4ZXGA

Ligandin binding site of pfgst
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
204
structure length
201
Chain Sequence
DNIVLYYFDARGKAELIRLIFAYLGIEYTDKRFGVNGDAFVEFKNFKKEKDTPFEQVPILQIGDLILAQSQAIVRYLSKKYNICGESELNEFYADMIFCGVQDIHYKFNNTNLFKQNETTFLNEDLPKWSGYFEKLLKKNHTNNNKYYFVGNNLTYADLAVFNLYDDIETKYPSLKNFPLLKAHNEFISNLPNIKNYITNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase
publication title High resolution structures of Plasmodium falciparum GST complexes provide novel insights into the dimer-tetramer transition and a novel ligand-binding site.
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 72
structure length 201
sequence length 204
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2015-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4zxgA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4zxgA01
1TW9A 4TXVA 3HVVA 1THXA 4IP6A 3MWHA 3D6IA 5IM9A 1T00A 3LFLA 3WT1A 4GSTA 4HUAA 4FYBA 5HQPA 4GCIA 1Z5YE 1ZGNA 1V40A 4MP4A 4YQVA 1PSQA 2YZUA 2BJXA 3MDKA 1SYRA 1HD2A 1GUKA 2C0FA 4BVXB 5LD0A 5DAKA 3FR3A 1OKTA 4F0BA 4G0LA 4IN0A 1U87A 4ULXA 3VLNA 2WJUA 1QQ2A 3GFKA 2GSTA 4O7HA 4KGIA 2GQMA 4XCSA 3GTUB 2CVKA 1PX6A 2H6XA 4F03A 4BWSA 3IAS2 4WF5A 5CRGA 3HJOA 3ZLPA 1EP8A 1SJZA 4EUYA 2DJJA 3KD0A 3GL5A 3IV4A 5DALB 5G30A 4FIWA 2GVPA 4L5LA 4TXOA 4XS4A 1W89A 5D8IA 4IQAA 2WB9A 3C1RA 3BJ5A 1VRSD 2HZEA 3EWLA 2GSRA 1R7HA 2EIRA 2OE1A 4K9ZA 2HNLA 1YZXA 3IK9A 3VK9A 2VCVA 4BVYB 3VI7A 3V1WA 4MZCA 3LXZA 3HA9A 2K9FA 2R5GA 2AAWA 1GSUA 1QFNA 4JR4A 1K0MA 4O32A 1UVZA 1TU8A 5ECMB 3L78A 3KH7A 2H0HA 1XFLA 3APSA 4NHWA 5GAPD 2VL2C 2C0EA 3DYRA 4N0VA 3LSZA 2AV4A 3TKQA 2EC4A 1SKRB 3QPMA 4ZBDA 3KIJA 1SK1A 4TR1A 5CREA 4J2FA 2O89A 3TRPA 2YZHA 5G2ZA 4MJBA 2LJKA 5J41A 2JZSA 3M3MA 1MTCA 5AIVA 4G9HA 1XWAA 5IMDA 3LG6A 6GSTA 1R5AA 3ISOA 4MA9A 3DMLA 2HQTA 4PGTA 3EYTA 2E2GA 3HD5A 2F3MA 4POLA 4K0NA 2RM5A 4HQSA 4WKWA 1DE1A 1RK4A 2XBIA 1JZRA 2ON7A 2JADA 4MCUA 5EVOA 3CTFA 4HI7A 5HFGA 3O76A 4DSSA 3I43A 1FW1A 3UJ1A 1EEJA 2H73A 5B6MA 3QAWA 3QMXA 1X5EA 3NZNA 1EGOA 5GZZB 5B7CA 1ERVA 5CRDA 1PGTA 2F9SA 1SJIA 1TDIA 2V6OA 2V41A 2QSIA 4IW9A 2VLTA 4AJ6A 2H1DA 1ACVA 3IC4A 2CX4A 1GSYA 5G5EA 2GZZA 2H1AA 2IFQA 5EPFA 2P5RA 4F2IA 4BA7A 4TOPA 4YH2A 3KMOA 2PVOC 4XS4B 4K7IA 4NMUA 2RM6A 2B5EA 4NWYA 2MBSA 5JWOB 4DEJA 1ZYQB 4OCFA 2DIZA 1SENA 3RPPA 5HFIA 2YWIA 4F82A 3LQ7A 1JZWA 5DQSA 2PGTA 1TRVA 2X8CA 3P8WA 1B9YC 1B8XA 2BTOT 1IYIA 1TU7A 4JR6A 1K0NA 4Z7XA 5ECQB 1EOHA 3QR6A 2I3YA 4USSA 4HZ4A 1FOVA 1X5DA 2XHFA 2B7KA 4EDYA 4EO3A 5ECSA 3I6AA 4NXIA 4WBJA 1URMA 4ZILA 2P0GA 2OJLA 4JZQA 1GSQA 3RBTA 5IMAA 1FG4A 2YWMA 5D96A 4P3YB 1J0FA 1Z7RA 1VF1A 2A2SA 4MMMA 4V2LA 4D73A 4IQ1A 3LYKA 3ERFA 4HU7A 4F0CA 4IJIA 3D21A 3GH9A 3SWLA 4I5QA 3GKNA 1B9XC 1HYUA 1OAZA 2RIIA 3N5OA 5IQYA 2N5AA 2HRKB 3ZFLA 3KXOA 2VL3A 1R5PA 4FYUA 4KDXA 1M2DA 3EE2A 3H79A 3UARA 3ME8A 1SKSB 3Q6OA 2C80A 3C1SA 3G7IA 3D22A 4GXZA 5J9BA 2HSYA 2KOKA 3KH9A 1J9BA 2VCZA 5F05A 5LNKe 1ERUA 3LWAA 1OC8A 1GTAA 3P90A 2XPEA 4K2DA 1MD3A 3TOTA 5J9CA 3GUSA 1R4WA 1BJXA 2LS5A 1KEBA 3DWVA 4G0IA 4Q5RA 3CMIA 1XWCA 2ZCTA 1WWJA 1SK0A 3IAM2 2AYTA 3HCZA 3DXBA 2OADA 3QFBC 1A8LA 2O7KA 4OWYA 5KN1A 2A4VA 1XWKA 3UEMA 2ON5A 1B48A 2TRCP 3C71A 2H30A 19GSA 2CAQA 3RPNA 1G6YA 1M9AA 5L71A 4AGSA 1V2AA 3GKMA 2LTKA 5CAXA 4E8EA 1Y6EA 3FK8A 1K0DA 5CRHA 5A4UA 3MNGA 3BD2A 2NTOA 1JLVA 1GSSA 4FH8A 4ZL9A 3U5RE 2NBSA 2OACA 4TR4A 2UZ8A 4BL7B 2MBTA 4MF6A 4HS1A 4IBPA 2VD1A 4ZL8A 3LORA 2LEGA 4JE1A 3LEFA 3A2WA 1K3OA 4RUVA 2C0GA 1LJRA 1GH2A 1PX7A 2H0GA 3E9JB 1QMVA 3LGCA 5JWQB 3D4MA 1NM3A 1WE0A 3ZIJA 4RQXA 1YY7A 2O8VB 1FAAA 1F3AA 3G7JA 5ECPB 1G0TA 3EINA 2OA7A 2ALBA 1DBYA 4NV5A 1AC1A 4TVEA 3GURA 1C72A 2FD3A 5AISA 1WJKA 2YOIA 3ZTLA 3GYKA 5JCWA 3HXSA 4ACSA 1OVNA 6GSWA 3HJPA 4MABA 4DSQA 2FWGA 3GKXA 1GNEA 4LMVA 2FNOA 1BEDA 3DIEA 2RUFA 1DSBA 3GSSA 4OMVA 3TRXA 3RHBA 2CA8A 4F9ZA 4CHSA 3AY8A 1EV4A 4JBBA 1F37A 5BMUA 4OO5A 4V2NA 6GSXA 1XPVA 1A2MA 4ML1A 3PR8A 3C7MA 3HZ8A 2C3QA 1XOBA 1FB6A 2PERA 1SKWB 1GSDA 2VCXA 3ED3A 3ZL5A 2RLIA 2HSMA 1VGLA 2KLXA 2Z9SA 5FHIA 1GP1A 5AGYA 2VLUA 1T7PB 4PQHA 4O5RA 5J4UA 1K0AA 2YV7A 3HVXA 5D73A 2HLSA 2MMNA 3UBKA 4ISDA 2MMZA 2FWFA 5JWRB 4MLYA 1U3AA 5HR0A 3RHCA 1B4QA 2HRAA 4NHZA 3MAKA 9GSSA 5ID2A 1O8XA 2LUSA 1GTBA 2CVDA 1F2EA 3HHVA 3E0UA 3NOFA 3QD9A 2YWNA 3VURA 2X8GA 4H86A 3KCMA 2GSSA 4TRXA 4GLTA 2IMEA 1UC7A 8GSSA 5CYYA 3A3TA 5JCUA 4PUAA 5J5NA 1GRXA 5F06A 2I4AA 2G2QA 4I8BA 2FHEA 1XVWA 5H5SA 3W8SA 1OC3A 3ERWA 1SL1B 2LQOA 2M72A 3HYPA 3CYNA 4V1Ap 1QUWA 4V1Ag 1ERWA 3LYPA 4BWQA 4PTSA 4PNGA 3W6GA 2DSAA 4OD7A 5ECIB 3ZREA 4ID0A 4G0KA 4MPGA 5E59A 3Q19A 3BOAA 2H6ZA 4K1FA 4EXJA 5FWGA 1T4ZA 4EE0A 3WYWA 1F9MA 2GT6A 1JHBA 2C4JA 3TKSE 3S9FA 4KCEA 3FZ9A 3KP9A 3ZVJD 4PNFA 1PQNA 1V57A 4PURA 3N9JA 3BCIA 3ZITA 1OC9A 5DBQA 3IC8A 4ZBBA 3ZFBA 3IK7A 2EIOA 4TR0A 1CQGA 1ABAA 2DMMA 3M8NA 1U88A 2BMXA 1A23A 1XIYA 3FKFA 1SD9A 4MZWA 1T3BA 3SBCA 3KEBA 3P7XA 2GS3A 3H4KA 2HFDA 2CZ3A 4K0GA 5CNWA 1GUHA 2L4CA 1GLQA 1YKAA 5F07A 1KTEA 4KSMA 5KEJA 3HJMA 2WZ9A 4RI6A 2L6CA 2GZYA 3F63A 1SL0B 4KNDA 2H0IA 4BPYA 2CT6A 1TJDA 3H1NA 3O3TA 4X43A 5DAKB 3GN3A 3UVTA 5KN2A 3D4TA 4KA0A 4PQIA 3WGEA 1T8EB 1XWBA 1VF2A 2DJ2A 2MMAA 2K8SA 4XHMA 1BAYA 2CZ2A 3L9UA 4IVFA 22GSA 3A2XA 4HOJA 1LU4A 5CRWA 1UA5A 1Z6MA 1Z7PA 12GSA 3FZ4A 2AHEA 3ZYWA 1SK2A 2H8LA 2L59A 2JSZA 1FVJA 5ELAA 4HJ2A 3PPUA 4KSOA 3UMAA 2QKEA 1H4OA 2VOCA 1X0RA 4TXOB 3GSTA 4JRRA 2OBKA 1O81A 1ON4A 1MDKA 4L8EA 2H19A 2WDUA 2GGTA 2L4QA 1WPIA 5IMFA 2AUVA 2B1KA 2PN8A 2V32A 1JLWA 3HDCA 3K8NA 2HZEB 2XPDA 5JCGA 1OKDA 1AAZA 2DJKA 5DCGA 4J56E 1SU9A 1TTZA 1ZYEA 1XW5A 3IBHA 1WIKA 3DGQA 1GTUA 3FHKA 3EMXA 3PINA 1KBNA 3H8QA 4MH3A 2TRXA 1GSFA 4ZB6A 5IMZA 1HNBA 3TKRA 3GIXA 2IJYA 2X8HA 4LA1A 3UAPA 5B6NA 11GSA 2VIMA 4KW6A 3GHAA 3QAGA 1XXUA 2LJAA 4TR1B 4MJCA 1MD4A 2K6VA 4NPBA 1A0RP 1K0OA 1YF1A 4GTUA 1E6BA 2YV9A 1KNGA 5DJLA 4I2TA 1YEPA 1TKDB 1A8YA 1YQ1A 2IMDA 3QOUA 1R26A 2DJ1A 2FA8A 3HY2A 4PUFC 2HXKA 1UN2A 1USBA 2JZRA 2KHPA 1EGRA 2JACA 5ECKB 2N5BA 1V98A 4QL9A 3BBYA 2JU5A 2IMFA 2V2GA 4G10A 2F8AA 2LRNA 3F4TA 2GQLA 2HRNA 1BG5A 1AXDA 3CBUA 4YQMA 2CQ9A 4MZBA 4YAVA 4N10A 4DSRA 3MSZA 1PL1A 5EL8A 4KB3A 3TCOA 2PUKC 2FCHA 3PGTA 2VAFA 4DSSB 3ME7A 1ML6A 1K0BA 1PD21 3KM6A 3VWUA 1JFUA 3WGDA 1M0UA 1THOA 3KTLA 3Q18A 2FLSA 4ECJA 1BQ7A 5IPGA 3DVXA 1O85A 18GSA 4RI7A 3ZIVA 2VUPA 1Q4JA 2H71A 2WS2A 3GX0A 10GSA 5IOXA 1Y25A 1EWXA 5IMVA 4EF0A 1G7OA 1EV9A 3C73A 2IFQB 5B8AA 3CSJA 4MJEA 2C8UA 1TK5B 4MF7A 3IR4A 4GQFA 3HZ4A 4FYCA 4BVXA 3FEUA 3I69A 3CSIA 4KDUA 2LQQA 1YJ6A 3DD3A 3IPZA 1ZOFA 5AIXA 3GRXA 1MEKA 1GLPA 3VWWA 1V9WA 3FR6A 3GTUA 1JZOA 4V2MA 2VM1A 3NIVA 3Q74A 5DCHA 2DJ3A 1M99A 4GRFA 4ML6A 2RUEA 2R2JA 5ECOB 2N5FA 4MF5A 5DALA 3LXTA 1N8JA 3QFAC 3UL3A 5CO3A 4KDYA 3IRAA 1QXHA 2GQKA 4GF0A 1SD8A 2H66A 1YDKA 3KMNA 2KP1A 5GAND 3M9JA 4TR3A 2IMKA 2I81A 2YP6A 3UOMA 2XC2A 1TRWA 4D73B 4Q5NA 4ZB9A 2MZCA 4KF9A 3EURA 3F3QA 3CTGA 1SL2B 4BVYA 4L0WA 5D93A 2VCTA 2X99A 1VF3A 3IA1A 3RDWA 1K3LA 2H70A 4PX1A 4HQZA 4POMA 4WBRD 2OE0A 4K6XA 1TK8B 1IYHA 4AJ7A 1PMTA 4PQ1A 3TGZA 1TI1A 3KGKA 5F0GA 1F6MC 1YEXA 5F8BA 4POKA 2HSNB 1W4VA 3DRNA 3CXGA 4WR4A 1WOUA 3DKSA 1X9MB 1XWGA 3J7Yb 5B8BA 4KUNA 2FWHA 1XZOA 3R2QA 2H1GA 4K7NA 4IJ3A 2XBQA 3L9SA 4EL1A 5HR1A 3EMPA 4ILFA 3HVSA 3I9V2 1WMJA 3ZVJA 1HNAA 1A2LA 2H1BA 2MMOA 3UIWA 1ILOA 2DJ0A 1A0FA 4I6XA 3WGXA 1PKZA 1T4YA 3FR9A 5H5RA 2B1LA 2P31A 2PWJA 5G31A 3KZQA 2IIYA 3VWVA 2YANA 2HZFA 1NSWA 2GDRA 2HRFA 3TKSA 5ECNB 1F3BA 5ECLB 1GWCA 2HT9A 4TW5A 6GSUA 1NW2A 3J7Yk 1TXXA 4QL7A 1OYJA 4Q5QA 2B5XA 2H72A 4O92A 2H01A 3TJBA 3TOUA 2E7PA 3IXRA 1YF0A 1MDIA 4MDCA 4MH2A 3TDGA 4ECIA 3DEXA 5IOWA 3F4SA 2B3SA 2CX3A 4ECBA 2LSTA 4J57E 17GSA 5INYA 4K8MA 2V6KA 4IS0A 3QAVA 2KUCA 3GL3A 5LCZA 5DJMA 2F51A 4AJ8A 1WRYA 5G1LA 5IMCA 3IHQA 3TRQA 2IN3A 1RW1A 1HQOA 3RAZA 5C00A 2JL4A 1E2YA 4FQUA 4DVCA 1XW9A 2C0DA 2K18A 1AUCA 3D5JA 1CQHA 2LNTA 3TJJA 1TRSA 4CW9A 2IPAA 2FGXA 3P2AA 4K7OA 1GULA 2HE3A 5ENUA 4TKYA 3FY7A 3ZRDA 5A4VA 4LL1B 5A4WA 4NAXA 3M1GA 1GSEA 3G7YA 1TOFA 2C3NA 1WP0A 6GSYA 3ZZXA 5GSSA 4IP1A 13GSA 1H75A 4IELA 1EEMA 2LRTA 2WRTA 1AQXA 16GSA 2VO4A 4IKHA 3VWXA 2LKUA 2PPTA 2AJQB 1O7UA 3A2VA 1U6TA 4LMWA 3W8JA 2F8FA 2E0QA 2GTUA 5AN1A 2C1YA 4ZIJA 1Z3EA 1M9BA 4KCAA 1AQWA 5D9TA 3FRCA 1B4PA 2HI7A 3EVIA 5D9XA 1XOAA 2J23A 1AQVA 1G6WA 1OE8A 3L4NA 2LV3A 1I5GA 4JU5A 5G5FA 4KX4A 4EDZA 2HRKA 4IGJA 2HSMB 4FO5A 1QK8A 2VLVA 3CRUA 2QC7A 2YJ7A 1V58A 3TJGA 5KN3A 1FB0A 3TB2A 3EC3A 4WF4A 1J08A 1TP9A 2PU9C 4WEYA 2JZTA 4OO4A 1M7TA 2M80A 2K8VA 1SJ6A 4JEDA 2H6YA 2B7JA 5ID2B 1Z9HA 4N30A 2H76A 2M46A 2WGRA 4EKZA 5IPHA 1I9DA 4WR5A 3GV1A 3US3A 5ELGA 4MPFA 2V1MA 1RQMA 2ZNMA 2PBJA 4CDOA 5ECHB 1S3DA 5D9VA 4GQCA 3D0ZA 1EOGA 3TKSC 20GSA 2VL9A 3ZMKA 2B6MA 3O6TA 4XTSA 5KN0A 2DC5A 5J3RA 2VD0A 5C04A 4AF2A 4G2EA 2LJRA 5G1KA 5ABRA 2DLXA 2C3TA 4XRAA 1ZZYA 2GSQA 1G7EA 4OFMA 5FT3A 4X1UA 3F9UA 1O8WA 3KTBA 3EU4A 1PRXA 3TUEA 1K3YA 2GLRA 1DE2A 1QGVA 3UVHA 14GSA 4YQUA 2DBCA 4GWRA 3PH9A 1XCCA 2DMLA 4POBA 2IL3A 1LBKA 2R6KA 3IDVA 4G19A 4OFTA 4GSSA 1EZKA 4OFNA 1A24A 2R3XA 3APOA 3VFIA 3R3EA 1GUMA 1T1VA 2LNSA 2WFCA 3TJKA 4BL7A 4XIHA 3H93A 1PA3A 2WULA 2PMTA 5HR3A 1A2JA 1OC9B 2WCIA 5DVBA 3ERGA 4HU9A 3CSHA 3QDNA 2R4VA 4KH7A 4GSNA 2YJHA 2GZPA 1PN9A 1TRUA 3OR5A 1DUGA 3FZAA 2HYXA 7GSSA 1TI3A 1YKCA 4KE3A 2YNXA 2L6DA 3DVWA 1ERTA 1O73A 4LL4B 3TJFA 5COHA 2I9HA 4IHUA 1U3IA 3FZ5A 3TKPA 5HFKA 4HEA2 2YPMA 1M2AA 5EY6A 5H5QA 4NV2A 5CP1A 3F0IA 2O85A 2IWTA 2J9HA 6GSVA 1ST9A 3IE3A 3M9KA 4Q5FA 1JZDA 2FWEA 4I97A 2FY6A 4XS6A 3GA4A 4WETA 1K0CA 4EVMA 1GL8A 5IO0A 5HR2A 2VM2A 1NHOA 2TIRA 4ECCA 1N2AA 3A5WA 6GSSA 3EU3A 3KP8A 2B5YA 1M2BA 2IMIA 2ZUPA 5IO2A 4I2UA 3F6FA 4ZB8A 2QGVA 3E3EA 2HSHA 1XW6A 3FW2A 4N11A 3UBLA 2KP2A 1X5CA 1BX9A 3F4RA 2X64A 1VF4A 4ZBAA 1FVKA 2REMA 4HDEA 2OBIA 1ZMAA 2PVQA 4QQ7A 4WXTA 4L0UA 2GT5A 5DDLA 3CRTA 3GX8A 1FO5A 4HJMA 3WD6A 1PL2A 5A5KA 1BYEA 1AW9A 1AIUA 3BCKA 4N0ZA 1PKWA 4YAPA 5ECRB 2NVLA 3C8EA 3QCPA 2VCQA 2DIYA 3F6DA 2E2MA 1HNCA 4RQRA 2OKAA 2G0FA 4PXOA 1TK0B 1MDJA 2EIQA 5IIZA 3VI5A 1SYXA 3FYGA 1X9WB 4XS1A 2NDOA 2OE3A 2P5QA 4XRDA 3IOSA 4EC0A 3GNJA 1OE7A 2A2RA 3VPTA 2CAIA 4MJAA 1NHYA 3GMFA 5GSTA 2R37A 3F8UA 4KAEA 2L5LA 2ES7A 3L9VA 3L0HA 5D9WA 4L5OA 1EP7A 1O6JA 1XBSA 1S3AA 2VL2A 2YN1A 3GH6A 3G9BA 2FUG2 2L57A 2CVBA 4ZXGA 4OCEA 3ZMLA 1XVQA 2H74A 3F3RA 2D2ZA 2YCDA 3HKRA 5E4WA 1X9SB 4E8HA 3M0FA 3LJRA 3JCML 2JSYA 1GTIA 2AB6A 3APQA 3WT2A 2O87A 1S3CA 2YWOA 2CV4A 2H75A 4MK3A 2NPBA 2I1UA 1Z6NA 2FA4A 3U6VA 1GNWA 4ZL7A 2VCWA 1FHEA 4TN8A 1ZL9A 1ZCPA 2LRCA 3GKKA 2L5OA 4X0XA 3KJYA 4LLRA 1Q98A 2MYGA 4HZ2A 3VPQA 5DQYA
