2HRKB

Structural basis of yeast aminoacyl-trna synthetase complex formation revealed by crystal structures of two binary sub-complexes
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
121
structure length
121
Chain Sequence
b'MSDLVTKFESLIISKYPVSFTKEQSAQAAQWESVLKSGQIQPHLDQLNLVLRDNTFIVSTLYPTSTDVHVFEVALPLIKDLVASSKDVKSTYTTYRHILRWIDYMQNLLEVSSTDKLEINH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamyl-tRNA synthetase, cytoplasmic
publication title Structural basis of yeast aminoacyl-tRNA synthetase complex formation revealed by crystal structures of two binary sub-complexes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ligase/rna binding protein
total genus 41
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2006-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2hrkB00
4BL7A 3VURA 1JLWA 4KF9A 1GSUA 3G7JA 4GF0A 5DJMA 1YKCA 1TU7A 3P8WA 5B7CA 3GTUB 4EXJA 3ISOA 5A5KA 2GSTA 2VD0A 2R3XA 3U6VA 3FR9A 2VD1A 6GSTA 2OA7A 1K0OA 4PQIA 4F0CA 1HQOA 3WYWA 5F06A 4JEDA 1PGTA 3IR4A 1PN9A 2ON5A 5FHIA 4BVYB 1FHEA 5ECMB 4N0VA 1MTCA 1BX9A 2WDUA 4O92A 17GSA 3PPUA 3ZMKA 3FRCA 5D9VA 3FR6A 1K3OA 1ZL9A 4ISDA 4KSMA 4BL7B 3SWLA 3BBYA 4WR5A 2A2RA 2VCVA 2PMTA 1KBNA 4MK3A 4J2FA 1NHYA 2YV9A 2HNLA 4MPFA 4PXOA 1GUMA 1VF1A 3I69A 4GTUA 2PERA 3VK9A 13GSA 1JZRA 2UZ8A 5JCWA 3R3EA 4BVXA 1AQVA 3N5OA 4IS0A 4PUAA 2N5FA 3IC8A 4MF5A 1BG5A 3DGQA 1OYJA 3KM6A 3QAWA 3DD3A 3O3TA 4G0IA 3CSHA 4NHZA 2DC5A 4G19A 18GSA 1GSSA 3EINA 4AGSA 1GSQA 3VPTA 3UVHA 1C72A 2YV7A 4MDCA 2VCTA 5A4WA 9GSSA 6GSXA 5D9XA 2A2SA 2GSSA 3AY8A 3LG6A 14GSA 4QQ7A 22GSA 5DALB 1HNAA 4JZQA 1GNEA 1PX7A 2PBJA 1GSFA 3GSSA 3IE3A 7GSSA 4GSSA 3M0FA 4MPGA 4MZWA 12GSA 4KX4A 5DCGA 1EEMA 3ERGA 1M9AA 3MAKA 1HNBA 1YJ6A 2WS2A 4G9HA 3GTUA 5ECSA 5D9TA 5KEJA 1GTBA 5BMUA 4ZB6A 3ERFA 2VCQA 1K0CA 5J5NA 3CSIA 1BAYA 2IMIA 4JBBA 4MP4A 2HQTA 1EOHA 4BVYA 4MF7A 2C80A 8GSSA 3TOUA 1GSYA 4G10A 3PGTA 4HJ2A 4LMWA 5DJLA 3H1NA 4K0GA 1XWGA 4FQUA 5F07A 3FY7A 1ZGNA 3KMNA 1GSEA 2DSAA 4ACSA 3R2QA 4YQMA 1IYHA 3IK9A 3HKRA 3VI5A 4E8EA 1K0MA 4OFMA 5LD0A 4YH2A 2HRKB 3CSJA 4ZXGA 2LJRA 1DUGA 3GURA 4EDZA 4ZB8A 4KAEA 20GSA 4ECJA 5F05A 10GSA 3C8EA 5ECKB 2C8UA 5ECPB 4Q5RA 6GSVA 1EV9A 5ELAA 4G0LA 5EY6A 5AISA 4HOJA 4CHSA 4RI6A 2R5GA 2J9HA 1UA5A 1GWCA 4GSNA 4GLTA 5ECNB 4MF6A 4YQUA 3P90A 5J41A 2C4JA 2JL4A 2WRTA 5GZZB 2GSQA 3KTLA 5D73A 3EE2A 3GUSA 1RK4A 2VCWA 1VF4A 5JCUA 11GSA 1GTUA 1K0BA 1FW1A 2D2ZA 2HRAA 5DALA 3Q74A 4IW9A 4YAVA 5F8BA 3LYKA 1XW5A 1G7OA 1OKTA 3F6FA 4NHWA 5ECHB 3HJOA 1LBKA 2CAIA 6GSUA 3LYPA 1Z9HA 1F3AA 5AN1A 2PGTA 2WB9A 4TOPA 1BYEA 4L5OA 5G5FA 3UBLA 2WJUA 1MD3A 1GNWA 2NTOA 4IQ1A 5A4VA 3UARA 3GSTA 3HJMA 1Y6EA 1PKZA 6GSYA 1OE7A 1JLVA 3LXTA 1PA3A 1R5AA 1GUKA 3IBHA 4KDUA 3VI7A 1XW6A 4USSA 1G6YA 2CZ3A 2C3TA 2F8FA 4KH7A 4KDYA 5AIVA 1AQXA 1IYIA 3NIVA 5LCZA 2GTUA 4KE3A 1V2AA 4WR4A 3QAGA 3LFLA 4ZB9A 1PL1A 2AB6A 2VCXA 4Q5QA 4HI7A 5IQYA 2HRKA 1YQ1A 2GSRA 4DEJA 1GLQA 1Q4JA 4LMVA 2CZ2A 3KMOA 1GULA 3GH6A 4IELA 3FR3A 3I6AA 1V40A 2VO4A 3GX0A 3LSZA 2IMKA 5DAKB 4I97A 1PD21 19GSA 1U3IA 2CVDA 4PGTA 4GCIA 3VLNA 1B4PA 3IK7A 5F0GA 1AXDA 1TDIA 4KDXA 5ECLB 1B8XA 2AHEA 3CRUA 4PNGA 4ECCA 4ECIA 4HZ4A 5DDLA 3LJRA 2GDRA 4KGIA 4IGJA 3PR8A 4K0NA 2X64A 4GSTA 2IL3A 1USBA 1OE8A 1MD4A 4PURA 1PL2A 3G7IA 1AW9A 4RI7A 1K0AA 1TW9A 1G6WA 1LJRA 4HZ2A 3WD6A 5FT3A 1YDKA 1M9BA 3QAVA 3KXOA 1EOGA 5J4UA 2FHEA 2HSNB 5ELGA 5G5EA 4IQAA 1GSDA 1YY7A 5ECQB 1GLPA 3CRTA 4PNFA 2F3MA 4ZBAA 1E6BA 3FYGA 4ID0A 3ZMLA 4Q5NA 5GSSA 2AAWA 3M8NA 1N2AA 4O7HA 3MDKA 3UAPA 2PVQA 1VF3A 