13GSA

Glutathione s-transferase complexed with sulfasalazine
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
210
structure length
210
Chain Sequence
b'MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE
publication title The Ligandin (Non-Substrate) Binding Site of Human Pi Class Glutathione Transferase is Located in the Electrophile Binding Site (H-Site).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 85
structure length 210
sequence length 210
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1997-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 13gsA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 13gsA01
2CZ2A 3EE2A 3NOFA 2PGTA 1F6MC 2C80A 1ERTA 3ME7A 1O85A 3LFLA 3LGCA 1X5EA 3IC4A 3F6DA 1ZZYA 4AJ7A 1F3BA 2R2JA 4QQ7A 4KDUA 2B5YA 4BWSA 2MZCA 4XTSA 3DMLA 17GSA 1A0FA 4ZB6A 1EV9A 4K7IA 2G0FA 3DWVA 2DJ3A 1GH2A 4OFNA 5B8BA 5ECMB 1SK2A 1TRWA 1SU9A 2LRCA 2LQOA 3QFBC 2XHFA 1S3DA 2GSQA 2LS5A 2E0QA 3KEBA 2CVDA 4V2NA 1O8WA 3HZ4A 4KNDA 4JEDA 3D4TA 2KUCA 2X8CA 4KA0A 2HRKB 1YEXA 1GTUA 2VCZA 2YP6A 1A23A 1YF0A 2I4AA 3TB2A 4MPFA 2FNOA 5B6NA 4TN8A 1U6TA 2K6VA 1G7OA 5COHA 3ZFLA 4MZCA 2IIYA 1GSUA 4L5LA 1UVZA 1B9XC 3GNJA 1XW9A 5G31A 3P90A 3Q74A 2FA4A 4G9HA 3CRTA 2YWMA 2AYTA 1E2YA 4XRDA 4OFMA 4KX4A 4L8EA 4GRFA 1EEMA 1T8EB 2B1LA 1THXA 3HYPA 3N5OA 2VCXA 1GRXA 4TR1A 4BL7A 2HSHA 3GX8A 4OMVA 4WF4A 2X8GA 2XPDA 2HSMB 3MDKA 1J08A 2VLUA 4MCUA 3D4MA 1PMTA 1ACVA 1PGTA 1PL2A 4ECCA 4G0IA 2RUFA 4L0UA 4TKYA 4L0WA 4TRXA 2FUG2 3BD2A 1O81A 1GL8A 4HU7A 1RK4A 4WKWA 3CSHA 3GURA 1ZYQB 5J9BA 3F4SA 1SKSB 4K8MA 4MJAA 1WJKA 1ST9A 1WPIA 1K0DA 3HD5A 2ZUPA 3RPNA 4G0KA 4O5RA 4I5QA 2PBJA 1O6JA 2C1YA 2F51A 2GT6A 5IMZA 3CTFA 1OVNA 3ZMLA 2O87A 2ALBA 1EGRA 3OR5A 2FWGA 2RLIA 1E6BA 1R5AA 6GSXA 2H6XA 2C3NA 1PX6A 5D9XA 3G7IA 4IN0A 5CAXA 1IYIA 2WRTA 5IPHA 2CZ3A 4KSMA 2K9FA 3KM6A 2V6OA 3G9BA 3I43A 2P5RA 3BBYA 3M9KA 2IWTA 4GF0A 1V58A 5CYYA 2YWNA 5DAKA 3F3RA 2LV3A 1AIUA 1ABAA 4FIWA 1YF1A 2ZCTA 1EV4A 4MF6A 2DMLA 3H1NA 5ECQB 2YANA 4O32A 3LG6A 1W89A 2N5BA 2NVLA 3DVWA 2JACA 1A2MA 4JBBA 1A8LA 3ZYWA 2DMMA 2HI7A 2GT5A 4GQFA 2DLXA 1FAAA 1TU7A 1A24A 1VF1A 2N5FA 5ID2B 2F3MA 3VURA 3HDCA 2JSYA 3C7MA 1TKDB 1F37A 1SK0A 2NDOA 3EVIA 2GSTA 4K9ZA 1YDKA 3F9UA 2P5QA 4WR5A 3D0ZA 3IR4A 5ECKB 1OC9B 4F2IA 5LNKe 4GSNA 1X9SB 1BG5A 6GSYA 4N0ZA 4MP4A 1TK5B 1A8YA 2IMIA 3AY8A 4POBA 2JSZA 1TXXA 4Q5RA 2F9SA 3IA1A 