4ZXGA

Ligandin binding site of pfgst
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
204
structure length
201
Chain Sequence
DNIVLYYFDARGKAELIRLIFAYLGIEYTDKRFGVNGDAFVEFKNFKKEKDTPFEQVPILQIGDLILAQSQAIVRYLSKKYNICGESELNEFYADMIFCGVQDIHYKFNNTNLFKQNETTFLNEDLPKWSGYFEKLLKKNHTNNNKYYFVGNNLTYADLAVFNLYDDIETKYPSLKNFPLLKAHNEFISNLPNIKNYITNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase
publication title High resolution structures of Plasmodium falciparum GST complexes provide novel insights into the dimer-tetramer transition and a novel ligand-binding site.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Transferase
total genus 72
structure length 201
sequence length 204
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2015-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4zxgA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4zxgA01
1E6BA 4KSMA 3H93A 1TU7A 5DDLA 2H8LA 3D22A 3MWHA 4HOJA 2B5EA 3ZMLA 3GL5A 3CYNA 4MMMA 4TRXA 2LQOA 4IS0A 4HZ4A 4IN0A 2KUCA 4CDOA 2C3TA 2LQQA 2H73A 2CAIA 2R4VA 4MJAA 1HNCA 4K7NA 1OC3A 2J23A 2XC2A 3GSSA 3UVTA 1KBNA 4EXJA 11GSA 3GX8A 4MJCA 2YCDA 3BBYA 2GQMA 2PMTA 5B6MA 2OA7A 2H74A 1GSDA 4MPGA 1TW9A 5FT3A 1HNBA 2DJKA 4MPFA 4WR4A 4I2UA 3CRUA 2J9HA 2E2GA 4YQUA 2ZCTA 1O7UA 3HZ8A 3A2VA 2VL9A 4TXVA 1TRVA 4PQ1A 1XOAA 3TOUA 1QK8A 2P0GA 5KEJA 1WE0A 1T4ZA 1XWGA 2HLSA 5AIVA 2FA4A 1OC8A 5J3RA 3F4RA 5ECSA 2PGTA 4POMA 2YPMA 4EE0A 20GSA 1LBKA 1F3AA 4O7HA 4TXOB 2A2SA 2O87A 3ME7A 2YP6A 1JHBA 3TJGA 1SKSB 5HR2A 1TRWA 2KP2A 2DIYA 3ISOA 2GDRA 2GZZA 3CMIA 5JWOB 4JZQA 1TK8B 5B7CA 1A24A 5ELGA 3LWAA 4BL7B 2YV9A 2YJHA 3ZIVA 1BJXA 1SKWB 5C04A 3EC3A 5J41A 4IQ1A 3I9V2 4H86A 5FHIA 3VPTA 3VURA 2ALBA 1T00A 1TP9A 2H72A 2HRNA 3FZ9A 3P2AA 1K0CA 4N10A 2H76A 4Q5FA 4ZXGA 4G10A 1GTBA 4JR4A 4K1FA 3UJ1A 1ERVA 1N8JA 1YQ1A 1ZGNA 3WGDA 3GTUB 1TOFA 3A5WA 1NW2A 3TOTA 2F8AA 3IK9A 3KP9A 4TOPA 2H19A 1GUKA 1GSUA 2VLVA 3D6IA 2O85A 4K0GA 1R26A 4GRFA 2CAQA 2FGXA 1GULA 3DD3A 3C1RA 4TKYA 2HSYA 2IMKA 3G7IA 2FWHA 3TKQA 4AJ8A 4KGIA 3L9UA 5B6NA 4PX1A 1H4OA 1FB0A 1ON4A 2JSZA 4E8HA 1YJ6A 5HR1A 4OFTA 2B5XA 3A2WA 2C1YA 1SYRA 4KA0A 1PRXA 1THOA 2HRKB 2IPAA 2P5QA 1Z6NA 3HVSA 1ERWA 4V1Ag 2TIRA 1XFLA 2GLRA 4G19A 2JSYA 4ID0A 1M7TA 2LUSA 3EE2A 3TJBA 1AUCA 3GHAA 5CRHA 4LL4B 2KHPA 1QGVA 4K0NA 4KB3A 1B48A 4XHMA 2FUG2 4FYCA 3EU4A 1O6JA 1QXHA 1JLVA 1WPIA 3GH6A 5E59A 2GSQA 2VCZA 3VI5A 4HDEA 4ULXA 4AJ6A 3BOAA 3D5JA 2GTUA 4J2FA 5J5NA 1DSBA 3L78A 5J4UA 1ZOFA 3F4TA 1XW6A 4P3YB 3TUEA 2DJJA 3TKSA 4F82A 2OBKA 1B9YC 4NWYA 4AJ7A 4YQVA 4K7IA 4BVYA 1F3BA 4EVMA 4GF0A 1JFUA 1SK0A 3Q74A 2LEGA 3CRTA 1GSFA 3KXOA 3RPPA 3UL3A 1VF1A 4HS1A 1T3BA 3APSA 4NXIA 3ED3A 2E2MA 2G2QA 5E4WA 1XBSA 1YKAA 2YWNA 5ECIB 1GUHA 3IC4A 2OKAA 2V6OA 4JRRA 3NIVA 1B4PA 4JEDA 3DGQA 5GAND 3R2QA 3PH9A 1MD3A 3N5OA 1A2LA 2LJKA 3ZREA 1Z9HA 4Z7XA 1TRSA 2LJRA 4GCIA 4OO5A 1QUWA 1GLQA 1PA3A 1A2MA 3QFAC 1X5EA 2R2JA 3HD5A 5IPHA 4ZIJA 2P31A 2X99A 5H5SA 3RPNA 3N9JA 2GS3A 5ECMB 1U3AA 2B5YA 3F9UA 3UBLA 4EO3A 5CREA 2LRTA 5ECRB 4EF0A 2MZCA 3C71A 1A2JA 4TR1A 1FW1A 1Z7PA 2DIZA 3P8WA 1SD8A 3A2XA 4QQ7A 3IV4A 5F06A 2H66A 1GWCA 5A5KA 4WF4A 3J7Yk 3D4MA 1ABAA 5LCZA 2C3NA 4O92A 3CXGA 5C00A 5D9WA 4WBJA 3PPUA 1U3IA 1GP1A 3KEBA 3I6AA 1RQMA 1NM3A 1Z7RA 1TDIA 1URMA 2IMEA 4RQRA 3LGCA 2WFCA 2O7KA 3Q18A 2VCQA 1BAYA 3HVVA 2HRFA 3EURA 2LJAA 2V6KA 2C0EA 3R3EA 2IMDA 1HD2A 3F3QA 4POBA 1N2AA 3UOMA 3GURA 2IFQA 5ECNB 4NHWA 1NHOA 4DSSB 4YAVA 1XXUA 3IE3A 3RDWA 1THXA 1O81A 3HY2A 3I43A 5ID2B 3HA9A 4CW9A 3L9SA 5DALA 3P90A 4XTSA 3CSHA 2V32A 3EU3A 3K8NA 2ZUPA 2F9SA 4L8EA 4OWYA 3H4KA 1AQWA 4HU7A 1AC1A 4MF5A 2FHEA 5KN2A 1K0OA 4K9ZA 4OCFA 3FYGA 2AYTA 4K7OA 4XS6A 1O85A 1ACVA 2YN1A 3MSZA 1M2AA 2YNXA 4F0BA 5J9CA 2DBCA 1A8YA 1YDKA 5KN3A 3U6VA 1S3AA 2OADA 3KM6A 2F3MA 2FD3A 4WR5A 2CVBA 5IM9A 2LNSA 1AXDA 3I69A 1AIUA 4AF2A 2TRXA 3M9JA 5IMCA 4WEYA 4GXZA 4KCEA 2OJLA 4TN8A 3HCZA 1SL0B 4MLYA 4V2NA 2YWOA 2EIRA 2WB9A 4KAEA 2B6MA 4ZL7A 1VF2A 3VWUA 2OACA 3HJOA 1PQNA 1K0BA 1RW1A 2MBSA 4OFMA 5D8IA 3GSTA 5ELAA 2FWFA 1YF0A 4PURA 3M1GA 4CHSA 1J08A 3TJFA 1XWCA 3IBHA 1B9XC 3IAM2 1GTUA 4MH3A 4XS4A 5FWGA 4XRAA 4HU9A 4BWQA 2C4JA 3IRAA 1ZL9A 2M72A 1ZMAA 3IOSA 4DSRA 1FHEA 4ZBDA 4PUAA 2VLTA 1YF1A 3FW2A 3TKSC 5G2ZA 4O32A 4ZB6A 2H6ZA 4YAPA 1OE8A 1TK5B 3F63A 2XBQA 5IMZA 4TR0A 2L4CA 1K0MA 4PQIA 2WS2A 3TKSE 1Y6EA 3ZMKA 3H79A 2C80A 3A3TA 1TRUA 2HXKA 5G31A 1PX6A 5D9VA 3C7MA 1WJKA 2BTOT 2GSSA 13GSA 3LEFA 3GKNA 3VPQA 1GL8A 1V2AA 3KMNA 1SL2B 1OKDA 1A8LA 3TB2A 4D73A 4N0VA 4MJEA 4I5QA 1SK1A 2CX4A 2VCVA 3Q6OA 4I8BA 2HSMB 2X8HA 1BX9A 2C0GA 3IDVA 1ZYEA 5ENUA 4NV2A 5A4VA 3CSIA 2YJ7A 4YQMA 1SYXA 4E8EA 1JZRA 1MEKA 2GT5A 2L5OA 2BJXA 2EC4A 4EC0A 2YZHA 3QD9A 3ERFA 1SD9A 2WDUA 3GA4A 3QMXA 2N5BA 3QAVA 1XZOA 1OVNA 1NHYA 2VL2A 3KH7A 2FWGA 4BPYA 2ES7A 2H6YA 1S3DA 5IOXA 4FIWA 1X0RA 1WWJA 7GSSA 1YEXA 1AW9A 4FQUA 2P5RA 3EMPA 5HFGA 2OE3A 4LMVA 4MZWA 3GUSA 4HQZA 5EL8A 1T1VA 2L5LA 3APQA 5D9TA 1KNGA 3BCKA 1I9DA 2XPEA 3F3RA 2WULA 3VK9A 5GSTA 2DMLA 2X8CA 2VUPA 4EDYA 1RK4A 1A0FA 3APOA 5HFIA 2K6VA 2H1BA 2WGRA 2B7KA 1E2YA 4KF9A 1BG5A 4OO4A 4RUVA 2B3SA 2OBIA 5HR3A 1K0AA 3AY8A 5IMVA 2RUFA 5IO2A 3D21A 4IP1A 4JE1A 4NV5A 3KP8A 4L0WA 1HQOA 3UARA 3OR5A 4N11A 1JZDA 1W89A 4KW6A 3IR4A 5INYA 5IO0A 3L0HA 5CRWA 14GSA 2I9HA 3F8UA 5IMFA 1GSEA 2IJYA 4OD7A 2RIIA 4KE3A 2B7JA 2KLXA 3FR9A 5JCUA 1OC9A 4HJ2A 4ZILA 3HVXA 2H1GA 3F6FA 4TW5A 1K0NA 2FCHA 2EIOA 3ZL5A 5KN1A 2LKUA 3Q19A 3QR6A 4ZB8A 5ECQB 2CZ2A 1X9WB 1PKZA 1G7EA 22GSA 2LRNA 3O6TA 1M2DA 19GSA 3HJMA 1O8WA 2YOIA 5B8AA 3RHBA 2HZEA 5G1KA 3HZ4A 4D73B 2OE0A 1WIKA 4KX4A 4Q5QA 1FVJA 1Z5YE 1M9AA 2HT9A 4RQXA 2AUVA 1MDIA 1XPVA 3C8EA 3TKPA 5HFKA 5F05A 2LV3A 2R3XA 5H5RA 3C73A 4DEJA 4EL1A 3ZITA 4J57E 16GSA 2HYXA 1F6MC 18GSA 10GSA 3VWVA 1YKCA 4K2DA 3L9VA 1LU4A 4TR4A 3DWVA 2OE1A 1GSQA 2R6KA 2A2RA 6GSUA 2FLSA 2PUKC 2VLUA 3F0IA 1HYUA 3J7Yb 5CNWA 1A0RP 2IN3A 1EWXA 3IA1A 5BMUA 4ISDA 1V9WA 4WKWA 5DAKA 4HJMA 3MDKA 4L5LA 3QDNA 4Q5RA 2A4VA 3CBUA 4MJBA 2N5AA 3KGKA 3MAKA 5AN1A 1FB6A 2C0DA 2JZSA 2MMOA 3ZFBA 5G1LA 1G7OA 2K18A 1PL1A 4NHZA 1AQVA 2PN8A 3WGXA 5ECHB 1MTCA 1VF4A 1QMVA 2CT6A 1V40A 2K8VA 2BMXA 3GYKA 2VD0A 2DJ1A 2CA8A 3BD2A 5LNKe 4WETA 3HYPA 2YWIA 4N30A 1A23A 2K9FA 9GSSA 3GL3A 4MF6A 2VIMA 5IIZA 5DCGA 1QQ2A 1G6WA 2GGTA 5B8BA 2DJ2A 3DEXA 1IYHA 4DVCA 4GQFA 3HKRA 3ZVJA 3GIXA 3G9BA 3W8JA 3KMOA 1V98A 3FK8A 1GSSA 3TGZA 3EVIA 1DE2A 3DXBA 3PINA 3LJRA 4N0ZA 2JACA 5F07A 2IIYA 6GSWA 1KEBA 4Q5NA 4MDCA 2VL2C 3WD6A 4GQCA 3KJYA 3CTFA 4XCSA 4JR6A 3ZLPA 4G9HA 3QAGA 1T4YA 3GKMA 3ZVJD 1H75A 3LSZA 4RI6A 1F2EA 3GFKA 1WOUA 3QOUA 2H75A 4IW9A 2PVQA 3FHKA 1PGTA 4IVFA 3HDCA 4HEA2 4MZBA 2RM6A 2JADA 1M99A 3TCOA 17GSA 4MH2A 6GSSA 1EP7A 2H6XA 5AISA 2PU9C 3KTLA 1OKTA 3DYRA 2CZ3A 2RLIA 3GKXA 1LJRA 4BVYB 4PTSA 4L0UA 2GQLA 2G0FA 1UVZA 1GNWA 3WT2A 4MA9A 2C8UA 3TJKA 4BVXA 1ZZYA 2DJ0A 5EPFA 4MP4A 1MD4A 3DMLA 4X1UA 5F8BA 4QL7A 4MZCA 4F03A 3WT1A 1W4VA 2JZRA 1GTAA 4G2EA 4JU5A 2AB6A 4TXOA 3NOFA 1SJZA 2MMAA 4FYUA 3IXRA 4GSTA 4OCEA 4EKZA 4X43A 2XHFA 4POLA 3BCIA 4XS1A 2CQ9A 5DBQA 12GSA 4BL7A 1JLWA 1TJDA 1XW9A 1M0UA 1EOHA 4DSQA 1IYIA 2H01A 3LQ7A 4I97A 2H71A 2H0IA 1OYJA 1AAZA 1XWBA 2VOCA 2CVDA 2LTKA 1PL2A 5IOWA 2GSTA 2HSHA 5DQYA 1TK0B 4ECJA 3RHCA 5D73A 3UBKA 5A4WA 4X0XA 3E9JB 2NTOA 1U87A 3LXTA 3FZ5A 4TR1B 1SJIA 2KOKA 5IMDA 5COHA 4LMWA 1XIYA 2ZNMA 4I6XA 1K0DA 3D0ZA 1ST9A 3GTUA 4K6XA 4LLRA 2PPTA 3QFBC 1X5CA 3VWWA 2NBSA 1X9MB 1DUGA 1B4QA 6GSTA 2VAFA 2C3QA 3HHVA 4G0IA 2I1UA 1GRXA 2C0FA 2HSNB 3O76A 3S9FA 3IHQA 3ZYWA 1VRSD 1Z3EA 2R37A 5HR0A 1TI3A 3TRPA 4ACSA 4IELA 3DVWA 5GZZB 1BEDA 2HRKA 2B1LA 1U88A 5CRGA 3GKKA 2RUEA 2IFQB 5G30A 4NAXA 1NSWA 3SWLA 3KTBA 5ECLB 2L6CA 2MBTA 4KNDA 3EWLA 3KD0A 4XRDA 4K8MA 1GUMA 2JL4A 2VM2A 3FZAA 3EYTA 1B8XA 4ECIA 5DALB 4PNFA 1MDJA 4TR3A 5GSSA 3KIJA 2QKEA 1EV9A 4GTUA 3PGTA 3WGEA 2IMIA 3TDGA 1AQXA 2H1DA 4GSNA 3MNGA 5CYYA 1U6TA 2ON5A 4BVXB 1PMTA 3LORA 1MDKA 1CQHA 3M9KA 1HNAA 3VI7A 4WF5A 4PUFC 3TRQA 2DMMA 4MCUA 4MK3A 2I4AA 5JCWA 4RI7A 2WJUA 5L71A 1VGLA 4IHUA 1I5GA 1UC7A 1ZCPA 4YH2A 3UMAA 5G5EA 2X64A 4KDXA 1EZKA 3LXZA 1M9BA 2V2GA 1Y25A 4V2MA 4HZ2A 3CTGA 3UIWA 1EGRA 3KCMA 3PR8A 5CP1A 2K8SA 3FEUA 1SU9A 3E0UA 3ZTLA 3GN3A 1O8XA 5IPGA 2R5GA 1WP0A 3LG6A 2TRCP 3ZIJA 3JCML 2FNOA 2GSRA 2MYGA 2ON7A 2LRCA 4XS4B 4IJ3A 2I81A 1USBA 3F6DA 2PERA 4ZB9A 2AAWA 1PN9A 2M80A 1V57A 1S3CA 5ECPB 3V1WA 4ECBA 3H8QA 3ZFLA 4G0LA 5F0GA 3DKSA 4HUAA 1SKRB 5JWQB 3FR6A 3QPMA 3QAWA 4KDYA 3UVHA 2HNLA 1JZWA 2I3YA 4OMVA 2QGVA 2YV7A 3UEMA 2GZYA 5LD0A 1SL1B 3DRNA 3HXSA 1EOGA 1XOBA 3IPZA 5AGYA 5CRDA 1BQ7A 2M46A 3RAZA 2V1MA 4F2IA 2PBJA 5IMAA 1C72A 2H1AA 4L5OA 3DVXA 3TKRA 1SENA 1JZOA 4ECCA 2VD1A 1GH2A 2LSTA 1ERUA 3VWXA 2H0HA 2L4QA 4PXOA 2B1KA 3RBTA 4ML1A 2VM1A 1KTEA 3P7XA 4BA7A 6GSYA 1DE1A 1UN2A 3LYPA 3GH9A 3CSJA 2XBIA 3KZQA 2O8VB 3F4SA 2GT6A 1FVKA 2REMA 1DBYA 3TJJA 1XVQA 2AJQB 4BWSA 1ZYQB 4DSSA 2DSAA 8GSSA 2JZTA 5D9XA 3NZNA 3VLNA 4I2TA 2IMFA 3LYKA 4PGTA 2GVPA 4V2LA 2FA8A 5ID2A 3LFLA 4POKA 1BYEA 4F0CA 5A4UA 4OFNA 2YZUA 2L59A 4O5RA 3US3A 2EIQA 3TRXA 1M2BA 2RM5A 1GNEA 5EY6A 1K3OA 2CX3A 1YEPA 5ECOB 1EGOA 2E0QA 2VCWA 1K3YA 4NPBA 1OAZA 3UAPA 1XWKA 4ZL9A 5CO3A 3G7YA 1TKDB 1OE7A 5EVOA 2CV4A 1EEMA 1X9SB 1YY7A 2NPBA 4ZBBA 1R4WA 4AGSA 2JU5A 1ILOA 1X5DA 1EEJA 5J9BA 1G0TA 5D93A 1GSYA 2VL3A 2VO4A 3QCPA 2FY6A 1TU8A 1F9MA 2FWEA 3U5RE 2DC5A 1T8EB 4ZL8A 1WMJA 5D96A 2QSIA 2DLXA 4GLTA 4FH8A 2YWMA 4GWRA 3D4TA 4ZBAA 4KH7A 2HZFA 2HFDA 2F8FA 3W6GA 3W8SA 2XPDA 1R5AA 3GX0A 2V41A 2NDOA 3C1SA 2VCTA 6GSVA 1CQGA 4NMUA 4USSA 5DJLA 2X8GA 3IC8A 3GV1A 2IWTA 2H30A 1ML6A 4IQAA 5ABRA 1OC9B 1GLPA 3ERWA 1TI1A 2DJ3A 3GRXA 1EP8A 1G6YA 1VF3A 2WRTA 3HJPA 4GSSA 4IP6A 4ILFA 2LNTA 1R7HA 5GAPD 4PNGA 3O3TA 1FOVA 2L57A 3IK7A 2WCIA 3ZRDA 1UA5A 1TXXA 4V1Ap 1GTIA 2E7PA 2O89A 4EUYA 4XIHA 1T7PB 4WBRD 3ERGA 3VFIA 2HZEB 5DVBA 1XVWA 1PSQA 3GMFA 5G5FA 2GZPA 3G7JA 2Z9SA 1WRYA 2WZ9A 4IJIA 1PKWA 2GQKA 3FR3A 4ML6A 1F37A 4QL9A 4KSOA 5AIXA 2UZ8A 2NVLA 5CAXA 3EINA 2MMNA 1R5PA 3FKFA 5DJMA 2D2ZA 3M0FA 1SJ6A 1FO5A 4KDUA 3ME8A 4IKHA 2HSMA 5JCGA 3FZ4A 2MMZA 2PVOC 2QC7A 2YANA 3M8NA 3DIEA 1XCCA 4IBPA 4IGJA 4F9ZA 1ERTA 2HRAA 1FG4A 1YZXA 1SK2A 1TTZA 3WYWA 3IAS2 1V58A 1O73A 2IL3A 4LL1B 3BJ5A 5ECKB 2CVKA 1XW5A 2HI7A 5H5QA 4HI7A 5DAKB 2HQTA 3EMXA 3SBCA 2VCXA 2H70A 2HE3A 6GSXA 1PD21 1Q98A 5JWRB 4LA1A 4TVEA 1Q4JA 4EDZA 2L6DA 3E3EA 5IQYA 4WXTA 2LS5A 3FY7A 3ZZXA 3L4NA 3KH9A 4MABA 2AV4A 4PQHA 2F51A 5DCHA 4FO5A 2H0GA 1PX7A 5HQPA 3FRCA 4FYBA 1J0FA 1J9BA 4J56E 1FAAA 5DQSA 4HQSA 1EV4A 2KP1A 3M3MA 2N5FA 4KUNA 4MF7A 1K3LA 1Z6MA 3GNJA 2PWJA 4G0KA 2AHEA 1XWAA 1QFNA 5KN0A 3H1NA 4KCAA 4JBBA
