2HRKB

Structural basis of yeast aminoacyl-trna synthetase complex formation revealed by crystal structures of two binary sub-complexes
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
121
structure length
121
Chain Sequence
MSDLVTKFESLIISKYPVSFTKEQSAQAAQWESVLKSGQIQPHLDQLNLVLRDNTFIVSTLYPTSTDVHVFEVALPLIKDLVASSKDVKSTYTTYRHILRWIDYMQNLLEVSSTDKLEINH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/rna binding protein
molecule keywords Glutamyl-tRNA synthetase, cytoplasmic
publication title Structural basis of yeast aminoacyl-tRNA synthetase complex formation revealed by crystal structures of two binary sub-complexes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 41
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2006-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2hrkB00
1YKCA 1BG5A 4KDUA 3BBYA 3UAPA 5A4UA 3KJYA 2CVDA 3GUSA 2OA7A 1V40A 4N0VA 4IQAA 3N5OA 4MPGA 2HSMB 3GSSA 3P90A 1PMTA 4USSA 3Q18A 3FY7A 3ZMKA 17GSA 3QAGA 4G10A 1OE8A 2GDRA 5ECHB 2PGTA 2PVQA 2WDUA 1M9AA 4PQIA 3LG6A 4J2FA 1M9BA 3ERFA 4MF7A 1U87A 3FRCA 3N9JA 3IK7A 1OKTA 5B7CA 3H1NA 3KMNA 4Q5FA 3KTLA 1LJRA 4IQ1A 3UBKA 2GTUA 5G5EA 18GSA 3LSZA 3NIVA 1VF3A 3M3MA 3DD3A 5AN1A 1K3OA 4K0GA 1ML6A 4I97A 5EY6A 5IQYA 4IW9A 2IMKA 2VCZA 2HQTA 2LJRA 4ZB9A 4EE0A 3UVHA 2GSRA 2ON5A 3PR8A 1GLPA 5DDLA 3GURA 1HNBA 3O76A 5AIXA 1AQXA 5ELGA 6GSUA 5ECPB 4MDCA 1EEMA 2AHEA 3QAWA 4PNFA 3U6VA 1G7OA 1PL2A 4GCIA 4EXJA 3MAKA 2YV9A 4JZQA 1PKZA 6GSXA 3AY8A 2VCQA 4PUAA 3QR6A 6GSYA 2VCWA 1B4PA 3R2QA 7GSSA 4PURA 4F0BA 2R5GA 5DAKB 2C8UA 4OFNA 1GTIA 2PBJA 3CSJA 1R5AA 4ZB8A 3UARA 1Q4JA 4BVYA 3PGTA 1TW9A 1M0UA 3LFLA 3TGZA 3VI5A 1Z9HA 4ECIA 3L0HA 1F3AA 5F0GA 5DALA 5LD0A 4BL7A 4E8HA 3LXTA 5JCUA 1K0BA 4GTUA 4YH2A 2VD0A 2WB9A 3HKRA 3O3TA 3VURA 2A2RA 5F8BA 2DC5A 2ON7A 4O92A 2R6KA 2VCVA 2OADA 1ZGNA 5AISA 1UA5A 2VCTA 5F06A 3TOTA 2HSMA 3LYKA 3EINA 4DEJA 4NAXA 1GNEA 2C3NA 2CZ2A 2HRKB 1GSYA 4BVXB 22GSA 3QAVA 4PNGA 4F03A 4GSSA 1HQOA 1VF2A 2VO4A 5J4UA 3FR6A 4RI7A 4ZBAA 3EE2A 4WR4A 9GSSA 2GSSA 4MF6A 5AGYA 3R3EA 1TU7A 1VF1A 4MZWA 3TOUA 4IKHA 1GUHA 4IELA 4KDXA 5A4VA 3KM6A 1GWCA 1MD4A 1EV4A 2FHEA 4NHZA 2R4VA 1EOGA 4HJ2A 3IC8A 2C3TA 5EL8A 4TOPA 1TDIA 4KX4A 1ZL9A 3LXZA 1IYHA 5ECLB 4LMWA 1GNWA 4L5LA 1F2EA 1AQWA 1PD21 1GTUA 3GTUB 4IVFA 2AB6A 2CA8A 4L8EA 1PGTA 4Q5RA 4HOJA 4O7HA 1KBNA 2NTOA 1MTCA 5FHIA 5DJLA 2WS2A 2UZ8A 5A5KA 3VK9A 5J41A 3C8EA 1OE7A 1PL1A 4HI7A 8GSSA 2A2SA 4G19A 5D9TA 3G7JA 1GSQA 4OFTA 5A4WA 1AXDA 4G0KA 5ECNB 5D9VA 4ACSA 4ECCA 2IMIA 3F6FA 4JEDA 5D9WA 1IYIA 1XWGA 1A0FA 1K0NA 4YAVA 3I69A 3M1GA 1AQVA 4ZXGA 5DQSA 1USBA 1GTBA 5AIVA 1YY7A 5F07A 1N2AA 3VLNA 3VPTA 4EDZA 1NHYA 4HZ4A 1VF4A 1GTAA 3ERGA 12GSA 3P8WA 4G0LA 5GSTA 2WRTA 2GSTA 3CSHA 3IE3A 3VI7A 1K0DA 1V2AA 3CSIA 1K0CA 4KH7A 1K0AA 4RI6A 5ECRB 5F05A 1BYEA 1GLQA 4KDYA 3Q19A 4MP4A 4MF5A 11GSA 4LMVA 3LYPA 1F3BA 4NHWA 2GLRA 2VD1A 3MDKA 4GF0A 4G9HA 3DGQA 5ECKB 1GULA 5ECSA 6GSTA 4L5OA 1PX6A 2DSAA 2F8FA 4KSMA 1GSEA 2PMTA 2J9HA 2CAIA 1PKWA 4ECJA 3M8NA 5BMUA 3M0FA 4MK3A 1E6BA 1C72A 1LBKA 4BVXA 1JZRA 4MPFA 3GX0A 2JL4A 4YQMA 5LCZA 3D0ZA 2FNOA 2PERA 3PPUA 1XW5A 3IBHA 2CAQA 3VWXA 2C3QA 4FQUA 4CHSA 4PQHA 4WR5A 3LJRA 1JLVA 5ECMB 2AAWA 3RBTA 5HFKA 19GSA 4ISDA 1B8XA 6GSSA 4KAEA 1PX7A 1DUGA 5DALB 3IR4A 5GSSA 4G0IA 3GTUA 3CRTA 4ID0A 2CZ3A 3IK9A 20GSA 10GSA 3UBLA 2V6KA 1JLWA 4YAPA 3CBUA 2N5FA 3ZMLA 1K0OA 1XW6A 2OACA 3FR3A 4KF9A 5G5FA 4IBPA 3CRUA 4IGJA 1RK4A 3FR9A 4K0NA 4EDYA 4GLTA 2GSQA 2C80A 5DJMA 3WD6A 4YQVA 2IL3A 1K3YA 5DCGA 2HNLA 4OMVA 1U3IA 4JBBA 