2V6KA

Structure of maleyl pyruvate isomerase, a bacterial glutathione-s- transferase in zeta class, in complex with substrate analogue dicarboxyethyl glutathione
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
214
structure length
214
Chain Sequence
b'AKMKLYNFWRSGTSHRLRIALNLKGVPYEYLAVHLGKEEHLKDAFKALNPQQLVPALDTGAQVLIQSPAIIEWLEEQYPTPALLPADADGRQRVRALAAIVGCDIHPINNRRILEYLRKTFGADEAAINAWCGTWISAGFDAYEALLAVDPKRGRYSFGDTPTLADCYLVPQVESARRFQVDLTPYPLIRAVDAACGELDAFRRAAPAAQPDSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MALEYLPYRUVATE ISOMERASE
publication title Structure of Bacterial Glutathione-S-Transferase Maleyl Pyruvate Isomerase and Implications for Mechanism of Isomerisation.
pubmed doi rcsb
source organism Ralstonia sp.
molecule tags Isomerase
total genus 79
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 5.2.1.4: Maleylpyruvate isomerase.
pdb deposition date 2007-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2v6kA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2v6kA01
3DD3A 4XS1A 3C73A 5ECSA 2FA8A 4XS6A 1AC1A 1WRYA 2LQOA 5C00A 3OR5A 3GNJA 3H79A 2H30A 2JU5A 1TRWA 3VURA 5E4WA 2F8AA 1O73A 3ME7A 3ZLPA 1PSQA 5F07A 4EXJA 3C7MA 2YWIA 2I81A 3R2QA 3VFIA 3IA1A 3DXBA 1V9WA 1U87A 2VL2C 4WETA 4G0IA 4JEDA 5J4UA 5AIXA 3LEFA 1TU8A 5DJMA 4F0BA 5ABRA 4D73A 4PTSA 4BVYA 2CAQA 2JZRA 2XHFA 3E9JB 3A2VA 4AGSA 4OWYA 1J0FA 4E8HA 4JRRA 1XFLA 3ZVJD 1TXXA 3L4NA 2KLXA 1GSSA 1YF1A 4K0GA 1HD2A 2KOKA 1WWJA 3IK9A 4IGJA 3DMLA 2LQQA 1QGVA 3IRAA 1OC9B 3FR9A 1PGTA 4OO4A 5DDLA 3IK7A 3HZ4A 3FZ5A 1TK8B 4FH8A 2FWGA 2GSTA 2GZPA 1WJKA 2H0IA 2MBTA 4DSQA 1TRVA 1M2AA 4MF6A 5J41A 5GAPD 3TB2A 1EGRA 2C3QA 1AAZA 1OE8A 2FWFA 2WULA 3ZMLA 1WP0A 3DRNA 2N5BA 2O8VB 3DYRA 1V40A 1ZL9A 4IQ1A 5B6NA 1T00A 3UIWA 1X0RA 1YEPA 3NZNA 5HQPA 4NHZA 5CRDA 1GLQA 4K6XA 1K0MA 4XRAA 3PH9A 1U88A 1NHOA 4J56E 1GH2A 3J7Yb 4OD7A 5IO0A 3QFBC 2UZ8A 4KUNA 1SD9A 1NSWA 4G2EA 2LTKA 3KMOA 2FD3A 2YN1A 2YWOA 1AQVA 1GSFA 3H8QA 4WEYA 4ILFA 6GSWA 1HQOA 3UBLA 2WZ9A 2NVLA 1O8XA 1F3AA 4PGTA 4MH3A 2IMIA 2OADA 3KTBA 2VD1A 4EC0A 1LU4A 2I9HA 3KP8A 4HJMA 3F63A 1JZRA 2HQTA 1ZGNA 3GA4A 4L5OA 3M1GA 4NHWA 4YAPA 1BX9A 2VCVA 1JLVA 4XCSA 2O89A 1GRXA 1DE2A 1BQ7A 1OVNA 2VOCA 2E7PA 1A8LA 1VRSD 3DIEA 5IOWA 1E6BA 3DWVA 20GSA 4PQHA 1CQHA 1ERVA 1OC3A 2H72A 3QMXA 5DALA 2DBCA 1GNWA 4HOJA 2WDUA 2H1GA 2I3YA 3SBCA 3IPZA 2GZZA 2EIQA 3RAZA 4IVFA 3KZQA 4JBBA 5IO2A 3VLNA 1EWXA 2RUFA 2VCQA 4HDEA 5EL8A 5CO3A 1MD3A 2RLIA 1ZMAA 4ZXGA 5J9CA 2G0FA 2LJRA 2R2JA 4HQZA 1ON4A 2R37A 4TXOB 2GTUA 2CVBA 5IOXA 1PL1A 2VO4A 3W6GA 3CSJA 1E2YA 5IMCA 2A2RA 5KN0A 1LJRA 4GLTA 2HRAA 1FVKA 1GSYA 1O7UA 2YV7A 2YPMA 1PN9A 3EC3A 4MJCA 1GWCA 3UJ1A 3IOSA 4ZL7A 4G0KA 2C80A 3EURA 4IS0A 3TKQA 2ON7A 2LUSA 5B8BA 3ZREA 1AQWA 5CNWA 2FGXA 2HNLA 2DJJA 6GSYA 2VL2A 5HFKA 1JZDA 1TOFA 1A23A 2DJKA 5JWQB 2HXKA 2K8SA 1FOVA 1PQNA 4OFTA 5ECOB 4NAXA 3CBUA 5EY6A 3U5RE 3TKSE 2F51A 4TOPA 2NPBA 2I4AA 3HVVA 3F0IA 1ACVA 4EVMA 1X5DA 2ZUPA 3RPNA 5KN1A 1F3BA 2O7KA 1WE0A 1XWBA 2LV3A 5JCUA 2MZCA 2DJ3A 1VF3A 1F37A 2L4CA 2M46A 3GTUA 2DMMA 4ZB8A 2H74A 2MMOA 3LQ7A 4MZBA 3F6DA 2X8HA 4OMVA 4HU9A 3CRUA 2B5XA 1TDIA 2L57A 5G30A 3ED3A 4XS4B 2CA8A 2AJQB 1GSEA 1OE7A 4HZ4A 2H70A 2YZUA 2JZTA 2HI7A 2B7JA 3F9UA 2VIMA 5G2ZA 1TI3A 3LJRA 1R5PA 4L5LA 1QFNA 5F8BA 1PL2A 3GV1A 1SL1B 2HSMA 4QQ7A 4DSRA 2R5GA 4MF7A 3TCOA 1XOAA 3NOFA 2YWNA 3PR8A 1XW5A 4FO5A 1KBNA 3MNGA 2PGTA 1N8JA 2YCDA 1X5EA 3HZ8A 3HY2A 4MA9A 2H0GA 2H8LA 2JACA 1XPVA 4KE3A 4F82A 1WOUA 4MCUA 2GSQA 3VI7A 2PBJA 2B5YA 1A2MA 3PGTA 1EP7A 1AIUA 3HKRA 3TRPA 4MZWA 2M80A 3HJMA 2PVQA 5J9BA 2FY6A 2B5EA 1FB0A 1Z9HA 4DVCA 2V6OA 4POBA 3VI5A 2DIZA 1WPIA 3MAKA 1AXDA 3D0ZA 3CRTA 2VLVA 3M0FA 5G5EA 1TTZA 3ZMKA 1A8YA 2P5RA 4MK3A 3TJBA 1XZOA 3UEMA 4BL7B 3O6TA 4Q5RA 3W8JA 1GTIA 3D4TA 4MPGA 1YY7A 2CAIA 1GSUA 2PMTA 4TXVA 5IM9A 3KGKA 4N0VA 2GT6A 5IQYA 3QDNA 4G19A 1M99A 1BAYA 4WR4A 2L4QA 1ZYQB 4HEA2 2C0GA 1QMVA 2H01A 4HUAA 4I2UA 5IPGA 4PUAA 3R3EA 3LG6A 3GH9A 3QFAC 2H6ZA 2R6KA 4GXZA 3AY8A 2HT9A 1XWCA 5EPFA 1H75A 1GUHA 5E59A 1X9WB 4CHSA 3MWHA 2VL9A 5CAXA 2H1BA 4WKWA 1JHBA 1T7PB 3QR6A 3GL5A 4ZBDA 2CVDA 5JCGA 3GX8A 1FG4A 5D9VA 2LKUA 5A4UA 4HQSA 3I43A 1G6WA 3J7Yk 1UC7A 4ML6A 3BOAA 3ERWA 5FT3A 1OAZA 1PRXA 3QAVA 2MBSA 4X1UA 3HYPA 2VCTA 3KXOA 4LMWA 4PUFC 3GYKA 4KGIA 5F06A 3FZAA 2CZ3A 1UN2A 2OBKA 1ERTA 2KP1A 3CMIA 2X99A 3A2XA 2WS2A 1QK8A 2I1UA 5FHIA 4MZCA 3CTGA 4DSSB 4AF2A 1URMA 4BA7A 1GP1A 1OC9A 1R7HA 3APSA 5CYYA 1V98A 5CP1A 5ECLB 5INYA 5ECNB 1ABAA 3DVWA 1YDKA 3GRXA 22GSA 3MSZA 1PX7A 4XTSA 1OC8A 3KD0A 1U3IA 5H5QA 2DC5A 4POKA 3LGCA 4EF0A 4Q5FA 5BMUA 5ID2B 5ECMB 5CREA 3IC8A 4MDCA 3P7XA 4OCFA 5KN3A 2GQMA 4TR0A 3D21A 1B8XA 1FVJA 3G7IA 3FR6A 5B7CA 4YQUA 4EE0A 2CQ9A 1BYEA 3FYGA 1KNGA 2OACA 2BJXA 6GSVA 4G9HA 4MF5A 3HVSA 5DVBA 2VUPA 3SWLA 3ISOA 3BCKA 1AQXA 2IFQB 1SKSB 4PQ1A 4OO5A 4GWRA 1HYUA 3A3TA 1MD4A 3RPPA 5DJLA 3HHVA 4V2NA 4ID0A 2MMNA 3WGXA 1MEKA 2YOIA 2F8FA 3DKSA 4IELA 1J9BA 1Y6EA 4EUYA 5IIZA 4K7OA 3O76A 2BMXA 1GULA 1Q4JA 5ENUA 4TR1B 4Z7XA 1BG5A 3LSZA 1XOBA 4WF5A 1FAAA 5IMZA 1JFUA 1IYIA 5D73A 3LWAA 2J23A 3S9FA 2GGTA 4X0XA 1FO5A 1GUMA 5GSTA 4K2DA 1S3AA 2WFCA 2RM5A 3GHAA 5H5RA 5A4WA 2FHEA 5GAND 2FA4A 3BJ5A 2GLRA 4O7HA 4TR3A 4V2LA 4N11A 1TRSA 3HD5A 3UVTA 3EINA 4ML1A 1M9AA 2B3SA 3UMAA 2FUG2 3FR3A 2L6CA 3IC4A 1V57A 4KCAA 1SK2A 2H1DA 5AIVA 1TK5B 1BEDA 6GSXA 2PVOC 1XXUA 1SENA 3H4KA 1K0DA 4KH7A 2B6MA 1F2EA 1GSDA 5COHA 2GDRA 4POMA 3UAPA 1NHYA 4XIHA 2TRXA 10GSA 1SJ6A 3TDGA 3QCPA 4N0ZA 1HNCA 4TXOA 3FZ9A 3EU3A 2YP6A 3G7JA 2NBSA 3FKFA 3L78A 2OE1A 2NDOA 1G7OA 4NPBA 3L0HA 4XHMA 4KSMA 2G2QA 3EYTA 1XWKA 4QL9A 4JR4A 1PX6A 3RBTA 1MTCA 1JLWA 3LYPA 4N10A 1XCCA 2WJUA 3CSHA 4J2FA 2B7KA 2IMKA 5D9XA 2CVKA 2H73A 2DJ2A 1EV9A 3UBKA 4V2MA 1M0UA 3MDKA 3GKNA 2PERA 3TRXA 4IN0A 1RW1A 1RK4A 3TKPA 5IPHA 4NV2A 2IMDA 4I97A 4L0UA 5KN2A 3FY7A 2QC7A 9GSSA 1THXA 1WIKA 2A4VA 2WGRA 5HR0A 1DE1A 2FNOA 1X9MB 1ZYEA 2TRCP 3KJYA 1SKRB 2H6YA 4Q5QA 1U6TA 4OFNA 1QQ2A 4WXTA 3TUEA 4KF9A 5C04A 2L5OA 3A5WA 4EDZA 5J3RA 2AAWA 2C0EA 3D6IA 4K0NA 5ELAA 2YV9A 3Q18A 5LCZA 3LXZA 2HZEB 3KM6A 2DIYA 4V1Ap 2LRCA 4J57E 5B6MA 5JWOB 1K0NA 2IMFA 1YKAA 1IYHA 2V2GA 4LA1A 4G0LA 4JR6A 2E2GA 1H4OA 4ECBA 3Q74A 2GSSA 3F4TA 3CSIA 4NMUA 2HRKB 2C8UA 1TKDB 4G10A 4XS4A 3M8NA 8GSSA 4MH2A 4FQUA 3VPQA 4MPFA 1HNAA 4HI7A 2L6DA 5ECPB 3HCZA 4YH2A 2ON5A 4L8EA 2LSTA 1R5AA 5IMFA 1Z6MA 2RIIA 2P31A 1ZZYA 2JZSA 4IQAA 4MJEA 3TJKA 4RQRA 4KW6A 3HJPA 4JE1A 3M9KA 1N2AA 2CT6A 4I5QA 4NWYA 14GSA 5ECRB 2F9SA 4TR4A 4TW5A 2YJ7A 1PD21 4IHUA 4GF0A 4AJ7A 5H5SA 1GL8A 1RQMA 2C4JA 1EP8A 5IMDA 3H93A 5D93A 1A24A 1TJDA 3ZIVA 5JWRB 4L0WA 3E3EA 2C3NA 2C3TA 3L9SA 3LFLA 3GURA 2LJAA 4BPYA 2V41A 2X8GA 5CRHA 4KAEA 3UOMA 2GZYA 3F3RA 4MABA 1PA3A 3BD2A 2LS5A 2IJYA 1XW9A 1YF0A 5CRWA 1SKWB 1XIYA 3A2WA 4BL7A 4KCEA 2XPDA 4EKZA 1Y25A 3BBYA 1THOA 4RUVA 4RI7A 5G1LA 1VGLA 3F4RA 3BCIA 3WT2A 5IMVA 2YZHA 2LJKA 2E2MA 2X8CA 1MDKA 1I9DA 1SJIA 2VL3A 3DEXA 2R4VA 6GSUA 1FB6A 1G7EA 4ZIJA 5DBQA 1EV4A 4WF4A 2H75A 1XWAA 3FZ4A 4GSSA 1M9BA 2C0FA 3PPUA 1HNBA 1F6MC 2OE0A 2LRTA 4POLA 3E0UA 2AV4A 1XBSA 3EMPA 2WB9A 1JZOA 5GZZB 5D9TA 2OBIA 1TW9A 1SYRA 5J5NA 3F6FA 1G0TA 2RUEA 4BWSA 2VAFA 4KX4A 4K8MA 1YJ6A 1NW2A 2IIYA 4EO3A 3FW2A 1QXHA 3ERGA 1CQGA 1B9XC 5LNKe 3KP9A 3HVXA 1Z3EA 2GQKA 4IJIA 2HLSA 4JZQA 2VM1A 3F3QA 2LNTA 2HYXA 2WCIA 3KH7A 4ECIA 1UVZA 3GKMA 4MMMA 1QUWA 4ZILA 1YKCA 2D2ZA 5AGYA 2L59A 3P8WA 1TP9A 5G31A 5KEJA 1YZXA 2EIOA 3VK9A 5L71A 4ULXA 2OKAA 3KH9A 2J9HA 1K0CA 1A0RP 2OE3A 2AYTA 2IL3A 3IR4A 2FLSA 4DSSA 2VLTA 2GT5A 2ALBA 2P5QA 4HZ2A 4ZL8A 4PQIA 1M2DA 5DAKB 3WYWA 2HSYA 3EWLA 4KA0A 1UA5A 3F8UA 4PNFA 4BVXB 2K18A 2VCXA 4HJ2A 1EOHA 5D96A 2WRTA 2N5FA 2XBIA 4HU7A 1B9YC 3IHQA 5G5FA 5ECHB 4ISDA 3VWXA 4CDOA 5AN1A 5HFGA 1JZWA 2CV4A 4GTUA 3TJJA 4WR5A 2GS3A 2QSIA 1YEXA 5ID2A 16GSA 3KIJA 4OCEA 3TOUA 3IBHA 1TI1A 2VCZA 3D5JA 5CRGA 4PX1A 17GSA 4ZBBA 2F3MA 4MJBA 2IFQA 3CTFA 4I2TA 1PMTA 4GSTA 5HR3A 3EU4A 4GQCA 1KTEA 4D73B 1K0BA 2V1MA 4DEJA 2CX4A 1EGOA 1AW9A 3ZITA 2JSZA 3CXGA 2LNSA 4BWQA 4BVYB 4NV5A 2V32A 1GNEA 1M7TA 2XPEA 3TKRA 13GSA 1SL2B 2PWJA 2DSAA 4ACSA 1B4QA 2AUVA 3TOTA 3IAM2 3C8EA 2DJ1A 7GSSA 3QOUA 19GSA 3L9VA 5DCGA 4TR1A 6GSTA 4F9ZA 3GKXA 2K9FA 2H71A 1ILOA 3O3TA 1AUCA 1YQ1A 3GFKA 3WGEA 3DVXA 5HR2A 4IKHA 4O92A 2JL4A 5F0GA 2C1YA 2XBQA 1A2JA 5LD0A 3UVHA 4F03A 5JCWA 2HFDA 3P2AA 2QGVA 1DUGA 4ZBAA 3GKKA 3QD9A 4IW9A 3QAWA 3FHKA 1TRUA 2EC4A 3C1RA 4KNDA 2DJ0A 5ECIB 1G6YA 18GSA 5DQSA 3US3A 3ZZXA 1DSBA 1Z7RA 3LYKA 4RQXA 5ECQB 4ECCA 3I69A 2CX3A 3APQA 1SK0A 2XC2A 1C72A 4IBPA 3W8SA 1MDJA 3HXSA 2HRFA 1XW6A 2ES7A 2GQLA 4GQFA 4FIWA 2PUKC 3M3MA 3WT1A 2HSHA 2H0HA 1MDIA 2IWTA 5D8IA 3N5OA 4IJ3A 2IMEA 1O85A 2JSYA 1FW1A 1K3YA 3VWVA 6GSSA 1EZKA 4I6XA 1OKDA 3GX0A 2AHEA 3RHBA 5IMAA 2DMLA 3JCML 1K0AA 3UARA 5GSSA 4MP4A 3IE3A 1SJZA 2YANA 3NIVA 1VF4A 1SK1A 3TKSC 1WMJA 3ZVJA 2ZCTA 1K3LA 3C1SA 5A4VA 1ZOFA 4P3YB 2H6XA 3D22A 2PU9C 4YQVA 4EL1A 1SD8A 3M9JA 3QPMA 2LEGA 4WBRD 1T4ZA 4FYCA 3I9V2 3U6VA 2FWHA 3GH6A 4EDYA 2PPTA 2VLUA 5FWGA 3TRQA 1T3BA 1NM3A 4F2IA 1ST9A 4GSNA 4KB3A 2V6KA 3FEUA 1USBA 3GIXA 2IN3A 3UL3A 3IXRA 1J08A 2C0DA 3WD6A 5DALB 4ZB6A 2ZNMA 4IP1A 2HRNA 3EE2A 3ZRDA 1ZCPA 2BTOT 5AISA 3H1NA 1V2AA 2QKEA 5ECKB 4RI6A 2K8VA 4GRFA 3FRCA 1GTBA 5G1KA 2YWMA 4PURA 1Z7PA 4ZL9A 2HZEA 4K1FA 3KMNA 1Z5YE 2VCWA 3ME8A 4K7NA 5HFIA 1U3AA 3VWUA 4KDYA 2E0QA 1W4VA 2P0GA 1A0FA 1F9MA 1EOGA 1GTAA 1V58A 4MLYA 1ERWA 1B4PA 3GL3A 2AB6A 4CW9A 2H76A 3FK8A 2IPAA 3F4SA 4TRXA 2LRNA 3I6AA 3TJGA 1R26A 4F0CA 3EMXA 2FCHA 2N5AA 2HRKA 3GSSA 1M2BA 1T8EB 4H86A 5F05A 2CZ2A 1GUKA 5EVOA 3CYNA 2TIRA 3K8NA 3ERFA 4OFMA 3APOA 1TU7A 1S3CA 4X43A 1I5GA 2L5LA 2H66A 3IAS2 3ZIJA 1K3OA 3PINA 2H1AA 4AJ8A 2K6VA 2A2SA 1Z6NA 3WGDA 2GSRA 2RM6A 4TKYA 4V1Ag 3EVIA 1T1VA 1OKTA 3V1WA 4XRDA 2YNXA 4WBJA 3KTLA 1DBYA 3ZFLA 4TN8A 4I8BA 2PN8A 4LLRA 1X9SB 2OJLA 2KHPA 1SU9A 1O81A 3TGZA 3ZYWA 2MYGA 3GN3A 4IP6A 4PXOA 1K0OA 3ZFBA 1SYXA 3LORA 1B48A 2NTOA 4QL7A 1T4YA 4AJ6A 1PKWA 1KEBA 2GVPA 3ZL5A 4Q5NA 1Q98A 4K7IA 4KSOA 1GTUA 4KDUA 5DQYA 2MMAA 3GTUB 3VWWA 2O85A 4O32A 2FWEA 3G9BA 2VM2A 3KEBA 1TK0B 5A5KA 1VF1A 1SL0B 1X5CA 2Z9SA 2KP2A 4N30A 1VF2A 1LBKA 1GLPA 3GSTA 4LL4B 3P90A 1ML6A 4ECJA 1BJXA 3C71A 2HZFA 4NXIA 4JU5A 3IV4A 1XVQA 4PNGA 2DLXA 2HSMB 3HJOA 2M72A 3QAGA 2HE3A 4K9ZA 1GSQA 11GSA 3IDVA 2H19A 3RHCA 3L9UA 4LL1B 3Q19A 2JADA 4TVEA 4E8EA 1FHEA 1XWGA 5ELGA 2REMA 3RDWA 3KCMA 4LMVA 1OYJA 1O6JA 2HSNB 4KDXA 2R3XA 4MJAA 4O5RA 2EIRA 5B8AA 3LXTA 3HDCA 4USSA 3TJFA 3HA9A 5D9WA 3GUSA 4YQMA 4FYBA 3D4MA 1XVWA 3TKSA 4ZB9A 1ERUA 1EEMA 1W89A 4FYUA 1EEJA 2OA7A 5HR1A 2B1KA 2MMZA 1A2LA 2B1LA 1O8WA 3Q6OA 3VPTA 2X64A 1S3DA 3GMFA 2VD0A 3ZTLA 2O87A 2KUCA 5DCHA 2YJHA 12GSA 4GCIA 1R4WA 4HS1A 3G7YA 1PKZA 5DAKA 3N9JA 4BVXA 3DGQA 4YAVA
