2HRKB

Structural basis of yeast aminoacyl-trna synthetase complex formation revealed by crystal structures of two binary sub-complexes
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
121
structure length
121
Chain Sequence
MSDLVTKFESLIISKYPVSFTKEQSAQAAQWESVLKSGQIQPHLDQLNLVLRDNTFIVSTLYPTSTDVHVFEVALPLIKDLVASSKDVKSTYTTYRHILRWIDYMQNLLEVSSTDKLEINH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamyl-tRNA synthetase, cytoplasmic
publication title Structural basis of yeast aminoacyl-tRNA synthetase complex formation revealed by crystal structures of two binary sub-complexes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ligase/rna binding protein
total genus 41
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2006-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2hrkB00
1FW1A 1GWCA 5A4UA 4ZB8A 2FNOA 1AQVA 2WS2A 2ON7A 3UBKA 5F06A 4KGIA 18GSA 1A0FA 3O76A 3VK9A 4BVYB 5D9VA 1EOGA 3LXZA 4EDZA 5J4UA 5FWGA 4L8EA 5GZZB 3WD6A 3FY7A 5F8BA 2UZ8A 1B4PA 6GSUA 4MPGA 5DAKA 4IKHA 6GSYA 5D73A 5ECOB 2FHEA 6GSWA 3I6AA 1TW9A 1M99A 2IMIA 4YQVA 3FRCA 4MK3A 4ZXGA 4HI7A 1R5AA 3LYPA 5HFKA 4DEJA 1YQ1A 1PN9A 1EEMA 5AN1A 1GSDA 2CAQA 3CSIA 3DD3A 4YAVA 2HSMB 1EV9A 3VURA 2VD0A 10GSA 16GSA 1C72A 2DC5A 5A4VA 4ECCA 3CRUA 4AGSA 1K3OA 4HZ4A 4KDXA 1GUHA 1K0AA 5ECHB 4MF5A 5F05A 3QAWA 2V6KA 2DSAA 2PMTA 3I69A 5DJLA 3FR3A 3M0FA 4ZB9A 1GTIA 1K0MA 2AAWA 5ELAA 1AQXA 4L5LA 1M0UA 3VI7A 4RI6A 4PX1A 1TU8A 3U6VA 6GSSA 5ECQB 4ECBA 2R5GA 4ID0A 2YV9A 1Y6EA 4OFNA 3KJYA 1E6BA 4F03A 1ML6A 2LJRA 4Q5QA 3O3TA 4O7HA 3VI5A 3BBYA 1PMTA 1OKTA 4IGJA 3ZFLA 4F0BA 3FYGA 1YKCA 5DCGA 4IW9A 4KDYA 1JLVA 1PX6A 1OYJA 2YCDA 3RBTA 2PBJA 2VCXA 1G6WA 1GSQA 3R2QA 3F63A 1TDIA 1G7OA 4O92A 2GTUA 2R6KA 1GUMA 3IK9A 4Q5NA 3LG6A 3GTUB 3LQ7A 3AY8A 5J5NA 3F6FA 5FHIA 4GSTA 1BYEA 5ECSA 4GF0A 4ZB6A 1PX7A 4MP4A 3GX0A 3ERFA 3QAVA 6GSVA 4KF9A 5ECNB 2NTOA 1GNEA 1XWGA 4MF6A 1HQOA 3HJOA 1K0NA 4QQ7A 9GSSA 5ECRB 1JLWA 2R4VA 1GUKA 2PGTA 5EVOA 2VCZA 22GSA 3IK7A 3LYKA 2AB6A 3WYWA 3MDKA 5ELGA 1AQWA 4OMVA 1GLPA 2CVDA 3CSJA 2VCQA 1VF2A 7GSSA 3LFLA 2N5FA 2D2ZA 1K0DA 4E8HA 4MF7A 3KMOA 2IL3A 1XW5A 2C4JA 4FQUA 5G5EA 1UA5A 4EE0A 3NIVA 1MD4A 5FT3A 2OACA 4KE3A 2AHEA 2VD1A 2HRKA 2HSNB 4NAXA 2X64A 5J41A 2GDRA 3UARA 4GSSA 1PD21 1U88A 1AXDA 6GSTA 4L5OA 5AISA 4MPFA 3VLNA 1NHYA 20GSA 3HJMA 4G10A 3DGQA 4YQMA 3F6DA 5DAKB 4LMWA 3KTLA 4BVXA 3GH6A 2C80A 4EXJA 3UVHA 3ZFBA 3VPQA 3CSHA 3D0ZA 2C8UA 1MD3A 4NHWA 5DALA 4GTUA 1VF3A 4IS0A 2CZ3A 4K0NA 2VCVA 1M9AA 3C8EA 4IQ1A 3EINA 5GSSA 1VF4A 1GSYA 4KAEA 3LXTA 2C3TA 1HNCA 1PL1A 4IJIA 3ZMLA 1U3IA 1LBKA 4WR4A 3VWXA 4BL7A 1PKZA 13GSA 1K3LA 5B7CA 1HNAA 4KH7A 4BVXB 1VF1A 4PQHA 5ECIB 4ECIA 5AIVA 4YAPA 4IQAA 4ACSA 5DDLA 3GURA 5D9TA 5DALB 2HNLA 1N2AA 1USBA 1XW6A 1GULA 4HOJA 4Q5FA 4J2FA 3CBUA 2VO4A 4JEDA 5EY6A 4EC0A 4PUAA 4E8EA 6GSXA 4LMVA 4KSMA 4BL7B 3L0HA 4NHZA 4RI7A 5D9XA 1BAYA 4HJ2A 1M9BA 4G0IA 1GSUA 3Q18A 2OADA 2CAIA 4IELA 3UBLA 1F3AA 1MTCA 3KXOA 4MDCA 1FHEA 2HRAA 1K3YA 3PPUA 1PGTA 17GSA 5JCWA 2A2SA 1BX9A 2GLRA 4WR5A 3P8WA 4KDUA 4N0VA 2C3NA 11GSA 1OE8A 2PVQA 4GSNA 2HQTA 4GCIA 3M8NA 5ECKB 1GTBA 1GSEA 3G7IA 2JL4A 3EE2A 2C3QA 4BVYA 1XWKA 2PERA 1PL2A 1G6YA 2CA8A 4G0LA 1PKWA 5LCZA 5AGYA 5JCUA 1F2EA 3LSZA 3Q74A 19GSA 3ZMKA 5F07A 3UAPA 3GSTA 3R3EA 1GLQA 14GSA 4OFTA 3N5OA 2A2RA 4PXOA 3GUSA 1ZL9A 3IE3A 1OE7A 4PQIA 5A4WA 3P90A 1B48A 4G9HA 4IBPA 2HSMA 2GSTA 3CRTA 4ZBDA 3MAKA 4MZWA 1GTAA 1HNBA 4ECJA 4YH2A 3M3MA 5ECMB 1GTUA 2CZ2A 2VCWA 1BG5A 1K0OA 3FR6A 4PTSA 4I97A 2HRKB 3GSSA 3VPTA 4IVFA 