5A34B

The crystal structure of the gst-like domains complex of eprs-aimp2
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
214
structure length
204
Chain Sequence
b'DLNSVLGKDYGALKDIVINANPASPPLSLLVLHRLLCEHFRVLSTVHTHSSVKSVPENLLKCFGRQDYQLGFTLIWKNVPKTQMKFSIQTMCPIEGEGNIARFLFSLFGQKHNAVNATLIDSWVDIAIFQLKEGSSKEKAAVFRSMNSALGKSPWLAGNELTVADVVLWSVLQQISVTVPANVQRWMRSCENLAPFNTALKLLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BIFUNCTIONAL GLUTAMATE/PROLINE--TRNA LIGASE
publication title Assembly of Multi-tRNA Synthetase Complex Via Heterotetrameric Glutathione Transferase-Homology Domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 57
structure length 204
sequence length 214
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2015-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00043 GST_C Glutathione S-transferase, C-terminal domain
B PF18569 Thioredoxin_16 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.130 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5a34B00
5A1NA 5A34B 4AKGA 5A5HA 5BMUB 4AKHA 5A1NB 5A5HB 4ZB7A 4AI6A 4W66A 4AKIA 5A34A
chains in the Genus database with same CATH superfamily
5A4VA 1BG5A 4GSNA 4IBPA 5ECSA 1LJRA 4KAEA 4PTSA 3M8NA 4KX4A 3GSSA 1XW5A 4KSMA 4HOJA 3GX0A 4GCIA 2F8FA 2WW0A 3QAGA 3FY7A 3IK9A 1JLWA 4IKHA 4BVXB 4O92A 5DCGA 6GSSA 1V40A 3FYGA 2WVXB 5A4UA 5F05A 2GSSA 2GLRA 5J4VA 2UZ8A 1GSQA 2F3MA 3GTUA 3LYKA 4L5LA 2R3XA 5ECOB 5ELGA 3ZMLA 3KM6A 5J4UA 6GSVA 1PL1A 3UBKA 1GSFA 2HSMB 5D9TA 3MDKA 1TU8A 1YKCA 2HSNA 4ECJA 1OE8A 1G6WA 3MAKA 3UAPA 1EEMA 4BL7A 4KDXA 3ERGA 5F06A 2VCQA 4BVYA 2VO4A 4F0CA 5J4YA 1LBKA 4AKHA 3IK7A 3P90A 1GUHA 2WW3A 3KXOA 4WR4A 5AIXA 4N0VA 3TOTA 1K0DA 4NAXA 3HJMA 4QQ7A 1GLPA 3Q18A 2PGTA 5AN1A 5J41A 4HZ2A 4EDYA 5KEJA 2A2SA 3LG6A 4LMWA 1EV9A 1I1IP 4ZXGA 2OADA 5DJLA 1Y1UA 1PD21 19GSA 5DALA 6GSUA 1BX9A 4G0LA 3ZFBA 3AY8A 1GUMA 1B8XA 2C3QA 4EDZA 5DQSA 4YQVA 3R3EA 1VF3A 2O3EA 3ISOA 2AB6A 2EFDA 5A1NB 4PNFA 5EVOA 1N25A 1F3AA 2N5FA 4J2FA 4N3ZA 10GSA 1GWCA 2R4VA 5A34B 4EE0A 2GDRA 2AAWA 2PVQA 3GSTA 5A5HB 1GTUA 3PPUA 3GH6A 8GSSA 4JBBA 4GF0A 3U6VA 4RI6A 4MPGA 1PKWA 4GSTA 1FHEA 1MD4A 2HRAA 3FR9A 4ID0A 4IJIA 1OE7A 4IELA 4AGSA 3WD6A 1DUGA 3KJYA 2WDUA 3GUSA 4Q5RA 3IR4A 4GTUA 4NHZA 1UA5A 2CAQA 5D9VA 4E68A 3UBLA 4PQIA 3DD3A 1U3IA 4PX1A 3VK9A 4F0BA 2PBJA 9GSSA 1GSSA 4PUAA 2HRKA 4KE3A 3SWLA 2DSAA 2PMTA 7GSSA 5B7CA 1M0UA 1K3LA 3L0HA 1SVLA 14GSA 5EL8A 1YY7A 3LXZA 4KGIA 4GSSA 5BMUB 2WVXA 1GSDA 5FWGA 5AGYA 3VLNA 1PX7A 1KBNA 4QMKA 3DGQA 18GSA 