chains in the Genus database with same CATH superfamily
3DD3A 4XS1A 3C73A 5ECSA 2FA8A 4XS6A 1AC1A 1TXUA 1WRYA 2LQOA 5C00A 3OR5A 3GNJA 3H79A 2H30A 2JU5A 5KOXA 1TRWA 3VURA 5E4WA 2F8AA 1O73A 3ME7A 3ZLPA 1PSQA 5F07A 4EXJA 3C7MA 2YWIA 4AI6A 2I81A 3R2QA 3VFIA 3IA1A 3DXBA 1V9WA 1U87A 2VL2C 4WETA 4G0IA 4JEDA 5J4UA 5AIXA 3LEFA 1TU8A 5DJMA 4F0BA 5ABRA 4D73A 4PTSA 4BVYA 2CAQA 2JZRA 2XHFA 3E9JB 3A2VA 4AGSA 4OWYA 1J0FA 4E8HA 2EFDA 4JRRA 2EFEA 1XFLA 3ZVJD 1TXXA 3L4NA 2KLXA 1GSSA 1YF1A 4K0GA 1HD2A 2KOKA 1WWJA 3IK9A 4IGJA 3DMLA 2LQQA 1QGVA 3IRAA 1OC9B 3FR9A 1PGTA 4OO4A 5DDLA 3IK7A 4PHZC 3HZ4A 3FZ5A 1TK8B 4FH8A 2FWGA 2GSTA 2GZPA 1WJKA 2H0IA 2MBTA 4DSQA 1TRVA 3MIXA 1M2AA 4MF6A 5J41A 5GAPD 3TB2A 1EGRA 2C3QA 1AAZA 1OE8A 2FWFA 2WULA 3ZMLA 1WP0A 3DRNA 2N5BA 2O8VB 3DYRA 1V40A 1ZL9A 4IQ1A 5B6NA 1T00A 3UIWA 1X0RA 1YEPA 3NZNA 5HQPA 4NHZA 5CRDA 1GLQA 4K6XA 1K0MA 4XRAA 3PH9A 4GDFA 1U88A 1NHOA 4J56E 1GH2A 3J7Yb 4OD7A 5IO0A 3QFBC 2UZ8A 4KUNA 1SD9A 1NSWA 4G2EA 2LTKA 3KMOA 2FD3A 2YN1A 2YWOA 1AQVA 1GSFA 3H8QA 4WEYA 4ILFA 6GSWA 5J47A 1HQOA 3UBLA 2WZ9A 2NVLA 1O8XA 1F3AA 4PGTA 4MH3A 2IMIA 2OADA 3KTBA 2VD1A 4EC0A 1LU4A 2I9HA 3KP8A 4HJMA 3F63A 1JZRA 2HQTA 2WVZA 1ZGNA 3GA4A 4L5OA 4A5PA 3M1GA 4NHWA 4YAPA 1BX9A 2VCVA 1JLVA 4XCSA 2O89A 1GRXA 1DE2A 2QA1A 1BQ7A 1OVNA 4O5UA 2VOCA 2E7PA 1A8LA 1VRSD 3DIEA 5IOWA 4FXYP 1E6BA 3DWVA 20GSA 4PQHA 1CQHA 1ERVA 1OC3A 2R0GA 2H72A 3QMXA 1M3JA 5DALA 2DBCA 1GNWA 4HOJA 4E68A 2WDUA 2H1GA 2I3YA 3SBCA 3IPZA 2A2PA 2GZZA 3RFRC 2EIQA 3RAZA 4IVFA 3KZQA 4JBBA 5IO2A 3VLNA 1EWXA 2RUFA 2VCQA 4HDEA 5EL8A 5CO3A 1MD3A 2RLIA 1ZMAA 4ZXGA 5J9CA 2G0FA 2EFHA 2LJRA 5J40A 2R2JA 4HQZA 1ON4A 2R37A 4TXOB 2GTUA 2CVBA 5IOXA 1PL1A 2VO4A 3W6GA 3CSJA 1E2YA 5IMCA 2A2RA 5A1NB 5KN0A 1LJRA 4GLTA 2HRAA 1FVKA 2WVYA 1GSYA 1O7UA 2YV7A 2YPMA 1PN9A 3MYDA 4X4JA 3EC3A 4MJCA 1GWCA 3UJ1A 3IOSA 4ZL7A 4G0KA 2O5VA 2C80A 3EURA 4IS0A 3TKQA 2ON7A 2LUSA 5B8BA 3ZREA 1AQWA 5CNWA 2FGXA 2HNLA 2DJJA 6GSYA 3EPTA 2VL2A 5HFKA 1JZDA 1TOFA 1A23A 2DJKA 5JWQB 2HXKA 2VKZG 2K8SA 1FOVA 1PQNA 4OFTA 5ECOB 4NAXA 3CBUA 5EY6A 3U5RE 3TKSE 2F51A 4TOPA 1Y1UA 2NPBA 2I4AA 3HVVA 1M3IA 3F0IA 1ACVA 2WVXB 4EVMA 1X5DA 2ZUPA 3RPNA 5KN1A 1F3BA 2O7KA 1WE0A 1XWBA 2LV3A 5JCUA 2MZCA 2DJ3A 1VF3A 1F37A 2L4CA 2M46A 3GTUA 2DMMA 4ZB8A 2H74A 2MMOA 3LQ7A 4MZBA 3F6DA 2X8HA 4OMVA 4HU9A 3CRUA 2B5XA 5A34A 4EIQA 1TDIA 2L57A 5G30A 3ED3A 4XS4B 2CA8A 2AJQB 1GSEA 1OE7A 4HZ4A 2H70A 2YZUA 2JZTA 2HI7A 2B7JA 3F9UA 2VIMA 2DKIA 5G2ZA 1TI3A 3LJRA 1R5PA 4L5LA 1QFNA 5F8BA 1PL2A 3GV1A 1SL1B 2HSMA 4QQ7A 4DSRA 2R5GA 4MF7A 3TCOA 1N25A 1XOAA 3NOFA 2YWNA 5KOWA 3PR8A 1XW5A 4FO5A 1KBNA 3MNGA 2PGTA 1N8JA 2HSNA 2YCDA 1X5EA 3HZ8A 3HY2A 4MA9A 2H0GA 2H8LA 2JACA 1XPVA 4KE3A 4F82A 1WOUA 4MCUA 2GSQA 3VI7A 2PBJA 2B5YA 1A2MA 3PGTA 1EP7A 1AIUA 3HKRA 3TRPA 4MZWA 2M80A 3HJMA 2PVQA 5J9BA 2WW0A 2B5EA 2FY6A 1FB0A 1Z9HA 4DVCA 2V6OA 4POBA 3VI5A 2DIZA 1WPIA 3MAKA 1AXDA 3D0ZA 3CRTA 1FOHA 2VLVA 3CWGA 4Z2UA 3M0FA 5G5EA 1TTZA 3ZMKA 1A8YA 2P5RA 4MK3A 3TJBA 1XZOA 3UEMA 4BL7B 3O6TA 4Q5RA 3W8JA 1GTIA 3D4TA 1YEWC 4MPGA 1YY7A 2CAIA 1GSUA 2PMTA 2O36A 4TXVA 1PFOA 3KGKA 5IM9A 4N0VA 4HSCX 2GT6A 5IQYA 3QDNA 4G19A 1M99A 1BAYA 4WR4A 1SVLA 2L4QA 1ZYQB 4HEA2 2C0GA 1QMVA 2H01A 4HUAA 4I2UA 5IPGA 4PUAA 3R3EA 3LG6A 3GH9A 3QFAC 1ZYNA 2H6ZA 2R6KA 4GXZA 3A5IA 3AY8A 2HT9A 1XWCA 5EPFA 1H75A 1GUHA 5E59A 1X9WB 1YVLA 4CHSA 3MWHA 2VL9A 5CAXA 1SVOA 2H1BA 4WKWA 1JHBA 1T7PB 3QR6A 3IHGA 3GL5A 4ZBDA 2CVDA 5JCGA 3GX8A 1FG4A 5D9VA 2LKUA 5A4UA 4HQSA 3I43A 1G6WA 3J7Yk 1UC7A 4ML6A 3BOAA 3ERWA 5FT3A 1OAZA 1PRXA 3QAVA 2MBSA 4X1UA 4W66A 3HYPA 2VCTA 3KXOA 4LMWA 4PUFC 3GYKA 4KGIA 5F06A 3FZAA 2CZ3A 1UN2A 2OBKA 1ERTA 2KP1A 3CMIA 2X99A 3A2XA 2WS2A 1QK8A 2I1UA 5FHIA 4MZCA 3CTGA 4DSSB 4AF2A 1URMA 4BA7A 1GP1A 1OC9A 1R7HA 3APSA 5CYYA 1V98A 5CP1A 5ECLB 5INYA 5ECNB 1ABAA 3DVWA 1YDKA 4AKIA 3GRXA 22GSA 3MSZA 1PX7A 4XTSA 1OC8A 3KD0A 1U3IA 5H5QA 2DC5A 4POKA 3LGCA 4EF0A 4Q5FA 5BMUA 5ID2B 5ECMB 5CREA 3IC8A 4MDCA 3P7XA 4OCFA 5KN3A 3RGBC 2GQMA 4TR0A 3D21A 1B8XA 1FVJA 3G7IA 3FR6A 5B7CA 4YQUA 4EE0A 2CQ9A 1BYEA 3FYGA 1KNGA 2OACA 2BJXA 6GSVA 4G9HA 4MF5A 3HVSA 5DVBA 2VUPA 3SWLA 3ISOA 3BCKA 1AQXA 5BMUB 2IFQB 1SKSB 4PQ1A 4OO5A 4GWRA 1HYUA 3A3TA 1MD4A 3RPPA 5DJLA 3HHVA 4V2NA 4ID0A 2MMNA 3WGXA 1MEKA 2YOIA 2F8FA 3DKSA 4IELA 1J9BA 1Y6EA 3HVNA 4EUYA 5IIZA 4K7OA 3O76A 4AKGA 2BMXA 1GULA 1Q4JA 5ENUA 4TR1B 4Z7XA 1BG5A 3LSZA 1XOBA 4WF5A 1FAAA 5IMZA 1JFUA 1IYIA 5D73A 3LWAA 2J23A 3S9FA 2GGTA 4X0XA 1FO5A 1GUMA 5GSTA 4K2DA 1S3AA 2WFCA 2RM5A 3GHAA 5H5RA 5A4WA 4MNNA 2FHEA 5GAND 2FA4A 3BJ5A 2GLRA 4O7HA 2A4HA 4TR3A 4V2LA 4N11A 1TRSA 3HD5A 3UVTA 3EINA 4ML1A 1M9AA 2B3SA 3UMAA 2FUG2 3FR3A 2OT3A 2L6CA 3IC4A 1V57A 4KCAA 1SK2A 2H1DA 5AIVA 1TK5B 1BEDA 6GSXA 2PVOC 1XXUA 1SENA 3H4KA 1K0DA 4KH7A 2B6MA 1F2EA 1GSDA 5COHA 2GDRA 4POMA 3UAPA 1NHYA 4XIHA 2TRXA 10GSA 1SJ6A 3TDGA 3QCPA 4N0ZA 1HNCA 4TXOA 3FZ9A 3EU3A 2YP6A 3G7JA 2NBSA 3FKFA 3L78A 5A1NA 2OE1A 2NDOA 1G7OA 4NPBA 3L0HA 4XHMA 4KSMA 2G2QA 4O5QA 3EYTA 1XWKA 4QL9A 4JR4A 1PX6A 3RBTA 1MTCA 1JLWA 3LYPA 4N10A 1XCCA 2WJUA 3CSHA 4J2FA 2B7KA 2IMKA 5D9XA 2CVKA 2H73A 2DJ2A 1EV9A 3UBKA 4V2MA 1M0UA 3MDKA 3GKNA 2PERA 3TRXA 4YKGA 4IN0A 1RW1A 1RK4A 3TKPA 5IPHA 4NV2A 4PI2C 4I97A 2IMDA 4L0UA 5KN2A 3FY7A 2QC7A 9GSSA 1THXA 1WIKA 2A4VA 2WGRA 5HR0A 1DE1A 2FNOA 1X9MB 1ZYEA 2TRCP 3KJYA 1SKRB 2H6YA 4Q5QA 1U6TA 4OFNA 1QQ2A 4WXTA 3TUEA 4KF9A 5C04A 2L5OA 3A5WA 4EDZA 5J3RA 2AAWA 2C0EA 3D6IA 4K0NA 5ELAA 4ZB7A 2YV9A 2X49A 4Z2TA 3Q18A 5LCZA 3LXZA 2HZEB 3KM6A 2DIYA 1BF5A 2WVXA 4V1Ap 1S3RA 2LRCA 2WW3A 4J57E 4K2XA 5B6MA 5JWOB 1K0NA 2IMFA 1YKAA 1IYHA 2V2GA 3TU3B 4LA1A 4G0LA 4JR6A 2E2GA 1H4OA 4ECBA 3Q74A 2GSSA 3F4TA 3CSIA 4K5SA 4NMUA 2HRKB 2C8UA 1TKDB 4G10A 4XS4A 3M8NA 8GSSA 4MH2A 4FQUA 2O3EA 3VPQA 4MPFA 1HNAA 4HI7A 2L6DA 5ECPB 3HCZA 4YH2A 2ON5A 4L8EA 2LSTA 1R5AA 5IMFA 1Z6MA 2RIIA 2P31A 1ZZYA 2JZSA 4EIPA 4IQAA 4MJEA 3TJKA 2X4AA 4RQRA 4KW6A 3HJPA 4JE1A 3M9KA 1N2AA 2CT6A 4I5QA 4NWYA 14GSA 5ECRB 2F9SA 4TR4A 4TW5A 2YJ7A 1PD21 4IHUA 4GF0A 4AJ7A 5H5SA 1GL8A 1RQMA 2C4JA 1EP8A 5IMDA 3H93A 5D93A 1A24A 1TJDA 3ZIVA 5JWRB 4L0WA 3E3EA 2C3NA 2C3TA 3L9SA 3LFLA 2H1LA 3GURA 2LJAA 1PN0A 4BPYA 2V41A 2X8GA 5CRHA 2QA2A 4KAEA 3UOMA 2GZYA 3F3RA 4MABA 1PA3A 3BD2A 2LS5A 2IJYA 1XW9A 1YF0A 5CRWA 1SKWB 1XIYA 3A2WA 4BL7A 4KCEA 2XPDA 4EKZA 1Y25A 3BBYA 1THOA 4RUVA 4RI7A 5G1LA 1VGLA 3F4RA 5A5HB 3BCIA 3WT2A 5IMVA 2YZHA 2LJKA 2E2MA 2X8CA 1MDKA 1I9DA 1SJIA 2VL3A 3DEXA 2R4VA 6GSUA 1FB6A 1G7EA 4ZIJA 5DBQA 4ICYA 1EV4A 4WF4A 2H75A 1XWAA 3FZ4A 4GSSA 1M9BA 2C0FA 3PPUA 1HNBA 1F6MC 2OE0A 2LRTA 4POLA 3E0UA 2AV4A 1XBSA 3EMPA 2WB9A 1JZOA 5GZZB 5D9TA 2OBIA 1TW9A 1SYRA 5J5NA 3F6FA 1G0TA 2RUEA 4BWSA 2VAFA 4KX4A 4K8MA 1YJ6A 1NW2A 2IIYA 4EO3A 3FW2A 1QXHA 3ERGA 1CQGA 1B9XC 5LNKe 3KP9A 3HVXA 1Z3EA 2GQKA 4IJIA 2HLSA 4JZQA 2VM1A 3F3QA 2LNTA 2HYXA 2WCIA 3KH7A 1SVMA 4ECIA 1UVZA 3GKMA 4MMMA 1QUWA 4ZILA 1YKCA 2D2ZA 5AGYA 2L59A 3P8WA 1TP9A 5G31A 5KEJA 1YZXA 2EIOA 3VK9A 5L71A 4ULXA 4QMKA 2OKAA 2J9HA 3KH9A 1K0CA 1A0RP 2OE3A 2AYTA 2IL3A 3IR4A 2FLSA 4DSSA 2VLTA 2GT5A 2ALBA 2P5QA 4HZ2A 4ZL8A 4PQIA 1M2DA 5DAKB 3WYWA 2HSYA 3EWLA 4KA0A 1UA5A 3F8UA 4PNFA 4BVXB 2K18A 2VCXA 4HJ2A 1EOHA 5D96A 2WRTA 2N5FA 2XBIA 4HU7A 1B9YC 3IHQA 5G5FA 5ECHB 4ISDA 3VWXA 4CDOA 5AN1A 5HFGA 1JZWA 2CV4A 4GTUA 3TJJA 4WR5A 2GS3A 2QSIA 1YEXA 5ID2A 16GSA 3KIJA 4OCEA 3TOUA 3IBHA 1TI1A 2VCZA 3D5JA 5CRGA 4PX1A 17GSA 4ZBBA 2F3MA 4MJBA 2IFQA 3CTFA 4I2TA 1PMTA 4YKFA 4GSTA 5HR3A 3EU4A 4GQCA 1KTEA 4D73B 1K0BA 2V1MA 4DEJA 2CX4A 1EGOA 1AW9A 3ZITA 2JSZA 3CXGA 2LNSA 4BWQA 4BVYB 4NV5A 2V32A 1GNEA 2WW1A 1M7TA 2XPEA 4PI0C 3TKRA 13GSA 1SL2B 2PWJA 2DSAA 4ACSA 1B4QA 2AUVA 3TOTA 3IAM2 3C8EA 1ZYPA 2DJ1A 7GSSA 3QOUA 19GSA 3L9VA 5DCGA 4TR1A 6GSTA 4F9ZA 3GKXA 2K9FA 2H71A 1ILOA 3O3TA 1AUCA 1YQ1A 3GFKA 3WGEA 3DVXA 5HR2A 4IKHA 2WW2A 4O92A 2JL4A 5F0GA 2C1YA 2XBQA 1A2JA 5LD0A 3UVHA 4F03A 5JCWA 2HFDA 3P2AA 2QGVA 1DUGA 4ZBAA 3GKKA 3QD9A 4IW9A 3QAWA 3FHKA 1TRUA 2EC4A 3C1RA 4KNDA 2DJ0A 5ECIB 1G6YA 18GSA 5DQSA 3US3A 5J4VA 3ZZXA 1DSBA 4CY8A 1Z7RA 3LYKA 4RQXA 5ECQB 4ECCA 3I69A 2CX3A 3APQA 1SK0A 2XC2A 1C72A 4IBPA 3W8SA 1MDJA 3HXSA 2HRFA 1XW6A 2ES7A 2GQLA 4GQFA 4FIWA 2PUKC 3M3MA 3WT1A 2HSHA 2H0HA 1MDIA 2IWTA 5D8IA 3N5OA 4IJ3A 2IMEA 1O85A 2JSYA 1FW1A 1K3YA 3VWVA 6GSSA 1EZKA 4I6XA 1OKDA 3GX0A 2AHEA 3RHBA 5IMAA 2DMLA 3JCML 1K0AA 3UARA 5GSSA 1XG8A 4MP4A 3IE3A 1SJZA 2YANA 3NIVA 1VF4A 1SK1A 3TKSC 1WMJA 3ZVJA 2ZCTA 1K3LA 3C1SA 5A4VA 1ZOFA 4P3YB 2H6XA 3D22A 2PU9C 4YQVA 1S4BP 4EL1A 1SD8A 3M9JA 3QPMA 2LEGA 4WBRD 1T4ZA 4FYCA 3I9V2 3U6VA 2FWHA 