3IK7A

Human glutathione transferase a4-4 with gsdhn
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
221
structure length
221
Chain Sequence
b'AARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase A4
molecule tags Transferase
source organism Homo sapiens
publication title Substrate specificity combined with stereopromiscuity in glutathione transferase A4-4-dependent metabolism of 4-hydroxynonenal.
pubmed doi rcsb
total genus 77
structure length 221
sequence length 221
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2009-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3ik7A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3ik7A01
2B1KA 1K0NA 4MF5A 5EPFA 1X9MB 3ZVJD 3IAM2 1F2EA 1N2AA 1T3BA 1GSYA 2DIYA 1HYUA 5ID2A 4F03A 1I5GA 3DXBA 4NV5A 5HFIA 4YQVA 3MDKA 2ZCTA 18GSA 2N5AA 2J9HA 2XBQA 2C3NA 3ZRDA 4V2LA 4LMWA 4KGIA 5EY6A 1X9WB 1EP8A 4EL1A 4IGJA 3ZITA 5IMCA 1U88A 3FZ4A 5IMDA 2LQOA 2I81A 4X0XA 4HZ4A 4RI7A 3LORA 2RUEA 1AIUA 4BWSA 1EOHA 4OFTA 1XW6A 3IC4A 2I4AA 2B1LA 2MBSA 4FH8A 4WETA 4GQFA 1M9BA 2GQKA 2KLXA 3FZAA 3BCIA 1DE2A 4HDEA 1CQHA 1OC3A 4BA7A 1SKSB 4N0ZA 1O6JA 2IMDA 4IP6A 3W6GA 1PL2A 1H75A 4K2DA 3D21A 2KP1A 2OE3A 2P31A 2PWJA 2LQQA 2HQTA 4POKA 1PN9A 4F0CA 3LEFA 3W8JA 5A4UA 2CQ9A 1VRSD 4N10A 1GSFA 2ON5A 4MF7A 1JZWA 4POBA 1TW9A 4FYUA 1TK0B 4DSQA 2QKEA 4J57E 5ECRB 2WB9A 5F05A 3VK9A 2V1MA 2B5XA 3PGTA 2VCVA 2VLTA 1NSWA 2LV3A 4F82A 1M2DA 2B5EA 5DCHA 22GSA 4TKYA 4PGTA 2YANA 1MEKA 1SD9A 4G9HA 2FD3A 5G30A 3BD2A 1BQ7A 1AW9A 6GSXA 1XFLA 4ZB9A 1SL2B 4ECIA 1JHBA 1BAYA 2CAIA 4ULXA 4IJIA 2QC7A 3IPZA 2VLUA 3FHKA 4ZL7A 4HZ2A 4NHZA 1KTEA 4ZBDA 4WF5A 3TRPA 4EDZA 4E8EA 4USSA 2OJLA 2RM6A 5D9XA 1BEDA 4AJ8A 2HRNA 1FOVA 3GRXA 2HSYA 4OO5A 4ZXGA 4ZB8A 2HZFA 5B8BA 5HQPA 3KIJA 2OE0A 4ILFA 3UAPA 1JLVA 2X64A 3F9UA 2JZSA 2FWFA 2H75A 4PQ1A 2YWOA 5H5SA 4BL7B 1QK8A 3WT2A 1Y25A 4MP4A 1HNCA 3U6VA 4NXIA 3TJBA 2C0GA 5ENUA 5FWGA 5IMAA 1EEJA 3BOAA 1JZOA 5KN2A 1GP1A 4TXVA 2K8VA 1H4OA 3Q74A 3G7JA 1XWGA 4O5RA 4XTSA 3FR9A 4MDCA 1UA5A 4TRXA 5J9CA 3TKPA 4K0GA 2YCDA 2NVLA 4PTSA 4FYCA 5DALB 1FW1A 5B7CA 1X5DA 3LJRA 1SL0B 3ERWA 3UVHA 4KDUA 1ZYQB 5HR0A 3L9SA 2A2RA 2KP2A 6GSSA 1GSQA 2VL2C 2VUPA 2DJ0A 4YAPA 1WIKA 5IM9A 3IHQA 3EVIA 3FZ9A 4K7IA 3UIWA 1XVQA 5IOXA 1FB0A 3CSIA 4L8EA 3EINA 3VPQA 3HY2A 1MD4A 11GSA 4GCIA 4HOJA 4JZQA 3DKSA 1GTUA 2R3XA 5D8IA 3M9JA 5CRDA 3FK8A 1ZL9A 5GAND 3E9JB 4KX4A 1GWCA 3HJMA 2FWGA 2FY6A 5IO0A 2H6ZA 1HNBA 3M0FA 3QAVA 3VI5A 4J56E 1ERUA 2H1AA 1E2YA 4HU9A 1VF1A 1Z7PA 2LNSA 2H73A 3M3MA 1SU9A 1PX6A 2C0FA 4NPBA 1O73A 1SKRB 1A23A 3F4TA 5CAXA 4AF2A 1FHEA 1Z6MA 2DJ3A 3HZ4A 2L57A 4AJ6A 4POLA 2PVOC 1EP7A 1OE8A 1OE7A 2CA8A 1A8YA 4MH2A 5ECOB 3WD6A 2TIRA 5B6NA 1MDKA 1XOBA 4IBPA 5F0GA 4KB3A 3HCZA 3UJ1A 5CYYA 2WFCA 4KCAA 1XZOA 2JSZA 1MTCA 1K0AA 1TRVA 2QSIA 2GVPA 3IDVA 5H5RA 2IFQA 2YOIA 1O8XA 2OE1A 5IMZA 1A2JA 5AIVA 2VL2A 1GSSA 1TU7A 5DCGA 1OC9A 1QXHA 4FIWA 4POMA 4BVYB 3UEMA 2V2GA 1QGVA 2V32A 4PX1A 2R2JA 4ML6A 4IVFA 2HRAA 2RUFA 1UN2A 2CZ3A 4L0UA 4MMMA 3E0UA 1V9WA 1FG4A 3HYPA 4TR3A 1M2BA 3TKQA 2IL3A 1EWXA 3KMOA 3TJKA 4XS4A 1F3BA 2DJ2A 2GZPA 2WRTA 2GT6A 3NZNA 3L78A 1GUKA 3CSJA 3D4MA 1PSQA 3MSZA 4NWYA 4I2UA 3TRQA 3QR6A 2OA7A 3FYGA 3LQ7A 3I9V2 3G9BA 2O85A 3GL3A 2WS2A 4ZL8A 1V2AA 5DBQA 3IOSA 1YY7A 3GSTA 2YWIA 3F6FA 6GSUA 1SK1A 4LL4B 1FO5A 4BPYA 1XWAA 5GZZB 2H0HA 4TR0A 2FWEA 4GSSA 1GTBA 2FNOA 2DJJA 3D6IA 1WWJA 2H70A 1M2AA 1MDJA 3G7IA 4G19A 2C3QA 1AUCA 3M9KA 1LU4A 1J0FA 1BG5A 1V98A 3TDGA 4HQSA 1LJRA 3VURA 1YJ6A 2XHFA 1UC7A 3ZVJA 1S3AA 1ON4A 1A8LA 4ECBA 3ZMLA 2L5OA 1Z9HA 2VL3A 1Z5YE 3WGEA 1TI1A 3ZYWA 1F9MA 5CNWA 3GURA 3KCMA 3UMAA 3TCOA 1XIYA 2O89A 4TXOB 5DVBA 4K7OA 2F3MA 2F9SA 3QFBC 4QL7A 3I6AA 1EV9A 1I9DA 1YZXA 2YV9A 3GKNA 3HVXA 3MWHA 1ZZYA 1HNAA 2FWHA 1XW9A 1KBNA 1YKCA 3F6DA 3KEBA 1U3AA 2FCHA 4CDOA 5D73A 1G7OA 2ZUPA 7GSSA 1SK2A 2O7KA 4V1Ag 4DSRA 3UARA 3MNGA 1B4QA 1PKWA 4EVMA 2P5QA 1A0RP 4KH7A 3EYTA 3L0HA 3TJJA 3DD3A 1F3AA 2DJKA 4K9ZA 4KAEA 5D93A 2YNXA 5DAKA 1TI3A 3KM6A 3PINA 2C80A 3KMNA 4GRFA 3F4RA 1OKTA 2GTUA 4KSMA 4I6XA 3P90A 3NOFA 2O87A 1NHYA 2YV7A 4V2NA 5CO3A 1ABAA 1M9AA 3KH7A 5ECPB 2GSQA 2K6VA 4L5LA 3ZLPA 4GSNA 5FHIA 2F51A 4PUAA 5ID2B 1W89A 1J08A 3RHBA 3FRCA 4G0LA 2OADA 5C04A 3HHVA 3QAGA 2I3YA 4G0KA 4WF4A 4JE1A 2M72A 3FR3A 4EXJA 1YDKA 2MMAA 5IMVA 2QGVA 4JEDA 2YWNA 5A5KA 4NMUA 2JADA 3I43A 1A0FA 1TKDB 4WBJA 17GSA 3WT1A 4HUAA 5ECQB 3RBTA 1B48A 5JWOB 2I9HA 5KN3A 3J7Yb 5ECSA 1NM3A 1TK5B 4BVYA 2G0FA 1EZKA 2H8LA 1K3OA 3PPUA 1AQWA 3BBYA 1X0RA 2IWTA 5IPHA 2TRCP 1S3CA 1QFNA 1FVKA 2LJAA 4HQZA 5D9TA 3C1SA 4XIHA 2IMFA 3CRUA 1B9XC 4PNGA 1OC8A 3ME7A 2RLIA 1U87A 4MABA 4WEYA 3EE2A 1JFUA 1GSEA 3KP8A 3Q18A 4PUFC 2A2SA 1YEXA 3N5OA 5AISA 3HD5A 1N8JA 4ZIJA 3GH9A 1GUMA 2REMA 4LMVA 1Q4JA 3PH9A 3C7MA 1NHOA 3HVVA 3IK7A 1K0DA 1A2LA 1IYIA 2VM2A 4K1FA 3ED3A 3O3TA 1O81A 5CP1A 1URMA 1TDIA 4I5QA 4JU5A 1NW2A 1GRXA 5EVOA 2VO4A 1XCCA 3D22A 4MJCA 4N11A 2VCTA 3KXOA 2CVKA 3IV4A 1HQOA 4GF0A 4JR4A 2V6OA 2MMZA 2PERA 3QCPA 4GSTA 4MLYA 2R6KA 2RIIA 2HSMB 2R5GA 1KEBA 4MF6A 2H76A 5L71A 2MMOA 3C8EA 3S9FA 1SENA 3C1RA 2VCZA 2VD1A 5H5QA 1T1VA 5CRGA 5F07A 1SD8A 3QPMA 1OVNA 1U6TA 1DBYA 2KUCA 1Z7RA 4TW5A 1WMJA 2YPMA 2VCQA 2L6CA 3TOUA 2TRXA 2H1DA 3O76A 2VIMA 4GQCA 5G5FA 1WRYA 2X8GA 2CAQA 4KF9A 2XPEA 1PRXA 2EIQA 5FT3A 1BX9A 2WDUA 1C72A 3QD9A 4OD7A 3TKSE 5GSTA 5GSSA 2JU5A 1G7EA 4K8MA 2C1YA 1AXDA 4MZBA 2B3SA 2FA4A 2E2MA 3IAS2 1Q98A 3QMXA 5J5NA 4HJ2A 4D73A 3CYNA 4O32A 2VM1A 3A3TA 5HFKA 3VWVA 4HS1A 4XS4B 3IBHA 4IW9A 5IOWA 1GTIA 1OKDA 1TU8A 1MD3A 4WR5A 5HR1A 1JLWA 5ECMB 1MDIA 3VWUA 2PMTA 4HU7A 3DIEA 4L0WA 2UZ8A 4MPFA 3ZTLA 1T4ZA 14GSA 3UVTA 2H72A 1GH2A 3RPPA 1EGOA 3LYKA 1M99A 2CT6A 2H0GA 3MAKA 1B4PA 4BVXB 1YF0A 4GLTA 5ELAA 5DQSA 2H6YA 3DVXA 2L59A 2R4VA 1JZRA 5IPGA 1ACVA 3US3A 3IR4A 1SYXA 4L5OA 4ZBAA 2M46A 5A4VA 1XWBA 3CTFA 3RDWA 4IP1A 3GX8A 4EF0A 3OR5A 1CQGA 1XWCA 2G2QA 5KN0A 2LKUA 2CVBA 3GYKA 4TR1B 3GFKA 1WJKA 2IMKA 4OFNA 1ERTA 3GNJA 2MZCA 2JACA 3V1WA 3E3EA 2NPBA 4Q5NA 3ZFBA 3BJ5A 4HI7A 1YEPA 2LSTA 3LSZA 3IK9A 5CRHA 5DJMA 2EIRA 5LNKe 2GQMA 4ZB6A 3KTBA 4TXOA 3F4SA 2X99A 3HXSA 4ZBBA 2CV4A 2WULA 1YF1A 2EC4A 3GL5A 1WPIA 3LWAA 5D9WA 3IXRA 3VPTA 1FB6A 1O85A 5JWQB 2HSHA 2DBCA 2YP6A 2IIYA 4FO5A 1QMVA 4N30A 4WR4A 5E59A 3VWXA 2HYXA 1VF3A 1QQ2A 2I1UA 3KD0A 2C0DA 3P7XA 4YQUA 4EC0A 2LS5A 4KDYA 3KTLA 1EOGA 2E0QA 4JBBA 4NAXA 1O8WA 5ECLB 2E7PA 1PGTA 4FYBA 4MJAA 3LXTA 4QL9A 3IC8A 3GIXA 4K7NA 5B6MA 3BCKA 2H1GA 4MZWA 4IS0A 3H1NA 2B6MA 2FGXA 2OBKA 4WKWA 4KW6A 4OO4A 3EMPA 5DJLA 4MPGA 1Z3EA 1VGLA 4G2EA 1R5PA 1JZDA 2H74A 4IN0A 2K9FA 4D73B 5DALA 1GLPA 4EO3A 2CX4A 4OCFA 1E6BA 2F8AA 1DUGA 2HRKA 1XXUA 1SK0A 1TTZA 3GUSA 5INYA 5HFGA 3TGZA 3ERFA 3UL3A 3GKXA 4LA1A 2L6DA 3FW2A 3UBLA 3FY7A 4KSOA 6GSTA 2LTKA 2V41A 4ZILA 3LFLA 3JCML 2B7JA 2XBIA 2XC2A 16GSA 3EU4A 1R26A 1XBSA 2C0EA 2WZ9A 1A24A 1EEMA 1TRWA 2YZUA 4DVCA 3GA4A 1ZGNA 1OAZA 1K3LA 5J4UA 2Z9SA 4Z7XA 4KA0A 1ZYEA 2AJQB 2J23A 1XVWA 3F8UA 4RQXA 3HJOA 4YQMA 13GSA 1X5CA 2N5FA 4Q5FA 2HSMA 4XRDA 1OC9B 5KN1A 4KE3A 3TUEA 1BYEA 2DIZA 1Z6NA 2PPTA 1B8XA 5C00A 1RK4A 1R7HA 3A2XA 1BJXA 2LJKA 2YWMA 5IMFA 4TN8A 3HVSA 2VLVA 3CSHA 3ZIJA 2HNLA 1V58A 2FUG2 3CMIA 5ECNB 2IPAA 2AAWA 3RHCA 1T00A 1TRUA 1DSBA 3CXGA 5ECIB 2HRKB 3FR6A 4DSSB 2P0GA 2HI7A 1QUWA 3KZQA 1PKZA 3DGQA 5ECHB 4I2TA 8GSSA 1T4YA 1K3YA 4PURA 2LRCA 3ME8A 4H86A 2VD0A 1YQ1A 3ZIVA 4GTUA 2L4CA 3GV1A 6GSWA 3N9JA 4YAVA 5ABRA 4IELA 4E8HA 4DEJA 2PGTA 4IJ3A 4JRRA 3L9UA 2DSAA 4ACSA 3O6TA 2V6KA 1K0MA 3I69A 2DLXA 2ES7A 4OFMA 1GNWA 2FLSA 3A5WA 2AUVA 2EIOA 4GWRA 5IIZA 3GHAA 2VAFA 2DC5A 5ECKB 4ECJA 1T8EB 5BMUA 2HRFA 3F0IA 2CZ2A 1USBA 5JWRB 2H19A 1SJIA 1J9BA 4IKHA 4ID0A 1ST9A 3U5RE 3FEUA 2X8HA 2C4JA 1ERWA 3IRAA 4PQHA 1A2MA 5IQYA 3FZ5A 2GS3A 1RQMA 1XOAA 1ZCPA 1F37A 3D0ZA 4TOPA 1LBKA 3VI7A 2E2GA 1RW1A 1WP0A 3QOUA 2KHPA 4IQAA 3WYWA 2JZTA 2FHEA 3QAWA 4Q5RA 4MH3A 4TR1A 2DMLA 4EDYA 2GZYA 5HR2A 5G1KA 1GNEA 2BMXA 2HXKA 1WE0A 3M8NA 3TKSC 1PQNA 2FA8A 3M1GA 1AQXA 4FQUA 2YJHA 2ALBA 4EE0A 2DMMA 3LGCA 2NDOA 4HJMA 5JCWA 1GUHA 3APOA 1G6WA 2C8UA 3TJGA 1F6MC 2IFQB 4XHMA 3LYPA 4K0NA 4F0BA 1M7TA 5LCZA 9GSSA 3DWVA 5B8AA 3APQA 1B9YC 4F2IA 5COHA 2H71A 1GSDA 4CW9A 1THXA 4KNDA 3GKMA 3H93A 3R3EA 4ECCA 3J7Yk 5JCUA 3TOTA 5EL8A 2F8FA 2XPDA 1Y6EA 5J3RA 4JR6A 3R2QA 3DMLA 1ILOA 4O7HA 2MYGA 3VFIA 2PUKC 3KJYA 1SKWB 1R4WA 2BJXA 3CTGA 3GKKA 4MJBA 1GSUA 2LEGA 2YJ7A 3F3RA 2R37A 2LNTA 3DRNA 3ZREA 1PA3A 5AGYA 5J41A 3ERGA 1TK8B 3ISOA 3KP9A 4OWYA 1TOFA 4MJEA 4OMVA 1G6YA 1SL1B 3VWWA 12GSA 3GTUB 2LRTA 5LD0A 3IA1A 1DE1A 3D4TA 1ML6A 3HDCA 3EC3A 2B7KA 2X8CA 1GULA 19GSA 2AV4A 2MBTA 3L4NA 2K8SA 3IE3A 1V57A 2OACA 5DQYA 3LG6A 3Q19A 4BWQA 4NHWA 4LLRA 4PXOA 3KH9A 5AIXA 2O8VB 4P3YB 2N5BA 3LXZA 3P8WA 4AJ7A 3ZFLA 4ML1A 4RUVA 2LJRA 2MMNA 2BTOT 4QQ7A 2HZEB 4X43A 3HKRA 3EU3A 2RM5A 3VLNA 2OBIA 3A2WA 1EV4A 5G2ZA 2CX3A 2GZZA 4CHSA 1ZOFA 6GSVA 3TJFA 3F3QA 3TKRA 4KDXA 1XW5A 4N0VA 1WOUA 5GAPD 1THOA 4PQIA 4RI6A 1X5EA 4V1Ap 5DAKB 4BVXA 2H0IA 3FKFA 1K0BA 3K8NA 4OCEA 1T7PB 1V40A 4XS6A 1XWKA 2H6XA 2JZRA 1TJDA 3GSSA 4MK3A 2OKAA 4Q5QA 2HLSA 5G5EA 2NTOA 1PL1A 5J9BA 4WXTA 1FVJA 5DDLA 2AHEA 3D5JA 3TRXA 2DJ1A 3A2VA 5CREA 2KOKA 4PNFA 4IQ1A 1R5AA 3NIVA 2IN3A 4XS1A 2HSNB 5E4WA 2GDRA 1TP9A 4DSSA 1HD2A 2H1BA 3HZ8A 3APSA 1M0UA 4I8BA 4LL1B 1K0CA 3GMFA 4MA9A 3H8QA 2A4VA 4ZL9A 3GH6A 2IMEA 4YH2A 4G0IA 4K6XA 3DEXA 2PU9C 5ELGA 1SJ6A 2CVDA 4ISDA 4GXZA 1ZMAA 2C3TA 4F9ZA 4XCSA 5IO2A 2HE3A 1SJZA 3L9VA 2GSSA 3RAZA 2HFDA 3UBKA 4I97A 5F8BA 5G1LA 1AAZA 1PD21 5JCGA 2L4QA 2L5LA 1AC1A 10GSA 2JL4A 2JSYA 2D2ZA 2VCWA 6GSYA 2GSRA 1YKAA 2YN1A 3SBCA 4TVEA 3PR8A 3C71A 2GLRA 2GGTA 4NV2A 5CRWA 1SYRA 2LUSA 1VF2A 2K18A 3QDNA 3AY8A 2ZNMA 3DYRA 1GLQA 3EWLA 2PBJA 1O7UA 1UVZA 3SWLA 5D9VA 3GX0A 4IHUA 3F63A 3WGXA 4TR4A 1EGRA 2GT5A 2AB6A 1G0TA 2NBSA 2WCIA 3ZMKA 5A4WA 1PX7A 4J2FA 3RPNA 3ZL5A 2VCXA 4G10A 3CRTA 3WGDA 2VL9A 1K0OA 4HEA2 2ON7A 3QFAC 2H01A 1OYJA 1TXXA 3HJPA 5F06A 1FAAA 5HR3A 4BL7A 2H66A 2M80A 3UOMA 2PN8A 2GQLA 5KEJA 4MCUA 4V2MA 1AQVA 4MZCA 1W4VA 2H30A 4KUNA 2HT9A 4KCEA 2VOCA 1ERVA 4O92A 2WGRA 3TKSA 3C73A 2HZEA 2YZHA 2IJYA 1GL8A 1X9SB 5AN1A 4RQRA 3ZZXA 3P2AA 2GSTA 1XPVA 3KGKA 2LRNA 3EMXA 5G31A 3Q6OA 3G7YA 3DVWA 1GTAA 2IMIA 2PVQA 3EURA 3W8SA 1VF4A 2B5YA 2WJUA 4WBRD 1IYHA 1TRSA 4X1UA 4XRAA 3GTUA 3H79A 4EKZA 3CBUA 20GSA 1KNGA 3GN3A 1PMTA 4EUYA 3H4KA 3TB2A 1S3DA 3HA9A 1U3IA 2AYTA 4AGSA 2P5RA 5D96A