chains in the Genus database with same CATH superfamily
1TW9A 4TXVA 3HVVA 1THXA 4IP6A 3MWHA 3D6IA 5IM9A 1T00A 3LFLA 1S4BP 3WT1A 4GSTA 4HUAA 4FYBA 5HQPA 4GCIA 1Z5YE 1ZGNA 1V40A 4MP4A 4YQVA 1PSQA 2YZUA 2BJXA 3MDKA 1SYRA 1HD2A 4MNNA 1GUKA 2C0FA 4BVXB 5LD0A 5DAKA 3FR3A 1OKTA 4F0BA 4G0LA 4IN0A 1U87A 3HMJG 4ULXA 3VLNA 2WJUA 1QQ2A 3GFKA 2GSTA 4O7HA 5J47A 4KGIA 2GQMA 4XCSA 3GTUB 2CVKA 1PX6A 2H6XA 4F03A 1SVLA 2UV8G 4Z2UA 4BWSA 3IAS2 4WF5A 5CRGA 3HJOA 3ZLPA 4BIKA 1EP8A 1SJZA 4EUYA 2DJJA 3KD0A 3GL5A 3IV4A 5DALB 5G30A 4FIWA 2GVPA 4L5LA 4PHZC 4TXOA 4XS4A 1W89A 5D8IA 4IQAA 2WB9A 3C1RA 3BJ5A 1VRSD 4Z2TA 2HZEA 3EWLA 2GSRA 1R7HA 2EIRA 1I1IP 2OE1A 4K9ZA 2HNLA 1YZXA 3IK9A 3VK9A 2VCVA 4BVYB 3VI7A 3V1WA 4MZCA 3LXZA 3HA9A 2K9FA 2R5GA 2AAWA 1GSUA 1QFNA 4JR4A 1K0MA 4O32A 1UVZA 1TU8A 5ECMB 3L78A 3KH7A 2H0HA 1XFLA 3APSA 4NHWA 5GAPD 2VL2C 2C0EA 3DYRA 4N0VA 3LSZA 2AV4A 3TKQA 2WW1A 2EC4A 1SKRB 2EFCA 3QPMA 4ZBDA 3KIJA 1SK1A 4TR1A 5CREA 4J2FA 2O89A 3TRPA 2YZHA 5G2ZA 4MJBA 2LJKA 5J41A 2JZSA 3M3MA 1MTCA 5AIVA 2A4HA 2WW2A 4G9HA 1XWAA 5IMDA 3LG6A 6GSTA 1R5AA 3ISOA 4MA9A 3DMLA 2HQTA 4PGTA 3EYTA 2E2GA 1BF5A 2F3MA 3HD5A 4POLA 4K0NA 2RM5A 4HQSA 4WKWA 1DE1A 1RK4A 2XBIA 1JZRA 2ON7A 2JADA 2O3EA 4MCUA 5EVOA 3CTFA 4HI7A 5HFGA 3O76A 4DSSA 3I43A 1FW1A 3UJ1A 1EEJA 2H73A 5B6MA 3QAWA 3QMXA 1X5EA 3NZNA 1EGOA 5GZZB 5B7CA 1ERVA 5CRDA 1PGTA 4K5RA 2F9SA 1SJIA 1TDIA 2V6OA 2V41A 2QSIA 4IW9A 2VLTA 5J40A 4AJ6A 2H1DA 1ACVA 3IC4A 2CX4A 1GSYA 5G5EA 2GZZA 2H1AA 2IFQA 5EPFA 4ZB7A 2P5RA 4F2IA 4BA7A 4TOPA 4YH2A 3KMOA 2PVOC 4XS4B 2O5VA 4K7IA 4NMUA 2RM6A 2B5EA 4NWYA 2MBSA 5JWOB 4DEJA 1ZYQB 4OCFA 2DIZA 2O36A 1SENA 3RPPA 5HFIA 2YWIA 2WVXB 4F82A 3LQ7A 1JZWA 5DQSA 3MIXA 2PGTA 1TRVA 2X8CA 3P8WA 1B9YC 1B8XA 2BTOT 4K2XA 1IYIA 1TU7A 4JR6A 1K0NA 4Z7XA 2WVYA 5ECQB 1EOHA 3QR6A 2I3YA 4USSA 4HZ4A 1FOVA 1X5DA 2XHFA 2B7KA 4EDYA 4EO3A 5ECSA 3I6AA 4NXIA 4WBJA 1URMA 4ZILA 2P0GA 2OJLA 4JZQA 1GSQA 3RBTA 5IMAA 1FG4A 2YWMA 5D96A 4P3YB 1J0FA 1Z7RA 1VF1A 2A2SA 4MMMA 4V2LA 4D73A 4IQ1A 3LYKA 3ERFA 4HU7A 2QA2A 4F0CA 2WVZA 4IJIA 3D21A 3GH9A 3SWLA 4I5QA 3GKNA 1B9XC 1HYUA 1OAZA 2RIIA 3N5OA 5IQYA 2WZSA 2N5AA 2HRKB 3ZFLA 3KXOA 2VL3A 1R5PA 4FYUA 4KDXA 1M2DA 3EE2A 3H79A 3UARA 4AI6A 1BG1A 3ME8A 1SKSB 3Q6OA 2C80A 3C1SA 3G7IA 3D22A 3MYDA 4GXZA 5J9BA 2H1LA 2HSNA 2HSYA 2KOKA 3KH9A 1J9BA 2VCZA 5F05A 5LNKe 1ERUA 3LWAA 1OC8A 1GTAA 3P90A 2XPEA 4K2DA 1MD3A 3TOTA 5J9CA 3GUSA 4EIQA 1R4WA 1BJXA 2LS5A 1KEBA 2R0GA 3DWVA 4G0IA 4Q5RA 3CMIA 1XWCA 2ZCTA 1WWJA 1SK0A 3IAM2 2AYTA 4HSCX 3HCZA 3DXBA 2OADA 3QFBC 1A8LA 2O7KA 4OWYA 5KN1A 1Y1UA 2A4VA 1XWKA 5A34A 3UEMA 2ON5A 1B48A 2TRCP 4YKGA 3C71A 2H30A 19GSA 2CAQA 3RFRC 3RPNA 1G6YA 1M9AA 5L71A 4AGSA 1V2AA 3GKMA 2LTKA 5CAXA 2R0CA 4E8EA 1Y6EA 3FK8A 1K0DA 5CRHA 5A4UA 3MNGA 3BD2A 2NTOA 1JLVA 1GSSA 4FH8A 4ZL9A 3U5RE 2NBSA 2OACA 4TR4A 2UZ8A 4BL7B 2MBTA 4MF6A 4HS1A 4IBPA 2VD1A 4ZL8A 3LORA 2LEGA 4JE1A 3LEFA 3A2WA 1K3OA 4RUVA 5A1NA 2C0GA 4YKFA 1LJRA 1GH2A 1PX7A 2H0GA 3E9JB 1QMVA 3LGCA 5JWQB 3TU3B 3D4MA 1NM3A 1WE0A 3ZIJA 4RQXA 1YY7A 2O8VB 1FAAA 1F3AA 3G7JA 5ECPB 1G0TA 3EINA 2OA7A 2ALBA 1DBYA 5A5HA 4NV5A 1AC1A 4TVEA 3GURA 1C72A 2FD3A 5AISA 1WJKA 2YOIA 3ZTLA 3GYKA 5JCWA 3HXSA 4ACSA 1OVNA 6GSWA 3HJPA 4MABA 4DSQA 2FWGA 3GKXA 1GNEA 4LMVA 2FNOA 1BEDA 3DIEA 2RUFA 1DSBA 3GSSA 4OMVA 3TRXA 3RHBA 2CA8A 4F9ZA 4AKHA 4CHSA 3AY8A 1EV4A 4JBBA 1F37A 1SVOA 5BMUA 4OO5A 4V2NA 6GSXA 1XPVA 1A2MA 4ML1A 3PR8A 3C7MA 3HZ8A 2C3QA 1XOBA 4CY8A 1FB6A 2PERA 1SKWB 1GSDA 2VCXA 3ED3A 3ZL5A 2RLIA 2HSMA 1VGLA 2KLXA 2Z9SA 5FHIA 1GP1A 5AGYA 2VLUA 1T7PB 4PQHA 4O5RA 5J4UA 1K0AA 2YV7A 3HVXA 5D73A 2HLSA 2MMNA 3UBKA 4ISDA 2MMZA 2FWFA 5JWRB 4MLYA 1U3AA 5HR0A 3RHCA 1B4QA 2HRAA 4NHZA 3MAKA 9GSSA 5ID2A 1O8XA 2LUSA 1GTBA 2CVDA 1F2EA 3HHVA 3E0UA 3NOFA 3QD9A 2YWNA 3VURA 2X8GA 4H86A 3KCMA 2GSSA 4TRXA 4GLTA 2IMEA 1UC7A 8GSSA 5CYYA 3A3TA 5JCUA 4PUAA 5J5NA 1GRXA 5F06A 2I4AA 2G2QA 4I8BA 2FHEA 1XVWA 5H5SA 3W8SA 2OT3A 1OC3A 3ERWA 1SL1B 2LQOA 2M72A 3HYPA 3CYNA 4V1Ap 4GDFA 1QUWA 4V1Ag 1ERWA 3LYPA 4BWQA 4PTSA 4PNGA 3W6GA 2DSAA 4OD7A 5A1NB 5ECIB 3ZREA 4ID0A 4G0KA 4MPGA 5E59A 3Q19A 3BOAA 4W66A 2H6ZA 4K1FA 4EXJA 5FWGA 1T4ZA 4EE0A 3WYWA 3CHXC 1F9MA 2GT6A 1JHBA 2C4JA 3TKSE 3S9FA 4KCEA 3FZ9A 3KP9A 3ZVJD 4PNFA 1PQNA 1V57A 4PURA 3N9JA 3BCIA 3A5IA 3ZITA 1OC9A 5DBQA 3IC8A 4ZBBA 3ZFBA 3IK7A 2EIOA 4TR0A 1CQGA 1ABAA 2DMMA 2DKHA 2EFDA 3M8NA 1U88A 2BMXA 1A23A 1XIYA 3FKFA 1SD9A 4MZWA 1T3BA 3SBCA 3KEBA 3P7XA 2GS3A 3H4KA 2HFDA 2CZ3A 4K0GA 5CNWA 1GUHA 2L4CA 1GLQA 1YKAA 5F07A 1KTEA 4KSMA 5KEJA 3HJMA 2WZ9A 4RI6A 2L6CA 2GZYA 3F63A 1SL0B 4KNDA 2H0IA 4BPYA 2CT6A 1TJDA 3H1NA 3O3TA 4X43A 5DAKB 3GN3A 3UVTA 3RGBC 5KN2A 3D4TA 4KA0A 4PQIA 3WGEA 1T8EB 1XWBA 1VF2A 2DJ2A 2MMAA 2K8SA 4XHMA 1BAYA 2CZ2A 3L9UA 4PI2C 4IVFA 22GSA 3A2XA 4HOJA 4X4JA 1LU4A 5CRWA 1UA5A 1Z6MA 1Z7PA 12GSA 3FZ4A 2AHEA 3ZYWA 1SK2A 2H8LA 2L59A 2JSZA 1FVJA 5ELAA 4HJ2A 3PPUA 4KSOA 3UMAA 1PN0A 2QKEA 1H4OA 2VOCA 1X0RA 4TXOB 3GSTA 4JRRA 4N3ZA 2OBKA 1O81A 1ON4A 1MDKA 4L8EA 2H19A 2WDUA 2GGTA 2L4QA 1WPIA 5IMFA 2AUVA 2B1KA 4K5SA 2PN8A 2V32A 1JLWA 3HDCA 3K8NA 2HZEB 2XPDA 5JCGA 1OKDA 1AAZA 2DJKA 5DCGA 4J56E 1SU9A 1TTZA 1ZYEA 1XW5A 3IBHA 1WIKA 3DGQA 1GTUA 3FHKA 2QA1A 3EMXA 3PINA 1KBNA 3H8QA 4MH3A 2TRXA 1GSFA 4ZB6A 5IMZA 1HNBA 3TKRA 3GIXA 2IJYA 2X8HA 4LA1A 3UAPA 5B6NA 11GSA 2VIMA 4KW6A 3GHAA 3QAGA 1XXUA 1XG8A 2LJAA 4TR1B 4MJCA 1MD4A 2K6VA 4NPBA 1A0RP 1K0OA 1YF1A 4GTUA 1E6BA 2YV9A 1KNGA 5DJLA 4I2TA 1YEPA 1TKDB 1A8YA 1YQ1A 2IMDA 3QOUA 1R26A 2DJ1A 2FA8A 3HY2A 4PUFC 2HXKA 1UN2A 1USBA 2JZRA 2KHPA 1EGRA 2JACA 5ECKB 2N5BA 1V98A 4QL9A 3BBYA 2JU5A 2IMFA 2V2GA 4G10A 2F8AA 2LRNA 3F4TA 2GQLA 2HRNA 1BG5A 1AXDA 3CBUA 4YQMA 2CQ9A 4MZBA 4YAVA 4N10A 4DSRA 3MSZA 1PL1A 5EL8A 4KB3A 3TCOA 2PUKC 2FCHA 3PGTA 2VAFA 4DSSB 3ME7A 1ML6A 1K0BA 1PD21 3KM6A 3VWUA 1JFUA 3WGDA 1M0UA 1THOA 3KTLA 3Q18A 2FLSA 4ECJA 1BQ7A 5IPGA 3DVXA 1O85A 18GSA 4RI7A 2A2PA 2VUPA 3ZIVA 1Q4JA 2H71A 2WS2A 3GX0A 10GSA 5IOXA 1Y25A 1EWXA 5IMVA 4EF0A 5KOXA 1G7OA 1EV9A 5KOWA 3C73A 2IFQB 5B8AA 3CSJA 4MJEA 2C8UA 1TK5B 4MF7A 3IR4A 4GQFA 3HZ4A 4FYCA 4BVXA 3FEUA 3I69A 3CSIA 4KDUA 2LQQA 1YJ6A 3DD3A 3IPZA 1ZOFA 5AIXA 3GRXA 1MEKA 1GLPA 3VWWA 1V9WA 3FR6A 3GTUA 1JZOA 4V2MA 2VM1A 3NIVA 3Q74A 5DCHA 2DJ3A 1M99A 4GRFA 4ML6A 2RUEA 2R2JA 5ECOB 2N5FA 4MF5A 5DALA 3LXTA 5BRTA 1N8JA 3QFAC 3UL3A 5CO3A 4KDYA 3IRAA 1QXHA 2GQKA 4GF0A 1SD8A 2H66A 1YDKA 3KMNA 2KP1A 5GAND 3M9JA 4TR3A 2IMKA 2I81A 2YP6A 3UOMA 2XC2A 1TRWA 4D73B 4Q5NA 4ZB9A 2MZCA 4KF9A 3EURA 3F3QA 3CTGA 1SL2B 4BVYA 4L0WA 5D93A 2VCTA 2X99A 2X49A 1VF3A 3IA1A 3RDWA 1K3LA 2H70A 4PX1A 4HQZA 4POMA 4WBRD 2OE0A 4K6XA 1TK8B 1IYHA 4AJ7A 1PMTA 2VKZG 4PQ1A 3TGZA 1TI1A 3KGKA 5F0GA 1F6MC 1YEXA 5F8BA 4POKA 2HSNB 1W4VA 3DRNA 2EFHA 3CXGA 4WR4A 1WOUA 3DKSA 1X9MB 1XWGA 3J7Yb 5B8BA 4KUNA 2FWHA 1XZOA 3R2QA 2H1GA 4K7NA 4IJ3A 2XBQA 3L9SA 4EL1A 5HR1A 3EMPA 4ILFA 3HVSA 3I9V2 1WMJA 3ZVJA 1HNAA 1A2LA 2DKIA 4O5QA 2H1BA 2MMOA 3UIWA 1ILOA 2DJ0A 1A0FA 4I6XA 3WGXA 4AKXB 5A34B 1PKZA 1T4YA 3FR9A 3LW9A 5H5RA 2B1LA 2P31A 2PWJA 1SVMA 3EPTA 5G31A 3KZQA 2IIYA 3VWVA 2YANA 2HZFA 1NSWA 2GDRA 2HRFA 3TKSA 5ECNB 1F3BA 5ECLB 1GWCA 2HT9A 2WW0A 4TW5A 1N25A 6GSUA 1NW2A 3J7Yk 1TXXA 4QL7A 1OYJA 4Q5QA 2B5XA 2H72A 4O92A 2H01A 3TJBA 3TOUA 2E7PA 3IXRA 1YF0A 1MDIA 4MDCA 4MH2A 3TDGA 4ECIA 3DEXA 5IOWA 3F4SA 2B3SA 2CX3A 4ECBA 2LSTA 4J57E 17GSA 5INYA 4K8MA 1M3JA 2V6KA 4IS0A 3QAVA 4AKGA 1S3RA 2KUCA 3GL3A 5LCZA 1YVLA 5DJMA 2F51A 4AJ8A 1WRYA 5G1LA 5IMCA 3IHQA 2WVXA 3TRQA 2IN3A 1RW1A 1HQOA 3RAZA 5C00A 2JL4A 1E2YA 4FQUA 4DVCA 1XW9A 2C0DA 5A5HB 2K18A 1AUCA 3D5JA 1CQHA 2LNTA 3TJJA 1TRSA 4CW9A 2IPAA 2R0PA 1PFOA 2FGXA 3P2AA 4K7OA 1GULA 2HE3A 5ENUA 4TKYA 4PI0C 3FY7A 3ZRDA 5A4VA 4LL1B 5A4WA 4NAXA 3CQFA 3M1GA 1GSEA 3G7YA 1TOFA 2C3NA 1WP0A 6GSYA 3ZZXA 5GSSA 4IP1A 13GSA 1H75A 4IELA 1EEMA 2LRTA 2WRTA 1AQXA 16GSA 2VO4A 4IKHA 3VWXA 2LKUA 2PPTA 2AJQB 1O7UA 3A2VA 1U6TA 4LMWA 3W8JA 2F8FA 2E0QA 2GTUA 5AN1A 5BMUB 2C1YA 4ZIJA 1Z3EA 1M9BA 4KCAA 1AQWA 5D9TA 3FRCA 1B4PA 2HI7A 3EVIA 5D9XA 1XOAA 2J23A 1AQVA 1G6WA 1OE8A 4AKIA 2LV3A 3L4NA 1I5GA 4JU5A 5G5FA 4KX4A 4EDZA 2HRKA 4IGJA 2HSMB 4FO5A 1QK8A 2VLVA 3CRUA 2QC7A 2YJ7A 1V58A 3TJGA 2EFEA 5KN3A 1FB0A 3TB2A 3EC3A 4WF4A 1J08A 1TP9A 2PU9C 4WEYA 2JZTA 4OO4A 1M7TA 1ZYNA 2M80A 2K8VA 1SJ6A 5J4YA 4JEDA 2H6YA 2B7JA 5ID2B 1Z9HA 4N30A 2H76A 2M46A 2WGRA 4EKZA 5IPHA 3IHGA 1I9DA 4WR5A 3GV1A 3US3A 5ELGA 4MPFA 2V1MA 4FXYP 1RQMA 2ZNMA 2PBJA 4CDOA 5ECHB 1S3DA 5D9VA 4GQCA 3D0ZA 1EOGA 3TKSC 20GSA 2VL9A 3ZMKA 2B6MA 3O6TA 4XTSA 5KN0A 2DC5A 5J3RA 2VD0A 5C04A 4AF2A 4G2EA 2LJRA 5G1KA 5ABRA 2DLXA 2C3TA 4XRAA 1ZZYA 2GSQA 4ICYA 1G7EA 4OFMA 5FT3A 4X1UA 3HVNA 3F9UA 1O8WA 3KTBA 3EU4A 1PRXA 3TUEA 1K3YA 2GLRA 1DE2A 