5J5NA 3I6AA 5FWGA 1YQ1A 3KMOA 4PGTA 3LQ7A 5DAKA 5JCWA 1OYJA 4KE3A 1K3LA 3G7IA 1K0MA 1G6YA 3FYGA 2WJUA 6GSWA 3F63A 4QQ7A 1Y6EA 1XWKA 1B48A 3ISOA 4PXOA 3HJMA 4ZB6A 2R3XA 3GH6A 3ZFBA 4YQUA 3Q74A 1GUKA 1PN9A 1FHEA 1BAYA 1HNCA 5ECIB 1AW9A 4KGIA 5ECOB 5KEJA 4IS0A 3WYWA 5D73A 2HSNB 2YV7A 4F0CA 16GSA 3GSTA 2HRAA 4EC0A 6GSVA 2VCXA 1GUMA 2X64A 1PA3A 14GSA 1EOHA 4PTSA 5EVOA 4ZBBA 5D9XA 3F6DA 3W8SA 1U88A 2D2ZA 4OFMA 3SWLA 2C4JA 2HRKA 5ELAA 4AGSA 2YCDA 3HJOA 4GSTA 4PX1A 1GSSA 1MD3A 1TU8A 5FT3A 1EV9A 4HZ2A 4GSNA 4ZBDA 1G6WA 1M99A 4Q5QA 4BVYB 5ECQB 1FW1A 1YJ6A 3VPQA 4IJIA 3ZFLA 13GSA 1HNAA 4BL7B 3KXOA 5GZZB 1YDKA 1GSDA 4Q5NA 4ECBA 1GSFA 4E8EA 2F3MA 1BX9A 1GSUA
chains in the Genus database with same CATH superfamily
1YKCA 1BG5A 4KDUA 3BBYA 3UAPA 5A4UA 3KJYA 2CVDA 3GUSA 2OA7A 1V40A 4N0VA 4IQAA 3N5OA 1I1IP 4MPGA 2HSMB 3GSSA 3P90A 1PMTA 4USSA 3Q18A 3FY7A 3ZMKA 17GSA 3QAGA 4G10A 1OE8A 2GDRA 5ECHB 2PGTA 2EFHA 2PVQA 2WDUA 1M9AA 1YVLA 4PQIA 3LG6A 4J2FA 4PI2C 1M9BA 3ERFA 4MF7A 1U87A 3FRCA 5A1NB 3N9JA 3HMJG 3IK7A 1OKTA 5B7CA 3H1NA 3KMNA 4Q5FA 3KTLA 2O3EA 1LJRA 4IQ1A 4W66A 3UBKA 2GTUA 5G5EA 18GSA 3LSZA 3NIVA 1VF3A 3M3MA 1BF5A 3DD3A 5AN1A 1K3OA 4K0GA 1ML6A 4I97A 4ZB7A 5EY6A 5IQYA 4IW9A 2IMKA 2VCZA 2HQTA 2LJRA 4ZB9A 4EE0A 3UVHA 2HSNA 2GSRA 2ON5A 3PR8A 1GLPA 5DDLA 3GURA 1HNBA 3O76A 5AIXA 1AQXA 5ELGA 4PI0C 6GSUA 5ECPB 4MDCA 1EEMA 2AHEA 3QAWA 4PNFA 3U6VA 1G7OA 1PL2A 4GCIA 4EXJA 3MAKA 2YV9A 4JZQA 1PKZA 6GSXA 3AY8A 2VCQA 4PUAA 3QR6A 6GSYA 2VCWA 1B4PA 3R2QA 7GSSA 4PURA 4F0BA 2R5GA 5DAKB 2C8UA 4OFNA 1GTIA 2PBJA 2H1LA 3CSJA 4AI6A 1R5AA 4ZB8A 3UARA 1Q4JA 5A34A 4BVYA 2WVXA 3PGTA 1TW9A 1M0UA 3LFLA 3TGZA 1SVOA 1Z9HA 3VI5A 4ECIA 3L0HA 1F3AA 5F0GA 5DALA 1N25A 5LD0A 4BL7A 4E8HA 3LXTA 5JCUA 1K0BA 4GTUA 4YH2A 2VD0A 2WB9A 3HKRA 3O3TA 3VURA 1YEWC 2A2RA 5F8BA 2DC5A 2ON7A 4O92A 2R6KA 2VCVA 2OADA 1ZGNA 5AISA 1UA5A 2VCTA 5F06A 3TOTA 2HSMA 3LYKA 3EINA 4N3ZA 4DEJA 5BMUB 4NAXA 1GNEA 2C3NA 2CZ2A 2EFDA 4AKHA 2HRKB 1GSYA 4BVXB 22GSA 3QAVA 4PNGA 4F03A 4GSSA 1HQOA 1VF2A 5J4VA 2VO4A 5J4UA 4AKGA 3FR6A 4RI7A 4ZBAA 3EE2A 4WR4A 5A1NA 9GSSA 2GSSA 4MF6A 5AGYA 3R3EA 1TU7A 1VF1A 4MZWA 3TOUA 4IKHA 1GUHA 4IELA 4KDXA 5A4VA 3KM6A 1GWCA 1MD4A 1EV4A 2FHEA 4NHZA 2R4VA 3RGBC 1EOGA 4HJ2A 3IC8A 2C3TA 5J40A 5EL8A 4TOPA 1TDIA 4KX4A 1ZL9A 3LXZA 4AKIA 1IYHA 5ECLB 4LMWA 1GNWA 4L5LA 1F2EA 1AQWA 2O5VA 1PD21 1GTUA 3GTUB 4IVFA 2AB6A 2CA8A 4L8EA 5A5HA 1PGTA 4Q5RA 4HOJA 4O7HA 1KBNA 2NTOA 1MTCA 5FHIA 5DJLA 2WS2A 2UZ8A 5A5KA 3VK9A 5J41A 3C8EA 2VKZG 1OE7A 1PL1A 4HI7A 4G01A 8GSSA 2A2SA 4G19A 5D9TA 3G7JA 1GSQA 4OFTA 5A4WA 1AXDA 4G0KA 5ECNB 5D9VA 4ACSA 4ECCA 1TXUA 2IMIA 3F6FA 5J47A 4JEDA 5D9WA 1IYIA 1XWGA 1A0FA 1S4BP 1K0NA 4YAVA 1Y1UA 3I69A 3M1GA 1AQVA 4ZXGA 5DQSA 1USBA 1GTBA 2WVYA 5AIVA 1YY7A 5F07A 1N2AA 3VLNA 3VPTA 4EDZA 1NHYA 4HZ4A 1VF4A 1GTAA 3ERGA 12GSA 3P8WA 4G0LA 5GSTA 2WRTA 2GSTA 3CSHA 3IE3A 3VI7A 1K0DA 1V2AA 3CSIA 1K0CA 4KH7A 1K0AA 4RI6A 5ECRB 5F05A 1BYEA 1GLQA 4KDYA 3Q19A 4MP4A 4MF5A 11GSA 4PHZC 4LMVA 3LYPA 1F3BA 4NHWA 2GLRA 2VD1A 3MDKA 4GF0A 4G9HA 3DGQA 5ECKB 1GULA 5ECSA 6GSTA 4L5OA 1PX6A 2DSAA 2F8FA 4KSMA 3CWGA 1GSEA 2PMTA 2J9HA 2CAIA 1PKWA 4ECJA 3M8NA 5BMUA 3M0FA 4MK3A 1E6BA 1C72A 1LBKA 4BVXA 1JZRA 4MPFA 3GX0A 2JL4A 4YQMA 5LCZA 3D0ZA 2FNOA 2PERA 3PPUA 1XW5A 3IBHA 2CAQA 3VWXA 2C3QA 4GDFA 2WW3A 4FQUA 4QMKA 3TU3B 4CHSA 4PQHA 4WR5A 3LJRA 1JLVA 5ECMB 2AAWA 3RBTA 5HFKA 19GSA 4ISDA 1B8XA 6GSSA 4KAEA 1PX7A 1DUGA 5DALB 3IR4A 5GSSA 1SVLA 4G0IA 3GTUA 3CRTA 4ID0A 2CZ3A 3IK9A 20GSA 2UV8G 10GSA 3UBLA 2V6KA 