3GH6A 4EDYA 2PPTA 2VLUA 5FWGA 3TRQA 1T3BA 1NM3A 4F2IA 4Z2RA 1ST9A 4GSNA 4KB3A 2V6KA 3FEUA 1USBA 3GIXA 2IN3A 3UL3A 3IXRA 1J08A 2C0DA 3WD6A 5DALB 4ZB6A 2ZNMA 4IP1A 2HRNA 3EE2A 3ZRDA 1ZCPA 2BTOT 5AISA 3H1NA 1V2AA 2QKEA 5ECKB 4RI6A 4BIKA 5BRTA 2K8VA 4GRFA 3FRCA 1GTBA 5G1KA 2YWMA 4PURA 1Z7PA 4AKHA 4ZL9A 2HZEA 4K1FA 3KMNA 1Z5YE 2VCWA 3ME8A 4K7NA 5HFIA 1U3AA 3VWUA 4KDYA 2E0QA 1W4VA 2P0GA 1A0FA 1F9MA 1EOGA 1GTAA 1V58A 4MLYA 2EFCA 1ERWA 1B4PA 3GL3A 2AB6A 4CW9A 2H76A 3FK8A 2IPAA 3F4SA 4TRXA 2LRNA 3I6AA 3TJGA 1R26A 4F0CA 3EMXA 2FCHA 2N5AA 2HRKA 3GSSA 1M2BA 1T8EB 4H86A 5F05A 3HMJG 2CZ2A 1GUKA 5EVOA 3CYNA 2TIRA 3K8NA 3ERFA 4OFMA 3APOA 1TU7A 4CY6A 1S3CA 4X43A 1I5GA 2L5LA 2H66A 3IAS2 3ZIJA 1K3OA 3PINA 2H1AA 4AJ8A 2K6VA 2A2SA 1Z6NA 3WGDA 2GSRA 2RM6A 4TKYA 4V1Ag 3EVIA 1T1VA 1OKTA 3V1WA 4XRDA 2YNXA 4WBJA 3KTLA 1DBYA 3ZFLA 3CQFA 4TN8A 4I8BA 2PN8A 4LLRA 1X9SB 4K5RA 2OJLA 2KHPA 1SU9A 1O81A 3TGZA 3ZYWA 2MYGA 3GN3A 4IP6A 4PXOA 1K0OA 3ZFBA 1SYXA 3LORA 1B48A 2NTOA 4QL7A 1T4YA 4AJ6A 1PKWA 1KEBA 2GVPA 3ZL5A 4Q5NA 1Q98A 4K7IA 4KSOA 1GTUA 2WZSA 4KDUA 5DQYA 2MMAA 3GTUB 3VWWA 2O85A 4O32A 2FWEA 5J4YA 1I1IP 5A34B 2VM2A 3G9BA 3KEBA 5A5KA 1TK0B 1VF1A 1SL0B 1X5CA 2Z9SA 5A5HA 2KP2A 4N30A 1VF2A 1LBKA 1GLPA 3GSTA 4LL4B 3P90A 1ML6A 4ECJA 1BJXA 3C71A 2HZFA 4NXIA 4JU5A 3IV4A 1XVQA 4PNGA 3LW9A 2DLXA 4G01A 2HSMB 3HJOA 2M72A 3QAGA 2HE3A 4K9ZA 1GSQA 1BG1A 11GSA 3IDVA 2H19A 3RHCA 2DKHA 3L9UA 4LL1B 2UV8G 3Q19A 2JADA 4TVEA 4E8EA 1FHEA 1XWGA 5ELGA 2REMA 3FMWA 3KCMA 3RDWA 4LMVA 1OYJA 1O6JA 2HSNB 4KDXA 2R3XA 4AKXB 4MJAA 4O5RA 2EIRA 5B8AA 3CHXC 3LXTA 3HDCA 4USSA 3TJFA 3HA9A 5D9WA 3GUSA 4YQMA 4N3ZA 4FYBA 3D4MA 1XVWA 3TKSA 4ZB9A 1ERUA 1EEMA 1W89A 4FYUA 1EEJA 2OA7A 5HR1A 2B1KA 2MMZA 1A2LA 2B1LA 1O8WA 3Q6OA 3VPTA 2X64A 1S3DA 3GMFA 2R0PA 2VD0A 2R0CA 3ZTLA 2O87A 2KUCA 5DCHA 2YJHA 12GSA 4GCIA 1R4WA 4HS1A 3G7YA 1PKZA 5DAKA 3N9JA 4BVXA 3DGQA 4YAVA
chains in the Genus database with same CATH topology
3DD3A 4XS1A 3C73A 5ECSA 2FA8A 4XS6A 1AC1A 1TXUA 1WRYA 2LQOA 5C00A 3OR5A 3GNJA 3H79A 2H30A 2JU5A 5KOXA 1TRWA 3VURA 5E4WA 2F8AA 1O73A 3ME7A 3ZLPA 1PSQA 5F07A 4EXJA 3C7MA 2YWIA 4AI6A 2I81A 3R2QA 3VFIA 3IA1A 3DXBA 1V9WA 1U87A 2VL2C 4WETA 4G0IA 4JEDA 5J4UA 5AIXA 3LEFA 1TU8A 5DJMA 4F0BA 5ABRA 4D73A 4PTSA 4BVYA 2CAQA 2JZRA 2XHFA 3E9JB 3A2VA 4AGSA 4OWYA 1J0FA 4E8HA 2EFDA 4JRRA 2EFEA 1XFLA 3ZVJD 1TXXA 3L4NA 2KLXA 1GSSA 1YF1A 4K0GA 1HD2A 2KOKA 1WWJA 3IK9A 4IGJA 3DMLA 2LQQA 1QGVA 3IRAA 1OC9B 3FR9A 1PGTA 4OO4A 5DDLA 3IK7A 3HZ4A 3FZ5A 1TK8B 4FH8A 2FWGA 2GSTA 2GZPA 1WJKA 2H0IA 2MBTA 4DSQA 1TRVA 3MIXA 1M2AA 4MF6A 5J41A 5GAPD 3TB2A 1EGRA 2C3QA 1AAZA 1OE8A 2FWFA 2WULA 3ZMLA 1WP0A 3DRNA 2N5BA 2O8VB 3DYRA 1V40A 1ZL9A 4IQ1A 5B6NA 1T00A 3UIWA 1X0RA 1YEPA 3NZNA 5HQPA 4NHZA 5CRDA 1GLQA 4K6XA 1K0MA 4XRAA 3PH9A 4GDFA 1U88A 1NHOA 4J56E 1GH2A 3J7Yb 4OD7A 5IO0A 3QFBC 2UZ8A 4KUNA 1SD9A 1NSWA 4G2EA 2LTKA 3KMOA 2FD3A 2YN1A 2YWOA 1AQVA 1GSFA 3H8QA 4WEYA 4ILFA 6GSWA 5J47A 1HQOA 3UBLA 2WZ9A 2NVLA 1O8XA 1F3AA 4PGTA 4MH3A 2IMIA 2OADA 3KTBA 2VD1A 4EC0A 1LU4A 2I9HA 3KP8A 4HJMA 3F63A 1JZRA 2HQTA 1ZGNA 3GA4A 4L5OA 4A5PA 3M1GA 4NHWA 4YAPA 1BX9A 2VCVA 1JLVA 4XCSA 2O89A 1GRXA 1DE2A 2QA1A 1BQ7A 1OVNA 4O5UA 2VOCA 2E7PA 1A8LA 1VRSD 3DIEA 5IOWA 1E6BA 3DWVA 20GSA 4PQHA 1CQHA 1ERVA 1OC3A 2R0GA 2H72A 3QMXA 5DALA 2DBCA 1GNWA 4HOJA 4E68A 2WDUA 2H1GA 2I3YA 3SBCA 3IPZA 2A2PA 2GZZA 2EIQA 3RAZA 4IVFA 3KZQA 4JBBA 5IO2A 3VLNA 1EWXA 2RUFA 2VCQA 4HDEA 5EL8A 5CO3A 1MD3A 2RLIA 1ZMAA 4ZXGA 5J9CA 2G0FA 2EFHA 2LJRA 5J40A 2R2JA 4HQZA 1ON4A 2R37A 4TXOB 2GTUA 2CVBA 5IOXA 1PL1A 2VO4A 3W6GA 3CSJA 1E2YA 5IMCA 2A2RA 5A1NB 5KN0A 1LJRA 4GLTA 2HRAA 1FVKA 1GSYA 1O7UA 2YV7A 2YPMA 1PN9A 3MYDA 4X4JA 3EC3A 4MJCA 1GWCA 3UJ1A 3IOSA 4ZL7A 4G0KA 2O5VA 2C80A 3EURA 4IS0A 3TKQA 2ON7A 2LUSA 5B8BA 3ZREA 1AQWA 5CNWA 2FGXA 2HNLA 2DJJA 6GSYA 3EPTA 2VL2A 5HFKA 1JZDA 1TOFA 1A23A 2DJKA 5JWQB 2HXKA 2VKZG 2K8SA 1FOVA 1PQNA 4OFTA 5ECOB 4NAXA 3CBUA 5EY6A 3U5RE 3TKSE 2F51A 4TOPA 1Y1UA 2NPBA 2I4AA 3HVVA 3F0IA 1ACVA 4EVMA 1X5DA 2ZUPA 3RPNA 5KN1A 1F3BA 2O7KA 1WE0A 1XWBA 2LV3A 5JCUA 2MZCA 2DJ3A 1VF3A 1F37A 2L4CA 2M46A 3GTUA 2DMMA 4ZB8A 2H74A 2MMOA 3LQ7A 4MZBA 3F6DA 2X8HA 4OMVA 4HU9A 3CRUA 2B5XA 5A34A 4EIQA 1TDIA 2L57A 5G30A 3ED3A 4XS4B 2CA8A 2AJQB 1GSEA 1OE7A 4HZ4A 2H70A 2YZUA 2JZTA 2HI7A 2B7JA 3F9UA 2VIMA 2DKIA 5G2ZA 1TI3A 3LJRA 1R5PA 4L5LA 1QFNA 5F8BA 1PL2A 3GV1A 1SL1B 2HSMA 4QQ7A 4DSRA 2R5GA 4MF7A 3TCOA 1N25A 1XOAA 3NOFA 2YWNA 5KOWA 3PR8A 1XW5A 4FO5A 1KBNA 3MNGA 2PGTA 1N8JA 2HSNA 2YCDA 1X5EA 3HZ8A 3HY2A 4MA9A 2H0GA 2H8LA 2JACA 1XPVA 4KE3A 4F82A 1WOUA 4MCUA 2GSQA 3VI7A 2PBJA 2B5YA 1A2MA 3PGTA 1EP7A 1AIUA 3HKRA 3TRPA 4MZWA 2M80A 3HJMA 2PVQA 5J9BA 2FY6A 2B5EA 1FB0A 1Z9HA 4DVCA 2V6OA 4POBA 3VI5A 2DIZA 1WPIA 3MAKA 1AXDA 3D0ZA 3CRTA 1FOHA 2VLVA 3CWGA 4Z2UA 3M0FA 5G5EA 1TTZA 3ZMKA 1A8YA 2P5RA 4MK3A 3TJBA 1XZOA 3UEMA 4BL7B 3O6TA 4Q5RA 3W8JA 1GTIA 3D4TA 4MPGA 1YY7A 2CAIA 1GSUA 2PMTA 4TXVA 5IM9A 3KGKA 4N0VA 2GT6A 5IQYA 3QDNA 4G19A 1M99A 1BAYA 4WR4A 1SVLA 2L4QA 1ZYQB 4HEA2 2C0GA 1QMVA 2H01A 4HUAA 4I2UA 5IPGA 4PUAA 3R3EA 3LG6A 3GH9A 3QFAC 1ZYNA 2H6ZA 2R6KA 4GXZA 3A5IA 3AY8A 2HT9A 1XWCA 5EPFA 1H75A 1GUHA 5E59A 1X9WB 1YVLA 4CHSA 3MWHA 2VL9A 5CAXA 1SVOA 2H1BA 4WKWA 1JHBA 1T7PB 3QR6A 3IHGA 3GL5A 4ZBDA 2CVDA 5JCGA 3GX8A 1FG4A 5D9VA 2LKUA 5A4UA 4HQSA 3I43A 1G6WA 3J7Yk 1UC7A 4ML6A 3BOAA 3ERWA 5FT3A 1OAZA 1PRXA 3QAVA 2MBSA 4X1UA 4W66A 3HYPA 2VCTA 3KXOA 4LMWA 4PUFC 3GYKA 4KGIA 5F06A 3FZAA 2CZ3A 1UN2A 2OBKA 1ERTA 2KP1A 3CMIA 2X99A 3A2XA 2WS2A 1QK8A 2I1UA 5FHIA 4MZCA 3CTGA 4DSSB 4AF2A 1URMA 4BA7A 1GP1A 1OC9A 1R7HA 3APSA 5CYYA 1V98A 5CP1A 5ECLB 5INYA 5ECNB 1ABAA 3DVWA 1YDKA 4AKIA 3GRXA 22GSA 3MSZA 1PX7A 4XTSA 1OC8A 3KD0A 1U3IA 5H5QA 2DC5A 4POKA 3LGCA 4EF0A 4Q5FA 5BMUA 5ID2B 5ECMB 5CREA 3IC8A 4MDCA 3P7XA 4OCFA 5KN3A 2GQMA 4TR0A 3D21A 1B8XA 1FVJA 3G7IA 3FR6A 5B7CA 4YQUA 4EE0A 2CQ9A 1BYEA 3FYGA 1KNGA 2OACA 2BJXA 6GSVA 4G9HA 4MF5A 3HVSA 5DVBA 2VUPA 3SWLA 3ISOA 3BCKA 1AQXA 5BMUB 2IFQB 1SKSB 4PQ1A 4OO5A 4GWRA 1HYUA 3A3TA 1MD4A 3RPPA 5DJLA 3HHVA 4V2NA 4ID0A 2MMNA 3WGXA 1MEKA 2YOIA 2F8FA 3DKSA 4IELA 1J9BA 1Y6EA 4EUYA 5IIZA 4K7OA 3O76A 4AKGA 2BMXA 1GULA 1Q4JA 5ENUA 4TR1B 4Z7XA 1BG5A 3LSZA 1XOBA 4WF5A 1FAAA 5IMZA 1JFUA 1IYIA 5D73A 3LWAA 2J23A 3S9FA 2GGTA 4X0XA 1FO5A 1GUMA 5GSTA 4K2DA 1S3AA 2WFCA 2RM5A 3GHAA 5H5RA 5A4WA 4MNNA 2FHEA 5GAND 2FA4A 3BJ5A 2GLRA 4O7HA 2A4HA 4TR3A 4V2LA 4N11A 1TRSA 3HD5A 3UVTA 3EINA 4ML1A 1M9AA 2B3SA 3UMAA 2FUG2 3FR3A 2OT3A 2L6CA 3IC4A 1V57A 4KCAA 1SK2A 2H1DA 5AIVA 1TK5B 1BEDA 6GSXA 2PVOC 1XXUA 1SENA 3H4KA 1K0DA 4KH7A 2B6MA 1F2EA 1GSDA 5COHA 2GDRA 4POMA 3UAPA 1NHYA 4XIHA 2TRXA 10GSA 1SJ6A 3TDGA 3QCPA 4N0ZA 1HNCA 4TXOA 3FZ9A 3EU3A 2YP6A 3G7JA 2NBSA 3FKFA 3L78A 5A1NA 2OE1A 2NDOA 1G7OA 4NPBA 3L0HA 4XHMA 4KSMA 2G2QA 4O5QA 3EYTA 1XWKA 4QL9A 4JR4A 1PX6A 3RBTA 1MTCA 1JLWA 3LYPA 4N10A 1XCCA 2WJUA 3CSHA 4J2FA 2B7KA 2IMKA 5D9XA 2CVKA 2H73A 2DJ2A 1EV9A 3UBKA 4V2MA 1M0UA 3MDKA 3GKNA 2PERA 3TRXA 4YKGA 4IN0A 1RW1A 1RK4A 3TKPA 5IPHA 4NV2A 2IMDA 4I97A 4L0UA 5KN2A 3FY7A 2QC7A 9GSSA 1THXA 1WIKA 2A4VA 2WGRA 5HR0A 1DE1A 2FNOA 1X9MB 1ZYEA 2TRCP 3KJYA 1SKRB 2H6YA 4Q5QA 1U6TA 4OFNA 1QQ2A 4WXTA 3TUEA 4KF9A 5C04A 2L5OA 3A5WA 4EDZA 5J3RA 2AAWA 2C0EA 3D6IA 4K0NA 5ELAA 4ZB7A 2YV9A 2X49A 4Z2TA 3Q18A 5LCZA 3LXZA 2HZEB 3KM6A 2DIYA 1BF5A 4V1Ap 2LRCA 4J57E 4K2XA 5B6MA 5JWOB 1K0NA 2IMFA 1YKAA 1IYHA 2V2GA 3TU3B 4LA1A 4G0LA 4JR6A 2E2GA 1H4OA 4ECBA 3Q74A 2GSSA 3F4TA 3CSIA 4K5SA 4NMUA 2HRKB 2C8UA 1TKDB 4G10A 4XS4A 3M8NA 8GSSA 4MH2A 4FQUA 3VPQA 4MPFA 1HNAA 4HI7A 2L6DA 5ECPB 3HCZA 4YH2A 2ON5A 4L8EA 2LSTA 1R5AA 5IMFA 1Z6MA 2RIIA 2P31A 1ZZYA 2JZSA 4EIPA 4IQAA 4MJEA 3TJKA 2X4AA 4RQRA 4KW6A 3HJPA 4JE1A 3M9KA 1N2AA 2CT6A 4I5QA 4NWYA 14GSA 5ECRB 2F9SA 4TR4A 4TW5A 2YJ7A 1PD21 4IHUA 4GF0A 4AJ7A 5H5SA 1GL8A 1RQMA 2C4JA 1EP8A 5IMDA 3H93A 5D93A 1A24A 1TJDA 3ZIVA 5JWRB 4L0WA 3E3EA 2C3NA 2C3TA 3L9SA 3LFLA 2H1LA 3GURA 2LJAA 1PN0A 4BPYA 2V41A 2X8GA 5CRHA 2QA2A 4KAEA 3UOMA 2GZYA 3F3RA 4MABA 1PA3A 3BD2A 2LS5A 2IJYA 1XW9A 1YF0A 5CRWA 1SKWB 1XIYA 3A2WA 4BL7A 4KCEA 2XPDA 4EKZA 1Y25A 3BBYA 1THOA 4RUVA 4RI7A 5G1LA 1VGLA 3F4RA 5A5HB 3BCIA 3WT2A 5IMVA 2YZHA 2LJKA 2E2MA 2X8CA 1MDKA 1I9DA 1SJIA 2VL3A 3DEXA 2R4VA 6GSUA 1FB6A 1G7EA 4ZIJA 5DBQA 4ICYA 1EV4A 4WF4A 2H75A 1XWAA 3FZ4A 4GSSA 1M9BA 2C0FA 3PPUA 1HNBA 1F6MC 2OE0A 2LRTA 4POLA 3E0UA 2AV4A 1XBSA 3EMPA 2WB9A 1JZOA 5GZZB 5D9TA 2OBIA 1TW9A 1SYRA 5J5NA 3F6FA 1G0TA 2RUEA 4BWSA 2VAFA 4KX4A 4K8MA 1YJ6A 1NW2A 2IIYA 4EO3A 3FW2A 1QXHA 3ERGA 1CQGA 1B9XC 5LNKe 3KP9A 3HVXA 1Z3EA 2GQKA 4IJIA 2HLSA 4JZQA 2VM1A 3F3QA 2LNTA 2HYXA 2WCIA 3KH7A 1SVMA 4ECIA 1UVZA 3GKMA 4MMMA 1QUWA 4ZILA 1YKCA 2D2ZA 5AGYA 2L59A 3P8WA 1TP9A 5G31A 5KEJA 1YZXA 2EIOA 3VK9A 5L71A 4ULXA 4QMKA 2OKAA 2J9HA 3KH9A 1K0CA 1A0RP 2OE3A 2AYTA 2IL3A 3IR4A 2FLSA 4DSSA 2VLTA 2GT5A 2ALBA 2P5QA 4HZ2A 4ZL8A 4PQIA 1M2DA 5DAKB 3WYWA 2HSYA 3EWLA 4KA0A 1UA5A 3F8UA 4PNFA 4BVXB 2K18A 2VCXA 4HJ2A 1EOHA 5D96A 2WRTA 2N5FA 2XBIA 4HU7A 1B9YC 3IHQA 5G5FA 5ECHB 4ISDA 3VWXA 4CDOA 5AN1A 5HFGA 1JZWA 2CV4A 4GTUA 3TJJA 4WR5A 2GS3A 2QSIA 1YEXA 5ID2A 16GSA 3KIJA 4OCEA 3TOUA 3IBHA 1TI1A 2VCZA 3D5JA 5CRGA 4PX1A 17GSA 4ZBBA 2F3MA 4MJBA 2IFQA 3CTFA 4I2TA 1PMTA 4YKFA 4GSTA 5HR3A 3EU4A 4GQCA 1KTEA 4D73B 1K0BA 2V1MA 4DEJA 2CX4A 1EGOA 1AW9A 3ZITA 2JSZA 3CXGA 2LNSA 4BWQA 4BVYB 4NV5A 2V32A 1GNEA 1M7TA 2XPEA 3TKRA 13GSA 1SL2B 2PWJA 2DSAA 4ACSA 1B4QA 2AUVA 3TOTA 3IAM2 3C8EA 1ZYPA 2DJ1A 7GSSA 3QOUA 19GSA 3L9VA 5DCGA 4TR1A 6GSTA 4F9ZA 3GKXA 2K9FA 2H71A 1ILOA 3O3TA 1AUCA 1YQ1A 3GFKA 3WGEA 3DVXA 5HR2A 4IKHA 4O92A 2JL4A 5F0GA 2C1YA 2XBQA 1A2JA 5LD0A 3UVHA 4F03A 5JCWA 