1K0NA 2VKZG 3FR6A 4DEJA 6GSYA 4PI0C 4IW9A 2C4JA 2YV7A 5D73A 4E8HA 2WZSA 3BBYA 3F6DA 2CAIA 4PQHA 4ZB9A 4OMVA 5ECRB 17GSA 3CSIA 4ZBDA 1IYHA 2GSTA 3VI7A 1VF1A 4PXOA 2CZ2A 3LSZA 1NHYA 1YEWC 4PNGA 4G0IA 4AKGA 3TOUA 2C8UA 3CSJA 5FHIA 1K0AA 16GSA 1PMTA 2R5GA 1Y6EA 1RK4A 1BYEA 1A0FA 4PHZC 4F03A 4ZB8A 2LJRA 2PERA 1AXDA 4YQMA 6GSWA 2VCZA 1M9AA 4AI6A 4Q5NA 3CRUA 4YAPA 4YQUA 4W66A 5LD0A 4KF9A 2D2ZA 4BL7B 3EINA 2GSQA 2HQTA 4BVYB 1TW9A 3LFLA 5ECMB 3QAVA 3M3MA 1YDKA 2WW1A 5G5EA 5G5FA 5GZZB 4TOPA 4ACSA 4G0KA 3NIVA 4ISDA 4KDUA 5FT3A 5GSTA 4EXJA 4MP4A 4KDYA 2C3NA 1HQOA 2NTOA 3G7JA 1PGTA 5A1NA 4L8EA 3Q19A 4FQUA 4ECCA 1K0CA 3FR3A 3R2QA 4MF7A 2WS2A 4AKXB 4PI2C 5A5HA 1JZRA 1TU7A 2C3TA 2WVZA 3Q74A 4RI7A 2WVYA 5D9WA 4OFTA 1BAYA 3VI5A 1VF4A 2IMIA 1GTIA 2J9HA 1K0BA 3ZMKA 4EC0A 1YVLA 2EFCA 3P8WA 4K0GA 3ZFLA 1C72A 3F63A 1AQXA 1HNCA 1S4BP 5ECLB 1ZL9A 4IS0A 5DAKA 5ECQB 2OA7A 2DC5A 4ZBAA 3LXTA 4E8EA 2O5VA 4L5OA 2X64A 1BG1A 5IQYA 1FW1A 4JEDA 2EFEA 5JCWA 3F6FA 4FXYP 1U88A 3WYWA 2CA8A 2C80A 3HJOA 1USBA 4HZ4A 6GSXA 4G19A 3I6AA 13GSA 1MD3A 3O3TA 2R6KA 2CZ3A 3CRTA 5ECPB 2A2RA 5LCZA 4BVXA 1B48A 3PGTA 3VURA 3HKRA 3C8EA 3N5OA 3ERFA 1K0MA 2FHEA 1F3BA 2IMKA 4NHWA 3D0ZA 1B4PA 2ON5A 4MF5A 4AKIA 2HNLA 4MZWA 1YJ6A 1TDIA 2HRKB 1AQWA 4JZQA 1AW9A 1PA3A 5F0GA 1ML6A 3FRCA 2HSMA 3QAWA 2VCWA 1OYJA 2WRTA 3RBTA 2V6KA 3CBUA 4CHSA 4OFNA 1Z9HA 1GNWA 4GDFA 1GNEA 4G9HA 2WJUA 1M99A 1XW6A 5J40A 2IL3A 4ECIA 3LJRA 2VCXA 1GSUA 5A4WA 4LMVA 5ELAA 3IE3A 3GTUB 4YH2A 1Q4JA 1HNAA 3VPTA 5ECKB 1AQVA 1SVOA 1PL2A 3QR6A 3LQ7A 1GULA 3VWXA 4IQ1A 2GTUA 4MDCA 2O36A 3G7IA 5AISA 2WW2A 1OKTA 4O7HA 3N9JA 2HSNB 1XWGA 1EV4A 5A5KA 1N2AA 5ECNB 3IBHA 2OACA 1JLVA 3PR8A 3O76A 4KH7A 1IYIA 12GSA 4WR5A 1K3OA 2H1LA 1VF2A 1SVMA 1EOHA 1GTBA 3CWGA 2YCDA 3TGZA 2YV9A 1HNBA 4ECBA 11GSA 4MK3A 1MTCA 2CVDA 1GTAA 2VD1A 3UVHA 4OFMA 5A34A 3EE2A 5JCUA 4G01A 1GSEA 3M1GA 1BF5A 2GSRA 4I97A 1PX6A 4HJ2A 3RFRC 1EOGA 2ON7A 3H1NA 3VPQA 3GURA 4ZB6A 4MF6A 5ECIB 20GSA 5HFKA 5DALB 1G6YA 2WB9A 2EFHA 4K0NA 3LYPA 6GSTA 4Q5QA 1M9BA 1GLQA 4ZBBA 3TU3B 4PGTA 2VCVA 1GUKA 3W8SA 5F07A 3CHXC 5ECHB 1E6BA 1U87A 1F2EA 1G7OA 3KMNA 1V2AA 4GLTA 4YAVA 3CSHA 4IGJA 2JL4A 4G10A 2FNOA 1XWKA 5DJMA 3UARA 4USSA 5J5NA 3I69A 5J47A 5AIVA 1K0OA 4Q5FA 2UV8G 2OT3A 5DDLA 1K3YA 1GSYA 2VCTA 4IQAA 5D9XA 2VD0A 3RGBC 4IVFA 4ZB7A 1PN9A 2AHEA 3KTLA 5BMUA 5DAKB 5GSSA 3IC8A 1ZGNA 4HI7A 3KMOA 1YQ1A 3M0FA 4MPFA 5EY6A 1R5AA 1TXUA 22GSA 4PURA 5F8BA 3HMJG 1PKZA
chains in the Genus database with same CATH topology
