3IK7A

Human glutathione transferase a4-4 with gsdhn
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
221
structure length
221
Chain Sequence
b'AARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase A4
publication title Substrate specificity combined with stereopromiscuity in glutathione transferase A4-4-dependent metabolism of 4-hydroxynonenal.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 77
structure length 221
sequence length 221
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2009-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3ik7A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3ik7A01
3GIXA 1MD3A 1SD9A 3J7Yb 2LRCA 3D4TA 2J9HA 2JL4A 1EWXA 2LS5A 4I6XA 3HKRA 3NIVA 3EC3A 3UBLA 3C7MA 1B4PA 2MBSA 3VWWA 1VRSD 1OC8A 2IFQA 5G5EA 4PNFA 2EIQA 3CTGA 2MMNA 1SKRB 2IN3A 1WWJA 5ECNB 1T3BA 5D96A 3RPNA 3F3RA 3ZMLA 1QK8A 4PNGA 4TKYA 3TRQA 1OVNA 3VI7A 2DMMA 2FLSA 1OYJA 4IKHA 2LSTA 1SK0A 1YY7A 2C0EA 4MMMA 4XIHA 2HZEA 3CMIA 4NWYA 1J9BA 3GH9A 1U6TA 5AGYA 1K0BA 3KH9A 2YWNA 4KW6A 4O5RA 4MDCA 4EC0A 3LORA 4O7HA 10GSA 2VCQA 4JR6A 1Z6MA 3UMAA 1GULA 3IBHA 3D4MA 4WKWA 2CAQA 4F82A 1AW9A 5ELAA 5BMUA 3ZTLA 3GFKA 3VWVA 4MZBA 3HVVA 3APSA 5HQPA 1XFLA 3M8NA 1O8XA 1GSEA 4KAEA 2HYXA 2DJ2A 2NBSA 3SBCA 4TRXA 1YEPA 3N5OA 4PUAA 1O73A 4JEDA 6GSYA 3EWLA 3Q6OA 3DIEA 2GQKA 2IWTA 3KIJA 2H01A 4HZ4A 2DJ3A 4GF0A 2EIOA 2YCDA 7GSSA 3GH6A 1KEBA 3KJYA 2B5YA 4XHMA 1TXXA 1XVQA 1AQXA 4MLYA 1I9DA 4RI6A 1GRXA 4MF5A 2ZCTA 4KB3A 2JADA 3V1WA 2FWFA 2RIIA 2H30A 1G6YA 4I5QA 3VWXA 2I9HA 5IPHA 5IO2A 3F4TA 4IN0A 1XXUA 5ECQB 2X99A 2K9FA 1WP0A 2O8VB 3GL3A 3K8NA 5ECKB 1TP9A 2ALBA 4ECCA 4EDZA 4MJEA 2E0QA 4TXVA 1SK1A 3HD5A 1A0FA 1YF1A 2O85A 5INYA 3M1GA 1SJZA 2V1MA 3F6FA 2X8HA 4EL1A 3WT2A 1FB0A 5DCGA 3IPZA 2F9SA 1V9WA 2KHPA 3G7YA 1EGOA 1V98A 4GSSA 3P7XA 4MCUA 4RQXA 1MD4A 1S3AA 1K3LA 2B5XA 1X9MB 1NW2A 2PMTA 3GTUA 1Q98A 2FGXA 2HXKA 2PVQA 3IV4A 1TU8A 5ECSA 4N0ZA 3GYKA 1DE1A 3IAS2 1VF1A 4LMWA 5B6MA 1JZOA 3CSHA 3E9JB 1SL2B 3CRTA 3LQ7A 1SENA 2DSAA 1YF0A 3GKXA 1YQ1A 4KDUA 3EMXA 4CDOA 4L8EA 1VF2A 4AGSA 2XBQA 4K0GA 1AUCA 2GQMA 1A2MA 2V6OA 3ISOA 2X8GA 5DALB 4G10A 5DVBA 3EMPA 4ZB6A 2IL3A 1M0UA 2C3QA 4K2DA 2OBKA 3I69A 3HCZA 1AXDA 2B3SA 4FYCA 4OMVA 4XS1A 4IVFA 4POLA 5G5FA 2HSHA 1FOVA 2H0HA 5HFKA 1AQWA 3CTFA 1BYEA 5EY6A 2B7KA 2O87A 1Y25A 2IMDA 2DIYA 2K8SA 3SWLA 3TJBA 1TU7A 2K8VA 4HJ2A 1RK4A 5CRDA 4AJ6A 4ZL9A 4L5LA 1B9XC 2MMAA 1Y6EA 4KX4A 3RPPA 3ZRDA 5ECIB 2VL2A 2JZSA 3H1NA 4I8BA 1X9WB 3WD6A 1O8WA 3QPMA 4AJ7A 3EVIA 2P5QA 1YJ6A 2AUVA 5D9WA 1XOAA 1PL1A 3A3TA 2IMEA 2VM1A 2YZUA 5HR0A 4PGTA 5DALA 2KOKA 4EKZA 1QUWA 3D21A 1VF4A 1UC7A 1T1VA 2I1UA 1R5PA 1ZOFA 1U3AA 2YOIA 1B9YC 1TW9A 2YV7A 2CX3A 3FKFA 1M9BA 3EURA 22GSA 4KUNA 4LMVA 3LXTA 1ST9A 2YZHA 1W89A 4BWSA 1WPIA 1NHOA 4X43A 4POBA 3VLNA 1DBYA 4OO4A 3IHQA 5CRGA 4DVCA 1BG5A 1K0NA 1TKDB 3PPUA 5ECOB 5HR3A 3IE3A 5ELGA 4MH3A 4KSOA 4Z7XA 1GUHA 1GSDA 3I9V2 1T8EB 4O32A 3F4SA 3MWHA 1ZZYA 2HSMB 1GH2A 3ZFLA 5CRHA 3RAZA 2DMLA 4PQHA 2CX4A 4JR4A 3Q18A 4V2MA 2DJJA 3TRXA 2WULA 5G2ZA 3ME8A 2KP2A 4ZBDA 2BTOT 3ZITA 5A5KA 4NV5A 1SK2A 2GGTA 1SD8A 1F6MC 2QC7A 2VLTA 1B48A 4I2TA 2VCXA 2XBIA 3KTBA 2C0GA 2EC4A 2F51A 2LJRA 3DRNA 5ECHB 4TXOB 2F8AA 2A4VA 19GSA 3VPTA 3FZ9A 4OO5A 2HT9A 6GSXA 2F3MA 1X9SB 3GX8A 4E8EA 4I97A 1NHYA 1GTUA 5KN3A 4G2EA 3HDCA 2GSTA 4K7NA 4RUVA 2QSIA 2YP6A 4RI7A 1HNBA 2E2MA 2WB9A 1DSBA 3ZZXA 2ZNMA 3TGZA 2VD1A 5D9XA 3LFLA 1V57A 1F37A 2HSMA 3EE2A 3PR8A 4NHZA 2GTUA 1DUGA 3FZ4A 4J56E 3W8JA 2K6VA 5ID2B 1AQVA 1T00A 3S9FA 2O7KA 4GLTA 3FR6A 1A23A 2E7PA 1ERWA 5IIZA 1ZGNA 2XHFA 3M0FA 3KCMA 2VAFA 3QDNA 2WJUA 1F3BA 1TTZA 3IA1A 1X0RA 1TK8B 1M9AA 4D73B 2OADA 1PRXA 3DEXA 3DMLA 4BWQA 2GVPA 5CNWA 5B6NA 2UZ8A 3QCPA 2H72A 4N10A 11GSA 3LXZA 3C1SA 5J5NA 1U88A 3GN3A 3EYTA 2HZEB 1N8JA 2VD0A 1R5AA 1EP7A 2OACA 4F0BA 2H71A 13GSA 3KP8A 3UOMA 3QFAC 3WGDA 4OFNA 2R5GA 4WETA 5ID2A 3H8QA 2P31A 3GV1A 1X5EA 3AY8A 3RHCA 2HZFA 3LSZA 3GUSA 1GSUA 3Q19A 5A4WA 4MABA 3A2XA 2WCIA 2GSRA 5KEJA 1FAAA 4YAVA 4D73A 3KP9A 2FD3A 3TCOA 3QAVA 3FY7A 1IYHA 4ECBA 2H6ZA 4WBJA 4GTUA 3ME7A 4NHWA 2AYTA 2PUKC 3CXGA 2AV4A 3KZQA 3ZYWA 3LGCA 2H73A 1PA3A 5J3RA 2JZRA 2OJLA 2KP1A 1OE7A 2VCVA 4FYBA 2H6XA 5GAND 3HZ8A 2CA8A 3KXOA 1M2AA 4ZL7A 3A5WA 5LD0A 2YWMA 2DLXA 4ZILA 2M46A 2L6CA 2N5FA 5CREA 2HQTA 3HXSA 3P90A 5E4WA 2HRFA 4CW9A 2ZUPA 2IMKA 5IMCA 5C00A 3ZVJD 4ID0A 4KDXA 3Q74A 2OE1A 1BJXA 4FYUA 1GL8A 5DCHA 4WR4A 5FWGA 4G0KA 1ZYEA 3G7JA 3P8WA 2PVOC 4BPYA 4XS6A 3ZFBA 1SU9A 4KF9A 2L5OA 1K0MA 3QAWA 4ZB8A 4HQZA 1V40A 3UVTA 1OC9A 2OE3A 2RUEA 2JACA 1F2EA 2R3XA 3GTUB 3MNGA 2B7JA 5B7CA 1XZOA 3ZIVA 3VFIA 3DD3A 1Z7PA 1X5DA 3WT1A 4DSSA 1LJRA 2YWIA 3QMXA 2HRNA 4KA0A 2OBIA 4ML6A 2H1DA 1XVWA 1EGRA 2B1LA 5JCUA 5IOXA 4HOJA 4V1Ag 2OKAA 2C8UA 2FUG2 4PQ1A 1MDIA 2V41A 5DDLA 1ACVA 4OCFA 2AHEA 4EO3A 1ABAA 2PWJA 3HY2A 1XWBA 5D8IA 1NSWA 1A24A 1TOFA 5FT3A 1Q4JA 14GSA 1SYXA 2PBJA 4ULXA 2H1AA 1AAZA 3M9KA 3JCML 3IDVA 4ZB9A 3RHBA 2MZCA 3TJFA 4MK3A 2YJHA 1QXHA 3PH9A 4WR5A 5CYYA 1KTEA 1JZWA 4GSTA 1XIYA 3D22A 3U6VA 3P2AA 1PSQA 1U87A 3KTLA 5D9VA 1YKAA 2VUPA 5JCGA 1LBKA 3BBYA 3LYPA 3A2VA 3TKSE 4Q5RA 4ML1A 1HD2A 1THOA 4K7IA 1U3IA 2D2ZA 2L59A 1F9MA 4ECJA 1PL2A 2LTKA 2WDUA 3MDKA 1HQOA 3QOUA 2CT6A 5AISA 4GRFA 3IK7A 2WRTA 5C04A 5AIVA 1Z5YE 5IOWA 3GKNA 4G19A 2V6KA 4PQIA 5ENUA 3TJGA 1C72A 1YDKA 3TOUA 1J0FA 1K0OA 3H4KA 3KEBA 3KH7A 5D93A 3TKPA 4K7OA 3GHAA 2FA8A 2VL2C 4HJMA 5G30A 5CO3A 4GQFA 1XOBA 3G9BA 2NVLA 1MEKA 2C1YA 1FO5A 8GSSA 1PMTA 2L57A 4TOPA 3FR9A 2G2QA 4K1FA 2H8LA 4TR1A 3R2QA 6GSWA 4LA1A 1EOGA 4J2FA 2YPMA 1QFNA 5JWOB 2LUSA 2R6KA 3MAKA 3D5JA 4PTSA 3UL3A 1K0CA 1GTBA 3D6IA 4HZ2A 2R2JA 1YEXA 1R26A 2DBCA 1M2BA 4L0UA 1ML6A 3FHKA 2B5EA 1SJIA 1FB6A 3GL5A 1G0TA 18GSA 1USBA 3IR4A 2VCZA 1F3AA 3RBTA 3ZL5A 2E2GA 1N2AA 3F4RA 2WS2A 4MJCA 4HS1A 1SYRA 2BJXA 4PXOA 1XWKA 2L4QA 3H93A 3KMNA 3O3TA 4OCEA 5B8AA 3UAPA 5A4VA 2YV9A 4KDYA 3IOSA 9GSSA 1JLWA 2HLSA 1XW9A 4IGJA 1QQ2A 3I6AA 1FVKA 3WGXA 1PGTA 1XPVA 3FW2A 3HVSA 1ZMAA 1WMJA 17GSA 2IPAA 2GT6A 1TDIA 1EV4A 2CZ2A 3GURA 1GLPA 2RLIA 16GSA 2ON5A 1KBNA 4HUAA 1TRVA 2NDOA 3HZ4A 2TIRA 4J57E 4CHSA 4G9HA 2QKEA 1G6WA 2PERA 3BCKA 2GT5A 4XTSA 2H76A 2VOCA 3L9SA 2REMA 1SL1B 2C0FA 3RDWA 3KMOA 4N0VA 3ZIJA 4GSNA 2H70A 1K3YA 3EU4A 3HA9A 4KSMA 2PGTA 3TOTA 3O76A 2R37A 2RM5A 4GXZA 4ECIA 2BMXA 1MDJA 4IQAA 4FO5A 1A2LA 1E6BA 4WF5A 2GDRA 4PURA 4OD7A 4QQ7A 5F0GA 4JU5A 3L0HA 2VCTA 4K6XA 1TRSA 3GKMA 4MP4A 3FR3A 5D9TA 1E2YA 4JBBA 1GNEA 1JZDA 1DE2A 1M2DA 1TRWA 4HU7A 1URMA 3HYPA 4YAPA 1ILOA 4NXIA 1EP8A 3A2WA 5EVOA 1TJDA 3UARA 2MMOA 5IMDA 2HE3A 3CBUA 3W6GA 4TR0A 3TJJA 1A8YA 3DYRA 3DVXA 1OKDA 3ERWA 3C8EA 2LQOA 5GSTA 4AJ8A 1GWCA 2H0IA 1WE0A 2MYGA 1A2JA 1THXA 2FWEA 5H5RA 2GSSA 4Q5FA 4IP1A 2HI7A 1TK5B 1NM3A 2LEGA 1GNWA 3M9JA 4WEYA 4DSRA 2IIYA 2I4AA 3F63A 1AC1A 5ABRA 5JWQB 4IBPA 1O7UA 3UJ1A 2HRAA 1FVJA 1BEDA 2Z9SA 5CRWA 5GZZB 3VK9A 2FY6A 3TKSC 4WF4A 2HFDA 1ERTA 1I5GA 3KD0A 1PX6A 2TRXA 5J9BA 4BL7A 2H0GA 3TKSA 4JZQA 2VM2A 3VWUA 1JFUA 4IHUA 2H6YA 4BVYB 2HRKA 5IMFA 1G7OA 4K0NA 4IELA 3PINA 5HFGA 4MZCA 5ECMB 5KN2A 4MF6A 5G1LA 4OFTA 3HHVA 1XWAA 5COHA 2LQQA 5IM9A 2V2GA 3ERFA 1ERUA 3FYGA 3TJKA 2XPDA 1BX9A 4POMA 1GP1A 3R3EA 5IPGA 4EXJA 5DBQA 5DQSA 3UVHA 1XW5A 4G0IA 1OC9B 3GX0A 5DAKA 4QL9A 2DJKA 2YNXA 4JE1A 1TI3A 1FG4A 3ERGA 1X5CA 3KGKA 3CSJA 6GSUA 4JRRA 2CZ3A 5EL8A 4DSSB 4EE0A 2GZYA 4EVMA 1G7EA 2G0FA 4EDYA 3QAGA 5IQYA 2IJYA 1GTAA 3F6DA 3KM6A 3M3MA 4F2IA 4ZBBA 1TI1A 3DWVA 4LL1B 1O85A 1SJ6A 2DJ1A 6GSVA 1J08A 4LL4B 1GSSA 3FZ5A 4BVYA 2R4VA 4YQUA 1H75A 2IMIA 3BJ5A 1V58A 1A0RP 3IC8A 4QL7A 4HDEA 4F9ZA 1IYIA 1WIKA 4IP6A 3GA4A 1S3CA 2VL3A 4HQSA 1WJKA 4Q5NA 3BD2A 2JSZA 3L9VA 2M72A 3TKRA 3F0IA 4V2LA 3DVWA 2AAWA 3LJRA 2H74A 4N11A 5F8BA 4N30A 1SL0B 1T4YA 3TKQA 3NOFA 2PU9C 2QGVA 1PX7A 4Q5QA 4H86A 3LWAA 3QR6A 5HR2A 5IMVA 1FW1A 4ZBAA 5HR1A 1ON4A 2A2SA 1JHBA 1WOUA 3D0ZA 4YQMA 4K9ZA 4POKA 5LNKe 4IJ3A 3VI5A 5LCZA 1R4WA 3OR5A 5CAXA 1PD21 4V1Ap 2A2RA 1EOHA 2M80A 4TVEA 1UVZA 3FK8A 4FH8A 3C71A 2GZPA 3IK9A 2GSQA 5D73A 2LRNA 3UIWA 4HEA2 4DSQA 2FHEA 2CQ9A 2LNSA 4O92A 2LNTA 3MSZA 1M99A 1O81A 5F06A 2IMFA 5DQYA 4MJAA 5KN0A 1GLQA 4ISDA 1MDKA 3C1RA 1LU4A 1OE8A 5ECPB 2VLVA 5F07A 2N5AA 3L9UA 1BAYA 2FCHA 1EZKA 4ZIJA 4TR1B 1CQHA 4ZXGA 4KH7A 2XC2A 1PN9A 3C73A 1OAZA 2C3NA 2CVDA 2GZZA 4PX1A 4L0WA 1EV9A 3UBKA 3F8UA 4XRDA 1JZRA 3DGQA 2B6MA 4X0XA 2P5RA 5J9CA 1T7PB 4DEJA 1VGLA 2V32A 4NAXA 5KN1A 2CV4A 3APQA 1T4ZA 3PGTA 1W4VA 5EPFA 4MJBA 3U5RE 3BCIA 3WGEA 4KCAA 2P0GA 3VPQA 4I2UA 4MPGA 6GSSA 4EUYA 5JCWA 5GAPD 4LLRA 4XS4B 1K3OA 4HI7A 4G0LA 4IS0A 2YJ7A 3APOA 3F9UA 3US3A 4TR3A 3TDGA 5ECRB 3O6TA 1S3DA 2C3TA 2FA4A 3FEUA 1KNGA 2OA7A 3CSIA 2GS3A 4KCEA 3ZREA 1Z3EA 4GWRA 1RQMA 1QGVA 5IO0A 2HSYA 4EF0A 1TRUA 2AJQB 1GUKA 4ZL8A 2FWHA 1WRYA 1FHEA 1MTCA 4KE3A 3I43A 2MBTA 1ZYQB 2MMZA 1HNAA 3CYNA 2HNLA 4GQCA 5A4UA 2EIRA 2I81A 1EEJA 1V2AA 3DKSA 3GSSA 4K8MA 5AIXA 2PN8A 4F0CA 4WBRD 4X1UA 1PKZA 2ON7A 4XRAA 5AN1A 4FQUA 1ERVA 2CVKA 1R7HA 5G31A 2GQLA 1JLVA 5IMAA 4ILFA 2LKUA 2RM6A 3F3QA 4XS4A 1SKSB 2ES7A 2YANA 3L4NA 1HNCA 5CP1A 2KLXA 3IAM2 2B1KA 1A8LA 3IRAA 2K18A 4XCSA 1XW6A 4AF2A 3UEMA 1O6JA 4F03A 2H1BA 3QFBC 5F05A 2I3YA 4IJIA 2WZ9A 4NPBA 4NMUA 1Z6NA 4HU9A 2DIZA 1K0AA 2O89A 4PUFC 2KUCA 5JWRB 1PQNA 4IQ1A 3LEFA 5L71A 3E3EA 4GCIA 3H79A 2TRCP 3GRXA 4FIWA 4P3YB 1BQ7A 4TN8A 5ECLB 2VL9A 5IMZA 1RW1A 5H5SA 3ZLPA 1PKWA 2CVBA 2L5LA 2H75A 3LYKA 3ZMKA 2NPBA 3HJPA 3LG6A 2YN1A 2X8CA 2VCWA 2WGRA 1XWCA 2JZTA 1CQGA 3GKKA 1K0DA 2C0DA 5DJLA 1OC3A 5FHIA 4NV2A 3ZVJA 1UN2A 5E59A 2VO4A 3TRPA 2YWOA 3BOAA 1M7TA 3IXRA 3FRCA 3L78A 1Z9HA 4MF7A 3NZNA 5J41A 5HFIA 3E0UA 4BA7A 20GSA 1GSFA 2C4JA 3FZAA 3J7Yk 3IC4A 2VIMA 4MA9A 4MPFA 1TK0B 1AIUA 4V2NA 2FNOA 3HJOA 4USSA 1OKTA 4OWYA 4MZWA 2H66A 3TB2A 3ED3A 1VF3A 2N5BA 4BL7B 2NTOA 3WYWA 2JU5A 5G1KA 1UA5A 2F8FA 2DC5A 2CAIA 3GNJA 4BVXB 2L6DA 3N9JA 2LV3A 2HRKB 2AB6A 1GUMA 4E8HA 3DXBA 4WXTA 1XWGA 1GSQA 1XCCA 5DJMA 4TW5A 2J23A 2LRTA 3G7IA 4L5OA 1QMVA 2PPTA 1YZXA 3HVXA 2JSYA 5H5QA 2XPEA 1B8XA 4RQRA 2LJKA 3GSTA 1ZCPA 1XBSA 2OE0A 5DAKB 4TXOA 3HJMA 2H1GA 2IFQB 3CRUA 2L4CA 4OFMA 1B4QA 5J4UA 4KNDA 3W8SA 1H4OA 4YH2A 2C80A 3EU3A 1GSYA 12GSA 2RUFA 1Z7RA 4ACSA 2GLRA 2HSNB 3QD9A 2FWGA 1ZL9A 2H19A 4MH2A 4TR4A 2X64A 2DJ0A 2VLUA 1HYUA 3VURA 3TUEA 6GSTA 5B8BA 1EEMA 3GMFA 2WFCA 4BVXA 4YQVA 1SKWB 1GTIA 2LJAA 3EINA 4IW9A 5GSSA 1YKCA 4KGIA