chains in the Genus database with same CATH superfamily
2B1KA 4AI6A 1K0NA 4MF5A 5EPFA 1X9MB 3ZVJD 3IAM2 1F2EA 1N2AA 1T3BA 1GSYA 2DIYA 1HYUA 5ID2A 4F03A 1I5GA 3DXBA 4NV5A 5HFIA 4YQVA 3MDKA 2ZCTA 18GSA 2EFCA 2N5AA 2J9HA 2XBQA 2C3NA 3ZRDA 4V2LA 4LMWA 4KGIA 5EY6A 1X9WB 1EP8A 4EL1A 4IGJA 3ZITA 5IMCA 1U88A 3FZ4A 5IMDA 2LQOA 2I81A 4X0XA 4HZ4A 4RI7A 3LORA 2RUEA 1AIUA 4BWSA 1EOHA 4OFTA 1XW6A 3IC4A 2I4AA 2B1LA 2MBSA 4FH8A 4WETA 4GQFA 1M9BA 2GQKA 2KLXA 3FZAA 3BCIA 1DE2A 4HDEA 1CQHA 1OC3A 4BA7A 1SKSB 4N0ZA 1O6JA 2IMDA 4IP6A 3W6GA 1PL2A 1H75A 4K2DA 3D21A 2KP1A 5A1NB 2OE3A 2P31A 2PWJA 2LQQA 5A34B 2HQTA 4POKA 1PN9A 4F0CA 3LEFA 3W8JA 5A4UA 2CQ9A 1VRSD 4N10A 1GSFA 2ON5A 4MF7A 1JZWA 4POBA 1TW9A 4FYUA 1TK0B 4DSQA 2QKEA 4J57E 5ECRB 2WB9A 5F05A 4GDFA 3VK9A 2V1MA 2B5XA 3PGTA 2VCVA 2VLTA 1NSWA 1PN0A 2LV3A 4F82A 1M2DA 2B5EA 5DCHA 22GSA 2R0GA 4TKYA 4PGTA 2A4HA 2YANA 1SVOA 1MEKA 1SD9A 4G9HA 2FD3A 5G30A 3BD2A 1BQ7A 6GSXA 1XFLA 4ZB9A 1SVMA 1SL2B 4ECIA 1JHBA 1BAYA 2CAIA 4ULXA 4IJIA 2QC7A 3IPZA 2VLUA 3FHKA 4ZL7A 4HZ2A 4NHZA 1KTEA 4ZBDA 4WF5A 3TRPA 4EDZA 4E8EA 4USSA 2UV8G 2OJLA 2RM6A 5D9XA 1BEDA 4AJ8A 2HRNA 1FOVA 3GRXA 2HSYA 4OO5A 4ZXGA 4ZB8A 2HZFA 5B8BA 5HQPA 4AKHA 3KIJA 2OE0A 4ILFA 3UAPA 1JLVA 2X64A 3F9UA 2JZSA 2FWFA 4A5PA 2H75A 4PQ1A 2YWOA 5H5SA 4BL7B 1QK8A 3WT2A 1Y25A 4MP4A 1HNCA 1YEWC 3U6VA 4NXIA 3TU3B 2O3EA 3TJBA 2C0GA 5ENUA 5FWGA 5IMAA 1EEJA 3BOAA 1JZOA 5KN2A 1GP1A 4TXVA 2K8VA 1H4OA 3Q74A 3G7JA 1XWGA 4O5RA 4XTSA 3FR9A 4MDCA 1UA5A 4TRXA 5J9CA 3TKPA 4K0GA 2YCDA 2NVLA 4PTSA 2EFEA 4FYCA 5DALB 1FW1A 5B7CA 1X5DA 3LJRA 1SL0B 3LW9A 3ERWA 3UVHA 4KDUA 1ZYQB 5HR0A 3L9SA 2A2RA 2KP2A 4PI0C 6GSSA 1GSQA 4PHZC 2VL2C 2VUPA 2DJ0A 4YAPA 1WIKA 5IM9A 3IHQA 3EVIA 4K5RA 3FZ9A 4K7IA 3UIWA 1XVQA 5IOXA 1FB0A 3CSIA 4L8EA 3EINA 3VPQA 3HY2A 1MD4A 11GSA 4GCIA 4HOJA 4JZQA 3DKSA 1GTUA 2R3XA 4YKFA 5D8IA 3M9JA 5CRDA 3FK8A 1ZL9A 4O5UA 3E9JB 5GAND 4KX4A 1GWCA 3HJMA 2FWGA 2FY6A 5IO0A 2H6ZA 1HNBA 3M0FA 3QAVA 3VI5A 4J56E 1ERUA 2H1AA 1E2YA 4HU9A 1VF1A 1Z7PA 2LNSA 2H73A 3M3MA 1SU9A 1PX6A 2C0FA 4NPBA 1O73A 1SKRB 1A23A 3F4TA 5CAXA 4AF2A 5A34A 1FHEA 1Z6MA 2DJ3A 3HZ4A 2L57A 4AJ6A 4POLA 2PVOC 1EP7A 1OE8A 1OE7A 2CA8A 1A8YA 4MH2A 5ECOB 3WD6A 2TIRA 5B6NA 1MDKA 1XOBA 2X4AA 4IBPA 5F0GA 4KB3A 3HCZA 3UJ1A 2O5VA 5CYYA 2WFCA 4KCAA 1XZOA 2JSZA 1MTCA 1K0AA 1TRVA 2QSIA 2GVPA 3IDVA 5H5RA 1M3IA 2IFQA 2YOIA 1O8XA 2OE1A 5IMZA 1A2JA 5AIVA 2VL2A 1GSSA 1TU7A 5DCGA 1OC9A 1QXHA 4FIWA 4POMA 4BVYB 3UEMA 2V2GA 1S4BP 1QGVA 2V32A 4PX1A 2R2JA 4ML6A 4IVFA 2R0CA 2HRAA 2RUFA 1UN2A 2CZ3A 4L0UA 4MMMA 3E0UA 1V9WA 1FG4A 3HYPA 4TR3A 1M2BA 3TKQA 2IL3A 1EWXA 4AKGA 3KMOA 3TJKA 4XS4A 1F3BA 2DJ2A 2X49A 2GZPA 2WRTA 2GT6A 3NZNA 3L78A 2VKZG 1GUKA 3CSJA 3D4MA 1PSQA 3MSZA 3A5IA 4I2UA 4NWYA 3TRQA 3QR6A 2OA7A 3FYGA 3LQ7A 3I9V2 3G9BA 2O85A 3GL3A 2WS2A 4ZL8A 1V2AA 5DBQA 3IOSA 1YY7A 3GSTA 2YWIA 3F6FA 6GSUA 1SK1A 4LL4B 1FO5A 4BPYA 1XWAA 5GZZB 2H0HA 4TR0A 2FWEA 4GSSA 1GTBA 2FNOA 2DJJA 3D6IA 1WWJA 2H70A 1M2AA 1MDJA 3G7IA 4G19A 2C3QA 1AUCA 3M9KA 1LU4A 1J0FA 1BG5A 1V98A 3TDGA 4HQSA 5J4VA 1LJRA 3VURA 1YJ6A 2XHFA 1UC7A 3ZVJA 1S3AA 1ON4A 1A8LA 4G01A 4ECBA 3ZMLA 2L5OA 1Z9HA 2VL3A 1Z5YE 3WGEA 1TI1A 3ZYWA 1F9MA 5CNWA 3GURA 3KCMA 4CY6A 3UMAA 4PI2C 3TCOA 1XIYA 2O89A 4TXOB 4Z2RA 5A1NA 5DVBA 4K7OA 2F3MA 2F9SA 3QFBC 4QL7A 3I6AA 1EV9A 1PFOA 1I9DA 1YZXA 2YV9A 3GKNA 3HVXA 3MWHA 1ZZYA 1HNAA 2FWHA 1XW9A 1KBNA 1YKCA 3F6DA 3KEBA 1U3AA 2FCHA 4CDOA 5D73A 1G7OA 2ZUPA 7GSSA 1SK2A 2O7KA 4V1Ag 4DSRA 3UARA 3MNGA 1B4QA 1PKWA 4EVMA 2P5QA 1A0RP 4KH7A 3EYTA 3L0HA 3TJJA 3DD3A 1F3AA 2DJKA 4K9ZA 4KAEA 5D93A 2YNXA 5DAKA 1TI3A 3KM6A 3PINA 2C80A 4Z2TA 3KMNA 4GRFA 3F4RA 1OKTA 2GTUA 4KSMA 4I6XA 3P90A 3NOFA 2O87A 1NHYA 2YV7A 4E68A 1ZYPA 4V2NA 5CO3A 1ABAA 1M9AA 3KH7A 1Y1UA 2GSQA 5ECPB 4L5LA 2K6VA 3ZLPA 4GSNA 5FHIA 2F51A 4PUAA 5ID2B 1W89A 1J08A 3RHBA 3FRCA 4G0LA 2OADA 5C04A 3HHVA 3QAGA 2I3YA 4G0KA 4JE1A 2M72A 4WF4A 3FR3A 4EXJA 1YDKA 2MMAA 5IMVA 2QGVA 4JEDA 2YWNA 5A5KA 4NMUA 2JADA 3I43A 1A0FA 1TKDB 4WBJA 17GSA 2WVXA 3WT1A 4HUAA 5ECQB 3RBTA 1B48A 5JWOB 2I9HA 5KN3A 3J7Yb 5ECSA 1NM3A 1TK5B 4BVYA 2G0FA 1EZKA 2H8LA 1K3OA 3PPUA 2WVXB 1AQWA 3BBYA 1X0RA 2IWTA 5IPHA 2TRCP 1S3CA 1QFNA 1FVKA 2LJAA 4HQZA 5D9TA 3C1SA 2IMFA 4XIHA 3CRUA 1B9XC 4PNGA 1OC8A 3ME7A 2RLIA 1U87A 4MABA 4WEYA 3EE2A 1JFUA 1GSEA 3KP8A 3Q18A 3EPTA 3RGBC 4PUFC 2A2SA 4MNNA 1YEXA 3N5OA 5AISA 3HD5A 1N8JA 4ZIJA 3GH9A 1GUMA 2REMA 4LMVA 1Q4JA 3PH9A 3C7MA 1NHOA 3HVVA 3IK7A 1K0DA 1A2LA 1IYIA 2VM2A 4K1FA 3ED3A 3O3TA 1O81A 5CP1A 1URMA 1TDIA 4I5QA 4JU5A 1NW2A 1GRXA 5EVOA 2VO4A 1XCCA 3D22A 4MJCA 4N11A 2VCTA 3KXOA 2CVKA 3IV4A 1HQOA 4GF0A 4JR4A 2V6OA 2MMZA 2PERA 3QCPA 4GSTA 4MLYA 2R6KA 2RIIA 2HSMB 2R5GA 1KEBA 3MIXA 4MF6A 2H76A 5L71A 2MMOA 3C8EA 3S9FA 1SENA 3C1RA 1S3RA 2VCZA 2VD1A 5H5QA 1T1VA 5CRGA 5F07A 1SD8A 3QPMA 2O36A 1OVNA 1U6TA 1DBYA 2KUCA 1Z7RA 4TW5A 1WMJA 2YPMA 2VCQA 2L6CA 3TOUA 2TRXA 2H1DA 3O76A 2VIMA 4GQCA 5G5FA 1WRYA 2X8GA 2CAQA 4KF9A 2XPEA 1PRXA 2EIQA 5FT3A 1BX9A 2WDUA 1C72A 3QD9A 4OD7A 5BMUB 4X4JA 3TKSE 5GSTA 5GSSA 2JU5A 1G7EA 4K8MA 2C1YA 1AXDA 4MZBA 2B3SA 2FA4A 2E2MA 3IAS2 1Q98A 3QMXA 5J5NA 4HJ2A 4D73A 3CYNA 4O32A 2VM1A 3A3TA 5HFKA 3VWVA 4HS1A 4XS4B 3IBHA 4IW9A 5IOWA 1GTIA 1OKDA 2EFDA 1TU8A 1MD3A 4WR5A 5HR1A 1JLWA 5ECMB 1MDIA 3VWUA 2PMTA 4HU7A 3DIEA 4L0WA 2UZ8A 4MPFA 3ZTLA 1T4ZA 14GSA 3UVTA 2H72A 1GH2A 3RPPA 1EGOA 3LYKA 1M99A 2CT6A 2H0GA 3MAKA 1B4PA 4BVXB 1YF0A 4GLTA 5ELAA 1XG8A 5DQSA 2H6YA 3DVXA 2QA2A 2L59A 2R4VA 1JZRA 5IPGA 1ACVA 3US3A 3IR4A 1SYXA 4L5OA 4ZBAA 2M46A 5A4VA 1XWBA 3CTFA 3RDWA 4IP1A 3GX8A 4EF0A 3OR5A 5A5HA 1CQGA 1XWCA 2G2QA 1TXUA 5KN0A 2LKUA 2CVBA 3GYKA 4TR1B 3GFKA 1WJKA 2IMKA 4OFNA 1ERTA 3GNJA 2MZCA 2JACA 3V1WA 3E3EA 2NPBA 4Q5NA 3ZFBA 3BJ5A 4HI7A 1YEPA 2LSTA 3LSZA 3IK9A 5CRHA 2EFHA 5DJMA 2EIRA 3MYDA 5LNKe 2GQMA 4ZB6A 3KTBA 4TXOA 3F4SA 2X99A 3HXSA 4ZBBA 5KOWA 2CV4A 2WULA 1I1IP 1YF1A 2EC4A 3GL5A 1WPIA 3LWAA 5D9WA 3IXRA 3VPTA 1FB6A 1O85A 5JWQB 2HSHA 2DBCA 2YP6A 2IIYA 4FO5A 1QMVA 4N30A 2WW0A 4WR4A 5E59A 3VWXA 2HYXA 1VF3A 4FXYP 1QQ2A 2I1UA 3KD0A 2C0DA 3P7XA 4YQUA 4EC0A 2LS5A 4KDYA 3KTLA 1EOGA 2E0QA 4JBBA 4NAXA 1O8WA 5ECLB 2E7PA 1PGTA 4FYBA 4MJAA 3LXTA 2WW1A 2R0PA 4QL9A 3IC8A 1SVLA 3GIXA 4K7NA 5B6MA 3BCKA 2H1GA 4MZWA 4IS0A 3H1NA 2B6MA 2FGXA 2OBKA 4WKWA 4KW6A 4OO4A 3EMPA 5DJLA 4MPGA 1Z3EA 1VGLA 4K5SA 4G2EA 1R5PA 1JZDA 2H74A 4IN0A 2K9FA 4D73B 5DALA 1GLPA 3CWGA 4EO3A 2CX4A 1E6BA 4OCFA 2F8AA 1DUGA 2HRKA 1XXUA 1SK0A 1TTZA 3GUSA 3HMJG 5HFGA 5INYA 3TGZA 3ERFA 3UL3A 3GKXA 4LA1A 2L6DA 3FW2A 3UBLA 3FY7A 4KSOA 6GSTA 2LTKA 2V41A 4ZILA 3LFLA 3JCML 2B7JA 2XBIA 2XC2A 16GSA 3EU4A 1R26A 1XBSA 2C0EA 2WZ9A 1A24A 1EEMA 1TRWA 2YZUA 4DVCA 3GA4A 1ZGNA 1OAZA 1K3LA 5J4UA 2Z9SA 4Z7XA 4KA0A 1ZYEA 2AJQB 2J23A 1XVWA 3F8UA 4RQXA 3HJOA 4YQMA 13GSA 1X5CA 2N5FA 4Q5FA 2HSMA 4XRDA 1OC9B 5KN1A 4KE3A 5J40A 3TUEA 1BYEA 2DIZA 1Z6NA 2PPTA 1B8XA 5C00A 1RK4A 1R7HA 3A2XA 1BJXA 2LJKA 2YWMA 5IMFA 4O5QA 4TN8A 1ZYNA 3HVSA 2VLVA 3CSHA 2OT3A 3ZIJA 2HNLA 1V58A 2FUG2 3CMIA 5ECNB 2IPAA 2AAWA 3RHCA 1T00A 1TRUA 4CY8A 1DSBA 2A2PA 3CXGA 5ECIB 2HRKB 4HSCX 3FR6A 4DSSB 2P0GA 2HI7A 1QUWA 3KZQA 2WW3A 1PKZA 3DGQA 5ECHB 4I2TA 8GSSA 1T4YA 4BIKA 1K3YA 4PURA 2LRCA 4H86A 3ME8A 2VD0A 4K2XA 1YQ1A 1BF5A 3ZIVA 4GTUA 2WVZA 2L4CA 3GV1A 6GSWA 3N9JA 4YAVA 5ABRA 4QMKA 4IELA 4E8HA 4DEJA 2PGTA 4IJ3A 4JRRA 3L9UA 2DSAA 1M3JA 4ACSA 3O6TA 2V6KA 1K0MA 3I69A 2DLXA 2DKIA 2ES7A 4OFMA 1GNWA 2FLSA 3A5WA 2AUVA 2EIOA 4GWRA 5IIZA 3GHAA 2VAFA 2DC5A 5ECKB 4ECJA 1T8EB 5BMUA 2HRFA 3F0IA 2CZ2A 1USBA 5JWRB 2H19A 1SJIA 1J9BA 4IKHA 4ID0A 1ST9A 3U5RE 3FEUA 2X8HA 2C4JA 1ERWA 3RFRC 3IRAA 4PQHA 1A2MA 5IQYA 3FZ5A 2WW2A 2GS3A 1RQMA 1XOAA 2WZSA 1ZCPA 1F37A 3D0ZA 2WVYA 4TOPA 1LBKA 3VI7A 2E2GA 1RW1A 1WP0A 3QOUA 2KHPA 4IQAA 3WYWA 2JZTA 2FHEA 3QAWA 4Q5RA 4MH3A 4TR1A 2DMLA 4EDYA 2GZYA 5HR2A 5G1KA 1GNEA 2BMXA 5KOXA 2HXKA 1WE0A 3M8NA 3TKSC 1PQNA 2FA8A 3M1GA 1AQXA 4FQUA 1FOHA 2YJHA 2ALBA 4EE0A 2DMMA 3LGCA 2NDOA 4HJMA 5JCWA 1N25A 1GUHA 3APOA 1G6WA 2C8UA 3TJGA 1F6MC 2IFQB 4XHMA 3LYPA 5J47A 4K0NA 4F0BA 1M7TA 5LCZA 9GSSA 3DWVA 5B8AA 3APQA 1B9YC 4F2IA 5COHA 2H71A 1GSDA 4CW9A 1THXA 4KNDA 3GKMA 3H93A 3R3EA 4ECCA 1YVLA 4W66A 3J7Yk 5JCUA 3TOTA 5EL8A 2F8FA 2XPDA 1Y6EA 5J3RA 4JR6A 3R2QA 3DMLA 1ILOA 4O7HA 2MYGA 3VFIA 2PUKC 3KJYA 1SKWB 1R4WA 2BJXA 3CTGA 3GKKA 4MJBA 1GSUA 2LEGA 2YJ7A 3F3RA 2R37A 2LNTA 3DRNA 3ZREA 1PA3A 5AGYA 5J41A 3ERGA 1TK8B 3ISOA 3KP9A 2QA1A 4OWYA 1TOFA 4MJEA 5BRTA 4OMVA 1G6YA 1SL1B 3IHGA 3VWWA 12GSA 3GTUB 2LRTA 5LD0A 5J4YA 3IA1A 1DE1A 3D4TA 1ML6A 3HDCA 3EC3A 2B7KA 2X8CA 1GULA 19GSA 2AV4A 2MBTA 3L4NA 2K8SA 3IE3A 1V57A 2OACA 5DQYA 3LG6A 3Q19A 4BWQA 4NHWA 4LLRA 4PXOA 3KH9A 5AIXA 2O8VB 4P3YB 2N5BA 3LXZA 3P8WA 4AJ7A 3ZFLA 4ML1A 4RUVA 2LJRA 2MMNA 2BTOT 4QQ7A 2HZEB 3CQFA 4X43A 3HKRA 3EU3A 2RM5A 3VLNA 2OBIA 3A2WA 1EV4A 5G2ZA 2CX3A 2GZZA 4EIQA 