1QGVA 3UVHA 14GSA 4YQUA 2DBCA 4GWRA 3PH9A 1XCCA 4QMKA 2DMLA 4POBA 2IL3A 1LBKA 2R6KA 3IDVA 4G19A 4OFTA 4GSSA 1EZKA 4OFNA 1A24A 2R3XA 3APOA 3VFIA 3R3EA 1GUMA 1T1VA 2LNSA 2WFCA 3TJKA 4BL7A 4XIHA 3H93A 1PA3A 2WULA 2PMTA 5HR3A 1A2JA 1OC9B 2WCIA 5DVBA 3ERGA 4HU9A 3CSHA 3QDNA 2R4VA 4KH7A 4GSNA 2YJHA 2GZPA 1PN9A 1TRUA 3OR5A 1DUGA 3FZAA 2HYXA 7GSSA 1TI3A 1YKCA 4KE3A 2YNXA 2L6DA 3DVWA 1ERTA 1O73A 4LL4B 3TJFA 5COHA 2I9HA 4IHUA 1U3IA 3FZ5A 1ZYPA 5J4VA 3TKPA 5HFKA 4HEA2 2YPMA 1M2AA 5EY6A 5H5QA 4NV2A 5CP1A 3F0IA 2O85A 2IWTA 2J9HA 6GSVA 1ST9A 3IE3A 3M9KA 4Q5FA 1JZDA 2FWEA 4I97A 2FY6A 4XS6A 1TXUA 3GA4A 1K0CA 4WETA 4EVMA 1GL8A 5IO0A 5HR2A 2VM2A 1NHOA 2TIRA 4ECCA 1N2AA 4A5PA 2WW3A 3A5WA 6GSSA 3EU3A 3KP8A 2B5YA 1M2BA 4Z2RA 2IMIA 2ZUPA 5IO2A 4I2UA 3F6FA 4ZB8A 2QGVA 3E3EA 2HSHA 1XW6A 4EIPA 3FW2A 4N11A 3UBLA 2KP2A 1X5CA 1BX9A 3F4RA 2X64A 1VF4A 4ZBAA 1FVKA 1M3IA 2REMA 4HDEA 2OBIA 1ZMAA 2PVQA 4QQ7A 3CWGA 4WXTA 4L0UA 2GT5A 5DDLA 3CRTA 3GX8A 1FO5A 4HJMA 3WD6A 1PL2A 5A5KA 1BYEA 1AW9A 1AIUA 3BCKA 4CY6A 4N0ZA 1PKWA 4YAPA 5ECRB 2NVLA 3C8EA 3QCPA 2VCQA 2DIYA 3F6DA 2E2MA 1HNCA 4RQRA 2OKAA 2G0FA 4PXOA 1TK0B 1MDJA 2EIQA 5IIZA 3VI5A 1SYXA 3FYGA 1X9WB 4XS1A 2NDOA 2OE3A 4E68A 2P5QA 4XRDA 3IOSA 4EC0A 3GNJA 1OE7A 2X4AA 2A2RA 3VPTA 2CAIA 4MJAA 1NHYA 3GMFA 5GSTA 2R37A 3F8UA 4KAEA 2L5LA 2ES7A 3L9VA 3L0HA 5D9WA 4L5OA 1EP7A 1O6JA 1XBSA 1S3AA 2VL2A 1FOHA 2YN1A 3GH6A 3G9BA 2FUG2 2L57A 2CVBA 4ZXGA 4OCEA 3ZMLA 1XVQA 2H74A 3F3RA 2D2ZA 2YCDA 3HKRA 5E4WA 1X9SB 4E8HA 3M0FA 3LJRA 3JCML 2JSYA 1GTIA 2AB6A 3APQA 3WT2A 2O87A 4G01A 1S3CA 2YWOA 3FMWA 2CV4A 2H75A 4MK3A 2NPBA 2I1UA 1Z6NA 2FA4A 3U6VA 1GNWA 4ZL7A 2VCWA 1FHEA 4TN8A 1YEWC 1ZL9A 1ZCPA 2LRCA 4O5UA 3GKKA 2L5OA 4X0XA 3KJYA 4LLRA 1Q98A 2MYGA 4HZ2A 3VPQA 5DQYA
chains in the Genus database with same CATH topology
1TW9A 4TXVA 3HVVA 1THXA 4IP6A 3MWHA 3D6IA 5IM9A 1T00A 3LFLA 3WT1A 4GSTA 4HUAA 4FYBA 5HQPA 4GCIA 1Z5YE 1ZGNA 1V40A 4MP4A 4YQVA 1PSQA 2YZUA 2BJXA 3MDKA 1SYRA 1HD2A 4MNNA 1GUKA 2C0FA 4BVXB 5LD0A 5DAKA 3FR3A 1OKTA 4F0BA 4G0LA 4IN0A 1U87A 3HMJG 4ULXA 3VLNA 2WJUA 1QQ2A 3GFKA 2GSTA 4O7HA 5J47A 4KGIA 2GQMA 4XCSA 3GTUB 2CVKA 1PX6A 2H6XA 4F03A 1SVLA 2UV8G 4Z2UA 4BWSA 3IAS2 4WF5A 5CRGA 3HJOA 3ZLPA 1EP8A 1SJZA 4EUYA 2DJJA 3KD0A 3GL5A 3IV4A 5DALB 5G30A 4FIWA 2GVPA 4L5LA 4TXOA 4XS4A 1W89A 5D8IA 4IQAA 2WB9A 3C1RA 3BJ5A 1VRSD 4Z2TA 2HZEA 3EWLA 2GSRA 1R7HA 2EIRA 2OE1A 4K9ZA 2HNLA 1YZXA 3IK9A 3VK9A 2VCVA 4BVYB 3VI7A 3V1WA 4MZCA 3LXZA 3HA9A 2K9FA 2R5GA 2AAWA 1GSUA 1QFNA 4JR4A 1K0MA 4O32A 1UVZA 1TU8A 5ECMB 3L78A 3KH7A 2H0HA 1XFLA 3APSA 4NHWA 5GAPD 2VL2C 2C0EA 3DYRA 4N0VA 3LSZA 2AV4A 3TKQA 2EC4A 1SKRB 2EFCA 3QPMA 4ZBDA 3KIJA 1SK1A 4TR1A 5CREA 4J2FA 2O89A 3TRPA 2YZHA 5G2ZA 4MJBA 2LJKA 5J41A 2JZSA 3M3MA 1MTCA 5AIVA 2A4HA 4G9HA 1XWAA 5IMDA 3LG6A 6GSTA 1R5AA 3ISOA 4MA9A 3DMLA 2HQTA 4PGTA 3EYTA 2E2GA 1BF5A 2F3MA 3HD5A 4POLA 4K0NA 2RM5A 4HQSA 4WKWA 1DE1A 1RK4A 2XBIA 1JZRA 2ON7A 2JADA 4MCUA 5EVOA 3CTFA 4HI7A 5HFGA 3O76A 4DSSA 3I43A 1FW1A 3UJ1A 1EEJA 2H73A 5B6MA 3QAWA 3QMXA 1X5EA 3NZNA 1EGOA 5GZZB 5B7CA 1ERVA 5CRDA 1PGTA 4K5RA 2F9SA 1SJIA 1TDIA 2V6OA 2V41A 2QSIA 4IW9A 2VLTA 5J40A 4AJ6A 2H1DA 1ACVA 3IC4A 2CX4A 1GSYA 5G5EA 2GZZA 2H1AA 2IFQA 5EPFA 4ZB7A 2P5RA 4F2IA 4BA7A 4TOPA 4YH2A 3KMOA 2PVOC 4XS4B 2O5VA 4K7IA 4NMUA 2RM6A 2B5EA 4NWYA 2MBSA 5JWOB 4DEJA 1ZYQB 4OCFA 2DIZA 1SENA 3RPPA 5HFIA 2YWIA 4F82A 3LQ7A 1JZWA 5DQSA 3MIXA 2PGTA 1TRVA 2X8CA 3P8WA 1B9YC 1B8XA 2BTOT 4K2XA 1IYIA 1TU7A 4JR6A 1K0NA 4Z7XA 5ECQB 1EOHA 3QR6A 2I3YA 4USSA 4HZ4A 1FOVA 1X5DA 2XHFA 2B7KA 4EDYA 4EO3A 5ECSA 3I6AA 4NXIA 4WBJA 1URMA 4ZILA 2P0GA 2OJLA 4JZQA 1GSQA 3RBTA 5IMAA 1FG4A 2YWMA 5D96A 4P3YB 1J0FA 1Z7RA 1VF1A 2A2SA 4MMMA 4V2LA 4D73A 4IQ1A 3LYKA 3ERFA 4HU7A 2QA2A 4F0CA 4IJIA 3D21A 3GH9A 3SWLA 4I5QA 3GKNA 1B9XC 1HYUA 1OAZA 2RIIA 3N5OA 5IQYA 2N5AA 2HRKB 3ZFLA 3KXOA 2VL3A 1R5PA 4FYUA 4KDXA 1M2DA 3EE2A 3H79A 3UARA 4AI6A 1BG1A 3ME8A 1SKSB 3Q6OA 2C80A 3C1SA 3G7IA 3D22A 4GXZA 5J9BA 2H1LA 2HSNA 2HSYA 2KOKA 3KH9A 1J9BA 2VCZA 5F05A 5LNKe 1ERUA 3LWAA 1OC8A 1GTAA 3P90A 2XPEA 4K2DA 1MD3A 3TOTA 5J9CA 3GUSA 4EIQA 1R4WA 1BJXA 2LS5A 1KEBA 2R0GA 3DWVA 4G0IA 4Q5RA 3CMIA 1XWCA 2ZCTA 1WWJA 1SK0A 3IAM2 2AYTA 3HCZA 3DXBA 2OADA 3QFBC 1A8LA 2O7KA 4OWYA 5KN1A 1Y1UA 2A4VA 1XWKA 5A34A 3UEMA 2ON5A 1B48A 2TRCP 4YKGA 3C71A 2H30A 19GSA 2CAQA 3RPNA 1G6YA 1M9AA 5L71A 4AGSA 1V2AA 3GKMA 2LTKA 5CAXA 2R0CA 4E8EA 1Y6EA 3FK8A 1K0DA 5CRHA 5A4UA 3MNGA 3BD2A 2NTOA 1JLVA 1GSSA 4FH8A 4ZL9A 3U5RE 2NBSA 2OACA 4TR4A 2UZ8A 4BL7B 2MBTA 4MF6A 4HS1A 4IBPA 2VD1A 4ZL8A 3LORA 2LEGA 4JE1A 3LEFA 3A2WA 1K3OA 4RUVA 5A1NA 2C0GA 4YKFA 1LJRA 1GH2A 1PX7A 2H0GA 3E9JB 1QMVA 3LGCA 5JWQB 3TU3B 3D4MA 1NM3A 1WE0A 3ZIJA 4RQXA 1YY7A 2O8VB 1FAAA 1F3AA 3G7JA 5ECPB 1G0TA 3EINA 2OA7A 2ALBA 1DBYA 5A5HA 4NV5A 1AC1A 4TVEA 3GURA 1C72A 2FD3A 5AISA 1WJKA 2YOIA 3ZTLA 3GYKA 5JCWA 3HXSA 4ACSA 1OVNA 6GSWA 3HJPA 4MABA 4DSQA 2FWGA 3GKXA 1GNEA 4LMVA 2FNOA 1BEDA 3DIEA 2RUFA 1DSBA 3GSSA 4OMVA 3TRXA 3RHBA 2CA8A 4F9ZA 4AKHA 4CHSA 3AY8A 1EV4A 4JBBA 1F37A 1SVOA 5BMUA 4OO5A 4V2NA 6GSXA 1XPVA 1A2MA 4ML1A 3PR8A 3C7MA 3HZ8A 2C3QA 1XOBA 4CY8A 1FB6A 2PERA 1SKWB 1GSDA 2VCXA 3ED3A 3ZL5A 2RLIA 2HSMA 1VGLA 2KLXA 2Z9SA 5FHIA 1GP1A 5AGYA 2VLUA 1T7PB 4PQHA 4O5RA 5J4UA 1K0AA 2YV7A 3HVXA 5D73A 2HLSA 2MMNA 3UBKA 4ISDA 2MMZA 2FWFA 5JWRB 4MLYA 1U3AA 5HR0A 3RHCA 1B4QA 2HRAA 4NHZA 3MAKA 9GSSA 5ID2A 1O8XA 2LUSA 1GTBA 2CVDA 1F2EA 3HHVA 3E0UA 3NOFA 3QD9A 2YWNA 3VURA 2X8GA 4H86A 3KCMA 2GSSA 4TRXA 4GLTA 2IMEA 1UC7A 8GSSA 5CYYA 3A3TA 5JCUA 4PUAA 5J5NA 1GRXA 5F06A 2I4AA 2G2QA 4I8BA 2FHEA 1XVWA 5H5SA 3W8SA 2OT3A 1OC3A 3ERWA 1SL1B 2LQOA 2M72A 3HYPA 3CYNA 4V1Ap 4GDFA 1QUWA 4V1Ag 1ERWA 3LYPA 4BWQA 4PTSA 4PNGA 3W6GA 2DSAA 4OD7A 5A1NB 5ECIB 3ZREA 4ID0A 4G0KA 4MPGA 5E59A 3Q19A 3BOAA 4W66A 2H6ZA 4K1FA 4EXJA 5FWGA 1T4ZA 4EE0A 3WYWA 1F9MA 2GT6A 1JHBA 2C4JA 3TKSE 3S9FA 4KCEA 3FZ9A 3KP9A 3ZVJD 4PNFA 1PQNA 1V57A 4PURA 3N9JA 3BCIA 3A5IA 3ZITA 1OC9A 5DBQA 3IC8A 4ZBBA 3ZFBA 3IK7A 2EIOA 4TR0A 1CQGA 1ABAA 2DMMA 2DKHA 2EFDA 3M8NA 1U88A 2BMXA 1A23A 1XIYA 3FKFA 1SD9A 4MZWA 1T3BA 3SBCA 3KEBA 3P7XA 2GS3A 3H4KA 2HFDA 2CZ3A 4K0GA 5CNWA 1GUHA 2L4CA 1GLQA 1YKAA 5F07A 1KTEA 4KSMA 5KEJA 3HJMA 2WZ9A 4RI6A 2L6CA 2GZYA 3F63A 1SL0B 4KNDA 2H0IA 4BPYA 2CT6A 1TJDA 3H1NA 3O3TA 4X43A 5DAKB 3GN3A 3UVTA 5KN2A 3D4TA 4KA0A 4PQIA 3WGEA 1T8EB 1XWBA 1VF2A 2DJ2A 2MMAA 2K8SA 4XHMA 1BAYA 2CZ2A 3L9UA 4IVFA 22GSA 3A2XA 4HOJA 4X4JA 1LU4A 5CRWA 1UA5A 1Z6MA 1Z7PA 12GSA 3FZ4A 2AHEA 3ZYWA 1SK2A 2H8LA 2L59A 2JSZA 1FVJA 5ELAA 4HJ2A 3PPUA 4KSOA 3UMAA 1PN0A 2QKEA 1H4OA 2VOCA 1X0RA 4TXOB 3GSTA 4JRRA 4N3ZA 2OBKA 1O81A 1ON4A 1MDKA 4L8EA 2H19A 2WDUA 2GGTA 2L4QA 1WPIA 5IMFA 2AUVA 2B1KA 4K5SA 2PN8A 2V32A 1JLWA 3HDCA 3K8NA 2HZEB 2XPDA 5JCGA 1OKDA 1AAZA 2DJKA 5DCGA 4J56E 1SU9A 1TTZA 1ZYEA 1XW5A 3IBHA 1WIKA 3DGQA 1GTUA 3FHKA 2QA1A 3EMXA 3PINA 1KBNA 3H8QA 4MH3A 2TRXA 1GSFA 4ZB6A 5IMZA 1HNBA 3TKRA 3GIXA 2IJYA 2X8HA 4LA1A 3UAPA 5B6NA 11GSA 2VIMA 4KW6A 3GHAA 3QAGA 1XXUA 2LJAA 4TR1B 4MJCA 1MD4A 2K6VA 4NPBA 1A0RP 1K0OA 1YF1A 4GTUA 1E6BA 2YV9A 1KNGA 5DJLA 4I2TA 1YEPA 1TKDB 1A8YA 1YQ1A 2IMDA 3QOUA 1R26A 2DJ1A 2FA8A 3HY2A 4PUFC 2HXKA 1UN2A 1USBA 2JZRA 2KHPA 1EGRA 2JACA 5ECKB 2N5BA 1V98A 4QL9A 3BBYA 2JU5A 2IMFA 2V2GA 4G10A 2F8AA 2LRNA 3F4TA 2GQLA 2HRNA 1BG5A 1AXDA 3CBUA 4YQMA 2CQ9A 4MZBA 4YAVA 4N10A 4DSRA 3MSZA 1PL1A 5EL8A 4KB3A 3TCOA 2PUKC 2FCHA 3PGTA 2VAFA 4DSSB 3ME7A 1ML6A 1K0BA 1PD21 3KM6A 3VWUA 1JFUA 3WGDA 1M0UA 1THOA 3KTLA 3Q18A 2FLSA 4ECJA 1BQ7A 5IPGA 3DVXA 1O85A 18GSA 4RI7A 2A2PA 2VUPA 3ZIVA 1Q4JA 2H71A 2WS2A 3GX0A 10GSA 5IOXA 1Y25A 1EWXA 5IMVA 4EF0A 5KOXA 1G7OA 1EV9A 5KOWA 3C73A 2IFQB 5B8AA 3CSJA 4MJEA 2C8UA 1TK5B 4MF7A 3IR4A 4GQFA 3HZ4A 4FYCA 4BVXA 3FEUA 3I69A 3CSIA 4KDUA 2LQQA 1YJ6A 3DD3A 3IPZA 1ZOFA 5AIXA 3GRXA 1MEKA 1GLPA 3VWWA 1V9WA 3FR6A 3GTUA 1JZOA 4V2MA 2VM1A 3NIVA 3Q74A 5DCHA 2DJ3A 1M99A 4GRFA 4ML6A 2RUEA 2R2JA 5ECOB 2N5FA 4MF5A 5DALA 3LXTA 5BRTA 1N8JA 3QFAC 3UL3A 5CO3A 4KDYA 3IRAA 1QXHA 2GQKA 4GF0A 1SD8A 2H66A 1YDKA 3KMNA 2KP1A 5GAND 3M9JA 4TR3A 2IMKA 2I81A 2YP6A 3UOMA 2XC2A 1TRWA 4D73B 4Q5NA 4ZB9A 2MZCA 4KF9A 3EURA 3F3QA 3CTGA 1SL2B 4BVYA 4L0WA 5D93A 2VCTA 2X99A 2X49A 1VF3A 3IA1A 3RDWA 1K3LA 2H70A 4PX1A 4HQZA 4POMA 4WBRD 2OE0A 4K6XA 1TK8B 1IYHA 4AJ7A 1PMTA 2VKZG 4PQ1A 3TGZA 1TI1A 3KGKA 5F0GA 1F6MC 1YEXA 5F8BA 4POKA 2HSNB 1W4VA 3DRNA 2EFHA 3CXGA 4WR4A 1WOUA 3DKSA 1X9MB 1XWGA 3J7Yb 5B8BA 4KUNA 2FWHA 1XZOA 3R2QA 2H1GA 4K7NA 4IJ3A 2XBQA 3L9SA 4EL1A 5HR1A 3EMPA 4ILFA 3HVSA 3I9V2 1WMJA 3ZVJA 1HNAA 1A2LA 2DKIA 4O5QA 2H1BA 2MMOA 3UIWA 1ILOA 2DJ0A 1A0FA 4I6XA 3WGXA 4AKXB 5A34B 1PKZA 1T4YA 3FR9A 3LW9A 5H5RA 2B1LA 2P31A 2PWJA 1SVMA 3EPTA 5G31A 3KZQA 2IIYA 3VWVA 2YANA 2HZFA 1NSWA 2GDRA 2HRFA 3TKSA 5ECNB 1F3BA 5ECLB 1GWCA 2HT9A 4TW5A 1N25A 6GSUA 1NW2A 3J7Yk 1TXXA 4QL7A 1OYJA 4Q5QA 2B5XA 2H72A 4O92A 2H01A 3TJBA 3TOUA 2E7PA 3IXRA 1YF0A 1MDIA 4MDCA 4MH2A 3TDGA 4ECIA 3DEXA 5IOWA 3F4SA 2B3SA 2CX3A 4ECBA 2LSTA 4J57E 17GSA 5INYA 4K8MA 2V6KA 4IS0A 3QAVA 4AKGA 2KUCA 3GL3A 5LCZA 1YVLA 5DJMA 2F51A 4AJ8A 1WRYA 5G1LA 5IMCA 3IHQA 3TRQA 2IN3A 1RW1A 1HQOA 3RAZA 5C00A 2JL4A 1E2YA 4FQUA 4DVCA 1XW9A 2C0DA 5A5HB 2K18A 1AUCA 3D5JA 1CQHA 2LNTA 3TJJA 1TRSA 4CW9A 2IPAA 2R0PA 2FGXA 3P2AA 4K7OA 1GULA 2HE3A 5ENUA 4TKYA 3FY7A 3ZRDA 5A4VA 4LL1B 5A4WA 4NAXA 3M1GA 1GSEA 3G7YA 1TOFA 2C3NA 1WP0A 6GSYA 3ZZXA 5GSSA 4IP1A 13GSA 3VPQA 1H75A 4IELA 1EEMA 2LRTA 2WRTA 1AQXA 16GSA 2VO4A 4IKHA 3VWXA 2LKUA 2PPTA 2AJQB 1O7UA 3A2VA 1U6TA 4LMWA 3W8JA 2F8FA 2E0QA 2GTUA 5AN1A 5BMUB 2C1YA 4ZIJA 1Z3EA 1M9BA 4KCAA 1AQWA 5D9TA 3FRCA 1B4PA 2HI7A 3EVIA 5D9XA 