3IK7A

Human glutathione transferase a4-4 with gsdhn
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
221
structure length
221
Chain Sequence
AARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase A4
publication title Substrate specificity combined with stereopromiscuity in glutathione transferase A4-4-dependent metabolism of 4-hydroxynonenal.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 77
structure length 221
sequence length 221
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2009-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3ik7A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3ik7A01
1SJZA 1TJDA 4K7OA 4K2DA 3RHBA 1S3DA 2B7JA 2GZYA 4ZBDA 1KEBA 5F0GA 1XXUA 4HJ2A 1M0UA 3FZAA 5KEJA 4XS4A 3CTFA 3QAVA 4OD7A 3L4NA 1K0AA 5JCUA 3C8EA 5JCWA 1F3AA 2GS3A 4EXJA 2VLTA 1AAZA 1GSDA 2VO4A 3ZRDA 2EIOA 3L9VA 2R37A 1T00A 3LJRA 3ZMKA 2WJUA 3GSSA 3EVIA 4E8EA 3VI7A 4RQXA 4CDOA 2H8LA 5IOWA 4ACSA 4MLYA 2AB6A 1FB6A 1URMA 1FW1A 2FUG2 5KN0A 3CTGA 4E8HA 5CP1A 3KMNA 5CRDA 5HR2A 3E9JB 3PR8A 2NDOA 4KE3A 4N0ZA 2ES7A 5AIVA 1WIKA 4RI7A 2TRCP 1XWAA 1MEKA 2WB9A 2C3QA 2WRTA 5CRGA 2DJ0A 1ERUA 3GUSA 2H75A 4TXOA 1GLPA 2C0GA 4KGIA 5JWQB 2LQOA 4IN0A 4F0CA 1FVJA 1U87A 3U5RE 5CAXA 2ON7A 3KH9A 1XWBA 3IK7A 1G0TA 2OJLA 3VURA 3HZ8A 3OR5A 4ECJA 3FR9A 3QAWA 2A4VA 2DBCA 3W8SA 2RM6A 4TR0A 2H1BA 3GKMA 4IVFA 3KP9A 4MF7A 3FEUA 4EF0A 3QAGA 2FLSA 5HR0A 5L71A 4G19A 2MMNA 4XS6A 1NHOA 4DEJA 3H8QA 4GCIA 3KM6A 1M99A 3US3A 2H6YA 20GSA 1ZYEA 5JWRB 2QGVA 3P90A 5IQYA 5ECQB 2RUFA 4AGSA 4NPBA 3TKSE 4Q5RA 2OE3A 3CSJA 1OKTA 1K3YA 1M7TA 2NBSA 3BJ5A 4O7HA 3O76A 3TRQA 3IOSA 4I8BA 4KUNA 1GUHA 1GUMA 2E7PA 6GSXA 4P3YB 1PMTA 2G2QA 2V2GA 5H5QA 3IHQA 4F9ZA 2IFQA 4EL1A 4G9HA 4HZ4A 2JADA 2FA8A 2E0QA 4JZQA 3HVVA 3DVWA 2F8FA 1C72A 5G1LA 3UOMA 2HZFA 3VPQA 2H0IA 4MJEA 1H4OA 1O8XA 4XS4B 2R2JA 1GTAA 2NPBA 3EMPA 3IC8A 3G7JA 4OMVA 3HA9A 3M9JA 2JACA 4WF5A 1MD3A 2I4AA 1EGRA 4MDCA 3A2WA 2B5EA 1XPVA 5G2ZA 3VWWA 2FWHA 2E2GA 2HI7A 1U6TA 2VL9A 1Z6NA 4I2UA 3GKXA 2Z9SA 4EVMA 4Q5QA 1X5DA 2P5RA 3UMAA 2EIQA 1OC3A 3LSZA 4IQAA 3ERFA 3BBYA 3CSIA 4OO5A 1UC7A 2H6XA 2GDRA 4HEA2 3HVXA 2GT6A 2KOKA 3KCMA 2HSNB 3NOFA 2P31A 2XC2A 1EEMA 2VD0A 1A23A 2VCZA 2B6MA 3IK9A 4MH2A 5DCHA 2CVDA 3FR6A 5JWOB 2V1MA 4PXOA 1FO5A 2JSZA 1IYIA 1V9WA 3A2VA 3S9FA 4ZB9A 3F4RA 3TRXA 2YZUA 2H1DA 1SD9A 2K6VA 4IP1A 3TKSA 4IELA 3ZTLA 3EURA 3H4KA 5ECKB 3ME8A 5KN1A 1WPIA 2B1LA 4ISDA 5ECHB 1ZYQB 2K8VA 3TKRA 1EWXA 3UARA 4NHWA 2DJ2A 2WZ9A 2G0FA 1X9MB 1CQGA 2YN1A 3A3TA 3D21A 1GP1A 1THXA 4DSSA 1Q98A 2L5LA 2VL2C 3QR6A 6GSVA 1AUCA 1TRWA 5ECLB 3V1WA 1R5AA 4BVXA 1B9XC 2VAFA 2YJ7A 1QK8A 2IJYA 1SJIA 2J23A 3ZFLA 1THOA 2IFQB 1PA3A 3KEBA 1W89A 4LMWA 1T3BA 3TDGA 1HYUA 12GSA 3D5JA 3GH9A 3L9UA 2V6OA 2LRNA 4K0GA 1PGTA 5B6NA 4POBA 1RQMA 1XWGA 3D0ZA 1JZOA 2HSYA 2IN3A 14GSA 2N5AA 4IJIA 1SJ6A 3C1SA 2TIRA 5DQYA 3ZIJA 3EE2A 4EDZA 4PNFA 4WETA 1PKZA 1SD8A 1DE2A 3ED3A 2X99A 1ZZYA 4K9ZA 5ELGA 2VCXA 5KN3A 3I6AA 2H0HA 4I5QA 2IL3A 2H76A 2I9HA 1TRVA 2H1GA 2C8UA 1XCCA 3F63A 3CRUA 2C0EA 1EZKA 2YOIA 4N30A 1T8EB 3O6TA 4POKA 4IS0A 2ON5A 3HYPA 3DWVA 2DSAA 5IMFA 1ON4A 4V1Ag 4IW9A 2HRKA 2HYXA 1A24A 5DDLA 1YJ6A 3IE3A 4JR6A 2FWFA 8GSSA 1EV4A 3QPMA 1A2LA 3CXGA 1UVZA 5DALA 2FHEA 4XCSA 4RI6A 2VCVA 2L57A 3GMFA 3QFBC 5HFKA 4J56E 3PGTA 1WP0A 2VIMA 4NHZA 1FAAA 5HFGA 1GNWA 1AW9A 2X8GA 3FZ4A 4G0IA 2WS2A 2H72A 1X9WB 4NXIA 2KHPA 3Q6OA 1HQOA 3PPUA 4AJ7A 3WGXA 5ECPB 2IMFA 2H74A 2FY6A 5DVBA 4ZXGA 2LQQA 1X0RA 5F8BA 3ME7A 2XBIA 4WBRD 5ECSA 1XW9A 4MP4A 1OVNA 2VLUA 2PGTA 4HQZA 2X64A 1T4ZA 1PX6A 1XVWA 4DSSB 2PVQA 2GSQA 1JZWA 4NWYA 1ZOFA 2I1UA 4IKHA 4BVXB 2I3YA 1FG4A 4KNDA 1SKSB 1KBNA 2DJ1A 2O8VB 1USBA 3I9V2 4MJBA 1WJKA 2H19A 1IYHA 2PVOC 1JFUA 2LUSA 1ZMAA 3ZL5A 5ABRA 2FWGA 4TN8A 1R5PA 4POLA 2DIYA 5DJMA 1UA5A 3QDNA 4ZBBA 5H5SA 4IP6A 1BYEA 4LA1A 4IGJA 3LXTA 3TJJA 1TDIA 4O32A 2LNTA 1JHBA 2YWNA 4ML6A 1TKDB 1OKDA 2OE1A 5ID2A 2H1AA 2F51A 1QMVA 4MA9A 3P2AA 1VRSD 1Y6EA 2YWOA 1K3OA 3VWXA 3VFIA 3F8UA 3VLNA 4HU7A 5IPHA 2LJRA 2M46A 4ZB8A 4LL1B 4HQSA 1EOHA 1DBYA 5B8AA 1F37A 2LV3A 2PERA 3ZVJA 2F9SA 5KN2A 1Z6MA 4ECBA 2L59A 4MPFA 5ECOB 2FA4A 4IBPA 5J4UA 3GV1A 1GSSA 2YANA 3VK9A 3TRPA 2LSTA 3WGDA 2GSTA 2LNSA 1XZOA 5COHA 1E2YA 1ZL9A 1T1VA 2V41A 3LWAA 4TR1B 1B9YC 2HRKB 4XHMA 1G6WA 2ZUPA 5A4WA 3DEXA 3UJ1A 2DLXA 3M0FA 1OAZA 1GSQA 3LXZA 3UVTA 2YV7A 2A2RA 1SL2B 1ERTA 2MBSA 4ZL9A 5DALB 2AYTA 4MJCA 1BAYA 5DAKA 2H73A 3GTUA 3LFLA 2D2ZA 2JSYA 5G5EA 2HT9A 2V32A 4NMUA 2A2SA 3L9SA 2OKAA 5ECIB 3L0HA 3IC4A 2P0GA 5GAND 4KB3A 6GSUA 4MMMA 5EL8A 4BWSA 4KDYA 3TJFA 3APOA 2HLSA 3TGZA 2M72A 5IMVA 4DSQA 1OC9A 3HJMA 1GH2A 4N0VA 3W6GA 1XFLA 1PRXA 1U3IA 1TTZA 4WR4A 3HDCA 4G2EA 3R3EA 4OO4A 2HFDA 1ACVA 3PH9A 3IA1A 5IPGA 4ZL7A 3H93A 3N5OA 2YNXA 3TB2A 4J57E 1EP8A 1ERVA 5GSTA 2GQKA 2OE0A 3ZITA 5D73A 1WOUA 2N5BA 1TI3A 2DJKA 5H5RA 3FRCA 1SK0A 1ST9A 3GX8A 5J41A 3RPNA 3AY8A 5GSSA 4I6XA 4TOPA 1S3AA 4GQCA 3TOTA 3KIJA 1B8XA 3LYKA 3LGCA 3G7YA 1ZGNA 2BTOT 4LLRA 1QGVA 4XS1A 5B7CA 4HDEA 3ZLPA 1SK1A 1EP7A 2GT5A 3MAKA 2K9FA 3BD2A 2AV4A 3WD6A 3U6VA 1T4YA 2QC7A 1MDJA 3GKNA 3M8NA 3GIXA 1SU9A 4FYUA 2RLIA 3QFAC 3BCKA 1O73A 5ID2B 2XHFA 4FYBA 1JLWA 4Q5FA 5GZZB 1XW5A 5G1KA 1V40A 4F03A 4L5OA 3C71A 1M2BA 3F0IA 4ULXA 5EY6A 3TKPA 1GSEA 2H66A 1EGOA 5GAPD 5IMDA 4MPGA 1A2MA 3DMLA 1O7UA 3F4TA 2GZPA 2OBKA 3TJGA 1TRSA 1WRYA 4MZWA 2O89A 2JL4A 4KCAA 2L4QA 4ZL8A 3HHVA 2KP1A 2ALBA 1A0FA 1R7HA 2EC4A 5DJLA 4BWQA 4XIHA 3FW2A 1M9AA 1YZXA 4TR3A 1AC1A 2GGTA 1KTEA 2HXKA 3ZFBA 4F82A 2F8AA 1TXXA 3P8WA 1HD2A 1FOVA 2VM1A 1SL0B 4IHUA 3D4TA 1F2EA 5F07A 1TRUA 2PMTA 3GRXA 2CQ9A 5DAKB 1MDKA 4Q5NA 5CREA 2HNLA 4F0BA 3GTUB 4JR4A 4FYCA 3FK8A 3IPZA 2VD1A 1FVKA 2HZEA 4FO5A 1RW1A 2X8HA 2V6KA 4LMVA 3HCZA 2EIRA 4AJ6A 4KW6A 4KX4A 2YP6A 3MNGA 1NW2A 3GL5A 2X8CA 2RUEA 2YWIA 1JZRA 3Q74A 4KH7A 4WR5A 1V57A 3BOAA 1OC9B 1BEDA 2KP2A 3UBKA 4YQMA 4F2IA 18GSA 2IIYA 2CX3A 2C0FA 2REMA 3R2QA 2H6ZA 3EMXA 4KSOA 5ECNB 4OFNA 5E59A 4TXVA 2YWMA 4CW9A 4PURA 3FY7A 4GSSA 2GVPA 1SKWB 1XOAA 3KTLA 4K6XA 1K0BA 3M1GA 4KCEA 3HJOA 5DCGA 3HY2A 5J5NA 5AIXA 4EUYA 2H70A 4BL7A 1GSUA 3RPPA 4V1Ap 5EPFA 2FGXA 3MSZA 4K0NA 1J0FA 5LD0A 4MABA 1B48A 2IPAA 3F4SA 3CRTA 2AAWA 2N5FA 4HI7A 4GSTA 1K3LA 3FHKA 2CVKA 3CMIA 4PX1A 3EC3A 1F6MC 1M2AA 4ZBAA 4WEYA 2DC5A 1TU7A 2FD3A 1TI1A 1SYRA 1GL8A 2LRTA 3Q18A 5DQSA 1LJRA 2C3TA 1HNAA 1XWKA 1S3CA 1ABAA 4HU9A 4N11A 1VGLA 2LEGA 4KA0A 1V2AA 1SENA 1A8LA 2KUCA 2CX4A 3VWUA 3VPTA 2HRAA 4L0WA 3GL3A 1V58A 5J9CA 3RDWA 1JLVA 3APQA 3C1RA 1GWCA 4HUAA 1T7PB 4TR1A 1YQ1A 2MZCA 4PUAA 4BVYA 4GTUA 13GSA 3RBTA 3SBCA 2DMMA 1AIUA 3HD5A 4GF0A 5G5FA 1PSQA 3FR3A 4AJ8A 1U88A 3TKSC 1JZDA 5G31A 2GSSA 3IV4A 5D9TA 4X1UA 2YV9A 3QMXA 2WCIA 3E0UA 2CAIA 1K0NA 1TU8A 3KP8A 4WKWA 5C04A 3CSHA 2HZEB 4O5RA 1EV9A 1VF4A 4XRAA 4Z7XA 1NSWA 5F05A 1XIYA 3ZYWA 2H71A 4K8MA 3FKFA 2DJ3A 2DJJA 2XBQA 1GTBA 2HSHA 2CZ3A 17GSA 1GSYA 4PTSA 5ENUA 2I81A 3H1NA 4ID0A 3GA4A 1TOFA 1DUGA 1O8WA 3GX0A 2PUKC 4HZ2A 22GSA 5CO3A 2VL3A 2DMLA 1SKRB 4OFMA 4AF2A 4K7IA 2K8SA 3EYTA 1BG5A 4GRFA 5AGYA 3TJKA 1GTUA 3CYNA 3W8JA 3D4MA 4RQRA 4YH2A 4O92A 1O85A 5IIZA 4RUVA 4YAVA 4BL7B 2OBIA 4EE0A 1Z9HA 4MF5A 5HQPA 1M2DA 3LORA 4KDXA 2R4VA 4X0XA 3RHCA 1SK2A 2LS5A 3DRNA 1DE1A 3C7MA 2MYGA 2GZZA 1XWCA 3UBLA 4IQ1A 4V2NA 4OFTA 5CRHA 1PL2A 1GTIA 2C3NA 2HRFA 2YCDA 4OWYA 2YZHA 1BQ7A 4MZBA 3WT2A 2CT6A 2VCWA 2BMXA 3KD0A 1XBSA 2J9HA 3EINA 1WWJA 1AQVA 2GQLA 3ERWA 3ZZXA 1HNBA 1Q4JA 2B1KA 5G30A 2R5GA 3UVHA 1YF1A 5B8BA 3HJPA 2RM5A 2E2MA 3O3TA 3KZQA 1M9BA 4N10A 2LJKA 4TRXA 5IO2A 1ML6A 4I97A 4HJMA 4G10A 2TRXA 2K18A 2KLXA 4FH8A 3UAPA 3IAS2 3DD3A 3K8NA 4ML1A 10GSA 1U3AA 2R3XA 4BVYB 3DYRA 4GWRA 2XPEA 6GSWA 2IMEA 1TK8B 1PN9A 4TVEA 2QSIA 1YF0A 3WGEA 2MBTA 1K0MA 2B5YA 1J9BA 5DBQA 2IWTA 4GQFA 4POMA 2LRCA 4JE1A 2L6DA 2PWJA 3BCIA 2P5QA 1UN2A 3QCPA 2GLRA 1MDIA 3F3RA 4I2TA 4GLTA 4EKZA 1Z7PA 2M80A 5INYA 4MK3A 1F9MA 4ZILA 1OE8A 1XVQA 1PQNA 2MMOA 2C4JA 2PBJA 3D22A 5E4WA 11GSA 3M9KA 2NTOA 3GHAA 1OE7A 3PINA 5FT3A 1PX7A 3TOUA 1TK0B 4JU5A 2HSMB 2WFCA 4WBJA 1K0OA 3KGKA 3ZIVA 3IXRA 3E3EA 4PQ1A 2WULA 1GSFA 5C00A 2JZTA 1YDKA 1VF3A 4L5LA 5A5KA 2L5OA 2B3SA 1EOGA 2VL2A 5AISA 1R26A 1PL1A 3GSTA 2C0DA 3TKQA 2CAQA 2C1YA 4D73A 2H30A 3GKKA 1QUWA 5CRWA 5ECRB 4MCUA 3F6FA 1K0DA 3HVSA 1W4VA 4V2MA 16GSA 3GURA 3QD9A 3SWLA 2DIZA 3LQ7A 3GFKA 5CNWA 5JCGA 3WYWA 2FCHA 4EO3A 4KDUA 5D8IA 3EU4A 5EVOA 4OCFA 4GSNA 2H0GA 2VCQA 2VLVA 2O7KA 2C80A 1N2AA 1AQWA 4ILFA 2WDUA 1A0RP 1E6BA 4PQHA 4YQUA 1GUKA 1X5EA 4H86A 4X43A 4EC0A 3NZNA 1BJXA 3F9UA 1YEXA 3A2XA 1GLQA 1KNGA 1TP9A 2NVLA 2FWEA 5FWGA 1X5CA 1PD21 1G6YA 1LBKA 5D9XA 4HS1A 3J7Yb 1FHEA 4KAEA 4JRRA 1GULA 2IMDA 2XPDA 1BX9A 1DSBA 1B4PA 1YY7A 2IMIA 3Q19A 4JBBA 1AXDA 5D96A 2LKUA 5D9VA 2LTKA 3FZ9A 3NIVA 1SL1B 1F3BA 1QXHA 4ECIA 5A4UA 2JZRA 3ZVJD 3WT1A 4K1FA 1HNCA 3VI5A 4FQUA 4PNGA 2OACA 5AN1A 5HR3A 2PN8A 1ERWA 3ISOA 1O81A 1WE0A 3HKRA 3IR4A 4TXOB 2VOCA 5IMAA 3FYGA 5IOXA 5LCZA 3EWLA 4PGTA 5IM9A 3VWVA 1WMJA 5FHIA 1A2JA 3C73A 3KXOA 3HXSA 2PPTA 2ZCTA 1VF2A 2L4CA 1V98A 4PUFC 4G0LA 2O85A 4ZB6A 2PU9C 3GN3A 3KMOA 3IDVA 4YAPA 2CV4A 3LYPA 2GSRA 1FB0A 3KTBA 5HFIA 5ECMB 3I43A 3DGQA 1NM3A 3IBHA 1Z7RA 2RIIA 5J9BA 1MD4A 4WF4A 4DVCA 3G7IA 3DXBA 3UIWA 2MMAA 2F3MA 2ZNMA 2CZ2A 3MWHA 1YEPA 4QQ7A 4KSMA 4XRDA 1TK5B 1OYJA 5D93A 3EU3A 6GSSA 3MDKA 1G7EA 1Y25A 1PKWA 2B5XA 5IMZA 4IJ3A 1AQXA 2QKEA 4TR4A 1MTCA 2OADA 3FZ5A 3TJBA 2YJHA 2VUPA 3H79A 4FIWA 4D73B 4TW5A 3JCML 1QFNA 4EDYA 1TW9A 4JEDA 6GSYA 3F3QA 1Z5YE 3N9JA 3KJYA 3ERGA 7GSSA 4TKYA 3G9BA 2IMKA 4PQIA 3LG6A 1YKAA 4V2LA 4NV2A 4L8EA 2UZ8A 4LL4B 1QQ2A 4NV5A 3J7Yk 4G0KA 2BJXA 1RK4A 3TUEA 3HZ4A 4USSA 1Z3EA 2VM2A 1H75A 4K7NA 4CHSA 4YQVA 2YPMA 2GTUA 1I9DA 3TCOA 3ZREA 1GRXA 1CQHA 5B6MA 1G7OA 1LU4A 1NHYA 1A8YA 3IAM2 2O87A 5LNKe 1I5GA 4HOJA 2CVBA 4WXTA 5CYYA 3F6DA 1SYXA 1K0CA 4BPYA 4QL9A 4XTSA 3GYKA 2AHEA 2LJAA 2HRNA 4MH3A 3APSA 2OA7A 3KH7A 3D6IA 4GXZA 5ELAA 4MF6A 1YKCA 4NAXA 4KF9A 2CA8A 6GSTA 5HR1A 3A5WA 2H01A 4L0UA 1OC8A 1XW6A 2WGRA 4BA7A 2GQMA 2HE3A 2L6CA 5IMCA 5A4VA 3I69A 2FNOA 2HQTA 3ZMLA 19GSA 3CBUA 2B7KA 2R6KA 3QOUA 2JZSA 3GNJA 3GH6A 5D9WA 3DIEA 5J3RA 2HSMA 3IRAA 4ZIJA 2JU5A 1B4QA 1ZCPA 9GSSA 1EEJA 4ECCA 3DVXA 4QL7A 1O6JA 3UL3A 4OCEA 3LEFA 1X9SB 3DKSA 2VCTA 1R4WA 4MJAA 3RAZA 4J2FA 1J08A 4MZCA 1GNEA 3L78A 2AJQB 2MMZA 2AUVA 3UEMA 5F06A 1VF1A 3M3MA 3P7XA 1N8JA 1ILOA 1XOBA 4DSRA 5IO0A 5BMUA