2OACA 4E8HA 3ZFBA 2CAQA 4F03A 16GSA 2HSMA 1ML6A 4PQHA 6GSWA 1PKWA 2C3QA 4G0KA 1K0NA 5ECRB 1K0DA 4OMVA 5DAKA 4YQVA 1M0UA 3L0HA 4ECBA 3VWXA 3D0ZA 4YAPA 1HNCA 1A0FA 5ECOB 1PX6A 3TOTA 4Q5FA 4ZBBA 1GTIA 1B48A 1AQWA 4IVFA 2FNOA 4PTSA 2VCZA 1GUHA 3F6DA 3LQ7A 3LXZA 1XWKA 1PMTA 1GTAA 3M1GA 5AGYA 2YCDA 1EV4A 2V6KA 5DQSA 4EE0A 3O76A 3W8SA 3F63A 3UBKA 2R6KA 2HSMB 1TU8A 4NAXA 3CBUA 2ON7A 1F3BA 4OFNA 3Q19A 4IKHA 2OADA 2C3NA 4IBPA 1K3YA 3RBTA 3KJYA 4EDYA 4BVXB 5AIXA 1F2EA 4L5LA 2GLRA 1M99A 3N9JA 5GSTA 3TGZA 3QR6A 1VF2A 2R4VA 1K3LA 3M3MA 5ECIB 4EC0A 4OFTA 5EVOA 3Q18A 5D9WA 4PX1A 5HFKA 4ZBDA 4F0BA 5FWGA 4L8EA 1U87A 2CA8A 3ZFLA 6GSSA 4IJIA 1U88A 5EL8A 3VPQA 5A4UA
chains in the Genus database with same CATH superfamily
4BL7A 5J47A 3VURA 5A34B 1JLWA 4KF9A 1GSUA 3G7JA 4GF0A 5DJMA 1YKCA 1TU7A 3P8WA 5B7CA 3GTUB 4EXJA 3ISOA 5A5KA 2GSTA 2VD0A 2R3XA 3U6VA 3FR9A 2VD1A 6GSTA 2OA7A 1K0OA 4PQIA 4F0CA 1HQOA 2WVXB 3WYWA 5F06A 4JEDA 1PGTA 3IR4A 1PN9A 2ON5A 5FHIA 4BVYB 2WW2A 1FHEA 5ECMB 4N0VA 1MTCA 1BX9A 4PI2C 2WDUA 4O92A 17GSA 3PPUA 3ZMKA 3FRCA 5D9VA 3FR6A 1K3OA 3CHXC 1ZL9A 4ISDA 4KSMA 4BL7B 3SWLA 3BBYA 4WR5A 2A2RA 2VCVA 2PMTA 1KBNA 4MK3A 4J2FA 4AKIA 1NHYA 1YEWC 2YV9A 2HNLA 4MPFA 4PXOA 1GUMA 1VF1A 3I69A 4GTUA 2PERA 3VK9A 13GSA 1JZRA 2UZ8A 5JCWA 3R3EA 4BVXA 4ZB7A 1AQVA 3N5OA 4IS0A 4PUAA 2N5FA 3IC8A 4MF5A 1BG5A 3DGQA 1OYJA 3KM6A 3QAWA 3DD3A 3O3TA 4G0IA 1BF5A 3CSHA 4NHZA 2DC5A 18GSA 3EINA 1GSSA 4G19A 4AGSA 1GSQA 3VPTA 3UVHA 2O3EA 1C72A 2YV7A 4MDCA 2VCTA 5J4YA 5A4WA 9GSSA 6GSXA 5D9XA 4AKGA 2A2SA 2GSSA 3AY8A 3LG6A 14GSA 4QQ7A 22GSA 2UV8G 1HNAA 4JZQA 5DALB 1GNEA 1PX7A 2PBJA 1GSFA 3GSSA 3IE3A 7GSSA 4AKXB 4GSSA 3M0FA 4MPGA 4MZWA 12GSA 4KX4A 5DCGA 1EEMA 3ERGA 1M9AA 3MAKA 1HNBA 5A1NA 1YJ6A 2WS2A 4G9HA 3GTUA 5ECSA 5D9TA 2WW0A 5KEJA 1GTBA 5BMUA 4ZB6A 3ERFA 2VCQA 1K0CA 5J5NA 3CSIA 2WVXA 1BAYA 2H1LA 2IMIA 4JBBA 4MP4A 2HQTA 1EOHA 4BVYA 2EFHA 4MF7A 4AI6A 2C80A 8GSSA 3TOUA 1GSYA 4G10A 3PGTA 2EFDA 4HJ2A 4LMWA 4G01A 5DJLA 3H1NA 4K0GA 1XWGA 2VKZG 4FQUA 5F07A 3FY7A 1ZGNA 3KMNA 1GSEA 2DSAA 4ACSA 2WVZA 3R2QA 4YQMA 1IYHA 3IK9A 3HKRA 5J40A 3VI5A 4E8EA 1K0MA 4OFMA 5LD0A 5A1NB 4YH2A 2HRKB 3CSJA 4ZXGA 5BMUB 2LJRA 1DUGA 3GURA 4EDZA 4ZB8A 4KAEA 20GSA 4ECJA 5F05A 10GSA 1Y1UA 3C8EA 5ECKB 2C8UA 5ECPB 4Q5RA 6GSVA 1N25A 1EV9A 5ELAA 4G0LA 5EY6A 5AISA 4HOJA 4CHSA 4RI6A 2R5GA 2J9HA 1UA5A 1GWCA 4GSNA 4GLTA 5ECNB 4MF6A 4YQUA 3P90A 5J41A 2C4JA 1SVLA 2JL4A 2WRTA 5GZZB 2GSQA 3KTLA 5D73A 3EE2A 3GUSA 1RK4A 2VCWA 1VF4A 5JCUA 11GSA 1GTUA 1K0BA 1FW1A 2D2ZA 2HRAA 5DALA 3RGBC 3Q74A 4IW9A 4YAVA 5F8BA 3LYKA 1XW5A 1G7OA 1OKTA 3F6FA 4NHWA 5ECHB 3HJOA 1LBKA 2CAIA 3RFRC 6GSUA 3LYPA 1Z9HA 1F3AA 5AN1A 2PGTA 2WB9A 4TOPA 1BYEA 4L5OA 5G5FA 4QMKA 3UBLA 1S4BP 2WJUA 1MD3A 1GNWA 2NTOA 2WW1A 4IQ1A 5A4VA 3UARA 3GSTA 3HJMA 1Y6EA 1PKZA 6GSYA 1OE7A 1JLVA 3LXTA 1PA3A 1R5AA 1GUKA 3IBHA 4KDUA 3VI7A 1XW6A 4USSA 1G6YA 2CZ3A 2C3TA 2F8FA 4KH7A 4KDYA 5AIVA 4PI0C 1AQXA 1IYIA 3NIVA 5LCZA 2GTUA 4KE3A 1V2AA 4WR4A 3QAGA 3LFLA 4ZB9A 1PL1A 2AB6A 2VCXA 4Q5QA 4HI7A 5IQYA 1SVMA 2HRKA 1YQ1A 2GSRA 4DEJA 1GLQA 1Q4JA 4LMVA 2CZ2A 3HMJG 1SVOA 3KMOA 1GULA 3GH6A 4IELA 3FR3A 3I6AA 1V40A 2VO4A 3GX0A 3LSZA 2IMKA 5DAKB 2O36A 4I97A 1YVLA 1PD21 19GSA 1U3IA 2CVDA 4PGTA 4GCIA 3VLNA 1B4PA 3IK7A 5F0GA 1AXDA 1TDIA 4KDXA 1TXUA 1I1IP 5ECLB 1B8XA 2OT3A 4E68A 2AHEA 3CRUA 4PNGA 4ECCA 4ECIA 4HZ4A 5DDLA 3LJRA 2GDRA 4KGIA 4IGJA 3PR8A 4K0NA 2X64A 2O5VA 4GSTA 2IL3A 4PHZC 1USBA 1OE8A 1MD4A 4PURA 5A5HA 1PL2A 3G7IA 1AW9A 4RI7A 1K0AA 1TW9A 1G6WA 1LJRA 4HZ2A 3WD6A 