5A4VA 1BG5A 4GSNA 4IBPA 5ECSA 1LJRA 4KAEA 4PTSA 3M8NA 4KX4A 3GSSA 1XW5A 4KSMA 4HOJA 3GX0A 4GCIA 2F8FA 3QAGA 3FY7A 3IK9A 1JLWA 4IKHA 4BVXB 4O92A 5DCGA 6GSSA 1V40A 3FYGA 5A4UA 5F05A 2GSSA 2GLRA 5J4VA 2UZ8A 1GSQA 2F3MA 3GTUA 3LYKA 4L5LA 2R3XA 5ECOB 5ELGA 3ZMLA 3KM6A 5J4UA 6GSVA 1PL1A 3UBKA 1GSFA 2HSMB 5D9TA 3MDKA 1TU8A 1YKCA 2HSNA 4ECJA 1OE8A 1G6WA 3MAKA 3UAPA 1EEMA 4BL7A 4KDXA 3ERGA 5F06A 2VCQA 4BVYA 2VO4A 4F0CA 5J4YA 1LBKA 4AKHA 3IK7A 3P90A 1GUHA 3KXOA 4WR4A 5AIXA 4N0VA 3TOTA 1K0DA 4NAXA 3HJMA 4QQ7A 1GLPA 3Q18A 2PGTA 5AN1A 5J41A 4HZ2A 4EDYA 5KEJA 2A2SA 3LG6A 4LMWA 1EV9A 4ZXGA 2OADA 5DJLA 1Y1UA 1PD21 19GSA 5DALA 6GSUA 1BX9A 4G0LA 3ZFBA 3AY8A 1GUMA 1B8XA 2C3QA 4EDZA 5DQSA 4YQVA 3R3EA 1VF3A 3ISOA 2AB6A 2EFDA 5A1NB 4PNFA 5EVOA 1N25A 1F3AA 2N5FA 4J2FA 4N3ZA 10GSA 1GWCA 2R4VA 5A34B 4EE0A 2GDRA 2AAWA 2PVQA 3GSTA 5A5HB 1GTUA 3PPUA 3GH6A 8GSSA 4JBBA 4GF0A 3U6VA 4RI6A 4MPGA 1PKWA 4GSTA 1FHEA 1MD4A 2HRAA 3FR9A 4ID0A 4IJIA 1OE7A 4IELA 4AGSA 3WD6A 1DUGA 3KJYA 2WDUA 3GUSA 4Q5RA 3IR4A 4GTUA 4NHZA 1UA5A 2CAQA 5D9VA 4E68A 3UBLA 4PQIA 3DD3A 1U3IA 4PX1A 3VK9A 4F0BA 2PBJA 9GSSA 1GSSA 4PUAA 2HRKA 4KE3A 3SWLA 2DSAA 2PMTA 7GSSA 5B7CA 1M0UA 1K3LA 3L0HA 1SVLA 14GSA 5EL8A 1YY7A 3LXZA 4KGIA 4GSSA 5BMUB 1GSDA 5FWGA 5AGYA 3VLNA 1PX7A 1KBNA 4QMKA 3DGQA 18GSA 1K0NA 2VKZG 3FR6A 4DEJA 6GSYA 4IW9A 2C4JA 2YV7A 5D73A 4E8HA 3BBYA 3F6DA 2CAIA 4PQHA 4ZB9A 4OMVA 5ECRB 17GSA 3CSIA 4ZBDA 1IYHA 2GSTA 3VI7A 1VF1A 4PXOA 2CZ2A 3LSZA 1NHYA 4AKGA 4PNGA 4G0IA 3TOUA 2C8UA 3CSJA 5FHIA 1K0AA 16GSA 1PMTA 2R5GA 1Y6EA 1RK4A 1BYEA 1A0FA 4F03A 4ZB8A 2LJRA 2PERA 1AXDA 4YQMA 6GSWA 2VCZA 1M9AA 4AI6A 4Q5NA 3CRUA 4YAPA 4YQUA 4W66A 5LD0A 4KF9A 2D2ZA 4BL7B 3EINA 2GSQA 2HQTA 4BVYB 1TW9A 3LFLA 5ECMB 3QAVA 3M3MA 1YDKA 5G5EA 5G5FA 5GZZB 4TOPA 4ACSA 4G0KA 3NIVA 4ISDA 4KDUA 5FT3A 5GSTA 4EXJA 4MP4A 4KDYA 2C3NA 1HQOA 2NTOA 3G7JA 1PGTA 5A1NA 4L8EA 3Q19A 4FQUA 4ECCA 1K0CA 3FR3A 3R2QA 4MF7A 2WS2A 4AKXB 5A5HA 1JZRA 1TU7A 2C3TA 3Q74A 4RI7A 5D9WA 4OFTA 1BAYA 3VI5A 1VF4A 2IMIA 1GTIA 2J9HA 1K0BA 3ZMKA 4EC0A 1YVLA 2EFCA 3P8WA 4K0GA 3ZFLA 1C72A 3F63A 1AQXA 1HNCA 5ECLB 1ZL9A 4IS0A 5DAKA 5ECQB 2OA7A 2DC5A 4ZBAA 3LXTA 4E8EA 2O5VA 4L5OA 2X64A 1BG1A 5IQYA 1FW1A 4JEDA 2EFEA 5JCWA 3F6FA 1U88A 3WYWA 2CA8A 2C80A 3HJOA 1USBA 4HZ4A 6GSXA 4G19A 3I6AA 13GSA 1MD3A 3O3TA 2R6KA 2CZ3A 3CRTA 5ECPB 2A2RA 5LCZA 4BVXA 1B48A 3PGTA 3VURA 3HKRA 3C8EA 3N5OA 3ERFA 1K0MA 2FHEA 1F3BA 2IMKA 4NHWA 3D0ZA 1B4PA 2ON5A 4MF5A 4AKIA 2HNLA 4MZWA 1YJ6A 1TDIA 2HRKB 1AQWA 4JZQA 1AW9A 1PA3A 5F0GA 1ML6A 3FRCA 2HSMA 