5A34B

The crystal structure of the gst-like domains complex of eprs-aimp2
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
214
structure length
204
Chain Sequence
DLNSVLGKDYGALKDIVINANPASPPLSLLVLHRLLCEHFRVLSTVHTHSSVKSVPENLLKCFGRQDYQLGFTLIWKNVPKTQMKFSIQTMCPIEGEGNIARFLFSLFGQKHNAVNATLIDSWVDIAIFQLKEGSSKEKAAVFRSMNSALGKSPWLAGNELTVADVVLWSVLQQISVTVPANVQRWMRSCENLAPFNTALKLLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BIFUNCTIONAL GLUTAMATE/PROLINE--TRNA LIGASE
publication title Assembly of Multi-tRNA Synthetase Complex Via Heterotetrameric Glutathione Transferase-Homology Domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 57
structure length 204
sequence length 214
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2015-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00043 GST_C Glutathione S-transferase, C-terminal domain
B PF18569 Thioredoxin_16 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.130 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5a34B00
5A34B 5A5HA 5A1NB 4AKIA 5BMUB 4AI6A 5A34A 4W66A 4ZB7A 5A1NA 4AKGA 5A5HB 4AKHA
chains in the Genus database with same CATH superfamily
1BX9A 2C4JA 2WVXA 3U6VA 4G9HA 4N0VA 4OFMA 1NHYA 5BMUA 3IR4A 6GSUA 1GLPA 4MF5A 4KGIA 3QR6A 4G10A 4N3ZA 2EFEA 3CRTA 4IBPA 1OE8A 2C3QA 2O36A 4PQIA 4PURA 5ECHB 3UARA 2WW0A 3UVHA 1JLVA 5DQSA 2WDUA 1OKTA 3VK9A 3FR3A 3VLNA 4RI7A 4TOPA 5DJLA 5DJMA 2WW3A 2GLRA 2FNOA 3O3TA 1ML6A 3LXTA 4USSA 2CA8A 1PL1A 4YQUA 1TXUA 4GCIA 4GDFA 4KAEA 1K0NA 1K0BA 4E8HA 2GDRA 1GSEA 1MTCA 4YAVA 1IYIA 3DD3A 2VCZA 4GSSA 4L5OA 4LMVA 1YJ6A 1N2AA 4NHZA 3I6AA 2CAQA 5ECRB 5DALA 1F3AA 4F0BA 3LYKA 3H1NA 4KF9A 1GUKA 5AN1A 5FHIA 2EFCA 1XW5A 4HOJA 4IQAA 4KX4A 1GTAA 4G0LA 2D2ZA 3FRCA 1AW9A 3P90A 4ZB6A 2O5VA 4ZBAA 3N5OA 5A5HB 4WR4A 1K0MA 6GSSA 1AXDA 3P8WA 4G01A 22GSA 3ZMKA 1EEMA 4ZBDA 4WR5A 3WD6A 4BL7A 4PXOA 4HJ2A 2CZ2A 3MAKA 3VWXA 4KDUA 5A1NB 3GUSA 5A1NA 5IQYA 4FXYP 2VD1A 2OACA 4L8EA 3WYWA 5HFKA 1M9BA 1DUGA 2VCWA 1PD21 4IKHA 1YQ1A 1EOHA 5F06A 5DCGA 4PI0C 1MD4A 4O7HA 2IMKA 5D9WA 3LSZA 2PERA 1GTUA 4I97A 3LXZA 4ZB7A 3IC8A 1GSSA 3GSTA 3GSSA 4PX1A 19GSA 5EY6A 1KBNA 1B8XA 4IS0A 5ECLB 1EV9A 1GWCA 3LQ7A 2HNLA 1UA5A 4GSTA 4F03A 3M0FA 1V40A 4Q5FA 5EVOA 4KSMA 1Y1UA 5DAKB 4EC0A 2OADA 4IW9A 4KDYA 3MDKA 4ZB8A 4DEJA 5A4WA 3LJRA 4OFTA 2WJUA 1BG1A 5ECKB 3VPQA 3UBKA 5GZZB 6GSYA 2X64A 4JZQA 3RBTA 2HQTA 5J40A 2DC5A 4AKHA 4PNGA 2GSRA 2VCXA 3HMJG 3ERGA 2VCQA 2C80A 2VO4A 4Q5RA 1AQVA 4ECIA 3FR9A 4GSNA 1TU7A 1PGTA 2A2RA 3IBHA 1YKCA 