chains in the Genus database with same CATH superfamily
5BMUB 3GIXA 1MD3A 1SD9A 3J7Yb 2LRCA 3D4TA 1PFOA 2J9HA 2JL4A 1EWXA 2LS5A 4I6XA 3HKRA 3NIVA 3EC3A 3UBLA 3C7MA 2OT3A 1B4PA 2MBSA 3VWWA 1VRSD 1OC8A 2IFQA 5G5EA 4PNFA 2EIQA 2QA1A 3CTGA 2MMNA 1SKRB 2IN3A 1WWJA 5ECNB 1T3BA 5D96A 3RPNA 3F3RA 3ZMLA 1QK8A 4PNGA 4TKYA 3TRQA 1OVNA 2HSNA 3VI7A 2DMMA 2FLSA 1OYJA 4IKHA 2LSTA 1SK0A 1YY7A 2C0EA 4MMMA 4XIHA 2HZEA 3CMIA 4NWYA 1J9BA 3GH9A 1U6TA 5AGYA 1K0BA 3KH9A 2YWNA 4KW6A 4O5RA 4MDCA 4EC0A 3LORA 4O7HA 4Z2RA 4AKGA 10GSA 2VCQA 4JR6A 5KOWA 1Z6MA 3UMAA 1GULA 4W66A 3IBHA 3D4MA 4WKWA 2CAQA 4F82A 1AW9A 5ELAA 5BMUA 3ZTLA 3GFKA 3VWVA 4MZBA 2R0PA 3HVVA 3APSA 5HQPA 1XFLA 2DKIA 2QA2A 3M8NA 1O8XA 1GSEA 4KAEA 2HYXA 2DJ2A 2NBSA 3SBCA 1YEWC 4TRXA 1YEPA 3N5OA 4PUAA 1O73A 4JEDA 6GSYA 3EWLA 3Q6OA 3DIEA 2GQKA 2IWTA 3KIJA 2H01A 5A5HB 4HZ4A 2DJ3A 4GF0A 2EIOA 2YCDA 7GSSA 3GH6A 1KEBA 3KJYA 2B5YA 4XHMA 1TXXA 1XVQA 3HVNA 1AQXA 4MLYA 1I9DA 4RI6A 1TXUA 1GRXA 4MF5A 2ZCTA 4O5QA 4KB3A 2JADA 3V1WA 2FWFA 2RIIA 3CWGA 2H30A 1G6YA 4I5QA 3VWXA 2I9HA 5IPHA 1BG1A 5IO2A 3F4TA 4IN0A 1XXUA 5ECQB 2X99A 2K9FA 1WP0A 2O8VB 3GL3A 3K8NA 5ECKB 1TP9A 1I1IP 2ALBA 4ECCA 4EDZA 4MJEA 1M3JA 5J40A 2E0QA 4TXVA 1SK1A 3HD5A 1A0FA 1YF1A 2O85A 5A5HA 5INYA 3M1GA 1SJZA 2V1MA 3F6FA 2X8HA 4EL1A 3WT2A 1FB0A 5DCGA 3IPZA 2F9SA 1V9WA 2KHPA 3G7YA 1EGOA 1V98A 4GSSA 3P7XA 4MCUA 4RQXA 1MD4A 1S3AA 1K3LA 2A4HA 2B5XA 1X9MB 1NW2A 2PMTA 3GTUA 1Q98A 2FGXA 2HXKA 1BF5A 2PVQA 3IV4A 1TU8A 5ECSA 4N0ZA 3GYKA 1DE1A 4Z2UA 3IAS2 1VF1A 4LMWA 5B6MA 1JZOA 3CSHA 3E9JB 1SL2B 3CRTA 3LQ7A 1SENA 2DSAA 1YF0A 2WW0A 3GKXA 1YQ1A 4KDUA 3EMXA 4CDOA 4L8EA 1VF2A 4AGSA 2XBQA 2R0CA 4K0GA 1AUCA 2GQMA 1A2MA 2V6OA 3ISOA 2X8GA 5DALB 4G10A 5DVBA 3EMPA 4ZB6A 2IL3A 1M0UA 2C3QA 4K2DA 2OBKA 3I69A 3HCZA 1AXDA 2B3SA 4FYCA 4OMVA 4XS1A 4IVFA 4POLA 5G5FA 2HSHA 1FOVA 2H0HA 5HFKA 1AQWA 3CTFA 1BYEA 5EY6A 2B7KA 2O87A 1Y25A 2IMDA 2DIYA 2K8SA 3SWLA 3TJBA 1TU7A 2K8VA 4HJ2A 1RK4A 5CRDA 4AJ6A 4ZL9A 4L5LA 1B9XC 2MMAA 1Y6EA 4KX4A 3RPPA 3ZRDA 5ECIB 2VL2A 2JZSA 3H1NA 4I8BA 1X9WB 3WD6A 1O8WA 3QPMA 4AJ7A 3EVIA 2P5QA 1YJ6A 2AUVA 5D9WA 1XOAA 1PL1A 3A3TA 2IMEA 2VM1A 2YZUA 5HR0A 4PGTA 5KOXA 5DALA 2KOKA 3IHGA 4EKZA 1QUWA 3D21A 1VF4A 1UC7A 1T1VA 2I1UA 1R5PA 1ZOFA 1U3AA 2YOIA 1B9YC 1TW9A 2YV7A 2CX3A 3FKFA 1M9BA 3EURA 22GSA 4K2XA 4KUNA 4LMVA 3LXTA 1ST9A 2YZHA 1W89A 4BWSA 1WPIA 1NHOA 4X43A 4POBA 1PN0A 3VLNA 1DBYA 4OO4A 3IHQA 5CRGA 4DVCA 1BG5A 1K0NA 1TKDB 3PPUA 5ECOB 5HR3A 3IE3A 5ELGA 4MH3A 4KSOA 4Z7XA 1GUHA 1GSDA 3I9V2 1T8EB 1Y1UA 4O32A 3F4SA 3MWHA 1ZZYA 2HSMB 1GH2A 3ZFLA 5CRHA 3RAZA 2DMLA 4PQHA 2CX4A 4JR4A 3Q18A 4V2MA 2DJJA 3TRXA 2WULA 5G2ZA 3ME8A 2KP2A 4ZBDA 2BTOT 3ZITA 5A5KA 4NV5A 1SK2A 2GGTA 1SD8A 1F6MC 2QC7A 2VLTA 1B48A 4I2TA 2VCXA 2XBIA 3KTBA 2C0GA 2EC4A 2F51A 2LJRA 3DRNA 5ECHB 4TXOB 2F8AA 2A4VA 19GSA 3VPTA 3FZ9A 4OO5A 2HT9A 6GSXA 2F3MA 1X9SB 3GX8A 4E8EA 4I97A 2WW3A 1NHYA 4A5PA 1GTUA 1ZYNA 5KN3A 4G2EA 3HDCA 2GSTA 4K7NA 4RUVA 2QSIA 2YP6A 4RI7A 1HNBA 2E2MA 4ICYA 2WB9A 1DSBA 3ZZXA 2ZNMA 3TGZA 2VD1A 5D9XA 3RGBC 3LFLA 1V57A 1F37A 2HSMA 3EE2A 3PR8A 1FOHA 4NHZA 4EIPA 4GDFA 2GTUA 1DUGA 3FZ4A 4J56E 3W8JA 2K6VA 5ID2B 1AQVA 1T00A 2WVXB 3S9FA 2O7KA 4GLTA 3FR6A 1A23A 2E7PA 1ERWA 5IIZA 1ZGNA 2XHFA 3M0FA 3KCMA 3MIXA 5J47A 2VAFA 3QDNA 2WJUA 1F3BA 1TTZA 3IA1A 1X0RA 1TK8B 1M9AA 4D73B 2OADA 1PRXA 3DEXA 3DMLA 4BWQA 2GVPA 5CNWA 5A34B 5B6NA 2UZ8A 3QCPA 2H72A 4N10A 11GSA 3LXZA 3C1SA 5J5NA 1U88A 3GN3A 3EYTA 2HZEB 1N8JA 2VD0A 1R5AA 5BRTA 1EP7A 2OACA 4F0BA 2H71A 13GSA 3KP8A 3UOMA 3QFAC 3WGDA 4OFNA 2R5GA 4WETA 5ID2A 3H8QA 2P31A 3GV1A 1X5EA 3AY8A 3RHCA 2HZFA 3LSZA 3GUSA 1GSUA 3Q19A 5A4WA 4MABA 3A2XA 4K5SA 2WCIA 2GSRA 5KEJA 1FAAA 4YAVA 4D73A 3KP9A 2FD3A 3TCOA 3QAVA 5A34A 3FY7A 1IYHA 4ECBA 4BIKA 2H6ZA 4WBJA 4GTUA 3ME7A 4NHWA 4N3ZA 2AYTA 2PUKC 3CXGA 2AV4A 3KZQA 3ZYWA 3LGCA 2H73A 1PA3A 5J3RA 2JZRA 2OJLA 2KP1A 1OE7A 2VCVA 4FYBA 2H6XA 5GAND 3HZ8A 2CA8A 3KXOA 1M2AA 4ZL7A 3A5WA 5LD0A 2YWMA 2DLXA 4ZILA 2M46A 2L6CA 2N5FA 5CREA 2HQTA 3HXSA 3P90A 5E4WA 2HRFA 4CW9A 2ZUPA 2IMKA 5IMCA 5C00A 3ZVJD 4ID0A 4KDXA 3Q74A 2OE1A 1BJXA 4FYUA 1GL8A 5DCHA 4WR4A 5FWGA 4G0KA 1ZYEA 3G7JA 3P8WA 2PVOC 4BPYA 4XS6A 3ZFBA 1SU9A 4KF9A 2L5OA 1K0MA 3QAWA 4ZB8A 4HQZA 1V40A 3UVTA 1OC9A 2OE3A 4AI6A 2RUEA 2JACA 1F2EA 2EFEA 2R3XA 3GTUB 3MNGA 2B7JA 5B7CA 1XZOA 3ZIVA 3VFIA 3DD3A 1Z7PA 1X5DA 3WT1A 4DSSA 1LJRA 5J4VA 2YWIA 3QMXA 4HSCX 2HRNA 4KA0A 2OBIA 4ML6A 2H1DA 1XVWA 1EGRA 2B1LA 5JCUA 5IOXA 1XG8A 4HOJA 4V1Ag 2OKAA 4PI2C 2C8UA 2FUG2 4PQ1A 1MDIA 2V41A 5DDLA 1ACVA 3RFRC 4OCFA 2AHEA 4EO3A 1ABAA 2PWJA 3HY2A 1XWBA 5D8IA 1NSWA 1A24A 1TOFA 5FT3A 1Q4JA 14GSA 1SYXA 2PBJA 4ULXA 2H1AA 1AAZA 3M9KA 3JCML 3IDVA 4ZB9A 3RHBA 2MZCA 3TJFA 4MK3A 4PHZC 2YJHA 1QXHA 3PH9A 4WR5A 5CYYA 1KTEA 1JZWA 4GSTA 1XIYA 3D22A 3U6VA 3P2AA 1PSQA 1U87A 3KTLA 5D9VA 1YKAA 2VUPA 5JCGA 1LBKA 3BBYA 3LYPA 3A2VA 3TKSE 4Q5RA 4ML1A 1HD2A 1THOA 4K7IA 1U3IA 2D2ZA 2L59A 2O36A 1F9MA 4EIQA 4ECJA 1PL2A 2LTKA 2WDUA 3MDKA 1HQOA 3QOUA 2CT6A 5AISA 4GRFA 3IK7A 2WRTA 4AKHA 5C04A 5AIVA 1Z5YE 5IOWA 3GKNA 4G19A 2V6KA 4PQIA 5ENUA 3TJGA 1C72A 1YDKA 3TOUA 1J0FA 1K0OA 3H4KA 3FMWA 3KEBA 3KH7A 5D93A 3TKPA 4K7OA 3GHAA 2EFCA 2FA8A 2VL2C 4HJMA 5G30A 5CO3A 4GQFA 1XOBA 3G9BA 2NVLA 1MEKA 2C1YA 1FO5A 8GSSA 1PMTA 2L57A 4TOPA 3FR9A 2G2QA 4K1FA 2H8LA 4TR1A 3R2QA 4CY6A 6GSWA 4LA1A 1EOGA 4J2FA 2YPMA 1QFNA 5JWOB 2LUSA 2R6KA 3MAKA 3D5JA 4PTSA 3UL3A 3A5IA 1K0CA 1GTBA 3D6IA 4HZ2A 2R2JA 1YEXA 1R26A 2DBCA 1M2BA 4L0UA 1ML6A 3FHKA 2B5EA 1SJIA 2WW2A 1FB6A 3GL5A 1G0TA 18GSA 1USBA 3IR4A 2VCZA 1F3AA 3RBTA 3ZL5A 2E2GA 4ZB7A 1N2AA 3F4RA 2WS2A 4MJCA 4HS1A 1SYRA 2BJXA 4PXOA 1XWKA 2L4QA 3H93A 3KMNA 3O3TA 4OCEA 5B8AA 3UAPA 5A4VA 2YV9A 4KDYA 3IOSA 3TU3B 9GSSA 1S3RA 1JLWA 2HLSA 1XW9A 4IGJA 1QQ2A 3I6AA 1FVKA 2X4AA 3WGXA 1PGTA 1XPVA 3FW2A 3HVSA 1ZMAA 1WMJA 17GSA 2IPAA 2GT6A 1TDIA 1EV4A 2CZ2A 3GURA 1GLPA 2RLIA 16GSA 2ON5A 1KBNA 4HUAA 4YKFA 1TRVA 2NDOA 3HZ4A 2TIRA 4J57E 4CHSA 4G9HA 2QKEA 1G6WA 2PERA 4AKIA 3BCKA 2GT5A 4XTSA 2H76A 2VOCA 3L9SA 3MYDA 2REMA 1SL1B 2C0FA 3RDWA 3KMOA 4N0VA 3ZIJA 4GSNA 2H70A 1K3YA 3EU4A 3HA9A 4KSMA 2PGTA 3TOTA 3O76A 2R37A 2RM5A 4GXZA 4ECIA 2BMXA 1MDJA 4IQAA 4FO5A 1A2LA 1E6BA 4WF5A 2GDRA 4PURA 4OD7A 4QQ7A 5F0GA 4JU5A 3L0HA 2VCTA 4K6XA 1TRSA 3GKMA 4MP4A 3FR3A 5D9TA 1E2YA 1N25A 4JBBA 1GNEA 1JZDA 1DE2A 1M2DA 1TRWA 4HU7A 1URMA 3HYPA 4YAPA 1ILOA 4NXIA 4YKGA 1EP8A 3A2WA 5EVOA 1TJDA 3UARA 2MMOA 5IMDA 2HE3A 3CBUA 3W6GA 4TR0A 3TJJA 4K5RA 1A8YA 3DYRA 3DVXA 1OKDA 3ERWA 3C8EA 2LQOA 5GSTA 4AJ8A 1GWCA 2H0IA 1WE0A 2MYGA 1A2JA 1THXA 2FWEA 5H5RA 2GSSA 4Q5FA 4IP1A 2HI7A 1TK5B 1NM3A 2LEGA 1GNWA 3M9JA 4WEYA 4DSRA 2IIYA 2I4AA 3F63A 1AC1A 5ABRA 5JWQB 4QMKA 4IBPA 1O7UA 3UJ1A 2HRAA 1FVJA 1BEDA 2Z9SA 5CRWA 5GZZB 3VK9A 2FY6A 3TKSC 4WF4A 2HFDA 1ERTA 1I5GA 3KD0A 1PX6A 3CHXC 2TRXA 5J9BA 4BL7A 2H0GA 3TKSA 4JZQA 2VM2A 3VWUA 1JFUA 4IHUA 2H6YA 4BVYB 2HRKA 2DKHA 5IMFA 1G7OA 4K0NA 4IELA 3PINA 5HFGA 4MZCA 5ECMB 5KN2A 4MF6A 5G1LA 4OFTA 3LW9A 3HHVA 1XWAA 5COHA 2LQQA 5IM9A 2V2GA 3ERFA 1ERUA 3FYGA 3TJKA 2XPDA 1BX9A 4POMA 1GP1A 3R3EA 5IPGA 4EXJA 5DBQA 5DQSA 3UVHA 1XW5A 4G0IA 1OC9B 3GX0A 5DAKA 4QL9A 2DJKA 2YNXA 4JE1A 1TI3A 1FG4A 3ERGA 1X5CA 3KGKA 3CSJA 6GSUA 2CZ3A 4JRRA 5EL8A 4DSSB 4EE0A 2A2PA 2GZYA 2X49A 4EVMA 1G7EA 2G0FA 4EDYA 3QAGA 5IQYA 2IJYA 1GTAA 3F6DA 3KM6A 2EFDA 3M3MA 4F2IA 4ZBBA 1TI1A 3DWVA 4LL1B 1O85A 1SJ6A 2DJ1A 6GSVA 1J08A 4LL4B 1GSSA 3FZ5A 4BVYA 2R4VA 4YQUA 1H75A 2IMIA 2O3EA 3BJ5A 1V58A 1A0RP 3IC8A 4QL7A 4HDEA 4F9ZA 1IYIA 1WIKA 3GA4A 4HQSA 1S3CA 2VL3A 4IP6A 1WJKA 4Q5NA 3BD2A 2JSZA 3L9VA 2M72A 3TKRA 3F0IA 4V2LA 3DVWA 2AAWA 3LJRA 2H74A 4N11A 5F8BA 4N30A 1SL0B 1T4YA 3TKQA 3NOFA 2PU9C 2QGVA 1YVLA 2WVYA 1PX7A 4Q5QA 4H86A 3LWAA 2WZSA 3QR6A 5HR2A 5IMVA 1FW1A 4ZBAA 5HR1A 1ON4A 2A2SA 1JHBA 1WOUA 3D0ZA 4YQMA 4K9ZA 4POKA 5LNKe 4IJ3A 3VI5A 5LCZA 1R4WA 3OR5A 5CAXA 1PD21 4V1Ap 1ZYPA 2A2RA 1EOHA 2M80A 4TVEA 1UVZA 3FK8A 4FH8A 3EPTA 3C71A 2GZPA 3IK9A 2GSQA 5D73A 2LRNA 3UIWA 4HEA2 3HMJG 4DSQA 2FHEA 2CQ9A 2LNSA 4O92A 2LNTA 3MSZA 1M99A 1O81A 5F06A 2IMFA 5DQYA 4MJAA 5KN0A 1GLQA 4ISDA 1MDKA 3C1RA 1LU4A 1OE8A 5ECPB 2VLVA 5F07A 2N5AA 3L9UA 1BAYA 2FCHA 1EZKA 4ZIJA 4TR1B 1CQHA 4ZXGA 4KH7A 2XC2A 1PN9A 3C73A 1OAZA 2C3NA 2CVDA 2GZZA 4PX1A 4L0WA 1EV9A 3UBKA 3F8UA 4XRDA 1JZRA 3DGQA 2B6MA 4X0XA 2P5RA 5J9CA 1T7PB 4DEJA 1VGLA 2V32A 4NAXA 4E68A 5KN1A 2CV4A 3APQA 1T4ZA 3PGTA 1W4VA 5EPFA 4MJBA 3U5RE 3BCIA 3WGEA 4KCAA 4Z2TA 2P0GA 3VPQA 4I2UA 2WW1A 4MPGA 6GSSA 4EUYA 5JCWA 5GAPD 4LLRA 4XS4B 1K3OA 4HI7A 4G0LA 4IS0A 2YJ7A 3APOA 3F9UA 3US3A 4TR3A 3TDGA 1SVOA 5ECRB 3O6TA 1S3DA 2C3TA 2FA4A 3FEUA 4CY8A 1KNGA 2OA7A 3CSIA 2GS3A 4KCEA 3ZREA 1Z3EA 4GWRA 2UV8G 1RQMA 1QGVA 5IO0A 2HSYA 4EF0A 1TRUA 2AJQB 1GUKA 4ZL8A 2FWHA 1WRYA 1FHEA 1MTCA 4KE3A 3I43A 2MBTA 1ZYQB 2MMZA 1HNAA 3CYNA 2HNLA 4GQCA 5A4UA 2EIRA 2I81A 1EEJA 1V2AA 3DKSA 