2VCTA 1KBNA 3H1NA 2YV7A 4CHSA 4HZ2A 4F0CA 3G7JA 1B8XA 3TOUA 4PURA 1K0BA 4ZBBA 1K0CA 5G5FA 4G19A 4PNFA 1GSFA 3TGZA 4USSA 5KEJA 3HKRA 12GSA 5IQYA 5F0GA 5AIXA 3IC8A 2WB9A 4ISDA 2OA7A 1U87A 1YJ6A 1JZRA 2GSQA 3QAGA 4TOPA 1GSSA 3GTUA 3M1GA 3TOTA 1IYHA 3PR8A 4JZQA 5ECLB 1AW9A 3ERGA 1DUGA 5ECPB 4GLTA 4YQUA 5A5KA 1IYIA 1PA3A 1YY7A 1GNWA 1EV4A 2J9HA 1EOHA 5DQSA 1TU7A 3IR4A 1Q4JA 4G0KA 2F3MA 1F3BA 1Z9HA 3KMNA 4OFMA 5D9WA 3Q19A 1V2AA 4ZBAA 2WRTA 3N9JA 3QR6A 1LJRA 4JBBA 5GSTA 3LJRA 1V40A 1YDKA 5DJMA 3KM6A 5BMUA 4Q5RA 3IBHA 1ZGNA 4EDYA 2F8FA 4PNGA 1RK4A 4KX4A 2WJUA 3W8SA 2IMKA 8GSSA 3PGTA 2GSSA 5LD0A 5EL8A 3ISOA 2R3XA 4PGTA 4K0GA 2ON5A 2GSRA 3FR9A 2WDUA 3SWLA
chains in the Genus database with same CATH superfamily
2HSNA 1FW1A 1GWCA 5A4UA 4ZB8A 2FNOA 1AQVA 2WS2A 2ON7A 3UBKA 5F06A 4KGIA 18GSA 1A0FA 3O76A 3VK9A 4BVYB 5D9VA 1EOGA 3LXZA 4EDZA 5J4UA 5FWGA 4L8EA 5GZZB 3WD6A 3FY7A 5F8BA 1N25A 1B4PA 2UZ8A 6GSUA 4MPGA 5J40A 5DAKA 4IKHA 6GSYA 5D73A 5ECOB 2FHEA 6GSWA 3I6AA 1TW9A 5A1NB 1M99A 2IMIA 4YQVA 3FRCA 4MK3A 4ZXGA 4HI7A 3RFRC 1R5AA 3LYPA 5HFKA 4DEJA 1YQ1A 1PN9A 1EEMA 5AN1A 1GSDA 2CAQA 3CSIA 3DD3A 4YAVA 2HSMB 1EV9A 3VURA 2VD0A 10GSA 16GSA 1C72A 2DC5A 5A4VA 4ECCA 3CRUA 4AGSA 3HMJG 1K3OA 4HZ4A 4KDXA 5A5HB 1GUHA 1K0AA 5ECHB 4MF5A 5F05A 3QAWA 2V6KA 2DSAA 2PMTA 3I69A 5DJLA 3FR3A 3M0FA 4ZB9A 1GTIA 1K0MA 2AAWA 5ELAA 1AQXA 4L5LA 1M0UA 3VI7A 4RI6A 4PX1A 1TU8A 3U6VA 6GSSA 5ECQB 4ECBA 4PI2C 2R5GA 4ID0A 2YV9A 1Y6EA 4OFNA 2OT3A 2WVXB 3KJYA 1E6BA 4F03A 1ML6A 2LJRA 2WVZA 4Q5QA 3O3TA 4O7HA 2EFCA 3VI5A 3BBYA 1PMTA 1OKTA 4IGJA 3ZFLA 4F0BA 3FYGA 1YKCA 5DCGA 4IW9A 4KDYA 1JLVA 1PX6A 1OYJA 2O5VA 2YCDA 3RBTA 2PBJA 2VCXA 4AKHA 1G6WA 1GSQA 2WW1A 3R2QA 3F63A 1TDIA 1G7OA 4O92A 2GTUA 2O36A 1GUMA 2R6KA 3IK9A 4Q5NA 3LG6A 3GTUB 3LQ7A 3AY8A 5J5NA 3F6FA 5FHIA 4GSTA 1BYEA 4AKIA 5ECSA 4GF0A 4ZB6A 1PX7A 4MP4A 3TU3B 1YEWC 3GX0A 3ERFA 3QAVA 6GSVA 2H1LA 4KF9A 5ECNB 2NTOA 1GNEA 1XWGA 4MF6A 1HQOA 3HJOA 1K0NA 4QQ7A 9GSSA 4N3ZA 5ECRB 1JLWA 2R4VA 1GUKA 2PGTA 5EVOA 2VCZA 22GSA 4PI0C 3IK7A 3LYKA 2AB6A 3WYWA 3MDKA 5BMUB 5ELGA 1AQWA 4OMVA 1GLPA 2CVDA 3CSJA 2VCQA 1VF2A 4QMKA 4FXYP 4G01A 7GSSA 3LFLA 2N5FA 2D2ZA 1K0DA 4E8HA 4MF7A 3KMOA 2IL3A 1XW5A 2C4JA 4FQUA 5G5EA 1UA5A 4EE0A 3NIVA 1MD4A 5FT3A 2OACA 4KE3A 2AHEA 2VD1A 2HRKA 2HSNB 3CHXC 4GDFA 4NAXA 2X64A 5J41A 5A34A 2GDRA 3UARA 4GSSA 1PD21 1U88A 1AXDA 6GSTA 4L5OA 5AISA 4MPFA 3VLNA 1NHYA 20GSA 3HJMA 4G10A 3DGQA 4YQMA 3F6DA 5DAKB 4LMWA 3KTLA 4BVXA 3GH6A 2C80A 4EXJA 3UVHA 3ZFBA 3VPQA 3CSHA 3D0ZA 2C8UA 1MD3A 4NHWA 5DALA 4GTUA 1VF3A 4IS0A 2CZ3A 4K0NA 2VCVA 1M9AA 3C8EA 2WVYA 4IQ1A 3EINA 5GSSA 1VF4A 1GSYA 4KAEA 3LXTA 2C3TA 1HNCA 1PL1A 4IJIA 3ZMLA 1U3IA 1LBKA 4WR4A 3VWXA 1I1IP 4BL7A 1PKZA 13GSA 1K3LA 5B7CA 1HNAA 4KH7A 4BVXB 1VF1A 4PQHA 5ECIB 4ECIA 5AIVA 4YAPA 4IQAA 4ACSA 5DDLA 3GURA 5D9TA 5DALB 1BF5A 2HNLA 1N2AA 4AI6A 1USBA 1XW6A 2UV8G 1GULA 4HOJA 4Q5FA 4J2FA 3CBUA 2VO4A 4JEDA 5EY6A 4EC0A 4PUAA 4E8EA 2EFEA 6GSXA 4LMVA 4KSMA 4BL7B 4ZB7A 3CWGA 3L0HA 4NHZA 4RI7A 5D9XA 1BAYA 4HJ2A 1M9BA 4G0IA 1GSUA 2OADA 3Q18A 2CAIA 4IELA 3UBLA 2WW0A 1F3AA 4PHZC 1MTCA 3KXOA 4MDCA 1FHEA 2HRAA 1K3YA 3PPUA 1PGTA 17GSA 5JCWA 2A2SA 1BX9A 2GLRA 4WR5A 3P8WA 4KDUA 4N0VA 4W66A 2C3NA 11GSA 1OE8A 2PVQA 4GSNA 2HQTA 4GCIA 3M8NA 5ECKB 1GTBA 1GSEA 3G7IA 2JL4A 3EE2A 2C3QA 1TXUA 4BVYA 1XWKA 2PERA 1PL2A 1G6YA 2CA8A 2O3EA 4G0LA 5J4YA 1PKWA 5LCZA 5AGYA 5JCUA 1F2EA 1SVOA 3LSZA 3Q74A 19GSA 3ZMKA 5F07A 3UAPA 3GSTA 3R3EA 1GLQA 3RGBC 14GSA 4OFTA 3N5OA 5A1NA 2A2RA 4PXOA 3GUSA 1ZL9A 3IE3A 