chains in the Genus database with same CATH superfamily
1E6BA 4KSMA 3H93A 1TU7A 5DDLA 2H8LA 3D22A 3MWHA 4HOJA 2B5EA 3ZMLA 3GL5A 3CYNA 4MMMA 4TRXA 2LQOA 4IS0A 4HZ4A 4IN0A 2KUCA 4CDOA 2C3TA 2LQQA 2H73A 2CAIA 2R4VA 4MJAA 1HNCA 4K7NA 1OC3A 2J23A 2XC2A 3GSSA 3UVTA 2R0GA 1KBNA 4EXJA 11GSA 3GX8A 4MJCA 2YCDA 3BBYA 2GQMA 2PMTA 5B6MA 2OA7A 2H74A 4E68A 1GSDA 4MPGA 1TW9A 5FT3A 1HNBA 2DJKA 4MPFA 4WR4A 2H1LA 4I2UA 3CRUA 2J9HA 2E2GA 4YQUA 2ZCTA 1O7UA 3HZ8A 3A2VA 2VL9A 4TXVA 1TRVA 4PQ1A 1XOAA 1TXUA 5KOXA 3TOUA 1QK8A 2P0GA 5KEJA 1WE0A 1T4ZA 1XWGA 2HLSA 5AIVA 2FA4A 1OC8A 5J3RA 3F4RA 5ECSA 2PGTA 4POMA 2YPMA 4EE0A 20GSA 1LBKA 1F3AA 4O7HA 4TXOB 2A2SA 2O87A 3ME7A 2YP6A 1JHBA 3TJGA 1SKSB 5HR2A 1TRWA 2KP2A 2DIYA 3ISOA 2GDRA 2GZZA 3CMIA 5JWOB 4JZQA 3RGBC 1TK8B 5B7CA 1A24A 5ELGA 3LWAA 4BL7B 2YV9A 2YJHA 3ZIVA 1BJXA 1SKWB 5C04A 3EC3A 5J41A 4IQ1A 3I9V2 4H86A 5FHIA 3VPTA 3VURA 2ALBA 1T00A 1TP9A 2H72A 2HRNA 5A1NA 3FZ9A 3P2AA 1K0CA 4N10A 2H76A 4Q5FA 4ZXGA 4G10A 1GTBA 4JR4A 4AKGA 4K1FA 3UJ1A 1ERVA 1N8JA 1YQ1A 1ZGNA 3WGDA 3GTUB 1TOFA 3A5WA 1NW2A 3TOTA 2F8AA 3IK9A 3KP9A 4TOPA 5A34B 2H19A 1GUKA 1GSUA 2VLVA 3D6IA 2O85A 4K0GA 1R26A 2WW2A 2CAQA 4GRFA 2FGXA 1GULA 3DD3A 3C1RA 4TKYA 2HSYA 2IMKA 3G7IA 2FWHA 3TKQA 4AJ8A 4KGIA 3L9UA 5B6NA 4PX1A 4A5PA 1H4OA 1FB0A 4G01A 1ON4A 2JSZA 4E8HA 4PI0C 1YJ6A 5HR1A 4OFTA 2B5XA 3A2WA 2C1YA 1SYRA 4KA0A 1PRXA 1THOA 2HRKB 2IPAA 2P5QA 1Z6NA 3HVSA 1ERWA 4V1Ag 2TIRA 1XFLA 2GLRA 4G19A 2JSYA 4ID0A 1M7TA 2LUSA 3EE2A 3TJBA 1AUCA 3GHAA 5CRHA 4LL4B 2KHPA 1QGVA 4K0NA 4KB3A 1B48A 4XHMA 2FUG2 4FYCA 1BF5A 3EU4A 1O6JA 1QXHA 1JLVA 1WPIA 3GH6A 4FXYP 5E59A 2GSQA 2VCZA 3VI5A 4HDEA 4ULXA 4AJ6A 3BOAA 3D5JA 2GTUA 4J2FA 5J5NA 1DSBA 3L78A 5J4UA 1ZOFA 3F4TA 1XW6A 4P3YB 3TUEA 2DJJA 3TKSA 4F82A 1YVLA 2OBKA 1B9YC 4NWYA 4AJ7A 4YQVA 4BVYA 4K7IA 1F3BA 4EVMA 4GF0A 1JFUA 1SK0A 3Q74A 2LEGA 3CRTA 1GSFA 3KXOA 3RPPA 1Y1UA 3UL3A 1VF1A 4HS1A 1T3BA 3APSA 4NXIA 3ED3A 2E2MA 2G2QA 5E4WA 3HMJG 1XBSA 1YKAA 2YWNA 5J40A 5ECIB 1GUHA 3IC4A 4PHZC 2OKAA 2V6OA 4JRRA 3NIVA 1B4PA 4JEDA 3DGQA 5GAND 3R2QA 3PH9A 1MD3A 3N5OA 1A2LA 2LJKA 4ZB7A 1Z9HA 3ZREA 4Z7XA 1TRSA 2LJRA 4GCIA 4OO5A 1QUWA 1GLQA 1PA3A 1A2MA 3QFAC 1X5EA 2R2JA 3HD5A 5IPHA 4ZIJA 2P31A 2X99A 5H5SA 3RPNA 3N9JA 2GS3A 5ECMB 1U3AA 2B5YA 2QA2A 2X4AA 3F9UA 3UBLA 4EO3A 5CREA 2LRTA 5ECRB 4EF0A 2MZCA 3C71A 1A2JA 4TR1A 1FW1A 1Z7PA 2DIZA 3P8WA 1SD8A 3A2XA 3TU3B 4QQ7A 3IV4A 5F06A 2H66A 1GWCA 5A5KA 4WF4A 3J7Yk 3D4MA 1ABAA 5LCZA 2C3NA 4O92A 3CXGA 5C00A 5D9WA 4WBJA 3PPUA 1U3IA 1GP1A 4YKGA 3KEBA 3I6AA 1RQMA 1NM3A 1Z7RA 1TDIA 1URMA 2IMEA 2EFHA 4RQRA 3LGCA 2WFCA 2O7KA 3Q18A 2VCQA 1BAYA 3HVVA 2HRFA 4CY6A 3EURA 2LJAA 2V6KA 2C0EA 3R3EA 2IMDA 1HD2A 3F3QA 4POBA 1N2AA 3UOMA 3GURA 2IFQA 5ECNB 4NHWA 1NHOA 4DSSB 4YAVA 1XXUA 3IE3A 3RDWA 1THXA 1O81A 3HY2A 3I43A 5ID2B 3HA9A 4CW9A 3L9SA 5DALA 3P90A 4XTSA 3CSHA 2V32A 3EU3A 3K8NA 2ZUPA 2F9SA 4L8EA 4OWYA 3H4KA 1AQWA 4HU7A 1AC1A 4MF5A 2FHEA 5KN2A 1K0OA 4K9ZA 4OCFA 3FYGA 2AYTA 4K7OA 4XS6A 1O85A 1ACVA 2YN1A 3MSZA 1M2AA 2YNXA 4F0BA 5J9CA 2DBCA 1A8YA 1YDKA 5KN3A 5J4VA 3U6VA 1S3AA 2OADA 3KM6A 2F3MA 2FD3A 4WR5A 2CVBA 5IM9A 2LNSA 1AXDA 3I69A 1AIUA 4AF2A 2TRXA 3M9JA 5IMCA 4WEYA 4GXZA 4KCEA 2OJLA 4TN8A 3HCZA 1SL0B 4MLYA 4V2NA 2YWOA 2EIRA 2WB9A 4KAEA 2B6MA 4ZL7A 1VF2A 3VWUA 2OACA 3HJOA 1PQNA 1K0BA 1RW1A 2MBSA 4OFMA 5D8IA 3GSTA 5ELAA 2FWFA 1YF0A 4PURA 3M1GA 4CHSA 1J08A 3TJFA 1XWCA 3IBHA 1B9XC 3IAM2 1GTUA 4MH3A 4XS4A 5FWGA 4XRAA 4HU9A 4BWQA 2C4JA 3IRAA 1ZL9A 2M72A 1ZMAA 3IOSA 4DSRA 1FHEA 4ZBDA 4PUAA 2VLTA 1YF1A 3FW2A 3TKSC 3CWGA 5G2ZA 4O32A 4ZB6A 2H6ZA 4YAPA 1OE8A 1TK5B 3F63A 2XBQA 5IMZA 4TR0A 2L4CA 1K0MA 4PQIA 2WS2A 3TKSE 1Y6EA 3ZMKA 3H79A 2C80A 3A3TA 1TRUA 2HXKA 5G31A 4PI2C 1PX6A 5D9VA 3C7MA 1WJKA 2BTOT 2GSSA 13GSA 3LEFA 3GKNA 3VPQA 1GL8A 1V2AA 3KMNA 1SL2B 1OKDA 2WVXA 1A8LA 3TB2A 4D73A 4N0VA 4MJEA 4I5QA 1SK1A 2CX4A 2VCVA 3Q6OA 4I8BA 2HSMB 2X8HA 2X49A 1BX9A 2C0GA 3IDVA 1ZYEA 5ENUA 4NV2A 5A4VA 3CSIA 2YJ7A 4YQMA 4O5QA 1SYXA 4E8EA 1JZRA 1MEKA 2GT5A 2L5OA 2BJXA 2EC4A 4EC0A 2YZHA 5A5HB 3QD9A 3ERFA 1SD9A 2WDUA 3GA4A 3QMXA 2N5BA 3QAVA 1XZOA 1OVNA 1NHYA 2VL2A 2FWGA 3KH7A 4BPYA 2ES7A 2H6YA 1S3DA 5IOXA 4Z2RA 4FIWA 1X0RA 1WWJA 7GSSA 1M3JA 1YEXA 1AW9A 4FQUA 2P5RA 3EMPA 5HFGA 2OE3A 4LMVA 4MZWA 3GUSA 4HQZA 5EL8A 2DKHA 1T1VA 2L5LA 3APQA 5D9TA 1KNGA 3BCKA 1I9DA 2XPEA 3F3RA 2WULA 3VK9A 5GSTA 2DMLA 2X8CA 2VUPA 4EDYA 1RK4A 1A0FA 3APOA 5HFIA 1SVMA 2K6VA 2H1BA 2WGRA 2B7KA 1E2YA 4KF9A 1BG5A 4OO4A 2DKIA 4RUVA 2B3SA 2OBIA 5KOWA 5HR3A 1K0AA 3AY8A 5IMVA 2RUFA 5IO2A 3D21A 4IP1A 4JE1A 4NV5A 3KP8A 4L0WA 3A5IA 1HQOA 3UARA 3OR5A 4N11A 4AKHA 1JZDA 1W89A 4KW6A 3IR4A 5INYA 5IO0A 3L0HA 5CRWA 14GSA 2I9HA 3F8UA 2UV8G 5IMFA 1GSEA 2IJYA 4OD7A 2RIIA 4KE3A 2B7JA 2KLXA 3FR9A 5JCUA 1OC9A 4HJ2A 3CQFA 4ZILA 4AI6A 3HVXA 2H1GA 3F6FA 4TW5A 4AKXB 2A2PA 1K0NA 2FCHA 2EIOA 3ZL5A 5KN1A 2LKUA 3Q19A 3QR6A 4ZB8A 5ECQB 2CZ2A 1X9WB 1PKZA 1G7EA 22GSA 2LRNA 2O5VA 2WW3A 1M2DA 3O6TA 19GSA 3HJMA 1O8WA 2YOIA 5B8AA 3RHBA 2HZEA 5G1KA 3HZ4A 4D73B 2OE0A 1WIKA 4KX4A 4Q5QA 1FVJA 1Z5YE 1M9AA 2HT9A 4RQXA 2OT3A 2AUVA 1MDIA 1XPVA 3C8EA 3TKPA 5HFKA 5F05A 2LV3A 2R3XA 5H5RA 3C73A 4DEJA 4EL1A 4EIQA 3ZITA 4J57E 16GSA 2HYXA 1F6MC 4O5UA 3EPTA 3HVNA 2EFEA 18GSA 10GSA 3VWVA 1SVOA 1YKCA 4K2DA 3L9VA 1LU4A 4TR4A 3DWVA 2OE1A 1GSQA 2R6KA 2A2RA 1XG8A 6GSUA 2FLSA 2PUKC 2VLUA 3F0IA 1HYUA 3J7Yb 5CNWA 1A0RP 2IN3A 5A1NB 1EWXA 3IA1A 4AKIA 5BMUA 4ISDA 1V9WA 4WKWA 5DAKA 4HJMA 3MDKA 4L5LA 3QDNA 4Q5RA 2A4VA 3CBUA 4MJBA 2N5AA 3KGKA 3MAKA 5AN1A 1FB6A 2C0DA 2JZSA 2MMOA 3ZFBA 4K5SA 5G1LA 1G7OA 2K18A 1PL1A 4NHZA 1AQVA 2PN8A 2QA1A 3WGXA 5ECHB 1MTCA 1VF4A 1QMVA 2CT6A 1V40A 2K8VA 2BMXA 3GYKA 2VD0A 2DJ1A 2CA8A 3BD2A 5LNKe 3MIXA 4WETA 3HYPA 2YWIA 4N30A 1A23A 2K9FA 9GSSA 3MYDA 3GL3A 4MF6A 2VIMA 5IIZA 5DCGA 1QQ2A 1G6WA 2GGTA 5B8BA 5BRTA 2DJ2A 3DEXA 1IYHA 4DVCA 4GQFA 3HKRA 3ZVJA 3GIXA 4Z2TA 3G9BA 3W8JA 3KMOA 1V98A 3FK8A 2WW1A 1GSSA 3TGZA 3EVIA 1DE2A 3DXBA 3PINA 3LJRA 4N0ZA 2JACA 4K2XA 5F07A 2IIYA 2HSNA 6GSWA 1SVLA 1KEBA 4Q5NA 4MDCA 2VL2C 3WD6A 4GQCA 3KJYA 3CTFA 4X4JA 4XCSA 4JR6A 3ZLPA 4G9HA 3QAGA 1T4YA 3GKMA 3ZVJD 1H75A 3LSZA 4RI6A 1F2EA 3GFKA 1WOUA 3QOUA 2H75A 4IW9A 2PVQA 3FHKA 1PGTA 4IVFA 3HDCA 4HEA2 4MZBA 2RM6A 2JADA 1M99A 3TCOA 17GSA 2A4HA 4MH2A 6GSSA 1EP7A 2H6XA 5AISA 2PU9C 3KTLA 1OKTA 3DYRA 2CZ3A 2RLIA 3GKXA 1LJRA 4BVYB 4PTSA 4L0UA 2GQLA 2G0FA 1UVZA 2R0CA 1GNWA 3WT2A 4MA9A 2C8UA 3TJKA 4HSCX 4BVXA 1ZZYA 2DJ0A 2O3EA 5EPFA 4MP4A 1MD4A 3DMLA 4X1UA 5F8BA 4QL7A 4MZCA 4F03A 3WT1A 1W4VA 2JZRA 1GTAA 4G2EA 4JU5A 2AB6A 4QMKA 4TXOA 3NOFA 1SJZA 2MMAA 4FYUA 3IXRA 4GSTA 4OCEA 4EKZA 2WVYA 4X43A 2XHFA 4POLA 3BCIA 4XS1A 2CQ9A 5DBQA 12GSA 4BL7A 1JLWA 1TJDA 1XW9A 1M0UA 1EOHA 4DSQA 1IYIA 2H01A 3LQ7A 5J47A 4I97A 2H71A 2H0IA 1OYJA 1AAZA 1XWBA 4EIPA 2VOCA 2CVDA 2LTKA 1PL2A 5IOWA 2GSTA 2HSHA 5DQYA 1TK0B 4ECJA 3RHCA 3CHXC 5D73A 3FMWA 3UBKA 5A4WA 4X0XA 3E9JB 2NTOA 1U87A 3LXTA 3FZ5A 4TR1B 1SJIA 2KOKA 2WVZA 2WW0A 5IMDA 5COHA 4LMWA 4BIKA 1XIYA 2ZNMA 4I6XA 1K0DA 3D0ZA 1ST9A 3GTUA 4K6XA 4LLRA 2PPTA 3QFBC 1X5CA 1YEWC 3VWWA 2NBSA 1X9MB 1DUGA 5A34A 1B4QA 6GSTA 2VAFA 2C3QA 3HHVA 4G0IA 2R0PA 2I1UA 1GRXA 2C0FA 2HSNB 3O76A 3S9FA 3IHQA 3ZYWA 1VRSD 1Z3EA 4YKFA 2R37A 5HR0A 1TI3A 3TRPA 4ACSA 4IELA 3DVWA 5GZZB 1BEDA 2HRKA 2B1LA 1U88A 5CRGA 3GKKA 2RUEA 2IFQB 5G30A 4NAXA 1NSWA 1I1IP 3SWLA 3KTBA 5ECLB 2L6CA 2MBTA 4KNDA 3EWLA 3KD0A 4XRDA 4Z2UA 4K8MA 1GUMA 2JL4A 2VM2A 3FZAA 3EYTA 5J4YA 1B8XA 4ECIA 5DALB 4PNFA 1MDJA 4TR3A 5GSSA 3KIJA 2QKEA 1EV9A 4GTUA 3PGTA 3WGEA 2IMIA 3TDGA 1AQXA 2H1DA 4GSNA 1N25A 3MNGA 5CYYA 1U6TA 2ON5A 4ICYA 4BVXB 1PMTA 4MNNA 3LORA 1MDKA 1CQHA 3M9KA 1HNAA 3VI7A 4WF5A 4PUFC 3TRQA 2DMMA 4MCUA 4MK3A 2I4AA 5JCWA 2WZSA 4RI7A 2WJUA 5L71A 1VGLA 4IHUA 1I5GA 1UC7A 1ZCPA 4YH2A 3UMAA 5G5EA 2X64A 4KDXA 1EZKA 3LXZA 1M9BA 2V2GA 1Y25A 4V2MA 4HZ2A 3CTGA 3UIWA 1EGRA 3KCMA 3PR8A 5CP1A 2K8SA 3FEUA 1SU9A 3E0UA 3ZTLA 3GN3A 3RFRC 1O8XA 5IPGA 2R5GA 1WP0A 3LG6A 2TRCP 1M3IA 3ZIJA 3JCML 2FNOA 2GSRA 2MYGA 2ON7A 2LRCA 4XS4B 4IJ3A 2I81A 1USBA 3F6DA 2PERA 1PN0A 4ZB9A 2AAWA 1PN9A 2M80A 1V57A 1S3CA 5ECPB 3V1WA 4ECBA 3H8QA 3ZFLA 4G0LA 5F0GA 3DKSA 4HUAA 1ZYPA 1SKRB 5JWQB 3FR6A 3QPMA 3QAWA 4KDYA 3UVHA 2HNLA 1JZWA 2I3YA 4OMVA 2QGVA 2YV7A 3UEMA 2GZYA 5LD0A 1S3RA 1SL1B 4N3ZA 3DRNA 3HXSA 1EOGA 1XOBA 3IPZA 5AGYA 5CRDA 1BQ7A 2M46A 3RAZA 1PFOA 2V1MA 4F2IA 2PBJA 5IMAA 1C72A 2H1AA 4L5OA 3DVXA 3TKRA 1SENA 1JZOA 4ECCA 2VD1A 1GH2A 2WVXB 2LSTA 1ERUA 3VWXA 2H0HA 2L4QA 4PXOA 2B1KA 3RBTA 4ML1A 2VM1A 1KTEA 3P7XA 4BA7A 6GSYA 1DE1A 3LW9A 1UN2A 4CY8A 3LYPA 3GH9A 3CSJA 4W66A 2XBIA 3KZQA 2O8VB 3F4SA 2GT6A 1FVKA 2REMA 1DBYA 3TJJA 1XVQA 2AJQB 4BWSA 1ZYQB 4DSSA 2EFDA 2DSAA 