1XOAA 2J23A 1AQVA 1G6WA 1OE8A 4AKIA 2LV3A 3L4NA 1I5GA 4JU5A 5G5FA 4KX4A 4EDZA 2HRKA 4IGJA 2HSMB 4FO5A 1QK8A 2VLVA 3CRUA 2QC7A 2YJ7A 1V58A 3TJGA 2EFEA 5KN3A 1FB0A 3TB2A 3EC3A 4WF4A 1J08A 1TP9A 2PU9C 4WEYA 2JZTA 4OO4A 1M7TA 1ZYNA 2M80A 2K8VA 1SJ6A 5J4YA 4JEDA 2H6YA 2B7JA 5ID2B 1Z9HA 4N30A 2H76A 2M46A 2WGRA 4EKZA 5IPHA 3IHGA 1I9DA 4WR5A 3GV1A 3US3A 5ELGA 4MPFA 2V1MA 1RQMA 2ZNMA 2PBJA 4CDOA 5ECHB 1S3DA 5D9VA 4GQCA 3D0ZA 1EOGA 3TKSC 20GSA 2VL9A 3ZMKA 2B6MA 3O6TA 4XTSA 5KN0A 2DC5A 5J3RA 2VD0A 5C04A 4AF2A 4G2EA 2LJRA 5G1KA 5ABRA 2DLXA 2C3TA 4XRAA 1ZZYA 2GSQA 4ICYA 1G7EA 4OFMA 5FT3A 4X1UA 3F9UA 1O8WA 3KTBA 3EU4A 1PRXA 3TUEA 1K3YA 2GLRA 1DE2A 1QGVA 3UVHA 14GSA 4YQUA 2DBCA 4GWRA 3PH9A 1XCCA 4QMKA 2DMLA 4POBA 2IL3A 1LBKA 2R6KA 3IDVA 4G19A 4OFTA 4GSSA 1EZKA 4OFNA 1A24A 2R3XA 3APOA 3VFIA 3R3EA 1GUMA 1T1VA 2LNSA 2WFCA 3TJKA 4BL7A 4XIHA 3H93A 1PA3A 2WULA 2PMTA 5HR3A 1A2JA 1OC9B 2WCIA 5DVBA 3ERGA 4HU9A 3CSHA 3QDNA 2R4VA 4KH7A 4GSNA 2YJHA 2GZPA 1PN9A 1TRUA 3OR5A 1DUGA 3FZAA 2HYXA 7GSSA 1TI3A 1YKCA 4KE3A 2YNXA 2L6DA 3DVWA 1ERTA 1O73A 4LL4B 3TJFA 5COHA 2I9HA 4IHUA 1U3IA 3FZ5A 1ZYPA 5J4VA 3TKPA 5HFKA 4HEA2 2YPMA 1M2AA 5EY6A 5H5QA 4NV2A 5CP1A 3F0IA 2O85A 2IWTA 2J9HA 6GSVA 1ST9A 3IE3A 3M9KA 4Q5FA 1JZDA 2FWEA 4I97A 2FY6A 4XS6A 1TXUA 3GA4A 1K0CA 4WETA 4EVMA 1GL8A 5IO0A 5HR2A 2VM2A 1NHOA 2TIRA 4ECCA 1N2AA 4A5PA 3A5WA 6GSSA 3EU3A 3KP8A 2B5YA 1M2BA 4Z2RA 2IMIA 2ZUPA 5IO2A 4I2UA 3F6FA 4ZB8A 2QGVA 3E3EA 2HSHA 1XW6A 4EIPA 3FW2A 4N11A 3UBLA 2KP2A 1X5CA 1BX9A 3F4RA 2X64A 1VF4A 4ZBAA 1FVKA 2REMA 4HDEA 2OBIA 1ZMAA 2PVQA 4QQ7A 3CWGA 4WXTA 4L0UA 2GT5A 5DDLA 3CRTA 3GX8A 1FO5A 4HJMA 3WD6A 1PL2A 5A5KA 1BYEA 1AW9A 1AIUA 3BCKA 4CY6A 4N0ZA 1PKWA 4YAPA 5ECRB 2NVLA 3C8EA 3QCPA 2VCQA 2DIYA 3F6DA 2E2MA 1HNCA 4RQRA 2OKAA 2G0FA 4PXOA 1TK0B 1MDJA 2EIQA 5IIZA 3VI5A 1SYXA 3FYGA 1X9WB 4XS1A 2NDOA 2OE3A 4E68A 2P5QA 4XRDA 3IOSA 4EC0A 3GNJA 1OE7A 2X4AA 2A2RA 3VPTA 2CAIA 4MJAA 1NHYA 3GMFA 5GSTA 2R37A 3F8UA 4KAEA 2L5LA 2ES7A 3L9VA 3L0HA 5D9WA 4L5OA 1EP7A 1O6JA 1XBSA 1S3AA 2VL2A 1FOHA 2YN1A 3GH6A 3G9BA 2FUG2 2L57A 2CVBA 4ZXGA 4OCEA 3ZMLA 1XVQA 2H74A 3F3RA 2D2ZA 2YCDA 3HKRA 5E4WA 1X9SB 4E8HA 3M0FA 3LJRA 3JCML 2JSYA 1GTIA 2AB6A 3APQA 3WT2A 2O87A 4G01A 1S3CA 2YWOA 3FMWA 2CV4A 2H75A 4MK3A 2NPBA 2I1UA 1Z6NA 2FA4A 3U6VA 1GNWA 4ZL7A 2VCWA 1FHEA 4TN8A 1ZL9A 1ZCPA 2LRCA 4O5UA 3GKKA 2L5OA 4X0XA 3KJYA 4LLRA 1Q98A 2MYGA 4HZ2A 3MYDA 5DQYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TW9 A;  4TXV A;  3HVV A;  1THX A;  4IP6 A;  3MWH A;  3D6I A;  5IM9 A;  1T00 A;  3LFL A;  3WT1 A;  4GST A;  4HUA A;  4FYB A;  5HQP A;  4GCI A;  1Z5Y E;  1ZGN A;  1V40 A;  4MP4 A;  4YQV A;  1PSQ A;  2YZU A;  2BJX A;  3MDK A;  1SYR A;  1HD2 A;  1GUK A;  2C0F A;  4BVX B;  5LD0 A;  5DAK A;  3FR3 A;  1OKT A;  4F0B A;  4G0L A;  4IN0 A;  1U87 A;  4ULX A;  3VLN A;  2WJU A;  1QQ2 A;  3GFK A;  2GST A;  4O7H A;  4KGI A;  2GQM A;  4XCS A;  3GTU B;  2CVK A;  1PX6 A;  2H6X A;  4F03 A;  4BWS A;  3IAS 2;  4WF5 A;  5CRG A;  3HJO A;  3ZLP A;  1EP8 A;  1SJZ A;  4EUY A;  2DJJ A;  3KD0 A;  3GL5 A;  3IV4 A;  5DAL B;  5G30 A;  4FIW A;  2GVP A;  4L5L A;  4TXO A;  4XS4 A;  1W89 A;  5D8I A;  4IQA A;  2WB9 A;  3C1R A;  3BJ5 A;  1VRS D;  2HZE A;  3EWL A;  2GSR A;  1R7H A;  2EIR A;  2OE1 A;  4K9Z A;  2HNL A;  1YZX A;  3IK9 A;  3VK9 A;  2VCV A;  4BVY B;  3VI7 A;  3V1W A;  4MZC A;  3LXZ A;  3HA9 A;  2K9F A;  2R5G A;  2AAW A;  1GSU A;  1QFN A;  4JR4 A;  1K0M A;  4O32 A;  1UVZ A;  1TU8 A;  5ECM B;  3L78 A;  3KH7 A;  2H0H A;  1XFL A;  3APS A;  4NHW A;  5GAP D;  2VL2 C;  2C0E A;  3DYR A;  4N0V A;  3LSZ A;  2AV4 A;  3TKQ A;  2EC4 A;  1SKR B;  3QPM A;  4ZBD A;  3KIJ A;  1SK1 A;  4TR1 A;  5CRE A;  4J2F A;  2O89 A;  3TRP A;  2YZH A;  5G2Z A;  4MJB A;  2LJK A;  5J41 A;  2JZS A;  3M3M A;  1MTC A;  5AIV A;  4G9H A;  1XWA A;  5IMD A;  3LG6 A;  6GST A;  1R5A A;  3ISO A;  4MA9 A;  3DML A;  2HQT A;  4PGT A;  3EYT A;  2E2G A;  3HD5 A;  2F3M A;  4POL A;  4K0N A;  2RM5 A;  4HQS A;  4WKW A;  1DE1 A;  1RK4 A;  2XBI A;  1JZR A;  2ON7 A;  2JAD A;  4MCU A;  5EVO A;  3CTF A;  4HI7 A;  5HFG A;  3O76 A;  4DSS A;  3I43 A;  1FW1 A;  3UJ1 A;  1EEJ A;  2H73 A;  5B6M A;  3QAW A;  3QMX A;  1X5E A;  3NZN A;  1EGO A;  5GZZ B;  5B7C A;  1ERV A;  5CRD A;  1PGT A;  2F9S A;  1SJI A;  1TDI A;  2V6O A;  2V41 A;  2QSI A;  4IW9 A;  2VLT A;  4AJ6 A;  2H1D A;  1ACV A;  3IC4 A;  2CX4 A;  1GSY A;  5G5E A;  2GZZ A;  2H1A A;  2IFQ A;  5EPF A;  2P5R A;  4F2I A;  4BA7 A;  4TOP A;  4YH2 A;  3KMO A;  2PVO C;  4XS4 B;  4K7I A;  4NMU A;  2RM6 A;  2B5E A;  4NWY A;  2MBS A;  5JWO B;  4DEJ A;  1ZYQ B;  4OCF A;  2DIZ A;  1SEN A;  3RPP A;  5HFI A;  2YWI A;  4F82 A;  3LQ7 A;  1JZW A;  5DQS A;  2PGT A;  1TRV A;  2X8C A;  3P8W A;  1B9Y C;  1B8X A;  2BTO T;  1IYI A;  1TU7 A;  4JR6 A;  1K0N A;  4Z7X A;  5ECQ B;  1EOH A;  3QR6 A;  2I3Y A;  4USS A;  4HZ4 A;  1FOV A;  1X5D A;  2XHF A;  2B7K A;  4EDY A;  4EO3 A;  5ECS A;  3I6A A;  4NXI A;  4WBJ A;  1URM A;  4ZIL A;  2P0G A;  2OJL A;  4JZQ A;  1GSQ A;  3RBT A;  5IMA A;  1FG4 A;  2YWM A;  5D96 A;  4P3Y B;  1J0F A;  1Z7R A;  1VF1 A;  2A2S A;  4MMM A;  4V2L A;  4D73 A;  4IQ1 A;  3LYK A;  3ERF A;  4HU7 A;  4F0C A;  4IJI A;  3D21 A;  3GH9 A;  3SWL A;  4I5Q A;  3GKN A;  1B9X C;  1HYU A;  1OAZ A;  2RII A;  3N5O A;  5IQY A;  2N5A A;  2HRK B;  3ZFL A;  3KXO A;  2VL3 A;  1R5P A;  4FYU A;  4KDX A;  1M2D A;  3EE2 A;  3H79 A;  3UAR A;  3ME8 A;  1SKS B;  3Q6O A;  2C80 A;  3C1S A;  3G7I A;  3D22 A;  4GXZ A;  5J9B A;  2HSY A;  2KOK A;  3KH9 A;  1J9B A;  2VCZ A;  5F05 A;  5LNK e;  1ERU A;  3LWA A;  1OC8 A;  1GTA A;  3P90 A;  2XPE A;  4K2D A;  1MD3 A;  3TOT A;  5J9C A;  3GUS A;  1R4W A;  1BJX A;  2LS5 A;  1KEB A;  3DWV A;  4G0I A;  4Q5R A;  3CMI A;  1XWC A;  2ZCT A;  1WWJ A;  1SK0 A;  3IAM 2;  2AYT A;  3HCZ A;  3DXB A;  2OAD A;  3QFB C;  1A8L A;  2O7K A;  4OWY A;  5KN1 A;  2A4V A;  1XWK A;  3UEM A;  2ON5 A;  1B48 A;  2TRC P;  3C71 A;  2H30 A;  19GS A;  2CAQ A;  3RPN A;  1G6Y A;  1M9A A;  5L71 A;  4AGS A;  1V2A A;  3GKM A;  2LTK A;  5CAX A;  4E8E A;  1Y6E A;  3FK8 A;  1K0D A;  5CRH A;  5A4U A;  3MNG A;  3BD2 A;  2NTO A;  1JLV A;  1GSS A;  4FH8 A;  4ZL9 A;  3U5R E;  2NBS A;  2OAC A;  4TR4 A;  2UZ8 A;  4BL7 B;  2MBT A;  4MF6 A;  4HS1 A;  4IBP A;  2VD1 A;  4ZL8 A;  3LOR A;  2LEG A;  4JE1 A;  3LEF A;  3A2W A;  1K3O A;  4RUV A;  2C0G A;  1LJR A;  1GH2 A;  1PX7 A;  2H0G A;  3E9J B;  1QMV A;  3LGC A;  5JWQ B;  3D4M A;  1NM3 A;  1WE0 A;  3ZIJ A;  4RQX A;  1YY7 A;  2O8V B;  1FAA A;  1F3A A;  3G7J A;  5ECP B;  1G0T A;  3EIN A;  2OA7 A;  2ALB A;  1DBY A;  4NV5 A;  1AC1 A;  4TVE A;  3GUR A;  1C72 A;  2FD3 A;  5AIS A;  1WJK A;  2YOI A;  3ZTL A;  3GYK A;  5JCW A;  3HXS A;  4ACS A;  1OVN A;  6GSW A;  3HJP A;  4MAB A;  4DSQ A;  2FWG A;  3GKX A;  1GNE A;  4LMV A;  2FNO A;  1BED A;  3DIE A;  2RUF A;  1DSB A;  3GSS A;  4OMV A;  3TRX A;  3RHB A;  2CA8 A;  4F9Z A;  4CHS A;  3AY8 A;  1EV4 A;  4JBB A;  1F37 A;  5BMU A;  4OO5 A;  4V2N A;  6GSX A;  1XPV A;  1A2M A;  4ML1 A;  3PR8 A;  3C7M A;  3HZ8 A;  2C3Q A;  1XOB A;  1FB6 A;  2PER A;  1SKW B;  1GSD A;  2VCX A;  3ED3 A;  3ZL5 A;  2RLI A;  2HSM A;  1VGL A;  2KLX A;  2Z9S A;  5FHI A;  1GP1 A;  5AGY A;  2VLU A;  1T7P B;  4PQH A;  4O5R A;  5J4U A;  1K0A A;  2YV7 A;  3HVX A;  5D73 A;  2HLS A;  2MMN A;  3UBK A;  4ISD A;  2MMZ A;  2FWF A;  5JWR B;  4MLY A;  1U3A A;  5HR0 A;  3RHC A;  1B4Q A;  2HRA A;  4NHZ A;  3MAK A;  9GSS A;  5ID2 A;  1O8X A;  2LUS A;  1GTB A;  2CVD A;  1F2E A;  3HHV A;  3E0U A;  3NOF A;  3QD9 A;  2YWN A;  3VUR A;  2X8G A;  4H86 A;  3KCM A;  2GSS A;  4TRX A;  4GLT A;  2IME A;  1UC7 A;  8GSS A;  5CYY A;  3A3T A;  5JCU A;  4PUA A;  5J5N A;  1GRX A;  5F06 A;  2I4A A;  2G2Q A;  4I8B A;  2FHE A;  1XVW A;  5H5S A;  3W8S A;  1OC3 A;  3ERW A;  1SL1 B;  2LQO A;  2M72 A;  3HYP A;  3CYN A;  4V1A p;  1QUW A;  4V1A g;  1ERW A;  3LYP A;  4BWQ A;  4PTS A;  4PNG A;  3W6G A;  2DSA A;  4OD7 A;  5ECI B;  3ZRE A;  4ID0 A;  4G0K A;  4MPG A;  5E59 A;  3Q19 A;  3BOA A;  2H6Z A;  4K1F A;  4EXJ A;  5FWG A;  1T4Z A;  4EE0 A;  3WYW A;  1F9M A;  2GT6 A;  1JHB A;  2C4J A;  3TKS E;  3S9F A;  4KCE A;  3FZ9 A;  3KP9 A;  3ZVJ D;  4PNF A;  1PQN A;  1V57 A;  4PUR A;  3N9J A;  3BCI A;  3ZIT A;  1OC9 A;  5DBQ A;  3IC8 A;  4ZBB A;  3ZFB A;  3IK7 A;  2EIO A;  4TR0 A;  1CQG A;  1ABA A;  2DMM A;  3M8N A;  1U88 A;  2BMX A;  1A23 A;  1XIY A;  3FKF A;  1SD9 A;  4MZW A;  1T3B A;  3SBC A;  3KEB A;  3P7X A;  2GS3 A;  3H4K A;  2HFD A;  2CZ3 A;  4K0G A;  5CNW A;  1GUH A;  2L4C A;  1GLQ A;  1YKA A;  5F07 A;  1KTE A;  4KSM A;  5KEJ A;  3HJM A;  2WZ9 A;  4RI6 A;  2L6C A;  2GZY A;  3F63 A;  1SL0 B;  4KND A;  2H0I A;  4BPY A;  2CT6 A;  1TJD A;  3H1N A;  3O3T A;  4X43 A;  5DAK B;  3GN3 A;  3UVT A;  5KN2 A;  3D4T A;  4KA0 A;  4PQI A;  3WGE A;  1T8E B;  1XWB A;  1VF2 A;  2DJ2 A;  2MMA A;  2K8S A;  4XHM A;  1BAY A;  2CZ2 A;  3L9U A;  4IVF A;  22GS A;  3A2X A;  4HOJ A;  1LU4 A;  5CRW A;  1UA5 A;  1Z6M A;  1Z7P A;  12GS A;  3FZ4 A;  2AHE A;  3ZYW A;  1SK2 A;  2H8L A;  2L59 A;  2JSZ A;  1FVJ A;  5ELA A;  4HJ2 A;  3PPU A;  4KSO A;  3UMA A;  2QKE A;  1H4O A;  2VOC A;  1X0R A;  4TXO B;  3GST A;  4JRR A;  2OBK A;  1O81 A;  1ON4 A;  1MDK A;  4L8E A;  2H19 A;  2WDU A;  2GGT A;  2L4Q A;  1WPI A;  5IMF A;  2AUV A;  2B1K A;  2PN8 A;  2V32 A;  1JLW A;  3HDC A;  3K8N A;  2HZE B;  2XPD A;  5JCG A;  1OKD A;  1AAZ A;  2DJK A;  5DCG A;  4J56 E;  1SU9 A;  1TTZ A;  1ZYE A;  1XW5 A;  3IBH A;  1WIK A;  3DGQ A;  1GTU A;  3FHK A;  3EMX A;  3PIN A;  1KBN A;  