2HFDA 3P2AA 2QGVA 1DUGA 4ZBAA 3GKKA 3QD9A 4IW9A 3QAWA 3FHKA 1TRUA 2EC4A 3C1RA 4KNDA 2DJ0A 5ECIB 1G6YA 18GSA 5DQSA 3US3A 5J4VA 3ZZXA 1DSBA 4CY8A 1Z7RA 3LYKA 4RQXA 5ECQB 4ECCA 3I69A 2CX3A 3APQA 1SK0A 2XC2A 1C72A 4IBPA 3W8SA 1MDJA 3HXSA 2HRFA 1XW6A 2ES7A 2GQLA 4GQFA 4FIWA 2PUKC 3M3MA 3WT1A 2HSHA 2H0HA 1MDIA 2IWTA 5D8IA 3N5OA 4IJ3A 2IMEA 1O85A 2JSYA 1FW1A 1K3YA 3VWVA 6GSSA 1EZKA 4I6XA 1OKDA 3GX0A 2AHEA 3RHBA 5IMAA 2DMLA 3JCML 1K0AA 3UARA 5GSSA 4MP4A 3IE3A 1SJZA 2YANA 3NIVA 1VF4A 1SK1A 3TKSC 1WMJA 3ZVJA 2ZCTA 1K3LA 3C1SA 5A4VA 1ZOFA 4P3YB 2H6XA 3D22A 2PU9C 4YQVA 4EL1A 1SD8A 3M9JA 3QPMA 2LEGA 4WBRD 1T4ZA 4FYCA 3I9V2 3U6VA 2FWHA 3GH6A 4EDYA 2PPTA 2VLUA 5FWGA 3TRQA 1T3BA 1NM3A 4F2IA 4Z2RA 1ST9A 4GSNA 4KB3A 2V6KA 3FEUA 1USBA 3GIXA 2IN3A 3UL3A 3IXRA 1J08A 2C0DA 3WD6A 5DALB 4ZB6A 2ZNMA 4IP1A 2HRNA 3EE2A 3ZRDA 1ZCPA 2BTOT 5AISA 3H1NA 1V2AA 2QKEA 5ECKB 4RI6A 5BRTA 2K8VA 4GRFA 3FRCA 1GTBA 5G1KA 2YWMA 4PURA 1Z7PA 4AKHA 4ZL9A 2HZEA 4K1FA 3KMNA 1Z5YE 2VCWA 3ME8A 4K7NA 5HFIA 1U3AA 3VWUA 4KDYA 2E0QA 1W4VA 2P0GA 1A0FA 1F9MA 1EOGA 1GTAA 1V58A 4MLYA 2EFCA 1ERWA 1B4PA 3GL3A 2AB6A 4CW9A 2H76A 3FK8A 2IPAA 3F4SA 4TRXA 2LRNA 3I6AA 3TJGA 1R26A 4F0CA 3EMXA 2FCHA 2N5AA 2HRKA 3GSSA 1M2BA 1T8EB 4H86A 5F05A 3HMJG 2CZ2A 1GUKA 5EVOA 3CYNA 2TIRA 3K8NA 3ERFA 4OFMA 3APOA 1TU7A 4CY6A 1S3CA 4X43A 1I5GA 2L5LA 2H66A 3IAS2 3ZIJA 1K3OA 3PINA 2H1AA 4AJ8A 2K6VA 2A2SA 1Z6NA 3WGDA 2GSRA 2RM6A 4TKYA 4V1Ag 3EVIA 1T1VA 1OKTA 3V1WA 4XRDA 2YNXA 4WBJA 3KTLA 1DBYA 3ZFLA 4TN8A 4I8BA 2PN8A 4LLRA 1X9SB 4K5RA 2OJLA 2KHPA 1SU9A 1O81A 3TGZA 3ZYWA 2MYGA 3GN3A 4IP6A 4PXOA 1K0OA 3ZFBA 1SYXA 3LORA 1B48A 2NTOA 4QL7A 1T4YA 4AJ6A 1PKWA 1KEBA 2GVPA 3ZL5A 4Q5NA 1Q98A 4K7IA 4KSOA 1GTUA 4KDUA 5DQYA 2MMAA 3GTUB 3VWWA 2O85A 4O32A 2FWEA 5J4YA 5A34B 2VM2A 3G9BA 3KEBA 5A5KA 1TK0B 1VF1A 1SL0B 1X5CA 2Z9SA 5A5HA 2KP2A 4N30A 1VF2A 1LBKA 1GLPA 3GSTA 4LL4B 3P90A 1ML6A 4ECJA 1BJXA 3C71A 2HZFA 4NXIA 4JU5A 3IV4A 1XVQA 4PNGA 3LW9A 2DLXA 4G01A 2HSMB 3HJOA 2M72A 3QAGA 2HE3A 4K9ZA 1GSQA 1BG1A 11GSA 3IDVA 2H19A 3RHCA 2DKHA 3L9UA 4LL1B 2UV8G 3Q19A 2JADA 4TVEA 4E8EA 1FHEA 1XWGA 5ELGA 2REMA 3FMWA 3KCMA 3RDWA 4LMVA 1OYJA 1O6JA 2HSNB 4KDXA 2R3XA 4AKXB 4MJAA 4O5RA 2EIRA 5B8AA 3LXTA 3HDCA 4USSA 3TJFA 3HA9A 5D9WA 3GUSA 4YQMA 4N3ZA 4FYBA 3D4MA 1XVWA 3TKSA 4ZB9A 1ERUA 1EEMA 1W89A 4FYUA 1EEJA 2OA7A 5HR1A 2B1KA 2MMZA 1A2LA 2B1LA 1O8WA 3Q6OA 3VPTA 2X64A 1S3DA 3GMFA 2R0PA 2VD0A 2R0CA 3ZTLA 2O87A 2KUCA 5DCHA 2YJHA 12GSA 4GCIA 1R4WA 4HS1A 3G7YA 1PKZA 5DAKA 3N9JA 4BVXA 3DGQA 4YAVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DD3 A;  4XS1 A;  3C73 A;  5ECS A;  2FA8 A;  4XS6 A;  1AC1 A;  1WRY A;  2LQO A;  5C00 A;  3OR5 A;  3GNJ A;  3H79 A;  2H30 A;  2JU5 A;  1TRW A;  3VUR A;  5E4W A;  2F8A A;  1O73 A;  3ME7 A;  3ZLP A;  1PSQ A;  5F07 A;  4EXJ A;  3C7M A;  2YWI A;  2I81 A;  3R2Q A;  3VFI A;  3IA1 A;  3DXB A;  1V9W A;  1U87 A;  2VL2 C;  4WET A;  4G0I A;  4JED A;  5J4U A;  5AIX A;  3LEF A;  1TU8 A;  5DJM A;  4F0B A;  5ABR A;  4D73 A;  4PTS A;  4BVY A;  2CAQ A;  2JZR A;  2XHF A;  3E9J B;  3A2V A;  4AGS A;  4OWY A;  1J0F A;  4E8H A;  4JRR A;  1XFL A;  3ZVJ D;  1TXX A;  3L4N A;  2KLX A;  1GSS A;  1YF1 A;  4K0G A;  1HD2 A;  2KOK A;  1WWJ A;  3IK9 A;  4IGJ A;  3DML A;  2LQQ A;  1QGV A;  3IRA A;  1OC9 B;  3FR9 A;  1PGT A;  4OO4 A;  5DDL A;  3IK7 A;  3HZ4 A;  3FZ5 A;  1TK8 B;  4FH8 A;  2FWG A;  2GST A;  2GZP A;  1WJK A;  2H0I A;  2MBT A;  4DSQ A;  1TRV A;  1M2A A;  4MF6 A;  5J41 A;  5GAP D;  3TB2 A;  1EGR A;  2C3Q A;  1AAZ A;  1OE8 A;  2FWF A;  2WUL A;  3ZML A;  1WP0 A;  3DRN A;  2N5B A;  2O8V B;  3DYR A;  1V40 A;  1ZL9 A;  4IQ1 A;  5B6N A;  1T00 A;  3UIW A;  1X0R A;  1YEP A;  3NZN A;  5HQP A;  4NHZ A;  5CRD A;  1GLQ A;  4K6X A;  1K0M A;  4XRA A;  3PH9 A;  1U88 A;  1NHO A;  4J56 E;  1GH2 A;  3J7Y b;  4OD7 A;  5IO0 A;  3QFB C;  2UZ8 A;  4KUN A;  1SD9 A;  1NSW A;  4G2E A;  2LTK A;  3KMO A;  2FD3 A;  2YN1 A;  2YWO A;  1AQV A;  1GSF A;  3H8Q A;  4WEY A;  4ILF A;  6GSW A;  1HQO A;  3UBL A;  2WZ9 A;  2NVL A;  1O8X A;  1F3A A;  4PGT A;  4MH3 A;  2IMI A;  2OAD A;  3KTB A;  2VD1 A;  4EC0 A;  1LU4 A;  2I9H A;  3KP8 A;  4HJM A;  3F63 A;  1JZR A;  2HQT A;  1ZGN A;  3GA4 A;  4L5O A;  3M1G A;  4NHW A;  4YAP A;  1BX9 A;  2VCV A;  1JLV A;  4XCS A;  2O89 A;  1GRX A;  1DE2 A;  1BQ7 A;  1OVN A;  2VOC A;  2E7P A;  1A8L A;  1VRS D;  3DIE A;  5IOW A;  1E6B A;  3DWV A;  20GS A;  4PQH A;  1CQH A;  1ERV A;  1OC3 A;  2H72 A;  3QMX A;  5DAL A;  2DBC A;  1GNW A;  4HOJ A;  2WDU A;  2H1G A;  2I3Y A;  3SBC A;  3IPZ A;  2GZZ A;  2EIQ A;  3RAZ A;  4IVF A;  3KZQ A;  4JBB A;  5IO2 A;  3VLN A;  1EWX A;  2RUF A;  2VCQ A;  4HDE A;  5EL8 A;  5CO3 A;  1MD3 A;  2RLI A;  1ZMA A;  4ZXG A;  5J9C A;  2G0F A;  2LJR A;  2R2J A;  4HQZ A;  1ON4 A;  2R37 A;  4TXO B;  2GTU A;  2CVB A;  5IOX A;  1PL1 A;  2VO4 A;  3W6G A;  3CSJ A;  1E2Y A;  5IMC A;  2A2R A;  5KN0 A;  1LJR A;  4GLT A;  2HRA A;  1FVK A;  1GSY A;  1O7U A;  2YV7 A;  2YPM A;  1PN9 A;  3EC3 A;  4MJC A;  1GWC A;  3UJ1 A;  3IOS A;  4ZL7 A;  4G0K A;  2C80 A;  3EUR A;  4IS0 A;  3TKQ A;  2ON7 A;  2LUS A;  5B8B A;  3ZRE A;  1AQW A;  5CNW A;  2FGX A;  2HNL A;  2DJJ A;  6GSY A;  2VL2 A;  5HFK A;  1JZD A;  1TOF A;  1A23 A;  2DJK A;  5JWQ B;  2HXK A;  2K8S A;  1FOV A;  1PQN A;  4OFT A;  5ECO B;  4NAX A;  3CBU A;  5EY6 A;  3U5R E;  3TKS E;  2F51 A;  4TOP A;  2NPB A;  2I4A A;  3HVV A;  3F0I A;  1ACV A;  4EVM A;  1X5D A;  2ZUP A;  3RPN A;  5KN1 A;  1F3B A;  2O7K A;  1WE0 A;  1XWB A;  2LV3 A;  5JCU A;  2MZC A;  2DJ3 A;  1VF3 A;  1F37 A;  2L4C A;  2M46 A;  3GTU A;  2DMM A;  4ZB8 A;  2H74 A;  2MMO A;  3LQ7 A;  4MZB A;  3F6D A;  2X8H A;  4OMV A;  4HU9 A;  3CRU A;  2B5X A;  1TDI A;  2L57 A;  5G30 A;  3ED3 A;  4XS4 B;  2CA8 A;  2AJQ B;  1GSE A;  1OE7 A;  4HZ4 A;  2H70 A;  2YZU A;  2JZT A;  2HI7 A;  2B7J A;  3F9U A;  2VIM A;  5G2Z A;  1TI3 A;  3LJR A;  1R5P A;  4L5L A;  1QFN A;  5F8B A;  1PL2 A;  3GV1 A;  1SL1 B;  2HSM A;  4QQ7 A;  4DSR A;  2R5G A;  4MF7 A;  3TCO A;  1XOA A;  3NOF A;  2YWN A;  3PR8 A;  1XW5 A;  4FO5 A;  1KBN A;  3MNG A;  2PGT A;  1N8J A;  2YCD A;  1X5E A;  3HZ8 A;  3HY2 A;  4MA9 A;  2H0G A;  2H8L A;  2JAC A;  1XPV A;  4KE3 A;  4F82 A;  1WOU A;  4MCU A;  2GSQ A;  3VI7 A;  2PBJ A;  2B5Y A;  1A2M A;  3PGT A;  1EP7 A;  1AIU A;  3HKR A;  3TRP A;  4MZW A;  2M80 A;  3HJM A;  2PVQ A;  5J9B A;  2FY6 A;  2B5E A;  1FB0 A;  1Z9H A;  4DVC A;  2V6O A;  4POB A;  3VI5 A;  2DIZ A;  1WPI A;  3MAK A;  1AXD A;  3D0Z A;  3CRT A;  2VLV A;  3M0F A;  5G5E A;  1TTZ A;  3ZMK A;  1A8Y A;  2P5R A;  4MK3 A;  3TJB A;  1XZO A;  3UEM A;  4BL7 B;  3O6T A;  4Q5R A;  3W8J A;  1GTI A;  3D4T A;  4MPG A;  1YY7 A;  2CAI A;  1GSU A;  2PMT A;  4TXV A;  5IM9 A;  3KGK A;  4N0V A;  2GT6 A;  5IQY A;  3QDN A;  4G19 A;  1M99 A;  1BAY A;  4WR4 A;  2L4Q A;  1ZYQ B;  4HEA 2;  2C0G A;  1QMV A;  2H01 A;  4HUA A;  4I2U A;  5IPG A;  4PUA A;  3R3E A;  3LG6 A;  3GH9 A;  3QFA C;  2H6Z A;  2R6K A;  4GXZ A;  3AY8 A;  2HT9 A;  1XWC A;  5EPF A;  1H75 A;  1GUH A;  5E59 A;  1X9W B;  4CHS A;  3MWH A;  2VL9 A;  5CAX A;  2H1B A;  4WKW A;  1JHB A;  1T7P B;  3QR6 A;  3GL5 A;  4ZBD A;  2CVD A;  5JCG A;  3GX8 A;  1FG4 A;  5D9V A;  2LKU A;  5A4U A;  4HQS A;  3I43 A;  1G6W A;  3J7Y k;  1UC7 A;  4ML6 A;  3BOA A;  3ERW A;  5FT3 A;  1OAZ A;  1PRX A;  3QAV A;  2MBS A;  4X1U A;  3HYP A;  2VCT A;  3KXO A;  4LMW A;  4PUF C;  3GYK A;  4KGI A;  5F06 A;  3FZA A;  2CZ3 A;  1UN2 A;  2OBK A;  1ERT A;  2KP1 A;  3CMI A;  2X99 A;  3A2X A;  2WS2 A;  1QK8 A;  2I1U A;  5FHI A;  4MZC A;  3CTG A;  4DSS B;  4AF2 A;  1URM A;  4BA7 A;  1GP1 A;  1OC9 A;  1R7H A;  3APS A;  5CYY A;  1V98 A;  5CP1 A;  5ECL B;  5INY A;  5ECN B;  1ABA A;  3DVW A;  1YDK A;  3GRX A;  22GS A;  3MSZ A;  1PX7 A;  4XTS A;  1OC8 A;  3KD0 A;  1U3I A;  5H5Q A;  2DC5 A;  4POK A;  3LGC A;  4EF0 A;  4Q5F A;  5BMU A;  5ID2 B;  5ECM B;  5CRE A;  3IC8 A;  4MDC A;  3P7X A;  4OCF A;  5KN3 A;  2GQM A;  4TR0 A;  3D21 A;  1B8X A;  1FVJ A;  3G7I A;  3FR6 A;  5B7C A;  4YQU A;  4EE0 A;  2CQ9 A;  1BYE A;  3FYG A;  1KNG A;  2OAC A;  2BJX A;  6GSV A;  4G9H A;  4MF5 A;  3HVS A;  5DVB A;  2VUP A;  3SWL A;  3ISO A;  3BCK A;  1AQX A;  2IFQ B;  1SKS B;  4PQ1 A;  4OO5 A;  4GWR A;  1HYU A;  3A3T A;  1MD4 A;  3RPP A;  5DJL A;  3HHV A;  4V2N A;  4ID0 A;  2MMN A;  3WGX A;  1MEK A;  2YOI A;  2F8F A;  3DKS A;  4IEL A;  1J9B A;  1Y6E A;  4EUY A;  5IIZ A;  4K7O A;  3O76 A;  2BMX A;  1GUL A;  1Q4J A;  5ENU A;  4TR1 B;  4Z7X A;  1BG5 A;  3LSZ A;  1XOB A;  4WF5 A;  1FAA A;  5IMZ A;  1JFU A;  1IYI A;  5D73 A;  3LWA A;  2J23 A;  3S9F A;  2GGT A;  4X0X A;  1FO5 A;  1GUM A;  5GST A;  4K2D A;  1S3A A;  2WFC A;  2RM5 A;  3GHA A;  5H5R A;  5A4W A;  2FHE A;  5GAN D;  2FA4 A;  3BJ5 A;  2GLR A;  4O7H A;  4TR3 A;  4V2L A;  4N11 A;  1TRS A;  3HD5 A;  3UVT A;  3EIN A;  4ML1 A;  1M9A A;  2B3S A;  3UMA A;  2FUG 2;  3FR3 A;  2L6C A;  3IC4 A;  1V57 A;  4KCA A;  1SK2 A;  2H1D A;  5AIV A;  1TK5 B;  1BED A;  6GSX A;  2PVO C;  1XXU A;  1SEN A;  3H4K A;  1K0D A;  4KH7 A;  2B6M A;  1F2E A;  1GSD A;  5COH A;  2GDR A;  4POM A;  3UAP A;  1NHY A;  4XIH A;  2TRX A;  10GS A;  1SJ6 A;  3TDG A;  3QCP A;  4N0Z A;  1HNC A;  4TXO A;  3FZ9 A;  3EU3 A;  2YP6 A;  3G7J A;  2NBS A;  3FKF A;  3L78 A;  2OE1 A;  2NDO A;  1G7O A;  4NPB A;  3L0H A;  4XHM A;  4KSM A;  2G2Q A;  3EYT A;  1XWK A;  4QL9 A;  4JR4 A;  1PX6 A;  3RBT A;  1MTC A;  1JLW A;  3LYP A;  4N10 A;  1XCC A;  2WJU A;  3CSH A;  4J2F A;  2B7K A;  2IMK A;  5D9X A;  2CVK A;  2H73 A;  2DJ2 A;  1EV9 A;  3UBK A;  4V2M A;  1M0U A;  3MDK