8GSSA 2JZTA 5D9XA 3NZNA 3VLNA 4I2TA 2IMFA 3LYKA 4GDFA 4PGTA 2GVPA 4V2LA 2FA8A 5ID2A 3LFLA 4POKA 1BYEA 4F0CA 5A4UA 4OFNA 2YZUA 2L59A 4O5RA 3US3A 2EIQA 3TRXA 1M2BA 2RM5A 1GNEA 5EY6A 1K3OA 2CX3A 1YEPA 5ECOB 1EGOA 2E0QA 2VCWA 1K3YA 4NPBA 1OAZA 3UAPA 1XWKA 4ZL9A 5CO3A 3G7YA 1TKDB 1OE7A 3IHGA 5EVOA 2CV4A 1EEMA 1X9SB 1YY7A 2NPBA 4ZBBA 1R4WA 4AGSA 2JU5A 1ILOA 1X5DA 1EEJA 5J9BA 1G0TA 5D93A 1GSYA 2VL3A 1FOHA 2VO4A 3QCPA 2FY6A 1TU8A 1F9MA 2FWEA 3U5RE 2DC5A 1T8EB 4ZL8A 1WMJA 5D96A 2QSIA 2DLXA 4GLTA 4FH8A 1S4BP 2YWMA 4GWRA 3D4TA 4ZBAA 4KH7A 4K5RA 2HZFA 2HFDA 2F8FA 3W6GA 3W8SA 2XPDA 1R5AA 3GX0A 2V41A 2NDOA 3C1SA 2VCTA 6GSVA 1CQGA 4NMUA 4USSA 5DJLA 2X8GA 3IC8A 3GV1A 2IWTA 2H30A 1ML6A 4IQAA 5ABRA 1BG1A 1OC9B 1GLPA 3ERWA 1TI1A 2DJ3A 3GRXA 1EP8A 1G6YA 1VF3A 2WRTA 3HJPA 4GSSA 4IP6A 4ILFA 2LNTA 1R7HA 2VKZG 5GAPD 4PNGA 3O3TA 1FOVA 2L57A 3IK7A 2WCIA 3ZRDA 1UA5A 1TXXA 4V1Ap 1GTIA 2E7PA 2O89A 4EUYA 4XIHA 1T7PB 4WBRD 3ERGA 3VFIA 2HZEB 5DVBA 1XVWA 1PSQA 3GMFA 5G5FA 2GZPA 3G7JA 2Z9SA 1WRYA 2WZ9A 4IJIA 1PKWA 2GQKA 3FR3A 4ML6A 1F37A 4QL9A 4KSOA 1ZYNA 5AIXA 2UZ8A 2NVLA 5CAXA 3EINA 2MMNA 1R5PA 3FKFA 5DJMA 2D2ZA 3M0FA 1SJ6A 1FO5A 4KDUA 2O36A 3ME8A 4IKHA 2HSMA 5JCGA 3FZ4A 2MMZA 2PVOC 2QC7A 2YANA 3M8NA 3DIEA 1XCCA 4IBPA 4IGJA 4F9ZA 1ERTA 2HRAA 1FG4A 2EFCA 1YZXA 1SK2A 1TTZA 3WYWA 3IAS2 1V58A 1O73A 5A5HA 2IL3A 4LL1B 3BJ5A 5ECKB 2CVKA 5BMUB 1XW5A 2HI7A 5H5QA 4HI7A 5DAKB 2HQTA 3EMXA 3SBCA 2VCXA 2H70A 2HE3A 6GSXA 1PD21 1Q98A 5JWRB 4LA1A 4TVEA 1Q4JA 4EDZA 2L6DA 3E3EA 5IQYA 4WXTA 2LS5A 3FY7A 3ZZXA 3L4NA 3KH9A 4MABA 2AV4A 4PQHA 2F51A 5DCHA 4FO5A 2H0GA 1PX7A 5HQPA 3FRCA 4FYBA 1J0FA 1J9BA 4J56E 1FAAA 5DQSA 4HQSA 1EV4A 2KP1A 3M3MA 2N5FA 4KUNA 4MF7A 1K3LA 1Z6MA 3GNJA 2PWJA 4G0KA 2AHEA 1XWAA 1QFNA 5KN0A 3H1NA 4KCAA 4JBBA
chains in the Genus database with same CATH topology
1E6BA 4KSMA 3H93A 1TU7A 5DDLA 2H8LA 3D22A 3MWHA 4HOJA 2B5EA 3ZMLA 3GL5A 3CYNA 4MMMA 4TRXA 2LQOA 4IS0A 4HZ4A 4IN0A 2KUCA 4CDOA 2C3TA 2LQQA 2H73A 2CAIA 2R4VA 4MJAA 1HNCA 4K7NA 1OC3A 2J23A 2XC2A 3GSSA 3UVTA 2R0GA 1KBNA 4EXJA 11GSA 3GX8A 4MJCA 2YCDA 3BBYA 2GQMA 2PMTA 5B6MA 2OA7A 2H74A 4E68A 1GSDA 4MPGA 1TW9A 5FT3A 1HNBA 2DJKA 4MPFA 4WR4A 2H1LA 4I2UA 3CRUA 2J9HA 2E2GA 4YQUA 2ZCTA 1O7UA 3HZ8A 3A2VA 2VL9A 4TXVA 1TRVA 4PQ1A 1XOAA 1TXUA 5KOXA 3TOUA 1QK8A 2P0GA 5KEJA 1WE0A 1T4ZA 1XWGA 2HLSA 5AIVA 2FA4A 1OC8A 5J3RA 3F4RA 5ECSA 2PGTA 4POMA 2YPMA 4EE0A 20GSA 1LBKA 1F3AA 4O7HA 4TXOB 2A2SA 2O87A 3ME7A 2YP6A 1JHBA 3TJGA 1SKSB 5HR2A 1TRWA 2KP2A 2DIYA 3ISOA 2GDRA 2GZZA 3CMIA 5JWOB 4JZQA 1TK8B 5B7CA 1A24A 5ELGA 3LWAA 4BL7B 2YV9A 2YJHA 3ZIVA 1BJXA 1SKWB 5C04A 3EC3A 5J41A 4IQ1A 3I9V2 4H86A 5FHIA 3VPTA 3VURA 2ALBA 1T00A 1TP9A 2H72A 2HRNA 5A1NA 3FZ9A 3P2AA 1K0CA 4N10A 2H76A 4Q5FA 4ZXGA 4G10A 1GTBA 4JR4A 4AKGA 4K1FA 3UJ1A 1ERVA 1N8JA 1YQ1A 1ZGNA 3WGDA 3GTUB 1TOFA 3A5WA 1NW2A 3TOTA 2F8AA 3IK9A 3KP9A 4TOPA 5A34B 2H19A 1GUKA 1GSUA 2VLVA 3D6IA 2O85A 4K0GA 1R26A 4GRFA 2CAQA 2FGXA 1GULA 3DD3A 3C1RA 4TKYA 2HSYA 2IMKA 3G7IA 2FWHA 3TKQA 4AJ8A 4KGIA 3L9UA 5B6NA 4PX1A 4A5PA 1H4OA 1FB0A 4G01A 1ON4A 2JSZA 4E8HA 1YJ6A 5HR1A 4OFTA 2B5XA 3A2WA 2C1YA 1SYRA 4KA0A 1PRXA 1THOA 2HRKB 2IPAA 2P5QA 1Z6NA 3HVSA 1ERWA 4V1Ag 2TIRA 1XFLA 2GLRA 4G19A 2JSYA 4ID0A 1M7TA 2LUSA 3EE2A 3TJBA 1AUCA 3GHAA 5CRHA 4LL4B 2KHPA 1QGVA 4K0NA 4KB3A 1B48A 4XHMA 2FUG2 4FYCA 1BF5A 3EU4A 1O6JA 1QXHA 1JLVA 1WPIA 3GH6A 5E59A 2GSQA 2VCZA 3VI5A 4HDEA 4ULXA 4AJ6A 3BOAA 3D5JA 2GTUA 4J2FA 5J5NA 1DSBA 3L78A 5J4UA 1ZOFA 3F4TA 1XW6A 4P3YB 3TUEA 2DJJA 3TKSA 4F82A 1YVLA 2OBKA 1B9YC 4NWYA 4AJ7A 4YQVA 4BVYA 4K7IA 1F3BA 4EVMA 4GF0A 1JFUA 1SK0A 3Q74A 2LEGA 3CRTA 1GSFA 3KXOA 3RPPA 1Y1UA 3UL3A 1VF1A 4HS1A 1T3BA 3APSA 4NXIA 3ED3A 2E2MA 2G2QA 5E4WA 3HMJG 1XBSA 1YKAA 2YWNA 5J40A 5ECIB 1GUHA 3IC4A 2OKAA 2V6OA 4JRRA 3NIVA 1B4PA 4JEDA 3DGQA 5GAND 3R2QA 3PH9A 1MD3A 3N5OA 1A2LA 2LJKA 4ZB7A 1Z9HA 3ZREA 4Z7XA 1TRSA 2LJRA 4GCIA 4OO5A 1QUWA 1GLQA 1PA3A 1A2MA 3QFAC 1X5EA 2R2JA 3HD5A 5IPHA 4ZIJA 2P31A 2X99A 5H5SA 3RPNA 3N9JA 2GS3A 5ECMB 1U3AA 2B5YA 2QA2A 2X4AA 3F9UA 3UBLA 4EO3A 5CREA 2LRTA 5ECRB 4EF0A 2MZCA 3C71A 1A2JA 4TR1A 1FW1A 1Z7PA 2DIZA 3P8WA 1SD8A 3A2XA 3TU3B 4QQ7A 3IV4A 5F06A 2H66A 1GWCA 5A5KA 4WF4A 3J7Yk 3D4MA 1ABAA 5LCZA 2C3NA 4O92A 3CXGA 5C00A 5D9WA 4WBJA 3PPUA 1U3IA 1GP1A 4YKGA 3KEBA 3I6AA 1RQMA 1NM3A 1Z7RA 1TDIA 1URMA 2IMEA 2EFHA 4RQRA 3LGCA 2WFCA 2O7KA 3Q18A 2VCQA 1BAYA 3HVVA 2HRFA 4CY6A 3EURA 2LJAA 2V6KA 2C0EA 3R3EA 2IMDA 1HD2A 3F3QA 4POBA 1N2AA 3UOMA 3GURA 2IFQA 5ECNB 4NHWA 1NHOA 4DSSB 4YAVA 1XXUA 3IE3A 3RDWA 1THXA 1O81A 3HY2A 3I43A 5ID2B 3HA9A 4CW9A 3L9SA 5DALA 3P90A 4XTSA 3CSHA 2V32A 3EU3A 3K8NA 2ZUPA 2F9SA 4L8EA 4OWYA 3H4KA 1AQWA 4HU7A 1AC1A 4MF5A 2FHEA 5KN2A 1K0OA 4K9ZA 4OCFA 3FYGA 2AYTA 4K7OA 4XS6A 1O85A 1ACVA 2YN1A 3MSZA 1M2AA 2YNXA 4F0BA 5J9CA 2DBCA 1A8YA 1YDKA 5KN3A 5J4VA 3U6VA 1S3AA 2OADA 3KM6A 2F3MA 2FD3A 4WR5A 2CVBA 5IM9A 2LNSA 1AXDA 3I69A 1AIUA 4AF2A 2TRXA 3M9JA 5IMCA 4WEYA 4GXZA 4KCEA 2OJLA 4TN8A 3HCZA 1SL0B 4MLYA 4V2NA 2YWOA 2EIRA 2WB9A 4KAEA 2B6MA 4ZL7A 1VF2A 3VWUA 2OACA 3HJOA 1PQNA 1K0BA 1RW1A 2MBSA 4OFMA 5D8IA 3GSTA 5ELAA 2FWFA 1YF0A 4PURA 3M1GA 4CHSA 1J08A 3TJFA 1XWCA 3IBHA 1B9XC 3IAM2 1GTUA 4MH3A 4XS4A 5FWGA 4XRAA 4HU9A 4BWQA 2C4JA 3IRAA 1ZL9A 2M72A 1ZMAA 3IOSA 4DSRA 1FHEA 4ZBDA 4PUAA 2VLTA 1YF1A 3FW2A 3TKSC 3CWGA 5G2ZA 4O32A 4ZB6A 2H6ZA 4YAPA 1OE8A 1TK5B 3F63A 2XBQA 5IMZA 4TR0A 2L4CA 1K0MA 4PQIA 2WS2A 3TKSE 1Y6EA 3ZMKA 3H79A 2C80A 3A3TA 1TRUA 2HXKA 5G31A 1PX6A 5D9VA 3C7MA 1WJKA 2BTOT 2GSSA 13GSA 3LEFA 3GKNA 3VPQA 1GL8A 1V2AA 3KMNA 1SL2B 1OKDA 1A8LA 3TB2A 4D73A 4N0VA 4MJEA 4I5QA 1SK1A 2CX4A 2VCVA 3Q6OA 4I8BA 2HSMB 2X8HA 2X49A 1BX9A 2C0GA 3IDVA 1ZYEA 5ENUA 4NV2A 5A4VA 3CSIA 2YJ7A 4YQMA 4O5QA 1SYXA 4E8EA 1JZRA 1MEKA 2GT5A 2L5OA 2BJXA 2EC4A 4EC0A 2YZHA 5A5HB 3QD9A 3ERFA 1SD9A 2WDUA 3GA4A 3QMXA 2N5BA 3QAVA 1XZOA 1OVNA 1NHYA 2VL2A 3KH7A 2FWGA 4BPYA 2ES7A 2H6YA 1S3DA 5IOXA 4Z2RA 4FIWA 1X0RA 1WWJA 7GSSA 1YEXA 1AW9A 4FQUA 2P5RA 3EMPA 5HFGA 2OE3A 4LMVA 4MZWA 3GUSA 4HQZA 5EL8A 2DKHA 1T1VA 2L5LA 3APQA 5D9TA 1KNGA 3BCKA 1I9DA 2XPEA 3F3RA 2WULA 3VK9A 5GSTA 2DMLA 2X8CA 2VUPA 4EDYA 1RK4A 1A0FA 3APOA 5HFIA 1SVMA 2K6VA 2H1BA 2WGRA 2B7KA 1E2YA 4KF9A 1BG5A 4OO4A 2DKIA 4RUVA 2B3SA 2OBIA 5KOWA 5HR3A 1K0AA 3AY8A 5IMVA 2RUFA 5IO2A 3D21A 4IP1A 4JE1A 4NV5A 3KP8A 4L0WA 3A5IA 1HQOA 3UARA 3OR5A 4N11A 4AKHA 1JZDA 1W89A 4KW6A 3IR4A 5INYA 5IO0A 3L0HA 5CRWA 14GSA 2I9HA 3F8UA 2UV8G 5IMFA 1GSEA 2IJYA 4OD7A 2RIIA 4KE3A 2B7JA 2KLXA 3FR9A 5JCUA 1OC9A 4HJ2A 4ZILA 4AI6A 3HVXA 2H1GA 3F6FA 4TW5A 4AKXB 2A2PA 1K0NA 2FCHA 2EIOA 3ZL5A 5KN1A 2LKUA 3Q19A 3QR6A 4ZB8A 5ECQB 2CZ2A 1X9WB 1PKZA 1G7EA 22GSA 2LRNA 2O5VA 3O6TA 1M2DA 19GSA 3HJMA 1O8WA 2YOIA 5B8AA 3RHBA 2HZEA 5G1KA 3HZ4A 4D73B 2OE0A 1WIKA 4KX4A 4Q5QA 1FVJA 1Z5YE 1M9AA 2HT9A 4RQXA 2OT3A 2AUVA 1MDIA 1XPVA 3C8EA 3TKPA 5HFKA 5F05A 2LV3A 2R3XA 5H5RA 3C73A 4DEJA 4EL1A 4EIQA 3ZITA 4J57E 16GSA 2HYXA 1F6MC 4O5UA 3EPTA 2EFEA 18GSA 10GSA 3VWVA 1SVOA 1YKCA 4K2DA 3L9VA 1LU4A 4TR4A 3DWVA 2OE1A 1GSQA 2R6KA 2A2RA 6GSUA 2FLSA 2PUKC 2VLUA 3F0IA 1HYUA 3J7Yb 5CNWA 1A0RP 2IN3A 5A1NB 1EWXA 3IA1A 4AKIA 5BMUA 4ISDA 1V9WA 4WKWA 5DAKA 4HJMA 3MDKA 4L5LA 3QDNA 4Q5RA 2A4VA 3CBUA 4MJBA 2N5AA 3KGKA 3MAKA 5AN1A 1FB6A 2C0DA 2JZSA 2MMOA 3ZFBA 4K5SA 5G1LA 1G7OA 2K18A 1PL1A 4NHZA 1AQVA 2PN8A 2QA1A 3WGXA 5ECHB 1MTCA 1VF4A 1QMVA 2CT6A 1V40A 2K8VA 2BMXA 3GYKA 2VD0A 2DJ1A 2CA8A 3BD2A 5LNKe 3MIXA 4WETA 3HYPA 2YWIA 4N30A 1A23A 2K9FA 9GSSA 3MYDA 3GL3A 4MF6A 2VIMA 5IIZA 5DCGA 1QQ2A 1G6WA 2GGTA 5B8BA 5BRTA 2DJ2A 3DEXA 1IYHA 4DVCA 4GQFA 3HKRA 3ZVJA 3GIXA 4Z2TA 3G9BA 3W8JA 3KMOA 1V98A 3FK8A 1GSSA 3TGZA 3EVIA 1DE2A 3DXBA 3PINA 3LJRA 4N0ZA 2JACA 4K2XA 5F07A 2IIYA 2HSNA 6GSWA 1SVLA 1KEBA 4Q5NA 4MDCA 2VL2C 3WD6A 4GQCA 3KJYA 3CTFA 4X4JA 4XCSA 4JR6A 3ZLPA 4G9HA 3QAGA 1T4YA 3GKMA 3ZVJD 1H75A 3LSZA 4RI6A 1F2EA 3GFKA 1WOUA 3QOUA 2H75A 4IW9A 2PVQA 3FHKA 1PGTA 4IVFA 3HDCA 4HEA2 4MZBA 2RM6A 2JADA 1M99A 3TCOA 17GSA 2A4HA 4MH2A 6GSSA 1EP7A 2H6XA 5AISA 2PU9C 3KTLA 1OKTA 3DYRA 2CZ3A 2RLIA 3GKXA 1LJRA 4BVYB 4PTSA 4L0UA 2GQLA 2G0FA 1UVZA 2R0CA 1GNWA 3WT2A 4MA9A 2C8UA 3TJKA 4BVXA 1ZZYA 2DJ0A 5EPFA 4MP4A 1MD4A 3DMLA 4X1UA 5F8BA 4QL7A 4MZCA 4F03A 3WT1A 1W4VA 2JZRA 1GTAA 4G2EA 4JU5A 2AB6A 4QMKA 4TXOA 3NOFA 1SJZA 2MMAA 4FYUA 3IXRA 4GSTA 4OCEA 4EKZA 4X43A 2XHFA 4POLA 3BCIA 4XS1A 2CQ9A 5DBQA 12GSA 4BL7A 1JLWA 1TJDA 1XW9A 1M0UA 1EOHA 4DSQA 1IYIA 2H01A 3LQ7A 5J47A 4I97A 2H71A 2H0IA 1OYJA 1AAZA 1XWBA 4EIPA 2VOCA 2CVDA 2LTKA 1PL2A 5IOWA 2GSTA 2HSHA 5DQYA 1TK0B 4ECJA 3RHCA 5D73A 3FMWA 3UBKA 5A4WA 4X0XA 3E9JB 2NTOA 1U87A 3LXTA 3FZ5A 4TR1B 1SJIA 2KOKA 5IMDA 5COHA 4LMWA 1XIYA 2ZNMA 4I6XA 1K0DA 3D0ZA 1ST9A 3GTUA 4K6XA 4LLRA 2PPTA 3QFBC 1X5CA 3VWWA 2NBSA 1X9MB 1DUGA 5A34A 1B4QA 6GSTA 2VAFA 2C3QA 3HHVA 4G0IA 2R0PA 2I1UA 1GRXA 2C0FA 2HSNB 3O76A 3S9FA 3IHQA 3ZYWA 1VRSD 1Z3EA 4YKFA 2R37A 5HR0A 1TI3A 3TRPA 4ACSA 4IELA 3DVWA 5GZZB 1BEDA 2HRKA 2B1LA 1U88A 5CRGA 3GKKA 2RUEA 2IFQB 5G30A 4NAXA 1NSWA 3SWLA 3KTBA 5ECLB 2L6CA 2MBTA 4KNDA 3EWLA 3KD0A 4XRDA 4Z2UA 4K8MA 1GUMA 2JL4A 2VM2A 3FZAA 3EYTA 5J4YA 1B8XA 4ECIA 5DALB 4PNFA 1MDJA 4TR3A 5GSSA 3KIJA 2QKEA 1EV9A 4GTUA 3PGTA 3WGEA 2IMIA 3TDGA 1AQXA 2H1DA 4GSNA 1N25A 3MNGA 5CYYA 1U6TA 2ON5A 4ICYA 4BVXB 1PMTA 4MNNA 3LORA 1MDKA 1CQHA 3M9KA 1HNAA 3VI7A 4WF5A 4PUFC 3TRQA 2DMMA 4MCUA 4MK3A 2I4AA 5JCWA 4RI7A 2WJUA 5L71A 1VGLA 4IHUA 1I5GA 1UC7A 1ZCPA 4YH2A 3UMAA 5G5EA 2X64A 4KDXA 1EZKA 3LXZA 1M9BA 2V2GA 1Y25A 4V2MA 4HZ2A 3CTGA 3UIWA 1EGRA 3KCMA 3PR8A 5CP1A 2K8SA 3FEUA 1SU9A 3E0UA 3ZTLA 3GN3A 1O8XA 5IPGA 2R5GA 1WP0A 3LG6A 2TRCP 3ZIJA 3JCML 2FNOA 2GSRA 