3QAWA 2VCWA 1OYJA 2WRTA 3RBTA 2V6KA 3CBUA 4CHSA 4OFNA 1Z9HA 1GNWA 4GDFA 1GNEA 4G9HA 2WJUA 1M99A 1XW6A 5J40A 2IL3A 4ECIA 3LJRA 2VCXA 1GSUA 5A4WA 4LMVA 5ELAA 3IE3A 3GTUB 4YH2A 1Q4JA 1HNAA 3VPTA 5ECKB 1AQVA 1SVOA 1PL2A 3QR6A 3LQ7A 1GULA 3VWXA 4IQ1A 2GTUA 4MDCA 3G7IA 5AISA 1OKTA 4O7HA 3N9JA 2HSNB 1XWGA 1EV4A 5A5KA 1N2AA 5ECNB 3IBHA 2OACA 1JLVA 3PR8A 3O76A 4KH7A 1IYIA 12GSA 4WR5A 1K3OA 2H1LA 1VF2A 1SVMA 1EOHA 1GTBA 3CWGA 2YCDA 3TGZA 2YV9A 1HNBA 4ECBA 11GSA 4MK3A 1MTCA 2CVDA 1GTAA 2VD1A 3UVHA 4OFMA 5A34A 3EE2A 5JCUA 4G01A 1GSEA 3M1GA 1BF5A 2GSRA 4I97A 1PX6A 4HJ2A 1EOGA 2ON7A 3H1NA 3VPQA 3GURA 4ZB6A 4MF6A 5ECIB 20GSA 5HFKA 5DALB 1G6YA 2WB9A 2EFHA 4K0NA 3LYPA 6GSTA 4Q5QA 1M9BA 1GLQA 4ZBBA 3TU3B 4PGTA 2VCVA 1GUKA 3W8SA 5F07A 5ECHB 1E6BA 1U87A 1F2EA 1G7OA 3KMNA 1V2AA 4GLTA 4YAVA 3CSHA 4IGJA 2JL4A 4G10A 2FNOA 1XWKA 5DJMA 3UARA 4USSA 5J5NA 3I69A 5J47A 5AIVA 1K0OA 4Q5FA 2UV8G 2OT3A 5DDLA 1K3YA 1GSYA 2VCTA 4IQAA 5D9XA 2VD0A 4IVFA 4ZB7A 1PN9A 2AHEA 3KTLA 5BMUA 5DAKB 5GSSA 3IC8A 1ZGNA 4HI7A 3KMOA 1YQ1A 3M0FA 4MPFA 5EY6A 1R5AA 1TXUA 22GSA 4PURA 5F8BA 3HMJG 1PKZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A1N A;  5A34 B;  4AKG A;  5A5H A;  5BMU B;  4AKH A;  5A1N B;  5A5H B;  4ZB7 A;  4AI6 A;  4W66 A;  4AKI A;  5A34 A; 
#chains in the Genus database with same CATH topology
 5A4V A;  1BG5 A;  4GSN A;  4IBP A;  5ECS A;  1LJR A;  4KAE A;  4PTS A;  3M8N A;  4KX4 A;  3GSS A;  1XW5 A;  4KSM A;  4HOJ A;  3GX0 A;  4GCI A;  2F8F A;  2WW0 A;  3QAG A;  3FY7 A;  3IK9 A;  1JLW A;  4IKH A;  4BVX B;  4O92 A;  5DCG A;  6GSS A;  1V40 A;  3FYG A;  2WVX B;  5A4U A;  5F05 A;  2GSS A;  2GLR A;  5J4V A;  2UZ8 A;  1GSQ A;  2F3M A;  3GTU A;  3LYK A;  4L5L A;  2R3X A;  5ECO B;  5ELG A;  3ZML A;  3KM6 A;  5J4U A;  6GSV A;  1PL1 A;  3UBK A;  1GSF A;  2HSM B;  5D9T A;  3MDK A;  1TU8 A;  1YKC A;  2HSN A;  4ECJ A;  1OE8 A;  1G6W A;  3MAK A;  3UAP A;  1EEM A;  4BL7 A;  4KDX A;  3ERG A;  5F06 A;  2VCQ A;  4BVY A;  2VO4 A;  4F0C A;  5J4Y A;  1LBK A;  4AKH A;  3IK7 A;  3P90 A;  1GUH A;  2WW3 A;  3KXO A;  4WR4 A;  5AIX A;  4N0V A;  3TOT A;  1K0D A;  4NAX A;  3HJM A;  4QQ7 A;  1GLP A;  3Q18 A;  2PGT A;  5AN1 A;  5J41 A;  4HZ2 A;  4EDY A;  5KEJ A;  2A2S A;  3LG6 A;  4LMW A;  1EV9 A;  1I1I P;  4ZXG A;  2OAD A;  5DJL A;  1Y1U A;  1PD2 1;  19GS A;  5DAL A;  6GSU A;  1BX9 A;  4G0L A;  3ZFB A;  3AY8 A;  1GUM A;  1B8X A;  2C3Q A;  4EDZ A;  5DQS A;  4YQV A;  3R3E A;  1VF3 A;  2O3E A;  3ISO A;  2AB6 A;  2EFD A;  5A1N B;  4PNF