3GSSA 4K8MA 5AIXA 2PN8A 4F0CA 4WBRD 4X1UA 1PKZA 2ON7A 4XRAA 5AN1A 4FQUA 1ERVA 2CVKA 1R7HA 5G31A 2GQLA 1JLVA 5IMAA 2R0GA 2LKUA 4AKXB 4ILFA 2RM6A 3F3QA 4XS4A 1SKSB 2ES7A 2YANA 3L4NA 1HNCA 5CP1A 2KLXA 3IAM2 2B1KA 1A8LA 3IRAA 2K18A 4XCSA 1XW6A 4AF2A 3UEMA 1O6JA 4F03A 2H1BA 3QFBC 5F05A 2I3YA 4IJIA 2WZ9A 4NPBA 4NMUA 1Z6NA 4HU9A 2DIZA 1K0AA 2O89A 4PUFC 2KUCA 5JWRB 1PQNA 5J4YA 4IQ1A 3LEFA 5L71A 3E3EA 4GCIA 3H79A 2TRCP 3GRXA 4FXYP 4FIWA 4P3YB 1BQ7A 2VKZG 4TN8A 5ECLB 2VL9A 5IMZA 1RW1A 5H5SA 3ZLPA 1PKWA 2CVBA 2L5LA 2H75A 3LYKA 3CQFA 3ZMKA 2NPBA 3HJPA 3LG6A 2YN1A 5A1NB 2X8CA 2VCWA 2WGRA 1XWCA 2JZTA 1CQGA 3GKKA 1SVMA 1K0DA 2C0DA 5DJLA 1OC3A 5FHIA 4NV2A 3ZVJA 4G01A 4MNNA 1UN2A 5E59A 2VO4A 2WVZA 3TRPA 2YWOA 3BOAA 1M7TA 3IXRA 3FRCA 3L78A 4X4JA 1Z9HA 4MF7A 3NZNA 5J41A 5HFIA 3E0UA 4BA7A 20GSA 1GSFA 2C4JA 3FZAA 3J7Yk 3IC4A 2VIMA 4MA9A 4MPFA 1TK0B 1AIUA 4V2NA 2FNOA 3HJOA 4USSA 1OKTA 4OWYA 4MZWA 2H66A 3TB2A 3ED3A 1VF3A 2N5BA 4BL7B 2NTOA 3WYWA 2JU5A 5G1KA 1UA5A 2F8FA 2DC5A 2CAIA 1S4BP 3GNJA 4BVXB 2L6DA 3N9JA 2LV3A 2HRKB 2AB6A 1GUMA 4E8HA 4PI0C 3DXBA 4WXTA 1XWGA 1GSQA 5A1NA 1XCCA 5DJMA 4TW5A 2J23A 2LRTA 3G7IA 4L5OA 1QMVA 2PPTA 1YZXA 3HVXA 2JSYA 5H5QA 2XPEA 2H1LA 1B8XA 4RQRA 2LJKA 3GSTA 1ZCPA 1XBSA 2OE0A 5DAKB 4TXOA 4O5UA 3HJMA 2H1GA 2IFQB 3CRUA 2O5VA 2L4CA 4OFMA 1B4QA 2EFHA 5J4UA 4KNDA 3W8SA 1H4OA 4YH2A 2C80A 3EU3A 1GSYA 12GSA 2RUFA 1Z7RA 4ACSA 2GLRA 2HSNB 3QD9A 2FWGA 1ZL9A 2H19A 4MH2A 4TR4A 2X64A 2DJ0A 2VLUA 1HYUA 3VURA 3TUEA 6GSTA 5B8BA 1EEMA 3GMFA 1SVLA 2WFCA 4BVXA 4YQVA 1SKWB 1GTIA 2LJAA 3EINA 1M3IA 4IW9A 5GSSA 1YKCA 2WVXA 4KGIA
chains in the Genus database with same CATH topology
5BMUB 3GIXA 1MD3A 1SD9A 3J7Yb 2LRCA 3D4TA 2J9HA 2JL4A 1EWXA 2LS5A 4I6XA 3HKRA 3NIVA 3EC3A 3UBLA 3C7MA 2OT3A 1B4PA 2MBSA 3VWWA 1VRSD 1OC8A 2IFQA 5G5EA 4PNFA 2EIQA 2QA1A 3CTGA 2MMNA 1SKRB 2IN3A 1WWJA 5ECNB 1T3BA 5D96A 3RPNA 3F3RA 3ZMLA 1QK8A 4PNGA 4TKYA 3TRQA 1OVNA 2HSNA 3VI7A 2DMMA 2FLSA 1OYJA 4IKHA 2LSTA 1SK0A 1YY7A 2C0EA 4MMMA 4XIHA 2HZEA 3CMIA 4NWYA 1J9BA 3GH9A 1U6TA 5AGYA 1K0BA 3KH9A 2YWNA 4KW6A 4O5RA 4MDCA 4EC0A 3LORA 4O7HA 4Z2RA 4AKGA 10GSA 2VCQA 4JR6A 5KOWA 1Z6MA 3UMAA 1GULA 4W66A 3IBHA 3D4MA 4WKWA 2CAQA 4F82A 1AW9A 5ELAA 5BMUA 3ZTLA 3GFKA 3VWVA 4MZBA 2R0PA 3HVVA 3APSA 5HQPA 1XFLA 2DKIA 2QA2A 3M8NA 1O8XA 1GSEA 4KAEA 2HYXA 2DJ2A 2NBSA 3SBCA 4TRXA 1YEPA 3N5OA 4PUAA 1O73A 4JEDA 6GSYA 3EWLA 3Q6OA 3DIEA 2GQKA 2IWTA 3KIJA 2H01A 5A5HB 4HZ4A 2DJ3A 4GF0A 2EIOA 2YCDA 7GSSA 3GH6A 1KEBA 3KJYA 2B5YA 4XHMA 1TXXA 1XVQA 1AQXA 4MLYA 1I9DA 4RI6A 1TXUA 1GRXA 4MF5A 2ZCTA 4O5QA 4KB3A 2JADA 3V1WA 2FWFA 2RIIA 3CWGA 2H30A 1G6YA 4I5QA 3VWXA 2I9HA 5IPHA 1BG1A 5IO2A 3F4TA 4IN0A 1XXUA 5ECQB 2X99A 2K9FA 1WP0A 2O8VB 3GL3A 3K8NA 5ECKB 1TP9A 2ALBA 4ECCA 4EDZA 4MJEA 5J40A 2E0QA 4TXVA 1SK1A 3HD5A 1A0FA 1YF1A 2O85A 5A5HA 5INYA 3M1GA 1SJZA 2V1MA 3F6FA 2X8HA 4EL1A 3WT2A 1FB0A 5DCGA 3IPZA 2F9SA 1V9WA 2KHPA 3G7YA 1EGOA 1V98A 4GSSA 3P7XA 4MCUA 4RQXA 1MD4A 1S3AA 1K3LA 2A4HA 2B5XA 1X9MB 1NW2A 2PMTA 3GTUA 1Q98A 2FGXA 2HXKA 1BF5A 2PVQA 3IV4A 1TU8A 5ECSA 4N0ZA 3GYKA 1DE1A 4Z2UA 3IAS2 1VF1A 4LMWA 5B6MA 1JZOA 3CSHA 3E9JB 1SL2B 3CRTA 3LQ7A 1SENA 2DSAA 1YF0A 3GKXA 1YQ1A 4KDUA 3EMXA 4CDOA 4L8EA 1VF2A 4AGSA 2XBQA 2R0CA 4K0GA 1AUCA 2GQMA 1A2MA 2V6OA 3ISOA 2X8GA 5DALB 4G10A 5DVBA 3EMPA 4ZB6A 2IL3A 1M0UA 2C3QA 4K2DA 2OBKA 3I69A 3HCZA 1AXDA 2B3SA 4FYCA 4OMVA 4XS1A 4IVFA 4POLA 5G5FA 2HSHA 1FOVA 2H0HA 5HFKA 1AQWA 3CTFA 1BYEA 5EY6A 2B7KA 2O87A 1Y25A 2IMDA 2DIYA 2K8SA 3SWLA 3TJBA 1TU7A 2K8VA 4HJ2A 1RK4A 5CRDA 4AJ6A 4ZL9A 4L5LA 1B9XC 2MMAA 1Y6EA 4KX4A 3RPPA 3ZRDA 5ECIB 2VL2A 2JZSA 3H1NA 4I8BA 1X9WB 3WD6A 1O8WA 3QPMA 4AJ7A 3EVIA 2P5QA 1YJ6A 2AUVA 5D9WA 1XOAA 1PL1A 3A3TA 2IMEA 2VM1A 2YZUA 5HR0A 4PGTA 5KOXA 5DALA 2KOKA 3IHGA 4EKZA 1QUWA 3D21A 1VF4A 1UC7A 1T1VA 2I1UA 1R5PA 1ZOFA 1U3AA 2YOIA 1B9YC 1TW9A 2YV7A 2CX3A 3FKFA 1M9BA 3EURA 22GSA 4K2XA 4KUNA 4LMVA 3LXTA 1ST9A 2YZHA 1W89A 4BWSA 1WPIA 1NHOA 4X43A 4POBA 1PN0A 3VLNA 1DBYA 4OO4A 3IHQA 5CRGA 4DVCA 1BG5A 1K0NA 1TKDB 3PPUA 5ECOB 5HR3A 3IE3A 5ELGA 4MH3A 4KSOA 4Z7XA 1GUHA 1GSDA 3I9V2 1T8EB 1Y1UA 4O32A 3F4SA 3MWHA 1ZZYA 2HSMB 1GH2A 3ZFLA 5CRHA 3RAZA 2DMLA 4PQHA 2CX4A 4JR4A 3Q18A 4V2MA 2DJJA 3TRXA 2WULA 5G2ZA 3ME8A 2KP2A 4ZBDA 2BTOT 3ZITA 5A5KA 4NV5A 1SK2A 2GGTA 1SD8A 1F6MC 2QC7A 2VLTA 1B48A 4I2TA 2VCXA 2XBIA 3KTBA 2C0GA 2EC4A 2F51A 2LJRA 3DRNA 5ECHB 4TXOB 2F8AA 2A4VA 19GSA 3VPTA 3FZ9A 4OO5A 2HT9A 6GSXA 2F3MA 1X9SB 3GX8A 4E8EA 4I97A 1NHYA 4A5PA 1GTUA 1ZYNA 5KN3A 4G2EA 3HDCA 2GSTA 4K7NA 4RUVA 2QSIA 2YP6A 4RI7A 1HNBA 2E2MA 4ICYA 2WB9A 1DSBA 3ZZXA 2ZNMA 3TGZA 2VD1A 5D9XA 3LFLA 1V57A 1F37A 2HSMA 3EE2A 3PR8A 1FOHA 4NHZA 4EIPA 4GDFA 2GTUA 1DUGA 3FZ4A 4J56E 3W8JA 2K6VA 5ID2B 1AQVA 1T00A 3S9FA 2O7KA 4GLTA 3FR6A 1A23A 2E7PA 1ERWA 5IIZA 1ZGNA 2XHFA 3M0FA 3KCMA 3MIXA 5J47A 2VAFA 3QDNA 2WJUA 1F3BA 1TTZA 3IA1A 1X0RA 1TK8B 1M9AA 4D73B 2OADA 1PRXA 3DEXA 3DMLA 4BWQA 2GVPA 5CNWA 5A34B 5B6NA 2UZ8A 3QCPA 2H72A 4N10A 11GSA 3LXZA 3C1SA 5J5NA 1U88A 3GN3A 3EYTA 2HZEB 1N8JA 2VD0A 1R5AA 5BRTA 1EP7A 2OACA 4F0BA 2H71A 13GSA 3KP8A 3UOMA 3QFAC 3WGDA 4OFNA 2R5GA 4WETA 5ID2A 3H8QA 2P31A 3GV1A 1X5EA 3AY8A 3RHCA 2HZFA 3LSZA 3GUSA 1GSUA 3Q19A 5A4WA 4MABA 3A2XA 4K5SA 2WCIA 2GSRA 5KEJA 1FAAA 4YAVA 4D73A 3KP9A 2FD3A 3TCOA 3QAVA 5A34A 3FY7A 1IYHA 4ECBA 2H6ZA 4WBJA 4GTUA 3ME7A 4NHWA 4N3ZA 2AYTA 2PUKC 3CXGA 2AV4A 3KZQA 3ZYWA 3LGCA 2H73A 1PA3A 5J3RA 2JZRA 2OJLA 2KP1A 1OE7A 2VCVA 4FYBA 2H6XA 5GAND 3HZ8A 2CA8A 3KXOA 1M2AA 4ZL7A 3A5WA 5LD0A 2YWMA 2DLXA 4ZILA 2M46A 2L6CA 2N5FA 5CREA 2HQTA 3HXSA 3P90A 5E4WA 2HRFA 4CW9A 2ZUPA 2IMKA 5IMCA 5C00A 3ZVJD 4ID0A 4KDXA 3Q74A 2OE1A 1BJXA 4FYUA 1GL8A 5DCHA 4WR4A 5FWGA 4G0KA 1ZYEA 3G7JA 3P8WA 2PVOC 4BPYA 4XS6A 3ZFBA 1SU9A 4KF9A 2L5OA 1K0MA 3QAWA 4ZB8A 4HQZA 1V40A 3UVTA 1OC9A 2OE3A 4AI6A 2RUEA 2JACA 1F2EA 2EFEA 2R3XA 3GTUB 3MNGA 2B7JA 5B7CA 1XZOA 3ZIVA 3VFIA 3DD3A 1Z7PA 1X5DA 3WT1A 4DSSA 1LJRA 5J4VA 2YWIA 3QMXA 2HRNA 4KA0A 2OBIA 4ML6A 2H1DA 1XVWA 1EGRA 2B1LA 5JCUA 5IOXA 4HOJA 4V1Ag 2OKAA 2C8UA 2FUG2 4PQ1A 1MDIA 2V41A 5DDLA 1ACVA 4OCFA 2AHEA 4EO3A 1ABAA 2PWJA 3HY2A 1XWBA 5D8IA 1NSWA 1A24A 1TOFA 5FT3A 1Q4JA 14GSA 1SYXA 2PBJA 4ULXA 2H1AA 1AAZA 3M9KA 3JCML 3IDVA 4ZB9A 3RHBA 2MZCA 3TJFA 4MK3A 2YJHA 1QXHA 3PH9A 4WR5A 5CYYA 1KTEA 1JZWA 4GSTA 1XIYA 3D22A 3U6VA 3P2AA 1PSQA 1U87A 3KTLA 5D9VA 1YKAA 2VUPA 5JCGA 1LBKA 3BBYA 3LYPA 3A2VA 3TKSE 4Q5RA 4ML1A 1HD2A 1THOA 4K7IA 1U3IA 2D2ZA 2L59A 1F9MA 4EIQA 4ECJA 1PL2A 2LTKA 2WDUA 3MDKA 1HQOA 3QOUA 2CT6A 5AISA 4GRFA 3IK7A 2WRTA 4AKHA 5C04A 5AIVA 1Z5YE 5IOWA 3GKNA 4G19A 2V6KA 4PQIA 5ENUA 3TJGA 1C72A 1YDKA 3TOUA 1J0FA 1K0OA 3H4KA 3FMWA 3KEBA 3KH7A 5D93A 3TKPA 4K7OA 3GHAA 2EFCA 2FA8A 2VL2C 4HJMA 5G30A 5CO3A 4GQFA 1XOBA 3G9BA 2NVLA 1MEKA 2C1YA 1FO5A 8GSSA 1PMTA 2L57A 4TOPA 3FR9A 2G2QA 4K1FA 2H8LA 4TR1A 3R2QA 4CY6A 6GSWA 4LA1A 1EOGA 4J2FA 2YPMA 1QFNA 5JWOB 2LUSA 2R6KA 3MAKA 3D5JA 4PTSA 3UL3A 3A5IA 1K0CA 1GTBA 3D6IA 4HZ2A 2R2JA 1YEXA 1R26A 2DBCA 1M2BA 4L0UA 1ML6A 3FHKA 2B5EA 1SJIA 1FB6A 3GL5A 1G0TA 18GSA 1USBA 3IR4A 2VCZA 1F3AA 3RBTA 3ZL5A 2E2GA 4ZB7A 1N2AA 3F4RA 2WS2A 4MJCA 4HS1A 1SYRA 2BJXA 4PXOA 1XWKA 2L4QA 3H93A 3KMNA 3O3TA 4OCEA 5B8AA 3UAPA 5A4VA 2YV9A 4KDYA 3IOSA 3TU3B 9GSSA 1JLWA 2HLSA 1XW9A 4IGJA 1QQ2A 3I6AA 1FVKA 2X4AA 3WGXA 1PGTA 1XPVA 3FW2A 3HVSA 1ZMAA 1WMJA 17GSA 2IPAA 2GT6A 1TDIA 1EV4A 2CZ2A 3GURA 1GLPA 2RLIA 16GSA 2ON5A 1KBNA 4HUAA 4YKFA 1TRVA 2NDOA 3HZ4A 2TIRA 4J57E 4CHSA 4G9HA 2QKEA 1G6WA 2PERA 4AKIA 3BCKA 2GT5A 4XTSA 2H76A 2VOCA 3L9SA 3MYDA 2REMA 1SL1B 2C0FA 3RDWA 3KMOA 4N0VA 3ZIJA 4GSNA 2H70A 1K3YA 3EU4A 3HA9A 4KSMA 2PGTA 3TOTA 3O76A 2R37A 2RM5A 4GXZA 4ECIA 2BMXA 1MDJA 4IQAA 4FO5A 1A2LA 1E6BA 4WF5A 2GDRA 4PURA 4OD7A 4QQ7A 5F0GA 4JU5A 3L0HA 2VCTA 4K6XA 1TRSA 3GKMA 4MP4A 3FR3A 5D9TA 1E2YA 1N25A 4JBBA 1GNEA 1JZDA 1DE2A 1M2DA 1TRWA 4HU7A 1URMA 3HYPA 4YAPA 1ILOA 4NXIA 4YKGA 1EP8A 3A2WA 5EVOA 1TJDA 3UARA 2MMOA 5IMDA 2HE3A 3CBUA 3W6GA 4TR0A 3TJJA 4K5RA 1A8YA 3DYRA 3DVXA 1OKDA 3ERWA 3C8EA 2LQOA 5GSTA 4AJ8A 1GWCA 2H0IA 1WE0A 2MYGA 1A2JA 1THXA 2FWEA 5H5RA 2GSSA 4Q5FA 4IP1A 2HI7A 1TK5B 1NM3A 2LEGA 1GNWA 3M9JA 4WEYA 4DSRA 2IIYA 2I4AA 3F63A 1AC1A 5ABRA 5JWQB 4QMKA 4IBPA 1O7UA 3UJ1A 2HRAA 1FVJA 1BEDA 2Z9SA 5CRWA 5GZZB 3VK9A 2FY6A 3TKSC 4WF4A 2HFDA 1ERTA 1I5GA 3KD0A 1PX6A 2TRXA 5J9BA 4BL7A 2H0GA 3TKSA 4JZQA 2VM2A 3VWUA 1JFUA 4IHUA 2H6YA 4BVYB 2HRKA 2DKHA 5IMFA 1G7OA 4K0NA 4IELA 3PINA 5HFGA 4MZCA 5ECMB 5KN2A 4MF6A 5G1LA 4OFTA 3LW9A 3HHVA 1XWAA 5COHA 2LQQA 5IM9A 2V2GA 3ERFA 1ERUA 3FYGA 3TJKA 2XPDA 1BX9A 4POMA 1GP1A 3R3EA 5IPGA 4EXJA 5DBQA 5DQSA 3UVHA 1XW5A 4G0IA 1OC9B 3GX0A 5DAKA 4QL9A 2DJKA 2YNXA 4JE1A 1TI3A 1FG4A 3ERGA 1X5CA 3KGKA 3CSJA 6GSUA 2CZ3A 4JRRA 5EL8A 4DSSB 4EE0A 2A2PA 2GZYA 2X49A 4EVMA 1G7EA 2G0FA 4EDYA 3QAGA 5IQYA 2IJYA 1GTAA 3F6DA 3KM6A 2EFDA 3M3MA 4F2IA 4ZBBA 1TI1A 3DWVA 4LL1B 1O85A 1SJ6A 2DJ1A 6GSVA 1J08A 4LL4B 1GSSA 3FZ5A 4BVYA 2R4VA 4YQUA 1H75A 2IMIA 3BJ5A 1V58A 1A0RP 3IC8A 4QL7A 4HDEA 4F9ZA 1IYIA 1WIKA 3GA4A 4HQSA 1S3CA 2VL3A 4IP6A 1WJKA 4Q5NA 3BD2A 2JSZA 3L9VA 2M72A 3TKRA 3F0IA 4V2LA 3DVWA 2AAWA 3LJRA 2H74A 4N11A 5F8BA 4N30A 1SL0B 1T4YA 3TKQA 3NOFA 2PU9C 2QGVA 1YVLA 1PX7A 4Q5QA 4H86A 3LWAA 3QR6A 5HR2A 5IMVA 1FW1A 4ZBAA 5HR1A 1ON4A 2A2SA 1JHBA 1WOUA 3D0ZA 4YQMA 4K9ZA 4POKA 5LNKe 4IJ3A 3VI5A 5LCZA 1R4WA 3OR5A 5CAXA 1PD21 4V1Ap 1ZYPA 2A2RA 1EOHA 2M80A 4TVEA 1UVZA 3FK8A 4FH8A 3EPTA 3C71A 2GZPA 3IK9A 2GSQA 5D73A 2LRNA 3UIWA 4HEA2 3HMJG 4DSQA 2FHEA 2CQ9A 2LNSA 4O92A 2LNTA 3MSZA 1M99A 1O81A 5F06A 2IMFA 5DQYA 4MJAA 5KN0A 1GLQA 4ISDA 1MDKA 3C1RA 1LU4A 1OE8A 5ECPB 