1FHEA 3DGQA 4NAXA 1HNBA 2UZ8A 4AGSA 2IL3A 4K0NA 2JL4A 16GSA 4PQHA 5ELAA 2V6KA 1G6YA 2WW1A 2OA7A 1M0UA 4GF0A 3FY7A 13GSA 4PI2C 4GLTA 4MDCA 2GSQA 2HRAA 2ON7A 1U88A 1USBA 3BBYA 3KTLA 5D9VA 2AHEA 4QQ7A 1PN9A 4MF6A 1JLWA 3F63A 4AKXB 4YH2A 4KDXA 5ECIB 2GSTA 2HSNB 3VI5A 1I1IP 2NTOA 3GURA 2HSNA 1OE7A 4YQVA 2CZ3A 3CHXC 4QMKA 5J4YA 3KXOA 4OFNA 1YVLA 4IJIA 1PKWA 4JEDA 2WS2A 4F0CA 1B4PA 3ERFA 2R3XA 5D9XA 2PGTA 4BVYB 4EXJA 1B48A 1PX6A 3HKRA 4KH7A 5A5HA 3CBUA 3KMOA 2HSMB 1U87A 3Q74A 1FW1A 4MF7A 5G5FA 2ON5A 1V2AA 4KE3A 4EDYA 6GSWA 2EFHA 5AIXA 4EDZA 1XWKA 3LG6A 3VPTA 2FHEA 1K0CA 1PMTA 3UAPA 1G7OA 1SVLA 14GSA 5ECNB 9GSSA 4ACSA 2J9HA 2R5GA 3F6FA 1BAYA 3CSHA 5GSSA 1F2EA 2GSSA 3LYPA 4RI6A 20GSA 3PPUA 4Q5NA 1YY7A 3FYGA 4J2FA 1K3YA 4BVXB 3IK7A 1GSFA 5AISA 2PVQA 4PNFA 5ELGA 3SWLA 1TU8A 1E6BA 2WRTA 3KM6A 4MP4A 1HQOA 3TOTA 3KMNA 1VF3A 1OYJA 4HZ2A 4E68A 4FQUA 4O92A 4ZXGA 1N25A 3EE2A 4YQMA 1AQWA 5DAKA 4PHZC 4PUAA 3R2QA 1GSUA 5F0GA 1GSYA 4MK3A 3M3MA 1EOGA 2CAIA 3GTUB 4G0KA 3ZFLA 3CRUA 2WVYA 2HRKB 4ISDA 18GSA 2F3MA 17GSA 4AKGA 4K0GA 5J4VA 3Q18A 5FWGA 3CSIA 5J4UA 1BYEA 12GSA 3TOUA 3VURA 3EINA 3G7IA 1ZL9A 3CWGA 5AGYA 4E8EA 2R6KA 5A34B 4AKIA 4NHWA 5A34A 1SVMA 2WVXB 2VCVA 10GSA 5G5EA 4EE0A 1K0AA 1M99A 2WW2A 5BMUB 5A4UA 4CHSA 5GSTA 1R5AA 2C3NA 4ZBBA 6GSTA 3PR8A 1BG5A 3ZMLA 1Y6EA 2R4VA 1GUHA 3KJYA 4PGTA 5JCWA 1PA3A 1GSQA 3IE3A 4AI6A 7GSSA 2AB6A 3C8EA 2N5FA 2YCDA 1PL2A 1K0OA 2H1LA 2O3EA 5ECQB 1VF2A 1BF5A 2PBJA 4ID0A 2WVZA 5A4VA 3FR6A 1GNEA 3O76A 4MPGA 5ECPB 1HNCA 4PTSA 5F8BA 2C3TA 1HNAA 3N9JA 3VI7A 4ZB9A 5F07A 3QAGA 4IVFA 3Q19A 1EV4A 11GSA 4BVYA 1GSDA 4GTUA 4L5LA 3PGTA 5DALB 2HSMA 4IQ1A 1GUMA 3ZFBA 3GX0A 4G0IA 3TGZA 1F3BA 1GULA 2LJRA 3ISOA 6GSVA 1Z9HA 2A2SA 3G7JA 1U3IA 5J5NA 1G6WA 4MPFA 1MD3A 5A5KA 1K3OA 5LCZA 3D0ZA 5D73A 3CSJA 3W8SA 3AY8A 8GSSA 5D9TA 4BL7B 3GH6A 1LJRA 3LFLA 4Q5QA 1XW6A 3R3EA 1TDIA 3NIVA 2IMIA 1K0DA 4BVXA 1K3LA 5ECSA 2EFDA 2UV8G 1VF4A 4IGJA 1S4BP 4MZWA 5J41A 2VD0A 5ECMB 5ECOB 1PX7A 1GTBA 2C8UA 2CVDA 2YV9A 3IK9A 3M1GA 3RGBC 6GSXA 4ECCA 3L0HA 5EL8A 1ZGNA 1Q4JA 3HJMA 2AAWA 4JBBA 4ECBA 5B7CA 3HJOA 4OMVA 3RFRC 1VF1A 3M8NA 1YDKA 3UBLA 2DSAA 3GTUA 3TU3B 1GNWA 5FT3A 1LBKA 2VCTA 1TW9A 1XWGA 5F05A 3I69A 2WB9A 4ECJA 1SVOA 4HI7A 4IELA 2WZSA 1AQXA 2YV7A 1RK4A 2HRKA 1YEWC 4LMWA 1GTIA 1A0FA 1JZRA 5KEJA 2OT3A 3QAVA 2PMTA 5LD0A 5J47A 4YAPA 4HZ4A 1PKZA 4W66A 2VKZG 3F6DA 1IYHA 3QAWA 1C72A 5JCUA 2GTUA 5AIVA 4G19A 1GLQA 5DDLA 1M9AA 2F8FA
chains in the Genus database with same CATH topology