4CHSA 1ZOFA 6GSVA 3TJFA 3F3QA 3TKRA 5A5HB 4KDXA 1XW5A 4N0VA 1WOUA 5GAPD 1THOA 4PQIA 5D96A 4RI6A 1X5EA 4V1Ap 5DAKB 4BVXA 2H0IA 3FKFA 1K0BA 3K8NA 4OCEA 1T7PB 1V40A 4XS6A 1XWKA 2H6XA 2JZRA 1TJDA 3GSSA 4MK3A 2OKAA 4Q5QA 2HLSA 2HSNA 3CHXC 5G5EA 2NTOA 1PL1A 5J9BA 4WXTA 1FVJA 5DDLA 2AHEA 3D5JA 3TRXA 2DJ1A 3A2VA 2KOKA 5CREA 4PNFA 4IQ1A 1R5AA 3NIVA 2IN3A 4XS1A 4ICYA 2HSNB 5E4WA 2GDRA 1TP9A 4DSSA 1HD2A 2H1BA 3HZ8A 3APSA 1M0UA 4AKIA 4I8BA 4LL1B 1K0CA 3GMFA 4MA9A 3H8QA 2A4VA 4ZL9A 3GH6A 2IMEA 4YH2A 4G0IA 4K6XA 3DEXA 2PU9C 5ELGA 1SJ6A 2CVDA 4ISDA 4GXZA 1ZMAA 2DKHA 2C3TA 4F9ZA 4XCSA 5IO2A 2HE3A 1SJZA 3L9VA 4YKGA 2GSSA 3RAZA 2HFDA 3UBKA 4I97A 5F8BA 4Z2UA 5G1LA 1AAZA 1PD21 5JCGA 2L4QA 2L5LA 1AC1A 10GSA 2JL4A 2JSYA 2D2ZA 2VCWA 6GSYA 2GSRA 1YKAA 2YN1A 3SBCA 4TVEA 3PR8A 3C71A 2GLRA 2GGTA 4NV2A 5CRWA 1SYRA 2LUSA 1VF2A 2K18A 3QDNA 3AY8A 2ZNMA 3DYRA 1GLQA 3EWLA 2PBJA 4ZB7A 1O7UA 1UVZA 3SWLA 5D9VA 3GX0A 4IHUA 3F63A 3WGXA 4TR4A 1EGRA 2GT5A 2AB6A 1G0TA 2NBSA 2WCIA 3ZMKA 5A4WA 1PX7A 4J2FA 3RPNA 3ZL5A 2VCXA 3HVNA 4G10A 3CRTA 3WGDA 2VL9A 1K0OA 4HEA2 2ON7A 3QFAC 2H01A 1OYJA 1TXXA 3HJPA 5F06A 1FAAA 5HR3A 4BL7A 1BG1A 2H66A 2M80A 3UOMA 2PN8A 2GQLA 5KEJA 4MCUA 4V2MA 1AQVA 4MZCA 1W4VA 2H30A 4KUNA 4EIPA 2HT9A 4KCEA 2VOCA 1ERVA 4O92A 2WGRA 3TKSA 3C73A 2HZEA 2YZHA 2IJYA 1GL8A 1X9SB 5AN1A 4RQRA 3ZZXA 3P2AA 2GSTA 1XPVA 3KGKA 2LRNA 4AKXB 4N3ZA 3EMXA 5G31A 3Q6OA 3G7YA 3DVWA 1GTAA 3FMWA 2IMIA 2PVQA 3EURA 3W8SA 1VF4A 2B5YA 2H1LA 2WJUA 4WBRD 1IYHA 1TRSA 4X1UA 4XRAA 3GTUA 3H79A 4EKZA 3CBUA 20GSA 1KNGA 3GN3A 1PMTA 4EUYA 3H4KA 3TB2A 1S3DA 3HA9A 1U3IA 2AYTA 4AGSA 2P5RA 1AW9A
chains in the Genus database with same CATH topology
2B1KA 4AI6A 1K0NA 4MF5A 5EPFA 1X9MB 3ZVJD 3IAM2 1F2EA 1N2AA 1T3BA 1GSYA 2DIYA 1HYUA 5ID2A 4F03A 1I5GA 3DXBA 4NV5A 5HFIA 4YQVA 3MDKA 2ZCTA 18GSA 2EFCA 2N5AA 2J9HA 2XBQA 2C3NA 3ZRDA 4V2LA 4LMWA 4KGIA 5EY6A 1X9WB 1EP8A 4EL1A 4IGJA 3ZITA 5IMCA 1U88A 3FZ4A 5IMDA 2LQOA 2I81A 4X0XA 4HZ4A 4RI7A 3LORA 2RUEA 1AIUA 4BWSA 1EOHA 4OFTA 1XW6A 3IC4A 2I4AA 2B1LA 2MBSA 4FH8A 4WETA 4GQFA 1M9BA 2GQKA 2KLXA 3FZAA 3BCIA 1DE2A 4HDEA 1CQHA 1OC3A 4BA7A 1SKSB 4N0ZA 1O6JA 2IMDA 4IP6A 3W6GA 1PL2A 1H75A 4K2DA 3D21A 2KP1A 5A1NB 2OE3A 2P31A 2PWJA 2LQQA 5A34B 2HQTA 4POKA 1PN9A 4F0CA 3LEFA 3W8JA 5A4UA 2CQ9A 1VRSD 4N10A 1GSFA 2ON5A 4MF7A 1JZWA 4POBA 1TW9A 4FYUA 1TK0B 4DSQA 2QKEA 4J57E 5ECRB 2WB9A 5F05A 4GDFA 3VK9A 2V1MA 2B5XA 3PGTA 2VCVA 2VLTA 1NSWA 1PN0A 2LV3A 4F82A 1M2DA 2B5EA 5DCHA 22GSA 2R0GA 4TKYA 4PGTA 2A4HA 2YANA 1SVOA 1MEKA 1SD9A 4G9HA 2FD3A 5G30A 3BD2A 1BQ7A 6GSXA 1XFLA 4ZB9A 1SVMA 1SL2B 4ECIA 1JHBA 1BAYA 2CAIA 4ULXA 4IJIA 2QC7A 3IPZA 2VLUA 3FHKA 4ZL7A 4HZ2A 4NHZA 1KTEA 4ZBDA 4WF5A 3TRPA 4EDZA 4E8EA 4USSA 2UV8G 2OJLA 2RM6A 5D9XA 1BEDA 4AJ8A 2HRNA 1FOVA 3GRXA 2HSYA 4OO5A 4ZXGA 4ZB8A 2HZFA 5B8BA 5HQPA 4AKHA 3KIJA 2OE0A 4ILFA 3UAPA 1JLVA 2X64A 3F9UA 2JZSA 2FWFA 4A5PA 2H75A 4PQ1A 2YWOA 5H5SA 4BL7B 1QK8A 3WT2A 1Y25A 4MP4A 1HNCA 3U6VA 4NXIA 3TU3B 3TJBA 2C0GA 5ENUA 5FWGA 5IMAA 1EEJA 3BOAA 1JZOA 5KN2A 1GP1A 4TXVA 2K8VA 1H4OA 3Q74A 3G7JA 1XWGA 4O5RA 4XTSA 3FR9A 4MDCA 1UA5A 4TRXA 5J9CA 3TKPA 4K0GA 2YCDA 2NVLA 4PTSA 2EFEA 4FYCA 5DALB 1FW1A 5B7CA 1X5DA 3LJRA 1SL0B 3LW9A 3ERWA 3UVHA 4KDUA 1ZYQB 5HR0A 3L9SA 2A2RA 2KP2A 6GSSA 1GSQA 2VL2C 2VUPA 2DJ0A 4YAPA 1WIKA 5IM9A 3IHQA 3EVIA 4K5RA 3FZ9A 4K7IA 3UIWA 1XVQA 5IOXA 1FB0A 3CSIA 4L8EA 3EINA 3VPQA 3HY2A 1MD4A 11GSA 4GCIA 4HOJA 4JZQA 3DKSA 1GTUA 2R3XA 4YKFA 5D8IA 3M9JA 5CRDA 3FK8A 1ZL9A 4O5UA 3E9JB 5GAND 4KX4A 1GWCA 3HJMA 2FWGA 2FY6A 5IO0A 2H6ZA 1HNBA 3M0FA 3QAVA 3VI5A 4J56E 1ERUA 2H1AA 1E2YA 4HU9A 1VF1A 1Z7PA 2LNSA 2H73A 3M3MA 1SU9A 1PX6A 2C0FA 4NPBA 1O73A 1SKRB 1A23A 3F4TA 5CAXA 4AF2A 5A34A 1FHEA 1Z6MA 2DJ3A 3HZ4A 2L57A 4AJ6A 4POLA 2PVOC 1EP7A 1OE8A 1OE7A 2CA8A 1A8YA 4MH2A 5ECOB 3WD6A 2TIRA 5B6NA 1MDKA 1XOBA 2X4AA 4IBPA 5F0GA 4KB3A 3HCZA 3UJ1A 2O5VA 5CYYA 2WFCA 4KCAA 1XZOA 2JSZA 1MTCA 1K0AA 1TRVA 2QSIA 2GVPA 3IDVA 5H5RA 2IFQA 2YOIA 1O8XA 2OE1A 5IMZA 1A2JA 5AIVA 2VL2A 1GSSA 1TU7A 5DCGA 1OC9A 1QXHA 4FIWA 4POMA 4BVYB 3UEMA 2V2GA 1QGVA 2V32A 4PX1A 2R2JA 4ML6A 4IVFA 2R0CA 2HRAA 2RUFA 1UN2A 2CZ3A 4L0UA 4MMMA 3E0UA 1V9WA 1FG4A 3HYPA 4TR3A 1M2BA 3TKQA 2IL3A 1EWXA 4AKGA 3KMOA 3TJKA 4XS4A 1F3BA 2DJ2A 2X49A 2GZPA 2WRTA 2GT6A 3NZNA 3L78A 2VKZG 1GUKA 3CSJA 3D4MA 1PSQA 3MSZA 3A5IA 4I2UA 4NWYA 3TRQA 3QR6A 2OA7A 3FYGA 3LQ7A 3I9V2 3G9BA 2O85A 3GL3A 2WS2A 4ZL8A 1V2AA 5DBQA 3IOSA 1YY7A 3GSTA 2YWIA 3F6FA 6GSUA 1SK1A 4LL4B 1FO5A 4BPYA 1XWAA 5GZZB 2H0HA 4TR0A 2FWEA 4GSSA 1GTBA 2FNOA 2DJJA 3D6IA 1WWJA 2H70A 1M2AA 1MDJA 3G7IA 4G19A 2C3QA 1AUCA 3M9KA 1LU4A 1J0FA 1BG5A 1V98A 3TDGA 4HQSA 5J4VA 1LJRA 3VURA 1YJ6A 2XHFA 1UC7A 3ZVJA 1S3AA 1ON4A 1A8LA 4G01A 4ECBA 3ZMLA 2L5OA 1Z9HA 2VL3A 1Z5YE 3WGEA 1TI1A 3ZYWA 1F9MA 5CNWA 3GURA 3KCMA 4CY6A 3UMAA 3TCOA 1XIYA 2O89A 4TXOB 4Z2RA 5A1NA 5DVBA 4K7OA 2F3MA 2F9SA 3QFBC 4QL7A 3I6AA 1EV9A 1I9DA 1YZXA 2YV9A 3GKNA 3HVXA 3MWHA 1ZZYA 1HNAA 2FWHA 1XW9A 1KBNA 1YKCA 3F6DA 3KEBA 1U3AA 2FCHA 4CDOA 5D73A 1G7OA 2ZUPA 7GSSA 1SK2A 2O7KA 4V1Ag 4DSRA 3UARA 3MNGA 1B4QA 1PKWA 4EVMA 2P5QA 1A0RP 4KH7A 3EYTA 3L0HA 3TJJA 3DD3A 1F3AA 2DJKA 4K9ZA 4KAEA 5D93A 2YNXA 5DAKA 1TI3A 3KM6A 3PINA 2C80A 4Z2TA 3KMNA 4GRFA 3F4RA 1OKTA 2GTUA 4KSMA 4I6XA 3P90A 3NOFA 2O87A 1NHYA 2YV7A 4E68A 1ZYPA 4V2NA 5CO3A 1ABAA 1M9AA 3KH7A 1Y1UA 2GSQA 5ECPB 4L5LA 2K6VA 3ZLPA 4GSNA 5FHIA 2F51A 4PUAA 5ID2B 1W89A 1J08A 3RHBA 3FRCA 4G0LA 2OADA 5C04A 3HHVA 3QAGA 2I3YA 4G0KA 4JE1A 2M72A 4WF4A 3FR3A 4EXJA 1YDKA 2MMAA 5IMVA 2QGVA 4JEDA 2YWNA 5A5KA 4NMUA 2JADA 3I43A 1A0FA 1TKDB 4WBJA 17GSA 3WT1A 4HUAA 5ECQB 3RBTA 1B48A 5JWOB 2I9HA 5KN3A 3J7Yb 5ECSA 1NM3A 1TK5B 4BVYA 2G0FA 1EZKA 2H8LA 1K3OA 3PPUA 1AQWA 3BBYA 1X0RA 2IWTA 5IPHA 2TRCP 1S3CA 1QFNA 1FVKA 2LJAA 4HQZA 5D9TA 3C1SA 2IMFA 4XIHA 3CRUA 1B9XC 4PNGA 1OC8A 3ME7A 2RLIA 1U87A 4MABA 4WEYA 3EE2A 1JFUA 1GSEA 3KP8A 3Q18A 3EPTA 4PUFC 2A2SA 4MNNA 1YEXA 3N5OA 5AISA 3HD5A 1N8JA 4ZIJA 3GH9A 1GUMA 2REMA 4LMVA 1Q4JA 3PH9A 3C7MA 1NHOA 3HVVA 3IK7A 1K0DA 1A2LA 1IYIA 2VM2A 4K1FA 3ED3A 3O3TA 1O81A 5CP1A 1URMA 1TDIA 4I5QA 4JU5A 1NW2A 1GRXA 5EVOA 2VO4A 1XCCA 3D22A 4MJCA 4N11A 2VCTA 3KXOA 2CVKA 3IV4A 1HQOA 4GF0A 4JR4A 2V6OA 2MMZA 2PERA 3QCPA 4GSTA 4MLYA 2R6KA 2RIIA 2HSMB 2R5GA 1KEBA 3MIXA 4MF6A 2H76A 5L71A 2MMOA 3C8EA 3S9FA 1SENA 3C1RA 2VCZA 2VD1A 5H5QA 1T1VA 5CRGA 5F07A 1SD8A 3QPMA 1OVNA 1U6TA 1DBYA 2KUCA 1Z7RA 4TW5A 1WMJA 2YPMA 2VCQA 2L6CA 3TOUA 2TRXA 2H1DA 3O76A 2VIMA 4GQCA 5G5FA 1WRYA 2X8GA 2CAQA 4KF9A 2XPEA 1PRXA 2EIQA 5FT3A 1BX9A 2WDUA 1C72A 3QD9A 4OD7A 5BMUB 4X4JA 3TKSE 5GSTA 5GSSA 2JU5A 1G7EA 4K8MA 2C1YA 1AXDA 4MZBA 2B3SA 2FA4A 2E2MA 3IAS2 1Q98A 3QMXA 5J5NA 4HJ2A 4D73A 3CYNA 4O32A 2VM1A 3A3TA 5HFKA 3VWVA 4HS1A 4XS4B 3IBHA 4IW9A 5IOWA 1GTIA 1OKDA 2EFDA 1TU8A 1MD3A 4WR5A 5HR1A 1JLWA 5ECMB 1MDIA 3VWUA 2PMTA 4HU7A 3DIEA 4L0WA 2UZ8A 4MPFA 3ZTLA 1T4ZA 14GSA 3UVTA 2H72A 1GH2A 3RPPA 1EGOA 3LYKA 1M99A 2CT6A 2H0GA 3MAKA 1B4PA 4BVXB 1YF0A 4GLTA 5ELAA 5DQSA 2H6YA 3DVXA 2QA2A 2L59A 2R4VA 1JZRA 5IPGA 1ACVA 3US3A 3IR4A 1SYXA 4L5OA 4ZBAA 2M46A 5A4VA 1XWBA 3CTFA 3RDWA 4IP1A 3GX8A 4EF0A 3OR5A 5A5HA 1CQGA 1XWCA 2G2QA 1TXUA 5KN0A 2LKUA 2CVBA 3GYKA 4TR1B 3GFKA 1WJKA 2IMKA 4OFNA 1ERTA 3GNJA 2MZCA 2JACA 3V1WA 3E3EA 2NPBA 4Q5NA 3ZFBA 3BJ5A 4HI7A 1YEPA 2LSTA 3LSZA 3IK9A 5CRHA 2EFHA 5DJMA 2EIRA 3MYDA 5LNKe 2GQMA 4ZB6A 3KTBA 4TXOA 3F4SA 2X99A 3HXSA 4ZBBA 5KOWA 2CV4A 2WULA 1YF1A 2EC4A 3GL5A 1WPIA 3LWAA 5D9WA 3IXRA 3VPTA 1FB6A 1O85A 5JWQB 2HSHA 2DBCA 2YP6A 2IIYA 4FO5A 1QMVA 4N30A 4WR4A 5E59A 3VWXA 2HYXA 1VF3A 1QQ2A 2I1UA 3KD0A 2C0DA 3P7XA 4YQUA 4EC0A 2LS5A 4KDYA 3KTLA 1EOGA 2E0QA 4JBBA 4NAXA 1O8WA 5ECLB 2E7PA 1PGTA 4FYBA 4MJAA 3LXTA 2R0PA 4QL9A 3IC8A 1SVLA 3GIXA 4K7NA 5B6MA 3BCKA 2H1GA 4MZWA 4IS0A 3H1NA 2B6MA 2FGXA 2OBKA 4WKWA 4KW6A 4OO4A 3EMPA 5DJLA 4MPGA 1Z3EA 1VGLA 4K5SA 4G2EA 1R5PA 1JZDA 2H74A 4IN0A 2K9FA 4D73B 5DALA 1GLPA 3CWGA 4EO3A 2CX4A 4OCFA 1E6BA 2F8AA 1DUGA 2HRKA 1XXUA 1SK0A 1TTZA 3GUSA 3HMJG 5HFGA 5INYA 3TGZA 3ERFA 3UL3A 3GKXA 4LA1A 2L6DA 3FW2A 3UBLA 3FY7A 4KSOA 6GSTA 2LTKA 2V41A 4ZILA 3LFLA 3JCML 2B7JA 2XBIA 2XC2A 16GSA 3EU4A 1R26A 1XBSA 2C0EA 2WZ9A 1A24A 1EEMA 1TRWA 2YZUA 4DVCA 3GA4A 1ZGNA 1OAZA 1K3LA 5J4UA 2Z9SA 4Z7XA 4KA0A 1ZYEA 2AJQB 2J23A 1XVWA 3F8UA 4RQXA 3HJOA 4YQMA 13GSA 1X5CA 2N5FA 4Q5FA 2HSMA 4XRDA 1OC9B 5KN1A 4KE3A 5J40A 3TUEA 1BYEA 2DIZA 1Z6NA 2PPTA 1B8XA 5C00A 1RK4A 1R7HA 3A2XA 1BJXA 2LJKA 2YWMA 5IMFA 4O5QA 4TN8A 1ZYNA 3HVSA 2VLVA 3CSHA 2OT3A 3ZIJA 2HNLA 1V58A 2FUG2 3CMIA 5ECNB 2IPAA 2AAWA 3RHCA 1T00A 1TRUA 4CY8A 1DSBA 2A2PA 3CXGA 5ECIB 2HRKB 3FR6A 4DSSB 2P0GA 2HI7A 1QUWA 3KZQA 1PKZA 3DGQA 5ECHB 4I2TA 8GSSA 1T4YA 1K3YA 4PURA 2LRCA 4H86A 3ME8A 2VD0A 4K2XA 1YQ1A 1BF5A 3ZIVA 4GTUA 2L4CA 3GV1A 6GSWA 3N9JA 4YAVA 5ABRA 4QMKA 4IELA 4E8HA 4DEJA 2PGTA 4IJ3A 4JRRA 3L9UA 2DSAA 4ACSA 3O6TA 2V6KA 1K0MA 3I69A 2DLXA 2DKIA 2ES7A 4OFMA 1GNWA 2FLSA 3A5WA 2AUVA 2EIOA 4GWRA 5IIZA 3GHAA 2VAFA 2DC5A 5ECKB 4ECJA 1T8EB 5BMUA 2HRFA 3F0IA 2CZ2A 1USBA 5JWRB 2H19A 1SJIA 1J9BA 4IKHA 4ID0A 1ST9A 3U5RE 3FEUA 2X8HA 2C4JA 1ERWA 3IRAA 4PQHA 1A2MA 5IQYA 3FZ5A 2GS3A 1RQMA 1XOAA 1ZCPA 1F37A 3D0ZA 4TOPA 1LBKA 3VI7A 2E2GA 1RW1A 1WP0A 3QOUA 2KHPA 4IQAA 3WYWA 2JZTA 2FHEA 3QAWA 4Q5RA 4MH3A 4TR1A 2DMLA 4EDYA 2GZYA 5HR2A 5G1KA 1GNEA 2BMXA 5KOXA 2HXKA 1WE0A 3M8NA 3TKSC 1PQNA 2FA8A 3M1GA 1AQXA 4FQUA 1FOHA 2YJHA 2ALBA 4EE0A 2DMMA 3LGCA 2NDOA 4HJMA 5JCWA 1N25A 1GUHA 3APOA 1G6WA 2C8UA 3TJGA 1F6MC 2IFQB 4XHMA 3LYPA 5J47A 4K0NA 4F0BA 1M7TA 5LCZA 9GSSA 3DWVA 5B8AA 3APQA 1B9YC 4F2IA 5COHA 2H71A 1GSDA 4CW9A 1THXA 4KNDA 3GKMA 