2VLVA 5F07A 2N5AA 3L9UA 1BAYA 2FCHA 1EZKA 4ZIJA 4TR1B 1CQHA 4ZXGA 4KH7A 2XC2A 1PN9A 3C73A 1OAZA 2C3NA 2CVDA 2GZZA 4PX1A 4L0WA 1EV9A 3UBKA 3F8UA 4XRDA 1JZRA 3DGQA 2B6MA 4X0XA 2P5RA 5J9CA 1T7PB 4DEJA 1VGLA 2V32A 4NAXA 4E68A 5KN1A 2CV4A 3APQA 1T4ZA 3PGTA 1W4VA 5EPFA 4MJBA 3U5RE 3BCIA 3WGEA 4KCAA 4Z2TA 2P0GA 3VPQA 4I2UA 4MPGA 6GSSA 4EUYA 5JCWA 5GAPD 4LLRA 4XS4B 1K3OA 4HI7A 4G0LA 4IS0A 2YJ7A 3APOA 3F9UA 3US3A 4TR3A 3TDGA 1SVOA 5ECRB 3O6TA 1S3DA 2C3TA 2FA4A 3FEUA 4CY8A 1KNGA 2OA7A 3CSIA 2GS3A 4KCEA 3ZREA 1Z3EA 4GWRA 2UV8G 1RQMA 1QGVA 5IO0A 2HSYA 4EF0A 1TRUA 2AJQB 1GUKA 4ZL8A 2FWHA 1WRYA 1FHEA 1MTCA 4KE3A 3I43A 2MBTA 1ZYQB 2MMZA 1HNAA 3CYNA 2HNLA 4GQCA 5A4UA 2EIRA 2I81A 1EEJA 1V2AA 3DKSA 3GSSA 4K8MA 5AIXA 2PN8A 4F0CA 4WBRD 4X1UA 1PKZA 2ON7A 4XRAA 5AN1A 4FQUA 1ERVA 2CVKA 1R7HA 5G31A 2GQLA 1JLVA 5IMAA 2R0GA 2LKUA 4AKXB 4ILFA 2RM6A 3F3QA 4XS4A 1SKSB 2ES7A 2YANA 3L4NA 1HNCA 5CP1A 2KLXA 3IAM2 2B1KA 1A8LA 3IRAA 2K18A 4XCSA 1XW6A 4AF2A 3UEMA 1O6JA 4F03A 2H1BA 3QFBC 5F05A 2I3YA 4IJIA 2WZ9A 4NPBA 4NMUA 1Z6NA 4HU9A 2DIZA 1K0AA 2O89A 4PUFC 2KUCA 5JWRB 1PQNA 5J4YA 4IQ1A 3LEFA 5L71A 3E3EA 4GCIA 3H79A 2TRCP 3GRXA 4FIWA 4P3YB 1BQ7A 2VKZG 4TN8A 5ECLB 2VL9A 5IMZA 1RW1A 5H5SA 3ZLPA 1PKWA 2CVBA 2L5LA 2H75A 3LYKA 3ZMKA 2NPBA 3HJPA 3LG6A 2YN1A 5A1NB 2X8CA 2VCWA 2WGRA 1XWCA 2JZTA 1CQGA 3GKKA 1SVMA 1K0DA 2C0DA 5DJLA 1OC3A 5FHIA 4NV2A 3ZVJA 4G01A 4MNNA 1UN2A 5E59A 2VO4A 3TRPA 2YWOA 3BOAA 1M7TA 3IXRA 3FRCA 3L78A 4X4JA 1Z9HA 4MF7A 3NZNA 5J41A 5HFIA 3E0UA 4BA7A 20GSA 1GSFA 2C4JA 3FZAA 3J7Yk 3IC4A 2VIMA 4MA9A 4MPFA 1TK0B 1AIUA 4V2NA 2FNOA 3HJOA 4USSA 1OKTA 4OWYA 4MZWA 2H66A 3TB2A 3ED3A 1VF3A 2N5BA 4BL7B 2NTOA 3WYWA 2JU5A 5G1KA 1UA5A 2F8FA 2DC5A 2CAIA 3GNJA 4BVXB 2L6DA 3N9JA 2LV3A 2HRKB 2AB6A 1GUMA 4E8HA 3DXBA 4WXTA 1XWGA 1GSQA 5A1NA 1XCCA 5DJMA 4TW5A 2J23A 2LRTA 3G7IA 4L5OA 1QMVA 2PPTA 1YZXA 3HVXA 2JSYA 5H5QA 2XPEA 2H1LA 1B8XA 4RQRA 2LJKA 3GSTA 1ZCPA 1XBSA 2OE0A 5DAKB 4TXOA 4O5UA 3HJMA 2H1GA 2IFQB 3CRUA 2O5VA 2L4CA 4OFMA 1B4QA 2EFHA 5J4UA 4KNDA 3W8SA 1H4OA 4YH2A 2C80A 3EU3A 1GSYA 12GSA 2RUFA 1Z7RA 4ACSA 2GLRA 2HSNB 3QD9A 2FWGA 1ZL9A 2H19A 4MH2A 4TR4A 2X64A 2DJ0A 2VLUA 1HYUA 3VURA 3TUEA 6GSTA 5B8BA 1EEMA 3GMFA 1SVLA 2WFCA 4BVXA 4YQVA 1SKWB 1GTIA 2LJAA 3EINA 4IW9A 5GSSA 1YKCA 4KGIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GIX A;  1MD3 A;  1SD9 A;  3J7Y b;  2LRC A;  3D4T A;  2J9H A;  2JL4 A;  1EWX A;  2LS5 A;  4I6X A;  3HKR A;  3NIV A;  3EC3 A;  3UBL A;  3C7M A;  1B4P A;  2MBS A;  3VWW A;  1VRS D;  1OC8 A;  2IFQ A;  5G5E A;  4PNF A;  2EIQ A;  3CTG A;  2MMN A;  1SKR B;  2IN3 A;  1WWJ A;  5ECN B;  1T3B A;  5D96 A;  3RPN A;  3F3R A;  3ZML A;  1QK8 A;  4PNG A;  4TKY A;  3TRQ A;  1OVN A;  3VI7 A;  2DMM A;  2FLS A;  1OYJ A;  4IKH A;  2LST A;  1SK0 A;  1YY7 A;  2C0E A;  4MMM A;  4XIH A;  2HZE A;  3CMI A;  4NWY A;  1J9B A;  3GH9 A;  1U6T A;  5AGY A;  1K0B A;  3KH9 A;  2YWN A;  4KW6 A;  4O5R A;  4MDC A;  4EC0 A;  3LOR A;  4O7H A;  10GS A;  2VCQ A;  4JR6 A;  1Z6M A;  3UMA A;  1GUL A;  3IBH A;  3D4M A;  4WKW A;  2CAQ A;  4F82 A;  1AW9 A;  5ELA A;  5BMU A;  3ZTL A;  3GFK A;  3VWV A;  4MZB A;  3HVV A;  3APS A;  5HQP A;  1XFL A;  3M8N A;  1O8X A;  1GSE A;  4KAE A;  2HYX A;  2DJ2 A;  2NBS A;  3SBC A;  4TRX A;  1YEP A;  3N5O A;  4PUA A;  1O73 A;  4JED A;  6GSY A;  3EWL A;  3Q6O A;  3DIE A;  2GQK A;  2IWT A;  3KIJ A;  2H01 A;  4HZ4 A;  2DJ3 A;  4GF0 A;  2EIO A;  2YCD A;  7GSS A;  3GH6 A;  1KEB A;  3KJY A;  2B5Y A;  4XHM A;  1TXX A;  1XVQ A;  1AQX A;  4MLY A;  1I9D A;  4RI6 A;  1GRX A;  4MF5 A;  2ZCT A;  4KB3 A;  2JAD A;  3V1W A;  2FWF A;  2RII A;  2H30 A;  1G6Y A;  4I5Q A;  3VWX A;  2I9H A;  5IPH A;  5IO2 A;  3F4T A;  4IN0 A;  1XXU A;  5ECQ B;  2X99 A;  2K9F A;  1WP0 A;  2O8V B;  3GL3 A;  3K8N A;  5ECK B;  1TP9 A;  2ALB A;  4ECC A;  4EDZ A;  4MJE A;  2E0Q A;  4TXV A;  1SK1 A;  3HD5 A;  1A0F A;  1YF1 A;  2O85 A;  5INY A;  3M1G A;  1SJZ A;  2V1M A;  3F6F A;  2X8H A;  4EL1 A;  3WT2 A;  1FB0 A;  5DCG A;  3IPZ A;  2F9S A;  1V9W A;  2KHP A;  3G7Y A;  1EGO A;  1V98 A;  4GSS A;  3P7X A;  4MCU A;  4RQX A;  1MD4 A;  1S3A A;  1K3L A;  2B5X A;  1X9M B;  1NW2 A;  2PMT A;  3GTU A;  1Q98 A;  2FGX A;  2HXK A;  2PVQ A;  3IV4 A;  1TU8 A;  5ECS A;  4N0Z A;  3GYK A;  1DE1 A;  3IAS 2;  1VF1 A;  4LMW A;  5B6M A;  1JZO A;  3CSH A;  3E9J B;  1SL2 B;  3CRT A;  3LQ7 A;  1SEN A;  2DSA A;  1YF0 A;  3GKX A;  1YQ1 A;  4KDU A;  3EMX A;  4CDO A;  4L8E A;  1VF2 A;  4AGS A;  2XBQ A;  4K0G A;  1AUC A;  2GQM A;  1A2M A;  2V6O A;  3ISO A;  2X8G A;  5DAL B;  4G10 A;  5DVB A;  3EMP A;  4ZB6 A;  2IL3 A;  1M0U A;  2C3Q A;  4K2D A;  2OBK A;  3I69 A;  3HCZ A;  1AXD A;  2B3S A;  4FYC A;  4OMV A;  4XS1 A;  4IVF A;  4POL A;  5G5F A;  2HSH A;  1FOV A;  2H0H A;  5HFK A;  1AQW A;  3CTF A;  1BYE A;  5EY6 A;  2B7K A;  2O87 A;  1Y25 A;  2IMD A;  2DIY A;  2K8S A;  3SWL A;  3TJB A;  1TU7 A;  2K8V A;  4HJ2 A;  1RK4 A;  5CRD A;  4AJ6 A;  4ZL9 A;  4L5L A;  1B9X C;  2MMA A;  1Y6E A;  4KX4 A;  3RPP A;  3ZRD A;  5ECI B;  2VL2 A;  2JZS A;  3H1N A;  4I8B A;  1X9W B;  3WD6 A;  1O8W A;  3QPM A;  4AJ7 A;  3EVI A;  2P5Q A;  1YJ6 A;  2AUV A;  5D9W A;  1XOA A;  1PL1 A;  3A3T A;  2IME A;  2VM1 A;  2YZU A;  5HR0 A;  4PGT A;  5DAL A;  2KOK A;  4EKZ A;  1QUW A;  3D21 A;  1VF4 A;  1UC7 A;  1T1V A;  2I1U A;  1R5P A;  1ZOF A;  1U3A A;  2YOI A;  1B9Y C;  1TW9 A;  2YV7 A;  2CX3 A;  3FKF A;  1M9B A;  3EUR A;  22GS A;  4KUN A;  4LMV A;  3LXT A;  1ST9 A;  2YZH A;  1W89 A;  4BWS A;  1WPI A;  1NHO A;  4X43 A;  4POB A;  3VLN A;  1DBY A;  4OO4 A;  3IHQ A;  5CRG A;  4DVC A;  1BG5 A;  1K0N A;  1TKD B;  3PPU A;  5ECO B;  5HR3 A;  3IE3 A;  5ELG A;  4MH3 A;  4KSO A;  4Z7X A;  1GUH A;  1GSD A;  3I9V 2;  1T8E B;  4O32 A;  3F4S A;  3MWH A;  1ZZY A;  2HSM B;  1GH2 A;  3ZFL A;  5CRH A;  3RAZ A;  2DML A;  4PQH A;  2CX4 A;  4JR4 A;  3Q18 A;  4V2M A;  2DJJ A;  3TRX A;  2WUL A;  5G2Z A;  3ME8 A;  2KP2 A;  4ZBD A;  2BTO T;  3ZIT A;  5A5K A;  4NV5 A;  1SK2 A;  2GGT A;  1SD8 A;  1F6M C;  2QC7 A;  2VLT A;  1B48 A;  4I2T A;  2VCX A;  2XBI A;  3KTB A;  2C0G A;  2EC4 A;  2F51 A;  2LJR A;  3DRN A;  5ECH B;  4TXO B;  2F8A A;  2A4V A;  19GS A;  3VPT A;  3FZ9 A;  4OO5 A;  2HT9 A;  6GSX A;  2F3M A;  1X9S B;  3GX8 A;  4E8E A;  4I97 A;  1NHY A;  1GTU A;  5KN3 A;  4G2E A;  3HDC A;  2GST A;  4K7N A;  4RUV A;  2QSI A;  2YP6 A;  4RI7 A;  1HNB A;  2E2M A;  2WB9 A;  1DSB A;  3ZZX A;  2ZNM A;  3TGZ A;  2VD1 A;  5D9X A;  3LFL A;  1V57 A;  1F37 A;  2HSM A;  3EE2 A;  3PR8 A;  4NHZ A;  2GTU A;  1DUG A;  3FZ4 A;  4J56 E;  3W8J A;  2K6V A;  5ID2 B;  1AQV A;  1T00 A;  3S9F A;  2O7K A;  4GLT A;  3FR6 A;  1A23 A;  2E7P A;  1ERW A;  5IIZ A;  1ZGN A;  2XHF A;  3M0F A;  3KCM A;  2VAF A;  3QDN A;  2WJU A;  1F3B A;  1TTZ A;  3IA1 A;  1X0R A;  1TK8 B;  1M9A A;  4D73 B;  2OAD A;  1PRX A;  3DEX A;  3DML A;  4BWQ A;  2GVP A;  5CNW A;  5B6N A;  2UZ8 A;  3QCP A;  2H72 A;  4N10 A;  11GS A;  3LXZ A;  3C1S A;  5J5N A;  1U88 A;  3GN3 A;  3EYT A;  2HZE B;  1N8J A;  2VD0 A;  1R5A A;  1EP7 A;  2OAC A;  4F0B A;  2H71 A;  13GS A;  3KP8 A;  3UOM A;  3QFA C;  3WGD A;  4OFN A;  2R5G A;  4WET A;  5ID2 A;  3H8Q A;  2P31 A;  3GV1 A;  1X5E A;  3AY8 A;  3RHC A;  2HZF A;  3LSZ A;  3GUS A;  1GSU A;  3Q19 A;  5A4W A;  4MAB A;  3A2X A;  2WCI A;  2GSR A;  5KEJ A;  1FAA A;  4YAV A;  4D73 A;  3KP9 A;  2FD3 A;  3TCO A;  3QAV A;  3FY7 A;  1IYH A;  4ECB A;  2H6Z A;  4WBJ A;  4GTU A;  3ME7 A;  4NHW A;  2AYT A;  2PUK C;  3CXG A;  2AV4 A;  3KZQ A;  3ZYW A;  3LGC A;  2H73 A;  1PA3 A;  5J3R A;  2JZR A;  2OJL A;  2KP1 A;  1OE7 A;  2VCV A;  4FYB A;  2H6X A;  5GAN D;  3HZ8 A;  2CA8 A;  3KXO A;  1M2A A;  4ZL7 A;  3A5W A;  5LD0 A;  2YWM A;  2DLX A;  4ZIL A;  2M46 A;  2L6C A;  2N5F A;  5CRE A;  2HQT A;  3HXS A;  3P90 A;  5E4W A;  2HRF A;  4CW9 A;  2ZUP A;  2IMK A;  5IMC A;  5C00 A;  3ZVJ D;  4ID0 A;  4KDX A;  3Q74 A;  2OE1 A;  1BJX A;  4FYU A;  1GL8 A;  5DCH A;  4WR4 A;  5FWG A;  4G0K A;  1ZYE A;  3G7J A;  3P8W A;  2PVO C;  4BPY A;  4XS6 A;  3ZFB A;  1SU9 A;  4KF9 A;  2L5O A;  1K0M A;  3QAW A;  4ZB8 A;  4HQZ A;  1V40 A;  3UVT A;  1OC9 A;  2OE3 A;  2RUE A;  2JAC A;  1F2E A;  2R3X A;  3GTU B;  3MNG A;  2B7J A;  5B7C A;  1XZO A;  3ZIV A;  3VFI A;  3DD3 A;  1Z7P A;  1X5D A;  3WT1 A;  4DSS A;  1LJR A;  2YWI A;  3QMX A;  2HRN A;  4KA0 A;  2OBI A;  4ML6 A;  2H1D A;  1XVW A;  1EGR A;  2B1L A;  5JCU A;  5IOX A;  4HOJ A;  4V1A g;  2OKA A;  2C8U A;  2FUG 2;  4PQ1 A;  1MDI A;  2V41 A;  5DDL A;  1ACV A;  4OCF A;  2AHE A;  4EO3 A;  1ABA A;  2PWJ A;  3HY2 A;  1XWB A;  5D8I A;  1NSW A;  1A24 A;  1TOF A;  5FT3 A;  1Q4J A;  14GS A;  1SYX A;  2PBJ A;  4ULX A;  2H1A A;  1AAZ A;  3M9K A;  3JCM L;  3IDV A;  4ZB9 A;  3RHB A;  2MZC A;  3TJF A;  4MK3 A;  2YJH A;  1QXH A;  3PH9 A;  4WR5 A;  5CYY A;  1KTE A;  1JZW A;  4GST A;  1XIY A;  3D22 A;  3U6V A;  3P2A A;  1PSQ A;  1U87 A;  3KTL A;  5D9V A;  1YKA A;  2VUP A;  5JCG A;  1LBK A;  3BBY A;  3LYP A;  3A2V A;  3TKS E;  4Q5R A;  4ML1 A;  1HD2 A;  1THO A;  4K7I A;  1U3I A;  2D2Z A;  2L59 A;  1F9M A;  4ECJ A;  1PL2 A;  2LTK A;  2WDU A;  3MDK A;  1HQO A;  3QOU A;  2CT6 A;  5AIS A;  4GRF A;  3IK7 A;  2WRT A;  5C04 A;  5AIV A;  1Z5Y E;  5IOW A;  3GKN A;  4G19 A;  2V6K A;  4PQI A;  5ENU A;  3TJG A;  1C72 A;  1YDK A;  3TOU A;  1J0F A;  1K0O A;  3H4K A;  3KEB A;  3KH7 A;  5D93 A;  3TKP A;  4K7O A;  3GHA A;  2FA8 A;  2VL2 C;  4HJM A;  5G30 A;  5CO3 A;  4GQF A;  1XOB A;  3G9B A;  2NVL A;  1MEK A;  2C1Y A;  1FO5 A;  8GSS A;  1PMT A;  2L57 A;  4TOP