A;  5EVO A;  1N25 A;  1F3A A;  2N5F A;  4J2F A;  4N3Z A;  10GS A;  1GWC A;  2R4V A;  5A34 B;  4EE0 A;  2GDR A;  2AAW A;  2PVQ A;  3GST A;  5A5H B;  1GTU A;  3PPU A;  3GH6 A;  8GSS A;  4JBB A;  4GF0 A;  3U6V A;  4RI6 A;  4MPG A;  1PKW A;  4GST A;  1FHE A;  1MD4 A;  2HRA A;  3FR9 A;  4ID0 A;  4IJI A;  1OE7 A;  4IEL A;  4AGS A;  3WD6 A;  1DUG A;  3KJY A;  2WDU A;  3GUS A;  4Q5R A;  3IR4 A;  4GTU A;  4NHZ A;  1UA5 A;  2CAQ A;  5D9V A;  4E68 A;  3UBL A;  4PQI A;  3DD3 A;  1U3I A;  4PX1 A;  3VK9 A;  4F0B A;  2PBJ A;  9GSS A;  1GSS A;  4PUA A;  2HRK A;  4KE3 A;  3SWL A;  2DSA A;  2PMT A;  7GSS A;  5B7C A;  1M0U A;  1K3L A;  3L0H A;  1SVL A;  14GS A;  5EL8 A;  1YY7 A;  3LXZ A;  4KGI A;  4GSS A;  5BMU B;  2WVX A;  1GSD A;  5FWG A;  5AGY A;  3VLN A;  1PX7 A;  1KBN A;  4QMK A;  3DGQ A;  18GS A;  1K0N A;  2VKZ G;  3FR6 A;  4DEJ A;  6GSY A;  4PI0 C;  4IW9 A;  2C4J A;  2YV7 A;  5D73 A;  4E8H A;  2WZS A;  3BBY A;  3F6D A;  2CAI A;  4PQH A;  4ZB9 A;  4OMV A;  5ECR B;  17GS A;  3CSI A;  4ZBD A;  1IYH A;  2GST A;  3VI7 A;  1VF1 A;  4PXO A;  2CZ2 A;  3LSZ A;  1NHY A;  1YEW C;  4PNG A;  4G0I A;  4AKG A;  3TOU A;  2C8U A;  3CSJ A;  5FHI A;  1K0A A;  16GS A;  1PMT A;  2R5G A;  1Y6E A;  1RK4 A;  1BYE A;  1A0F A;  4PHZ C;  4F03 A;  4ZB8 A;  2LJR A;  2PER A;  1AXD A;  4YQM A;  6GSW A;  2VCZ A;  1M9A A;  4AI6 A;  4Q5N A;  3CRU A;  4YAP A;  4YQU A;  4W66 A;  5LD0 A;  4KF9 A;  2D2Z A;  4BL7 B;  3EIN A;  2GSQ A;  2HQT A;  4BVY B;  1TW9 A;  3LFL A;  5ECM B;  3QAV A;  3M3M A;  1YDK A;  2WW1 A;  5G5E A;  5G5F A;  5GZZ B;  4TOP A;  4ACS A;  4G0K A;  3NIV A;  4ISD A;  4KDU A;  5FT3 A;  5GST A;  4EXJ A;  4MP4 A;  4KDY A;  2C3N A;  1HQO A;  2NTO A;  3G7J A;  1PGT A;  5A1N A;  4L8E A;  3Q19 A;  4FQU A;  4ECC A;  1K0C A;  3FR3 A;  3R2Q A;  4MF7 A;  2WS2 A;  4AKX B;  4PI2 C;  5A5H A;  1JZR A;  1TU7 A;  2C3T A;  2WVZ A;  3Q74 A;  4RI7 A;  2WVY A;  5D9W A;  4OFT A;  1BAY A;  3VI5 A;  1VF4 A;  2IMI A;  1GTI A;  2J9H A;  1K0B A;  3ZMK A;  4EC0 A;  1YVL A;  2EFC A;  3P8W A;  4K0G A;  3ZFL A;  1C72 A;  3F63 A;  1AQX A;  1HNC A;  1S4B P;  5ECL B;  1ZL9 A;  4IS0 A;  5DAK A;  5ECQ B;  2OA7 A;  2DC5 A;  4ZBA A;  3LXT A;  4E8E A;  2O5V A;  4L5O A;  2X64 A;  1BG1 A;  5IQY A;  1FW1 A;  4JED A;  2EFE A;  5JCW A;  3F6F A;  4FXY P;  1U88 A;  3WYW A;  2CA8 A;  2C80 A;  3HJO A;  1USB A;  4HZ4 A;  6GSX A;  4G19 A;  3I6A A;  13GS A;  1MD3 A;  3O3T A;  2R6K A;  2CZ3 A;  3CRT A;  5ECP B;  2A2R A;  5LCZ A;  4BVX A;  1B48 A;  3PGT A;  