3H8Q A;  4MH3 A;  2TRX A;  1GSF A;  4ZB6 A;  5IMZ A;  1HNB A;  3TKR A;  3GIX A;  2IJY A;  2X8H A;  4LA1 A;  3UAP A;  5B6N A;  11GS A;  2VIM A;  4KW6 A;  3GHA A;  3QAG A;  1XXU A;  2LJA A;  4TR1 B;  4MJC A;  1MD4 A;  2K6V A;  4NPB A;  1A0R P;  1K0O A;  1YF1 A;  4GTU A;  1E6B A;  2YV9 A;  1KNG A;  5DJL A;  4I2T A;  1YEP A;  1TKD B;  1A8Y A;  1YQ1 A;  2IMD A;  3QOU A;  1R26 A;  2DJ1 A;  2FA8 A;  3HY2 A;  4PUF C;  2HXK A;  1UN2 A;  1USB A;  2JZR A;  2KHP A;  1EGR A;  2JAC A;  5ECK B;  2N5B A;  1V98 A;  4QL9 A;  3BBY A;  2JU5 A;  2IMF A;  2V2G A;  4G10 A;  2F8A A;  2LRN A;  3F4T A;  2GQL A;  2HRN A;  1BG5 A;  1AXD A;  3CBU A;  4YQM A;  2CQ9 A;  4MZB A;  4YAV A;  4N10 A;  4DSR A;  3MSZ A;  1PL1 A;  5EL8 A;  4KB3 A;  3TCO A;  2PUK C;  2FCH A;  3PGT A;  2VAF A;  4DSS B;  3ME7 A;  1ML6 A;  1K0B A;  1PD2 1;  3KM6 A;  3VWU A;  1JFU A;  3WGD A;  1M0U A;  1THO A;  3KTL A;  3Q18 A;  2FLS A;  4ECJ A;  1BQ7 A;  5IPG A;  3DVX A;  1O85 A;  18GS A;  4RI7 A;  3ZIV A;  2VUP A;  1Q4J A;  2H71 A;  2WS2 A;  3GX0 A;  10GS A;  5IOX A;  1Y25 A;  1EWX A;  5IMV A;  4EF0 A;  1G7O A;  1EV9 A;  3C73 A;  2IFQ B;  5B8A A;  3CSJ A;  4MJE A;  2C8U A;  1TK5 B;  4MF7 A;  3IR4 A;  4GQF A;  3HZ4 A;  4FYC A;  4BVX A;  3FEU A;  3I69 A;  3CSI A;  4KDU A;  2LQQ A;  1YJ6 A;  3DD3 A;  3IPZ A;  1ZOF A;  5AIX A;  3GRX A;  1MEK A;  1GLP A;  3VWW A;  1V9W A;  3FR6 A;  3GTU A;  1JZO A;  4V2M A;  2VM1 A;  3NIV A;  3Q74 A;  5DCH A;  2DJ3 A;  1M99 A;  4GRF A;  4ML6 A;  2RUE A;  2R2J A;  5ECO B;  2N5F A;  4MF5 A;  5DAL A;  3LXT A;  1N8J A;  3QFA C;  3UL3 A;  5CO3 A;  4KDY A;  3IRA A;  1QXH A;  2GQK A;  4GF0 A;  1SD8 A;  2H66 A;  1YDK A;  3KMN A;  2KP1 A;  5GAN D;  3M9J A;  4TR3 A;  2IMK A;  2I81 A;  2YP6 A;  3UOM A;  2XC2 A;  1TRW A;  4D73 B;  4Q5N A;  4ZB9 A;  2MZC A;  4KF9 A;  3EUR A;  3F3Q A;  3CTG A;  1SL2 B;  4BVY A;  4L0W A;  5D93 A;  2VCT A;  2X99 A;  1VF3 A;  3IA1 A;  3RDW A;  1K3L A;  2H70 A;  4PX1 A;  4HQZ A;  4POM A;  4WBR D;  2OE0 A;  4K6X A;  1TK8 B;  1IYH A;  4AJ7 A;  1PMT A;  4PQ1 A;  3TGZ A;  1TI1 A;  3KGK A;  5F0G A;  1F6M C;  1YEX A;  5F8B A;  4POK A;  2HSN B;  1W4V A;  3DRN A;  3CXG A;  4WR4 A;  1WOU A;  3DKS A;  1X9M B;  1XWG A;  3J7Y b;  5B8B A;  4KUN A;  2FWH A;  1XZO A;  3R2Q A;  2H1G A;  4K7N A;  4IJ3 A;  2XBQ A;  3L9S A;  4EL1 A;  5HR1 A;  3EMP A;  4ILF A;  3HVS A;  3I9V 2;  1WMJ A;  3ZVJ A;  1HNA A;  1A2L A;  2H1B A;  2MMO A;  3UIW A;  1ILO A;  2DJ0 A;  1A0F A;  4I6X A;  3WGX A;  1PKZ A;  1T4Y A;  3FR9 A;  5H5R A;  2B1L A;  2P31 A;  2PWJ A;  5G31 A;  3KZQ A;  2IIY A;  3VWV A;  2YAN A;  2HZF A;  1NSW A;  2GDR A;  2HRF A;  3TKS A;  5ECN B;  1F3B A;  5ECL B;  1GWC A;  2HT9 A;  4TW5 A;  6GSU A;  1NW2 A;  3J7Y k;  1TXX A;  4QL7 A;  1OYJ A;  4Q5Q A;  2B5X A;  2H72 A;  4O92 A;  2H01 A;  3TJB A;  3TOU A;  2E7P A;  3IXR A;  1YF0 A;  1MDI A;  4MDC A;  4MH2 A;  3TDG A;  4ECI A;  3DEX A;  5IOW A;  3F4S A;  2B3S A;  2CX3 A;  4ECB A;  2LST A;  4J57 E;  17GS A;  5INY A;  4K8M A;  2V6K A;  4IS0 A;  3QAV A;  2KUC A;  3GL3 A;  5LCZ A;  5DJM A;  2F51 A;  4AJ8 A;  1WRY A;  5G1L A;  5IMC A;  3IHQ A;  3TRQ A;  2IN3 A;  1RW1 A;  1HQO A;  3RAZ A;  5C00 A;  2JL4 A;  1E2Y A;  4FQU A;  4DVC A;  1XW9 A;  2C0D A;  2K18 A;  1AUC A;  3D5J A;  1CQH A;  2LNT A;  3TJJ A;  1TRS A;  4CW9 A;  2IPA A;  2FGX A;  3P2A A;  4K7O A;  1GUL A;  2HE3 A;  5ENU A;  4TKY A;  3FY7 A;  3ZRD A;  5A4V A;  4LL1 B;  5A4W A;  4NAX A;  3M1G A;  1GSE A;  3G7Y A;  1TOF A;  2C3N A;  1WP0 A;  6GSY A;  3ZZX A;  5GSS A;  4IP1 A;  13GS A;  1H75 A;  4IEL A;  1EEM A;  2LRT A;  2WRT A;  1AQX A;  16GS A;  2VO4 A;  4IKH A;  3VWX A;  2LKU A;  2PPT A;  2AJQ B;  1O7U A;  3A2V A;  1U6T A;  4LMW A;  3W8J A;  2F8F A;  2E0Q A;  2GTU A;  5AN1 A;  2C1Y A;  4ZIJ A;  1Z3E A;  1M9B A;  4KCA A;  1AQW A;  5D9T A;  3FRC A;  1B4P A;  2HI7 A;  3EVI A;  5D9X A;  1XOA A;  2J23 A;  1AQV A;  1G6W A;  1OE8 A;  3L4N A;  2LV3 A;  1I5G A;  4JU5 A;  5G5F A;  4KX4 A;  4EDZ A;  2HRK A;  4IGJ A;  2HSM B;  4FO5 A;  1QK8 A;  2VLV A;  3CRU A;  2QC7 A;  2YJ7 A;  1V58 A;  3TJG A;  5KN3 A;  1FB0 A;  3TB2 A;  3EC3 A;  4WF4 A;  1J08 A;  1TP9 A;  2PU9 C;  4WEY A;  2JZT A;  4OO4 A;  1M7T A;  2M80 A;  2K8V A;  1SJ6 A;  4JED A;  2H6Y A;  2B7J A;  5ID2 B;  1Z9H A;  4N30 A;  2H76 A;  2M46 A;  2WGR A;  4EKZ A;  5IPH A;  1I9D A;  4WR5 A;  3GV1 A;  3US3 A;  5ELG A;  4MPF A;  2V1M A;  1RQM A;  2ZNM A;  2PBJ A;  4CDO A;  5ECH B;  1S3D A;  5D9V A;  4GQC A;  3D0Z A;  1EOG A;  3TKS C;  20GS A;  2VL9 A;  3ZMK A;  2B6M A;  3O6T A;  4XTS A;  5KN0 A;  2DC5 A;  5J3R A;  2VD0 A;  5C04 A;  4AF2 A;  4G2E A;  2LJR A;  5G1K A;  5ABR A;  2DLX A;  2C3T A;  4XRA A;  1ZZY A;  2GSQ A;  1G7E A;  4OFM A;  5FT3 A;  4X1U A;  3F9U A;  1O8W A;  3KTB A;  3EU4 A;  1PRX A;  3TUE A;  1K3Y A;  2GLR A;  1DE2 A;  1QGV A;  3UVH A;  14GS A;  4YQU A;  2DBC A;  4GWR A;  3PH9 A;  1XCC A;  2DML A;  4POB A;  2IL3 A;  1LBK A;  2R6K A;  3IDV A;  4G19 A;  4OFT A;  4GSS A;  1EZK A;  4OFN A;  1A24 A;  2R3X A;  3APO A;  3VFI A;  3R3E A;  1GUM A;  1T1V A;  2LNS A;  2WFC A;  3TJK A;  4BL7 A;  4XIH A;  3H93 A;  1PA3 A;  2WUL A;  2PMT A;  5HR3 A;  1A2J A;  1OC9 B;  2WCI A;  5DVB A;  3ERG A;  4HU9 A;  3CSH A;  3QDN A;  2R4V A;  4KH7 A;  4GSN A;  2YJH A;  2GZP A;  1PN9 A;  1TRU A;  3OR5 A;  1DUG A;  3FZA A;  2HYX A;  7GSS A;  1TI3 A;  1YKC A;  4KE3 A;  2YNX A;  2L6D A;  3DVW A;  1ERT A;  1O73 A;  4LL4 B;  3TJF A;  5COH A;  2I9H A;  4IHU A;  1U3I A;  3FZ5 A;  3TKP A;  5HFK A;  4HEA 2;  2YPM A;  1M2A A;  5EY6 A;  5H5Q A;  4NV2 A;  5CP1 A;  3F0I A;  2O85 A;  2IWT A;  2J9H A;  6GSV A;  1ST9 A;  3IE3 A;  3M9K A;  4Q5F A;  1JZD A;  2FWE A;  4I97 A;  2FY6 A;  4XS6 A;  3GA4 A;  4WET A;  1K0C A;  4EVM A;  1GL8 A;  5IO0 A;  5HR2 A;  2VM2 A;  1NHO A;  2TIR A;  4ECC A;  1N2A A;  3A5W A;  6GSS A;  3EU3 A;  3KP8 A;  2B5Y A;  1M2B A;  2IMI A;  2ZUP A;  5IO2 A;  4I2U A;  3F6F A;  4ZB8 A;  2QGV A;  3E3E A;  2HSH A;  1XW6 A;  3FW2 A;  4N11 A;  3UBL A;  2KP2 A;  1X5C A;  1BX9 A;  3F4R A;  2X64 A;  1VF4 A;  4ZBA A;  1FVK A;  2REM A;  4HDE A;  2OBI A;  1ZMA A;  2PVQ A;  4QQ7 A;  4WXT A;  4L0U A;  2GT5 A;  5DDL A;  3CRT A;  3GX8 A;  1FO5 A;  4HJM A;  3WD6 A;  1PL2 A;  5A5K A;  1BYE A;  1AW9 A;  1AIU A;  3BCK A;  4N0Z A;  1PKW A;  4YAP A;  5ECR B;  2NVL A;  3C8E A;  3QCP A;  2VCQ A;  2DIY A;  3F6D A;  2E2M A;  1HNC A;  4RQR A;  2OKA A;  2G0F A;  4PXO A;  1TK0 B;  1MDJ A;  2EIQ A;  5IIZ A;  3VI5 A;  1SYX A;  3FYG A;  1X9W B;  4XS1 A;  2NDO A;  2OE3 A;  2P5Q A;  4XRD A;  3IOS A;  4EC0 A;  3GNJ A;  1OE7 A;  2A2R A;  3VPT A;  2CAI A;  4MJA A;  1NHY A;  3GMF A;  5GST A;  2R37 A;  3F8U A;  4KAE A;  2L5L A;  2ES7 A;  3L9V A;  3L0H A;  5D9W A;  4L5O A;  1EP7 A;  1O6J A;  1XBS A;  1S3A A;  2VL2 A;  2YN1 A;  3GH6 A;  3G9B A;  2FUG 2;  2L57 A;  2CVB A;  4ZXG A;  4OCE A;  3ZML A;  1XVQ A;  2H74 A;  3F3R A;  2D2Z A;  2YCD A;  3HKR A;  5E4W A;  1X9S B;  4E8H A;  3M0F A;  3LJR A;  3JCM L;  2JSY A;  1GTI A;  2AB6 A;  3APQ A;  3WT2 A;  2O87 A;  1S3C A;  2YWO A;  2CV4 A;  2H75 A;  4MK3 A;  2NPB A;  2I1U A;  1Z6N A;  2FA4 A;  3U6V A;  1GNW A;  4ZL7 A;  2VCW A;  1FHE A;  4TN8 A;  1ZL9 A;  1ZCP A;  2LRC A;  3GKK A;  2L5O A;  4X0X A;  3KJY A;  4LLR A;  1Q98 A;  2MYG A;  4HZ2 A;  3VPQ A;  5DQY A; 
#chains in the Genus database with same CATH topology
 1TW9 A;  4TXV A;  3HVV A;  1THX A;  4IP6 A;  3MWH A;  3D6I A;  5IM9 A;  1T00 A;  3LFL A;  1S4B P;  3WT1 A;  4GST A;  4HUA A;  4FYB A;  5HQP A;  4GCI A;  1Z5Y E;  1ZGN A;  1V40 A;  4MP4 A;  4YQV A;  1PSQ A;  2YZU A;  2BJX A;  3MDK A;  1SYR A;  1HD2 A;  4MNN A;  1GUK A;  2C0F A;  4BVX B;  5LD0 A;  5DAK A;  3FR3 A;  1OKT A;  4F0B A;  4G0L A;  4IN0 A;  1U87 A;  3HMJ G;  4ULX A;  3VLN A;  2WJU A;  1QQ2 A;  3GFK A;  2GST A;  4O7H A;  5J47 A;  4KGI A;  2GQM A;  4XCS A;  3GTU B;  2CVK A;  1PX6 A;  2H6X A;  4F03 A;  1SVL A;  2UV8 G;  4Z2U A;  4BWS A;  3IAS 2;  4WF5 A;  5CRG A;  3HJO A;  3ZLP A;  4BIK A;  1EP8 A;  1SJZ A;  4EUY A;  2DJJ A;  3KD0 A;  3GL5 A;  3IV4 A;  5DAL B;  5G30 A;  4FIW A;  2GVP A;  4L5L A;  4PHZ C;  4TXO A;  4XS4 A;  1W89 A;  5D8I A;  4IQA A;  2WB9 A;  3C1R A;  3BJ5 A;  1VRS D;  4Z2T A;  2HZE A;  3EWL A;  2GSR A;  1R7H A;  2EIR A;  1I1I P;  2OE1 A;  4K9Z A;  2HNL A;  1YZX A;  3IK9 A;  3VK9 A;  2VCV A;  4BVY B;  3VI7 A;  3V1W A;  4MZC A;  3LXZ A;  3HA9 A;  2K9F A;  2R5G A;  2AAW A;  1GSU A;  1QFN A;  4JR4 A;  1K0M A;  4O32 A;  1UVZ A;  1TU8 A;  5ECM B;  3L78 A;  3KH7 A;  2H0H A;  1XFL A;  3APS A;  4NHW A;  5GAP D;  2VL2 C;  2C0E A;  3DYR A;  4N0V A;  3LSZ A;  2AV4 A;  3TKQ A;  2WW1 A;  2EC4 A;  1SKR B;  2EFC A;  3QPM A;  4ZBD A;  3KIJ A;  1SK1 A;  4TR1 A;  5CRE A;  4J2F A;  2O89 A;  3TRP A;  2YZH A;  5G2Z A;  4MJB A;  2LJK A;  5J41 A;  2JZS A;  3M3M A;  1MTC A;  5AIV A;  2A4H A;  2WW2 A;  4G9H A;  1XWA A;  5IMD A;  3LG6 A;  6GST A;  1R5A A;  3ISO A;  4MA9 A;  3DML A;  2HQT A;  4PGT A;  3EYT A;  2E2G A;  1BF5 A;  2F3M A;  3HD5 A;  4POL A;  4K0N A;  2RM5 A;  4HQS A;  4WKW A;  1DE1 A;  1RK4 A;  2XBI A;  1JZR A;  2ON7 A;  2JAD A;  2O3E A;  4MCU A;  5EVO A;  3CTF A;  4HI7 A;  5HFG A;  3O76 A;  4DSS A;  3I43 A;  1FW1 A;  3UJ1 A;  1EEJ A;  2H73 A;  5B6M A;  3QAW A;  3QMX A;  1X5E A;  3NZN A;  1EGO A;  5GZZ B;  5B7C A;  1ERV A;  5CRD A;  1PGT A;  4K5R A;  2F9S A;  1SJI A;  1TDI A;  2V6O A;  2V41 A;  2QSI A;  4IW9 A;  2VLT A;  5J40 A;  4AJ6 A;  2H1D A;  1ACV A;  3IC4 A;  2CX4 A;  1GSY A;  5G5E A;  2GZZ A;  2H1A A;  2IFQ A;  5EPF A;  4ZB7 A;  2P5R A;  