2V6KA

Structure of maleyl pyruvate isomerase, a bacterial glutathione-s- transferase in zeta class, in complex with substrate analogue dicarboxyethyl glutathione
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
214
structure length
214
Chain Sequence
AKMKLYNFWRSGTSHRLRIALNLKGVPYEYLAVHLGKEEHLKDAFKALNPQQLVPALDTGAQVLIQSPAIIEWLEEQYPTPALLPADADGRQRVRALAAIVGCDIHPINNRRILEYLRKTFGADEAAINAWCGTWISAGFDAYEALLAVDPKRGRYSFGDTPTLADCYLVPQVESARRFQVDLTPYPLIRAVDAACGELDAFRRAAPAAQPDSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords MALEYLPYRUVATE ISOMERASE
publication title Structure of Bacterial Glutathione-S-Transferase Maleyl Pyruvate Isomerase and Implications for Mechanism of Isomerisation.
pubmed doi rcsb
source organism Ralstonia sp.
total genus 79
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 5.2.1.4: Maleylpyruvate isomerase.
pdb deposition date 2007-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2v6kA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2v6kA01
4PNGA 18GSA 3TDGA 4K8MA 5ECPB 3UVHA 4EF0A 2WFCA 1SKRB 2PBJA 4ISDA 3ZIJA 1EGOA 3FK8A 5LD0A 5GSTA 3A3TA 1PN9A 1T7PB 4QL9A 2YN1A 2XPDA 2OKAA 8GSSA 5B8AA 1U3IA 5L71A 5C04A 4OO5A 1FG4A 2P31A 4V1Ag 1AAZA 3PGTA 3IAS2 2L6DA 5G2ZA 4XS4B 2WB9A 1DBYA 5IO2A 5F8BA 1TXXA 2KUCA 1A2LA 4IKHA 1SJ6A 2KLXA 3RHBA 4LL4B 3H8QA 2FGXA 2WCIA 2I81A 2WS2A 2GGTA 2ZCTA 3VWWA 4Q5RA 3LXTA 4FYBA 4TRXA 2X99A 2JACA 1SENA 3A2XA 2I3YA 3IHQA 1QMVA 14GSA 1GTIA 4OWYA 3FZ5A 3HJPA 5ECQB 2P0GA 4EO3A 4G0IA 1ABAA 3LYPA 4QL7A 2VCVA 2LKUA 1G7EA 2EC4A 4HDEA 1X0RA 1T3BA 3FYGA 2H76A 2R4VA 4HOJA 1KEBA 2K8VA 2HSHA 3ZFBA 2H75A 5J5NA 1J9BA 3KZQA 5HR3A 2DJJA 2FD3A 5D9WA 2LNTA 1AUCA 3ED3A 4L5LA 3Q18A 3UIWA 1FVJA 4KW6A 3ZMKA 2NVLA 1PGTA 1MDKA 5H5SA 3F6DA 4LMWA 3GH6A 2K9FA 1JLVA 3ZFLA 1T8EB 2WJUA 1GSUA 2DIYA 3CSJA 2DMMA 4EXJA 2OBIA 4GWRA 2H30A 1SK1A 3PR8A 5AN1A 4ZL9A 1HQOA 1OE8A 3WT1A 4POMA 2VD1A 5ECMB 3LEFA 2H74A 4KCAA 5IOWA 2PGTA 4K7IA 2O89A 3WT2A 3TOTA 1K0DA 2RLIA 5A5KA 3H93A 1JZOA 1X9WB 1PL1A 3RBTA 5D73A 5F06A 2FLSA 3LORA 3LYKA 1EOGA 2L4QA 5KN3A 4MABA 1OE7A 2MMNA 5ECIB 2FCHA 1HNBA 4YQVA 5FT3A 1WRYA 2YANA 1TDIA 4BWQA 5ECSA 3TKPA 5LCZA 3W8SA 2GTUA 1A8YA 1UVZA 1JZWA 1A0FA 2I1UA 3DIEA 2KHPA 2RM6A 1K0MA 3FR3A 1UC7A 1XOAA 3KD0A 1ZMAA 2HI7A 2KP1A 4KGIA 3D4TA 3O6TA 4TVEA 4ECBA 1XIYA 3FR6A 2L5OA 5KN1A 2NPBA 1TK8B 1SK2A 4PXOA 4FQUA 3ZYWA 4KSMA 2DMLA 5DJLA 5E4WA 3H79A 5J3RA 4PQIA 4QQ7A 4XTSA 3D5JA 1V57A 1LBKA 4ZB8A 5ID2A 3SWLA 4J57E 2FUG2 2GSRA 2LQQA 2B5XA 3FEUA 2WDUA 2O85A 3TKQA 3TKRA 1HNCA 4POLA 1XWBA 1EV9A 2FHEA 4WF5A 1B4QA 3EURA 3M0FA 1TRUA 3I43A 1PRXA 1A2MA 4Q5FA 1PL2A 2GQMA 3FZ4A 1YZXA 3TJGA 1XWCA 17GSA 3SBCA 1V98A 2LJRA 4G9HA 4RI6A 5ECNB 4K7OA 5IMZA 3TKSE 4BVYA 2VIMA 3O76A 3C7MA 3GSSA 4HQSA 2BMXA 2VCZA 1FW1A 4PQHA 4NPBA 3O3TA 1S3DA 2H72A 5IMAA 2B7KA 1CQHA 3HYPA 4GLTA 1RQMA 5ELGA 1K0NA 4XS6A 4PUAA 5F0GA 6GSTA 2LRCA 3W8JA 5GZZB 2G2QA 3HCZA 3KM6A 3DYRA 4GRFA 4K2DA 5ECKB 5DVBA 5E59A 1WOUA 2YJHA 5A4VA 4L0UA 1BEDA 1GH2A 3QPMA 4PGTA 3UVTA 5J9CA 4G10A 2M80A 1T00A 2MYGA 2HZFA 1X5EA 2GLRA 2H1DA 5HR1A 4LA1A 4NWYA 2GQLA 3ERGA 4IQ1A 2IN3A 5ECOB 5A4WA 4GQCA 5JCGA 4N0VA 2GSQA 5H5RA 1EP7A 2X64A 4PTSA 3ERWA 3ZITA 2FNOA 2OJLA 3EMXA 2C0EA 1SD9A 4Q5QA 4WR4A 7GSSA 4TXOA 1B4PA 1A23A 3J7Yb 3A5WA 4KE3A 5ABRA 1BYEA 4DEJA 5D8IA 1QGVA 1EP8A 1NSWA 2VLTA 5CRGA 4CDOA 2LV3A 5ID2B 3QAGA 1G0TA 1HD2A 3BD2A 4GSNA 3GKMA 3Q74A 4JRRA 2VCWA 6GSSA 1Y25A 4TOPA 1FAAA 4MH2A 1V2AA 1WJKA 3ZL5A 4KDYA 1GTBA 4KA0A 4Z7XA 3KGKA 2HRNA 3KCMA 2H6XA 2GZZA 3E9JB 3MNGA 1YF0A 4F0CA 4G2EA 3APQA 1Z6MA 2GDRA 1ZCPA 4BVXA 3KP8A 4HU9A 2QSIA 3PINA 2TRCP 1MEKA 3C8EA 2A2RA 3G9BA 4MJEA 2M72A 2VM1A 4LL1B 4EVMA 3P7XA 2VL2C 3LSZA 1V9WA 2YZUA 1HYUA 5IIZA 5LNKe 2H19A 1TI3A 1YY7A 4I2UA 6GSWA 3UAPA 1THXA 1SJZA 3DEXA 4ID0A 5ECRB 2OADA 3H1NA 3KEBA 2B7JA 1F3BA 5DJMA 1AXDA 1YEXA 5HR2A 4POBA 2HQTA 1O6JA 3TCOA 3IK9A 2N5AA 1X5DA 3J7Yk 1H4OA 2G0FA 2TRXA 3D6IA 4GSSA 3K8NA 3LG6A 5AISA 3DGQA 5HQPA 5DDLA 2PVOC 5HFIA 4MMMA 4E8HA 3EWLA 3ZVJA 2H70A 1IYIA 2R5GA 2YP6A 1M9AA 1GSQA 2PWJA 5D9VA 3WD6A 1E2YA 1X9SB 3UMAA 3QFAC 3FKFA 4I2TA 3G7JA 1J08A 4TXVA 3VPTA 1X5CA 3L4NA 1BAYA 1GWCA 3LWAA 3HXSA 2K8SA 1ZL9A 1XWKA 4TXOB 2HRKA 4RUVA 4KB3A 1O73A 4OFNA 2PMTA 4EE0A 2KOKA 1Q4JA 2CX3A 2YOIA 1VRSD 2FWEA 3DKSA 1NHYA 1O8XA 1K0CA 3Q6OA 4GCIA 2GT6A 2O7KA 3GL3A 3NOFA 3UBKA 1YKCA 3FW2A 4DSSA 2IL3A 1O81A 1U3AA 2CAIA 3DXBA 1K3LA 2VLUA 1Z7RA 5J41A 3F3QA 5IO0A 3F0IA 5ENUA 3ZVJD 3TKSA 3VWVA 1RK4A 2F9SA 3CSIA 1SK0A 3FHKA 4Q5NA 4TR0A 3BCIA 1G6WA 3R2QA 1I9DA 2BJXA 1QUWA 2VL9A 4PQ1A 1XVQA 3QDNA 4BL7B 2CT6A 3GURA 1TRSA 3GV1A 3IRAA 5AIXA 3GNJA 1JLWA 2AJQB 4J56E 1GTUA 1GULA 1SU9A 3GTUA 5B7CA 1ACVA 4MZWA 4OO4A 4MZCA 3UARA 2LQOA 3HZ8A 5CNWA 3FZAA 5IOXA 6GSYA 1YEPA 3VWUA 2H0GA 2LRNA 3C73A 1OYJA 3A2WA 2PERA 2R37A 2H0HA 3IXRA 3E3EA 4L5OA 1XPVA 4TKYA 4D73A 2TIRA 2IMIA 1PX6A 4N30A 2B1KA 3VURA 3TB2A 3JCML 4AGSA 2LJKA 4GXZA 4NV5A 2L6CA 3KH9A 2C4JA 1ZZYA 1XWAA 2AV4A 4HS1A 3CXGA 4DSRA 2EIRA 1M7TA 1TP9A 2P5QA 1Y6EA 3US3A 4MH3A 3KJYA 3IPZA 3HVXA 3M3MA 2H01A 1K0OA 2FWHA 2H66A 2F8AA 3GH9A 4GQFA 3L9SA 3VLNA 2HRKB 4BA7A 1GLQA 5JCUA 1MD4A 1V40A 1ERUA 2IFQA 3UEMA 2O87A 3KTLA 3ME8A 1ILOA 4MF5A 3W6GA 1XXUA 1K0BA 2V6OA 3GX0A 4OFTA 3TUEA 1EWXA 4DSSB 5G5EA 4IJ3A 4HJMA 2DJKA 3F4SA 4KF9A 1THOA 2LEGA 2IMFA 3BOAA 4GSTA 2MBTA 1R5PA 3LQ7A 2KP2A 3HVVA 4LMVA 4XRAA 2MMAA 3D22A 1B8XA 4YQUA 3M1GA 5KN2A 3UBLA 4ZIJA 4IW9A 2F3MA 1M2BA 3ZMLA 1TKDB 4JR4A 2WULA 3DVWA 4HUAA 5AIVA 2BTOT 4F9ZA 4EC0A 4NV2A 3VWXA 4HI7A 3CBUA 3EU3A 1XFLA 3CMIA 4YAVA 2EIOA 5EL8A 1C72A 3GIXA 2VL3A 1M99A 5J4UA 2HZEA 2VOCA 2XPEA 1XVWA 3D4MA 4OD7A 2HRAA 1TTZA 3IBHA 1SYRA 1UN2A 1TOFA 1F3AA 1A2JA 2C0FA 2DSAA 4IJIA 4WR5A 1TI1A 1PD21 4ZL8A 5DALA 3GX8A 4V2LA 1ML6A 2LS5A 3KIJA 3R3EA 3EE2A 2YWOA 1GSYA 2ES7A 3RPPA 1TU7A 3UJ1A 5HR0A 5A4UA 2FA4A 3FZ9A 1NM3A 1ON4A 4PX1A 1SL0B 4G19A 3IK7A 2J9HA 5D9XA 4H86A 2E0QA 2IPAA 3FR9A 1XW9A 2FWGA 4EL1A 4FH8A 1R4WA 2ALBA 19GSA 2VM2A 4TR1A 2JADA 2GZPA 3VK9A 2NDOA 3ERFA 9GSSA 2YCDA 1ST9A 2IMEA 2IFQB 2GSTA 2PUKC 3TRPA 3GKXA 4EDYA 4NAXA 1K0AA 1TK5B 1AW9A 3ZRDA 3HY2A 5ELAA 1UA5A 2HNLA 3GUSA 1GUHA 1F2EA 5G5FA 3F8UA 4ACSA 5CO3A 3HJMA 4O32A 4O7HA 2FY6A 1LJRA 4ZB9A 1JHBA 1YQ1A 2YWIA 5IM9A 3F9UA 1TU8A 2HSNB 3S9FA 4MJBA 1XW6A 2O8VB 4LLRA 2MMZA 2C3QA 2DBCA 4WF4A 1R7HA 2PU9C 3IDVA 4OMVA 3HKRA 4V2NA 1Q98A 2X8GA 3LFLA 1Z3EA 3VPQA 2ON5A 2CVKA 3TRXA 3QR6A 13GSA 3KMOA 2HXKA 4DVCA 2L5LA 2V41A 1QFNA 1WE0A 3KMNA 3DVXA 3E0UA 1A24A 2N5FA 3ZTLA 4DSQA 2L4CA 1A8LA 4X0XA 2GZYA 2R2JA 1GRXA 4JZQA 5GAND 1OVNA 3M9JA 1NHOA 3GL5A 4P3YB 4POKA 1N2AA 4ZB6A 6GSXA 1VF3A 2CAQA 4AJ6A 4RQXA 3QCPA 3IAM2 2B3SA 3G7IA 4K0NA 2H1BA 4YH2A 4ECIA 3KXOA 5G30A 4XCSA 4BVYB 2IMKA 3HD5A 2L57A 3HHVA 2HE3A 3CYNA 1U88A 3GMFA 5DALB 4EUYA 4N10A 5C00A 4MDCA 3EINA 1U87A 1IYHA 4AF2A 4WKWA 5IMVA 4HEA2 2HT9A 4N0ZA 2DLXA 2VUPA 3GKKA 4NXIA 2F51A 1GSDA 1A0RP 1DUGA 4FIWA 2CX4A 2WZ9A 4MJCA 3QOUA 4MF6A 2P5RA 1XZOA 2R3XA 1OKDA 2B1LA 1M2DA 4TR1B 3MWHA 2VD0A 2VCTA 4JE1A 4G0KA 3M8NA 4K1FA 2C0DA 3IC8A 4PUFC 2YJ7A 4ULXA 1QK8A 1USBA 5CRHA 2JZRA 1VF1A 2VCXA 1VGLA 2YWNA 1PA3A 3BJ5A 3LGCA 3ZIVA 4AJ7A 5HFKA 1PMTA 2IWTA 1FB6A 4G0LA 3GYKA 1B48A 2V1MA 11GSA 1S3CA 2HSYA 3VFIA 4KDUA 2QGVA 1B9YC 1MD3A 4YQMA 3H4KA 3TJKA 4KCEA 3CTGA 1G6YA 5D96A 1FB0A 1Z9HA 3I6AA 4MJAA 5DCGA 1EOHA 5DQSA 2V32A 3QAWA 4O5RA 5ECLB 1S3AA 3EU4A 1O8WA 2EIQA 2YWMA 5B8BA 1FHEA 2OBKA 4TR3A 4BPYA 2DJ3A 2JZSA 3WGDA 2C3TA 2N5BA 1SJIA 3VI5A 1ZYEA 5J9BA 4TR4A 4WEYA 3L9UA 4BWSA 2R6KA 1TRWA 2QC7A 2X8CA 1XBSA 1Z6NA 2E2MA 1KNGA 4PURA 2CV4A 5IMFA 4ZL7A 4KX4A 16GSA 3PPUA 5HFGA 4O92A 5G1LA 1EV4A 2IIYA 2VO4A 2AUVA 3DMLA 4F2IA 4IN0A 2JSYA 3NIVA 4K6XA 4L8EA 4BVXB 2FA8A 3KP9A 2LRTA 1URMA 1VF2A 1OAZA 3N9JA 2OA7A 2OACA 4IELA 3KTBA 2YNXA 2MBSA 2B6MA 2K6VA 4MA9A 3TJJA 2H8LA 4JEDA 2M46A 3L0HA 1GLPA 4JU5A 3FRCA 1PKWA 2VL2A 1AC1A 4J2FA 4HZ2A 5ECHB 4WXTA 4NMUA 3C1RA 1F37A 2OE0A 2MZCA 2CZ3A 2MMOA 1ERWA 2YZHA 3LXZA 3EMPA 1FVKA 4XHMA 2RIIA 2VCQA 2H1GA 2JSZA 10GSA 1WMJA 5D93A 1MTCA 2V6KA 3OR5A 12GSA 3RPNA 4GTUA 3HZ4A 3HVSA 4WETA 1BQ7A 2I9HA 4MZBA 3GSTA 2PN8A 4WBRD 3V1WA 4K7NA 1PKZA 3L9VA 3NZNA 1DE1A 1OC9A 1V58A 1YF1A 1KBNA 2HRFA 2YV7A 3F63A 4IP6A 1TRVA 4MPGA 1WP0A 1GTAA 4NHWA 4HZ4A 1XWGA 1TK0B 1EEMA 1SD8A 2REMA 4E8EA 3A2VA 5CYYA 2C0GA 4TN8A 1VF4A 1AQWA 3PH9A 1XCCA 1NW2A 5JWQB 2JL4A 5FWGA 2NBSA 5GAPD 3EC3A 5DCHA 5CAXA 3IA1A 2CVBA 4FYCA 3M9KA 4ZBBA 2GVPA 1AQVA 1U6TA 2CQ9A 2FWFA 2AB6A 1MDIA 4WBJA 5JWOB 3F4TA 5CP1A 3FY7A 4IS0A 4ZILA 3G7YA 1JFUA 1HNAA 4MCUA 3IE3A 3GRXA 2NTOA 2HYXA 4XRDA 3TJBA 2JU5A 1J0FA 1K3OA 1AIUA 1B9XC 4I8BA 1N8JA 4IVFA 1MDJA 1WPIA 1SL1B 1W89A 3EVIA 3GA4A 3UL3A 5FHIA 2E7PA 3CRTA 1M2AA 2HFDA 3I69A 5F05A 3CRUA 3CSHA 1SKSB 2XBQA 1GSFA 1GNWA 5CRWA 5IMCA 1WWJA 3ISOA 4X1UA 2VAFA 4KAEA 2C80A 5DAKA 4MF7A 4MK3A 4N11A 2JZTA 1YJ6A 2IMDA 2RM5A 1F9MA 2PPTA 3RDWA 5EVOA 22GSA 4CW9A 4KSOA 2QKEA 1M9BA 3ZREA 2F8FA 2DC5A 3GTUB 2L59A 4ECCA 5INYA 3F4RA 3IOSA 4IGJA 2AAWA 3Q19A 2LJAA 1F6MC 2VLVA 3CTFA 6GSVA 3DD3A 4I6XA 5EPFA 2GSSA 4D73B 2GS3A 2I4AA 3U6VA 5COHA 1OC3A 2RUEA 3APSA 2B5EA 1T4ZA 2CVDA 1EZKA 1OC8A 2DJ1A 1OC9B 3RAZA 1XOBA 4EDZA 2X8HA 2J23A 4ILFA 4GF0A 4ML1A 4USSA 1YDKA 5F07A 3DRNA 4TW5A 3MDKA 3HDCA 3ZZXA 4OCFA 3C1SA 5KN0A 1XW5A 1I5GA 2XBIA 3DWVA 2YPMA 3KH7A 3GKNA 1ERVA 3TRQA 1DE2A 1GSEA 3TOUA 3TGZA 2RUFA 1YKAA 4RI7A 1R5AA 2C1YA 2HSMA 2OE1A 3AY8A 3MAKA 1T1VA 4F0BA 3D21A 5CRDA 1DSBA 3GN3A 4V2MA 1Z7PA 3BBYA 5IQYA 3C71A 4PNFA 1OKTA 4OFMA 2H71A 1BJXA 3IC4A 5G31A 1GUKA 4HQZA 1FO5A 2XC2A 4JR6A 5IMDA 4ZBDA 1GNEA 5B6MA 2A2SA 4ML6A 4NHZA 2E2GA 3IV4A 5GSSA 4CHSA 3HA9A 3F6FA 4JBBA 5KEJA 2WGRA 5DAKB 3WYWA 3U5RE 2A4VA 4HU7A 1PX7A 5DBQA 5B6NA 2H0IA 5EY6A 2IJYA 1Z5YE 4L0WA 1PQNA 1GP1A 2ZNMA 2XHFA 20GSA 1SKWB 4MPFA 5JWRB 3QMXA 3ME7A 4EKZA 2GQKA 3VI7A 4F82A 1GSSA 3UOMA 4ZXGA 2LUSA 2HZEB 1SYXA 4FO5A 2LTKA 3P8WA 3TKSC 2H73A 4FYUA 2H6ZA 3QD9A 2C8UA 3GHAA 3RHCA 3QAVA 2LSTA 3EYTA 3N5OA 3GFKA 4XS4A 4HJ2A 5D9TA 2ZUPA 2UZ8A 1JZRA 4KDXA 5IPHA 4IHUA 5DQYA 3I9V2 1K3YA 2AYTA 3IR4A 3HJOA 3QFBC 1LU4A 5CREA 1EGRA 1GUMA 1O85A 1G7OA 1TW9A 4F03A 3LJRA 1QXHA 4RQRA 1W4VA 4YAPA 4AJ8A 1M0UA 1GL8A 1KTEA 4K0GA 1ERTA 2B5YA 3MSZA 4BL7A 3APOA 3P90A 4IQAA 1TJDA 2H1AA 2DJ0A 5BMUA 1CQGA 1E6BA 2AHEA 4OCEA 4ECJA 4IP1A 4IBPA 3WGEA 3BCKA 2PVQA 2DJ2A 1QQ2A 2HSMB 3TJFA 4XIHA 1ZYQB 4I5QA 4ZBAA 6GSUA 3D0ZA 2ON7A 1T4YA 2YV9A 5H5QA 1RW1A 1JZDA 4KH7A 2K18A 1BX9A 2C3NA 3P2AA 4V1Ap 3L78A 1R26A 5G1KA 1X9MB 1BG5A 4XS1A 2GT5A 5IPGA 1SL2B 1AQXA 2LNSA 3WGXA 1FOVA 1H75A 3ZLPA 2V2GA 4K9ZA 4I97A 2HLSA 4KNDA 5AGYA 2H6YA 2CA8A 3F3RA 1WIKA 2D2ZA 2Z9SA 1PSQA 2OE3A 5JCWA 1ZOFA 2DIZA 4KUNA 1O7UA 4MLYA 2CZ2A 1EEJA 4X43A 4MP4A 2WRTA 1ZGNA