A;  3FR9 A;  2G2Q A;  4K1F A;  2H8L A;  4TR1 A;  3R2Q A;  6GSW A;  4LA1 A;  1EOG A;  4J2F A;  2YPM A;  1QFN A;  5JWO B;  2LUS A;  2R6K A;  3MAK A;  3D5J A;  4PTS A;  3UL3 A;  1K0C A;  1GTB A;  3D6I A;  4HZ2 A;  2R2J A;  1YEX A;  1R26 A;  2DBC A;  1M2B A;  4L0U A;  1ML6 A;  3FHK A;  2B5E A;  1SJI A;  1FB6 A;  3GL5 A;  1G0T A;  18GS A;  1USB A;  3IR4 A;  2VCZ A;  1F3A A;  3RBT A;  3ZL5 A;  2E2G A;  1N2A A;  3F4R A;  2WS2 A;  4MJC A;  4HS1 A;  1SYR A;  2BJX A;  4PXO A;  1XWK A;  2L4Q A;  3H93 A;  3KMN A;  3O3T A;  4OCE A;  5B8A A;  3UAP A;  5A4V A;  2YV9 A;  4KDY A;  3IOS A;  9GSS A;  1JLW A;  2HLS A;  1XW9 A;  4IGJ A;  1QQ2 A;  3I6A A;  1FVK A;  3WGX A;  1PGT A;  1XPV A;  3FW2 A;  3HVS A;  1ZMA A;  1WMJ A;  17GS A;  2IPA A;  2GT6 A;  1TDI A;  1EV4 A;  2CZ2 A;  3GUR A;  1GLP A;  2RLI A;  16GS A;  2ON5 A;  1KBN A;  4HUA A;  1TRV A;  2NDO A;  3HZ4 A;  2TIR A;  4J57 E;  4CHS A;  4G9H A;  2QKE A;  1G6W A;  2PER A;  3BCK A;  2GT5 A;  4XTS A;  2H76 A;  2VOC A;  3L9S A;  2REM A;  1SL1 B;  2C0F A;  3RDW A;  3KMO A;  4N0V A;  3ZIJ A;  4GSN A;  2H70 A;  1K3Y A;  3EU4 A;  3HA9 A;  4KSM A;  2PGT A;  3TOT A;  3O76 A;  2R37 A;  2RM5 A;  4GXZ A;  4ECI A;  2BMX A;  1MDJ A;  4IQA A;  4FO5 A;  1A2L A;  1E6B A;  4WF5 A;  2GDR A;  4PUR A;  4OD7 A;  4QQ7 A;  5F0G A;  4JU5 A;  3L0H A;  2VCT A;  4K6X A;  1TRS A;  3GKM A;  4MP4 A;  3FR3 A;  5D9T A;  1E2Y A;  4JBB A;  1GNE A;  1JZD A;  1DE2 A;  1M2D A;  1TRW A;  4HU7 A;  1URM A;  3HYP A;  4YAP A;  1ILO A;  4NXI A;  1EP8 A;  3A2W A;  5EVO A;  1TJD A;  3UAR A;  2MMO A;  5IMD A;  2HE3 A;  3CBU A;  3W6G A;  4TR0 A;  3TJJ A;  1A8Y A;  3DYR A;  3DVX A;  1OKD A;  3ERW A;  3C8E A;  2LQO A;  5GST A;  4AJ8 A;  1GWC A;  2H0I A;  1WE0 A;  2MYG A;  1A2J A;  1THX A;  2FWE A;  5H5R A;  2GSS A;  4Q5F A;  4IP1 A;  2HI7 A;  1TK5 B;  1NM3 A;  2LEG A;  1GNW A;  3M9J A;  4WEY A;  4DSR A;  2IIY A;  2I4A A;  3F63 A;  1AC1 A;  5ABR A;  5JWQ B;  4IBP A;  1O7U A;  3UJ1 A;  2HRA A;  1FVJ A;  1BED A;  2Z9S A;  5CRW A;  5GZZ B;  3VK9 A;  2FY6 A;  3TKS C;  4WF4 A;  2HFD A;  1ERT A;  1I5G A;  3KD0 A;  1PX6 A;  2TRX A;  5J9B A;  4BL7 A;  2H0G A;  3TKS A;  4JZQ A;  2VM2 A;  3VWU A;  1JFU A;  4IHU A;  2H6Y A;  4BVY B;  2HRK A;  5IMF A;  1G7O A;  4K0N A;  4IEL A;  3PIN A;  5HFG A;  4MZC A;  5ECM B;  5KN2 A;  4MF6 A;  5G1L A;  4OFT A;  3HHV A;  1XWA A;  5COH A;  2LQQ A;  5IM9 A;  2V2G A;  3ERF A;  1ERU A;  3FYG A;  3TJK A;  2XPD A;  1BX9 A;  4POM A;  1GP1 A;  3R3E A;  5IPG A;  4EXJ A;  5DBQ A;  5DQS A;  3UVH A;  1XW5 A;  4G0I A;  1OC9 B;  3GX0 A;  5DAK A;  4QL9 A;  2DJK A;  2YNX A;  4JE1 A;  1TI3 A;  1FG4 A;  3ERG A;  1X5C A;  3KGK A;  3CSJ A;  6GSU A;  4JRR A;  2CZ3 A;  5EL8 A;  4DSS B;  4EE0 A;  2GZY A;  4EVM A;  1G7E A;  2G0F A;  4EDY A;  3QAG A;  5IQY A;  2IJY A;  1GTA A;  3F6D A;  3KM6 A;  3M3M A;  4F2I A;  4ZBB A;  1TI1 A;  3DWV A;  4LL1 B;  1O85 A;  1SJ6 A;  2DJ1 A;  6GSV A;  1J08 A;  4LL4 B;  1GSS A;  3FZ5 A;  4BVY A;  2R4V A;  4YQU A;  1H75 A;  2IMI A;  3BJ5 A;  1V58 A;  1A0R P;  3IC8 A;  4QL7 A;  4HDE A;  4F9Z A;  1IYI A;  1WIK A;  4IP6 A;  3GA4 A;  1S3C A;  2VL3 A;  4HQS A;  1WJK A;  4Q5N A;  3BD2 A;  2JSZ A;  3L9V A;  2M72 A;  3TKR A;  3F0I A;  4V2L A;  3DVW A;  2AAW A;  3LJR A;  2H74 A;  4N11 A;  5F8B A;  4N30 A;  1SL0 B;  1T4Y A;  3TKQ A;  3NOF A;  2PU9 C;  2QGV A;  1PX7 A;  4Q5Q A;  4H86 A;  3LWA A;  3QR6 A;  5HR2 A;  5IMV A;  1FW1 A;  4ZBA A;  5HR1 A;  1ON4 A;  2A2S A;  1JHB A;  1WOU A;  3D0Z A;  4YQM A;  4K9Z A;  4POK A;  5LNK e;  4IJ3 A;  3VI5 A;  5LCZ A;  1R4W A;  3OR5 A;  5CAX A;  1PD2 1;  4V1A p;  2A2R A;  1EOH A;  2M80 A;  4TVE A;  1UVZ A;  3FK8 A;  4FH8 A;  3C71 A;  2GZP A;  3IK9 A;  2GSQ A;  5D73 A;  2LRN A;  3UIW A;  4HEA 2;  4DSQ A;  2FHE A;  2CQ9 A;  2LNS A;  4O92 A;  2LNT A;  3MSZ A;  1M99 A;  1O81 A;  5F06 A;  2IMF A;  5DQY A;  4MJA A;  5KN0 A;  1GLQ A;  4ISD A;  1MDK A;  3C1R A;  1LU4 A;  1OE8 A;  5ECP B;  2VLV A;  5F07 A;  2N5A A;  3L9U A;  1BAY A;  2FCH A;  1EZK A;  4ZIJ A;  4TR1 B;  1CQH A;  4ZXG A;  4KH7 A;  2XC2 A;  1PN9 A;  3C73 A;  1OAZ A;  2C3N A;  2CVD A;  2GZZ A;  4PX1 A;  4L0W A;  1EV9 A;  3UBK A;  3F8U A;  4XRD A;  1JZR A;  3DGQ A;  2B6M A;  4X0X A;  2P5R A;  5J9C A;  1T7P B;  4DEJ A;  1VGL A;  2V32 A;  4NAX A;  5KN1 A;  2CV4 A;  3APQ A;  1T4Z A;  3PGT A;  1W4V A;  5EPF A;  4MJB A;  3U5R E;  3BCI A;  3WGE A;  4KCA A;  2P0G A;  3VPQ A;  4I2U A;  4MPG A;  6GSS A;  4EUY A;  5JCW A;  5GAP D;  4LLR A;  4XS4 B;  1K3O A;  4HI7 A;  4G0L A;  4IS0 A;  2YJ7 A;  3APO A;  3F9U A;  3US3 A;  4TR3 A;  3TDG A;  5ECR B;  3O6T A;  1S3D A;  2C3T A;  2FA4 A;  3FEU A;  1KNG A;  2OA7 A;  3CSI A;  2GS3 A;  4KCE A;  3ZRE A;  1Z3E A;  4GWR A;  1RQM A;  1QGV A;  5IO0 A;  2HSY A;  4EF0 A;  1TRU A;  2AJQ B;  1GUK A;  4ZL8 A;  2FWH A;  1WRY A;  1FHE A;  1MTC A;  4KE3 A;  3I43 A;  2MBT A;  1ZYQ B;  2MMZ A;  1HNA A;  3CYN A;  2HNL A;  4GQC A;  5A4U A;  2EIR A;  2I81 A;  1EEJ A;  1V2A A;  3DKS A;  3GSS A;  4K8M A;  5AIX A;  2PN8 A;  4F0C A;  4WBR D;  4X1U A;  1PKZ A;  2ON7 A;  4XRA A;  5AN1 A;  4FQU A;  1ERV A;  2CVK A;  1R7H A;  5G31 A;  2GQL A;  1JLV A;  5IMA A;  4ILF A;  2LKU A;  2RM6 A;  3F3Q A;  4XS4 A;  1SKS B;  2ES7 A;  2YAN A;  3L4N A;  1HNC A;  5CP1 A;  2KLX A;  3IAM 2;  2B1K A;  1A8L A;  3IRA A;  2K18 A;  4XCS A;  1XW6 A;  4AF2 A;  3UEM A;  1O6J A;  4F03 A;  2H1B A;  3QFB C;  5F05 A;  2I3Y A;  4IJI A;  2WZ9 A;  4NPB A;  4NMU A;  1Z6N A;  4HU9 A;  2DIZ A;  1K0A A;  2O89 A;  4PUF C;  2KUC A;  5JWR B;  1PQN A;  4IQ1 A;  3LEF A;  5L71 A;  3E3E A;  4GCI A;  3H79 A;  2TRC P;  3GRX A;  4FIW A;  4P3Y B;  1BQ7 A;  4TN8 A;  5ECL B;  2VL9 A;  5IMZ A;  1RW1 A;  5H5S A;  3ZLP A;  1PKW A;  2CVB A;  2L5L A;  2H75 A;  3LYK A;  3ZMK A;  2NPB A;  3HJP A;  3LG6 A;  2YN1 A;  2X8C A;  2VCW A;  2WGR A;  1XWC A;  2JZT A;  1CQG A;  3GKK A;  1K0D A;  2C0D A;  5DJL A;  1OC3 A;  5FHI A;  4NV2 A;  3ZVJ A;  1UN2 A;  5E59 A;  2VO4 A;  3TRP A;  2YWO A;  3BOA A;  1M7T A;  3IXR A;  3FRC A;  3L78 A;  1Z9H A;  4MF7 A;  3NZN A;  5J41 A;  5HFI A;  3E0U A;  4BA7 A;  20GS A;  1GSF A;  2C4J A;  3FZA A;  3J7Y k;  3IC4 A;  2VIM A;  4MA9 A;  4MPF A;  1TK0 B;  1AIU A;  4V2N A;  2FNO A;  3HJO A;  4USS A;  1OKT A;  4OWY A;  4MZW A;  2H66 A;  3TB2 A;  3ED3 A;  1VF3 A;  2N5B A;  4BL7 B;  2NTO A;  3WYW A;  2JU5 A;  5G1K A;  1UA5 A;  2F8F A;  2DC5 A;  2CAI A;  3GNJ A;  4BVX B;  2L6D A;  3N9J A;  2LV3 A;  2HRK B;  2AB6 A;  1GUM A;  4E8H A;  3DXB A;  4WXT A;  1XWG A;  1GSQ A;  1XCC A;  5DJM A;  4TW5 A;  2J23 A;  2LRT A;  3G7I A;  4L5O A;  1QMV A;  2PPT A;  1YZX A;  3HVX A;  2JSY A;  5H5Q A;  2XPE A;  1B8X A;  4RQR A;  2LJK A;  3GST A;  1ZCP A;  1XBS A;  2OE0 A;  5DAK B;  4TXO A;  3HJM A;  2H1G A;  2IFQ B;  3CRU A;  2L4C A;  4OFM A;  1B4Q A;  5J4U A;  4KND A;  3W8S A;  1H4O A;  4YH2 A;  2C80 A;  3EU3 A;  1GSY A;  12GS A;  2RUF A;  1Z7R A;  4ACS A;  2GLR A;  2HSN B;  3QD9 A;  2FWG A;  1ZL9 A;  2H19 A;  4MH2 A;  4TR4 A;  2X64 A;  2DJ0 A;  2VLU A;  1HYU A;  3VUR A;  3TUE A;  6GST A;  5B8B A;  1EEM A;  3GMF A;  2WFC A;  4BVX A;  4YQV A;  1SKW B;  1GTI A;  2LJA A;  3EIN A;  4IW9 A;  5GSS A;  1YKC A;  4KGI A; 
#chains in the Genus database with same CATH topology
 5BMU B;  3GIX A;  1MD3 A;  1SD9 A;  3J7Y b;  2LRC A;  3D4T A;  1PFO A;  2J9H A;  2JL4 A;  1EWX A;  2LS5 A;  4I6X A;  3HKR A;  3NIV A;  3EC3 A;  3UBL A;  3C7M A;  2OT3 A;  1B4P A;  2MBS A;  3VWW A;  1VRS D;  1OC8 A;  2IFQ A;  5G5E A;  4PNF A;  2EIQ A;  2QA1 A;  3CTG A;  2MMN A;  1SKR B;  2IN3 A;  1WWJ A;  5ECN B;  1T3B A;  5D96 A;  3RPN A;  3F3R A;  3ZML A;  1QK8 A;  4PNG A;  4TKY A;  3TRQ A;  1OVN A;  2HSN A;  3VI7 A;  2DMM A;  2FLS A;  1OYJ A;  4IKH A;  2LST A;  1SK0 A;  1YY7 A;  2C0E A;  4MMM A;  4XIH A;  2HZE A;  3CMI A;  4NWY A;  1J9B A;  3GH9 A;  1U6T A;  5AGY A;  1K0B A;  3KH9 A;  2YWN A;  4KW6 A;  4O5R A;  4MDC A;  4EC0 A;  3LOR A;  4O7H A;  4Z2R A;  4AKG A;  10GS A;  2VCQ A;  4JR6 A;  5KOW A;  1Z6M A;  3UMA A;  1GUL A;  4W66 A;  3IBH A;  3D4M A;  4WKW A;  2CAQ A;  4F82 A;  1AW9 A;  5ELA A;  5BMU A;  3ZTL A;  3GFK A;  3VWV A;  4MZB A;  2R0P A;  3HVV A;  3APS A;  5HQP A;  1XFL A;  2DKI A;  2QA2 A;  3M8N A;  1O8X A;  1GSE A;  4KAE A;  2HYX A;  2DJ2 A;  2NBS A;  3SBC A;  1YEW C;  4TRX A;  1YEP A;  3N5O A;  4PUA A;  1O73 A;  4JED A;  6GSY A;  3EWL A;  3Q6O A;  3DIE A;  2GQK A;  2IWT A;  3KIJ A;  2H01 A;  5A5H B;  4HZ4 A;  2DJ3 A;  4GF0 A;  2EIO A;  2YCD A;  7GSS A;  3GH6 A;  1KEB A;  3KJY A;  2B5Y A;  4XHM A;  1TXX A;  1XVQ A;  3HVN A;  1AQX A;  4MLY A;  1I9D A;  4RI6 A;  1TXU A;  1GRX A;  4MF5 A;  2ZCT A;  4O5Q A;  4KB3 A;  2JAD A;  3V1W A;  2FWF A;  2RII A;  3CWG A;  2H30 A;  1G6Y A;  4I5Q A;  3VWX A;  2I9H A;  5IPH A;  1BG1 A;  5IO2 A;  3F4T A;  4IN0 A;  1XXU A;  5ECQ B;  2X99 A;  2K9F A;  1WP0 A;  2O8V B;  3GL3 A;  3K8N A;  5ECK B;  1TP9 A;  1I1I P;  2ALB A;  4ECC A;  4EDZ A;  4MJE A;  1M3J A;  5J40 A;  2E0Q A;  4TXV A;  1SK1 A;  3HD5 A;  1A0F A;  1YF1 A;  2O85 A;  5A5H A;  5INY A;  3M1G A;  1SJZ A;  2V1M A;  3F6F A;  2X8H A;  4EL1 A;  3WT2 A;  1FB0 A;  5DCG A;  3IPZ A;  2F9S A;  1V9W A;  2KHP A;  3G7Y A;  1EGO A;  1V98 A;  4GSS A;  3P7X A;  4MCU A;  4RQX A;  1MD4 A;  1S3A A;  1K3L A;  2A4H A;  2B5X A;  1X9M B;  1NW2 A;  2PMT A;  3GTU A;  1Q98 A;  2FGX A;  2HXK A;  1BF5 A;  2PVQ A;  3IV4 A;  1TU8 A;  5ECS A;  4N0Z A;  3GYK A;  1DE1 A;  4Z2U A;  3IAS 2;  1VF1 A;  4LMW A;  5B6M A;  1JZO A;  3CSH A;  3E9J B;  1SL2 B;  3CRT