2MYGA 2ON7A 2LRCA 4XS4B 4IJ3A 2I81A 1USBA 3F6DA 2PERA 1PN0A 4ZB9A 2AAWA 1PN9A 2M80A 1V57A 1S3CA 5ECPB 3V1WA 4ECBA 3H8QA 3ZFLA 4G0LA 5F0GA 3DKSA 4HUAA 1ZYPA 1SKRB 5JWQB 3FR6A 3QPMA 3QAWA 4KDYA 3UVHA 2HNLA 1JZWA 2I3YA 4OMVA 2QGVA 2YV7A 3UEMA 2GZYA 5LD0A 1SL1B 4N3ZA 3DRNA 3HXSA 1EOGA 1XOBA 3IPZA 5AGYA 5CRDA 1BQ7A 2M46A 3RAZA 2V1MA 4F2IA 2PBJA 5IMAA 1C72A 2H1AA 4L5OA 3DVXA 3TKRA 1SENA 1JZOA 4ECCA 2VD1A 1GH2A 2LSTA 1ERUA 3VWXA 2H0HA 2L4QA 4PXOA 2B1KA 3RBTA 4ML1A 2VM1A 1KTEA 3P7XA 4BA7A 6GSYA 1DE1A 3LW9A 1UN2A 4CY8A 3LYPA 3GH9A 3CSJA 4W66A 2XBIA 3KZQA 2O8VB 3F4SA 2GT6A 1FVKA 2REMA 1DBYA 3TJJA 1XVQA 2AJQB 4BWSA 1ZYQB 4DSSA 2EFDA 2DSAA 8GSSA 2JZTA 5D9XA 3NZNA 3VLNA 4I2TA 2IMFA 3LYKA 4GDFA 4PGTA 2GVPA 4V2LA 2FA8A 5ID2A 3LFLA 4POKA 1BYEA 4F0CA 5A4UA 4OFNA 2YZUA 2L59A 4O5RA 3US3A 2EIQA 3TRXA 1M2BA 2RM5A 1GNEA 5EY6A 1K3OA 2CX3A 1YEPA 5ECOB 1EGOA 2E0QA 2VCWA 1K3YA 4NPBA 1OAZA 3UAPA 1XWKA 4ZL9A 5CO3A 3G7YA 1TKDB 1OE7A 3IHGA 5EVOA 2CV4A 1EEMA 1X9SB 1YY7A 2NPBA 4ZBBA 1R4WA 4AGSA 2JU5A 1ILOA 1X5DA 1EEJA 5J9BA 1G0TA 5D93A 1GSYA 2VL3A 1FOHA 2VO4A 3QCPA 2FY6A 1TU8A 1F9MA 2FWEA 3U5RE 2DC5A 1T8EB 4ZL8A 1WMJA 5D96A 2QSIA 2DLXA 4GLTA 4FH8A 2YWMA 4GWRA 3D4TA 4ZBAA 4KH7A 4K5RA 2HZFA 2HFDA 2F8FA 3W6GA 3W8SA 2XPDA 1R5AA 3GX0A 2V41A 2NDOA 3C1SA 2VCTA 6GSVA 1CQGA 4NMUA 4USSA 5DJLA 2X8GA 3IC8A 3GV1A 2IWTA 2H30A 1ML6A 4IQAA 5ABRA 1BG1A 1OC9B 1GLPA 3ERWA 1TI1A 2DJ3A 3GRXA 1EP8A 1G6YA 1VF3A 2WRTA 3HJPA 4GSSA 4IP6A 4ILFA 2LNTA 1R7HA 2VKZG 5GAPD 4PNGA 3O3TA 1FOVA 2L57A 3IK7A 2WCIA 3ZRDA 1UA5A 1TXXA 4V1Ap 1GTIA 2E7PA 2O89A 4EUYA 4XIHA 1T7PB 4WBRD 3ERGA 3VFIA 2HZEB 5DVBA 1XVWA 1PSQA 3GMFA 5G5FA 2GZPA 3G7JA 2Z9SA 1WRYA 2WZ9A 4IJIA 1PKWA 2GQKA 3FR3A 4ML6A 1F37A 4QL9A 4KSOA 1ZYNA 5AIXA 2UZ8A 2NVLA 5CAXA 3EINA 2MMNA 1R5PA 3FKFA 5DJMA 2D2ZA 3M0FA 1SJ6A 1FO5A 4KDUA 3ME8A 4IKHA 2HSMA 5JCGA 3FZ4A 2MMZA 2PVOC 2QC7A 2YANA 3M8NA 3DIEA 1XCCA 4IBPA 4IGJA 4F9ZA 1ERTA 2HRAA 1FG4A 2EFCA 1YZXA 1SK2A 1TTZA 3WYWA 3IAS2 1V58A 1O73A 5A5HA 2IL3A 4LL1B 3BJ5A 5ECKB 2CVKA 5BMUB 1XW5A 2HI7A 5H5QA 4HI7A 5DAKB 2HQTA 3EMXA 3SBCA 2VCXA 2H70A 2HE3A 6GSXA 1PD21 1Q98A 5JWRB 4LA1A 4TVEA 1Q4JA 4EDZA 2L6DA 3E3EA 5IQYA 4WXTA 2LS5A 3FY7A 3ZZXA 3L4NA 3KH9A 4MABA 2AV4A 4PQHA 2F51A 5DCHA 4FO5A 2H0GA 1PX7A 5HQPA 3FRCA 4FYBA 1J0FA 1J9BA 4J56E 1FAAA 5DQSA 4HQSA 1EV4A 2KP1A 3M3MA 2N5FA 4KUNA 4MF7A 1K3LA 1Z6MA 3GNJA 2PWJA 4G0KA 2AHEA 1XWAA 1QFNA 5KN0A 3H1NA 4KCAA 4JBBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E6B A;  4KSM A;  3H93 A;  1TU7 A;  5DDL A;  2H8L A;  3D22 A;  3MWH A;  4HOJ A;  2B5E A;  3ZML A;  3GL5 A;  3CYN A;  4MMM A;  4TRX A;  2LQO A;  4IS0 A;  4HZ4 A;  4IN0 A;  2KUC A;  4CDO A;  2C3T A;  2LQQ A;  2H73 A;  2CAI A;  2R4V A;  4MJA A;  1HNC A;  4K7N A;  1OC3 A;  2J23 A;  2XC2 A;  3GSS A;  3UVT A;  1KBN A;  4EXJ A;  11GS A;  3GX8 A;  4MJC A;  2YCD A;  3BBY A;  2GQM A;  2PMT A;  5B6M A;  2OA7 A;  2H74 A;  1GSD A;  4MPG A;  1TW9 A;  5FT3 A;  1HNB A;  2DJK A;  4MPF A;  4WR4 A;  4I2U A;  3CRU A;  2J9H A;  2E2G A;  4YQU A;  2ZCT A;  1O7U A;  3HZ8 A;  3A2V A;  2VL9 A;  4TXV A;  1TRV A;  4PQ1 A;  1XOA A;  3TOU A;  1QK8 A;  2P0G A;  5KEJ A;  1WE0 A;  1T4Z A;  1XWG A;  2HLS A;  5AIV A;  2FA4 A;  1OC8 A;  5J3R A;  3F4R A;  5ECS A;  2PGT A;  4POM A;  2YPM A;  4EE0 A;  20GS A;  1LBK A;  1F3A A;  4O7H A;  4TXO B;  2A2S A;  2O87 A;  3ME7 A;  2YP6 A;  1JHB A;  3TJG A;  1SKS B;  5HR2 A;  1TRW A;  2KP2 A;  2DIY A;  3ISO A;  2GDR A;  2GZZ A;  3CMI A;  5JWO B;  4JZQ A;  1TK8 B;  5B7C A;  1A24 A;  5ELG A;  3LWA A;  4BL7 B;  2YV9 A;  2YJH A;  3ZIV A;  1BJX A;  1SKW B;  5C04 A;  3EC3 A;  5J41 A;  4IQ1 A;  3I9V 2;  4H86 A;  5FHI A;  3VPT A;  3VUR A;  2ALB A;  1T00 A;  1TP9 A;  2H72 A;  2HRN A;  3FZ9 A;  3P2A A;  1K0C A;  4N10 A;  2H76 A;  4Q5F A;  4ZXG A;  4G10 A;  1GTB A;  4JR4 A;  4K1F A;  3UJ1 A;  1ERV A;  1N8J A;  1YQ1 A;  1ZGN A;  3WGD A;  3GTU B;  1TOF A;  3A5W A;  1NW2 A;  3TOT A;  2F8A A;  3IK9 A;  3KP9 A;  4TOP A;  2H19 A;  1GUK A;  1GSU A;  2VLV A;  3D6I A;  2O85 A;  4K0G A;  1R26 A;  4GRF A;  2CAQ A;  2FGX A;  1GUL A;  3DD3 A;  3C1R A;  4TKY A;  2HSY A;  2IMK A;  3G7I A;  2FWH A;  3TKQ A;  4AJ8 A;  4KGI A;  3L9U A;  5B6N A;  4PX1 A;  1H4O A;  1FB0 A;  1ON4 A;  2JSZ A;  4E8H A;  1YJ6 A;  5HR1 A;  4OFT A;  2B5X A;  3A2W A;  2C1Y A;  1SYR A;  4KA0 A;  1PRX A;  1THO A;  2HRK B;  2IPA A;  2P5Q A;  1Z6N A;  3HVS A;  1ERW A;  4V1A g;  2TIR A;  1XFL A;  2GLR A;  4G19 A;  2JSY A;  4ID0 A;  1M7T A;  2LUS A;  3EE2 A;  3TJB A;  1AUC A;  3GHA A;  5CRH A;  4LL4 B;  2KHP A;  1QGV A;  4K0N A;  4KB3 A;  1B48 A;  4XHM A;  2FUG 2;  4FYC A;  3EU4 A;  1O6J A;  1QXH A;  1JLV A;  1WPI A;  3GH6 A;  5E59 A;  2GSQ A;  2VCZ A;  3VI5 A;  4HDE A;  4ULX A;  4AJ6 A;  3BOA A;  3D5J A;  2GTU A;  4J2F A;  5J5N A;  1DSB A;  3L78 A;  5J4U A;  1ZOF A;  3F4T A;  1XW6 A;  4P3Y B;  3TUE A;  2DJJ A;  3TKS A;  4F82 A;  2OBK A;  1B9Y C;  4NWY A;  4AJ7 A;  4YQV A;  4K7I A;  4BVY A;  1F3B A;  4EVM A;  4GF0 A;  1JFU A;  1SK0 A;  3Q74 A;  2LEG A;  3CRT A;  1GSF A;  3KXO A;  3RPP A;  3UL3 A;  1VF1 A;  4HS1 A;  1T3B A;  3APS A;  4NXI A;  3ED3 A;  2E2M A;  2G2Q A;  5E4W A;  1XBS A;  1YKA A;  2YWN A;  5ECI B;  1GUH A;  3IC4 A;  2OKA A;  2V6O A;  4JRR A;  3NIV A;  1B4P A;  4JED A;  3DGQ A;  5GAN D;  3R2Q A;  3PH9 A;  1MD3 A;  3N5O A;  1A2L A;  2LJK A;  3ZRE A;  1Z9H A;  4Z7X A;  1TRS A;  2LJR A;  4GCI A;  4OO5 A;  1QUW A;  1GLQ A;  1PA3 A;  1A2M A;  3QFA C;  1X5E A;  2R2J A;  3HD5 A;  5IPH A;  4ZIJ A;  2P31 A;  2X99 A;  5H5S A;  3RPN A;  3N9J A;  2GS3 A;  5ECM B;  1U3A A;  2B5Y A;  3F9U A;  3UBL A;  4EO3 A;  5CRE A;  2LRT A;  5ECR B;  4EF0 A;  2MZC A;  3C71 A;  1A2J A;  4TR1 A;  1FW1 A;  1Z7P A;  2DIZ A;  3P8W A;  1SD8 A;  3A2X A;  4QQ7 A;  3IV4 A;  5F06 A;  2H66 A;  1GWC A;  5A5K A;  4WF4 A;  3J7Y k;  3D4M A;  1ABA A;  5LCZ A;  2C3N A;  4O92 A;  3CXG A;  5C00 A;  5D9W A;  4WBJ A;  3PPU A;  1U3I A;  1GP1 A;  3KEB A;  3I6A A;  1RQM A;  1NM3 A;  1Z7R A;  1TDI A;  1URM A;  2IME A;  4RQR A;  3LGC A;  2WFC A;  2O7K A;  3Q18 A;  2VCQ A;  1BAY A;  3HVV A;  2HRF A;  3EUR A;  2LJA A;  2V6K A;  2C0E A;  3R3E A;  2IMD A;  1HD2 A;  3F3Q A;  4POB A;  1N2A A;  3UOM A;  3GUR A;  2IFQ A;  5ECN B;  4NHW A;  1NHO A;  4DSS B;  4YAV A;  1XXU A;  3IE3 A;  3RDW A;  1THX A;  1O81 A;  3HY2 A;  3I43 A;  5ID2 B;  3HA9 A;  4CW9 A;  3L9S A;  5DAL A;  3P90 A;  4XTS A;  3CSH A;  2V32 A;  3EU3 A;  3K8N A;  2ZUP A;  2F9S A;  4L8E A;  4OWY A;  3H4K A;  1AQW A;  4HU7 A;  1AC1 A;  4MF5 A;  2FHE A;  5KN2 A;  1K0O A;  4K9Z A;  4OCF A;  3FYG A;  2AYT A;  4K7O A;  4XS6 A;  1O85 A;  1ACV A;  2YN1 A;  3MSZ A;  1M2A A;  2YNX A;  4F0B A;  5J9C A;  2DBC A;  1A8Y A;  1YDK A;  5KN3 A;  3U6V A;  1S3A A;  2OAD A;  3KM6 A;  2F3M A;  2FD3 A;  4WR5 A;  2CVB A;  5IM9 A;  2LNS A;  1AXD A;  3I69 A;  1AIU A;  4AF2 A;  2TRX A;  3M9J A;  5IMC A;  4WEY A;  4GXZ A;  4KCE A;  2OJL A;  4TN8 A;  3HCZ A;  1SL0 B;  4MLY A;  4V2N A;  2YWO A;  2EIR A;  2WB9 A;  4KAE A;  2B6M A;  4ZL7 A;  1VF2 A;  3VWU A;  2OAC A;  3HJO A;  1PQN A;  1K0B A;  1RW1 A;  2MBS A;  4OFM A;  5D8I A;  3GST A;  5ELA A;  2FWF A;  1YF0 A;  4PUR A;  3M1G A;  4CHS A;  1J08 A;  3TJF A;  1XWC A;  3IBH A;  1B9X C;  3IAM 2;  1GTU A;  4MH3 A;  4XS4 A;  5FWG A;  4XRA A;  4HU9 A;  4BWQ A;  2C4J A;  3IRA A;  1ZL9 A;  2M72 A;  1ZMA A;  3IOS A;  4DSR A;  1FHE A;  4ZBD A;  4PUA A;  2VLT A;  1YF1 A;  3FW2 A;  3TKS C;  5G2Z A;  4O32 A;  4ZB6 A;  2H6Z A;  4YAP A;  1OE8 A;  1TK5 B;  3F63 A;  2XBQ A;  5IMZ A;  4TR0 A;  2L4C A;  1K0M A;  4PQI A;  2WS2 A;  3TKS E;  1Y6E A;  3ZMK A;  3H79 A;  2C80 A;  3A3T A;  1TRU A;  2HXK A;  5G31 A;  1PX6 A;  5D9V A;  3C7M A;  1WJK A;  2BTO T;  2GSS A;  13GS A;  3LEF A;  3GKN A;  3VPQ A;  1GL8 A;  1V2A A;  3KMN A;  1SL2 B;  1OKD A;  1A8L A;  3TB2 A;  4D73 A;  4N0V A;  4MJE A;  4I5Q A;  1SK1 A;  2CX4 A;  2VCV A;  3Q6O A;  4I8B A;  2HSM B;  2X8H A;  1BX9 A;  2C0G A;  3IDV A;  1ZYE A;  5ENU A;  4NV2 A;  5A4V A;  3CSI A;  2YJ7 A;  4YQM A;  1SYX A;  4E8E A;  1JZR A;  1MEK A;  2GT5 A;  2L5O A;  2BJX A;  2EC4 A;  4EC0 A;  2YZH A;  3QD9 A;  3ERF A;  1SD9 A;  2WDU A;  3GA4 A;  3QMX A;  2N5B A;  3QAV A;  1XZO A;  1OVN A;  1NHY A;  2VL2 A;  3KH7 A;  2FWG A;  4BPY A;  2ES7 A;  2H6Y A;  1S3D A;  5IOX A;  4FIW A;  1X0R A;  1WWJ A;  7GSS A;  1YEX A;  1AW9 A;  4FQU A;  2P5R A;  3EMP A;  5HFG A;  2OE3 A;  4LMV A;  4MZW A;  3GUS A;  4HQZ A;  5EL8 A;  1T1V A;  2L5L A;  3APQ A;  5D9T A;  1KNG A;  3BCK A;  1I9D A;  2XPE A;  3F3R A;  2WUL A;  3VK9 A;  5GST A;  2DML A;  2X8C A;  2VUP A;  4EDY A;  1RK4 A;  1A0F A;  3APO A;  5HFI A;  2K6V A;  2H1B A;  2WGR A;  2B7K A;  1E2Y A;  4KF9 A;  1BG5 A;  4OO4 A;  4RUV A;  2B3S A;  2OBI A;  5HR3 A;  1K0A A;  3AY8 A;  5IMV A;  2RUF A;  5IO2 A;  3D21 A;  4IP1 A;  4JE1 A;  4NV5 A;  3KP8 A;  4L0W A;  1HQO A;  3UAR A;  3OR5 A;  4N11 A;  1JZD A;  1W89 A;  4KW6 A;  3IR4 A;  5INY A;  5IO0 A;  3L0H A;  5CRW A;  14GS A;  2I9H A;  3F8U A;  5IMF A;  1GSE A;  2IJY A;  4OD7 A;  2RII A;  4KE3 A;  2B7J A;  2KLX A;  3FR9 A;  5JCU A;  1OC9 A;  4HJ2 A;  4ZIL A;  3HVX A;  2H1G A;  3F6F A;  4TW5 A;  1K0N A;  2FCH A;  2EIO A;  3ZL5 A;  5KN1 A;  2LKU A;  3Q19 A;  3QR6 A;  4ZB8 A;  5ECQ B;  2CZ2 A;  1X9W B;  1PKZ A;  1G7E A;  22GS A;  2LRN A;  3O6T A;  1M2D A;  19GS A;  3HJM A;  1O8W A;  2YOI A;  5B8A A;  3RHB A;  2HZE A;  5G1K A;  3HZ4 A;  4D73 B;  2OE0 A;  1WIK A;  4KX4 A;  4Q5Q A;  1FVJ A;  1Z5Y E;  1M9A A;  2HT9 A;  4RQX A;  2AUV A;  1MDI A;  1XPV A;  3C8E A;  3TKP A;  5HFK