3VUR A;  3HKR A;  3C8E A;  3N5O A;  3ERF A;  1K0M A;  2FHE A;  1F3B A;  2IMK A;  4NHW A;  3D0Z A;  1B4P A;  2ON5 A;  4MF5 A;  4AKI A;  2HNL A;  4MZW A;  1YJ6 A;  1TDI A;  2HRK B;  1AQW A;  4JZQ A;  1AW9 A;  1PA3 A;  5F0G A;  1ML6 A;  3FRC A;  2HSM A;  3QAW A;  2VCW A;  1OYJ A;  2WRT A;  3RBT A;  2V6K A;  3CBU A;  4CHS A;  4OFN A;  1Z9H A;  1GNW A;  4GDF A;  1GNE A;  4G9H A;  2WJU A;  1M99 A;  1XW6 A;  5J40 A;  2IL3 A;  4ECI A;  3LJR A;  2VCX A;  1GSU A;  5A4W A;  4LMV A;  5ELA A;  3IE3 A;  3GTU B;  4YH2 A;  1Q4J A;  1HNA A;  3VPT A;  5ECK B;  1AQV A;  1SVO A;  1PL2 A;  3QR6 A;  3LQ7 A;  1GUL A;  3VWX A;  4IQ1 A;  2GTU A;  4MDC A;  2O36 A;  3G7I A;  5AIS A;  2WW2 A;  1OKT A;  4O7H A;  3N9J A;  2HSN B;  1XWG A;  1EV4 A;  5A5K A;  1N2A A;  5ECN B;  3IBH A;  2OAC A;  1JLV A;  3PR8 A;  3O76 A;  4KH7 A;  1IYI A;  12GS A;  4WR5 A;  1K3O A;  2H1L A;  1VF2 A;  1SVM A;  1EOH A;  1GTB A;  3CWG A;  2YCD A;  3TGZ A;  2YV9 A;  1HNB A;  4ECB A;  11GS A;  4MK3 A;  1MTC A;  2CVD A;  1GTA A;  2VD1 A;  3UVH A;  4OFM A;  5A34 A;  3EE2 A;  5JCU A;  4G01 A;  1GSE A;  3M1G A;  1BF5 A;  2GSR A;  4I97 A;  1PX6 A;  4HJ2 A;  3RFR C;  1EOG A;  2ON7 A;  3H1N A;  3VPQ A;  3GUR A;  4ZB6 A;  4MF6 A;  5ECI B;  20GS A;  5HFK A;  5DAL B;  1G6Y A;  2WB9 A;  2EFH A;  4K0N A;  3LYP A;  6GST A;  4Q5Q A;  1M9B A;  1GLQ A;  4ZBB A;  3TU3 B;  4PGT A;  2VCV A;  1GUK A;  3W8S A;  5F07 A;  3CHX C;  5ECH B;  1E6B A;  1U87 A;  1F2E A;  1G7O A;  3KMN A;  1V2A A;  4GLT A;  4YAV A;  3CSH A;  4IGJ A;  2JL4 A;  4G10 A;  2FNO A;  1XWK A;  5DJM A;  3UAR A;  4USS A;  5J5N A;  3I69 A;  5J47 A;  5AIV A;  1K0O A;  4Q5F A;  2UV8 G;  2OT3 A;  5DDL A;  1K3Y A;  1GSY A;  2VCT A;  4IQA A;  5D9X A;  2VD0 A;  3RGB C;  4IVF A;  4ZB7 A;  1PN9 A;  2AHE A;  3KTL A;  5BMU A;  5DAK B;  5GSS A;  3IC8 A;  1ZGN A;  4HI7 A;  3KMO A;  1YQ1 A;  3M0F A;  4MPF A;  5EY6 A;  1R5A A;  1TXU A;  22GS A;  4PUR A;  5F8B A;  3HMJ G;  1PKZ A; 
#chains in the Genus database with same CATH homology
 5A4V A;  1BG5 A;  4GSN A;  4IBP A;  5ECS A;  1LJR A;  4KAE A;  4PTS A;  3M8N A;  4KX4 A;  3GSS A;  1XW5 A;  4KSM A;  4HOJ A;  3GX0 A;  4GCI A;  2F8F A;  3QAG A;  3FY7 A;  3IK9 A;  1JLW A;  4IKH A;  4BVX B;  4O92 A;  5DCG A;  6GSS A;  1V40 A;  3FYG A;  5A4U A;  5F05 A;  2GSS A;  2GLR A;  5J4V A;  2UZ8 A;  1GSQ A;  2F3M A;  3GTU A;  3LYK A;  4L5L A;  2R3X A;  5ECO B;  5ELG A;  3ZML A;  3KM6 A;  5J4U A;  6GSV A;  1PL1 A;  3UBK A;  1GSF A;  2HSM B;  5D9T A;  3MDK A;  