3BOAA 2HYXA 4POKA 2TIRA 4NV2A 3QR6A 2FD3A 2HNLA 2YWOA 2XPEA 3VFIA 4WEYA 4KAEA 2AB6A 6GSTA 3TKQA 1X9WB 2VAFA 1XWBA 2E7PA 1U88A 1GWCA 3KIJA 4WBJA 4ML6A 2IFQA 2CX3A 4Q5FA 3DRNA 1B48A 1FHEA 2FY6A 1URMA 1JLWA 1V98A 5D9WA 3F4RA 2L5OA 2QSIA 2DJKA 3F6FA 2L6CA 5HFGA 3WYWA 1T4ZA 3LYPA 2H6YA 1Z7RA 2VL9A 5D96A 1Z6MA 3UVTA 3RHCA 13GSA 3HY2A 2FWHA 4XHMA 1TI3A 1GSYA 1MTCA 1MDIA 1KBNA 3S9FA 2HRKA 5D9VA 3UJ1A 4KSOA 1A2LA 2HZFA 3VPQA 1OKTA 1XOAA 3SWLA 2WB9A 4XCSA 3GHAA 1VRSD 4IVFA 4NPBA 1R7HA 3QCPA 4HQSA 4N11A 2V32A 3O3TA 4N0VA 2H73A 3F4TA 4BPYA 3KP9A 3FR9A 2C8UA 1T3BA 4IKHA 2RM6A 4HOJA 3WGEA 5HR3A 4K6XA 2VUPA 4V1Ag 3TKRA 1PX7A 2H6ZA 3F0IA 2GSSA 3ERFA 2EIQA 4PTSA 2LJKA 1SJZA 5LD0A 3GKNA 3IE3A 1BYEA 2FGXA 1SL0B 1U3IA 3IK9A 2PERA 3Q19A 2DSAA 2VL3A 2GZPA 4FO5A 3C1SA 2MMOA 3PINA 3KH9A 3N9JA 2WS2A 6GSWA 3GL3A 4PQIA 4GSTA 3D21A 3IRAA 1GP1A 1G6WA 1M0UA 1RQMA 1TRVA 5JCWA 4JR4A 4GXZA 4HQZA 2VL2A 4IGJA 3C73A 2VLTA 4MPGA 1PKZA 4BVYB 3A3TA 3TRPA 2X99A 4IW9A 4FYCA 2PU9C 4ZBBA 1OE7A 2RIIA 10GSA 5DQYA 4NV5A 6GSSA 4XRAA 3KD0A 3HVSA 3GSTA 2VIMA 4MJCA 3KTLA 4EE0A 1R26A 3E9JB 4OO5A 3CSJA 2CVBA 4MABA 5G30A 3FKFA 2P0GA 2NPBA 3LSZA 1BQ7A 1I9DA 3TJJA 2H1GA 4IP6A 1Z6NA 5D93A 4RQXA 4G0LA 2YNXA 3D22A 4PNGA 5CRDA 1DE2A 2I1UA 4MLYA 4DEJA 1CQHA 3GIXA 2OACA 4RI6A 1Z3EA 2VCTA 2A4VA 2YZUA 2KP2A 1DBYA 5CNWA 2IFQB 2DC5A 1EOGA 1CQGA 3HZ8A 3H93A 3GL5A 2O7KA 2LRTA 4I2TA 1WRYA 1HD2A 4X0XA 1ERWA 5ID2A 5J3RA 4X1UA 2GTUA 1ERUA 4POMA 3C8EA 3LQ7A 4HZ2A 2AV4A 4BVXB 1S3AA 2WFCA 1SYXA 3MAKA 1Q98A 3RBTA 2H71A 5D9TA 5HQPA 3KH7A 3DEXA 1OC9A 4J56E 3J7Yk 4F03A 2JADA 8GSSA 4JZQA 1SYRA 4WETA 3DVXA 2VD1A 3CXGA 2KHPA 2I3YA 5INYA 2KOKA 2YN1A 1WE0A 3GTUB 3TOTA 3QAGA 5ECPB 3CBUA 3NIVA 1UN2A 3GUSA 3ZFBA 3PR8A 3IHQA 3FEUA 5ELGA 4K2DA 2FCHA 1WMJA 1DUGA 4TVEA 4ZB9A 4LL4B 2C3QA 2DJ2A 3VK9A 1NM3A 2B3SA 3GFKA 2K8VA 4LL1B 2FWFA 1SKWB 1FVJA 1F2EA 1M2AA 1PQNA 2REMA 2AUVA 1X5CA 22GSA 1SL2B 3VWXA 2PUKC 3ZTLA 1H75A 1K0NA 1LBKA 5H5SA 1VF3A 3HXSA 2R4VA 3BJ5A 3QPMA 3C1RA 3UMAA 3TUEA 4ZIJA 1YKCA 4OCEA 1FG4A 1TK8B 1JHBA 2H74A 4I97A 1NHYA 20GSA 4IQ1A 1O8XA 4F0CA 1THOA 4CDOA 3TKSE 5GAND 2NTOA 1FVKA 5G5EA 3GKKA 3QAWA 4AJ6A 2L59A 4KB3A 1J9BA 5F07A 4IBPA 1BX9A 1T7PB 3I9V2 1YZXA 3UL3A 5KN3A 4JU5A 1EZKA 3LYKA 1ERVA 3E3EA 2A2RA 4TR4A 1QGVA 4EVMA 3P2AA 3PGTA 2H0GA 3L0HA 3NZNA 4L5OA 1Q4JA 1FB0A 1JZDA 5G5FA 2KLXA 2HSYA 3U6VA 4ECJA 3DKSA 1OC3A 3R2QA 4IHUA 1OAZA 