chains in the Genus database with same CATH superfamily
1SJZA 1TXUA 1TJDA 4K7OA 4K2DA 3RHBA 1S3DA 2B7JA 2GZYA 4ZBDA 1KEBA 5F0GA 1XXUA 4HJ2A 1M0UA 3FZAA 5KEJA 4XS4A 3CTFA 3QAVA 4OD7A 3L4NA 1K0AA 5JCUA 3C8EA 1M3IA 5JCWA 1F3AA 2GS3A 4EXJA 2VLTA 1AAZA 1GSDA 2VO4A 3ZRDA 1Y1UA 2EIOA 3L9VA 2R37A 1T00A 3LJRA 3ZMKA 2WJUA 3GSSA 3EVIA 4E8EA 3VI7A 2X4AA 4RQXA 1FOHA 4CDOA 2H8LA 5IOWA 4ACSA 4MLYA 2AB6A 1FB6A 1URMA 1FW1A 2FUG2 5KN0A 3CTGA 4E8HA 5CP1A 3KMNA 5CRDA 5HR2A 3E9JB 3PR8A 2DKHA 2NDOA 4KE3A 4N0ZA 2ES7A 5AIVA 1WIKA 4RI7A 2TRCP 1XWAA 1MEKA 2WRTA 2C3QA 2WB9A 2HSNA 5CRGA 2DJ0A 1ERUA 3GUSA 2H75A 4TXOA 1GLPA 2C0GA 4KGIA 5JWQB 2LQOA 4IN0A 4F0CA 3FMWA 1FVJA 1XG8A 1U87A 3U5RE 5CAXA 2ON7A 3KH9A 1XWBA 3IK7A 1G0TA 2OJLA 3VURA 3HZ8A 3OR5A 4ECJA 3FR9A 3QAWA 2A4VA 2DBCA 3W8SA 2RM6A 4TR0A 2H1BA 3GKMA 4IVFA 3KP9A 4MF7A 3FEUA 4EIPA 4EF0A 3QAGA 2FLSA 5HR0A 5L71A 4G19A 2MMNA 4XS6A 1NHOA 4DEJA 3H8QA 4GCIA 3KM6A 1M99A 3US3A 2H6YA 20GSA 1ZYEA 5JWRB 2QGVA 3P90A 5IQYA 5ECQB 2RUFA 4AGSA 4NPBA 3TKSE 4Q5RA 2OE3A 3HVNA 3CSJA 1OKTA 1K3YA 1M7TA 2NBSA 3BJ5A 4O7HA 5J47A 3O76A 3TRQA 3IOSA 3EPTA 4I8BA 4KUNA 1GUHA 1GUMA 2E7PA 6GSXA 4P3YB 1PMTA 2G2QA 2V2GA 5H5QA 3IHQA 4F9ZA 2IFQA 4EL1A 4G9HA 4HZ4A 2JADA 2FA8A 2E0QA 5BMUB 4JZQA 3HVVA 3DVWA 2F8FA 1C72A 5G1LA 3UOMA 2HZFA 3VPQA 2H0IA 4MJEA 1H4OA 1O8XA 4XS4B 2R2JA 1GTAA 2NPBA 3EMPA 3IC8A 3G7JA 4OMVA 3HA9A 3M9JA 2JACA 4WF5A 1I1IP 1MD3A 2I4AA 1EGRA 4MDCA 3A2WA 2B5EA 1XPVA 5G2ZA 2WW3A 5BRTA 3VWWA 2FWHA 2E2GA 2HI7A 1U6TA 2VL9A 1Z6NA 4I2UA 3GKXA 2Z9SA 4EVMA 4Q5QA 1X5DA 2P5RA 3UMAA 2EIQA 1OC3A 3LSZA 4IQAA 3ERFA 3BBYA 3CSIA 4OO5A 1UC7A 2H6XA 4Z2RA 2GDRA 4HEA2 3HVXA 2GT6A 2KOKA 3KCMA 2HSNB 3NOFA 2P31A 2XC2A 4N3ZA 1EEMA 2VD0A 1A23A 2VCZA 2B6MA 3IK9A 4MH2A 2EFCA 5DCHA 2CVDA 3FR6A 5JWOB 2V1MA 4PXOA 3A5IA 1FO5A 2JSZA 1ZYPA 1IYIA 1V9WA 3A2VA 3S9FA 2QA1A 4ZB9A 3F4RA 3TRXA 2YZUA 2H1DA 1SD9A 2K6VA 4IP1A 3TKSA 4IELA 3ZTLA 3EURA 3H4KA 5ECKB 3ME8A 5KN1A 1WPIA 4AKIA 2B1LA 4ISDA 5ECHB 1ZYQB 1N25A 2K8VA 3TKRA 1EWXA 3UARA 4NHWA 2DJ2A 2WZ9A 2G0FA 1X9MB 1CQGA 2YN1A 3A3TA 3D21A 1YVLA 1GP1A 5A1NA 1THXA 4DSSA 1Q98A 2L5LA 2VL2C 3QR6A 6GSVA 1AUCA 1TRWA 5ECLB 3V1WA 1R5AA 4BVXA 1B9XC 2VAFA 2YJ7A 4HSCX 1QK8A 2IJYA 1SJIA 2J23A 3ZFLA 1THOA 2IFQB 1PA3A 3KEBA 1W89A 4LMWA 1T3BA 3TDGA 1HYUA 12GSA 3D5JA 3GH9A 3L9UA 2V6OA 2LRNA 4K0GA 1PGTA 5B6NA 4POBA 1RQMA 1XWGA 3D0ZA 1JZOA 2HSYA 2IN3A 14GSA 2N5AA 4IJIA 1SJ6A 3C1SA 2TIRA 5DQYA 3ZIJA 3EE2A 4EDZA 4PNFA 4WETA 1PKZA 1SD8A 1DE2A 3ED3A 2X99A 1ZZYA 4K9ZA 5ELGA 2VCXA 5KN3A 3I6AA 4ICYA 2H0HA 4I5QA 2IL3A 2H76A 2I9HA 1TRVA 2H1GA 2C8UA 1XCCA 2EFEA 3F63A 3CRUA 2C0EA 1EZKA 2YOIA 4N30A 1T8EB 3O6TA 4YKFA 4POKA 4IS0A 2ON5A 3HYPA 3DWVA 2DSAA 5IMFA 1ON4A 4V1Ag 3LW9A 4IW9A 2HRKA 2HYXA 1A24A 5DDLA 1YJ6A 3IE3A 4JR6A 2FWFA 8GSSA 1EV4A 3QPMA 1A2LA 3CXGA 1UVZA 5DALA 2FHEA 4XCSA 4RI6A 2VCVA 2L57A 3GMFA 3QFBC 5HFKA 4J56E 3PGTA 1WP0A 2VIMA 4NHZA 1FAAA 4O5QA 5HFGA 1GNWA 1AW9A 2X8GA 3FZ4A 2EFDA 4G0IA 2O5VA 2WS2A 2H72A 1X9WB 4NXIA 2KHPA 3Q6OA 1HQOA 3PPUA 4AJ7A 3WGXA 5ECPB 2IMFA 2H74A 2FY6A 5DVBA 4ZXGA 2LQQA 1X0RA 5F8BA 3ME7A 2XBIA 4WBRD 5ECSA 1XW9A 4MP4A 1OVNA 2VLUA 2PGTA 4HQZA 5A1NB 2X64A 1T4ZA 1PX6A 1XVWA 4DSSB 2PVQA 2GSQA 1JZWA 4NWYA 1ZOFA 2I1UA 4IKHA 4BVXB 2I3YA 1FG4A 4KNDA 1SKSB 1KBNA 2DJ1A 2O8VB 1USBA 3I9V2 4MJBA 1WJKA 2H19A 1IYHA 2PVOC 1JFUA 2LUSA 2WW2A 1ZMAA 3ZL5A 5ABRA 2FWGA 4TN8A 1R5PA 4POLA 2DIYA 5DJMA 1UA5A 3QDNA 4ZBBA 5H5SA 4IP6A 1BYEA 4LA1A 4IGJA 3LXTA 2WW0A 3TJJA 1TDIA 4O32A 2LNTA 4CY6A 4EIQA 1JHBA 2YWNA 4ML6A 4PI2C 1TKDB 1OKDA 2OE1A 5ID2A 2H1AA 2F51A 1QMVA 4MA9A 3P2AA 1VRSD 1Y6EA 2YWOA 1K3OA 3VWXA 3VFIA 3F8UA 3VLNA 4HU7A 5IPHA 2LJRA 2M46A 4ZB8A 1PFOA 4LL1B 4HQSA 1EOHA 1DBYA 5B8AA 1F37A 2LV3A 3HMJG 2PERA 3ZVJA 2F9SA 5KN2A 1Z6MA 4ECBA 2L59A 4MPFA 1BF5A 5ECOB 2FA4A 4IBPA 5J4UA 3GV1A 1GSSA 2YANA 3VK9A 3TRPA 2LSTA 3WGDA 2GSTA 2LNSA 1XZOA 5COHA 1E2YA 1ZL9A 1T1VA 2V41A 3LWAA 4TR1B 1B9YC 2HRKB 4XHMA 1G6WA 2ZUPA 5A4WA 3DEXA 3UJ1A 2DLXA 3M0FA 1OAZA 1GSQA 3LXZA 3UVTA 2YV7A 2A2RA 1SL2B 1ERTA 2MBSA 4ZL9A 5DALB 2AYTA 4MJCA 1BAYA 5DAKA 2R0PA 2H73A 3GTUA 3LFLA 2D2ZA 2JSYA 5G5EA 2HT9A 2V32A 4NMUA 2A2SA 3L9SA 2OKAA 5ECIB 2UV8G 3L0HA 3IC4A 2P0GA 5GAND 4KB3A 6GSUA 4MMMA 5EL8A 4BWSA 4KDYA 3TJFA 3APOA 2HLSA 2VKZG 3TGZA 2M72A 5IMVA 4DSQA 1OC9A 3HJMA 1GH2A 4N0VA 3W6GA 1XFLA 1PRXA 1U3IA 1TTZA 4Z2UA 4WR4A 3HDCA 4G2EA 3R3EA 4OO4A 2HFDA 1ACVA 3PH9A 3IA1A 5IPGA 4ZL7A 3H93A 3N5OA 2YNXA 3TB2A 4J57E 1EP8A 1ERVA 5GSTA 2GQKA 2OE0A 3ZITA 2O36A 5D73A 1WOUA 2N5BA 1TI3A 2DJKA 5H5RA 3FRCA 1SK0A 1ST9A 3GX8A 5J41A 3RPNA 3AY8A 4CY8A 5GSSA 4I6XA 4TOPA 1S3AA 4GQCA 3TOTA 3KIJA 1B8XA 3LYKA 3LGCA 3G7YA 1ZGNA 2BTOT 4LLRA 1QGVA 4XS1A 5B7CA 4HDEA 3ZLPA 1SK1A 1EP7A 2GT5A 3MAKA 2K9FA 3BD2A 2AV4A 3WD6A 3U6VA 1T4YA 2QC7A 1MDJA 4X4JA 3GKNA 3M8NA 3GIXA 1SU9A 4FYUA 2RLIA 3QFAC 3BCKA 3CWGA 1O73A 5ID2B 2XHFA 4FYBA 1JLWA 4Q5FA 5GZZB 1XW5A 5J40A 5G1KA 1V40A 4F03A 4L5OA 3C71A 4ZB7A 1M2BA 3F0IA 4ULXA 5EY6A 3TKPA 1GSEA 2H66A 1EGOA 5GAPD 4FXYP 2DKIA 5IMDA 4MPGA 1A2MA 3DMLA 1O7UA 3F4TA 2GZPA 2OBKA 3TJGA 1TRSA 1WRYA 2WZSA 4MZWA 2O89A 2JL4A 4KCAA 3RFRC 2L4QA 4ZL8A 3HHVA 2KP1A 2ALBA 1A0FA 1R7HA 2EC4A 5DJLA 4BWQA 4XIHA 3FW2A 1M9AA 1YZXA 4TR3A 4PI0C 1AC1A 2GGTA 1KTEA 2HXKA 3ZFBA 4F82A 2F8AA 1TXXA 3P8WA 1HD2A 1FOVA 5A34A 2VM1A 1SL0B 4IHUA 3D4TA 1F2EA 5F07A 1TRUA 2PMTA 3GRXA 2CQ9A 5DAKB 1MDKA 4Q5NA 5CREA 2HNLA 4F0BA 3GTUB 4JR4A 4AKXB 4FYCA 3FK8A 3IPZA 2VD1A 1FVKA 2HZEA 4FO5A 1RW1A 2X8HA 2V6KA 4LMVA 3HCZA 2EIRA 4AJ6A 4KW6A 4KX4A 2YP6A 4AI6A 4W66A 3MNGA 1NW2A 3GL5A 2X8CA 2RUEA 2YWIA 1JZRA 3Q74A 4KH7A 4WR5A 1V57A 3BOAA 1OC9B 1BEDA 2KP2A 3UBKA 4YQMA 4F2IA 18GSA 2IIYA 2CX3A 2C0FA 2REMA 3R2QA 2H6ZA 3EMXA 4KSOA 5ECNB 4OFNA 5E59A 2X49A 4TXVA 2YWMA 1YEWC 4CW9A 3IHGA 4PURA 3FY7A 4GSSA 2GVPA 1SKWB 1XOAA 3KTLA 4K6XA 1K0BA 3M1GA 4KCEA 3HJOA 5DCGA 3HY2A 5J5NA 5AIXA 4EUYA 2H70A 4BL7A 1GSUA 3RPPA 4V1Ap 5EPFA 2FGXA 3MSZA 4K0NA 1J0FA 5LD0A 4MABA 1B48A 2IPAA 3F4SA 3CRTA 2AAWA 2N5FA 4HI7A 4GSTA 1K3LA 2WVYA 3FHKA 2CVKA 3CMIA 4PX1A 3EC3A 1F6MC 1M2AA 4ZBAA 4WEYA 2DC5A 1TU7A 2FD3A 1TI1A 1SYRA 1GL8A 2LRTA 3Q18A 5DQSA 1LJRA 2C3TA 1HNAA 1XWKA 1S3CA 1ABAA 4HU9A 4N11A 2OT3A 1VGLA 2LEGA 4KA0A 1V2AA 1SENA 2A2PA 1A8LA 2KUCA 2CX4A 3VWUA 3VPTA 2HRAA 4L0WA 3GL3A 1V58A 5J9CA 3CHXC 3RDWA 1JLVA 3APQA 3C1RA 1GWCA 4HUAA 1T7PB 4TR1A 1YQ1A 2MZCA 4AKHA 4PUAA 4BVYA 4GTUA 13GSA 3RBTA 4AKGA 3SBCA 2DMMA 1AIUA 3HD5A 4GF0A 5G5FA 2O3EA 1PSQA 3FR3A 4AJ8A 5A34B 1U88A 3TKSC 1JZDA 5G31A 5J4YA 3MYDA 2GSSA 3IV4A 5D9TA 4X1UA 2YV9A 3QMXA 2WCIA 3E0UA 2CAIA 1K0NA 1TU8A 3KP8A 4WKWA 5C04A 3CSHA 2HZEB 4O5RA 1EV9A 2WVXA 1VF4A 4XRAA 4Z7XA 1NSWA 1ZYNA 1S3RA 4K2XA 5F05A 1XIYA 3ZYWA 2H71A 4K8MA 3FKFA 2DJ3A 2DJJA 2XBQA 1GTBA 2HSHA 2CZ3A 1SVLA 17GSA 1GSYA 4PTSA 5ENUA 2I81A 3H1NA 4ID0A 3GA4A 1TOFA 1DUGA 1O8WA 3GX0A 2PUKC 4HZ2A 22GSA 5CO3A 2VL3A 2DMLA 2QA2A 1SKRB 4OFMA 4AF2A 1PN0A 4K7IA 2K8SA 3EYTA 1BG5A 4GRFA 5AGYA 3TJKA 1GTUA 4QMKA 4E68A 3CYNA 3W8JA 3D4MA 4RQRA 4YH2A 4O92A 1O85A 5IIZA 4RUVA 4YAVA 5A5HA 4BL7B 2OBIA 4EE0A 1Z9HA 4MF5A 5HQPA 3TU3B 1M2DA 3LORA 4KDXA 2R4VA 4X0XA 3RHCA 1SK2A 2LS5A 3DRNA 1DE1A 3C7MA 2MYGA 2GZZA 1M3JA 1XWCA 3UBLA 4IQ1A 4V2NA 4OFTA 5CRHA 1PL2A 1GTIA 2C3NA 2HRFA 2YCDA 4OWYA 2YZHA 1BQ7A 4MZBA 3WT2A 2CT6A 2VCWA 2BMXA 3KD0A 1XBSA 2J9HA 3EINA 1WWJA 1AQVA 2GQLA 3ERWA 3ZZXA 1HNBA 1Q4JA 2B1KA 5G30A 2R5GA 3UVHA 1YF1A 5B8BA 3HJPA 2RM5A 2E2MA 3O3TA 3KZQA 1M9BA 2WW1A 4N10A 2LJKA 4TRXA 5IO2A 1ML6A 4I97A 4G10A 4HJMA 2TRXA 2K18A 2KLXA 4FH8A 3UAPA 3IAS2 3DD3A 3K8NA 4ML1A 10GSA 1U3AA 2R3XA 4BVYB 3DYRA 4GWRA 2XPEA 6GSWA 2IMEA 1TK8B 1PN9A 4TVEA 2QSIA 1YF0A 3WGEA 2MBTA 1K0MA 2B5YA 1J9BA 5DBQA 2IWTA 4GQFA 4POMA 2LRCA 4JE1A 2L6DA 2PWJA 3RGBC 2P5QA 3BCIA 1UN2A 3QCPA 2GLRA 1MDIA 3F3RA 4I2TA 4GLTA 4EKZA 1Z7PA 2M80A 5INYA 4MK3A 1F9MA 4ZILA 1OE8A 1XVQA 1PQNA 2MMOA 2C4JA 2PBJA 3D22A 5E4WA 11GSA 3M9KA 2NTOA 3GHAA 1OE7A 3PINA 5FT3A 1PX7A 3TOUA 1TK0B 2WVXB 4JU5A 2HSMB 2WFCA 4WBJA 1K0OA 3KGKA 3ZIVA 3IXRA 3E3EA 4PQ1A 2WULA 1GSFA 1SVOA 5C00A 2JZTA 1YDKA 1VF3A 4L5LA 5A5KA 2L5OA 2B3SA 2R0CA 1EOGA 2VL2A 5AISA 1R26A 1PL1A 3GSTA 2C0DA 3TKQA 2CAQA 2C1YA 4D73A 2H30A 3GKKA 1QUWA 5CRWA 5ECRB 4MCUA 3F6FA 1K0DA 3HVSA 1SVMA 1W4VA 4V2MA 16GSA 3GURA 3QD9A 3SWLA 2DIZA 3LQ7A 3GFKA 5CNWA 2A4HA 5JCGA 3WYWA 2FCHA 4EO3A 4KDUA 5D8IA 3EU4A 5EVOA 4OCFA 4GSNA 2H0GA 2VCQA 2VLVA 2O7KA 5A5HB 2C80A 1N2AA 1AQWA 4ILFA 2WDUA 1A0RP 1E6BA 4PQHA 4YQUA 1GUKA 1X5EA 4H86A 4X43A 4EC0A 3NZNA 1BJXA 3F9UA 1YEXA 3A2XA 1GLQA 1KNGA 1TP9A 2NVLA 2FWEA 5FWGA 1X5CA 1PD21 4O5UA 1G6YA 1LBKA 5D9XA 4HS1A 3J7Yb 1FHEA 4KAEA 1S4BP 4YKGA 4JRRA 1GULA 2IMDA 2XPDA 1BX9A 1DSBA 1B4PA 1YY7A 2IMIA 3Q19A 4JBBA 1AXDA 5D96A 2LKUA 5D9VA 2LTKA 3FZ9A 3NIVA 1SL1B 1F3BA 1QXHA 4ECIA 5A4UA 2JZRA 3ZVJD 3WT1A 4K1FA 1HNCA 3VI5A 4FQUA 4PNGA 2OACA 5AN1A 5HR3A 2PN8A 1ERWA 3ISOA 1O81A 