A;  3GKN A;  2PER A;  3TRX A;  4IN0 A;  1RW1 A;  1RK4 A;  3TKP A;  5IPH A;  4NV2 A;  2IMD A;  4I97 A;  4L0U A;  5KN2 A;  3FY7 A;  2QC7 A;  9GSS A;  1THX A;  1WIK A;  2A4V A;  2WGR A;  5HR0 A;  1DE1 A;  2FNO A;  1X9M B;  1ZYE A;  2TRC P;  3KJY A;  1SKR B;  2H6Y A;  4Q5Q A;  1U6T A;  4OFN A;  1QQ2 A;  4WXT A;  3TUE A;  4KF9 A;  5C04 A;  2L5O A;  3A5W A;  4EDZ A;  5J3R A;  2AAW A;  2C0E A;  3D6I A;  4K0N A;  5ELA A;  2YV9 A;  3Q18 A;  5LCZ A;  3LXZ A;  2HZE B;  3KM6 A;  2DIY A;  4V1A p;  2LRC A;  4J57 E;  5B6M A;  5JWO B;  1K0N A;  2IMF A;  1YKA A;  1IYH A;  2V2G A;  4LA1 A;  4G0L A;  4JR6 A;  2E2G A;  1H4O A;  4ECB A;  3Q74 A;  2GSS A;  3F4T A;  3CSI A;  4NMU A;  2HRK B;  2C8U A;  1TKD B;  4G10 A;  4XS4 A;  3M8N A;  8GSS A;  4MH2 A;  4FQU A;  3VPQ A;  4MPF A;  1HNA A;  4HI7 A;  2L6D A;  5ECP B;  3HCZ A;  4YH2 A;  2ON5 A;  4L8E A;  2LST A;  1R5A A;  5IMF A;  1Z6M A;  2RII A;  2P31 A;  1ZZY A;  2JZS A;  4IQA A;  4MJE A;  3TJK A;  4RQR A;  4KW6 A;  3HJP A;  4JE1 A;  3M9K A;  1N2A A;  2CT6 A;  4I5Q A;  4NWY A;  14GS A;  5ECR B;  2F9S A;  4TR4 A;  4TW5 A;  2YJ7 A;  1PD2 1;  4IHU A;  4GF0 A;  4AJ7 A;  5H5S A;  1GL8 A;  1RQM A;  2C4J A;  1EP8 A;  5IMD A;  3H93 A;  5D93 A;  1A24 A;  1TJD A;  3ZIV A;  5JWR B;  4L0W A;  3E3E A;  2C3N A;  2C3T A;  3L9S A;  3LFL A;  3GUR A;  2LJA A;  4BPY A;  2V41 A;  2X8G A;  5CRH A;  4KAE A;  3UOM A;  2GZY A;  3F3R A;  4MAB A;  1PA3 A;  3BD2 A;  2LS5 A;  2IJY A;  1XW9 A;  1YF0 A;  5CRW A;  1SKW B;  1XIY A;  3A2W A;  4BL7 A;  4KCE A;  2XPD A;  4EKZ A;  1Y25 A;  3BBY A;  1THO A;  4RUV A;  4RI7 A;  5G1L A;  1VGL A;  3F4R A;  3BCI A;  3WT2 A;  5IMV A;  2YZH A;  2LJK A;  2E2M A;  2X8C A;  1MDK A;  1I9D A;  1SJI A;  2VL3 A;  3DEX A;  2R4V A;  6GSU A;  1FB6 A;  1G7E A;  4ZIJ A;  5DBQ A;  1EV4 A;  4WF4 A;  2H75 A;  1XWA A;  3FZ4 A;  4GSS A;  1M9B A;  2C0F A;  3PPU A;  1HNB A;  1F6M C;  2OE0 A;  2LRT A;  4POL A;  3E0U A;  2AV4 A;  1XBS A;  3EMP A;  2WB9 A;  1JZO A;  5GZZ B;  5D9T A;  2OBI A;  1TW9 A;  1SYR A;  5J5N A;  3F6F A;  1G0T A;  2RUE A;  4BWS A;  2VAF A;  4KX4 A;  4K8M A;  1YJ6 A;  1NW2 A;  2IIY A;  4EO3 A;  3FW2 A;  1QXH A;  3ERG A;  1CQG A;  1B9X C;  5LNK e;  3KP9 A;  3HVX A;  1Z3E A;  2GQK A;  4IJI A;  2HLS A;  4JZQ A;  2VM1 A;  3F3Q A;  2LNT A;  2HYX A;  2WCI A;  3KH7 A;  4ECI A;  1UVZ A;  3GKM A;  4MMM A;  1QUW A;  4ZIL A;  1YKC A;  2D2Z A;  5AGY A;  2L59 A;  3P8W A;  1TP9 A;  5G31 A;  5KEJ A;  1YZX A;  2EIO A;  3VK9 A;  5L71 A;  4ULX A;  2OKA A;  3KH9 A;  2J9H A;  1K0C A;  1A0R P;  2OE3 A;  2AYT A;  2IL3 A;  3IR4 A;  2FLS A;  4DSS A;  2VLT A;  2GT5 A;  2ALB A;  2P5Q A;  4HZ2 A;  4ZL8 A;  4PQI A;  1M2D A;  5DAK B;  3WYW A;  2HSY A;  3EWL A;  4KA0 A;  1UA5 A;  3F8U A;  4PNF A;  4BVX B;  2K18 A;  2VCX A;  4HJ2 A;  1EOH A;  5D96 A;  2WRT A;  2N5F A;  2XBI A;  4HU7 A;  1B9Y C;  3IHQ A;  5G5F A;  5ECH B;  4ISD A;  3VWX A;  4CDO A;  5AN1 A;  5HFG A;  1JZW A;  2CV4 A;  4GTU A;  3TJJ A;  4WR5 A;  2GS3 A;  2QSI A;  1YEX A;  5ID2 A;  16GS A;  3KIJ A;  4OCE A;  3TOU A;  3IBH A;  1TI1 A;  2VCZ A;  3D5J A;  5CRG A;  4PX1 A;  17GS A;  4ZBB A;  2F3M A;  4MJB A;  2IFQ A;  3CTF A;  4I2T A;  1PMT A;  4GST A;  5HR3 A;  3EU4 A;  4GQC A;  1KTE A;  4D73 B;  1K0B A;  2V1M A;  4DEJ A;  2CX4 A;  1EGO A;  1AW9 A;  3ZIT A;  2JSZ A;  3CXG A;  2LNS A;  4BWQ A;  4BVY B;  4NV5 A;  2V32 A;  1GNE A;  1M7T A;  2XPE A;  3TKR A;  13GS A;  1SL2 B;  2PWJ A;  2DSA A;  4ACS A;  1B4Q A;  2AUV A;  3TOT A;  3IAM 2;  3C8E A;  2DJ1 A;  7GSS A;  3QOU A;  19GS A;  3L9V A;  5DCG A;  4TR1 A;  6GST A;  4F9Z A;  3GKX A;  2K9F A;  2H71 A;  1ILO A;  3O3T A;  1AUC A;  1YQ1 A;  3GFK A;  3WGE A;  3DVX A;  5HR2 A;  4IKH A;  4O92 A;  2JL4 A;  5F0G A;  2C1Y A;  2XBQ A;  1A2J A;  5LD0 A;  3UVH A;  4F03 A;  5JCW A;  2HFD A;  3P2A A;  2QGV A;  1DUG A;  4ZBA A;  3GKK A;  3QD9 A;  4IW9 A;  3QAW A;  3FHK A;  1TRU A;  2EC4 A;  3C1R A;  4KND A;  2DJ0 A;  5ECI B;  1G6Y A;  18GS A;  5DQS A;  3US3 A;  3ZZX A;  1DSB A;  1Z7R A;  3LYK A;  4RQX A;  5ECQ B;  4ECC A;  3I69 A;  2CX3 A;  3APQ A;  1SK0 A;  2XC2 A;  1C72 A;  4IBP A;  3W8S A;  1MDJ A;  3HXS A;  2HRF A;  1XW6 A;  2ES7 A;  2GQL A;  4GQF A;  4FIW A;  2PUK C;  3M3M A;  3WT1 A;  2HSH A;  2H0H A;  1MDI A;  2IWT A;  5D8I A;  3N5O A;  4IJ3 A;  2IME A;  1O85 A;  2JSY A;  1FW1 A;  1K3Y A;  3VWV A;  6GSS A;  1EZK A;  4I6X A;  1OKD A;  3GX0 A;  2AHE A;  3RHB A;  5IMA A;  2DML A;  3JCM L;  1K0A A;  3UAR A;  5GSS A;  4MP4 A;  3IE3 A;  1SJZ A;  2YAN A;  3NIV A;  1VF4 A;  1SK1 A;  3TKS C;  1WMJ A;  3ZVJ A;  2ZCT A;  1K3L A;  3C1S A;  5A4V A;  1ZOF A;  4P3Y B;  2H6X A;  3D22 A;  2PU9 C;  4YQV A;  4EL1 A;  1SD8 A;  3M9J A;  3QPM A;  2LEG A;  4WBR D;  1T4Z A;  4FYC A;  3I9V 2;  3U6V A;  2FWH A;  3GH6 A;  4EDY A;  2PPT A;  2VLU A;  5FWG A;  3TRQ A;  1T3B A;  1NM3 A;  4F2I A;  1ST9 A;  4GSN A;  4KB3 A;  2V6K A;  3FEU A;  1USB A;  3GIX A;  2IN3 A;  3UL3 A;  3IXR A;  1J08 A;  2C0D A;  3WD6 A;  5DAL B;  4ZB6 A;  2ZNM A;  4IP1 A;  2HRN A;  3EE2 A;  3ZRD A;  1ZCP A;  2BTO T;  5AIS A;  3H1N A;  1V2A A;  2QKE A;  5ECK B;  4RI6 A;  2K8V A;  4GRF A;  3FRC A;  1GTB A;  5G1K A;  2YWM A;  4PUR A;  1Z7P A;  4ZL9 A;  2HZE A;  4K1F A;  3KMN A;  1Z5Y E;  2VCW A;  3ME8 A;  4K7N A;  5HFI A;  1U3A A;  3VWU A;  4KDY A;  2E0Q A;  1W4V A;  2P0G A;  1A0F A;  1F9M A;  1EOG A;  1GTA A;  1V58 A;  4MLY A;  1ERW A;  1B4P A;  3GL3 A;  2AB6 A;  4CW9 A;  2H76 A;  3FK8 A;  2IPA A;  3F4S A;  4TRX A;  2LRN A;  3I6A A;  3TJG A;  1R26 A;  4F0C A;  3EMX A;  2FCH A;  2N5A A;  2HRK A;  3GSS A;  1M2B A;  1T8E B;  4H86 A;  5F05 A;  2CZ2 A;  1GUK A;  5EVO A;  3CYN A;  2TIR A;  3K8N A;  3ERF A;  4OFM A;  3APO A;  1TU7 A;  1S3C A;  4X43 A;  1I5G A;  2L5L A;  2H66 A;  3IAS 2;  3ZIJ A;  1K3O A;  3PIN A;  2H1A A;  4AJ8 A;  2K6V A;  2A2S A;  1Z6N A;  3WGD A;  2GSR A;  2RM6 A;  4TKY A;  4V1A g;  3EVI A;  1T1V A;  1OKT A;  3V1W A;  4XRD A;  2YNX A;  4WBJ A;  3KTL A;  1DBY A;  3ZFL A;  4TN8 A;  4I8B A;  2PN8 A;  4LLR A;  1X9S B;  2OJL A;  2KHP A;  1SU9 A;  1O81 A;  3TGZ A;  3ZYW A;  2MYG A;  3GN3 A;  4IP6 A;  4PXO A;  1K0O A;  3ZFB A;  1SYX A;  3LOR A;  1B48 A;  2NTO A;  4QL7 A;  1T4Y A;  4AJ6 A;  1PKW A;  1KEB A;  2GVP A;  3ZL5 A;  4Q5N A;  1Q98 A;  4K7I A;  4KSO A;  1GTU A;  4KDU A;  5DQY A;  2MMA A;  3GTU B;  3VWW A;  2O85 A;  4O32 A;  2FWE A;  3G9B A;  2VM2 A;  3KEB A;  1TK0 B;  5A5K A;  1VF1 A;  1SL0 B;  1X5C A;  2Z9S A;  2KP2 A;  4N30 A;  1VF2 A;  1LBK A;  1GLP A;  3GST A;  4LL4 B;  3P90 A;  1ML6 A;  4ECJ A;  1BJX A;  3C71 A;  2HZF A;  4NXI A;  4JU5 A;  3IV4 A;  1XVQ A;  4PNG A;  2DLX A;  2HSM B;  3HJO A;  2M72 A;  3QAG A;  2HE3 A;  4K9Z A;  1GSQ A;  11GS A;  3IDV A;  2H19 A;  3RHC A;  3L9U A;  4LL1 B;  3Q19 A;  2JAD A;  4TVE A;  4E8E A;  1FHE A;  1XWG A;  5ELG A;  2REM A;  3RDW A;  3KCM A;  4LMV A;  1OYJ A;  1O6J A;  2HSN B;  4KDX A;  2R3X A;  4MJA A;  4O5R A;  2EIR A;  5B8A A;  3LXT A;  3HDC A;  4USS A;  3TJF A;  3HA9 A;  5D9W A;  3GUS A;  4YQM A;  4FYB A;  3D4M A;  1XVW A;  3TKS A;  4ZB9 A;  1ERU A;  1EEM A;  1W89 A;  4FYU A;  1EEJ A;  2OA7 A;  5HR1 A;  2B1K A;  2MMZ A;  1A2L A;  2B1L A;  1O8W A;  3Q6O A;  3VPT A;  2X64 A;  1S3D A;  3GMF A;  2VD0 A;  3ZTL A;  2O87 A;  2KUC A;  5DCH A;  2YJH A;  12GS A;  4GCI A;  1R4W A;  4HS1 A;  3G7Y A;  1PKZ A;  5DAK A;  3N9J A;  4BVX A;  3DGQ A;  4YAV A; 
#chains in the Genus database with same CATH topology
 3DD3 A;  4XS1 A;  3C73 A;  5ECS A;  2FA8 A;  4XS6 A;  1AC1 A;  1TXU A;  1WRY A;  2LQO A;  5C00 A;  3OR5 A;  3GNJ A;  3H79 A;  2H30 A;  2JU5 A;  5KOX A;  1TRW A;  3VUR A;  5E4W A;  2F8A A;  1O73 A;  3ME7 A;  3ZLP A;  1PSQ A;  5F07 A;  4EXJ A;  3C7M A;  2YWI A;  4AI6 A;  2I81 A;  3R2Q A;  3VFI A;  3IA1 A;  3DXB A;  1V9W A;  1U87 A;  2VL2 C;  4WET A;  4G0I A;  4JED A;  5J4U A;  5AIX A;  3LEF A;  1TU8 A;  5DJM A;  4F0B A;  5ABR A;  4D73 A;  4PTS A;  4BVY A;  2CAQ A;  2JZR A;  2XHF A;  3E9J B;  3A2V A;  4AGS A;  4OWY A;  1J0F A;  4E8H A;  2EFD A;  4JRR A;  2EFE A;  1XFL A;  3ZVJ D;  1TXX A;  3L4N A;  2KLX A;  1GSS A;  1YF1 A;  4K0G A;  1HD2 A;  2KOK A;  1WWJ A;  3IK9 A;  4IGJ A;  3DML A;  2LQQ A;  1QGV A;  3IRA A;  1OC9 B;  3FR9 A;  1PGT A;  4OO4 A;  5DDL A;  3IK7 A;  4PHZ C;  3HZ4 A;  3FZ5 A;  1TK8 B;  4FH8 A;  2FWG A;  2GST A;  2GZP A;  1WJK A;  2H0I A;  2MBT A;  4DSQ A;  1TRV A;  3MIX A;  1M2A A;  4MF6 A;  5J41 A;  5GAP D;  3TB2 A;  1EGR A;  2C3Q A;  1AAZ A;  1OE8 A;  2FWF A;  2WUL A;  3ZML A;  1WP0 A;  3DRN A;  2N5B A;  2O8V B;  3DYR A;  1V40 A;  1ZL9 A;  4IQ1 A;  5B6N A;  1T00 A;  3UIW A;  1X0R A;  1YEP A;  3NZN A;  5HQP A;  4NHZ A;  5CRD A;  1GLQ A;  4K6X A;  1K0M A;  4XRA A;  3PH9 A;  4GDF A;  1U88 A;  1NHO A;  4J56 E;  1GH2 A;  3J7Y b;  4OD7 A;  5IO0 A;  3QFB C;  2UZ8 A;  4KUN A;  1SD9 A;  1NSW A;  4G2E A;  2LTK A;  3KMO A;  2FD3 A;  2YN1 A;  2YWO A;  1AQV A;  1GSF A;  3H8Q A;  4WEY A;  4ILF A;  6GSW A;  5J47 A;  1HQO A;  3UBL A;  2WZ9 A;  2NVL A;  1O8X A;  1F3A A;  4PGT A;  4MH3 A;  2IMI A;  2OAD A;  3KTB A;  2VD1 A;  4EC0 A;  1LU4 A;  2I9H A;  3KP8 A;  4HJM A;  3F63 A;  1JZR A;  2HQT A;  2WVZ A;  1ZGN A;  3GA4 A;  4L5O A;  4A5P A;  3M1G A;  4NHW A;  4YAP A;  1BX9 A;  2VCV A;  1JLV A;  4XCS A;  2O89 A;  1GRX A;  1DE2 A;  2QA1 A;  1BQ7 A;  1OVN A;  4O5U A;  2VOC A;  2E7P A;  1A8L A;  1VRS D;  3DIE A;  5IOW A;  4FXY P;  1E6B A;  3DWV A;  20GS A;  4PQH A;  1CQH A;  1ERV A;  1OC3 A;  2R0G A;  2H72 A;  3QMX A;  1M3J A;  5DAL A;  2DBC A;  1GNW A;  4HOJ A;  4E68 A;  2WDU A;  2H1G A;  2I3Y A;  