 3RDWA 3BD2A 3UL3A 2MYGA 1FG4A 4LMWA 2JU5A 1N8JA 2KUCA 5ECSA 1TRVA 1HYUA 3IE3A 2EIRA 1A2LA 2MMNA 2YJ7A 4KX4A 1VRSD 4E8HA 4EC0A 2WJUA 1T4YA 3KMNA 19GSA 3APQA 1PN9A 3IK7A 5F8BA 4BVYB 2R2JA 3LEFA 1ZCPA 4MCUA 3FZAA 2P5QA 4OFMA 4I2UA 2OACA 2XPEA 1GL8A 1M0UA 3RPPA 2LRTA 2I9HA 4BPYA 4K7NA 3W8SA 4MPFA 5FT3A 4CHSA 4K8MA 3HY2A 2CQ9A 4IGJA 5IMAA 3ZITA 4IW9A 2B3SA 4MMMA 2L5OA 1K0CA 1Z6NA 4HS1A 3GL5A 4GRFA 2FWGA 1PMTA 4ZILA 3O76A 4XS6A 3MWHA 3KCMA 2QSIA 3ISOA 4TXOB 3LORA 3L9VA 4HU9A 2ON7A 5J9CA 4N0VA 4HQZA 1X5EA 3IV4A 5C04A 2K18A 1VF2A 4K9ZA 3UJ1A 4YAVA 1YF0A 2H8LA 2WB9A 1U87A 1SJIA 4GWRA 3ZLPA 4GLTA 2M72A 2O87A 5IPGA 4ZBBA 4IELA 2GDRA 1T7PB 5HR3A 1EV4A 1F2EA 3HVXA 13GSA 5E4WA 1K0AA 1XW9A 4KSMA 4HJMA 3I43A 2PMTA 2HRFA 1EOHA
chains in the Genus database with same CATH superfamily
1GH2A 4YKFA 1ACVA 4BVXA 4F2IA 4MK3A 4LMVA 1XWKA 3KM6A 2FA8A 1GLPA 1G6WA 1GSUA 2F51A 1VGLA 3FK8A 5J5NA 5LD0A 2CZ2A 1BAYA 3GKMA 4G0LA 1A24A 4OD7A 1Z7PA 2OA7A 2V1MA 2OT3A 4L0UA 1SENA 4TXVA 1UC7A 1QK8A 2K8VA 2RUEA 4POBA 3VFIA 1K0MA 1MDJA 5H5RA 3R3EA 3G7JA 4E8EA 4KNDA 4KW6A 3FHKA 1GSEA 3M0FA 4ECJA 1OE7A 1ERVA 1OC9B 5F07A 3SWLA 1BEDA 2V2GA 3TKRA 4IBPA 3LWAA 5JCGA 2QA1A 2R0PA 3U6VA 1M9BA 1OAZA 2DJ3A 2PVOC 2H74A 4NV2A 4AKXB 4JRRA 2UZ8A 2AHEA 4NXIA 2VL2A 4EL1A 2O89A 3UMAA 4MLYA 2JSZA 3QFBC 4Z2RA 1TJDA 4AGSA 2FD3A 2IFQB 4QQ7A 1B9YC 5H5SA 4FYUA 3DKSA 2DBCA 2WVYA 4KGIA 4TR4A 2XC2A 4AJ6A 4PQHA 5ECMB 1MD3A 1QMVA 4TXOA 4N0ZA 2N5BA 3P7XA 3KD0A 5DJLA 2H73A 3LG6A 3GH6A 3DD3A 1FVKA 5F06A 4W66A 3H4KA 2R5GA 3FZ9A 1K0NA 2HRKA 1I9DA 1TRSA 3GL3A 1QFNA 5GAND 3KTBA 2B7KA 2E0QA 1JZRA 3WGDA 2L57A 5J9BA 3EINA 2DJ1A 4I2TA 3QAGA 3KP9A 4ECIA 1O73A 3HZ4A 6GSSA 1J9BA 1SD9A 2NDOA 2CVKA 3EMXA 4LL4B 5DCGA 3IA1A 2J9HA 4WR5A 2F3MA 4JR6A 4D73B 1A8LA 6GSVA 2FWHA 3IRAA 3DMLA 4ZL7A 3ZYWA 3CQFA 5DALB 1PKZA 3GRXA 3TJFA 2H1GA 2VCZA 2FWFA 2L6DA 2MZCA 4HDEA 4TVEA 4HI7A 3GX0A 5DAKA 4NMUA 3FR9A 1JLVA 3J7Yk 1NHOA 1TU7A 5IPHA 2X8HA 2FNOA 2QGVA 3RHBA 3APOA 3F3RA 4Z2UA 4ZB7A 2A4VA 4CY6A 4DSSA 3WGXA 4E68A 5B6NA 1GTBA 1YF1A 3A2XA 3TKSE 1GLQA 1LBKA 4NAXA 5D9TA 4MABA 5A5KA 3QD9A 1ZYEA 2LUSA 1NSWA 3LGCA 1B4PA 4K0GA 1DUGA 2PVQA 1SJZA 2YPMA 5CYYA 3LYPA 1RW1A 2DSAA 2HSHA 3F4SA 3ZL5A 1SKWB 1ZL9A 1T3BA 2X4AA 3VWUA 4V1Ap 1KBNA 1SJ6A 2L4CA 1V2AA 2WCIA 4PNGA 4WR4A 4IVFA 4BL7B 2VL2C 3APSA 1TXUA 4IQAA 3LXTA 2EC4A 1XFLA 5DALA 2X49A 3MDKA 3TKQA 2C4JA 2PWJA 2Z9SA 12GSA 1F3AA 2HRAA 1ST9A 1TRUA 1WOUA 3RBTA 4GF0A 2B1LA 1PFOA 1H4OA 4FXYP 1S3AA 4PI0C 4OCFA 3GNJA 5HR2A 5ID2A 2IFQA 1AQVA 5LCZA 4IHUA 3R2QA 5E59A 1N2AA 4J2FA 5ECOB 2IMDA 3UVHA 5ABRA 2FHEA 1A2JA 2HYXA 3IXRA 4TRXA 1ZZYA 1O6JA 3EURA 4CY8A 1OVNA 4KCEA 1FAAA 3H8QA 1XPVA 2G2QA 3DIEA 3UOMA 3GUSA 3TB2A 3IDVA 1B8XA 5B8BA 4J56E 4MH3A 2N5AA 1GUMA 2ES7A 18GSA 3F9UA 1PA3A 4WXTA 1KNGA 2HSYA 4G10A 2O85A 3D6IA 5HR0A 1GSQA 2DJJA 2LJAA 2G0FA 1A23A 1X9MB 2RM6A 1JLWA 2YWNA 2B5EA 3GURA 3W8JA 2HT9A 2F8FA 2GS3A 5ID2B 5DAKB 5EPFA 4HU7A 1JZDA 1AC1A 2H0GA 4YKGA 4O92A 3TKSA 2NBSA 1OC8A 1WE0A 4WF4A 5HFGA 1V58A 1IYIA 3TOUA 4ISDA 1X5CA 2O7KA 1URMA 1HD2A 4MF7A 3RFRC 2YN1A 4BIKA 2WZSA 2IIYA 2H6YA 2GSQA 5F05A 1GRXA 3HCZA 2YZHA 2LRNA 5ECLB 4OO5A 3NOFA 4ZB6A 2C0EA 1FW1A 3A5IA 4N3ZA 3MIXA 4CW9A 1GSSA 1FO5A 2H76A 1UN2A 4KB3A 4ML1A 1OE8A 3A2WA 1R7HA 2K8SA 4X43A 1XZOA 5IMVA 5IM9A 1PX6A 20GSA 1Z3EA 5AIVA 2E2MA 5BRTA 1KTEA 3H93A 3ZREA 2YCDA 3NZNA 2H72A 2JL4A 5GSTA 5A1NA 1GNWA 2O36A 1EGRA 3C73A 1T8EB 3M3MA 2H1DA 4PTSA 1PL2A 3DVWA 4ZB8A 5AIXA 1YZXA 4XS1A 1SL1B 1FVJA 2RM5A 3IOSA 3A3TA 2RIIA 3CHXC 3EYTA 2A2PA 2X8CA 2YZUA 3KMOA 2OE1A 2C8UA 2I3YA 2LRCA 1T4ZA 2ZNMA 1YJ6A 3DEXA 2H70A 1R4WA 2HI7A 1JFUA 3WGEA 3OR5A 5D8IA 4EKZA 2J23A 2K6VA 1PX7A 5GAPD 2CX4A 1SK2A 4BVYA 5A4VA 1Z9HA 3ZTLA 3M9KA 2HNLA 5IMZA 2GSTA 2CVDA 2X99A 3VWWA 4HJ2A 2H0IA 2A2SA 5DVBA 4EDYA 3Q19A 2EFCA 4NV5A 1TP9A 1SKRB 3KH9A 1BG5A 3G7YA 3I9V2 1VF4A 4DEJA 4IJ3A 4GTUA 1E6BA 4USSA 4HZ4A 1EP8A 1THOA 5ECKB 4DSRA 2C80A 3TRXA 3CWGA 3UBKA 2I1UA 4JR4A 4MH2A 3KGKA 5J47A 4XCSA 1WPIA 5DCHA 2R37A 2DJKA 1YDKA 1BX9A 4MDCA 3KIJA 4IP6A 1EV9A 1ZYNA 1Z6MA 3IC8A 1C72A 3AY8A 2VOCA 2BJXA 1G7OA 4N30A 2FUG2 3PPUA 1THXA 3UARA 2DIYA 2XHFA 5ECHB 4TKYA 3HMJG 1X5DA 4K2XA 3FRCA 4ILFA 2CV4A 3WT1A 4GQCA 3M1GA 4AJ7A 3IPZA 2PPTA 4K7OA 5A4WA 2FGXA 1EEMA 2H75A 3DGQA 1GTAA 3NIVA 1Z7RA 1XIYA 3W6GA 2OBKA 3H1NA 5AGYA 2JSYA 3KZQA 1ERTA 3VPQA 1A2MA 2YWIA 2WRTA 1NM3A 1SVLA 1O8XA 2QA2A 1Z5YE 1GULA 1UA5A 3FR3A 2O5VA 2MMZA 5G30A 4PGTA 4EVMA 2GSSA 2XBIA 3M9JA 4HSCX 4AKGA 2PGTA 3L9UA 1TOFA 3ERWA 1DBYA 1R26A 2H66A 3ERGA 1M2AA 2WVZA 6GSUA 5HR1A 17GSA 3F6DA 5G2ZA 5HQPA 2V6OA 5IMDA 5JCUA 1SK1A 1YEPA 4G0IA 2C3TA 2DKHA 4ZL8A 4TR1A 4IKHA 1G0TA 5KN1A 4TN8A 1MEKA 4BWQA 1TI3A 3RHCA 2ZCTA 2CT6A 1XWCA 3RGBC 4O5RA 5KOWA 2H01A 4OCEA 1X9SB 4RI6A 8GSSA 2NPBA 1IYHA 5G5FA 4FO5A 3IAS2 2MMAA 2IPAA 2B6MA 4BVXB 3HYPA 1FOVA 1ERWA 4BWSA 2OE3A 1K0DA 1B9XC 2E7PA 1SL2B 3MYDA 2UV8G 5D96A 1WP0A 3G9BA 3PINA 3CSIA 3CRUA 2H71A 4MA9A 2B7JA 1ZMAA 3CSJA 2HSNB 4GQFA 2GQMA 2OBIA 4PQIA 2VD0A 5D9WA 1JHBA 3DRNA 4ZBAA 2X8GA 1ON4A 4HEA2 2GSRA 5G5EA 2JZSA 2YNXA 1K3YA 2WVXA 2EIQA 1USBA 3C8EA 1T00A 1WMJA 4KDUA 3LJRA 2VL9A 2ON5A 1A8YA 4XS4A 1J08A 3JCML 3VLNA 2KLXA 2LV3A 5A5HA 2GT6A 1YVLA 4TOPA 1M7TA 3HVNA 2PN8A 4F03A 1W89A 4V2LA 3CSHA 3FYGA 1QQ2A 6GSTA 2K9FA 3EMPA 2HSMB 1NHYA 3IBHA 1BQ7A 2LS5A 5J41A 3P2AA 4ZL9A 3GKXA 1TRWA 4PXOA 3FKFA 1GTIA 10GSA 1PSQA 3D21A 2TIRA 1AXDA 3D5JA 3HA9A 1YKAA 4POKA 5CO3A 2QKEA 1EOGA 4XRDA 4LLRA 1U3IA 3WYWA 4BL7A 1AAZA 1M3JA 2WVXB 2YWMA 2OE0A 5IOWA 3WD6A 5IQYA 1LU4A 1SK0A 4EIPA 2D2ZA 3ZMKA 5DQYA 1GUHA 22GSA 1K0OA 2VCWA 4GCIA 1M9AA 3KTLA 3U5RE 5A4UA 1F9MA 2P5RA 3HKRA 2CZ3A 3M8NA 4O32A 5J4VA 3GFKA 2DC5A 4MJEA 4OFNA 3ZFBA 3FEUA 4DSSB 3PR8A 5GZZB 1AIUA 4F9ZA 1G7EA 3F0IA 5J40A 2AJQB 2HZFA 1PD21 2OJLA 2LQQA 4K1FA 4DSQA 3QMXA 1XVQA 4HUAA 2HXKA 3VPTA 2A2RA 14GSA 3TKPA 3HDCA 3BCIA 3GV1A 5CREA 5G31A 1CQGA 4KA0A 3TJJA 6GSXA 2C1YA 2KP1A 3K8NA 4G01A 3LFLA 3TDGA 5CRDA 1FB6A 1SVOA 3ME8A 4YAPA 2WGRA 3KJYA 3DWVA 2HSMA 4NHWA 5IO0A 2JADA 1TTZA 3UIWA 1YKCA 2B5YA 4CDOA 1W4VA 1BJXA 4ACSA 4MZWA 1AW9A 3LXZA 4D73A 4L5LA 1SD8A 3ZZXA 5GSSA 2VCXA 4PURA 4O5UA 2WW3A 5J3RA 4RUVA 1V40A 3F63A 16GSA 3MNGA 3FY7A 1WRYA 1YEWC 4FH8A 4KF9A 5EL8A 2L6CA 4PQ1A 5INYA 4GXZA 2FLSA 1J0FA 3HJOA 4TW5A 3HD5A 5IIZA 4ICYA 3EE2A 4F0CA 3EC3A 3GKNA 1YQ1A 5ECIB 2VUPA 11GSA 4IN0A 1ZYPA 4BA7A 2GQLA 2N5FA 3GTUA 3HJMA 4K6XA 1DE2A 1S3DA 3G7IA 2VIMA 1O81A 2C0DA 3ZMLA 3L9SA 4IQ1A 5B8AA 1GWCA 1LJRA 3D22A 3P90A 5A1NB 2HZEA 1XOAA 2GT5A 1AQXA 2RLIA 2LTKA 3QAWA 5LNKe 4MF6A 2YJHA 1OYJA 3LQ7A 4OMVA 3L0HA 2HFDA 1MD4A 2M80A 2PERA 4JBBA 5ECPB 4WBRD 1N25A 2DIZA 5IOXA 2KHPA 4I6XA 1PGTA 1GSDA 2WW1A 3PH9A 4ZBDA 3GX8A 2AV4A 3VURA 1JZOA 3GTUB 3UBLA 3IR4A 3IHQA 5CRWA 2V41A 3GIXA 1QXHA 3EVIA 3F3QA 1K3OA 5HFIA 4XS4B 3C1RA 4FYBA 2EIOA 1HNBA 2AB6A 3GSSA 3BOAA 2C3QA 2TRCP 2R4VA 4AI6A 3MAKA 4F82A 5B6MA 4PUAA 1RQMA 4EF0A 5L71A 2YOIA 4KE3A 4X0XA 4GSSA 1FB0A 1S3RA 1AUCA 4WETA 2VL3A 2JZTA 2AYTA 4AKHA 1AQWA 2GTUA 4EUYA 4K0NA 3EU3A 2M46A 4G19A 4MJCA 4Q5QA 4MNNA 5H5QA 3ZRDA 4XTSA 1SU9A 1O7UA 4WKWA 4V2NA 2C0FA 1YEXA 1H75A 3I69A 2WULA 3IK9A 3MSZA 3ZIVA 4FYCA 1XBSA 4I5QA 3C1SA 2WS2A 4HQSA 3C71A 1SYXA 4GSNA 5JCWA 4FQUA 1TK5B 1WWJA 4K7IA 5G1LA 5J4UA 2HQTA 1GSYA 3EU4A 4L5OA 3DXBA 4PNFA 3VI7A 2LJRA 3GSTA 1ZYQB 5KN2A 3QCPA 3O6TA 5ECRB 3F4TA 4KH7A 2GQKA 2HE3A 4K5RA 3CTFA 3ED3A 2DMLA 4KCAA 3GKKA 5DQSA 2IMIA 3KXOA 3TJGA 2GZPA 1DE1A 1F6MC 2TRXA 9GSSA 1R5PA 1K3LA 3KEBA 3CYNA 4EXJA 4MJBA 1ERUA 2L59A 3TUEA 2MBSA 5IMCA 1EZKA 2VLUA 2MMOA 3CRTA 2VKZG 4KAEA 4I97A 4AF2A 1Y6EA 4XIHA 2IJYA 2VLVA 1M99A 5COHA 3Q18A 2YP6A 2GVPA 5JWQB 5HFKA 1G6YA 1VF1A 6GSYA 3ZFLA 2LSTA 3E0UA 4ID0A 1MDKA 1CQHA 1WJKA 2KOKA 2LKUA 4V2MA 1TI1A 1X9WB 4PUFC 2OKAA 3HVSA 2H19A 3GH9A 5EVOA 3QR6A 3UAPA 4LA1A 1A0RP 3CXGA 4ECCA 5C00A 2YWOA 1EGOA 1SKSB 4EO3A 4XRAA 1S4BP 3LW9A 4QL7A 4AJ8A 1TDIA 1XWAA 3TRPA 1TXXA 2L4QA 4J57E 2H30A 4NPBA 4P3YB 5FHIA 2XPDA 2B5XA 1YY7A 4HZ2A 1TK8B 3QFAC 3TU3B 1M2DA 4ML6A 2DJ0A 3SBCA 1XW6A 3QAVA 2H0HA 3HZ8A 3FW2A 1SVMA 3DVXA 1BYEA 3PGTA 2MBTA 2NTOA 4XHMA 1QUWA 3QDNA 4YQUA 4JU5A 4G0KA 2O8VB 1X0RA 5CRHA 5DJMA 4ZXGA 3A5WA 4TR0A 2LEGA 3Q6OA 1TU8A 3F4RA 2IMEA 1DSBA 3US3A 4JEDA 1ZGNA 3E9JB 5ELGA 1WIKA 3BCKA 4MP4A 4ZIJA 2P0GA 4L0WA 3GHAA 2CX3A 5CRGA 3ZVJA 2PU9C 4YQVA 3BBYA 1V9WA 2EFEA 3KH7A 3HJPA 1XCCA 1XWBA 3GN3A 1XOBA 2WZ9A 4PI2C 3C7MA 2VD1A 1MDIA 