5FT3A 1YDKA 1M9BA 3QAVA 3KXOA 1EOGA 5J4UA 2FHEA 2HSNB 5ELGA 5G5EA 4IQAA 1GSDA 1YY7A 5ECQB 1GLPA 3CRTA 4PNFA 5J4VA 4AKHA 2F3MA 4ZBAA 1E6BA 3FYGA 4ID0A 3ZMLA 4Q5NA 5GSSA 2AAWA 3M8NA 1N2AA 2WZSA 4O7HA 4FXYP 3MDKA 3UAPA 2PVQA 1VF3A 2OACA 5A5HB 4E8HA 3ZFBA 2CAQA 4F03A 16GSA 2HSMA 1ML6A 4PQHA 6GSWA 1PKWA 2C3QA 4G0KA 1K0NA 5ECRB 1K0DA 4OMVA 5DAKA 4YQVA 1M0UA 3L0HA 4ECBA 3VWXA 3D0ZA 3TU3B 4YAPA 1HNCA 1A0FA 5ECOB 1PX6A 3TOTA 4Q5FA 4ZBBA 1GTIA 1B48A 1AQWA 4IVFA 2FNOA 4PTSA 2VCZA 1GUHA 3F6DA 3LQ7A 2WW3A 3LXZA 1XWKA 1PMTA 1GTAA 3M1GA 5AGYA 2YCDA 1EV4A 2V6KA 5DQSA 4EE0A 3O76A 3W8SA 2EFEA 3CWGA 3F63A 3UBKA 2R6KA 4N3ZA 2HSMB 1TU8A 4NAXA 3CBUA 2ON7A 1F3BA 1BG1A 4OFNA 5A34A 3Q19A 4IKHA 2OADA 2C3NA 4IBPA 2EFCA 2WVYA 1K3YA 3RBTA 3KJYA 4EDYA 4BVXB 5AIXA 1F2EA 4L5LA 2GLRA 1M99A 3N9JA 5GSTA 3TGZA 4GDFA 3QR6A 1VF2A 2R4VA 1K3LA 3M3MA 5ECIB 4EC0A 4OFTA 5EVOA 3Q18A 5D9WA 4PX1A 2HSNA 5HFKA 4ZBDA 4F0BA 5FWGA 4L8EA 4W66A 1U87A 2CA8A 3ZFLA 6GSSA 4IJIA 1U88A 5EL8A 3VPQA 5A4UA
chains in the Genus database with same CATH topology
4BL7A 5J47A 3VURA 5A34B 1JLWA 4KF9A 1GSUA 3G7JA 4GF0A 5DJMA 1YKCA 1TU7A 3P8WA 5B7CA 3GTUB 4EXJA 3ISOA 5A5KA 2GSTA 2VD0A 2R3XA 3U6VA 3FR9A 2VD1A 6GSTA 2OA7A 1K0OA 4PQIA 4F0CA 1HQOA 3WYWA 5F06A 4JEDA 1PGTA 3IR4A 1PN9A 2ON5A 5FHIA 4BVYB 1FHEA 5ECMB 4N0VA 1MTCA 1BX9A 2WDUA 4O92A 17GSA 3PPUA 3ZMKA 3FRCA 5D9VA 3FR6A 1K3OA 1ZL9A 4ISDA 4KSMA 4BL7B 3SWLA 3BBYA 4WR5A 2A2RA 2VCVA 2PMTA 1KBNA 4MK3A 4J2FA 4AKIA 1NHYA 2YV9A 2HNLA 4MPFA 4PXOA 1GUMA 1VF1A 3I69A 4GTUA 2PERA 3VK9A 13GSA 1JZRA 2UZ8A 5JCWA 3R3EA 4BVXA 4ZB7A 1AQVA 3N5OA 4IS0A 4PUAA 2N5FA 3IC8A 4MF5A 1BG5A 3DGQA 1OYJA 3KM6A 3QAWA 3DD3A 3O3TA 4G0IA 1BF5A 3CSHA 4NHZA 2DC5A 18GSA 3EINA 1GSSA 4G19A 4AGSA 1GSQA 3VPTA 3UVHA 1C72A 2YV7A 4MDCA 2VCTA 5J4YA 5A4WA 9GSSA 6GSXA 5D9XA 4AKGA 2A2SA 2GSSA 3AY8A 3LG6A 14GSA 4QQ7A 22GSA 2UV8G 1HNAA 4JZQA 5DALB 1GNEA 1PX7A 2PBJA 1GSFA 3GSSA 3IE3A 7GSSA 4AKXB 4GSSA 3M0FA 4MPGA 4MZWA 12GSA 4KX4A 5DCGA 1EEMA 3ERGA 1M9AA 3MAKA 1HNBA 5A1NA 1YJ6A 2WS2A 4G9HA 3GTUA 5ECSA 5D9TA 5KEJA 1GTBA 5BMUA 4ZB6A 3ERFA 2VCQA 1K0CA 5J5NA 3CSIA 1BAYA 2H1LA 2IMIA 4JBBA 4MP4A 2HQTA 1EOHA 4BVYA 2EFHA 4MF7A 4AI6A 2C80A 8GSSA 3TOUA 1GSYA 4G10A 3PGTA 2EFDA 4HJ2A 4LMWA 4G01A 5DJLA 3H1NA 4K0GA 1XWGA 2VKZG 4FQUA 5F07A 3FY7A 1ZGNA 3KMNA 1GSEA 2DSAA 4ACSA 3R2QA 4YQMA 1IYHA 3IK9A 3HKRA 5J40A 3VI5A 4E8EA 1K0MA 4OFMA 5LD0A 5A1NB 4YH2A 2HRKB 3CSJA 4ZXGA 5BMUB 2LJRA 1DUGA 3GURA 4EDZA 4ZB8A 4KAEA 20GSA 4ECJA 5F05A 10GSA 1Y1UA 3C8EA 5ECKB 2C8UA 5ECPB 4Q5RA 6GSVA 1N25A 1EV9A 5ELAA 4G0LA 5EY6A 5AISA 4HOJA 4CHSA 4RI6A 2R5GA 2J9HA 1UA5A 1GWCA 4GSNA 4GLTA 5ECNB 4MF6A 4YQUA 3P90A 5J41A 2C4JA 1SVLA 2JL4A 2WRTA 5GZZB 2GSQA 3KTLA 5D73A 3EE2A 3GUSA 1RK4A 2VCWA 1VF4A 5JCUA 11GSA 1GTUA 1K0BA 1FW1A 2D2ZA 2HRAA 5DALA 3Q74A 4IW9A 4YAVA 5F8BA 3LYKA 1XW5A 1G7OA 1OKTA 3F6FA 4NHWA 5ECHB 3HJOA 1LBKA 2CAIA 6GSUA 3LYPA 1Z9HA 1F3AA 5AN1A 2PGTA 2WB9A 4TOPA 1BYEA 4L5OA 5G5FA 4QMKA 3UBLA 2WJUA 1MD3A 1GNWA 2NTOA 4IQ1A 5A4VA 3UARA 3GSTA 3HJMA 1Y6EA 1PKZA 6GSYA 1OE7A 1JLVA 3LXTA 1PA3A 1R5AA 1GUKA 3IBHA 4KDUA 3VI7A 1XW6A 4USSA 1G6YA 2CZ3A 2C3TA 2F8FA 4KH7A 4KDYA 5AIVA 1AQXA 1IYIA 3NIVA 5LCZA 2GTUA 4KE3A 1V2AA 4WR4A 3QAGA 3LFLA 4ZB9A 1PL1A 2AB6A 2VCXA 4Q5QA 4HI7A 5IQYA 1SVMA 2HRKA 1YQ1A 2GSRA 4DEJA 1GLQA 1Q4JA 4LMVA 2CZ2A 3HMJG 1SVOA 3KMOA 1GULA 3GH6A 4IELA 3FR3A 3I6AA 1V40A 2VO4A 3GX0A 3LSZA 2IMKA 5DAKB 4I97A 1YVLA 1PD21 19GSA 1U3IA 2CVDA 4PGTA 4GCIA 3VLNA 1B4PA 3IK7A 5F0GA 1AXDA 1TDIA 4KDXA 1TXUA 5ECLB 1B8XA 2OT3A 