A;  3LQ7 A;  1SEN A;  2DSA A;  1YF0 A;  2WW0 A;  3GKX A;  1YQ1 A;  4KDU A;  3EMX A;  4CDO A;  4L8E A;  1VF2 A;  4AGS A;  2XBQ A;  2R0C A;  4K0G A;  1AUC A;  2GQM A;  1A2M A;  2V6O A;  3ISO A;  2X8G A;  5DAL B;  4G10 A;  5DVB A;  3EMP A;  4ZB6 A;  2IL3 A;  1M0U A;  2C3Q A;  4K2D A;  2OBK A;  3I69 A;  3HCZ A;  1AXD A;  2B3S A;  4FYC A;  4OMV A;  4XS1 A;  4IVF A;  4POL A;  5G5F A;  2HSH A;  1FOV A;  2H0H A;  5HFK A;  1AQW A;  3CTF A;  1BYE A;  5EY6 A;  2B7K A;  2O87 A;  1Y25 A;  2IMD A;  2DIY A;  2K8S A;  3SWL A;  3TJB A;  1TU7 A;  2K8V A;  4HJ2 A;  1RK4 A;  5CRD A;  4AJ6 A;  4ZL9 A;  4L5L A;  1B9X C;  2MMA A;  1Y6E A;  4KX4 A;  3RPP A;  3ZRD A;  5ECI B;  2VL2 A;  2JZS A;  3H1N A;  4I8B A;  1X9W B;  3WD6 A;  1O8W A;  3QPM A;  4AJ7 A;  3EVI A;  2P5Q A;  1YJ6 A;  2AUV A;  5D9W A;  1XOA A;  1PL1 A;  3A3T A;  2IME A;  2VM1 A;  2YZU A;  5HR0 A;  4PGT A;  5KOX A;  5DAL A;  2KOK A;  3IHG A;  4EKZ A;  1QUW A;  3D21 A;  1VF4 A;  1UC7 A;  1T1V A;  2I1U A;  1R5P A;  1ZOF A;  1U3A A;  2YOI A;  1B9Y C;  1TW9 A;  2YV7 A;  2CX3 A;  3FKF A;  1M9B A;  3EUR A;  22GS A;  4K2X A;  4KUN A;  4LMV A;  3LXT A;  1ST9 A;  2YZH A;  1W89 A;  4BWS A;  1WPI A;  1NHO A;  4X43 A;  4POB A;  1PN0 A;  3VLN A;  1DBY A;  4OO4 A;  3IHQ A;  5CRG A;  4DVC A;  1BG5 A;  1K0N A;  1TKD B;  3PPU A;  5ECO B;  5HR3 A;  3IE3 A;  5ELG A;  4MH3 A;  4KSO A;  4Z7X A;  1GUH A;  1GSD A;  3I9V 2;  1T8E B;  1Y1U A;  4O32 A;  3F4S A;  3MWH A;  1ZZY A;  2HSM B;  1GH2 A;  3ZFL A;  5CRH A;  3RAZ A;  2DML A;  4PQH A;  2CX4 A;  4JR4 A;  3Q18 A;  4V2M A;  2DJJ A;  3TRX A;  2WUL A;  5G2Z A;  3ME8 A;  2KP2 A;  4ZBD A;  2BTO T;  3ZIT A;  5A5K A;  4NV5 A;  1SK2 A;  2GGT A;  1SD8 A;  1F6M C;  2QC7 A;  2VLT A;  1B48 A;  4I2T A;  2VCX A;  2XBI A;  3KTB A;  2C0G A;  2EC4 A;  2F51 A;  2LJR A;  3DRN A;  5ECH B;  4TXO B;  2F8A A;  2A4V A;  19GS A;  3VPT A;  3FZ9 A;  4OO5 A;  2HT9 A;  6GSX A;  2F3M A;  1X9S B;  3GX8 A;  4E8E A;  4I97 A;  2WW3 A;  1NHY A;  4A5P A;  1GTU A;  1ZYN A;  5KN3 A;  4G2E A;  3HDC A;  2GST A;  4K7N A;  4RUV A;  2QSI A;  2YP6 A;  4RI7 A;  1HNB A;  2E2M A;  4ICY A;  2WB9 A;  1DSB A;  3ZZX A;  2ZNM A;  3TGZ A;  2VD1 A;  5D9X A;  3RGB C;  3LFL A;  1V57 A;  1F37 A;  2HSM A;  3EE2 A;  3PR8 A;  1FOH A;  4NHZ A;  4EIP A;  4GDF A;  2GTU A;  1DUG A;  3FZ4 A;  4J56 E;  3W8J A;  2K6V A;  5ID2 B;  1AQV A;  1T00 A;  2WVX B;  3S9F A;  2O7K A;  4GLT A;  3FR6 A;  1A23 A;  2E7P A;  1ERW A;  5IIZ A;  1ZGN A;  2XHF A;  3M0F A;  3KCM A;  3MIX A;  5J47 A;  2VAF A;  3QDN A;  2WJU A;  1F3B A;  1TTZ A;  3IA1 A;  1X0R A;  1TK8 B;  1M9A A;  4D73 B;  2OAD A;  1PRX A;  3DEX A;  3DML A;  4BWQ A;  2GVP A;  5CNW A;  5A34 B;  5B6N A;  2UZ8 A;  3QCP A;  2H72 A;  4N10 A;  11GS A;  3LXZ A;  3C1S A;  5J5N A;  1U88 A;  3GN3 A;  3EYT A;  2HZE B;  1N8J A;  2VD0 A;  1R5A A;  5BRT A;  1EP7 A;  2OAC A;  4F0B A;  2H71 A;  13GS A;  3KP8 A;  3UOM A;  3QFA C;  3WGD A;  4OFN A;  2R5G A;  4WET A;  5ID2 A;  3H8Q A;  2P31 A;  3GV1 A;  1X5E A;  3AY8 A;  3RHC A;  2HZF A;  3LSZ A;  3GUS A;  1GSU A;  3Q19 A;  5A4W A;  4MAB A;  3A2X A;  4K5S A;  2WCI A;  2GSR A;  5KEJ A;  1FAA A;  4YAV A;  4D73 A;  3KP9 A;  2FD3 A;  3TCO A;  3QAV A;  5A34 A;  3FY7 A;  1IYH A;  4ECB A;  4BIK A;  2H6Z A;  4WBJ A;  4GTU A;  3ME7 A;  4NHW A;  4N3Z A;  2AYT A;  2PUK C;  3CXG A;  2AV4 A;  3KZQ A;  3ZYW A;  3LGC A;  2H73 A;  1PA3 A;  5J3R A;  2JZR A;  2OJL A;  2KP1 A;  1OE7 A;  2VCV A;  4FYB A;  2H6X A;  5GAN D;  3HZ8 A;  2CA8 A;  3KXO A;  1M2A A;  4ZL7 A;  3A5W A;  5LD0 A;  2YWM A;  2DLX A;  4ZIL A;  2M46 A;  2L6C A;  2N5F A;  5CRE A;  2HQT A;  3HXS A;  3P90 A;  5E4W A;  2HRF A;  4CW9 A;  2ZUP A;  2IMK A;  5IMC A;  5C00 A;  3ZVJ D;  4ID0 A;  4KDX A;  3Q74 A;  2OE1 A;  1BJX A;  4FYU A;  1GL8 A;  5DCH A;  4WR4 A;  5FWG A;  4G0K A;  1ZYE A;  3G7J A;  3P8W A;  2PVO C;  4BPY A;  4XS6 A;  3ZFB A;  1SU9 A;  4KF9 A;  2L5O A;  1K0M A;  3QAW A;  4ZB8 A;  4HQZ A;  1V40 A;  3UVT A;  1OC9 A;  2OE3 A;  4AI6 A;  2RUE A;  2JAC A;  1F2E A;  2EFE A;  2R3X A;  3GTU B;  3MNG A;  2B7J A;  5B7C A;  1XZO A;  3ZIV A;  3VFI A;  3DD3 A;  1Z7P A;  1X5D A;  3WT1 A;  4DSS A;  1LJR A;  5J4V A;  2YWI A;  3QMX A;  4HSC X;  2HRN A;  4KA0 A;  2OBI A;  4ML6 A;  2H1D A;  1XVW A;  1EGR A;  2B1L A;  5JCU A;  5IOX A;  1XG8 A;  4HOJ A;  4V1A g;  2OKA A;  4PI2 C;  2C8U A;  2FUG 2;  4PQ1 A;  1MDI A;  2V41 A;  5DDL A;  1ACV A;  3RFR C;  4OCF A;  2AHE A;  4EO3 A;  1ABA A;  2PWJ A;  3HY2 A;  1XWB A;  5D8I A;  1NSW A;  1A24 A;  1TOF A;  5FT3 A;  1Q4J A;  14GS A;  1SYX A;  2PBJ A;  4ULX A;  2H1A A;  1AAZ A;  3M9K A;  3JCM L;  3IDV A;  4ZB9 A;  3RHB A;  2MZC A;  3TJF A;  4MK3 A;  4PHZ C;  2YJH A;  1QXH A;  3PH9 A;  4WR5 A;  5CYY A;  1KTE A;  1JZW A;  4GST A;  1XIY A;  3D22 A;  3U6V A;  3P2A A;  1PSQ A;  1U87 A;  3KTL A;  5D9V A;  1YKA A;  2VUP A;  5JCG A;  1LBK A;  3BBY A;  3LYP A;  3A2V A;  3TKS E;  4Q5R A;  4ML1 A;  1HD2 A;  1THO A;  4K7I A;  1U3I A;  2D2Z A;  2L59 A;  2O36 A;  1F9M A;  4EIQ A;  4ECJ A;  1PL2 A;  2LTK A;  2WDU A;  3MDK A;  1HQO A;  3QOU A;  2CT6 A;  5AIS A;  4GRF A;  3IK7 A;  2WRT A;  4AKH A;  5C04 A;  5AIV A;  1Z5Y E;  5IOW A;  3GKN A;  4G19 A;  2V6K A;  4PQI A;  5ENU A;  3TJG A;  1C72 A;  1YDK A;  3TOU A;  1J0F A;  1K0O A;  3H4K A;  3FMW A;  3KEB A;  3KH7 A;  5D93 A;  3TKP A;  4K7O A;  3GHA A;  2EFC A;  2FA8 A;  2VL2 C;  4HJM A;  5G30 A;  5CO3 A;  4GQF A;  1XOB A;  3G9B A;  2NVL A;  1MEK A;  2C1Y A;  1FO5 A;  8GSS A;  1PMT A;  2L57 A;  4TOP A;  3FR9 A;  2G2Q A;  4K1F A;  2H8L A;  4TR1 A;  3R2Q A;  4CY6 A;  6GSW A;  4LA1 A;  1EOG A;  4J2F A;  2YPM A;  1QFN A;  5JWO B;  2LUS A;  2R6K A;  3MAK A;  3D5J A;  4PTS A;  3UL3 A;  3A5I A;  1K0C A;  1GTB A;  3D6I A;  4HZ2 A;  2R2J A;  1YEX A;  1R26 A;  2DBC A;  1M2B A;  4L0U A;  1ML6 A;  3FHK A;  2B5E A;  1SJI A;  2WW2 A;  1FB6 A;  3GL5 A;  1G0T A;  18GS A;  1USB A;  3IR4 A;  2VCZ A;  1F3A A;  3RBT A;  3ZL5 A;  2E2G A;  4ZB7 A;  1N2A A;  3F4R A;  2WS2 A;  4MJC A;  4HS1 A;  1SYR A;  2BJX A;  4PXO A;  1XWK A;  2L4Q A;  3H93 A;  3KMN A;  3O3T A;  4OCE A;  5B8A A;  3UAP A;  5A4V A;  2YV9 A;  4KDY A;  3IOS A;  3TU3 B;  9GSS A;  1S3R A;  1JLW A;  2HLS A;  1XW9 A;  4IGJ A;  1QQ2 A;  3I6A A;  1FVK A;  2X4A A;  3WGX A;  1PGT A;  1XPV A;  3FW2 A;  3HVS A;  1ZMA A;  1WMJ A;  17GS A;  2IPA A;  2GT6 A;  1TDI A;  1EV4 A;  2CZ2 A;  3GUR A;  1GLP A;  2RLI A;  16GS A;  2ON5 A;  1KBN A;  4HUA A;  4YKF A;  1TRV A;  2NDO A;  3HZ4 A;  2TIR A;  4J57 E;  4CHS A;  4G9H A;  2QKE A;  1G6W A;  2PER A;  4AKI A;  3BCK A;  2GT5 A;  4XTS A;  2H76 A;  2VOC A;  3L9S A;  3MYD A;  2REM A;  1SL1 B;  2C0F A;  3RDW A;  3KMO A;  4N0V A;  3ZIJ A;  4GSN A;  2H70 A;  1K3Y A;  3EU4 A;  3HA9 A;  4KSM A;  2PGT A;  3TOT A;  3O76 A;  2R37 A;  2RM5 A;  4GXZ A;  4ECI A;  2BMX A;  1MDJ A;  4IQA A;  4FO5 A;  1A2L A;  1E6B A;  4WF5 A;  2GDR A;  4PUR A;  4OD7 A;  4QQ7 A;  5F0G A;  4JU5 A;  3L0H A;  2VCT A;  4K6X A;  1TRS A;  3GKM A;  4MP4 A;  3FR3 A;  5D9T A;  1E2Y A;  1N25 A;  4JBB A;  1GNE A;  1JZD A;  1DE2 A;  1M2D A;  1TRW A;  4HU7 A;  1URM A;  3HYP A;  4YAP A;  1ILO A;  4NXI A;  4YKG A;  1EP8 A;  3A2W A;  5EVO A;  1TJD A;  3UAR A;  2MMO A;  5IMD A;  2HE3 A;  3CBU A;  3W6G A;  4TR0 A;  3TJJ A;  4K5R A;  1A8Y A;  3DYR A;  3DVX A;  1OKD A;  3ERW A;  3C8E A;  2LQO A;  5GST A;  4AJ8 A;  1GWC A;  2H0I A;  1WE0 A;  2MYG A;  1A2J A;  1THX A;  2FWE A;  5H5R A;  2GSS A;  4Q5F A;  4IP1 A;  2HI7 A;  1TK5 B;  1NM3 A;  2LEG A;  1GNW A;  3M9J A;  4WEY A;  4DSR A;  2IIY A;  2I4A A;  3F63 A;  1AC1 A;  5ABR A;  5JWQ B;  4QMK A;  4IBP A;  1O7U A;  3UJ1 A;  2HRA A;  1FVJ A;  1BED A;  2Z9S A;  5CRW A;  5GZZ B;  3VK9 A;  2FY6 A;  3TKS C;  4WF4 A;  2HFD A;  1ERT A;  1I5G A;  3KD0 A;  1PX6 A;  3CHX C;  2TRX A;  5J9B A;  4BL7 A;  2H0G A;  3TKS A;  4JZQ A;  2VM2 A;  3VWU A;  1JFU A;  4IHU A;  2H6Y A;  4BVY B;  2HRK A;  2DKH A;  5IMF A;  1G7O A;  4K0N A;  4IEL A;  3PIN A;  5HFG A;  4MZC A;  5ECM B;  5KN2 A;  4MF6 A;  5G1L A;  4OFT A;  3LW9 A;  3HHV A;  1XWA A;  5COH A;  2LQQ A;  5IM9 A;  2V2G A;  3ERF A;  1ERU A;  3FYG A;  3TJK A;  2XPD A;  1BX9 A;  4POM A;  1GP1 A;  3R3E A;  5IPG A;  4EXJ A;  5DBQ A;  5DQS A;  3UVH A;  1XW5 A;  4G0I A;  1OC9 B;  3GX0 A;  5DAK A;  4QL9 A;  2DJK A;  2YNX A;  4JE1 A;  1TI3 A;  1FG4 A;  3ERG A;  1X5C A;  3KGK A;  3CSJ A;  6GSU A;  2CZ3 A;  4JRR A;  5EL8 A;  4DSS B;  4EE0 A;  2A2P A;  2GZY A;  2X49 A;  4EVM A;  1G7E A;  2G0F A;  4EDY A;  3QAG A;  5IQY A;  2IJY A;  1GTA A;  3F6D A;  3KM6 A;  2EFD A;  3M3M A;  4F2I A;  4ZBB A;  1TI1 A;  3DWV A;  4LL1 B;  1O85 A;  1SJ6 A;  2DJ1 A;  6GSV A;  1J08 A;  4LL4 B;  1GSS A;  3FZ5 A;  4BVY A;  2R4V A;  4YQU A;  1H75 A;  2IMI A;  2O3E A;  3BJ5 A;  1V58 A;  1A0R P;  3IC8 A;  4QL7 A;  4HDE A;  4F9Z A;  1IYI A;  1WIK A;  3GA4 A;  4HQS A;  1S3C A;  2VL3 A;  4IP6 A;  1WJK A;  4Q5N A;  3BD2 A;  2JSZ A;  3L9V A;  2M72 A;  3TKR A;  3F0I A;  4V2L A;  3DVW A;  2AAW A;  3LJR A;  2H74 A;  4N11 A;  5F8B A;  4N30 A;  1SL0 B;  1T4Y A;  3TKQ A;  3NOF A;  2PU9 C;  2QGV A;  1YVL A;  2WVY A;  1PX7 A;  4Q5Q A;  4H86 A;  3LWA A;  2WZS A;  3QR6 A;  5HR2 A;  5IMV A;  1FW1 A;  4ZBA A;  5HR1 A;  1ON4 A;  2A2S A;  1JHB A;  1WOU A;  3D0Z A;  4YQM A;  4K9Z A;  4POK A;  5LNK e;  4IJ3 A;  3VI5 A;  5LCZ A;  1R4W A;  3OR5 A;  5CAX A;  1PD2 1;  4V1A p;  1ZYP A;  2A2R A;  1EOH A;  2M80 A;  4TVE A;  1UVZ A;  3FK8 A;  4FH8 A;  3EPT A;  3C71 A;  2GZP A;  3IK9 A;  2GSQ A;  5D73 A;  2LRN A;  3UIW A;  