2K18A 3HJPA 1XCCA 3P7XA 1ILOA 5GAPD 2B7KA 4H86A 4KW6A 4X43A 4KE3A 1XWAA 4MZWA 2GS3A 1K0CA 2IMKA 3K8NA 3GA4A 2OA7A 3TKSA 2H0IA 1GSQA 1ZOFA 4PUAA 1W4VA 5ELAA 2OE0A 4GQCA 4LMWA 3GYKA 5CP1A 2EIRA 2LKUA 1V9WA 1V2AA 3UARA 3DGQA 3IAM2 2DJ0A 2H70A 4XS6A 4ECIA 2X64A 4ZL9A 4MF7A 2H0HA 4GWRA 1AQVA 3IXRA 3ISOA 1V40A 3HKRA 1O7UA 3RAZA 4LLRA 2MMNA 2GQKA 3I69A 2H01A 1PKWA 4BVYA 4MDCA 1RW1A 1H4OA 1S3CA 4PNFA 5KN1A 3ZL5A 3VPTA 4EXJA 2DIYA 1VF2A 3TJGA 2I9HA 4MJEA 3ZMKA 3GKMA 5H5RA 3M0FA 1GTAA 4WF5A 4I8BA 1GTBA 1XZOA 1IYHA 1GSFA 1KTEA 1NHOA 1ZL9A 1WIKA 3KXOA 4YAVA 5GSSA 5GZZB 2CQ9A 3KMOA 1XVWA 5ECIB 3RPPA 3QOUA 3WGDA 2BMXA 1K0AA 2G2QA 1AXDA 4HJMA 1TU8A 1XXUA 2C0FA 1X9MB 1F9MA 1USBA 5IQYA 1DSBA 5ECLB 1ON4A 1QQ2A 5B6MA 6GSUA 2H8LA 3HA9A 2D2ZA 2HZEB 2FWEA 1SD9A 2CT6A 1QFNA 4ZBAA 4EL1A 1TW9A 2MBSA 1BEDA 2AJQB 4J2FA 3WD6A 5ECHB 4HDEA 4XS4B 4XS1A 4MJBA 3A2WA 2GLRA 3LJRA 4KCEA 3H79A 2AAWA 1OKDA 4BVXA 1SD8A 1X0RA 5JCGA 3BCIA 1R5PA 3IAS2 4PGTA 2B6MA 1VF4A 4FH8A 4ZL7A 2C0GA 3FZ5A 3U5RE 3FK8A 3M1GA 2K8SA 5DJLA 5HFKA 2MBTA 4JE1A 2MYGA 3GTUA 2HXKA 4HI7A 3CTGA 1TRUA 2YOIA 3M8NA 1PN9A 1A0RP 3F3QA 1GUHA 4HZ4A 4V2MA 5A4UA 3W6GA 4HUAA 4D73B 4DSSB 3HVVA 2VO4A 3HJOA 1TP9A 4YH2A 4AJ8A 3KP8A 1N8JA 1HQOA 2B5XA 3ME8A 4HS1A 2VCWA 1GSEA 2YZHA 1BJXA 1JZRA 1OE8A 3KMNA 5G1KA 1UA5A 1HYUA 5HR1A 4O92A 5EL8A 1UC7A 2LUSA 3QDNA 4K0GA 2WCIA 2L4CA 2J9HA 3MWHA 5IOWA 4IELA 2LEGA 2OBIA 3TRXA 3MNGA 4OFTA 1PL1A 2HRNA 2IMEA 3VWUA 2YV7A 4NAXA 4G2EA 3EMPA 5AIVA 2HRFA 2WZ9A 4K7NA 2H72A 3TDGA 3F8UA 5JWQB 2O8VB 5DCGA 3ZITA 5E4WA 1U3AA 2JU5A 4TR3A 1SKRB 11GSA 4ML1A 4MH2A 3LXZA 2GGTA 2GZYA 2R37A 1AQXA 5IMCA 3RDWA 2XBQA 2H76A 5KN0A 2O85A 2I81A 2KP1A 4K0NA 1Y25A 1XW6A 4PQ1A 3LEFA 4EDYA 4PX1A 3UBKA 1PA3A 1ZYEA 2CAIA 4Q5NA 5H5QA 1G0TA 5DQSA 2GZZA 1NSWA 5EPFA 5HFIA 4F9ZA 3UIWA 2A2SA 2H1BA 3M3MA 2O89A 3KTBA 2L6DA 5J9CA 1QUWA 3H4KA 2N5AA 2FLSA 1MDJA 5EVOA 3VLNA 1XWGA 3FR3A 2PMTA 3QD9A 2DJJA 3GRXA 2HE3A 1M99A 5IM9A 4WBRD 4F82A 1O73A 1K0BA 4G19A 3FYGA 1YEPA 2IJYA 4ECBA 3CSIA 1Y6EA 1VGLA 4HU9A 2XBIA 3F63A 4EC0A 3TKPA 2CA8A 1GUKA 5IMDA 2PN8A 2RUEA 3A2XA 5HR2A 5DALA 1GNWA 2YV9A 1QXHA 2R6KA 1JZOA 4PUFC 3TJBA 3IBHA 3KZQA 4IJIA 3QFAC 1K0OA 1Z5YE 1AQWA 3FHKA 1OC8A 1SJIA 1T00A 3FRCA 3GX0A 5IO2A 5C04A 4KDYA 4F0BA 4LMVA 3L4NA 2CVKA 1XWKA 3EC3A 4N10A 1J0FA 1M9BA 5G1LA 2GQMA 1I5GA 4ZILA 1V57A 4TOPA 3VWVA 3A5WA 4ISDA 1M2DA 3DD3A 3ZREA 2CAQA 