1JLWA 4YAPA 3CBUA 2N5FA 3ZMLA 1K0OA 1XW6A 2OACA 3FR3A 4KF9A 5G5FA 4IBPA 2WVZA 3CRUA 4IGJA 1RK4A 3FR9A 4K0NA 4EDYA 4GLTA 2GSQA 2C80A 5DJMA 3WD6A 4YQVA 2IL3A 1K3YA 5DCGA 2HNLA 4OMVA 1U3IA 4JBBA 5J5NA 3I6AA 5FWGA 1YQ1A 3KMOA 4PGTA 3LQ7A 5DAKA 4AKXB 1OYJA 4KE3A 1K3LA 5JCWA 3G7IA 1K0MA 1G6YA 3FYGA 2WJUA 6GSWA 3F63A 4QQ7A 1Y6EA 1XWKA 5A5HB 5J4YA 2WZSA 1B48A 3ISOA 4PXOA 3HJMA 4ZB6A 4E68A 2R3XA 3GH6A 2OT3A 1SVMA 4YQUA 1GUKA 3Q74A 3ZFBA 1PN9A 1FHEA 1BAYA 1HNCA 5ECIB 1AW9A 4KGIA 5ECOB 5KEJA 4IS0A 3WYWA 5D73A 2HSNB 2YV7A 4F0CA 16GSA 3GSTA 2HRAA 4EC0A 6GSVA 4FXYP 2VCXA 1GUMA 2X64A 1PA3A 14GSA 1EOHA 2WW0A 4PTSA 5EVOA 4ZBBA 5D9XA 3F6DA 3W8SA 1U88A 2D2ZA 4OFMA 3SWLA 2C4JA 2HRKA 2EFEA 3CHXC 5ELAA 4AGSA 2YCDA 3HJOA 4GSTA 4PX1A 1GSSA 1MD3A 1TU8A 5FT3A 2EFCA 1EV9A 4HZ2A 4GSNA 4ZBDA 5A34B 2WW1A 1G6WA 1M99A 4Q5QA 3RFRC 4BVYB 2WVXB 2WW2A 5ECQB 1FW1A 1YJ6A 3VPQA 4IJIA 3ZFLA 13GSA 2O36A 1HNAA 4BL7B 3KXOA 1BG1A 5GZZB 1YDKA 1GSDA 4Q5NA 4ECBA 1GSFA 4E8EA 2F3MA 1BX9A 1GSUA
chains in the Genus database with same CATH topology
1YKCA 1BG5A 4KDUA 3BBYA 3UAPA 5A4UA 3KJYA 2CVDA 3GUSA 2OA7A 1V40A 4N0VA 4IQAA 3N5OA 4MPGA 2HSMB 3GSSA 3P90A 1PMTA 4USSA 3Q18A 3FY7A 3ZMKA 17GSA 3QAGA 4G10A 1OE8A 2GDRA 5ECHB 2PGTA 2EFHA 2PVQA 2WDUA 1M9AA 1YVLA 4PQIA 3LG6A 4J2FA 1M9BA 3ERFA 4MF7A 1U87A 3FRCA 5A1NB 3N9JA 3HMJG 3IK7A 1OKTA 5B7CA 3H1NA 3KMNA 4Q5FA 3KTLA 1LJRA 4IQ1A 4W66A 3UBKA 2GTUA 5G5EA 18GSA 3LSZA 3NIVA 1VF3A 3M3MA 1BF5A 3DD3A 5AN1A 1K3OA 4K0GA 1ML6A 4I97A 4ZB7A 5EY6A 5IQYA 4IW9A 2IMKA 2VCZA 2HQTA 2LJRA 4ZB9A 4EE0A 3UVHA 2HSNA 2GSRA 2ON5A 3PR8A 1GLPA 5DDLA 3GURA 1HNBA 3O76A 5AIXA 1AQXA 5ELGA 6GSUA 5ECPB 4MDCA 1EEMA 2AHEA 3QAWA 4PNFA 3U6VA 1G7OA 1PL2A 4GCIA 4EXJA 3MAKA 2YV9A 4JZQA 1PKZA 6GSXA 3AY8A 2VCQA 4PUAA 3QR6A 6GSYA 2VCWA 1B4PA 3R2QA 7GSSA 4PURA 4F0BA 2R5GA 5DAKB 2C8UA 4OFNA 1GTIA 2PBJA 2H1LA 3CSJA 4AI6A 1R5AA 4ZB8A 3UARA 1Q4JA 5A34A 4BVYA 3PGTA 1TW9A 1M0UA 3LFLA 3TGZA 1SVOA 1Z9HA 3VI5A 4ECIA 3L0HA 1F3AA 5F0GA 5DALA 1N25A 5LD0A 4BL7A 4E8HA 3LXTA 5JCUA 1K0BA 4GTUA 4YH2A 2VD0A 2WB9A 3HKRA 3O3TA 3VURA 2A2RA 5F8BA 2DC5A 2ON7A 4O92A 2R6KA 2VCVA 2OADA 1ZGNA 5AISA 1UA5A 2VCTA 5F06A 3TOTA 2HSMA 3LYKA 3EINA 4N3ZA 4DEJA 5BMUB 4NAXA 1GNEA 2C3NA 2CZ2A 2EFDA 4AKHA 2HRKB 1GSYA 4BVXB 22GSA 3QAVA 4PNGA 4F03A 4GSSA 1HQOA 1VF2A 5J4VA 2VO4A 5J4UA 4AKGA 3FR6A 4RI7A 4ZBAA 3EE2A 4WR4A 5A1NA 9GSSA 2GSSA 4MF6A 5AGYA 3R3EA 1TU7A 1VF1A 4MZWA 3TOUA 4IKHA 1GUHA 4IELA 4KDXA 5A4VA 3KM6A 1GWCA 1MD4A 1EV4A 2FHEA 4NHZA 2R4VA 1EOGA 4HJ2A 3IC8A 2C3TA 5J40A 5EL8A 4TOPA 1TDIA 4KX4A 1ZL9A 3LXZA 4AKIA 1IYHA 5ECLB 4LMWA 1GNWA 4L5LA 1F2EA 1AQWA 2O5VA 1PD21 1GTUA 3GTUB 4IVFA 2AB6A 2CA8A 4L8EA 5A5HA 1PGTA 4Q5RA 4HOJA 4O7HA 1KBNA 2NTOA 1MTCA 5FHIA 5DJLA 2WS2A 2UZ8A 5A5KA 3VK9A 5J41A 3C8EA 2VKZG 1OE7A 1PL1A 4HI7A 4G01A 8GSSA 2A2SA 4G19A 5D9TA 3G7JA 1GSQA 4OFTA 5A4WA 1AXDA 4G0KA 5ECNB 5D9VA 4ACSA 4ECCA 1TXUA 2IMIA 3F6FA 5J47A 4JEDA 5D9WA 1IYIA 1XWGA 1A0FA 1K0NA 4YAVA 1Y1UA 3I69A 3M1GA 1AQVA 4ZXGA 5DQSA 1USBA 1GTBA 5AIVA 1YY7A 5F07A 1N2AA 3VLNA 3VPTA 4EDZA 1NHYA 4HZ4A 1VF4A 1GTAA 3ERGA 12GSA 3P8WA 4G0LA 5GSTA 2WRTA 2GSTA 3CSHA 3IE3A 3VI7A 1K0DA 1V2AA 3CSIA 1K0CA 4KH7A 1K0AA 4RI6A 5ECRB 5F05A 1BYEA 1GLQA 4KDYA 3Q19A 4MP4A 4MF5A 11GSA 4LMVA 3LYPA 1F3BA 4NHWA 2GLRA 2VD1A 3MDKA 4GF0A 4G9HA 3DGQA 5ECKB 1GULA 5ECSA 6GSTA 4L5OA 1PX6A 2DSAA 2F8FA 4KSMA 3CWGA 1GSEA 2PMTA 2J9HA 2CAIA 1PKWA 4ECJA 3M8NA 5BMUA 3M0FA 4MK3A 1E6BA 1C72A 1LBKA 4BVXA 1JZRA 4MPFA 3GX0A 2JL4A 4YQMA 5LCZA 3D0ZA 2FNOA 2PERA 3PPUA 