chains in the Genus database with same CATH superfamily
4PNGA 18GSA 3TDGA 4K8MA 5ECPB 3UVHA 4EF0A 2WFCA 1SKRB 2PBJA 4ISDA 3ZIJA 1EGOA 3FK8A 5LD0A 5GSTA 3A3TA 1PN9A 1T7PB 4QL9A 2YN1A 2XPDA 2OKAA 8GSSA 5B8AA 4CY8A 1U3IA 5L71A 5C04A 4OO5A 1FG4A 2P31A 4V1Ag 1AAZA 3PGTA 3IAS2 2L6DA 5G2ZA 4XS4B 5A5HB 2WB9A 1DBYA 5IO2A 5F8BA 1TXXA 2KUCA 1A2LA 4EIQA 4IKHA 1SJ6A 2KLXA 3RHBA 4LL4B 3H8QA 2FGXA 2WCIA 2I81A 2WS2A 5J4YA 2GGTA 2ZCTA 3VWWA 4Q5RA 3LXTA 4X4JA 4FYBA 4TRXA 2X99A 2JACA 1SENA 3A2XA 2I3YA 3IHQA 1QMVA 14GSA 1GTIA 4OWYA 3FZ5A 3HJPA 5ECQB 2P0GA 4EO3A 4G0IA 1ABAA 3LYPA 5BMUB 4QL7A 2VCVA 2LKUA 1G7EA 2EC4A 4HDEA 1X0RA 1T3BA 2WW0A 3FYGA 2H76A 2R4VA 4HOJA 1KEBA 2K8VA 2HSHA 4FXYP 3ZFBA 2H75A 5J5NA 1J9BA 3KZQA 5HR3A 2DJJA 1FOHA 2FD3A 5D9WA 2LNTA 1AUCA 1BG1A 3ED3A 4L5LA 3Q18A 3UIWA 1FVJA 4KW6A 3ZMKA 2NVLA 1PGTA 1MDKA 5H5SA 3F6DA 4LMWA 3GH6A 2K9FA 1JLVA 3ZFLA 1T8EB 2WJUA 1GSUA 2DIYA 3MIXA 3CSJA 2DMMA 4EXJA 2OBIA 4GWRA 2H30A 1SK1A 3PR8A 5AN1A 2A2PA 4ZL9A 1HQOA 1OE8A 3WT1A 4POMA 2VD1A 5ECMB 3LEFA 2H74A 4KCAA 5BRTA 5IOWA 2PGTA 4K7IA 2O89A 3WT2A 3TOTA 1K0DA 2WW1A 5A5KA 2RLIA 3H93A 1JZOA 1X9WB 2EFCA 1PL1A 3RBTA 5D73A 5F06A 2FLSA 3LORA 3LYKA 1EOGA 2L4QA 5KN3A 4MABA 1OE7A 2MMNA 5ECIB 2FCHA 1HNBA 2WW2A 4YQVA 5FT3A 1WRYA 2YANA 1TDIA 4BWQA 5ECSA 3TKPA 5LCZA 3W8SA 2GTUA 1A8YA 1UVZA 1JZWA 1A0FA 2I1UA 3DIEA 2KHPA 2RM6A 2OT3A 1K0MA 3FR3A 1UC7A 1XOAA 3KD0A 1ZMAA 2HI7A 2EFHA 2KP1A 4KGIA 3D4TA 3O6TA 4TVEA 4ECBA 1XIYA 3FR6A 2L5OA 5KN1A 2NPBA 1TK8B 1SK2A 4PXOA 4FQUA 3ZYWA 4KSMA 2DMLA 5DJLA 5E4WA 3H79A 5J3RA 4PQIA 4QQ7A 4XTSA 3D5JA 1V57A 1LBKA 4ZB8A 5ID2A 3SWLA 4J57E 2FUG2 1SVLA 2GSRA 2O36A 2B5XA 2LQQA 3FEUA 2WDUA 2O85A 3TKQA 3TKRA 1HNCA 4POLA 1XWBA 1EV9A 2FHEA 4WF5A 1B4QA 3EURA 3M0FA 1TRUA 3I43A 1PRXA 1A2MA 4Q5FA 1PL2A 2GQMA 3FZ4A 1YZXA 3TJGA 1XWCA 17GSA 3SBCA 1V98A 2LJRA 1PFOA 4G9HA 2R0GA 4RI6A 5ECNB 4K7OA 5IMZA 3TKSE 4BVYA 2VIMA 3O76A 3C7MA 3GSSA 4HQSA 2BMXA 2VCZA 1FW1A 4PQHA 4NPBA 3O3TA 1S3DA 2H72A 5IMAA 2B7KA 1CQHA 3HYPA 4GLTA 1RQMA 5A34A 5ELGA 1K0NA 4XS6A 4PUAA 5F0GA 6GSTA 5J4VA 2LRCA 3W8JA 5GZZB 2G2QA 3HCZA 3KM6A 3DYRA 4GRFA 4K2DA 5ECKB 5DVBA 5E59A 1WOUA 2YJHA 5A4VA 4L0UA 1BEDA 1GH2A 3QPMA 4PGTA 3UVTA 5J9CA 4G10A 2M80A 1T00A 2MYGA 2HZFA 1X5EA 2GLRA 2H1DA 5HR1A 3HVNA 4LA1A 4NWYA 2GQLA 3ERGA 4IQ1A 2IN3A 5ECOB 5A4WA 4GQCA 5JCGA 4N0VA 2GSQA 2WZSA 5H5RA 1EP7A 2X64A 4PTSA 3ERWA 3ZITA 2FNOA 1I1IP 2OJLA 3EMXA 2C0EA 1SD9A 4Q5QA 4WR4A 7GSSA 4TXOA 1B4PA 1A23A 3J7Yb 3A5WA 4KE3A 5ABRA 1BYEA 2A4HA 4DEJA 5D8IA 1QGVA 1EP8A 1NSWA 2VLTA 5CRGA 4CDOA 2LV3A 5ID2B 3QAGA 1G0TA 2DKHA 1HD2A 3BD2A 4GSNA 3GKMA 3Q74A 4JRRA 2VCWA 6GSSA 1Y25A 4TOPA 1FAAA 4MH2A 1V2AA 1WJKA 3ZL5A 3RFRC 4KDYA 1GTBA 4KA0A 4Z7XA 3KGKA 2HRNA 3KCMA 2H6XA 2GZZA 3E9JB 3MNGA 1YF0A 4F0CA 4G2EA 3APQA 1Z6MA 2GDRA 1ZCPA 4BVXA 3KP8A 4HU9A 2QSIA 3PINA 2TRCP 1MEKA 3C8EA 2A2RA 3G9BA 4MJEA 2M72A 2VM1A 4LL1B 4EVMA 3P7XA 2VL2C 3LSZA 1V9WA 2YZUA 1HYUA 5IIZA 5LNKe 2H19A 1TI3A 1YY7A 4I2UA 6GSWA 3UAPA 1THXA 1SJZA 3DEXA 4ID0A 5A34B 5ECRB 2OADA 3H1NA 3KEBA 2B7JA 1F3BA 5DJMA 1AXDA 1YEXA 5HR2A 4POBA 2HQTA 1O6JA 3TCOA 3IK9A 2N5AA 1X5DA 3J7Yk 1H4OA 2G0FA 2TRXA 3D6IA 4GSSA 3K8NA 3LG6A 5AISA 3DGQA 5HQPA 5DDLA 2WVXA 2PVOC 5HFIA 4MMMA 4E8HA 3EWLA 3ZVJA 2H70A 1IYIA 2R5GA 2YP6A 1M9AA 1GSQA 2PWJA 5D9VA 3WD6A 1E2YA 1X9SB 3UMAA 3QFAC 3FKFA 4I2TA 3G7JA 1J08A 4TXVA 3VPTA 1X5CA 3L4NA 1BAYA 1GWCA 3LWAA 4O5QA 3HXSA 2K8SA 1ZL9A 1XWKA 4TXOB 2HRKA 4RUVA 4KB3A 1O73A 4OFNA 2PMTA 4EE0A 2KOKA 1Q4JA 2CX3A 2EFEA 2YOIA 1VRSD 2FWEA 3DKSA 1NHYA 1O8XA 1K0CA 2R0CA 3Q6OA 4GCIA 2GT6A 2O7KA 3GL3A 3NOFA 3UBKA 1YKCA 3FW2A 4DSSA 2IL3A 1O81A 1U3AA 2CAIA 3DXBA 1K3LA 2VLUA 4YKFA 1Z7RA 5J41A 3F3QA 5IO0A 3F0IA 5ENUA 3ZVJD 3TKSA 3VWVA 2EFDA 4E68A 1RK4A 2F9SA 3CSIA 3RGBC 3FHKA 1SK0A 4Q5NA 4TR0A 3BCIA 1G6WA 1M3IA 3R2QA 1I9DA 2BJXA 1QUWA 2VL9A 4PQ1A 1XVQA 3QDNA 4BL7B 2CT6A 3GURA 1TRSA 3GV1A 3IRAA 5AIXA 3GNJA 1JLWA 2AJQB 4J56E 1GTUA 1GULA 4W66A 1SU9A 3GTUA 5B7CA 1ACVA 4MZWA 4OO4A 4MZCA 3UARA 2LQOA 3HZ8A 5CNWA 3FZAA 5IOXA 6GSYA 1YEPA 3VWUA 4O5UA 2H0GA 2LRNA 3CWGA 3C73A 1OYJA 3A2WA 2PERA 2R37A 2H0HA 3IXRA 3E3EA 4L5OA 1XPVA 4TKYA 4D73A 2TIRA 2IMIA 1PX6A 4N30A 1N25A 2B1KA 3VURA 3TB2A 3JCML 4AGSA 2LJKA 4GXZA 4NV5A 2L6CA 3KH9A 2C4JA 2X4AA 1S4BP 1ZZYA 1XWAA 2AV4A 4HS1A 3CXGA 4DSRA 2EIRA 1M7TA 1TP9A 2P5QA 1Y6EA 3US3A 4MH3A 3KJYA 3IPZA 3HVXA 3M3MA 2H01A 1K0OA 2FWHA 2H66A 2F8AA 3GH9A 4GQFA 3L9SA 3VLNA 2HRKB 4BA7A 1GLQA 5JCUA 1MD4A 1V40A 1ERUA 2IFQA 3UEMA 2O87A 3KTLA 3ME8A 5A1NA 4GDFA 1ILOA 4MF5A 3W6GA 1XXUA 1K0BA 2V6OA 3GX0A 4OFTA 3TUEA 1EWXA 1ZYNA 5G5EA 4DSSB 4IJ3A 4HJMA 2DJKA 3F4SA 4KF9A 1THOA 2LEGA 2IMFA 3BOAA 4GSTA 2MBTA 1R5PA 3LQ7A 2KP2A 3HVVA 4LMVA 4XRAA 2MMAA 2HSNA 3D22A 2UV8G 1B8XA 4YQUA 1XG8A 3M1GA 5KN2A 4AKGA 3UBLA 4ZIJA 4IW9A 2F3MA 1M2BA 3ZMLA 1TKDB 4JR4A 2WULA 3DVWA 4HUAA 5AIVA 2BTOT 4F9ZA 4EC0A 4NV2A 1M3JA 3VWXA 4HI7A 3CBUA 3EU3A 1XFLA 3CMIA 4YAVA 2EIOA 5EL8A 1C72A 2O5VA 3GIXA 2VL3A 1M99A 5J4UA 2HZEA 2VOCA 2XPEA 1XVWA 3D4MA 4OD7A 2HRAA 1TTZA 3MYDA 3IBHA 1SYRA 1UN2A 1TOFA 1F3AA 1Y1UA 1A2JA 2C0FA 2DSAA 2R0PA 4IJIA 4WR5A 1TI1A 1PN0A 1PD21 4ZL8A 5DALA 3GX8A 4V2LA 1ML6A 2LS5A 3KIJA 3R3EA 3EE2A 2YWOA 1GSYA 2ES7A 3RPPA 1TU7A 3UJ1A 5HR0A 5A4UA 2FA4A 3FZ9A 1NM3A 1ON4A 1SVOA 4EIPA 4PX1A 1SL0B 4G19A 1BF5A 3IK7A 2J9HA 5D9XA 4H86A 2WVYA 2E0QA 2IPAA 3FR9A 1XW9A 1YEWC 2FWGA 4EL1A 4FH8A 1R4WA 2ALBA 19GSA 2VM2A 4TR1A 2JADA 2GZPA 3VK9A 2NDOA 2WW3A 3ERFA 9GSSA 2YCDA 1ST9A 2IMEA 5KOXA 4ICYA 2IFQB 2GSTA 2PUKC 3TRPA 3GKXA 4EDYA 5A1NB 4NAXA 1K0AA 4PI0C 1TK5B 1AW9A 3ZRDA 3HY2A 5ELAA 1UA5A 2HNLA 3GUSA 1GUHA 1F2EA 5G5FA 3F8UA 4ACSA 5CO3A 3HJMA 4O32A 4Z2RA 4O7HA 2FY6A 1LJRA 4ZB9A 1JHBA 1YQ1A 2YWIA 5IM9A 3F9UA 1TU8A 2HSNB 3S9FA 4MJBA 1XW6A 3A5IA 2O8VB 4LLRA 2MMZA 2C3QA 2DBCA 4K2XA 4WF4A 1R7HA 2PU9C 3IDVA 4OMVA 3HKRA 4V2NA 1Q98A 2X8GA 3LFLA 1Z3EA 3VPQA 2ON5A 2CVKA 3TRXA 3QR6A 13GSA 3KMOA 2HXKA 4DVCA 2L5LA 2V41A 1QFNA 1WE0A 3KMNA 3DVXA 3E0UA 1A24A 3EPTA 2N5FA 3ZTLA 4DSQA 2L4CA 1A8LA 2O3EA 4X0XA 2GZYA 2R2JA 1GRXA 4JZQA 5GAND 1OVNA 3M9JA 2WVZA 1NHOA 3GL5A 4P3YB 4POKA 1N2AA 1YVLA 4ZB6A 6GSXA 1VF3A 2CAQA 4AJ6A 4RQXA 3QCPA 3IAM2 3LW9A 2B3SA 3G7IA 4K0NA 2H1BA 4YH2A 4ECIA 4Z2UA 3KXOA 5G30A 4XCSA 4BVYB 2IMKA 3HD5A 2L57A 3HHVA 2HE3A 3CYNA 1U88A 3GMFA 5DALB 4EUYA 4N10A 5C00A 4MDCA 3EINA 1U87A 1IYHA 4AF2A 4WKWA 5IMVA 4HEA2 2HT9A 4N0ZA 2DLXA 2VUPA 3GKKA 4NXIA 2F51A 1GSDA 1A0RP 1DUGA 4FIWA 2CX4A 1S3RA 2WZ9A 4MJCA 3QOUA 4MF6A 2P5RA 1XZOA 2R3XA 1OKDA 2B1LA 1M2DA 4TR1B 3MWHA 2VD0A 2VCTA 4JE1A 4G0KA 3M8NA 4K1FA 2C0DA 3IC8A 4PUFC 2YJ7A 4ULXA 1QK8A 1USBA 5CRHA 2JZRA 1VF1A 2VCXA 1VGLA 3HMJG 2YWNA 1PA3A 3BJ5A 2X49A 3LGCA 3ZIVA 4AJ7A 5HFKA 1PMTA 2IWTA 1FB6A 2QA1A 4G0LA 3GYKA 1B48A 2V1MA 11GSA 1S3CA 2HSYA 3VFIA 4KDUA 2QGVA 1B9YC 4HSCX 1MD3A 1ZYPA 4YQMA 3H4KA 3TJKA 4KCEA 3CTGA 1G6YA 5D96A 1FB0A 1Z9HA 3I6AA 4MJAA 5DCGA 1EOHA 5DQSA 2V32A 3QAWA 4O5RA 5ECLB 1S3AA 3EU4A 4K5SA 1O8WA 2EIQA 2YWMA 5B8BA 4AI6A 5KOWA 1FHEA 2OBKA 4TR3A 4BPYA 2DJ3A 2JZSA 3WGDA 2C3TA 2N5BA 1SJIA 3VI5A 4YKGA 1ZYEA 5J9BA 4G01A 4TR4A 4WEYA 3L9UA 4BWSA 2R6KA 1TRWA 2QC7A 2X8CA 1XBSA 1Z6NA 2E2MA 1KNGA 4PURA 2CV4A 5IMFA 4ZL7A 4KX4A 16GSA 3PPUA 5HFGA 4O92A 2QA2A 5G1LA 1EV4A 2IIYA 2VO4A 2AUVA 3DMLA 4F2IA 4IN0A 2JSYA 3NIVA 4K6XA 4L8EA 4BVXB 2FA8A 3KP9A 2LRTA 1URMA 1VF2A 1OAZA 3N9JA 2OA7A 2OACA 4IELA 3KTBA 2YNXA 2MBSA 2B6MA 2K6VA 4MA9A 3TJJA 2H8LA 4JEDA 2M46A 3L0HA 1GLPA 4JU5A 3FRCA 1PKWA 4QMKA 4PI2C 2VL2A 1AC1A 4J2FA 4HZ2A 5ECHB 4WXTA 4NMUA 3C1RA 1F37A 2OE0A 2MZCA 2CZ3A 2MMOA 1ERWA 2YZHA 3LXZA 3EMPA 1FVKA 4XHMA 2RIIA 2VCQA 2H1GA 2JSZA 10GSA 1WMJA 5D93A 1MTCA 2V6KA 3OR5A 12GSA 3RPNA 2WVXB 4GTUA 3HZ4A 3HVSA 4WETA 2DKIA 5J47A 1BQ7A 2I9HA 4MZBA 3GSTA 2PN8A 4WBRD 3V1WA 4K7NA 1PKZA 3L9VA 3NZNA 1DE1A 1OC9A 1V58A 1YF1A 1KBNA 2HRFA 2YV7A 4N3ZA 3F63A 4IP6A 1TRVA 4MPGA 1WP0A 1GTAA 4NHWA 4HZ4A 1XWGA 1TK0B 4AKIA 1EEMA 1SD8A 2REMA 4E8EA 3A2VA 5CYYA 2C0GA 4TN8A 1VF4A 1AQWA 3PH9A 1XCCA 1NW2A 5JWQB 2JL4A 5FWGA 2NBSA 5GAPD 3EC3A 5DCHA 5CAXA 3IA1A 2CVBA 4FYCA 3M9KA 4ZBBA 2GVPA 1AQVA 1U6TA 2CQ9A 2FWFA 2AB6A 1MDIA 4WBJA 5JWOB 3F4TA 5CP1A 3FY7A 4IS0A 4ZILA 3G7YA 4MNNA 1JFUA 1HNAA 4MCUA 3IE3A 3GRXA 4Z2TA 2NTOA 2HYXA 4XRDA 3TJBA 2JU5A 1J0FA 1K3OA 1TXUA 1AIUA 1B9XC 4I8BA 1N8JA 4IVFA 1MDJA 1WPIA 1SL1B 1W89A 3EVIA 3FMWA 3GA4A 3UL3A 5FHIA 2E7PA 3CRTA 1M2AA 2HFDA 3I69A 5F05A 3CRUA 3CSHA 1SKSB 2XBQA 1GSFA 1GNWA 5CRWA 5IMCA 1WWJA 3ISOA 4X1UA 2VAFA 4KAEA 1SVMA 2C80A 5DAKA 4MF7A 4MK3A 4N11A 4PHZC 2JZTA 1YJ6A 2IMDA 2RM5A 1F9MA 2PPTA 3RDWA 5EVOA 22GSA 4CW9A 4KSOA 