4MNNA 1WE0A 3HKRA 3IR4A 4TXOB 2VOCA 5IMAA 3FYGA 5IOXA 5LCZA 3EWLA 4PGTA 5IM9A 3VWVA 1WMJA 5FHIA 1A2JA 3C73A 3KXOA 3HXSA 2PPTA 2ZCTA 1VF2A 2L4CA 3CQFA 1V98A 4PUFC 4G0LA 2O85A 4ZB6A 4K5SA 2PU9C 3GN3A 3KMOA 3IDVA 4YAPA 2CV4A 3LYPA 2GSRA 4K5RA 1FB0A 3KTBA 5HFIA 5ECMB 3I43A 3DGQA 1NM3A 3IBHA 1Z7RA 2RIIA 5J9BA 1MD4A 4WF4A 4DVCA 3G7IA 3DXBA 3UIWA 2MMAA 2F3MA 2ZNMA 2CZ2A 3MWHA 1YEPA 4QQ7A 4KSMA 4XRDA 1TK5B 1OYJA 5D93A 3EU3A 6GSSA 3MDKA 1G7EA 1Y25A 1PKWA 2B5XA 5IMZA 4IJ3A 1AQXA 2QKEA 2WVZA 4TR4A 2R0GA 1MTCA 2OADA 3FZ5A 3TJBA 2YJHA 5KOWA 2VUPA 3H79A 4FIWA 4D73B 4TW5A 3JCML 1QFNA 4EDYA 1TW9A 4JEDA 6GSYA 3F3QA 1Z5YE 3N9JA 3KJYA 3ERGA 7GSSA 4BIKA 4A5PA 4TKYA 3G9BA 2IMKA 4PQIA 3LG6A 1YKAA 4V2LA 4NV2A 4L8EA 5J4VA 2UZ8A 4LL4B 1QQ2A 4NV5A 3J7Yk 4G0KA 2BJXA 1RK4A 3TUEA 3HZ4A 4USSA 1Z3EA 2VM2A 1H75A 4K7NA 4CHSA 4YQVA 2YPMA 2GTUA 1I9DA 3TCOA 3ZREA 1GRXA 1CQHA 5B6MA 1G7OA 1LU4A 1NHYA 4G01A 1A8YA 4PHZC 3IAM2 2O87A 5LNKe 1I5GA 4HOJA 2CVBA 2EFHA 4WXTA 5CYYA 3F6DA 1SYXA 1K0CA 4BPYA 4QL9A 4XTSA 3GYKA 2AHEA 2LJAA 2HRNA 4MH3A 3APSA 2OA7A 3KH7A 3D6IA 4GXZA 5ELAA 4MF6A 1YKCA 4NAXA 4KF9A 5KOXA 2CA8A 6GSTA 5HR1A 3A5WA 2H01A 4L0UA 1OC8A 1XW6A 2H1LA 2WGRA 4BA7A 2GQMA 2HE3A 2L6CA 5IMCA 4GDFA 5A4VA 3I69A 2FNOA 2HQTA 3ZMLA 19GSA 3CBUA 2B7KA 2R6KA 3QOUA 2JZSA 3GNJA 3GH6A 5D9WA 3DIEA 5J3RA 2HSMA 3IRAA 4ZIJA 2JU5A 1B4QA 1ZCPA 9GSSA 1EEJA 1BG1A 4ECCA 4Z2TA 3DVXA 4QL7A 1O6JA 3UL3A 4OCEA 3LEFA 1X9SB 3DKSA 2VCTA 1R4WA 4MJAA 3RAZA 4J2FA 1J08A 4MZCA 1GNEA 3L78A 3MIXA 2AJQB 2MMZA 2AUVA 3UEMA 5F06A 1VF1A 3M3MA 3P7XA 1N8JA 1ILOA 1XOBA 4DSRA 5IO0A 5BMUA
chains in the Genus database with same CATH topology
1SJZA 1TXUA 1TJDA 4K7OA 4K2DA 3RHBA 1S3DA 2B7JA 2GZYA 4ZBDA 1KEBA 5F0GA 1XXUA 4HJ2A 1M0UA 3FZAA 5KEJA 4XS4A 3CTFA 3QAVA 4OD7A 3L4NA 1K0AA 5JCUA 3C8EA 5JCWA 1F3AA 2GS3A 4EXJA 2VLTA 1AAZA 1GSDA 2VO4A 3ZRDA 1Y1UA 2EIOA 3L9VA 2R37A 1T00A 3LJRA 3ZMKA 2WJUA 3GSSA 3EVIA 4E8EA 3VI7A 2X4AA 4RQXA 1FOHA 4CDOA 2H8LA 5IOWA 4ACSA 4MLYA 2AB6A 1FB6A 1URMA 1FW1A 2FUG2 5KN0A 3CTGA 4E8HA 5CP1A 3KMNA 5CRDA 5HR2A 3E9JB 3PR8A 2DKHA 2NDOA 4KE3A 4N0ZA 2ES7A 5AIVA 1WIKA 4RI7A 2TRCP 1XWAA 1MEKA 2WRTA 2C3QA 2WB9A 2HSNA 5CRGA 2DJ0A 1ERUA 3GUSA 2H75A 4TXOA 1GLPA 2C0GA 4KGIA 5JWQB 2LQOA 4IN0A 4F0CA 3FMWA 1FVJA 1U87A 3U5RE 5CAXA 2ON7A 3KH9A 1XWBA 3IK7A 1G0TA 2OJLA 3VURA 3HZ8A 3OR5A 4ECJA 3FR9A 3QAWA 2A4VA 2DBCA 3W8SA 2RM6A 4TR0A 2H1BA 3GKMA 4IVFA 3KP9A 4MF7A 3FEUA 4EIPA 4EF0A 3QAGA 2FLSA 5HR0A 5L71A 4G19A 2MMNA 4XS6A 1NHOA 4DEJA 3H8QA 4GCIA 3KM6A 1M99A 3US3A 2H6YA 20GSA 1ZYEA 5JWRB 2QGVA 3P90A 5IQYA 5ECQB 2RUFA 4AGSA 4NPBA 3TKSE 4Q5RA 2OE3A 3CSJA 1OKTA 1K3YA 1M7TA 2NBSA 3BJ5A 4O7HA 5J47A 3O76A 3TRQA 3IOSA 3EPTA 4I8BA 4KUNA 1GUHA 1GUMA 2E7PA 6GSXA 4P3YB 1PMTA 2G2QA 2V2GA 5H5QA 3IHQA 4F9ZA 2IFQA 4EL1A 4G9HA 4HZ4A 2JADA 2FA8A 2E0QA 5BMUB 4JZQA 3HVVA 3DVWA 2F8FA 1C72A 5G1LA 3UOMA 2HZFA 3VPQA 2H0IA 4MJEA 1H4OA 1O8XA 4XS4B 2R2JA 1GTAA 2NPBA 3EMPA 3IC8A 3G7JA 4OMVA 3HA9A 3M9JA 2JACA 4WF5A 1MD3A 2I4AA 1EGRA 4MDCA 3A2WA 2B5EA 1XPVA 5G2ZA 5BRTA 3VWWA 2FWHA 2E2GA 2HI7A 1U6TA 2VL9A 1Z6NA 4I2UA 3GKXA 2Z9SA 4EVMA 4Q5QA 1X5DA 2P5RA 3UMAA 2EIQA 1OC3A 3LSZA 4IQAA 3ERFA 3BBYA 3CSIA 4OO5A 1UC7A 2H6XA 4Z2RA 2GDRA 4HEA2 3HVXA 2GT6A 2KOKA 3KCMA 2HSNB 3NOFA 2P31A 2XC2A 4N3ZA 1EEMA 2VD0A 1A23A 2VCZA 2B6MA 3IK9A 4MH2A 2EFCA 5DCHA 2CVDA 3FR6A 5JWOB 2V1MA 4PXOA 3A5IA 1FO5A 2JSZA 1ZYPA 1IYIA 1V9WA 3A2VA 3S9FA 2QA1A 4ZB9A 3F4RA 3TRXA 2YZUA 2H1DA 1SD9A 2K6VA 4IP1A 3TKSA 4IELA 3ZTLA 3EURA 3H4KA 5ECKB 3ME8A 5KN1A 1WPIA 4AKIA 2B1LA 4ISDA 5ECHB 1ZYQB 1N25A 2K8VA 3TKRA 1EWXA 3UARA 4NHWA 2DJ2A 2WZ9A 2G0FA 1X9MB 1CQGA 2YN1A 3A3TA 3D21A 1YVLA 1GP1A 5A1NA 1THXA 4DSSA 1Q98A 2L5LA 2VL2C 3QR6A 6GSVA 1AUCA 1TRWA 5ECLB 3V1WA 1R5AA 4BVXA 1B9XC 2VAFA 2YJ7A 1QK8A 2IJYA 1SJIA 2J23A 3ZFLA 1THOA 2IFQB 1PA3A 3KEBA 1W89A 4LMWA 1T3BA 3TDGA 1HYUA 12GSA 3D5JA 3GH9A 3L9UA 2V6OA 2LRNA 4K0GA 1PGTA 5B6NA 4POBA 1RQMA 1XWGA 3D0ZA 1JZOA 2HSYA 2IN3A 14GSA 2N5AA 4IJIA 1SJ6A 3C1SA 2TIRA 5DQYA 3ZIJA 3EE2A 4EDZA 4PNFA 4WETA 1PKZA 1SD8A 1DE2A 3ED3A 2X99A 1ZZYA 4K9ZA 5ELGA 2VCXA 5KN3A 3I6AA 4ICYA 2H0HA 4I5QA 2IL3A 2H76A 2I9HA 1TRVA 2H1GA 2C8UA 1XCCA 2EFEA 3F63A 3CRUA 2C0EA 1EZKA 2YOIA 4N30A 1T8EB 3O6TA 4YKFA 4POKA 4IS0A 2ON5A 3HYPA 3DWVA 2DSAA 5IMFA 1ON4A 4V1Ag 3LW9A 4IW9A 2HRKA 2HYXA 1A24A 5DDLA 1YJ6A 3IE3A 4JR6A 2FWFA 8GSSA 1EV4A 3QPMA 1A2LA 3CXGA 1UVZA 5DALA 2FHEA 4XCSA 4RI6A 2VCVA 2L57A 3GMFA 3QFBC 5HFKA 4J56E 3PGTA 1WP0A 2VIMA 4NHZA 1FAAA 4O5QA 5HFGA 1GNWA 1AW9A 2X8GA 3FZ4A 2EFDA 4G0IA 2O5VA 2WS2A 2H72A 1X9WB 4NXIA 2KHPA 3Q6OA 1HQOA 3PPUA 4AJ7A 3WGXA 5ECPB 2IMFA 2H74A 2FY6A 5DVBA 4ZXGA 2LQQA 1X0RA 5F8BA 3ME7A 2XBIA 4WBRD 5ECSA 1XW9A 4MP4A 1OVNA 2VLUA 2PGTA 4HQZA 5A1NB 2X64A 1T4ZA 1PX6A 1XVWA 4DSSB 2PVQA 2GSQA 1JZWA 4NWYA 1ZOFA 2I1UA 4IKHA 4BVXB 2I3YA 1FG4A 4KNDA 1SKSB 1KBNA 2DJ1A 2O8VB 1USBA 3I9V2 4MJBA 1WJKA 2H19A 1IYHA 2PVOC 1JFUA 2LUSA 1ZMAA 3ZL5A 5ABRA 2FWGA 4TN8A 1R5PA 4POLA 2DIYA 5DJMA 1UA5A 3QDNA 4ZBBA 5H5SA 4IP6A 1BYEA 4LA1A 4IGJA 3LXTA 3TJJA 1TDIA 4O32A 2LNTA 4CY6A 4EIQA 1JHBA 2YWNA 4ML6A 1TKDB 1OKDA 2OE1A 5ID2A 2H1AA 2F51A 1QMVA 4MA9A 3P2AA 1VRSD 1Y6EA 2YWOA 1K3OA 3VWXA 3VFIA 3F8UA 3VLNA 4HU7A 5IPHA 2LJRA 2M46A 4ZB8A 4LL1B 4HQSA 1EOHA 1DBYA 5B8AA 1F37A 2LV3A 3HMJG 2PERA 3ZVJA 2F9SA 5KN2A 1Z6MA 4ECBA 2L59A 4MPFA 1BF5A 5ECOB 2FA4A 4IBPA 5J4UA 3GV1A 1GSSA 2YANA 3VK9A 3TRPA 2LSTA 3WGDA 2GSTA 2LNSA 1XZOA 5COHA 1E2YA 1ZL9A 1T1VA 2V41A 3LWAA 4TR1B 1B9YC 2HRKB 4XHMA 1G6WA 2ZUPA 5A4WA 3DEXA 3UJ1A 2DLXA 3M0FA 1OAZA 1GSQA 3LXZA 3UVTA 2YV7A 2A2RA 1SL2B 1ERTA 2MBSA 4ZL9A 5DALB 2AYTA 4MJCA 1BAYA 5DAKA 2R0PA 2H73A 3GTUA 3LFLA 2D2ZA 2JSYA 5G5EA 2HT9A 2V32A 4NMUA 2A2SA 3L9SA 2OKAA 5ECIB 2UV8G 3L0HA 3IC4A 2P0GA 5GAND 4KB3A 6GSUA 4MMMA 5EL8A 4BWSA 4KDYA 3TJFA 3APOA 2HLSA 2VKZG 3TGZA 2M72A 5IMVA 4DSQA 1OC9A 3HJMA 1GH2A 4N0VA 3W6GA 1XFLA 1PRXA 1U3IA 1TTZA 4Z2UA 4WR4A 3HDCA 4G2EA 3R3EA 4OO4A 2HFDA 1ACVA 3PH9A 3IA1A 5IPGA 4ZL7A 3H93A 3N5OA 2YNXA 3TB2A 4J57E 1EP8A 1ERVA 5GSTA 2GQKA 2OE0A 3ZITA 5D73A 1WOUA 2N5BA 1TI3A 2DJKA 5H5RA 3FRCA 1SK0A 1ST9A 3GX8A 5J41A 3RPNA 3AY8A 4CY8A 5GSSA 4I6XA 4TOPA 1S3AA 4GQCA 3TOTA 3KIJA 1B8XA 3LYKA 3LGCA 3G7YA 1ZGNA 2BTOT 4LLRA 1QGVA 4XS1A 5B7CA 4HDEA 3ZLPA 1SK1A 1EP7A 2GT5A 3MAKA 2K9FA 3BD2A 2AV4A 3WD6A 3U6VA 1T4YA 2QC7A 1MDJA 4X4JA 3GKNA 3M8NA 3GIXA 1SU9A 4FYUA 2RLIA 3QFAC 3BCKA 3CWGA 1O73A 5ID2B 2XHFA 4FYBA 1JLWA 4Q5FA 5GZZB 1XW5A 5J40A 5G1KA 1V40A 4F03A 4L5OA 3C71A 4ZB7A 1M2BA 3F0IA 4ULXA 5EY6A 3TKPA 1GSEA 2H66A 1EGOA 5GAPD 2DKIA 5IMDA 4MPGA 1A2MA 3DMLA 1O7UA 3F4TA 2GZPA 2OBKA 3TJGA 1TRSA 1WRYA 4MZWA 2O89A 2JL4A 4KCAA 2L4QA 4ZL8A 3HHVA 2KP1A 2ALBA 1A0FA 1R7HA 2EC4A 5DJLA 4BWQA 4XIHA 3FW2A 1M9AA 1YZXA 4TR3A 1AC1A 2GGTA 1KTEA 2HXKA 3ZFBA 4F82A 2F8AA 1TXXA 3P8WA 1HD2A 1FOVA 5A34A 2VM1A 1SL0B 4IHUA 3D4TA 1F2EA 5F07A 1TRUA 2PMTA 3GRXA 2CQ9A 5DAKB 1MDKA 4Q5NA 5CREA 2HNLA 4F0BA 3GTUB 4JR4A 4AKXB 4FYCA 3FK8A 3IPZA 2VD1A 1FVKA 2HZEA 4FO5A 1RW1A 2X8HA 2V6KA 4LMVA 3HCZA 2EIRA 4AJ6A 4KW6A 4KX4A 2YP6A 4AI6A 4W66A 3MNGA 1NW2A 3GL5A 2X8CA 2RUEA 2YWIA 1JZRA 3Q74A 4KH7A 4WR5A 1V57A 3BOAA 1OC9B 1BEDA 2KP2A 3UBKA 4YQMA 4F2IA 18GSA 2IIYA 2CX3A 2C0FA 2REMA 3R2QA 2H6ZA 3EMXA 4KSOA 5ECNB 4OFNA 5E59A 2X49A 4TXVA 2YWMA 4CW9A 3IHGA 4PURA 3FY7A 4GSSA 2GVPA 1SKWB 1XOAA 3KTLA 4K6XA 1K0BA 3M1GA 4KCEA 3HJOA 5DCGA 3HY2A 5J5NA 5AIXA 4EUYA 2H70A 4BL7A 1GSUA 3RPPA 4V1Ap 5EPFA 2FGXA 3MSZA 4K0NA 1J0FA 5LD0A 4MABA 1B48A 2IPAA 3F4SA 3CRTA 2AAWA 2N5FA 4HI7A 4GSTA 1K3LA 3FHKA 2CVKA 3CMIA 4PX1A 3EC3A 1F6MC 1M2AA 4ZBAA 4WEYA 2DC5A 1TU7A 2FD3A 1TI1A 1SYRA 1GL8A 2LRTA 3Q18A 5DQSA 1LJRA 2C3TA 1HNAA 1XWKA 1S3CA 1ABAA 4HU9A 4N11A 2OT3A 1VGLA 2LEGA 4KA0A 1V2AA 1SENA 2A2PA 1A8LA 2KUCA 2CX4A 3VWUA 3VPTA 2HRAA 4L0WA 3GL3A 1V58A 5J9CA 3RDWA 1JLVA 3APQA 3C1RA 1GWCA 4HUAA 1T7PB 4TR1A 1YQ1A 2MZCA 4AKHA 4PUAA 4BVYA 4GTUA 13GSA 3RBTA 4AKGA 3SBCA 2DMMA 1AIUA 3HD5A 4GF0A 5G5FA 1PSQA 3FR3A 4AJ8A 5A34B 1U88A 3TKSC 1JZDA 5G31A 5J4YA 3MYDA 2GSSA 3IV4A 5D9TA 4X1UA 2YV9A 3QMXA 2WCIA 3E0UA 2CAIA 1K0NA 1TU8A 3KP8A 4WKWA 5C04A 3CSHA 2HZEB 4O5RA 1EV9A 1VF4A 4XRAA 4Z7XA 1NSWA 1ZYNA 4K2XA 5F05A 1XIYA 3ZYWA 2H71A 4K8MA 3FKFA 2DJ3A 2DJJA 2XBQA 1GTBA 2HSHA 2CZ3A 1SVLA 17GSA 1GSYA 4PTSA 5ENUA 2I81A 3H1NA 4ID0A 3GA4A 1TOFA 1DUGA 1O8WA 3GX0A 2PUKC 4HZ2A 22GSA 5CO3A 2VL3A 2DMLA 2QA2A 1SKRB 4OFMA 4AF2A 1PN0A 4K7IA 2K8SA 3EYTA 1BG5A 4GRFA 5AGYA 3TJKA 1GTUA 4QMKA 4E68A 3CYNA 3W8JA 3D4MA 4RQRA 4YH2A 4O92A 1O85A 5IIZA 4RUVA 4YAVA 5A5HA 4BL7B 2OBIA 4EE0A 1Z9HA 4MF5A 5HQPA 3TU3B 1M2DA 3LORA 4KDXA 2R4VA 4X0XA 3RHCA 1SK2A 2LS5A 3DRNA 1DE1A 3C7MA 2MYGA 2GZZA 1XWCA 3UBLA 4IQ1A 4V2NA 4OFTA 5CRHA 1PL2A 1GTIA 2C3NA 2HRFA 2YCDA 4OWYA 2YZHA 1BQ7A 4MZBA 3WT2A 2CT6A 2VCWA 2BMXA 3KD0A 1XBSA 2J9HA 3EINA 1WWJA 1AQVA 2GQLA 3ERWA 3ZZXA 1HNBA 1Q4JA 2B1KA 5G30A 2R5GA 3UVHA 1YF1A 5B8BA 3HJPA 2RM5A 2E2MA 3O3TA 3KZQA 1M9BA 4N10A 2LJKA 4TRXA 5IO2A 1ML6A 4I97A 4G10A 4HJMA 2TRXA 2K18A 2KLXA 4FH8A 3UAPA 3IAS2 3DD3A 3K8NA 4ML1A 10GSA 1U3AA 2R3XA 4BVYB 3DYRA 4GWRA 2XPEA 6GSWA 2IMEA 1TK8B 1PN9A 4TVEA 2QSIA 1YF0A 3WGEA 2MBTA 1K0MA 2B5YA 1J9BA 5DBQA 2IWTA 4GQFA 4POMA 2LRCA 4JE1A 2L6DA 2PWJA 3BCIA 2P5QA 1UN2A 3QCPA 2GLRA 1MDIA 3F3RA 4I2TA 4GLTA 4EKZA 1Z7PA 2M80A 5INYA 4MK3A 1F9MA 4ZILA 1OE8A 1XVQA 1PQNA 2MMOA 2C4JA 2PBJA 3D22A 5E4WA 11GSA 3M9KA 2NTOA 3GHAA 1OE7A 3PINA 5FT3A 1PX7A 3TOUA 1TK0B 4JU5A 2HSMB 2WFCA 4WBJA 1K0OA 3KGKA 3ZIVA 3IXRA 3E3EA 4PQ1A 2WULA 1GSFA 1SVOA 5C00A 2JZTA 1YDKA 1VF3A 4L5LA 5A5KA 2L5OA 2B3SA 2R0CA 1EOGA 2VL2A 5AISA 1R26A 1PL1A 3GSTA 2C0DA 3TKQA 