1XW5A 3IBHA 2CAQA 3VWXA 2C3QA 4GDFA 4FQUA 4QMKA 3TU3B 4CHSA 4PQHA 4WR5A 3LJRA 1JLVA 5ECMB 2AAWA 3RBTA 5HFKA 19GSA 4ISDA 1B8XA 6GSSA 4KAEA 1PX7A 1DUGA 5DALB 3IR4A 5GSSA 1SVLA 4G0IA 3GTUA 3CRTA 4ID0A 2CZ3A 3IK9A 20GSA 2UV8G 10GSA 3UBLA 2V6KA 1JLWA 4YAPA 3CBUA 2N5FA 3ZMLA 1K0OA 1XW6A 2OACA 3FR3A 4KF9A 5G5FA 4IBPA 3CRUA 4IGJA 1RK4A 3FR9A 4K0NA 4EDYA 4GLTA 2GSQA 2C80A 5DJMA 3WD6A 4YQVA 2IL3A 1K3YA 5DCGA 2HNLA 4OMVA 1U3IA 4JBBA 5J5NA 3I6AA 5FWGA 1YQ1A 3KMOA 4PGTA 3LQ7A 5DAKA 4AKXB 1OYJA 4KE3A 1K3LA 5JCWA 3G7IA 1K0MA 1G6YA 3FYGA 2WJUA 6GSWA 3F63A 4QQ7A 1Y6EA 1XWKA 5A5HB 5J4YA 1B48A 3ISOA 4PXOA 3HJMA 4ZB6A 4E68A 2R3XA 3GH6A 2OT3A 1SVMA 4YQUA 1GUKA 3Q74A 3ZFBA 1PN9A 1FHEA 1BAYA 1HNCA 5ECIB 1AW9A 4KGIA 5ECOB 5KEJA 4IS0A 3WYWA 5D73A 2HSNB 2YV7A 4F0CA 16GSA 3GSTA 2HRAA 4EC0A 6GSVA 2VCXA 1GUMA 2X64A 1PA3A 14GSA 1EOHA 4PTSA 5EVOA 4ZBBA 5D9XA 3F6DA 3W8SA 1U88A 2D2ZA 4OFMA 3SWLA 2C4JA 2HRKA 2EFEA 5ELAA 4AGSA 2YCDA 3HJOA 4GSTA 4PX1A 1GSSA 1MD3A 1TU8A 5FT3A 2EFCA 1EV9A 4HZ2A 4GSNA 4ZBDA 5A34B 1G6WA 1M99A 4Q5QA 4BVYB 5ECQB 1FW1A 1YJ6A 3VPQA 4IJIA 3ZFLA 13GSA 1HNAA 4BL7B 3KXOA 1BG1A 5GZZB 1YDKA 1GSDA 4Q5NA 4ECBA 1GSFA 4E8EA 2F3MA 1BX9A 1GSUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YKC A;  1BG5 A;  4KDU A;  3BBY A;  3UAP A;  5A4U A;  3KJY A;  2CVD A;  3GUS A;  2OA7 A;  1V40 A;  4N0V A;  4IQA A;  3N5O A;  4MPG A;  2HSM B;  3GSS A;  3P90 A;  1PMT A;  4USS A;  3Q18 A;  3FY7 A;  3ZMK A;  17GS A;  3QAG A;  4G10 A;  1OE8 A;  2GDR A;  5ECH B;  2PGT A;  2PVQ A;  2WDU A;  1M9A A;  4PQI A;  3LG6 A;  4J2F A;  1M9B A;  3ERF A;  4MF7 A;  1U87 A;  3FRC A;  3N9J A;  3IK7 A;  1OKT A;  5B7C A;  3H1N A;  3KMN A;  4Q5F A;  3KTL A;  1LJR A;  4IQ1 A;  3UBK A;  2GTU A;  5G5E A;  18GS A;  3LSZ A;  3NIV A;  1VF3 A;  3M3M A;  3DD3 A;  5AN1 A;  1K3O A;  4K0G A;  1ML6 A;  4I97 A;  5EY6 A;  5IQY A;  4IW9 A;  2IMK A;  2VCZ A;  2HQT A;  2LJR A;  4ZB9 A;  4EE0 A;  3UVH A;  2GSR A;  2ON5 A;  3PR8 A;  1GLP A;  5DDL A;  3GUR A;  1HNB A;  3O76 A;  5AIX A;  1AQX A;  5ELG A;  6GSU A;  5ECP B;  4MDC A;  1EEM A;  2AHE A;  3QAW A;  4PNF A;  3U6V A;  1G7O A;  1PL2 A;  4GCI A;  4EXJ A;  3MAK A;  2YV9 A;  4JZQ A;  1PKZ A;  6GSX A;  3AY8 A;  2VCQ A;  4PUA A;  3QR6 A;  6GSY A;  2VCW A;  1B4P A;  3R2Q A;  7GSS A;  4PUR A;  4F0B A;  2R5G A;  5DAK B;  2C8U A;  4OFN A;  1GTI A;  2PBJ A;  3CSJ A;  1R5A A;  4ZB8 A;  3UAR A;  1Q4J A;  4BVY A;  3PGT A;  1TW9 A;  1M0U A;  3LFL A;  3TGZ A;  3VI5 A;  1Z9H A;  4ECI A;  3L0H A;  1F3A A;  5F0G A;  5DAL A;  5LD0 A;  4BL7 A;  4E8H A;  3LXT A;  5JCU A;  1K0B A;  4GTU A;  4YH2 A;  2VD0 A;  2WB9 A;  3HKR A;  3O3T A;  3VUR A;  2A2R A;  5F8B A;  2DC5 A;  2ON7 A;  4O92 A;  2R6K A;  2VCV A;  2OAD A;  1ZGN A;  5AIS A;  1UA5 A;  2VCT A;  5F06 A;  3TOT A;  2HSM A;  3LYK A;  3EIN A;  4DEJ A;  4NAX A;  1GNE A;  2C3N A;  2CZ2 A;  2HRK B;  1GSY A;  4BVX B;  22GS A;  3QAV A;  4PNG A;  4F03 A;  4GSS A;  1HQO A;  1VF2 A;  2VO4 A;  5J4U A;  3FR6 A;  4RI7 A;  4ZBA A;  3EE2 A;  4WR4 A;  9GSS A;  2GSS A;  4MF6 A;  5AGY A;  3R3E A;  1TU7 A;  1VF1 A;  4MZW A;  3TOU A;  4IKH A;  1GUH A;  4IEL A;  4KDX A;  5A4V A;  3KM6 A;  1GWC A;  1MD4 A;  1EV4 A;  2FHE A;  4NHZ A;  2R4V A;  1EOG A;  4HJ2 A;  3IC8 A;  2C3T A;  5EL8 A;  4TOP A;  1TDI A;  4KX4 A;  1ZL9 A;  3LXZ A;  1IYH A;  5ECL B;  4LMW A;  1GNW A;  4L5L A;  1F2E A;  1AQW A;  1PD2 1;  1GTU A;  3GTU B;  4IVF A;  2AB6 A;  2CA8 A;  4L8E A;  1PGT A;  4Q5R A;  4HOJ A;  4O7H A;  1KBN A;  2NTO A;  1MTC A;  5FHI A;  