2GGTA 4Q5RA 3TOTA 4A5PA 4G2EA 2B1KA 5ENUA 1VF3A 3VWXA 4H86A 1TK0B 4IS0A 2LNSA 4Q5FA 2REMA 4KUNA 3ZVJD 3UEMA 3EWLA 1M2BA 3D0ZA 2VM2A 2IMKA 2F9SA 4K2DA 1EP7A 4WEYA 2XBQA 4ECBA 4RQRA 1ABAA 2HLSA 1PN0A 3GA4A 2I4AA 5A34B 4MJAA 2VCTA 5D73A 4EE0A 4MZBA 3GMFA 2WDUA 5D9XA 5KN3A 2AAWA 1Y25A 4TR1B 2R3XA 2YV7A 1R5AA 4N10A 4FIWA 3TRQA 1PRXA 4Z7XA 1U3AA 2CVBA 4LL1B 1E2YA 1O85A 1QGVA 2GLRA 5D9VA 5J4YA 3CTGA 1FOHA 1V98A 1I5GA 4G9HA 3KP8A 1BG1A 2BTOT 1Q98A 3V1WA 3LYKA 2A4HA 2V32A 4O7HA 3DYRA 2H1BA 1ILOA 3S9FA 3L4NA 1OC3A 2KP2A 3HHVA 3VK9A 1RK4A 4OFTA 1Q4JA 2ZUPA 4QMKA 1KEBA 4ZB9A 3L78A 2CAQA 3HVVA 1XXUA 4IP1A 3IC4A 4F0BA 4GSTA 2DMMA 1V57A 3BJ5A 2F8AA 2C0GA 4L8EA 1XW5A 4V1Ag 4AKIA 2I81A 2P31A 3H79A 3O3TA 3TGZA 3E3EA 4KDXA 4JE1A 1F37A 2O3EA 3CMIA 1A0FA 2HRKB 4WF5A 1I1IP 1U88A 4HOJA 4MPGA 2VO4A 1M3IA 5ECQB 3N9JA 3QOUA 3N5OA 1MTCA 3WT2A 5BMUB 4OWYA 4X1UA 1GP1A 5CNWA 2VCVA 2H1AA 3ME7A 4RI7A 2L5LA 5D93A 3RPNA 1S3CA 5IMFA 2WW0A 2IL3A 5CAXA 3ERFA 3FZ5A 5BMUA 2H6ZA 1T1VA 1UVZA 1GTUA 3CBUA 3TKSC 2VCQA 4KSOA 1O8WA 2R0CA 5F0GA 3TJKA 1SYRA 1U6TA 5ELAA 4PX1A 2EFHA 4EDZA 2ALBA 3A2VA 1EEJA 2WW2A 4WBJA 4MZCA 1OC9A 2FWEA 3FMWA 2LQOA 5JWRB 2DJ2A 1FHEA 1TKDB 3ZIJA 4N11A 1HNCA 1PKWA 2GZYA 3FR6A 2IN3A 3IHGA 1JZWA 2JZRA 3QPMA 2VM1A 3RAZA 1GSFA 4JZQA 3HXSA 4YQMA 3GYKA 1XWGA 4OO4A 2IMFA 2FY6A 2YV9A 2HRNA 4ULXA 1GNEA 2AUVA 1XG8A 3Q74A 5KEJA 4TR3A 2YANA 2LNTA 1B48A 4Q5NA 4IJIA 5EY6A 4NWYA 4POMA 1OKTA 3TJBA 1Y1UA 2NVLA 2VAFA 1TW9A 2QC7A 3EPTA 5KOXA 1OKDA 3D4TA 2CA8A 1GUKA 1SL0B 1BF5A 1F3BA 2OADA 4MF5A 2JACA 2C3NA 1HQOA 5AISA 1HNAA 5IO2A 2WFCA 1B4QA 4GDFA 1ZOFA 5ECNB 1PQNA 5FWGA 3D4MA 2PUKC 1EWXA 4KDYA 1K0BA 5A5HB 5B7CA 4YH2A 3VI5A 2VLTA 5DBQA 5CP1A 2HZEB 2CAIA 3UVTA 1ML6A 3P8WA 5DDLA 2EFDA 2HSNA 2FA4A 2H6XA 5AN1A 1XVWA 2X64A 3F8UA 4POLA 2BMXA 3FZ4A 4NHZA 2FCHA 3I6AA 6GSWA 4QL9A 5JWOB 1NW2A 5KN0A 2GZZA 3TCOA 3F6FA 2IWTA 3IAM2 2R6KA 5G1KA 3J7Yb 2DLXA 4PHZC 2E2GA 1PL1A 3VWVA 3LSZA 4RQXA 4I8BA 2LJKA 2V6KA 4DVCA 2PBJA 2RUFA 7GSSA 3RDWA 3BD2A 3UL3A 2MYGA 1FG4A 4LMWA 2JU5A 1N8JA 2KUCA 5ECSA 4K5SA 1TRVA 1HYUA 3IE3A 2EIRA 1A2LA 2MMNA 2YJ7A 4KX4A 1VRSD 2R0GA 4E8HA 4EIQA 4EC0A 2WJUA 1T4YA 2H1LA 3KMNA 19GSA 3APQA 1PN9A 3IK7A 5F8BA 4BVYB 2R2JA 3LEFA 4MCUA 1ZCPA 3FZAA 5A34A 2P5QA 4OFMA 4I2UA 2OACA 2XPEA 1GL8A 1M0UA 3RPPA 2LRTA 2I9HA 4BPYA 4K7NA 3W8SA 4MPFA 5FT3A 4K8MA 4CHSA 3HY2A 2CQ9A 4IGJA 5IMAA 4Z2TA 3ZITA 4IW9A 2B3SA 4MMMA 2L5OA 1K0CA 1Z6NA 4HS1A 3GL5A 4GRFA 2FWGA 1PMTA 4ZILA 3O76A 4XS6A 3MWHA 3KCMA 2QSIA 3ISOA 4TXOB 3LORA 3L9VA 4HU9A 2ON7A 5J9CA 4N0VA 4HQZA 1X5EA 3IV4A 5C04A 2K18A 1VF2A 4K9ZA 3UJ1A 4YAVA 1YF0A 2H8LA 4O5QA 2WB9A 1U87A 1SJIA 4GWRA 3ZLPA 4GLTA 2M72A 2O87A 5IPGA 4ZBBA 4X4JA 4IELA 2GDRA 1T7PB 5HR3A 1EV4A 1F2EA 3HVXA 2DKIA 13GSA 5E4WA 1K0AA 1XW9A 4KSMA 4HJMA 3I43A 2PMTA 2HRFA 1EOHA
chains in the Genus database with same CATH topology
1GH2A 4YKFA 1ACVA 4BVXA 4F2IA 4MK3A 4LMVA 1XWKA 3KM6A 2FA8A 1GLPA 1G6WA 1GSUA 2F51A 1VGLA 3FK8A 5J5NA 5LD0A 2CZ2A 1BAYA 3GKMA 4G0LA 1A24A 4OD7A 1Z7PA 2OA7A 2V1MA 2OT3A 4L0UA 1SENA 4TXVA 1UC7A 1QK8A 2K8VA 2RUEA 4POBA 3VFIA 1K0MA 1MDJA 5H5RA 3R3EA 3G7JA 4E8EA 4KNDA 4KW6A 3FHKA 1GSEA 3M0FA 4ECJA 1OE7A 1ERVA 1OC9B 5F07A 3SWLA 1BEDA 2V2GA 3TKRA 4IBPA 3LWAA 5JCGA 2QA1A 2R0PA 3U6VA 1M9BA 1OAZA 2DJ3A 2PVOC 2H74A 4NV2A 4AKXB 4JRRA 2UZ8A 2AHEA 4NXIA 2VL2A 4EL1A 2O89A 3UMAA 4MLYA 2JSZA 3QFBC 4Z2RA 1TJDA 4AGSA 2FD3A 2IFQB 4QQ7A 1B9YC 5H5SA 4FYUA 3DKSA 2DBCA 4KGIA 4TR4A 2XC2A 4AJ6A 4PQHA 5ECMB 1MD3A 1QMVA 4TXOA 4N0ZA 2N5BA 3P7XA 3KD0A 5DJLA 2H73A 3LG6A 3GH6A 3DD3A 1FVKA 5F06A 4W66A 3H4KA 2R5GA 3FZ9A 1K0NA 2HRKA 1I9DA 1TRSA 3GL3A 1QFNA 5GAND 3KTBA 2B7KA 2E0QA 1JZRA 3WGDA 2L57A 5J9BA 3EINA 2DJ1A 4I2TA 3QAGA 3KP9A 4ECIA 1O73A 3HZ4A 6GSSA 1J9BA 1SD9A 2NDOA 2CVKA 3EMXA 4LL4B 5DCGA 3IA1A 2J9HA 4WR5A 2F3MA 4JR6A 4D73B 1A8LA 6GSVA 2FWHA 3IRAA 3DMLA 4ZL7A 3ZYWA 5DALB 1PKZA 3GRXA 3TJFA 2H1GA 2VCZA 2FWFA 2L6DA 2MZCA 4HDEA 4TVEA 4HI7A 3GX0A 5DAKA 4NMUA 3FR9A 1JLVA 3J7Yk 1NHOA 1TU7A 5IPHA 2X8HA 2FNOA 2QGVA 3RHBA 3APOA 3F3RA 4Z2UA 4ZB7A 2A4VA 4CY6A 4DSSA 3WGXA 4E68A 5B6NA 1GTBA 1YF1A 3A2XA 3TKSE 1GLQA 1LBKA 4NAXA 5D9TA 4MABA 5A5KA 3QD9A 1ZYEA 2LUSA 1NSWA 3LGCA 1B4PA 4K0GA 1DUGA 2PVQA 1SJZA 2YPMA 5CYYA 3LYPA 1RW1A 2DSAA 2HSHA 3F4SA 3ZL5A 1SKWB 1ZL9A 1T3BA 2X4AA 3VWUA 4V1Ap 1KBNA 1SJ6A 2L4CA 1V2AA 2WCIA 4PNGA 4WR4A 4IVFA 4BL7B 2VL2C 3APSA 1TXUA 4IQAA 3LXTA 2EC4A 1XFLA 5DALA 2X49A 3MDKA 3TKQA 2C4JA 2PWJA 2Z9SA 12GSA 1F3AA 2HRAA 1ST9A 1TRUA 1WOUA 3RBTA 4GF0A 2B1LA 1H4OA 1S3AA 4OCFA 3GNJA 5HR2A 5ID2A 2IFQA 1AQVA 5LCZA 4IHUA 3R2QA 5E59A 1N2AA 4J2FA 5ECOB 2IMDA 3UVHA 5ABRA 2FHEA 1A2JA 2HYXA 3IXRA 4TRXA 1ZZYA 1O6JA 3EURA 4CY8A 1OVNA 4KCEA 1FAAA 3H8QA 1XPVA 2G2QA 3DIEA 3UOMA 3GUSA 3TB2A 3IDVA 1B8XA 5B8BA 4J56E 4MH3A 2N5AA 1GUMA 2ES7A 18GSA 3F9UA 1PA3A 4WXTA 1KNGA 2HSYA 4G10A 2O85A 3D6IA 5HR0A 1GSQA 2DJJA 2LJAA 2G0FA 1A23A 1X9MB 2RM6A 1JLWA 2YWNA 2B5EA 3GURA 3W8JA 2HT9A 2F8FA 2GS3A 5ID2B 5DAKB 5EPFA 4HU7A 1JZDA 1AC1A 2H0GA 4YKGA 4O92A 3TKSA 2NBSA 1OC8A 1WE0A 4WF4A 5HFGA 1V58A 1IYIA 3TOUA 4ISDA 1X5CA 2O7KA 1URMA 1HD2A 4MF7A 2YN1A 2IIYA 2H6YA 2GSQA 5F05A 1GRXA 3HCZA 2YZHA 2LRNA 5ECLB 4OO5A 3NOFA 4ZB6A 2C0EA 1FW1A 3A5IA 4N3ZA 3MIXA 4CW9A 1GSSA 1FO5A 2H76A 1UN2A 4KB3A 4ML1A 1OE8A 3A2WA 1R7HA 2K8SA 4X43A 1XZOA 5IMVA 5IM9A 1PX6A 20GSA 1Z3EA 5AIVA 2E2MA 5BRTA 1KTEA 3H93A 3ZREA 2YCDA 3NZNA 2H72A 2JL4A 5GSTA 5A1NA 1GNWA 1EGRA 3C73A 1T8EB 3M3MA 2H1DA 4PTSA 1PL2A 3DVWA 4ZB8A 5AIXA 1YZXA 4XS1A 1SL1B 1FVJA 2RM5A 3IOSA 3A3TA 2RIIA 3EYTA 2A2PA 2X8CA 2YZUA 3KMOA 2OE1A 2C8UA 2I3YA 2LRCA 1T4ZA 2ZNMA 1YJ6A 3DEXA 2H70A 1R4WA 2HI7A 1JFUA 3WGEA 3OR5A 5D8IA 4EKZA 2J23A 2K6VA 1PX7A 5GAPD 2CX4A 1SK2A 4BVYA 5A4VA 1Z9HA 3ZTLA 3M9KA 2HNLA 5IMZA 2GSTA 2CVDA 2X99A 3VWWA 4HJ2A 2H0IA 2A2SA 5DVBA 4EDYA 3Q19A 2EFCA 4NV5A 1TP9A 1SKRB 3KH9A 1BG5A 3G7YA 3I9V2 1VF4A 4DEJA 4IJ3A 4GTUA 1E6BA 4USSA 4HZ4A 1EP8A 1THOA 5ECKB 4DSRA 2C80A 3TRXA 3CWGA 3UBKA 2I1UA 4JR4A 4MH2A 3KGKA 5J47A 4XCSA 1WPIA 5DCHA 2R37A 2DJKA 1YDKA 1BX9A 4MDCA 3KIJA 4IP6A 1EV9A 1ZYNA 1Z6MA 3IC8A 1C72A 3AY8A 2VOCA 2BJXA 1G7OA 4N30A 2FUG2 3PPUA 1THXA 3UARA 2DIYA 2XHFA 5ECHB 4TKYA 3HMJG 1X5DA 4K2XA 3FRCA 4ILFA 2CV4A 3WT1A 4GQCA 3M1GA 4AJ7A 3IPZA 2PPTA 4K7OA 5A4WA 2FGXA 1EEMA 2H75A 3DGQA 1GTAA 3NIVA 1Z7RA 1XIYA 3W6GA 2OBKA 3H1NA 5AGYA 2JSYA 3KZQA 1ERTA 3VPQA 1A2MA 2YWIA 2WRTA 1NM3A 1SVLA 1O8XA 2QA2A 1Z5YE 1GULA 1UA5A 3FR3A 2O5VA 2MMZA 5G30A 4PGTA 4EVMA 2GSSA 2XBIA 3M9JA 4AKGA 2PGTA 3L9UA 1TOFA 3ERWA 1DBYA 1R26A 2H66A 3ERGA 1M2AA 6GSUA 5HR1A 17GSA 3F6DA 5G2ZA 5HQPA 2V6OA 5IMDA 5JCUA 1SK1A 1YEPA 4G0IA 2C3TA 2DKHA 4ZL8A 4TR1A 4IKHA 1G0TA 5KN1A 4TN8A 1MEKA 4BWQA 1TI3A 3RHCA 2ZCTA 2CT6A 1XWCA 4O5RA 5KOWA 2H01A 4OCEA 1X9SB 4RI6A 8GSSA 2NPBA 1IYHA 5G5FA 4FO5A 3IAS2 2MMAA 2IPAA 2B6MA 4BVXB 3HYPA 1FOVA 1ERWA 4BWSA 2OE3A 1K0DA 1B9XC 2E7PA 1SL2B 3MYDA 2UV8G 5D96A 1WP0A 3G9BA 3PINA 3CSIA 3CRUA 2H71A 4MA9A 2B7JA 1ZMAA 3CSJA 2HSNB 4GQFA 2GQMA 2OBIA 4PQIA 2VD0A 5D9WA 1JHBA 3DRNA 4ZBAA 2X8GA 1ON4A 4HEA2 2GSRA 5G5EA 2JZSA 2YNXA 1K3YA 2EIQA 1USBA 3C8EA 1T00A 1WMJA 4KDUA 3LJRA 2VL9A 2ON5A 1A8YA 4XS4A 1J08A 3JCML 3VLNA 2KLXA 2LV3A 5A5HA 2GT6A 1YVLA 4TOPA 1M7TA 2PN8A 4F03A 1W89A 4V2LA 3CSHA 3FYGA 1QQ2A 6GSTA 2K9FA 3EMPA 2HSMB 1NHYA 3IBHA 1BQ7A 2LS5A 5J41A 3P2AA 4ZL9A 3GKXA 1TRWA 4PXOA 3FKFA 1GTIA 10GSA 1PSQA 3D21A 2TIRA 1AXDA 3D5JA 3HA9A 1YKAA 4POKA 5CO3A 2QKEA 1EOGA 4XRDA 4LLRA 1U3IA 3WYWA 4BL7A 1AAZA 2YWMA 2OE0A 5IOWA 3WD6A 5IQYA 1LU4A 1SK0A 4EIPA 2D2ZA 3ZMKA 5DQYA 1GUHA 22GSA 1K0OA 2VCWA 4GCIA 1M9AA 3KTLA 3U5RE 5A4UA 1F9MA 2P5RA 3HKRA 2CZ3A 3M8NA 4O32A 5J4VA 3GFKA 2DC5A 4MJEA 4OFNA 3ZFBA 3FEUA 4DSSB 3PR8A 5GZZB 1AIUA 4F9ZA 1G7EA 3F0IA 5J40A 2AJQB 2HZFA 1PD21 2OJLA 2LQQA 4K1FA 4DSQA 3QMXA 1XVQA 4HUAA 2HXKA 3VPTA 2A2RA 14GSA 3TKPA 3HDCA 3BCIA 3GV1A 5CREA 5G31A 1CQGA 4KA0A 3TJJA 6GSXA 2C1YA 2KP1A 3K8NA 4G01A 3LFLA 3TDGA 5CRDA 1FB6A 1SVOA 3ME8A 4YAPA 2WGRA 3KJYA 3DWVA 2HSMA 4NHWA 5IO0A 2JADA 1TTZA 3UIWA 1YKCA 2B5YA 4CDOA 1W4VA 1BJXA 4ACSA 4MZWA 1AW9A 3LXZA 4D73A 4L5LA 1SD8A 3ZZXA 5GSSA 2VCXA 4PURA 4O5UA 5J3RA 4RUVA 1V40A 3F63A 16GSA 3MNGA 3FY7A 1WRYA 4FH8A 4KF9A 5EL8A 2L6CA 4PQ1A 5INYA 4GXZA 2FLSA 1J0FA 3HJOA 4TW5A 3HD5A 5IIZA 4ICYA 3EE2A 4F0CA 3EC3A 3GKNA 1YQ1A 5ECIB 2VUPA 11GSA 4IN0A 1ZYPA 4BA7A 2GQLA 2N5FA 3GTUA 3HJMA 4K6XA 1DE2A 1S3DA 3G7IA 2VIMA 1O81A 2C0DA 3ZMLA 