1TU8 A;  1YKC A;  2HSN A;  4ECJ A;  1OE8 A;  1G6W A;  3MAK A;  3UAP A;  1EEM A;  4BL7 A;  4KDX A;  3ERG A;  5F06 A;  2VCQ A;  4BVY A;  2VO4 A;  4F0C A;  5J4Y A;  1LBK A;  4AKH A;  3IK7 A;  3P90 A;  1GUH A;  3KXO A;  4WR4 A;  5AIX A;  4N0V A;  3TOT A;  1K0D A;  4NAX A;  3HJM A;  4QQ7 A;  1GLP A;  3Q18 A;  2PGT A;  5AN1 A;  5J41 A;  4HZ2 A;  4EDY A;  5KEJ A;  2A2S A;  3LG6 A;  4LMW A;  1EV9 A;  4ZXG A;  2OAD A;  5DJL A;  1Y1U A;  1PD2 1;  19GS A;  5DAL A;  6GSU A;  1BX9 A;  4G0L A;  3ZFB A;  3AY8 A;  1GUM A;  1B8X A;  2C3Q A;  4EDZ A;  5DQS A;  4YQV A;  3R3E A;  1VF3 A;  3ISO A;  2AB6 A;  2EFD A;  5A1N B;  4PNF A;  5EVO A;  1N25 A;  1F3A A;  2N5F A;  4J2F A;  4N3Z A;  10GS A;  1GWC A;  2R4V A;  5A34 B;  4EE0 A;  2GDR A;  2AAW A;  2PVQ A;  3GST A;  5A5H B;  1GTU A;  3PPU A;  3GH6 A;  8GSS A;  4JBB A;  4GF0 A;  3U6V A;  4RI6 A;  4MPG A;  1PKW A;  4GST A;  1FHE A;  1MD4 A;  2HRA A;  3FR9 A;  4ID0 A;  4IJI A;  1OE7 A;  4IEL A;  4AGS A;  3WD6 A;  1DUG A;  3KJY A;  2WDU A;  3GUS A;  4Q5R A;  3IR4 A;  4GTU A;  4NHZ A;  1UA5 A;  2CAQ A;  5D9V A;  4E68 A;  3UBL A;  4PQI A;  3DD3 A;  1U3I A;  4PX1 A;  3VK9 A;  4F0B A;  2PBJ A;  9GSS A;  1GSS A;  4PUA A;  2HRK A;  4KE3 A;  3SWL A;  2DSA A;  2PMT A;  7GSS A;  5B7C A;  1M0U A;  1K3L A;  3L0H A;  1SVL A;  14GS A;  5EL8 A;  1YY7 A;  3LXZ A;  4KGI A;  4GSS A;  5BMU B;  1GSD A;  5FWG A;  5AGY A;  3VLN A;  1PX7 A;  1KBN A;  4QMK A;  3DGQ A;  18GS A;  1K0N A;  2VKZ G;  3FR6 A;  4DEJ A;  6GSY A;  4IW9 A;  2C4J A;  2YV7 A;  5D73 A;  4E8H A;  3BBY A;  3F6D A;  2CAI A;  4PQH A;  4ZB9 A;  4OMV A;  5ECR B;  17GS A;  3CSI A;  4ZBD A;  1IYH A;  2GST A;  3VI7 A;  1VF1 A;  4PXO A;  2CZ2 A;  3LSZ A;  1NHY A;  4AKG A;  4PNG A;  4G0I A;  3TOU A;  2C8U A;  3CSJ A;  5FHI A;  1K0A A;  16GS A;  1PMT A;  2R5G A;  1Y6E A;  1RK4 A;  1BYE A;  1A0F A;  4F03 A;  4ZB8 A;  2LJR A;  2PER A;  1AXD A;  4YQM A;  6GSW A;  2VCZ A;  1M9A A;  4AI6 A;  4Q5N A;  3CRU A;  4YAP A;  4YQU A;  4W66 A;  5LD0 A;  4KF9 A;  2D2Z A;  4BL7 B;  3EIN A;  2GSQ A;  2HQT A;  4BVY B;  1TW9 A;  3LFL A;  5ECM B;  3QAV A;  3M3M A;  1YDK A;  5G5E A;  5G5F A;  5GZZ B;  4TOP A;  4ACS A;  4G0K A;  3NIV A;  4ISD A;  4KDU A;  5FT3 A;  5GST A;  4EXJ A;  4MP4 A;  4KDY A;  2C3N A;  1HQO A;  2NTO A;  3G7J A;  1PGT A;  5A1N A;  4L8E A;  3Q19 A;  4FQU A;  4ECC A;  1K0C A;  3FR3 A;  3R2Q A;  4MF7 A;  2WS2 A;  4AKX B;  5A5H A;  1JZR A;  1TU7 A;  2C3T A;  3Q74 A;  4RI7 A;  5D9W A;  4OFT A;  1BAY A;  3VI5 A;  1VF4 