1OE7A 4PQIA 5A4WA 3P90A 1B48A 4G9HA 4IBPA 2HSMA 2GSTA 3CRTA 4ZBDA 3MAKA 4MZWA 1GTAA 1HNBA 4ECJA 4YH2A 1YVLA 3M3MA 5ECMB 1GTUA 5A5HA 4E68A 2CZ2A 2VCWA 1BG5A 1K0OA 3FR6A 4PTSA 4I97A 2HRKB 3GSSA 3VPTA 4IVFA 2VCTA 1KBNA 3H1NA 2YV7A 5A34B 5J47A 2WVXA 4CHSA 4HZ2A 4F0CA 3G7JA 1B8XA 3TOUA 4PURA 1K0BA 4ZBBA 1K0CA 2VKZG 5G5FA 4G19A 4PNFA 1GSFA 3TGZA 4USSA 2EFDA 2WW3A 5KEJA 3HKRA 1S4BP 12GSA 5IQYA 5F0GA 5AIXA 3IC8A 2WB9A 1SVLA 2OA7A 1U87A 1YJ6A 1JZRA 2GSQA 3QAGA 4ISDA 4TOPA 1GSSA 3GTUA 3M1GA 3TOTA 1IYHA 3PR8A 4JZQA 5ECLB 1AW9A 3ERGA 1Y1UA 4AKXB 1DUGA 5ECPB 4GLTA 4YQUA 5A5KA 1IYIA 1PA3A 1YY7A 1GNWA 1EV4A 2J9HA 1EOHA 5DQSA 5J4VA 1TU7A 3IR4A 1Q4JA 4G0KA 2F3MA 1F3BA 1Z9HA 3KMNA 4OFMA 2EFHA 5D9WA 3Q19A 1V2AA 4ZBAA 2WRTA 1BG1A 3N9JA 3QR6A 1LJRA 4JBBA 5GSTA 3LJRA 1V40A 1YDKA 5DJMA 2WW2A 3KM6A 1SVMA 5BMUA 4Q5RA 3IBHA 1ZGNA 4EDYA 2F8FA 4PNGA 1RK4A 2WZSA 4KX4A 2WJUA 3W8SA 2IMKA 8GSSA 3PGTA 2GSSA 5LD0A 5EL8A 3ISOA 2R3XA 4PGTA 4K0GA 2ON5A 4AKGA 2GSRA 3FR9A 2WDUA 3SWLA
chains in the Genus database with same CATH topology
2HSNA 1FW1A 1GWCA 5A4UA 4ZB8A 2FNOA 1AQVA 2WS2A 2ON7A 3UBKA 5F06A 4KGIA 18GSA 1A0FA 3O76A 3VK9A 4BVYB 5D9VA 1EOGA 3LXZA 4EDZA 5J4UA 5FWGA 4L8EA 5GZZB 3WD6A 3FY7A 5F8BA 1N25A 1B4PA 2UZ8A 6GSUA 4MPGA 5J40A 5DAKA 4IKHA 6GSYA 5D73A 5ECOB 2FHEA 6GSWA 3I6AA 1TW9A 5A1NB 1M99A 2IMIA 4YQVA 3FRCA 4MK3A 4ZXGA 4HI7A 1R5AA 3LYPA 5HFKA 4DEJA 1YQ1A 1PN9A 1EEMA 5AN1A 1GSDA 2CAQA 3CSIA 3DD3A 4YAVA 2HSMB 1EV9A 3VURA 2VD0A 10GSA 16GSA 1C72A 2DC5A 5A4VA 4ECCA 3CRUA 4AGSA 3HMJG 1K3OA 4HZ4A 4KDXA 5A5HB 1GUHA 1K0AA 5ECHB 4MF5A 5F05A 3QAWA 2V6KA 2DSAA 2PMTA 3I69A 5DJLA 3FR3A 3M0FA 4ZB9A 1GTIA 1K0MA 2AAWA 5ELAA 1AQXA 4L5LA 1M0UA 3VI7A 4RI6A 4PX1A 1TU8A 3U6VA 6GSSA 5ECQB 4ECBA 2R5GA 4ID0A 2YV9A 1Y6EA 4OFNA 2OT3A 3KJYA 1E6BA 4F03A 1ML6A 2LJRA 4Q5QA 3O3TA 4O7HA 2EFCA 3VI5A 3BBYA 1PMTA 1OKTA 4IGJA 3ZFLA 4F0BA 3FYGA 1YKCA 5DCGA 4IW9A 4KDYA 1JLVA 1PX6A 1OYJA 2O5VA 2YCDA 3RBTA 2PBJA 2VCXA 4AKHA 1G6WA 1GSQA 3R2QA 3F63A 1TDIA 1G7OA 4O92A 2GTUA 2R6KA 1GUMA 3IK9A 4Q5NA 3LG6A 3GTUB 3LQ7A 3AY8A 5J5NA 3F6FA 5FHIA 4GSTA 1BYEA 4AKIA 5ECSA 4GF0A 4ZB6A 1PX7A 4MP4A 3TU3B 3GX0A 3ERFA 3QAVA 6GSVA 2H1LA 4KF9A 5ECNB 2NTOA 1GNEA 1XWGA 4MF6A 1HQOA 3HJOA 1K0NA 4QQ7A 9GSSA 4N3ZA 5ECRB 1JLWA 2R4VA 1GUKA 2PGTA 5EVOA 2VCZA 22GSA 3IK7A 3LYKA 2AB6A 3WYWA 3MDKA 5BMUB 5ELGA 1AQWA 4OMVA 1GLPA 2CVDA 3CSJA 2VCQA 1VF2A 4QMKA 7GSSA 4G01A 3LFLA 2N5FA 2D2ZA 1K0DA 4E8HA 4MF7A 3KMOA 2IL3A 1XW5A 2C4JA 4FQUA 5G5EA 1UA5A 4EE0A 3NIVA 1MD4A 5FT3A 2OACA 4KE3A 2AHEA 2VD1A 2HRKA 2HSNB 4GDFA 4NAXA 2X64A 5J41A 5A34A 2GDRA 3UARA 4GSSA 1PD21 1U88A 1AXDA 6GSTA 4L5OA 5AISA 4MPFA 3VLNA 1NHYA 20GSA 3HJMA 4G10A 3DGQA 4YQMA 3F6DA 5DAKB 4LMWA 3KTLA 4BVXA 3GH6A 2C80A 4EXJA 3UVHA 3ZFBA 3VPQA 3CSHA 3D0ZA 2C8UA 1MD3A 4NHWA 5DALA 4GTUA 1VF3A 4IS0A 2CZ3A 4K0NA 2VCVA 1M9AA 3C8EA 4IQ1A 3EINA 5GSSA 1VF4A 1GSYA 4KAEA 3LXTA 2C3TA 1HNCA 1PL1A 4IJIA 3ZMLA 1U3IA 1LBKA 4WR4A 3VWXA 4BL7A 1PKZA 13GSA 1K3LA 5B7CA 1HNAA 4KH7A 4BVXB 1VF1A 4PQHA 5ECIB 4ECIA 5AIVA 4YAPA 4IQAA 4ACSA 5DDLA 3GURA 5D9TA 5DALB 1BF5A 2HNLA 1N2AA 4AI6A 1USBA 1XW6A 2UV8G 1GULA 4HOJA 4Q5FA 4J2FA 3CBUA 2VO4A 4JEDA 5EY6A 4EC0A 4PUAA 4E8EA 2EFEA 6GSXA 4LMVA 4KSMA 4BL7B 4ZB7A 3CWGA 3L0HA 4NHZA 4RI7A 5D9XA 1BAYA 4HJ2A 1M9BA 4G0IA 1GSUA 2OADA 3Q18A 2CAIA 4IELA 3UBLA 1F3AA 1MTCA 3KXOA 4MDCA 1FHEA 2HRAA 1K3YA 3PPUA 1PGTA 17GSA 5JCWA 2A2SA 1BX9A 2GLRA 4WR5A 3P8WA 4KDUA 4N0VA 4W66A 2C3NA 11GSA 1OE8A 2PVQA 4GSNA 2HQTA 4GCIA 3M8NA 5ECKB 1GTBA 1GSEA 3G7IA 2JL4A 3EE2A 