3L9SA 4IQ1A 5B8AA 1GWCA 1LJRA 3D22A 3P90A 5A1NB 2HZEA 1XOAA 2GT5A 1AQXA 2RLIA 2LTKA 3QAWA 5LNKe 4MF6A 2YJHA 1OYJA 3LQ7A 4OMVA 3L0HA 2HFDA 1MD4A 2M80A 2PERA 4JBBA 5ECPB 4WBRD 1N25A 2DIZA 5IOXA 2KHPA 4I6XA 1PGTA 1GSDA 3PH9A 4ZBDA 3GX8A 2AV4A 3VURA 1JZOA 3GTUB 3UBLA 3IR4A 3IHQA 5CRWA 2V41A 3GIXA 1QXHA 3EVIA 3F3QA 1K3OA 5HFIA 4XS4B 3C1RA 4FYBA 2EIOA 1HNBA 2AB6A 3GSSA 3BOAA 2C3QA 2TRCP 2R4VA 4AI6A 3MAKA 4F82A 5B6MA 4PUAA 1RQMA 4EF0A 5L71A 2YOIA 4KE3A 4X0XA 4GSSA 1FB0A 1AUCA 4WETA 2VL3A 2JZTA 2AYTA 4AKHA 1AQWA 2GTUA 4EUYA 4K0NA 3EU3A 2M46A 4G19A 4MJCA 4Q5QA 4MNNA 5H5QA 3ZRDA 4XTSA 1SU9A 1O7UA 4WKWA 4V2NA 2C0FA 1YEXA 1H75A 3I69A 2WULA 3IK9A 3MSZA 3ZIVA 4FYCA 1XBSA 4I5QA 3C1SA 2WS2A 4HQSA 3C71A 1SYXA 4GSNA 5JCWA 4FQUA 1TK5B 1WWJA 4K7IA 5G1LA 5J4UA 2HQTA 1GSYA 3EU4A 4L5OA 3DXBA 4PNFA 3VI7A 2LJRA 3GSTA 1ZYQB 5KN2A 3QCPA 3O6TA 5ECRB 3F4TA 4KH7A 2GQKA 2HE3A 4K5RA 3CTFA 3ED3A 2DMLA 4KCAA 3GKKA 5DQSA 2IMIA 3KXOA 3TJGA 2GZPA 1DE1A 1F6MC 2TRXA 9GSSA 1R5PA 1K3LA 3KEBA 3CYNA 4EXJA 4MJBA 1ERUA 2L59A 3TUEA 2MBSA 5IMCA 1EZKA 2VLUA 2MMOA 3CRTA 2VKZG 4KAEA 4I97A 4AF2A 1Y6EA 4XIHA 2IJYA 2VLVA 1M99A 5COHA 3Q18A 2YP6A 2GVPA 5JWQB 5HFKA 1G6YA 1VF1A 6GSYA 3ZFLA 2LSTA 3E0UA 4ID0A 1MDKA 1CQHA 1WJKA 2KOKA 2LKUA 4V2MA 1TI1A 1X9WB 4PUFC 2OKAA 3HVSA 2H19A 3GH9A 5EVOA 3QR6A 3UAPA 4LA1A 1A0RP 3CXGA 4ECCA 5C00A 2YWOA 1EGOA 1SKSB 4EO3A 4XRAA 3LW9A 4QL7A 4AJ8A 1TDIA 1XWAA 3TRPA 1TXXA 2L4QA 4J57E 2H30A 4NPBA 4P3YB 5FHIA 2XPDA 2B5XA 1YY7A 4HZ2A 1TK8B 3QFAC 3TU3B 1M2DA 4ML6A 2DJ0A 3SBCA 1XW6A 3QAVA 2H0HA 3HZ8A 3FW2A 1SVMA 3DVXA 1BYEA 3PGTA 2MBTA 2NTOA 4XHMA 1QUWA 3QDNA 4YQUA 4JU5A 4G0KA 2O8VB 1X0RA 5CRHA 5DJMA 4ZXGA 3A5WA 4TR0A 2LEGA 3Q6OA 1TU8A 3F4RA 2IMEA 1DSBA 3US3A 4JEDA 1ZGNA 3E9JB 5ELGA 1WIKA 3BCKA 4MP4A 4ZIJA 2P0GA 4L0WA 3GHAA 2CX3A 5CRGA 3ZVJA 2PU9C 4YQVA 3BBYA 1V9WA 2EFEA 3KH7A 3HJPA 1XCCA 1XWBA 3GN3A 1XOBA 2WZ9A 3C7MA 2VD1A 1MDIA 2GGTA 4Q5RA 3TOTA 4A5PA 4G2EA 2B1KA 5ENUA 1VF3A 3VWXA 4H86A 1TK0B 4IS0A 2LNSA 4Q5FA 2REMA 4KUNA 3ZVJD 3UEMA 3EWLA 1M2BA 3D0ZA 2VM2A 2IMKA 2F9SA 4K2DA 1EP7A 4WEYA 2XBQA 4ECBA 4RQRA 1ABAA 2HLSA 1PN0A 3GA4A 2I4AA 5A34B 4MJAA 2VCTA 5D73A 4EE0A 4MZBA 3GMFA 2WDUA 5D9XA 5KN3A 2AAWA 1Y25A 4TR1B 2R3XA 2YV7A 1R5AA 4N10A 4FIWA 3TRQA 1PRXA 4Z7XA 1U3AA 2CVBA 4LL1B 1E2YA 1O85A 1QGVA 2GLRA 5D9VA 5J4YA 3CTGA 1FOHA 1V98A 1I5GA 4G9HA 3KP8A 1BG1A 2BTOT 1Q98A 3V1WA 3LYKA 2A4HA 2V32A 4O7HA 3DYRA 2H1BA 1ILOA 3S9FA 3L4NA 1OC3A 2KP2A 3HHVA 3VK9A 1RK4A 4OFTA 1Q4JA 2ZUPA 4QMKA 1KEBA 4ZB9A 3L78A 2CAQA 3HVVA 1XXUA 4IP1A 3IC4A 4F0BA 4GSTA 2DMMA 1V57A 3BJ5A 2F8AA 2C0GA 4L8EA 1XW5A 4V1Ag 4AKIA 2I81A 2P31A 3H79A 3O3TA 3TGZA 3E3EA 4KDXA 4JE1A 1F37A 3CMIA 1A0FA 2HRKB 4WF5A 1U88A 4HOJA 4MPGA 2VO4A 5ECQB 3N9JA 3QOUA 3N5OA 1MTCA 3WT2A 5BMUB 4OWYA 4X1UA 1GP1A 5CNWA 2VCVA 2H1AA 3ME7A 4RI7A 2L5LA 5D93A 3RPNA 1S3CA 5IMFA 2IL3A 5CAXA 3ERFA 3FZ5A 5BMUA 2H6ZA 1T1VA 1UVZA 1GTUA 3CBUA 3TKSC 2VCQA 4KSOA 1O8WA 2R0CA 5F0GA 3TJKA 1SYRA 1U6TA 5ELAA 4PX1A 2EFHA 4EDZA 2ALBA 3A2VA 1EEJA 4WBJA 4MZCA 1OC9A 2FWEA 3FMWA 2LQOA 5JWRB 2DJ2A 1FHEA 1TKDB 3ZIJA 4N11A 1HNCA 1PKWA 2GZYA 3FR6A 2IN3A 3IHGA 1JZWA 2JZRA 3QPMA 2VM1A 3RAZA 1GSFA 4JZQA 3HXSA 4YQMA 3GYKA 1XWGA 4OO4A 2IMFA 2FY6A 2YV9A 2HRNA 4ULXA 1GNEA 2AUVA 3Q74A 5KEJA 4TR3A 2YANA 2LNTA 1B48A 4Q5NA 4IJIA 5EY6A 4NWYA 4POMA 1OKTA 3TJBA 1Y1UA 2NVLA 2VAFA 1TW9A 2QC7A 3EPTA 5KOXA 1OKDA 3D4TA 2CA8A 1GUKA 1SL0B 1BF5A 1F3BA 2OADA 4MF5A 2JACA 2C3NA 1HQOA 5AISA 1HNAA 5IO2A 2WFCA 1B4QA 4GDFA 1ZOFA 5ECNB 1PQNA 5FWGA 3D4MA 2PUKC 1EWXA 4KDYA 1K0BA 5A5HB 5B7CA 4YH2A 3VI5A 2VLTA 5DBQA 5CP1A 2HZEB 2CAIA 3UVTA 1ML6A 3P8WA 5DDLA 2EFDA 2HSNA 2FA4A 2H6XA 5AN1A 1XVWA 2X64A 3F8UA 4POLA 2BMXA 3FZ4A 4NHZA 2FCHA 3I6AA 6GSWA 4QL9A 5JWOB 1NW2A 5KN0A 2GZZA 3TCOA 3F6FA 2IWTA 3IAM2 2R6KA 5G1KA 3J7Yb 2DLXA 2E2GA 1PL1A 3VWVA 3LSZA 4RQXA 4I8BA 2LJKA 2V6KA 4DVCA 2PBJA 2RUFA 7GSSA 3RDWA 3BD2A 3UL3A 2MYGA 1FG4A 4LMWA 2JU5A 1N8JA 2KUCA 5ECSA 4K5SA 1TRVA 1HYUA 3IE3A 2EIRA 1A2LA 2MMNA 2YJ7A 4KX4A 1VRSD 2R0GA 4E8HA 4EIQA 4EC0A 2WJUA 1T4YA 2H1LA 3KMNA 19GSA 3APQA 1PN9A 3IK7A 5F8BA 4BVYB 2R2JA 3LEFA 4MCUA 1ZCPA 3FZAA 5A34A 2P5QA 4OFMA 4I2UA 2OACA 2XPEA 1GL8A 1M0UA 3RPPA 2LRTA 2I9HA 4BPYA 4K7NA 3W8SA 4MPFA 5FT3A 4CHSA 4K8MA 3HY2A 2CQ9A 4IGJA 5IMAA 4Z2TA 3ZITA 4IW9A 2B3SA 4MMMA 2L5OA 1K0CA 1Z6NA 4HS1A 3GL5A 4GRFA 2FWGA 1PMTA 4ZILA 3O76A 4XS6A 3MWHA 3KCMA 2QSIA 3ISOA 4TXOB 3LORA 3L9VA 4HU9A 2ON7A 5J9CA 4N0VA 4HQZA 1X5EA 3IV4A 5C04A 2K18A 1VF2A 4K9ZA 3UJ1A 4YAVA 1YF0A 2H8LA 4O5QA 2WB9A 1U87A 1SJIA 4GWRA 3ZLPA 4GLTA 2M72A 2O87A 5IPGA 4ZBBA 4X4JA 4IELA 2GDRA 1T7PB 5HR3A 1EV4A 1F2EA 3HVXA 2DKIA 13GSA 5E4WA 1K0AA 1XW9A 4KSMA 4HJMA 3I43A 2PMTA 2HRFA 1EOHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GH2 A;  1ACV A;  4BVX A;  4F2I A;  4MK3 A;  4LMV A;  1XWK A;  3KM6 A;  2FA8 A;  1GLP A;  1G6W A;  1GSU A;  2F51 A;  1VGL A;  3FK8 A;  5J5N A;  5LD0 A;  2CZ2 A;  1BAY A;  3GKM A;  4G0L A;  1A24 A;  4OD7 A;  1Z7P A;  2OA7 A;  2V1M A;  4L0U A;  1SEN A;  4TXV A;  1UC7 A;  1QK8 A;  2K8V A;  2RUE A;  4POB A;  3VFI A;  1K0M A;  1MDJ A;  5H5R A;  3R3E A;  3G7J A;  4E8E A;  4KND A;  4KW6 A;  3FHK A;  1GSE A;  3M0F A;  4ECJ A;  1OE7 A;  1ERV A;  1OC9 B;  5F07 A;  3SWL A;  1BED A;  2V2G A;  3TKR A;  4IBP A;  3LWA A;  5JCG A;  3U6V A;  1M9B A;  1OAZ A;  2DJ3 A;  2PVO C;  2H74 A;  4NV2 A;  4JRR A;  2UZ8 A;  2AHE A;  4NXI A;  2VL2 A;  4EL1 A;  2O89 A;  3UMA A;  4MLY A;  2JSZ A;  3QFB C;  1TJD A;  4AGS A;  2FD3 A;  2IFQ B;  4QQ7 A;  5H5S A;  1B9Y C;  4FYU A;  3DKS A;  2DBC A;  4KGI A;  4TR4 A;  2XC2 A;  4AJ6 A;  4PQH A;  5ECM B;  1MD3 A;  1QMV A;  4TXO A;  4N0Z A;  2N5B A;  3P7X A;  3KD0 A;  5DJL A;  2H73 A;  3LG6 A;  3GH6 A;  3DD3 A;  1FVK A;  5F06 A;  3H4K A;  2R5G A;  3FZ9 A;  1K0N A;  2HRK A;  1I9D A;  1TRS A;  3GL3 A;  1QFN A;  5GAN D;  3KTB A;  2B7K A;  2E0Q A;  1JZR A;  3WGD A;  2L57 A;  5J9B A;  3EIN A;  2DJ1 A;  4I2T A;  3QAG A;  3KP9 A;  4ECI A;  1O73 A;  3HZ4 A;  6GSS A;  1J9B A;  1SD9 A;  2NDO A;  2CVK A;  3EMX A;  4LL4 B;  5DCG A;  3IA1 A;  2J9H A;  4WR5 A;  2F3M A;  4JR6 A;  4D73 B;  1A8L A;  6GSV A;  2FWH A;  3IRA A;  3DML A;  4ZL7 A;  3ZYW A;  5DAL B;  1PKZ A;  3GRX A;  3TJF A;  2H1G A;  2VCZ A;  2FWF A;  2L6D A;  2MZC A;  4HDE A;  4TVE A;  4HI7 A;  3GX0 A;  5DAK A;  4NMU A;  3FR9 A;  1JLV A;  3J7Y k;  1NHO A;  1TU7 A;  5IPH A;  2X8H A;  2FNO A;  2QGV A;  3RHB A;  3APO A;  3F3R A;  2A4V A;  4DSS A;  3WGX A;  5B6N A;  1GTB A;  1YF1 A;  3A2X A;  3TKS E;  1GLQ A;  1LBK A;  4NAX A;  5D9T A;  4MAB A;  5A5K A;  3QD9 A;  1ZYE A;  2LUS A;  1NSW A;  3LGC A;  1B4P A;  4K0G A;  1DUG A;  2PVQ A;  1SJZ A;  2YPM A;  5CYY A;  3LYP A;  1RW1 A;  2DSA A;  2HSH A;  3F4S A;  3ZL5 A;  1SKW B;  1ZL9 A;  1T3B A;  3VWU A;  4V1A p;  1KBN A;  1SJ6 A;  2L4C A;  1V2A A;  2WCI A;  4PNG A;  4WR4 A;  4IVF A;  4BL7 B;  2VL2 C;  3APS A;  4IQA A;  3LXT A;  2EC4 A;  1XFL A;  5DAL A;  3MDK A;  3TKQ A;  2C4J A;  2PWJ A;  2Z9S A;  12GS A;  1F3A A;  2HRA A;  1ST9 A;  1TRU A;  1WOU A;  3RBT A;  4GF0 A;  2B1L A;  1H4O A;  1S3A A;  4OCF A;  3GNJ A;  5HR2 A;  5ID2 A;  2IFQ A;  1AQV A;  5LCZ A;  4IHU A;  3R2Q A;  5E59 A;  1N2A A;  4J2F A;  5ECO B;  2IMD A;  3UVH A;  5ABR A;  2FHE A;  1A2J A;  2HYX A;  3IXR A;  4TRX A;  1ZZY A;  1O6J A;  3EUR A;  1OVN A;  4KCE A;  1FAA A;  3H8Q A;  1XPV A;  2G2Q A;  3DIE A;  3UOM A;  3GUS A;  3TB2 A;  3IDV A;  1B8X A;  5B8B A;  4J56 E;  4MH3 A;  2N5A A;  1GUM A;  2ES7 A;  18GS A;  3F9U A;  1PA3 A;  4WXT A;  1KNG A;  2HSY A;  4G10 A;  2O85 A;  3D6I A;  5HR0 A;  1GSQ A;  2DJJ A;  2LJA A;  2G0F A;  1A23 A;  1X9M B;  2RM6 A;  1JLW A;  2YWN A;  2B5E A;  3GUR A;  3W8J A;  2HT9 A;  2F8F A;  2GS3 A;  5ID2 B;  5DAK B;  5EPF A;  4HU7 A;  1JZD A;  1AC1 A;  2H0G A;  4O92 A;  3TKS A;  2NBS A;  1OC8 A;  1WE0 A;  4WF4 A;  5HFG A;  1V58 A;  1IYI A;  3TOU A;  4ISD A;  1X5C A;  2O7K A;  1URM A;  1HD2 A;  4MF7 A;  2YN1 A;  2IIY A;  2H6Y A;  2GSQ A;  5F05 A;  1GRX A;  3HCZ A;  2YZH A;  2LRN A;  5ECL B;  4OO5 A;  3NOF A;  4ZB6 A;  2C0E A;  1FW1 A;  4CW9 A;  1GSS A;  1FO5 A;  2H76 A;  1UN2 A;  4KB3 A;  4ML1 A;  1OE8 A;  3A2W A;  1R7H A;  2K8S A;  4X43 A;  1XZO A;  5IMV A;  5IM9 A;  1PX6 A;  20GS A;  1Z3E A;  5AIV A;  2E2M A;  1KTE A;  3H93 A;  3ZRE A;  2YCD A;  3NZN A;  2H72 A;  2JL4 A;  5GST A;  1GNW A;  1EGR A;  