4F2I A;  4BA7 A;  4TOP A;  4YH2 A;  3KMO A;  2PVO C;  4XS4 B;  2O5V A;  4K7I A;  4NMU A;  2RM6 A;  2B5E A;  4NWY A;  2MBS A;  5JWO B;  4DEJ A;  1ZYQ B;  4OCF A;  2DIZ A;  2O36 A;  1SEN A;  3RPP A;  5HFI A;  2YWI A;  2WVX B;  4F82 A;  3LQ7 A;  1JZW A;  5DQS A;  3MIX A;  2PGT A;  1TRV A;  2X8C A;  3P8W A;  1B9Y C;  1B8X A;  2BTO T;  4K2X A;  1IYI A;  1TU7 A;  4JR6 A;  1K0N A;  4Z7X A;  2WVY A;  5ECQ B;  1EOH A;  3QR6 A;  2I3Y A;  4USS A;  4HZ4 A;  1FOV A;  1X5D A;  2XHF A;  2B7K A;  4EDY A;  4EO3 A;  5ECS A;  3I6A A;  4NXI A;  4WBJ A;  1URM A;  4ZIL A;  2P0G A;  2OJL A;  4JZQ A;  1GSQ A;  3RBT A;  5IMA A;  1FG4 A;  2YWM A;  5D96 A;  4P3Y B;  1J0F A;  1Z7R A;  1VF1 A;  2A2S A;  4MMM A;  4V2L A;  4D73 A;  4IQ1 A;  3LYK A;  3ERF A;  4HU7 A;  2QA2 A;  4F0C A;  2WVZ A;  4IJI A;  3D21 A;  3GH9 A;  3SWL A;  4I5Q A;  3GKN A;  1B9X C;  1HYU A;  1OAZ A;  2RII A;  3N5O A;  5IQY A;  2WZS A;  2N5A A;  2HRK B;  3ZFL A;  3KXO A;  2VL3 A;  1R5P A;  4FYU A;  4KDX A;  1M2D A;  3EE2 A;  3H79 A;  3UAR A;  4AI6 A;  1BG1 A;  3ME8 A;  1SKS B;  3Q6O A;  2C80 A;  3C1S A;  3G7I A;  3D22 A;  3MYD A;  4GXZ A;  5J9B A;  2H1L A;  2HSN A;  2HSY A;  2KOK A;  3KH9 A;  1J9B A;  2VCZ A;  5F05 A;  5LNK e;  1ERU A;  3LWA A;  1OC8 A;  1GTA A;  3P90 A;  2XPE A;  4K2D A;  1MD3 A;  3TOT A;  5J9C A;  3GUS A;  4EIQ A;  1R4W A;  1BJX A;  2LS5 A;  1KEB A;  2R0G A;  3DWV A;  4G0I A;  4Q5R A;  3CMI A;  1XWC A;  2ZCT A;  1WWJ A;  1SK0 A;  3IAM 2;  2AYT A;  4HSC X;  3HCZ A;  3DXB A;  2OAD A;  3QFB C;  1A8L A;  2O7K A;  4OWY A;  5KN1 A;  1Y1U A;  2A4V A;  1XWK A;  5A34 A;  3UEM A;  2ON5 A;  1B48 A;  2TRC P;  4YKG A;  3C71 A;  2H30 A;  19GS A;  2CAQ A;  3RFR C;  3RPN A;  1G6Y A;  1M9A A;  5L71 A;  4AGS A;  1V2A A;  3GKM A;  2LTK A;  5CAX A;  2R0C A;  4E8E A;  1Y6E A;  3FK8 A;  1K0D A;  5CRH A;  5A4U A;  3MNG A;  3BD2 A;  2NTO A;  1JLV A;  1GSS A;  4FH8 A;  4ZL9 A;  3U5R E;  2NBS A;  2OAC A;  4TR4 A;  2UZ8 A;  4BL7 B;  2MBT A;  4MF6 A;  4HS1 A;  4IBP A;  2VD1 A;  4ZL8 A;  3LOR A;  2LEG A;  4JE1 A;  3LEF A;  3A2W A;  1K3O A;  4RUV A;  5A1N A;  2C0G A;  4YKF A;  1LJR A;  1GH2 A;  1PX7 A;  2H0G A;  3E9J B;  1QMV A;  3LGC A;  5JWQ B;  3TU3 B;  3D4M A;  1NM3 A;  1WE0 A;  3ZIJ A;  4RQX A;  1YY7 A;  2O8V B;  1FAA A;  1F3A A;  3G7J A;  5ECP B;  1G0T A;  3EIN A;  2OA7 A;  2ALB A;  1DBY A;  5A5H A;  4NV5 A;  1AC1 A;  4TVE A;  3GUR A;  1C72 A;  2FD3 A;  5AIS A;  1WJK A;  2YOI A;  3ZTL A;  3GYK A;  5JCW A;  3HXS A;  4ACS A;  1OVN A;  6GSW A;  3HJP A;  4MAB A;  4DSQ A;  2FWG A;  3GKX A;  1GNE A;  4LMV A;  2FNO A;  1BED A;  3DIE A;  2RUF A;  1DSB A;  3GSS A;  4OMV A;  3TRX A;  3RHB A;  2CA8 A;  4F9Z A;  4AKH A;  4CHS A;  3AY8 A;  1EV4 A;  4JBB A;  1F37 A;  1SVO A;  5BMU A;  4OO5 A;  4V2N A;  6GSX A;  1XPV A;  1A2M A;  4ML1 A;  3PR8 A;  3C7M A;  3HZ8 A;  2C3Q A;  1XOB A;  4CY8 A;  1FB6 A;  2PER A;  1SKW B;  1GSD A;  2VCX A;  3ED3 A;  3ZL5 A;  2RLI A;  2HSM A;  1VGL A;  2KLX A;  2Z9S A;  5FHI A;  1GP1 A;  5AGY A;  2VLU A;  1T7P B;  4PQH A;  4O5R A;  5J4U A;  1K0A A;  2YV7 A;  3HVX A;  5D73 A;  2HLS A;  2MMN A;  3UBK A;  4ISD A;  2MMZ A;  2FWF A;  5JWR B;  4MLY A;  1U3A A;  5HR0 A;  3RHC A;  1B4Q A;  2HRA A;  4NHZ A;  3MAK A;  9GSS A;  5ID2 A;  1O8X A;  2LUS A;  1GTB A;  2CVD A;  1F2E A;  3HHV A;  3E0U A;  3NOF A;  3QD9 A;  2YWN A;  3VUR A;  2X8G A;  4H86 A;  3KCM A;  2GSS A;  4TRX A;  4GLT A;  2IME A;  1UC7 A;  8GSS A;  5CYY A;  3A3T A;  5JCU A;  4PUA A;  5J5N A;  1GRX A;  5F06 A;  2I4A A;  2G2Q A;  4I8B A;  2FHE A;  1XVW A;  5H5S A;  3W8S A;  2OT3 A;  1OC3 A;  3ERW A;  1SL1 B;  2LQO A;  2M72 A;  3HYP A;  3CYN A;  4V1A p;  4GDF A;  1QUW A;  4V1A g;  1ERW A;  3LYP A;  4BWQ A;  4PTS A;  4PNG A;  3W6G A;  2DSA A;  4OD7 A;  5A1N B;  5ECI B;  3ZRE A;  4ID0 A;  4G0K A;  4MPG A;  5E59 A;  3Q19 A;  3BOA A;  4W66 A;  2H6Z A;  4K1F A;  4EXJ A;  5FWG A;  1T4Z A;  4EE0 A;  3WYW A;  3CHX C;  1F9M A;  2GT6 A;  1JHB A;  2C4J A;  3TKS E;  3S9F A;  4KCE A;  3FZ9 A;  3KP9 A;  3ZVJ D;  4PNF A;  1PQN A;  1V57 A;  4PUR A;  3N9J A;  3BCI A;  3A5I A;  3ZIT A;  1OC9 A;  5DBQ A;  3IC8 A;  4ZBB A;  3ZFB A;  3IK7 A;  2EIO A;  4TR0 A;  1CQG A;  1ABA A;  2DMM A;  2DKH A;  2EFD A;  3M8N A;  1U88 A;  2BMX A;  1A23 A;  1XIY A;  3FKF A;  1SD9 A;  4MZW A;  1T3B A;  3SBC A;  3KEB A;  3P7X A;  2GS3 A;  3H4K A;  2HFD A;  2CZ3 A;  4K0G A;  5CNW A;  1GUH A;  2L4C A;  1GLQ A;  1YKA A;  5F07 A;  1KTE A;  4KSM A;  5KEJ A;  3HJM A;  2WZ9 A;  4RI6 A;  2L6C A;  2GZY A;  3F63 A;  1SL0 B;  4KND A;  2H0I A;  4BPY A;  2CT6 A;  1TJD A;  3H1N A;  3O3T A;  4X43 A;  5DAK B;  3GN3 A;  3UVT A;  3RGB C;  5KN2 A;  3D4T A;  4KA0 A;  4PQI A;  3WGE A;  1T8E B;  1XWB A;  1VF2 A;  2DJ2 A;  2MMA A;  2K8S A;  4XHM A;  1BAY A;  2CZ2 A;  3L9U A;  4PI2 C;  4IVF A;  22GS A;  3A2X A;  4HOJ A;  4X4J A;  1LU4 A;  5CRW A;  1UA5 A;  1Z6M A;  1Z7P A;  12GS A;  3FZ4 A;  2AHE A;  3ZYW A;  1SK2 A;  2H8L A;  2L59 A;  2JSZ A;  1FVJ A;  5ELA A;  4HJ2 A;  3PPU A;  4KSO A;  3UMA A;  1PN0 A;  2QKE A;  1H4O A;  2VOC A;  1X0R A;  4TXO B;  3GST A;  4JRR A;  4N3Z A;  2OBK A;  1O81 A;  1ON4 A;  1MDK A;  4L8E A;  2H19 A;  2WDU A;  2GGT A;  2L4Q A;  1WPI A;  5IMF A;  2AUV A;  2B1K A;  4K5S A;  2PN8 A;  2V32 A;  1JLW A;  3HDC A;  3K8N A;  2HZE B;  2XPD A;  5JCG A;  1OKD A;  1AAZ A;  2DJK A;  5DCG A;  4J56 E;  1SU9 A;  1TTZ A;  1ZYE A;  1XW5 A;  3IBH A;  1WIK A;  3DGQ A;  1GTU A;  3FHK A;  2QA1 A;  3EMX A;  3PIN A;  1KBN A;  3H8Q A;  4MH3 A;  2TRX A;  1GSF A;  4ZB6 A;  5IMZ A;  1HNB A;  3TKR A;  3GIX A;  2IJY A;  2X8H A;  4LA1 A;  3UAP A;  5B6N A;  11GS A;  2VIM A;  4KW6 A;  3GHA A;  3QAG A;  1XXU A;  1XG8 A;  2LJA A;  4TR1 B;  4MJC A;  1MD4 A;  2K6V A;  4NPB A;  1A0R P;  1K0O A;  1YF1 A;  4GTU A;  1E6B A;  2YV9 A;  1KNG A;  5DJL A;  4I2T A;  1YEP A;  1TKD B;  1A8Y A;  1YQ1 A;  2IMD A;  3QOU A;  1R26 A;  2DJ1 A;  2FA8 A;  3HY2 A;  4PUF C;  2HXK A;  1UN2 A;  1USB A;  2JZR A;  2KHP A;  1EGR A;  2JAC A;  5ECK B;  2N5B A;  1V98 A;  4QL9 A;  3BBY A;  2JU5 A;  2IMF A;  2V2G A;  4G10 A;  2F8A A;  2LRN A;  3F4T A;  2GQL A;  2HRN A;  1BG5 A;  1AXD A;  3CBU A;  4YQM A;  2CQ9 A;  4MZB A;  4YAV A;  4N10 A;  4DSR A;  3MSZ A;  1PL1 A;  5EL8 A;  4KB3 A;  3TCO A;  2PUK C;  2FCH A;  3PGT A;  2VAF A;  4DSS B;  3ME7 A;  1ML6 A;  1K0B A;  1PD2 1;  3KM6 A;  3VWU A;  1JFU A;  3WGD A;  1M0U A;  1THO A;  3KTL A;  3Q18 A;  2FLS A;  4ECJ A;  1BQ7 A;  5IPG A;  3DVX A;  1O85 A;  18GS A;  4RI7 A;  2A2P A;  2VUP A;  3ZIV A;  1Q4J A;  2H71 A;  2WS2 A;  3GX0 A;  10GS A;  5IOX A;  1Y25 A;  1EWX A;  5IMV A;  4EF0 A;  5KOX A;  1G7O A;  1EV9 A;  5KOW A;  3C73 A;  2IFQ B;  5B8A A;  3CSJ A;  4MJE A;  2C8U A;  1TK5 B;  4MF7 A;  3IR4 A;  4GQF A;  3HZ4 A;  4FYC A;  4BVX A;  3FEU A;  3I69 A;  3CSI A;  4KDU A;  2LQQ A;  1YJ6 A;  3DD3 A;  3IPZ A;  1ZOF A;  5AIX A;  3GRX A;  1MEK A;  1GLP A;  3VWW A;  1V9W A;  3FR6 A;  3GTU A;  1JZO A;  4V2M A;  2VM1 A;  3NIV A;  3Q74 A;  5DCH A;  2DJ3 A;  1M99 A;  4GRF A;  4ML6 A;  2RUE A;  2R2J A;  5ECO B;  2N5F A;  4MF5 A;  5DAL A;  3LXT A;  5BRT A;  1N8J A;  3QFA C;  3UL3 A;  5CO3 A;  4KDY A;  3IRA A;  1QXH A;  2GQK A;  4GF0 A;  1SD8 A;  2H66 A;  1YDK A;  3KMN A;  2KP1 A;  5GAN D;  3M9J A;  4TR3 A;  2IMK A;  2I81 A;  2YP6 A;  3UOM A;  2XC2 A;  1TRW A;  4D73 B;  4Q5N A;  4ZB9 A;  2MZC A;  4KF9 A;  3EUR A;  3F3Q A;  3CTG A;  1SL2 B;  4BVY A;  4L0W A;  5D93 A;  2VCT A;  2X99 A;  2X49 A;  1VF3 A;  3IA1 A;  3RDW A;  1K3L A;  2H70 A;  4PX1 A;  4HQZ A;  4POM A;  4WBR D;  2OE0 A;  4K6X A;  1TK8 B;  1IYH A;  4AJ7 A;  1PMT A;  2VKZ G;  4PQ1 A;  3TGZ A;  1TI1 A;  3KGK A;  5F0G A;  1F6M C;  1YEX A;  5F8B A;  4POK A;  2HSN B;  1W4V A;  3DRN A;  2EFH A;  3CXG A;  4WR4 A;  1WOU A;  3DKS A;  1X9M B;  1XWG A;  3J7Y b;  5B8B A;  4KUN A;  2FWH A;  1XZO A;  3R2Q A;  2H1G A;  4K7N A;  4IJ3 A;  2XBQ A;  3L9S A;  4EL1 A;  5HR1 A;  3EMP A;  4ILF A;  3HVS A;  3I9V 2;  1WMJ A;  3ZVJ A;  1HNA A;  1A2L A;  2DKI A;  4O5Q A;  2H1B A;  2MMO A;  3UIW A;  1ILO A;  2DJ0 A;  1A0F A;  4I6X A;  3WGX A;  4AKX B;  5A34 B;  1PKZ A;  1T4Y A;  3FR9 A;  3LW9 A;  5H5R A;  2B1L A;  2P31 A;  2PWJ A;  1SVM A;  3EPT A;  5G31 A;  3KZQ A;  2IIY A;  3VWV A;  2YAN A;  2HZF A;  1NSW A;  2GDR A;  2HRF A;  3TKS A;  5ECN B;  1F3B A;  5ECL B;  1GWC A;  2HT9 A;  2WW0 A;  4TW5 A;  1N25 A;  6GSU A;  1NW2 A;  3J7Y k;  1TXX A;  4QL7 A;  1OYJ A;  4Q5Q A;  2B5X A;  2H72 A;  4O92 A;  2H01 A;  3TJB A;  3TOU A;  2E7P A;  3IXR A;  1YF0 A;  1MDI A;  4MDC A;  4MH2 A;  3TDG A;  4ECI A;  3DEX A;  5IOW A;  3F4S A;  2B3S A;  2CX3 A;  4ECB A;  2LST A;  4J57 E;  17GS A;  5INY A;  4K8M A;  1M3J A;  2V6K A;  4IS0 A;  3QAV A;  4AKG A;  1S3R A;  2KUC A;  3GL3 A;  5LCZ A;  1YVL A;  5DJM A;  2F51 A;  4AJ8 A;  1WRY A;  5G1L A;  5IMC A;  3IHQ A;  2WVX A;  3TRQ A;  2IN3 A;  1RW1 A;  1HQO A;  3RAZ A;  5C00 A;  2JL4 A;  1E2Y A;  4FQU A;  4DVC A;  1XW9 A;  2C0D A;  5A5H B;  2K18 A;  1AUC A;  3D5J A;  1CQH A;  2LNT A;  3TJJ A;  1TRS A;  4CW9 A;  2IPA A;  2R0P A;  1PFO A;  2FGX A;  3P2A A;  4K7O A;  1GUL A;  2HE3 A;  5ENU A;  4TKY A;  4PI0 C;  3FY7 A;  3ZRD A;  5A4V A;  4LL1 B;  5A4W A;  4NAX A;  3CQF A;  3M1G A;  1GSE A;  3G7Y A;  1TOF A;  2C3N A;  1WP0 A;  6GSY A;  3ZZX A;  5GSS A;  4IP1 A;  13GS A;  1H75 A;  4IEL A;  1EEM A;  2LRT A;  2WRT A;  1AQX A;  16GS A;  2VO4 A;  4IKH A;  3VWX A;  2LKU A;  2PPT A;  2AJQ B;  1O7U A;  3A2V A;  1U6T A;  4LMW A;  3W8J A;  2F8F A;  2E0Q A;  2GTU A;  5AN1 A;  5BMU B;  2C1Y A;  