3H93A 3R3EA 4ECCA 1YVLA 4W66A 3J7Yk 5JCUA 3TOTA 5EL8A 2F8FA 2XPDA 1Y6EA 5J3RA 4JR6A 3R2QA 3DMLA 1ILOA 4O7HA 2MYGA 3VFIA 2PUKC 3KJYA 1SKWB 1R4WA 2BJXA 3CTGA 3GKKA 4MJBA 1GSUA 2LEGA 2YJ7A 3F3RA 2R37A 2LNTA 3DRNA 3ZREA 1PA3A 5AGYA 5J41A 3ERGA 1TK8B 3ISOA 3KP9A 2QA1A 4OWYA 1TOFA 4MJEA 5BRTA 4OMVA 1G6YA 1SL1B 3IHGA 3VWWA 12GSA 3GTUB 2LRTA 5LD0A 5J4YA 3IA1A 1DE1A 3D4TA 1ML6A 3HDCA 3EC3A 2B7KA 2X8CA 1GULA 19GSA 2AV4A 2MBTA 3L4NA 2K8SA 3IE3A 1V57A 2OACA 5DQYA 3LG6A 3Q19A 4BWQA 4NHWA 4LLRA 4PXOA 3KH9A 5AIXA 2O8VB 4P3YB 2N5BA 3LXZA 3P8WA 4AJ7A 3ZFLA 4ML1A 4RUVA 2LJRA 2MMNA 2BTOT 4QQ7A 2HZEB 4X43A 3HKRA 3EU3A 2RM5A 3VLNA 2OBIA 3A2WA 1EV4A 5G2ZA 2CX3A 2GZZA 4EIQA 4CHSA 1ZOFA 6GSVA 3TJFA 3F3QA 3TKRA 5A5HB 4KDXA 1XW5A 4N0VA 1WOUA 5GAPD 1THOA 4PQIA 5D96A 4RI6A 1X5EA 4V1Ap 5DAKB 4BVXA 2H0IA 3FKFA 1K0BA 3K8NA 4OCEA 1T7PB 1V40A 4XS6A 1XWKA 2H6XA 2JZRA 1TJDA 3GSSA 4MK3A 2OKAA 4Q5QA 2HLSA 2HSNA 5G5EA 2NTOA 1PL1A 5J9BA 4WXTA 1FVJA 5DDLA 2AHEA 3D5JA 3TRXA 2DJ1A 3A2VA 2KOKA 5CREA 4PNFA 4IQ1A 1R5AA 3NIVA 2IN3A 4XS1A 4ICYA 2HSNB 5E4WA 2GDRA 1TP9A 4DSSA 1HD2A 2H1BA 3HZ8A 3APSA 1M0UA 4AKIA 4I8BA 4LL1B 1K0CA 3GMFA 4MA9A 3H8QA 2A4VA 4ZL9A 3GH6A 2IMEA 4YH2A 4G0IA 4K6XA 3DEXA 2PU9C 5ELGA 1SJ6A 2CVDA 4ISDA 4GXZA 1ZMAA 2DKHA 2C3TA 4F9ZA 4XCSA 5IO2A 2HE3A 1SJZA 3L9VA 4YKGA 2GSSA 3RAZA 2HFDA 3UBKA 4I97A 5F8BA 4Z2UA 5G1LA 1AAZA 1PD21 5JCGA 2L4QA 2L5LA 1AC1A 10GSA 2JL4A 2JSYA 2D2ZA 2VCWA 6GSYA 2GSRA 1YKAA 2YN1A 3SBCA 4TVEA 3PR8A 3C71A 2GLRA 2GGTA 4NV2A 5CRWA 1SYRA 2LUSA 1VF2A 2K18A 3QDNA 3AY8A 2ZNMA 3DYRA 1GLQA 3EWLA 2PBJA 4ZB7A 1O7UA 1UVZA 3SWLA 5D9VA 3GX0A 4IHUA 3F63A 3WGXA 4TR4A 1EGRA 2GT5A 2AB6A 1G0TA 2NBSA 2WCIA 3ZMKA 5A4WA 1PX7A 4J2FA 3RPNA 3ZL5A 2VCXA 4G10A 3CRTA 3WGDA 2VL9A 1K0OA 4HEA2 2ON7A 3QFAC 2H01A 1OYJA 1TXXA 3HJPA 5F06A 1FAAA 5HR3A 4BL7A 1BG1A 2H66A 2M80A 3UOMA 2PN8A 2GQLA 5KEJA 4MCUA 4V2MA 1AQVA 4MZCA 1W4VA 2H30A 4KUNA 4EIPA 2HT9A 4KCEA 2VOCA 1ERVA 4O92A 2WGRA 3TKSA 3C73A 2HZEA 2YZHA 2IJYA 1GL8A 1X9SB 5AN1A 4RQRA 3ZZXA 3P2AA 2GSTA 1XPVA 3KGKA 2LRNA 4AKXB 4N3ZA 3EMXA 5G31A 3Q6OA 3G7YA 3DVWA 1GTAA 3FMWA 2IMIA 2PVQA 3EURA 3W8SA 1VF4A 2B5YA 2H1LA 2WJUA 4WBRD 1IYHA 1TRSA 4X1UA 4XRAA 3GTUA 3H79A 4EKZA 3CBUA 20GSA 1KNGA 3GN3A 1PMTA 4EUYA 3H4KA 3TB2A 1S3DA 3HA9A 1U3IA 2AYTA 4AGSA 2P5RA 1AW9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B1K A;  1K0N A;  4MF5 A;  5EPF A;  1X9M B;  3ZVJ D;  3IAM 2;  1F2E A;  1N2A A;  1T3B A;  1GSY A;  2DIY A;  1HYU A;  5ID2 A;  4F03 A;  1I5G A;  3DXB A;  4NV5 A;  5HFI A;  4YQV A;  3MDK A;  2ZCT A;  18GS A;  2N5A A;  2J9H A;  2XBQ A;  2C3N A;  3ZRD A;  4V2L A;  4LMW A;  4KGI A;  5EY6 A;  1X9W B;  1EP8 A;  4EL1 A;  4IGJ A;  3ZIT A;  5IMC A;  1U88 A;  3FZ4 A;  5IMD A;  2LQO A;  2I81 A;  4X0X A;  4HZ4 A;  4RI7 A;  3LOR A;  2RUE A;  1AIU A;  4BWS A;  1EOH A;  4OFT A;  1XW6 A;  3IC4 A;  2I4A A;  2B1L A;  2MBS A;  4FH8 A;  4WET A;  4GQF A;  1M9B A;  2GQK A;  2KLX A;  3FZA A;  3BCI A;  1DE2 A;  4HDE A;  1CQH A;  1OC3 A;  4BA7 A;  1SKS B;  4N0Z A;  1O6J A;  2IMD A;  4IP6 A;  3W6G A;  1PL2 A;  1H75 A;  4K2D A;  3D21 A;  2KP1 A;  2OE3 A;  2P31 A;  2PWJ A;  2LQQ A;  2HQT A;  4POK A;  1PN9 A;  4F0C A;  3LEF A;  3W8J A;  5A4U A;  2CQ9 A;  1VRS D;  4N10 A;  1GSF A;  2ON5 A;  4MF7 A;  1JZW A;  4POB A;  1TW9 A;  4FYU A;  1TK0 B;  4DSQ A;  2QKE A;  4J57 E;  5ECR B;  2WB9 A;  5F05 A;  3VK9 A;  2V1M A;  2B5X A;  3PGT A;  2VCV A;  2VLT A;  1NSW A;  2LV3 A;  4F82 A;  1M2D A;  2B5E A;  5DCH A;  22GS A;  4TKY A;  4PGT A;  2YAN A;  1MEK A;  1SD9 A;  4G9H A;  2FD3 A;  5G30 A;  3BD2 A;  1BQ7 A;  1AW9 A;  6GSX A;  1XFL A;  4ZB9 A;  1SL2 B;  4ECI A;  1JHB A;  1BAY A;  2CAI A;  4ULX A;  4IJI A;  2QC7 A;  3IPZ A;  2VLU A;  3FHK A;  4ZL7 A;  4HZ2 A;  4NHZ A;  1KTE A;  4ZBD A;  4WF5 A;  3TRP A;  4EDZ A;  4E8E A;  4USS A;  2OJL A;  2RM6 A;  5D9X A;  1BED A;  4AJ8 A;  2HRN A;  1FOV A;  3GRX A;  2HSY A;  4OO5 A;  4ZXG A;  4ZB8 A;  2HZF A;  5B8B A;  5HQP A;  3KIJ A;  2OE0 A;  4ILF A;  3UAP A;  1JLV A;  2X64 A;  3F9U A;  2JZS A;  2FWF A;  2H75 A;  4PQ1 A;  2YWO A;  5H5S A;  4BL7 B;  1QK8 A;  3WT2 A;  1Y25 A;  4MP4 A;  1HNC A;  3U6V A;  4NXI A;  3TJB A;  2C0G A;  5ENU A;  5FWG A;  5IMA A;  1EEJ A;  3BOA A;  1JZO A;  5KN2 A;  1GP1 A;  4TXV A;  2K8V A;  1H4O A;  3Q74 A;  3G7J A;  1XWG A;  4O5R A;  4XTS A;  3FR9 A;  4MDC A;  1UA5 A;  4TRX A;  5J9C A;  3TKP A;  4K0G A;  2YCD A;  2NVL A;  4PTS A;  4FYC A;  5DAL B;  1FW1 A;  5B7C A;  1X5D A;  3LJR A;  1SL0 B;  3ERW A;  3UVH A;  4KDU A;  1ZYQ B;  5HR0 A;  3L9S A;  2A2R A;  2KP2 A;  6GSS A;  1GSQ A;  2VL2 C;  2VUP A;  2DJ0 A;  4YAP A;  1WIK A;  5IM9 A;  3IHQ A;  3EVI A;  3FZ9 A;  4K7I A;  3UIW A;  1XVQ A;  5IOX A;  1FB0 A;  3CSI A;  4L8E A;  3EIN A;  3VPQ A;  3HY2 A;  1MD4 A;  11GS A;  4GCI A;  4HOJ A;  4JZQ A;  3DKS A;  1GTU A;  2R3X A;  5D8I A;  3M9J A;  5CRD A;  3FK8 A;  1ZL9 A;  5GAN D;  3E9J B;  4KX4 A;  1GWC A;  3HJM A;  2FWG A;  2FY6 A;  5IO0 A;  2H6Z A;  1HNB A;  3M0F A;  3QAV A;  3VI5 A;  4J56 E;  1ERU A;  2H1A A;  1E2Y A;  4HU9 A;  1VF1 A;  1Z7P A;  2LNS A;  2H73 A;  3M3M A;  1SU9 A;  1PX6 A;  2C0F A;  4NPB A;  1O73 A;  1SKR B;  1A23 A;  3F4T A;  5CAX A;  4AF2 A;  1FHE A;  1Z6M A;  2DJ3 A;  3HZ4 A;  2L57 A;  4AJ6 A;  4POL A;  2PVO C;  1EP7 A;  1OE8 A;  1OE7 A;  2CA8 A;  1A8Y A;  4MH2 A;  5ECO B;  3WD6 A;  2TIR A;  5B6N A;  1MDK A;  1XOB A;  4IBP A;  5F0G A;  4KB3 A;  3HCZ A;  3UJ1 A;  5CYY A;  2WFC A;  4KCA A;  1XZO A;  2JSZ A;  1MTC A;  1K0A A;  1TRV A;  2QSI A;  2GVP A;  3IDV A;  5H5R A;  2IFQ A;  2YOI A;  1O8X A;  2OE1 A;  5IMZ A;  1A2J A;  5AIV A;  2VL2 A;  1GSS A;  1TU7 A;  5DCG A;  1OC9 A;  1QXH A;  4FIW A;  4POM A;  4BVY B;  3UEM A;  2V2G A;  1QGV A;  2V32 A;  4PX1 A;  2R2J A;  4ML6 A;  4IVF A;  2HRA A;  2RUF A;  1UN2 A;  2CZ3 A;  4L0U A;  4MMM A;  3E0U A;  1V9W A;  1FG4 A;  3HYP A;  4TR3 A;  1M2B A;  3TKQ A;  2IL3 A;  1EWX A;  3KMO A;  3TJK A;  4XS4 A;  1F3B A;  2DJ2 A;  2GZP A;  2WRT A;  2GT6 A;  3NZN A;  3L78 A;  1GUK A;  3CSJ A;  3D4M A;  1PSQ A;  3MSZ A;  4NWY A;  4I2U A;  3TRQ A;  3QR6 A;  2OA7 A;  3FYG A;  3LQ7 A;  3I9V 2;  3G9B A;  2O85 A;  3GL3 A;  2WS2 A;  4ZL8 A;  1V2A A;  5DBQ A;  3IOS A;  1YY7 A;  3GST A;  2YWI A;  3F6F A;  6GSU A;  1SK1 A;  4LL4 B;  1FO5 A;  4BPY A;  1XWA A;  5GZZ B;  2H0H A;  4TR0 A;  2FWE A;  4GSS A;  1GTB A;  2FNO A;  2DJJ A;  3D6I A;  1WWJ A;  2H70 A;  1M2A A;  1MDJ A;  3G7I A;  4G19 A;  2C3Q A;  1AUC A;  3M9K A;  1LU4 A;  1J0F A;  1BG5 A;  1V98 A;  3TDG A;  4HQS A;  1LJR A;  3VUR A;  1YJ6 A;  2XHF A;  1UC7 A;  3ZVJ A;  1S3A A;  1ON4 A;  1A8L A;  4ECB A;  3ZML A;  2L5O A;  1Z9H A;  2VL3 A;  1Z5Y E;  3WGE A;  1TI1 A;  3ZYW A;  1F9M A;  5CNW A;  3GUR A;  3KCM A;  3UMA A;  3TCO A;  1XIY A;  2O89 A;  4TXO B;  5DVB A;  4K7O A;  2F3M A;  2F9S A;  3QFB C;  4QL7 A;  3I6A A;  1EV9 A;  1I9D A;  1YZX A;  2YV9 A;  3GKN A;  3HVX A;  3MWH A;  1ZZY A;  1HNA A;  2FWH A;  1XW9 A;  1KBN A;  1YKC A;  3F6D A;  3KEB A;  1U3A A;  2FCH A;  4CDO A;  5D73 A;  1G7O A;  2ZUP A;  7GSS A;  1SK2 A;  2O7K A;  4V1A g;  4DSR A;  3UAR A;  3MNG A;  1B4Q A;  1PKW A;  4EVM A;  2P5Q A;  1A0R P;  4KH7 A;  3EYT A;  3L0H A;  3TJJ A;  3DD3 A;  1F3A A;  2DJK A;  4K9Z A;  4KAE A;  5D93 A;  2YNX A;  5DAK A;  1TI3 A;  3KM6 A;  3PIN A;  2C80 A;  3KMN A;  4GRF A;  3F4R A;  1OKT A;  2GTU A;  4KSM A;  4I6X A;  3P90 A;  3NOF A;  2O87 A;  1NHY A;  2YV7 A;  4V2N A;  5CO3 A;  1ABA A;  1M9A A;  3KH7 A;  5ECP B;  2GSQ A;  2K6V A;  4L5L A;  3ZLP A;  4GSN A;  5FHI A;  2F51 A;  4PUA A;  5ID2 B;  1W89 A;  1J08 A;  3RHB A;  3FRC A;  4G0L A;  2OAD A;  5C04 A;  3HHV A;  3QAG A;  2I3Y A;  4G0K A;  4WF4 A;  4JE1 A;  2M72 A;  3FR3 A;  4EXJ A;  1YDK A;  2MMA A;  5IMV A;  2QGV A;  4JED A;  2YWN A;  5A5K A;  4NMU A;  2JAD A;  3I43 A;  1A0F A;  1TKD B;  4WBJ A;  17GS A;  3WT1 A;  4HUA A;  5ECQ B;  3RBT A;  1B48 A;  5JWO B;  2I9H A;  5KN3 A;  3J7Y b;  5ECS A;  1NM3 A;  1TK5 B;  4BVY A;  2G0F A;  1EZK A;  2H8L A;  1K3O A;  3PPU A;  1AQW A;  3BBY A;  1X0R A;  2IWT A;  5IPH A;  2TRC P;  1S3C A;  1QFN A;  1FVK A;  2LJA A;  4HQZ A;  5D9T A;  3C1S A;  4XIH A;  2IMF A;  3CRU A;  1B9X C;  4PNG A;  1OC8 A;  3ME7 A;  2RLI A;  1U87 A;  4MAB A;  4WEY A;  3EE2 A;  1JFU A;  1GSE A;  3KP8 A;  3Q18 A;  4PUF C;  2A2S A;  1YEX A;  3N5O A;  5AIS A;  3HD5 A;  1N8J A;  4ZIJ A;  3GH9 A;  1GUM A;  2REM A;  4LMV A;  1Q4J A;  3PH9 A;  3C7M A;  1NHO A;  3HVV A;  3IK7 A;  1K0D A;  1A2L A;  1IYI A;  2VM2 A;  4K1F A;  3ED3 A;  3O3T A;  1O81 A;  5CP1 A;  1URM A;  1TDI A;  4I5Q A;  4JU5 A;  1NW2 A;  1GRX A;  5EVO A;  2VO4 A;  1XCC A;  3D22 A;  4MJC A;  4N11 A;  2VCT A;  3KXO A;  2CVK A;  3IV4 A;  1HQO A;  4GF0 A;  4JR4 A;  2V6O A;  2MMZ A;  2PER A;  3QCP A;  4GST A;  4MLY A;  2R6K A;  2RII A;  2HSM B;  2R5G A;  1KEB A;  4MF6 A;  2H76 A;  5L71 A;  2MMO A;  3C8E A;  3S9F A;  1SEN A;  3C1R A;  2VCZ A;  2VD1 A;  5H5Q A;  1T1V A;  5CRG A;  5F07 A;  1SD8 A;  3QPM A;  1OVN A;  1U6T A;  1DBY A;  2KUC A;  1Z7R A;  4TW5 A;  1WMJ A;  2YPM A;  2VCQ A;  2L6C A;  3TOU A;  2TRX A;  2H1D A;  3O76 A;  2VIM A;  4GQC A;  5G5F A;  1WRY A;  2X8G A;  2CAQ A;  4KF9 A;  2XPE A;  1PRX A;  2EIQ A;  5FT3 A;  1BX9 A;  2WDU A;  1C72 A;  3QD9 A;  4OD7 A;  3TKS E;  5GST A;  5GSS A;  2JU5 A;  1G7E A;  4K8M A;  2C1Y A;  1AXD A;  4MZB A;  2B3S A;  2FA4 A;  2E2M A;  3IAS 2;  1Q98 A;  3QMX A;  5J5N A;  4HJ2 A;  4D73 A;  3CYN A;  4O32 A;  2VM1 A;  3A3T A;  5HFK A;  3VWV A;  4HS1 A;  4XS4 B;  3IBH A;  4IW9 A;  5IOW