4AGSA 3D6IA 3EINA 5F0GA 4USSA 1XPVA 4RI7A 3GKXA 4DVCA 4V2LA 2ON5A 3BCKA 3D5JA 3APSA 2JZSA 4MMMA 1GUMA 4MZBA 2E2GA 2VL2C 1T4YA 2UZ8A 1XBSA 4EKZA 5IMVA 3O76A 5DDLA 2M72A 3UEMA 1F3AA 4EUYA 1B4PA 3R3EA 1K3OA 2MMAA 4I6XA 3LXTA 2OJLA 1TTZA 2C3TA 3H8QA 4IJ3A 4ZBDA 4KDXA 1PD21 5AISA 4EDZA 2YWIA 3EWLA 1NW2A 2HZEA 1M7TA 5ENUA 4DSRA 4FYUA 5ECNB 3PPUA 2LTKA 2OE1A 1KEBA 6GSVA 1YKAA 1TJDA 1GLPA 1TK0B 4WR4A 2H1DA 4N30A 5ECSA 3C71A 3Q6OA 1ZGNA 5IMAA 1WP0A 2CV4A 4XS4A 3GN3A 3L78A 1JFUA 3ERGA 3ZVJA 1DE1A 3E0UA 1MDKA 2BJXA 3TJFA 4HEA2 3JCML 1EEJA 3FW2A 2GDRA 3G7JA 5EY6A 5F8BA 2DIZA 5IPGA 1BAYA 1SL1B 4MK3A 4V1Ap 2LNSA 2DJ1A 1QK8A 5DVBA 4J57E 2TRCP 3SBCA 5KN2A 3EYTA 4ACSA 2FA8A 4OD7A 5IOXA 2JZRA 1JLVA 5J5NA 1XWCA 2C0DA 2JZTA 4JR6A 3ERWA 1U87A 1N2AA 5DBQA 1AAZA 2VD0A 2BTOT 3VI5A 2EIOA 3KJYA 2B1KA 4D73A 4DSSA 3LWAA 2YJ7A 1GSSA 1EWXA 3IDVA 2OADA 1Z7PA 3RHBA 2M46A 1WOUA 2PVQA 3O6TA 3US3A 4IP1A 4YQVA 1HNBA 2YCDA 4KUNA 1R4WA 5AN1A 5CO3A 2IL3A 1ZCPA 5A4VA 4TXOB 4P3YB 2HT9A 5D8IA 4NXIA 1XIYA 3W8JA 2C0EA 3TCOA 4IS0A 4EF0A 5D73A 4KCAA 2JL4A 2IMFA 5DALB 1PSQA 3FZAA 3HVXA 2IMDA 3DYRA 4G10A 3I6AA 4TW5A 2GQLA 5FHIA 2VLVA 5J4UA 3WT1A 3IK7A 5B8AA 2J23A 3GH9A 2H1AA 1M2BA 2ON7A 5FWGA 4RUVA 4NWYA 2L5LA 2YJHA 3L9SA 3HCZA 2OKAA 4ID0A 3A2VA 2L57A 4ZB8A 1C72A 1MEKA 2H30A 5F06A 3V1WA 4QL9A 2XC2A 1SK1A 1XOBA 3ZZXA 4LA1A 2B7JA 4GLTA 5A5KA 4MH3A 4IQAA 5F05A 2LRNA 2GSRA 5A4WA 2VCQA 3ZRDA 1GTIA 3ZLPA 1AW9A 1TOFA 3L9VA 1GULA 1K3YA 4E8HA 1KNGA 1AC1A 3DXBA 3UOMA 5BMUA 4EO3A 3L9UA 2V1MA 1WWJA 2AHEA 1K3LA 4MF5A 3EMXA 5DJMA 3IOSA 1QMVA 2F8AA 2IPAA 3LORA 4NMUA 4BWQA 4ZL8A 5E59A 2QKEA 3WGXA 2HRAA 4KGIA 4Q5QA 2LSTA 1A2JA 1GSDA 2HQTA 2PVOC 2PWJA 5IIZA 3HHVA 3M9JA 1Z9HA 3ZIVA 1EOHA 2ES7A 4POLA 1OYJA 1EGOA 5B7CA 18GSA 3FZ4A 2OE3A 4TR0A 9GSSA 4I2UA 1TI1A 5GSTA 1MD4A 5CRHA 4MA9A 1M9AA 4TR1B 5DCHA 4BL7B 2WULA 4PXOA 4ULXA 2YPMA 3TKSC 3J7Yb 3UVHA 5IO0A 5FT3A 4KF9A 3ZIJA 2RM5A 1G6YA 4GSSA 1SENA 1XFLA 5JWOB 4CW9A 1HNCA 3CRUA 5LCZA 2M80A 4PURA 4GCIA 4CHSA 2B5EA 4XIHA 4GTUA 5ABRA 2WDUA 2QC7A 1LU4A 5HR0A 2H66A 2V2GA 3EU4A 2QGVA 5G2ZA 3W8SA 1TDIA 4OCFA 3DIEA 2L4QA 2WJUA 3HJMA 1FOVA 3KGKA 5IMFA 4E8EA 4ILFA 1T1VA 4DSQA 1MD3A 2V6KA 3APQA 2WGRA 2HSNB 4BA7A 5ECOB 5C00A 2R5GA 2X8HA 3GSSA 1HNAA 4NHWA 5JWRB 2VM1A 2VOCA 2HLSA 1GNEA 3EURA 3WT2A 2P31A 5AGYA 1B9YC 4OO4A 5ECRB 4O7HA 4YQUA 4TXVA 2CX4A 4K1FA 5AIXA 4YAPA 2LNTA 3ED3A 2E2MA 