2C3QA 1TXUA 4BVYA 1XWKA 2PERA 1PL2A 1G6YA 2CA8A 4G0LA 5J4YA 1PKWA 5LCZA 5AGYA 5JCUA 1F2EA 1SVOA 3LSZA 3Q74A 19GSA 3ZMKA 5F07A 3UAPA 3GSTA 3R3EA 1GLQA 14GSA 4OFTA 3N5OA 5A1NA 2A2RA 4PXOA 3GUSA 1ZL9A 3IE3A 1OE7A 4PQIA 5A4WA 3P90A 1B48A 4G9HA 4IBPA 2HSMA 2GSTA 3CRTA 4ZBDA 3MAKA 4MZWA 1GTAA 1HNBA 4ECJA 4YH2A 3M3MA 1YVLA 5ECMB 1GTUA 5A5HA 4E68A 2CZ2A 2VCWA 1BG5A 1K0OA 3FR6A 4PTSA 4I97A 2HRKB 3GSSA 3VPTA 4IVFA 2VCTA 1KBNA 3H1NA 2YV7A 5A34B 5J47A 4CHSA 4HZ2A 4F0CA 3G7JA 1B8XA 3TOUA 4PURA 1K0BA 4ZBBA 1K0CA 2VKZG 5G5FA 4G19A 4PNFA 1GSFA 3TGZA 4USSA 2EFDA 5KEJA 3HKRA 12GSA 5IQYA 5F0GA 5AIXA 3IC8A 2WB9A 1SVLA 2OA7A 1U87A 1YJ6A 1JZRA 2GSQA 3QAGA 4ISDA 4TOPA 1GSSA 3GTUA 3M1GA 3TOTA 1IYHA 3PR8A 4JZQA 5ECLB 1AW9A 3ERGA 1Y1UA 4AKXB 1DUGA 5ECPB 4GLTA 4YQUA 5A5KA 1IYIA 1PA3A 1YY7A 1GNWA 1EV4A 2J9HA 1EOHA 5DQSA 5J4VA 1TU7A 3IR4A 1Q4JA 4G0KA 2F3MA 1F3BA 1Z9HA 3KMNA 4OFMA 2EFHA 5D9WA 3Q19A 1V2AA 4ZBAA 2WRTA 1BG1A 3N9JA 3QR6A 1LJRA 4JBBA 5GSTA 3LJRA 1V40A 1YDKA 5DJMA 3KM6A 1SVMA 5BMUA 4Q5RA 3IBHA 1ZGNA 4EDYA 2F8FA 4PNGA 1RK4A 4KX4A 2WJUA 3W8SA 2IMKA 8GSSA 3PGTA 2GSSA 5LD0A 5EL8A 3ISOA 2R3XA 4PGTA 4K0GA 2ON5A 4AKGA 2GSRA 3FR9A 2WDUA 3SWLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FW1 A;  1GWC A;  5A4U A;  4ZB8 A;  2FNO A;  1AQV A;  2WS2 A;  2ON7 A;  3UBK A;  5F06 A;  4KGI A;  18GS A;  1A0F A;  3O76 A;  3VK9 A;  4BVY B;  5D9V A;  1EOG A;  3LXZ A;  4EDZ A;  5J4U A;  5FWG A;  4L8E A;  5GZZ B;  3WD6 A;  3FY7 A;  5F8B A;  2UZ8 A;  1B4P A;  6GSU A;  4MPG A;  5DAK A;  4IKH A;  6GSY A;  5D73 A;  5ECO B;  2FHE A;  6GSW A;  3I6A A;  1TW9 A;  1M99 A;  2IMI A;  4YQV A;  3FRC A;  4MK3 A;  4ZXG A;  4HI7 A;  1R5A A;  3LYP A;  5HFK A;  4DEJ A;  1YQ1 A;  1PN9 A;  1EEM A;  5AN1 A;  1GSD A;  2CAQ A;  3CSI A;  3DD3 A;  4YAV A;  2HSM B;  1EV9 A;  3VUR A;  2VD0 A;  10GS A;  16GS A;  1C72 A;  2DC5 A;  5A4V A;  4ECC A;  3CRU A;  4AGS A;  1K3O A;  4HZ4 A;  4KDX A;  1GUH A;  1K0A A;  5ECH B;  4MF5 A;  5F05 A;  3QAW A;  2V6K A;  2DSA A;  2PMT A;  3I69 A;  5DJL A;  3FR3 A;  3M0F A;  4ZB9 A;  1GTI A;  1K0M A;  2AAW A;  5ELA A;  1AQX A;  4L5L A;  1M0U A;  3VI7 A;  4RI6 A;  4PX1 A;  1TU8 A;  3U6V A;  6GSS A;  5ECQ B;  4ECB A;  2R5G A;  4ID0 A;  2YV9 A;  1Y6E A;  4OFN A;  3KJY A;  1E6B A;  4F03 A;  1ML6 A;  2LJR A;  4Q5Q A;  3O3T A;  4O7H A;  3VI5 A;  3BBY A;  1PMT A;  1OKT A;  4IGJ A;  3ZFL A;  4F0B A;  3FYG A;  1YKC A;  5DCG A;  4IW9 A;  4KDY A;  1JLV A;  1PX6 A;  1OYJ A;  2YCD A;  3RBT A;  2PBJ A;  2VCX A;  1G6W A;  1GSQ A;  3R2Q A;  3F63 A;  1TDI A;  1G7O A;  4O92 A;  2GTU A;  2R6K A;  1GUM A;  3IK9 A;  4Q5N A;  3LG6 A;  3GTU B;  3LQ7 A;  3AY8 A;  5J5N A;  3F6F A;  5FHI A;  4GST A;  1BYE A;  5ECS A;  4GF0 A;  4ZB6 A;  1PX7 A;  4MP4 A;  3GX0 A;  3ERF A;  3QAV A;  6GSV A;  4KF9 A;  5ECN B;  2NTO A;  1GNE A;  1XWG A;  4MF6 A;  1HQO A;  3HJO A;  1K0N A;  4QQ7 A;  9GSS A;  5ECR B;  1JLW A;  2R4V A;  1GUK A;  2PGT A;  5EVO A;  2VCZ A;  22GS A;  3IK7 A;  3LYK A;  2AB6 A;  3WYW A;  3MDK A;  5ELG A;  1AQW A;  4OMV A;  1GLP A;  2CVD A;  3CSJ A;  2VCQ A;  1VF2 A;  7GSS A;  3LFL A;  2N5F A;  2D2Z A;  1K0D A;  4E8H A;  4MF7 A;  3KMO A;  2IL3 A;  1XW5 A;  2C4J A;  4FQU A;  5G5E A;  1UA5 A;  4EE0 A;  3NIV A;  1MD4 A;  5FT3 A;  2OAC A;  4KE3 A;  2AHE A;  2VD1 A;  2HRK A;  2HSN B;  4NAX A;  2X64 A;  5J41 A;  2GDR A;  3UAR A;  4GSS A;  1PD2 1;  1U88 A;  1AXD A;  6GST A;  4L5O A;  5AIS A;  4MPF A;  3VLN A;  1NHY A;  20GS A;  3HJM A;  4G10 A;  3DGQ A;  4YQM A;  3F6D A;  