A;  1GTI A;  1OKD A;  1TU8 A;  1MD3 A;  4WR5 A;  5HR1 A;  1JLW A;  5ECM B;  1MDI A;  3VWU A;  2PMT A;  4HU7 A;  3DIE A;  4L0W A;  2UZ8 A;  4MPF A;  3ZTL A;  1T4Z A;  14GS A;  3UVT A;  2H72 A;  1GH2 A;  3RPP A;  1EGO A;  3LYK A;  1M99 A;  2CT6 A;  2H0G A;  3MAK A;  1B4P A;  4BVX B;  1YF0 A;  4GLT A;  5ELA A;  5DQS A;  2H6Y A;  3DVX A;  2L59 A;  2R4V A;  1JZR A;  5IPG A;  1ACV A;  3US3 A;  3IR4 A;  1SYX A;  4L5O A;  4ZBA A;  2M46 A;  5A4V A;  1XWB A;  3CTF A;  3RDW A;  4IP1 A;  3GX8 A;  4EF0 A;  3OR5 A;  1CQG A;  1XWC A;  2G2Q A;  5KN0 A;  2LKU A;  2CVB A;  3GYK A;  4TR1 B;  3GFK A;  1WJK A;  2IMK A;  4OFN A;  1ERT A;  3GNJ A;  2MZC A;  2JAC A;  3V1W A;  3E3E A;  2NPB A;  4Q5N A;  3ZFB A;  3BJ5 A;  4HI7 A;  1YEP A;  2LST A;  3LSZ A;  3IK9 A;  5CRH A;  5DJM A;  2EIR A;  5LNK e;  2GQM A;  4ZB6 A;  3KTB A;  4TXO A;  3F4S A;  2X99 A;  3HXS A;  4ZBB A;  2CV4 A;  2WUL A;  1YF1 A;  2EC4 A;  3GL5 A;  1WPI A;  3LWA A;  5D9W A;  3IXR A;  3VPT A;  1FB6 A;  1O85 A;  5JWQ B;  2HSH A;  2DBC A;  2YP6 A;  2IIY A;  4FO5 A;  1QMV A;  4N30 A;  4WR4 A;  5E59 A;  3VWX A;  2HYX A;  1VF3 A;  1QQ2 A;  2I1U A;  3KD0 A;  2C0D A;  3P7X A;  4YQU A;  4EC0 A;  2LS5 A;  4KDY A;  3KTL A;  1EOG A;  2E0Q A;  4JBB A;  4NAX A;  1O8W A;  5ECL B;  2E7P A;  1PGT A;  4FYB A;  4MJA A;  3LXT A;  4QL9 A;  3IC8 A;  3GIX A;  4K7N A;  5B6M A;  3BCK A;  2H1G A;  4MZW A;  4IS0 A;  3H1N A;  2B6M A;  2FGX A;  2OBK A;  4WKW A;  4KW6 A;  4OO4 A;  3EMP A;  5DJL A;  4MPG A;  1Z3E A;  1VGL A;  4G2E A;  1R5P A;  1JZD A;  2H74 A;  4IN0 A;  2K9F A;  4D73 B;  5DAL A;  1GLP A;  4EO3 A;  2CX4 A;  4OCF A;  1E6B A;  2F8A A;  1DUG A;  2HRK A;  1XXU A;  1SK0 A;  1TTZ A;  3GUS A;  5INY A;  5HFG A;  3TGZ A;  3ERF A;  3UL3 A;  3GKX A;  4LA1 A;  2L6D A;  3FW2 A;  3UBL A;  3FY7 A;  4KSO A;  6GST A;  2LTK A;  2V41 A;  4ZIL A;  3LFL A;  3JCM L;  2B7J A;  2XBI A;  2XC2 A;  16GS A;  3EU4 A;  1R26 A;  1XBS A;  2C0E A;  2WZ9 A;  1A24 A;  1EEM A;  1TRW A;  2YZU A;  4DVC A;  3GA4 A;  1ZGN A;  1OAZ A;  1K3L A;  5J4U A;  2Z9S A;  4Z7X A;  4KA0 A;  1ZYE A;  2AJQ B;  2J23 A;  1XVW A;  3F8U A;  4RQX A;  3HJO A;  4YQM A;  13GS A;  1X5C A;  2N5F A;  4Q5F A;  2HSM A;  4XRD A;  1OC9 B;  5KN1 A;  4KE3 A;  3TUE A;  1BYE A;  2DIZ A;  1Z6N A;  2PPT A;  1B8X A;  5C00 A;  1RK4 A;  1R7H A;  3A2X A;  1BJX A;  2LJK A;  2YWM A;  5IMF A;  4TN8 A;  3HVS A;  2VLV A;  3CSH A;  3ZIJ A;  2HNL A;  1V58 A;  2FUG 2;  3CMI A;  5ECN B;  2IPA A;  2AAW A;  3RHC A;  1T00 A;  1TRU A;  1DSB A;  3CXG A;  5ECI B;  2HRK B;  3FR6 A;  4DSS B;  2P0G A;  2HI7 A;  1QUW A;  3KZQ A;  1PKZ A;  3DGQ A;  5ECH B;  4I2T A;  8GSS A;  1T4Y A;  1K3Y A;  4PUR A;  2LRC A;  3ME8 A;  4H86 A;  2VD0 A;  1YQ1 A;  3ZIV A;  4GTU A;  2L4C A;  3GV1 A;  6GSW A;  3N9J A;  4YAV A;  5ABR A;  4IEL A;  4E8H A;  4DEJ A;  2PGT A;  4IJ3 A;  4JRR A;  3L9U A;  2DSA A;  4ACS A;  3O6T A;  2V6K A;  1K0M A;  3I69 A;  2DLX A;  2ES7 A;  4OFM A;  1GNW A;  2FLS A;  3A5W A;  2AUV A;  2EIO A;  4GWR A;  5IIZ A;  3GHA A;  2VAF A;  2DC5 A;  5ECK B;  4ECJ A;  1T8E B;  5BMU A;  2HRF A;  3F0I A;  2CZ2 A;  1USB A;  5JWR B;  2H19 A;  1SJI A;  1J9B A;  4IKH A;  4ID0 A;  1ST9 A;  3U5R E;  3FEU A;  2X8H A;  2C4J A;  1ERW A;  3IRA A;  4PQH A;  1A2M A;  5IQY A;  3FZ5 A;  2GS3 A;  1RQM A;  1XOA A;  1ZCP A;  1F37 A;  3D0Z A;  4TOP A;  1LBK A;  3VI7 A;  2E2G A;  1RW1 A;  1WP0 A;  3QOU A;  2KHP A;  4IQA A;  3WYW A;  2JZT A;  2FHE A;  3QAW A;  4Q5R A;  4MH3 A;  4TR1 A;  2DML A;  4EDY A;  2GZY A;  5HR2 A;  5G1K A;  1GNE A;  2BMX A;  2HXK A;  1WE0 A;  3M8N A;  3TKS C;  1PQN A;  2FA8 A;  3M1G A;  1AQX A;  4FQU A;  2YJH A;  2ALB A;  4EE0 A;  2DMM A;  3LGC A;  2NDO A;  4HJM A;  5JCW A;  1GUH A;  3APO A;  1G6W A;  2C8U A;  3TJG A;  1F6M C;  2IFQ B;  4XHM A;  3LYP A;  4K0N A;  4F0B A;  1M7T A;  5LCZ A;  9GSS A;  3DWV A;  5B8A A;  3APQ A;  1B9Y C;  4F2I A;  5COH A;  2H71 A;  1GSD A;  4CW9 A;  1THX A;  4KND A;  3GKM A;  3H93 A;  3R3E A;  4ECC A;  3J7Y k;  5JCU A;  3TOT A;  5EL8 A;  2F8F A;  2XPD A;  1Y6E A;  5J3R A;  4JR6 A;  3R2Q A;  3DML A;  1ILO A;  4O7H A;  2MYG A;  3VFI A;  2PUK C;  3KJY A;  1SKW B;  1R4W A;  2BJX A;  3CTG A;  3GKK A;  4MJB A;  1GSU A;  2LEG A;  2YJ7 A;  3F3R A;  2R37 A;  2LNT A;  3DRN A;  3ZRE A;  1PA3 A;  5AGY A;  5J41 A;  3ERG A;  1TK8 B;  3ISO A;  3KP9 A;  4OWY A;  1TOF A;  4MJE A;  4OMV A;  1G6Y A;  1SL1 B;  3VWW A;  12GS A;  3GTU B;  2LRT A;  5LD0 A;  3IA1 A;  1DE1 A;  3D4T A;  1ML6 A;  3HDC A;  3EC3 A;  2B7K A;  2X8C A;  1GUL A;  19GS A;  2AV4 A;  2MBT A;  3L4N A;  2K8S A;  3IE3 A;  1V57 A;  2OAC A;  5DQY A;  3LG6 A;  3Q19 A;  4BWQ A;  4NHW A;  4LLR A;  4PXO A;  3KH9 A;  5AIX A;  2O8V B;  4P3Y B;  2N5B A;  3LXZ A;  3P8W A;  4AJ7 A;  3ZFL A;  4ML1 A;  4RUV A;  2LJR A;  2MMN A;  2BTO T;  4QQ7 A;  2HZE B;  4X43 A;  3HKR A;  3EU3 A;  2RM5 A;  3VLN A;  2OBI A;  3A2W A;  1EV4 A;  5G2Z A;  2CX3 A;  2GZZ A;  4CHS A;  1ZOF A;  6GSV A;  3TJF A;  3F3Q A;  3TKR A;  4KDX A;  1XW5 A;  4N0V A;  1WOU A;  5GAP D;  1THO A;  4PQI A;  4RI6 A;  1X5E A;  4V1A p;  5DAK B;  4BVX A;  2H0I A;  3FKF A;  1K0B A;  3K8N A;  4OCE A;  1T7P B;  1V40 A;  4XS6 A;  1XWK A;  2H6X A;  2JZR A;  1TJD A;  3GSS A;  4MK3 A;  2OKA A;  4Q5Q A;  2HLS A;  5G5E A;  2NTO A;  1PL1 A;  5J9B A;  4WXT A;  1FVJ A;  5DDL A;  2AHE A;  3D5J A;  3TRX A;  2DJ1 A;  3A2V A;  5CRE A;  2KOK A;  4PNF A;  4IQ1 A;  1R5A A;  3NIV A;  2IN3 A;  4XS1 A;  2HSN B;  5E4W A;  2GDR A;  1TP9 A;  4DSS A;  1HD2 A;  2H1B A;  3HZ8 A;  3APS A;  1M0U A;  4I8B A;  4LL1 B;  1K0C A;  3GMF A;  4MA9 A;  3H8Q A;  2A4V A;  4ZL9 A;  3GH6 A;  2IME A;  4YH2 A;  4G0I A;  4K6X A;  3DEX A;  2PU9 C;  5ELG A;  1SJ6 A;  2CVD A;  4ISD A;  4GXZ A;  1ZMA A;  2C3T A;  4F9Z A;  4XCS A;  5IO2 A;  2HE3 A;  1SJZ A;  3L9V A;  2GSS A;  3RAZ A;  2HFD A;  3UBK A;  4I97 A;  5F8B A;  5G1L A;  1AAZ A;  1PD2 1;  5JCG A;  2L4Q A;  2L5L A;  1AC1 A;  10GS A;  2JL4 A;  2JSY A;  2D2Z A;  2VCW A;  6GSY A;  2GSR A;  1YKA A;  2YN1 A;  3SBC A;  4TVE A;  3PR8 A;  3C71 A;  2GLR A;  2GGT A;  4NV2 A;  5CRW A;  1SYR A;  2LUS A;  1VF2 A;  2K18 A;  3QDN A;  3AY8 A;  2ZNM A;  3DYR A;  1GLQ A;  3EWL A;  2PBJ A;  1O7U A;  1UVZ A;  3SWL A;  5D9V A;  3GX0 A;  4IHU A;  3F63 A;  3WGX A;  4TR4 A;  1EGR A;  2GT5 A;  2AB6 A;  1G0T A;  2NBS A;  2WCI A;  3ZMK A;  5A4W A;  1PX7 A;  4J2F A;  3RPN A;  3ZL5 A;  2VCX A;  4G10 A;  3CRT A;  3WGD A;  2VL9 A;  1K0O A;  4HEA 2;  2ON7 A;  3QFA C;  2H01 A;  1OYJ A;  1TXX A;  3HJP A;  5F06 A;  1FAA A;  5HR3 A;  4BL7 A;  2H66 A;  2M80 A;  3UOM A;  2PN8 A;  2GQL A;  5KEJ A;  4MCU A;  4V2M A;  1AQV A;  4MZC A;  1W4V A;  2H30 A;  4KUN A;  2HT9 A;  4KCE A;  2VOC A;  1ERV A;  4O92 A;  2WGR A;  3TKS A;  3C73 A;  2HZE A;  2YZH A;  2IJY A;  1GL8 A;  1X9S B;  5AN1 A;  4RQR A;  3ZZX A;  3P2A A;  2GST A;  1XPV A;  3KGK A;  2LRN A;  3EMX A;  5G31 A;  3Q6O A;  3G7Y A;  3DVW A;  1GTA A;  2IMI A;  2PVQ A;  3EUR A;  3W8S A;  1VF4 A;  2B5Y A;  2WJU A;  4WBR D;  1IYH A;  1TRS A;  4X1U A;  4XRA A;  3GTU A;  3H79 A;  4EKZ A;  3CBU A;  20GS A;  1KNG A;  3GN3 A;  1PMT A;  4EUY A;  3H4K A;  3TB2 A;  1S3D A;  3HA9 A;  1U3I A;  2AYT A;  4AGS A;  2P5R A;  5D96 A; 
#chains in the Genus database with same CATH topology
 2B1K A;  4AI6 A;  1K0N A;  4MF5 A;  5EPF A;  1X9M B;  3ZVJ D;  3IAM 2;  1F2E A;  1N2A A;  1T3B A;  1GSY A;  2DIY A;  1HYU A;  5ID2 A;  4F03 A;  1I5G A;  3DXB A;  4NV5 A;  5HFI A;  4YQV A;  3MDK A;  2ZCT A;  18GS A;  2EFC A;  2N5A A;  2J9H A;  2XBQ A;  2C3N A;  3ZRD A;  4V2L A;  4LMW A;  4KGI A;  5EY6 A;  1X9W B;  1EP8 A;  4EL1 A;  4IGJ A;  3ZIT A;  5IMC A;  1U88 A;  3FZ4 A;  5IMD A;  2LQO A;  2I81 A;  4X0X A;  4HZ4 A;  4RI7 A;  3LOR A;  2RUE A;  1AIU A;  4BWS A;  1EOH A;  4OFT A;  1XW6 A;  3IC4 A;  2I4A A;  2B1L A;  2MBS A;  4FH8 A;  4WET A;  4GQF A;  1M9B A;  2GQK A;  2KLX A;  3FZA A;  3BCI A;  1DE2 A;  4HDE A;  1CQH A;  1OC3 A;  4BA7 A;  1SKS B;  4N0Z A;  1O6J A;  2IMD A;  4IP6 A;  3W6G A;  1PL2 A;  1H75 A;  4K2D A;  3D21 A;  2KP1 A;  5A1N B;  2OE3 A;  2P31 A;  2PWJ A;  2LQQ A;  5A34 B;  2HQT A;  4POK A;  1PN9 A;  4F0C A;  3LEF A;  3W8J A;  5A4U A;  2CQ9 A;  1VRS D;  4N10 A;  1GSF A;  2ON5 A;  4MF7 A;  1JZW A;  4POB A;  1TW9 A;  4FYU A;  1TK0 B;  4DSQ A;  2QKE A;  4J57 E;  5ECR B;  2WB9 A;  5F05 A;  4GDF A;  3VK9 A;  2V1M A;  2B5X A;  3PGT A;  2VCV A;  2VLT A;  1NSW A;  1PN0 A;  2LV3 A;  4F82 A;  1M2D A;  2B5E A;  5DCH A;  22GS A;  2R0G A;  4TKY A;  4PGT A;  2A4H A;  2YAN A;  1SVO A;  1MEK A;  1SD9 A;  4G9H A;  2FD3 A;  5G30 A;  3BD2 A;  1BQ7 A;  6GSX A;  1XFL A;  4ZB9 A;  1SVM A;  1SL2 B;  4ECI A;  1JHB A;  1BAY A;  2CAI A;  4ULX A;  4IJI A;  2QC7 A;  3IPZ A;  2VLU A;  3FHK A;  4ZL7 A;  4HZ2 A;  4NHZ A;  1KTE A;  4ZBD A;  4WF5 A;  3TRP A;  4EDZ A;  4E8E A;  4USS A;  2UV8 G;  2OJL A;  2RM6 A;  5D9X A;  1BED A;  4AJ8 A;  2HRN A;  1FOV A;  3GRX A;  2HSY A;  4OO5 A;  4ZXG A;  4ZB8 A;  2HZF A;  5B8B A;  5HQP A;  4AKH A;  3KIJ A;  2OE0 A;  4ILF A;  3UAP A;  1JLV A;  2X64 A;  3F9U A;  2JZS A;  2FWF A;  4A5P A;  2H75 A;  4PQ1 A;  2YWO A;  5H5S A;  4BL7 B;  1QK8 A;  3WT2 A;  1Y25 A;  4MP4 A;  1HNC A;  1YEW C;  3U6V A;  4NXI A;  3TU3 B;  2O3E A;  3TJB A;  2C0G A;  5ENU A;  5FWG A;  5IMA A;  1EEJ A;  3BOA A;  1JZO A;  5KN2 A;  1GP1 A;  4TXV A;  2K8V A;  1H4O A;  3Q74 A;  3G7J A;  1XWG A;  4O5R A;  4XTS A;  3FR9 A;  4MDC A;  1UA5 A;  4TRX A;  5J9C A;  3TKP A;  4K0G A;  2YCD A;  2NVL A;  4PTS A;  2EFE A;  4FYC A;  5DAL B;  1FW1 