14GSA 2H75A 4PQHA 1G7EA 19GSA 2HSMA 3MSZA 5DAKB 1EP7A 1YJ6A 3GV1A 4RQRA 5JCUA 2NBSA 3GH6A 1SJ6A 3FR6A 2VCVA 3TOUA 1ML6A 2HFDA 4KH7A 1FB6A 1GLQA 4YQMA 4WXTA 16GSA 2OBKA 1FO5A 3QAVA 3G7YA 3IPZA 1YQ1A 1EP8A 1AUCA 3CYNA 2F8FA 3VI7A 4ZXGA 2ZNMA 3TGZA 2Z9SA 4HJ2A 4K7OA 3APOA 3TRQA 1YY7A 5KEJA 2H19A 12GSA 1XW5A 5CRGA 2LQQA 3FY7A 2FHEA 1B8XA 3IC8A 3Q18A 3CMIA 4QL7A 1LJRA 2LJRA 3GMFA 2EC4A 2VM2A 4AF2A 1TRSA 4NHZA 5CRWA 3FZ9A 4TXOA 2V41A 1XVQA 4FQUA 5L71A 1FW1A 4OWYA 1PRXA 7GSSA 2MMZA 2LJAA 3P8WA 4JRRA 2IN3A 3KCMA 2TRXA 1K0MA 3PH9A 1X5DA 3IV4A 2GVPA 3EU3A 2R3XA 3UBLA 1ZMAA 4Z7XA 5CREA 1B4QA 3ZVJD 1JZWA 3QMXA 3UAPA 2C4JA 3TJKA 3VWWA 5J41A 4FYBA 2DBCA 2PPTA
chains in the Genus database with same CATH superfamily
2CZ2A 3EE2A 3NOFA 2PGTA 1F6MC 1SVLA 2C80A 1ERTA 3ME7A 1O85A 3LFLA 3LGCA 1X5EA 3IC4A 3F6DA 1ZZYA 4AJ7A 1F3BA 3A5IA 2R2JA 4QQ7A 4KDUA 2B5YA 4BWSA 2MZCA 4XTSA 3DMLA 17GSA 1A0FA 4ZB6A 1EV9A 4K7IA 5A5HA 2G0FA 3DWVA 2DJ3A 1GH2A 4OFNA 5B8BA 5ECMB 2WZSA 1SK2A 1TRWA 1SU9A 1N25A 2LRCA 2LQOA 3QFBC 5J40A 2XHFA 1S3DA 2GSQA 2LS5A 2E0QA 3KEBA 2CVDA 4V2NA 1O8WA 3HZ4A 4KNDA 4JEDA 3D4TA 2KUCA 2X8CA 4KA0A 2HRKB 1YEXA 1GTUA 2VCZA 2YP6A 1A23A 1YF0A 2I4AA 3TB2A 4MPFA 2FNOA 5B6NA 4TN8A 1U6TA 2K6VA 1G7OA 5COHA 3ZFLA 4MZCA 2IIYA 1GSUA 4L5LA 1UVZA 1B9XC 3GNJA 1XW9A 5G31A 3P90A 3Q74A 2FA4A 4G9HA 3CRTA 2YWMA 2AYTA 1E2YA 4XRDA 4OFMA 4KX4A 4L8EA 4GRFA 1EEMA 1T8EB 2B1LA 1THXA 3HYPA 3N5OA 2VCXA 1GRXA 4TR1A 4BL7A 2HSHA 3GX8A 4OMVA 4WF4A 2X8GA 2XPDA 2HSMB 3MDKA 1J08A 2VLUA 4MCUA 3D4MA 1PMTA 1ACVA 1PGTA 1PL2A 4ECCA 4G0IA 2RUFA 4L0UA 4W66A 4TKYA 4L0WA 4TRXA 2FUG2 3BD2A 1O81A 1GL8A 2DKIA 4HU7A 2EFHA 1RK4A 4WKWA 3CSHA 3GURA 1ZYQB 5J9BA 2A4HA 3F4SA 4K8MA 1SKSB 4MJAA 1WJKA 1ST9A 1WPIA 1K0DA 3HD5A 4X4JA 2ZUPA 3RPNA 4G0KA 4O5RA 4I5QA 2PBJA 1O6JA 2C1YA 2F51A 2GT6A 5IMZA 3CTFA 1OVNA 3ZMLA 2O87A 2ALBA 1EGRA 3OR5A 2FWGA 2RLIA 2HSNA 4ZB7A 1E6BA 1R5AA 6GSXA 2H6XA 2C3NA 1PX6A 5D9XA 3G7IA 4IN0A 5CAXA 1IYIA 2WRTA 5IPHA 2CZ3A 4KSMA 2K9FA 3KM6A 2V6OA 3G9BA 3I43A 2P5RA 3BBYA 3M9KA 2IWTA 4GF0A 1V58A 5CYYA 2YWNA 5DAKA 2WW0A 3F3RA 2LV3A 1AIUA 1ABAA 4FIWA 1YF1A 2ZCTA 1EV4A 4MF6A 2DMLA 3H1NA 5ECQB 2YANA 4O32A 3LG6A 1W89A 2N5BA 2NVLA 3DVWA 2JACA 1A2MA 2DKHA 4JBBA 1A8LA 3ZYWA 2DMMA 2HI7A 2GT5A 4GQFA 2DLXA 1FAAA 1TU7A 1YVLA 1A24A 1VF1A 2N5FA 5ID2B 2F3MA 3VURA 3HDCA 2JSYA 3C7MA 1TKDB 1F37A 1SK0A 2NDOA 3EVIA 4PI0C 2GSTA 