1BX9A 2C4JA 3U6VA 4G9HA 4N0VA 4OFMA 1NHYA 5BMUA 3IR4A 6GSUA 1GLPA 4MF5A 4KGIA 3QR6A 4G10A 4N3ZA 2EFEA 3CRTA 4IBPA 1OE8A 2C3QA 4PQIA 4PURA 5ECHB 3UARA 3UVHA 1JLVA 5DQSA 2WDUA 1OKTA 3VK9A 3FR3A 3VLNA 4RI7A 4TOPA 5DJLA 5DJMA 2GLRA 2FNOA 3O3TA 1ML6A 3LXTA 4USSA 2CA8A 1PL1A 4YQUA 1TXUA 4GCIA 4GDFA 4KAEA 1K0NA 1K0BA 4E8HA 2GDRA 1GSEA 1MTCA 4YAVA 1IYIA 3DD3A 2VCZA 4GSSA 4L5OA 4LMVA 1YJ6A 1N2AA 4NHZA 3I6AA 2CAQA 5ECRB 5DALA 1F3AA 4F0BA 3LYKA 3H1NA 4KF9A 1GUKA 5AN1A 5FHIA 2EFCA 1XW5A 4HOJA 4IQAA 4KX4A 1GTAA 4G0LA 2D2ZA 3FRCA 1AW9A 3P90A 4ZB6A 2O5VA 4ZBAA 3N5OA 5A5HB 4WR4A 1K0MA 6GSSA 1AXDA 3P8WA 4G01A 22GSA 3ZMKA 1EEMA 4ZBDA 4WR5A 3WD6A 4BL7A 4PXOA 4HJ2A 2CZ2A 3MAKA 3VWXA 4KDUA 5A1NB 3GUSA 5A1NA 5IQYA 2VD1A 2OACA 4L8EA 3WYWA 5HFKA 1M9BA 1DUGA 2VCWA 1PD21 4IKHA 1YQ1A 1EOHA 5F06A 5DCGA 1MD4A 4O7HA 2IMKA 5D9WA 3LSZA 2PERA 1GTUA 4I97A 3LXZA 4ZB7A 3IC8A 1GSSA 3GSTA 3GSSA 4PX1A 19GSA 5EY6A 1KBNA 1B8XA 4IS0A 5ECLB 1EV9A 1GWCA 3LQ7A 2HNLA 1UA5A 4GSTA 4F03A 3M0FA 1V40A 4Q5FA 5EVOA 4KSMA 1Y1UA 5DAKB 4EC0A 2OADA 4IW9A 4KDYA 3MDKA 4ZB8A 4DEJA 5A4WA 3LJRA 4OFTA 2WJUA 1BG1A 5ECKB 3VPQA 3UBKA 5GZZB 6GSYA 2X64A 4JZQA 3RBTA 2HQTA 5J40A 2DC5A 4AKHA 4PNGA 2GSRA 2VCXA 3HMJG 3ERGA 2VCQA 2C80A 2VO4A 4Q5RA 1AQVA 4ECIA 3FR9A 4GSNA 1TU7A 1PGTA 2A2RA 3IBHA 1YKCA 1FHEA 3DGQA 4NAXA 1HNBA 2UZ8A 4AGSA 2IL3A 4K0NA 2JL4A 16GSA 4PQHA 5ELAA 2V6KA 1G6YA 2OA7A 1M0UA 4GF0A 3FY7A 13GSA 4GLTA 4MDCA 2GSQA 2HRAA 2ON7A 1U88A 1USBA 3BBYA 3KTLA 5D9VA 2AHEA 4QQ7A 1PN9A 4MF6A 1JLWA 3F63A 4AKXB 4YH2A 4KDXA 5ECIB 2GSTA 2HSNB 3VI5A 2NTOA 3GURA 2HSNA 1OE7A 4YQVA 2CZ3A 4QMKA 5J4YA 3KXOA 4OFNA 1YVLA 4IJIA 1PKWA 4JEDA 2WS2A 4F0CA 1B4PA 3ERFA 2R3XA 5D9XA 2PGTA 4BVYB 4EXJA 1B48A 1PX6A 3HKRA 4KH7A 5A5HA 3CBUA 3KMOA 2HSMB 1U87A 3Q74A 1FW1A 4MF7A 5G5FA 2ON5A 1V2AA 4KE3A 4EDYA 6GSWA 2EFHA 5AIXA 4EDZA 1XWKA 3LG6A 3VPTA 2FHEA 1K0CA 1PMTA 3UAPA 1G7OA 1SVLA 14GSA 5ECNB 9GSSA 4ACSA 2J9HA 2R5GA 3F6FA 1BAYA 3CSHA 5GSSA 1F2EA 2GSSA 3LYPA 4RI6A 20GSA 3PPUA 4Q5NA 1YY7A 3FYGA 4J2FA 1K3YA 4BVXB 3IK7A 1GSFA 5AISA 2PVQA 4PNFA 5ELGA 3SWLA 1TU8A 1E6BA 2WRTA 3KM6A 4MP4A 1HQOA 3TOTA 3KMNA 1VF3A 1OYJA 4HZ2A 4E68A 4FQUA 4O92A 4ZXGA 1N25A 3EE2A 4YQMA 1AQWA 5DAKA 4PUAA 3R2QA 1GSUA 5F0GA 1GSYA 4MK3A 3M3MA 1EOGA 2CAIA 3GTUB 4G0KA 3ZFLA 3CRUA 2HRKB 4ISDA 18GSA 2F3MA 17GSA 4AKGA 4K0GA 5J4VA 3Q18A 5FWGA 3CSIA 5J4UA 1BYEA 12GSA 3TOUA 3VURA 3EINA 3G7IA 1ZL9A 3CWGA 5AGYA 4E8EA 2R6KA 5A34B 4AKIA 4NHWA 5A34A 1SVMA 2VCVA 10GSA 5G5EA 4EE0A 1K0AA 1M99A 5BMUB 5A4UA 4CHSA 5GSTA 1R5AA 2C3NA 4ZBBA 