5DJL A;  2WS2 A;  2UZ8 A;  5A5K A;  3VK9 A;  5J41 A;  3C8E A;  1OE7 A;  1PL1 A;  4HI7 A;  8GSS A;  2A2S A;  4G19 A;  5D9T A;  3G7J A;  1GSQ A;  4OFT A;  5A4W A;  1AXD A;  4G0K A;  5ECN B;  5D9V A;  4ACS A;  4ECC A;  2IMI A;  3F6F A;  4JED A;  5D9W A;  1IYI A;  1XWG A;  1A0F A;  1K0N A;  4YAV A;  3I69 A;  3M1G A;  1AQV A;  4ZXG A;  5DQS A;  1USB A;  1GTB A;  5AIV A;  1YY7 A;  5F07 A;  1N2A A;  3VLN A;  3VPT A;  4EDZ A;  1NHY A;  4HZ4 A;  1VF4 A;  1GTA A;  3ERG A;  12GS A;  3P8W A;  4G0L A;  5GST A;  2WRT A;  2GST A;  3CSH A;  3IE3 A;  3VI7 A;  1K0D A;  1V2A A;  3CSI A;  1K0C A;  4KH7 A;  1K0A A;  4RI6 A;  5ECR B;  5F05 A;  1BYE A;  1GLQ A;  4KDY A;  3Q19 A;  4MP4 A;  4MF5 A;  11GS A;  4LMV A;  3LYP A;  1F3B A;  4NHW A;  2GLR A;  2VD1 A;  3MDK A;  4GF0 A;  4G9H A;  3DGQ A;  5ECK B;  1GUL A;  5ECS A;  6GST A;  4L5O A;  1PX6 A;  2DSA A;  2F8F A;  4KSM A;  1GSE A;  2PMT A;  2J9H A;  2CAI A;  1PKW A;  4ECJ A;  3M8N A;  5BMU A;  3M0F A;  4MK3 A;  1E6B A;  1C72 A;  1LBK A;  4BVX A;  1JZR A;  4MPF A;  3GX0 A;  2JL4 A;  4YQM A;  5LCZ A;  3D0Z A;  2FNO A;  2PER A;  3PPU A;  1XW5 A;  3IBH A;  2CAQ A;  3VWX A;  2C3Q A;  4FQU A;  4CHS A;  4PQH A;  4WR5 A;  3LJR A;  1JLV A;  5ECM B;  2AAW A;  3RBT A;  5HFK A;  19GS A;  4ISD A;  1B8X A;  6GSS A;  4KAE A;  1PX7 A;  1DUG A;  5DAL B;  3IR4 A;  5GSS A;  4G0I A;  3GTU A;  3CRT A;  4ID0 A;  2CZ3 A;  3IK9 A;  20GS A;  10GS A;  3UBL A;  2V6K A;  1JLW A;  4YAP A;  3CBU A;  2N5F A;  3ZML A;  1K0O A;  1XW6 A;  2OAC A;  3FR3 A;  4KF9 A;  5G5F A;  4IBP A;  3CRU A;  4IGJ A;  1RK4 A;  3FR9 A;  4K0N A;  4EDY A;  4GLT A;  2GSQ A;  2C80 A;  5DJM A;  3WD6 A;  4YQV A;  2IL3 A;  1K3Y A;  5DCG A;  2HNL A;  4OMV A;  1U3I A;  4JBB A;  5J5N A;  3I6A A;  5FWG A;  1YQ1 A;  3KMO A;  4PGT A;  3LQ7 A;  5DAK A;  5JCW A;  1OYJ A;  4KE3 A;  1K3L A;  3G7I A;  1K0M A;  1G6Y A;  3FYG A;  2WJU A;  6GSW A;  3F63 A;  4QQ7 A;  1Y6E A;  1XWK A;  1B48 A;  3ISO A;  4PXO A;  3HJM A;  4ZB6 A;  2R3X A;  3GH6 A;  3ZFB A;  4YQU A;  3Q74 A;  1GUK A;  1PN9 A;  1FHE A;  1BAY A;  1HNC A;  5ECI B;  1AW9 A;  4KGI A;  5ECO B;  5KEJ A;  4IS0 A;  3WYW A;  5D73 A;  2HSN B;  2YV7 A;  4F0C A;  16GS A;  3GST A;  2HRA A;  4EC0 A;  6GSV A;  2VCX A;  1GUM A;  2X64 A;  1PA3 A;  14GS A;  1EOH A;  4PTS A;  5EVO A;  4ZBB A;  5D9X A;  3F6D A;  3W8S A;  1U88 A;  2D2Z A;  4OFM A;  3SWL A;  2C4J A;  2HRK A;  5ELA A;  4AGS A;  2YCD A;  3HJO A;  4GST A;  4PX1 A;  1GSS A;  1MD3 A;  1TU8 A;  5FT3 A;  1EV9 A;  4HZ2 A;  4GSN A;  4ZBD A;  1G6W A;  1M99 A;  4Q5Q A;  4BVY B;  5ECQ B;  1FW1 A;  1YJ6 A;  3VPQ A;  4IJI A;  3ZFL A;  13GS A;  1HNA A;  4BL7 B;  3KXO A;  5GZZ B;  1YDK A;  1GSD A;  4Q5N A;  4ECB A;  1GSF A;  4E8E A;  2F3M A;  1BX9 A;  1GSU A; 
#chains in the Genus database with same CATH topology
 1YKC A;  1BG5 A;  4KDU A;  3BBY A;  3UAP A;  5A4U A;  3KJY A;  2CVD A;  3GUS A;  2OA7 A;  1V40 A;  4N0V A;  4IQA A;  3N5O A;  1I1I P;  4MPG A;  2HSM B;  3GSS A;  3P90 A;  1PMT A;  4USS A;  3Q18 A;  3FY7 A;  3ZMK A;  17GS A;  3QAG A;  4G10 A;  1OE8 A;  2GDR A;  5ECH B;  2PGT A;  2EFH A;  2PVQ A;  2WDU A;  1M9A A;  1YVL A;  4PQI A;  3LG6 A;  4J2F A;  4PI2 C;  1M9B A;  3ERF A;  4MF7 A;  1U87 A;  3FRC A;  5A1N B;  3N9J A;  3HMJ G;  3IK7 A;  1OKT A;  5B7C A;  3H1N A;  3KMN A;  4Q5F A;  3KTL A;  2O3E A;  1LJR A;  4IQ1 A;  4W66 A;  3UBK A;  2GTU A;  5G5E A;  18GS A;  3LSZ A;  3NIV A;  1VF3 A;  3M3M A;  1BF5 A;  3DD3 A;  5AN1 A;  1K3O A;  4K0G A;  1ML6 A;  4I97 A;  