A;  5B7C A;  1X5D A;  3LJR A;  1SL0 B;  3LW9 A;  3ERW A;  3UVH A;  4KDU A;  1ZYQ B;  5HR0 A;  3L9S A;  2A2R A;  2KP2 A;  4PI0 C;  6GSS A;  1GSQ A;  4PHZ C;  2VL2 C;  2VUP A;  2DJ0 A;  4YAP A;  1WIK A;  5IM9 A;  3IHQ A;  3EVI A;  4K5R A;  3FZ9 A;  4K7I A;  3UIW A;  1XVQ A;  5IOX A;  1FB0 A;  3CSI A;  4L8E A;  3EIN A;  3VPQ A;  3HY2 A;  1MD4 A;  11GS A;  4GCI A;  4HOJ A;  4JZQ A;  3DKS A;  1GTU A;  2R3X A;  4YKF A;  5D8I A;  3M9J A;  5CRD A;  3FK8 A;  1ZL9 A;  4O5U A;  3E9J B;  5GAN D;  4KX4 A;  1GWC A;  3HJM A;  2FWG A;  2FY6 A;  5IO0 A;  2H6Z A;  1HNB A;  3M0F A;  3QAV A;  3VI5 A;  4J56 E;  1ERU A;  2H1A A;  1E2Y A;  4HU9 A;  1VF1 A;  1Z7P A;  2LNS A;  2H73 A;  3M3M A;  1SU9 A;  1PX6 A;  2C0F A;  4NPB A;  1O73 A;  1SKR B;  1A23 A;  3F4T A;  5CAX A;  4AF2 A;  5A34 A;  1FHE A;  1Z6M A;  2DJ3 A;  3HZ4 A;  2L57 A;  4AJ6 A;  4POL A;  2PVO C;  1EP7 A;  1OE8 A;  1OE7 A;  2CA8 A;  1A8Y A;  4MH2 A;  5ECO B;  3WD6 A;  2TIR A;  5B6N A;  1MDK A;  1XOB A;  2X4A A;  4IBP A;  5F0G A;  4KB3 A;  3HCZ A;  3UJ1 A;  2O5V A;  5CYY A;  2WFC A;  4KCA A;  1XZO A;  2JSZ A;  1MTC A;  1K0A A;  1TRV A;  2QSI A;  2GVP A;  3IDV A;  5H5R A;  1M3I A;  2IFQ A;  2YOI A;  1O8X A;  2OE1 A;  5IMZ A;  1A2J A;  5AIV A;  2VL2 A;  1GSS A;  1TU7 A;  5DCG A;  1OC9 A;  1QXH A;  4FIW A;  4POM A;  4BVY B;  3UEM A;  2V2G A;  1S4B P;  1QGV A;  2V32 A;  4PX1 A;  2R2J A;  4ML6 A;  4IVF A;  2R0C A;  2HRA A;  2RUF A;  1UN2 A;  2CZ3 A;  4L0U A;  4MMM A;  3E0U A;  1V9W A;  1FG4 A;  3HYP A;  4TR3 A;  1M2B A;  3TKQ A;  2IL3 A;  1EWX A;  4AKG A;  3KMO A;  3TJK A;  4XS4 A;  1F3B A;  2DJ2 A;  2X49 A;  2GZP A;  2WRT A;  2GT6 A;  3NZN A;  3L78 A;  2VKZ G;  1GUK A;  3CSJ A;  3D4M A;  1PSQ A;  3MSZ A;  3A5I A;  4I2U A;  4NWY A;  3TRQ A;  3QR6 A;  2OA7 A;  3FYG A;  3LQ7 A;  3I9V 2;  3G9B A;  2O85 A;  3GL3 A;  2WS2 A;  4ZL8 A;  1V2A A;  5DBQ A;  3IOS A;  1YY7 A;  3GST A;  2YWI A;  3F6F A;  6GSU A;  1SK1 A;  4LL4 B;  1FO5 A;  4BPY A;  1XWA A;  5GZZ B;  2H0H A;  4TR0 A;  2FWE A;  4GSS A;  1GTB A;  2FNO A;  2DJJ A;  3D6I A;  1WWJ A;  2H70 A;  1M2A A;  1MDJ A;  3G7I A;  4G19 A;  2C3Q A;  1AUC A;  3M9K A;  1LU4 A;  1J0F A;  1BG5 A;  1V98 A;  3TDG A;  4HQS A;  5J4V A;  1LJR A;  3VUR A;  1YJ6 A;  2XHF A;  1UC7 A;  3ZVJ A;  1S3A A;  1ON4 A;  1A8L A;  4G01 A;  4ECB A;  3ZML A;  2L5O A;  1Z9H A;  2VL3 A;  1Z5Y E;  3WGE A;  1TI1 A;  3ZYW A;  1F9M A;  5CNW A;  3GUR A;  3KCM A;  4CY6 A;  3UMA A;  4PI2 C;  3TCO A;  1XIY A;  2O89 A;  4TXO B;  4Z2R A;  5A1N A;  5DVB A;  4K7O A;  2F3M A;  2F9S A;  3QFB C;  4QL7 A;  3I6A A;  1EV9 A;  1PFO A;  1I9D A;  1YZX A;  2YV9 A;  3GKN A;  3HVX A;  3MWH A;  1ZZY A;  1HNA A;  2FWH A;  1XW9 A;  1KBN A;  1YKC A;  3F6D A;  3KEB A;  1U3A A;  2FCH A;  4CDO A;  5D73 A;  1G7O A;  2ZUP A;  7GSS A;  1SK2 A;  2O7K A;  4V1A g;  4DSR A;  3UAR A;  3MNG A;  1B4Q A;  1PKW A;  4EVM A;  2P5Q A;  1A0R P;  4KH7 A;  3EYT A;  3L0H A;  3TJJ A;  3DD3 A;  1F3A A;  2DJK A;  4K9Z A;  4KAE A;  5D93 A;  2YNX A;  5DAK A;  1TI3 A;  3KM6 A;  3PIN A;  2C80 A;  4Z2T A;  3KMN A;  4GRF A;  3F4R A;  1OKT A;  2GTU A;  4KSM A;  4I6X A;  3P90 A;  3NOF A;  2O87 A;  1NHY A;  2YV7 A;  4E68 A;  1ZYP A;  4V2N A;  5CO3 A;  1ABA A;  1M9A A;  3KH7 A;  1Y1U A;  2GSQ A;  5ECP B;  4L5L A;  2K6V A;  3ZLP A;  4GSN A;  5FHI A;  2F51 A;  4PUA A;  5ID2 B;  1W89 A;  1J08 A;  3RHB A;  3FRC A;  4G0L A;  2OAD A;  5C04 A;  3HHV A;  3QAG A;  2I3Y A;  4G0K A;  4JE1 A;  2M72 A;  4WF4 A;  3FR3 A;  4EXJ A;  1YDK A;  2MMA A;  5IMV A;  2QGV A;  4JED A;  2YWN A;  5A5K A;  4NMU A;  2JAD A;  3I43 A;  1A0F A;  1TKD B;  4WBJ A;  17GS A;  2WVX A;  3WT1 A;  4HUA A;  5ECQ B;  3RBT A;  1B48 A;  5JWO B;  2I9H A;  5KN3 A;  3J7Y b;  5ECS A;  1NM3 A;  1TK5 B;  4BVY A;  2G0F A;  1EZK A;  2H8L A;  1K3O A;  3PPU A;  2WVX B;  1AQW A;  3BBY A;  1X0R A;  2IWT A;  5IPH A;  2TRC P;  1S3C A;  1QFN A;  1FVK A;  2LJA A;  4HQZ A;  5D9T A;  3C1S A;  2IMF A;  4XIH A;  3CRU A;  1B9X C;  4PNG A;  1OC8 A;  3ME7 A;  2RLI A;  1U87 A;  4MAB A;  4WEY A;  3EE2 A;  1JFU A;  1GSE A;  3KP8 A;  3Q18 A;  3EPT A;  3RGB C;  4PUF C;  2A2S A;  4MNN A;  1YEX A;  3N5O A;  5AIS A;  3HD5 A;  1N8J A;  4ZIJ A;  3GH9 A;  1GUM A;  2REM A;  4LMV A;  1Q4J A;  3PH9 A;  3C7M A;  1NHO A;  3HVV A;  3IK7 A;  1K0D A;  1A2L A;  1IYI A;  2VM2 A;  4K1F A;  3ED3 A;  3O3T A;  1O81 A;  5CP1 A;  1URM A;  1TDI A;  4I5Q A;  4JU5 A;  1NW2 A;  1GRX A;  5EVO A;  2VO4 A;  1XCC A;  3D22 A;  4MJC A;  4N11 A;  2VCT A;  3KXO A;  2CVK A;  3IV4 A;  1HQO A;  4GF0 A;  4JR4 A;  2V6O A;  2MMZ A;  2PER A;  3QCP A;  4GST A;  4MLY A;  2R6K A;  2RII A;  2HSM B;  2R5G A;  1KEB A;  3MIX A;  4MF6 A;  2H76 A;  5L71 A;  2MMO A;  3C8E A;  3S9F A;  1SEN A;  3C1R A;  1S3R A;  2VCZ A;  2VD1 A;  5H5Q A;  1T1V A;  5CRG A;  5F07 A;  1SD8 A;  3QPM A;  2O36 A;  1OVN A;  1U6T A;  1DBY A;  2KUC A;  1Z7R A;  4TW5 A;  1WMJ A;  2YPM A;  2VCQ A;  2L6C A;  3TOU A;  2TRX A;  2H1D A;  3O76 A;  2VIM A;  4GQC A;  5G5F A;  1WRY A;  2X8G A;  2CAQ A;  4KF9 A;  2XPE A;  1PRX A;  2EIQ A;  5FT3 A;  1BX9 A;  2WDU A;  1C72 A;  3QD9 A;  4OD7 A;  5BMU B;  4X4J A;  3TKS E;  5GST A;  5GSS A;  2JU5 A;  1G7E A;  4K8M A;  2C1Y A;  1AXD A;  4MZB A;  2B3S A;  2FA4 A;  2E2M A;  3IAS 2;  1Q98 A;  3QMX A;  5J5N A;  4HJ2 A;  4D73 A;  3CYN A;  4O32 A;  2VM1 A;  3A3T A;  5HFK A;  3VWV A;  4HS1 A;  4XS4 B;  3IBH A;  4IW9 A;  5IOW A;  1GTI A;  1OKD A;  2EFD A;  1TU8 A;  1MD3 A;  4WR5 A;  5HR1 A;  1JLW A;  5ECM B;  1MDI A;  3VWU A;  2PMT A;  4HU7 A;  3DIE A;  4L0W A;  2UZ8 A;  4MPF A;  3ZTL A;  1T4Z A;  14GS A;  3UVT A;  2H72 A;  1GH2 A;  3RPP A;  1EGO A;  3LYK A;  1M99 A;  2CT6 A;  2H0G A;  3MAK A;  1B4P A;  4BVX B;  1YF0 A;  4GLT A;  5ELA A;  1XG8 A;  5DQS A;  2H6Y A;  3DVX A;  2QA2 A;  2L59 A;  2R4V A;  1JZR A;  5IPG A;  1ACV A;  3US3 A;  3IR4 A;  1SYX A;  4L5O A;  4ZBA A;  2M46 A;  5A4V A;  1XWB A;  3CTF A;  3RDW A;  4IP1 A;  3GX8 A;  4EF0 A;  3OR5 A;  5A5H A;  1CQG A;  1XWC A;  2G2Q A;  1TXU A;  5KN0 A;  2LKU A;  2CVB A;  3GYK A;  4TR1 B;  3GFK A;  1WJK A;  2IMK A;  4OFN A;  1ERT A;  3GNJ A;  2MZC A;  2JAC A;  3V1W A;  3E3E A;  2NPB A;  4Q5N A;  3ZFB A;  3BJ5 A;  4HI7 A;  1YEP A;  2LST A;  3LSZ A;  3IK9 A;  5CRH A;  2EFH A;  5DJM A;  2EIR A;  3MYD A;  5LNK e;  2GQM A;  4ZB6 A;  3KTB A;  4TXO A;  3F4S A;  2X99 A;  3HXS A;  4ZBB A;  5KOW A;  2CV4 A;  2WUL A;  1I1I P;  1YF1 A;  2EC4 A;  3GL5 A;  1WPI A;  3LWA A;  5D9W A;  3IXR A;  3VPT A;  1FB6 A;  1O85 A;  5JWQ B;  2HSH A;  2DBC A;  2YP6 A;  2IIY A;  4FO5 A;  1QMV A;  4N30 A;  2WW0 A;  4WR4 A;  5E59 A;  3VWX A;  2HYX A;  1VF3 A;  4FXY P;  1QQ2 A;  2I1U A;  3KD0 A;  2C0D A;  3P7X A;  4YQU A;  4EC0 A;  2LS5 A;  4KDY A;  3KTL A;  1EOG A;  2E0Q A;  4JBB A;  4NAX A;  1O8W A;  5ECL B;  2E7P A;  1PGT A;  4FYB A;  4MJA A;  3LXT A;  2WW1 A;  2R0P A;  4QL9 A;  3IC8 A;  1SVL A;  3GIX A;  4K7N A;  5B6M A;  3BCK A;  2H1G A;  4MZW A;  4IS0 A;  3H1N A;  2B6M A;  2FGX A;  2OBK A;  4WKW A;  4KW6 A;  4OO4 A;  3EMP A;  5DJL A;  4MPG A;  1Z3E A;  1VGL A;  4K5S A;  4G2E A;  1R5P A;  1JZD A;  2H74 A;  4IN0 A;  2K9F A;  4D73 B;  5DAL A;  1GLP A;  3CWG A;  4EO3 A;  2CX4 A;  1E6B A;  4OCF A;  2F8A A;  1DUG A;  2HRK A;  1XXU A;  1SK0 A;  1TTZ A;  3GUS A;  3HMJ G;  5HFG A;  5INY A;  3TGZ A;  3ERF A;  3UL3 A;  3GKX A;  4LA1 A;  2L6D A;  3FW2 A;  3UBL A;  3FY7 A;  4KSO A;  6GST A;  2LTK A;  2V41 A;  4ZIL A;  3LFL A;  3JCM L;  2B7J A;  2XBI A;  2XC2 A;  16GS A;  3EU4 A;  1R26 A;  1XBS A;  2C0E A;  2WZ9 A;  1A24 A;  1EEM A;  1TRW A;  2YZU A;  4DVC A;  3GA4 A;  1ZGN A;  1OAZ A;  1K3L A;  5J4U A;  2Z9S A;  4Z7X A;  4KA0 A;  1ZYE A;  2AJQ B;  2J23 A;  1XVW A;  3F8U A;  4RQX A;  3HJO A;  4YQM A;  13GS A;  1X5C A;  2N5F A;  4Q5F A;  2HSM A;  4XRD A;  1OC9 B;  5KN1 A;  4KE3 A;  5J40 A;  3TUE A;  1BYE A;  2DIZ A;  1Z6N A;  2PPT A;  1B8X A;  5C00 A;  1RK4 A;  1R7H A;  3A2X A;  1BJX A;  2LJK A;  2YWM A;  5IMF A;  4O5Q A;  4TN8 A;  1ZYN A;  3HVS A;  2VLV A;  3CSH A;  2OT3 A;  3ZIJ A;  2HNL A;  1V58 A;  2FUG 2;  3CMI A;  5ECN B;  2IPA A;  2AAW A;  3RHC A;  1T00 A;  1TRU A;  4CY8 A;  1DSB A;  2A2P A;  3CXG A;  5ECI B;  2HRK B;  4HSC X;  3FR6 A;  4DSS B;  2P0G A;  2HI7 A;  1QUW A;  3KZQ A;  2WW3 A;  1PKZ A;  3DGQ A;  5ECH B;  4I2T A;  8GSS A;  1T4Y A;  4BIK A;  1K3Y A;  4PUR A;  2LRC A;  4H86 A;  3ME8 A;  2VD0 A;  4K2X A;  1YQ1 A;  1BF5 A;  3ZIV A;  4GTU A;  2WVZ A;  2L4C A;  3GV1 A;  6GSW A;  3N9J A;  4YAV A;  5ABR A;  4QMK A;  4IEL A;  4E8H A;  4DEJ A;  2PGT A;  4IJ3 A;  4JRR A;  3L9U A;  2DSA A;  1M3J A;  4ACS A;  3O6T A;  2V6K A;  1K0M A;  3I69 A;  2DLX A;  2DKI A;  2ES7 A;  4OFM A;  1GNW A;  2FLS A;  3A5W A;  2AUV A;  2EIO A;  4GWR A;  5IIZ A;  3GHA A;  2VAF A;  2DC5 A;  5ECK B;  4ECJ A;  1T8E B;  5BMU A;  2HRF A;  3F0I A;  2CZ2 A;  1USB A;  5JWR B;  2H19 A;  1SJI A;  1J9B A;  4IKH A;  4ID0 A;  1ST9 A;  3U5R E;  3FEU A;  2X8H A;  2C4J A;  1ERW A;  3RFR C;  3IRA A;  4PQH A;  1A2M A;  5IQY A;  3FZ5 A;  2WW2 A;  2GS3 A;  1RQM A;  1XOA A;  2WZS A;  1ZCP A;  1F37 A;  3D0Z A;  2WVY A;  4TOP A;  1LBK A;  3VI7 A;  2E2G A;  1RW1 A;  1WP0 A;  3QOU A;  2KHP A;  4IQA A;  3WYW A;  2JZT A;  2FHE A;  3QAW A;  4Q5R A;  4MH3 A;  4TR1 A;  2DML A;  4EDY A;  2GZY A;  5HR2 A;  5G1K A;  1GNE A;  2BMX A;  5KOX A;  2HXK A;  1WE0 A;  3M8N A;  3TKS C;  1PQN A;  2FA8 A;  3M1G A;  1AQX A;  4FQU A;  1FOH A;  2YJH A;  2ALB A;  4EE0 A;  2DMM A;  3LGC A;  2NDO A;  4HJM A;  5JCW A;  1N25 A;  1GUH A;  