2QKEA 1M9BA 3ZREA 2F8FA 3GTUB 2DC5A 2L59A 4A5PA 4ECCA 5INYA 3F4RA 3IOSA 4IGJA 4AKXB 3CQFA 2AAWA 3Q19A 2LJAA 1F6MC 2VLVA 3CTFA 6GSVA 4CY6A 3DD3A 4I6XA 5EPFA 2GSSA 4D73B 2GS3A 2I4AA 3U6VA 5COHA 1OC3A 2RUEA 3APSA 2B5EA 1T4ZA 2CVDA 1EZKA 1OC8A 2DJ1A 1OC9B 3RAZA 1XOBA 4EDZA 2X8HA 2J23A 4ILFA 4GF0A 4ML1A 4USSA 1YDKA 5F07A 3DRNA 4TW5A 3MDKA 3HDCA 3ZZXA 4OCFA 3C1SA 5KN0A 1XW5A 1I5GA 2XBIA 3DWVA 2YPMA 3KH7A 3GKNA 1ERVA 3TRQA 1DE2A 1GSEA 3TOUA 3TGZA 2RUFA 1YKAA 4RI7A 1R5AA 2C1YA 2HSMA 2OE1A 3AY8A 3MAKA 1T1VA 4F0BA 3D21A 5CRDA 1DSBA 3GN3A 4V2MA 1Z7PA 3BBYA 5IQYA 3C71A 4PNFA 1OKTA 4OFMA 2H71A 1BJXA 3IC4A 5G31A 1GUKA 4HQZA 1FO5A 2H1LA 2XC2A 4JR6A 5IMDA 4ZBDA 1GNEA 5B6MA 4ZB7A 2A2SA 4ML6A 4NHZA 2E2GA 3IV4A 5GSSA 4CHSA 3HA9A 3F6FA 4JBBA 5KEJA 2WGRA 5DAKB 3WYWA 3U5RE 5J40A 2A4VA 4HU7A 1PX7A 5DBQA 5B6NA 2H0IA 4AKHA 5EY6A 3TU3B 2IJYA 1Z5YE 4L0WA 1PQNA 1GP1A 2ZNMA 2XHFA 20GSA 1SKWB 4MPFA 5JWRB 3QMXA 3ME7A 4EKZA 2GQKA 3VI7A 4F82A 1GSSA 3UOMA 4ZXGA 2LUSA 2HZEB 1SYXA 4FO5A 2LTKA 3P8WA 3TKSC 2H73A 4FYUA 2H6ZA 3QD9A 2C8UA 3GHAA 3RHCA 3QAVA 2LSTA 3EYTA 3N5OA 3GFKA 4XS4A 4HJ2A 3IHGA 5D9TA 2ZUPA 5A5HA 2UZ8A 1JZRA 4KDXA 5IPHA 4IHUA 5DQYA 3I9V2 1K3YA 2AYTA 3IR4A 3HJOA 3QFBC 1LU4A 5CREA 1EGRA 1GUMA 1O85A 3CHXC 1G7OA 1TW9A 4F03A 3LJRA 1QXHA 4RQRA 1W4VA 4YAPA 4AJ8A 1M0UA 1GL8A 1KTEA 4K0GA 1ERTA 2B5YA 3MSZA 4BL7A 3APOA 3P90A 4IQAA 1TJDA 2H1AA 2DJ0A 5BMUA 1CQGA 1E6BA 2AHEA 4OCEA 4ECJA 4IP1A 4IBPA 3WGEA 4BIKA 3BCKA 2PVQA 2DJ2A 1QQ2A 2HSMB 3TJFA 4XIHA 1ZYQB 4I5QA 4ZBAA 6GSUA 3D0ZA 2ON7A 1T4YA 2YV9A 5H5QA 1RW1A 1JZDA 4KH7A 2K18A 1BX9A 2C3NA 3P2AA 4V1Ap 3L78A 1R26A 2VKZG 5G1KA 1X9MB 1BG5A 4K5RA 4XS1A 2GT5A 5IPGA 1SL2B 1AQXA 2LNSA 3WGXA 1FOVA 1H75A 3ZLPA 2V2GA 4K9ZA 4I97A 2HLSA 4KNDA 5AGYA 2H6YA 2CA8A 3F3RA 1WIKA 2D2ZA 2Z9SA 1PSQA 2OE3A 5JCWA 1ZOFA 2DIZA 4KUNA 1O7UA 4MLYA 2CZ2A 1EEJA 4X43A 4MP4A 2WRTA 1ZGNA
chains in the Genus database with same CATH topology
4PNGA 18GSA 3TDGA 4K8MA 5ECPB 3UVHA 4EF0A 2WFCA 1SKRB 2PBJA 4ISDA 3ZIJA 1EGOA 3FK8A 5LD0A 5GSTA 3A3TA 1PN9A 1T7PB 4QL9A 2YN1A 2XPDA 2OKAA 8GSSA 5B8AA 4CY8A 1U3IA 5L71A 5C04A 4OO5A 1FG4A 2P31A 4V1Ag 1AAZA 3PGTA 3IAS2 2L6DA 5G2ZA 4XS4B 5A5HB 2WB9A 1DBYA 5IO2A 5F8BA 1TXXA 2KUCA 1A2LA 4EIQA 4IKHA 1SJ6A 2KLXA 3RHBA 4LL4B 3H8QA 2FGXA 2WCIA 2I81A 2WS2A 5J4YA 2GGTA 2ZCTA 3VWWA 4Q5RA 3LXTA 4X4JA 4FYBA 4TRXA 2X99A 2JACA 1SENA 3A2XA 2I3YA 3IHQA 1QMVA 14GSA 1GTIA 4OWYA 3FZ5A 3HJPA 5ECQB 2P0GA 4EO3A 4G0IA 1ABAA 3LYPA 5BMUB 4QL7A 2VCVA 2LKUA 1G7EA 2EC4A 4HDEA 1X0RA 1T3BA 3FYGA 2H76A 2R4VA 4HOJA 1KEBA 2K8VA 2HSHA 3ZFBA 2H75A 5J5NA 1J9BA 3KZQA 5HR3A 2DJJA 1FOHA 2FD3A 5D9WA 2LNTA 1AUCA 1BG1A 3ED3A 4L5LA 3Q18A 3UIWA 1FVJA 4KW6A 3ZMKA 2NVLA 1PGTA 1MDKA 5H5SA 3F6DA 4LMWA 3GH6A 2K9FA 1JLVA 3ZFLA 1T8EB 2WJUA 3MIXA 1GSUA 2DIYA 3CSJA 2DMMA 4EXJA 2OBIA 4GWRA 2H30A 1SK1A 3PR8A 5AN1A 2A2PA 4ZL9A 1HQOA 1OE8A 3WT1A 4POMA 2VD1A 5ECMB 3LEFA 2H74A 4KCAA 5BRTA 5IOWA 2PGTA 4K7IA 2O89A 3WT2A 3TOTA 1K0DA 2RLIA 5A5KA 3H93A 1JZOA 1X9WB 2EFCA 1PL1A 3RBTA 5D73A 5F06A 2FLSA 3LORA 3LYKA 1EOGA 2L4QA 5KN3A 4MABA 1OE7A 2MMNA 5ECIB 2FCHA 1HNBA 4YQVA 5FT3A 1WRYA 2YANA 1TDIA 4BWQA 5ECSA 3TKPA 5LCZA 3W8SA 2GTUA 1A8YA 1UVZA 1JZWA 1A0FA 2I1UA 3DIEA 2KHPA 2RM6A 2OT3A 1K0MA 3FR3A 1UC7A 1XOAA 3KD0A 1ZMAA 2HI7A 2EFHA 2KP1A 4KGIA 3D4TA 3O6TA 4TVEA 4ECBA 1XIYA 3FR6A 2L5OA 5KN1A 2NPBA 1TK8B 1SK2A 4PXOA 4FQUA 3ZYWA 4KSMA 2DMLA 5DJLA 5E4WA 3H79A 5J3RA 4PQIA 4QQ7A 4XTSA 3D5JA 1V57A 1LBKA 4ZB8A 5ID2A 3SWLA 4J57E 2FUG2 1SVLA 2GSRA 2LQQA 2B5XA 3FEUA 2WDUA 2O85A 3TKQA 3TKRA 1HNCA 4POLA 1XWBA 1EV9A 2FHEA 4WF5A 1B4QA 3EURA 3M0FA 1TRUA 3I43A 1PRXA 1A2MA 4Q5FA 1PL2A 2GQMA 3FZ4A 1YZXA 3TJGA 1XWCA 17GSA 3SBCA 1V98A 2LJRA 4G9HA 2R0GA 4RI6A 5ECNB 4K7OA 5IMZA 3TKSE 4BVYA 2VIMA 3O76A 3C7MA 3GSSA 4HQSA 2BMXA 2VCZA 1FW1A 4PQHA 4NPBA 3O3TA 1S3DA 2H72A 5IMAA 2B7KA 1CQHA 3HYPA 4GLTA 1RQMA 5A34A 5ELGA 1K0NA 4XS6A 4PUAA 5F0GA 6GSTA 5J4VA 2LRCA 3W8JA 5GZZB 2G2QA 3HCZA 3KM6A 3DYRA 4GRFA 4K2DA 5ECKB 5DVBA 5E59A 1WOUA 2YJHA 5A4VA 4L0UA 1BEDA 1GH2A 3QPMA 4PGTA 3UVTA 5J9CA 4G10A 2M80A 1T00A 2MYGA 2HZFA 1X5EA 2GLRA 2H1DA 5HR1A 4LA1A 4NWYA 2GQLA 3ERGA 4IQ1A 2IN3A 5ECOB 5A4WA 4GQCA 5JCGA 4N0VA 2GSQA 5H5RA 1EP7A 2X64A 4PTSA 3ERWA 3ZITA 2FNOA 2OJLA 3EMXA 2C0EA 1SD9A 4Q5QA 4WR4A 7GSSA 4TXOA 1B4PA 1A23A 3J7Yb 3A5WA 4KE3A 5ABRA 1BYEA 2A4HA 4DEJA 5D8IA 1QGVA 1EP8A 1NSWA 2VLTA 5CRGA 4CDOA 2LV3A 5ID2B 3QAGA 1G0TA 2DKHA 1HD2A 3BD2A 4GSNA 3GKMA 3Q74A 4JRRA 2VCWA 6GSSA 1Y25A 4TOPA 1FAAA 4MH2A 1V2AA 1WJKA 3ZL5A 4KDYA 1GTBA 4KA0A 4Z7XA 3KGKA 2HRNA 3KCMA 2H6XA 2GZZA 3E9JB 3MNGA 1YF0A 4F0CA 4G2EA 3APQA 1Z6MA 2GDRA 1ZCPA 4BVXA 3KP8A 4HU9A 2QSIA 3PINA 2TRCP 1MEKA 3C8EA 2A2RA 3G9BA 4MJEA 2M72A 2VM1A 4LL1B 4EVMA 3P7XA 2VL2C 3LSZA 1V9WA 2YZUA 1HYUA 5IIZA 5LNKe 2H19A 1TI3A 1YY7A 4I2UA 6GSWA 3UAPA 1THXA 1SJZA 3DEXA 4ID0A 5A34B 5ECRB 2OADA 3H1NA 3KEBA 2B7JA 1F3BA 5DJMA 1AXDA 1YEXA 5HR2A 4POBA 2HQTA 1O6JA 3TCOA 3IK9A 2N5AA 1X5DA 3J7Yk 1H4OA 2G0FA 2TRXA 3D6IA 4GSSA 3K8NA 3LG6A 5AISA 3DGQA 5HQPA 5DDLA 2PVOC 5HFIA 4MMMA 4E8HA 3EWLA 3ZVJA 2H70A 1IYIA 2R5GA 2YP6A 1M9AA 1GSQA 2PWJA 5D9VA 3WD6A 1E2YA 1X9SB 3UMAA 3QFAC 3FKFA 4I2TA 3G7JA 1J08A 4TXVA 3VPTA 1X5CA 3L4NA 1BAYA 1GWCA 3LWAA 4O5QA 3HXSA 2K8SA 1ZL9A 1XWKA 4TXOB 2HRKA 4RUVA 4KB3A 1O73A 4OFNA 2PMTA 4EE0A 2KOKA 1Q4JA 2CX3A 2EFEA 2YOIA 1VRSD 2FWEA 3DKSA 1NHYA 1O8XA 1K0CA 2R0CA 3Q6OA 4GCIA 2GT6A 2O7KA 3GL3A 3NOFA 3UBKA 1YKCA 3FW2A 4DSSA 2IL3A 1O81A 1U3AA 2CAIA 3DXBA 1K3LA 2VLUA 4YKFA 1Z7RA 5J41A 3F3QA 5IO0A 3F0IA 5ENUA 3ZVJD 3TKSA 3VWVA 2EFDA 4E68A 1RK4A 2F9SA 3CSIA 1SK0A 3FHKA 4Q5NA 4TR0A 3BCIA 1G6WA 3R2QA 1I9DA 2BJXA 1QUWA 2VL9A 4PQ1A 1XVQA 3QDNA 4BL7B 2CT6A 3GURA 1TRSA 3GV1A 3IRAA 5AIXA 3GNJA 1JLWA 2AJQB 4J56E 1GTUA 1GULA 4W66A 1SU9A 3GTUA 5B7CA 1ACVA 4MZWA 4OO4A 4MZCA 3UARA 2LQOA 3HZ8A 5CNWA 3FZAA 5IOXA 6GSYA 1YEPA 3VWUA 4O5UA 2H0GA 2LRNA 3CWGA 3C73A 1OYJA 3A2WA 2PERA 2R37A 2H0HA 3IXRA 3E3EA 4L5OA 1XPVA 4TKYA 4D73A 2TIRA 2IMIA 1PX6A 4N30A 1N25A 2B1KA 3VURA 3TB2A 3JCML 4AGSA 2LJKA 4GXZA 4NV5A 2L6CA 3KH9A 2C4JA 2X4AA 1ZZYA 1XWAA 2AV4A 4HS1A 3CXGA 4DSRA 2EIRA 1M7TA 1TP9A 2P5QA 1Y6EA 3US3A 4MH3A 3KJYA 3IPZA 3HVXA 3M3MA 2H01A 1K0OA 2FWHA 2H66A 2F8AA 3GH9A 4GQFA 3L9SA 3VLNA 2HRKB 4BA7A 1GLQA 5JCUA 1MD4A 1V40A 1ERUA 2IFQA 3UEMA 2O87A 3KTLA 3ME8A 5A1NA 4GDFA 1ILOA 4MF5A 3W6GA 1XXUA 1K0BA 2V6OA 3GX0A 4OFTA 3TUEA 1EWXA 1ZYNA 5G5EA 4DSSB 4IJ3A 4HJMA 2DJKA 3F4SA 4KF9A 1THOA 2LEGA 2IMFA 3BOAA 4GSTA 2MBTA 1R5PA 3LQ7A 2KP2A 3HVVA 4LMVA 4XRAA 2MMAA 2HSNA 3D22A 2UV8G 1B8XA 4YQUA 3M1GA 5KN2A 4AKGA 3UBLA 4ZIJA 4IW9A 2F3MA 1M2BA 3ZMLA 1TKDB 4JR4A 2WULA 3DVWA 4HUAA 5AIVA 2BTOT 4F9ZA 4EC0A 4NV2A 3VWXA 4HI7A 3CBUA 3EU3A 1XFLA 3CMIA 4YAVA 2EIOA 5EL8A 1C72A 2O5VA 3GIXA 2VL3A 1M99A 5J4UA 2HZEA 2VOCA 2XPEA 1XVWA 3D4MA 4OD7A 2HRAA 1TTZA 3MYDA 3IBHA 1SYRA 1UN2A 1TOFA 1F3AA 1Y1UA 1A2JA 2C0FA 2DSAA 2R0PA 4IJIA 4WR5A 1TI1A 1PN0A 1PD21 4ZL8A 5DALA 3GX8A 4V2LA 1ML6A 2LS5A 3KIJA 3R3EA 3EE2A 2YWOA 1GSYA 2ES7A 3RPPA 1TU7A 3UJ1A 5HR0A 5A4UA 2FA4A 3FZ9A 1NM3A 1ON4A 1SVOA 4EIPA 4PX1A 1SL0B 4G19A 1BF5A 3IK7A 2J9HA 5D9XA 4H86A 2E0QA 2IPAA 3FR9A 1XW9A 2FWGA 4EL1A 4FH8A 1R4WA 2ALBA 19GSA 2VM2A 4TR1A 2JADA 2GZPA 3VK9A 2NDOA 3ERFA 9GSSA 2YCDA 1ST9A 2IMEA 5KOXA 4ICYA 2IFQB 2GSTA 2PUKC 3TRPA 3GKXA 4EDYA 5A1NB 4NAXA 1K0AA 1TK5B 1AW9A 3ZRDA 3HY2A 5ELAA 1UA5A 2HNLA 3GUSA 1GUHA 1F2EA 5G5FA 3F8UA 4ACSA 5CO3A 3HJMA 4O32A 4Z2RA 4O7HA 2FY6A 1LJRA 4ZB9A 1JHBA 1YQ1A 2YWIA 5IM9A 3F9UA 1TU8A 2HSNB 3S9FA 4MJBA 1XW6A 3A5IA 2O8VB 4LLRA 2MMZA 2C3QA 2DBCA 4K2XA 4WF4A 1R7HA 2PU9C 3IDVA 4OMVA 3HKRA 4V2NA 1Q98A 2X8GA 3LFLA 1Z3EA 3VPQA 2ON5A 2CVKA 3TRXA 3QR6A 13GSA 3KMOA 2HXKA 4DVCA 2L5LA 2V41A 1QFNA 1WE0A 3KMNA 3DVXA 3E0UA 1A24A 3EPTA 2N5FA 3ZTLA 4DSQA 2L4CA 1A8LA 4X0XA 2GZYA 2R2JA 1GRXA 4JZQA 5GAND 1OVNA 3M9JA 1NHOA 3GL5A 4P3YB 4POKA 1N2AA 1YVLA 4ZB6A 6GSXA 1VF3A 2CAQA 4AJ6A 4RQXA 3QCPA 3IAM2 3LW9A 2B3SA 3G7IA 4K0NA 2H1BA 4YH2A 4ECIA 4Z2UA 3KXOA 5G30A 4XCSA 4BVYB 2IMKA 3HD5A 2L57A 3HHVA 2HE3A 3CYNA 1U88A 3GMFA 5DALB 4EUYA 4N10A 5C00A 4MDCA 3EINA 1U87A 1IYHA 4AF2A 4WKWA 5IMVA 4HEA2 2HT9A 4N0ZA 2DLXA 2VUPA 3GKKA 4NXIA 2F51A 1GSDA 1A0RP 1DUGA 4FIWA 2CX4A 2WZ9A 4MJCA 3QOUA 4MF6A 2P5RA 1XZOA 2R3XA 1OKDA 2B1LA 1M2DA 4TR1B 3MWHA 2VD0A 2VCTA 4JE1A 4G0KA 3M8NA 4K1FA 2C0DA 3IC8A 4PUFC 2YJ7A 4ULXA 1QK8A 1USBA 5CRHA 2JZRA 1VF1A 2VCXA 1VGLA 3HMJG 2YWNA 1PA3A 3BJ5A 2X49A 3LGCA 3ZIVA 4AJ7A 5HFKA 1PMTA 2IWTA 1FB6A 2QA1A 4G0LA 3GYKA 1B48A 2V1MA 11GSA 1S3CA 2HSYA 3VFIA 4KDUA 2QGVA 1B9YC 1MD3A 1ZYPA 4YQMA 3H4KA 3TJKA 4KCEA 3CTGA 1G6YA 5D96A 1FB0A 1Z9HA 3I6AA 4MJAA 5DCGA 1EOHA 5DQSA 2V32A 3QAWA 4O5RA 5ECLB 1S3AA 3EU4A 4K5SA 1O8WA 2EIQA 2YWMA 5B8BA 4AI6A 5KOWA 1FHEA 2OBKA 4TR3A 4BPYA 2DJ3A 2JZSA 3WGDA 2C3TA 2N5BA 1SJIA 3VI5A 4YKGA 1ZYEA 5J9BA 4G01A 4TR4A 4WEYA 3L9UA 4BWSA 2R6KA 1TRWA 2QC7A 2X8CA 1XBSA 1Z6NA 2E2MA 1KNGA 4PURA 2CV4A 5IMFA 4ZL7A 4KX4A 16GSA 3PPUA 5HFGA 4O92A 2QA2A 5G1LA 1EV4A 2IIYA 2VO4A 2AUVA 3DMLA 4F2IA 4IN0A 2JSYA 3NIVA 4K6XA 4L8EA 4BVXB 2FA8A 3KP9A 2LRTA 1URMA 1VF2A 1OAZA 3N9JA 2OA7A 2OACA 4IELA 3KTBA 2YNXA 2MBSA 2B6MA 2K6VA 4MA9A 3TJJA 2H8LA 4JEDA 2M46A 3L0HA 1GLPA 4JU5A 3FRCA 1PKWA 4QMKA 2VL2A 1AC1A 4J2FA 4HZ2A 5ECHB 4WXTA 4NMUA 3C1RA 1F37A 2OE0A 2MZCA 2CZ3A 2MMOA 1ERWA 2YZHA 3LXZA 3EMPA 1FVKA 4XHMA 2RIIA 2VCQA 2H1GA 2JSZA 10GSA 1WMJA 5D93A 1MTCA 2V6KA 3OR5A 12GSA 3RPNA 4GTUA 3HZ4A 3HVSA 4WETA 2DKIA 5J47A 1BQ7A 2I9HA 4MZBA 3GSTA 2PN8A 4WBRD 3V1WA 4K7NA 1PKZA 3L9VA 3NZNA 1DE1A 1OC9A 1V58A 1YF1A 1KBNA 2HRFA 2YV7A 4N3ZA 3F63A 4IP6A 1TRVA 4MPGA 1WP0A 1GTAA 4NHWA 4HZ4A 1XWGA 1TK0B 4AKIA 1EEMA 1SD8A 