2CAQA 2C1YA 4D73A 2H30A 3GKKA 1QUWA 5CRWA 5ECRB 4MCUA 3F6FA 1K0DA 3HVSA 1SVMA 1W4VA 4V2MA 16GSA 3GURA 3QD9A 3SWLA 2DIZA 3LQ7A 3GFKA 5CNWA 2A4HA 5JCGA 3WYWA 2FCHA 4EO3A 4KDUA 5D8IA 3EU4A 5EVOA 4OCFA 4GSNA 2H0GA 2VCQA 2VLVA 2O7KA 5A5HB 2C80A 1N2AA 1AQWA 4ILFA 2WDUA 1A0RP 1E6BA 4PQHA 4YQUA 1GUKA 1X5EA 4H86A 4X43A 4EC0A 3NZNA 1BJXA 3F9UA 1YEXA 3A2XA 1GLQA 1KNGA 1TP9A 2NVLA 2FWEA 5FWGA 1X5CA 1PD21 4O5UA 1G6YA 1LBKA 5D9XA 4HS1A 3J7Yb 1FHEA 4KAEA 4YKGA 4JRRA 1GULA 2IMDA 2XPDA 1BX9A 1DSBA 1B4PA 1YY7A 2IMIA 3Q19A 4JBBA 1AXDA 5D96A 2LKUA 5D9VA 2LTKA 3FZ9A 3NIVA 1SL1B 1F3BA 1QXHA 4ECIA 5A4UA 2JZRA 3ZVJD 3WT1A 4K1FA 1HNCA 3VI5A 4FQUA 4PNGA 2OACA 5AN1A 5HR3A 2PN8A 1ERWA 3ISOA 1O81A 4MNNA 1WE0A 3HKRA 3IR4A 4TXOB 2VOCA 5IMAA 3FYGA 5IOXA 5LCZA 3EWLA 4PGTA 5IM9A 3VWVA 1WMJA 5FHIA 1A2JA 3C73A 3KXOA 3HXSA 2PPTA 2ZCTA 1VF2A 2L4CA 1V98A 4PUFC 4G0LA 2O85A 4ZB6A 4K5SA 2PU9C 3GN3A 3KMOA 3IDVA 4YAPA 2CV4A 3LYPA 2GSRA 4K5RA 1FB0A 3KTBA 5HFIA 5ECMB 3I43A 3DGQA 1NM3A 3IBHA 1Z7RA 2RIIA 5J9BA 1MD4A 4WF4A 4DVCA 3G7IA 3DXBA 3UIWA 2MMAA 2F3MA 2ZNMA 2CZ2A 3MWHA 1YEPA 4QQ7A 4KSMA 4XRDA 1TK5B 1OYJA 5D93A 3EU3A 6GSSA 3MDKA 1G7EA 1Y25A 1PKWA 2B5XA 5IMZA 4IJ3A 1AQXA 2QKEA 4TR4A 2R0GA 1MTCA 2OADA 3FZ5A 3TJBA 2YJHA 5KOWA 2VUPA 3H79A 4FIWA 4D73B 4TW5A 3JCML 1QFNA 4EDYA 1TW9A 4JEDA 6GSYA 3F3QA 1Z5YE 3N9JA 3KJYA 3ERGA 7GSSA 4A5PA 4TKYA 3G9BA 2IMKA 4PQIA 3LG6A 1YKAA 4V2LA 4NV2A 4L8EA 5J4VA 2UZ8A 4LL4B 1QQ2A 4NV5A 3J7Yk 4G0KA 2BJXA 1RK4A 3TUEA 3HZ4A 4USSA 1Z3EA 2VM2A 1H75A 4K7NA 4CHSA 4YQVA 2YPMA 2GTUA 1I9DA 3TCOA 3ZREA 1GRXA 1CQHA 5B6MA 1G7OA 1LU4A 1NHYA 4G01A 1A8YA 3IAM2 2O87A 5LNKe 1I5GA 4HOJA 2CVBA 2EFHA 4WXTA 5CYYA 3F6DA 1SYXA 1K0CA 4BPYA 4QL9A 4XTSA 3GYKA 2AHEA 2LJAA 2HRNA 4MH3A 3APSA 2OA7A 3KH7A 3D6IA 4GXZA 5ELAA 4MF6A 1YKCA 4NAXA 4KF9A 5KOXA 2CA8A 6GSTA 5HR1A 3A5WA 2H01A 4L0UA 1OC8A 1XW6A 2H1LA 2WGRA 4BA7A 2GQMA 2HE3A 2L6CA 5IMCA 4GDFA 5A4VA 3I69A 2FNOA 2HQTA 3ZMLA 19GSA 3CBUA 2B7KA 2R6KA 3QOUA 2JZSA 3GNJA 3GH6A 5D9WA 3DIEA 5J3RA 2HSMA 3IRAA 4ZIJA 2JU5A 1B4QA 1ZCPA 9GSSA 1EEJA 1BG1A 4ECCA 4Z2TA 3DVXA 4QL7A 1O6JA 3UL3A 4OCEA 3LEFA 1X9SB 3DKSA 2VCTA 1R4WA 4MJAA 3RAZA 4J2FA 1J08A 4MZCA 1GNEA 3L78A 3MIXA 2AJQB 2MMZA 2AUVA 3UEMA 5F06A 1VF1A 3M3MA 3P7XA 1N8JA 1ILOA 1XOBA 4DSRA 5IO0A 5BMUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SJZ A;  1TJD A;  4K7O A;  4K2D A;  3RHB A;  1S3D A;  2B7J A;  2GZY A;  4ZBD A;  1KEB A;  5F0G A;  1XXU A;  4HJ2 A;  1M0U A;  3FZA A;  5KEJ A;  4XS4 A;  3CTF A;  3QAV A;  4OD7 A;  3L4N A;  1K0A A;  5JCU A;  3C8E A;  5JCW A;  1F3A A;  2GS3 A;  4EXJ A;  2VLT A;  1AAZ A;  1GSD A;  2VO4 A;  3ZRD A;  2EIO A;  3L9V A;  2R37 A;  1T00 A;  3LJR A;  3ZMK A;  2WJU A;  3GSS A;  3EVI A;  4E8E A;  3VI7 A;  4RQX A;  4CDO A;  2H8L A;  5IOW A;  4ACS A;  4MLY A;  2AB6 A;  1FB6 A;  1URM A;  1FW1 A;  2FUG 2;  5KN0 A;  3CTG A;  4E8H A;  5CP1 A;  3KMN A;  5CRD A;  5HR2 A;  3E9J B;  3PR8 A;  2NDO A;  4KE3 A;  4N0Z A;  2ES7 A;  5AIV A;  1WIK A;  4RI7 A;  2TRC P;  1XWA A;  1MEK A;  2WB9 A;  2C3Q A;  2WRT A;  5CRG A;  2DJ0 A;  1ERU A;  3GUS A;  2H75 A;  4TXO A;  1GLP A;  2C0G A;  4KGI A;  5JWQ B;  2LQO A;  4IN0 A;  4F0C A;  1FVJ A;  1U87 A;  3U5R E;  5CAX A;  2ON7 A;  3KH9 A;  1XWB A;  3IK7 A;  1G0T A;  2OJL A;  3VUR A;  3HZ8 A;  3OR5 A;  4ECJ A;  3FR9 A;  3QAW A;  2A4V A;  2DBC A;  3W8S A;  2RM6 A;  4TR0 A;  2H1B A;  3GKM A;  4IVF A;  3KP9 A;  4MF7 A;  3FEU A;  4EF0 A;  3QAG A;  2FLS A;  5HR0 A;  5L71 A;  4G19 A;  2MMN A;  4XS6 A;  1NHO A;  4DEJ A;  3H8Q A;  4GCI A;  3KM6 A;  1M99 A;  3US3 A;  2H6Y A;  20GS A;  1ZYE A;  5JWR B;  2QGV A;  3P90 A;  5IQY A;  5ECQ B;  2RUF A;  4AGS A;  4NPB A;  3TKS E;  4Q5R A;  2OE3 A;  3CSJ A;  1OKT A;  1K3Y A;  1M7T A;  2NBS A;  3BJ5 A;  4O7H A;  3O76 A;  3TRQ A;  3IOS A;  4I8B A;  4KUN A;  1GUH A;  1GUM A;  2E7P A;  6GSX A;  4P3Y B;  1PMT A;  2G2Q A;  2V2G A;  5H5Q A;  3IHQ A;  4F9Z A;  2IFQ A;  4EL1 A;  4G9H A;  4HZ4 A;  2JAD A;  2FA8 A;  2E0Q A;  4JZQ A;  3HVV A;  3DVW A;  2F8F A;  1C72 A;  5G1L A;  3UOM A;  2HZF A;  3VPQ A;  2H0I A;  4MJE A;  1H4O A;  1O8X A;  4XS4 B;  2R2J A;  1GTA A;  2NPB A;  3EMP A;  3IC8 A;  3G7J A;  4OMV A;  3HA9 A;  3M9J A;  2JAC A;  4WF5 A;  1MD3 A;  2I4A A;  1EGR A;  4MDC A;  3A2W A;  2B5E A;  1XPV A;  5G2Z A;  3VWW A;  2FWH A;  2E2G A;  2HI7 A;  1U6T A;  2VL9 A;  1Z6N A;  4I2U A;  3GKX A;  2Z9S A;  4EVM A;  4Q5Q A;  1X5D A;  2P5R A;  3UMA A;  2EIQ A;  1OC3 A;  3LSZ A;  4IQA A;  3ERF A;  3BBY A;  3CSI A;  4OO5 A;  1UC7 A;  2H6X A;  2GDR A;  4HEA 2;  3HVX A;  2GT6 A;  2KOK A;  3KCM A;  2HSN B;  3NOF A;  2P31 A;  2XC2 A;  1EEM A;  2VD0 A;  1A23 A;  2VCZ A;  2B6M A;  3IK9 A;  4MH2 A;  5DCH A;  2CVD A;  3FR6 A;  5JWO B;  2V1M A;  4PXO A;  1FO5 A;  2JSZ A;  1IYI A;  1V9W A;  3A2V A;  3S9F A;  4ZB9 A;  3F4R A;  3TRX A;  2YZU A;  2H1D A;  1SD9 A;  2K6V A;  4IP1 A;  3TKS A;  4IEL A;  3ZTL A;  3EUR A;  3H4K A;  5ECK B;  3ME8 A;  5KN1 A;  1WPI A;  2B1L A;  4ISD A;  5ECH B;  1ZYQ B;  2K8V A;  3TKR A;  1EWX A;  3UAR A;  4NHW A;  2DJ2 A;  2WZ9 A;  2G0F A;  1X9M B;  1CQG A;  2YN1 A;  3A3T A;  3D21 A;  1GP1 A;  1THX A;  4DSS A;  1Q98 A;  2L5L A;  2VL2 C;  3QR6 A;  6GSV A;  1AUC A;  1TRW A;  5ECL B;  3V1W A;  1R5A A;  4BVX A;  1B9X C;  2VAF A;  2YJ7 A;  1QK8 A;  2IJY A;  1SJI A;  2J23 A;  3ZFL A;  1THO A;  2IFQ B;  1PA3 A;  3KEB A;  1W89 A;  4LMW A;  1T3B A;  3TDG A;  1HYU A;  12GS A;  3D5J A;  3GH9 A;  3L9U A;  2V6O A;  2LRN A;  4K0G A;  1PGT A;  5B6N A;  4POB A;  1RQM A;  1XWG A;  3D0Z A;  1JZO A;  2HSY A;  2IN3 A;  14GS A;  2N5A A;  4IJI A;  1SJ6 A;  3C1S A;  2TIR A;  5DQY A;  3ZIJ A;  3EE2 A;  4EDZ A;  4PNF A;  4WET A;  1PKZ A;  1SD8 A;  1DE2 A;  3ED3 A;  2X99 A;  1ZZY A;  4K9Z A;  5ELG A;  2VCX A;  5KN3 A;  3I6A A;  2H0H A;  4I5Q A;  2IL3 A;  2H76 A;  2I9H A;  1TRV A;  2H1G A;  2C8U A;  1XCC A;  3F63 A;  3CRU A;  2C0E A;  1EZK A;  2YOI A;  4N30 A;  1T8E B;  3O6T A;  4POK A;  4IS0 A;  2ON5 A;  3HYP A;  3DWV A;  2DSA A;  5IMF A;  1ON4 A;  4V1A g;  4IW9 A;  2HRK A;  2HYX A;  1A24 A;  5DDL A;  1YJ6 A;  3IE3 A;  4JR6 A;  2FWF A;  8GSS A;  1EV4 A;  3QPM A;  1A2L A;  3CXG A;  1UVZ A;  5DAL A;  2FHE A;  4XCS A;  4RI6 A;  2VCV A;  2L57 A;  3GMF A;  3QFB C;  5HFK A;  4J56 E;  3PGT A;  1WP0 A;  2VIM A;  4NHZ A;  1FAA A;  5HFG A;  1GNW A;  1AW9 A;  2X8G A;  3FZ4 A;  4G0I A;  2WS2 A;  2H72 A;  1X9W B;  4NXI A;  2KHP A;  3Q6O A;  1HQO A;  3PPU A;  4AJ7 A;  3WGX A;  5ECP B;  2IMF A;  2H74 A;  2FY6 A;  5DVB A;  4ZXG A;  2LQQ A;  1X0R A;  5F8B A;  3ME7 A;  2XBI A;  4WBR D;  5ECS A;  1XW9 A;  4MP4 A;  1OVN A;  2VLU A;  2PGT A;  4HQZ A;  2X64 A;  1T4Z A;  1PX6 A;  1XVW A;  4DSS B;  2PVQ A;  2GSQ A;  1JZW A;  4NWY A;  1ZOF A;  2I1U A;  4IKH A;  4BVX B;  2I3Y A;  1FG4 A;  4KND A;  1SKS B;  1KBN A;  2DJ1 A;  2O8V B;  1USB A;  3I9V 2;  4MJB A;  1WJK A;  2H19 A;  1IYH A;  2PVO C;  1JFU A;  2LUS A;  1ZMA A;  3ZL5 A;  5ABR A;  2FWG A;  4TN8 A;  1R5P A;  4POL A;  2DIY A;  5DJM A;  1UA5 A;  3QDN A;  4ZBB A;  5H5S A;  4IP6 A;  1BYE A;  4LA1 A;  4IGJ A;  3LXT A;  3TJJ A;  1TDI A;  4O32 A;  2LNT A;  1JHB A;  2YWN A;  4ML6 A;  1TKD B;  1OKD A;  2OE1 A;  5ID2 A;  2H1A A;  2F51 A;  1QMV A;  4MA9 A;  3P2A A;  1VRS D;  1Y6E A;  2YWO A;  1K3O A;  3VWX A;  3VFI A;  3F8U A;  3VLN A;  4HU7 A;  5IPH A;  2LJR A;  2M46 A;  4ZB8 A;  4LL1 B;  4HQS A;  1EOH A;  1DBY A;  5B8A A;  1F37 A;  2LV3 A;  2PER A;  3ZVJ A;  2F9S A;  5KN2 A;  1Z6M A;  4ECB A;  2L59 A;  4MPF A;  5ECO B;  2FA4 A;  4IBP A;  5J4U A;  3GV1 A;  1GSS A;  2YAN A;  3VK9 A;  3TRP A;  2LST A;  3WGD A;  2GST A;  2LNS A;  1XZO A;  5COH A;  1E2Y A;  1ZL9 A;  1T1V A;  2V41 A;  3LWA A;  4TR1 B;  1B9Y C;  2HRK B;  4XHM A;  1G6W A;  2ZUP A;  5A4W A;  3DEX A;  3UJ1 A;  2DLX A;  3M0F A;  1OAZ A;  1GSQ A;  3LXZ A;  3UVT A;  2YV7 A;  2A2R A;  1SL2 B;  1ERT A;  2MBS A;  4ZL9 A;  5DAL B;  2AYT A;  4MJC A;  1BAY A;  5DAK A;  2H73 A;  3GTU A;  3LFL A;  2D2Z A;  2JSY A;  5G5E A;  2HT9 A;  2V32 A;  4NMU A;  2A2S A;  3L9S A;  2OKA A;  5ECI B;  3L0H A;  3IC4 A;  2P0G A;  5GAN D;  4KB3 A;  6GSU A;  4MMM A;  5EL8 A;  4BWS A;  4KDY A;  3TJF A;  3APO A;  2HLS A;  3TGZ A;  2M72 A;  5IMV A;  4DSQ A;  1OC9 A;  3HJM A;  1GH2 A;  4N0V A;  3W6G A;  1XFL A;  1PRX A;  1U3I A;  1TTZ A;  4WR4 A;  3HDC A;  4G2E A;  3R3E A;  4OO4 A;  2HFD A;  1ACV A;  3PH9 A;  3IA1 A;  5IPG A;  4ZL7 A;  3H93 A;  3N5O A;  2YNX A;  3TB2 A;  4J57 E;  1EP8 A;  1ERV A;  5GST A;  2GQK A;  2OE0 A;  3ZIT A;  5D73 A;  1WOU A;  2N5B A;  1TI3 A;  2DJK A;  5H5R A;  3FRC A;  1SK0 A;  1ST9 A;  3GX8 A;  5J41 A;  3RPN A;  3AY8 A;  5GSS A;  4I6X A;  4TOP A;  1S3A A;  4GQC A;  3TOT A;  3KIJ A;  1B8X A;  3LYK A;  3LGC A;  3G7Y A;  1ZGN A;  2BTO T;  4LLR A;  1QGV A;  4XS1 A;  5B7C A;  4HDE A;  3ZLP A;  1SK1 A;  1EP7 A;  2GT5 A;  3MAK A;  2K9F A;  3BD2 A;  2AV4 A;  3WD6 A;  3U6V A;  1T4Y A;  2QC7 A;  1MDJ A;  3GKN A;  3M8N A;  3GIX A;  1SU9 A;  4FYU A;  2RLI A;  3QFA C;  3BCK A;  1O73 A;  5ID2 B;  2XHF A;  4FYB A;  1JLW A;  4Q5F A;  5GZZ B;  1XW5 A;  5G1K A;  1V40 A;  4F03 A;  4L5O A;  3C71 A;  1M2B A;  3F0I A;  4ULX A;  5EY6 A;  3TKP A;  1GSE A;  2H66 A;  1EGO A;  5GAP D;  5IMD A;  4MPG A;  1A2M A;  3DML A;  1O7U A;  3F4T A;  2GZP A;  2OBK A;  3TJG A;  1TRS A;  1WRY A;  4MZW A;  2O89 A;  2JL4 A;  4KCA A;  2L4Q A;  4ZL8 A;  3HHV A;  2KP1 A;  2ALB A;  1A0F A;  1R7H A;  2EC4 A;  5DJL A;  4BWQ A;  4XIH A;  3FW2 A;  1M9A A;  1YZX A;  4TR3 A;  1AC1 A;  2GGT A;  1KTE A;  2HXK A;  3ZFB