3APO A;  1G6W A;  2C8U A;  3TJG A;  1F6M C;  2IFQ B;  4XHM A;  3LYP A;  5J47 A;  4K0N A;  4F0B A;  1M7T A;  5LCZ A;  9GSS A;  3DWV A;  5B8A A;  3APQ A;  1B9Y C;  4F2I A;  5COH A;  2H71 A;  1GSD A;  4CW9 A;  1THX A;  4KND A;  3GKM A;  3H93 A;  3R3E A;  4ECC A;  1YVL A;  4W66 A;  3J7Y k;  5JCU A;  3TOT A;  5EL8 A;  2F8F A;  2XPD A;  1Y6E A;  5J3R A;  4JR6 A;  3R2Q A;  3DML A;  1ILO A;  4O7H A;  2MYG A;  3VFI A;  2PUK C;  3KJY A;  1SKW B;  1R4W A;  2BJX A;  3CTG A;  3GKK A;  4MJB A;  1GSU A;  2LEG A;  2YJ7 A;  3F3R A;  2R37 A;  2LNT A;  3DRN A;  3ZRE A;  1PA3 A;  5AGY A;  5J41 A;  3ERG A;  1TK8 B;  3ISO A;  3KP9 A;  2QA1 A;  4OWY A;  1TOF A;  4MJE A;  5BRT A;  4OMV A;  1G6Y A;  1SL1 B;  3IHG A;  3VWW A;  12GS A;  3GTU B;  2LRT A;  5LD0 A;  5J4Y A;  3IA1 A;  1DE1 A;  3D4T A;  1ML6 A;  3HDC A;  3EC3 A;  2B7K A;  2X8C A;  1GUL A;  19GS A;  2AV4 A;  2MBT A;  3L4N A;  2K8S A;  3IE3 A;  1V57 A;  2OAC A;  5DQY A;  3LG6 A;  3Q19 A;  4BWQ A;  4NHW A;  4LLR A;  4PXO A;  3KH9 A;  5AIX A;  2O8V B;  4P3Y B;  2N5B A;  3LXZ A;  3P8W A;  4AJ7 A;  3ZFL A;  4ML1 A;  4RUV A;  2LJR A;  2MMN A;  2BTO T;  4QQ7 A;  2HZE B;  3CQF A;  4X43 A;  3HKR A;  3EU3 A;  2RM5 A;  3VLN A;  2OBI A;  3A2W A;  1EV4 A;  5G2Z A;  2CX3 A;  2GZZ A;  4EIQ A;  4CHS A;  1ZOF A;  6GSV A;  3TJF A;  3F3Q A;  3TKR A;  5A5H B;  4KDX A;  1XW5 A;  4N0V A;  1WOU A;  5GAP D;  1THO A;  4PQI A;  5D96 A;  4RI6 A;  1X5E A;  4V1A p;  5DAK B;  4BVX A;  2H0I A;  3FKF A;  1K0B A;  3K8N A;  4OCE A;  1T7P B;  1V40 A;  4XS6 A;  1XWK A;  2H6X A;  2JZR A;  1TJD A;  3GSS A;  4MK3 A;  2OKA A;  4Q5Q A;  2HLS A;  2HSN A;  3CHX C;  5G5E A;  2NTO A;  1PL1 A;  5J9B A;  4WXT A;  1FVJ A;  5DDL A;  2AHE A;  3D5J A;  3TRX A;  2DJ1 A;  3A2V A;  2KOK A;  5CRE A;  4PNF A;  4IQ1 A;  1R5A A;  3NIV A;  2IN3 A;  4XS1 A;  4ICY A;  2HSN B;  5E4W A;  2GDR A;  1TP9 A;  4DSS A;  1HD2 A;  2H1B A;  3HZ8 A;  3APS A;  1M0U A;  4AKI A;  4I8B A;  4LL1 B;  1K0C A;  3GMF A;  4MA9 A;  3H8Q A;  2A4V A;  4ZL9 A;  3GH6 A;  2IME A;  4YH2 A;  4G0I A;  4K6X A;  3DEX A;  2PU9 C;  5ELG A;  1SJ6 A;  2CVD A;  4ISD A;  4GXZ A;  1ZMA A;  2DKH A;  2C3T A;  4F9Z A;  4XCS A;  5IO2 A;  2HE3 A;  1SJZ A;  3L9V A;  4YKG A;  2GSS A;  3RAZ A;  2HFD A;  3UBK A;  4I97 A;  5F8B A;  4Z2U A;  5G1L A;  1AAZ A;  1PD2 1;  5JCG A;  2L4Q A;  2L5L A;  1AC1 A;  10GS A;  2JL4 A;  2JSY A;  2D2Z A;  2VCW A;  6GSY A;  2GSR A;  1YKA A;  2YN1 A;  3SBC A;  4TVE A;  3PR8 A;  3C71 A;  2GLR A;  2GGT A;  4NV2 A;  5CRW A;  1SYR A;  2LUS A;  1VF2 A;  2K18 A;  3QDN A;  3AY8 A;  2ZNM A;  3DYR A;  1GLQ A;  3EWL A;  2PBJ A;  4ZB7 A;  1O7U A;  1UVZ A;  3SWL A;  5D9V A;  3GX0 A;  4IHU A;  3F63 A;  3WGX A;  4TR4 A;  1EGR A;  2GT5 A;  2AB6 A;  1G0T A;  2NBS A;  2WCI A;  3ZMK A;  5A4W A;  1PX7 A;  4J2F A;  3RPN A;  3ZL5 A;  2VCX A;  3HVN A;  4G10 A;  3CRT A;  3WGD A;  2VL9 A;  1K0O A;  4HEA 2;  2ON7 A;  3QFA C;  2H01 A;  1OYJ A;  1TXX A;  3HJP A;  5F06 A;  1FAA A;  5HR3 A;  4BL7 A;  1BG1 A;  2H66 A;  2M80 A;  3UOM A;  2PN8 A;  2GQL A;  5KEJ A;  4MCU A;  4V2M A;  1AQV A;  4MZC A;  1W4V A;  2H30 A;  4KUN A;  4EIP A;  2HT9 A;  4KCE A;  2VOC A;  1ERV A;  4O92 A;  2WGR A;  3TKS A;  3C73 A;  2HZE A;  2YZH A;  2IJY A;  1GL8 A;  1X9S B;  5AN1 A;  4RQR A;  3ZZX A;  3P2A A;  2GST A;  1XPV A;  3KGK A;  2LRN A;  4AKX B;  4N3Z A;  3EMX A;  5G31 A;  3Q6O A;  3G7Y A;  3DVW A;  1GTA A;  3FMW A;  2IMI A;  2PVQ A;  3EUR A;  3W8S A;  1VF4 A;  2B5Y A;  2H1L A;  2WJU A;  4WBR D;  1IYH A;  1TRS A;  4X1U A;  4XRA A;  3GTU A;  3H79 A;  4EKZ A;  3CBU A;  20GS A;  1KNG A;  3GN3 A;  1PMT A;  4EUY A;  3H4K A;  3TB2 A;  1S3D A;  3HA9 A;  1U3I A;  2AYT A;  4AGS A;  2P5R A;  1AW9 A; 
#chains in the Genus database with same CATH homology
 2B1K A;  4AI6 A;  1K0N A;  4MF5 A;  5EPF A;  1X9M B;  3ZVJ D;  3IAM 2;  1F2E A;  1N2A A;  1T3B A;  1GSY A;  2DIY A;  1HYU A;  5ID2 A;  4F03 A;  1I5G A;  3DXB A;  4NV5 A;  5HFI A;  4YQV A;  3MDK A;  2ZCT A;  18GS A;  2EFC A;  2N5A A;  2J9H A;  2XBQ A;  2C3N A;  3ZRD A;  4V2L A;  4LMW A;  4KGI A;  5EY6 A;  1X9W B;  1EP8 A;  4EL1 A;  4IGJ A;  3ZIT A;  5IMC A;  1U88 A;  3FZ4 A;  5IMD A;  2LQO A;  2I81 A;  4X0X A;  4HZ4 A;  4RI7 A;  3LOR A;  2RUE A;  1AIU A;  4BWS A;  1EOH A;  4OFT A;  1XW6 A;  3IC4 A;  2I4A A;  2B1L A;  2MBS A;  4FH8 A;  4WET A;  4GQF A;  1M9B A;  2GQK A;  2KLX A;  3FZA A;  3BCI A;  1DE2 A;  4HDE A;  1CQH A;  1OC3 A;  4BA7 A;  1SKS B;  4N0Z A;  1O6J A;  2IMD A;  4IP6 A;  3W6G A;  1PL2 A;  1H75 A;  4K2D A;  3D21 A;  2KP1 A;  5A1N B;  2OE3 A;  2P31 A;  2PWJ A;  2LQQ A;  5A34 B;  2HQT A;  4POK A;  1PN9 A;  4F0C A;  3LEF A;  3W8J A;  5A4U A;  2CQ9 A;  1VRS D;  4N10 A;  1GSF A;  2ON5 A;  4MF7 A;  1JZW A;  4POB A;  1TW9 A;  4FYU A;  1TK0 B;  4DSQ A;  2QKE A;  4J57 E;  5ECR B;  2WB9 A;  5F05 A;  4GDF A;  3VK9 A;  2V1M A;  2B5X A;  3PGT A;  2VCV A;  2VLT A;  1NSW A;  1PN0 A;  2LV3 A;  4F82 A;  1M2D A;  2B5E A;  5DCH A;  22GS A;  2R0G A;  4TKY A;  4PGT A;  2A4H A;  2YAN A;  1SVO A;  1MEK A;  1SD9 A;  4G9H A;  2FD3 A;  5G30 A;  3BD2 A;  1BQ7 A;  6GSX A;  1XFL A;  4ZB9 A;  1SVM A;  1SL2 B;  4ECI A;  1JHB A;  1BAY A;  2CAI A;  4ULX A;  4IJI A;  2QC7 A;  3IPZ A;  2VLU A;  3FHK A;  4ZL7 A;  4HZ2 A;  4NHZ A;  1KTE A;  4ZBD A;  4WF5 A;  3TRP A;  4EDZ A;  4E8E A;  4USS A;  2UV8 G;  2OJL A;  2RM6 A;  5D9X A;  1BED A;  4AJ8 A;  2HRN A;  1FOV A;  3GRX A;  2HSY A;  4OO5 A;  4ZXG A;  4ZB8 A;  2HZF A;  5B8B A;  5HQP A;  4AKH A;  3KIJ A;  2OE0 A;  4ILF A;  3UAP A;  1JLV A;  2X64 A;  3F9U A;  2JZS A;  2FWF A;  4A5P A;  2H75 A;  4PQ1 A;  2YWO A;  5H5S A;  4BL7 B;  1QK8 A;  3WT2 A;  1Y25 A;  4MP4 A;  1HNC A;  3U6V A;  4NXI A;  3TU3 B;  3TJB A;  2C0G A;  5ENU A;  5FWG A;  5IMA A;  1EEJ A;  3BOA A;  1JZO A;  5KN2 A;  1GP1 A;  4TXV A;  2K8V A;  1H4O A;  3Q74 A;  3G7J A;  1XWG A;  4O5R A;  4XTS A;  3FR9 A;  4MDC A;  1UA5 A;  4TRX A;  5J9C A;  3TKP A;  4K0G A;  2YCD A;  2NVL A;  4PTS A;  2EFE A;  4FYC A;  5DAL B;  1FW1 A;  5B7C A;  1X5D A;  3LJR A;  1SL0 B;  3LW9 A;  3ERW A;  3UVH A;  4KDU A;  1ZYQ B;  5HR0 A;  3L9S A;  2A2R A;  2KP2 A;  6GSS A;  1GSQ A;  2VL2 C;  2VUP A;  2DJ0 A;  4YAP A;  1WIK A;  5IM9 A;  3IHQ A;  3EVI A;  4K5R A;  3FZ9 A;  4K7I A;  3UIW A;  1XVQ A;  5IOX A;  1FB0 A;  3CSI A;  4L8E A;  3EIN A;  3VPQ A;  3HY2 A;  1MD4 A;  11GS A;  4GCI A;  4HOJ A;  4JZQ A;  3DKS A;  1GTU A;  2R3X A;  4YKF A;  5D8I A;  3M9J A;  5CRD A;  3FK8 A;  1ZL9 A;  4O5U A;  3E9J B;  5GAN D;  4KX4 A;  1GWC A;  3HJM A;  2FWG A;  2FY6 A;  5IO0 A;  2H6Z A;  1HNB A;  3M0F A;  3QAV A;  3VI5 A;  4J56 E;  1ERU A;  2H1A A;  1E2Y A;  4HU9 A;  1VF1 A;  1Z7P A;  2LNS A;  2H73 A;  3M3M A;  1SU9 A;  1PX6 A;  2C0F A;  4NPB A;  1O73 A;  1SKR B;  1A23 A;  3F4T A;  5CAX A;  4AF2 A;  5A34 A;  1FHE A;  1Z6M A;  2DJ3 A;  3HZ4 A;  2L57 A;  4AJ6 A;  4POL A;  2PVO C;  1EP7 A;  1OE8 A;  1OE7 A;  2CA8 A;  1A8Y A;  4MH2 A;  5ECO B;  3WD6 A;  2TIR A;  5B6N A;  1MDK A;  1XOB A;  2X4A A;  4IBP A;  5F0G A;  4KB3 A;  3HCZ A;  3UJ1 A;  2O5V A;  5CYY A;  2WFC A;  4KCA A;  1XZO A;  2JSZ A;  1MTC A;  1K0A A;  1TRV A;  2QSI A;  2GVP A;  3IDV A;  5H5R A;  2IFQ A;  2YOI A;  1O8X A;  2OE1 A;  5IMZ A;  1A2J A;  5AIV A;  2VL2 A;  1GSS A;  1TU7 A;  5DCG A;  1OC9 A;  1QXH A;  4FIW A;  4POM A;  4BVY B;  3UEM A;  2V2G A;  1QGV A;  2V32 A;  4PX1 A;  2R2J A;  4ML6 A;  4IVF A;  2R0C A;  2HRA A;  2RUF A;  1UN2 A;  2CZ3 A;  4L0U A;  4MMM A;  3E0U A;  1V9W A;  1FG4 A;  3HYP A;  4TR3 A;  1M2B A;  3TKQ A;  2IL3 A;  1EWX A;  4AKG A;  3KMO A;  3TJK A;  4XS4 A;  1F3B A;  2DJ2 A;  2X49 A;  2GZP A;  2WRT A;  2GT6 A;  3NZN A;  3L78 A;  2VKZ G;  1GUK A;  3CSJ A;  3D4M A;  1PSQ A;  3MSZ A;  3A5I A;  4I2U A;  4NWY A;  3TRQ A;  3QR6 A;  2OA7 A;  3FYG A;  3LQ7 A;  3I9V 2;  3G9B A;  2O85 A;  3GL3 A;  2WS2 A;  4ZL8 A;  1V2A A;  5DBQ A;  3IOS A;  1YY7 A;  3GST A;  2YWI A;  3F6F A;  6GSU A;  1SK1 A;  4LL4 B;  1FO5 A;  4BPY A;  1XWA A;  5GZZ B;  2H0H A;  4TR0 A;  2FWE A;  4GSS A;  1GTB A;  2FNO A;  2DJJ A;  3D6I A;  1WWJ A;  2H70 A;  1M2A A;  1MDJ A;  3G7I A;  4G19 A;  2C3Q A;  1AUC A;  3M9K A;  1LU4 A;  1J0F A;  1BG5 A;  1V98 A;  3TDG A;  4HQS A;  5J4V A;  1LJR A;  3VUR A;  1YJ6 A;  2XHF A;  1UC7 A;  3ZVJ A;  1S3A A;  1ON4 A;  1A8L A;  4G01 A;  4ECB A;  3ZML A;  2L5O A;  1Z9H A;  2VL3 A;  1Z5Y E;  3WGE A;  1TI1 A;  3ZYW A;  1F9M A;  5CNW A;  3GUR A;  3KCM A;  4CY6 A;  3UMA A;  3TCO A;  1XIY A;  2O89 A;  4TXO B;  4Z2R A;  5A1N A;  5DVB A;  4K7O A;  2F3M A;  2F9S A;  3QFB C;  4QL7 A;  3I6A A;  1EV9 A;  1I9D A;  1YZX A;  2YV9 A;  3GKN A;  3HVX A;  3MWH A;  1ZZY A;  1HNA A;  2FWH A;  1XW9 A;  1KBN A;  1YKC A;  3F6D A;  3KEB A;  1U3A A;  2FCH A;  4CDO A;  5D73 A;  1G7O A;  2ZUP A;  7GSS A;  1SK2 A;  2O7K A;  4V1A g;  4DSR A;  3UAR A;  3MNG A;  1B4Q A;  1PKW A;  4EVM A;  2P5Q A;  1A0R P;  4KH7 A;  3EYT A;  3L0H A;  3TJJ A;  3DD3 A;  1F3A A;  2DJK A;  4K9Z A;  4KAE A;  5D93 A;  2YNX A;  5DAK A;  1TI3 A;  3KM6 A;  3PIN A;  2C80 A;  4Z2T A;  3KMN A;  4GRF A;  3F4R A;  1OKT A;  2GTU A;  4KSM A;  4I6X A;  3P90 A;  3NOF A;  2O87 A;  1NHY A;  2YV7 A;  4E68 A;  1ZYP A;  4V2N A;  5CO3 A;  1ABA A;  1M9A A;  3KH7 A;  1Y1U A;  2GSQ A;  5ECP B;  4L5L A;  2K6V A;  3ZLP A;  4GSN A;  5FHI A;  2F51 A;  4PUA A;  5ID2 B;  1W89 A;  1J08 A;  3RHB A;  3FRC A;  4G0L A;  2OAD A;  5C04 A;  3HHV A;  3QAG A;  2I3Y A;  4G0K A;  4JE1 A;  2M72 A;  4WF4 A;  3FR3 A;  4EXJ A;  1YDK A;  2MMA A;  5IMV A;  2QGV A;  4JED A;  2YWN A;  