4E68A 2AHEA 3CRUA 4PNGA 4ECCA 4ECIA 4HZ4A 5DDLA 3LJRA 2GDRA 4KGIA 4IGJA 3PR8A 4K0NA 2X64A 2O5VA 4GSTA 2IL3A 1USBA 1OE8A 1MD4A 4PURA 5A5HA 1PL2A 3G7IA 1AW9A 4RI7A 1K0AA 1TW9A 1G6WA 1LJRA 4HZ2A 3WD6A 5FT3A 1YDKA 1M9BA 3QAVA 3KXOA 1EOGA 5J4UA 2FHEA 2HSNB 5ELGA 5G5EA 4IQAA 1GSDA 1YY7A 5ECQB 1GLPA 3CRTA 4PNFA 5J4VA 4AKHA 2F3MA 4ZBAA 1E6BA 3FYGA 4ID0A 3ZMLA 4Q5NA 5GSSA 2AAWA 3M8NA 1N2AA 4O7HA 3MDKA 3UAPA 2PVQA 1VF3A 2OACA 5A5HB 4E8HA 3ZFBA 2CAQA 4F03A 16GSA 2HSMA 1ML6A 4PQHA 6GSWA 1PKWA 2C3QA 4G0KA 1K0NA 5ECRB 1K0DA 4OMVA 5DAKA 4YQVA 1M0UA 3L0HA 4ECBA 3VWXA 3D0ZA 3TU3B 4YAPA 1HNCA 1A0FA 5ECOB 1PX6A 3TOTA 4Q5FA 4ZBBA 1GTIA 1B48A 1AQWA 4IVFA 2FNOA 4PTSA 2VCZA 1GUHA 3F6DA 3LQ7A 3LXZA 1XWKA 1PMTA 1GTAA 3M1GA 5AGYA 2YCDA 1EV4A 2V6KA 5DQSA 4EE0A 3O76A 3W8SA 2EFEA 3CWGA 3F63A 3UBKA 2R6KA 4N3ZA 2HSMB 1TU8A 4NAXA 3CBUA 2ON7A 1F3BA 1BG1A 4OFNA 5A34A 3Q19A 4IKHA 2OADA 2C3NA 4IBPA 2EFCA 1K3YA 3RBTA 3KJYA 4EDYA 4BVXB 5AIXA 1F2EA 4L5LA 2GLRA 1M99A 3N9JA 5GSTA 3TGZA 4GDFA 3QR6A 1VF2A 2R4VA 1K3LA 3M3MA 5ECIB 4EC0A 4OFTA 5EVOA 3Q18A 5D9WA 4PX1A 2HSNA 5HFKA 4ZBDA 4F0BA 5FWGA 4L8EA 4W66A 1U87A 2CA8A 3ZFLA 6GSSA 4IJIA 1U88A 5EL8A 3VPQA 5A4UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BL7 A;  3VUR A;  1JLW A;  4KF9 A;  1GSU A;  3G7J A;  4GF0 A;  5DJM A;  1YKC A;  1TU7 A;  3P8W A;  5B7C A;  3GTU B;  4EXJ A;  3ISO A;  5A5K A;  2GST A;  2VD0 A;  2R3X A;  3U6V A;  3FR9 A;  2VD1 A;  6GST A;  2OA7 A;  1K0O A;  4PQI A;  4F0C A;  1HQO A;  3WYW A;  5F06 A;  4JED A;  1PGT A;  3IR4 A;  1PN9 A;  2ON5 A;  5FHI A;  4BVY B;  1FHE A;  5ECM B;  4N0V A;  1MTC A;  1BX9 A;  2WDU A;  4O92 A;  17GS A;  3PPU A;  3ZMK A;  3FRC A;  5D9V A;  3FR6 A;  1K3O A;  1ZL9 A;  4ISD A;  4KSM A;  4BL7 B;  3SWL A;  3BBY A;  4WR5 A;  2A2R A;  2VCV A;  2PMT A;  1KBN A;  4MK3 A;  4J2F A;  1NHY A;  2YV9 A;  2HNL A;  4MPF A;  4PXO A;  1GUM A;  1VF1 A;  3I69 A;  4GTU A;  2PER A;  3VK9 A;  13GS A;  1JZR A;  2UZ8 A;  5JCW A;  3R3E A;  4BVX A;  1AQV A;  3N5O A;  4IS0 A;  4PUA A;  2N5F A;  3IC8 A;  4MF5 A;  1BG5 A;  3DGQ A;  1OYJ A;  3KM6 A;  3QAW A;  3DD3 A;  3O3T A;  4G0I A;  3CSH A;  4NHZ A;  2DC5 A;  4G19 A;  18GS A;  1GSS A;  3EIN A;  4AGS A;  1GSQ A;  3VPT A;  3UVH A;  1C72 A;  2YV7 A;  4MDC A;  2VCT A;  5A4W A;  9GSS A;  6GSX A;  5D9X A;  2A2S A;  2GSS A;  3AY8 A;  3LG6 A;  14GS A;  4QQ7 A;  22GS A;  5DAL B;  1HNA A;  4JZQ A;  1GNE A;  1PX7 A;  2PBJ A;  1GSF A;  3GSS A;  3IE3 A;  7GSS A;  4GSS A;  3M0F A;  4MPG A;  4MZW A;  12GS A;  4KX4 A;  5DCG A;  1EEM A;  3ERG A;  1M9A A;  3MAK A;  1HNB A;  1YJ6 A;  2WS2 A;  4G9H A;  3GTU A;  5ECS A;  5D9T A;  5KEJ A;  1GTB A;  5BMU A;  4ZB6 A;  3ERF A;  2VCQ A;  1K0C A;  5J5N A;  3CSI A;  1BAY A;  2IMI A;  4JBB A;  4MP4 A;  2HQT A;  1EOH A;  4BVY A;  4MF7 A;  2C80 A;  8GSS A;  3TOU A;  1GSY A;  4G10 A;  3PGT A;  4HJ2 A;  4LMW A;  5DJL A;  3H1N A;  4K0G A;  1XWG A;  4FQU A;  5F07 A;  3FY7 A;  1ZGN A;  3KMN A;  1GSE A;  2DSA A;  4ACS A;  3R2Q A;  4YQM A;  1IYH A;  3IK9 A;  3HKR A;  3VI5 A;  4E8E A;  1K0M A;  4OFM A;  5LD0 A;  4YH2 A;  2HRK B;  3CSJ A;  4ZXG A;  2LJR A;  1DUG A;  3GUR A;  4EDZ A;  4ZB8 A;  4KAE A;  20GS A;  4ECJ A;  5F05 A;  10GS A;  3C8E A;  5ECK B;  2C8U A;  5ECP B;  4Q5R A;  6GSV A;  1EV9 A;  5ELA A;  4G0L A;  5EY6 A;  5AIS A;  4HOJ A;  4CHS A;  4RI6 A;  2R5G A;  2J9H A;  1UA5 A;  1GWC A;  4GSN A;  4GLT A;  5ECN B;  4MF6 A;  4YQU A;  3P90 A;  5J41 A;  2C4J A;  2JL4 A;  2WRT A;  5GZZ B;  2GSQ A;  3KTL A;  5D73 A;  