A;  4F82 A;  2F8A A;  1TXX A;  3P8W A;  1HD2 A;  1FOV A;  2VM1 A;  1SL0 B;  4IHU A;  3D4T A;  1F2E A;  5F07 A;  1TRU A;  2PMT A;  3GRX A;  2CQ9 A;  5DAK B;  1MDK A;  4Q5N A;  5CRE A;  2HNL A;  4F0B A;  3GTU B;  4JR4 A;  4FYC A;  3FK8 A;  3IPZ A;  2VD1 A;  1FVK A;  2HZE A;  4FO5 A;  1RW1 A;  2X8H A;  2V6K A;  4LMV A;  3HCZ A;  2EIR A;  4AJ6 A;  4KW6 A;  4KX4 A;  2YP6 A;  3MNG A;  1NW2 A;  3GL5 A;  2X8C A;  2RUE A;  2YWI A;  1JZR A;  3Q74 A;  4KH7 A;  4WR5 A;  1V57 A;  3BOA A;  1OC9 B;  1BED A;  2KP2 A;  3UBK A;  4YQM A;  4F2I A;  18GS A;  2IIY A;  2CX3 A;  2C0F A;  2REM A;  3R2Q A;  2H6Z A;  3EMX A;  4KSO A;  5ECN B;  4OFN A;  5E59 A;  4TXV A;  2YWM A;  4CW9 A;  4PUR A;  3FY7 A;  4GSS A;  2GVP A;  1SKW B;  1XOA A;  3KTL A;  4K6X A;  1K0B A;  3M1G A;  4KCE A;  3HJO A;  5DCG A;  3HY2 A;  5J5N A;  5AIX A;  4EUY A;  2H70 A;  4BL7 A;  1GSU A;  3RPP A;  4V1A p;  5EPF A;  2FGX A;  3MSZ A;  4K0N A;  1J0F A;  5LD0 A;  4MAB A;  1B48 A;  2IPA A;  3F4S A;  3CRT A;  2AAW A;  2N5F A;  4HI7 A;  4GST A;  1K3L A;  3FHK A;  2CVK A;  3CMI A;  4PX1 A;  3EC3 A;  1F6M C;  1M2A A;  4ZBA A;  4WEY A;  2DC5 A;  1TU7 A;  2FD3 A;  1TI1 A;  1SYR A;  1GL8 A;  2LRT A;  3Q18 A;  5DQS A;  1LJR A;  2C3T A;  1HNA A;  1XWK A;  1S3C A;  1ABA A;  4HU9 A;  4N11 A;  1VGL A;  2LEG A;  4KA0 A;  1V2A A;  1SEN A;  1A8L A;  2KUC A;  2CX4 A;  3VWU A;  3VPT A;  2HRA A;  4L0W A;  3GL3 A;  1V58 A;  5J9C A;  3RDW A;  1JLV A;  3APQ A;  3C1R A;  1GWC A;  4HUA A;  1T7P B;  4TR1 A;  1YQ1 A;  2MZC A;  4PUA A;  4BVY A;  4GTU A;  13GS A;  3RBT A;  3SBC A;  2DMM A;  1AIU A;  3HD5 A;  4GF0 A;  5G5F A;  1PSQ A;  3FR3 A;  4AJ8 A;  1U88 A;  3TKS C;  1JZD A;  5G31 A;  2GSS A;  3IV4 A;  5D9T A;  4X1U A;  2YV9 A;  3QMX A;  2WCI A;  3E0U A;  2CAI A;  1K0N A;  1TU8 A;  3KP8 A;  4WKW A;  5C04 A;  3CSH A;  2HZE B;  4O5R A;  1EV9 A;  1VF4 A;  4XRA A;  4Z7X A;  1NSW A;  5F05 A;  1XIY A;  3ZYW A;  2H71 A;  4K8M A;  3FKF A;  2DJ3 A;  2DJJ A;  2XBQ A;  1GTB A;  2HSH A;  2CZ3 A;  17GS A;  1GSY A;  4PTS A;  5ENU A;  2I81 A;  3H1N A;  4ID0 A;  3GA4 A;  1TOF A;  1DUG A;  1O8W A;  3GX0 A;  2PUK C;  4HZ2 A;  22GS A;  5CO3 A;  2VL3 A;  2DML A;  1SKR B;  4OFM A;  4AF2 A;  4K7I A;  2K8S A;  3EYT A;  1BG5 A;  4GRF A;  5AGY A;  3TJK A;  1GTU A;  3CYN A;  3W8J A;  3D4M A;  4RQR A;  4YH2 A;  4O92 A;  1O85 A;  5IIZ A;  4RUV A;  4YAV A;  4BL7 B;  2OBI A;  4EE0 A;  1Z9H A;  4MF5 A;  5HQP A;  1M2D A;  3LOR A;  4KDX A;  2R4V A;  4X0X A;  3RHC A;  1SK2 A;  2LS5 A;  3DRN A;  1DE1 A;  3C7M A;  2MYG A;  2GZZ A;  1XWC A;  3UBL A;  4IQ1 A;  4V2N A;  4OFT A;  5CRH A;  1PL2 A;  1GTI A;  2C3N A;  2HRF A;  2YCD A;  4OWY A;  2YZH A;  1BQ7 A;  4MZB A;  3WT2 A;  2CT6 A;  2VCW A;  2BMX A;  3KD0 A;  1XBS A;  2J9H A;  3EIN A;  1WWJ A;  1AQV A;  2GQL A;  3ERW A;  3ZZX A;  1HNB A;  1Q4J A;  2B1K A;  5G30 A;  2R5G A;  3UVH A;  1YF1 A;  5B8B A;  3HJP A;  2RM5 A;  2E2M A;  3O3T A;  3KZQ A;  1M9B A;  4N10 A;  2LJK A;  4TRX A;  5IO2 A;  1ML6 A;  4I97 A;  4HJM A;  4G10 A;  2TRX A;  2K18 A;  2KLX A;  4FH8 A;  3UAP A;  3IAS 2;  3DD3 A;  3K8N A;  4ML1 A;  10GS A;  1U3A A;  2R3X A;  4BVY B;  3DYR A;  4GWR A;  2XPE A;  6GSW A;  2IME A;  1TK8 B;  1PN9 A;  4TVE A;  2QSI A;  1YF0 A;  3WGE A;  2MBT A;  1K0M A;  2B5Y A;  1J9B A;  5DBQ A;  2IWT A;  4GQF A;  4POM A;  2LRC A;  4JE1 A;  2L6D A;  2PWJ A;  3BCI A;  2P5Q A;  1UN2 A;  3QCP A;  2GLR A;  1MDI A;  3F3R A;  4I2T A;  4GLT A;  4EKZ A;  1Z7P A;  2M80 A;  5INY A;  4MK3 A;  1F9M A;  4ZIL A;  1OE8 A;  1XVQ A;  1PQN A;  2MMO A;  2C4J A;  2PBJ A;  3D22 A;  5E4W A;  11GS A;  3M9K A;  2NTO A;  3GHA A;  1OE7 A;  3PIN A;  5FT3 A;  1PX7 A;  3TOU A;  1TK0 B;  4JU5 A;  2HSM B;  2WFC A;  4WBJ A;  1K0O A;  3KGK A;  3ZIV A;  3IXR A;  3E3E A;  4PQ1 A;  2WUL A;  1GSF A;  5C00 A;  2JZT A;  1YDK A;  1VF3 A;  4L5L A;  5A5K A;  2L5O A;  2B3S A;  1EOG A;  2VL2 A;  5AIS A;  1R26 A;  1PL1 A;  3GST A;  2C0D A;  3TKQ A;  2CAQ A;  2C1Y A;  4D73 A;  2H30 A;  3GKK A;  1QUW A;  5CRW A;  5ECR B;  4MCU A;  3F6F A;  1K0D A;  3HVS A;  1W4V A;  4V2M A;  16GS A;  3GUR A;  3QD9 A;  3SWL A;  2DIZ A;  3LQ7 A;  3GFK A;  5CNW A;  5JCG A;  3WYW A;  2FCH A;  4EO3 A;  4KDU A;  5D8I A;  3EU4 A;  5EVO A;  4OCF A;  4GSN A;  2H0G A;  2VCQ A;  2VLV A;  2O7K A;  2C80 A;  1N2A A;  1AQW A;  4ILF A;  2WDU A;  1A0R P;  1E6B A;  4PQH A;  4YQU A;  1GUK A;  1X5E A;  4H86 A;  4X43 A;  4EC0 A;  3NZN A;  1BJX A;  3F9U A;  1YEX A;  3A2X A;  1GLQ A;  1KNG A;  1TP9 A;  2NVL A;  2FWE A;  5FWG A;  1X5C A;  1PD2 1;  1G6Y A;  1LBK A;  5D9X A;  4HS1 A;  3J7Y b;  1FHE A;  4KAE A;  4JRR A;  1GUL A;  2IMD A;  2XPD A;  1BX9 A;  1DSB A;  1B4P A;  1YY7 A;  2IMI A;  3Q19 A;  4JBB A;  1AXD A;  5D96 A;  2LKU A;  5D9V A;  2LTK A;  3FZ9 A;  3NIV A;  1SL1 B;  1F3B A;  1QXH A;  4ECI A;  5A4U A;  2JZR A;  3ZVJ D;  3WT1 A;  4K1F A;  1HNC A;  3VI5 A;  4FQU A;  4PNG A;  2OAC A;  5AN1 A;  5HR3 A;  2PN8 A;  1ERW A;  3ISO A;  1O81 A;  1WE0 A;  3HKR A;  3IR4 A;  4TXO B;  2VOC A;  5IMA A;  3FYG A;  5IOX A;  5LCZ A;  3EWL A;  4PGT A;  5IM9 A;  3VWV A;  1WMJ A;  5FHI A;  1A2J A;  3C73 A;  3KXO A;  3HXS A;  2PPT A;  2ZCT A;  1VF2 A;  2L4C A;  1V98 A;  4PUF C;  4G0L A;  2O85 A;  4ZB6 A;  2PU9 C;  3GN3 A;  3KMO A;  3IDV A;  4YAP A;  2CV4 A;  3LYP A;  2GSR A;  1FB0 A;  3KTB A;  5HFI A;  5ECM B;  3I43 A;  3DGQ A;  1NM3 A;  3IBH A;  1Z7R A;  2RII A;  5J9B A;  1MD4 A;  4WF4 A;  4DVC A;  3G7I A;  3DXB A;  3UIW A;  2MMA A;  2F3M A;  2ZNM A;  2CZ2 A;  3MWH A;  1YEP A;  4QQ7 A;  4KSM A;  4XRD A;  1TK5 B;  1OYJ A;  5D93 A;  3EU3 A;  6GSS A;  3MDK A;  1G7E A;  1Y25 A;  1PKW A;  2B5X A;  5IMZ A;  4IJ3 A;  1AQX A;  2QKE A;  4TR4 A;  1MTC A;  2OAD A;  3FZ5 A;  3TJB A;  2YJH A;  2VUP A;  3H79 A;  4FIW A;  4D73 B;  4TW5 A;  3JCM L;  1QFN A;  4EDY A;  1TW9 A;  4JED A;  6GSY A;  3F3Q A;  1Z5Y E;  3N9J A;  3KJY A;  3ERG A;  7GSS A;  4TKY A;  3G9B A;  2IMK A;  4PQI A;  3LG6 A;  1YKA A;  4V2L A;  4NV2 A;  4L8E A;  2UZ8 A;  4LL4 B;  1QQ2 A;  4NV5 A;  3J7Y k;  4G0K A;  2BJX A;  1RK4 A;  3TUE A;  3HZ4 A;  4USS A;  1Z3E A;  2VM2 A;  1H75 A;  4K7N A;  4CHS A;  4YQV A;  2YPM A;  2GTU A;  1I9D A;  3TCO A;  3ZRE A;  1GRX A;  1CQH A;  5B6M A;  1G7O A;  1LU4 A;  1NHY A;  1A8Y A;  3IAM 2;  2O87 A;  5LNK e;  1I5G A;  4HOJ A;  2CVB A;  4WXT A;  5CYY A;  3F6D A;  1SYX A;  1K0C A;  4BPY A;  4QL9 A;  4XTS A;  3GYK A;  2AHE A;  2LJA A;  2HRN A;  4MH3 A;  3APS A;  2OA7 A;  3KH7 A;  3D6I A;  4GXZ A;  5ELA A;  4MF6 A;  1YKC A;  4NAX A;  4KF9 A;  2CA8 A;  6GST A;  5HR1 A;  3A5W A;  2H01 A;  4L0U A;  1OC8 A;  1XW6 A;  2WGR A;  4BA7 A;  2GQM A;  2HE3 A;  2L6C A;  5IMC A;  5A4V A;  3I69 A;  2FNO A;  2HQT A;  3ZML A;  19GS A;  3CBU A;  2B7K A;  2R6K A;  3QOU A;  2JZS A;  3GNJ A;  3GH6 A;  5D9W A;  3DIE A;  5J3R A;  2HSM A;  3IRA A;  4ZIJ A;  2JU5 A;  1B4Q A;  1ZCP A;  9GSS A;  1EEJ A;  4ECC A;  3DVX A;  4QL7 A;  1O6J A;  3UL3 A;  4OCE A;  3LEF A;  1X9S B;  3DKS A;  2VCT A;  1R4W A;  4MJA A;  3RAZ A;  4J2F A;  1J08 A;  4MZC A;  1GNE A;  3L78 A;  2AJQ B;  2MMZ A;  2AUV A;  3UEM A;  5F06 A;  1VF1 A;  3M3M A;  3P7X A;  1N8J A;  1ILO A;  1XOB A;  4DSR A;  5IO0 A;  5BMU A; 
#chains in the Genus database with same CATH topology
 1SJZ A;  1TXU A;  1TJD A;  4K7O A;  4K2D A;  3RHB A;  1S3D A;  2B7J A;  2GZY A;  4ZBD A;  1KEB A;  5F0G A;  1XXU A;  4HJ2 A;  1M0U A;  3FZA A;  5KEJ A;  4XS4 A;  3CTF A;  3QAV A;  4OD7 A;  3L4N A;  1K0A A;  5JCU A;  3C8E A;  1M3I A;  5JCW A;  1F3A A;  2GS3 A;  4EXJ A;  2VLT A;  1AAZ A;  1GSD A;  2VO4 A;  3ZRD A;  1Y1U A;  2EIO A;  3L9V A;  2R37 A;  1T00 A;  3LJR A;  3ZMK A;  2WJU A;  3GSS A;  3EVI A;  4E8E A;  3VI7 A;  2X4A A;  4RQX A;  1FOH A;  4CDO A;  2H8L A;  5IOW A;  4ACS A;  4MLY A;  2AB6 A;  1FB6 A;  1URM A;  1FW1 A;  2FUG 2;  5KN0 A;  3CTG A;  4E8H A;  5CP1 A;  3KMN A;  5CRD A;  5HR2 A;  3E9J B;  3PR8 A;  2DKH A;  2NDO A;  4KE3 A;  4N0Z A;  2ES7 A;  5AIV A;  1WIK A;  4RI7 A;  2TRC P;  1XWA A;  1MEK A;  2WRT A;  2C3Q A;  2WB9 A;  2HSN A;  5CRG A;  2DJ0 A;  1ERU A;  3GUS A;  2H75 A;  4TXO A;  1GLP A;  2C0G A;  4KGI A;  5JWQ B;  2LQO A;  4IN0 A;  4F0C A;  3FMW A;  1FVJ A;  1XG8 A;  1U87 A;  3U5R E;  5CAX A;  2ON7 A;  3KH9 A;  1XWB A;  3IK7 A;  1G0T A;  2OJL A;  3VUR A;  3HZ8 A;  3OR5 A;  4ECJ A;  3FR9 A;  3QAW A;  2A4V A;  2DBC A;  3W8S A;  2RM6 A;  4TR0 A;  2H1B A;  3GKM A;  4IVF A;  3KP9 A;  4MF7 A;  3FEU A;  4EIP A;  4EF0 A;  3QAG A;  2FLS A;  5HR0 A;  5L71 A;  4G19 A;  2MMN A;  4XS6 A;  1NHO A;  4DEJ A;  3H8Q A;  4GCI A;  3KM6 A;  1M99 A;  3US3 A;  2H6Y A;  20GS A;  1ZYE A;  5JWR B;  2QGV A;  3P90 A;  5IQY A;  5ECQ B;  2RUF A;  4AGS A;  4NPB A;  3TKS E;  4Q5R A;  2OE3 A;  3HVN A;  3CSJ A;  1OKT A;  1K3Y A;  1M7T A;  2NBS A;  3BJ5 A;  4O7H A;  5J47 A;  3O76 A;  3TRQ A;  3IOS A;  3EPT A;  4I8B A;  4KUN A;  1GUH A;  1GUM A;  2E7P A;  6GSX A;  4P3Y B;  1PMT A;  2G2Q A;  2V2G A;  5H5Q A;  3IHQ A;  4F9Z A;  2IFQ A;  4EL1 A;  4G9H A;  4HZ4 A;  2JAD A;  2FA8 A;  2E0Q A;  5BMU B;  4JZQ A;  3HVV A;  3DVW A;  2F8F A;  1C72 A;  5G1L A;  3UOM A;  2HZF A;  3VPQ A;  2H0I A;  4MJE A;  1H4O A;  1O8X A;  4XS4 B;  2R2J A;  1GTA A;  2NPB A;  3EMP A;  3IC8 A;  3G7J A;  4OMV A;  3HA9 A;  3M9J A;  2JAC A;  4WF5 A;  1I1I P;  1MD3 A;  2I4A A;  1EGR A;  4MDC A;  3A2W A;  2B5E A;  1XPV A;  5G2Z A;  2WW3 A;  5BRT A;  3VWW A;  2FWH A;  2E2G A;  2HI7 A;  1U6T A;  2VL9 A;  1Z6N A;  4I2U A;  3GKX A;  2Z9S A;  4EVM A;  4Q5Q A;  1X5D A;  2P5R A;  3UMA