3C73 A;  1T8E B;  3M3M A;  2H1D A;  4PTS A;  1PL2 A;  3DVW A;  4ZB8 A;  5AIX A;  1YZX A;  4XS1 A;  1SL1 B;  1FVJ A;  2RM5 A;  3IOS A;  3A3T A;  2RII A;  3EYT A;  2X8C A;  2YZU A;  3KMO A;  2OE1 A;  2C8U A;  2I3Y A;  2LRC A;  1T4Z A;  2ZNM A;  1YJ6 A;  3DEX A;  2H70 A;  1R4W A;  2HI7 A;  1JFU A;  3WGE A;  3OR5 A;  5D8I A;  4EKZ A;  2J23 A;  2K6V A;  1PX7 A;  5GAP D;  2CX4 A;  1SK2 A;  4BVY A;  5A4V A;  1Z9H A;  3ZTL A;  3M9K A;  2HNL A;  5IMZ A;  2GST A;  2CVD A;  2X99 A;  3VWW A;  4HJ2 A;  2H0I A;  2A2S A;  5DVB A;  4EDY A;  3Q19 A;  4NV5 A;  1TP9 A;  1SKR B;  3KH9 A;  1BG5 A;  3G7Y A;  3I9V 2;  1VF4 A;  4DEJ A;  4IJ3 A;  4GTU A;  1E6B A;  4USS A;  4HZ4 A;  1EP8 A;  1THO A;  5ECK B;  4DSR A;  2C80 A;  3TRX A;  3UBK A;  2I1U A;  4JR4 A;  4MH2 A;  3KGK A;  4XCS A;  1WPI A;  5DCH A;  2R37 A;  2DJK A;  1YDK A;  1BX9 A;  4MDC A;  3KIJ A;  4IP6 A;  1EV9 A;  1Z6M A;  3IC8 A;  1C72 A;  3AY8 A;  2VOC A;  2BJX A;  1G7O A;  4N30 A;  2FUG 2;  3PPU A;  1THX A;  3UAR A;  2DIY A;  2XHF A;  5ECH B;  4TKY A;  1X5D A;  3FRC A;  4ILF A;  2CV4 A;  3WT1 A;  4GQC A;  3M1G A;  4AJ7 A;  3IPZ A;  2PPT A;  4K7O A;  5A4W A;  2FGX A;  1EEM A;  2H75 A;  3DGQ A;  1GTA A;  3NIV A;  1Z7R A;  1XIY A;  3W6G A;  2OBK A;  3H1N A;  5AGY A;  2JSY A;  3KZQ A;  1ERT A;  3VPQ A;  1A2M A;  2YWI A;  2WRT A;  1NM3 A;  1O8X A;  1Z5Y E;  1GUL A;  1UA5 A;  3FR3 A;  2MMZ A;  5G30 A;  4PGT A;  4EVM A;  2GSS A;  2XBI A;  3M9J A;  2PGT A;  3L9U A;  1TOF A;  3ERW A;  1DBY A;  1R26 A;  2H66 A;  3ERG A;  1M2A A;  6GSU A;  5HR1 A;  17GS A;  3F6D A;  5G2Z A;  5HQP A;  2V6O A;  5IMD A;  5JCU A;  1SK1 A;  1YEP A;  4G0I A;  2C3T A;  4ZL8 A;  4TR1 A;  4IKH A;  1G0T A;  5KN1 A;  4TN8 A;  1MEK A;  4BWQ A;  1TI3 A;  3RHC A;  2ZCT A;  2CT6 A;  1XWC A;  4O5R A;  2H01 A;  4OCE A;  1X9S B;  4RI6 A;  8GSS A;  2NPB A;  1IYH A;  5G5F A;  4FO5 A;  3IAS 2;  2MMA A;  2IPA A;  2B6M A;  4BVX B;  3HYP A;  1FOV A;  1ERW A;  4BWS A;  2OE3 A;  1K0D A;  1B9X C;  2E7P A;  1SL2 B;  5D96 A;  1WP0 A;  3G9B A;  3PIN A;  3CSI A;  3CRU A;  2H71 A;  4MA9 A;  2B7J A;  1ZMA A;  3CSJ A;  2HSN B;  4GQF A;  2GQM A;  2OBI A;  4PQI A;  2VD0 A;  5D9W A;  1JHB A;  3DRN A;  4ZBA A;  2X8G A;  1ON4 A;  4HEA 2;  2GSR A;  5G5E A;  2JZS A;  2YNX A;  1K3Y A;  2EIQ A;  1USB A;  3C8E A;  1T00 A;  1WMJ A;  4KDU A;  3LJR A;  2VL9 A;  2ON5 A;  1A8Y A;  4XS4 A;  1J08 A;  3JCM L;  3VLN A;  2KLX A;  2LV3 A;  2GT6 A;  4TOP A;  1M7T A;  2PN8 A;  4F03 A;  1W89 A;  4V2L A;  3CSH A;  3FYG A;  1QQ2 A;  6GST A;  2K9F A;  3EMP A;  2HSM B;  1NHY A;  3IBH A;  1BQ7 A;  2LS5 A;  5J41 A;  3P2A A;  4ZL9 A;  3GKX A;  1TRW A;  4PXO A;  3FKF A;  1GTI A;  10GS A;  1PSQ A;  3D21 A;  2TIR A;  1AXD A;  3D5J A;  3HA9 A;  1YKA A;  4POK A;  5CO3 A;  2QKE A;  1EOG A;  4XRD A;  4LLR A;  1U3I A;  3WYW A;  4BL7 A;  1AAZ A;  2YWM A;  2OE0 A;  5IOW A;  3WD6 A;  5IQY A;  1LU4 A;  1SK0 A;  2D2Z A;  3ZMK A;  5DQY A;  1GUH A;  22GS A;  1K0O A;  2VCW A;  4GCI A;  1M9A A;  3KTL A;  3U5R E;  5A4U A;  1F9M A;  2P5R A;  3HKR A;  2CZ3 A;  3M8N A;  4O32 A;  3GFK A;  2DC5 A;  4MJE A;  4OFN A;  3ZFB A;  3FEU A;  4DSS B;  3PR8 A;  5GZZ B;  1AIU A;  4F9Z A;  1G7E A;  3F0I A;  2AJQ B;  2HZF A;  1PD2 1;  2OJL A;  2LQQ A;  4K1F A;  4DSQ A;  3QMX A;  1XVQ A;  4HUA A;  2HXK A;  3VPT A;  2A2R A;  14GS A;  3TKP A;  3HDC A;  3BCI A;  3GV1 A;  5CRE A;  5G31 A;  1CQG A;  4KA0 A;  3TJJ A;  6GSX A;  2C1Y A;  2KP1 A;  3K8N A;  3LFL A;  3TDG A;  5CRD A;  1FB6 A;  3ME8 A;  4YAP A;  2WGR A;  3KJY A;  3DWV A;  2HSM A;  4NHW A;  5IO0 A;  2JAD A;  1TTZ A;  3UIW A;  1YKC A;  2B5Y A;  4CDO A;  1W4V A;  1BJX A;  4ACS A;  4MZW A;  1AW9 A;  3LXZ A;  4D73 A;  4L5L A;  1SD8 A;  3ZZX A;  5GSS A;  2VCX A;  4PUR A;  5J3R A;  4RUV A;  1V40 A;  3F63 A;  16GS A;  3MNG A;  3FY7 A;  1WRY A;  4FH8 A;  4KF9 A;  5EL8 A;  2L6C A;  4PQ1 A;  5INY A;  4GXZ A;  2FLS A;  1J0F A;  3HJO A;  4TW5 A;  3HD5 A;  5IIZ A;  3EE2 A;  4F0C A;  3EC3 A;  3GKN A;  1YQ1 A;  5ECI B;  2VUP A;  11GS A;  4IN0 A;  4BA7 A;  2GQL A;  2N5F A;  3GTU A;  3HJM A;  4K6X A;  1DE2 A;  1S3D A;  3G7I A;  2VIM A;  1O81 A;  2C0D A;  3ZML A;  3L9S A;  4IQ1 A;  5B8A A;  1GWC A;  1LJR A;  3D22 A;  3P90 A;  2HZE A;  1XOA A;  2GT5 A;  1AQX A;  2RLI A;  2LTK A;  3QAW A;  5LNK e;  4MF6 A;  2YJH A;  1OYJ A;  3LQ7 A;  4OMV A;  3L0H A;  2HFD A;  1MD4 A;  2M80 A;  2PER A;  4JBB A;  5ECP B;  4WBR D;  2DIZ A;  5IOX A;  2KHP A;  4I6X A;  1PGT A;  1GSD A;  3PH9 A;  4ZBD A;  3GX8 A;  2AV4 A;  3VUR A;  1JZO A;  3GTU B;  3UBL A;  3IR4 A;  3IHQ A;  5CRW A;  2V41 A;  3GIX A;  1QXH A;  3EVI A;  3F3Q A;  1K3O A;  5HFI A;  4XS4 B;  3C1R A;  4FYB A;  2EIO A;  1HNB A;  2AB6 A;  3GSS A;  3BOA A;  2C3Q A;  2TRC P;  2R4V A;  3MAK A;  4F82 A;  5B6M A;  4PUA A;  1RQM A;  4EF0 A;  5L71 A;  2YOI A;  4KE3 A;  4X0X A;  4GSS A;  1FB0 A;  1AUC A;  4WET A;  2VL3 A;  2JZT A;  2AYT A;  1AQW A;  2GTU A;  4EUY A;  4K0N A;  3EU3 A;  2M46 A;  4G19 A;  4MJC A;  4Q5Q A;  5H5Q A;  3ZRD A;  4XTS A;  1SU9 A;  1O7U A;  4WKW A;  4V2N A;  2C0F A;  1YEX A;  1H75 A;  3I69 A;  2WUL A;  3IK9 A;  3MSZ A;  3ZIV A;  4FYC A;  1XBS A;  4I5Q A;  3C1S A;  2WS2 A;  4HQS A;  3C71 A;  1SYX A;  4GSN A;  5JCW A;  4FQU A;  1TK5 B;  1WWJ A;  4K7I A;  5G1L A;  5J4U A;  2HQT A;  1GSY A;  3EU4 A;  4L5O A;  3DXB A;  4PNF A;  3VI7 A;  2LJR A;  3GST A;  1ZYQ B;  5KN2 A;  3QCP A;  3O6T A;  5ECR B;  3F4T A;  4KH7 A;  2GQK A;  2HE3 A;  3CTF A;  3ED3 A;  2DML A;  4KCA A;  3GKK A;  5DQS A;  2IMI A;  3KXO A;  3TJG A;  2GZP A;  1DE1 A;  1F6M C;  2TRX A;  9GSS A;  1R5P A;  1K3L A;  3KEB A;  3CYN A;  4EXJ A;  4MJB A;  1ERU A;  2L59 A;  3TUE A;  2MBS A;  5IMC A;  1EZK A;  2VLU A;  2MMO A;  3CRT A;  4KAE A;  4I97 A;  4AF2 A;  1Y6E A;  4XIH A;  2IJY A;  2VLV A;  1M99 A;  5COH A;  3Q18 A;  2YP6 A;  2GVP A;  5JWQ B;  5HFK A;  1G6Y A;  1VF1 A;  6GSY A;  3ZFL A;  2LST A;  3E0U A;  4ID0 A;  1MDK A;  1CQH A;  1WJK A;  2KOK A;  2LKU A;  4V2M A;  1TI1 A;  1X9W B;  4PUF C;  2OKA A;  3HVS A;  2H19 A;  3GH9 A;  5EVO A;  3QR6 A;  3UAP A;  4LA1 A;  1A0R P;  3CXG A;  4ECC A;  5C00 A;  2YWO A;  1EGO A;  1SKS B;  4EO3 A;  4XRA A;  4QL7 A;  4AJ8 A;  1TDI A;  1XWA A;  3TRP A;  1TXX A;  2L4Q A;  4J57 E;  2H30 A;  4NPB A;  4P3Y B;  5FHI A;  2XPD A;  2B5X A;  1YY7 A;  4HZ2 A;  1TK8 B;  3QFA C;  1M2D A;  4ML6 A;  2DJ0 A;  3SBC A;  1XW6 A;  3QAV A;  2H0H A;  3HZ8 A;  3FW2 A;  3DVX A;  1BYE A;  3PGT A;  2MBT A;  2NTO A;  4XHM A;  1QUW A;  3QDN A;  4YQU A;  4JU5 A;  4G0K A;  2O8V B;  1X0R A;  5CRH A;  5DJM A;  4ZXG A;  3A5W A;  4TR0 A;  2LEG A;  3Q6O A;  1TU8 A;  3F4R A;  2IME A;  1DSB A;  3US3 A;  4JED A;  1ZGN A;  3E9J B;  5ELG A;  1WIK A;  3BCK A;  4MP4 A;  4ZIJ A;  2P0G A;  4L0W A;  3GHA A;  2CX3 A;  5CRG A;  3ZVJ A;  2PU9 C;  4YQV A;  3BBY A;  1V9W A;  3KH7 A;  3HJP A;  1XCC A;  1XWB A;  3GN3 A;  1XOB A;  2WZ9 A;  3C7M A;  2VD1 A;  1MDI A;  2GGT A;  4Q5R A;  3TOT A;  4G2E A;  2B1K A;  5ENU A;  1VF3 A;  3VWX A;  4H86 A;  1TK0 B;  4IS0 A;  2LNS A;  4Q5F A;  2REM A;  4KUN A;  3ZVJ D;  3UEM A;  3EWL A;  1M2B A;  3D0Z A;  2VM2 A;  2IMK A;  2F9S A;  4K2D A;  1EP7 A;  4WEY A;  2XBQ A;  4ECB A;  4RQR A;  1ABA A;  2HLS A;  3GA4 A;  2I4A A;  4MJA A;  2VCT A;  5D73 A;  4EE0 A;  4MZB A;  3GMF A;  2WDU A;  5D9X A;  5KN3 A;  2AAW A;  1Y25 A;  4TR1 B;  2R3X A;  2YV7 A;  1R5A A;  4N10 A;  4FIW A;  3TRQ A;  1PRX A;  4Z7X A;  1U3A A;  2CVB A;  4LL1 B;  1E2Y A;  1O85 A;  1QGV A;  2GLR A;  5D9V A;  3CTG A;  1V98 A;  1I5G A;  4G9H A;  3KP8 A;  2BTO T;  1Q98 A;  3V1W A;  3LYK A;  2V32 A;  4O7H A;  3DYR A;  2H1B A;  1ILO A;  3S9F A;  3L4N A;  1OC3 A;  2KP2 A;  3HHV A;  3VK9 A;  1RK4 A;  4OFT A;  1Q4J A;  2ZUP A;  1KEB A;  4ZB9 A;  3L78 A;  2CAQ A;  3HVV A;  1XXU A;  4IP1 A;  3IC4 A;  4F0B A;  4GST A;  2DMM A;  1V57 A;  3BJ5 A;  2F8A A;  2C0G A;  4L8E A;  1XW5 A;  4V1A g;  2I81 A;  2P31 A;  3H79 A;  3O3T A;  3TGZ A;  3E3E A;  4KDX A;  4JE1 A;  1F37 A;  3CMI A;  1A0F A;  2HRK B;  4WF5 A;  1U88 A;  4HOJ A;  4MPG A;  2VO4 A;  5ECQ B;  3N9J A;  3QOU A;  3N5O A;  1MTC A;  3WT2 A;  4OWY A;  4X1U A;  1GP1 A;  5CNW A;  2VCV A;  2H1A A;  3ME7 A;  4RI7 A;  2L5L A;  5D93 A;  3RPN A;  1S3C A;  5IMF A;  2IL3 A;  5CAX A;  3ERF A;  3FZ5 A;  5BMU A;  2H6Z A;  1T1V A;  1UVZ A;  1GTU A;  3CBU A;  3TKS