4ZIJ A;  1Z3E A;  1M9B A;  4KCA A;  1AQW A;  5D9T A;  3FRC A;  1B4P A;  2HI7 A;  3EVI A;  5D9X A;  1XOA A;  2J23 A;  1AQV A;  1G6W A;  1OE8 A;  4AKI A;  2LV3 A;  3L4N A;  1I5G A;  4JU5 A;  5G5F A;  4KX4 A;  4EDZ A;  2HRK A;  4IGJ A;  2HSM B;  4FO5 A;  1QK8 A;  2VLV A;  3CRU A;  2QC7 A;  2YJ7 A;  1V58 A;  3TJG A;  2EFE A;  5KN3 A;  1FB0 A;  3TB2 A;  3EC3 A;  4WF4 A;  1J08 A;  1TP9 A;  2PU9 C;  4WEY A;  2JZT A;  4OO4 A;  1M7T A;  1ZYN A;  2M80 A;  2K8V A;  1SJ6 A;  5J4Y A;  4JED A;  2H6Y A;  2B7J A;  5ID2 B;  1Z9H A;  4N30 A;  2H76 A;  2M46 A;  2WGR A;  4EKZ A;  5IPH A;  3IHG A;  1I9D A;  4WR5 A;  3GV1 A;  3US3 A;  5ELG A;  4MPF A;  2V1M A;  4FXY P;  1RQM A;  2ZNM A;  2PBJ A;  4CDO A;  5ECH B;  1S3D A;  5D9V A;  4GQC A;  3D0Z A;  1EOG A;  3TKS C;  20GS A;  2VL9 A;  3ZMK A;  2B6M A;  3O6T A;  4XTS A;  5KN0 A;  2DC5 A;  5J3R A;  2VD0 A;  5C04 A;  4AF2 A;  4G2E A;  2LJR A;  5G1K A;  5ABR A;  2DLX A;  2C3T A;  4XRA A;  1ZZY A;  2GSQ A;  4ICY A;  1G7E A;  4OFM A;  5FT3 A;  4X1U A;  3HVN A;  3F9U A;  1O8W A;  3KTB A;  3EU4 A;  1PRX A;  3TUE A;  1K3Y A;  2GLR A;  1DE2 A;  1QGV A;  3UVH A;  14GS A;  4YQU A;  2DBC A;  4GWR A;  3PH9 A;  1XCC A;  4QMK A;  2DML A;  4POB A;  2IL3 A;  1LBK A;  2R6K A;  3IDV A;  4G19 A;  4OFT A;  4GSS A;  1EZK A;  4OFN A;  1A24 A;  2R3X A;  3APO A;  3VFI A;  3R3E A;  1GUM A;  1T1V A;  2LNS A;  2WFC A;  3TJK A;  4BL7 A;  4XIH A;  3H93 A;  1PA3 A;  2WUL A;  2PMT A;  5HR3 A;  1A2J A;  1OC9 B;  2WCI A;  5DVB A;  3ERG A;  4HU9 A;  3CSH A;  3QDN A;  2R4V A;  4KH7 A;  4GSN A;  2YJH A;  2GZP A;  1PN9 A;  1TRU A;  3OR5 A;  1DUG A;  3FZA A;  2HYX A;  7GSS A;  1TI3 A;  1YKC A;  4KE3 A;  2YNX A;  2L6D A;  3DVW A;  1ERT A;  1O73 A;  4LL4 B;  3TJF A;  5COH A;  2I9H A;  4IHU A;  1U3I A;  3FZ5 A;  1ZYP A;  5J4V A;  3TKP A;  5HFK A;  4HEA 2;  2YPM A;  1M2A A;  5EY6 A;  5H5Q A;  4NV2 A;  5CP1 A;  3F0I A;  2O85 A;  2IWT A;  2J9H A;  6GSV A;  1ST9 A;  3IE3 A;  3M9K A;  4Q5F A;  1JZD A;  2FWE A;  4I97 A;  2FY6 A;  4XS6 A;  1TXU A;  3GA4 A;  1K0C A;  4WET A;  4EVM A;  1GL8 A;  5IO0 A;  5HR2 A;  2VM2 A;  1NHO A;  2TIR A;  4ECC A;  1N2A A;  4A5P A;  2WW3 A;  3A5W A;  6GSS A;  3EU3 A;  3KP8 A;  2B5Y A;  1M2B A;  4Z2R A;  2IMI A;  2ZUP A;  5IO2 A;  4I2U A;  3F6F A;  4ZB8 A;  2QGV A;  3E3E A;  2HSH A;  1XW6 A;  4EIP A;  3FW2 A;  4N11 A;  3UBL A;  2KP2 A;  1X5C A;  1BX9 A;  3F4R A;  2X64 A;  1VF4 A;  4ZBA A;  1FVK A;  1M3I A;  2REM A;  4HDE A;  2OBI A;  1ZMA A;  2PVQ A;  4QQ7 A;  3CWG A;  4WXT A;  4L0U A;  2GT5 A;  5DDL A;  3CRT A;  3GX8 A;  1FO5 A;  4HJM A;  3WD6 A;  1PL2 A;  5A5K A;  1BYE A;  1AW9 A;  1AIU A;  3BCK A;  4CY6 A;  4N0Z A;  1PKW A;  4YAP A;  5ECR B;  2NVL A;  3C8E A;  3QCP A;  2VCQ A;  2DIY A;  3F6D A;  2E2M A;  1HNC A;  4RQR A;  2OKA A;  2G0F A;  4PXO A;  1TK0 B;  1MDJ A;  2EIQ A;  5IIZ A;  3VI5 A;  1SYX A;  3FYG A;  1X9W B;  4XS1 A;  2NDO A;  2OE3 A;  4E68 A;  2P5Q A;  4XRD A;  3IOS A;  4EC0 A;  3GNJ A;  1OE7 A;  2X4A A;  2A2R A;  3VPT A;  2CAI A;  4MJA A;  1NHY A;  3GMF A;  5GST A;  2R37 A;  3F8U A;  4KAE A;  2L5L A;  2ES7 A;  3L9V A;  3L0H A;  5D9W A;  4L5O A;  1EP7 A;  1O6J A;  1XBS A;  1S3A A;  2VL2 A;  1FOH A;  2YN1 A;  3GH6 A;  3G9B A;  2FUG 2;  2L57 A;  2CVB A;  4ZXG A;  4OCE A;  3ZML A;  1XVQ A;  2H74 A;  3F3R A;  2D2Z A;  2YCD A;  3HKR A;  5E4W A;  1X9S B;  4E8H A;  3M0F A;  3LJR A;  3JCM L;  2JSY A;  1GTI A;  2AB6 A;  3APQ A;  3WT2 A;  2O87 A;  4G01 A;  1S3C A;  2YWO A;  3FMW A;  2CV4 A;  2H75 A;  4MK3 A;  2NPB A;  2I1U A;  1Z6N A;  2FA4 A;  3U6V A;  1GNW A;  4ZL7 A;  2VCW A;  1FHE A;  4TN8 A;  1YEW C;  1ZL9 A;  1ZCP A;  2LRC A;  4O5U A;  3GKK A;  2L5O A;  4X0X A;  3KJY A;  4LLR A;  1Q98 A;  2MYG A;  4HZ2 A;  3VPQ A;  5DQY A; 
#chains in the Genus database with same CATH homology
 1TW9 A;  4TXV A;  3HVV A;  1THX A;  4IP6 A;  3MWH A;  3D6I A;  5IM9 A;  1T00 A;  3LFL A;  3WT1 A;  4GST A;  4HUA A;  4FYB A;  5HQP A;  4GCI A;  1Z5Y E;  1ZGN A;  1V40 A;  4MP4 A;  4YQV A;  1PSQ A;  2YZU A;  2BJX A;  3MDK A;  1SYR A;  1HD2 A;  4MNN A;  1GUK A;  2C0F A;  4BVX B;  5LD0 A;  5DAK A;  3FR3 A;  1OKT A;  4F0B A;  4G0L A;  4IN0 A;  1U87 A;  3HMJ G;  4ULX A;  3VLN A;  2WJU A;  1QQ2 A;  3GFK A;  2GST A;  4O7H A;  5J47 A;  4KGI A;  2GQM A;  4XCS A;  3GTU B;  2CVK A;  1PX6 A;  2H6X A;  4F03 A;  1SVL A;  2UV8 G;  4Z2U A;  4BWS A;  3IAS 2;  4WF5 A;  5CRG A;  3HJO A;  3ZLP A;  1EP8 A;  1SJZ A;  4EUY A;  2DJJ A;  3KD0 A;  3GL5 A;  3IV4 A;  5DAL B;  5G30 A;  4FIW A;  2GVP A;  4L5L A;  4TXO A;  4XS4 A;  1W89 A;  5D8I A;  4IQA A;  2WB9 A;  3C1R A;  3BJ5 A;  1VRS D;  4Z2T A;  2HZE A;  3EWL A;  2GSR A;  1R7H A;  2EIR A;  2OE1 A;  4K9Z A;  2HNL A;  1YZX A;  3IK9 A;  3VK9 A;  2VCV A;  4BVY B;  3VI7 A;  3V1W A;  4MZC A;  3LXZ A;  3HA9 A;  2K9F A;  2R5G A;  2AAW A;  1GSU A;  1QFN A;  4JR4 A;  1K0M A;  4O32 A;  1UVZ A;  1TU8 A;  5ECM B;  3L78 A;  3KH7 A;  2H0H A;  1XFL A;  3APS A;  4NHW A;  5GAP D;  2VL2 C;  2C0E A;  3DYR A;  4N0V A;  3LSZ A;  2AV4 A;  3TKQ A;  2EC4 A;  1SKR B;  2EFC A;  3QPM A;  4ZBD A;  3KIJ A;  1SK1 A;  4TR1 A;  5CRE A;  4J2F A;  2O89 A;  3TRP A;  2YZH A;  5G2Z A;  4MJB A;  2LJK A;  5J41 A;  2JZS A;  3M3M A;  1MTC A;  5AIV A;  2A4H A;  4G9H A;  1XWA A;  5IMD A;  3LG6 A;  6GST A;  1R5A A;  3ISO A;  4MA9 A;  3DML A;  2HQT A;  4PGT A;  3EYT A;  2E2G A;  1BF5 A;  2F3M A;  3HD5 A;  4POL A;  4K0N A;  2RM5 A;  4HQS A;  4WKW A;  1DE1 A;  1RK4 A;  2XBI A;  1JZR A;  2ON7 A;  2JAD A;  4MCU A;  5EVO A;  3CTF A;  4HI7 A;  5HFG A;  3O76 A;  4DSS A;  3I43 A;  1FW1 A;  3UJ1 A;  1EEJ A;  2H73 A;  5B6M A;  3QAW A;  3QMX A;  1X5E A;  3NZN A;  1EGO A;  5GZZ B;  5B7C A;  1ERV A;  5CRD A;  1PGT A;  4K5R A;  2F9S A;  1SJI A;  1TDI A;  2V6O A;  2V41 A;  2QSI A;  4IW9 A;  2VLT A;  5J40 A;  4AJ6 A;  2H1D A;  1ACV A;  3IC4 A;  2CX4 A;  1GSY A;  5G5E A;  2GZZ A;  2H1A A;  2IFQ A;  5EPF A;  4ZB7 A;  2P5R A;  4F2I A;  4BA7 A;  4TOP A;  4YH2 A;  3KMO A;  2PVO C;  4XS4 B;  2O5V A;  4K7I A;  4NMU A;  2RM6 A;  2B5E A;  4NWY A;  2MBS A;  5JWO B;  4DEJ A;  1ZYQ B;  4OCF A;  2DIZ A;  1SEN A;  3RPP A;  5HFI A;  2YWI A;  4F82 A;  3LQ7 A;  1JZW A;  5DQS A;  3MIX A;  2PGT A;  1TRV A;  2X8C A;  3P8W A;  1B9Y C;  1B8X A;  2BTO T;  4K2X A;  1IYI A;  1TU7 A;  4JR6 A;  1K0N A;  4Z7X A;  5ECQ B;  1EOH A;  3QR6 A;  2I3Y A;  4USS A;  4HZ4 A;  1FOV A;  1X5D A;  2XHF A;  2B7K A;  4EDY A;  4EO3 A;  5ECS A;  3I6A A;  4NXI A;  4WBJ A;  1URM A;  4ZIL A;  2P0G A;  2OJL A;  4JZQ A;  1GSQ A;  3RBT A;  5IMA A;  1FG4 A;  2YWM A;  5D96 A;  4P3Y B;  1J0F A;  1Z7R A;  1VF1 A;  2A2S A;  4MMM A;  4V2L A;  4D73 A;  4IQ1 A;  3LYK A;  3ERF A;  4HU7 A;  2QA2 A;  4F0C A;  4IJI A;  3D21 A;  3GH9 A;  3SWL A;  4I5Q A;  3GKN A;  1B9X C;  1HYU A;  1OAZ A;  2RII A;  3N5O A;  5IQY A;  2N5A A;  2HRK B;  3ZFL A;  3KXO A;  2VL3 A;  1R5P A;  4FYU A;  4KDX A;  1M2D A;  3EE2 A;  3H79 A;  3UAR A;  4AI6 A;  1BG1 A;  3ME8 A;  1SKS B;  3Q6O A;  2C80 A;  3C1S A;  3G7I A;  3D22 A;  4GXZ A;  5J9B A;  2H1L A;  2HSN A;  2HSY A;  2KOK A;  3KH9 A;  1J9B A;  2VCZ A;  5F05 A;  5LNK e;  1ERU A;  3LWA A;  1OC8 A;  1GTA A;  3P90 A;  2XPE A;  4K2D A;  1MD3 A;  3TOT A;  5J9C A;  3GUS A;  4EIQ A;  1R4W A;  1BJX A;  2LS5 A;  1KEB A;  2R0G A;  3DWV A;  4G0I A;  4Q5R A;  3CMI A;  1XWC A;  2ZCT A;  1WWJ A;  1SK0 A;  3IAM 2;  2AYT A;  3HCZ A;  3DXB A;  2OAD A;  3QFB C;  1A8L A;  2O7K A;  4OWY A;  5KN1 A;  1Y1U A;  2A4V A;  1XWK A;  5A34 A;  3UEM A;  2ON5 A;  1B48 A;  2TRC P;  4YKG A;  3C71 A;  2H30 A;  19GS A;  2CAQ A;  3RPN A;  1G6Y A;  1M9A A;  5L71 A;  4AGS A;  1V2A A;  3GKM A;  2LTK A;  5CAX A;  2R0C A;  4E8E A;  1Y6E A;  3FK8 A;  1K0D A;  5CRH A;  5A4U A;  3MNG A;  3BD2 A;  2NTO A;  1JLV A;  1GSS A;  4FH8 A;  4ZL9 A;  3U5R E;  2NBS A;  2OAC A;  4TR4 A;  2UZ8 A;  4BL7 B;  2MBT A;  4MF6 A;  4HS1 A;  4IBP A;  2VD1 A;  4ZL8 A;  3LOR A;  2LEG A;  4JE1 A;  3LEF A;  3A2W A;  1K3O A;  4RUV A;  5A1N A;  2C0G A;  4YKF A;  1LJR A;  1GH2 A;  1PX7 A;  2H0G A;  3E9J B;  1QMV A;  3LGC A;  5JWQ B;  3TU3 B;  3D4M A;  1NM3 A;  1WE0 A;  3ZIJ A;  4RQX A;  1YY7 A;  2O8V B;  1FAA A;  1F3A A;  3G7J A;  5ECP B;  1G0T A;  3EIN A;  2OA7 A;  2ALB A;  1DBY A;  5A5H A;  4NV5 A;  1AC1 A;  4TVE A;  3GUR A;  1C72 A;  2FD3 A;  5AIS A;  1WJK A;  2YOI A;  3ZTL A;  3GYK A;  5JCW A;  3HXS A;  4ACS A;  1OVN A;  6GSW A;  3HJP A;  4MAB A;  4DSQ A;  2FWG A;  3GKX A;  1GNE A;  4LMV A;  2FNO A;  1BED A;  3DIE A;  2RUF A;  1DSB A;  3GSS A;  4OMV A;  3TRX A;  3RHB A;  2CA8 A;  4F9Z A;  4AKH A;  4CHS A;  3AY8 A;  1EV4 A;  4JBB A;  1F37 A;  1SVO A;  5BMU A;  4OO5 A;  4V2N A;  6GSX A;  1XPV A;  1A2M A;  4ML1 A;  3PR8 A;  3C7M A;  3HZ8 A;  2C3Q A;  1XOB A;  4CY8 A;  1FB6 A;  2PER A;  1SKW B;  1GSD A;  2VCX A;  3ED3 A;  3ZL5 A;  2RLI A;  2HSM A;  1VGL A;  2KLX A;  2Z9S A;  5FHI A;  1GP1 A;  5AGY A;  2VLU A;  1T7P B;  4PQH A;  4O5R A;  5J4U A;  1K0A A;  2YV7 A;  3HVX A;  5D73 A;  2HLS A;  2MMN A;  3UBK A;  4ISD A;  2MMZ A;  2FWF A;  5JWR B;  4MLY A;  1U3A A;  5HR0 A;  3RHC A;  1B4Q A;  2HRA A;  4NHZ A;  3MAK A;  9GSS A;  5ID2 A;  1O8X A;  2LUS A;  1GTB A;  2CVD A;  1F2E A;  3HHV A;  3E0U A;  3NOF A;  3QD9 A;  2YWN A;  3VUR A;  2X8G A;  4H86 A;  3KCM A;  2GSS A;  4TRX A;  4GLT A;  2IME A;  1UC7 A;  8GSS A;  5CYY A;  3A3T A;  5JCU A;  4PUA A;  5J5N A;  1GRX A;  5F06 A;  2I4A A;  2G2Q A;  4I8B A;  2FHE A;  1XVW A;  5H5S A;  3W8S A;  2OT3 A;  1OC3 A;  3ERW A;  1SL1 B;  2LQO A;  2M72 A;  3HYP A;  3CYN A;  4V1A p;  4GDF