2REMA 4E8EA 3A2VA 5CYYA 2C0GA 4TN8A 1VF4A 1AQWA 3PH9A 1XCCA 1NW2A 5JWQB 2JL4A 5FWGA 2NBSA 5GAPD 3EC3A 5DCHA 5CAXA 3IA1A 2CVBA 4FYCA 3M9KA 4ZBBA 2GVPA 1AQVA 1U6TA 2CQ9A 2FWFA 2AB6A 1MDIA 4WBJA 5JWOB 3F4TA 5CP1A 3FY7A 4IS0A 4ZILA 3G7YA 4MNNA 1JFUA 1HNAA 4MCUA 3IE3A 3GRXA 4Z2TA 2NTOA 2HYXA 4XRDA 3TJBA 2JU5A 1J0FA 1K3OA 1TXUA 1AIUA 1B9XC 4I8BA 1N8JA 4IVFA 1MDJA 1WPIA 1SL1B 1W89A 3EVIA 3FMWA 3GA4A 3UL3A 5FHIA 2E7PA 3CRTA 1M2AA 2HFDA 3I69A 5F05A 3CRUA 3CSHA 1SKSB 2XBQA 1GSFA 1GNWA 5CRWA 5IMCA 1WWJA 3ISOA 4X1UA 2VAFA 4KAEA 1SVMA 2C80A 5DAKA 4MF7A 4MK3A 4N11A 2JZTA 1YJ6A 2IMDA 2RM5A 1F9MA 2PPTA 3RDWA 5EVOA 22GSA 4CW9A 4KSOA 2QKEA 1M9BA 3ZREA 2F8FA 3GTUB 2DC5A 2L59A 4A5PA 4ECCA 5INYA 3F4RA 3IOSA 4IGJA 4AKXB 2AAWA 3Q19A 2LJAA 1F6MC 2VLVA 3CTFA 6GSVA 4CY6A 3DD3A 4I6XA 5EPFA 2GSSA 4D73B 2GS3A 2I4AA 3U6VA 5COHA 1OC3A 2RUEA 3APSA 2B5EA 1T4ZA 2CVDA 1EZKA 1OC8A 2DJ1A 1OC9B 3RAZA 1XOBA 4EDZA 2X8HA 2J23A 4ILFA 4GF0A 4ML1A 4USSA 1YDKA 5F07A 3DRNA 4TW5A 3MDKA 3HDCA 3ZZXA 4OCFA 3C1SA 5KN0A 1XW5A 1I5GA 2XBIA 3DWVA 2YPMA 3KH7A 3GKNA 1ERVA 3TRQA 1DE2A 1GSEA 3TOUA 3TGZA 2RUFA 1YKAA 4RI7A 1R5AA 2C1YA 2HSMA 2OE1A 3AY8A 3MAKA 1T1VA 4F0BA 3D21A 5CRDA 1DSBA 3GN3A 4V2MA 1Z7PA 3BBYA 5IQYA 3C71A 4PNFA 1OKTA 4OFMA 2H71A 1BJXA 3IC4A 5G31A 1GUKA 4HQZA 1FO5A 2H1LA 2XC2A 4JR6A 5IMDA 4ZBDA 1GNEA 5B6MA 4ZB7A 2A2SA 4ML6A 4NHZA 2E2GA 3IV4A 5GSSA 4CHSA 3HA9A 3F6FA 4JBBA 5KEJA 2WGRA 5DAKB 3WYWA 3U5RE 5J40A 2A4VA 4HU7A 1PX7A 5DBQA 5B6NA 2H0IA 4AKHA 5EY6A 3TU3B 2IJYA 1Z5YE 4L0WA 1PQNA 1GP1A 2ZNMA 2XHFA 20GSA 1SKWB 4MPFA 5JWRB 3QMXA 3ME7A 4EKZA 2GQKA 3VI7A 4F82A 1GSSA 3UOMA 4ZXGA 2LUSA 2HZEB 1SYXA 4FO5A 2LTKA 3P8WA 3TKSC 2H73A 4FYUA 2H6ZA 3QD9A 2C8UA 3GHAA 3RHCA 3QAVA 2LSTA 3EYTA 3N5OA 3GFKA 4XS4A 4HJ2A 3IHGA 5D9TA 2ZUPA 5A5HA 2UZ8A 1JZRA 4KDXA 5IPHA 4IHUA 5DQYA 3I9V2 1K3YA 2AYTA 3IR4A 3HJOA 3QFBC 1LU4A 5CREA 1EGRA 1GUMA 1O85A 1G7OA 1TW9A 4F03A 3LJRA 1QXHA 4RQRA 1W4VA 4YAPA 4AJ8A 1M0UA 1GL8A 1KTEA 4K0GA 1ERTA 2B5YA 3MSZA 4BL7A 3APOA 3P90A 4IQAA 1TJDA 2H1AA 2DJ0A 5BMUA 1CQGA 1E6BA 2AHEA 4OCEA 4ECJA 4IP1A 4IBPA 3WGEA 3BCKA 2PVQA 2DJ2A 1QQ2A 2HSMB 3TJFA 4XIHA 1ZYQB 4I5QA 4ZBAA 6GSUA 3D0ZA 2ON7A 1T4YA 2YV9A 5H5QA 1RW1A 1JZDA 4KH7A 2K18A 1BX9A 2C3NA 3P2AA 4V1Ap 3L78A 1R26A 2VKZG 5G1KA 1X9MB 1BG5A 4K5RA 4XS1A 2GT5A 5IPGA 1SL2B 1AQXA 2LNSA 3WGXA 1FOVA 1H75A 3ZLPA 2V2GA 4K9ZA 4I97A 2HLSA 4KNDA 5AGYA 2H6YA 2CA8A 3F3RA 1WIKA 2D2ZA 2Z9SA 1PSQA 2OE3A 5JCWA 1ZOFA 2DIZA 4KUNA 1O7UA 4MLYA 2CZ2A 1EEJA 4X43A 4MP4A 2WRTA 1ZGNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PNG A;  18GS A;  3TDG A;  4K8M A;  5ECP B;  3UVH A;  4EF0 A;  2WFC A;  1SKR B;  2PBJ A;  4ISD A;  3ZIJ A;  1EGO A;  3FK8 A;  5LD0 A;  5GST A;  3A3T A;  1PN9 A;  1T7P B;  4QL9 A;  2YN1 A;  2XPD A;  2OKA A;  8GSS A;  5B8A A;  1U3I A;  5L71 A;  5C04 A;  4OO5 A;  1FG4 A;  2P31 A;  4V1A g;  1AAZ A;  3PGT A;  3IAS 2;  2L6D A;  5G2Z A;  4XS4 B;  2WB9 A;  1DBY A;  5IO2 A;  5F8B A;  1TXX A;  2KUC A;  1A2L A;  4IKH A;  1SJ6 A;  2KLX A;  3RHB A;  4LL4 B;  3H8Q A;  2FGX A;  2WCI A;  2I81 A;  2WS2 A;  2GGT A;  2ZCT A;  3VWW A;  4Q5R A;  3LXT A;  4FYB A;  4TRX A;  2X99 A;  2JAC A;  1SEN A;  3A2X A;  2I3Y A;  3IHQ A;  1QMV A;  14GS A;  1GTI A;  4OWY A;  3FZ5 A;  3HJP A;  5ECQ B;  2P0G A;  4EO3 A;  4G0I A;  1ABA A;  3LYP A;  4QL7 A;  2VCV A;  2LKU A;  1G7E A;  2EC4 A;  4HDE A;  1X0R A;  1T3B A;  3FYG A;  2H76 A;  2R4V A;  4HOJ A;  1KEB A;  2K8V A;  2HSH A;  3ZFB A;  2H75 A;  5J5N A;  1J9B A;  3KZQ A;  5HR3 A;  2DJJ A;  2FD3 A;  5D9W A;  2LNT A;  1AUC A;  3ED3 A;  4L5L A;  3Q18 A;  3UIW A;  1FVJ A;  4KW6 A;  3ZMK A;  2NVL A;  1PGT A;  1MDK A;  5H5S A;  3F6D A;  4LMW A;  3GH6 A;  2K9F A;  1JLV A;  3ZFL A;  1T8E B;  2WJU A;  1GSU A;  2DIY A;  3CSJ A;  2DMM A;  4EXJ A;  2OBI A;  4GWR A;  2H30 A;  1SK1 A;  3PR8 A;  5AN1 A;  4ZL9 A;  1HQO A;  1OE8 A;  3WT1 A;  4POM A;  2VD1 A;  5ECM B;  3LEF A;  2H74 A;  4KCA A;  5IOW A;  2PGT A;  4K7I A;  2O89 A;  3WT2 A;  3TOT A;  1K0D A;  2RLI A;  5A5K A;  3H93 A;  1JZO A;  1X9W B;  1PL1 A;  3RBT A;  5D73 A;  5F06 A;  2FLS A;  3LOR A;  3LYK A;  1EOG A;  2L4Q A;  5KN3 A;  4MAB A;  1OE7 A;  2MMN A;  5ECI B;  2FCH A;  1HNB A;  4YQV A;  5FT3 A;  1WRY A;  2YAN A;  1TDI A;  4BWQ A;  5ECS A;  3TKP A;  5LCZ A;  3W8S A;  2GTU A;  1A8Y A;  1UVZ A;  1JZW A;  1A0F A;  2I1U A;  3DIE A;  2KHP A;  2RM6 A;  1K0M A;  3FR3 A;  1UC7 A;  1XOA A;  3KD0 A;  1ZMA A;  2HI7 A;  2KP1 A;  4KGI A;  3D4T A;  3O6T A;  4TVE A;  4ECB A;  1XIY A;  3FR6 A;  2L5O A;  5KN1 A;  2NPB A;  1TK8 B;  1SK2 A;  4PXO A;  4FQU A;  3ZYW A;  4KSM A;  2DML A;  5DJL A;  5E4W A;  3H79 A;  5J3R A;  4PQI A;  4QQ7 A;  4XTS A;  3D5J A;  1V57 A;  1LBK A;  4ZB8 A;  5ID2 A;  3SWL A;  4J57 E;  2FUG 2;  2GSR A;  2LQQ A;  2B5X A;  3FEU A;  2WDU A;  2O85 A;  3TKQ A;  3TKR A;  1HNC A;  4POL A;  1XWB A;  1EV9 A;  2FHE A;  4WF5 A;  1B4Q A;  3EUR A;  3M0F A;  1TRU A;  3I43 A;  1PRX A;  1A2M A;  4Q5F A;  1PL2 A;  2GQM A;  3FZ4 A;  1YZX A;  3TJG A;  1XWC A;  17GS A;  3SBC A;  1V98 A;  2LJR A;  4G9H A;  4RI6 A;  5ECN B;  4K7O A;  5IMZ A;  3TKS E;  4BVY A;  2VIM A;  3O76 A;  3C7M A;  3GSS A;  4HQS A;  2BMX A;  2VCZ A;  1FW1 A;  4PQH A;  4NPB A;  3O3T A;  1S3D A;  2H72 A;  5IMA A;  2B7K A;  1CQH A;  3HYP A;  4GLT A;  1RQM A;  5ELG A;  1K0N A;  4XS6 A;  4PUA A;  5F0G A;  6GST A;  2LRC A;  3W8J A;  5GZZ B;  2G2Q A;  3HCZ A;  3KM6 A;  3DYR A;  4GRF A;  4K2D A;  5ECK B;  5DVB A;  5E59 A;  1WOU A;  2YJH A;  5A4V A;  4L0U A;  1BED A;  1GH2 A;  3QPM A;  4PGT A;  3UVT A;  5J9C A;  4G10 A;  2M80 A;  1T00 A;  2MYG A;  2HZF A;  1X5E A;  2GLR A;  2H1D A;  5HR1 A;  4LA1 A;  4NWY A;  2GQL A;  3ERG A;  4IQ1 A;  2IN3 A;  5ECO B;  5A4W A;  4GQC A;  5JCG A;  4N0V A;  2GSQ A;  5H5R A;  1EP7 A;  2X64 A;  4PTS A;  3ERW A;  3ZIT A;  2FNO A;  2OJL A;  3EMX A;  2C0E A;  1SD9 A;  4Q5Q A;  4WR4 A;  7GSS A;  4TXO A;  1B4P A;  1A23 A;  3J7Y b;  3A5W A;  4KE3 A;  5ABR A;  1BYE A;  4DEJ A;  5D8I A;  1QGV A;  1EP8 A;  1NSW A;  2VLT A;  5CRG A;  4CDO A;  2LV3 A;  5ID2 B;  3QAG A;  1G0T A;  1HD2 A;  3BD2 A;  4GSN A;  3GKM A;  3Q74 A;  4JRR A;  2VCW A;  6GSS A;  1Y25 A;  4TOP A;  1FAA A;  4MH2 A;  1V2A A;  1WJK A;  3ZL5 A;  4KDY A;  1GTB A;  4KA0 A;  4Z7X A;  3KGK A;  2HRN A;  3KCM A;  2H6X A;  2GZZ A;  3E9J B;  3MNG A;  1YF0 A;  4F0C A;  4G2E A;  3APQ A;  1Z6M A;  2GDR A;  1ZCP A;  4BVX A;  3KP8 A;  4HU9 A;  2QSI A;  3PIN A;  2TRC P;  1MEK A;  3C8E A;  2A2R A;  3G9B A;  4MJE A;  2M72 A;  2VM1 A;  4LL1 B;  4EVM A;  3P7X A;  2VL2 C;  3LSZ A;  1V9W A;  2YZU A;  1HYU A;  5IIZ A;  5LNK e;  2H19 A;  1TI3 A;  1YY7 A;  4I2U A;  6GSW A;  3UAP A;  1THX A;  1SJZ A;  3DEX A;  4ID0 A;  5ECR B;  2OAD A;  3H1N A;  3KEB A;  2B7J A;  1F3B A;  5DJM A;  1AXD A;  1YEX A;  5HR2 A;  4POB A;  2HQT A;  1O6J A;  3TCO A;  3IK9 A;  2N5A A;  1X5D A;  3J7Y k;  1H4O A;  2G0F A;  2TRX A;  3D6I A;  4GSS A;  3K8N A;  3LG6 A;  5AIS A;  3DGQ A;  5HQP A;  5DDL A;  2PVO C;  5HFI A;  4MMM A;  4E8H A;  3EWL A;  3ZVJ A;  2H70 A;  1IYI A;  2R5G A;  2YP6 A;  1M9A A;  1GSQ A;  2PWJ A;  5D9V A;  3WD6 A;  1E2Y A;  1X9S B;  3UMA A;  3QFA C;  3FKF A;  4I2T A;  3G7J A;  1J08 A;  4TXV A;  3VPT A;  1X5C A;  3L4N A;  1BAY A;  1GWC A;  3LWA A;  3HXS A;  2K8S A;  1ZL9 A;  1XWK A;  4TXO B;  2HRK A;  4RUV A;  4KB3 A;  1O73 A;  4OFN A;  2PMT A;  4EE0 A;  2KOK A;  1Q4J A;  2CX3 A;  2YOI A;  1VRS D;  2FWE A;  3DKS A;  1NHY A;  1O8X A;  1K0C A;  3Q6O A;  4GCI A;  2GT6 A;  2O7K A;  3GL3 A;  3NOF A;  3UBK A;  1YKC A;  3FW2 A;  4DSS A;  2IL3 A;  1O81 A;  1U3A A;  2CAI A;  3DXB A;  1K3L A;  2VLU A;  1Z7R A;  5J41 A;  3F3Q A;  5IO0 A;  3F0I A;  5ENU A;  3ZVJ D;  3TKS A;  3VWV A;  1RK4 A;  2F9S A;  3CSI A;  1SK0 A;  3FHK A;  4Q5N A;  4TR0 A;  3BCI A;  1G6W A;  3R2Q A;  1I9D A;  2BJX A;  1QUW A;  2VL9 A;  4PQ1 A;  1XVQ A;  3QDN A;  4BL7 B;  2CT6 A;  3GUR A;  1TRS A;  3GV1 A;  3IRA A;  5AIX A;  3GNJ A;  1JLW A;  2AJQ B;  4J56 E;  1GTU A;  1GUL A;  1SU9 A;  3GTU A;  5B7C A;  1ACV A;  4MZW A;  4OO4 A;  4MZC A;  3UAR A;  2LQO A;  3HZ8 A;  5CNW A;  3FZA A;  5IOX A;  6GSY A;  1YEP A;  3VWU A;  2H0G A;  2LRN A;  3C73 A;  1OYJ A;  3A2W A;  2PER A;  2R37 A;  2H0H A;  3IXR A;  3E3E A;  4L5O A;  1XPV A;  4TKY A;  4D73 A;  2TIR A;  2IMI A;  1PX6 A;  4N30 A;  2B1K A;  3VUR A;  3TB2 A;  3JCM L;  4AGS A;  2LJK A;  4GXZ A;  4NV5 A;  2L6C A;  3KH9 A;  2C4J A;  1ZZY A;  1XWA A;  2AV4 A;  4HS1 A;  3CXG A;  4DSR A;  2EIR A;  1M7T A;  1TP9 A;  2P5Q A;  1Y6E A;  3US3 A;  4MH3 A;  3KJY A;  3IPZ A;  3HVX A;  3M3M A;  2H01 A;  1K0O A;  2FWH A;  2H66 A;  2F8A A;  3GH9 A;  4GQF A;  3L9S A;  3VLN A;  2HRK B;  4BA7 A;  1GLQ A;  5JCU A;  1MD4 A;  1V40 A;  1ERU A;  2IFQ A;  3UEM A;  2O87 A;  3KTL A;  3ME8 A;  1ILO A;  4MF5 A;  3W6G A;  1XXU A;  1K0B A;  2V6O A;  3GX0 A;  4OFT A;  3TUE A;  1EWX A;  4DSS B;  5G5E A;  4IJ3 A;  4HJM A;  2DJK A;  3F4S A;  4KF9 A;  1THO A;  2LEG A;  2IMF A;  3BOA A;  4GST A;  2MBT A;  1R5P A;  3LQ7 A;  2KP2 A;  3HVV A;  4LMV A;  4XRA A;  2MMA A;  3D22 A;  1B8X A;  4YQU A;  3M1G A;  5KN2 A;  3UBL A;  4ZIJ A;  4IW9 A;  2F3M A;  1M2B A;  3ZML A;  1TKD B;  4JR4 A;  2WUL A;  3DVW A;  4HUA A;  5AIV A;  2BTO T;  4F9Z A;  4EC0 A;  4NV2 A;  3VWX A;  4HI7 A;  3CBU A;  3EU3 A;  1XFL A;  3CMI A;  4YAV A;  2EIO A;  5EL8 A;  1C72 A;  3GIX A;  2VL3 A;  1M99 A;  5J4U A;  2HZE A;  2VOC A;  2XPE A;  1XVW A;  3D4M A;  4OD7 A;  2HRA A;  1TTZ A;  3IBH A;  1SYR A;  1UN2 A;  1TOF A;  1F3A A;  1A2J A;  2C0F A;  2DSA A;  4IJI A;  4WR5 A;  1TI1 A;  1PD2 