C;  2VCQ A;  4KSO A;  1O8W A;  5F0G A;  3TJK A;  1SYR A;  1U6T A;  5ELA A;  4PX1 A;  4EDZ A;  2ALB A;  3A2V A;  1EEJ A;  4WBJ A;  4MZC A;  1OC9 A;  2FWE A;  2LQO A;  5JWR B;  2DJ2 A;  1FHE A;  1TKD B;  3ZIJ A;  4N11 A;  1HNC A;  1PKW A;  2GZY A;  3FR6 A;  2IN3 A;  1JZW A;  2JZR A;  3QPM A;  2VM1 A;  3RAZ A;  1GSF A;  4JZQ A;  3HXS A;  4YQM A;  3GYK A;  1XWG A;  4OO4 A;  2IMF A;  2FY6 A;  2YV9 A;  2HRN A;  4ULX A;  1GNE A;  2AUV A;  3Q74 A;  5KEJ A;  4TR3 A;  2YAN A;  2LNT A;  1B48 A;  4Q5N A;  4IJI A;  5EY6 A;  4NWY A;  4POM A;  1OKT A;  3TJB A;  2NVL A;  2VAF A;  1TW9 A;  2QC7 A;  1OKD A;  3D4T A;  2CA8 A;  1GUK A;  1SL0 B;  1F3B A;  2OAD A;  4MF5 A;  2JAC A;  2C3N A;  1HQO A;  5AIS A;  1HNA A;  5IO2 A;  2WFC A;  1B4Q A;  1ZOF A;  5ECN B;  1PQN A;  5FWG A;  3D4M A;  2PUK C;  1EWX A;  4KDY A;  1K0B A;  5B7C A;  4YH2 A;  3VI5 A;  2VLT A;  5DBQ A;  5CP1 A;  2HZE B;  2CAI A;  3UVT A;  1ML6 A;  3P8W A;  5DDL A;  2FA4 A;  2H6X A;  5AN1 A;  1XVW A;  2X64 A;  3F8U A;  4POL A;  2BMX A;  3FZ4 A;  4NHZ A;  2FCH A;  3I6A A;  6GSW A;  4QL9 A;  5JWO B;  1NW2 A;  5KN0 A;  2GZZ A;  3TCO A;  3F6F A;  2IWT A;  3IAM 2;  2R6K A;  5G1K A;  3J7Y b;  2DLX A;  2E2G A;  1PL1 A;  3VWV A;  3LSZ A;  4RQX A;  4I8B A;  2LJK A;  2V6K A;  4DVC A;  2PBJ A;  2RUF A;  7GSS A;  3RDW A;  3BD2 A;  3UL3 A;  2MYG A;  1FG4 A;  4LMW A;  2JU5 A;  1N8J A;  2KUC A;  5ECS A;  1TRV A;  1HYU A;  3IE3 A;  2EIR A;  1A2L A;  2MMN A;  2YJ7 A;  4KX4 A;  1VRS D;  4E8H A;  4EC0 A;  2WJU A;  1T4Y A;  3KMN A;  19GS A;  3APQ A;  1PN9 A;  3IK7 A;  5F8B A;  4BVY B;  2R2J A;  3LEF A;  1ZCP A;  4MCU A;  3FZA A;  2P5Q A;  4OFM A;  4I2U A;  2OAC A;  2XPE A;  1GL8 A;  1M0U A;  3RPP A;  2LRT A;  2I9H A;  4BPY A;  4K7N A;  3W8S A;  4MPF A;  5FT3 A;  4CHS A;  4K8M A;  3HY2 A;  2CQ9 A;  4IGJ A;  5IMA A;  3ZIT A;  4IW9 A;  2B3S A;  4MMM A;  2L5O A;  1K0C A;  1Z6N A;  4HS1 A;  3GL5 A;  4GRF A;  2FWG A;  1PMT A;  4ZIL A;  3O76 A;  4XS6 A;  3MWH A;  3KCM A;  2QSI A;  3ISO A;  4TXO B;  3LOR A;  3L9V A;  4HU9 A;  2ON7 A;  5J9C A;  4N0V A;  4HQZ A;  1X5E A;  3IV4 A;  5C04 A;  2K18 A;  1VF2 A;  4K9Z A;  3UJ1 A;  4YAV A;  1YF0 A;  2H8L A;  2WB9 A;  1U87 A;  1SJI A;  4GWR A;  3ZLP A;  4GLT A;  2M72 A;  2O87 A;  5IPG A;  4ZBB A;  4IEL A;  2GDR A;  1T7P B;  5HR3 A;  1EV4 A;  1F2E A;  3HVX A;  13GS A;  5E4W A;  1K0A A;  1XW9 A;  4KSM A;  4HJM A;  3I43 A;  2PMT A;  2HRF A;  1EOH A; 
#chains in the Genus database with same CATH topology
 1GH2 A;  4YKF A;  1ACV A;  4BVX A;  4F2I A;  4MK3 A;  4LMV A;  1XWK A;  3KM6 A;  2FA8 A;  1GLP A;  1G6W A;  1GSU A;  2F51 A;  1VGL A;  3FK8 A;  5J5N A;  5LD0 A;  2CZ2 A;  1BAY A;  3GKM A;  4G0L A;  1A24 A;  4OD7 A;  1Z7P A;  2OA7 A;  2V1M A;  2OT3 A;  4L0U A;  1SEN A;  4TXV A;  1UC7 A;  1QK8 A;  2K8V A;  2RUE A;  4POB A;  3VFI A;  1K0M A;  1MDJ A;  5H5R A;  3R3E A;  3G7J A;  4E8E A;  4KND A;  4KW6 A;  3FHK A;  1GSE A;  3M0F A;  4ECJ A;  1OE7 A;  1ERV A;  1OC9 B;  5F07 A;  3SWL A;  1BED A;  2V2G A;  3TKR A;  4IBP A;  3LWA A;  5JCG A;  2QA1 A;  2R0P A;  3U6V A;  1M9B A;  1OAZ A;  2DJ3 A;  2PVO C;  2H74 A;  4NV2 A;  4AKX B;  4JRR A;  2UZ8 A;  2AHE A;  4NXI A;  2VL2 A;  4EL1 A;  2O89 A;  3UMA A;  4MLY A;  2JSZ A;  3QFB C;  4Z2R A;  1TJD A;  4AGS A;  2FD3 A;  2IFQ B;  4QQ7 A;  1B9Y C;  5H5S A;  4FYU A;  3DKS A;  2DBC A;  2WVY A;  4KGI A;  4TR4 A;  2XC2 A;  4AJ6 A;  4PQH A;  5ECM B;  1MD3 A;  1QMV A;  4TXO A;  4N0Z A;  2N5B A;  3P7X A;  3KD0 A;  5DJL A;  2H73 A;  3LG6 A;  3GH6 A;  3DD3 A;  1FVK A;  5F06 A;  4W66 A;  3H4K A;  2R5G A;  3FZ9 A;  1K0N A;  2HRK A;  1I9D A;  1TRS A;  3GL3 A;  1QFN A;  5GAN D;  3KTB A;  2B7K A;  2E0Q A;  1JZR A;  3WGD A;  2L57 A;  5J9B A;  3EIN A;  2DJ1 A;  4I2T A;  3QAG A;  3KP9 A;  4ECI A;  1O73 A;  3HZ4 A;  6GSS A;  1J9B A;  1SD9 A;  2NDO A;  2CVK A;  3EMX A;  4LL4 B;  5DCG A;  3IA1 A;  2J9H A;  4WR5 A;  2F3M A;  4JR6 A;  4D73 B;  1A8L A;  6GSV A;  2FWH A;  3IRA A;  3DML A;  4ZL7 A;  3ZYW A;  3CQF A;  5DAL B;  1PKZ A;  3GRX A;  3TJF A;  2H1G A;  2VCZ A;  2FWF A;  2L6D A;  2MZC A;  4HDE A;  4TVE A;  4HI7 A;  3GX0 A;  5DAK A;  4NMU A;  3FR9 A;  1JLV A;  3J7Y k;  1NHO A;  1TU7 A;  5IPH A;  2X8H A;  2FNO A;  2QGV A;  3RHB A;  3APO A;  3F3R A;  4Z2U A;  4ZB7 A;  2A4V A;  4CY6 A;  4DSS A;  3WGX A;  4E68 A;  5B6N A;  1GTB A;  1YF1 A;  3A2X A;  3TKS E;  1GLQ A;  1LBK A;  4NAX A;  5D9T A;  4MAB A;  5A5K A;  3QD9 A;  1ZYE A;  2LUS A;  1NSW A;  3LGC A;  1B4P A;  4K0G A;  1DUG A;  2PVQ A;  1SJZ A;  2YPM A;  5CYY A;  3LYP A;  1RW1 A;  2DSA A;  2HSH A;  3F4S A;  3ZL5 A;  1SKW B;  1ZL9 A;  1T3B A;  2X4A A;  3VWU A;  4V1A p;  1KBN A;  1SJ6 A;  2L4C A;  1V2A A;  2WCI A;  4PNG A;  4WR4 A;  4IVF A;  4BL7 B;  2VL2 C;  3APS A;  1TXU A;  4IQA A;  3LXT A;  2EC4 A;  1XFL A;  5DAL A;  2X49 A;  3MDK A;  3TKQ A;  2C4J A;  2PWJ A;  2Z9S A;  12GS A;  1F3A A;  2HRA A;  1ST9 A;  1TRU A;  1WOU A;  3RBT A;  4GF0 A;  2B1L A;  1PFO A;  1H4O A;  4FXY P;  1S3A A;  4PI0 C;  4OCF A;  3GNJ A;  5HR2 A;  5ID2 A;  2IFQ A;  1AQV A;  5LCZ A;  4IHU A;  3R2Q A;  5E59 A;  1N2A A;  4J2F A;  5ECO B;  2IMD A;  3UVH A;  5ABR A;  2FHE A;  1A2J A;  2HYX A;  3IXR A;  4TRX A;  1ZZY A;  1O6J A;  3EUR A;  4CY8 A;  1OVN A;  4KCE A;  1FAA A;  3H8Q A;  1XPV A;  2G2Q A;  3DIE A;  3UOM A;  3GUS A;  3TB2 A;  3IDV A;  1B8X A;  5B8B A;  4J56 E;  4MH3 A;  2N5A A;  1GUM A;  2ES7 A;  18GS A;  3F9U A;  1PA3 A;  4WXT A;  1KNG A;  2HSY A;  4G10 A;  2O85 A;  3D6I A;  5HR0 A;  1GSQ A;  2DJJ A;  2LJA A;  2G0F A;  1A23 A;  1X9M B;  2RM6 A;  1JLW A;  2YWN A;  2B5E A;  3GUR A;  3W8J A;  2HT9 A;  2F8F A;  2GS3 A;  5ID2 B;  5DAK B;  5EPF A;  4HU7 A;  1JZD A;  1AC1 A;  2H0G A;  4YKG A;  4O92 A;  3TKS A;  2NBS A;  1OC8 A;  1WE0 A;  4WF4 A;  5HFG A;  1V58 A;  1IYI A;  3TOU A;  4ISD A;  1X5C A;  2O7K A;  1URM A;  1HD2 A;  4MF7 A;  3RFR C;  2YN1 A;  4BIK A;  2WZS A;  2IIY A;  2H6Y A;  2GSQ A;  5F05 A;  1GRX A;  3HCZ A;  2YZH A;  2LRN A;  5ECL B;  4OO5 A;  3NOF A;  4ZB6 A;  2C0E A;  1FW1 A;  3A5I A;  4N3Z A;  3MIX A;  4CW9 A;  1GSS A;  1FO5 A;  2H76 A;  1UN2 A;  4KB3 A;  4ML1 A;  1OE8 A;  3A2W A;  1R7H A;  2K8S A;  4X43 A;  1XZO A;  5IMV A;  5IM9 A;  1PX6 A;  20GS A;  1Z3E A;  5AIV A;  2E2M A;  5BRT A;  1KTE A;  3H93 A;  3ZRE A;  2YCD A;  3NZN A;  2H72 A;  2JL4 A;  5GST A;  5A1N A;  1GNW A;  2O36 A;  1EGR A;  3C73 A;  1T8E B;  3M3M A;  2H1D A;  4PTS A;  1PL2 A;  3DVW A;  4ZB8 A;  5AIX A;  1YZX A;  4XS1 A;  1SL1 B;  1FVJ A;  2RM5 A;  3IOS A;  3A3T A;  2RII A;  3CHX C;  3EYT A;  2A2P A;  2X8C A;  2YZU A;  3KMO A;  2OE1 A;  2C8U A;  2I3Y A;  2LRC A;  1T4Z A;  2ZNM A;  1YJ6 A;  3DEX A;  2H70 A;  1R4W A;  2HI7 A;  1JFU A;  3WGE A;  3OR5 A;  5D8I A;  4EKZ A;  2J23 A;  2K6V A;  1PX7 A;  5GAP D;  2CX4 A;  1SK2 A;  4BVY A;  5A4V A;  1Z9H A;  3ZTL A;  3M9K A;  2HNL A;  5IMZ A;  2GST A;  2CVD A;  2X99 A;  3VWW A;  4HJ2 A;  2H0I A;  2A2S A;  5DVB A;  4EDY A;  3Q19 A;  2EFC A;  4NV5 A;  1TP9 A;  1SKR B;  3KH9 A;  1BG5 A;  3G7Y A;  3I9V 2;  1VF4 A;  4DEJ A;  4IJ3 A;  4GTU A;  1E6B A;  4USS A;  4HZ4 A;  1EP8 A;  1THO A;  5ECK B;  4DSR A;  2C80 A;  3TRX A;  3CWG A;  3UBK A;  2I1U A;  4JR4 A;  4MH2 A;  3KGK A;  5J47 A;  4XCS A;  1WPI A;  5DCH A;  2R37 A;  2DJK A;  1YDK A;  1BX9 A;  4MDC A;  3KIJ A;  4IP6 A;  1EV9 A;  1ZYN A;  1Z6M A;  3IC8 A;  1C72 A;  3AY8 A;  2VOC A;  2BJX A;  1G7O A;  4N30 A;  2FUG 2;  3PPU A;  1THX A;  3UAR A;  2DIY A;  2XHF A;  5ECH B;  4TKY A;  3HMJ G;  1X5D A;  4K2X A;  3FRC A;  4ILF A;  2CV4 A;  3WT1 A;  4GQC A;  3M1G A;  4AJ7 A;  3IPZ A;  2PPT A;  4K7O A;  5A4W A;  2FGX A;  1EEM A;  2H75 A;  3DGQ A;  1GTA A;  3NIV A;  1Z7R A;  1XIY A;  3W6G A;  2OBK A;  3H1N A;  5AGY A;  2JSY A;  3KZQ A;  1ERT A;  3VPQ A;  1A2M A;  2YWI A;  2WRT A;  1NM3 A;  1SVL A;  1O8X A;  2QA2 A;  1Z5Y E;  1GUL A;  1UA5 A;  3FR3 A;  2O5V A;  2MMZ A;  5G30 A;  4PGT A;  4EVM A;  2GSS A;  2XBI A;  3M9J A;  4HSC X;  4AKG A;  2PGT A;  3L9U A;  1TOF A;  3ERW A;  1DBY A;  1R26 A;  2H66 A;  3ERG A;  1M2A A;  2WVZ A;  6GSU A;  5HR1 A;  17GS A;  3F6D A;  5G2Z A;  5HQP A;  2V6O A;  5IMD A;  5JCU A;  1SK1 A;  1YEP A;  4G0I A;  2C3T A;  2DKH A;  4ZL8 A;  4TR1 A;  4IKH A;  1G0T A;  5KN1 A;  4TN8 A;  1MEK A;  4BWQ A;  1TI3 A;  3RHC A;  2ZCT A;  2CT6 A;  1XWC A;  3RGB