6GSTA 3PR8A 1BG5A 3ZMLA 1Y6EA 2R4VA 1GUHA 3KJYA 4PGTA 5JCWA 1PA3A 1GSQA 3IE3A 4AI6A 7GSSA 2AB6A 3C8EA 2N5FA 2YCDA 1PL2A 1K0OA 2H1LA 5ECQB 1VF2A 1BF5A 2PBJA 4ID0A 5A4VA 3FR6A 1GNEA 3O76A 4MPGA 5ECPB 1HNCA 4PTSA 5F8BA 2C3TA 1HNAA 3N9JA 3VI7A 4ZB9A 5F07A 3QAGA 4IVFA 3Q19A 1EV4A 11GSA 4BVYA 1GSDA 4GTUA 4L5LA 3PGTA 5DALB 2HSMA 4IQ1A 1GUMA 3ZFBA 3GX0A 4G0IA 3TGZA 1F3BA 1GULA 2LJRA 3ISOA 6GSVA 1Z9HA 2A2SA 3G7JA 1U3IA 5J5NA 1G6WA 4MPFA 1MD3A 5A5KA 1K3OA 5LCZA 3D0ZA 5D73A 3CSJA 3W8SA 3AY8A 8GSSA 5D9TA 4BL7B 3GH6A 1LJRA 3LFLA 4Q5QA 1XW6A 3R3EA 1TDIA 3NIVA 2IMIA 1K0DA 4BVXA 1K3LA 5ECSA 2EFDA 2UV8G 1VF4A 4IGJA 4MZWA 5J41A 2VD0A 5ECMB 5ECOB 1PX7A 1GTBA 2C8UA 2CVDA 2YV9A 3IK9A 3M1GA 6GSXA 4ECCA 3L0HA 5EL8A 1ZGNA 1Q4JA 3HJMA 2AAWA 4JBBA 4ECBA 5B7CA 3HJOA 4OMVA 1VF1A 3M8NA 1YDKA 3UBLA 2DSAA 3GTUA 3TU3B 1GNWA 5FT3A 1LBKA 2VCTA 1TW9A 1XWGA 5F05A 3I69A 2WB9A 4ECJA 1SVOA 4HI7A 4IELA 1AQXA 1RK4A 2HRKA 2YV7A 4LMWA 1GTIA 1A0FA 1JZRA 5KEJA 2OT3A 3QAVA 2PMTA 5LD0A 5J47A 4YAPA 4HZ4A 1PKZA 4W66A 2VKZG 3F6DA 1IYHA 3QAWA 1C72A 5JCUA 2GTUA 5AIVA 4G19A 1GLQA 5DDLA 1M9AA 2F8FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A34 B;  5A5H A;  5A1N B;  4AKI A;  5BMU B;  4AI6 A;  5A34 A;  4W66 A;  4ZB7 A;  5A1N A;  4AKG A;  5A5H B;  4AKH A; 
#chains in the Genus database with same CATH topology
 1BX9 A;  2C4J A;  2WVX A;  3U6V A;  4G9H A;  4N0V A;  4OFM A;  1NHY A;  5BMU A;  3IR4 A;  6GSU A;  1GLP A;  4MF5 A;  4KGI A;  3QR6 A;  4G10 A;  4N3Z A;  2EFE A;  3CRT A;  4IBP A;  1OE8 A;  2C3Q A;  2O36 A;  4PQI A;  4PUR A;  5ECH B;  3UAR A;  2WW0 A;  3UVH A;  1JLV A;  5DQS A;  2WDU A;  1OKT A;  3VK9 A;  3FR3 A;  3VLN A;  4RI7 A;  4TOP A;  5DJL A;  5DJM A;  2WW3 A;  2GLR A;  2FNO A;  3O3T A;  1ML6 A;  3LXT A;  4USS A;  2CA8 A;  1PL1 A;  4YQU A;  1TXU A;  4GCI A;  4GDF A;  4KAE A;  1K0N A;  1K0B A;  4E8H A;  2GDR A;  1GSE A;  1MTC A;  4YAV A;  1IYI A;  3DD3 A;  2VCZ A;  4GSS A;  4L5O A;  4LMV A;  1YJ6 A;  1N2A A;  4NHZ A;  3I6A A;  2CAQ A;  5ECR B;  5DAL A;  1F3A A;  4F0B A;  3LYK A;  3H1N A;  4KF9 A;  1GUK A;  5AN1 A;  5FHI A;  2EFC A;  1XW5 A;  4HOJ A;  4IQA A;  4KX4 A;  1GTA A;  4G0L A;  2D2Z A;  3FRC A;  1AW9 A;  3P90 A;  4ZB6 A;  2O5V A;  4ZBA A;  3N5O A;  5A5H B;  4WR4 A;  1K0M A;  6GSS A;  1AXD A;  3P8W A;  4G01 A;  22GS A;  3ZMK A;  1EEM A;  4ZBD A;  4WR5 A;  3WD6 A;  4BL7 A;  4PXO A;  4HJ2 A;  2CZ2 A;  3MAK A;  3VWX A;  4KDU A;  5A1N B;  3GUS A;  5A1N A;  5IQY A;  4FXY P;  2VD1 A;  2OAC A;  4L8E A;  3WYW