4HEA 2;  3HMJ G;  4DSQ A;  2FHE A;  2CQ9 A;  2LNS A;  4O92 A;  2LNT A;  3MSZ A;  1M99 A;  1O81 A;  5F06 A;  2IMF A;  5DQY A;  4MJA A;  5KN0 A;  1GLQ A;  4ISD A;  1MDK A;  3C1R A;  1LU4 A;  1OE8 A;  5ECP B;  2VLV A;  5F07 A;  2N5A A;  3L9U A;  1BAY A;  2FCH A;  1EZK A;  4ZIJ A;  4TR1 B;  1CQH A;  4ZXG A;  4KH7 A;  2XC2 A;  1PN9 A;  3C73 A;  1OAZ A;  2C3N A;  2CVD A;  2GZZ A;  4PX1 A;  4L0W A;  1EV9 A;  3UBK A;  3F8U A;  4XRD A;  1JZR A;  3DGQ A;  2B6M A;  4X0X A;  2P5R A;  5J9C A;  1T7P B;  4DEJ A;  1VGL A;  2V32 A;  4NAX A;  4E68 A;  5KN1 A;  2CV4 A;  3APQ A;  1T4Z A;  3PGT A;  1W4V A;  5EPF A;  4MJB A;  3U5R E;  3BCI A;  3WGE A;  4KCA A;  4Z2T A;  2P0G A;  3VPQ A;  4I2U A;  2WW1 A;  4MPG A;  6GSS A;  4EUY A;  5JCW A;  5GAP D;  4LLR A;  4XS4 B;  1K3O A;  4HI7 A;  4G0L A;  4IS0 A;  2YJ7 A;  3APO A;  3F9U A;  3US3 A;  4TR3 A;  3TDG A;  1SVO A;  5ECR B;  3O6T A;  1S3D A;  2C3T A;  2FA4 A;  3FEU A;  4CY8 A;  1KNG A;  2OA7 A;  3CSI A;  2GS3 A;  4KCE A;  3ZRE A;  1Z3E A;  4GWR A;  2UV8 G;  1RQM A;  1QGV A;  5IO0 A;  2HSY A;  4EF0 A;  1TRU A;  2AJQ B;  1GUK A;  4ZL8 A;  2FWH A;  1WRY A;  1FHE A;  1MTC A;  4KE3 A;  3I43 A;  2MBT A;  1ZYQ B;  2MMZ A;  1HNA A;  3CYN A;  2HNL A;  4GQC A;  5A4U A;  2EIR A;  2I81 A;  1EEJ A;  1V2A A;  3DKS A;  3GSS A;  4K8M A;  5AIX A;  2PN8 A;  4F0C A;  4WBR D;  4X1U A;  1PKZ A;  2ON7 A;  4XRA A;  5AN1 A;  4FQU A;  1ERV A;  2CVK A;  1R7H A;  5G31 A;  2GQL A;  1JLV A;  5IMA A;  2R0G A;  2LKU A;  4AKX B;  4ILF A;  2RM6 A;  3F3Q A;  4XS4 A;  1SKS B;  2ES7 A;  2YAN A;  3L4N A;  1HNC A;  5CP1 A;  2KLX A;  3IAM 2;  2B1K A;  1A8L A;  3IRA A;  2K18 A;  4XCS A;  1XW6 A;  4AF2 A;  3UEM A;  1O6J A;  4F03 A;  2H1B A;  3QFB C;  5F05 A;  2I3Y A;  4IJI A;  2WZ9 A;  4NPB A;  4NMU A;  1Z6N A;  4HU9 A;  2DIZ A;  1K0A A;  2O89 A;  4PUF C;  2KUC A;  5JWR B;  1PQN A;  5J4Y A;  4IQ1 A;  3LEF A;  5L71 A;  3E3E A;  4GCI A;  3H79 A;  2TRC P;  3GRX A;  4FXY P;  4FIW A;  4P3Y B;  1BQ7 A;  2VKZ G;  4TN8 A;  5ECL B;  2VL9 A;  5IMZ A;  1RW1 A;  5H5S A;  3ZLP A;  1PKW A;  2CVB A;  2L5L A;  2H75 A;  3LYK A;  3CQF A;  3ZMK A;  2NPB A;  3HJP A;  3LG6 A;  2YN1 A;  5A1N B;  2X8C A;  2VCW A;  2WGR A;  1XWC A;  2JZT A;  1CQG A;  3GKK A;  1SVM A;  1K0D A;  2C0D A;  5DJL A;  1OC3 A;  5FHI A;  4NV2 A;  3ZVJ A;  4G01 A;  4MNN A;  1UN2 A;  5E59 A;  2VO4 A;  2WVZ A;  3TRP A;  2YWO A;  3BOA A;  1M7T A;  3IXR A;  3FRC A;  3L78 A;  4X4J A;  1Z9H A;  4MF7 A;  3NZN A;  5J41 A;  5HFI A;  3E0U A;  4BA7 A;  20GS A;  1GSF A;  2C4J A;  3FZA A;  3J7Y k;  3IC4 A;  2VIM A;  4MA9 A;  4MPF A;  1TK0 B;  1AIU A;  4V2N A;  2FNO A;  3HJO A;  4USS A;  1OKT A;  4OWY A;  4MZW A;  2H66 A;  3TB2 A;  3ED3 A;  1VF3 A;  2N5B A;  4BL7 B;  2NTO A;  3WYW A;  2JU5 A;  5G1K A;  1UA5 A;  2F8F A;  2DC5 A;  2CAI A;  1S4B P;  3GNJ A;  4BVX B;  2L6D A;  3N9J A;  2LV3 A;  2HRK B;  2AB6 A;  1GUM A;  4E8H A;  4PI0 C;  3DXB A;  4WXT A;  1XWG A;  1GSQ A;  5A1N A;  1XCC A;  5DJM A;  4TW5 A;  2J23 A;  2LRT A;  3G7I A;  4L5O A;  1QMV A;  2PPT A;  1YZX A;  3HVX A;  2JSY A;  5H5Q A;  2XPE A;  2H1L A;  1B8X A;  4RQR A;  2LJK A;  3GST A;  1ZCP A;  1XBS A;  2OE0 A;  5DAK B;  4TXO A;  4O5U A;  3HJM A;  2H1G A;  2IFQ B;  3CRU A;  2O5V A;  2L4C A;  4OFM A;  1B4Q A;  2EFH A;  5J4U A;  4KND A;  3W8S A;  1H4O A;  4YH2 A;  2C80 A;  3EU3 A;  1GSY A;  12GS A;  2RUF A;  1Z7R A;  4ACS A;  2GLR A;  2HSN B;  3QD9 A;  2FWG A;  1ZL9 A;  2H19 A;  4MH2 A;  4TR4 A;  2X64 A;  2DJ0 A;  2VLU A;  1HYU A;  3VUR A;  3TUE A;  6GST A;  5B8B A;  1EEM A;  3GMF A;  1SVL A;  2WFC A;  4BVX A;  4YQV A;  1SKW B;  1GTI A;  2LJA A;  3EIN A;  1M3I A;  4IW9 A;  5GSS A;  1YKC A;  2WVX A;  4KGI A; 
#chains in the Genus database with same CATH homology
 5BMU B;  3GIX A;  1MD3 A;  1SD9 A;  3J7Y b;  2LRC A;  3D4T A;  2J9H A;  2JL4 A;  1EWX A;  2LS5 A;  4I6X A;  3HKR A;  3NIV A;  3EC3 A;  3UBL A;  3C7M A;  2OT3 A;  1B4P A;  2MBS A;  3VWW A;  1VRS D;  1OC8 A;  2IFQ A;  5G5E A;  4PNF A;  2EIQ A;  2QA1 A;  3CTG A;  2MMN A;  1SKR B;  2IN3 A;  1WWJ A;  5ECN B;  1T3B A;  5D96 A;  3RPN A;  3F3R A;  3ZML A;  1QK8 A;  4PNG A;  4TKY A;  3TRQ A;  1OVN A;  2HSN A;  3VI7 A;  2DMM A;  2FLS A;  1OYJ A;  4IKH A;  2LST A;  1SK0 A;  1YY7 A;  2C0E A;  4MMM A;  4XIH A;  2HZE A;  3CMI A;  4NWY A;  1J9B A;  3GH9 A;  1U6T A;  5AGY A;  1K0B A;  3KH9 A;  2YWN A;  4KW6 A;  4O5R A;  4MDC A;  4EC0 A;  3LOR A;  4O7H A;  4Z2R A;  4AKG A;  10GS A;  2VCQ A;  4JR6 A;  5KOW A;  1Z6M A;  3UMA A;  1GUL A;  4W66 A;  3IBH A;  3D4M A;  4WKW A;  2CAQ A;  4F82 A;  1AW9 A;  5ELA A;  5BMU A;  3ZTL A;  3GFK A;  3VWV A;  4MZB A;  2R0P A;  3HVV A;  3APS A;  5HQP A;  1XFL A;  2DKI A;  2QA2 A;  3M8N A;  1O8X A;  1GSE A;  4KAE A;  2HYX A;  2DJ2 A;  2NBS A;  3SBC A;  4TRX A;  1YEP A;  3N5O A;  4PUA A;  1O73 A;  4JED A;  6GSY A;  3EWL A;  3Q6O A;  3DIE A;  2GQK A;  2IWT A;  3KIJ A;  2H01 A;  5A5H B;  4HZ4 A;  2DJ3 A;  4GF0 A;  2EIO A;  2YCD A;  7GSS A;  3GH6 A;  1KEB A;  3KJY A;  2B5Y A;  4XHM A;  1TXX A;  1XVQ A;  1AQX A;  4MLY A;  1I9D A;  4RI6 A;  1TXU A;  1GRX A;  4MF5 A;  2ZCT A;  4O5Q A;  4KB3 A;  2JAD A;  3V1W A;  2FWF A;  2RII A;  3CWG A;  2H30 A;  1G6Y A;  4I5Q A;  3VWX A;  2I9H A;  5IPH A;  1BG1 A;  5IO2 A;  3F4T A;  4IN0 A;  1XXU A;  5ECQ B;  2X99 A;  2K9F A;  1WP0 A;  2O8V B;  3GL3 A;  3K8N A;  5ECK B;  1TP9 A;  2ALB A;  4ECC A;  4EDZ A;  4MJE A;  5J40 A;  2E0Q A;  4TXV A;  1SK1 A;  3HD5 A;  1A0F A;  1YF1 A;  2O85 A;  5A5H A;  5INY A;  3M1G A;  1SJZ A;  2V1M A;  3F6F A;  2X8H A;  4EL1 A;  3WT2 A;  1FB0 A;  5DCG A;  3IPZ A;  2F9S A;  1V9W A;  2KHP A;  3G7Y A;  1EGO A;  1V98 A;  4GSS A;  3P7X A;  4MCU A;  4RQX A;  1MD4 A;  1S3A A;  1K3L A;  2A4H A;  2B5X A;  1X9M B;  1NW2 A;  2PMT A;  3GTU A;  1Q98 A;  2FGX A;  2HXK A;  1BF5 A;  2PVQ A;  3IV4 A;  1TU8 A;  5ECS A;  4N0Z A;  3GYK A;  1DE1 A;  4Z2U A;  3IAS 2;  1VF1 A;  4LMW A;  5B6M A;  1JZO A;  3CSH A;  3E9J B;  1SL2 B;  3CRT A;  3LQ7 A;  1SEN A;  2DSA A;  1YF0 A;  3GKX A;  1YQ1 A;  4KDU A;  3EMX A;  4CDO A;  4L8E A;  1VF2 A;  4AGS A;  2XBQ A;  2R0C A;  4K0G A;  1AUC A;  2GQM A;  1A2M A;  2V6O A;  3ISO A;  2X8G A;  5DAL B;  4G10 A;  5DVB A;  3EMP A;  4ZB6 A;  2IL3 A;  1M0U A;  2C3Q A;  4K2D A;  2OBK A;  3I69 A;  3HCZ A;  1AXD A;  2B3S A;  4FYC A;  4OMV A;  4XS1 A;  4IVF A;  4POL A;  5G5F A;  2HSH A;  1FOV A;  2H0H A;  5HFK A;  1AQW A;  3CTF A;  1BYE A;  5EY6 A;  2B7K A;  2O87 A;  1Y25 A;  2IMD A;  2DIY A;  2K8S A;  3SWL A;  3TJB A;  1TU7 A;  2K8V A;  4HJ2 A;  1RK4 A;  5CRD A;  4AJ6 A;  4ZL9 A;  4L5L A;  1B9X C;  2MMA A;  1Y6E A;  4KX4 A;  3RPP A;  3ZRD A;  5ECI B;  2VL2 A;  2JZS A;  3H1N A;  4I8B A;  1X9W B;  3WD6 A;  1O8W A;  3QPM A;  4AJ7 A;  3EVI A;  2P5Q A;  1YJ6 A;  2AUV A;  5D9W A;  1XOA A;  1PL1 A;  3A3T A;  2IME A;  2VM1 A;  2YZU A;  5HR0 A;  4PGT A;  5KOX A;  5DAL A;  2KOK A;  3IHG A;  4EKZ A;  1QUW A;  3D21 A;  1VF4 A;  1UC7 A;  1T1V A;  2I1U A;  1R5P A;  1ZOF A;  1U3A A;  2YOI A;  1B9Y C;  1TW9 A;  2YV7 A;  2CX3 A;  3FKF A;  1M9B A;  3EUR A;  22GS A;  4K2X A;  4KUN A;  4LMV A;  3LXT A;  1ST9 A;  2YZH A;  1W89 A;  4BWS A;  1WPI A;  1NHO A;  4X43 A;  4POB A;  1PN0 A;  3VLN A;  1DBY A;  4OO4 A;  3IHQ A;  5CRG A;  4DVC A;  1BG5 A;  1K0N A;  1TKD B;  3PPU A;  5ECO B;  5HR3 A;  3IE3 A;  5ELG A;  4MH3 A;  4KSO A;  4Z7X A;  1GUH A;  1GSD A;  3I9V 2;  1T8E B;  1Y1U A;  4O32 A;  3F4S A;  3MWH A;  1ZZY A;  2HSM B;  1GH2 A;  3ZFL A;  5CRH A;  3RAZ A;  2DML A;  4PQH A;  2CX4 A;  4JR4 A;  3Q18 A;  4V2M A;  2DJJ A;  3TRX A;  2WUL A;  5G2Z A;  3ME8 A;  2KP2 A;  4ZBD A;  2BTO T;  3ZIT A;  5A5K A;  4NV5 A;  1SK2 A;  2GGT A;  1SD8 A;  1F6M C;  2QC7 A;  2VLT A;  1B48 A;  4I2T A;  2VCX A;  2XBI A;  3KTB A;  2C0G A;  2EC4 A;  2F51 A;  2LJR A;  3DRN A;  5ECH B;  4TXO B;  2F8A A;  2A4V A;  19GS A;  3VPT A;  3FZ9 A;  4OO5 A;  2HT9 A;  6GSX A;  2F3M A;  1X9S B;  3GX8 A;  4E8E A;  4I97 A;  1NHY A;  4A5P A;  1GTU A;  1ZYN A;  5KN3 A;  4G2E A;  3HDC A;  2GST A;  4K7N A;  4RUV A;  2QSI A;  2YP6 A;  4RI7 A;  1HNB A;  2E2M A;  4ICY A;  2WB9 A;  1DSB A;  3ZZX A;  2ZNM A;  3TGZ A;  2VD1 A;  5D9X A;  3LFL A;  1V57 A;  1F37 A;  2HSM A;  3EE2 A;  3PR8 A;  1FOH A;  4NHZ A;  4EIP A;  4GDF A;  2GTU A;  1DUG A;  3FZ4 A;  4J56 E;  3W8J A;  2K6V A;  5ID2 B;  1AQV A;  1T00 A;  3S9F A;  2O7K A;  4GLT A;  3FR6 A;  1A23 A;  2E7P A;  1ERW A;  5IIZ A;  1ZGN A;  2XHF A;  3M0F A;  3KCM A;  3MIX A;  5J47 A;  2VAF A;  3QDN A;  2WJU A;  1F3B A;  1TTZ A;  3IA1 A;  1X0R A;  1TK8 B;  1M9A A;  4D73 B;  2OAD A;  1PRX A;  3DEX A;  3DML A;  4BWQ A;  2GVP A;  5CNW A;  5A34 B;  5B6N A;  2UZ8 A;  3QCP A;  2H72 A;  4N10 A;  11GS A;  3LXZ A;  3C1S A;  5J5N A;  1U88 A;  3GN3 A;  3EYT A;  2HZE B;  1N8J A;  2VD0 A;  1R5A A;  5BRT A;  1EP7 A;  2OAC A;  4F0B A;  2H71 A;  13GS A;  3KP8 A;  3UOM A;  3QFA C;  3WGD A;  4OFN A;  2R5G A;  4WET A;  5ID2 A;  3H8Q A;  2P31 A;  3GV1 A;  1X5E A;  3AY8 A;  3RHC A;  2HZF A;  3LSZ A;  3GUS A;  1GSU A;  3Q19 A;  5A4W A;  4MAB A;  3A2X A;  4K5S A;  2WCI A;  2GSR A;  5KEJ A;  1FAA A;  4YAV A;  4D73 A;  3KP9 A;  2FD3 A;  3TCO A;  3QAV A;  5A34 A;  3FY7 A;  1IYH A;  4ECB A;  2H6Z A;  4WBJ A;  4GTU A;  3ME7 A;  4NHW A;  4N3Z A;  2AYT A;  2PUK C;  3CXG A;  2AV4 A;  3KZQ A;  3ZYW A;  3LGC A;  2H73 A;  1PA3 A;  5J3R A;  2JZR A;  2OJL A;  2KP1 A;  1OE7 A;  2VCV A;  4FYB A;  2H6X A;  5GAN D;  3HZ8 A;  2CA8 A;  3KXO A;  1M2A A;  4ZL7 A;  3A5W A;  5LD0 A;  2YWM A;  2DLX A;  