C;  4O5R A;  5KOW A;  2H01 A;  4OCE A;  1X9S B;  4RI6 A;  8GSS A;  2NPB A;  1IYH A;  5G5F A;  4FO5 A;  3IAS 2;  2MMA A;  2IPA A;  2B6M A;  4BVX B;  3HYP A;  1FOV A;  1ERW A;  4BWS A;  2OE3 A;  1K0D A;  1B9X C;  2E7P A;  1SL2 B;  3MYD A;  2UV8 G;  5D96 A;  1WP0 A;  3G9B A;  3PIN A;  3CSI A;  3CRU A;  2H71 A;  4MA9 A;  2B7J A;  1ZMA A;  3CSJ A;  2HSN B;  4GQF A;  2GQM A;  2OBI A;  4PQI A;  2VD0 A;  5D9W A;  1JHB A;  3DRN A;  4ZBA A;  2X8G A;  1ON4 A;  4HEA 2;  2GSR A;  5G5E A;  2JZS A;  2YNX A;  1K3Y A;  2WVX A;  2EIQ A;  1USB A;  3C8E A;  1T00 A;  1WMJ A;  4KDU A;  3LJR A;  2VL9 A;  2ON5 A;  1A8Y A;  4XS4 A;  1J08 A;  3JCM L;  3VLN A;  2KLX A;  2LV3 A;  5A5H A;  2GT6 A;  1YVL A;  4TOP A;  1M7T A;  3HVN A;  2PN8 A;  4F03 A;  1W89 A;  4V2L A;  3CSH A;  3FYG A;  1QQ2 A;  6GST A;  2K9F A;  3EMP A;  2HSM B;  1NHY A;  3IBH A;  1BQ7 A;  2LS5 A;  5J41 A;  3P2A A;  4ZL9 A;  3GKX A;  1TRW A;  4PXO A;  3FKF A;  1GTI A;  10GS A;  1PSQ A;  3D21 A;  2TIR A;  1AXD A;  3D5J A;  3HA9 A;  1YKA A;  4POK A;  5CO3 A;  2QKE A;  1EOG A;  4XRD A;  4LLR A;  1U3I A;  3WYW A;  4BL7 A;  1AAZ A;  1M3J A;  2WVX B;  2YWM A;  2OE0 A;  5IOW A;  3WD6 A;  5IQY A;  1LU4 A;  1SK0 A;  4EIP A;  2D2Z A;  3ZMK A;  5DQY A;  1GUH A;  22GS A;  1K0O A;  2VCW A;  4GCI A;  1M9A A;  3KTL A;  3U5R E;  5A4U A;  1F9M A;  2P5R A;  3HKR A;  2CZ3 A;  3M8N A;  4O32 A;  5J4V A;  3GFK A;  2DC5 A;  4MJE A;  4OFN A;  3ZFB A;  3FEU A;  4DSS B;  3PR8 A;  5GZZ B;  1AIU A;  4F9Z A;  1G7E A;  3F0I A;  5J40 A;  2AJQ B;  2HZF A;  1PD2 1;  2OJL A;  2LQQ A;  4K1F A;  4DSQ A;  3QMX A;  1XVQ A;  4HUA A;  2HXK A;  3VPT A;  2A2R A;  14GS A;  3TKP A;  3HDC A;  3BCI A;  3GV1 A;  5CRE A;  5G31 A;  1CQG A;  4KA0 A;  3TJJ A;  6GSX A;  2C1Y A;  2KP1 A;  3K8N A;  4G01 A;  3LFL A;  3TDG A;  5CRD A;  1FB6 A;  1SVO A;  3ME8 A;  4YAP A;  2WGR A;  3KJY A;  3DWV A;  2HSM A;  4NHW A;  5IO0 A;  2JAD A;  1TTZ A;  3UIW A;  1YKC A;  2B5Y A;  4CDO A;  1W4V A;  1BJX A;  4ACS A;  4MZW A;  1AW9 A;  3LXZ A;  4D73 A;  4L5L A;  1SD8 A;  3ZZX A;  5GSS A;  2VCX A;  4PUR A;  4O5U A;  2WW3 A;  5J3R A;  4RUV A;  1V40 A;  3F63 A;  16GS A;  3MNG A;  3FY7 A;  1WRY A;  1YEW C;  4FH8 A;  4KF9 A;  5EL8 A;  2L6C A;  4PQ1 A;  5INY A;  4GXZ A;  2FLS A;  1J0F A;  3HJO A;  4TW5 A;  3HD5 A;  5IIZ A;  4ICY A;  3EE2 A;  4F0C A;  3EC3 A;  3GKN A;  1YQ1 A;  5ECI B;  2VUP A;  11GS A;  4IN0 A;  1ZYP A;  4BA7 A;  2GQL A;  2N5F A;  3GTU A;  3HJM A;  4K6X A;  1DE2 A;  1S3D A;  3G7I A;  2VIM A;  1O81 A;  2C0D A;  3ZML A;  3L9S A;  4IQ1 A;  5B8A A;  1GWC A;  1LJR A;  3D22 A;  3P90 A;  5A1N B;  2HZE A;  1XOA A;  2GT5 A;  1AQX A;  2RLI A;  2LTK A;  3QAW A;  5LNK e;  4MF6 A;  2YJH A;  1OYJ A;  3LQ7 A;  4OMV A;  3L0H A;  2HFD A;  1MD4 A;  2M80 A;  2PER A;  4JBB A;  5ECP B;  4WBR D;  1N25 A;  2DIZ A;  5IOX A;  2KHP A;  4I6X A;  1PGT A;  1GSD A;  2WW1 A;  3PH9 A;  4ZBD A;  3GX8 A;  2AV4 A;  3VUR A;  1JZO A;  3GTU B;  3UBL A;  3IR4 A;  3IHQ A;  5CRW A;  2V41 A;  3GIX A;  1QXH A;  3EVI A;  3F3Q A;  1K3O A;  5HFI A;  4XS4 B;  3C1R A;  4FYB A;  2EIO A;  1HNB A;  2AB6 A;  3GSS A;  3BOA A;  2C3Q A;  2TRC P;  2R4V A;  4AI6 A;  3MAK A;  4F82 A;  5B6M A;  4PUA A;  1RQM A;  4EF0 A;  5L71 A;  2YOI A;  4KE3 A;  4X0X A;  4GSS A;  1FB0 A;  1S3R A;  1AUC A;  4WET A;  2VL3 A;  2JZT A;  2AYT A;  4AKH A;  1AQW A;  2GTU A;  4EUY A;  4K0N A;  3EU3 A;  2M46 A;  4G19 A;  4MJC A;  4Q5Q A;  4MNN A;  5H5Q A;  3ZRD A;  4XTS A;  1SU9 A;  1O7U A;  4WKW A;  4V2N A;  2C0F A;  1YEX A;  1H75 A;  3I69 A;  2WUL A;  3IK9 A;  3MSZ A;  3ZIV A;  4FYC A;  1XBS A;  4I5Q A;  3C1S A;  2WS2 A;  4HQS A;  3C71 A;  1SYX A;  4GSN A;  5JCW A;  4FQU A;  1TK5 B;  1WWJ A;  4K7I A;  5G1L A;  5J4U A;  2HQT A;  1GSY A;  3EU4 A;  4L5O A;  3DXB A;  4PNF A;  3VI7 A;  2LJR A;  3GST A;  1ZYQ B;  5KN2 A;  3QCP A;  3O6T A;  5ECR B;  3F4T A;  4KH7 A;  2GQK A;  2HE3 A;  4K5R A;  3CTF A;  3ED3 A;  2DML A;  4KCA A;  3GKK A;  5DQS A;  2IMI A;  3KXO A;  3TJG A;  2GZP A;  1DE1 A;  1F6M C;  2TRX A;  9GSS A;  1R5P A;  1K3L A;  3KEB A;  3CYN A;  4EXJ A;  4MJB A;  1ERU A;  2L59 A;  3TUE A;  2MBS A;  5IMC A;  1EZK A;  2VLU A;  2MMO A;  3CRT A;  2VKZ G;  4KAE A;  4I97 A;  4AF2 A;  1Y6E A;  4XIH A;  2IJY A;  2VLV A;  1M99 A;  5COH A;  3Q18 A;  2YP6 A;  2GVP A;  5JWQ B;  5HFK A;  1G6Y A;  1VF1 A;  6GSY A;  3ZFL A;  2LST A;  3E0U A;  4ID0 A;  1MDK A;  1CQH A;  1WJK A;  2KOK A;  2LKU A;  4V2M A;  1TI1 A;  1X9W B;  4PUF C;  2OKA A;  3HVS A;  2H19 A;  3GH9 A;  5EVO A;  3QR6 A;  3UAP A;  4LA1 A;  1A0R P;  3CXG A;  4ECC A;  5C00 A;  2YWO A;  1EGO A;  1SKS B;  4EO3 A;  4XRA A;  1S4B P;  3LW9 A;  4QL7 A;  4AJ8 A;  1TDI A;  1XWA A;  3TRP A;  1TXX A;  2L4Q A;  4J57 E;  2H30 A;  4NPB A;  4P3Y B;  5FHI A;  2XPD A;  2B5X A;  1YY7 A;  4HZ2 A;  1TK8 B;  3QFA C;  3TU3 B;  1M2D A;  4ML6 A;  2DJ0 A;  3SBC A;  1XW6 A;  3QAV A;  2H0H A;  3HZ8 A;  3FW2 A;  1SVM A;  3DVX A;  1BYE A;  3PGT A;  2MBT A;  2NTO A;  4XHM A;  1QUW A;  3QDN A;  4YQU A;  4JU5 A;  4G0K A;  2O8V B;  1X0R A;  5CRH A;  5DJM A;  4ZXG A;  3A5W A;  4TR0 A;  2LEG A;  3Q6O A;  1TU8 A;  3F4R A;  2IME A;  1DSB A;  3US3 A;  4JED A;  1ZGN A;  3E9J B;  5ELG A;  1WIK A;  3BCK A;  4MP4 A;  4ZIJ A;  2P0G A;  4L0W A;  3GHA A;  2CX3 A;  5CRG A;  3ZVJ A;  2PU9 C;  4YQV A;  3BBY A;  1V9W A;  2EFE A;  3KH7 A;  3HJP A;  1XCC A;  1XWB A;  3GN3 A;  1XOB A;  2WZ9 A;  4PI2 C;  3C7M A;  2VD1 A;  1MDI A;  2GGT A;  4Q5R A;  3TOT A;  4A5P A;  4G2E A;  2B1K A;  5ENU A;  1VF3 A;  3VWX A;  4H86 A;  1TK0 B;  4IS0 A;  2LNS A;  4Q5F A;  2REM A;  4KUN A;  3ZVJ D;  3UEM A;  3EWL A;  1M2B A;  3D0Z A;  2VM2 A;  2IMK A;  2F9S A;  4K2D A;  1EP7 A;  4WEY A;  2XBQ A;  4ECB A;  4RQR A;  1ABA A;  2HLS A;  1PN0 A;  3GA4 A;  2I4A A;  5A34 B;  4MJA A;  2VCT A;  5D73 A;  4EE0 A;  4MZB A;  3GMF A;  2WDU A;  5D9X A;  5KN3 A;  2AAW A;  1Y25 A;  4TR1 B;  2R3X A;  2YV7 A;  1R5A A;  4N10 A;  4FIW A;  3TRQ A;  1PRX A;  4Z7X A;  1U3A A;  2CVB A;  4LL1 B;  1E2Y A;  1O85 A;  1QGV A;  2GLR A;  5D9V A;  5J4Y A;  3CTG A;  1FOH A;  1V98 A;  1I5G A;  4G9H A;  3KP8 A;  1BG1 A;  2BTO T;  1Q98 A;  3V1W A;  3LYK A;  2A4H A;  2V32 A;  4O7H A;  3DYR A;  2H1B A;  1ILO A;  3S9F A;  3L4N A;  1OC3 A;  2KP2 A;  3HHV A;  3VK9 A;  1RK4 A;  4OFT A;  1Q4J A;  2ZUP A;  4QMK A;  1KEB A;  4ZB9 A;  3L78 A;  2CAQ A;  3HVV A;  1XXU A;  4IP1 A;  3IC4 A;  4F0B A;  4GST A;  2DMM A;  1V57 A;  3BJ5 A;  2F8A A;  2C0G A;  4L8E A;  1XW5 A;  4V1A g;  4AKI A;  2I81 A;  2P31 A;  3H79 A;  3O3T A;  3TGZ A;  3E3E A;  4KDX A;  4JE1 A;  1F37 A;  2O3E A;  3CMI A;  1A0F A;  2HRK B;  4WF5 A;  1I1I P;  1U88 A;  4HOJ A;  4MPG A;  2VO4 A;  1M3I A;  5ECQ B;  3N9J A;  3QOU A;  3N5O A;  1MTC A;  3WT2 A;  5BMU B;  4OWY A;  4X1U A;  1GP1 A;  5CNW A;  2VCV A;  2H1A A;  3ME7 A;  4RI7 A;  2L5L A;  5D93 A;  3RPN A;  1S3C A;  5IMF A;  2WW0 A;  2IL3 A;  5CAX A;  3ERF A;  3FZ5 A;  5BMU A;  2H6Z A;  1T1V A;  1UVZ A;  1GTU A;  3CBU A;  3TKS C;  2VCQ A;  4KSO A;  1O8W A;  2R0C A;  5F0G A;  3TJK A;  1SYR A;  1U6T A;  5ELA A;  4PX1 A;  2EFH A;  4EDZ A;  2ALB A;  3A2V A;  1EEJ A;  2WW2 A;  4WBJ A;  4MZC A;  1OC9 A;  2FWE A;  3FMW A;  2LQO A;  5JWR B;  2DJ2 A;  1FHE A;  1TKD B;  3ZIJ A;  4N11 A;  1HNC A;  1PKW A;  2GZY A;  3FR6 A;  2IN3 A;  3IHG A;  1JZW A;  2JZR A;  3QPM A;  2VM1 A;  3RAZ A;  1GSF A;  4JZQ A;  3HXS A;  4YQM A;  3GYK A;  1XWG A;  4OO4 A;  2IMF A;  2FY6 A;  2YV9 A;  2HRN A;  4ULX A;  1GNE A;  2AUV A;  1XG8 A;  3Q74 A;  5KEJ A;  4TR3 A;  2YAN A;  2LNT A;  1B48 A;  4Q5N A;  4IJI A;  5EY6 A;  4NWY A;  4POM A;  1OKT A;  3TJB A;  1Y1U A;  2NVL A;  2VAF A;  1TW9 A;  2QC7 A;  3EPT A;  5KOX A;  1OKD A;  3D4T A;  2CA8 A;  1GUK A;  1SL0 B;  1BF5 A;  1F3B A;  2OAD A;  4MF5 A;  2JAC A;  2C3N A;  1HQO A;  5AIS A;  1HNA A;  5IO2 A;  2WFC A;  1B4Q A;  4GDF A;  1ZOF A;  5ECN B;  1PQN A;  5FWG A;  3D4M A;  2PUK C;  1EWX A;  4KDY A;  1K0B A;  5A5H B;  5B7C A;  4YH2 A;  3VI5 A;  2VLT A;  5DBQ A;  5CP1 A;  2HZE B;  2CAI A;  3UVT A;  1ML6 A;  3P8W A;  5DDL A;  2EFD A;  2HSN A;  2FA4 A;  2H6X A;  5AN1 A;  1XVW A;  2X64 A;  3F8U A;  4POL A;  2BMX A;  3FZ4 A;  4NHZ A;  2FCH A;  3I6A A;  6GSW A;  4QL9 A;  5JWO B;  1NW2 A;  5KN0 A;  2GZZ A;  3TCO A;  3F6F A;  2IWT A;  3IAM 2;  2R6K A;  5G1K A;  3J7Y b;  2DLX