4ZB7 A;  5EY6 A;  5IQY A;  4IW9 A;  2IMK A;  2VCZ A;  2HQT A;  2LJR A;  4ZB9 A;  4EE0 A;  3UVH A;  2HSN A;  2GSR A;  2ON5 A;  3PR8 A;  1GLP A;  5DDL A;  3GUR A;  1HNB A;  3O76 A;  5AIX A;  1AQX A;  5ELG A;  4PI0 C;  6GSU A;  5ECP B;  4MDC A;  1EEM A;  2AHE A;  3QAW A;  4PNF A;  3U6V A;  1G7O A;  1PL2 A;  4GCI A;  4EXJ A;  3MAK A;  2YV9 A;  4JZQ A;  1PKZ A;  6GSX A;  3AY8 A;  2VCQ A;  4PUA A;  3QR6 A;  6GSY A;  2VCW A;  1B4P A;  3R2Q A;  7GSS A;  4PUR A;  4F0B A;  2R5G A;  5DAK B;  2C8U A;  4OFN A;  1GTI A;  2PBJ A;  2H1L A;  3CSJ A;  4AI6 A;  1R5A A;  4ZB8 A;  3UAR A;  1Q4J A;  5A34 A;  4BVY A;  2WVX A;  3PGT A;  1TW9 A;  1M0U A;  3LFL A;  3TGZ A;  1SVO A;  1Z9H A;  3VI5 A;  4ECI A;  3L0H A;  1F3A A;  5F0G A;  5DAL A;  1N25 A;  5LD0 A;  4BL7 A;  4E8H A;  3LXT A;  5JCU A;  1K0B A;  4GTU A;  4YH2 A;  2VD0 A;  2WB9 A;  3HKR A;  3O3T A;  3VUR A;  1YEW C;  2A2R A;  5F8B A;  2DC5 A;  2ON7 A;  4O92 A;  2R6K A;  2VCV A;  2OAD A;  1ZGN A;  5AIS A;  1UA5 A;  2VCT A;  5F06 A;  3TOT A;  2HSM A;  3LYK A;  3EIN A;  4N3Z A;  4DEJ A;  5BMU B;  4NAX A;  1GNE A;  2C3N A;  2CZ2 A;  2EFD A;  4AKH A;  2HRK B;  1GSY A;  4BVX B;  22GS A;  3QAV A;  4PNG A;  4F03 A;  4GSS A;  1HQO A;  1VF2 A;  5J4V A;  2VO4 A;  5J4U A;  4AKG A;  3FR6 A;  4RI7 A;  4ZBA A;  3EE2 A;  4WR4 A;  5A1N A;  9GSS A;  2GSS A;  4MF6 A;  5AGY A;  3R3E A;  1TU7 A;  1VF1 A;  4MZW A;  3TOU A;  4IKH A;  1GUH A;  4IEL A;  4KDX A;  5A4V A;  3KM6 A;  1GWC A;  1MD4 A;  1EV4 A;  2FHE A;  4NHZ A;  2R4V A;  3RGB C;  1EOG A;  4HJ2 A;  3IC8 A;  2C3T A;  5J40 A;  5EL8 A;  4TOP A;  1TDI A;  4KX4 A;  1ZL9 A;  3LXZ A;  4AKI A;  1IYH A;  5ECL B;  4LMW A;  1GNW A;  4L5L A;  1F2E A;  1AQW A;  2O5V A;  1PD2 1;  1GTU A;  3GTU B;  4IVF A;  2AB6 A;  2CA8 A;  4L8E A;  5A5H A;  1PGT A;  4Q5R A;  4HOJ A;  4O7H A;  1KBN A;  2NTO A;  1MTC A;  5FHI A;  5DJL A;  2WS2 A;  2UZ8 A;  5A5K A;  3VK9 A;  5J41 A;  3C8E A;  2VKZ G;  1OE7 A;  1PL1 A;  4HI7 A;  4G01 A;  8GSS A;  2A2S A;  4G19 A;  5D9T A;  3G7J A;  1GSQ A;  4OFT A;  5A4W A;  1AXD A;  4G0K A;  5ECN B;  5D9V A;  4ACS A;  4ECC A;  1TXU A;  2IMI A;  3F6F A;  5J47 A;  4JED A;  5D9W A;  1IYI A;  1XWG A;  1A0F A;  1S4B P;  1K0N A;  4YAV A;  1Y1U A;  3I69 A;  3M1G A;  1AQV A;  4ZXG A;  5DQS A;  1USB A;  1GTB A;  2WVY A;  5AIV A;  1YY7 A;  5F07 A;  1N2A A;  3VLN A;  3VPT A;  4EDZ A;  1NHY A;  4HZ4 A;  1VF4 A;  1GTA A;  3ERG A;  12GS A;  3P8W A;  4G0L A;  5GST A;  2WRT A;  2GST A;  3CSH A;  3IE3 A;  3VI7 A;  1K0D A;  1V2A A;  3CSI A;  1K0C A;  4KH7 A;  1K0A A;  4RI6 A;  5ECR B;  5F05 A;  1BYE A;  1GLQ A;  4KDY A;  3Q19 A;  4MP4 A;  4MF5 A;  11GS A;  4PHZ C;  4LMV A;  3LYP A;  1F3B A;  4NHW A;  2GLR A;  2VD1 A;  3MDK A;  4GF0 A;  4G9H A;  3DGQ A;  5ECK B;  1GUL A;  5ECS A;  6GST A;  4L5O A;  1PX6 A;  2DSA A;  2F8F A;  4KSM A;  3CWG A;  1GSE A;  2PMT A;  2J9H A;  2CAI A;  1PKW A;  4ECJ A;  3M8N A;  5BMU A;  3M0F A;  4MK3 A;  1E6B A;  1C72 A;  1LBK A;  4BVX A;  1JZR A;  4MPF A;  3GX0 A;  2JL4 A;  4YQM A;  5LCZ A;  3D0Z A;  2FNO A;  2PER A;  3PPU A;  1XW5 A;  3IBH A;  2CAQ A;  3VWX A;  2C3Q A;  4GDF A;  2WW3 A;  4FQU A;  4QMK A;  3TU3 B;  4CHS A;  4PQH A;  4WR5 A;  3LJR A;  1JLV A;  5ECM B;  2AAW A;  3RBT A;  5HFK A;  19GS A;  4ISD A;  1B8X A;  6GSS A;  4KAE A;  1PX7 A;  1DUG A;  5DAL B;  3IR4 A;  5GSS A;  1SVL A;  4G0I A;  3GTU A;  3CRT A;  4ID0 A;  2CZ3 A;  3IK9 A;  20GS A;  2UV8 G;  10GS A;  3UBL A;  2V6K A;  1JLW A;  4YAP A;  3CBU A;  2N5F A;  3ZML A;  