3EE2 A;  3GUS A;  1RK4 A;  2VCW A;  1VF4 A;  5JCU A;  11GS A;  1GTU A;  1K0B A;  1FW1 A;  2D2Z A;  2HRA A;  5DAL A;  3Q74 A;  4IW9 A;  4YAV A;  5F8B A;  3LYK A;  1XW5 A;  1G7O A;  1OKT A;  3F6F A;  4NHW A;  5ECH B;  3HJO A;  1LBK A;  2CAI A;  6GSU A;  3LYP A;  1Z9H A;  1F3A A;  5AN1 A;  2PGT A;  2WB9 A;  4TOP A;  1BYE A;  4L5O A;  5G5F A;  3UBL A;  2WJU A;  1MD3 A;  1GNW A;  2NTO A;  4IQ1 A;  5A4V A;  3UAR A;  3GST A;  3HJM A;  1Y6E A;  1PKZ A;  6GSY A;  1OE7 A;  1JLV A;  3LXT A;  1PA3 A;  1R5A A;  1GUK A;  3IBH A;  4KDU A;  3VI7 A;  1XW6 A;  4USS A;  1G6Y A;  2CZ3 A;  2C3T A;  2F8F A;  4KH7 A;  4KDY A;  5AIV A;  1AQX A;  1IYI A;  3NIV A;  5LCZ A;  2GTU A;  4KE3 A;  1V2A A;  4WR4 A;  3QAG A;  3LFL A;  4ZB9 A;  1PL1 A;  2AB6 A;  2VCX A;  4Q5Q A;  4HI7 A;  5IQY A;  2HRK A;  1YQ1 A;  2GSR A;  4DEJ A;  1GLQ A;  1Q4J A;  4LMV A;  2CZ2 A;  3KMO A;  1GUL A;  3GH6 A;  4IEL A;  3FR3 A;  3I6A A;  1V40 A;  2VO4 A;  3GX0 A;  3LSZ A;  2IMK A;  5DAK B;  4I97 A;  1PD2 1;  19GS A;  1U3I A;  2CVD A;  4PGT A;  4GCI A;  3VLN A;  1B4P A;  3IK7 A;  5F0G A;  1AXD A;  1TDI A;  4KDX A;  5ECL B;  1B8X A;  2AHE A;  3CRU A;  4PNG A;  4ECC A;  4ECI A;  4HZ4 A;  5DDL A;  3LJR A;  2GDR A;  4KGI A;  4IGJ A;  3PR8 A;  4K0N A;  2X64 A;  4GST A;  2IL3 A;  1USB A;  1OE8 A;  1MD4 A;  4PUR A;  1PL2 A;  3G7I A;  1AW9 A;  4RI7 A;  1K0A A;  1TW9 A;  1G6W A;  1LJR A;  4HZ2 A;  3WD6 A;  5FT3 A;  1YDK A;  1M9B A;  3QAV A;  3KXO A;  1EOG A;  5J4U A;  2FHE A;  2HSN B;  5ELG A;  5G5E A;  4IQA A;  1GSD A;  1YY7 A;  5ECQ B;  1GLP A;  3CRT A;  4PNF A;  2F3M A;  4ZBA A;  1E6B A;  3FYG A;  4ID0 A;  3ZML A;  4Q5N A;  5GSS A;  2AAW A;  3M8N A;  1N2A A;  4O7H A;  3MDK A;  3UAP A;  2PVQ A;  1VF3 A;  2OAC A;  4E8H A;  3ZFB A;  2CAQ A;  4F03 A;  16GS A;  2HSM A;  1ML6 A;  4PQH A;  6GSW A;  1PKW A;  2C3Q A;  4G0K A;  1K0N A;  5ECR B;  1K0D A;  4OMV A;  5DAK A;  4YQV A;  1M0U A;  3L0H A;  4ECB A;  3VWX A;  3D0Z A;  4YAP A;  1HNC A;  1A0F A;  5ECO B;  1PX6 A;  3TOT A;  4Q5F A;  4ZBB A;  1GTI A;  1B48 A;  1AQW A;  4IVF A;  2FNO A;  4PTS A;  2VCZ A;  1GUH A;  3F6D A;  3LQ7 A;  3LXZ A;  1XWK A;  1PMT A;  1GTA A;  3M1G A;  5AGY A;  2YCD A;  1EV4 A;  2V6K A;  5DQS A;  4EE0 A;  3O76 A;  3W8S A;  3F63 A;  3UBK A;  2R6K A;  2HSM B;  1TU8 A;  4NAX A;  3CBU A;  2ON7 A;  1F3B A;  4OFN A;  3Q19 A;  4IKH A;  2OAD A;  2C3N A;  4IBP A;  1K3Y A;  3RBT A;  3KJY A;  4EDY A;  4BVX B;  5AIX A;  1F2E A;  4L5L A;  2GLR A;  1M99 A;  3N9J A;  5GST A;  3TGZ A;  3QR6 A;  1VF2 A;  2R4V A;  1K3L A;  3M3M A;  5ECI B;  4EC0 A;  4OFT A;  5EVO A;  3Q18 A;  5D9W A;  4PX1 A;  5HFK A;  4ZBD A;  4F0B A;  5FWG A;  4L8E A;  1U87 A;  2CA8 A;  3ZFL A;  6GSS A;  4IJI A;  1U88 A;  5EL8 A;  3VPQ A;  5A4U A; 
#chains in the Genus database with same CATH topology
 4BL7 A;  5J47 A;  3VUR A;  5A34 B;  1JLW A;  4KF9 A;  1GSU A;  3G7J A;  4GF0 A;  5DJM A;  1YKC A;  1TU7 A;  3P8W A;  5B7C A;  3GTU B;  4EXJ A;  3ISO A;  5A5K A;  2GST A;  2VD0 A;  2R3X A;  3U6V A;  3FR9 A;  2VD1 A;  6GST A;  2OA7 A;  1K0O A;  4PQI A;  4F0C A;  1HQO A;  2WVX B;  3WYW A;  5F06 A;  4JED A;  1PGT A;  3IR4 A;  1PN9 A;  2ON5 A;  5FHI A;  4BVY B;  2WW2 A;  1FHE A;  5ECM B;  4N0V A;  1MTC A;  1BX9 A;  4PI2 C;  2WDU A;  4O92 A;  17GS A;  3PPU A;  3ZMK A;  3FRC A;  5D9V A;  3FR6 A;  1K3O A;  3CHX C;  1ZL9 A;  4ISD A;  4KSM A;  4BL7 B;  3SWL A;  3BBY A;  4WR5 A;  2A2R A;  2VCV A;  2PMT A;  1KBN A;  4MK3 A;  4J2F A;  4AKI A;  1NHY A;  1YEW C;  2YV9 A;  