A;  2EIQ A;  1OC3 A;  3LSZ A;  4IQA A;  3ERF A;  3BBY A;  3CSI A;  4OO5 A;  1UC7 A;  2H6X A;  4Z2R A;  2GDR A;  4HEA 2;  3HVX A;  2GT6 A;  2KOK A;  3KCM A;  2HSN B;  3NOF A;  2P31 A;  2XC2 A;  4N3Z A;  1EEM A;  2VD0 A;  1A23 A;  2VCZ A;  2B6M A;  3IK9 A;  4MH2 A;  2EFC A;  5DCH A;  2CVD A;  3FR6 A;  5JWO B;  2V1M A;  4PXO A;  3A5I A;  1FO5 A;  2JSZ A;  1ZYP A;  1IYI A;  1V9W A;  3A2V A;  3S9F A;  2QA1 A;  4ZB9 A;  3F4R A;  3TRX A;  2YZU A;  2H1D A;  1SD9 A;  2K6V A;  4IP1 A;  3TKS A;  4IEL A;  3ZTL A;  3EUR A;  3H4K A;  5ECK B;  3ME8 A;  5KN1 A;  1WPI A;  4AKI A;  2B1L A;  4ISD A;  5ECH B;  1ZYQ B;  1N25 A;  2K8V A;  3TKR A;  1EWX A;  3UAR A;  4NHW A;  2DJ2 A;  2WZ9 A;  2G0F A;  1X9M B;  1CQG A;  2YN1 A;  3A3T A;  3D21 A;  1YVL A;  1GP1 A;  5A1N A;  1THX A;  4DSS A;  1Q98 A;  2L5L A;  2VL2 C;  3QR6 A;  6GSV A;  1AUC A;  1TRW A;  5ECL B;  3V1W A;  1R5A A;  4BVX A;  1B9X C;  2VAF A;  2YJ7 A;  4HSC X;  1QK8 A;  2IJY A;  1SJI A;  2J23 A;  3ZFL A;  1THO A;  2IFQ B;  1PA3 A;  3KEB A;  1W89 A;  4LMW A;  1T3B A;  3TDG A;  1HYU A;  12GS A;  3D5J A;  3GH9 A;  3L9U A;  2V6O A;  2LRN A;  4K0G A;  1PGT A;  5B6N A;  4POB A;  1RQM A;  1XWG A;  3D0Z A;  1JZO A;  2HSY A;  2IN3 A;  14GS A;  2N5A A;  4IJI A;  1SJ6 A;  3C1S A;  2TIR A;  5DQY A;  3ZIJ A;  3EE2 A;  4EDZ A;  4PNF A;  4WET A;  1PKZ A;  1SD8 A;  1DE2 A;  3ED3 A;  2X99 A;  1ZZY A;  4K9Z A;  5ELG A;  2VCX A;  5KN3 A;  3I6A A;  4ICY A;  2H0H A;  4I5Q A;  2IL3 A;  2H76 A;  2I9H A;  1TRV A;  2H1G A;  2C8U A;  1XCC A;  2EFE A;  3F63 A;  3CRU A;  2C0E A;  1EZK A;  2YOI A;  4N30 A;  1T8E B;  3O6T A;  4YKF A;  4POK A;  4IS0 A;  2ON5 A;  3HYP A;  3DWV A;  2DSA A;  5IMF A;  1ON4 A;  4V1A g;  3LW9 A;  4IW9 A;  2HRK A;  2HYX A;  1A24 A;  5DDL A;  1YJ6 A;  3IE3 A;  4JR6 A;  2FWF A;  8GSS A;  1EV4 A;  3QPM A;  1A2L A;  3CXG A;  1UVZ A;  5DAL A;  2FHE A;  4XCS A;  4RI6 A;  2VCV A;  2L57 A;  3GMF A;  3QFB C;  5HFK A;  4J56 E;  3PGT A;  1WP0 A;  2VIM A;  4NHZ A;  1FAA A;  4O5Q A;  5HFG A;  1GNW A;  1AW9 A;  2X8G A;  3FZ4 A;  2EFD A;  4G0I A;  2O5V A;  2WS2 A;  2H72 A;  1X9W B;  4NXI A;  2KHP A;  3Q6O A;  1HQO A;  3PPU A;  4AJ7 A;  3WGX A;  5ECP B;  2IMF A;  2H74 A;  2FY6 A;  5DVB A;  4ZXG A;  2LQQ A;  1X0R A;  5F8B A;  3ME7 A;  2XBI A;  4WBR D;  5ECS A;  1XW9 A;  4MP4 A;  1OVN A;  2VLU A;  2PGT A;  4HQZ A;  5A1N B;  2X64 A;  1T4Z A;  1PX6 A;  1XVW A;  4DSS B;  2PVQ A;  2GSQ A;  1JZW A;  4NWY A;  1ZOF A;  2I1U A;  4IKH A;  4BVX B;  2I3Y A;  1FG4 A;  4KND A;  1SKS B;  1KBN A;  2DJ1 A;  2O8V B;  1USB A;  3I9V 2;  4MJB A;  1WJK A;  2H19 A;  1IYH A;  2PVO C;  1JFU A;  2LUS A;  2WW2 A;  1ZMA A;  3ZL5 A;  5ABR A;  2FWG A;  4TN8 A;  1R5P A;  4POL A;  2DIY A;  5DJM A;  1UA5 A;  3QDN A;  4ZBB A;  5H5S A;  4IP6 A;  1BYE A;  4LA1 A;  4IGJ A;  3LXT A;  2WW0 A;  3TJJ A;  1TDI A;  4O32 A;  2LNT A;  4CY6 A;  4EIQ A;  1JHB A;  2YWN A;  4ML6 A;  4PI2 C;  1TKD B;  1OKD A;  2OE1 A;  5ID2 A;  2H1A A;  2F51 A;  1QMV A;  4MA9 A;  3P2A A;  1VRS D;  1Y6E A;  2YWO A;  1K3O A;  3VWX A;  3VFI A;  3F8U A;  3VLN A;  4HU7 A;  5IPH A;  2LJR A;  2M46 A;  4ZB8 A;  1PFO A;  4LL1 B;  4HQS A;  1EOH A;  1DBY A;  5B8A A;  1F37 A;  2LV3 A;  3HMJ G;  2PER A;  3ZVJ A;  2F9S A;  5KN2 A;  1Z6M A;  4ECB A;  2L59 A;  4MPF A;  1BF5 A;  5ECO B;  2FA4 A;  4IBP A;  5J4U A;  3GV1 A;  1GSS A;  2YAN A;  3VK9 A;  3TRP A;  2LST A;  3WGD A;  2GST A;  2LNS A;  1XZO A;  5COH A;  1E2Y A;  1ZL9 A;  1T1V A;  2V41 A;  3LWA A;  4TR1 B;  1B9Y C;  2HRK B;  4XHM A;  1G6W A;  2ZUP A;  5A4W A;  3DEX A;  3UJ1 A;  2DLX A;  3M0F A;  1OAZ A;  1GSQ A;  3LXZ A;  3UVT A;  2YV7 A;  2A2R A;  1SL2 B;  1ERT A;  2MBS A;  4ZL9 A;  5DAL B;  2AYT A;  4MJC A;  1BAY A;  5DAK A;  2R0P A;  2H73 A;  3GTU A;  3LFL A;  2D2Z A;  2JSY A;  5G5E A;  2HT9 A;  2V32 A;  4NMU A;  2A2S A;  3L9S A;  2OKA A;  5ECI B;  2UV8 G;  3L0H A;  3IC4 A;  2P0G A;  5GAN D;  4KB3 A;  6GSU A;  4MMM A;  5EL8 A;  4BWS A;  4KDY A;  3TJF A;  3APO A;  2HLS A;  2VKZ G;  3TGZ A;  2M72 A;  5IMV A;  4DSQ A;  1OC9 A;  3HJM A;  1GH2 A;  4N0V A;  3W6G A;  1XFL A;  1PRX A;  1U3I A;  1TTZ A;  4Z2U A;  4WR4 A;  3HDC A;  4G2E A;  3R3E A;  4OO4 A;  2HFD A;  1ACV A;  3PH9 A;  3IA1 A;  5IPG A;  4ZL7 A;  3H93 A;  3N5O A;  2YNX A;  3TB2 A;  4J57 E;  1EP8 A;  1ERV A;  5GST A;  2GQK A;  2OE0 A;  3ZIT A;  2O36 A;  5D73 A;  1WOU A;  2N5B A;  1TI3 A;  2DJK A;  5H5R A;  3FRC A;  1SK0 A;  1ST9 A;  3GX8 A;  5J41 A;  3RPN A;  3AY8 A;  4CY8 A;  5GSS A;  4I6X A;  4TOP A;  1S3A A;  4GQC A;  3TOT A;  3KIJ A;  1B8X A;  3LYK A;  3LGC A;  3G7Y A;  1ZGN A;  2BTO T;  4LLR A;  1QGV A;  4XS1 A;  5B7C A;  4HDE A;  3ZLP A;  1SK1 A;  1EP7 A;  2GT5 A;  3MAK A;  2K9F A;  3BD2 A;  2AV4 A;  3WD6 A;  3U6V A;  1T4Y A;  2QC7 A;  1MDJ A;  4X4J A;  3GKN A;  3M8N A;  3GIX A;  1SU9 A;  4FYU A;  2RLI A;  3QFA C;  3BCK A;  3CWG A;  1O73 A;  5ID2 B;  2XHF A;  4FYB A;  1JLW A;  4Q5F A;  5GZZ B;  1XW5 A;  5J40 A;  5G1K A;  1V40 A;  4F03 A;  4L5O A;  3C71 A;  4ZB7 A;  1M2B A;  3F0I A;  4ULX A;  5EY6 A;  3TKP A;  1GSE A;  2H66 A;  1EGO A;  5GAP D;  4FXY P;  2DKI A;  5IMD A;  4MPG A;  1A2M A;  3DML A;  1O7U A;  3F4T A;  2GZP A;  2OBK A;  3TJG A;  1TRS A;  1WRY A;  2WZS A;  4MZW A;  2O89 A;  2JL4 A;  4KCA A;  3RFR C;  2L4Q A;  4ZL8 A;  3HHV A;  2KP1 A;  2ALB A;  1A0F A;  1R7H A;  2EC4 A;  5DJL A;  4BWQ A;  4XIH A;  3FW2 A;  1M9A A;  1YZX A;  4TR3 A;  4PI0 C;  1AC1 A;  2GGT A;  1KTE A;  2HXK A;  3ZFB A;  4F82 A;  2F8A A;  1TXX A;  3P8W A;  1HD2 A;  1FOV A;  5A34 A;  2VM1 A;  1SL0 B;  4IHU A;  3D4T A;  1F2E A;  5F07 A;  1TRU A;  2PMT A;  3GRX A;  2CQ9 A;  5DAK B;  1MDK A;  4Q5N A;  5CRE A;  2HNL A;  4F0B A;  3GTU B;  4JR4 A;  4AKX B;  4FYC A;  3FK8 A;  3IPZ A;  2VD1 A;  1FVK A;  2HZE A;  4FO5 A;  1RW1 A;  2X8H A;  2V6K A;  4LMV A;  3HCZ A;  2EIR A;  4AJ6 A;  4KW6 A;  4KX4 A;  2YP6 A;  4AI6 A;  4W66 A;  3MNG A;  1NW2 A;  3GL5 A;  2X8C A;  2RUE A;  2YWI A;  1JZR A;  3Q74 A;  4KH7 A;  4WR5 A;  1V57 A;  3BOA A;  1OC9 B;  1BED A;  2KP2 A;  3UBK A;  4YQM A;  4F2I A;  18GS A;  2IIY A;  2CX3 A;  2C0F A;  2REM A;  3R2Q A;  2H6Z A;  3EMX A;  4KSO A;  5ECN B;  4OFN A;  5E59 A;  2X49 A;  4TXV A;  2YWM A;  1YEW C;  4CW9 A;  3IHG A;  4PUR A;  3FY7 A;  4GSS A;  2GVP A;  1SKW B;  1XOA A;  3KTL A;  4K6X A;  1K0B A;  3M1G A;  4KCE A;  3HJO A;  5DCG A;  3HY2 A;  5J5N A;  5AIX A;  4EUY A;  2H70 A;  4BL7 A;  1GSU A;  3RPP A;  4V1A p;  5EPF A;  2FGX A;  3MSZ A;  4K0N A;  1J0F A;  5LD0 A;  4MAB A;  1B48 A;  2IPA A;  3F4S A;  3CRT A;  2AAW A;  2N5F A;  4HI7 A;  4GST A;  1K3L A;  2WVY A;  3FHK A;  2CVK A;  3CMI A;  4PX1 A;  3EC3 A;  1F6M C;  1M2A A;  4ZBA A;  4WEY A;  2DC5 A;  1TU7 A;  2FD3 A;  1TI1 A;  1SYR A;  1GL8 A;  2LRT A;  3Q18 A;  5DQS A;  1LJR A;  2C3T A;  1HNA A;  1XWK A;  1S3C A;  1ABA A;  4HU9 A;  4N11 A;  2OT3 A;  1VGL A;  2LEG A;  4KA0 A;  1V2A A;  1SEN A;  2A2P A;  1A8L A;  2KUC A;  2CX4 A;  3VWU A;  3VPT A;  2HRA A;  4L0W A;  3GL3 A;  1V58 A;  5J9C A;  3CHX C;  3RDW A;  1JLV A;  3APQ A;  3C1R A;  1GWC A;  4HUA A;  1T7P B;  4TR1 A;  1YQ1 A;  2MZC A;  4AKH A;  4PUA A;  4BVY A;  4GTU A;  13GS A;  3RBT A;  4AKG A;  3SBC A;  2DMM A;  1AIU A;  3HD5 A;  4GF0 A;  5G5F A;  2O3E A;  1PSQ A;  3FR3 A;  4AJ8 A;  5A34 B;  1U88 A;  3TKS C;  1JZD A;  5G31 A;  5J4Y A;  3MYD A;  2GSS A;  3IV4 A;  5D9T A;  4X1U A;  2YV9 A;  3QMX A;  2WCI A;  3E0U A;  2CAI A;  1K0N A;  1TU8 A;  3KP8 A;  4WKW A;  5C04 A;  3CSH A;  2HZE B;  4O5R A;  1EV9 A;  2WVX A;  1VF4 A;  4XRA A;  4Z7X A;  1NSW A;  1ZYN A;  1S3R A;  4K2X A;  5F05 A;  1XIY A;  3ZYW A;  2H71 A;  4K8M A;  3FKF A;  2DJ3 A;  2DJJ A;  2XBQ A;  1GTB A;  2HSH A;  2CZ3 A;  1SVL A;  17GS A;  1GSY A;  4PTS A;  5ENU A;  2I81 A;  3H1N A;  4ID0 A;  3GA4 A;  1TOF A;  1DUG A;  1O8W A;  3GX0 A;  2PUK C;  4HZ2 A;  22GS A;  5CO3 A;  2VL3 A;  2DML A;  2QA2 A;  1SKR B;  4OFM A;  4AF2 A;  1PN0 A;  4K7I A;  2K8S A;  3EYT A;  1BG5 A;  4GRF A;  5AGY A;  3TJK A;  1GTU A;  4QMK A;  4E68 A;  3CYN A;  3W8J A;  3D4M A;  4RQR A;  4YH2 A;  4O92 A;  1O85 A;  5IIZ A;  4RUV A;  4YAV A;  5A5H A;  4BL7 B;  2OBI A;  4EE0 A;  1Z9H A;  4MF5 A;  5HQP A;  3TU3 B;  1M2D A;  3LOR A;  4KDX A;  2R4V A;  4X0X A;  3RHC A;  1SK2 A;  2LS5 A;  3DRN A;  1DE1 A;  3C7M A;  2MYG A;  2GZZ A;  1M3J A;  1XWC A;  3UBL A;  4IQ1 A;  4V2N A;  4OFT A;  5CRH A;  1PL2 A;  1GTI A;  2C3N A;  2HRF A;  2YCD A;  4OWY A;  2YZH A;  1BQ7 A;  4MZB A;  3WT2 A;  2CT6 A;  2VCW A;  2BMX A;  3KD0 A;  1XBS A;  2J9H A;  3EIN A;  1WWJ A;  1AQV A;  2GQL A;  3ERW A;  3ZZX A;  1HNB A;  1Q4J A;  2B1K A;  5G30 A;  2R5G A;  3UVH A;  1YF1 A;  5B8B A;  3HJP A;  2RM5 A;  2E2M A;  3O3T A;  3KZQ A;  1M9B A;  2WW1 A;  4N10 A;  2LJK A;  4TRX A;  5IO2 A;  1ML6 A;  4I97 A;  4G10 A;  4HJM A;  2TRX A;  2K18 A;  2KLX A;  4FH8 A;  3UAP A;  3IAS 2;  3DD3 A;  3K8N A;  4ML1 A;  10GS A;  1U3A A;  2R3X A;  4BVY B;  3DYR A;  4GWR A;  2XPE A;  6GSW A;  2IME A;  1TK8 B;  1PN9 A;  4TVE A;  2QSI A;  1YF0 A;  3WGE A;  2MBT A;  1K0M A;  2B5Y A;  1J9B A;  5DBQ A;  2IWT A;  4GQF A;  4POM A;  2LRC A;  4JE1 A;  2L6D A;  2PWJ A;  3RGB C;  2P5Q A;  3BCI A;  1UN2 A;  3QCP A;  2GLR A;  1MDI A;  3F3R A;  4I2T A;  4GLT A;  4EKZ A;  1Z7P A;  2M80 A;  5INY A;  4MK3 A;  1F9M A;  4ZIL A;  1OE8 A;  1XVQ A;  1PQN A;  2MMO A;  2C4J A;  2PBJ A;  3D22 A;  5E4W A;  11GS A;  3M9K A;  2NTO A;  3GHA A;  1OE7 A;  3PIN A;  5FT3 A;  1PX7 A;  3TOU A;  1TK0 B;  2WVX B;  4JU5 A;  2HSM B;  2WFC A;  4WBJ A;  