4K9ZA 1YDKA 3F9UA 2P5QA 4WR5A 3D0ZA 3IR4A 5ECKB 1OC9B 4F2IA 5LNKe 4GSNA 1X9SB 1BG5A 6GSYA 4N0ZA 4MP4A 1TK5B 1A8YA 4HSCX 2IMIA 3AY8A 4POBA 2JSZA 1TXXA 4Q5RA 2F9SA 3IA1A 3BOAA 2HYXA 2VKZG 1S4BP 4POKA 5A1NB 4AKHA 2TIRA 4NV2A 3QR6A 2FD3A 2HNLA 2YWOA 2XPEA 2WW2A 3VFIA 4WEYA 4KAEA 2AB6A 6GSTA 3TKQA 1X9WB 2VAFA 1XWBA 2E7PA 1U88A 1GWCA 3KIJA 4WBJA 4ML6A 2IFQA 2CX3A 4Q5FA 3DRNA 1B48A 1FHEA 2FY6A 1URMA 1JLWA 1V98A 5D9WA 3F4RA 2L5OA 2QSIA 2DJKA 3F6FA 2L6CA 5HFGA 3WYWA 1T4ZA 3LYPA 2H6YA 1Z7RA 2VL9A 5D96A 1Z6MA 3UVTA 3RHCA 13GSA 3HY2A 4GDFA 2FWHA 4XHMA 4AI6A 1TI3A 1GSYA 1MTCA 1MDIA 1KBNA 3S9FA 2HRKA 5D9VA 3UJ1A 4KSOA 1A2LA 2HZFA 3VPQA 1OKTA 1XOAA 3SWLA 1SVMA 2WB9A 4XCSA 5A34B 3GHAA 1VRSD 4BIKA 4IVFA 4NPBA 1R7HA 3QCPA 4HQSA 4N11A 2V32A 3O3TA 4N0VA 2H73A 3F4TA 4BPYA 3KP9A 3FR9A 5J4VA 2C8UA 1T3BA 4IKHA 2RM6A 4HOJA 3WGEA 5HR3A 4K6XA 1BF5A 2VUPA 4V1Ag 3TKRA 1PX7A 2H6ZA 3F0IA 2GSSA 3ERFA 2EIQA 4PTSA 2LJKA 1SJZA 5LD0A 3GKNA 3IE3A 1BYEA 2FGXA 1SL0B 2WVXB 1U3IA 3IK9A 2PERA 3Q19A 2DSAA 2VL3A 2GZPA 4FO5A 3C1SA 2MMOA 3PINA 3KH9A 3N9JA 2WS2A 6GSWA 3GL3A 4PQIA 4GSTA 1PN0A 3D21A 3IRAA 1GP1A 1G6WA 1M0UA 1RQMA 1TRVA 5JCWA 4JR4A 4GXZA 4HQZA 2VL2A 4IGJA 3C73A 2VLTA 4MPGA 1PKZA 4BVYB 3A3TA 3TRPA 2X99A 4IW9A 4FYCA 2PU9C 4ZBBA 1OE7A 4CY8A 2RIIA 10GSA 5DQYA 3FMWA 4NV5A 6GSSA 4XRAA 3KD0A 3HVSA 3GSTA 1S3RA 2VIMA 4MJCA 3KTLA 4EE0A 1R26A 3E9JB 4OO5A 2WW1A 3CSJA 2CVBA 4MABA 5G30A 3FKFA 2P0GA 2NPBA 3LSZA 1BQ7A 1I9DA 1M3JA 2H1GA 4IP6A 3TJJA 1Z6NA 5D93A 4RQXA 4G0LA 2YNXA 3D22A 4PNGA 4YKFA 5CRDA 1DE2A 2I1UA 4MLYA 4DEJA 1CQHA 3GIXA 2OACA 4RI6A 1Z3EA 2VCTA 2WVZA 2A4VA 2YZUA 2KP2A 1DBYA 5CNWA 2IFQB 2DC5A 1EOGA 1CQGA 3HZ8A 3H93A 3GL5A 2O7KA 2LRTA 4I2TA 1WRYA 1HD2A 4X0XA 1ERWA 5ID2A 5J3RA 4X1UA 2GTUA 1ERUA 4POMA 3C8EA 3LQ7A 4HZ2A 2AV4A 4BVXB 1S3AA 2WFCA 1SYXA 3MAKA 1Q98A 3RBTA 2H71A 5D9TA 5HQPA 3KH7A 3DEXA 1OC9A 4J56E 3J7Yk 4F03A 2JADA 8GSSA 4JZQA 1SYRA 4WETA 3DVXA 2VD1A 3CXGA 2KHPA 2I3YA 5INYA 2KOKA 2YN1A 1WE0A 3GTUB 3TOTA 3QAGA 5ECPB 3CBUA 3NIVA 1UN2A 3GUSA 3ZFBA 3PR8A 3IHQA 3FEUA 5ELGA 5A1NA 2FCHA 4K2DA 1WMJA 1DUGA 4TVEA 4ZB9A 4LL4B 2C3QA 2DJ2A 3VK9A 1NM3A 2B3SA 3GFKA 2K8VA 4LL1B 2FWFA 1SKWB 1FVJA 1F2EA 1M2AA 1PQNA 2REMA 2AUVA 1X5CA 22GSA 1SL2B 3VWXA 2PUKC 3ZTLA 1H75A 1K0NA 1LBKA 1YEWC 5H5SA 1VF3A 3HXSA 2R4VA 3BJ5A 3QPMA 3C1RA 3UMAA 3TUEA 4ZIJA 1YKCA 4OCEA 1FG4A 4AKXB 1TK8B 1JHBA 2H74A 4I97A 1NHYA 