5DAK B;  4LMW A;  3KTL A;  4BVX A;  3GH6 A;  2C80 A;  4EXJ A;  3UVH A;  3ZFB A;  3VPQ A;  3CSH A;  3D0Z A;  2C8U A;  1MD3 A;  4NHW A;  5DAL A;  4GTU A;  1VF3 A;  4IS0 A;  2CZ3 A;  4K0N A;  2VCV A;  1M9A A;  3C8E A;  4IQ1 A;  3EIN A;  5GSS A;  1VF4 A;  1GSY A;  4KAE A;  3LXT A;  2C3T A;  1HNC A;  1PL1 A;  4IJI A;  3ZML A;  1U3I A;  1LBK A;  4WR4 A;  3VWX A;  4BL7 A;  1PKZ A;  13GS A;  1K3L A;  5B7C A;  1HNA A;  4KH7 A;  4BVX B;  1VF1 A;  4PQH A;  5ECI B;  4ECI A;  5AIV A;  4YAP A;  4IQA A;  4ACS A;  5DDL A;  3GUR A;  5D9T A;  5DAL B;  2HNL A;  1N2A A;  1USB A;  1XW6 A;  1GUL A;  4HOJ A;  4Q5F A;  4J2F A;  3CBU A;  2VO4 A;  4JED A;  5EY6 A;  4EC0 A;  4PUA A;  4E8E A;  6GSX A;  4LMV A;  4KSM A;  4BL7 B;  3L0H A;  4NHZ A;  4RI7 A;  5D9X A;  1BAY A;  4HJ2 A;  1M9B A;  4G0I A;  1GSU A;  3Q18 A;  2OAD A;  2CAI A;  4IEL A;  3UBL A;  1F3A A;  1MTC A;  3KXO A;  4MDC A;  1FHE A;  2HRA A;  1K3Y A;  3PPU A;  1PGT A;  17GS A;  5JCW A;  2A2S A;  1BX9 A;  2GLR A;  4WR5 A;  3P8W A;  4KDU A;  4N0V A;  2C3N A;  11GS A;  1OE8 A;  2PVQ A;  4GSN A;  2HQT A;  4GCI A;  3M8N A;  5ECK B;  1GTB A;  1GSE A;  3G7I A;  2JL4 A;  3EE2 A;  2C3Q A;  4BVY A;  1XWK A;  2PER A;  1PL2 A;  1G6Y A;  2CA8 A;  4G0L A;  1PKW A;  5LCZ A;  5AGY A;  5JCU A;  1F2E A;  3LSZ A;  3Q74 A;  19GS A;  3ZMK A;  5F07 A;  3UAP A;  3GST A;  3R3E A;  1GLQ A;  14GS A;  4OFT A;  3N5O A;  2A2R A;  4PXO A;  3GUS A;  1ZL9 A;  3IE3 A;  1OE7 A;  4PQI A;  5A4W A;  3P90 A;  1B48 A;  4G9H A;  4IBP A;  2HSM A;  2GST A;  3CRT A;  4ZBD A;  3MAK A;  4MZW A;  1GTA A;  1HNB A;  4ECJ A;  4YH2 A;  3M3M A;  5ECM B;  1GTU A;  2CZ2 A;  2VCW A;  1BG5 A;  1K0O A;  3FR6 A;  4PTS A;  4I97 A;  2HRK B;  3GSS A;  3VPT A;  4IVF A;  2VCT A;  1KBN A;  3H1N A;  2YV7 A;  4CHS A;  4HZ2 A;  4F0C A;  3G7J A;  1B8X A;  3TOU A;  4PUR A;  1K0B A;  4ZBB A;  1K0C A;  5G5F A;  4G19 A;  4PNF A;  1GSF A;  3TGZ A;  4USS A;  5KEJ A;  3HKR A;  12GS A;  5IQY A;  5F0G A;  5AIX A;  3IC8 A;  2WB9 A;  4ISD A;  2OA7 A;  1U87 A;  1YJ6 A;  1JZR A;  2GSQ A;  3QAG A;  4TOP A;  1GSS A;  3GTU A;  3M1G A;  3TOT A;  1IYH A;  3PR8 A;  4JZQ A;  5ECL B;  1AW9 A;  3ERG A;  1DUG A;  5ECP B;  4GLT A;  4YQU A;  5A5K A;  1IYI A;  1PA3 A;  1YY7 A;  1GNW A;  1EV4 A;  2J9H A;  1EOH A;  5DQS A;  1TU7 A;  3IR4 A;  1Q4J A;  4G0K A;  2F3M A;  1F3B A;  1Z9H A;  3KMN A;  4OFM A;  5D9W A;  3Q19 A;  1V2A A;  4ZBA A;  2WRT A;  3N9J A;  3QR6 A;  1LJR A;  4JBB A;  5GST A;  3LJR A;  1V40 A;  1YDK A;  5DJM A;  3KM6 A;  5BMU A;  4Q5R A;  3IBH A;  1ZGN A;  4EDY A;  2F8F A;  4PNG A;  1RK4 A;  4KX4 A;  2WJU A;  3W8S A;  2IMK A;  8GSS A;  3PGT A;  2GSS A;  5LD0 A;  5EL8 A;  3ISO A;  2R3X A;  4PGT A;  4K0G A;  2ON5 A;  2GSR A;  3FR9 A;  2WDU A;  3SWL A; 
#chains in the Genus database with same CATH topology
 2HSN A;  1FW1 A;  1GWC A;  5A4U A;  4ZB8 A;  2FNO A;  1AQV A;  2WS2 A;  2ON7 A;  3UBK A;  5F06 A;  4KGI A;  18GS A;  1A0F A;  3O76 A;  3VK9 A;  4BVY B;  5D9V A;  1EOG A;  3LXZ A;  4EDZ A;  5J4U A;  5FWG A;  4L8E A;  5GZZ B;  3WD6 A;  3FY7 A;  5F8B A;  1N25 A;  1B4P A;  2UZ8 A;  6GSU A;  4MPG A;  5J40 A;  5DAK A;  4IKH A;  6GSY A;  5D73 A;  5ECO B;  2FHE A;  6GSW A;  3I6A A;  1TW9 A;  5A1N B;  1M99 A;  2IMI A;  4YQV A;  3FRC A;  4MK3 A;  4ZXG A;  4HI7 A;  3RFR C;  1R5A A;  3LYP A;  5HFK A;  4DEJ A;  1YQ1 A;  1PN9 A;  1EEM A;  5AN1 A;  1GSD A;  2CAQ A;  3CSI A;  3DD3 A;  4YAV A;  2HSM B;  1EV9 A;  3VUR A;  2VD0 A;  10GS A;  16GS A;  1C72 A;  2DC5 A;  5A4V A;  