1K0O A;  3KGK A;  3ZIV A;  3IXR A;  3E3E A;  4PQ1 A;  2WUL A;  1GSF A;  1SVO A;  5C00 A;  2JZT A;  1YDK A;  1VF3 A;  4L5L A;  5A5K A;  2L5O A;  2B3S A;  2R0C A;  1EOG A;  2VL2 A;  5AIS A;  1R26 A;  1PL1 A;  3GST A;  2C0D A;  3TKQ A;  2CAQ A;  2C1Y A;  4D73 A;  2H30 A;  3GKK A;  1QUW A;  5CRW A;  5ECR B;  4MCU A;  3F6F A;  1K0D A;  3HVS A;  1SVM A;  1W4V A;  4V2M A;  16GS A;  3GUR A;  3QD9 A;  3SWL A;  2DIZ A;  3LQ7 A;  3GFK A;  5CNW A;  2A4H A;  5JCG A;  3WYW A;  2FCH A;  4EO3 A;  4KDU A;  5D8I A;  3EU4 A;  5EVO A;  4OCF A;  4GSN A;  2H0G A;  2VCQ A;  2VLV A;  2O7K A;  5A5H B;  2C80 A;  1N2A A;  1AQW A;  4ILF A;  2WDU A;  1A0R P;  1E6B A;  4PQH A;  4YQU A;  1GUK A;  1X5E A;  4H86 A;  4X43 A;  4EC0 A;  3NZN A;  1BJX A;  3F9U A;  1YEX A;  3A2X A;  1GLQ A;  1KNG A;  1TP9 A;  2NVL A;  2FWE A;  5FWG A;  1X5C A;  1PD2 1;  4O5U A;  1G6Y A;  1LBK A;  5D9X A;  4HS1 A;  3J7Y b;  1FHE A;  4KAE A;  1S4B P;  4YKG A;  4JRR A;  1GUL A;  2IMD A;  2XPD A;  1BX9 A;  1DSB A;  1B4P A;  1YY7 A;  2IMI A;  3Q19 A;  4JBB A;  1AXD A;  5D96 A;  2LKU A;  5D9V A;  2LTK A;  3FZ9 A;  3NIV A;  1SL1 B;  1F3B A;  1QXH A;  4ECI A;  5A4U A;  2JZR A;  3ZVJ D;  3WT1 A;  4K1F A;  1HNC A;  3VI5 A;  4FQU A;  4PNG A;  2OAC A;  5AN1 A;  5HR3 A;  2PN8 A;  1ERW A;  3ISO A;  1O81 A;  4MNN A;  1WE0 A;  3HKR A;  3IR4 A;  4TXO B;  2VOC A;  5IMA A;  3FYG A;  5IOX A;  5LCZ A;  3EWL A;  4PGT A;  5IM9 A;  3VWV A;  1WMJ A;  5FHI A;  1A2J A;  3C73 A;  3KXO A;  3HXS A;  2PPT A;  2ZCT A;  1VF2 A;  2L4C A;  3CQF A;  1V98 A;  4PUF C;  4G0L A;  2O85 A;  4ZB6 A;  4K5S A;  2PU9 C;  3GN3 A;  3KMO A;  3IDV A;  4YAP A;  2CV4 A;  3LYP A;  2GSR A;  4K5R A;  1FB0 A;  3KTB A;  5HFI A;  5ECM B;  3I43 A;  3DGQ A;  1NM3 A;  3IBH A;  1Z7R A;  2RII A;  5J9B A;  1MD4 A;  4WF4 A;  4DVC A;  3G7I A;  3DXB A;  3UIW A;  2MMA A;  2F3M A;  2ZNM A;  2CZ2 A;  3MWH A;  1YEP A;  4QQ7 A;  4KSM A;  4XRD A;  1TK5 B;  1OYJ A;  5D93 A;  3EU3 A;  6GSS A;  3MDK A;  1G7E A;  1Y25 A;  1PKW A;  2B5X A;  5IMZ A;  4IJ3 A;  1AQX A;  2QKE A;  2WVZ A;  4TR4 A;  2R0G A;  1MTC A;  2OAD A;  3FZ5 A;  3TJB A;  2YJH A;  5KOW A;  2VUP A;  3H79 A;  4FIW A;  4D73 B;  4TW5 A;  3JCM L;  1QFN A;  4EDY A;  1TW9 A;  4JED A;  6GSY A;  3F3Q A;  1Z5Y E;  3N9J A;  3KJY A;  3ERG A;  7GSS A;  4BIK A;  4A5P A;  4TKY A;  3G9B A;  2IMK A;  4PQI A;  3LG6 A;  1YKA A;  4V2L A;  4NV2 A;  4L8E A;  5J4V A;  2UZ8 A;  4LL4 B;  1QQ2 A;  4NV5 A;  3J7Y k;  4G0K A;  2BJX A;  1RK4 A;  3TUE A;  3HZ4 A;  4USS A;  1Z3E A;  2VM2 A;  1H75 A;  4K7N A;  4CHS A;  4YQV A;  2YPM A;  2GTU A;  1I9D A;  3TCO A;  3ZRE A;  1GRX A;  1CQH A;  5B6M A;  1G7O A;  1LU4 A;  1NHY A;  4G01 A;  1A8Y A;  4PHZ C;  3IAM 2;  2O87 A;  5LNK e;  1I5G A;  4HOJ A;  2CVB A;  2EFH A;  4WXT A;  5CYY A;  3F6D A;  1SYX A;  1K0C A;  4BPY A;  4QL9 A;  4XTS A;  3GYK A;  2AHE A;  2LJA A;  2HRN A;  4MH3 A;  3APS A;  2OA7 A;  3KH7 A;  3D6I A;  4GXZ A;  5ELA A;  4MF6 A;  1YKC A;  4NAX A;  4KF9 A;  5KOX A;  2CA8 A;  6GST A;  5HR1 A;  3A5W A;  2H01 A;  4L0U A;  1OC8 A;  1XW6 A;  2H1L A;  2WGR A;  4BA7 A;  2GQM A;  2HE3 A;  2L6C A;  5IMC A;  4GDF A;  5A4V A;  3I69 A;  2FNO A;  2HQT A;  3ZML A;  19GS A;  3CBU A;  2B7K A;  2R6K A;  3QOU A;  2JZS A;  3GNJ A;  3GH6 A;  5D9W A;  3DIE A;  5J3R A;  2HSM A;  3IRA A;  4ZIJ A;  2JU5 A;  1B4Q A;  1ZCP A;  9GSS A;  1EEJ A;  1BG1 A;  4ECC A;  4Z2T A;  3DVX A;  4QL7 A;  1O6J A;  3UL3 A;  4OCE A;  3LEF A;  1X9S B;  3DKS A;  2VCT A;  1R4W A;  4MJA A;  3RAZ A;  4J2F A;  1J08 A;  4MZC A;  1GNE A;  3L78 A;  3MIX A;  2AJQ B;  2MMZ A;  2AUV A;  3UEM A;  5F06 A;  1VF1 A;  3M3M A;  3P7X A;  1N8J A;  1ILO A;  1XOB A;  4DSR A;  5IO0 A;  5BMU A; 
#chains in the Genus database with same CATH homology
 1SJZ A;  1TXU A;  1TJD A;  4K7O A;  4K2D A;  3RHB A;  1S3D A;  2B7J A;  2GZY A;  4ZBD A;  1KEB A;  5F0G A;  1XXU A;  4HJ2 A;  1M0U A;  3FZA A;  5KEJ A;  4XS4 A;  3CTF A;  3QAV A;  4OD7 A;  3L4N A;  1K0A A;  5JCU A;  3C8E A;  5JCW A;  1F3A A;  2GS3 A;  4EXJ A;  2VLT A;  1AAZ A;  1GSD A;  2VO4 A;  3ZRD A;  1Y1U A;  2EIO A;  3L9V A;  2R37 A;  1T00 A;  3LJR A;  3ZMK A;  2WJU A;  3GSS A;  3EVI A;  4E8E A;  3VI7 A;  2X4A A;  4RQX A;  1FOH A;  4CDO A;  2H8L A;  5IOW A;  4ACS A;  4MLY A;  2AB6 A;  1FB6 A;  1URM A;  1FW1 A;  2FUG 2;  5KN0 A;  3CTG A;  4E8H A;  5CP1 A;  3KMN A;  5CRD A;  5HR2 A;  3E9J B;  3PR8 A;  2DKH A;  2NDO A;  4KE3 A;  4N0Z A;  2ES7 A;  5AIV A;  1WIK A;  4RI7 A;  2TRC P;  1XWA A;  1MEK A;  2WRT A;  2C3Q A;  2WB9 A;  2HSN A;  5CRG A;  2DJ0 A;  1ERU A;  3GUS A;  2H75 A;  4TXO A;  1GLP A;  2C0G A;  4KGI A;  5JWQ B;  2LQO A;  4IN0 A;  4F0C A;  3FMW A;  1FVJ A;  1U87 A;  3U5R E;  5CAX A;  2ON7 A;  3KH9 A;  1XWB A;  3IK7 A;  1G0T A;  2OJL A;  3VUR A;  3HZ8 A;  3OR5 A;  4ECJ A;  3FR9 A;  3QAW A;  2A4V A;  2DBC A;  3W8S A;  2RM6 A;  4TR0 A;  2H1B A;  3GKM A;  4IVF A;  3KP9 A;  4MF7 A;  3FEU A;  4EIP A;  4EF0 A;  3QAG A;  2FLS A;  5HR0 A;  5L71 A;  4G19 A;  2MMN A;  4XS6 A;  1NHO A;  4DEJ A;  3H8Q A;  4GCI A;  3KM6 A;  1M99 A;  3US3 A;  2H6Y A;  20GS A;  1ZYE A;  5JWR B;  2QGV A;  3P90 A;  5IQY A;  5ECQ B;  2RUF A;  4AGS A;  4NPB A;  3TKS E;  4Q5R A;  2OE3 A;  3CSJ A;  1OKT A;  1K3Y A;  1M7T A;  2NBS A;  3BJ5 A;  4O7H A;  5J47 A;  3O76 A;  3TRQ A;  3IOS A;  3EPT A;  4I8B A;  4KUN A;  1GUH A;  1GUM A;  2E7P A;  6GSX A;  4P3Y B;  1PMT A;  2G2Q A;  2V2G A;  5H5Q A;  3IHQ A;  4F9Z A;  2IFQ A;  4EL1 A;  4G9H A;  4HZ4 A;  2JAD A;  2FA8 A;  2E0Q A;  5BMU B;  4JZQ A;  3HVV A;  3DVW A;  2F8F A;  1C72 A;  5G1L A;  3UOM A;  2HZF A;  3VPQ A;  2H0I A;  4MJE A;  1H4O A;  1O8X A;  4XS4 B;  2R2J A;  1GTA A;  2NPB A;  3EMP A;  3IC8 A;  3G7J A;  4OMV A;  3HA9 A;  3M9J A;  2JAC A;  4WF5 A;  1MD3 A;  2I4A A;  1EGR A;  4MDC A;  3A2W A;  2B5E A;  1XPV A;  5G2Z A;  5BRT A;  3VWW A;  2FWH A;  2E2G A;  2HI7 A;  1U6T A;  2VL9 A;  1Z6N A;  4I2U A;  3GKX A;  2Z9S A;  4EVM A;  4Q5Q A;  1X5D A;  2P5R A;  3UMA A;  2EIQ A;  1OC3 A;  3LSZ A;  4IQA A;  3ERF A;  3BBY A;  3CSI A;  4OO5 A;  1UC7 A;  2H6X A;  4Z2R A;  2GDR A;  4HEA 2;  3HVX A;  2GT6 A;  2KOK A;  3KCM A;  2HSN B;  3NOF A;  2P31 A;  2XC2 A;  4N3Z A;  1EEM A;  2VD0 A;  1A23 A;  2VCZ A;  2B6M A;  3IK9 A;  4MH2 A;  2EFC A;  5DCH A;  2CVD A;  3FR6 A;  5JWO B;  2V1M A;  4PXO A;  3A5I A;  1FO5 A;  2JSZ A;  1ZYP A;  1IYI A;  1V9W A;  3A2V A;  3S9F A;  2QA1 A;  4ZB9 A;  3F4R A;  3TRX A;  2YZU A;  2H1D A;  1SD9 A;  2K6V A;  4IP1 A;  3TKS A;  4IEL A;  3ZTL A;  3EUR A;  3H4K A;  5ECK B;  3ME8 A;  5KN1 A;  1WPI A;  4AKI A;  2B1L A;  4ISD A;  5ECH B;  1ZYQ B;  1N25 A;  2K8V A;  3TKR A;  1EWX A;  3UAR A;  4NHW A;  2DJ2 A;  2WZ9 A;  2G0F A;  1X9M B;  1CQG A;  2YN1 A;  3A3T A;  3D21 A;  1YVL A;  1GP1 A;  5A1N A;  1THX A;  4DSS A;  1Q98 A;  2L5L A;  2VL2 C;  3QR6 A;  6GSV A;  1AUC A;  1TRW A;  5ECL B;  3V1W A;  1R5A A;  4BVX A;  1B9X C;  2VAF A;  2YJ7 A;  1QK8 A;  2IJY A;  1SJI A;  2J23 A;  3ZFL A;  1THO A;  2IFQ B;  1PA3 A;  3KEB A;  1W89 A;  4LMW A;  1T3B A;  3TDG A;  1HYU A;  12GS A;  3D5J A;  3GH9 A;  3L9U A;  2V6O A;  2LRN A;  4K0G A;  1PGT A;  5B6N A;  4POB A;  1RQM A;  1XWG A;  3D0Z A;  1JZO A;  2HSY A;  2IN3 A;  14GS A;  2N5A A;  4IJI A;  1SJ6 A;  3C1S A;  2TIR A;  5DQY A;  3ZIJ A;  3EE2 A;  4EDZ A;  4PNF A;  4WET A;  1PKZ A;  1SD8 A;  1DE2 A;  3ED3 A;  2X99 A;  1ZZY A;  4K9Z A;  5ELG A;  2VCX A;  5KN3 A;  3I6A A;  4ICY A;  2H0H A;  4I5Q A;  2IL3 A;  2H76 A;  2I9H A;  1TRV A;  2H1G A;  2C8U A;  1XCC A;  2EFE A;  3F63 A;  3CRU A;  2C0E A;  1EZK A;  2YOI A;  4N30 A;  1T8E B;  3O6T A;  4YKF A;  4POK A;  4IS0 A;  2ON5 A;  3HYP A;  3DWV A;  2DSA A;  5IMF A;  1ON4 A;  4V1A g;  3LW9 A;  4IW9 A;  2HRK A;  2HYX A;  1A24 A;  5DDL A;  1YJ6 A;  3IE3 A;  4JR6 A;  2FWF A;  8GSS A;  1EV4 A;  3QPM A;  1A2L A;  3CXG A;  1UVZ A;  5DAL A;  2FHE A;  4XCS A;  4RI6 A;  2VCV A;  2L57 A;  3GMF A;  3QFB C;  5HFK A;  4J56 E;  3PGT A;  1WP0 A;  2VIM A;  4NHZ A;  1FAA A;  4O5Q A;  5HFG A;  1GNW A;  1AW9 A;  2X8G A;  3FZ4 A;  2EFD A;  4G0I A;  2O5V A;  2WS2 A;  2H72 A;  1X9W B;  4NXI A;  2KHP A;  3Q6O A;  1HQO A;  3PPU A;  4AJ7 A;  3WGX A;  5ECP B;  2IMF A;  2H74 A;  2FY6 A;  5DVB A;  4ZXG A;  2LQQ A;  1X0R A;  5F8B A;  3ME7 A;  2XBI A;  4WBR D;  5ECS A;  1XW9 A;  4MP4 A;  1OVN A;  2VLU A;  2PGT A;  4HQZ A;  5A1N B;  2X64 A;  1T4Z A;  1PX6 A;  1XVW A;  4DSS B;  2PVQ A;  2GSQ A;  1JZW A;  4NWY A;  1ZOF A;  2I1U A;  4IKH A;  4BVX B;  2I3Y A;  1FG4 A;  4KND A;  1SKS B;  1KBN A;  2DJ1 A;  2O8V B;  1USB A;  3I9V 2;  4MJB A;  1WJK A;  2H19 A;  1IYH A;  2PVO C;  1JFU A;  2LUS A;  1ZMA A;  3ZL5 A;  5ABR A;  2FWG A;  4TN8 A;  1R5P A;  4POL A;  2DIY A;  5DJM A;  1UA5 A;  3QDN A;  4ZBB A;  5H5S A;  4IP6 A;  1BYE A;  4LA1 A;  4IGJ A;  3LXT A;  3TJJ A;  1TDI A;  4O32 A;  2LNT A;  4CY6 A;  4EIQ A;  1JHB A;  2YWN A;  4ML6 A;  1TKD B;  1OKD A;  2OE1 A;  5ID2 A;  2H1A A;  2F51 A;  1QMV A;  4MA9 A;  3P2A A;  1VRS D;  1Y6E A;  2YWO A;  1K3O A;  3VWX A;  3VFI A;  3F8U A;  3VLN A;  4HU7 A;  5IPH A;  2LJR A;  2M46 A;  4ZB8 A;  4LL1 B;  4HQS A;  1EOH A;  1DBY A;  5B8A A;  1F37 A;  2LV3 A;  3HMJ G;  2PER A;  3ZVJ A;  2F9S A;  5KN2 A;  1Z6M A;  4ECB A;  2L59 A;  4MPF A;  1BF5 A;  5ECO B;  2FA4 A;  4IBP A;  5J4U A;  3GV1 A;  1GSS A;  2YAN A;  3VK9 A;  3TRP A;  2LST A;  3WGD A;  2GST A;  2LNS A;  1XZO A;  5COH A;  1E2Y A;  1ZL9 A;  1T1V A;  2V41 A;  3LWA A;  4TR1 B;  1B9Y C;  2HRK B;  4XHM A;  1G6W A;  2ZUP A;  5A4W A;  3DEX A;  3UJ1 