A;  5F05 A;  2LV3 A;  2R3X A;  5H5R A;  3C73 A;  4DEJ A;  4EL1 A;  3ZIT A;  4J57 E;  16GS A;  2HYX A;  1F6M C;  18GS A;  10GS A;  3VWV A;  1YKC A;  4K2D A;  3L9V A;  1LU4 A;  4TR4 A;  3DWV A;  2OE1 A;  1GSQ A;  2R6K A;  2A2R A;  6GSU A;  2FLS A;  2PUK C;  2VLU A;  3F0I A;  1HYU A;  3J7Y b;  5CNW A;  1A0R P;  2IN3 A;  1EWX A;  3IA1 A;  5BMU A;  4ISD A;  1V9W A;  4WKW A;  5DAK A;  4HJM A;  3MDK A;  4L5L A;  3QDN A;  4Q5R A;  2A4V A;  3CBU A;  4MJB A;  2N5A A;  3KGK A;  3MAK A;  5AN1 A;  1FB6 A;  2C0D A;  2JZS A;  2MMO A;  3ZFB A;  5G1L A;  1G7O A;  2K18 A;  1PL1 A;  4NHZ A;  1AQV A;  2PN8 A;  3WGX A;  5ECH B;  1MTC A;  1VF4 A;  1QMV A;  2CT6 A;  1V40 A;  2K8V A;  2BMX A;  3GYK A;  2VD0 A;  2DJ1 A;  2CA8 A;  3BD2 A;  5LNK e;  4WET A;  3HYP A;  2YWI A;  4N30 A;  1A23 A;  2K9F A;  9GSS A;  3GL3 A;  4MF6 A;  2VIM A;  5IIZ A;  5DCG A;  1QQ2 A;  1G6W A;  2GGT A;  5B8B A;  2DJ2 A;  3DEX A;  1IYH A;  4DVC A;  4GQF A;  3HKR A;  3ZVJ A;  3GIX A;  3G9B A;  3W8J A;  3KMO A;  1V98 A;  3FK8 A;  1GSS A;  3TGZ A;  3EVI A;  1DE2 A;  3DXB A;  3PIN A;  3LJR A;  4N0Z A;  2JAC A;  5F07 A;  2IIY A;  6GSW A;  1KEB A;  4Q5N A;  4MDC A;  2VL2 C;  3WD6 A;  4GQC A;  3KJY A;  3CTF A;  4XCS A;  4JR6 A;  3ZLP A;  4G9H A;  3QAG A;  1T4Y A;  3GKM A;  3ZVJ D;  1H75 A;  3LSZ A;  4RI6 A;  1F2E A;  3GFK A;  1WOU A;  3QOU A;  2H75 A;  4IW9 A;  2PVQ A;  3FHK A;  1PGT A;  4IVF A;  3HDC A;  4HEA 2;  4MZB A;  2RM6 A;  2JAD A;  1M99 A;  3TCO A;  17GS A;  4MH2 A;  6GSS A;  1EP7 A;  2H6X A;  5AIS A;  2PU9 C;  3KTL A;  1OKT A;  3DYR A;  2CZ3 A;  2RLI A;  3GKX A;  1LJR A;  4BVY B;  4PTS A;  4L0U A;  2GQL A;  2G0F A;  1UVZ A;  1GNW A;  3WT2 A;  4MA9 A;  2C8U A;  3TJK A;  4BVX A;  1ZZY A;  2DJ0 A;  5EPF A;  4MP4 A;  1MD4 A;  3DML A;  4X1U A;  5F8B A;  4QL7 A;  4MZC A;  4F03 A;  3WT1 A;  1W4V A;  2JZR A;  1GTA A;  4G2E A;  4JU5 A;  2AB6 A;  4TXO A;  3NOF A;  1SJZ A;  2MMA A;  4FYU A;  3IXR A;  4GST A;  4OCE A;  4EKZ A;  4X43 A;  2XHF A;  4POL A;  3BCI A;  4XS1 A;  2CQ9 A;  5DBQ A;  12GS A;  4BL7 A;  1JLW A;  1TJD A;  1XW9 A;  1M0U A;  1EOH A;  4DSQ A;  1IYI A;  2H01 A;  3LQ7 A;  4I97 A;  2H71 A;  2H0I A;  1OYJ A;  1AAZ A;  1XWB A;  2VOC A;  2CVD A;  2LTK A;  1PL2 A;  5IOW A;  2GST A;  2HSH A;  5DQY A;  1TK0 B;  4ECJ A;  3RHC A;  5D73 A;  3UBK A;  5A4W A;  4X0X A;  3E9J B;  2NTO A;  1U87 A;  3LXT A;  3FZ5 A;  4TR1 B;  1SJI A;  2KOK A;  5IMD A;  5COH A;  4LMW A;  1XIY A;  2ZNM A;  4I6X A;  1K0D A;  3D0Z A;  1ST9 A;  3GTU A;  4K6X A;  4LLR A;  2PPT A;  3QFB C;  1X5C A;  3VWW A;  2NBS A;  1X9M B;  1DUG A;  1B4Q A;  6GST A;  2VAF A;  2C3Q A;  3HHV A;  4G0I A;  2I1U A;  1GRX A;  2C0F A;  2HSN B;  3O76 A;  3S9F A;  3IHQ A;  3ZYW A;  1VRS D;  1Z3E A;  2R37 A;  5HR0 A;  1TI3 A;  3TRP A;  4ACS A;  4IEL A;  3DVW A;  5GZZ B;  1BED A;  2HRK A;  2B1L A;  1U88 A;  5CRG A;  3GKK A;  2RUE A;  2IFQ B;  5G30 A;  4NAX A;  1NSW A;  3SWL A;  3KTB A;  5ECL B;  2L6C A;  2MBT A;  4KND A;  3EWL A;  3KD0 A;  4XRD A;  4K8M A;  1GUM A;  2JL4 A;  2VM2 A;  3FZA A;  3EYT A;  1B8X A;  4ECI A;  5DAL B;  4PNF A;  1MDJ A;  4TR3 A;  5GSS A;  3KIJ A;  2QKE A;  1EV9 A;  4GTU A;  3PGT A;  3WGE A;  2IMI A;  3TDG A;  1AQX A;  2H1D A;  4GSN A;  3MNG A;  5CYY A;  1U6T A;  2ON5 A;  4BVX B;  1PMT A;  3LOR A;  1MDK A;  1CQH A;  3M9K A;  1HNA A;  3VI7 A;  4WF5 A;  4PUF C;  3TRQ A;  2DMM A;  4MCU A;  4MK3 A;  2I4A A;  5JCW A;  4RI7 A;  2WJU A;  5L71 A;  1VGL A;  4IHU A;  1I5G A;  1UC7 A;  1ZCP A;  4YH2 A;  3UMA A;  5G5E A;  2X64 A;  4KDX A;  1EZK A;  3LXZ A;  1M9B A;  2V2G A;  1Y25 A;  4V2M A;  4HZ2 A;  3CTG A;  3UIW A;  1EGR A;  3KCM A;  3PR8 A;  5CP1 A;  2K8S A;  3FEU A;  1SU9 A;  3E0U A;  3ZTL A;  3GN3 A;  1O8X A;  5IPG A;  2R5G A;  1WP0 A;  3LG6 A;  2TRC P;  3ZIJ A;  3JCM L;  2FNO A;  2GSR A;  2MYG A;  2ON7 A;  2LRC A;  4XS4 B;  4IJ3 A;  2I81 A;  1USB A;  3F6D A;  2PER A;  4ZB9 A;  2AAW A;  1PN9 A;  2M80 A;  1V57 A;  1S3C A;  5ECP B;  3V1W A;  4ECB A;  3H8Q A;  3ZFL A;  4G0L A;  5F0G A;  3DKS A;  4HUA A;  1SKR B;  5JWQ B;  3FR6 A;  3QPM A;  3QAW A;  4KDY A;  3UVH A;  2HNL A;  1JZW A;  2I3Y A;  4OMV A;  2QGV A;  2YV7 A;  3UEM A;  2GZY A;  5LD0 A;  1SL1 B;  3DRN A;  3HXS A;  1EOG A;  1XOB A;  3IPZ A;  5AGY A;  5CRD A;  1BQ7 A;  2M46 A;  3RAZ A;  2V1M A;  4F2I A;  2PBJ A;  5IMA A;  1C72 A;  2H1A A;  4L5O A;  3DVX A;  3TKR A;  1SEN A;  1JZO A;  4ECC A;  2VD1 A;  1GH2 A;  2LST A;  1ERU A;  3VWX A;  2H0H A;  2L4Q A;  4PXO A;  2B1K A;  3RBT A;  4ML1 A;  2VM1 A;  1KTE A;  3P7X A;  4BA7 A;  6GSY A;  1DE1 A;  1UN2 A;  3LYP A;  3GH9 A;  3CSJ A;  2XBI A;  3KZQ A;  2O8V B;  3F4S A;  2GT6 A;  1FVK A;  2REM A;  1DBY A;  3TJJ A;  1XVQ A;  2AJQ B;  4BWS A;  1ZYQ B;  4DSS A;  2DSA A;  8GSS A;  2JZT A;  5D9X A;  3NZN A;  3VLN A;  4I2T A;  2IMF A;  3LYK A;  4PGT A;  2GVP A;  4V2L A;  2FA8 A;  5ID2 A;  3LFL A;  4POK A;  1BYE A;  4F0C A;  5A4U A;  4OFN A;  2YZU A;  2L59 A;  4O5R A;  3US3 A;  2EIQ A;  3TRX A;  1M2B A;  2RM5 A;  1GNE A;  5EY6 A;  1K3O A;  2CX3 A;  1YEP A;  5ECO B;  1EGO A;  2E0Q A;  2VCW A;  1K3Y A;  4NPB A;  1OAZ A;  3UAP A;  1XWK A;  4ZL9 A;  5CO3 A;  3G7Y A;  1TKD B;  1OE7 A;  5EVO A;  2CV4 A;  1EEM A;  1X9S B;  1YY7 A;  2NPB A;  4ZBB A;  1R4W A;  4AGS A;  2JU5 A;  1ILO A;  1X5D A;  1EEJ A;  5J9B A;  1G0T A;  5D93 A;  1GSY A;  2VL3 A;  2VO4 A;  3QCP A;  2FY6 A;  1TU8 A;  1F9M A;  2FWE A;  3U5R E;  2DC5 A;  1T8E B;  4ZL8 A;  1WMJ A;  5D96 A;  2QSI A;  2DLX A;  4GLT A;  4FH8 A;  2YWM A;  4GWR A;  3D4T A;  4ZBA A;  4KH7 A;  2HZF A;  2HFD A;  2F8F A;  3W6G A;  3W8S A;  2XPD A;  1R5A A;  3GX0 A;  2V41 A;  2NDO A;  3C1S A;  2VCT A;  6GSV A;  1CQG A;  4NMU A;  4USS A;  5DJL A;  2X8G A;  3IC8 A;  3GV1 A;  2IWT A;  2H30 A;  1ML6 A;  4IQA A;  5ABR A;  1OC9 B;  1GLP A;  3ERW A;  1TI1 A;  2DJ3 A;  3GRX A;  1EP8 A;  1G6Y A;  1VF3 A;  2WRT A;  3HJP A;  4GSS A;  4IP6 A;  4ILF A;  2LNT A;  1R7H A;  5GAP D;  4PNG A;  3O3T A;  1FOV A;  2L57 A;  3IK7 A;  2WCI A;  3ZRD A;  1UA5 A;  1TXX A;  4V1A p;  1GTI A;  2E7P A;  2O89 A;  4EUY A;  4XIH A;  1T7P B;  4WBR D;  3ERG A;  3VFI A;  2HZE B;  5DVB A;  1XVW A;  1PSQ A;  3GMF A;  5G5F A;  2GZP A;  3G7J A;  2Z9S A;  1WRY A;  2WZ9 A;  4IJI A;  1PKW A;  2GQK A;  3FR3 A;  4ML6 A;  1F37 A;  4QL9 A;  4KSO A;  5AIX A;  2UZ8 A;  2NVL A;  5CAX A;  3EIN A;  2MMN A;  1R5P A;  3FKF A;  5DJM A;  2D2Z A;  3M0F A;  1SJ6 A;  1FO5 A;  4KDU A;  3ME8 A;  4IKH A;  2HSM A;  5JCG A;  3FZ4 A;  2MMZ A;  2PVO C;  2QC7 A;  2YAN A;  3M8N A;  3DIE A;  1XCC A;  4IBP A;  4IGJ A;  4F9Z A;  1ERT A;  2HRA A;  1FG4 A;  1YZX A;  1SK2 A;  1TTZ A;  3WYW A;  3IAS 2;  1V58 A;  1O73 A;  2IL3 A;  4LL1 B;  3BJ5 A;  5ECK B;  2CVK A;  1XW5 A;  2HI7 A;  5H5Q A;  4HI7 A;  5DAK B;  2HQT A;  3EMX A;  3SBC A;  2VCX A;  2H70 A;  2HE3 A;  6GSX A;  1PD2 1;  1Q98 A;  5JWR B;  4LA1 A;  4TVE A;  1Q4J A;  4EDZ A;  2L6D A;  3E3E A;  5IQY A;  4WXT A;  2LS5 A;  3FY7 A;  3ZZX A;  3L4N A;  3KH9 A;  4MAB A;  2AV4 A;  4PQH A;  2F51 A;  5DCH A;  4FO5 A;  2H0G A;  1PX7 A;  5HQP A;  3FRC A;  4FYB A;  1J0F A;  1J9B A;  4J56 E;  1FAA A;  5DQS A;  4HQS A;  1EV4 A;  2KP1 A;  3M3M A;  2N5F A;  4KUN A;  4MF7 A;  1K3L A;  1Z6M A;  3GNJ A;  2PWJ A;  4G0K A;  2AHE A;  1XWA A;  1QFN A;  5KN0 A;  3H1N A;  4KCA A;  4JBB A; 
#chains in the Genus database with same CATH topology
 1E6B A;  4KSM A;  3H93 A;  1TU7 A;  5DDL A;  2H8L A;  3D22 A;  3MWH A;  4HOJ A;  2B5E A;  3ZML A;  3GL5 A;  3CYN A;  4MMM A;  4TRX A;  2LQO A;  4IS0 A;  4HZ4 A;  4IN0 A;  2KUC A;  4CDO A;  2C3T A;  2LQQ A;  2H73 A;  2CAI A;  2R4V A;  4MJA A;  1HNC A;  4K7N A;  1OC3 A;  2J23 A;  2XC2 A;  3GSS A;  3UVT A;  2R0G A;  1KBN A;  4EXJ A;  11GS A;  3GX8 A;  4MJC A;  2YCD A;  3BBY A;  2GQM A;  2PMT A;  5B6M A;  2OA7 A;  2H74 A;  4E68 A;  1GSD A;  4MPG A;  1TW9 A;  5FT3 A;  1HNB A;  2DJK A;  4MPF A;  4WR4 A;  2H1L A;  4I2U A;  3CRU A;  2J9H A;  2E2G A;  4YQU A;  2ZCT A;  1O7U A;  3HZ8 A;  3A2V A;  2VL9 A;  4TXV A;  1TRV A;  4PQ1 A;  1XOA A;  1TXU A;  5KOX A;  3TOU A;  1QK8 A;  2P0G A;  5KEJ A;  1WE0 A;  1T4Z A;  1XWG A;  2HLS A;  5AIV A;  2FA4 A;  1OC8 A;  5J3R A;  3F4R A;  5ECS A;  2PGT A;  4POM A;  2YPM A;  4EE0 A;  20GS A;  1LBK A;  1F3A A;  4O7H A;  4TXO B;  2A2S A;  2O87 A;  3ME7 A;  2YP6 A;  1JHB A;  3TJG A;  1SKS B;  5HR2 A;  1TRW A;  2KP2 A;  2DIY A;  3ISO A;  2GDR A;  2GZZ A;  3CMI A;  5JWO B;  4JZQ A;  3RGB C;  1TK8 B;  5B7C A;  1A24 A;  5ELG A;  3LWA A;  4BL7 B;  2YV9 A;  2YJH A;  3ZIV A;  1BJX A;  1SKW B;  5C04 A;  3EC3 A;  5J41 A;  4IQ1 A;  3I9V 2;  4H86 A;  5FHI A;  3VPT A;  3VUR A;  2ALB A;  1T00 A;  1TP9 A;  2H72 A;  2HRN A;  5A1N A;  3FZ9 A;  3P2A A;  1K0C A;  4N10 A;  2H76 A;  4Q5F A;  4ZXG A;  4G10 A;  1GTB A;  4JR4 A;  4AKG A;  4K1F A;  3UJ1 A;  1ERV A;  1N8J A;  1YQ1 A;  1ZGN A;  3WGD A;  3GTU B;  1TOF A;  3A5W A;  1NW2 A;  3TOT A;  2F8A A;  3IK9 A;  3KP9 A;  4TOP A;  5A34 B;  2H19 A;  1GUK A;  1GSU A;  2VLV A;  3D6I A;  2O85 A;  4K0G A;  1R26 A;  2WW2 A;  2CAQ A;  4GRF A;  2FGX A;  1GUL A;  3DD3 A;  3C1R A;  4TKY A;  2HSY A;  2IMK A;  3G7I A;  2FWH A;  3TKQ A;  4AJ8 A;  4KGI A;  3L9U A;  5B6N A;  4PX1 A;  4A5P A;  1H4O A;  1FB0 A;  4G01 A;  1ON4 A;  2JSZ A;  4E8H A;  4PI0 C;  1YJ6 A;  5HR1 A;  4OFT A;  2B5X A;  3A2W A;  2C1Y A;  1SYR A;  4KA0 A;  1PRX A;  1THO A;  2HRK B;  2IPA A;  2P5Q A;  1Z6N A;  3HVS A;  1ERW A;  4V1A g;  2TIR A;  1XFL A;  2GLR A;  4G19 A;  2JSY A;  4ID0 A;  1M7T A;  2LUS A;  3EE2 A;  3TJB A;  1AUC A;  3GHA A;  