4ECC A;  3CRU A;  4AGS A;  3HMJ G;  1K3O A;  4HZ4 A;  4KDX A;  5A5H B;  1GUH A;  1K0A A;  5ECH B;  4MF5 A;  5F05 A;  3QAW A;  2V6K A;  2DSA A;  2PMT A;  3I69 A;  5DJL A;  3FR3 A;  3M0F A;  4ZB9 A;  1GTI A;  1K0M A;  2AAW A;  5ELA A;  1AQX A;  4L5L A;  1M0U A;  3VI7 A;  4RI6 A;  4PX1 A;  1TU8 A;  3U6V A;  6GSS A;  5ECQ B;  4ECB A;  4PI2 C;  2R5G A;  4ID0 A;  2YV9 A;  1Y6E A;  4OFN A;  2OT3 A;  2WVX B;  3KJY A;  1E6B A;  4F03 A;  1ML6 A;  2LJR A;  2WVZ A;  4Q5Q A;  3O3T A;  4O7H A;  2EFC A;  3VI5 A;  3BBY A;  1PMT A;  1OKT A;  4IGJ A;  3ZFL A;  4F0B A;  3FYG A;  1YKC A;  5DCG A;  4IW9 A;  4KDY A;  1JLV A;  1PX6 A;  1OYJ A;  2O5V A;  2YCD A;  3RBT A;  2PBJ A;  2VCX A;  4AKH A;  1G6W A;  1GSQ A;  2WW1 A;  3R2Q A;  3F63 A;  1TDI A;  1G7O A;  4O92 A;  2GTU A;  2O36 A;  1GUM A;  2R6K A;  3IK9 A;  4Q5N A;  3LG6 A;  3GTU B;  3LQ7 A;  3AY8 A;  5J5N A;  3F6F A;  5FHI A;  4GST A;  1BYE A;  4AKI A;  5ECS A;  4GF0 A;  4ZB6 A;  1PX7 A;  4MP4 A;  3TU3 B;  1YEW C;  3GX0 A;  3ERF A;  3QAV A;  6GSV A;  2H1L A;  4KF9 A;  5ECN B;  2NTO A;  1GNE A;  1XWG A;  4MF6 A;  1HQO A;  3HJO A;  1K0N A;  4QQ7 A;  9GSS A;  4N3Z A;  5ECR B;  1JLW A;  2R4V A;  1GUK A;  2PGT A;  5EVO A;  2VCZ A;  22GS A;  4PI0 C;  3IK7 A;  3LYK A;  2AB6 A;  3WYW A;  3MDK A;  5BMU B;  5ELG A;  1AQW A;  4OMV A;  1GLP A;  2CVD A;  3CSJ A;  2VCQ A;  1VF2 A;  4QMK A;  4FXY P;  4G01 A;  7GSS A;  3LFL A;  2N5F A;  2D2Z A;  1K0D A;  4E8H A;  4MF7 A;  3KMO A;  2IL3 A;  1XW5 A;  2C4J A;  4FQU A;  5G5E A;  1UA5 A;  4EE0 A;  3NIV A;  1MD4 A;  5FT3 A;  2OAC A;  4KE3 A;  2AHE A;  2VD1 A;  2HRK A;  2HSN B;  3CHX C;  4GDF A;  4NAX A;  2X64 A;  5J41 A;  5A34 A;  2GDR A;  3UAR A;  4GSS A;  1PD2 1;  1U88 A;  1AXD A;  6GST A;  4L5O A;  5AIS A;  4MPF A;  3VLN A;  1NHY A;  20GS A;  3HJM A;  4G10 A;  3DGQ A;  4YQM A;  3F6D A;  5DAK B;  4LMW A;  3KTL A;  4BVX A;  3GH6 A;  2C80 A;  4EXJ A;  3UVH A;  3ZFB A;  3VPQ A;  3CSH A;  3D0Z A;  2C8U A;  1MD3 A;  4NHW A;  5DAL A;  4GTU A;  1VF3 A;  4IS0 A;  2CZ3 A;  4K0N A;  2VCV A;  1M9A A;  3C8E A;  2WVY A;  4IQ1 A;  3EIN A;  5GSS A;  1VF4 A;  1GSY A;  4KAE A;  3LXT A;  2C3T A;  1HNC A;  1PL1 A;  4IJI A;  3ZML A;  1U3I A;  1LBK A;  4WR4 A;  3VWX A;  1I1I P;  4BL7 A;  1PKZ A;  13GS A;  1K3L A;  5B7C A;  1HNA A;  4KH7 A;  4BVX B;  1VF1 A;  4PQH A;  5ECI B;  4ECI A;  5AIV A;  4YAP A;  4IQA A;  4ACS A;  5DDL A;  3GUR A;  5D9T A;  5DAL B;  1BF5 A;  2HNL A;  1N2A A;  4AI6 A;  1USB A;  1XW6 A;  2UV8 G;  1GUL A;  4HOJ A;  4Q5F A;  4J2F A;  3CBU A;  2VO4 A;  4JED A;  5EY6 A;  4EC0 A;  4PUA A;  4E8E A;  2EFE A;  6GSX A;  4LMV A;  4KSM A;  4BL7 B;  4ZB7 A;  3CWG A;  3L0H A;  4NHZ A;  4RI7 A;  5D9X A;  1BAY A;  4HJ2 A;  1M9B A;  4G0I A;  1GSU A;  2OAD A;  3Q18 A;  2CAI A;  4IEL A;  3UBL A;  2WW0 A;  1F3A A;  4PHZ C;  1MTC A;  3KXO A;  4MDC A;  1FHE A;  2HRA A;  1K3Y A;  3PPU A;  1PGT A;  17GS A;  5JCW A;  2A2S A;  1BX9 A;  2GLR A;  4WR5 A;  3P8W A;  4KDU A;  4N0V A;  4W66 A;  2C3N A;  11GS A;  1OE8 A;  2PVQ A;  4GSN A;  2HQT A;  4GCI A;  3M8N A;  5ECK B;  1GTB A;  1GSE A;  3G7I A;  2JL4 A;  3EE2 A;  2C3Q A;  1TXU A;  4BVY A;  1XWK A;  2PER A;  1PL2 A;  1G6Y A;  2CA8 A;  2O3E A;  4G0L A;  5J4Y A;  1PKW A;  5LCZ A;  5AGY A;  5JCU A;  1F2E A;  1SVO A;  3LSZ A;  3Q74 A;  19GS A;  3ZMK A;  5F07 A;  3UAP A;  3GST A;  3R3E A;  1GLQ A;  3RGB C;  14GS A;  4OFT A;  3N5O A;  5A1N A;  2A2R A;  4PXO A;  3GUS A;  1ZL9 A;  3IE3 A;  1OE7 A;  4PQI A;  5A4W A;  3P90 A;  1B48 A;  