A;  2DLX A;  3M0F A;  1OAZ A;  1GSQ A;  3LXZ A;  3UVT A;  2YV7 A;  2A2R A;  1SL2 B;  1ERT A;  2MBS A;  4ZL9 A;  5DAL B;  2AYT A;  4MJC A;  1BAY A;  5DAK A;  2R0P A;  2H73 A;  3GTU A;  3LFL A;  2D2Z A;  2JSY A;  5G5E A;  2HT9 A;  2V32 A;  4NMU A;  2A2S A;  3L9S A;  2OKA A;  5ECI B;  2UV8 G;  3L0H A;  3IC4 A;  2P0G A;  5GAN D;  4KB3 A;  6GSU A;  4MMM A;  5EL8 A;  4BWS A;  4KDY A;  3TJF A;  3APO A;  2HLS A;  2VKZ G;  3TGZ A;  2M72 A;  5IMV A;  4DSQ A;  1OC9 A;  3HJM A;  1GH2 A;  4N0V A;  3W6G A;  1XFL A;  1PRX A;  1U3I A;  1TTZ A;  4Z2U A;  4WR4 A;  3HDC A;  4G2E A;  3R3E A;  4OO4 A;  2HFD A;  1ACV A;  3PH9 A;  3IA1 A;  5IPG A;  4ZL7 A;  3H93 A;  3N5O A;  2YNX A;  3TB2 A;  4J57 E;  1EP8 A;  1ERV A;  5GST A;  2GQK A;  2OE0 A;  3ZIT A;  5D73 A;  1WOU A;  2N5B A;  1TI3 A;  2DJK A;  5H5R A;  3FRC A;  1SK0 A;  1ST9 A;  3GX8 A;  5J41 A;  3RPN A;  3AY8 A;  4CY8 A;  5GSS A;  4I6X A;  4TOP A;  1S3A A;  4GQC A;  3TOT A;  3KIJ A;  1B8X A;  3LYK A;  3LGC A;  3G7Y A;  1ZGN A;  2BTO T;  4LLR A;  1QGV A;  4XS1 A;  5B7C A;  4HDE A;  3ZLP A;  1SK1 A;  1EP7 A;  2GT5 A;  3MAK A;  2K9F A;  3BD2 A;  2AV4 A;  3WD6 A;  3U6V A;  1T4Y A;  2QC7 A;  1MDJ A;  4X4J A;  3GKN A;  3M8N A;  3GIX A;  1SU9 A;  4FYU A;  2RLI A;  3QFA C;  3BCK A;  3CWG A;  1O73 A;  5ID2 B;  2XHF A;  4FYB A;  1JLW A;  4Q5F A;  5GZZ B;  1XW5 A;  5J40 A;  5G1K A;  1V40 A;  4F03 A;  4L5O A;  3C71 A;  4ZB7 A;  1M2B A;  3F0I A;  4ULX A;  5EY6 A;  3TKP A;  1GSE A;  2H66 A;  1EGO A;  5GAP D;  2DKI A;  5IMD A;  4MPG A;  1A2M A;  3DML A;  1O7U A;  3F4T A;  2GZP A;  2OBK A;  3TJG A;  1TRS A;  1WRY A;  4MZW A;  2O89 A;  2JL4 A;  4KCA A;  2L4Q A;  4ZL8 A;  3HHV A;  2KP1 A;  2ALB A;  1A0F A;  1R7H A;  2EC4 A;  5DJL A;  4BWQ A;  4XIH A;  3FW2 A;  1M9A A;  1YZX A;  4TR3 A;  1AC1 A;  2GGT A;  1KTE A;  2HXK A;  3ZFB A;  4F82 A;  2F8A A;  1TXX A;  3P8W A;  1HD2 A;  1FOV A;  5A34 A;  2VM1 A;  1SL0 B;  4IHU A;  3D4T A;  1F2E A;  5F07 A;  1TRU A;  2PMT A;  3GRX A;  2CQ9 A;  5DAK B;  1MDK A;  4Q5N A;  5CRE A;  2HNL A;  4F0B A;  3GTU B;  4JR4 A;  4AKX B;  4FYC A;  3FK8 A;  3IPZ A;  2VD1 A;  1FVK A;  2HZE A;  4FO5 A;  1RW1 A;  2X8H A;  2V6K A;  4LMV A;  3HCZ A;  2EIR A;  4AJ6 A;  4KW6 A;  4KX4 A;  2YP6 A;  4AI6 A;  4W66 A;  3MNG A;  1NW2 A;  3GL5 A;  2X8C A;  2RUE A;  2YWI A;  1JZR A;  3Q74 A;  4KH7 A;  4WR5 A;  1V57 A;  3BOA A;  1OC9 B;  1BED A;  2KP2 A;  3UBK A;  4YQM A;  4F2I A;  18GS A;  2IIY A;  2CX3 A;  2C0F A;  2REM A;  3R2Q A;  2H6Z A;  3EMX A;  4KSO A;  5ECN B;  4OFN A;  5E59 A;  2X49 A;  4TXV A;  2YWM A;  4CW9 A;  3IHG A;  4PUR A;  3FY7 A;  4GSS A;  2GVP A;  1SKW B;  1XOA A;  3KTL A;  4K6X A;  1K0B A;  3M1G A;  4KCE A;  3HJO A;  5DCG A;  3HY2 A;  5J5N A;  5AIX A;  4EUY A;  2H70 A;  4BL7 A;  1GSU A;  3RPP A;  4V1A p;  5EPF A;  2FGX A;  3MSZ A;  4K0N A;  1J0F A;  5LD0 A;  4MAB A;  1B48 A;  2IPA A;  3F4S A;  3CRT A;  2AAW A;  2N5F A;  4HI7 A;  4GST A;  1K3L A;  3FHK A;  2CVK A;  3CMI A;  4PX1 A;  3EC3 A;  1F6M C;  1M2A A;  4ZBA A;  4WEY A;  2DC5 A;  1TU7 A;  2FD3 A;  1TI1 A;  1SYR A;  1GL8 A;  2LRT A;  3Q18 A;  5DQS A;  1LJR A;  2C3T A;  1HNA A;  1XWK A;  1S3C A;  1ABA A;  4HU9 A;  4N11 A;  2OT3 A;  1VGL A;  2LEG A;  4KA0 A;  1V2A A;  1SEN A;  2A2P A;  1A8L A;  2KUC A;  2CX4 A;  3VWU A;  3VPT A;  2HRA A;  4L0W A;  3GL3 A;  1V58 A;  5J9C A;  3RDW A;  1JLV A;  3APQ A;  3C1R A;  1GWC A;  4HUA A;  1T7P B;  4TR1 A;  1YQ1 A;  2MZC A;  4AKH A;  4PUA A;  4BVY A;  4GTU A;  13GS A;  3RBT A;  4AKG A;  3SBC A;  2DMM A;  1AIU A;  3HD5 A;  4GF0 A;  5G5F A;  1PSQ A;  3FR3 A;  4AJ8 A;  5A34 B;  1U88 A;  3TKS C;  1JZD A;  5G31 A;  5J4Y A;  3MYD A;  2GSS A;  3IV4 A;  5D9T A;  4X1U A;  2YV9 A;  3QMX A;  2WCI A;  3E0U A;  2CAI A;  1K0N A;  1TU8 A;  3KP8 A;  4WKW A;  5C04 A;  3CSH A;  2HZE B;  4O5R A;  1EV9 A;  1VF4 A;  4XRA A;  4Z7X A;  1NSW A;  1ZYN A;  4K2X A;  5F05 A;  1XIY A;  3ZYW A;  2H71 A;  4K8M A;  3FKF A;  2DJ3 A;  2DJJ A;  2XBQ A;  1GTB A;  2HSH A;  2CZ3 A;  1SVL A;  17GS A;  1GSY A;  4PTS A;  5ENU A;  2I81 A;  3H1N A;  4ID0 A;  3GA4 A;  1TOF A;  1DUG A;  1O8W A;  3GX0 A;  2PUK C;  4HZ2 A;  22GS A;  5CO3 A;  2VL3 A;  2DML A;  2QA2 A;  1SKR B;  4OFM A;  4AF2 A;  1PN0 A;  4K7I A;  2K8S A;  3EYT A;  1BG5 A;  4GRF A;  5AGY A;  3TJK A;  1GTU A;  4QMK A;  4E68 A;  3CYN A;  3W8J A;  3D4M A;  4RQR A;  4YH2 A;  4O92 A;  1O85 A;  5IIZ A;  4RUV A;  4YAV A;  5A5H A;  4BL7 B;  2OBI A;  4EE0 A;  1Z9H A;  4MF5 A;  5HQP A;  3TU3 B;  1M2D A;  3LOR A;  4KDX A;  2R4V A;  4X0X A;  3RHC A;  1SK2 A;  2LS5 A;  3DRN A;  1DE1 A;  3C7M A;  2MYG A;  2GZZ A;  1XWC A;  3UBL A;  4IQ1 A;  4V2N A;  4OFT A;  5CRH A;  1PL2 A;  1GTI A;  2C3N A;  2HRF A;  2YCD A;  4OWY A;  2YZH A;  1BQ7 A;  4MZB A;  3WT2 A;  2CT6 A;  2VCW A;  2BMX A;  3KD0 A;  1XBS A;  2J9H A;  3EIN A;  1WWJ A;  1AQV A;  2GQL A;  3ERW A;  3ZZX A;  1HNB A;  1Q4J A;  2B1K A;  5G30 A;  2R5G A;  3UVH A;  1YF1 A;  5B8B A;  3HJP A;  2RM5 A;  2E2M A;  3O3T A;  3KZQ A;  1M9B A;  4N10 A;  2LJK A;  4TRX A;  5IO2 A;  1ML6 A;  4I97 A;  4G10 A;  4HJM A;  2TRX A;  2K18 A;  2KLX A;  4FH8 A;  3UAP A;  3IAS 2;  3DD3 A;  3K8N A;  4ML1 A;  10GS A;  1U3A A;  2R3X A;  4BVY B;  3DYR A;  4GWR A;  2XPE A;  6GSW A;  2IME A;  1TK8 B;  1PN9 A;  4TVE A;  2QSI A;  1YF0 A;  3WGE A;  2MBT A;  1K0M A;  2B5Y A;  1J9B A;  5DBQ A;  2IWT A;  4GQF A;  4POM A;  2LRC A;  4JE1 A;  2L6D A;  2PWJ A;  3BCI A;  2P5Q A;  1UN2 A;  3QCP A;  2GLR A;  1MDI A;  3F3R A;  4I2T A;  4GLT A;  4EKZ A;  1Z7P A;  2M80 A;  5INY A;  4MK3 A;  1F9M A;  4ZIL A;  1OE8 A;  1XVQ A;  1PQN A;  2MMO A;  2C4J A;  2PBJ A;  3D22 A;  5E4W A;  11GS A;  3M9K A;  2NTO A;  3GHA A;  1OE7 A;  3PIN A;  5FT3 A;  1PX7 A;  3TOU A;  1TK0 B;  4JU5 A;  2HSM B;  2WFC A;  4WBJ A;  1K0O A;  3KGK A;  3ZIV A;  3IXR A;  3E3E A;  4PQ1 A;  2WUL A;  1GSF A;  1SVO A;  5C00 A;  2JZT A;  1YDK A;  1VF3 A;  4L5L A;  5A5K A;  2L5O A;  2B3S A;  2R0C A;  1EOG A;  2VL2 A;  5AIS A;  1R26 A;  1PL1 A;  3GST A;  2C0D A;  3TKQ A;  2CAQ A;  2C1Y A;  4D73 A;  2H30 A;  3GKK A;  1QUW A;  5CRW A;  5ECR B;  4MCU A;  3F6F A;  1K0D A;  3HVS A;  1SVM A;  1W4V A;  4V2M A;  16GS A;  3GUR A;  3QD9 A;  3SWL A;  2DIZ A;  3LQ7 A;  3GFK A;  5CNW A;  2A4H A;  5JCG A;  3WYW A;  2FCH A;  4EO3 A;  4KDU A;  5D8I A;  3EU4 A;  5EVO A;  4OCF A;  4GSN A;  2H0G A;  2VCQ A;  2VLV A;  2O7K A;  5A5H B;  2C80 A;  1N2A A;  1AQW A;  4ILF A;  2WDU A;  1A0R P;  1E6B A;  4PQH A;  4YQU A;  1GUK A;  1X5E A;  4H86 A;  4X43 A;  4EC0 A;  3NZN A;  1BJX A;  3F9U A;  1YEX A;  3A2X A;  1GLQ A;  1KNG A;  1TP9 A;  2NVL A;  2FWE A;  5FWG A;  1X5C A;  1PD2 1;  4O5U A;  1G6Y A;  1LBK A;  5D9X A;  4HS1 A;  3J7Y b;  1FHE A;  4KAE A;  4YKG A;  4JRR A;  1GUL A;  2IMD A;  2XPD A;  1BX9 A;  1DSB A;  1B4P A;  1YY7 A;  2IMI A;  3Q19 A;  4JBB A;  1AXD A;  5D96 A;  2LKU A;  5D9V A;  2LTK A;  3FZ9 A;  3NIV A;  1SL1 B;  1F3B A;  1QXH A;  4ECI A;  5A4U A;  2JZR A;  3ZVJ D;  3WT1 A;  4K1F A;  1HNC A;  3VI5 A;  4FQU A;  4PNG A;  2OAC A;  5AN1 A;  5HR3 A;  2PN8 A;  1ERW A;  3ISO A;  1O81 A;  4MNN A;  1WE0 A;  3HKR A;  3IR4 A;  4TXO B;  2VOC A;  5IMA A;  3FYG A;  5IOX A;  5LCZ A;  3EWL A;  4PGT A;  5IM9 A;  3VWV A;  1WMJ A;  5FHI A;  1A2J A;  3C73 A;  3KXO A;  3HXS A;  2PPT A;  2ZCT A;  1VF2 A;  2L4C A;  1V98 A;  4PUF C;  4G0L A;  2O85 A;  4ZB6 A;  4K5S A;  2PU9 C;  3GN3 A;  3KMO A;  3IDV A;  4YAP A;  2CV4 A;  3LYP A;  2GSR A;  4K5R A;  1FB0 A;  3KTB A;  5HFI A;  5ECM B;  3I43 A;  3DGQ A;  1NM3 A;  3IBH A;  1Z7R A;  2RII A;  5J9B A;  1MD4 A;  4WF4 A;  4DVC A;  3G7I A;  3DXB A;  3UIW A;  2MMA A;  2F3M A;  2ZNM A;  2CZ2 A;  3MWH A;  1YEP A;  4QQ7 A;  4KSM A;  4XRD A;  1TK5 B;  1OYJ A;  5D93 A;  3EU3 A;  6GSS A;  3MDK A;  1G7E A;  1Y25 A;  1PKW A;  2B5X A;  5IMZ A;  4IJ3 A;  1AQX A;  2QKE A;  4TR4 A;  2R0G A;  1MTC A;  2OAD A;  3FZ5 A;  3TJB A;  2YJH A;  5KOW A;  2VUP A;  3H79 A;  4FIW A;  4D73 B;  4TW5 A;  3JCM L;  1QFN A;  4EDY A;  1TW9 A;  4JED A;  6GSY A;  3F3Q A;  1Z5Y E;  3N9J A;  3KJY A;  3ERG A;  7GSS A;  4A5P A;  4TKY A;  3G9B A;  2IMK A;  4PQI A;  3LG6 A;  1YKA A;  4V2L A;  4NV2 A;  4L8E A;  5J4V A;  2UZ8 A;  4LL4 B;  1QQ2 A;  4NV5 A;  3J7Y k;  4G0K A;  2BJX A;  1RK4 A;  3TUE A;  3HZ4 A;  4USS A;  1Z3E A;  2VM2 A;  1H75 A;  4K7N A;  4CHS A;  4YQV A;  2YPM A;  2GTU A;  1I9D A;  3TCO A;  3ZRE A;  1GRX A;  1CQH A;  5B6M A;  1G7O A;  1LU4 A;  1NHY A;  4G01 A;  1A8Y A;  3IAM 2;  2O87 A;  5LNK e;  1I5G A;  4HOJ A;  2CVB A;  2EFH A;  4WXT A;  5CYY A;  3F6D A;  1SYX A;  1K0C A;  4BPY A;  4QL9 A;  4XTS A;  3GYK A;  2AHE A;  2LJA A;  2HRN A;  4MH3 A;  3APS A;  2OA7 A;  3KH7 A;  3D6I A;  4GXZ A;  5ELA A;  4MF6 A;  1YKC A;  4NAX A;  4KF9 A;  5KOX A;  2CA8 A;  6GST A;  5HR1 A;  3A5W A;  2H01 A;  4L0U A;  1OC8 A;  1XW6 A;  2H1L A;  2WGR A;  4BA7 A;  2GQM A;  2HE3 A;  2L6C A;  5IMC A;  4GDF A;  5A4V A;  3I69 A;  2FNO A;  2HQT A;  3ZML A;  19GS A;  3CBU A;  2B7K A;  2R6K A;  3QOU A;  2JZS A;  3GNJ A;  3GH6 A;  5D9W A;  3DIE A;  5J3R A;  2HSM A;  3IRA A;  4ZIJ A;  2JU5 A;  1B4Q A;  1ZCP A;  9GSS A;  1EEJ A;  1BG1 A;  4ECC A;  4Z2T A;  3DVX A;  4QL7 A;  1O6J A;  3UL3 A;  4OCE A;  3LEF A;  1X9S B;  3DKS A;  2VCT A;  1R4W A;  4MJA A;  3RAZ A;  4J2F A;  1J08 A;  4MZC A;  1GNE A;  3L78 A;  3MIX A;  2AJQ B;  2MMZ A;  2AUV A;  3UEM A;  5F06 A;  1VF1 A;  3M3M A;  3P7X A;  1N8J A;  1ILO A;  1XOB A;  4DSR A;  5IO0 A;  5BMU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...