A;  4PHZ C;  2E2G A;  1PL1 A;  3VWV A;  3LSZ A;  4RQX A;  4I8B A;  2LJK A;  2V6K A;  4DVC A;  2PBJ A;  2RUF A;  7GSS A;  3RDW A;  3BD2 A;  3UL3 A;  2MYG A;  1FG4 A;  4LMW A;  2JU5 A;  1N8J A;  2KUC A;  5ECS A;  4K5S A;  1TRV A;  1HYU A;  3IE3 A;  2EIR A;  1A2L A;  2MMN A;  2YJ7 A;  4KX4 A;  1VRS D;  2R0G A;  4E8H A;  4EIQ A;  4EC0 A;  2WJU A;  1T4Y A;  2H1L A;  3KMN A;  19GS A;  3APQ A;  1PN9 A;  3IK7 A;  5F8B A;  4BVY B;  2R2J A;  3LEF A;  4MCU A;  1ZCP A;  3FZA A;  5A34 A;  2P5Q A;  4OFM A;  4I2U A;  2OAC A;  2XPE A;  1GL8 A;  1M0U A;  3RPP A;  2LRT A;  2I9H A;  4BPY A;  4K7N A;  3W8S A;  4MPF A;  5FT3 A;  4K8M A;  4CHS A;  3HY2 A;  2CQ9 A;  4IGJ A;  5IMA A;  4Z2T A;  3ZIT A;  4IW9 A;  2B3S A;  4MMM A;  2L5O A;  1K0C A;  1Z6N A;  4HS1 A;  3GL5 A;  4GRF A;  2FWG A;  1PMT A;  4ZIL A;  3O76 A;  4XS6 A;  3MWH A;  3KCM A;  2QSI A;  3ISO A;  4TXO B;  3LOR A;  3L9V A;  4HU9 A;  2ON7 A;  5J9C A;  4N0V A;  4HQZ A;  1X5E A;  3IV4 A;  5C04 A;  2K18 A;  1VF2 A;  4K9Z A;  3UJ1 A;  4YAV A;  1YF0 A;  2H8L A;  4O5Q A;  2WB9 A;  1U87 A;  1SJI A;  4GWR A;  3ZLP A;  4GLT A;  2M72 A;  2O87 A;  5IPG A;  4ZBB A;  4X4J A;  4IEL A;  2GDR A;  1T7P B;  5HR3 A;  1EV4 A;  1F2E A;  3HVX A;  2DKI A;  13GS A;  5E4W A;  1K0A A;  1XW9 A;  4KSM A;  4HJM A;  3I43 A;  2PMT A;  2HRF A;  1EOH A; 
#chains in the Genus database with same CATH homology
 1GH2 A;  4YKF A;  1ACV A;  4BVX A;  4F2I A;  4MK3 A;  4LMV A;  1XWK A;  3KM6 A;  2FA8 A;  1GLP A;  1G6W A;  1GSU A;  2F51 A;  1VGL A;  3FK8 A;  5J5N A;  5LD0 A;  2CZ2 A;  1BAY A;  3GKM A;  4G0L A;  1A24 A;  4OD7 A;  1Z7P A;  2OA7 A;  2V1M A;  2OT3 A;  4L0U A;  1SEN A;  4TXV A;  1UC7 A;  1QK8 A;  2K8V A;  2RUE A;  4POB A;  3VFI A;  1K0M A;  1MDJ A;  5H5R A;  3R3E A;  3G7J A;  4E8E A;  4KND A;  4KW6 A;  3FHK A;  1GSE A;  3M0F A;  4ECJ A;  1OE7 A;  1ERV A;  1OC9 B;  5F07 A;  3SWL A;  1BED A;  2V2G A;  3TKR A;  4IBP A;  3LWA A;  5JCG A;  2QA1 A;  2R0P A;  3U6V A;  1M9B A;  1OAZ A;  2DJ3 A;  2PVO C;  2H74 A;  4NV2 A;  4AKX B;  4JRR A;  2UZ8 A;  2AHE A;  4NXI A;  2VL2 A;  4EL1 A;  2O89 A;  3UMA A;  4MLY A;  2JSZ A;  3QFB C;  4Z2R A;  1TJD A;  4AGS A;  2FD3 A;  2IFQ B;  4QQ7 A;  1B9Y C;  5H5S A;  4FYU A;  3DKS A;  2DBC A;  4KGI A;  4TR4 A;  2XC2 A;  4AJ6 A;  4PQH A;  5ECM B;  1MD3 A;  1QMV A;  4TXO A;  4N0Z A;  2N5B A;  3P7X A;  3KD0 A;  5DJL A;  2H73 A;  3LG6 A;  3GH6 A;  3DD3 A;  1FVK A;  5F06 A;  4W66 A;  3H4K A;  2R5G A;  3FZ9 A;  1K0N A;  2HRK A;  1I9D A;  1TRS A;  3GL3 A;  1QFN A;  5GAN D;  3KTB A;  2B7K A;  2E0Q A;  1JZR A;  3WGD A;  2L57 A;  5J9B A;  3EIN A;  2DJ1 A;  4I2T A;  3QAG A;  3KP9 A;  4ECI A;  1O73 A;  3HZ4 A;  6GSS A;  1J9B A;  1SD9 A;  2NDO A;  2CVK A;  3EMX A;  4LL4 B;  5DCG A;  3IA1 A;  2J9H A;  4WR5 A;  2F3M A;  4JR6 A;  4D73 B;  1A8L A;  6GSV A;  2FWH A;  3IRA A;  3DML A;  4ZL7 A;  3ZYW A;  5DAL B;  1PKZ A;  3GRX A;  3TJF A;  2H1G A;  2VCZ A;  2FWF A;  2L6D A;  2MZC A;  4HDE A;  4TVE A;  4HI7 A;  3GX0 A;  5DAK A;  4NMU A;  3FR9 A;  1JLV A;  3J7Y k;  1NHO A;  1TU7 A;  5IPH A;  2X8H A;  2FNO A;  2QGV A;  3RHB A;  3APO A;  3F3R A;  4Z2U A;  4ZB7 A;  2A4V A;  4CY6 A;  4DSS A;  3WGX A;  4E68 A;  5B6N A;  1GTB A;  1YF1 A;  3A2X A;  3TKS E;  1GLQ A;  1LBK A;  4NAX A;  5D9T A;  4MAB A;  5A5K A;  3QD9 A;  1ZYE A;  2LUS A;  1NSW A;  3LGC A;  1B4P A;  4K0G A;  1DUG A;  2PVQ A;  1SJZ A;  2YPM A;  5CYY A;  3LYP A;  1RW1 A;  2DSA A;  2HSH A;  3F4S A;  3ZL5 A;  1SKW B;  1ZL9 A;  1T3B A;  2X4A A;  3VWU A;  4V1A p;  1KBN A;  1SJ6 A;  2L4C A;  1V2A A;  2WCI A;  4PNG A;  4WR4 A;  4IVF A;  4BL7 B;  2VL2 C;  3APS A;  1TXU A;  4IQA A;  3LXT A;  2EC4 A;  1XFL A;  5DAL A;  2X49 A;  3MDK A;  3TKQ A;  2C4J A;  2PWJ A;  2Z9S A;  12GS A;  1F3A A;  2HRA A;  1ST9 A;  1TRU A;  1WOU A;  3RBT A;  4GF0 A;  2B1L A;  1H4O A;  1S3A A;  4OCF A;  3GNJ A;  5HR2 A;  5ID2 A;  2IFQ A;  1AQV A;  5LCZ A;  4IHU A;  3R2Q A;  5E59 A;  1N2A A;  4J2F A;  5ECO B;  2IMD A;  3UVH A;  5ABR A;  2FHE A;  1A2J A;  2HYX A;  3IXR A;  4TRX A;  1ZZY A;  1O6J A;  3EUR A;  4CY8 A;  1OVN A;  4KCE A;  1FAA A;  3H8Q A;  1XPV A;  2G2Q A;  3DIE A;  3UOM A;  3GUS A;  3TB2 A;  3IDV A;  1B8X A;  5B8B A;  4J56 E;  4MH3 A;  2N5A A;  1GUM A;  2ES7 A;  18GS A;  3F9U A;  1PA3 A;  4WXT A;  1KNG A;  2HSY A;  4G10 A;  2O85 A;  3D6I A;  5HR0 A;  1GSQ A;  2DJJ A;  2LJA A;  2G0F A;  1A23 A;  1X9M B;  2RM6 A;  1JLW A;  2YWN A;  2B5E A;  3GUR A;  3W8J A;  2HT9 A;  2F8F A;  2GS3 A;  5ID2 B;  5DAK B;  5EPF A;  4HU7 A;  1JZD A;  1AC1 A;  2H0G A;  4YKG A;  4O92 A;  3TKS A;  2NBS A;  1OC8 A;  1WE0 A;  4WF4 A;  5HFG A;  1V58 A;  1IYI A;  3TOU A;  4ISD A;  1X5C A;  2O7K A;  1URM A;  1HD2 A;  4MF7 A;  2YN1 A;  2IIY A;  2H6Y A;  2GSQ A;  5F05 A;  1GRX A;  3HCZ A;  2YZH A;  2LRN A;  5ECL B;  4OO5 A;  3NOF A;  4ZB6 A;  2C0E A;  1FW1 A;  3A5I A;  4N3Z A;  3MIX A;  4CW9 A;  1GSS A;  1FO5 A;  2H76 A;  1UN2 A;  4KB3 A;  4ML1 A;  1OE8 A;  3A2W A;  1R7H A;  2K8S A;  4X43 A;  1XZO A;  5IMV A;  5IM9 A;  1PX6 A;  20GS A;  1Z3E A;  5AIV A;  2E2M A;  5BRT A;  1KTE A;  3H93 A;  3ZRE A;  2YCD A;  3NZN A;  2H72 A;  2JL4 A;  5GST A;  5A1N A;  1GNW A;  1EGR A;  3C73 A;  1T8E B;  3M3M A;  2H1D A;  4PTS A;  1PL2 A;  3DVW A;  4ZB8 A;  5AIX A;  1YZX A;  4XS1 A;  1SL1 B;  1FVJ A;  2RM5 A;  3IOS A;  3A3T A;  2RII A;  3EYT A;  2A2P A;  2X8C A;  2YZU A;  3KMO A;  2OE1 A;  2C8U A;  2I3Y A;  2LRC A;  1T4Z A;  2ZNM A;  1YJ6 A;  3DEX A;  2H70 A;  1R4W A;  2HI7 A;  1JFU A;  3WGE A;  3OR5 A;  5D8I A;  4EKZ A;  2J23 A;  2K6V A;  1PX7 A;  5GAP D;  2CX4 A;  1SK2 A;  4BVY A;  5A4V A;  1Z9H A;  3ZTL A;  3M9K A;  2HNL A;  5IMZ A;  2GST A;  2CVD A;  2X99 A;  3VWW A;  4HJ2 A;  2H0I A;  2A2S A;  5DVB A;  4EDY A;  3Q19 A;  2EFC A;  4NV5 A;  1TP9 A;  1SKR B;  3KH9 A;  1BG5 A;  3G7Y A;  3I9V 2;  1VF4 A;  4DEJ A;  4IJ3 A;  4GTU A;  1E6B A;  4USS A;  4HZ4 A;  1EP8 A;  1THO A;  5ECK B;  4DSR A;  2C80 A;  3TRX A;  3CWG A;  3UBK A;  2I1U A;  4JR4 A;  4MH2 A;  3KGK A;  5J47 A;  4XCS A;  1WPI A;  5DCH A;  2R37 A;  2DJK A;  1YDK A;  1BX9 A;  4MDC A;  3KIJ A;  4IP6 A;  1EV9 A;  1ZYN A;  1Z6M A;  3IC8 A;  1C72 A;  3AY8 A;  2VOC A;  2BJX A;  1G7O A;  4N30 A;  2FUG 2;  3PPU A;  1THX A;  3UAR A;  2DIY A;  2XHF A;  5ECH B;  4TKY A;  3HMJ G;  1X5D A;  4K2X A;  3FRC A;  4ILF A;  2CV4 A;  3WT1 A;  4GQC A;  3M1G A;  4AJ7 A;  3IPZ A;  2PPT A;  4K7O A;  5A4W A;  2FGX A;  1EEM A;  2H75 A;  3DGQ A;  1GTA A;  3NIV A;  1Z7R A;  1XIY A;  3W6G A;  2OBK A;  3H1N A;  5AGY A;  2JSY A;  3KZQ A;  1ERT A;  3VPQ A;  1A2M A;  2YWI A;  2WRT A;  1NM3 A;  1SVL A;  1O8X A;  2QA2 A;  1Z5Y E;  1GUL A;  1UA5 A;  3FR3 A;  2O5V A;  2MMZ A;  5G30 A;  4PGT A;  4EVM A;  2GSS A;  2XBI A;  3M9J A;  4AKG A;  2PGT A;  3L9U A;  1TOF A;  3ERW A;  1DBY A;  1R26 A;  2H66 A;  3ERG A;  1M2A A;  6GSU A;  5HR1 A;  17GS A;  3F6D A;  5G2Z A;  5HQP A;  2V6O A;  5IMD A;  5JCU A;  1SK1 A;  1YEP A;  4G0I A;  2C3T A;  2DKH A;  4ZL8 A;  4TR1 A;  4IKH A;  1G0T A;  5KN1 A;  4TN8 A;  1MEK A;  4BWQ A;  1TI3 A;  3RHC A;  2ZCT A;  2CT6 A;  1XWC A;  4O5R A;  5KOW A;  2H01 A;  4OCE A;  1X9S B;  4RI6 A;  8GSS A;  2NPB A;  1IYH A;  5G5F A;  4FO5 A;  3IAS 2;  2MMA A;  2IPA A;  2B6M A;  4BVX B;  3HYP A;  1FOV A;  1ERW A;  4BWS A;  2OE3 A;  1K0D A;  1B9X C;  2E7P A;  1SL2 B;  3MYD A;  2UV8 G;  5D96 A;  1WP0 A;  3G9B A;  3PIN A;  3CSI A;  3CRU A;  2H71 A;  4MA9 A;  2B7J A;  1ZMA A;  3CSJ A;  2HSN B;  4GQF A;  2GQM A;  2OBI A;  4PQI A;  2VD0 A;  5D9W A;  1JHB A;  3DRN A;  4ZBA A;  2X8G A;  1ON4 A;  4HEA 2;  2GSR A;  5G5E A;  2JZS A;  2YNX A;  1K3Y A;  2EIQ A;  1USB A;  3C8E A;  1T00 A;  1WMJ A;  4KDU A;  3LJR A;  2VL9 A;  2ON5 A;  1A8Y A;  4XS4 A;  1J08 A;  3JCM L;  3VLN A;  2KLX A;  2LV3 A;  5A5H A;  2GT6 A;  1YVL A;  4TOP A;  1M7T A;  2PN8 A;  4F03 A;  1W89 A;  4V2L A;  3CSH A;  3FYG A;  1QQ2 A;  6GST A;  2K9F A;  3EMP A;  2HSM B;  1NHY A;  3IBH A;  1BQ7 A;  2LS5 A;  5J41 A;  3P2A A;  4ZL9 A;  3GKX A;  1TRW A;  4PXO A;  3FKF A;  1GTI A;  10GS A;  1PSQ A;  3D21 A;  2TIR A;  1AXD A;  3D5J A;  3HA9 A;  1YKA A;  4POK A;  5CO3 A;  2QKE A;  1EOG A;  4XRD A;  4LLR A;  1U3I A;  3WYW A;  4BL7 A;  1AAZ A;  2YWM A;  2OE0 A;  5IOW A;  3WD6 A;  5IQY A;  1LU4 A;  1SK0 A;  4EIP A;  2D2Z A;  3ZMK A;  5DQY A;  1GUH A;  22GS