4G9H A;  4IBP A;  2HSM A;  2GST A;  3CRT A;  4ZBD A;  3MAK A;  4MZW A;  1GTA A;  1HNB A;  4ECJ A;  4YH2 A;  1YVL A;  3M3M A;  5ECM B;  1GTU A;  5A5H A;  4E68 A;  2CZ2 A;  2VCW A;  1BG5 A;  1K0O A;  3FR6 A;  4PTS A;  4I97 A;  2HRK B;  3GSS A;  3VPT A;  4IVF A;  2VCT A;  1KBN A;  3H1N A;  2YV7 A;  5A34 B;  5J47 A;  2WVX A;  4CHS A;  4HZ2 A;  4F0C A;  3G7J A;  1B8X A;  3TOU A;  4PUR A;  1K0B A;  4ZBB A;  1K0C A;  2VKZ G;  5G5F A;  4G19 A;  4PNF A;  1GSF A;  3TGZ A;  4USS A;  2EFD A;  2WW3 A;  5KEJ A;  3HKR A;  1S4B P;  12GS A;  5IQY A;  5F0G A;  5AIX A;  3IC8 A;  2WB9 A;  1SVL A;  2OA7 A;  1U87 A;  1YJ6 A;  1JZR A;  2GSQ A;  3QAG A;  4ISD A;  4TOP A;  1GSS A;  3GTU A;  3M1G A;  3TOT A;  1IYH A;  3PR8 A;  4JZQ A;  5ECL B;  1AW9 A;  3ERG A;  1Y1U A;  4AKX B;  1DUG A;  5ECP B;  4GLT A;  4YQU A;  5A5K A;  1IYI A;  1PA3 A;  1YY7 A;  1GNW A;  1EV4 A;  2J9H A;  1EOH A;  5DQS A;  5J4V A;  1TU7 A;  3IR4 A;  1Q4J A;  4G0K A;  2F3M A;  1F3B A;  1Z9H A;  3KMN A;  4OFM A;  2EFH A;  5D9W A;  3Q19 A;  1V2A A;  4ZBA A;  2WRT A;  1BG1 A;  3N9J A;  3QR6 A;  1LJR A;  4JBB A;  5GST A;  3LJR A;  1V40 A;  1YDK A;  5DJM A;  2WW2 A;  3KM6 A;  1SVM A;  5BMU A;  4Q5R A;  3IBH A;  1ZGN A;  4EDY A;  2F8F A;  4PNG A;  1RK4 A;  2WZS A;  4KX4 A;  2WJU A;  3W8S A;  2IMK A;  8GSS A;  3PGT A;  2GSS A;  5LD0 A;  5EL8 A;  3ISO A;  2R3X A;  4PGT A;  4K0G A;  2ON5 A;  4AKG A;  2GSR A;  3FR9 A;  2WDU A;  3SWL A; 
#chains in the Genus database with same CATH homology
 2HSN A;  1FW1 A;  1GWC A;  5A4U A;  4ZB8 A;  2FNO A;  1AQV A;  2WS2 A;  2ON7 A;  3UBK A;  5F06 A;  4KGI A;  18GS A;  1A0F A;  3O76 A;  3VK9 A;  4BVY B;  5D9V A;  1EOG A;  3LXZ A;  4EDZ A;  5J4U A;  5FWG A;  4L8E A;  5GZZ B;  3WD6 A;  3FY7 A;  5F8B A;  1N25 A;  1B4P A;  2UZ8 A;  6GSU A;  4MPG A;  5J40 A;  5DAK A;  4IKH A;  6GSY A;  5D73 A;  5ECO B;  2FHE A;  6GSW A;  3I6A A;  1TW9 A;  5A1N B;  1M99 A;  2IMI A;  4YQV A;  3FRC A;  4MK3 A;  4ZXG A;  4HI7 A;  1R5A A;  3LYP A;  5HFK A;  4DEJ A;  1YQ1 A;  1PN9 A;  1EEM A;  5AN1 A;  1GSD A;  2CAQ A;  3CSI A;  3DD3 A;  4YAV A;  2HSM B;  1EV9 A;  3VUR A;  2VD0 A;  10GS A;  16GS A;  1C72 A;  2DC5 A;  5A4V A;  4ECC A;  3CRU A;  4AGS A;  3HMJ G;  1K3O A;  4HZ4 A;  4KDX A;  5A5H B;  1GUH A;  1K0A A;  5ECH B;  4MF5 A;  5F05 A;  3QAW A;  2V6K A;  2DSA A;  2PMT A;  3I69 A;  5DJL A;  3FR3 A;  3M0F A;  4ZB9 A;  1GTI A;  1K0M A;  2AAW A;  5ELA A;  1AQX A;  4L5L A;  1M0U A;  3VI7 A;  4RI6 A;  4PX1 A;  1TU8 A;  3U6V A;  6GSS A;  5ECQ B;  4ECB A;  2R5G A;  4ID0 A;  2YV9 A;  1Y6E A;  4OFN A;  2OT3 A;  3KJY A;  1E6B A;  4F03 A;  1ML6 A;  2LJR A;  4Q5Q A;  3O3T A;  4O7H A;  2EFC A;  3VI5 A;  3BBY A;  1PMT A;  1OKT A;  4IGJ A;  3ZFL A;  4F0B A;  3FYG A;  1YKC A;  5DCG A;  4IW9 A;  4KDY A;  1JLV A;  1PX6 A;  1OYJ A;  2O5V A;  2YCD A;  3RBT A;  2PBJ A;  2VCX A;  4AKH A;  1G6W A;  1GSQ A;  3R2Q A;  3F63 A;  1TDI A;  1G7O A;  4O92 A;  2GTU A;  2R6K A;  1GUM A;  3IK9 A;  4Q5N A;  3LG6 A;  3GTU B;  3LQ7 A;  3AY8 A;  5J5N A;  3F6F A;  5FHI A;  4GST A;  1BYE A;  4AKI A;  5ECS A;  4GF0 A;  4ZB6 A;  1PX7 A;  4MP4 A;  3TU3 B;  3GX0 A;  3ERF A;  3QAV A;  6GSV A;  2H1L A;  4KF9 A;  5ECN B;  2NTO A;  1GNE A;  1XWG A;  4MF6 A;  1HQO A;  3HJO A;  1K0N A;  4QQ7 A;  9GSS A;  4N3Z A;  5ECR B;  1JLW A;  2R4V A;  1GUK A;  2PGT A;  5EVO A;  2VCZ A;  22GS A;  3IK7 A;  3LYK A;  2AB6 A;  3WYW A;  3MDK A;  5BMU B;  5ELG A;  1AQW A;  4OMV A;  1GLP A;  2CVD A;  3CSJ A;  2VCQ A;  1VF2 A;  4QMK