1;  4ZL8 A;  5DAL A;  3GX8 A;  4V2L A;  1ML6 A;  2LS5 A;  3KIJ A;  3R3E A;  3EE2 A;  2YWO A;  1GSY A;  2ES7 A;  3RPP A;  1TU7 A;  3UJ1 A;  5HR0 A;  5A4U A;  2FA4 A;  3FZ9 A;  1NM3 A;  1ON4 A;  4PX1 A;  1SL0 B;  4G19 A;  3IK7 A;  2J9H A;  5D9X A;  4H86 A;  2E0Q A;  2IPA A;  3FR9 A;  1XW9 A;  2FWG A;  4EL1 A;  4FH8 A;  1R4W A;  2ALB A;  19GS A;  2VM2 A;  4TR1 A;  2JAD A;  2GZP A;  3VK9 A;  2NDO A;  3ERF A;  9GSS A;  2YCD A;  1ST9 A;  2IME A;  2IFQ B;  2GST A;  2PUK C;  3TRP A;  3GKX A;  4EDY A;  4NAX A;  1K0A A;  1TK5 B;  1AW9 A;  3ZRD A;  3HY2 A;  5ELA A;  1UA5 A;  2HNL A;  3GUS A;  1GUH A;  1F2E A;  5G5F A;  3F8U A;  4ACS A;  5CO3 A;  3HJM A;  4O32 A;  4O7H A;  2FY6 A;  1LJR A;  4ZB9 A;  1JHB A;  1YQ1 A;  2YWI A;  5IM9 A;  3F9U A;  1TU8 A;  2HSN B;  3S9F A;  4MJB A;  1XW6 A;  2O8V B;  4LLR A;  2MMZ A;  2C3Q A;  2DBC A;  4WF4 A;  1R7H A;  2PU9 C;  3IDV A;  4OMV A;  3HKR A;  4V2N A;  1Q98 A;  2X8G A;  3LFL A;  1Z3E A;  3VPQ A;  2ON5 A;  2CVK A;  3TRX A;  3QR6 A;  13GS A;  3KMO A;  2HXK A;  4DVC A;  2L5L A;  2V41 A;  1QFN A;  1WE0 A;  3KMN A;  3DVX A;  3E0U A;  1A24 A;  2N5F A;  3ZTL A;  4DSQ A;  2L4C A;  1A8L A;  4X0X A;  2GZY A;  2R2J A;  1GRX A;  4JZQ A;  5GAN D;  1OVN A;  3M9J A;  1NHO A;  3GL5 A;  4P3Y B;  4POK A;  1N2A A;  4ZB6 A;  6GSX A;  1VF3 A;  2CAQ A;  4AJ6 A;  4RQX A;  3QCP A;  3IAM 2;  2B3S A;  3G7I A;  4K0N A;  2H1B A;  4YH2 A;  4ECI A;  3KXO A;  5G30 A;  4XCS A;  4BVY B;  2IMK A;  3HD5 A;  2L57 A;  3HHV A;  2HE3 A;  3CYN A;  1U88 A;  3GMF A;  5DAL B;  4EUY A;  4N10 A;  5C00 A;  4MDC A;  3EIN A;  1U87 A;  1IYH A;  4AF2 A;  4WKW A;  5IMV A;  4HEA 2;  2HT9 A;  4N0Z A;  2DLX A;  2VUP A;  3GKK A;  4NXI A;  2F51 A;  1GSD A;  1A0R P;  1DUG A;  4FIW A;  2CX4 A;  2WZ9 A;  4MJC A;  3QOU A;  4MF6 A;  2P5R A;  1XZO A;  2R3X A;  1OKD A;  2B1L A;  1M2D A;  4TR1 B;  3MWH A;  2VD0 A;  2VCT A;  4JE1 A;  4G0K A;  3M8N A;  4K1F A;  2C0D A;  3IC8 A;  4PUF C;  2YJ7 A;  4ULX A;  1QK8 A;  1USB A;  5CRH A;  2JZR A;  1VF1 A;  2VCX A;  1VGL A;  2YWN A;  1PA3 A;  3BJ5 A;  3LGC A;  3ZIV A;  4AJ7 A;  5HFK A;  1PMT A;  2IWT A;  1FB6 A;  4G0L A;  3GYK A;  1B48 A;  2V1M A;  11GS A;  1S3C A;  2HSY A;  3VFI A;  4KDU A;  2QGV A;  1B9Y C;  1MD3 A;  4YQM A;  3H4K A;  3TJK A;  4KCE A;  3CTG A;  1G6Y A;  5D96 A;  1FB0 A;  1Z9H A;  3I6A A;  4MJA A;  5DCG A;  1EOH A;  5DQS A;  2V32 A;  3QAW A;  4O5R A;  5ECL B;  1S3A A;  3EU4 A;  1O8W A;  2EIQ A;  2YWM A;  5B8B A;  1FHE A;  2OBK A;  4TR3 A;  4BPY A;  2DJ3 A;  2JZS A;  3WGD A;  2C3T A;  2N5B A;  1SJI A;  3VI5 A;  1ZYE A;  5J9B A;  4TR4 A;  4WEY A;  3L9U A;  4BWS A;  2R6K A;  1TRW A;  2QC7 A;  2X8C A;  1XBS A;  1Z6N A;  2E2M A;  1KNG A;  4PUR A;  2CV4 A;  5IMF A;  4ZL7 A;  4KX4 A;  16GS A;  3PPU A;  5HFG A;  4O92 A;  5G1L A;  1EV4 A;  2IIY A;  2VO4 A;  2AUV A;  3DML A;  4F2I A;  4IN0 A;  2JSY A;  3NIV A;  4K6X A;  4L8E A;  4BVX B;  2FA8 A;  3KP9 A;  2LRT A;  1URM A;  1VF2 A;  1OAZ A;  3N9J A;  2OA7 A;  2OAC A;  4IEL A;  3KTB A;  2YNX A;  2MBS A;  2B6M A;  2K6V A;  4MA9 A;  3TJJ A;  2H8L A;  4JED A;  2M46 A;  3L0H A;  1GLP A;  4JU5 A;  3FRC A;  1PKW A;  2VL2 A;  1AC1 A;  4J2F A;  4HZ2 A;  5ECH B;  4WXT A;  4NMU A;  3C1R A;  1F37 A;  2OE0 A;  2MZC A;  2CZ3 A;  2MMO A;  1ERW A;  2YZH A;  3LXZ A;  3EMP A;  1FVK A;  4XHM A;  2RII A;  2VCQ A;  2H1G A;  2JSZ A;  10GS A;  1WMJ A;  5D93 A;  1MTC A;  2V6K A;  3OR5 A;  12GS A;  3RPN A;  4GTU A;  3HZ4 A;  3HVS A;  4WET A;  1BQ7 A;  2I9H A;  4MZB A;  3GST A;  2PN8 A;  4WBR D;  3V1W A;  4K7N A;  1PKZ A;  3L9V A;  3NZN A;  1DE1 A;  1OC9 A;  1V58 A;  1YF1 A;  1KBN A;  2HRF A;  2YV7 A;  3F63 A;  4IP6 A;  1TRV A;  4MPG A;  1WP0 A;  1GTA A;  4NHW A;  4HZ4 A;  1XWG A;  1TK0 B;  1EEM A;  1SD8 A;  2REM A;  4E8E A;  3A2V A;  5CYY A;  2C0G A;  4TN8 A;  1VF4 A;  1AQW A;  3PH9 A;  1XCC A;  1NW2 A;  5JWQ B;  2JL4 A;  5FWG A;  2NBS A;  5GAP D;  3EC3 A;  5DCH A;  5CAX A;  3IA1 A;  2CVB A;  4FYC A;  3M9K A;  4ZBB A;  2GVP A;  1AQV A;  1U6T A;  2CQ9 A;  2FWF A;  2AB6 A;  1MDI A;  4WBJ A;  5JWO B;  3F4T A;  5CP1 A;  3FY7 A;  4IS0 A;  4ZIL A;  3G7Y A;  1JFU A;  1HNA A;  4MCU A;  3IE3 A;  3GRX A;  2NTO A;  2HYX A;  4XRD A;  3TJB A;  2JU5 A;  1J0F A;  1K3O A;  1AIU A;  1B9X C;  4I8B A;  1N8J A;  4IVF A;  1MDJ A;  1WPI A;  1SL1 B;  1W89 A;  3EVI A;  3GA4 A;  3UL3 A;  5FHI A;  2E7P A;  3CRT A;  1M2A A;  2HFD A;  3I69 A;  5F05 A;  3CRU A;  3CSH A;  1SKS B;  2XBQ A;  1GSF A;  1GNW A;  5CRW A;  5IMC A;  1WWJ A;  3ISO A;  4X1U A;  2VAF A;  4KAE A;  2C80 A;  5DAK A;  4MF7 A;  4MK3 A;  4N11 A;  2JZT A;  1YJ6 A;  2IMD A;  2RM5 A;  1F9M A;  2PPT A;  3RDW A;  5EVO A;  22GS A;  4CW9 A;  4KSO A;  2QKE A;  1M9B A;  3ZRE A;  2F8F A;  2DC5 A;  3GTU B;  2L59 A;  4ECC A;  5INY A;  3F4R A;  3IOS A;  4IGJ A;  2AAW A;  3Q19 A;  2LJA A;  1F6M C;  2VLV A;  3CTF A;  6GSV A;  3DD3 A;  4I6X A;  5EPF A;  2GSS A;  4D73 B;  2GS3 A;  2I4A A;  3U6V A;  5COH A;  1OC3 A;  2RUE A;  3APS A;  2B5E A;  1T4Z A;  2CVD A;  1EZK A;  1OC8 A;  2DJ1 A;  1OC9 B;  3RAZ A;  1XOB A;  4EDZ A;  2X8H A;  2J23 A;  4ILF A;  4GF0 A;  4ML1 A;  4USS A;  1YDK A;  5F07 A;  3DRN A;  4TW5 A;  3MDK A;  3HDC A;  3ZZX A;  4OCF A;  3C1S A;  5KN0 A;  1XW5 A;  1I5G A;  2XBI A;  3DWV A;  2YPM A;  3KH7 A;  3GKN A;  1ERV A;  3TRQ A;  1DE2 A;  1GSE A;  3TOU A;  3TGZ A;  2RUF A;  1YKA A;  4RI7 A;  1R5A A;  2C1Y A;  2HSM A;  2OE1 A;  3AY8 A;  3MAK A;  1T1V A;  4F0B A;  3D21 A;  5CRD A;  1DSB A;  3GN3 A;  4V2M A;  1Z7P A;  3BBY A;  5IQY A;  3C71 A;  4PNF A;  1OKT A;  4OFM A;  2H71 A;  1BJX A;  3IC4 A;  5G31 A;  1GUK A;  4HQZ A;  1FO5 A;  2XC2 A;  4JR6 A;  5IMD A;  4ZBD A;  1GNE A;  5B6M A;  2A2S A;  4ML6 A;  4NHZ A;  2E2G A;  3IV4 A;  5GSS A;  4CHS A;  3HA9 A;  3F6F A;  4JBB A;  5KEJ A;  2WGR A;  5DAK B;  3WYW A;  3U5R E;  2A4V A;  4HU7 A;  1PX7 A;  5DBQ A;  5B6N A;  2H0I A;  5EY6 A;  2IJY A;  1Z5Y E;  4L0W A;  1PQN A;  1GP1 A;  2ZNM A;  2XHF A;  20GS A;  1SKW B;  4MPF A;  5JWR B;  3QMX A;  3ME7 A;  4EKZ A;  2GQK A;  3VI7 A;  4F82 A;  1GSS A;  3UOM A;  4ZXG A;  2LUS A;  2HZE B;  1SYX A;  4FO5 A;  2LTK A;  3P8W A;  3TKS C;  2H73 A;  4FYU A;  2H6Z A;  3QD9 A;  2C8U A;  3GHA A;  3RHC A;  3QAV A;  2LST A;  3EYT A;  3N5O A;  3GFK A;  4XS4 A;  4HJ2 A;  5D9T A;  2ZUP A;  2UZ8 A;  1JZR A;  4KDX A;  5IPH A;  4IHU A;  5DQY A;  3I9V 2;  1K3Y A;  2AYT A;  3IR4 A;  3HJO A;  3QFB C;  1LU4 A;  5CRE A;  1EGR A;  1GUM A;  1O85 A;  1G7O A;  1TW9 A;  4F03 A;  3LJR A;  1QXH A;  4RQR A;  1W4V A;  4YAP A;  4AJ8 A;  1M0U A;  1GL8 A;  1KTE A;  4K0G A;  1ERT A;  2B5Y A;  3MSZ A;  4BL7 A;  3APO A;  3P90 A;  4IQA A;  1TJD A;  2H1A A;  2DJ0 A;  5BMU A;  1CQG A;  1E6B A;  2AHE A;  4OCE A;  4ECJ A;  4IP1 A;  4IBP A;  3WGE A;  3BCK A;  2PVQ A;  2DJ2 A;  1QQ2 A;  2HSM B;  3TJF A;  4XIH A;  1ZYQ B;  4I5Q A;  4ZBA A;  6GSU A;  3D0Z A;  2ON7 A;  1T4Y A;  2YV9 A;  5H5Q A;  1RW1 A;  1JZD A;  4KH7 A;  2K18 A;  1BX9 A;  2C3N A;  3P2A A;  4V1A p;  3L78 A;  1R26 A;  5G1K A;  1X9M B;  1BG5 A;  4XS1 A;  2GT5 A;  5IPG A;  1SL2 B;  1AQX A;  2LNS A;  3WGX A;  1FOV A;  1H75 A;  3ZLP A;  2V2G A;  4K9Z A;  4I97 A;  2HLS A;  4KND A;  5AGY A;  2H6Y A;  2CA8 A;  3F3R A;  1WIK A;  2D2Z A;  2Z9S A;  1PSQ A;  2OE3 A;  5JCW A;  1ZOF A;  2DIZ A;  4KUN A;  1O7U A;  4MLY A;  2CZ2 A;  1EEJ A;  4X43 A;  4MP4 A;  2WRT A;  1ZGN A; 
#chains in the Genus database with same CATH topology
 4PNG A;  18GS A;  3TDG A;  4K8M A;  5ECP B;  3UVH A;  4EF0 A;  2WFC A;  1SKR B;  2PBJ A;  4ISD A;  3ZIJ A;  1EGO A;  3FK8 A;  5LD0 A;  5GST A;  3A3T A;  1PN9 A;  1T7P B;  4QL9 A;  2YN1 A;  2XPD A;  2OKA A;  8GSS A;  5B8A A;  4CY8 A;  1U3I A;  5L71 A;  5C04 A;  4OO5 A;  1FG4 A;  2P31 A;  4V1A g;  1AAZ A;  3PGT A;  3IAS 2;  2L6D A;  5G2Z A;  4XS4 B;  5A5H B;  2WB9 A;  1DBY A;  5IO2 A;  5F8B A;  1TXX A;  2KUC A;  1A2L A;  4EIQ A;  4IKH A;  1SJ6 A;  2KLX A;  3RHB A;  4LL4 B;  3H8Q A;  2FGX A;  2WCI A;  2I81 A;  2WS2 A;  5J4Y A;  2GGT A;  2ZCT A;  3VWW A;  4Q5R A;  3LXT A;  4X4J A;  4FYB A;  4TRX A;  2X99 A;  2JAC A;  1SEN A;  3A2X A;  2I3Y A;  3IHQ A;  1QMV A;  14GS A;  1GTI A;  4OWY A;  3FZ5 A;  3HJP A;  5ECQ B;  2P0G A;  4EO3 A;  4G0I A;  1ABA A;  3LYP A;  5BMU B;  4QL7 A;  2VCV A;  2LKU A;  1G7E A;  2EC4 A;  4HDE A;  1X0R A;  1T3B A;  2WW0 A;  3FYG A;  2H76 A;  2R4V A;  4HOJ A;  1KEB A;  2K8V A;  2HSH A;  4FXY P;  3ZFB A;  2H75 A;  5J5N A;  1J9B A;  3KZQ A;  5HR3 A;  2DJJ A;  1FOH A;  2FD3 A;  5D9W A;  2LNT A;  1AUC A;  1BG1 A;  3ED3 A;  4L5L A;  3Q18 A;  3UIW A;  1FVJ A;  4KW6 A;  3ZMK A;  2NVL A;  1PGT A;  1MDK A;  5H5S A;  3F6D A;  4LMW A;  3GH6 A;  2K9F A;  1JLV A;  3ZFL A;  1T8E B;  2WJU A;  1GSU A;  2DIY A;  3MIX A;  3CSJ A;  2DMM A;  4EXJ A;  2OBI A;  4GWR A;  2H30 A;  1SK1 A;  3PR8 A;  5AN1 A;  2A2P A;  4ZL9 A;  1HQO A;  1OE8 A;  3WT1 A;  4POM A;  2VD1 A;  5ECM B;  3LEF A;  2H74 A;  4KCA A;  5BRT A;  5IOW A;  2PGT A;  4K7I A;  2O89 A;  3WT2 A;  3TOT A;  1K0D A;  2WW1 A;  5A5K A;  2RLI A;  3H93 A;  1JZO A;  1X9W B;  2EFC A;  1PL1 A;  3RBT A;  5D73 A;  5F06 A;  2FLS A;  3LOR A;  3LYK A;  1EOG A;  2L4Q A;  5KN3 A;  4MAB A;  1OE7 A;  2MMN A;  5ECI B;  2FCH A;  1HNB A;  2WW2 A;  4YQV A;  5FT3 A;  1WRY A;  2YAN A;  1TDI A;  4BWQ A;  5ECS A;  3TKP A;  5LCZ A;  3W8S A;  2GTU A;  1A8Y A;  1UVZ A;  1JZW A;  1A0F A;  2I1U A;  3DIE A;  2KHP A;  2RM6 A;  2OT3 A;  1K0M A;  3FR3 A;  1UC7 A;  1XOA A;  3KD0 A;  1ZMA A;  2HI7 A;  2EFH A;  2KP1 A;  4KGI A;  3D4T A;  3O6T A;  4TVE A;  4ECB A;  1XIY A;  3FR6 