1K0O A;  1XW6 A;  2OAC A;  3FR3 A;  4KF9 A;  5G5F A;  4IBP A;  2WVZ A;  3CRU A;  4IGJ A;  1RK4 A;  3FR9 A;  4K0N A;  4EDY A;  4GLT A;  2GSQ A;  2C80 A;  5DJM A;  3WD6 A;  4YQV A;  2IL3 A;  1K3Y A;  5DCG A;  2HNL A;  4OMV A;  1U3I A;  4JBB A;  5J5N A;  3I6A A;  5FWG A;  1YQ1 A;  3KMO A;  4PGT A;  3LQ7 A;  5DAK A;  4AKX B;  1OYJ A;  4KE3 A;  1K3L A;  5JCW A;  3G7I A;  1K0M A;  1G6Y A;  3FYG A;  2WJU A;  6GSW A;  3F63 A;  4QQ7 A;  1Y6E A;  1XWK A;  5A5H B;  5J4Y A;  2WZS A;  1B48 A;  3ISO A;  4PXO A;  3HJM A;  4ZB6 A;  4E68 A;  2R3X A;  3GH6 A;  2OT3 A;  1SVM A;  4YQU A;  1GUK A;  3Q74 A;  3ZFB A;  1PN9 A;  1FHE A;  1BAY A;  1HNC A;  5ECI B;  1AW9 A;  4KGI A;  5ECO B;  5KEJ A;  4IS0 A;  3WYW A;  5D73 A;  2HSN B;  2YV7 A;  4F0C A;  16GS A;  3GST A;  2HRA A;  4EC0 A;  6GSV A;  4FXY P;  2VCX A;  1GUM A;  2X64 A;  1PA3 A;  14GS A;  1EOH A;  2WW0 A;  4PTS A;  5EVO A;  4ZBB A;  5D9X A;  3F6D A;  3W8S A;  1U88 A;  2D2Z A;  4OFM A;  3SWL A;  2C4J A;  2HRK A;  2EFE A;  3CHX C;  5ELA A;  4AGS A;  2YCD A;  3HJO A;  4GST A;  4PX1 A;  1GSS A;  1MD3 A;  1TU8 A;  5FT3 A;  2EFC A;  1EV9 A;  4HZ2 A;  4GSN A;  4ZBD A;  5A34 B;  2WW1 A;  1G6W A;  1M99 A;  4Q5Q A;  3RFR C;  4BVY B;  2WVX B;  2WW2 A;  5ECQ B;  1FW1 A;  1YJ6 A;  3VPQ A;  4IJI A;  3ZFL A;  13GS A;  2O36 A;  1HNA A;  4BL7 B;  3KXO A;  1BG1 A;  5GZZ B;  1YDK A;  1GSD A;  4Q5N A;  4ECB A;  1GSF A;  4E8E A;  2F3M A;  1BX9 A;  1GSU A; 
#chains in the Genus database with same CATH homology
 1YKC A;  1BG5 A;  4KDU A;  3BBY A;  3UAP A;  5A4U A;  3KJY A;  2CVD A;  3GUS A;  2OA7 A;  1V40 A;  4N0V A;  4IQA A;  3N5O A;  4MPG A;  2HSM B;  3GSS A;  3P90 A;  1PMT A;  4USS A;  3Q18 A;  3FY7 A;  3ZMK A;  17GS A;  3QAG A;  4G10 A;  1OE8 A;  2GDR A;  5ECH B;  2PGT A;  2EFH A;  2PVQ A;  2WDU A;  1M9A A;  1YVL A;  4PQI A;  3LG6 A;  4J2F A;  1M9B A;  3ERF A;  4MF7 A;  1U87 A;  3FRC A;  5A1N B;  3N9J A;  3HMJ G;  3IK7 A;  1OKT A;  5B7C A;  3H1N A;  3KMN A;  4Q5F A;  3KTL A;  1LJR A;  4IQ1 A;  4W66 A;  3UBK A;  2GTU A;  5G5E A;  18GS A;  3LSZ A;  3NIV A;  1VF3 A;  3M3M A;  1BF5 A;  3DD3 A;  5AN1 A;  1K3O A;  4K0G A;  1ML6 A;  4I97 A;  4ZB7 A;  5EY6 A;  5IQY A;  4IW9 A;  2IMK A;  2VCZ A;  2HQT A;  2LJR A;  4ZB9 A;  4EE0 A;  3UVH A;  2HSN A;  2GSR A;  2ON5 A;  3PR8 A;  1GLP A;  5DDL A;  3GUR A;  1HNB A;  3O76 A;  5AIX A;  1AQX A;  5ELG A;  6GSU A;  5ECP B;  4MDC A;  1EEM A;  2AHE A;  3QAW A;  4PNF A;  3U6V A;  1G7O A;  1PL2 A;  4GCI A;  4EXJ A;  3MAK A;  2YV9 A;  4JZQ A;  1PKZ A;  6GSX A;  3AY8 A;  2VCQ A;  4PUA A;  3QR6 A;  6GSY A;  2VCW A;  1B4P A;  3R2Q A;  7GSS A;  4PUR A;  4F0B A;  2R5G A;  5DAK B;  2C8U A;  4OFN A;  1GTI A;  2PBJ A;  2H1L A;  3CSJ A;  4AI6 A;  1R5A A;  4ZB8 A;  3UAR A;  1Q4J A;  5A34 A;  4BVY A;  3PGT A;  1TW9 A;  1M0U A;  3LFL A;  3TGZ A;  1SVO A;  1Z9H A;  3VI5 A;  4ECI A;  3L0H A;  1F3A A;  5F0G A;  5DAL A;  1N25 A;  5LD0 A;  4BL7 A;  4E8H A;  3LXT A;  5JCU A;  1K0B A;  4GTU A;  4YH2 A;  2VD0 A;  2WB9 A;  3HKR A;  3O3T A;  3VUR A;  2A2R A;  5F8B A;  2DC5 A;  2ON7 A;  4O92 A;  2R6K A;  2VCV A;  2OAD A;  1ZGN A;  5AIS A;  1UA5 A;  2VCT A;  5F06 A;  3TOT A;  2HSM A;  3LYK A;  3EIN A;  4N3Z A;  4DEJ A;  5BMU B;  4NAX A;  1GNE A;  2C3N A;  2CZ2 A;  2EFD A;  4AKH A;  2HRK B;  1GSY A;  4BVX B;  22GS A;  3QAV A;  4PNG A;  4F03 A;  4GSS A;  1HQO A;  1VF2 A;  5J4V A;  2VO4 A;  5J4U A;  4AKG A;  3FR6 A;  4RI7 A;  4ZBA A;  3EE2 A;  4WR4 A;  5A1N A;  9GSS A;  2GSS A;  4MF6 A;  5AGY