20GSA 4IQ1A 1O8XA 4F0CA 1THOA 4CDOA 3TKSE 5GAND 2NTOA 1FVKA 5G5EA 3GKKA 3QAWA 4AJ6A 2L59A 4KB3A 1J9BA 5F07A 4IBPA 1BX9A 1T7PB 3I9V2 1YZXA 3UL3A 5KN3A 4JU5A 1EZKA 2EFCA 5A34A 3LYKA 1ERVA 3E3EA 2A2RA 4TR4A 1QGVA 4EVMA 3P2AA 3PGTA 2H0GA 3L0HA 3NZNA 4L5OA 1Q4JA 3LW9A 1FB0A 1JZDA 5G5FA 2KLXA 2HSYA 2UV8G 3U6VA 4ECJA 3DKSA 1OC3A 3R2QA 4IHUA 1OAZA 2K18A 1BG1A 3HJPA 1XCCA 3P7XA 1ILOA 5GAPD 2B7KA 4H86A 4KW6A 4X43A 4KE3A 1XWAA 4MZWA 2GS3A 1K0CA 2IMKA 3K8NA 3GA4A 4K5RA 5J4YA 2OA7A 2WVXA 3TKSA 2H0IA 1GSQA 1ZOFA 4PUAA 1W4VA 5ELAA 2OE0A 4GQCA 4LMWA 3GYKA 2X49A 5CP1A 2EIRA 4EIQA 2LKUA 1V9WA 1V2AA 3UARA 3DGQA 3IAM2 2DJ0A 2H70A 4XS6A 4ECIA 2X64A 4ZL9A 5KOWA 4MF7A 2H0HA 4GWRA 1AQVA 3IXRA 3ISOA 1V40A 3HKRA 1O7UA 3RAZA 4LLRA 2MMNA 2GQKA 3I69A 2H01A 1PKWA 4BVYA 4MDCA 1RW1A 1H4OA 1S3CA 4PNFA 5KN1A 3ZL5A 3VPTA 4EXJA 2DIYA 1VF2A 3TJGA 2I9HA 4MJEA 3ZMKA 3GKMA 5H5RA 3M0FA 1GTAA 4WF5A 4I8BA 1GTBA 1XZOA 1IYHA 1GSFA 1KTEA 1NHOA 1ZL9A 1WIKA 3KXOA 4YAVA 5GSSA 5GZZB 2CQ9A 3KMOA 1XVWA 5ECIB 3RPPA 3QOUA 3WGDA 2BMXA 1K0AA 2G2QA 1AXDA 4HJMA 1TU8A 4G01A 1XXUA 2C0FA 1X9MB 1F9MA 1ZYPA 1USBA 5IQYA 1DSBA 5ECLB 1ON4A 1QQ2A 5B6MA 6GSUA 2H8LA 3HA9A 2D2ZA 2HZEB 2FWEA 1SD9A 2CT6A 1QFNA 4ZBAA 4EL1A 1TW9A 1I1IP 2MBSA 1BEDA 2AJQB 4J2FA 3WD6A 5ECHB 4HDEA 4XS4B 4XS1A 4MJBA 3A2WA 2GLRA 3LJRA 4KCEA 1XG8A 3H79A 2AAWA 1OKDA 4BVXA 1SD8A 1X0RA 5JCGA 3BCIA 1R5PA 3IAS2 4PGTA 2B6MA 1VF4A 4FH8A 4ZL7A 2C0GA 3FZ5A 3U5RE 3FK8A 3M1GA 2K8SA 5DJLA 5HFKA 2MBTA 4JE1A 2MYGA 3GTUA 2HXKA 4HI7A 3CTGA 1TRUA 2YOIA 3M8NA 1PN9A 1A0RP 3F3QA 1GUHA 4HZ4A 4V2MA 5A4UA 3W6GA 4HUAA 4D73B 4DSSB 3HVVA 2VO4A 3HJOA 1TP9A 4YH2A 4AJ8A 3KP8A 1N8JA 1HQOA 2B5XA 3ME8A 4HS1A 2VCWA 1GSEA 2YZHA 4N3ZA 4A5PA 1BJXA 1JZRA 1OE8A 3KMNA 5G1KA 1UA5A 1HYUA 5HR1A 3RGBC 4O92A 5EL8A 1UC7A 2LUSA 3QDNA 4K0GA 2WCIA 2L4CA 2J9HA 3MWHA 5IOWA 4IELA 2LEGA 2OBIA 3TRXA 3MNGA 4OFTA 1PL1A 2HRNA 2IMEA 3VWUA 2YV7A 4NAXA 4G2EA 3EMPA 5AIVA 2HRFA 2WZ9A 4K7NA 2H72A 3TDGA 3F8UA 3IHGA 5JWQB 2O8VB 5DCGA 3ZITA 5E4WA 1U3AA 2JU5A 4TR3A 1SKRB 11GSA 4ML1A 4MH2A 3LXZA 2GGTA 2O5VA 2GZYA 2R37A 1AQXA 5IMCA 3RDWA 2XBQA 2H76A 5KN0A 2O85A 4Z2TA 2I81A 2KP1A 4K0NA 1Y25A 1XW6A 4PQ1A 3LEFA 4EDYA 4PX1A 3UBKA 1PA3A 1ZYEA 2CAIA 4Q5NA 5H5QA 1G0TA 5DQSA 2GZZA 1NSWA 5EPFA 5HFIA 4F9ZA 3UIWA 2A2SA 2H1BA 3M3MA 2O89A 3KTBA 2L6DA 5J9CA 1QUWA 3H4KA 2N5AA 2FLSA 1MDJA 2A2PA 5EVOA 3VLNA 1XWGA 3FR3A 2PMTA 3QD9A 