A;  2L5O A;  5KN1 A;  2NPB A;  1TK8 B;  1SK2 A;  4PXO A;  4FQU A;  3ZYW A;  4KSM A;  2DML A;  5DJL A;  5E4W A;  3H79 A;  5J3R A;  4PQI A;  4QQ7 A;  4XTS A;  3D5J A;  1V57 A;  1LBK A;  4ZB8 A;  5ID2 A;  3SWL A;  4J57 E;  2FUG 2;  1SVL A;  2GSR A;  2O36 A;  2B5X A;  2LQQ A;  3FEU A;  2WDU A;  2O85 A;  3TKQ A;  3TKR A;  1HNC A;  4POL A;  1XWB A;  1EV9 A;  2FHE A;  4WF5 A;  1B4Q A;  3EUR A;  3M0F A;  1TRU A;  3I43 A;  1PRX A;  1A2M A;  4Q5F A;  1PL2 A;  2GQM A;  3FZ4 A;  1YZX A;  3TJG A;  1XWC A;  17GS A;  3SBC A;  1V98 A;  2LJR A;  1PFO A;  4G9H A;  2R0G A;  4RI6 A;  5ECN B;  4K7O A;  5IMZ A;  3TKS E;  4BVY A;  2VIM A;  3O76 A;  3C7M A;  3GSS A;  4HQS A;  2BMX A;  2VCZ A;  1FW1 A;  4PQH A;  4NPB A;  3O3T A;  1S3D A;  2H72 A;  5IMA A;  2B7K A;  1CQH A;  3HYP A;  4GLT A;  1RQM A;  5A34 A;  5ELG A;  1K0N A;  4XS6 A;  4PUA A;  5F0G A;  6GST A;  5J4V A;  2LRC A;  3W8J A;  5GZZ B;  2G2Q A;  3HCZ A;  3KM6 A;  3DYR A;  4GRF A;  4K2D A;  5ECK B;  5DVB A;  5E59 A;  1WOU A;  2YJH A;  5A4V A;  4L0U A;  1BED A;  1GH2 A;  3QPM A;  4PGT A;  3UVT A;  5J9C A;  4G10 A;  2M80 A;  1T00 A;  2MYG A;  2HZF A;  1X5E A;  2GLR A;  2H1D A;  5HR1 A;  3HVN A;  4LA1 A;  4NWY A;  2GQL A;  3ERG A;  4IQ1 A;  2IN3 A;  5ECO B;  5A4W A;  4GQC A;  5JCG A;  4N0V A;  2GSQ A;  2WZS A;  5H5R A;  1EP7 A;  2X64 A;  4PTS A;  3ERW A;  3ZIT A;  2FNO A;  1I1I P;  2OJL A;  3EMX A;  2C0E A;  1SD9 A;  4Q5Q A;  4WR4 A;  7GSS A;  4TXO A;  1B4P A;  1A23 A;  3J7Y b;  3A5W A;  4KE3 A;  5ABR A;  1BYE A;  2A4H A;  4DEJ A;  5D8I A;  1QGV A;  1EP8 A;  1NSW A;  2VLT A;  5CRG A;  4CDO A;  2LV3 A;  5ID2 B;  3QAG A;  1G0T A;  2DKH A;  1HD2 A;  3BD2 A;  4GSN A;  3GKM A;  3Q74 A;  4JRR A;  2VCW A;  6GSS A;  1Y25 A;  4TOP A;  1FAA A;  4MH2 A;  1V2A A;  1WJK A;  3ZL5 A;  3RFR C;  4KDY A;  1GTB A;  4KA0 A;  4Z7X A;  3KGK A;  2HRN A;  3KCM A;  2H6X A;  2GZZ A;  3E9J B;  3MNG A;  1YF0 A;  4F0C A;  4G2E A;  3APQ A;  1Z6M A;  2GDR A;  1ZCP A;  4BVX A;  3KP8 A;  4HU9 A;  2QSI A;  3PIN A;  2TRC P;  1MEK A;  3C8E A;  2A2R A;  3G9B A;  4MJE A;  2M72 A;  2VM1 A;  4LL1 B;  4EVM A;  3P7X A;  2VL2 C;  3LSZ A;  1V9W A;  2YZU A;  1HYU A;  5IIZ A;  5LNK e;  2H19 A;  1TI3 A;  1YY7 A;  4I2U A;  6GSW A;  3UAP A;  1THX A;  1SJZ A;  3DEX A;  4ID0 A;  5A34 B;  5ECR B;  2OAD A;  3H1N A;  3KEB A;  2B7J A;  1F3B A;  5DJM A;  1AXD A;  1YEX A;  5HR2 A;  4POB A;  2HQT A;  1O6J A;  3TCO A;  3IK9 A;  2N5A A;  1X5D A;  3J7Y k;  1H4O A;  2G0F A;  2TRX A;  3D6I A;  4GSS A;  3K8N A;  3LG6 A;  5AIS A;  3DGQ A;  5HQP A;  5DDL A;  2WVX A;  2PVO C;  5HFI A;  4MMM A;  4E8H A;  3EWL A;  3ZVJ A;  2H70 A;  1IYI A;  2R5G A;  2YP6 A;  1M9A A;  1GSQ A;  2PWJ A;  5D9V A;  3WD6 A;  1E2Y A;  1X9S B;  3UMA A;  3QFA C;  3FKF A;  4I2T A;  3G7J A;  1J08 A;  4TXV A;  3VPT A;  1X5C A;  3L4N A;  1BAY A;  1GWC A;  3LWA A;  4O5Q A;  3HXS A;  2K8S A;  1ZL9 A;  1XWK A;  4TXO B;  2HRK A;  4RUV A;  4KB3 A;  1O73 A;  4OFN A;  2PMT A;  4EE0 A;  2KOK A;  1Q4J A;  2CX3 A;  2EFE A;  2YOI A;  1VRS D;  2FWE A;  3DKS A;  1NHY A;  1O8X A;  1K0C A;  2R0C A;  3Q6O A;  4GCI A;  2GT6 A;  2O7K A;  3GL3 A;  3NOF A;  3UBK A;  1YKC A;  3FW2 A;  4DSS A;  2IL3 A;  1O81 A;  1U3A A;  2CAI A;  3DXB A;  1K3L A;  2VLU A;  4YKF A;  1Z7R A;  5J41 A;  3F3Q A;  5IO0 A;  3F0I A;  5ENU A;  3ZVJ D;  3TKS A;  3VWV A;  2EFD A;  4E68 A;  1RK4 A;  2F9S A;  3CSI A;  3RGB C;  3FHK A;  1SK0 A;  4Q5N A;  4TR0 A;  3BCI A;  1G6W A;  1M3I A;  3R2Q A;  1I9D A;  2BJX A;  1QUW A;  2VL9 A;  4PQ1 A;  1XVQ A;  3QDN A;  4BL7 B;  2CT6 A;  3GUR A;  1TRS A;  3GV1 A;  3IRA A;  5AIX A;  3GNJ A;  1JLW A;  2AJQ B;  4J56 E;  1GTU A;  1GUL A;  4W66 A;  1SU9 A;  3GTU A;  5B7C A;  1ACV A;  4MZW A;  4OO4 A;  4MZC A;  3UAR A;  2LQO A;  3HZ8 A;  5CNW A;  3FZA A;  5IOX A;  6GSY A;  1YEP A;  3VWU A;  4O5U A;  2H0G A;  2LRN A;  3CWG A;  3C73 A;  1OYJ A;  3A2W A;  2PER A;  2R37 A;  2H0H A;  3IXR A;  3E3E A;  4L5O A;  1XPV A;  4TKY A;  4D73 A;  2TIR A;  2IMI A;  1PX6 A;  4N30 A;  1N25 A;  2B1K A;  3VUR A;  3TB2 A;  3JCM L;  4AGS A;  2LJK A;  4GXZ A;  4NV5 A;  2L6C A;  3KH9 A;  2C4J A;  2X4A A;  1S4B P;  1ZZY A;  1XWA A;  2AV4 A;  4HS1 A;  3CXG A;  4DSR A;  2EIR A;  1M7T A;  1TP9 A;  2P5Q A;  1Y6E A;  3US3 A;  4MH3 A;  3KJY A;  3IPZ A;  3HVX A;  3M3M A;  2H01 A;  1K0O A;  2FWH A;  2H66 A;  2F8A A;  3GH9 A;  4GQF A;  3L9S A;  3VLN A;  2HRK B;  4BA7 A;  1GLQ A;  5JCU A;  1MD4 A;  1V40 A;  1ERU A;  2IFQ A;  3UEM A;  2O87 A;  3KTL A;  3ME8 A;  5A1N A;  4GDF A;  1ILO A;  4MF5 A;  3W6G A;  1XXU A;  1K0B A;  2V6O A;  3GX0 A;  4OFT A;  3TUE A;  1EWX A;  1ZYN A;  5G5E A;  4DSS B;  4IJ3 A;  4HJM A;  2DJK A;  3F4S A;  4KF9 A;  1THO A;  2LEG A;  2IMF A;  3BOA A;  4GST A;  2MBT A;  1R5P A;  3LQ7 A;  2KP2 A;  3HVV A;  4LMV A;  4XRA A;  2MMA A;  2HSN A;  3D22 A;  2UV8 G;  1B8X A;  4YQU A;  1XG8 A;  3M1G A;  5KN2 A;  4AKG A;  3UBL A;  4ZIJ A;  4IW9 A;  2F3M A;  1M2B A;  3ZML A;  1TKD B;  4JR4 A;  2WUL A;  3DVW A;  4HUA A;  5AIV A;  2BTO T;  4F9Z A;  4EC0 A;  4NV2 A;  1M3J A;  3VWX A;  4HI7 A;  3CBU A;  3EU3 A;  1XFL A;  3CMI A;  4YAV A;  2EIO A;  5EL8 A;  1C72 A;  2O5V A;  3GIX A;  2VL3 A;  1M99 A;  5J4U A;  2HZE A;  2VOC A;  2XPE A;  1XVW A;  3D4M A;  4OD7 A;  2HRA A;  1TTZ A;  3MYD A;  3IBH A;  1SYR A;  1UN2 A;  1TOF A;  1F3A A;  1Y1U A;  1A2J A;  2C0F A;  2DSA A;  2R0P A;  4IJI A;  4WR5 A;  1TI1 A;  1PN0 A;  1PD2 1;  4ZL8 A;  5DAL A;  3GX8 A;  4V2L A;  1ML6 A;  2LS5 A;  3KIJ A;  3R3E A;  3EE2 A;  2YWO A;  1GSY A;  2ES7 A;  3RPP A;  1TU7 A;  3UJ1 A;  5HR0 A;  5A4U A;  2FA4 A;  3FZ9 A;  1NM3 A;  1ON4 A;  1SVO A;  4EIP A;  4PX1 A;  1SL0 B;  4G19 A;  1BF5 A;  3IK7 A;  2J9H A;  5D9X A;  4H86 A;  2WVY A;  2E0Q A;  2IPA A;  3FR9 A;  1XW9 A;  1YEW C;  2FWG A;  4EL1 A;  4FH8 A;  1R4W A;  2ALB A;  19GS A;  2VM2 A;  4TR1 A;  2JAD A;  2GZP A;  3VK9 A;  2NDO A;  2WW3 A;  3ERF A;  9GSS A;  2YCD A;  1ST9 A;  2IME A;  5KOX A;  4ICY A;  2IFQ B;  2GST A;  2PUK C;  3TRP A;  3GKX A;  4EDY A;  5A1N B;  4NAX A;  1K0A A;  4PI0 C;  1TK5 B;  1AW9 A;  3ZRD A;  3HY2 A;  5ELA A;  1UA5 A;  2HNL A;  3GUS A;  1GUH A;  1F2E A;  5G5F A;  3F8U A;  4ACS A;  5CO3 A;  3HJM A;  4O32 A;  4Z2R A;  4O7H A;  2FY6 A;  1LJR A;  4ZB9 A;  1JHB A;  1YQ1 A;  2YWI A;  5IM9 A;  3F9U A;  1TU8 A;  2HSN B;  3S9F A;  4MJB A;  1XW6 A;  3A5I A;  2O8V B;  4LLR A;  2MMZ A;  2C3Q A;  2DBC A;  4K2X A;  4WF4 A;  1R7H A;  2PU9 C;  3IDV A;  4OMV A;  3HKR A;  4V2N A;  1Q98 A;  2X8G A;  3LFL A;  1Z3E A;  3VPQ A;  2ON5 A;  2CVK A;  3TRX A;  3QR6 A;  13GS A;  3KMO A;  2HXK A;  4DVC A;  2L5L A;  2V41 A;  1QFN A;  1WE0 A;  3KMN A;  3DVX A;  3E0U A;  1A24 A;  3EPT A;  2N5F A;  3ZTL A;  4DSQ A;  2L4C A;  1A8L A;  2O3E A;  4X0X A;  2GZY A;  2R2J A;  1GRX A;  4JZQ A;  5GAN D;  1OVN A;  3M9J A;  2WVZ A;  1NHO A;  3GL5 A;  4P3Y B;  4POK A;  1N2A A;  1YVL A;  4ZB6 A;  6GSX A;  1VF3 A;  2CAQ A;  4AJ6 A;  4RQX A;  3QCP A;  3IAM 2;  3LW9 A;  2B3S A;  3G7I A;  4K0N A;  2H1B A;  4YH2 A;  4ECI A;  4Z2U A;  3KXO A;  5G30 A;  4XCS A;  4BVY B;  2IMK A;  3HD5 A;  2L57 A;  3HHV A;  2HE3 A;  3CYN A;  1U88 A;  3GMF A;  5DAL B;  4EUY A;  4N10 A;  5C00 A;  4MDC A;  3EIN A;  1U87 A;  1IYH A;  4AF2 A;  4WKW A;  5IMV A;  4HEA 2;  2HT9 A;  4N0Z A;  2DLX A;  2VUP A;  3GKK A;  4NXI A;  2F51 A;  1GSD A;  1A0R P;  1DUG A;  4FIW A;  2CX4 A;  1S3R A;  2WZ9 A;  4MJC A;  3QOU A;  4MF6 A;  2P5R A;  1XZO A;  2R3X A;  1OKD A;  2B1L A;  1M2D A;  4TR1 B;  3MWH A;  2VD0 A;  2VCT A;  4JE1 A;  4G0K A;  3M8N A;  4K1F A;  2C0D A;  3IC8 A;  4PUF C;  2YJ7 A;  4ULX A;  1QK8 A;  1USB A;  5CRH A;  2JZR A;  1VF1 A;  2VCX A;  1VGL A;  3HMJ G;  2YWN A;  1PA3 A;  3BJ5 A;  2X49 A;  3LGC A;  3ZIV A;  4AJ7 A;  5HFK A;  1PMT A;  2IWT A;  1FB6 A;  2QA1 A;  4G0L A;  3GYK A;  1B48 A;  2V1M A;  11GS A;  1S3C A;  2HSY A;  3VFI A;  4KDU A;  2QGV A;  1B9Y C;  4HSC X;  1MD3 A;  1ZYP A;  4YQM A;  3H4K A;  3TJK A;  4KCE A;  3CTG A;  1G6Y A;  5D96 A;  1FB0 A;  1Z9H A;  3I6A A;  4MJA A;  5DCG A;  1EOH A;  5DQS A;  2V32 A;  3QAW A;  4O5R A;  5ECL B;  1S3A A;  3EU4 A;  4K5S A;  1O8W A;  2EIQ A;  2YWM A;  5B8B A;  4AI6 A;  5KOW A;  1FHE A;  2OBK A;  4TR3 A;  4BPY A;  2DJ3 A;  2JZS A;  3WGD A;  2C3T A;  2N5B A;  1SJI A;  3VI5 A;  4YKG A;  1ZYE A;  5J9B A;  4G01 A;  4TR4 A;  4WEY A;  3L9U A;  4BWS A;  2R6K A;  1TRW A;  2QC7 A;  2X8C A;  1XBS A;  1Z6N A;  2E2M A;  1KNG A;  4PUR A;  2CV4 A;  5IMF A;  4ZL7 A;  4KX4 A;  16GS A;  3PPU A;  5HFG A;  4O92 A;  2QA2 A;  5G1L A;  1EV4 A;  2IIY A;  2VO4 A;  2AUV A;  3DML A;  4F2I A;  4IN0 A;  2JSY A;  3NIV A;  4K6X A;  4L8E A;  4BVX B;  2FA8 A;  3KP9 A;  2LRT A;  1URM A;  1VF2 A;  1OAZ A;  3N9J A;  2OA7 A;  2OAC A;  4IEL A;  3KTB A;  2YNX A;  2MBS A;  2B6M A;  2K6V A;  4MA9 A;  3TJJ A;  2H8L A;  4JED A;  2M46 A;  3L0H A;  1GLP A;  4JU5 A;  3FRC A;  1PKW A;  4QMK A;  4PI2 C;  2VL2 A;  1AC1 A;  4J2F A;  4HZ2 A;  5ECH B;  4WXT A;  4NMU A;  3C1R A;  1F37 A;  2OE0 A;  2MZC A;  2CZ3 A;  2MMO A;  1ERW A;  2YZH A;  3LXZ A;  3EMP A;  1FVK A;  4XHM A;  2RII A;  2VCQ A;  2H1G A;  2JSZ A;  10GS A;  1WMJ A;  5D93 A;  1MTC A;  2V6K A;  3OR5 A;  12GS A;  3RPN A;  2WVX B;  4GTU A;  3HZ4 A;  3HVS A;  4WET A;  2DKI A;  5J47 A;  1BQ7 A;  2I9H A;  4MZB A;  3GST A;  2PN8 A;  4WBR D;  3V1W A;  4K7N A;  1PKZ A;  3L9V A;  3NZN A;  1DE1 A;  1OC9 A;  1V58 A;  1YF1 A;  1KBN A;  2HRF A;  2YV7 A;  4N3Z A;  3F63 A;  4IP6 A;  1TRV A;  4MPG A;  1WP0 A;  1GTA A;  4NHW A;  4HZ4 A;  1XWG A;  1TK0 B;  4AKI A;  1EEM A;  1SD8 A;  