3SBC A;  3IPZ A;  2A2P A;  2GZZ A;  3RFR C;  2EIQ A;  3RAZ A;  4IVF A;  3KZQ A;  4JBB A;  5IO2 A;  3VLN A;  1EWX A;  2RUF A;  2VCQ A;  4HDE A;  5EL8 A;  5CO3 A;  1MD3 A;  2RLI A;  1ZMA A;  4ZXG A;  5J9C A;  2G0F A;  2EFH A;  2LJR A;  5J40 A;  2R2J A;  4HQZ A;  1ON4 A;  2R37 A;  4TXO B;  2GTU A;  2CVB A;  5IOX A;  1PL1 A;  2VO4 A;  3W6G A;  3CSJ A;  1E2Y A;  5IMC A;  2A2R A;  5A1N B;  5KN0 A;  1LJR A;  4GLT A;  2HRA A;  1FVK A;  2WVY A;  1GSY A;  1O7U A;  2YV7 A;  2YPM A;  1PN9 A;  3MYD A;  4X4J A;  3EC3 A;  4MJC A;  1GWC A;  3UJ1 A;  3IOS A;  4ZL7 A;  4G0K A;  2O5V A;  2C80 A;  3EUR A;  4IS0 A;  3TKQ A;  2ON7 A;  2LUS A;  5B8B A;  3ZRE A;  1AQW A;  5CNW A;  2FGX A;  2HNL A;  2DJJ A;  6GSY A;  3EPT A;  2VL2 A;  5HFK A;  1JZD A;  1TOF A;  1A23 A;  2DJK A;  5JWQ B;  2HXK A;  2VKZ G;  2K8S A;  1FOV A;  1PQN A;  4OFT A;  5ECO B;  4NAX A;  3CBU A;  5EY6 A;  3U5R E;  3TKS E;  2F51 A;  4TOP A;  1Y1U A;  2NPB A;  2I4A A;  3HVV A;  1M3I A;  3F0I A;  1ACV A;  2WVX B;  4EVM A;  1X5D A;  2ZUP A;  3RPN A;  5KN1 A;  1F3B A;  2O7K A;  1WE0 A;  1XWB A;  2LV3 A;  5JCU A;  2MZC A;  2DJ3 A;  1VF3 A;  1F37 A;  2L4C A;  2M46 A;  3GTU A;  2DMM A;  4ZB8 A;  2H74 A;  2MMO A;  3LQ7 A;  4MZB A;  3F6D A;  2X8H A;  4OMV A;  4HU9 A;  3CRU A;  2B5X A;  5A34 A;  4EIQ A;  1TDI A;  2L57 A;  5G30 A;  3ED3 A;  4XS4 B;  2CA8 A;  2AJQ B;  1GSE A;  1OE7 A;  4HZ4 A;  2H70 A;  2YZU A;  2JZT A;  2HI7 A;  2B7J A;  3F9U A;  2VIM A;  2DKI A;  5G2Z A;  1TI3 A;  3LJR A;  1R5P A;  4L5L A;  1QFN A;  5F8B A;  1PL2 A;  3GV1 A;  1SL1 B;  2HSM A;  4QQ7 A;  4DSR A;  2R5G A;  4MF7 A;  3TCO A;  1N25 A;  1XOA A;  3NOF A;  2YWN A;  5KOW A;  3PR8 A;  1XW5 A;  4FO5 A;  1KBN A;  3MNG A;  2PGT A;  1N8J A;  2HSN A;  2YCD A;  1X5E A;  3HZ8 A;  3HY2 A;  4MA9 A;  2H0G A;  2H8L A;  2JAC A;  1XPV A;  4KE3 A;  4F82 A;  1WOU A;  4MCU A;  2GSQ A;  3VI7 A;  2PBJ A;  2B5Y A;  1A2M A;  3PGT A;  1EP7 A;  1AIU A;  3HKR A;  3TRP A;  4MZW A;  2M80 A;  3HJM A;  2PVQ A;  5J9B A;  2WW0 A;  2B5E A;  2FY6 A;  1FB0 A;  1Z9H A;  4DVC A;  2V6O A;  4POB A;  3VI5 A;  2DIZ A;  1WPI A;  3MAK A;  1AXD A;  3D0Z A;  3CRT A;  1FOH A;  2VLV A;  3CWG A;  4Z2U A;  3M0F A;  5G5E A;  1TTZ A;  3ZMK A;  1A8Y A;  2P5R A;  4MK3 A;  3TJB A;  1XZO A;  3UEM A;  4BL7 B;  3O6T A;  4Q5R A;  3W8J A;  1GTI A;  3D4T A;  1YEW C;  4MPG A;  1YY7 A;  2CAI A;  1GSU A;  2PMT A;  2O36 A;  4TXV A;  1PFO A;  3KGK A;  5IM9 A;  4N0V A;  4HSC X;  2GT6 A;  5IQY A;  3QDN A;  4G19 A;  1M99 A;  1BAY A;  4WR4 A;  1SVL A;  2L4Q A;  1ZYQ B;  4HEA 2;  2C0G A;  1QMV A;  2H01 A;  4HUA A;  4I2U A;  5IPG A;  4PUA A;  3R3E A;  3LG6 A;  3GH9 A;  3QFA C;  1ZYN A;  2H6Z A;  2R6K A;  4GXZ A;  3A5I A;  3AY8 A;  2HT9 A;  1XWC A;  5EPF A;  1H75 A;  1GUH A;  5E59 A;  1X9W B;  1YVL A;  4CHS A;  3MWH A;  2VL9 A;  5CAX A;  1SVO A;  2H1B A;  4WKW A;  1JHB A;  1T7P B;  3QR6 A;  3IHG A;  3GL5 A;  4ZBD A;  2CVD A;  5JCG A;  3GX8 A;  1FG4 A;  5D9V A;  2LKU A;  5A4U A;  4HQS A;  3I43 A;  1G6W A;  3J7Y k;  1UC7 A;  4ML6 A;  3BOA A;  3ERW A;  5FT3 A;  1OAZ A;  1PRX A;  3QAV A;  2MBS A;  4X1U A;  4W66 A;  3HYP A;  2VCT A;  3KXO A;  4LMW A;  4PUF C;  3GYK A;  4KGI A;  5F06 A;  3FZA A;  2CZ3 A;  1UN2 A;  2OBK A;  1ERT A;  2KP1 A;  3CMI A;  2X99 A;  3A2X A;  2WS2 A;  1QK8 A;  2I1U A;  5FHI A;  4MZC A;  3CTG A;  4DSS B;  4AF2 A;  1URM A;  4BA7 A;  1GP1 A;  1OC9 A;  1R7H A;  3APS A;  5CYY A;  1V98 A;  5CP1 A;  5ECL B;  5INY A;  5ECN B;  1ABA A;  3DVW A;  1YDK A;  4AKI A;  3GRX A;  22GS A;  3MSZ A;  1PX7 A;  4XTS A;  1OC8 A;  3KD0 A;  1U3I A;  5H5Q A;  2DC5 A;  4POK A;  3LGC A;  4EF0 A;  4Q5F A;  5BMU A;  5ID2 B;  5ECM B;  5CRE A;  3IC8 A;  4MDC A;  3P7X A;  4OCF A;  5KN3 A;  3RGB C;  2GQM A;  4TR0 A;  3D21 A;  1B8X A;  1FVJ A;  3G7I A;  3FR6 A;  5B7C A;  4YQU A;  4EE0 A;  2CQ9 A;  1BYE A;  3FYG A;  1KNG A;  2OAC A;  2BJX A;  6GSV A;  4G9H A;  4MF5 A;  3HVS A;  5DVB A;  2VUP A;  3SWL A;  3ISO A;  3BCK A;  1AQX A;  5BMU B;  2IFQ B;  1SKS B;  4PQ1 A;  4OO5 A;  4GWR A;  1HYU A;  3A3T A;  1MD4 A;  3RPP A;  5DJL A;  3HHV A;  4V2N A;  4ID0 A;  2MMN A;  3WGX A;  1MEK A;  2YOI A;  2F8F A;  3DKS A;  4IEL A;  1J9B A;  1Y6E A;  3HVN A;  4EUY A;  5IIZ A;  4K7O A;  3O76 A;  4AKG A;  2BMX A;  1GUL A;  1Q4J A;  5ENU A;  4TR1 B;  4Z7X A;  1BG5 A;  3LSZ A;  1XOB A;  4WF5 A;  1FAA A;  5IMZ A;  1JFU A;  1IYI A;  5D73 A;  3LWA A;  2J23 A;  3S9F A;  2GGT A;  4X0X A;  1FO5 A;  1GUM A;  5GST A;  4K2D A;  1S3A A;  2WFC A;  2RM5 A;  3GHA A;  5H5R A;  5A4W A;  4MNN A;  2FHE A;  5GAN D;  2FA4 A;  3BJ5 A;  2GLR A;  4O7H A;  2A4H A;  4TR3 A;  4V2L A;  4N11 A;  1TRS A;  3HD5 A;  3UVT A;  3EIN A;  4ML1 A;  1M9A A;  2B3S A;  3UMA A;  2FUG 2;  3FR3 A;  2OT3 A;  2L6C A;  3IC4 A;  1V57 A;  4KCA A;  1SK2 A;  2H1D A;  5AIV A;  1TK5 B;  1BED A;  6GSX A;  2PVO C;  1XXU A;  1SEN A;  3H4K A;  1K0D A;  4KH7 A;  2B6M A;  1F2E A;  1GSD A;  5COH A;  2GDR A;  4POM A;  3UAP A;  1NHY A;  4XIH A;  2TRX A;  10GS A;  1SJ6 A;  3TDG A;  3QCP A;  4N0Z A;  1HNC A;  4TXO A;  3FZ9 A;  3EU3 A;  2YP6 A;  3G7J A;  2NBS A;  3FKF A;  3L78 A;  5A1N A;  2OE1 A;  2NDO A;  1G7O A;  4NPB A;  3L0H A;  4XHM A;  4KSM A;  2G2Q A;  4O5Q A;  3EYT A;  1XWK A;  4QL9 A;  4JR4 A;  1PX6 A;  3RBT A;  1MTC A;  1JLW A;  3LYP A;  4N10 A;  1XCC A;  2WJU A;  3CSH A;  4J2F A;  2B7K A;  2IMK A;  5D9X A;  2CVK A;  2H73 A;  2DJ2 A;  1EV9 A;  3UBK A;  4V2M A;  1M0U A;  3MDK A;  3GKN A;  2PER A;  3TRX A;  4YKG A;  4IN0 A;  1RW1 A;  1RK4 A;  3TKP A;  5IPH A;  4NV2 A;  4PI2 C;  4I97 A;  2IMD A;  4L0U A;  5KN2 A;  3FY7 A;  2QC7 A;  9GSS A;  1THX A;  1WIK A;  2A4V A;  2WGR A;  5HR0 A;  1DE1 A;  2FNO A;  1X9M B;  1ZYE A;  2TRC P;  3KJY A;  1SKR B;  2H6Y A;  4Q5Q A;  1U6T A;  4OFN A;  1QQ2 A;  4WXT A;  3TUE A;  4KF9 A;  5C04 A;  2L5O A;  3A5W A;  4EDZ A;  5J3R A;  2AAW A;  2C0E A;  3D6I A;  4K0N A;  5ELA A;  4ZB7 A;  2YV9 A;  2X49 A;  4Z2T A;  3Q18 A;  5LCZ A;  3LXZ A;  2HZE B;  3KM6 A;  2DIY A;  1BF5 A;  2WVX A;  4V1A p;  1S3R A;  2LRC A;  2WW3 A;  4J57 E;  4K2X A;  5B6M A;  5JWO B;  1K0N A;  2IMF A;  1YKA A;  1IYH A;  2V2G A;  3TU3 B;  4LA1 A;  4G0L A;  4JR6 A;  2E2G A;  1H4O A;  4ECB A;  3Q74 A;  2GSS A;  3F4T A;  3CSI A;  4K5S A;  4NMU A;  2HRK B;  2C8U A;  1TKD B;  4G10 A;  4XS4 A;  3M8N A;  8GSS A;  4MH2 A;  4FQU A;  2O3E A;  3VPQ A;  4MPF A;  1HNA A;  4HI7 A;  2L6D A;  5ECP B;  3HCZ A;  4YH2 A;  2ON5 A;  4L8E A;  2LST A;  1R5A A;  5IMF A;  1Z6M A;  2RII A;  2P31 A;  1ZZY A;  2JZS A;  4EIP A;  4IQA A;  4MJE A;  3TJK A;  2X4A A;  4RQR A;  4KW6 A;  3HJP A;  4JE1 A;  3M9K A;  1N2A A;  2CT6 A;  4I5Q A;  4NWY A;  14GS A;  5ECR B;  2F9S A;  4TR4 A;  4TW5 A;  2YJ7 A;  1PD2 1;  4IHU A;  4GF0 A;  4AJ7 A;  5H5S A;  1GL8 A;  1RQM A;  2C4J A;  1EP8 A;  5IMD A;  3H93 A;  5D93 A;  1A24 A;  1TJD A;  3ZIV A;  5JWR B;  4L0W A;  3E3E A;  2C3N A;  2C3T A;  3L9S A;  3LFL A;  2H1L A;  3GUR A;  2LJA A;  1PN0 A;  4BPY A;  2V41 A;  2X8G A;  5CRH A;  2QA2 A;  4KAE A;  3UOM A;  2GZY A;  3F3R A;  4MAB A;  1PA3 A;  3BD2 A;  2LS5 A;  2IJY A;  1XW9 A;  1YF0 A;  5CRW A;  1SKW B;  1XIY A;  3A2W A;  4BL7 A;  4KCE A;  2XPD A;  4EKZ A;  1Y25 A;  3BBY A;  1THO A;  4RUV A;  4RI7 A;  5G1L A;  1VGL A;  3F4R A;  5A5H B;  3BCI A;  3WT2 A;  5IMV A;  2YZH A;  2LJK A;  2E2M A;  2X8C A;  1MDK A;  1I9D A;  1SJI A;  2VL3 A;  3DEX A;  2R4V A;  6GSU A;  1FB6 A;  1G7E A;  4ZIJ A;  5DBQ A;  4ICY A;  1EV4 A;  4WF4 A;  2H75 A;  1XWA A;  3FZ4 A;  4GSS A;  1M9B A;  2C0F A;  3PPU A;  1HNB A;  1F6M C;  2OE0 A;  2LRT A;  4POL A;  3E0U A;  2AV4 A;  1XBS A;  3EMP A;  2WB9 A;  1JZO A;  5GZZ B;  5D9T A;  2OBI A;  1TW9 A;  1SYR A;  5J5N A;  3F6F A;  1G0T A;  2RUE A;  4BWS A;  2VAF A;  4KX4 A;  4K8M A;  1YJ6 A;  1NW2 A;  2IIY A;  4EO3 A;  3FW2 A;  1QXH A;  3ERG A;  1CQG A;  1B9X C;  5LNK e;  3KP9 A;  3HVX A;  1Z3E A;  2GQK A;  4IJI A;  2HLS A;  4JZQ A;  2VM1 A;  3F3Q A;  2LNT A;  2HYX A;  2WCI A;  3KH7 A;  1SVM A;  4ECI A;  1UVZ A;  3GKM A;  4MMM A;  1QUW A;  4ZIL A;  1YKC A;  2D2Z A;  5AGY A;  2L59 A;  3P8W A;  1TP9 A;  5G31 A;  5KEJ A;  1YZX A;  2EIO A;  3VK9 A;  5L71 A;  4ULX A;  4QMK A;  2OKA A;  2J9H A;  3KH9 A;  1K0C A;  1A0R P;  2OE3 A;  2AYT A;  2IL3 A;  3IR4 A;  2FLS A;  4DSS A;  2VLT A;  2GT5 A;  2ALB A;  2P5Q A;  4HZ2 A;  4ZL8 A;  4PQI A;  1M2D A;  5DAK B;  3WYW A;  2HSY A;  3EWL A;  4KA0 A;  1UA5 A;  3F8U A;  4PNF A;  4BVX B;  2K18 A;  2VCX A;  4HJ2 A;  1EOH A;  5D96 A;  2WRT A;  2N5F A;  2XBI A;  4HU7 A;  1B9Y C;  3IHQ A;  5G5F A;  5ECH B;  4ISD A;  3VWX A;  4CDO A;  5AN1 A;  5HFG A;  1JZW A;  2CV4 A;  4GTU A;  3TJJ A;  4WR5 A;  2GS3 A;  2QSI A;  1YEX A;  5ID2 A;  16GS A;  3KIJ A;  4OCE A;  3TOU A;  3IBH A;  1TI1 A;  2VCZ A;  3D5J A;  5CRG A;  4PX1 A;  17GS A;  4ZBB A;  2F3M A;  4MJB A;  2IFQ A;  3CTF A;  4I2T A;  1PMT A;  4YKF A;  4GST A;  5HR3 A;  3EU4 A;  4GQC A;  1KTE A;  4D73 B;  1K0B A;  2V1M A;  4DEJ A;  2CX4 A;  1EGO A;  1AW9 A;  3ZIT A;  2JSZ A;  3CXG A;  2LNS A;  4BWQ A;  4BVY B;  4NV5 A;  2V32 A;  1GNE A;  2WW1 A;  1M7T A;  2XPE A;  4PI0 C;  3TKR A;  13GS A;  1SL2 B;  2PWJ A;  2DSA A;  4ACS A;  1B4Q A;  2AUV A;  3TOT A;  3IAM 2;  3C8E A;  1ZYP A;  2DJ1 A;  7GSS A;  3QOU A;  19GS A;  3L9V A;  5DCG A;  4TR1 A;  6GST A;  4F9Z A;  3GKX A;  2K9F A;  2H71 A;  1ILO A;  3O3T A;  1AUC A;  1YQ1 A;  3GFK A;  3WGE A;  3DVX A;  5HR2 A;  4IKH A;  2WW2 A;  4O92 A;  2JL4 A;  5F0G A;  2C1Y A;  2XBQ A;  1A2J A;  5LD0 A;  3UVH A;  4F03 A;  5JCW A;  2HFD A;  3P2A A;  2QGV A;  1DUG A;  4ZBA