A;  3R3E A;  1TU7 A;  1VF1 A;  4MZW A;  3TOU A;  4IKH A;  1GUH A;  4IEL A;  4KDX A;  5A4V A;  3KM6 A;  1GWC A;  1MD4 A;  1EV4 A;  2FHE A;  4NHZ A;  2R4V A;  1EOG A;  4HJ2 A;  3IC8 A;  2C3T A;  5J40 A;  5EL8 A;  4TOP A;  1TDI A;  4KX4 A;  1ZL9 A;  3LXZ A;  4AKI A;  1IYH A;  5ECL B;  4LMW A;  1GNW A;  4L5L A;  1F2E A;  1AQW A;  2O5V A;  1PD2 1;  1GTU A;  3GTU B;  4IVF A;  2AB6 A;  2CA8 A;  4L8E A;  5A5H A;  1PGT A;  4Q5R A;  4HOJ A;  4O7H A;  1KBN A;  2NTO A;  1MTC A;  5FHI A;  5DJL A;  2WS2 A;  2UZ8 A;  5A5K A;  3VK9 A;  5J41 A;  3C8E A;  2VKZ G;  1OE7 A;  1PL1 A;  4HI7 A;  4G01 A;  8GSS A;  2A2S A;  4G19 A;  5D9T A;  3G7J A;  1GSQ A;  4OFT A;  5A4W A;  1AXD A;  4G0K A;  5ECN B;  5D9V A;  4ACS A;  4ECC A;  1TXU A;  2IMI A;  3F6F A;  5J47 A;  4JED A;  5D9W A;  1IYI A;  1XWG A;  1A0F A;  1K0N A;  4YAV A;  1Y1U A;  3I69 A;  3M1G A;  1AQV A;  4ZXG A;  5DQS A;  1USB A;  1GTB A;  5AIV A;  1YY7 A;  5F07 A;  1N2A A;  3VLN A;  3VPT A;  4EDZ A;  1NHY A;  4HZ4 A;  1VF4 A;  1GTA A;  3ERG A;  12GS A;  3P8W A;  4G0L A;  5GST A;  2WRT A;  2GST A;  3CSH A;  3IE3 A;  3VI7 A;  1K0D A;  1V2A A;  3CSI A;  1K0C A;  4KH7 A;  1K0A A;  4RI6 A;  5ECR B;  5F05 A;  1BYE A;  1GLQ A;  4KDY A;  3Q19 A;  4MP4 A;  4MF5 A;  11GS A;  4LMV A;  3LYP A;  1F3B A;  4NHW A;  2GLR A;  2VD1 A;  3MDK A;  4GF0 A;  4G9H A;  3DGQ A;  5ECK B;  1GUL A;  5ECS A;  6GST A;  4L5O A;  1PX6 A;  2DSA A;  2F8F A;  4KSM A;  3CWG A;  1GSE A;  2PMT A;  2J9H A;  2CAI A;  1PKW A;  4ECJ A;  3M8N A;  5BMU A;  3M0F A;  4MK3 A;  1E6B A;  1C72 A;  1LBK A;  4BVX A;  1JZR A;  4MPF A;  3GX0 A;  2JL4 A;  4YQM A;  5LCZ A;  3D0Z A;  2FNO A;  2PER A;  3PPU A;  1XW5 A;  3IBH A;  2CAQ A;  3VWX A;  2C3Q A;  4GDF A;  4FQU A;  4QMK A;  3TU3 B;  4CHS A;  4PQH A;  4WR5 A;  3LJR A;  1JLV A;  5ECM B;  2AAW A;  3RBT A;  5HFK A;  19GS A;  4ISD A;  1B8X A;  6GSS A;  4KAE A;  1PX7 A;  1DUG A;  5DAL B;  3IR4 A;  5GSS A;  1SVL A;  4G0I A;  3GTU A;  3CRT A;  4ID0 A;  2CZ3 A;  3IK9 A;  20GS A;  2UV8 G;  10GS A;  3UBL A;  2V6K A;  1JLW A;  4YAP A;  3CBU A;  2N5F A;  3ZML A;  1K0O A;  1XW6 A;  2OAC A;  3FR3 A;  4KF9 A;  5G5F A;  4IBP A;  3CRU A;  4IGJ A;  1RK4 A;  3FR9 A;  4K0N A;  4EDY A;  4GLT A;  2GSQ A;  2C80 A;  5DJM A;  3WD6 A;  4YQV A;  2IL3 A;  1K3Y A;  5DCG A;  2HNL A;  4OMV A;  1U3I A;  4JBB A;  5J5N A;  3I6A A;  5FWG A;  1YQ1 A;  3KMO A;  4PGT A;  3LQ7 A;  5DAK A;  4AKX B;  1OYJ A;  4KE3 A;  1K3L A;  5JCW A;  3G7I A;  1K0M A;  1G6Y A;  3FYG A;  2WJU A;  6GSW A;  3F63 A;  4QQ7 A;  1Y6E A;  1XWK A;  5A5H B;  5J4Y A;  1B48 A;  3ISO A;  4PXO A;  3HJM A;  4ZB6 A;  4E68 A;  2R3X A;  3GH6 A;  2OT3 A;  1SVM A;  4YQU A;  1GUK A;  3Q74 A;  3ZFB A;  1PN9 A;  1FHE A;  1BAY A;  1HNC A;  5ECI B;  1AW9 A;  4KGI A;  5ECO B;  5KEJ A;  4IS0 A;  3WYW A;  5D73 A;  2HSN B;  2YV7 A;  4F0C A;  16GS A;  3GST A;  2HRA A;  4EC0 A;  6GSV A;  2VCX A;  1GUM A;  2X64 A;  1PA3 A;  14GS A;  1EOH A;  4PTS A;  5EVO A;  4ZBB A;  5D9X A;  3F6D A;  3W8S A;  1U88 A;  2D2Z A;  4OFM A;  3SWL A;  2C4J A;  2HRK A;  2EFE A;  5ELA A;  4AGS A;  2YCD A;  3HJO A;  4GST A;  4PX1 A;  1GSS A;  1MD3 A;  1TU8 A;  5FT3 A;  2EFC A;  1EV9 A;  4HZ2 A;  4GSN A;  4ZBD A;  5A34 B;  1G6W A;  1M99 A;  4Q5Q A;  4BVY B;  5ECQ B;  1FW1 A;  1YJ6 A;  3VPQ A;  4IJI A;  3ZFL A;  13GS A;  1HNA A;  4BL7 B;  3KXO A;  1BG1 A;  5GZZ B;  1YDK A;  1GSD A;  4Q5N A;  4ECB A;  1GSF A;  4E8E A;  2F3M A;  1BX9 A;  1GSU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...