2HNL A;  4MPF A;  4PXO A;  1GUM A;  1VF1 A;  3I69 A;  4GTU A;  2PER A;  3VK9 A;  13GS A;  1JZR A;  2UZ8 A;  5JCW A;  3R3E A;  4BVX A;  4ZB7 A;  1AQV A;  3N5O A;  4IS0 A;  4PUA A;  2N5F A;  3IC8 A;  4MF5 A;  1BG5 A;  3DGQ A;  1OYJ A;  3KM6 A;  3QAW A;  3DD3 A;  3O3T A;  4G0I A;  1BF5 A;  3CSH A;  4NHZ A;  2DC5 A;  18GS A;  3EIN A;  1GSS A;  4G19 A;  4AGS A;  1GSQ A;  3VPT A;  3UVH A;  2O3E A;  1C72 A;  2YV7 A;  4MDC A;  2VCT A;  5J4Y A;  5A4W A;  9GSS A;  6GSX A;  5D9X A;  4AKG A;  2A2S A;  2GSS A;  3AY8 A;  3LG6 A;  14GS A;  4QQ7 A;  22GS A;  2UV8 G;  1HNA A;  4JZQ A;  5DAL B;  1GNE A;  1PX7 A;  2PBJ A;  1GSF A;  3GSS A;  3IE3 A;  7GSS A;  4AKX B;  4GSS A;  3M0F A;  4MPG A;  4MZW A;  12GS A;  4KX4 A;  5DCG A;  1EEM A;  3ERG A;  1M9A A;  3MAK A;  1HNB A;  5A1N A;  1YJ6 A;  2WS2 A;  4G9H A;  3GTU A;  5ECS A;  5D9T A;  2WW0 A;  5KEJ A;  1GTB A;  5BMU A;  4ZB6 A;  3ERF A;  2VCQ A;  1K0C A;  5J5N A;  3CSI A;  2WVX A;  1BAY A;  2H1L A;  2IMI A;  4JBB A;  4MP4 A;  2HQT A;  1EOH A;  4BVY A;  2EFH A;  4MF7 A;  4AI6 A;  2C80 A;  8GSS A;  3TOU A;  1GSY A;  4G10 A;  3PGT A;  2EFD A;  4HJ2 A;  4LMW A;  4G01 A;  5DJL A;  3H1N A;  4K0G A;  1XWG A;  2VKZ G;  4FQU A;  5F07 A;  3FY7 A;  1ZGN A;  3KMN A;  1GSE A;  2DSA A;  4ACS A;  2WVZ A;  3R2Q A;  4YQM A;  1IYH A;  3IK9 A;  3HKR A;  5J40 A;  3VI5 A;  4E8E A;  1K0M A;  4OFM A;  5LD0 A;  5A1N B;  4YH2 A;  2HRK B;  3CSJ A;  4ZXG A;  5BMU B;  2LJR A;  1DUG A;  3GUR A;  4EDZ A;  4ZB8 A;  4KAE A;  20GS A;  4ECJ A;  5F05 A;  10GS A;  1Y1U A;  3C8E A;  5ECK B;  2C8U A;  5ECP B;  4Q5R A;  6GSV A;  1N25 A;  1EV9 A;  5ELA A;  4G0L A;  5EY6 A;  5AIS A;  4HOJ A;  4CHS A;  4RI6 A;  2R5G A;  2J9H A;  1UA5 A;  1GWC A;  4GSN A;  4GLT A;  5ECN B;  4MF6 A;  4YQU A;  3P90 A;  5J41 A;  2C4J A;  1SVL A;  2JL4 A;  2WRT A;  5GZZ B;  2GSQ A;  3KTL A;  5D73 A;  3EE2 A;  3GUS A;  1RK4 A;  2VCW A;  1VF4 A;  5JCU A;  11GS A;  1GTU A;  1K0B A;  1FW1 A;  2D2Z A;  2HRA A;  5DAL A;  3RGB C;  3Q74 A;  4IW9 A;  4YAV A;  5F8B A;  3LYK A;  1XW5 A;  1G7O A;  1OKT A;  3F6F A;  4NHW A;  5ECH B;  3HJO A;  1LBK A;  2CAI A;  3RFR C;  6GSU A;  3LYP A;  1Z9H A;  1F3A A;  5AN1 A;  2PGT A;  2WB9 A;  4TOP A;  1BYE A;  4L5O A;  5G5F A;  4QMK A;  3UBL A;  1S4B P;  2WJU A;  1MD3 A;  1GNW A;  2NTO A;  2WW1 A;  4IQ1 A;  5A4V A;  3UAR A;  3GST A;  3HJM A;  1Y6E A;  1PKZ A;  6GSY A;  1OE7 A;  1JLV A;  3LXT A;  1PA3 A;  1R5A A;  1GUK A;  3IBH A;  4KDU A;  3VI7 A;  1XW6 A;  4USS A;  1G6Y A;  2CZ3 A;  2C3T A;  2F8F A;  4KH7 A;  4KDY A;  5AIV A;  4PI0 C;  1AQX A;  1IYI A;  3NIV A;  5LCZ A;  2GTU A;  4KE3 A;  1V2A A;  4WR4 A;  3QAG A;  3LFL A;  4ZB9 A;  1PL1 A;  2AB6 A;  2VCX A;  4Q5Q A;  4HI7 A;  5IQY A;  1SVM A;  2HRK A;  1YQ1 A;  2GSR A;  4DEJ A;  1GLQ A;  1Q4J A;  4LMV A;  2CZ2 A;  3HMJ G;  1SVO A;  3KMO A;  1GUL A;  3GH6 A;  4IEL A;  3FR3 A;  3I6A A;  1V40 A;  2VO4 A;  3GX0 A;  3LSZ A;  2IMK A;  5DAK B;  2O36 A;  4I97 A;  1YVL A;  1PD2 1;  19GS A;  1U3I A;  2CVD A;  4PGT A;  4GCI A;  3VLN A;  1B4P A;  3IK7 A;  5F0G A;  1AXD A;  1TDI A;  4KDX A;  1TXU A;  1I1I P;  5ECL B;  1B8X A;  2OT3 A;  4E68 A;  2AHE A;  3CRU A;  4PNG A;  4ECC A;  4ECI A;  4HZ4 A;  5DDL A;  3LJR A;  2GDR A;  4KGI A;  4IGJ A;  3PR8 A;  4K0N A;  2X64 A;  2O5V A;  4GST A;  2IL3 A;  4PHZ C;  1USB A;  1OE8 A;  1MD4 A;  4PUR A;  5A5H A;  1PL2 A;  3G7I A;  1AW9 A;  4RI7 A;  1K0A A;  1TW9 A;  1G6W A;  1LJR A;  4HZ2 A;  3WD6 A;  5FT3 A;  1YDK A;  1M9B A;  3QAV A;  3KXO A;  