A;  1QUW A;  4V1A g;  1ERW A;  3LYP A;  4BWQ A;  4PTS A;  4PNG A;  3W6G A;  2DSA A;  4OD7 A;  5A1N B;  5ECI B;  3ZRE A;  4ID0 A;  4G0K A;  4MPG A;  5E59 A;  3Q19 A;  3BOA A;  4W66 A;  2H6Z A;  4K1F A;  4EXJ A;  5FWG A;  1T4Z A;  4EE0 A;  3WYW A;  1F9M A;  2GT6 A;  1JHB A;  2C4J A;  3TKS E;  3S9F A;  4KCE A;  3FZ9 A;  3KP9 A;  3ZVJ D;  4PNF A;  1PQN A;  1V57 A;  4PUR A;  3N9J A;  3BCI A;  3A5I A;  3ZIT A;  1OC9 A;  5DBQ A;  3IC8 A;  4ZBB A;  3ZFB A;  3IK7 A;  2EIO A;  4TR0 A;  1CQG A;  1ABA A;  2DMM A;  2DKH A;  2EFD A;  3M8N A;  1U88 A;  2BMX A;  1A23 A;  1XIY A;  3FKF A;  1SD9 A;  4MZW A;  1T3B A;  3SBC A;  3KEB A;  3P7X A;  2GS3 A;  3H4K A;  2HFD A;  2CZ3 A;  4K0G A;  5CNW A;  1GUH A;  2L4C A;  1GLQ A;  1YKA A;  5F07 A;  1KTE A;  4KSM A;  5KEJ A;  3HJM A;  2WZ9 A;  4RI6 A;  2L6C A;  2GZY A;  3F63 A;  1SL0 B;  4KND A;  2H0I A;  4BPY A;  2CT6 A;  1TJD A;  3H1N A;  3O3T A;  4X43 A;  5DAK B;  3GN3 A;  3UVT A;  5KN2 A;  3D4T A;  4KA0 A;  4PQI A;  3WGE A;  1T8E B;  1XWB A;  1VF2 A;  2DJ2 A;  2MMA A;  2K8S A;  4XHM A;  1BAY A;  2CZ2 A;  3L9U A;  4IVF A;  22GS A;  3A2X A;  4HOJ A;  4X4J A;  1LU4 A;  5CRW A;  1UA5 A;  1Z6M A;  1Z7P A;  12GS A;  3FZ4 A;  2AHE A;  3ZYW A;  1SK2 A;  2H8L A;  2L59 A;  2JSZ A;  1FVJ A;  5ELA A;  4HJ2 A;  3PPU A;  4KSO A;  3UMA A;  1PN0 A;  2QKE A;  1H4O A;  2VOC A;  1X0R A;  4TXO B;  3GST A;  4JRR A;  4N3Z A;  2OBK A;  1O81 A;  1ON4 A;  1MDK A;  4L8E A;  2H19 A;  2WDU A;  2GGT A;  2L4Q A;  1WPI A;  5IMF A;  2AUV A;  2B1K A;  4K5S A;  2PN8 A;  2V32 A;  1JLW A;  3HDC A;  3K8N A;  2HZE B;  2XPD A;  5JCG A;  1OKD A;  1AAZ A;  2DJK A;  5DCG A;  4J56 E;  1SU9 A;  1TTZ A;  1ZYE A;  1XW5 A;  3IBH A;  1WIK A;  3DGQ A;  1GTU A;  3FHK A;  2QA1 A;  3EMX A;  3PIN A;  1KBN A;  3H8Q A;  4MH3 A;  2TRX A;  1GSF A;  4ZB6 A;  5IMZ A;  1HNB A;  3TKR A;  3GIX A;  2IJY A;  2X8H A;  4LA1 A;  3UAP A;  5B6N A;  11GS A;  2VIM A;  4KW6 A;  3GHA A;  3QAG A;  1XXU A;  2LJA A;  4TR1 B;  4MJC A;  1MD4 A;  2K6V A;  4NPB A;  1A0R P;  1K0O A;  1YF1 A;  4GTU A;  1E6B A;  2YV9 A;  1KNG A;  5DJL A;  4I2T A;  1YEP A;  1TKD B;  1A8Y A;  1YQ1 A;  2IMD A;  3QOU A;  1R26 A;  2DJ1 A;  2FA8 A;  3HY2 A;  4PUF C;  2HXK A;  1UN2 A;  1USB A;  2JZR A;  2KHP A;  1EGR A;  2JAC A;  5ECK B;  2N5B A;  1V98 A;  4QL9 A;  3BBY A;  2JU5 A;  2IMF A;  2V2G A;  4G10 A;  2F8A A;  2LRN A;  3F4T A;  2GQL A;  2HRN A;  1BG5 A;  1AXD A;  3CBU A;  4YQM A;  2CQ9 A;  4MZB A;  4YAV A;  4N10 A;  4DSR A;  3MSZ A;  1PL1 A;  5EL8 A;  4KB3 A;  3TCO A;  2PUK C;  2FCH A;  3PGT A;  2VAF A;  4DSS B;  3ME7 A;  1ML6 A;  1K0B A;  1PD2 1;  3KM6 A;  3VWU A;  1JFU A;  3WGD A;  1M0U A;  1THO A;  3KTL A;  3Q18 A;  2FLS A;  4ECJ A;  1BQ7 A;  5IPG A;  3DVX A;  1O85 A;  18GS A;  4RI7 A;  2A2P A;  2VUP A;  3ZIV A;  1Q4J A;  2H71 A;  2WS2 A;  3GX0 A;  10GS A;  5IOX A;  1Y25 A;  1EWX A;  5IMV A;  4EF0 A;  5KOX A;  1G7O A;  1EV9 A;  5KOW A;  3C73 A;  2IFQ B;  5B8A A;  3CSJ A;  4MJE A;  2C8U A;  1TK5 B;  4MF7 A;  3IR4 A;  4GQF A;  3HZ4 A;  4FYC A;  4BVX A;  3FEU A;  3I69 A;  3CSI A;  4KDU A;  2LQQ A;  1YJ6 A;  3DD3 A;  3IPZ A;  1ZOF A;  5AIX A;  3GRX A;  1MEK A;  1GLP A;  3VWW A;  1V9W A;  3FR6 A;  3GTU A;  1JZO A;  4V2M A;  2VM1 A;  3NIV A;  3Q74 A;  5DCH A;  2DJ3 A;  1M99 A;  4GRF A;  4ML6 A;  2RUE A;  2R2J A;  5ECO B;  2N5F A;  4MF5 A;  5DAL A;  3LXT A;  5BRT A;  1N8J A;  3QFA C;  3UL3 A;  5CO3 A;  4KDY A;  3IRA A;  1QXH A;  2GQK A;  4GF0 A;  1SD8 A;  2H66 A;  1YDK A;  3KMN A;  2KP1 A;  5GAN D;  3M9J A;  4TR3 A;  2IMK A;  2I81 A;  2YP6 A;  3UOM A;  2XC2 A;  1TRW A;  4D73 B;  4Q5N A;  4ZB9 A;  2MZC A;  4KF9 A;  3EUR A;  3F3Q A;  3CTG A;  1SL2 B;  4BVY A;  4L0W A;  5D93 A;  2VCT A;  2X99 A;  2X49 A;  1VF3 A;  3IA1 A;  3RDW A;  1K3L A;  2H70 A;  4PX1 A;  4HQZ A;  4POM A;  4WBR D;  2OE0 A;  4K6X A;  1TK8 B;  1IYH A;  4AJ7 A;  1PMT A;  2VKZ G;  4PQ1 A;  3TGZ A;  1TI1 A;  3KGK A;  5F0G A;  1F6M C;  1YEX A;  5F8B A;  4POK A;  2HSN B;  1W4V A;  3DRN A;  2EFH A;  3CXG A;  4WR4 A;  1WOU A;  3DKS A;  1X9M B;  1XWG A;  3J7Y b;  5B8B A;  4KUN A;  2FWH A;  1XZO A;  3R2Q A;  2H1G A;  4K7N A;  4IJ3 A;  2XBQ A;  3L9S A;  4EL1 A;  5HR1 A;  3EMP A;  4ILF A;  3HVS A;  3I9V 2;  1WMJ A;  3ZVJ A;  1HNA A;  1A2L A;  2DKI A;  4O5Q A;  2H1B A;  2MMO A;  3UIW A;  1ILO A;  2DJ0 A;  1A0F A;  4I6X A;  3WGX A;  4AKX B;  5A34 B;  1PKZ A;  1T4Y A;  3FR9 A;  3LW9 A;  5H5R A;  2B1L A;  2P31 A;  2PWJ A;  1SVM A;  3EPT A;  5G31 A;  3KZQ A;  2IIY A;  3VWV A;  2YAN A;  2HZF A;  1NSW A;  2GDR A;  2HRF A;  3TKS A;  5ECN B;  1F3B A;  5ECL B;  1GWC A;  2HT9 A;  4TW5 A;  1N25 A;  6GSU A;  1NW2 A;  3J7Y k;  1TXX A;  4QL7 A;  1OYJ A;  4Q5Q A;  2B5X A;  2H72 A;  4O92 A;  2H01 A;  3TJB A;  3TOU A;  2E7P A;  3IXR A;  1YF0 A;  1MDI A;  4MDC A;  4MH2 A;  3TDG A;  4ECI A;  3DEX A;  5IOW A;  3F4S A;  2B3S A;  2CX3 A;  4ECB A;  2LST A;  4J57 E;  17GS A;  5INY A;  4K8M A;  2V6K A;  4IS0 A;  3QAV A;  4AKG A;  2KUC A;  3GL3 A;  5LCZ A;  1YVL A;  5DJM A;  2F51 A;  4AJ8 A;  1WRY A;  5G1L A;  5IMC A;  3IHQ A;  3TRQ A;  2IN3 A;  1RW1 A;  1HQO A;  3RAZ A;  5C00 A;  2JL4 A;  1E2Y A;  4FQU A;  4DVC A;  1XW9 A;  2C0D A;  5A5H B;  2K18 A;  1AUC A;  3D5J A;  1CQH A;  2LNT A;  3TJJ A;  1TRS A;  4CW9 A;  2IPA A;  2R0P A;  2FGX A;  3P2A A;  4K7O A;  1GUL A;  2HE3 A;  5ENU A;  4TKY A;  3FY7 A;  3ZRD A;  5A4V A;  4LL1 B;  5A4W A;  4NAX A;  3M1G A;  1GSE A;  3G7Y A;  1TOF A;  2C3N A;  1WP0 A;  6GSY A;  3ZZX A;  5GSS A;  4IP1 A;  13GS A;  3VPQ A;  1H75 A;  4IEL A;  1EEM A;  2LRT A;  2WRT A;  1AQX A;  16GS A;  2VO4 A;  4IKH A;  3VWX A;  2LKU A;  2PPT A;  2AJQ B;  1O7U A;  3A2V A;  1U6T A;  4LMW A;  3W8J A;  2F8F A;  2E0Q A;  2GTU A;  5AN1 A;  5BMU B;  2C1Y A;  4ZIJ A;  1Z3E A;  1M9B A;  4KCA A;  1AQW A;  5D9T A;  3FRC A;  1B4P A;  2HI7 A;  3EVI A;  5D9X A;  1XOA A;  2J23 A;  1AQV A;  1G6W A;  1OE8 A;  4AKI A;  2LV3 A;  3L4N A;  1I5G A;  4JU5 A;  5G5F A;  4KX4 A;  4EDZ A;  2HRK A;  4IGJ A;  2HSM B;  4FO5 A;  1QK8 A;  2VLV A;  3CRU A;  2QC7 A;  2YJ7 A;  1V58 A;  3TJG A;  2EFE A;  5KN3 A;  1FB0 A;  3TB2 A;  3EC3 A;  4WF4 A;  1J08 A;  1TP9 A;  2PU9 C;  4WEY A;  2JZT A;  4OO4 A;  1M7T A;  1ZYN A;  2M80 A;  2K8V A;  1SJ6 A;  5J4Y A;  4JED A;  2H6Y A;  2B7J A;  5ID2 B;  1Z9H A;  4N30 A;  2H76 A;  2M46 A;  2WGR A;  4EKZ A;  5IPH A;  3IHG A;  1I9D A;  4WR5 A;  3GV1 A;  3US3 A;  5ELG A;  4MPF A;  2V1M A;  1RQM A;  2ZNM A;  2PBJ A;  4CDO A;  5ECH B;  1S3D A;  5D9V A;  4GQC A;  3D0Z A;  1EOG A;  3TKS C;  20GS A;  2VL9 A;  3ZMK A;  2B6M A;  3O6T A;  4XTS A;  5KN0 A;  2DC5 A;  5J3R A;  2VD0 A;  5C04 A;  4AF2 A;  4G2E A;  2LJR A;  5G1K A;  5ABR A;  2DLX A;  2C3T A;  4XRA A;  1ZZY A;  2GSQ A;  4ICY A;  1G7E A;  4OFM A;  5FT3 A;  4X1U A;  3F9U A;  1O8W A;  3KTB A;  3EU4 A;  1PRX A;  3TUE A;  1K3Y A;  2GLR A;  1DE2 A;  1QGV A;  3UVH A;  14GS A;  4YQU A;  2DBC A;  4GWR A;  3PH9 A;  1XCC A;  4QMK A;  2DML A;  4POB A;  2IL3 A;  1LBK A;  2R6K A;  3IDV A;  4G19 A;  4OFT A;  4GSS A;  1EZK A;  4OFN A;  1A24 A;  2R3X A;  3APO A;  3VFI A;  3R3E A;  1GUM A;  1T1V A;  2LNS A;  2WFC A;  3TJK A;  4BL7 A;  4XIH A;  3H93 A;  1PA3 A;  2WUL A;  2PMT A;  5HR3 A;  1A2J A;  1OC9 B;  2WCI A;  5DVB A;  3ERG A;  4HU9 A;  3CSH A;  3QDN A;  2R4V A;  4KH7 A;  4GSN A;  2YJH A;  2GZP A;  1PN9 A;  1TRU A;  3OR5 A;  1DUG A;  3FZA A;  2HYX A;  7GSS A;  1TI3 A;  1YKC A;  4KE3 A;  2YNX A;  2L6D A;  3DVW A;  1ERT A;  1O73 A;  4LL4 B;  3TJF A;  5COH A;  2I9H A;  4IHU A;  1U3I A;  3FZ5 A;  1ZYP A;  5J4V A;  3TKP A;  5HFK A;  4HEA 2;  2YPM A;  1M2A A;  5EY6 A;  5H5Q A;  4NV2 A;  5CP1 A;  3F0I A;  2O85 A;  2IWT A;  2J9H A;  6GSV A;  1ST9 A;  3IE3 A;  3M9K A;  4Q5F A;  1JZD A;  2FWE A;  4I97 A;  2FY6 A;  4XS6 A;  1TXU A;  3GA4 A;  1K0C A;  4WET A;  4EVM A;  1GL8 A;  5IO0 A;  5HR2 A;  2VM2 A;  1NHO A;  2TIR A;  4ECC A;  1N2A A;  4A5P A;  3A5W A;  6GSS A;  3EU3 A;  3KP8 A;  2B5Y A;  1M2B A;  4Z2R A;  2IMI A;  2ZUP A;  5IO2 A;  4I2U A;  3F6F A;  4ZB8 A;  2QGV A;  3E3E A;  2HSH A;  1XW6 A;  4EIP A;  3FW2 A;  4N11 A;  3UBL A;  2KP2 A;  1X5C A;  1BX9 A;  3F4R A;  2X64 A;  1VF4 A;  4ZBA A;  1FVK A;  2REM A;  4HDE A;  2OBI A;  1ZMA A;  2PVQ A;  4QQ7 A;  3CWG A;  4WXT A;  4L0U A;  2GT5 A;  5DDL A;  3CRT A;  3GX8 A;  1FO5 A;  4HJM A;  3WD6 A;  1PL2 A;  5A5K A;  1BYE A;  1AW9 A;  1AIU A;  3BCK A;  4CY6 A;  4N0Z A;  1PKW A;  4YAP A;  5ECR B;  2NVL A;  3C8E A;  3QCP A;  2VCQ A;  2DIY A;  3F6D A;  2E2M A;  1HNC A;  4RQR A;  2OKA A;  2G0F A;  4PXO A;  1TK0 B;  1MDJ A;  2EIQ A;  5IIZ A;  3VI5 A;  1SYX A;  3FYG A;  1X9W B;  4XS1 A;  2NDO A;  2OE3 A;  4E68 A;  2P5Q A;  4XRD A;  3IOS A;  4EC0 A;  3GNJ A;  1OE7 A;  2X4A A;  2A2R A;  3VPT A;  2CAI A;  4MJA A;  1NHY A;  3GMF A;  5GST A;  2R37 A;  3F8U A;  4KAE A;  2L5L A;  2ES7 A;  3L9V A;  3L0H A;  5D9W A;  4L5O A;  1EP7 A;  1O6J A;  1XBS A;  1S3A A;  2VL2 A;  1FOH A;  2YN1 A;  3GH6 A;  3G9B A;  2FUG 2;  2L57 A;  2CVB A;  4ZXG A;  4OCE A;  3ZML A;  1XVQ A;  2H74 A;  3F3R A;  2D2Z A;  2YCD A;  3HKR A;  5E4W A;  1X9S B;  4E8H A;  3M0F A;  3LJR A;  3JCM L;  2JSY A;  1GTI A;  2AB6 A;  3APQ A;  3WT2 A;  2O87 A;  4G01 A;  1S3C A;  2YWO A;  3FMW A;  2CV4 A;  2H75 A;  4MK3 A;  2NPB A;  2I1U A;  1Z6N A;  2FA4 A;  3U6V A;  1GNW A;  4ZL7 A;  2VCW A;  1FHE A;  4TN8 A;  1ZL9 A;  1ZCP A;  2LRC A;  4O5U A;  3GKK A;  2L5O A;  4X0X A;  3KJY A;  4LLR A;  1Q98 A;  2MYG A;  4HZ2 A;  3MYD A;  5DQY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...