2REM A;  4E8E A;  3A2V A;  5CYY A;  2C0G A;  4TN8 A;  1VF4 A;  1AQW A;  3PH9 A;  1XCC A;  1NW2 A;  5JWQ B;  2JL4 A;  5FWG A;  2NBS A;  5GAP D;  3EC3 A;  5DCH A;  5CAX A;  3IA1 A;  2CVB A;  4FYC A;  3M9K A;  4ZBB A;  2GVP A;  1AQV A;  1U6T A;  2CQ9 A;  2FWF A;  2AB6 A;  1MDI A;  4WBJ A;  5JWO B;  3F4T A;  5CP1 A;  3FY7 A;  4IS0 A;  4ZIL A;  3G7Y A;  4MNN A;  1JFU A;  1HNA A;  4MCU A;  3IE3 A;  3GRX A;  4Z2T A;  2NTO A;  2HYX A;  4XRD A;  3TJB A;  2JU5 A;  1J0F A;  1K3O A;  1TXU A;  1AIU A;  1B9X C;  4I8B A;  1N8J A;  4IVF A;  1MDJ A;  1WPI A;  1SL1 B;  1W89 A;  3EVI A;  3FMW A;  3GA4 A;  3UL3 A;  5FHI A;  2E7P A;  3CRT A;  1M2A A;  2HFD A;  3I69 A;  5F05 A;  3CRU A;  3CSH A;  1SKS B;  2XBQ A;  1GSF A;  1GNW A;  5CRW A;  5IMC A;  1WWJ A;  3ISO A;  4X1U A;  2VAF A;  4KAE A;  1SVM A;  2C80 A;  5DAK A;  4MF7 A;  4MK3 A;  4N11 A;  4PHZ C;  2JZT A;  1YJ6 A;  2IMD A;  2RM5 A;  1F9M A;  2PPT A;  3RDW A;  5EVO A;  22GS A;  4CW9 A;  4KSO A;  2QKE A;  1M9B A;  3ZRE A;  2F8F A;  3GTU B;  2DC5 A;  2L59 A;  4A5P A;  4ECC A;  5INY A;  3F4R A;  3IOS A;  4IGJ A;  4AKX B;  3CQF A;  2AAW A;  3Q19 A;  2LJA A;  1F6M C;  2VLV A;  3CTF A;  6GSV A;  4CY6 A;  3DD3 A;  4I6X A;  5EPF A;  2GSS A;  4D73 B;  2GS3 A;  2I4A A;  3U6V A;  5COH A;  1OC3 A;  2RUE A;  3APS A;  2B5E A;  1T4Z A;  2CVD A;  1EZK A;  1OC8 A;  2DJ1 A;  1OC9 B;  3RAZ A;  1XOB A;  4EDZ A;  2X8H A;  2J23 A;  4ILF A;  4GF0 A;  4ML1 A;  4USS A;  1YDK A;  5F07 A;  3DRN A;  4TW5 A;  3MDK A;  3HDC A;  3ZZX A;  4OCF A;  3C1S A;  5KN0 A;  1XW5 A;  1I5G A;  2XBI A;  3DWV A;  2YPM A;  3KH7 A;  3GKN A;  1ERV A;  3TRQ A;  1DE2 A;  1GSE A;  3TOU A;  3TGZ A;  2RUF A;  1YKA A;  4RI7 A;  1R5A A;  2C1Y A;  2HSM A;  2OE1 A;  3AY8 A;  3MAK A;  1T1V A;  4F0B A;  3D21 A;  5CRD A;  1DSB A;  3GN3 A;  4V2M A;  1Z7P A;  3BBY A;  5IQY A;  3C71 A;  4PNF A;  1OKT A;  4OFM A;  2H71 A;  1BJX A;  3IC4 A;  5G31 A;  1GUK A;  4HQZ A;  1FO5 A;  2H1L A;  2XC2 A;  4JR6 A;  5IMD A;  4ZBD A;  1GNE A;  5B6M A;  4ZB7 A;  2A2S A;  4ML6 A;  4NHZ A;  2E2G A;  3IV4 A;  5GSS A;  4CHS A;  3HA9 A;  3F6F A;  4JBB A;  5KEJ A;  2WGR A;  5DAK B;  3WYW A;  3U5R E;  5J40 A;  2A4V A;  4HU7 A;  1PX7 A;  5DBQ A;  5B6N A;  2H0I A;  4AKH A;  5EY6 A;  3TU3 B;  2IJY A;  1Z5Y E;  4L0W A;  1PQN A;  1GP1 A;  2ZNM A;  2XHF A;  20GS A;  1SKW B;  4MPF A;  5JWR B;  3QMX A;  3ME7 A;  4EKZ A;  2GQK A;  3VI7 A;  4F82 A;  1GSS A;  3UOM A;  4ZXG A;  2LUS A;  2HZE B;  1SYX A;  4FO5 A;  2LTK A;  3P8W A;  3TKS C;  2H73 A;  4FYU A;  2H6Z A;  3QD9 A;  2C8U A;  3GHA A;  3RHC A;  3QAV A;  2LST A;  3EYT A;  3N5O A;  3GFK A;  4XS4 A;  4HJ2 A;  3IHG A;  5D9T A;  2ZUP A;  5A5H A;  2UZ8 A;  1JZR A;  4KDX A;  5IPH A;  4IHU A;  5DQY A;  3I9V 2;  1K3Y A;  2AYT A;  3IR4 A;  3HJO A;  3QFB C;  1LU4 A;  5CRE A;  1EGR A;  1GUM A;  1O85 A;  3CHX C;  1G7O A;  1TW9 A;  4F03 A;  3LJR A;  1QXH A;  4RQR A;  1W4V A;  4YAP A;  4AJ8 A;  1M0U A;  1GL8 A;  1KTE A;  4K0G A;  1ERT A;  2B5Y A;  3MSZ A;  4BL7 A;  3APO A;  3P90 A;  4IQA A;  1TJD A;  2H1A A;  2DJ0 A;  5BMU A;  1CQG A;  1E6B A;  2AHE A;  4OCE A;  4ECJ A;  4IP1 A;  4IBP A;  3WGE A;  4BIK A;  3BCK A;  2PVQ A;  2DJ2 A;  1QQ2 A;  2HSM B;  3TJF A;  4XIH A;  1ZYQ B;  4I5Q A;  4ZBA A;  6GSU A;  3D0Z A;  2ON7 A;  1T4Y A;  2YV9 A;  5H5Q A;  1RW1 A;  1JZD A;  4KH7 A;  2K18 A;  1BX9 A;  2C3N A;  3P2A A;  4V1A p;  3L78 A;  1R26 A;  2VKZ G;  5G1K A;  1X9M B;  1BG5 A;  4K5R A;  4XS1 A;  2GT5 A;  5IPG A;  1SL2 B;  1AQX A;  2LNS A;  3WGX A;  1FOV A;  1H75 A;  3ZLP A;  2V2G A;  4K9Z A;  4I97 A;  2HLS A;  4KND A;  5AGY A;  2H6Y A;  2CA8 A;  3F3R A;  1WIK A;  2D2Z A;  2Z9S A;  1PSQ A;  2OE3 A;  5JCW A;  1ZOF A;  2DIZ A;  4KUN A;  1O7U A;  4MLY A;  2CZ2 A;  1EEJ A;  4X43 A;  4MP4 A;  2WRT A;  1ZGN A; 
#chains in the Genus database with same CATH homology
 4PNG A;  18GS A;  3TDG A;  4K8M A;  5ECP B;  3UVH A;  4EF0 A;  2WFC A;  1SKR B;  2PBJ A;  4ISD A;  3ZIJ A;  1EGO A;  3FK8 A;  5LD0 A;  5GST A;  3A3T A;  1PN9 A;  1T7P B;  4QL9 A;  2YN1 A;  2XPD A;  2OKA A;  8GSS A;  5B8A A;  4CY8 A;  1U3I A;  5L71 A;  5C04 A;  4OO5 A;  1FG4 A;  2P31 A;  4V1A g;  1AAZ A;  3PGT A;  3IAS 2;  2L6D A;  5G2Z A;  4XS4 B;  5A5H B;  2WB9 A;  1DBY A;  5IO2 A;  5F8B A;  1TXX A;  2KUC A;  1A2L A;  4EIQ A;  4IKH A;  1SJ6 A;  2KLX A;  3RHB A;  4LL4 B;  3H8Q A;  2FGX A;  2WCI A;  2I81 A;  2WS2 A;  5J4Y A;  2GGT A;  2ZCT A;  3VWW A;  4Q5R A;  3LXT A;  4X4J A;  4FYB A;  4TRX A;  2X99 A;  2JAC A;  1SEN A;  3A2X A;  2I3Y A;  3IHQ A;  1QMV A;  14GS A;  1GTI A;  4OWY A;  3FZ5 A;  3HJP A;  5ECQ B;  2P0G A;  4EO3 A;  4G0I A;  1ABA A;  3LYP A;  5BMU B;  4QL7 A;  2VCV A;  2LKU A;  1G7E A;  2EC4 A;  4HDE A;  1X0R A;  1T3B A;  3FYG A;  2H76 A;  2R4V A;  4HOJ A;  1KEB A;  2K8V A;  2HSH A;  3ZFB A;  2H75 A;  5J5N A;  1J9B A;  3KZQ A;  5HR3 A;  2DJJ A;  1FOH A;  2FD3 A;  5D9W A;  2LNT A;  1AUC A;  1BG1 A;  3ED3 A;  4L5L A;  3Q18 A;  3UIW A;  1FVJ A;  4KW6 A;  3ZMK A;  2NVL A;  1PGT A;  1MDK A;  5H5S A;  3F6D A;  4LMW A;  3GH6 A;  2K9F A;  1JLV A;  3ZFL A;  1T8E B;  2WJU A;  3MIX A;  1GSU A;  2DIY A;  3CSJ A;  2DMM A;  4EXJ A;  2OBI A;  4GWR A;  2H30 A;  1SK1 A;  3PR8 A;  5AN1 A;  2A2P A;  4ZL9 A;  1HQO A;  1OE8 A;  3WT1 A;  4POM A;  2VD1 A;  5ECM B;  3LEF A;  2H74 A;  4KCA A;  5BRT A;  5IOW A;  2PGT A;  4K7I A;  2O89 A;  3WT2 A;  3TOT A;  1K0D A;  2RLI A;  5A5K A;  3H93 A;  1JZO A;  1X9W B;  2EFC A;  1PL1 A;  3RBT A;  5D73 A;  5F06 A;  2FLS A;  3LOR A;  3LYK A;  1EOG A;  2L4Q A;  5KN3 A;  4MAB A;  1OE7 A;  2MMN A;  5ECI B;  2FCH A;  1HNB A;  4YQV A;  5FT3 A;  1WRY A;  2YAN A;  1TDI A;  4BWQ A;  5ECS A;  3TKP A;  5LCZ A;  3W8S A;  2GTU A;  1A8Y A;  1UVZ A;  1JZW A;  1A0F A;  2I1U A;  3DIE A;  2KHP A;  2RM6 A;  2OT3 A;  1K0M A;  3FR3 A;  1UC7 A;  1XOA A;  3KD0 A;  1ZMA A;  2HI7 A;  2EFH A;  2KP1 A;  4KGI A;  3D4T A;  3O6T A;  4TVE A;  4ECB A;  1XIY A;  3FR6 A;  2L5O A;  5KN1 A;  2NPB A;  1TK8 B;  1SK2 A;  4PXO A;  4FQU A;  3ZYW A;  4KSM A;  2DML A;  5DJL A;  5E4W A;  3H79 A;  5J3R A;  4PQI A;  4QQ7 A;  4XTS A;  3D5J A;  1V57 A;  1LBK A;  4ZB8 A;  5ID2 A;  3SWL A;  4J57 E;  2FUG 2;  1SVL A;  2GSR A;  2LQQ A;  2B5X A;  3FEU A;  2WDU A;  2O85 A;  3TKQ A;  3TKR A;  1HNC A;  4POL A;  1XWB A;  1EV9 A;  2FHE A;  4WF5 A;  1B4Q A;  3EUR A;  3M0F A;  1TRU A;  3I43 A;  1PRX A;  1A2M A;  4Q5F A;  1PL2 A;  2GQM A;  3FZ4 A;  1YZX A;  3TJG A;  1XWC A;  17GS A;  3SBC A;  1V98 A;  2LJR A;  4G9H A;  2R0G A;  4RI6 A;  5ECN B;  4K7O A;  5IMZ A;  3TKS E;  4BVY A;  2VIM A;  3O76 A;  3C7M A;  3GSS A;  4HQS A;  2BMX A;  2VCZ A;  1FW1 A;  4PQH A;  4NPB A;  3O3T A;  1S3D A;  2H72 A;  5IMA A;  2B7K A;  1CQH A;  3HYP A;  4GLT A;  1RQM A;  5A34 A;  5ELG A;  1K0N A;  4XS6 A;  4PUA A;  5F0G A;  6GST A;  5J4V A;  2LRC A;  3W8J A;  5GZZ B;  2G2Q A;  3HCZ A;  3KM6 A;  3DYR A;  4GRF A;  4K2D A;  5ECK B;  5DVB A;  5E59 A;  1WOU A;  2YJH A;  5A4V A;  4L0U A;  1BED A;  1GH2 A;  3QPM A;  4PGT A;  3UVT A;  5J9C A;  4G10 A;  2M80 A;  1T00 A;  2MYG A;  2HZF A;  1X5E A;  2GLR A;  2H1D A;  5HR1 A;  4LA1 A;  4NWY A;  2GQL A;  3ERG A;  4IQ1 A;  2IN3 A;  5ECO B;  5A4W A;  4GQC A;  5JCG A;  4N0V A;  2GSQ A;  5H5R A;  1EP7 A;  2X64 A;  4PTS A;  3ERW A;  3ZIT A;  2FNO A;  2OJL A;  3EMX A;  2C0E A;  1SD9 A;  4Q5Q A;  4WR4 A;  7GSS A;  4TXO A;  1B4P A;  1A23 A;  3J7Y b;  3A5W A;  4KE3 A;  5ABR A;  1BYE A;  2A4H A;  4DEJ A;  5D8I A;  1QGV A;  1EP8 A;  1NSW A;  2VLT A;  5CRG A;  4CDO A;  2LV3 A;  5ID2 B;  3QAG A;  1G0T A;  2DKH A;  1HD2 A;  3BD2 A;  4GSN A;  3GKM A;  3Q74 A;  4JRR A;  2VCW A;  6GSS A;  1Y25 A;  4TOP A;  1FAA A;  4MH2 A;  1V2A A;  1WJK A;  3ZL5 A;  4KDY A;  1GTB A;  4KA0 A;  4Z7X A;  3KGK A;  2HRN A;  3KCM A;  2H6X A;  2GZZ A;  3E9J B;  3MNG A;  1YF0 A;  4F0C A;  4G2E A;  3APQ A;  1Z6M A;  2GDR A;  1ZCP A;  4BVX A;  3KP8 A;  4HU9 A;  2QSI A;  3PIN A;  2TRC P;  1MEK A;  3C8E A;  2A2R A;  3G9B A;  4MJE A;  2M72 A;  2VM1 A;  4LL1 B;  4EVM A;  3P7X A;  2VL2 C;  3LSZ A;  1V9W A;  2YZU A;  1HYU A;  5IIZ A;  5LNK e;  2H19 A;  1TI3 A;  1YY7 A;  4I2U A;  6GSW A;  3UAP A;  1THX A;  1SJZ A;  3DEX A;  4ID0 A;  5A34 B;  5ECR B;  2OAD A;  3H1N A;  3KEB A;  2B7J A;  1F3B A;  5DJM A;  1AXD A;  1YEX A;  5HR2 A;  4POB A;  2HQT A;  1O6J A;  3TCO A;  3IK9 A;  2N5A A;  1X5D A;  3J7Y k;  1H4O A;  2G0F A;  2TRX A;  3D6I A;  4GSS A;  3K8N A;  3LG6 A;  5AIS A;  3DGQ A;  5HQP A;  5DDL A;  2PVO C;  5HFI A;  4MMM A;  4E8H A;  3EWL A;  3ZVJ A;  2H70 A;  1IYI A;  2R5G A;  2YP6 A;  1M9A A;  1GSQ A;  2PWJ A;  5D9V A;  3WD6 A;  1E2Y A;  1X9S B;  3UMA A;  3QFA C;  3FKF A;  4I2T A;  3G7J A;  1J08 A;  4TXV A;  3VPT A;  1X5C A;  3L4N A;  1BAY A;  1GWC A;  3LWA A;  4O5Q A;  3HXS A;  2K8S A;  1ZL9 A;  1XWK A;  4TXO B;  2HRK A;  4RUV A;  4KB3 A;  1O73 A;  4OFN A;  2PMT A;  4EE0 A;  2KOK A;  1Q4J A;  2CX3 A;  2EFE A;  2YOI A;  1VRS D;  2FWE A;  3DKS A;  1NHY A;  1O8X A;  1K0C A;  2R0C A;  3Q6O A;  4GCI A;  2GT6 A;  2O7K A;  3GL3 A;  3NOF A;  3UBK A;  1YKC A;  3FW2 A;  4DSS A;  2IL3 A;  1O81 A;  1U3A A;  2CAI A;  3DXB A;  1K3L A;  2VLU A;  4YKF A;  1Z7R A;  5J41 A;  3F3Q A;  5IO0 A;  3F0I A;  5ENU A;  3ZVJ D;  3TKS A;  3VWV A;  2EFD A;  4E68 A;  1RK4 A;  2F9S A;  3CSI A;  1SK0 A;  3FHK A;  4Q5N A;  4TR0 A;  3BCI A;  1G6W A;  3R2Q A;  1I9D A;  2BJX A;  1QUW A;  2VL9 A;  4PQ1 A;  1XVQ A;  3QDN A;  4BL7 B;  2CT6 A;  3GUR A;  1TRS A;  3GV1 A;  3IRA A;  5AIX A;  3GNJ A;  1JLW A;  2AJQ B;  4J56 E;  1GTU A;  1GUL A;  4W66 A;  1SU9 A;  3GTU