5CRH A;  4LL4 B;  2KHP A;  1QGV A;  4K0N A;  4KB3 A;  1B48 A;  4XHM A;  2FUG 2;  4FYC A;  1BF5 A;  3EU4 A;  1O6J A;  1QXH A;  1JLV A;  1WPI A;  3GH6 A;  4FXY P;  5E59 A;  2GSQ A;  2VCZ A;  3VI5 A;  4HDE A;  4ULX A;  4AJ6 A;  3BOA A;  3D5J A;  2GTU A;  4J2F A;  5J5N A;  1DSB A;  3L78 A;  5J4U A;  1ZOF A;  3F4T A;  1XW6 A;  4P3Y B;  3TUE A;  2DJJ A;  3TKS A;  4F82 A;  1YVL A;  2OBK A;  1B9Y C;  4NWY A;  4AJ7 A;  4YQV A;  4BVY A;  4K7I A;  1F3B A;  4EVM A;  4GF0 A;  1JFU A;  1SK0 A;  3Q74 A;  2LEG A;  3CRT A;  1GSF A;  3KXO A;  3RPP A;  1Y1U A;  3UL3 A;  1VF1 A;  4HS1 A;  1T3B A;  3APS A;  4NXI A;  3ED3 A;  2E2M A;  2G2Q A;  5E4W A;  3HMJ G;  1XBS A;  1YKA A;  2YWN A;  5J40 A;  5ECI B;  1GUH A;  3IC4 A;  4PHZ C;  2OKA A;  2V6O A;  4JRR A;  3NIV A;  1B4P A;  4JED A;  3DGQ A;  5GAN D;  3R2Q A;  3PH9 A;  1MD3 A;  3N5O A;  1A2L A;  2LJK A;  4ZB7 A;  1Z9H A;  3ZRE A;  4Z7X A;  1TRS A;  2LJR A;  4GCI A;  4OO5 A;  1QUW A;  1GLQ A;  1PA3 A;  1A2M A;  3QFA C;  1X5E A;  2R2J A;  3HD5 A;  5IPH A;  4ZIJ A;  2P31 A;  2X99 A;  5H5S A;  3RPN A;  3N9J A;  2GS3 A;  5ECM B;  1U3A A;  2B5Y A;  2QA2 A;  2X4A A;  3F9U A;  3UBL A;  4EO3 A;  5CRE A;  2LRT A;  5ECR B;  4EF0 A;  2MZC A;  3C71 A;  1A2J A;  4TR1 A;  1FW1 A;  1Z7P A;  2DIZ A;  3P8W A;  1SD8 A;  3A2X A;  3TU3 B;  4QQ7 A;  3IV4 A;  5F06 A;  2H66 A;  1GWC A;  5A5K A;  4WF4 A;  3J7Y k;  3D4M A;  1ABA A;  5LCZ A;  2C3N A;  4O92 A;  3CXG A;  5C00 A;  5D9W A;  4WBJ A;  3PPU A;  1U3I A;  1GP1 A;  4YKG A;  3KEB A;  3I6A A;  1RQM A;  1NM3 A;  1Z7R A;  1TDI A;  1URM A;  2IME A;  2EFH A;  4RQR A;  3LGC A;  2WFC A;  2O7K A;  3Q18 A;  2VCQ A;  1BAY A;  3HVV A;  2HRF A;  4CY6 A;  3EUR A;  2LJA A;  2V6K A;  2C0E A;  3R3E A;  2IMD A;  1HD2 A;  3F3Q A;  4POB A;  1N2A A;  3UOM A;  3GUR A;  2IFQ A;  5ECN B;  4NHW A;  1NHO A;  4DSS B;  4YAV A;  1XXU A;  3IE3 A;  3RDW A;  1THX A;  1O81 A;  3HY2 A;  3I43 A;  5ID2 B;  3HA9 A;  4CW9 A;  3L9S A;  5DAL A;  3P90 A;  4XTS A;  3CSH A;  2V32 A;  3EU3 A;  3K8N A;  2ZUP A;  2F9S A;  4L8E A;  4OWY A;  3H4K A;  1AQW A;  4HU7 A;  1AC1 A;  4MF5 A;  2FHE A;  5KN2 A;  1K0O A;  4K9Z A;  4OCF A;  3FYG A;  2AYT A;  4K7O A;  4XS6 A;  1O85 A;  1ACV A;  2YN1 A;  3MSZ A;  1M2A A;  2YNX A;  4F0B A;  5J9C A;  2DBC A;  1A8Y A;  1YDK A;  5KN3 A;  5J4V A;  3U6V A;  1S3A A;  2OAD A;  3KM6 A;  2F3M A;  2FD3 A;  4WR5 A;  2CVB A;  5IM9 A;  2LNS A;  1AXD A;  3I69 A;  1AIU A;  4AF2 A;  2TRX A;  3M9J A;  5IMC A;  4WEY A;  4GXZ A;  4KCE A;  2OJL A;  4TN8 A;  3HCZ A;  1SL0 B;  4MLY A;  4V2N A;  2YWO A;  2EIR A;  2WB9 A;  4KAE A;  2B6M A;  4ZL7 A;  1VF2 A;  3VWU A;  2OAC A;  3HJO A;  1PQN A;  1K0B A;  1RW1 A;  2MBS A;  4OFM A;  5D8I A;  3GST A;  5ELA A;  2FWF A;  1YF0 A;  4PUR A;  3M1G A;  4CHS A;  1J08 A;  3TJF A;  1XWC A;  3IBH A;  1B9X C;  3IAM 2;  1GTU A;  4MH3 A;  4XS4 A;  5FWG A;  4XRA A;  4HU9 A;  4BWQ A;  2C4J A;  3IRA A;  1ZL9 A;  2M72 A;  1ZMA A;  3IOS A;  4DSR A;  1FHE A;  4ZBD A;  4PUA A;  2VLT A;  1YF1 A;  3FW2 A;  3TKS C;  3CWG A;  5G2Z A;  4O32 A;  4ZB6 A;  2H6Z A;  4YAP A;  1OE8 A;  1TK5 B;  3F63 A;  2XBQ A;  5IMZ A;  4TR0 A;  2L4C A;  1K0M A;  4PQI A;  2WS2 A;  3TKS E;  1Y6E A;  3ZMK A;  3H79 A;  2C80 A;  3A3T A;  1TRU A;  2HXK A;  5G31 A;  4PI2 C;  1PX6 A;  5D9V A;  3C7M A;  1WJK A;  2BTO T;  2GSS A;  13GS A;  3LEF A;  3GKN A;  3VPQ A;  1GL8 A;  1V2A A;  3KMN A;  1SL2 B;  1OKD A;  2WVX A;  1A8L A;  3TB2 A;  4D73 A;  4N0V A;  4MJE A;  4I5Q A;  1SK1 A;  2CX4 A;  2VCV A;  3Q6O A;  4I8B A;  2HSM B;  2X8H A;  2X49 A;  1BX9 A;  2C0G A;  3IDV A;  1ZYE A;  5ENU A;  4NV2 A;  5A4V A;  3CSI A;  2YJ7 A;  4YQM A;  4O5Q A;  1SYX A;  4E8E A;  1JZR A;  1MEK A;  2GT5 A;  2L5O A;  2BJX A;  2EC4 A;  4EC0 A;  2YZH A;  5A5H B;  3QD9 A;  3ERF A;  1SD9 A;  2WDU A;  3GA4 A;  3QMX A;  2N5B A;  3QAV A;  1XZO A;  1OVN A;  1NHY A;  2VL2 A;  2FWG A;  3KH7 A;  4BPY A;  2ES7 A;  2H6Y A;  1S3D A;  5IOX A;  4Z2R A;  4FIW A;  1X0R A;  1WWJ A;  7GSS A;  1M3J A;  1YEX A;  1AW9 A;  4FQU A;  2P5R A;  3EMP A;  5HFG A;  2OE3 A;  4LMV A;  4MZW A;  3GUS A;  4HQZ A;  5EL8 A;  2DKH A;  1T1V A;  2L5L A;  3APQ A;  5D9T A;  1KNG A;  3BCK A;  1I9D A;  2XPE A;  3F3R A;  2WUL A;  3VK9 A;  5GST A;  2DML A;  2X8C A;  2VUP A;  4EDY A;  1RK4 A;  1A0F A;  3APO A;  5HFI A;  1SVM A;  2K6V A;  2H1B A;  2WGR A;  2B7K A;  1E2Y A;  4KF9 A;  1BG5 A;  4OO4 A;  2DKI A;  4RUV A;  2B3S A;  2OBI A;  5KOW A;  5HR3 A;  1K0A A;  3AY8 A;  5IMV A;  2RUF A;  5IO2 A;  3D21 A;  4IP1 A;  4JE1 A;  4NV5 A;  3KP8 A;  4L0W A;  3A5I A;  1HQO A;  3UAR A;  3OR5 A;  4N11 A;  4AKH A;  1JZD A;  1W89 A;  4KW6 A;  3IR4 A;  5INY A;  5IO0 A;  3L0H A;  5CRW A;  14GS A;  2I9H A;  3F8U A;  2UV8 G;  5IMF A;  1GSE A;  2IJY A;  4OD7 A;  2RII A;  4KE3 A;  2B7J A;  2KLX A;  3FR9 A;  5JCU A;  1OC9 A;  4HJ2 A;  3CQF A;  4ZIL A;  4AI6 A;  3HVX A;  2H1G A;  3F6F A;  4TW5 A;  4AKX B;  2A2P A;  1K0N A;  2FCH A;  2EIO A;  3ZL5 A;  5KN1 A;  2LKU A;  3Q19 A;  3QR6 A;  4ZB8 A;  5ECQ B;  2CZ2 A;  1X9W B;  1PKZ A;  1G7E A;  22GS A;  2LRN A;  2O5V A;  2WW3 A;  1M2D A;  3O6T A;  19GS A;  3HJM A;  1O8W A;  2YOI A;  5B8A A;  3RHB A;  2HZE A;  5G1K A;  3HZ4 A;  4D73 B;  2OE0 A;  1WIK A;  4KX4 A;  4Q5Q A;  1FVJ A;  1Z5Y E;  1M9A A;  2HT9 A;  4RQX A;  2OT3 A;  2AUV A;  1MDI A;  1XPV A;  3C8E A;  3TKP A;  5HFK A;  5F05 A;  2LV3 A;  2R3X A;  5H5R A;  3C73 A;  4DEJ A;  4EL1 A;  4EIQ A;  3ZIT A;  4J57 E;  16GS A;  2HYX A;  1F6M C;  4O5U A;  3EPT A;  3HVN A;  2EFE A;  18GS A;  10GS A;  3VWV A;  1SVO A;  1YKC A;  4K2D A;  3L9V A;  1LU4 A;  4TR4 A;  3DWV A;  2OE1 A;  1GSQ A;  2R6K A;  2A2R A;  1XG8 A;  6GSU A;  2FLS A;  2PUK C;  2VLU A;  3F0I A;  1HYU A;  3J7Y b;  5CNW A;  1A0R P;  2IN3 A;  5A1N B;  1EWX A;  3IA1 A;  4AKI A;  5BMU A;  4ISD A;  1V9W A;  4WKW A;  5DAK A;  4HJM A;  3MDK A;  4L5L A;  3QDN A;  4Q5R A;  2A4V A;  3CBU A;  4MJB A;  2N5A A;  3KGK A;  3MAK A;  5AN1 A;  1FB6 A;  2C0D A;  2JZS A;  2MMO A;  3ZFB A;  4K5S A;  5G1L A;  1G7O A;  2K18 A;  1PL1 A;  4NHZ A;  1AQV A;  2PN8 A;  2QA1 A;  3WGX A;  5ECH B;  1MTC A;  1VF4 A;  1QMV A;  2CT6 A;  1V40 A;  2K8V A;  2BMX A;  3GYK A;  2VD0 A;  2DJ1 A;  2CA8 A;  3BD2 A;  5LNK e;  3MIX A;  4WET A;  3HYP A;  2YWI A;  4N30 A;  1A23 A;  2K9F A;  9GSS A;  3MYD A;  3GL3 A;  4MF6 A;  2VIM A;  5IIZ A;  5DCG A;  1QQ2 A;  1G6W A;  2GGT A;  5B8B A;  5BRT A;  2DJ2 A;  3DEX A;  1IYH A;  4DVC A;  4GQF A;  3HKR A;  3ZVJ A;  3GIX A;  4Z2T A;  3G9B A;  3W8J A;  3KMO A;  1V98 A;  3FK8 A;  2WW1 A;  1GSS A;  3TGZ A;  3EVI A;  1DE2 A;  3DXB A;  3PIN A;  3LJR A;  4N0Z A;  2JAC A;  4K2X A;  5F07 A;  2IIY A;  2HSN A;  6GSW A;  1SVL A;  1KEB A;  4Q5N A;  4MDC A;  2VL2 C;  3WD6 A;  4GQC A;  3KJY A;  3CTF A;  4X4J A;  4XCS A;  4JR6 A;  3ZLP A;  4G9H A;  3QAG A;  1T4Y A;  3GKM A;  3ZVJ D;  1H75 A;  3LSZ A;  4RI6 A;  1F2E A;  3GFK A;  1WOU A;  3QOU A;  2H75 A;  4IW9 A;  2PVQ A;  3FHK A;  1PGT A;  4IVF A;  3HDC A;  4HEA 2;  4MZB A;  2RM6 A;  2JAD A;  1M99 A;  3TCO A;  17GS A;  2A4H A;  4MH2 A;  6GSS A;  1EP7 A;  2H6X A;  5AIS A;  2PU9 C;  3KTL A;  1OKT A;  3DYR A;  2CZ3 A;  2RLI A;  3GKX A;  1LJR A;  4BVY B;  4PTS A;  4L0U A;  2GQL A;  2G0F A;  1UVZ A;  2R0C A;  1GNW A;  3WT2 A;  4MA9 A;  2C8U A;  3TJK A;  4HSC X;  4BVX A;  1ZZY A;  2DJ0 A;  2O3E A;  5EPF A;  4MP4 A;  1MD4 A;  3DML A;  4X1U A;  5F8B A;  4QL7 A;  4MZC A;  4F03 A;  3WT1 A;  1W4V A;  2JZR A;  1GTA A;  4G2E A;  4JU5 A;  2AB6 A;  4QMK A;  4TXO A;  3NOF A;  1SJZ A;  2MMA A;  4FYU A;  3IXR A;  4GST A;  4OCE A;  4EKZ A;  2WVY A;  4X43 A;  2XHF A;  4POL A;  3BCI A;  4XS1 A;  2CQ9 A;  5DBQ A;  12GS A;  4BL7 A;  1JLW A;  1TJD A;  1XW9 A;  1M0U A;  1EOH A;  4DSQ A;  1IYI A;  2H01 A;  3LQ7 A;  5J47 A;  4I97 A;  2H71 A;  2H0I A;  1OYJ A;  1AAZ A;  1XWB A;  4EIP A;  2VOC A;  2CVD A;  2LTK A;  1PL2 A;  5IOW A;  2GST A;  2HSH A;  5DQY A;  1TK0 B;  4ECJ A;  3RHC A;  3CHX C;  5D73 A;  3FMW A;  3UBK A;  5A4W A;  4X0X A;  3E9J B;  2NTO A;  1U87 A;  3LXT A;  3FZ5 A;  4TR1 B;  1SJI A;  2KOK A;  2WVZ A;  2WW0 A;  5IMD A;  5COH A;  4LMW A;  4BIK A;  1XIY A;  2ZNM A;  4I6X A;  1K0D A;  3D0Z A;  1ST9 A;  3GTU A;  4K6X A;  4LLR A;  2PPT A;  3QFB C;  1X5C A;  1YEW C;  3VWW A;  2NBS A;  1X9M B;  1DUG A;  5A34 A;  1B4Q A;  6GST A;  2VAF A;  2C3Q A;  3HHV A;  4G0I A;  2R0P A;  2I1U A;  1GRX A;  2C0F A;  2HSN B;  3O76 A;  3S9F A;  3IHQ A;  3ZYW A;  1VRS D;  1Z3E A;  4YKF A;  2R37 A;  5HR0 A;  1TI3 A;  3TRP A;  4ACS A;  4IEL A;  3DVW A;  5GZZ B;  1BED A;  2HRK A;  2B1L A;  1U88 A;  5CRG A;  3GKK A;  2RUE A;  2IFQ B;  5G30 A;  4NAX A;  1NSW A;  1I1I P;  3SWL A;  3KTB A;  5ECL B;  2L6C A;  2MBT A;  4KND A;  3EWL A;  3KD0 A;  4XRD A;  4Z2U A;  4K8M A;  1GUM A;  2JL4 A;  2VM2 A;  3FZA A;  3EYT A;  5J4Y A;  1B8X A;  4ECI A;  5DAL B;  4PNF A;  1MDJ A;  4TR3 A;  5GSS A;  3KIJ A;  2QKE A;  1EV9 A;  4GTU A;  3PGT A;  3WGE A;  2IMI A;  3TDG A;  1AQX A;  2H1D A;  4GSN A;  1N25 A;  3MNG A;  5CYY A;  1U6T A;  2ON5 A;  4ICY A;  4BVX B;  1PMT A;  4MNN A;  3LOR A;  1MDK A;  1CQH A;  3M9K A;  1HNA A;  3VI7 A;  4WF5 A;  4PUF C;  3TRQ A;  2DMM A;  4MCU A;  4MK3 A;  2I4A A;  5JCW A;  2WZS A;  4RI7 A;  2WJU A;  5L71 A;  1VGL A;  4IHU A;  1I5G A;  1UC7 A;  1ZCP A;  4YH2 A;  3UMA A;  5G5E A;  2X64 A;  4KDX A;  1EZK A;  3LXZ A;  1M9B A;  2V2G A;  1Y25 A;  4V2M A;  4HZ2 A;  3CTG A;  3UIW A;  1EGR A;  3KCM A;  3PR8 A;  5CP1 A;  2K8S A;  3FEU A;  1SU9 A;  3E0U A;  3ZTL A;  3GN3 A;  3RFR C;  1O8X A;  5IPG A;  2R5G