A;  3GKK A;  3QD9 A;  4IW9 A;  3QAW A;  3FHK A;  1TRU A;  2EC4 A;  3C1R A;  4KND A;  2DJ0 A;  5ECI B;  1G6Y A;  18GS A;  5DQS A;  3US3 A;  5J4V A;  3ZZX A;  1DSB A;  4CY8 A;  1Z7R A;  3LYK A;  4RQX A;  5ECQ B;  4ECC A;  3I69 A;  2CX3 A;  3APQ A;  1SK0 A;  2XC2 A;  1C72 A;  4IBP A;  3W8S A;  1MDJ A;  3HXS A;  2HRF A;  1XW6 A;  2ES7 A;  2GQL A;  4GQF A;  4FIW A;  2PUK C;  3M3M A;  3WT1 A;  2HSH A;  2H0H A;  1MDI A;  2IWT A;  5D8I A;  3N5O A;  4IJ3 A;  2IME A;  1O85 A;  2JSY A;  1FW1 A;  1K3Y A;  3VWV A;  6GSS A;  1EZK A;  4I6X A;  1OKD A;  3GX0 A;  2AHE A;  3RHB A;  5IMA A;  2DML A;  3JCM L;  1K0A A;  3UAR A;  5GSS A;  1XG8 A;  4MP4 A;  3IE3 A;  1SJZ A;  2YAN A;  3NIV A;  1VF4 A;  1SK1 A;  3TKS C;  1WMJ A;  3ZVJ A;  2ZCT A;  1K3L A;  3C1S A;  5A4V A;  1ZOF A;  4P3Y B;  2H6X A;  3D22 A;  2PU9 C;  4YQV A;  1S4B P;  4EL1 A;  1SD8 A;  3M9J A;  3QPM A;  2LEG A;  4WBR D;  1T4Z A;  4FYC A;  3I9V 2;  3U6V A;  2FWH A;  3GH6 A;  4EDY A;  2PPT A;  2VLU A;  5FWG A;  3TRQ A;  1T3B A;  1NM3 A;  4F2I A;  4Z2R A;  1ST9 A;  4GSN A;  4KB3 A;  2V6K A;  3FEU A;  1USB A;  3GIX A;  2IN3 A;  3UL3 A;  3IXR A;  1J08 A;  2C0D A;  3WD6 A;  5DAL B;  4ZB6 A;  2ZNM A;  4IP1 A;  2HRN A;  3EE2 A;  3ZRD A;  1ZCP A;  2BTO T;  5AIS A;  3H1N A;  1V2A A;  2QKE A;  5ECK B;  4RI6 A;  4BIK A;  5BRT A;  2K8V A;  4GRF A;  3FRC A;  1GTB A;  5G1K A;  2YWM A;  4PUR A;  1Z7P A;  4AKH A;  4ZL9 A;  2HZE A;  4K1F A;  3KMN A;  1Z5Y E;  2VCW A;  3ME8 A;  4K7N A;  5HFI A;  1U3A A;  3VWU A;  4KDY A;  2E0Q A;  1W4V A;  2P0G A;  1A0F A;  1F9M A;  1EOG A;  1GTA A;  1V58 A;  4MLY A;  2EFC A;  1ERW A;  1B4P A;  3GL3 A;  2AB6 A;  4CW9 A;  2H76 A;  3FK8 A;  2IPA A;  3F4S A;  4TRX A;  2LRN A;  3I6A A;  3TJG A;  1R26 A;  4F0C A;  3EMX A;  2FCH A;  2N5A A;  2HRK A;  3GSS A;  1M2B A;  1T8E B;  4H86 A;  5F05 A;  3HMJ G;  2CZ2 A;  1GUK A;  5EVO A;  3CYN A;  2TIR A;  3K8N A;  3ERF A;  4OFM A;  3APO A;  1TU7 A;  4CY6 A;  1S3C A;  4X43 A;  1I5G A;  2L5L A;  2H66 A;  3IAS 2;  3ZIJ A;  1K3O A;  3PIN A;  2H1A A;  4AJ8 A;  2K6V A;  2A2S A;  1Z6N A;  3WGD A;  2GSR A;  2RM6 A;  4TKY A;  4V1A g;  3EVI A;  1T1V A;  1OKT A;  3V1W A;  4XRD A;  2YNX A;  4WBJ A;  3KTL A;  1DBY A;  3ZFL A;  3CQF A;  4TN8 A;  4I8B A;  2PN8 A;  4LLR A;  1X9S B;  4K5R A;  2OJL A;  2KHP A;  1SU9 A;  1O81 A;  3TGZ A;  3ZYW A;  2MYG A;  3GN3 A;  4IP6 A;  4PXO A;  1K0O A;  3ZFB A;  1SYX A;  3LOR A;  1B48 A;  2NTO A;  4QL7 A;  1T4Y A;  4AJ6 A;  1PKW A;  1KEB A;  2GVP A;  3ZL5 A;  4Q5N A;  1Q98 A;  4K7I A;  4KSO A;  1GTU A;  2WZS A;  4KDU A;  5DQY A;  2MMA A;  3GTU B;  3VWW A;  2O85 A;  4O32 A;  2FWE A;  5J4Y A;  1I1I P;  5A34 B;  2VM2 A;  3G9B A;  3KEB A;  5A5K A;  1TK0 B;  1VF1 A;  1SL0 B;  1X5C A;  2Z9S A;  5A5H A;  2KP2 A;  4N30 A;  1VF2 A;  1LBK A;  1GLP A;  3GST A;  4LL4 B;  3P90 A;  1ML6 A;  4ECJ A;  1BJX A;  3C71 A;  2HZF A;  4NXI A;  4JU5 A;  3IV4 A;  1XVQ A;  4PNG A;  3LW9 A;  2DLX A;  4G01 A;  2HSM B;  3HJO A;  2M72 A;  3QAG A;  2HE3 A;  4K9Z A;  1GSQ A;  1BG1 A;  11GS A;  3IDV A;  2H19 A;  3RHC A;  2DKH A;  3L9U A;  4LL1 B;  2UV8 G;  3Q19 A;  2JAD A;  4TVE A;  4E8E A;  1FHE A;  1XWG A;  5ELG A;  2REM A;  3FMW A;  3KCM A;  3RDW A;  4LMV A;  1OYJ A;  1O6J A;  2HSN B;  4KDX A;  2R3X A;  4AKX B;  4MJA A;  4O5R A;  2EIR A;  5B8A A;  3CHX C;  3LXT A;  3HDC A;  4USS A;  3TJF A;  3HA9 A;  5D9W A;  3GUS A;  4YQM A;  4N3Z A;  4FYB A;  3D4M A;  1XVW A;  3TKS A;  4ZB9 A;  1ERU A;  1EEM A;  1W89 A;  4FYU A;  1EEJ A;  2OA7 A;  5HR1 A;  2B1K A;  2MMZ A;  1A2L A;  2B1L A;  1O8W A;  3Q6O A;  3VPT A;  2X64 A;  1S3D A;  3GMF A;  2R0P A;  2VD0 A;  2R0C A;  3ZTL A;  2O87 A;  2KUC A;  5DCH A;  2YJH A;  12GS A;  4GCI A;  1R4W A;  4HS1 A;  3G7Y A;  1PKZ A;  5DAK A;  3N9J A;  4BVX A;  3DGQ A;  4YAV A; 
#chains in the Genus database with same CATH homology
 3DD3 A;  4XS1 A;  3C73 A;  5ECS A;  2FA8 A;  4XS6 A;  1AC1 A;  1TXU A;  1WRY A;  2LQO A;  5C00 A;  3OR5 A;  3GNJ A;  3H79 A;  2H30 A;  2JU5 A;  5KOX A;  1TRW A;  3VUR A;  5E4W A;  2F8A A;  1O73 A;  3ME7 A;  3ZLP A;  1PSQ A;  5F07 A;  4EXJ A;  3C7M A;  2YWI A;  4AI6 A;  2I81 A;  3R2Q A;  3VFI A;  3IA1 A;  3DXB A;  1V9W A;  1U87 A;  2VL2 C;  4WET A;  4G0I A;  4JED A;  5J4U A;  5AIX A;  3LEF A;  1TU8 A;  5DJM A;  4F0B A;  5ABR A;  4D73 A;  4PTS A;  4BVY A;  2CAQ A;  2JZR A;  2XHF A;  3E9J B;  3A2V A;  4AGS A;  4OWY A;  1J0F A;  4E8H A;  2EFD A;  4JRR A;  2EFE A;  1XFL A;  3ZVJ D;  1TXX A;  3L4N A;  2KLX A;  1GSS A;  1YF1 A;  4K0G A;  1HD2 A;  2KOK A;  1WWJ A;  3IK9 A;  4IGJ A;  3DML A;  2LQQ A;  1QGV A;  3IRA A;  1OC9 B;  3FR9 A;  1PGT A;  4OO4 A;  5DDL A;  3IK7 A;  3HZ4 A;  3FZ5 A;  1TK8 B;  4FH8 A;  2FWG A;  2GST A;  2GZP A;  1WJK A;  2H0I A;  2MBT A;  4DSQ A;  1TRV A;  3MIX A;  1M2A A;  4MF6 A;  5J41 A;  5GAP D;  3TB2 A;  1EGR A;  2C3Q A;  1AAZ A;  1OE8 A;  2FWF A;  2WUL A;  3ZML A;  1WP0 A;  3DRN A;  2N5B A;  2O8V B;  3DYR A;  1V40 A;  1ZL9 A;  4IQ1 A;  5B6N A;  1T00 A;  3UIW A;  1X0R A;  1YEP A;  3NZN A;  5HQP A;  4NHZ A;  5CRD A;  1GLQ A;  4K6X A;  1K0M A;  4XRA A;  3PH9 A;  4GDF A;  1U88 A;  1NHO A;  4J56 E;  1GH2 A;  3J7Y b;  4OD7 A;  5IO0 A;  3QFB C;  2UZ8 A;  4KUN A;  1SD9 A;  1NSW A;  4G2E A;  2LTK A;  3KMO A;  2FD3 A;  2YN1 A;  2YWO A;  1AQV A;  1GSF A;  3H8Q A;  4WEY A;  4ILF A;  6GSW A;  5J47 A;  1HQO A;  3UBL A;  2WZ9 A;  2NVL A;  1O8X A;  1F3A A;  4PGT A;  4MH3 A;  2IMI A;  2OAD A;  3KTB A;  2VD1 A;  4EC0 A;  1LU4 A;  2I9H A;  3KP8 A;  4HJM A;  3F63 A;  1JZR A;  2HQT A;  1ZGN A;  3GA4 A;  4L5O A;  4A5P A;  3M1G A;  4NHW A;  4YAP A;  1BX9 A;  2VCV A;  1JLV A;  4XCS A;  2O89 A;  1GRX A;  1DE2 A;  2QA1 A;  1BQ7 A;  1OVN A;  4O5U A;  2VOC A;  2E7P A;  1A8L A;  1VRS D;  3DIE A;  5IOW A;  1E6B A;  3DWV A;  20GS A;  4PQH A;  1CQH A;  1ERV A;  1OC3 A;  2R0G A;  2H72 A;  3QMX A;  5DAL A;  2DBC A;  1GNW A;  4HOJ A;  4E68 A;  2WDU A;  2H1G A;  2I3Y A;  3SBC A;  3IPZ A;  2A2P A;  2GZZ A;  2EIQ A;  3RAZ A;  4IVF A;  3KZQ A;  4JBB A;  5IO2 A;  3VLN A;  1EWX A;  2RUF A;  2VCQ A;  4HDE A;  5EL8 A;  5CO3 A;  1MD3 A;  2RLI A;  1ZMA A;  4ZXG A;  5J9C A;  2G0F A;  2EFH A;  2LJR A;  5J40 A;  2R2J A;  4HQZ A;  1ON4 A;  2R37 A;  4TXO B;  2GTU A;  2CVB A;  5IOX A;  1PL1 A;  2VO4 A;  3W6G A;  3CSJ A;  1E2Y A;  5IMC A;  2A2R A;  5A1N B;  5KN0 A;  1LJR A;  4GLT A;  2HRA A;  1FVK A;  1GSY A;  1O7U A;  2YV7 A;  2YPM A;  1PN9 A;  3MYD A;  4X4J A;  3EC3 A;  4MJC A;  1GWC A;  3UJ1 A;  3IOS A;  4ZL7 A;  4G0K A;  2O5V A;  2C80 A;  3EUR A;  4IS0 A;  3TKQ A;  2ON7 A;  2LUS A;  5B8B A;  3ZRE A;  1AQW A;  5CNW A;  2FGX A;  2HNL A;  2DJJ A;  6GSY A;  3EPT A;  2VL2 A;  5HFK A;  1JZD A;  1TOF A;  1A23 A;  2DJK A;  5JWQ B;  2HXK A;  2VKZ G;  2K8S A;  1FOV A;  1PQN A;  4OFT A;  5ECO B;  4NAX A;  3CBU A;  5EY6 A;  3U5R E;  3TKS E;  2F51 A;  4TOP A;  1Y1U A;  2NPB A;  2I4A A;  3HVV A;  3F0I A;  1ACV A;  4EVM A;  1X5D A;  2ZUP A;  3RPN A;  5KN1 A;  1F3B A;  2O7K A;  1WE0 A;  1XWB A;  2LV3 A;  5JCU A;  2MZC A;  2DJ3 A;  1VF3 A;  1F37 A;  2L4C A;  2M46 A;  3GTU A;  2DMM A;  4ZB8 A;  2H74 A;  2MMO A;  3LQ7 A;  4MZB A;  3F6D A;  2X8H A;  4OMV A;  4HU9 A;  3CRU A;  2B5X A;  5A34 A;  4EIQ A;  1TDI A;  2L57 A;  5G30 A;  3ED3 A;  4XS4 B;  2CA8 A;  2AJQ B;  1GSE A;  1OE7 A;  4HZ4 A;  2H70 A;  2YZU A;  2JZT A;  2HI7 A;  2B7J A;  3F9U A;  2VIM A;  2DKI A;  5G2Z A;  1TI3 A;  3LJR A;  1R5P A;  4L5L A;  1QFN A;  5F8B A;  1PL2 A;  3GV1 A;  1SL1 B;  2HSM A;  4QQ7 A;  4DSR A;  2R5G A;  4MF7 A;  3TCO A;  1N25 A;  1XOA A;  3NOF A;  2YWN A;  5KOW A;  3PR8 A;  1XW5 A;  4FO5 A;  1KBN A;  3MNG A;  2PGT A;  1N8J A;  2HSN A;  2YCD A;  1X5E A;  3HZ8 A;  3HY2 A;  4MA9 A;  2H0G A;  2H8L A;  2JAC A;  1XPV A;  4KE3 A;  4F82 A;  1WOU A;  4MCU A;  2GSQ A;  3VI7 A;  2PBJ A;  2B5Y A;  1A2M A;  3PGT A;  1EP7 A;  1AIU A;  3HKR A;  3TRP A;  4MZW A;  2M80 A;  3HJM A;  2PVQ A;  5J9B A;  2FY6 A;  2B5E A;  1FB0 A;  1Z9H A;  4DVC A;  2V6O A;  4POB A;  3VI5 A;  2DIZ A;  1WPI A;  3MAK A;  1AXD A;  3D0Z A;  3CRT A;  1FOH A;  2VLV A;  3CWG A;  4Z2U A;  3M0F A;  5G5E A;  1TTZ A;  3ZMK A;  1A8Y A;  2P5R A;  4MK3 A;  3TJB A;  1XZO A;  3UEM A;  4BL7 B;  3O6T A;  4Q5R A;  3W8J A;  1GTI A;  3D4T A;  4MPG A;  1YY7 A;  2CAI A;  1GSU A;  2PMT A;  4TXV A;  5IM9 A;  3KGK A;  4N0V A;  2GT6 A;  5IQY A;  3QDN A;  4G19 A;  1M99 A;  1BAY A;  4WR4 A;  1SVL A;  2L4Q A;  1ZYQ B;  4HEA 2;  2C0G A;  1QMV A;  2H01 A;  4HUA A;  4I2U A;  5IPG A;  4PUA A;  3R3E A;  3LG6 A;  3GH9 A;  3QFA C;  1ZYN A;  2H6Z A;  2R6K A;  4GXZ A;  3A5I A;  3AY8 A;  2HT9 A;  1XWC A;  5EPF A;  1H75 A;  1GUH A;  5E59 A;  1X9W B;  1YVL A;  4CHS A;  3MWH A;  2VL9 A;  5CAX A;  1SVO A;  2H1B A;  4WKW A;  1JHB A;  1T7P B;  3QR6 A;  3IHG A;  3GL5 A;  4ZBD A;  2CVD A;  5JCG A;  3GX8 A;  1FG4 A;  5D9V A;  2LKU A;  5A4U A;  4HQS A;  3I43 A;  1G6W A;  3J7Y k;  1UC7 A;  4ML6 A;  3BOA A;  3ERW A;  5FT3 A;  1OAZ A;  1PRX A;  3QAV A;  2MBS A;  4X1U A;  4W66 A;  3HYP A;  2VCT A;  3KXO A;  4LMW A;  4PUF C;  3GYK A;  4KGI A;  5F06 A;  3FZA A;  2CZ3 A;  1UN2 A;  2OBK A;  1ERT A;  2KP1 A;  3CMI A;  2X99 A;  3A2X A;  2WS2 A;  1QK8 A;  2I1U A;  5FHI A;  4MZC A;  3CTG A;  4DSS B;  4AF2 A;  1URM A;  4BA7 A;  1GP1 A;  1OC9 A;  1R7H A;  3APS A;  5CYY A;  1V98 A;  5CP1 A;  5ECL B;  5INY A;  5ECN B;  1ABA A;  3DVW A;  1YDK A;  4AKI A;  3GRX A;  22GS A;  3MSZ A;  1PX7 A;  4XTS A;  1OC8 A;  3KD0 A;  1U3I A;  5H5Q A;  2DC5 A;  4POK A;  3LGC A;  4EF0 A;  4Q5F A;  5BMU A;  5ID2 B;  5ECM B;  5CRE A;  3IC8 A;  