A;  5HFK A;  1M9B A;  1DUG A;  2VCW A;  1PD2 1;  4IKH A;  1YQ1 A;  1EOH A;  5F06 A;  5DCG A;  4PI0 C;  1MD4 A;  4O7H A;  2IMK A;  5D9W A;  3LSZ A;  2PER A;  1GTU A;  4I97 A;  3LXZ A;  4ZB7 A;  3IC8 A;  1GSS A;  3GST A;  3GSS A;  4PX1 A;  19GS A;  5EY6 A;  1KBN A;  1B8X A;  4IS0 A;  5ECL B;  1EV9 A;  1GWC A;  3LQ7 A;  2HNL A;  1UA5 A;  4GST A;  4F03 A;  3M0F A;  1V40 A;  4Q5F A;  5EVO A;  4KSM A;  1Y1U A;  5DAK B;  4EC0 A;  2OAD A;  4IW9 A;  4KDY A;  3MDK A;  4ZB8 A;  4DEJ A;  5A4W A;  3LJR A;  4OFT A;  2WJU A;  1BG1 A;  5ECK B;  3VPQ A;  3UBK A;  5GZZ B;  6GSY A;  2X64 A;  4JZQ A;  3RBT A;  2HQT A;  5J40 A;  2DC5 A;  4AKH A;  4PNG A;  2GSR A;  2VCX A;  3HMJ G;  3ERG A;  2VCQ A;  2C80 A;  2VO4 A;  4Q5R A;  1AQV A;  4ECI A;  3FR9 A;  4GSN A;  1TU7 A;  1PGT A;  2A2R A;  3IBH A;  1YKC A;  1FHE A;  3DGQ A;  4NAX A;  1HNB A;  2UZ8 A;  4AGS A;  2IL3 A;  4K0N A;  2JL4 A;  16GS A;  4PQH A;  5ELA A;  2V6K A;  1G6Y A;  2WW1 A;  2OA7 A;  1M0U A;  4GF0 A;  3FY7 A;  13GS A;  4PI2 C;  4GLT A;  4MDC A;  2GSQ A;  2HRA A;  2ON7 A;  1U88 A;  1USB A;  3BBY A;  3KTL A;  5D9V A;  2AHE A;  4QQ7 A;  1PN9 A;  4MF6 A;  1JLW A;  3F63 A;  4AKX B;  4YH2 A;  4KDX A;  5ECI B;  2GST A;  2HSN B;  3VI5 A;  1I1I P;  2NTO A;  3GUR A;  2HSN A;  1OE7 A;  4YQV A;  2CZ3 A;  3CHX C;  4QMK A;  5J4Y A;  3KXO A;  4OFN A;  1YVL A;  4IJI A;  1PKW A;  4JED A;  2WS2 A;  4F0C A;  1B4P A;  3ERF A;  2R3X A;  5D9X A;  2PGT A;  4BVY B;  4EXJ A;  1B48 A;  1PX6 A;  3HKR A;  4KH7 A;  5A5H A;  3CBU A;  3KMO A;  2HSM B;  1U87 A;  3Q74 A;  1FW1 A;  4MF7 A;  5G5F A;  2ON5 A;  1V2A A;  4KE3 A;  4EDY A;  6GSW A;  2EFH A;  5AIX A;  4EDZ A;  1XWK A;  3LG6 A;  3VPT A;  2FHE A;  1K0C A;  1PMT A;  3UAP A;  1G7O A;  1SVL A;  14GS A;  5ECN B;  9GSS A;  4ACS A;  2J9H A;  2R5G A;  3F6F A;  1BAY A;  3CSH A;  5GSS A;  1F2E A;  2GSS A;  3LYP A;  4RI6 A;  20GS A;  3PPU A;  4Q5N A;  1YY7 A;  3FYG A;  4J2F A;  1K3Y A;  4BVX B;  3IK7 A;  1GSF A;  5AIS A;  2PVQ A;  4PNF A;  5ELG A;  3SWL A;  1TU8 A;  1E6B A;  2WRT A;  3KM6 A;  4MP4 A;  1HQO A;  3TOT A;  3KMN A;  1VF3 A;  1OYJ A;  4HZ2 A;  4E68 A;  4FQU A;  4O92 A;  4ZXG A;  1N25 A;  3EE2 A;  4YQM A;  1AQW A;  5DAK A;  4PHZ C;  4PUA A;  3R2Q A;  1GSU A;  5F0G A;  1GSY A;  4MK3 A;  3M3M A;  1EOG A;  2CAI A;  3GTU B;  4G0K A;  3ZFL A;  3CRU A;  2WVY A;  2HRK B;  4ISD A;  18GS A;  2F3M A;  17GS A;  4AKG A;  4K0G A;  5J4V A;  3Q18 A;  5FWG A;  3CSI A;  5J4U A;  1BYE A;  12GS A;  3TOU A;  3VUR A;  3EIN A;  