5A5K A;  4NMU A;  2JAD A;  3I43 A;  1A0F A;  1TKD B;  4WBJ A;  17GS A;  3WT1 A;  4HUA A;  5ECQ B;  3RBT A;  1B48 A;  5JWO B;  2I9H A;  5KN3 A;  3J7Y b;  5ECS A;  1NM3 A;  1TK5 B;  4BVY A;  2G0F A;  1EZK A;  2H8L A;  1K3O A;  3PPU A;  1AQW A;  3BBY A;  1X0R A;  2IWT A;  5IPH A;  2TRC P;  1S3C A;  1QFN A;  1FVK A;  2LJA A;  4HQZ A;  5D9T A;  3C1S A;  2IMF A;  4XIH A;  3CRU A;  1B9X C;  4PNG A;  1OC8 A;  3ME7 A;  2RLI A;  1U87 A;  4MAB A;  4WEY A;  3EE2 A;  1JFU A;  1GSE A;  3KP8 A;  3Q18 A;  3EPT A;  4PUF C;  2A2S A;  4MNN A;  1YEX A;  3N5O A;  5AIS A;  3HD5 A;  1N8J A;  4ZIJ A;  3GH9 A;  1GUM A;  2REM A;  4LMV A;  1Q4J A;  3PH9 A;  3C7M A;  1NHO A;  3HVV A;  3IK7 A;  1K0D A;  1A2L A;  1IYI A;  2VM2 A;  4K1F A;  3ED3 A;  3O3T A;  1O81 A;  5CP1 A;  1URM A;  1TDI A;  4I5Q A;  4JU5 A;  1NW2 A;  1GRX A;  5EVO A;  2VO4 A;  1XCC A;  3D22 A;  4MJC A;  4N11 A;  2VCT A;  3KXO A;  2CVK A;  3IV4 A;  1HQO A;  4GF0 A;  4JR4 A;  2V6O A;  2MMZ A;  2PER A;  3QCP A;  4GST A;  4MLY A;  2R6K A;  2RII A;  2HSM B;  2R5G A;  1KEB A;  3MIX A;  4MF6 A;  2H76 A;  5L71 A;  2MMO A;  3C8E A;  3S9F A;  1SEN A;  3C1R A;  2VCZ A;  2VD1 A;  5H5Q A;  1T1V A;  5CRG A;  5F07 A;  1SD8 A;  3QPM A;  1OVN A;  1U6T A;  1DBY A;  2KUC A;  1Z7R A;  4TW5 A;  1WMJ A;  2YPM A;  2VCQ A;  2L6C A;  3TOU A;  2TRX A;  2H1D A;  3O76 A;  2VIM A;  4GQC A;  5G5F A;  1WRY A;  2X8G A;  2CAQ A;  4KF9 A;  2XPE A;  1PRX A;  2EIQ A;  5FT3 A;  1BX9 A;  2WDU A;  1C72 A;  3QD9 A;  4OD7 A;  5BMU B;  4X4J A;  3TKS E;  5GST A;  5GSS A;  2JU5 A;  1G7E A;  4K8M A;  2C1Y A;  1AXD A;  4MZB A;  2B3S A;  2FA4 A;  2E2M A;  3IAS 2;  1Q98 A;  3QMX A;  5J5N A;  4HJ2 A;  4D73 A;  3CYN A;  4O32 A;  2VM1 A;  3A3T A;  5HFK A;  3VWV A;  4HS1 A;  4XS4 B;  3IBH A;  4IW9 A;  5IOW A;  1GTI A;  1OKD A;  2EFD A;  1TU8 A;  1MD3 A;  4WR5 A;  5HR1 A;  1JLW A;  5ECM B;  1MDI A;  3VWU A;  2PMT A;  4HU7 A;  3DIE A;  4L0W A;  2UZ8 A;  4MPF A;  3ZTL A;  1T4Z A;  14GS A;  3UVT A;  2H72 A;  1GH2 A;  3RPP A;  1EGO A;  3LYK A;  1M99 A;  2CT6 A;  2H0G A;  3MAK A;  1B4P A;  4BVX B;  1YF0 A;  4GLT A;  5ELA A;  5DQS A;  2H6Y A;  3DVX A;  2QA2 A;  2L59 A;  2R4V A;  1JZR A;  5IPG A;  1ACV A;  3US3 A;  3IR4 A;  1SYX A;  4L5O A;  4ZBA A;  2M46 A;  5A4V A;  1XWB A;  3CTF A;  3RDW A;  4IP1 A;  3GX8 A;  4EF0 A;  3OR5 A;  5A5H A;  1CQG A;  1XWC A;  2G2Q A;  1TXU A;  5KN0 A;  2LKU A;  2CVB A;  3GYK A;  4TR1 B;  3GFK A;  1WJK A;  2IMK A;  4OFN A;  1ERT A;  3GNJ A;  2MZC A;  2JAC A;  3V1W A;  3E3E A;  2NPB A;  4Q5N A;  3ZFB A;  3BJ5 A;  4HI7 A;  1YEP A;  2LST A;  3LSZ A;  3IK9 A;  5CRH A;  2EFH A;  5DJM A;  2EIR A;  3MYD A;  5LNK e;  2GQM A;  4ZB6 A;  3KTB A;  4TXO A;  3F4S A;  2X99 A;  3HXS A;  4ZBB A;  5KOW A;  2CV4 A;  2WUL A;  1YF1 A;  2EC4 A;  3GL5 A;  1WPI A;  3LWA A;  5D9W A;  3IXR A;  3VPT A;  1FB6 A;  1O85 A;  5JWQ B;  2HSH A;  2DBC A;  2YP6 A;  2IIY A;  4FO5 A;  1QMV A;  4N30 A;  4WR4 A;  5E59 A;  3VWX A;  2HYX A;  1VF3 A;  1QQ2 A;  2I1U A;  3KD0 A;  2C0D A;  3P7X A;  4YQU A;  4EC0 A;  2LS5 A;  4KDY A;  3KTL A;  1EOG A;  2E0Q A;  4JBB A;  4NAX A;  1O8W A;  5ECL B;  2E7P A;  1PGT A;  4FYB A;  4MJA A;  3LXT A;  2R0P A;  4QL9 A;  3IC8 A;  1SVL A;  3GIX A;  4K7N A;  5B6M A;  3BCK A;  2H1G A;  4MZW A;  4IS0 A;  3H1N A;  2B6M A;  2FGX A;  2OBK A;  4WKW A;  4KW6 A;  4OO4 A;  3EMP A;  5DJL A;  4MPG A;  1Z3E A;  1VGL A;  4K5S A;  4G2E A;  1R5P A;  1JZD A;  2H74 A;  4IN0 A;  2K9F A;  4D73 B;  5DAL A;  1GLP A;  3CWG A;  4EO3 A;  2CX4 A;  4OCF A;  1E6B A;  2F8A A;  1DUG A;  2HRK A;  1XXU A;  1SK0 A;  1TTZ A;  3GUS A;  3HMJ G;  5HFG A;  5INY A;  3TGZ A;  3ERF A;  3UL3 A;  3GKX A;  4LA1 A;  2L6D A;  3FW2 A;  3UBL A;  3FY7 A;  4KSO A;  6GST A;  2LTK A;  2V41 A;  4ZIL A;  3LFL A;  3JCM L;  2B7J A;  2XBI A;  2XC2 A;  16GS A;  3EU4 A;  1R26 A;  1XBS A;  2C0E A;  2WZ9 A;  1A24 A;  1EEM A;  1TRW A;  2YZU A;  4DVC A;  3GA4 A;  1ZGN A;  1OAZ A;  1K3L A;  5J4U A;  2Z9S A;  4Z7X A;  4KA0 A;  1ZYE A;  2AJQ B;  2J23 A;  1XVW A;  3F8U A;  4RQX A;  3HJO A;  4YQM A;  13GS A;  1X5C A;  2N5F A;  4Q5F A;  2HSM A;  4XRD A;  1OC9 B;  5KN1 A;  4KE3 A;  5J40 A;  3TUE A;  1BYE A;  2DIZ A;  1Z6N A;  2PPT A;  1B8X A;  5C00 A;  1RK4 A;  1R7H A;  3A2X A;  1BJX A;  2LJK A;  2YWM A;  5IMF A;  4O5Q A;  4TN8 A;  1ZYN A;  3HVS A;  2VLV A;  3CSH A;  2OT3 A;  3ZIJ A;  2HNL A;  1V58 A;  2FUG 2;  3CMI A;  5ECN B;  2IPA A;  2AAW A;  3RHC A;  1T00 A;  1TRU A;  4CY8 A;  1DSB A;  2A2P A;  3CXG A;  5ECI B;  2HRK B;  3FR6 A;  4DSS B;  2P0G A;  2HI7 A;  1QUW A;  3KZQ A;  1PKZ A;  3DGQ A;  5ECH B;  4I2T A;  8GSS A;  1T4Y A;  1K3Y A;  4PUR A;  2LRC A;  4H86 A;  3ME8 A;  2VD0 A;  4K2X A;  1YQ1 A;  1BF5 A;  3ZIV A;  4GTU A;  2L4C A;  3GV1 A;  6GSW A;  3N9J A;  4YAV A;  5ABR A;  4QMK A;  4IEL A;  4E8H A;  4DEJ A;  2PGT A;  4IJ3 A;  4JRR A;  3L9U A;  2DSA A;  4ACS A;  3O6T A;  2V6K A;  1K0M A;  3I69 A;  2DLX A;  2DKI A;  2ES7 A;  4OFM A;  1GNW A;  2FLS A;  3A5W A;  2AUV A;  2EIO A;  4GWR A;  5IIZ A;  3GHA A;  2VAF A;  2DC5 A;  5ECK B;  4ECJ A;  1T8E B;  5BMU A;  2HRF A;  3F0I A;  2CZ2 A;  1USB A;  5JWR B;  2H19 A;  1SJI A;  1J9B A;  4IKH A;  4ID0 A;  1ST9 A;  3U5R E;  3FEU A;  2X8H A;  2C4J A;  1ERW A;  3IRA A;  4PQH A;  1A2M A;  5IQY A;  3FZ5 A;  2GS3 A;  1RQM A;  1XOA A;  1ZCP A;  1F37 A;  3D0Z A;  4TOP A;  1LBK A;  3VI7 A;  2E2G A;  1RW1 A;  1WP0 A;  3QOU A;  2KHP A;  4IQA A;  3WYW A;  2JZT A;  2FHE A;  3QAW A;  4Q5R A;  4MH3 A;  4TR1 A;  2DML A;  4EDY A;  2GZY A;  5HR2 A;  5G1K A;  1GNE A;  2BMX A;  5KOX A;  2HXK A;  1WE0 A;  3M8N A;  3TKS C;  1PQN A;  2FA8 A;  3M1G A;  1AQX A;  4FQU A;  1FOH A;  2YJH A;  2ALB A;  4EE0 A;  2DMM A;  3LGC A;  2NDO A;  4HJM A;  5JCW A;  1N25 A;  1GUH A;  3APO A;  1G6W A;  2C8U A;  3TJG A;  1F6M C;  2IFQ B;  4XHM A;  3LYP A;  5J47 A;  4K0N A;  4F0B A;  1M7T A;  5LCZ A;  9GSS A;  3DWV A;  5B8A A;  3APQ A;  1B9Y C;  4F2I A;  5COH A;  2H71 A;  1GSD A;  4CW9 A;  1THX A;  4KND A;  3GKM A;  3H93 A;  3R3E A;  4ECC A;  1YVL A;  4W66 A;  3J7Y k;  5JCU A;  3TOT A;  5EL8 A;  2F8F A;  2XPD A;  1Y6E A;  5J3R A;  4JR6 A;  3R2Q A;  3DML A;  1ILO A;  4O7H A;  2MYG A;  3VFI A;  2PUK C;  3KJY A;  1SKW B;  1R4W A;  2BJX A;  3CTG A;  3GKK A;  4MJB A;  1GSU A;  2LEG A;  2YJ7 A;  3F3R A;  2R37 A;  2LNT A;  3DRN A;  3ZRE A;  1PA3 A;  5AGY A;  5J41 A;  3ERG A;  1TK8 B;  3ISO A;  3KP9 A;  2QA1 A;  4OWY A;  1TOF A;  4MJE A;  5BRT A;  4OMV A;  1G6Y A;  1SL1 B;  3IHG A;  3VWW A;  12GS A;  3GTU B;  2LRT A;  5LD0 A;  5J4Y A;  3IA1 A;  1DE1 A;  3D4T A;  1ML6 A;  3HDC A;  3EC3 A;  2B7K A;  2X8C A;  1GUL A;  19GS A;  2AV4 A;  2MBT A;  3L4N A;  2K8S A;  3IE3 A;  1V57 A;  2OAC A;  5DQY A;  3LG6 A;  3Q19 A;  4BWQ A;  4NHW A;  4LLR A;  4PXO A;  3KH9 A;  5AIX A;  2O8V B;  4P3Y B;  2N5B A;  3LXZ A;  3P8W A;  4AJ7 A;  3ZFL A;  4ML1 A;  4RUV A;  2LJR A;  2MMN A;  2BTO T;  4QQ7 A;  2HZE B;  4X43 A;  3HKR A;  3EU3 A;  2RM5 A;  3VLN A;  2OBI A;  3A2W A;  1EV4 A;  5G2Z A;  2CX3 A;  2GZZ A;  4EIQ A;  4CHS A;  1ZOF A;  6GSV A;  3TJF A;  3F3Q A;  3TKR A;  5A5H B;  4KDX A;  1XW5 A;  4N0V A;  1WOU A;  5GAP D;  1THO A;  4PQI A;  5D96 A;  4RI6 A;  1X5E A;  4V1A p;  5DAK B;  4BVX A;  2H0I A;  3FKF A;  1K0B A;  3K8N A;  4OCE A;  1T7P B;  1V40 A;  4XS6 A;  1XWK A;  2H6X A;  2JZR A;  1TJD A;  3GSS A;  4MK3 A;  2OKA A;  4Q5Q A;  2HLS A;  2HSN A;  5G5E A;  2NTO A;  1PL1 A;  5J9B A;  4WXT A;  1FVJ A;  5DDL A;  2AHE A;  3D5J A;  3TRX A;  2DJ1 A;  3A2V A;  2KOK A;  5CRE A;  4PNF A;  4IQ1 A;  1R5A A;  3NIV A;  2IN3 A;  4XS1 A;  4ICY A;  2HSN B;  5E4W A;  2GDR A;  1TP9 A;  4DSS A;  1HD2 A;  2H1B A;  3HZ8 A;  3APS A;  1M0U A;  4AKI A;  4I8B A;  4LL1 B;  1K0C A;  3GMF A;  4MA9 A;  3H8Q A;  2A4V A;  4ZL9 A;  3GH6 A;  2IME A;  4YH2 A;  4G0I A;  4K6X A;  3DEX A;  2PU9 C;  5ELG A;  1SJ6 A;  2CVD A;  4ISD A;  4GXZ A;  1ZMA A;  2DKH A;  2C3T A;  4F9Z A;  4XCS A;  5IO2 A;  2HE3 A;  1SJZ A;  3L9V A;  4YKG A;  2GSS A;  3RAZ A;  2HFD A;  3UBK A;  4I97 A;  5F8B A;  4Z2U A;  5G1L A;  1AAZ A;  1PD2 1;  5JCG A;  2L4Q A;  2L5L A;  1AC1 A;  10GS A;  2JL4 A;  2JSY A;  2D2Z A;  2VCW A;  6GSY A;  2GSR A;  1YKA A;  2YN1 A;  3SBC A;  4TVE A;  3PR8 A;  3C71 A;  2GLR A;  2GGT A;  4NV2 A;  5CRW A;  1SYR A;  2LUS A;  1VF2 A;  2K18 A;  3QDN A;  3AY8 A;  2ZNM A;  3DYR A;  1GLQ A;  3EWL A;  2PBJ A;  4ZB7 A;  1O7U A;  1UVZ A;  3SWL A;  5D9V A;  3GX0 A;  4IHU A;  3F63 A;  3WGX A;  4TR4 A;  1EGR A;  2GT5 A;  2AB6 A;  1G0T A;  2NBS A;  2WCI A;  3ZMK A;  5A4W A;  1PX7 A;  4J2F A;  3RPN A;  3ZL5 A;  2VCX A;  4G10 A;  3CRT A;  3WGD A;  2VL9 A;  1K0O A;  4HEA 2;  2ON7 A;  3QFA C;  2H01 A;  1OYJ A;  1TXX A;  3HJP A;  5F06 A;  1FAA A;  5HR3 A;  4BL7 A;  1BG1 A;  2H66 A;  2M80 A;  3UOM A;  2PN8 A;  2GQL A;  5KEJ A;  4MCU A;  4V2M A;  1AQV A;  4MZC A;  1W4V A;  2H30 A;  4KUN A;  4EIP A;  2HT9 A;  4KCE A;  2VOC A;  1ERV A;  4O92 A;  2WGR A;  3TKS A;  3C73 A;  2HZE A;  2YZH A;  2IJY A;  1GL8 A;  1X9S B;  5AN1 A;  4RQR A;  3ZZX A;  3P2A A;  2GST A;  1XPV A;  3KGK A;  2LRN A;  4AKX B;  4N3Z A;  3EMX A;  5G31 A;  3Q6O A;  3G7Y A;  3DVW A;  1GTA A;  3FMW A;  2IMI A;  2PVQ A;  3EUR A;  3W8S A;  1VF4 A;  2B5Y A;  2H1L A;  2WJU A;  4WBR D;  1IYH A;  1TRS A;  4X1U A;  4XRA A;  3GTU A;  3H79 A;  4EKZ A;  3CBU A;  20GS A;  1KNG A;  3GN3 A;  1PMT A;  4EUY A;  3H4K A;  3TB2 A;  1S3D A;  3HA9 A;  1U3I A;  2AYT A;  4AGS A;  2P5R A;  1AW9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...