A;  1K0O A;  2VCW A;  4GCI A;  1M9A A;  3KTL A;  3U5R E;  5A4U A;  1F9M A;  2P5R A;  3HKR A;  2CZ3 A;  3M8N A;  4O32 A;  5J4V A;  3GFK A;  2DC5 A;  4MJE A;  4OFN A;  3ZFB A;  3FEU A;  4DSS B;  3PR8 A;  5GZZ B;  1AIU A;  4F9Z A;  1G7E A;  3F0I A;  5J40 A;  2AJQ B;  2HZF A;  1PD2 1;  2OJL A;  2LQQ A;  4K1F A;  4DSQ A;  3QMX A;  1XVQ A;  4HUA A;  2HXK A;  3VPT A;  2A2R A;  14GS A;  3TKP A;  3HDC A;  3BCI A;  3GV1 A;  5CRE A;  5G31 A;  1CQG A;  4KA0 A;  3TJJ A;  6GSX A;  2C1Y A;  2KP1 A;  3K8N A;  4G01 A;  3LFL A;  3TDG A;  5CRD A;  1FB6 A;  1SVO A;  3ME8 A;  4YAP A;  2WGR A;  3KJY A;  3DWV A;  2HSM A;  4NHW A;  5IO0 A;  2JAD A;  1TTZ A;  3UIW A;  1YKC A;  2B5Y A;  4CDO A;  1W4V A;  1BJX A;  4ACS A;  4MZW A;  1AW9 A;  3LXZ A;  4D73 A;  4L5L A;  1SD8 A;  3ZZX A;  5GSS A;  2VCX A;  4PUR A;  4O5U A;  5J3R A;  4RUV A;  1V40 A;  3F63 A;  16GS A;  3MNG A;  3FY7 A;  1WRY A;  4FH8 A;  4KF9 A;  5EL8 A;  2L6C A;  4PQ1 A;  5INY A;  4GXZ A;  2FLS A;  1J0F A;  3HJO A;  4TW5 A;  3HD5 A;  5IIZ A;  4ICY A;  3EE2 A;  4F0C A;  3EC3 A;  3GKN A;  1YQ1 A;  5ECI B;  2VUP A;  11GS A;  4IN0 A;  1ZYP A;  4BA7 A;  2GQL A;  2N5F A;  3GTU A;  3HJM A;  4K6X A;  1DE2 A;  1S3D A;  3G7I A;  2VIM A;  1O81 A;  2C0D A;  3ZML A;  3L9S A;  4IQ1 A;  5B8A A;  1GWC A;  1LJR A;  3D22 A;  3P90 A;  5A1N B;  2HZE A;  1XOA A;  2GT5 A;  1AQX A;  2RLI A;  2LTK A;  3QAW A;  5LNK e;  4MF6 A;  2YJH A;  1OYJ A;  3LQ7 A;  4OMV A;  3L0H A;  2HFD A;  1MD4 A;  2M80 A;  2PER A;  4JBB A;  5ECP B;  4WBR D;  1N25 A;  2DIZ A;  5IOX A;  2KHP A;  4I6X A;  1PGT A;  1GSD A;  3PH9 A;  4ZBD A;  3GX8 A;  2AV4 A;  3VUR A;  1JZO A;  3GTU B;  3UBL A;  3IR4 A;  3IHQ A;  5CRW A;  2V41 A;  3GIX A;  1QXH A;  3EVI A;  3F3Q A;  1K3O A;  5HFI A;  4XS4 B;  3C1R A;  4FYB A;  2EIO A;  1HNB A;  2AB6 A;  3GSS A;  3BOA A;  2C3Q A;  2TRC P;  2R4V A;  4AI6 A;  3MAK A;  4F82 A;  5B6M A;  4PUA A;  1RQM A;  4EF0 A;  5L71 A;  2YOI A;  4KE3 A;  4X0X A;  4GSS A;  1FB0 A;  1AUC A;  4WET A;  2VL3 A;  2JZT A;  2AYT A;  4AKH A;  1AQW A;  2GTU A;  4EUY A;  4K0N A;  3EU3 A;  2M46 A;  4G19 A;  4MJC A;  4Q5Q A;  4MNN A;  5H5Q A;  3ZRD A;  4XTS A;  1SU9 A;  1O7U A;  4WKW A;  4V2N A;  2C0F A;  1YEX A;  1H75 A;  3I69 A;  2WUL A;  3IK9 A;  3MSZ A;  3ZIV A;  4FYC A;  1XBS A;  4I5Q A;  3C1S A;  2WS2 A;  4HQS A;  3C71 A;  1SYX A;  4GSN A;  5JCW A;  4FQU A;  1TK5 B;  1WWJ A;  4K7I A;  5G1L A;  5J4U A;  2HQT A;  1GSY A;  3EU4 A;  4L5O A;  3DXB A;  4PNF A;  3VI7 A;  2LJR A;  3GST A;  1ZYQ B;  5KN2 A;  3QCP A;  3O6T A;  5ECR B;  3F4T A;  4KH7 A;  2GQK A;  2HE3 A;  4K5R A;  3CTF A;  3ED3 A;  2DML A;  4KCA A;  3GKK A;  5DQS A;  2IMI A;  3KXO A;  3TJG A;  2GZP A;  1DE1 A;  1F6M C;  2TRX A;  9GSS A;  1R5P A;  1K3L A;  3KEB A;  3CYN A;  4EXJ A;  4MJB A;  1ERU A;  2L59 A;  3TUE A;  2MBS A;  5IMC A;  1EZK A;  2VLU A;  2MMO A;  3CRT A;  2VKZ G;  4KAE A;  4I97 A;  4AF2 A;  1Y6E A;  4XIH A;  2IJY A;  2VLV A;  1M99 A;  5COH A;  3Q18 A;  2YP6 A;  2GVP A;  5JWQ B;  5HFK A;  1G6Y A;  1VF1 A;  6GSY A;  3ZFL A;  2LST A;  3E0U A;  4ID0 A;  1MDK A;  1CQH A;  1WJK A;  2KOK A;  2LKU A;  4V2M A;  1TI1 A;  1X9W B;  4PUF C;  2OKA A;  3HVS A;  2H19 A;  3GH9 A;  5EVO A;  3QR6 A;  3UAP A;  4LA1 A;  1A0R P;  3CXG A;  4ECC A;  5C00 A;  2YWO A;  1EGO A;  1SKS B;  4EO3 A;  4XRA A;  3LW9 A;  4QL7 A;  4AJ8 A;  1TDI A;  1XWA A;  3TRP A;  1TXX A;  2L4Q A;  4J57 E;  2H30 A;  4NPB A;  4P3Y B;  5FHI A;  2XPD A;  2B5X A;  1YY7 A;  4HZ2 A;  1TK8 B;  3QFA C;  3TU3 B;  1M2D A;  4ML6 A;  2DJ0 A;  3SBC A;  1XW6 A;  3QAV A;  2H0H A;  3HZ8 A;  3FW2 A;  1SVM A;  3DVX A;  1BYE A;  3PGT A;  2MBT A;  2NTO A;  4XHM A;  1QUW A;  3QDN A;  4YQU A;  4JU5 A;  4G0K A;  2O8V B;  1X0R A;  5CRH A;  5DJM A;  4ZXG A;  3A5W A;  4TR0 A;  2LEG A;  3Q6O A;  1TU8 A;  3F4R A;  2IME A;  1DSB A;  3US3 A;  4JED A;  1ZGN A;  3E9J B;  5ELG A;  1WIK A;  3BCK A;  4MP4 A;  4ZIJ A;  2P0G A;  4L0W A;  3GHA A;  2CX3 A;  5CRG A;  3ZVJ A;  2PU9 C;  4YQV A;  3BBY A;  1V9W A;  2EFE A;  3KH7 A;  3HJP A;  1XCC A;  1XWB A;  3GN3 A;  1XOB A;  2WZ9 A;  3C7M A;  2VD1 A;  1MDI A;  2GGT A;  4Q5R A;  3TOT A;  4A5P A;  4G2E A;  2B1K A;  5ENU A;  1VF3 A;  3VWX A;  4H86 A;  1TK0 B;  4IS0 A;  2LNS A;  4Q5F A;  2REM A;  4KUN A;  3ZVJ D;  3UEM A;  3EWL A;  1M2B A;  3D0Z A;  2VM2 A;  2IMK A;  2F9S A;  4K2D A;  1EP7 A;  4WEY A;  2XBQ A;  4ECB A;  4RQR A;  1ABA A;  2HLS A;  1PN0 A;  3GA4 A;  2I4A A;  5A34 B;  4MJA A;  2VCT A;  5D73 A;  4EE0 A;  4MZB A;  3GMF A;  2WDU A;  5D9X A;  5KN3 A;  2AAW A;  1Y25 A;  4TR1 B;  2R3X A;  2YV7 A;  1R5A A;  4N10 A;  4FIW A;  3TRQ A;  1PRX A;  4Z7X A;  1U3A A;  2CVB A;  4LL1 B;  1E2Y A;  1O85 A;  1QGV A;  2GLR A;  5D9V A;  5J4Y A;  3CTG A;  1FOH A;  1V98 A;  1I5G A;  4G9H A;  3KP8 A;  1BG1 A;  2BTO T;  1Q98 A;  3V1W A;  3LYK A;  2A4H A;  2V32 A;  4O7H A;  3DYR A;  2H1B A;  1ILO A;  3S9F A;  3L4N A;  1OC3 A;  2KP2 A;  3HHV A;  3VK9 A;  1RK4 A;  4OFT A;  1Q4J A;  2ZUP A;  4QMK A;  1KEB A;  4ZB9 A;  3L78 A;  2CAQ A;  3HVV A;  1XXU A;  4IP1 A;  3IC4 A;  4F0B A;  4GST A;  2DMM A;  1V57 A;  3BJ5 A;  2F8A A;  2C0G A;  4L8E A;  1XW5 A;  4V1A g;  4AKI A;  2I81 A;  2P31 A;  3H79 A;  3O3T A;  3TGZ A;  3E3E A;  4KDX A;  4JE1 A;  1F37 A;  3CMI A;  1A0F A;  2HRK B;  4WF5 A;  1U88 A;  4HOJ A;  4MPG A;  2VO4 A;  5ECQ B;  3N9J A;  3QOU A;  3N5O A;  1MTC A;  3WT2 A;  5BMU B;  4OWY A;  4X1U A;  1GP1 A;  5CNW A;  2VCV A;  2H1A A;  3ME7 A;  4RI7 A;  2L5L A;  5D93 A;  3RPN A;  1S3C A;  5IMF A;  2IL3 A;  5CAX A;  3ERF A;  3FZ5 A;  5BMU A;  2H6Z A;  1T1V A;  1UVZ A;  1GTU A;  3CBU A;  3TKS C;  2VCQ A;  4KSO A;  1O8W A;  2R0C A;  5F0G A;  3TJK A;  1SYR A;  1U6T A;  5ELA A;  4PX1 A;  2EFH A;  4EDZ A;  2ALB A;  3A2V A;  1EEJ A;  4WBJ A;  4MZC A;  1OC9 A;  2FWE A;  3FMW A;  2LQO A;  5JWR B;  2DJ2 A;  1FHE A;  1TKD B;  3ZIJ A;  4N11 A;  1HNC A;  1PKW A;  2GZY A;  3FR6 A;  2IN3 A;  3IHG A;  1JZW A;  2JZR A;  3QPM A;  2VM1 A;  3RAZ A;  1GSF A;  4JZQ A;  3HXS A;  4YQM A;  3GYK A;  1XWG A;  4OO4 A;  2IMF A;  2FY6 A;  2YV9 A;  2HRN A;  4ULX A;  1GNE A;  2AUV A;  3Q74 A;  5KEJ A;  4TR3 A;  2YAN A;  2LNT A;  1B48 A;  4Q5N A;  4IJI A;  5EY6 A;  4NWY A;  4POM A;  1OKT A;  3TJB A;  1Y1U A;  2NVL A;  2VAF A;  1TW9 A;  2QC7 A;  3EPT A;  5KOX A;  1OKD A;  3D4T A;  2CA8 A;  1GUK A;  1SL0 B;  1BF5 A;  1F3B A;  2OAD A;  4MF5 A;  2JAC A;  2C3N A;  1HQO A;  5AIS A;  1HNA A;  5IO2 A;  2WFC A;  1B4Q A;  4GDF A;  1ZOF A;  5ECN B;  1PQN A;  5FWG A;  3D4M A;  2PUK C;  1EWX A;  4KDY A;  1K0B A;  5A5H B;  5B7C A;  4YH2 A;  3VI5 A;  2VLT A;  5DBQ A;  5CP1 A;  2HZE B;  2CAI A;  3UVT A;  1ML6 A;  3P8W A;  5DDL A;  2EFD A;  2HSN A;  2FA4 A;  2H6X A;  5AN1 A;  1XVW A;  2X64 A;  3F8U A;  4POL A;  2BMX A;  3FZ4 A;  4NHZ A;  2FCH A;  3I6A A;  6GSW A;  4QL9 A;  5JWO B;  1NW2 A;  5KN0 A;  2GZZ A;  3TCO A;  3F6F A;  2IWT A;  3IAM 2;  2R6K A;  5G1K A;  3J7Y b;  2DLX A;  2E2G A;  1PL1 A;  3VWV A;  3LSZ A;  4RQX A;  4I8B A;  2LJK A;  2V6K A;  4DVC A;  2PBJ A;  2RUF A;  7GSS A;  3RDW A;  3BD2 A;  3UL3 A;  2MYG A;  1FG4 A;  4LMW A;  2JU5 A;  1N8J A;  2KUC A;  5ECS A;  4K5S A;  1TRV A;  1HYU A;  3IE3 A;  2EIR A;  1A2L A;  2MMN A;  2YJ7 A;  4KX4 A;  1VRS D;  2R0G A;  4E8H A;  4EIQ A;  4EC0 A;  2WJU A;  1T4Y A;  2H1L A;  3KMN A;  19GS A;  3APQ A;  1PN9 A;  3IK7 A;  5F8B A;  4BVY B;  2R2J A;  3LEF A;  4MCU A;  1ZCP A;  3FZA A;  5A34 A;  2P5Q A;  4OFM A;  4I2U A;  2OAC A;  2XPE A;  1GL8 A;  1M0U A;  3RPP A;  2LRT A;  2I9H A;  4BPY A;  4K7N A;  3W8S A;  4MPF A;  5FT3 A;  4CHS A;  4K8M A;  3HY2 A;  2CQ9 A;  4IGJ A;  5IMA A;  4Z2T A;  3ZIT A;  4IW9 A;  2B3S A;  4MMM A;  2L5O A;  1K0C A;  1Z6N A;  4HS1 A;  3GL5 A;  4GRF A;  2FWG A;  1PMT A;  4ZIL A;  3O76 A;  4XS6 A;  3MWH A;  3KCM A;  2QSI A;  3ISO A;  4TXO B;  3LOR A;  3L9V A;  4HU9 A;  2ON7 A;  5J9C A;  4N0V A;  4HQZ A;  1X5E A;  3IV4 A;  5C04 A;  2K18 A;  1VF2 A;  4K9Z A;  3UJ1 A;  4YAV A;  1YF0 A;  2H8L A;  4O5Q A;  2WB9 A;  1U87 A;  1SJI A;  4GWR A;  3ZLP A;  4GLT A;  2M72 A;  2O87 A;  5IPG A;  4ZBB A;  4X4J A;  4IEL A;  2GDR A;  1T7P B;  5HR3 A;  1EV4 A;  1F2E A;  3HVX A;  2DKI A;  13GS A;  5E4W A;  1K0A A;  1XW9 A;  4KSM A;  4HJM A;  3I43 A;  2PMT A;  2HRF A;  1EOH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...