3G7I A;  1ZL9 A;  3CWG A;  5AGY A;  4E8E A;  2R6K A;  5A34 B;  4AKI A;  4NHW A;  5A34 A;  1SVM A;  2WVX B;  2VCV A;  10GS A;  5G5E A;  4EE0 A;  1K0A A;  1M99 A;  2WW2 A;  5BMU B;  5A4U A;  4CHS A;  5GST A;  1R5A A;  2C3N A;  4ZBB A;  6GST A;  3PR8 A;  1BG5 A;  3ZML A;  1Y6E A;  2R4V A;  1GUH A;  3KJY A;  4PGT A;  5JCW A;  1PA3 A;  1GSQ A;  3IE3 A;  4AI6 A;  7GSS A;  2AB6 A;  3C8E A;  2N5F A;  2YCD A;  1PL2 A;  1K0O A;  2H1L A;  2O3E A;  5ECQ B;  1VF2 A;  1BF5 A;  2PBJ A;  4ID0 A;  2WVZ A;  5A4V A;  3FR6 A;  1GNE A;  3O76 A;  4MPG A;  5ECP B;  1HNC A;  4PTS A;  5F8B A;  2C3T A;  1HNA A;  3N9J A;  3VI7 A;  4ZB9 A;  5F07 A;  3QAG A;  4IVF A;  3Q19 A;  1EV4 A;  11GS A;  4BVY A;  1GSD A;  4GTU A;  4L5L A;  3PGT A;  5DAL B;  2HSM A;  4IQ1 A;  1GUM A;  3ZFB A;  3GX0 A;  4G0I A;  3TGZ A;  1F3B A;  1GUL A;  2LJR A;  3ISO A;  6GSV A;  1Z9H A;  2A2S A;  3G7J A;  1U3I A;  5J5N A;  1G6W A;  4MPF A;  1MD3 A;  5A5K A;  1K3O A;  5LCZ A;  3D0Z A;  5D73 A;  3CSJ A;  3W8S A;  3AY8 A;  8GSS A;  5D9T A;  4BL7 B;  3GH6 A;  1LJR A;  3LFL A;  4Q5Q A;  1XW6 A;  3R3E A;  1TDI A;  3NIV A;  2IMI A;  1K0D A;  4BVX A;  1K3L A;  5ECS A;  2EFD A;  2UV8 G;  1VF4 A;  4IGJ A;  1S4B P;  4MZW A;  5J41 A;  2VD0 A;  5ECM B;  5ECO B;  1PX7 A;  1GTB A;  2C8U A;  2CVD A;  2YV9 A;  3IK9 A;  3M1G A;  3RGB C;  6GSX A;  4ECC A;  3L0H A;  5EL8 A;  1ZGN A;  1Q4J A;  3HJM A;  2AAW A;  4JBB A;  4ECB A;  5B7C A;  3HJO A;  4OMV A;  3RFR C;  1VF1 A;  3M8N A;  1YDK A;  3UBL A;  2DSA A;  3GTU A;  3TU3 B;  1GNW A;  5FT3 A;  1LBK A;  2VCT A;  1TW9 A;  1XWG A;  5F05 A;  3I69 A;  2WB9 A;  4ECJ A;  1SVO A;  4HI7 A;  4IEL A;  2WZS A;  1AQX A;  2YV7 A;  1RK4 A;  2HRK A;  1YEW C;  4LMW A;  1GTI A;  1A0F A;  1JZR A;  5KEJ A;  2OT3 A;  3QAV A;  2PMT A;  5LD0 A;  5J47 A;  4YAP A;  4HZ4 A;  1PKZ A;  4W66 A;  2VKZ G;  3F6D A;  1IYH A;  3QAW A;  1C72 A;  5JCU A;  2GTU A;  5AIV A;  4G19 A;  1GLQ A;  5DDL A;  1M9A A;  2F8F A; 
#chains in the Genus database with same CATH homology
 1BX9 A;  2C4J A;  3U6V A;  4G9H A;  4N0V A;  4OFM A;  1NHY A;  5BMU A;  3IR4 A;  6GSU A;  1GLP A;  4MF5 A;  4KGI A;  3QR6 A;  4G10 A;  4N3Z A;  2EFE A;  3CRT A;  4IBP A;  1OE8 A;  2C3Q A;  4PQI A;  4PUR A;  5ECH B;  3UAR A;  3UVH A;  1JLV A;  5DQS A;  2WDU A;  1OKT A;  3VK9 A;  3FR3 A;  3VLN A;  4RI7 A;  4TOP A;  5DJL A;  5DJM A;  2GLR A;  2FNO A;  3O3T A;  1ML6 A;  3LXT A;  4USS A;  2CA8 A;  1PL1 A;  4YQU A;  1TXU A;  4GCI A;  4GDF A;  4KAE A;  1K0N A;  1K0B A;  