4MDC A;  3P7X A;  4OCF A;  5KN3 A;  2GQM A;  4TR0 A;  3D21 A;  1B8X A;  1FVJ A;  3G7I A;  3FR6 A;  5B7C A;  4YQU A;  4EE0 A;  2CQ9 A;  1BYE A;  3FYG A;  1KNG A;  2OAC A;  2BJX A;  6GSV A;  4G9H A;  4MF5 A;  3HVS A;  5DVB A;  2VUP A;  3SWL A;  3ISO A;  3BCK A;  1AQX A;  5BMU B;  2IFQ B;  1SKS B;  4PQ1 A;  4OO5 A;  4GWR A;  1HYU A;  3A3T A;  1MD4 A;  3RPP A;  5DJL A;  3HHV A;  4V2N A;  4ID0 A;  2MMN A;  3WGX A;  1MEK A;  2YOI A;  2F8F A;  3DKS A;  4IEL A;  1J9B A;  1Y6E A;  4EUY A;  5IIZ A;  4K7O A;  3O76 A;  4AKG A;  2BMX A;  1GUL A;  1Q4J A;  5ENU A;  4TR1 B;  4Z7X A;  1BG5 A;  3LSZ A;  1XOB A;  4WF5 A;  1FAA A;  5IMZ A;  1JFU A;  1IYI A;  5D73 A;  3LWA A;  2J23 A;  3S9F A;  2GGT A;  4X0X A;  1FO5 A;  1GUM A;  5GST A;  4K2D A;  1S3A A;  2WFC A;  2RM5 A;  3GHA A;  5H5R A;  5A4W A;  4MNN A;  2FHE A;  5GAN D;  2FA4 A;  3BJ5 A;  2GLR A;  4O7H A;  2A4H A;  4TR3 A;  4V2L A;  4N11 A;  1TRS A;  3HD5 A;  3UVT A;  3EIN A;  4ML1 A;  1M9A A;  2B3S A;  3UMA A;  2FUG 2;  3FR3 A;  2OT3 A;  2L6C A;  3IC4 A;  1V57 A;  4KCA A;  1SK2 A;  2H1D A;  5AIV A;  1TK5 B;  1BED A;  6GSX A;  2PVO C;  1XXU A;  1SEN A;  3H4K A;  1K0D A;  4KH7 A;  2B6M A;  1F2E A;  1GSD A;  5COH A;  2GDR A;  4POM A;  3UAP A;  1NHY A;  4XIH A;  2TRX A;  10GS A;  1SJ6 A;  3TDG A;  3QCP A;  4N0Z A;  1HNC A;  4TXO A;  3FZ9 A;  3EU3 A;  2YP6 A;  3G7J A;  2NBS A;  3FKF A;  3L78 A;  5A1N A;  2OE1 A;  2NDO A;  1G7O A;  4NPB A;  3L0H A;  4XHM A;  4KSM A;  2G2Q A;  4O5Q A;  3EYT A;  1XWK A;  4QL9 A;  4JR4 A;  1PX6 A;  3RBT A;  1MTC A;  1JLW A;  3LYP A;  4N10 A;  1XCC A;  2WJU A;  3CSH A;  4J2F A;  2B7K A;  2IMK A;  5D9X A;  2CVK A;  2H73 A;  2DJ2 A;  1EV9 A;  3UBK A;  4V2M A;  1M0U A;  3MDK A;  3GKN A;  2PER A;  3TRX A;  4YKG A;  4IN0 A;  1RW1 A;  1RK4 A;  3TKP A;  5IPH A;  4NV2 A;  2IMD A;  4I97 A;  4L0U A;  5KN2 A;  3FY7 A;  2QC7 A;  9GSS A;  1THX A;  1WIK A;  2A4V A;  2WGR A;  5HR0 A;  1DE1 A;  2FNO A;  1X9M B;  1ZYE A;  2TRC P;  3KJY A;  1SKR B;  2H6Y A;  4Q5Q A;  1U6T A;  4OFN A;  1QQ2 A;  4WXT A;  3TUE A;  4KF9 A;  5C04 A;  2L5O A;  3A5W A;  4EDZ A;  5J3R A;  2AAW A;  2C0E A;  3D6I A;  4K0N A;  5ELA A;  4ZB7 A;  2YV9 A;  2X49 A;  4Z2T A;  3Q18 A;  5LCZ A;  3LXZ A;  2HZE B;  3KM6 A;  2DIY A;  1BF5 A;  4V1A p;  2LRC A;  4J57 E;  4K2X A;  5B6M A;  5JWO B;  1K0N A;  2IMF A;  1YKA A;  1IYH A;  2V2G A;  3TU3 B;  4LA1 A;  4G0L A;  4JR6 A;  2E2G A;  1H4O A;  4ECB A;  3Q74 A;  2GSS A;  3F4T A;  3CSI A;  4K5S A;  4NMU A;  2HRK B;  2C8U A;  1TKD B;  4G10 A;  4XS4 A;  3M8N A;  8GSS A;  4MH2 A;  4FQU A;  3VPQ A;  4MPF A;  1HNA A;  4HI7 A;  2L6D A;  5ECP B;  3HCZ A;  4YH2 A;  2ON5 A;  4L8E A;  2LST A;  1R5A A;  5IMF A;  1Z6M A;  2RII A;  2P31 A;  1ZZY A;  2JZS A;  4EIP A;  4IQA A;  4MJE A;  3TJK A;  2X4A A;  4RQR A;  4KW6 A;  3HJP A;  4JE1 A;  3M9K A;  1N2A A;  2CT6 A;  4I5Q A;  4NWY A;  14GS A;  5ECR B;  2F9S A;  4TR4 A;  4TW5 A;  2YJ7 A;  1PD2 1;  4IHU A;  4GF0 A;  4AJ7 A;  5H5S A;  1GL8 A;  1RQM A;  2C4J A;  1EP8 A;  5IMD A;  3H93 A;  5D93 A;  1A24 A;  1TJD A;  3ZIV A;  5JWR B;  4L0W A;  3E3E A;  2C3N A;  2C3T A;  3L9S A;  3LFL A;  2H1L A;  3GUR A;  2LJA A;  1PN0 A;  4BPY A;  2V41 A;  2X8G A;  5CRH A;  2QA2 A;  4KAE A;  3UOM A;  2GZY A;  3F3R A;  4MAB A;  1PA3 A;  3BD2 A;  2LS5 A;  2IJY A;  1XW9 A;  1YF0 A;  5CRW A;  1SKW B;  1XIY A;  3A2W A;  4BL7 A;  4KCE A;  2XPD A;  4EKZ A;  1Y25 A;  3BBY A;  1THO A;  4RUV A;  4RI7 A;  5G1L A;  1VGL A;  3F4R A;  5A5H B;  3BCI A;  3WT2 A;  5IMV A;  2YZH A;  2LJK A;  2E2M A;  2X8C A;  1MDK A;  1I9D A;  1SJI A;  2VL3 A;  3DEX A;  2R4V A;  6GSU A;  1FB6 A;  1G7E A;  4ZIJ A;  5DBQ A;  4ICY A;  1EV4 A;  4WF4 A;  2H75 A;  1XWA A;  3FZ4 A;  4GSS A;  1M9B A;  2C0F A;  3PPU A;  1HNB A;  1F6M C;  2OE0 A;  2LRT A;  4POL A;  3E0U A;  2AV4 A;  1XBS A;  3EMP A;  2WB9 A;  1JZO A;  5GZZ B;  5D9T A;  2OBI A;  1TW9 A;  1SYR A;  5J5N A;  3F6F A;  1G0T A;  2RUE A;  4BWS A;  2VAF A;  4KX4 A;  4K8M A;  1YJ6 A;  1NW2 A;  2IIY A;  4EO3 A;  3FW2 A;  1QXH A;  3ERG A;  1CQG A;  1B9X C;  5LNK e;  3KP9 A;  3HVX A;  1Z3E A;  2GQK A;  4IJI A;  2HLS A;  4JZQ A;  2VM1 A;  3F3Q A;  2LNT A;  2HYX A;  2WCI A;  3KH7 A;  1SVM A;  4ECI A;  1UVZ A;  3GKM A;  4MMM A;  1QUW A;  4ZIL A;  1YKC A;  2D2Z A;  5AGY A;  2L59 A;  3P8W A;  1TP9 A;  5G31 A;  5KEJ A;  1YZX A;  2EIO A;  3VK9 A;  5L71 A;  4ULX A;  4QMK A;  2OKA A;  2J9H A;  3KH9 A;  1K0C A;  1A0R P;  2OE3 A;  2AYT A;  2IL3 A;  3IR4 A;  2FLS A;  4DSS A;  2VLT A;  2GT5 A;  2ALB A;  2P5Q A;  4HZ2 A;  4ZL8 A;  4PQI A;  1M2D A;  5DAK B;  3WYW A;  2HSY A;  3EWL A;  4KA0 A;  1UA5 A;  3F8U A;  4PNF A;  4BVX B;  2K18 A;  2VCX A;  4HJ2 A;  1EOH A;  5D96 A;  2WRT A;  2N5F A;  2XBI A;  4HU7 A;  1B9Y C;  3IHQ A;  5G5F A;  5ECH B;  4ISD A;  3VWX A;  4CDO A;  5AN1 A;  5HFG A;  1JZW A;  2CV4 A;  4GTU A;  3TJJ A;  4WR5 A;  2GS3 A;  2QSI A;  1YEX A;  5ID2 A;  16GS A;  3KIJ A;  4OCE A;  3TOU A;  3IBH A;  1TI1 A;  2VCZ A;  3D5J A;  5CRG A;  4PX1 A;  17GS A;  4ZBB A;  2F3M A;  4MJB A;  2IFQ A;  3CTF A;  4I2T A;  1PMT A;  4YKF A;  4GST A;  5HR3 A;  3EU4 A;  4GQC A;  1KTE A;  4D73 B;  1K0B A;  2V1M A;  4DEJ A;  2CX4 A;  1EGO A;  1AW9 A;  3ZIT A;  2JSZ A;  3CXG A;  2LNS A;  4BWQ A;  4BVY B;  4NV5 A;  2V32 A;  1GNE A;  1M7T A;  2XPE A;  3TKR A;  13GS A;  1SL2 B;  2PWJ A;  2DSA A;  4ACS A;  1B4Q A;  2AUV A;  3TOT A;  3IAM 2;  3C8E A;  1ZYP A;  2DJ1 A;  7GSS A;  3QOU A;  19GS A;  3L9V A;  5DCG A;  4TR1 A;  6GST A;  4F9Z A;  3GKX A;  2K9F A;  2H71 A;  1ILO A;  3O3T A;  1AUC A;  1YQ1 A;  3GFK A;  3WGE A;  3DVX A;  5HR2 A;  4IKH A;  4O92 A;  2JL4 A;  5F0G A;  2C1Y A;  2XBQ A;  1A2J A;  5LD0 A;  3UVH A;  4F03 A;  5JCW A;  2HFD A;  3P2A A;  2QGV A;  1DUG A;  4ZBA A;  3GKK A;  3QD9 A;  4IW9 A;  3QAW A;  3FHK A;  1TRU A;  2EC4 A;  3C1R A;  4KND A;  2DJ0 A;  5ECI B;  1G6Y A;  18GS A;  5DQS A;  3US3 A;  5J4V A;  3ZZX A;  1DSB A;  4CY8 A;  1Z7R A;  3LYK A;  4RQX A;  5ECQ B;  4ECC A;  3I69 A;  2CX3 A;  3APQ A;  1SK0 A;  2XC2 A;  1C72 A;  4IBP A;  3W8S A;  1MDJ A;  3HXS A;  2HRF A;  1XW6 A;  2ES7 A;  2GQL A;  4GQF A;  4FIW A;  2PUK C;  3M3M A;  3WT1 A;  2HSH A;  2H0H A;  1MDI A;  2IWT A;  5D8I A;  3N5O A;  4IJ3 A;  2IME A;  1O85 A;  2JSY A;  1FW1 A;  1K3Y A;  3VWV A;  6GSS A;  1EZK A;  4I6X A;  1OKD A;  3GX0 A;  2AHE A;  3RHB A;  5IMA A;  2DML A;  3JCM L;  1K0A A;  3UAR A;  5GSS A;  4MP4 A;  3IE3 A;  1SJZ A;  2YAN A;  3NIV A;  1VF4 A;  1SK1 A;  3TKS C;  1WMJ A;  3ZVJ A;  2ZCT A;  1K3L A;  3C1S A;  5A4V A;  1ZOF A;  4P3Y B;  2H6X A;  3D22 A;  2PU9 C;  4YQV A;  4EL1 A;  1SD8 A;  3M9J A;  3QPM A;  2LEG A;  4WBR D;  1T4Z A;  4FYC A;  3I9V 2;  3U6V A;  2FWH A;  3GH6 A;  4EDY A;  2PPT A;  2VLU A;  5FWG A;  3TRQ A;  1T3B A;  1NM3 A;  4F2I A;  4Z2R A;  1ST9 A;  4GSN A;  4KB3 A;  2V6K A;  3FEU A;  1USB A;  3GIX A;  2IN3 A;  3UL3 A;  3IXR A;  1J08 A;  2C0D A;  3WD6 A;  5DAL B;  4ZB6 A;  2ZNM A;  4IP1 A;  2HRN A;  3EE2 A;  3ZRD A;  1ZCP A;  2BTO T;  5AIS A;  3H1N A;  1V2A A;  2QKE A;  5ECK B;  4RI6 A;  5BRT A;  2K8V A;  4GRF A;  3FRC A;  1GTB A;  5G1K A;  2YWM A;  4PUR A;  1Z7P A;  4AKH A;  4ZL9 A;  2HZE A;  4K1F A;  3KMN A;  1Z5Y E;  2VCW A;  3ME8 A;  4K7N A;  5HFI A;  1U3A A;  3VWU A;  4KDY A;  2E0Q A;  1W4V A;  2P0G A;  1A0F A;  1F9M A;  1EOG A;  1GTA A;  1V58 A;  4MLY A;  2EFC A;  1ERW A;  1B4P A;  3GL3 A;  2AB6 A;  4CW9 A;  2H76 A;  3FK8 A;  2IPA A;  3F4S A;  4TRX A;  2LRN A;  3I6A A;  3TJG A;  1R26 A;  4F0C A;  3EMX A;  2FCH A;  2N5A A;  2HRK A;  3GSS A;  1M2B A;  1T8E B;  4H86 A;  5F05 A;  3HMJ G;  2CZ2 A;  1GUK A;  5EVO A;  3CYN A;  2TIR A;  3K8N A;  3ERF A;  4OFM A;  3APO A;  1TU7 A;  4CY6 A;  1S3C A;  4X43 A;  1I5G A;  2L5L A;  2H66 A;  3IAS 2;  3ZIJ A;  1K3O A;  3PIN A;  2H1A A;  4AJ8 A;  2K6V A;  2A2S A;  1Z6N A;  3WGD A;  2GSR A;  2RM6 A;  4TKY A;  4V1A g;  3EVI A;  1T1V A;  1OKT A;  3V1W A;  4XRD A;  2YNX A;  4WBJ A;  3KTL A;  1DBY A;  3ZFL A;  4TN8 A;  4I8B A;  2PN8 A;  4LLR A;  1X9S B;  4K5R A;  2OJL A;  2KHP A;  1SU9 A;  1O81 A;  3TGZ A;  3ZYW A;  2MYG A;  3GN3 A;  4IP6 A;  4PXO A;  1K0O A;  3ZFB A;  1SYX A;  3LOR A;  1B48 A;  2NTO A;  4QL7 A;  1T4Y A;  4AJ6 A;  1PKW A;  1KEB A;  2GVP A;  3ZL5 A;  4Q5N A;  1Q98 A;  4K7I A;  4KSO A;  1GTU A;  4KDU A;  5DQY A;  2MMA A;  3GTU B;  3VWW A;  2O85 A;  4O32 A;  2FWE A;  5J4Y A;  5A34 B;  2VM2 A;  3G9B A;  3KEB A;  5A5K A;  1TK0 B;  1VF1 A;  1SL0 B;  1X5C A;  2Z9S A;  5A5H A;  2KP2 A;  4N30 A;  1VF2 A;  1LBK A;  1GLP A;  3GST A;  4LL4 B;  3P90 A;  1ML6 A;  4ECJ A;  1BJX A;  3C71 A;  2HZF A;  4NXI A;  4JU5 A;  3IV4 A;  1XVQ A;  4PNG A;  3LW9 A;  2DLX A;  4G01 A;  2HSM B;  3HJO A;  2M72 A;  3QAG A;  2HE3 A;  4K9Z A;  1GSQ A;  1BG1 A;  11GS A;  3IDV A;  2H19 A;  3RHC A;  2DKH A;  3L9U A;  4LL1 B;  2UV8 G;  3Q19 A;  2JAD A;  4TVE A;  4E8E A;  1FHE A;  1XWG A;  5ELG A;  2REM A;  3FMW A;  3KCM A;  3RDW A;  4LMV A;  1OYJ A;  1O6J A;  2HSN B;  4KDX A;  2R3X A;  4AKX B;  4MJA A;  4O5R A;  2EIR A;  5B8A A;  3LXT A;  3HDC A;  4USS A;  3TJF A;  3HA9 A;  5D9W A;  3GUS A;  4YQM A;  4N3Z A;  4FYB A;  3D4M A;  1XVW A;  3TKS A;  4ZB9 A;  1ERU A;  1EEM A;  1W89 A;  4FYU A;  1EEJ A;  2OA7 A;  5HR1 A;  2B1K A;  2MMZ A;  1A2L A;  2B1L A;  1O8W A;  3Q6O A;  3VPT A;  2X64 A;  1S3D A;  3GMF A;  2R0P A;  2VD0 A;  2R0C A;  3ZTL A;  2O87 A;  2KUC A;  5DCH A;  2YJH A;  12GS A;  4GCI A;  1R4W A;  4HS1 A;  3G7Y A;  1PKZ A;  5DAK A;  3N9J A;  4BVX A;  3DGQ A;  4YAV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...