A;  5B7C A;  1ACV A;  4MZW A;  4OO4 A;  4MZC A;  3UAR A;  2LQO A;  3HZ8 A;  5CNW A;  3FZA A;  5IOX A;  6GSY A;  1YEP A;  3VWU A;  4O5U A;  2H0G A;  2LRN A;  3CWG A;  3C73 A;  1OYJ A;  3A2W A;  2PER A;  2R37 A;  2H0H A;  3IXR A;  3E3E A;  4L5O A;  1XPV A;  4TKY A;  4D73 A;  2TIR A;  2IMI A;  1PX6 A;  4N30 A;  1N25 A;  2B1K A;  3VUR A;  3TB2 A;  3JCM L;  4AGS A;  2LJK A;  4GXZ A;  4NV5 A;  2L6C A;  3KH9 A;  2C4J A;  2X4A A;  1ZZY A;  1XWA A;  2AV4 A;  4HS1 A;  3CXG A;  4DSR A;  2EIR A;  1M7T A;  1TP9 A;  2P5Q A;  1Y6E A;  3US3 A;  4MH3 A;  3KJY A;  3IPZ A;  3HVX A;  3M3M A;  2H01 A;  1K0O A;  2FWH A;  2H66 A;  2F8A A;  3GH9 A;  4GQF A;  3L9S A;  3VLN A;  2HRK B;  4BA7 A;  1GLQ A;  5JCU A;  1MD4 A;  1V40 A;  1ERU A;  2IFQ A;  3UEM A;  2O87 A;  3KTL A;  3ME8 A;  5A1N A;  4GDF A;  1ILO A;  4MF5 A;  3W6G A;  1XXU A;  1K0B A;  2V6O A;  3GX0 A;  4OFT A;  3TUE A;  1EWX A;  1ZYN A;  5G5E A;  4DSS B;  4IJ3 A;  4HJM A;  2DJK A;  3F4S A;  4KF9 A;  1THO A;  2LEG A;  2IMF A;  3BOA A;  4GST A;  2MBT A;  1R5P A;  3LQ7 A;  2KP2 A;  3HVV A;  4LMV A;  4XRA A;  2MMA A;  2HSN A;  3D22 A;  2UV8 G;  1B8X A;  4YQU A;  3M1G A;  5KN2 A;  4AKG A;  3UBL A;  4ZIJ A;  4IW9 A;  2F3M A;  1M2B A;  3ZML A;  1TKD B;  4JR4 A;  2WUL A;  3DVW A;  4HUA A;  5AIV A;  2BTO T;  4F9Z A;  4EC0 A;  4NV2 A;  3VWX A;  4HI7 A;  3CBU A;  3EU3 A;  1XFL A;  3CMI A;  4YAV A;  2EIO A;  5EL8 A;  1C72 A;  2O5V A;  3GIX A;  2VL3 A;  1M99 A;  5J4U A;  2HZE A;  2VOC A;  2XPE A;  1XVW A;  3D4M A;  4OD7 A;  2HRA A;  1TTZ A;  3MYD A;  3IBH A;  1SYR A;  1UN2 A;  1TOF A;  1F3A A;  1Y1U A;  1A2J A;  2C0F A;  2DSA A;  2R0P A;  4IJI A;  4WR5 A;  1TI1 A;  1PN0 A;  1PD2 1;  4ZL8 A;  5DAL A;  3GX8 A;  4V2L A;  1ML6 A;  2LS5 A;  3KIJ A;  3R3E A;  3EE2 A;  2YWO A;  1GSY A;  2ES7 A;  3RPP A;  1TU7 A;  3UJ1 A;  5HR0 A;  5A4U A;  2FA4 A;  3FZ9 A;  1NM3 A;  1ON4 A;  1SVO A;  4EIP A;  4PX1 A;  1SL0 B;  4G19 A;  1BF5 A;  3IK7 A;  2J9H A;  5D9X A;  4H86 A;  2E0Q A;  2IPA A;  3FR9 A;  1XW9 A;  2FWG A;  4EL1 A;  4FH8 A;  1R4W A;  2ALB A;  19GS A;  2VM2 A;  4TR1 A;  2JAD A;  2GZP A;  3VK9 A;  2NDO A;  3ERF A;  9GSS A;  2YCD A;  1ST9 A;  2IME A;  5KOX A;  4ICY A;  2IFQ B;  2GST A;  2PUK C;  3TRP A;  3GKX A;  4EDY A;  5A1N B;  4NAX A;  1K0A A;  1TK5 B;  1AW9 A;  3ZRD A;  3HY2 A;  5ELA A;  1UA5 A;  2HNL A;  3GUS A;  1GUH A;  1F2E A;  5G5F A;  3F8U A;  4ACS A;  5CO3 A;  3HJM A;  4O32 A;  4Z2R A;  4O7H A;  2FY6 A;  1LJR A;  4ZB9 A;  1JHB A;  1YQ1 A;  2YWI A;  5IM9 A;  3F9U A;  1TU8 A;  2HSN B;  3S9F A;  4MJB A;  1XW6 A;  3A5I A;  2O8V B;  4LLR A;  2MMZ A;  2C3Q A;  2DBC A;  4K2X A;  4WF4 A;  1R7H A;  2PU9 C;  3IDV A;  4OMV A;  3HKR A;  4V2N A;  1Q98 A;  2X8G A;  3LFL A;  1Z3E A;  3VPQ A;  2ON5 A;  2CVK A;  3TRX A;  3QR6 A;  13GS A;  3KMO A;  2HXK A;  4DVC A;  2L5L A;  2V41 A;  1QFN A;  1WE0 A;  3KMN A;  3DVX A;  3E0U A;  1A24 A;  3EPT A;  2N5F A;  3ZTL A;  4DSQ A;  2L4C A;  1A8L A;  4X0X A;  2GZY A;  2R2J A;  1GRX A;  4JZQ A;  5GAN D;  1OVN A;  3M9J A;  1NHO A;  3GL5 A;  4P3Y B;  4POK A;  1N2A A;  1YVL A;  4ZB6 A;  6GSX A;  1VF3 A;  2CAQ A;  4AJ6 A;  4RQX A;  3QCP A;  3IAM 2;  3LW9 A;  2B3S A;  3G7I A;  4K0N A;  2H1B A;  4YH2 A;  4ECI A;  4Z2U A;  3KXO A;  5G30 A;  4XCS A;  4BVY B;  2IMK A;  3HD5 A;  2L57 A;  3HHV A;  2HE3 A;  3CYN A;  1U88 A;  3GMF A;  5DAL B;  4EUY A;  4N10 A;  5C00 A;  4MDC A;  3EIN A;  1U87 A;  1IYH A;  4AF2 A;  4WKW A;  5IMV A;  4HEA 2;  2HT9 A;  4N0Z A;  2DLX A;  2VUP A;  3GKK A;  4NXI A;  2F51 A;  1GSD A;  1A0R P;  1DUG A;  4FIW A;  2CX4 A;  2WZ9 A;  4MJC A;  3QOU A;  4MF6 A;  2P5R A;  1XZO A;  2R3X A;  1OKD A;  2B1L A;  1M2D A;  4TR1 B;  3MWH A;  2VD0 A;  2VCT A;  4JE1 A;  4G0K A;  3M8N A;  4K1F A;  2C0D A;  3IC8 A;  4PUF C;  2YJ7 A;  4ULX A;  1QK8 A;  1USB A;  5CRH A;  2JZR A;  1VF1 A;  2VCX A;  1VGL A;  3HMJ G;  2YWN A;  1PA3 A;  3BJ5 A;  2X49 A;  3LGC A;  3ZIV A;  4AJ7 A;  5HFK A;  1PMT A;  2IWT A;  1FB6 A;  2QA1 A;  4G0L A;  3GYK A;  1B48 A;  2V1M A;  11GS A;  1S3C A;  2HSY A;  3VFI A;  4KDU A;  2QGV A;  1B9Y C;  1MD3 A;  1ZYP A;  4YQM A;  3H4K A;  3TJK A;  4KCE A;  3CTG A;  1G6Y A;  5D96 A;  1FB0 A;  1Z9H A;  3I6A A;  4MJA A;  5DCG A;  1EOH A;  5DQS A;  2V32 A;  3QAW A;  4O5R A;  5ECL B;  1S3A A;  3EU4 A;  4K5S A;  1O8W A;  2EIQ A;  2YWM A;  5B8B A;  4AI6 A;  5KOW A;  1FHE A;  2OBK A;  4TR3 A;  4BPY A;  2DJ3 A;  2JZS A;  3WGD A;  2C3T A;  2N5B A;  1SJI A;  3VI5 A;  4YKG A;  1ZYE A;  5J9B A;  4G01 A;  4TR4 A;  4WEY A;  3L9U A;  4BWS A;  2R6K A;  1TRW A;  2QC7 A;  2X8C A;  1XBS A;  1Z6N A;  2E2M A;  1KNG A;  4PUR A;  2CV4 A;  5IMF A;  4ZL7 A;  4KX4 A;  16GS A;  3PPU A;  5HFG A;  4O92 A;  2QA2 A;  5G1L A;  1EV4 A;  2IIY A;  2VO4 A;  2AUV A;  3DML A;  4F2I A;  4IN0 A;  2JSY A;  3NIV A;  4K6X A;  4L8E A;  4BVX B;  2FA8 A;  3KP9 A;  2LRT A;  1URM A;  1VF2 A;  1OAZ A;  3N9J A;  2OA7 A;  2OAC A;  4IEL A;  3KTB A;  2YNX A;  2MBS A;  2B6M A;  2K6V A;  4MA9 A;  3TJJ A;  2H8L A;  4JED A;  2M46 A;  3L0H A;  1GLP A;  4JU5 A;  3FRC A;  1PKW A;  4QMK A;  2VL2 A;  1AC1 A;  4J2F A;  4HZ2 A;  5ECH B;  4WXT A;  4NMU A;  3C1R A;  1F37 A;  2OE0 A;  2MZC A;  2CZ3 A;  2MMO A;  1ERW A;  2YZH A;  3LXZ A;  3EMP A;  1FVK A;  4XHM A;  2RII A;  2VCQ A;  2H1G A;  2JSZ A;  10GS A;  1WMJ A;  5D93 A;  1MTC A;  2V6K A;  3OR5 A;  12GS A;  3RPN A;  4GTU A;  3HZ4 A;  3HVS A;  4WET A;  2DKI A;  5J47 A;  1BQ7 A;  2I9H A;  4MZB A;  3GST A;  2PN8 A;  4WBR D;  3V1W A;  4K7N A;  1PKZ A;  3L9V A;  3NZN A;  1DE1 A;  1OC9 A;  1V58 A;  1YF1 A;  1KBN A;  2HRF A;  2YV7 A;  4N3Z A;  3F63 A;  4IP6 A;  1TRV A;  4MPG A;  1WP0 A;  1GTA A;  4NHW A;  4HZ4 A;  1XWG A;  1TK0 B;  4AKI A;  1EEM A;  1SD8 A;  2REM A;  4E8E A;  3A2V A;  5CYY A;  2C0G A;  4TN8 A;  1VF4 A;  1AQW A;  3PH9 A;  1XCC A;  1NW2 A;  5JWQ B;  2JL4 A;  5FWG A;  2NBS A;  5GAP D;  3EC3 A;  5DCH A;  5CAX A;  3IA1 A;  2CVB A;  4FYC A;  3M9K A;  4ZBB A;  2GVP A;  1AQV A;  1U6T A;  2CQ9 A;  2FWF A;  2AB6 A;  1MDI A;  4WBJ A;  5JWO B;  3F4T A;  5CP1 A;  3FY7 A;  4IS0 A;  4ZIL A;  3G7Y A;  4MNN A;  1JFU A;  1HNA A;  4MCU A;  3IE3 A;  3GRX A;  4Z2T A;  2NTO A;  2HYX A;  4XRD A;  3TJB A;  2JU5 A;  1J0F A;  1K3O A;  1TXU A;  1AIU A;  1B9X C;  4I8B A;  1N8J A;  4IVF A;  1MDJ A;  1WPI A;  1SL1 B;  1W89 A;  3EVI A;  3FMW A;  3GA4 A;  3UL3 A;  5FHI A;  2E7P A;  3CRT A;  1M2A A;  2HFD A;  3I69 A;  5F05 A;  3CRU A;  3CSH A;  1SKS B;  2XBQ A;  1GSF A;  1GNW A;  5CRW A;  5IMC A;  1WWJ A;  3ISO A;  4X1U A;  2VAF A;  4KAE A;  1SVM A;  2C80 A;  5DAK A;  4MF7 A;  4MK3 A;  4N11 A;  2JZT A;  1YJ6 A;  2IMD A;  2RM5 A;  1F9M A;  2PPT A;  3RDW A;  5EVO A;  22GS A;  4CW9 A;  4KSO A;  2QKE A;  1M9B A;  3ZRE A;  2F8F A;  3GTU B;  2DC5 A;  2L59 A;  4A5P A;  4ECC A;  5INY A;  3F4R A;  3IOS A;  4IGJ A;  4AKX B;  2AAW A;  3Q19 A;  2LJA A;  1F6M C;  2VLV A;  3CTF A;  6GSV A;  4CY6 A;  3DD3 A;  4I6X A;  5EPF A;  2GSS A;  4D73 B;  2GS3 A;  2I4A A;  3U6V A;  5COH A;  1OC3 A;  2RUE A;  3APS A;  2B5E A;  1T4Z A;  2CVD A;  1EZK A;  1OC8 A;  2DJ1 A;  1OC9 B;  3RAZ A;  1XOB A;  4EDZ A;  2X8H A;  2J23 A;  4ILF A;  4GF0 A;  4ML1 A;  4USS A;  1YDK A;  5F07 A;  3DRN A;  4TW5 A;  3MDK A;  3HDC A;  3ZZX A;  4OCF A;  3C1S A;  5KN0 A;  1XW5 A;  1I5G A;  2XBI A;  3DWV A;  2YPM A;  3KH7 A;  3GKN A;  1ERV A;  3TRQ A;  1DE2 A;  1GSE A;  3TOU A;  3TGZ A;  2RUF A;  1YKA A;  4RI7 A;  1R5A A;  2C1Y A;  2HSM A;  2OE1 A;  3AY8 A;  3MAK A;  1T1V A;  4F0B A;  3D21 A;  5CRD A;  1DSB A;  3GN3 A;  4V2M A;  1Z7P A;  3BBY A;  5IQY A;  3C71 A;  4PNF A;  1OKT A;  4OFM A;  2H71 A;  1BJX A;  3IC4 A;  5G31 A;  1GUK A;  4HQZ A;  1FO5 A;  2H1L A;  2XC2 A;  4JR6 A;  5IMD A;  4ZBD A;  1GNE A;  5B6M A;  4ZB7 A;  2A2S A;  4ML6 A;  4NHZ A;  2E2G A;  3IV4 A;  5GSS A;  4CHS A;  3HA9 A;  3F6F A;  4JBB A;  5KEJ A;  2WGR A;  5DAK B;  3WYW A;  3U5R E;  5J40 A;  2A4V A;  4HU7 A;  1PX7 A;  5DBQ A;  5B6N A;  2H0I A;  4AKH A;  5EY6 A;  3TU3 B;  2IJY A;  1Z5Y E;  4L0W A;  1PQN A;  1GP1 A;  2ZNM A;  2XHF A;  20GS A;  1SKW B;  4MPF A;  5JWR B;  3QMX A;  3ME7 A;  4EKZ A;  2GQK A;  3VI7 A;  4F82 A;  1GSS A;  3UOM A;  4ZXG A;  2LUS A;  2HZE B;  1SYX A;  4FO5 A;  2LTK A;  3P8W A;  3TKS C;  2H73 A;  4FYU A;  2H6Z A;  3QD9 A;  2C8U A;  3GHA A;  3RHC A;  3QAV A;  2LST A;  3EYT A;  3N5O A;  3GFK A;  4XS4 A;  4HJ2 A;  3IHG A;  5D9T A;  2ZUP A;  5A5H A;  2UZ8 A;  1JZR A;  4KDX A;  5IPH A;  4IHU A;  5DQY A;  3I9V 2;  1K3Y A;  2AYT A;  3IR4 A;  3HJO A;  3QFB C;  1LU4 A;  5CRE A;  1EGR A;  1GUM A;  1O85 A;  1G7O A;  1TW9 A;  4F03 A;  3LJR A;  1QXH A;  4RQR A;  1W4V A;  4YAP A;  4AJ8 A;  1M0U A;  1GL8 A;  1KTE A;  4K0G A;  1ERT A;  2B5Y A;  3MSZ A;  4BL7 A;  3APO A;  3P90 A;  4IQA A;  1TJD A;  2H1A A;  2DJ0 A;  5BMU A;  1CQG A;  1E6B A;  2AHE A;  4OCE A;  4ECJ A;  4IP1 A;  4IBP A;  3WGE A;  3BCK A;  2PVQ A;  2DJ2 A;  1QQ2 A;  2HSM B;  3TJF A;  4XIH A;  1ZYQ B;  4I5Q A;  4ZBA A;  6GSU A;  3D0Z A;  2ON7 A;  1T4Y A;  2YV9 A;  5H5Q A;  1RW1 A;  1JZD A;  4KH7 A;  2K18 A;  1BX9 A;  2C3N A;  3P2A A;  4V1A p;  3L78 A;  1R26 A;  2VKZ G;  5G1K A;  1X9M B;  1BG5 A;  4K5R A;  4XS1 A;  2GT5 A;  5IPG A;  1SL2 B;  1AQX A;  2LNS A;  3WGX A;  1FOV A;  1H75 A;  3ZLP A;  2V2G A;  4K9Z A;  4I97 A;  2HLS A;  4KND A;  5AGY A;  2H6Y A;  2CA8 A;  3F3R A;  1WIK A;  2D2Z A;  2Z9S A;  1PSQ A;  2OE3 A;  5JCW A;  1ZOF A;  2DIZ A;  4KUN A;  1O7U A;  4MLY A;  2CZ2 A;  1EEJ A;  4X43 A;  4MP4 A;  2WRT A;  1ZGN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...