4E8H A;  2GDR A;  1GSE A;  1MTC A;  4YAV A;  1IYI A;  3DD3 A;  2VCZ A;  4GSS A;  4L5O A;  4LMV A;  1YJ6 A;  1N2A A;  4NHZ A;  3I6A A;  2CAQ A;  5ECR B;  5DAL A;  1F3A A;  4F0B A;  3LYK A;  3H1N A;  4KF9 A;  1GUK A;  5AN1 A;  5FHI A;  2EFC A;  1XW5 A;  4HOJ A;  4IQA A;  4KX4 A;  1GTA A;  4G0L A;  2D2Z A;  3FRC A;  1AW9 A;  3P90 A;  4ZB6 A;  2O5V A;  4ZBA A;  3N5O A;  5A5H B;  4WR4 A;  1K0M A;  6GSS A;  1AXD A;  3P8W A;  4G01 A;  22GS A;  3ZMK A;  1EEM A;  4ZBD A;  4WR5 A;  3WD6 A;  4BL7 A;  4PXO A;  4HJ2 A;  2CZ2 A;  3MAK A;  3VWX A;  4KDU A;  5A1N B;  3GUS A;  5A1N A;  5IQY A;  2VD1 A;  2OAC A;  4L8E A;  3WYW A;  5HFK A;  1M9B A;  1DUG A;  2VCW A;  1PD2 1;  4IKH A;  1YQ1 A;  1EOH A;  5F06 A;  5DCG A;  1MD4 A;  4O7H A;  2IMK A;  5D9W A;  3LSZ A;  2PER A;  1GTU A;  4I97 A;  3LXZ A;  4ZB7 A;  3IC8 A;  1GSS A;  3GST A;  3GSS A;  4PX1 A;  19GS A;  5EY6 A;  1KBN A;  1B8X A;  4IS0 A;  5ECL B;  1EV9 A;  1GWC A;  3LQ7 A;  2HNL A;  1UA5 A;  4GST A;  4F03 A;  3M0F A;  1V40 A;  4Q5F A;  5EVO A;  4KSM A;  1Y1U A;  5DAK B;  4EC0 A;  2OAD A;  4IW9 A;  4KDY A;  3MDK A;  4ZB8 A;  4DEJ A;  5A4W A;  3LJR A;  4OFT A;  2WJU A;  1BG1 A;  5ECK B;  3VPQ A;  3UBK A;  5GZZ B;  6GSY A;  2X64 A;  4JZQ A;  3RBT A;  2HQT A;  5J40 A;  2DC5 A;  4AKH A;  4PNG A;  2GSR A;  2VCX A;  3HMJ G;  3ERG A;  2VCQ A;  2C80 A;  2VO4 A;  4Q5R A;  1AQV A;  4ECI A;  3FR9 A;  4GSN A;  1TU7 A;  1PGT A;  2A2R A;  3IBH A;  1YKC A;  1FHE A;  3DGQ A;  4NAX A;  1HNB A;  2UZ8 A;  4AGS A;  2IL3 A;  4K0N A;  2JL4 A;  16GS A;  4PQH A;  5ELA A;  2V6K A;  1G6Y A;  2OA7 A;  1M0U A;  4GF0 A;  3FY7 A;  13GS A;  4GLT A;  4MDC A;  2GSQ A;  2HRA A;  2ON7 A;  1U88 A;  1USB A;  3BBY A;  3KTL A;  5D9V A;  2AHE A;  4QQ7 A;  1PN9 A;  4MF6 A;  1JLW A;  3F63 A;  4AKX B;  4YH2 A;  4KDX A;  5ECI B;  2GST A;  2HSN B;  3VI5 A;  2NTO A;  3GUR A;  2HSN A;  1OE7 A;  4YQV A;  2CZ3 A;  4QMK A;  5J4Y A;  3KXO A;  4OFN A;  1YVL A;  4IJI A;  1PKW A;  4JED A;  2WS2 A;  4F0C A;  1B4P A;  3ERF A;  2R3X A;  5D9X A;  2PGT A;  4BVY B;  4EXJ A;  1B48 A;  1PX6 A;  3HKR A;  4KH7 A;  5A5H A;  3CBU A;  3KMO A;  2HSM B;  1U87 A;  3Q74 A;  1FW1 A;  4MF7 A;  5G5F A;  2ON5 A;  1V2A A;  4KE3 A;  4EDY A;  6GSW A;  2EFH A;  5AIX A;  4EDZ A;  1XWK A;  3LG6 A;  3VPT A;  2FHE A;  1K0C A;  1PMT A;  3UAP A;  1G7O A;  1SVL A;  14GS A;  5ECN B;  9GSS A;  4ACS A;  2J9H A;  2R5G A;  3F6F A;  1BAY A;  3CSH A;  5GSS A;  1F2E A;  2GSS A;  3LYP A;  4RI6 A;  20GS A;  3PPU A;  4Q5N A;  1YY7 