A;  7GSS A;  4G01 A;  3LFL A;  2N5F A;  2D2Z A;  1K0D A;  4E8H A;  4MF7 A;  3KMO A;  2IL3 A;  1XW5 A;  2C4J A;  4FQU A;  5G5E A;  1UA5 A;  4EE0 A;  3NIV A;  1MD4 A;  5FT3 A;  2OAC A;  4KE3 A;  2AHE A;  2VD1 A;  2HRK A;  2HSN B;  4GDF A;  4NAX A;  2X64 A;  5J41 A;  5A34 A;  2GDR A;  3UAR A;  4GSS A;  1PD2 1;  1U88 A;  1AXD A;  6GST A;  4L5O A;  5AIS A;  4MPF A;  3VLN A;  1NHY A;  20GS A;  3HJM A;  4G10 A;  3DGQ A;  4YQM A;  3F6D A;  5DAK B;  4LMW A;  3KTL A;  4BVX A;  3GH6 A;  2C80 A;  4EXJ A;  3UVH A;  3ZFB A;  3VPQ A;  3CSH A;  3D0Z A;  2C8U A;  1MD3 A;  4NHW A;  5DAL A;  4GTU A;  1VF3 A;  4IS0 A;  2CZ3 A;  4K0N A;  2VCV A;  1M9A A;  3C8E A;  4IQ1 A;  3EIN A;  5GSS A;  1VF4 A;  1GSY A;  4KAE A;  3LXT A;  2C3T A;  1HNC A;  1PL1 A;  4IJI A;  3ZML A;  1U3I A;  1LBK A;  4WR4 A;  3VWX A;  4BL7 A;  1PKZ A;  13GS A;  1K3L A;  5B7C A;  1HNA A;  4KH7 A;  4BVX B;  1VF1 A;  4PQH A;  5ECI B;  4ECI A;  5AIV A;  4YAP A;  4IQA A;  4ACS A;  5DDL A;  3GUR A;  5D9T A;  5DAL B;  1BF5 A;  2HNL A;  1N2A A;  4AI6 A;  1USB A;  1XW6 A;  2UV8 G;  1GUL A;  4HOJ A;  4Q5F A;  4J2F A;  3CBU A;  2VO4 A;  4JED A;  5EY6 A;  4EC0 A;  4PUA A;  4E8E A;  2EFE A;  6GSX A;  4LMV A;  4KSM A;  4BL7 B;  4ZB7 A;  3CWG A;  3L0H A;  4NHZ A;  4RI7 A;  5D9X A;  1BAY A;  4HJ2 A;  1M9B A;  4G0I A;  1GSU A;  2OAD A;  3Q18 A;  2CAI A;  4IEL A;  3UBL A;  1F3A A;  1MTC A;  3KXO A;  4MDC A;  1FHE A;  2HRA A;  1K3Y A;  3PPU A;  1PGT A;  17GS A;  5JCW A;  2A2S A;  1BX9 A;  2GLR A;  4WR5 A;  3P8W A;  4KDU A;  4N0V A;  4W66 A;  2C3N A;  11GS A;  1OE8 A;  2PVQ A;  4GSN A;  2HQT A;  4GCI A;  3M8N A;  5ECK B;  1GTB A;  1GSE A;  3G7I A;  2JL4 A;  3EE2 A;  2C3Q A;  1TXU A;  4BVY A;  1XWK A;  2PER A;  1PL2 A;  1G6Y A;  2CA8 A;  4G0L A;  5J4Y A;  1PKW A;  5LCZ A;  5AGY A;  5JCU A;  1F2E A;  1SVO A;  3LSZ A;  3Q74 A;  19GS A;  3ZMK A;  5F07 A;  3UAP A;  3GST A;  3R3E A;  1GLQ A;  14GS A;  4OFT A;  3N5O A;  5A1N A;  2A2R A;  4PXO A;  3GUS A;  1ZL9 A;  3IE3 A;  1OE7 A;  4PQI A;  5A4W A;  3P90 A;  1B48 A;  4G9H A;  4IBP A;  2HSM A;  2GST A;  3CRT A;  4ZBD A;  3MAK A;  4MZW A;  1GTA A;  1HNB A;  4ECJ A;  4YH2 A;  3M3M A;  1YVL A;  5ECM B;  1GTU A;  5A5H A;  4E68 A;  2CZ2 A;  2VCW A;  1BG5 A;  1K0O A;  3FR6 A;  4PTS A;  4I97 A;  2HRK B;  3GSS A;  3VPT A;  4IVF A;  2VCT A;  1KBN A;  3H1N A;  2YV7 A;  5A34 B;  5J47 A;  4CHS A;  4HZ2 A;  4F0C A;  3G7J A;  1B8X A;  3TOU A;  4PUR A;  1K0B A;  4ZBB A;  1K0C A;  2VKZ G;  5G5F A;  4G19 A;  4PNF A;  1GSF A;  3TGZ A;  4USS A;  2EFD A;  5KEJ A;  3HKR A;  12GS A;  5IQY A;  5F0G A;  5AIX A;  3IC8 A;  2WB9 A;  1SVL A;  2OA7 A;  1U87 A;  1YJ6 A;  1JZR A;  2GSQ A;  3QAG A;  4ISD A;  4TOP A;  1GSS A;  3GTU A;  3M1G A;  3TOT A;  1IYH A;  3PR8 A;  4JZQ A;  5ECL B;  1AW9 A;  3ERG A;  1Y1U A;  4AKX B;  1DUG A;  5ECP B;  4GLT A;  4YQU A;  5A5K A;  1IYI A;  1PA3 A;  1YY7 A;  1GNW A;  1EV4 A;  2J9H A;  1EOH A;  5DQS A;  5J4V A;  1TU7 A;  3IR4 A;  1Q4J A;  4G0K A;  2F3M A;  1F3B A;  1Z9H A;  3KMN A;  4OFM A;  2EFH A;  5D9W A;  3Q19 A;  1V2A A;  4ZBA A;  2WRT A;  1BG1 A;  3N9J A;  3QR6 A;  1LJR A;  4JBB A;  5GST A;  3LJR A;  1V40 A;  1YDK A;  5DJM A;  3KM6 A;  1SVM A;  5BMU A;  4Q5R A;  3IBH A;  1ZGN A;  4EDY A;  2F8F A;  4PNG A;  1RK4 A;  4KX4 A;  2WJU A;  3W8S A;  2IMK A;  8GSS A;  3PGT A;  2GSS A;  5LD0 A;  5EL8 A;  3ISO A;  2R3X A;  4PGT A;  4K0G A;  2ON5 A;  4AKG A;  2GSR A;  3FR9 A;  2WDU A;  3SWL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...