A;  1WP0 A;  3LG6 A;  2TRC P;  1M3I A;  3ZIJ A;  3JCM L;  2FNO A;  2GSR A;  2MYG A;  2ON7 A;  2LRC A;  4XS4 B;  4IJ3 A;  2I81 A;  1USB A;  3F6D A;  2PER A;  1PN0 A;  4ZB9 A;  2AAW A;  1PN9 A;  2M80 A;  1V57 A;  1S3C A;  5ECP B;  3V1W A;  4ECB A;  3H8Q A;  3ZFL A;  4G0L A;  5F0G A;  3DKS A;  4HUA A;  1ZYP A;  1SKR B;  5JWQ B;  3FR6 A;  3QPM A;  3QAW A;  4KDY A;  3UVH A;  2HNL A;  1JZW A;  2I3Y A;  4OMV A;  2QGV A;  2YV7 A;  3UEM A;  2GZY A;  5LD0 A;  1S3R A;  1SL1 B;  4N3Z A;  3DRN A;  3HXS A;  1EOG A;  1XOB A;  3IPZ A;  5AGY A;  5CRD A;  1BQ7 A;  2M46 A;  3RAZ A;  1PFO A;  2V1M A;  4F2I A;  2PBJ A;  5IMA A;  1C72 A;  2H1A A;  4L5O A;  3DVX A;  3TKR A;  1SEN A;  1JZO A;  4ECC A;  2VD1 A;  1GH2 A;  2WVX B;  2LST A;  1ERU A;  3VWX A;  2H0H A;  2L4Q A;  4PXO A;  2B1K A;  3RBT A;  4ML1 A;  2VM1 A;  1KTE A;  3P7X A;  4BA7 A;  6GSY A;  1DE1 A;  3LW9 A;  1UN2 A;  4CY8 A;  3LYP A;  3GH9 A;  3CSJ A;  4W66 A;  2XBI A;  3KZQ A;  2O8V B;  3F4S A;  2GT6 A;  1FVK A;  2REM A;  1DBY A;  3TJJ A;  1XVQ A;  2AJQ B;  4BWS A;  1ZYQ B;  4DSS A;  2EFD A;  2DSA A;  8GSS A;  2JZT A;  5D9X A;  3NZN A;  3VLN A;  4I2T A;  2IMF A;  3LYK A;  4GDF A;  4PGT A;  2GVP A;  4V2L A;  2FA8 A;  5ID2 A;  3LFL A;  4POK A;  1BYE A;  4F0C A;  5A4U A;  4OFN A;  2YZU A;  2L59 A;  4O5R A;  3US3 A;  2EIQ A;  3TRX A;  1M2B A;  2RM5 A;  1GNE A;  5EY6 A;  1K3O A;  2CX3 A;  1YEP A;  5ECO B;  1EGO A;  2E0Q A;  2VCW A;  1K3Y A;  4NPB A;  1OAZ A;  3UAP A;  1XWK A;  4ZL9 A;  5CO3 A;  3G7Y A;  1TKD B;  1OE7 A;  3IHG A;  5EVO A;  2CV4 A;  1EEM A;  1X9S B;  1YY7 A;  2NPB A;  4ZBB A;  1R4W A;  4AGS A;  2JU5 A;  1ILO A;  1X5D A;  1EEJ A;  5J9B A;  1G0T A;  5D93 A;  1GSY A;  2VL3 A;  1FOH A;  2VO4 A;  3QCP A;  2FY6 A;  1TU8 A;  1F9M A;  2FWE A;  3U5R E;  2DC5 A;  1T8E B;  4ZL8 A;  1WMJ A;  5D96 A;  2QSI A;  2DLX A;  4GLT A;  4FH8 A;  1S4B P;  2YWM A;  4GWR A;  3D4T A;  4ZBA A;  4KH7 A;  4K5R A;  2HZF A;  2HFD A;  2F8F A;  3W6G A;  3W8S A;  2XPD A;  1R5A A;  3GX0 A;  2V41 A;  2NDO A;  3C1S A;  2VCT A;  6GSV A;  1CQG A;  4NMU A;  4USS A;  5DJL A;  2X8G A;  3IC8 A;  3GV1 A;  2IWT A;  2H30 A;  1ML6 A;  4IQA A;  5ABR A;  1BG1 A;  1OC9 B;  1GLP A;  3ERW A;  1TI1 A;  2DJ3 A;  3GRX A;  1EP8 A;  1G6Y A;  1VF3 A;  2WRT A;  3HJP A;  4GSS A;  4IP6 A;  4ILF A;  2LNT A;  1R7H A;  2VKZ G;  5GAP D;  4PNG A;  3O3T A;  1FOV A;  2L57 A;  3IK7 A;  2WCI A;  3ZRD A;  1UA5 A;  1TXX A;  4V1A p;  1GTI A;  2E7P A;  2O89 A;  4EUY A;  4XIH A;  1T7P B;  4WBR D;  3ERG A;  3VFI A;  2HZE B;  5DVB A;  1XVW A;  1PSQ A;  3GMF A;  5G5F A;  2GZP A;  3G7J A;  2Z9S A;  1WRY A;  2WZ9 A;  4IJI A;  1PKW A;  2GQK A;  3FR3 A;  4ML6 A;  1F37 A;  4QL9 A;  4KSO A;  1ZYN A;  5AIX A;  2UZ8 A;  2NVL A;  5CAX A;  3EIN A;  2MMN A;  1R5P A;  3FKF A;  5DJM A;  2D2Z A;  3M0F A;  1SJ6 A;  1FO5 A;  4KDU A;  2O36 A;  3ME8 A;  4IKH A;  2HSM A;  5JCG A;  3FZ4 A;  2MMZ A;  2PVO C;  2QC7 A;  2YAN A;  3M8N A;  3DIE A;  1XCC A;  4IBP A;  4IGJ A;  4F9Z A;  1ERT A;  2HRA A;  1FG4 A;  2EFC A;  1YZX A;  1SK2 A;  1TTZ A;  3WYW A;  3IAS 2;  1V58 A;  1O73 A;  5A5H A;  2IL3 A;  4LL1 B;  3BJ5 A;  5ECK B;  2CVK A;  5BMU B;  1XW5 A;  2HI7 A;  5H5Q A;  4HI7 A;  5DAK B;  2HQT A;  3EMX A;  3SBC A;  2VCX A;  2H70 A;  2HE3 A;  6GSX A;  1PD2 1;  1Q98 A;  5JWR B;  4LA1 A;  4TVE A;  1Q4J A;  4EDZ A;  2L6D A;  3E3E A;  5IQY A;  4WXT A;  2LS5 A;  3FY7 A;  3ZZX A;  3L4N A;  3KH9 A;  4MAB A;  2AV4 A;  4PQH A;  2F51 A;  5DCH A;  4FO5 A;  2H0G A;  1PX7 A;  5HQP A;  3FRC A;  4FYB A;  1J0F A;  1J9B A;  4J56 E;  1FAA A;  5DQS A;  4HQS A;  1EV4 A;  2KP1 A;  3M3M A;  2N5F A;  4KUN A;  4MF7 A;  1K3L A;  1Z6M A;  3GNJ A;  2PWJ A;  4G0K A;  2AHE A;  1XWA A;  1QFN A;  5KN0 A;  3H1N A;  4KCA A;  4JBB A; 
#chains in the Genus database with same CATH homology
 1E6B A;  4KSM A;  3H93 A;  1TU7 A;  5DDL A;  2H8L A;  3D22 A;  3MWH A;  4HOJ A;  2B5E A;  3ZML A;  3GL5 A;  3CYN A;  4MMM A;  4TRX A;  2LQO A;  4IS0 A;  4HZ4 A;  4IN0 A;  2KUC A;  4CDO A;  2C3T A;  2LQQ A;  2H73 A;  2CAI A;  2R4V A;  4MJA A;  1HNC A;  4K7N A;  1OC3 A;  2J23 A;  2XC2 A;  3GSS A;  3UVT A;  2R0G A;  1KBN A;  4EXJ A;  11GS A;  3GX8 A;  4MJC A;  2YCD A;  3BBY A;  2GQM A;  2PMT A;  5B6M A;  2OA7 A;  2H74 A;  4E68 A;  1GSD A;  4MPG A;  1TW9 A;  5FT3 A;  1HNB A;  2DJK A;  4MPF A;  4WR4 A;  2H1L A;  4I2U A;  3CRU A;  2J9H A;  2E2G A;  4YQU A;  2ZCT A;  1O7U A;  3HZ8 A;  3A2V A;  2VL9 A;  4TXV A;  1TRV A;  4PQ1 A;  1XOA A;  1TXU A;  5KOX A;  3TOU A;  1QK8 A;  2P0G A;  5KEJ A;  1WE0 A;  1T4Z A;  1XWG A;  2HLS A;  5AIV A;  2FA4 A;  1OC8 A;  5J3R A;  3F4R A;  5ECS A;  2PGT A;  4POM A;  2YPM A;  4EE0 A;  20GS A;  1LBK A;  1F3A A;  4O7H A;  4TXO B;  2A2S A;  2O87 A;  3ME7 A;  2YP6 A;  1JHB A;  3TJG A;  1SKS B;  5HR2 A;  1TRW A;  2KP2 A;  2DIY A;  3ISO A;  2GDR A;  2GZZ A;  3CMI A;  5JWO B;  4JZQ A;  1TK8 B;  5B7C A;  1A24 A;  5ELG A;  3LWA A;  4BL7 B;  2YV9 A;  2YJH A;  3ZIV A;  1BJX A;  1SKW B;  5C04 A;  3EC3 A;  5J41 A;  4IQ1 A;  3I9V 2;  4H86 A;  5FHI A;  3VPT A;  3VUR A;  2ALB A;  1T00 A;  1TP9 A;  2H72 A;  2HRN A;  5A1N A;  3FZ9 A;  3P2A A;  1K0C A;  4N10 A;  2H76 A;  4Q5F A;  4ZXG A;  4G10 A;  1GTB A;  4JR4 A;  4AKG A;  4K1F A;  3UJ1 A;  1ERV A;  1N8J A;  1YQ1 A;  1ZGN A;  3WGD A;  3GTU B;  1TOF A;  3A5W A;  1NW2 A;  3TOT A;  2F8A A;  3IK9 A;  3KP9 A;  4TOP A;  5A34 B;  2H19 A;  1GUK A;  1GSU A;  2VLV A;  3D6I A;  2O85 A;  4K0G A;  1R26 A;  4GRF A;  2CAQ A;  2FGX A;  1GUL A;  3DD3 A;  3C1R A;  4TKY A;  2HSY A;  2IMK A;  3G7I A;  2FWH A;  3TKQ A;  4AJ8 A;  4KGI A;  3L9U A;  5B6N A;  4PX1 A;  4A5P A;  1H4O A;  1FB0 A;  4G01 A;  1ON4 A;  2JSZ A;  4E8H A;  1YJ6 A;  5HR1 A;  4OFT A;  2B5X A;  3A2W A;  2C1Y A;  1SYR A;  4KA0 A;  1PRX A;  1THO A;  2HRK B;  2IPA A;  2P5Q A;  1Z6N A;  3HVS A;  1ERW A;  4V1A g;  2TIR A;  1XFL A;  2GLR A;  4G19 A;  2JSY A;  4ID0 A;  1M7T A;  2LUS A;  3EE2 A;  3TJB A;  1AUC A;  3GHA A;  5CRH A;  4LL4 B;  2KHP A;  1QGV A;  4K0N A;  4KB3 A;  1B48 A;  4XHM A;  2FUG 2;  4FYC A;  1BF5 A;  3EU4 A;  1O6J A;  1QXH A;  1JLV A;  1WPI A;  3GH6 A;  5E59 A;  2GSQ A;  2VCZ A;  3VI5 A;  4HDE A;  4ULX A;  4AJ6 A;  3BOA A;  3D5J A;  2GTU A;  4J2F A;  5J5N A;  1DSB A;  3L78 A;  5J4U A;  1ZOF A;  3F4T A;  1XW6 A;  4P3Y B;  3TUE A;  2DJJ A;  3TKS A;  4F82 A;  1YVL A;  2OBK A;  1B9Y C;  4NWY A;  4AJ7 A;  4YQV A;  4BVY A;  4K7I A;  1F3B A;  4EVM A;  4GF0 A;  1JFU A;  1SK0 A;  3Q74 A;  2LEG A;  3CRT A;  1GSF A;  3KXO A;  3RPP A;  1Y1U A;  3UL3 A;  1VF1 A;  4HS1 A;  1T3B A;  3APS A;  4NXI A;  3ED3 A;  2E2M A;  2G2Q A;  5E4W A;  3HMJ G;  1XBS A;  1YKA A;  2YWN A;  5J40 A;  5ECI B;  1GUH A;  3IC4 A;  2OKA A;  2V6O A;  4JRR A;  3NIV A;  1B4P A;  4JED A;  3DGQ A;  5GAN D;  3R2Q A;  3PH9 A;  1MD3 A;  3N5O A;  1A2L A;  2LJK A;  4ZB7 A;  1Z9H A;  3ZRE A;  4Z7X A;  1TRS A;  2LJR A;  4GCI A;  4OO5 A;  1QUW A;  1GLQ A;  1PA3 A;  1A2M A;  3QFA C;  1X5E A;  2R2J A;  3HD5 A;  5IPH A;  4ZIJ A;  2P31 A;  2X99 A;  5H5S A;  3RPN A;  3N9J A;  2GS3 A;  5ECM B;  1U3A A;  2B5Y A;  2QA2 A;  2X4A A;  3F9U A;  3UBL A;  4EO3 A;  5CRE A;  2LRT A;  5ECR B;  4EF0 A;  2MZC A;  3C71 A;  1A2J A;  4TR1 A;  1FW1 A;  1Z7P A;  2DIZ A;  3P8W A;  1SD8 A;  3A2X A;  3TU3 B;  4QQ7 A;  3IV4 A;  5F06 A;  2H66 A;  1GWC A;  5A5K A;  4WF4 A;  3J7Y k;  3D4M A;  1ABA A;  5LCZ A;  2C3N A;  4O92 A;  3CXG A;  5C00 A;  5D9W A;  4WBJ A;  3PPU A;  1U3I A;  1GP1 A;  4YKG A;  3KEB A;  3I6A A;  1RQM A;  1NM3 A;  1Z7R A;  1TDI A;  1URM A;  2IME A;  2EFH A;  4RQR A;  3LGC A;  2WFC A;  2O7K A;  3Q18 A;  2VCQ A;  1BAY A;  3HVV A;  2HRF A;  4CY6 A;  3EUR A;  2LJA A;  2V6K A;  2C0E A;  3R3E A;  2IMD A;  1HD2 A;  3F3Q A;  4POB A;  1N2A A;  3UOM A;  3GUR A;  2IFQ A;  5ECN B;  4NHW A;  1NHO A;  4DSS B;  4YAV A;  1XXU A;  3IE3 A;  3RDW A;  1THX A;  1O81 A;  3HY2 A;  3I43 A;  5ID2 B;  3HA9 A;  4CW9 A;  3L9S A;  5DAL A;  3P90 A;  4XTS A;  3CSH A;  2V32 A;  3EU3 A;  3K8N A;  2ZUP A;  2F9S A;  4L8E A;  4OWY A;  3H4K A;  1AQW A;  4HU7 A;  1AC1 A;  4MF5 A;  2FHE A;  5KN2 A;  1K0O A;  4K9Z A;  4OCF A;  3FYG A;  2AYT A;  4K7O A;  4XS6 A;  1O85 A;  1ACV A;  2YN1 A;  3MSZ A;  1M2A A;  2YNX A;  4F0B A;  5J9C A;  2DBC A;  1A8Y A;  1YDK A;  5KN3 A;  5J4V A;  3U6V A;  1S3A A;  2OAD A;  3KM6 A;  2F3M A;  2FD3 A;  4WR5 A;  2CVB A;  5IM9 A;  2LNS A;  1AXD A;  3I69 A;  1AIU A;  4AF2 A;  2TRX A;  3M9J A;  5IMC A;  4WEY A;  4GXZ A;  4KCE A;  2OJL A;  4TN8 A;  3HCZ A;  1SL0 B;  4MLY A;  4V2N A;  2YWO A;  2EIR A;  2WB9 A;  4KAE A;  2B6M A;  4ZL7 A;  1VF2 A;  3VWU A;  2OAC A;  3HJO A;  1PQN A;  1K0B A;  1RW1 A;  2MBS A;  4OFM A;  5D8I A;  3GST A;  5ELA A;  2FWF A;  1YF0 A;  4PUR A;  3M1G A;  4CHS A;  1J08 A;  3TJF A;  1XWC A;  3IBH A;  1B9X C;  3IAM 2;  1GTU A;  4MH3 A;  4XS4 A;  5FWG A;  4XRA A;  4HU9 A;  4BWQ A;  2C4J A;  3IRA A;  1ZL9 A;  2M72 A;  1ZMA A;  3IOS A;  4DSR A;  1FHE A;  4ZBD A;  4PUA A;  2VLT A;  1YF1 A;  3FW2 A;  3TKS C;  3CWG A;  5G2Z A;  4O32 A;  4ZB6 A;  2H6Z A;  4YAP A;  1OE8 A;  1TK5 B;  3F63 A;  2XBQ A;  5IMZ A;  4TR0 A;  2L4C A;  1K0M A;  4PQI A;  2WS2 A;  3TKS E;  1Y6E A;  3ZMK A;  3H79 A;  2C80 A;  3A3T A;  1TRU A;  2HXK A;  5G31 A;  1PX6 A;  5D9V A;  3C7M A;  1WJK A;  2BTO T;  2GSS A;  13GS A;  3LEF A;  3GKN A;  3VPQ A;  1GL8 A;  1V2A A;  3KMN A;  1SL2 B;  1OKD A;  1A8L A;  3TB2 A;  4D73 A;  4N0V A;  4MJE A;  4I5Q A;  1SK1 A;  2CX4 A;  2VCV A;  3Q6O A;  4I8B A;  2HSM B;  2X8H A;  2X49 A;  1BX9 A;  2C0G A;  3IDV A;  1ZYE A;  