1EOG A;  5J4U A;  2FHE A;  2HSN B;  5ELG A;  5G5E A;  4IQA A;  1GSD A;  1YY7 A;  5ECQ B;  1GLP A;  3CRT A;  4PNF A;  5J4V A;  4AKH A;  2F3M A;  4ZBA A;  1E6B A;  3FYG A;  4ID0 A;  3ZML A;  4Q5N A;  5GSS A;  2AAW A;  3M8N A;  1N2A A;  2WZS A;  4O7H A;  4FXY P;  3MDK A;  3UAP A;  2PVQ A;  1VF3 A;  2OAC A;  5A5H B;  4E8H A;  3ZFB A;  2CAQ A;  4F03 A;  16GS A;  2HSM A;  1ML6 A;  4PQH A;  6GSW A;  1PKW A;  2C3Q A;  4G0K A;  1K0N A;  5ECR B;  1K0D A;  4OMV A;  5DAK A;  4YQV A;  1M0U A;  3L0H A;  4ECB A;  3VWX A;  3D0Z A;  3TU3 B;  4YAP A;  1HNC A;  1A0F A;  5ECO B;  1PX6 A;  3TOT A;  4Q5F A;  4ZBB A;  1GTI A;  1B48 A;  1AQW A;  4IVF A;  2FNO A;  4PTS A;  2VCZ A;  1GUH A;  3F6D A;  3LQ7 A;  2WW3 A;  3LXZ A;  1XWK A;  1PMT A;  1GTA A;  3M1G A;  5AGY A;  2YCD A;  1EV4 A;  2V6K A;  5DQS A;  4EE0 A;  3O76 A;  3W8S A;  2EFE A;  3CWG A;  3F63 A;  3UBK A;  2R6K A;  4N3Z A;  2HSM B;  1TU8 A;  4NAX A;  3CBU A;  2ON7 A;  1F3B A;  1BG1 A;  4OFN A;  5A34 A;  3Q19 A;  4IKH A;  2OAD A;  2C3N A;  4IBP A;  2EFC A;  2WVY A;  1K3Y A;  3RBT A;  3KJY A;  4EDY A;  4BVX B;  5AIX A;  1F2E A;  4L5L A;  2GLR A;  1M99 A;  3N9J A;  5GST A;  3TGZ A;  4GDF A;  3QR6 A;  1VF2 A;  2R4V A;  1K3L A;  3M3M A;  5ECI B;  4EC0 A;  4OFT A;  5EVO A;  3Q18 A;  5D9W A;  4PX1 A;  2HSN A;  5HFK A;  4ZBD A;  4F0B A;  5FWG A;  4L8E A;  4W66 A;  1U87 A;  2CA8 A;  3ZFL A;  6GSS A;  4IJI A;  1U88 A;  5EL8 A;  3VPQ A;  5A4U A; 
#chains in the Genus database with same CATH homology
 4BL7 A;  5J47 A;  3VUR A;  5A34 B;  1JLW A;  4KF9 A;  1GSU A;  3G7J A;  4GF0 A;  5DJM A;  1YKC A;  1TU7 A;  3P8W A;  5B7C A;  3GTU B;  4EXJ A;  3ISO A;  5A5K A;  2GST A;  2VD0 A;  2R3X A;  3U6V A;  3FR9 A;  2VD1 A;  6GST A;  2OA7 A;  1K0O A;  4PQI A;  4F0C A;  1HQO A;  3WYW A;  5F06 A;  4JED A;  1PGT A;  3IR4 A;  1PN9 A;  2ON5 A;  5FHI A;  4BVY B;  1FHE A;  5ECM B;  4N0V A;  1MTC A;  1BX9 A;  2WDU A;  4O92 A;  17GS A;  3PPU A;  3ZMK A;  3FRC A;  5D9V A;  3FR6 A;  1K3O A;  1ZL9 A;  4ISD A;  4KSM A;  4BL7 B;  3SWL A;  3BBY A;  4WR5 A;  2A2R A;  2VCV A;  2PMT A;  1KBN A;  4MK3 A;  4J2F A;  4AKI A;  1NHY A;  2YV9 A;  2HNL A;  4MPF A;  4PXO A;  1GUM A;  1VF1 A;  3I69 A;  4GTU A;  2PER A;  3VK9 A;  13GS A;  1JZR A;  2UZ8 A;  5JCW A;  3R3E A;  4BVX A;  4ZB7 A;  1AQV A;  3N5O A;  4IS0 A;  4PUA A;  2N5F A;  3IC8 A;  4MF5 A;  1BG5 A;  3DGQ A;  1OYJ A;  3KM6 A;  3QAW A;  3DD3 A;  3O3T A;  4G0I A;  1BF5 A;  3CSH A;  4NHZ A;  2DC5 A;  18GS A;  3EIN A;  1GSS A;  4G19 A;  4AGS A;  1GSQ A;  3VPT A;  3UVH A;  1C72 A;  2YV7 A;  4MDC A;  2VCT A;  5J4Y A;  5A4W A;  9GSS A;  6GSX A;  5D9X A;  4AKG A;  2A2S A;  2GSS A;  3AY8 A;  3LG6 A;  14GS A;  4QQ7 A;  22GS A;  2UV8 G;  1HNA A;  4JZQ A;  5DAL B;  1GNE A;  1PX7 A;  2PBJ A;  1GSF A;  3GSS A;  3IE3 A;  7GSS A;  4AKX B;  4GSS A;  3M0F A;  4MPG A;  4MZW A;  12GS A;  4KX4 A;  5DCG A;  1EEM A;  3ERG A;  1M9A A;  3MAK A;  1HNB A;  5A1N A;  1YJ6 A;  2WS2 A;  4G9H A;  3GTU A;  5ECS A;  5D9T A;  5KEJ A;  1GTB A;  5BMU A;  4ZB6 A;  3ERF A;  2VCQ A;  1K0C A;  5J5N A;  3CSI A;  1BAY A;  2H1L A;  2IMI A;  4JBB A;  4MP4 A;  2HQT A;  1EOH A;  4BVY A;  2EFH A;  4MF7 A;  4AI6 A;  2C80 A;  8GSS A;  3TOU A;  1GSY A;  4G10 A;  3PGT A;  2EFD A;  4HJ2 A;  4LMW A;  4G01 A;  5DJL A;  3H1N A;  4K0G A;  1XWG A;  2VKZ G;  4FQU A;  5F07 A;  3FY7 A;  1ZGN A;  3KMN A;  1GSE A;  2DSA A;  4ACS A;  3R2Q A;  4YQM A;  1IYH A;  3IK9 A;  3HKR A;  5J40 A;  3VI5 A;  4E8E A;  1K0M A;  4OFM A;  5LD0 