A;  2IMI A;  1GTI A;  2J9H A;  1K0B A;  3ZMK A;  4EC0 A;  1YVL A;  2EFC A;  3P8W A;  4K0G A;  3ZFL A;  1C72 A;  3F63 A;  1AQX A;  1HNC A;  5ECL B;  1ZL9 A;  4IS0 A;  5DAK A;  5ECQ B;  2OA7 A;  2DC5 A;  4ZBA A;  3LXT A;  4E8E A;  2O5V A;  4L5O A;  2X64 A;  1BG1 A;  5IQY A;  1FW1 A;  4JED A;  2EFE A;  5JCW A;  3F6F A;  1U88 A;  3WYW A;  2CA8 A;  2C80 A;  3HJO A;  1USB A;  4HZ4 A;  6GSX A;  4G19 A;  3I6A A;  13GS A;  1MD3 A;  3O3T A;  2R6K A;  2CZ3 A;  3CRT A;  5ECP B;  2A2R A;  5LCZ A;  4BVX A;  1B48 A;  3PGT A;  3VUR A;  3HKR A;  3C8E A;  3N5O A;  3ERF A;  1K0M A;  2FHE A;  1F3B A;  2IMK A;  4NHW A;  3D0Z A;  1B4P A;  2ON5 A;  4MF5 A;  4AKI A;  2HNL A;  4MZW A;  1YJ6 A;  1TDI A;  2HRK B;  1AQW A;  4JZQ A;  1AW9 A;  1PA3 A;  5F0G A;  1ML6 A;  3FRC A;  2HSM A;  3QAW A;  2VCW A;  1OYJ A;  2WRT A;  3RBT A;  2V6K A;  3CBU A;  4CHS A;  4OFN A;  1Z9H A;  1GNW A;  4GDF A;  1GNE A;  4G9H A;  2WJU A;  1M99 A;  1XW6 A;  5J40 A;  2IL3 A;  4ECI A;  3LJR A;  2VCX A;  1GSU A;  5A4W A;  4LMV A;  5ELA A;  3IE3 A;  3GTU B;  4YH2 A;  1Q4J A;  1HNA A;  3VPT A;  5ECK B;  1AQV A;  1SVO A;  1PL2 A;  3QR6 A;  3LQ7 A;  1GUL A;  3VWX A;  4IQ1 A;  2GTU A;  4MDC A;  3G7I A;  5AIS A;  1OKT A;  4O7H A;  3N9J A;  2HSN B;  1XWG A;  1EV4 A;  5A5K A;  1N2A A;  5ECN B;  3IBH A;  2OAC A;  1JLV A;  3PR8 A;  3O76 A;  4KH7 A;  1IYI A;  12GS A;  4WR5 A;  1K3O A;  2H1L A;  1VF2 A;  1SVM A;  1EOH A;  1GTB A;  3CWG A;  2YCD A;  3TGZ A;  2YV9 A;  1HNB A;  4ECB A;  11GS A;  4MK3 A;  1MTC A;  2CVD A;  1GTA A;  2VD1 A;  3UVH A;  4OFM A;  5A34 A;  3EE2 A;  5JCU A;  4G01 A;  1GSE A;  3M1G A;  1BF5 A;  2GSR A;  4I97 A;  1PX6 A;  4HJ2 A;  1EOG A;  2ON7 A;  3H1N A;  3VPQ A;  3GUR A;  4ZB6 A;  4MF6 A;  5ECI B;  20GS A;  5HFK A;  5DAL B;  1G6Y A;  2WB9 A;  2EFH A;  4K0N A;  3LYP A;  6GST A;  4Q5Q A;  1M9B A;  1GLQ A;  4ZBB A;  3TU3 B;  4PGT A;  2VCV A;  1GUK A;  3W8S A;  5F07 A;  5ECH B;  1E6B A;  1U87 A;  1F2E A;  1G7O A;  3KMN A;  1V2A A;  4GLT A;  4YAV A;  3CSH A;  4IGJ A;  2JL4 A;  4G10 A;  2FNO A;  1XWK A;  5DJM A;  3UAR A;  4USS A;  5J5N A;  3I69 A;  5J47 A;  5AIV A;  1K0O A;  4Q5F A;  2UV8 G;  2OT3 A;  5DDL A;  1K3Y A;  1GSY A;  2VCT A;  4IQA A;  5D9X A;  2VD0 A;  4IVF A;  4ZB7 A;  1PN9 A;  2AHE A;  3KTL A;  5BMU A;  5DAK B;  5GSS A;  3IC8 A;  1ZGN A;  4HI7 A;  3KMO A;  1YQ1 A;  3M0F A;  4MPF A;  5EY6 A;  1R5A A;  1TXU A;  22GS A;  4PUR A;  5F8B A;  3HMJ G;  1PKZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...