4ZIL A;  2M46 A;  2L6C A;  2N5F A;  5CRE A;  2HQT A;  3HXS A;  3P90 A;  5E4W A;  2HRF A;  4CW9 A;  2ZUP A;  2IMK A;  5IMC A;  5C00 A;  3ZVJ D;  4ID0 A;  4KDX A;  3Q74 A;  2OE1 A;  1BJX A;  4FYU A;  1GL8 A;  5DCH A;  4WR4 A;  5FWG A;  4G0K A;  1ZYE A;  3G7J A;  3P8W A;  2PVO C;  4BPY A;  4XS6 A;  3ZFB A;  1SU9 A;  4KF9 A;  2L5O A;  1K0M A;  3QAW A;  4ZB8 A;  4HQZ A;  1V40 A;  3UVT A;  1OC9 A;  2OE3 A;  4AI6 A;  2RUE A;  2JAC A;  1F2E A;  2EFE A;  2R3X A;  3GTU B;  3MNG A;  2B7J A;  5B7C A;  1XZO A;  3ZIV A;  3VFI A;  3DD3 A;  1Z7P A;  1X5D A;  3WT1 A;  4DSS A;  1LJR A;  5J4V A;  2YWI A;  3QMX A;  2HRN A;  4KA0 A;  2OBI A;  4ML6 A;  2H1D A;  1XVW A;  1EGR A;  2B1L A;  5JCU A;  5IOX A;  4HOJ A;  4V1A g;  2OKA A;  2C8U A;  2FUG 2;  4PQ1 A;  1MDI A;  2V41 A;  5DDL A;  1ACV A;  4OCF A;  2AHE A;  4EO3 A;  1ABA A;  2PWJ A;  3HY2 A;  1XWB A;  5D8I A;  1NSW A;  1A24 A;  1TOF A;  5FT3 A;  1Q4J A;  14GS A;  1SYX A;  2PBJ A;  4ULX A;  2H1A A;  1AAZ A;  3M9K A;  3JCM L;  3IDV A;  4ZB9 A;  3RHB A;  2MZC A;  3TJF A;  4MK3 A;  2YJH A;  1QXH A;  3PH9 A;  4WR5 A;  5CYY A;  1KTE A;  1JZW A;  4GST A;  1XIY A;  3D22 A;  3U6V A;  3P2A A;  1PSQ A;  1U87 A;  3KTL A;  5D9V A;  1YKA A;  2VUP A;  5JCG A;  1LBK A;  3BBY A;  3LYP A;  3A2V A;  3TKS E;  4Q5R A;  4ML1 A;  1HD2 A;  1THO A;  4K7I A;  1U3I A;  2D2Z A;  2L59 A;  1F9M A;  4EIQ A;  4ECJ A;  1PL2 A;  2LTK A;  2WDU A;  3MDK A;  1HQO A;  3QOU A;  2CT6 A;  5AIS A;  4GRF A;  3IK7 A;  2WRT A;  4AKH A;  5C04 A;  5AIV A;  1Z5Y E;  5IOW A;  3GKN A;  4G19 A;  2V6K A;  4PQI A;  5ENU A;  3TJG A;  1C72 A;  1YDK A;  3TOU A;  1J0F A;  1K0O A;  3H4K A;  3FMW A;  3KEB A;  3KH7 A;  5D93 A;  3TKP A;  4K7O A;  3GHA A;  2EFC A;  2FA8 A;  2VL2 C;  4HJM A;  5G30 A;  5CO3 A;  4GQF A;  1XOB A;  3G9B A;  2NVL A;  1MEK A;  2C1Y A;  1FO5 A;  8GSS A;  1PMT A;  2L57 A;  4TOP A;  3FR9 A;  2G2Q A;  4K1F A;  2H8L A;  4TR1 A;  3R2Q A;  4CY6 A;  6GSW A;  4LA1 A;  1EOG A;  4J2F A;  2YPM A;  1QFN A;  5JWO B;  2LUS A;  2R6K A;  3MAK A;  3D5J A;  4PTS A;  3UL3 A;  3A5I A;  1K0C A;  1GTB A;  3D6I A;  4HZ2 A;  2R2J A;  1YEX A;  1R26 A;  2DBC A;  1M2B A;  4L0U A;  1ML6 A;  3FHK A;  2B5E A;  1SJI A;  1FB6 A;  3GL5 A;  1G0T A;  18GS A;  1USB A;  3IR4 A;  2VCZ A;  1F3A A;  3RBT A;  3ZL5 A;  2E2G A;  4ZB7 A;  1N2A A;  3F4R A;  2WS2 A;  4MJC A;  4HS1 A;  1SYR A;  2BJX A;  4PXO A;  1XWK A;  2L4Q A;  3H93 A;  3KMN A;  3O3T A;  4OCE A;  5B8A A;  3UAP A;  5A4V A;  2YV9 A;  4KDY A;  3IOS A;  3TU3 B;  9GSS A;  1JLW A;  2HLS A;  1XW9 A;  4IGJ A;  1QQ2 A;  3I6A A;  1FVK A;  2X4A A;  3WGX A;  1PGT A;  1XPV A;  3FW2 A;  3HVS A;  1ZMA A;  1WMJ A;  17GS A;  2IPA A;  2GT6 A;  1TDI A;  1EV4 A;  2CZ2 A;  3GUR A;  1GLP A;  2RLI A;  16GS A;  2ON5 A;  1KBN A;  4HUA A;  4YKF A;  1TRV A;  2NDO A;  3HZ4 A;  2TIR A;  4J57 E;  4CHS A;  4G9H A;  2QKE A;  1G6W A;  2PER A;  4AKI A;  3BCK A;  2GT5 A;  4XTS A;  2H76 A;  2VOC A;  3L9S A;  3MYD A;  2REM A;  1SL1 B;  2C0F A;  3RDW A;  3KMO A;  4N0V A;  3ZIJ A;  4GSN A;  2H70 A;  1K3Y A;  3EU4 A;  3HA9 A;  4KSM A;  2PGT A;  3TOT A;  3O76 A;  2R37 A;  2RM5 A;  4GXZ A;  4ECI A;  2BMX A;  1MDJ A;  4IQA A;  4FO5 A;  1A2L A;  1E6B A;  4WF5 A;  2GDR A;  4PUR A;  4OD7 A;  4QQ7 A;  5F0G A;  4JU5 A;  3L0H A;  2VCT A;  4K6X A;  1TRS A;  3GKM A;  4MP4 A;  3FR3 A;  5D9T A;  1E2Y A;  1N25 A;  4JBB A;  1GNE A;  1JZD A;  1DE2 A;  1M2D A;  1TRW A;  4HU7 A;  1URM A;  3HYP A;  4YAP A;  1ILO A;  4NXI A;  4YKG A;  1EP8 A;  3A2W A;  5EVO A;  1TJD A;  3UAR A;  2MMO A;  5IMD A;  2HE3 A;  3CBU A;  3W6G A;  4TR0 A;  3TJJ A;  4K5R A;  1A8Y A;  3DYR A;  3DVX A;  1OKD A;  3ERW A;  3C8E A;  2LQO A;  5GST A;  4AJ8 A;  1GWC A;  2H0I A;  1WE0 A;  2MYG A;  1A2J A;  1THX A;  2FWE A;  5H5R A;  2GSS A;  4Q5F A;  4IP1 A;  2HI7 A;  1TK5 B;  1NM3 A;  2LEG A;  1GNW A;  3M9J A;  4WEY A;  4DSR A;  2IIY A;  2I4A A;  3F63 A;  1AC1 A;  5ABR A;  5JWQ B;  4QMK A;  4IBP A;  1O7U A;  3UJ1 A;  2HRA A;  1FVJ A;  1BED A;  2Z9S A;  5CRW A;  5GZZ B;  3VK9 A;  2FY6 A;  3TKS C;  4WF4 A;  2HFD A;  1ERT A;  1I5G A;  3KD0 A;  1PX6 A;  2TRX A;  5J9B A;  4BL7 A;  2H0G A;  3TKS A;  4JZQ A;  2VM2 A;  3VWU A;  1JFU A;  4IHU A;  2H6Y A;  4BVY B;  2HRK A;  2DKH A;  5IMF A;  1G7O A;  4K0N A;  4IEL A;  3PIN A;  5HFG A;  4MZC A;  5ECM B;  5KN2 A;  4MF6 A;  5G1L A;  4OFT A;  3LW9 A;  3HHV A;  1XWA A;  5COH A;  2LQQ A;  5IM9 A;  2V2G A;  3ERF A;  1ERU A;  3FYG A;  3TJK A;  2XPD A;  1BX9 A;  4POM A;  1GP1 A;  3R3E A;  5IPG A;  4EXJ A;  5DBQ A;  5DQS A;  3UVH A;  1XW5 A;  4G0I A;  1OC9 B;  3GX0 A;  5DAK A;  4QL9 A;  2DJK A;  2YNX A;  4JE1 A;  1TI3 A;  1FG4 A;  3ERG A;  1X5C A;  3KGK A;  3CSJ A;  6GSU A;  2CZ3 A;  4JRR A;  5EL8 A;  4DSS B;  4EE0 A;  2A2P A;  2GZY A;  2X49 A;  4EVM A;  1G7E A;  2G0F A;  4EDY A;  3QAG A;  5IQY A;  2IJY A;  1GTA A;  3F6D A;  3KM6 A;  2EFD A;  3M3M A;  4F2I A;  4ZBB A;  1TI1 A;  3DWV A;  4LL1 B;  1O85 A;  1SJ6 A;  2DJ1 A;  6GSV A;  1J08 A;  4LL4 B;  1GSS A;  3FZ5 A;  4BVY A;  2R4V A;  4YQU A;  1H75 A;  2IMI A;  3BJ5 A;  1V58 A;  1A0R P;  3IC8 A;  4QL7 A;  4HDE A;  4F9Z A;  1IYI A;  1WIK A;  3GA4 A;  4HQS A;  1S3C A;  2VL3 A;  4IP6 A;  1WJK A;  4Q5N A;  3BD2 A;  2JSZ A;  3L9V A;  2M72 A;  3TKR A;  3F0I A;  4V2L A;  3DVW A;  2AAW A;  3LJR A;  2H74 A;  4N11 A;  5F8B A;  4N30 A;  1SL0 B;  1T4Y A;  3TKQ A;  3NOF A;  2PU9 C;  2QGV A;  1YVL A;  1PX7 A;  4Q5Q A;  4H86 A;  3LWA A;  3QR6 A;  5HR2 A;  5IMV A;  1FW1 A;  4ZBA A;  5HR1 A;  1ON4 A;  2A2S A;  1JHB A;  1WOU A;  3D0Z A;  4YQM A;  4K9Z A;  4POK A;  5LNK e;  4IJ3 A;  3VI5 A;  5LCZ A;  1R4W A;  3OR5 A;  5CAX A;  1PD2 1;  4V1A p;  1ZYP A;  2A2R A;  1EOH A;  2M80 A;  4TVE A;  1UVZ A;  3FK8 A;  4FH8 A;  3EPT A;  3C71 A;  2GZP A;  3IK9 A;  2GSQ A;  5D73 A;  2LRN A;  3UIW A;  4HEA 2;  3HMJ G;  4DSQ A;  2FHE A;  2CQ9 A;  2LNS A;  4O92 A;  2LNT A;  3MSZ A;  1M99 A;  1O81 A;  5F06 A;  2IMF A;  5DQY A;  4MJA A;  5KN0 A;  1GLQ A;  4ISD A;  1MDK A;  3C1R A;  1LU4 A;  1OE8 A;  5ECP B;  2VLV A;  5F07 A;  2N5A A;  3L9U A;  1BAY A;  2FCH A;  1EZK A;  4ZIJ A;  4TR1 B;  1CQH A;  4ZXG A;  4KH7 A;  2XC2 A;  1PN9 A;  3C73 A;  1OAZ A;  2C3N A;  2CVD A;  2GZZ A;  4PX1 A;  4L0W A;  1EV9 A;  3UBK A;  3F8U A;  4XRD A;  1JZR A;  3DGQ A;  2B6M A;  4X0X A;  2P5R A;  5J9C A;  1T7P B;  4DEJ A;  1VGL A;  2V32 A;  4NAX A;  4E68 A;  5KN1 A;  2CV4 A;  3APQ A;  1T4Z A;  3PGT A;  1W4V A;  5EPF A;  4MJB A;  3U5R E;  3BCI A;  3WGE A;  4KCA A;  4Z2T A;  2P0G A;  3VPQ A;  4I2U A;  4MPG A;  6GSS A;  4EUY A;  5JCW A;  5GAP D;  4LLR A;  4XS4 B;  1K3O A;  4HI7 A;  4G0L A;  4IS0 A;  2YJ7 A;  3APO A;  3F9U A;  3US3 A;  4TR3 A;  3TDG A;  1SVO A;  5ECR B;  3O6T A;  1S3D A;  2C3T A;  2FA4 A;  3FEU A;  4CY8 A;  1KNG A;  2OA7 A;  3CSI A;  2GS3 A;  4KCE A;  3ZRE A;  1Z3E A;  4GWR A;  2UV8 G;  1RQM A;  1QGV A;  5IO0 A;  2HSY A;  4EF0 A;  1TRU A;  2AJQ B;  1GUK A;  4ZL8 A;  2FWH A;  1WRY A;  1FHE A;  1MTC A;  4KE3 A;  3I43 A;  2MBT A;  1ZYQ B;  2MMZ A;  1HNA A;  3CYN A;  2HNL A;  4GQC A;  5A4U A;  2EIR A;  2I81 A;  1EEJ A;  1V2A A;  3DKS A;  3GSS A;  4K8M A;  5AIX A;  2PN8 A;  4F0C A;  4WBR D;  4X1U A;  1PKZ A;  2ON7 A;  4XRA A;  5AN1 A;  4FQU A;  1ERV A;  2CVK A;  1R7H A;  5G31 A;  2GQL A;  1JLV A;  5IMA A;  2R0G A;  2LKU A;  4AKX B;  4ILF A;  2RM6 A;  3F3Q A;  4XS4 A;  1SKS B;  2ES7 A;  2YAN A;  3L4N A;  1HNC A;  5CP1 A;  2KLX A;  3IAM 2;  2B1K A;  1A8L A;  3IRA A;  2K18 A;  4XCS A;  1XW6 A;  4AF2 A;  3UEM A;  1O6J A;  4F03 A;  2H1B A;  3QFB C;  5F05 A;  2I3Y A;  4IJI A;  2WZ9 A;  4NPB A;  4NMU A;  1Z6N A;  4HU9 A;  2DIZ A;  1K0A A;  2O89 A;  4PUF C;  2KUC A;  5JWR B;  1PQN A;  5J4Y A;  4IQ1 A;  3LEF A;  5L71 A;  3E3E A;  4GCI A;  3H79 A;  2TRC P;  3GRX A;  4FIW A;  4P3Y B;  1BQ7 A;  2VKZ G;  4TN8 A;  5ECL B;  2VL9 A;  5IMZ A;  1RW1 A;  5H5S A;  3ZLP A;  1PKW A;  2CVB A;  2L5L A;  2H75 A;  3LYK A;  3ZMK A;  2NPB A;  3HJP A;  3LG6 A;  2YN1 A;  5A1N B;  2X8C A;  2VCW A;  2WGR A;  1XWC A;  2JZT A;  1CQG A;  3GKK A;  1SVM A;  1K0D A;  2C0D A;  5DJL A;  1OC3 A;  5FHI A;  4NV2 A;  3ZVJ A;  4G01 A;  4MNN A;  1UN2 A;  5E59 A;  2VO4 A;  3TRP A;  2YWO A;  3BOA A;  1M7T A;  3IXR A;  3FRC A;  3L78 A;  4X4J A;  1Z9H A;  4MF7 A;  3NZN A;  5J41 A;  5HFI A;  3E0U A;  4BA7 A;  20GS A;  1GSF A;  2C4J A;  3FZA A;  3J7Y k;  3IC4 A;  2VIM A;  4MA9 A;  4MPF A;  1TK0 B;  1AIU A;  4V2N A;  2FNO A;  3HJO A;  4USS A;  1OKT A;  4OWY A;  4MZW A;  2H66 A;  3TB2 A;  3ED3 A;  1VF3 A;  2N5B A;  4BL7 B;  2NTO A;  3WYW A;  2JU5 A;  5G1K A;  1UA5 A;  2F8F A;  2DC5 A;  2CAI A;  3GNJ A;  4BVX B;  2L6D A;  3N9J A;  2LV3 A;  2HRK B;  2AB6 A;  1GUM A;  4E8H A;  3DXB A;  4WXT A;  1XWG A;  1GSQ A;  5A1N A;  1XCC A;  5DJM A;  4TW5 A;  2J23 A;  2LRT A;  3G7I A;  4L5O A;  1QMV A;  2PPT A;  1YZX A;  3HVX A;  2JSY A;  5H5Q A;  2XPE A;  2H1L A;  1B8X A;  4RQR A;  2LJK A;  3GST A;  1ZCP A;  1XBS A;  2OE0 A;  5DAK B;  4TXO A;  4O5U A;  3HJM A;  2H1G A;  2IFQ B;  3CRU A;  2O5V A;  2L4C A;  4OFM A;  1B4Q A;  2EFH A;  5J4U A;  4KND A;  3W8S A;  1H4O A;  4YH2 A;  2C80 A;  3EU3 A;  1GSY A;  12GS A;  2RUF A;  1Z7R A;  4ACS A;  2GLR A;  2HSN B;  3QD9 A;  2FWG A;  1ZL9 A;  2H19 A;  4MH2 A;  4TR4 A;  2X64 A;  2DJ0 A;  2VLU A;  1HYU A;  3VUR A;  3TUE A;  6GST A;  5B8B A;  1EEM A;  3GMF A;  1SVL A;  2WFC A;  4BVX A;  4YQV A;  1SKW B;  1GTI A;  2LJA A;  3EIN A;  4IW9 A;  5GSS A;  1YKC A;  4KGI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...