A;  5A1N B;  4YH2 A;  2HRK B;  3CSJ A;  4ZXG A;  5BMU B;  2LJR A;  1DUG A;  3GUR A;  4EDZ A;  4ZB8 A;  4KAE A;  20GS A;  4ECJ A;  5F05 A;  10GS A;  1Y1U A;  3C8E A;  5ECK B;  2C8U A;  5ECP B;  4Q5R A;  6GSV A;  1N25 A;  1EV9 A;  5ELA A;  4G0L A;  5EY6 A;  5AIS A;  4HOJ A;  4CHS A;  4RI6 A;  2R5G A;  2J9H A;  1UA5 A;  1GWC A;  4GSN A;  4GLT A;  5ECN B;  4MF6 A;  4YQU A;  3P90 A;  5J41 A;  2C4J A;  1SVL A;  2JL4 A;  2WRT A;  5GZZ B;  2GSQ A;  3KTL A;  5D73 A;  3EE2 A;  3GUS A;  1RK4 A;  2VCW A;  1VF4 A;  5JCU A;  11GS A;  1GTU A;  1K0B A;  1FW1 A;  2D2Z A;  2HRA A;  5DAL A;  3Q74 A;  4IW9 A;  4YAV A;  5F8B A;  3LYK A;  1XW5 A;  1G7O A;  1OKT A;  3F6F A;  4NHW A;  5ECH B;  3HJO A;  1LBK A;  2CAI A;  6GSU A;  3LYP A;  1Z9H A;  1F3A A;  5AN1 A;  2PGT A;  2WB9 A;  4TOP A;  1BYE A;  4L5O A;  5G5F A;  4QMK A;  3UBL A;  2WJU A;  1MD3 A;  1GNW A;  2NTO A;  4IQ1 A;  5A4V A;  3UAR A;  3GST A;  3HJM A;  1Y6E A;  1PKZ A;  6GSY A;  1OE7 A;  1JLV A;  3LXT A;  1PA3 A;  1R5A A;  1GUK A;  3IBH A;  4KDU A;  3VI7 A;  1XW6 A;  4USS A;  1G6Y A;  2CZ3 A;  2C3T A;  2F8F A;  4KH7 A;  4KDY A;  5AIV A;  1AQX A;  1IYI A;  3NIV A;  5LCZ A;  2GTU A;  4KE3 A;  1V2A A;  4WR4 A;  3QAG A;  3LFL A;  4ZB9 A;  1PL1 A;  2AB6 A;  2VCX A;  4Q5Q A;  4HI7 A;  5IQY A;  1SVM A;  2HRK A;  1YQ1 A;  2GSR A;  4DEJ A;  1GLQ A;  1Q4J A;  4LMV A;  2CZ2 A;  3HMJ G;  1SVO A;  3KMO A;  1GUL A;  3GH6 A;  4IEL A;  3FR3 A;  3I6A A;  1V40 A;  2VO4 A;  3GX0 A;  3LSZ A;  2IMK A;  5DAK B;  4I97 A;  1YVL A;  1PD2 1;  19GS A;  1U3I A;  2CVD A;  4PGT A;  4GCI A;  3VLN A;  1B4P A;  3IK7 A;  5F0G A;  1AXD A;  1TDI A;  4KDX A;  1TXU A;  5ECL B;  1B8X A;  2OT3 A;  4E68 A;  2AHE A;  3CRU A;  4PNG A;  4ECC A;  4ECI A;  4HZ4 A;  5DDL A;  3LJR A;  2GDR A;  4KGI A;  4IGJ A;  3PR8 A;  4K0N A;  2X64 A;  2O5V A;  4GST A;  2IL3 A;  1USB A;  1OE8 A;  1MD4 A;  4PUR A;  5A5H A;  1PL2 A;  3G7I A;  1AW9 A;  4RI7 A;  1K0A A;  1TW9 A;  1G6W A;  1LJR A;  4HZ2 A;  3WD6 A;  5FT3 A;  1YDK A;  1M9B A;  3QAV A;  3KXO A;  1EOG A;  5J4U A;  2FHE A;  2HSN B;  5ELG A;  5G5E A;  4IQA A;  1GSD A;  1YY7 A;  5ECQ B;  1GLP A;  3CRT A;  4PNF A;  5J4V A;  4AKH A;  2F3M A;  4ZBA A;  1E6B A;  3FYG A;  4ID0 A;  3ZML A;  4Q5N A;  5GSS A;  2AAW A;  3M8N A;  1N2A A;  4O7H A;  3MDK A;  3UAP A;  2PVQ A;  1VF3 A;  2OAC A;  5A5H B;  4E8H A;  3ZFB A;  2CAQ A;  4F03 A;  16GS A;  2HSM A;  1ML6 A;  4PQH A;  6GSW A;  1PKW A;  2C3Q A;  4G0K A;  1K0N A;  5ECR B;  1K0D A;  4OMV A;  5DAK A;  4YQV A;  1M0U A;  3L0H A;  4ECB A;  3VWX A;  3D0Z A;  3TU3 B;  4YAP A;  1HNC A;  1A0F A;  5ECO B;  1PX6 A;  3TOT A;  4Q5F A;  4ZBB A;  1GTI A;  1B48 A;  1AQW A;  4IVF A;  2FNO A;  4PTS A;  2VCZ A;  1GUH A;  3F6D A;  3LQ7 A;  3LXZ A;  1XWK A;  1PMT A;  1GTA A;  3M1G A;  5AGY A;  2YCD A;  1EV4 A;  2V6K A;  5DQS A;  4EE0 A;  3O76 A;  3W8S A;  2EFE A;  3CWG A;  3F63 A;  3UBK A;  2R6K A;  4N3Z A;  2HSM B;  1TU8 A;  4NAX A;  3CBU A;  2ON7 A;  1F3B A;  1BG1 A;  4OFN A;  5A34 A;  3Q19 A;  4IKH A;  2OAD A;  2C3N A;  4IBP A;  2EFC A;  1K3Y A;  3RBT A;  3KJY A;  4EDY A;  4BVX B;  5AIX A;  1F2E A;  4L5L A;  2GLR A;  1M99 A;  3N9J A;  5GST A;  3TGZ A;  4GDF A;  3QR6 A;  1VF2 A;  2R4V A;  1K3L A;  3M3M A;  5ECI B;  4EC0 A;  4OFT A;  5EVO A;  3Q18 A;  5D9W A;  4PX1 A;  2HSN A;  5HFK A;  4ZBD A;  4F0B A;  5FWG A;  4L8E A;  4W66 A;  1U87 A;  2CA8 A;  3ZFL A;  6GSS A;  4IJI A;  1U88 A;  5EL8 A;  3VPQ A;  5A4U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...