5ENU A;  4NV2 A;  5A4V A;  3CSI A;  2YJ7 A;  4YQM A;  4O5Q A;  1SYX A;  4E8E A;  1JZR A;  1MEK A;  2GT5 A;  2L5O A;  2BJX A;  2EC4 A;  4EC0 A;  2YZH A;  5A5H B;  3QD9 A;  3ERF A;  1SD9 A;  2WDU A;  3GA4 A;  3QMX A;  2N5B A;  3QAV A;  1XZO A;  1OVN A;  1NHY A;  2VL2 A;  3KH7 A;  2FWG A;  4BPY A;  2ES7 A;  2H6Y A;  1S3D A;  5IOX A;  4Z2R A;  4FIW A;  1X0R A;  1WWJ A;  7GSS A;  1YEX A;  1AW9 A;  4FQU A;  2P5R A;  3EMP A;  5HFG A;  2OE3 A;  4LMV A;  4MZW A;  3GUS A;  4HQZ A;  5EL8 A;  2DKH A;  1T1V A;  2L5L A;  3APQ A;  5D9T A;  1KNG A;  3BCK A;  1I9D A;  2XPE A;  3F3R A;  2WUL A;  3VK9 A;  5GST A;  2DML A;  2X8C A;  2VUP A;  4EDY A;  1RK4 A;  1A0F A;  3APO A;  5HFI A;  1SVM A;  2K6V A;  2H1B A;  2WGR A;  2B7K A;  1E2Y A;  4KF9 A;  1BG5 A;  4OO4 A;  2DKI A;  4RUV A;  2B3S A;  2OBI A;  5KOW A;  5HR3 A;  1K0A A;  3AY8 A;  5IMV A;  2RUF A;  5IO2 A;  3D21 A;  4IP1 A;  4JE1 A;  4NV5 A;  3KP8 A;  4L0W A;  3A5I A;  1HQO A;  3UAR A;  3OR5 A;  4N11 A;  4AKH A;  1JZD A;  1W89 A;  4KW6 A;  3IR4 A;  5INY A;  5IO0 A;  3L0H A;  5CRW A;  14GS A;  2I9H A;  3F8U A;  2UV8 G;  5IMF A;  1GSE A;  2IJY A;  4OD7 A;  2RII A;  4KE3 A;  2B7J A;  2KLX A;  3FR9 A;  5JCU A;  1OC9 A;  4HJ2 A;  4ZIL A;  4AI6 A;  3HVX A;  2H1G A;  3F6F A;  4TW5 A;  4AKX B;  2A2P A;  1K0N A;  2FCH A;  2EIO A;  3ZL5 A;  5KN1 A;  2LKU A;  3Q19 A;  3QR6 A;  4ZB8 A;  5ECQ B;  2CZ2 A;  1X9W B;  1PKZ A;  1G7E A;  22GS A;  2LRN A;  2O5V A;  3O6T A;  1M2D A;  19GS A;  3HJM A;  1O8W A;  2YOI A;  5B8A A;  3RHB A;  2HZE A;  5G1K A;  3HZ4 A;  4D73 B;  2OE0 A;  1WIK A;  4KX4 A;  4Q5Q A;  1FVJ A;  1Z5Y E;  1M9A A;  2HT9 A;  4RQX A;  2OT3 A;  2AUV A;  1MDI A;  1XPV A;  3C8E A;  3TKP A;  5HFK A;  5F05 A;  2LV3 A;  2R3X A;  5H5R A;  3C73 A;  4DEJ A;  4EL1 A;  4EIQ A;  3ZIT A;  4J57 E;  16GS A;  2HYX A;  1F6M C;  4O5U A;  3EPT A;  2EFE A;  18GS A;  10GS A;  3VWV A;  1SVO A;  1YKC A;  4K2D A;  3L9V A;  1LU4 A;  4TR4 A;  3DWV A;  2OE1 A;  1GSQ A;  2R6K A;  2A2R A;  6GSU A;  2FLS A;  2PUK C;  2VLU A;  3F0I A;  1HYU A;  3J7Y b;  5CNW A;  1A0R P;  2IN3 A;  5A1N B;  1EWX A;  3IA1 A;  4AKI A;  5BMU A;  4ISD A;  1V9W A;  4WKW A;  5DAK A;  4HJM A;  3MDK A;  4L5L A;  3QDN A;  4Q5R A;  2A4V A;  3CBU A;  4MJB A;  2N5A A;  3KGK A;  3MAK A;  5AN1 A;  1FB6 A;  2C0D A;  2JZS A;  2MMO A;  3ZFB A;  4K5S A;  5G1L A;  1G7O A;  2K18 A;  1PL1 A;  4NHZ A;  1AQV A;  2PN8 A;  2QA1 A;  3WGX A;  5ECH B;  1MTC A;  1VF4 A;  1QMV A;  2CT6 A;  1V40 A;  2K8V A;  2BMX A;  3GYK A;  2VD0 A;  2DJ1 A;  2CA8 A;  3BD2 A;  5LNK e;  3MIX A;  4WET A;  3HYP A;  2YWI A;  4N30 A;  1A23 A;  2K9F A;  9GSS A;  3MYD A;  3GL3 A;  4MF6 A;  2VIM A;  5IIZ A;  5DCG A;  1QQ2 A;  1G6W A;  2GGT A;  5B8B A;  5BRT A;  2DJ2 A;  3DEX A;  1IYH A;  4DVC A;  4GQF A;  3HKR A;  3ZVJ A;  3GIX A;  4Z2T A;  3G9B A;  3W8J A;  3KMO A;  1V98 A;  3FK8 A;  1GSS A;  3TGZ A;  3EVI A;  1DE2 A;  3DXB A;  3PIN A;  3LJR A;  4N0Z A;  2JAC A;  4K2X A;  5F07 A;  2IIY A;  2HSN A;  6GSW A;  1SVL A;  1KEB A;  4Q5N A;  4MDC A;  2VL2 C;  3WD6 A;  4GQC A;  3KJY A;  3CTF A;  4X4J A;  4XCS A;  4JR6 A;  3ZLP A;  4G9H A;  3QAG A;  1T4Y A;  3GKM A;  3ZVJ D;  1H75 A;  3LSZ A;  4RI6 A;  1F2E A;  3GFK A;  1WOU A;  3QOU A;  2H75 A;  4IW9 A;  2PVQ A;  3FHK A;  1PGT A;  4IVF A;  3HDC A;  4HEA 2;  4MZB A;  2RM6 A;  2JAD A;  1M99 A;  3TCO A;  17GS A;  2A4H A;  4MH2 A;  6GSS A;  1EP7 A;  2H6X A;  5AIS A;  2PU9 C;  3KTL A;  1OKT A;  3DYR A;  2CZ3 A;  2RLI A;  3GKX A;  1LJR A;  4BVY B;  4PTS A;  4L0U A;  2GQL A;  2G0F A;  1UVZ A;  2R0C A;  1GNW A;  3WT2 A;  4MA9 A;  2C8U A;  3TJK A;  4BVX A;  1ZZY A;  2DJ0 A;  5EPF A;  4MP4 A;  1MD4 A;  3DML A;  4X1U A;  5F8B A;  4QL7 A;  4MZC A;  4F03 A;  3WT1 A;  1W4V A;  2JZR A;  1GTA A;  4G2E A;  4JU5 A;  2AB6 A;  4QMK A;  4TXO A;  3NOF A;  1SJZ A;  2MMA A;  4FYU A;  3IXR A;  4GST A;  4OCE A;  4EKZ A;  4X43 A;  2XHF A;  4POL A;  3BCI A;  4XS1 A;  2CQ9 A;  5DBQ A;  12GS A;  4BL7 A;  1JLW A;  1TJD A;  1XW9 A;  1M0U A;  1EOH A;  4DSQ A;  1IYI A;  2H01 A;  3LQ7 A;  5J47 A;  4I97 A;  2H71 A;  2H0I A;  1OYJ A;  1AAZ A;  1XWB A;  4EIP A;  2VOC A;  2CVD A;  2LTK A;  1PL2 A;  5IOW A;  2GST A;  2HSH A;  5DQY A;  1TK0 B;  4ECJ A;  3RHC A;  5D73 A;  3FMW A;  3UBK A;  5A4W A;  4X0X A;  3E9J B;  2NTO A;  1U87 A;  3LXT A;  3FZ5 A;  4TR1 B;  1SJI A;  2KOK A;  5IMD A;  5COH A;  4LMW A;  1XIY A;  2ZNM A;  4I6X A;  1K0D A;  3D0Z A;  1ST9 A;  3GTU A;  4K6X A;  4LLR A;  2PPT A;  3QFB C;  1X5C A;  3VWW A;  2NBS A;  1X9M B;  1DUG A;  5A34 A;  1B4Q A;  6GST A;  2VAF A;  2C3Q A;  3HHV A;  4G0I A;  2R0P A;  2I1U A;  1GRX A;  2C0F A;  2HSN B;  3O76 A;  3S9F A;  3IHQ A;  3ZYW A;  1VRS D;  1Z3E A;  4YKF A;  2R37 A;  5HR0 A;  1TI3 A;  3TRP A;  4ACS A;  4IEL A;  3DVW A;  5GZZ B;  1BED A;  2HRK A;  2B1L A;  1U88 A;  5CRG A;  3GKK A;  2RUE A;  2IFQ B;  5G30 A;  4NAX A;  1NSW A;  3SWL A;  3KTB A;  5ECL B;  2L6C A;  2MBT A;  4KND A;  3EWL A;  3KD0 A;  4XRD A;  4Z2U A;  4K8M A;  1GUM A;  2JL4 A;  2VM2 A;  3FZA A;  3EYT A;  5J4Y A;  1B8X A;  4ECI A;  5DAL B;  4PNF A;  1MDJ A;  4TR3 A;  5GSS A;  3KIJ A;  2QKE A;  1EV9 A;  4GTU A;  3PGT A;  3WGE A;  2IMI A;  3TDG A;  1AQX A;  2H1D A;  4GSN A;  1N25 A;  3MNG A;  5CYY A;  1U6T A;  2ON5 A;  4ICY A;  4BVX B;  1PMT A;  4MNN A;  3LOR A;  1MDK A;  1CQH A;  3M9K A;  1HNA A;  3VI7 A;  4WF5 A;  4PUF C;  3TRQ A;  2DMM A;  4MCU A;  4MK3 A;  2I4A A;  5JCW A;  4RI7 A;  2WJU A;  5L71 A;  1VGL A;  4IHU A;  1I5G A;  1UC7 A;  1ZCP A;  4YH2 A;  3UMA A;  5G5E A;  2X64 A;  4KDX A;  1EZK A;  3LXZ A;  1M9B A;  2V2G A;  1Y25 A;  4V2M A;  4HZ2 A;  3CTG A;  3UIW A;  1EGR A;  3KCM A;  3PR8 A;  5CP1 A;  2K8S A;  3FEU A;  1SU9 A;  3E0U A;  3ZTL A;  3GN3 A;  1O8X A;  5IPG A;  2R5G A;  1WP0 A;  3LG6 A;  2TRC P;  3ZIJ A;  3JCM L;  2FNO A;  2GSR A;  2MYG A;  2ON7 A;  2LRC A;  4XS4 B;  4IJ3 A;  2I81 A;  1USB A;  3F6D A;  2PER A;  1PN0 A;  4ZB9 A;  2AAW A;  1PN9 A;  2M80 A;  1V57 A;  1S3C A;  5ECP B;  3V1W A;  4ECB A;  3H8Q A;  3ZFL A;  4G0L A;  5F0G A;  3DKS A;  4HUA A;  1ZYP A;  1SKR B;  5JWQ B;  3FR6 A;  3QPM A;  3QAW A;  4KDY A;  3UVH A;  2HNL A;  1JZW A;  2I3Y A;  4OMV A;  2QGV A;  2YV7 A;  3UEM A;  2GZY A;  5LD0 A;  1SL1 B;  4N3Z A;  3DRN A;  3HXS A;  1EOG A;  1XOB A;  3IPZ A;  5AGY A;  5CRD A;  1BQ7 A;  2M46 A;  3RAZ A;  2V1M A;  4F2I A;  2PBJ A;  5IMA A;  1C72 A;  2H1A A;  4L5O A;  3DVX A;  3TKR A;  1SEN A;  1JZO A;  4ECC A;  2VD1 A;  1GH2 A;  2LST A;  1ERU A;  3VWX A;  2H0H A;  2L4Q A;  4PXO A;  2B1K A;  3RBT A;  4ML1 A;  2VM1 A;  1KTE A;  3P7X A;  4BA7 A;  6GSY A;  1DE1 A;  3LW9 A;  1UN2 A;  4CY8 A;  3LYP A;  3GH9 A;  3CSJ A;  4W66 A;  2XBI A;  3KZQ A;  2O8V B;  3F4S A;  2GT6 A;  1FVK A;  2REM A;  1DBY A;  3TJJ A;  1XVQ A;  2AJQ B;  4BWS A;  1ZYQ B;  4DSS A;  2EFD A;  2DSA A;  8GSS A;  2JZT A;  5D9X A;  3NZN A;  3VLN A;  4I2T A;  2IMF A;  3LYK A;  4GDF A;  4PGT A;  2GVP A;  4V2L A;  2FA8 A;  5ID2 A;  3LFL A;  4POK A;  1BYE A;  4F0C A;  5A4U A;  4OFN A;  2YZU A;  2L59 A;  4O5R A;  3US3 A;  2EIQ A;  3TRX A;  1M2B A;  2RM5 A;  1GNE A;  5EY6 A;  1K3O A;  2CX3 A;  1YEP A;  5ECO B;  1EGO A;  2E0Q A;  2VCW A;  1K3Y A;  4NPB A;  1OAZ A;  3UAP A;  1XWK A;  4ZL9 A;  5CO3 A;  3G7Y A;  1TKD B;  1OE7 A;  3IHG A;  5EVO A;  2CV4 A;  1EEM A;  1X9S B;  1YY7 A;  2NPB A;  4ZBB A;  1R4W A;  4AGS A;  2JU5 A;  1ILO A;  1X5D A;  1EEJ A;  5J9B A;  1G0T A;  5D93 A;  1GSY A;  2VL3 A;  1FOH A;  2VO4 A;  3QCP A;  2FY6 A;  1TU8 A;  1F9M A;  2FWE A;  3U5R E;  2DC5 A;  1T8E B;  4ZL8 A;  1WMJ A;  5D96 A;  2QSI A;  2DLX A;  4GLT A;  4FH8 A;  2YWM A;  4GWR A;  3D4T A;  4ZBA A;  4KH7 A;  4K5R A;  2HZF A;  2HFD A;  2F8F A;  3W6G A;  3W8S A;  2XPD A;  1R5A A;  3GX0 A;  2V41 A;  2NDO A;  3C1S A;  2VCT A;  6GSV A;  1CQG A;  4NMU A;  4USS A;  5DJL A;  2X8G A;  3IC8 A;  3GV1 A;  2IWT A;  2H30 A;  1ML6 A;  4IQA A;  5ABR A;  1BG1 A;  1OC9 B;  1GLP A;  3ERW A;  1TI1 A;  2DJ3 A;  3GRX A;  1EP8 A;  1G6Y A;  1VF3 A;  2WRT A;  3HJP A;  4GSS A;  4IP6 A;  4ILF A;  2LNT A;  1R7H A;  2VKZ G;  5GAP D;  4PNG A;  3O3T A;  1FOV A;  2L57 A;  3IK7 A;  2WCI A;  3ZRD A;  1UA5 A;  1TXX A;  4V1A p;  1GTI A;  2E7P A;  2O89 A;  4EUY A;  4XIH A;  1T7P B;  4WBR D;  3ERG A;  3VFI A;  2HZE B;  5DVB A;  1XVW A;  1PSQ A;  3GMF A;  5G5F A;  2GZP A;  3G7J A;  2Z9S A;  1WRY A;  2WZ9 A;  4IJI A;  1PKW A;  2GQK A;  3FR3 A;  4ML6 A;  1F37 A;  4QL9 A;  4KSO A;  1ZYN A;  5AIX A;  2UZ8 A;  2NVL A;  5CAX A;  3EIN A;  2MMN A;  1R5P A;  3FKF A;  5DJM A;  2D2Z A;  3M0F A;  1SJ6 A;  1FO5 A;  4KDU A;  3ME8 A;  4IKH A;  2HSM A;  5JCG A;  3FZ4 A;  2MMZ A;  2PVO C;  2QC7 A;  2YAN A;  3M8N A;  3DIE A;  1XCC A;  4IBP A;  4IGJ A;  4F9Z A;  1ERT A;  2HRA A;  1FG4 A;  2EFC A;  1YZX A;  1SK2 A;  1TTZ A;  3WYW A;  3IAS 2;  1V58 A;  1O73 A;  5A5H A;  2IL3 A;  4LL1 B;  3BJ5 A;  5ECK B;  2CVK A;  5BMU B;  1XW5 A;  2HI7 A;  5H5Q A;  4HI7 A;  5DAK B;  2HQT A;  3EMX A;  3SBC A;  2VCX A;  2H70 A;  2HE3 A;  6GSX A;  1PD2 1;  1Q98 A;  5JWR B;  4LA1 A;  4TVE A;  1Q4J A;  4EDZ A;  2L6D A;  3E3E A;  5IQY A;  4WXT A;  2LS5 A;  3FY7 A;  3ZZX A;  3L4N A;  3KH9 A;  4MAB A;  2AV4 A;  4PQH A;  2F51 A;  5DCH A;  4FO5 A;  2H0G A;  1PX7 A;  5HQP A;  3FRC A;  4FYB A;  1J0F A;  1J9B A;  4J56 E;  1FAA A;  5DQS A;  4HQS A;  1EV4 A;  2KP1 A;  3M3M A;  2N5F A;  4KUN A;  4MF7 A;  1K3L A;  1Z6M A;  3GNJ A;  2PWJ A;  4G0K A;  2AHE A;  1XWA A;  1QFN A;  5KN0 A;  3H1N A;  4KCA A;  4JBB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...