A;  3FYG A;  4J2F A;  1K3Y A;  4BVX B;  3IK7 A;  1GSF A;  5AIS A;  2PVQ A;  4PNF A;  5ELG A;  3SWL A;  1TU8 A;  1E6B A;  2WRT A;  3KM6 A;  4MP4 A;  1HQO A;  3TOT A;  3KMN A;  1VF3 A;  1OYJ A;  4HZ2 A;  4E68 A;  4FQU A;  4O92 A;  4ZXG A;  1N25 A;  3EE2 A;  4YQM A;  1AQW A;  5DAK A;  4PUA A;  3R2Q A;  1GSU A;  5F0G A;  1GSY A;  4MK3 A;  3M3M A;  1EOG A;  2CAI A;  3GTU B;  4G0K A;  3ZFL A;  3CRU A;  2HRK B;  4ISD A;  18GS A;  2F3M A;  17GS A;  4AKG A;  4K0G A;  5J4V A;  3Q18 A;  5FWG A;  3CSI A;  5J4U A;  1BYE A;  12GS A;  3TOU A;  3VUR A;  3EIN A;  3G7I A;  1ZL9 A;  3CWG A;  5AGY A;  4E8E A;  2R6K A;  5A34 B;  4AKI A;  4NHW A;  5A34 A;  1SVM A;  2VCV A;  10GS A;  5G5E A;  4EE0 A;  1K0A A;  1M99 A;  5BMU B;  5A4U A;  4CHS A;  5GST A;  1R5A A;  2C3N A;  4ZBB A;  6GST A;  3PR8 A;  1BG5 A;  3ZML A;  1Y6E A;  2R4V A;  1GUH A;  3KJY A;  4PGT A;  5JCW A;  1PA3 A;  1GSQ A;  3IE3 A;  4AI6 A;  7GSS A;  2AB6 A;  3C8E A;  2N5F A;  2YCD A;  1PL2 A;  1K0O A;  2H1L A;  5ECQ B;  1VF2 A;  1BF5 A;  2PBJ A;  4ID0 A;  5A4V A;  3FR6 A;  1GNE A;  3O76 A;  4MPG A;  5ECP B;  1HNC A;  4PTS A;  5F8B A;  2C3T A;  1HNA A;  3N9J A;  3VI7 A;  4ZB9 A;  5F07 A;  3QAG A;  4IVF A;  3Q19 A;  1EV4 A;  11GS A;  4BVY A;  1GSD A;  4GTU A;  4L5L A;  3PGT A;  5DAL B;  2HSM A;  4IQ1 A;  1GUM A;  3ZFB A;  3GX0 A;  4G0I A;  3TGZ A;  1F3B A;  1GUL A;  2LJR A;  3ISO A;  6GSV A;  1Z9H A;  2A2S A;  3G7J A;  1U3I A;  5J5N A;  1G6W A;  4MPF A;  1MD3 A;  5A5K A;  1K3O A;  5LCZ A;  3D0Z A;  5D73 A;  3CSJ A;  3W8S A;  3AY8 A;  8GSS A;  5D9T A;  4BL7 B;  3GH6 A;  1LJR A;  3LFL A;  4Q5Q A;  1XW6 A;  3R3E A;  1TDI A;  3NIV A;  2IMI A;  1K0D A;  4BVX A;  1K3L A;  5ECS A;  2EFD A;  2UV8 G;  1VF4 A;  4IGJ A;  4MZW A;  5J41 A;  2VD0 A;  5ECM B;  5ECO B;  1PX7 A;  1GTB A;  2C8U A;  2CVD A;  2YV9 A;  3IK9 A;  3M1G A;  6GSX A;  4ECC A;  3L0H A;  5EL8 A;  1ZGN A;  1Q4J A;  3HJM A;  2AAW A;  4JBB A;  4ECB A;  5B7C A;  3HJO A;  4OMV A;  1VF1 A;  3M8N A;  1YDK A;  3UBL A;  2DSA A;  3GTU A;  3TU3 B;  1GNW A;  5FT3 A;  1LBK A;  2VCT A;  1TW9 A;  1XWG A;  5F05 A;  3I69 A;  2WB9 A;  4ECJ A;  1SVO A;  4HI7 A;  4IEL A;  1AQX A;  1RK4 A;  2HRK A;  2YV7 A;  4LMW A;  1GTI A;  1A0F A;  1JZR A;  5KEJ A;  2OT3 A;  3QAV A;  2PMT A;  5LD0 A;  5J47 A;  4YAP A;  4HZ4 A;  1PKZ A;  4W66 A;  2VKZ G;  3F6D A;  1IYH A;  3QAW A;  1C72 A;  5JCU A;  2GTU A;  5AIV A;  4G19 A;  1GLQ A;  5DDL A;  1M9A A;  2F8F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...