2DJJA 4QMKA 3GRXA 2HE3A 1M99A 3HVNA 5IM9A 4WBRD 4F82A 1O73A 2R0GA 1K0BA 4G19A 3FYGA 1YEPA 2IJYA 4ECBA 3CSIA 5BMUB 1Y6EA 1VGLA 4HU9A 5BRTA 2XBIA 3F63A 4EC0A 3TKPA 2CA8A 1GUKA 5IMDA 2PN8A 2RUEA 3A2XA 5HR2A 5DALA 1GNWA 2YV9A 1QXHA 2R6KA 1JZOA 4PUFC 1PFOA 3TJBA 3IBHA 3KZQA 4IJIA 3QFAC 1K0OA 1Z5YE 1ZYNA 1AQWA 3FHKA 1OC8A 1SJIA 3MIXA 3RFRC 1T00A 3FRCA 3GX0A 5IO2A 5C04A 4KDYA 4F0BA 4LMVA 3L4NA 2CVKA 1XWKA 3EC3A 4N10A 1J0FA 1M9BA 5G1LA 2GQMA 1I5GA 4ZILA 1V57A 4TOPA 3VWVA 3A5WA 4ISDA 1M2DA 3DD3A 3ZREA 2CAQA 4AGSA 3D6IA 3EINA 3HMJG 5F0GA 4USSA 1XPVA 4RI7A 3GKXA 4DVCA 4V2LA 2ON5A 3BCKA 3D5JA 4ICYA 3APSA 2JZSA 4Z2UA 4MMMA 1GUMA 4MZBA 2E2GA 2VL2C 1T4YA 2UZ8A 1XBSA 4EKZA 5IMVA 3O76A 5DDLA 2M72A 3UEMA 1F3AA 4EUYA 1B4PA 3R3EA 1K3OA 2MMAA 4I6XA 3LXTA 2OJLA 1TTZA 2C3TA 3H8QA 4IJ3A 4ZBDA 4KDXA 1PD21 5AISA 4EDZA 2YWIA 3EWLA 1NW2A 2HZEA 1M7TA 5ENUA 4DSRA 4FYUA 5ECNB 3PPUA 2LTKA 2OE1A 1KEBA 6GSVA 1YKAA 1TJDA 1GLPA 1TK0B 4WR4A 2H1DA 4N30A 5ECSA 3C71A 3Q6OA 1ZGNA 5IMAA 1WP0A 1M3IA 2CV4A 4XS4A 3GN3A 2OT3A 3L78A 1JFUA 3ERGA 3ZVJA 1DE1A 3E0UA 1MDKA 2BJXA 3TJFA 4HEA2 3JCML 1EEJA 3FW2A 2GDRA 3G7JA 5EY6A 5F8BA 2DIZA 5IPGA 1BAYA 1SL1B 4MK3A 4V1Ap 2LNSA 2DJ1A 1QK8A 3MYDA 5DVBA 2WVYA 4J57E 2TRCP 3SBCA 5KN2A 3EYTA 4E68A 4ACSA 2FA8A 4OD7A 5IOXA 2JZRA 1JLVA 5J5NA 1XWCA 2C0DA 4PI2C 2JZTA 2H1LA 4JR6A 3ERWA 1U87A 1N2AA 5DBQA 1AAZA 2VD0A 2BTOT 3VI5A 2EIOA 3KJYA 2B1KA 4D73A 4DSSA 3LWAA 2YJ7A 1GSSA 1EWXA 4AKIA 3IDVA 2OADA 1Z7PA 3RHBA 2M46A 4O5UA 1WOUA 2PVQA 3O6TA 4AKGA 3US3A 4IP1A 4YQVA 1HNBA 2YCDA 4KUNA 1R4WA 5AN1A 5CO3A 2IL3A 1ZCPA 5A4VA 4TXOB 4P3YB 2HT9A 5D8IA 4NXIA 1XIYA 3W8JA 2C0EA 3TCOA 4IS0A 4EF0A 5D73A 4KCAA 2JL4A 2IMFA 5DALB 1PSQA 3FZAA 3HVXA 2IMDA 3DYRA 4G10A 3I6AA 4TW5A 4K5SA 2GQLA 5FHIA 2VLVA 5J4UA 3WT1A 3IK7A 5B8AA 2J23A 3GH9A 2H1AA 1M2BA 2ON7A 5FWGA 4RUVA 4NWYA 2X4AA 2L5LA 2YJHA 3L9SA 3HCZA 2OKAA 4ID0A 3A2VA 2L57A 4ZB8A 1C72A 1MEKA 2H30A 5F06A 3V1WA 4QL9A 2XC2A 2O3EA 1SK1A 1XOBA 3ZZXA 4LA1A 2B7JA 4GLTA 5A5KA 4MH3A 4IQAA 4Z2RA 5F05A 5A5HB 2LRNA 2GSRA 5A4WA 4EIPA 2VCQA 3ZRDA 1GTIA 3ZLPA 1AW9A 1TOFA 3L9VA 1GULA 1K3YA 4FXYP 4E8HA 1KNGA 1AC1A 3DXBA 3UOMA 5BMUA 4EO3A 3L9UA 2V1MA 1WWJA 2AHEA 1K3LA 4MF5A 3EMXA 5DJMA 3IOSA 1QMVA 2F8AA 2IPAA 3LORA 4NMUA 4BWQA 4ZL8A 5E59A 2QKEA 3WGXA 2HRAA 4KGIA 4Q5QA 2LSTA 1A2JA 4MNNA 1GSDA 2HQTA 2PVOC 2PWJA 5IIZA 3HHVA 3M9JA 1Z9HA 3ZIVA 1EOHA 2ES7A 4POLA 1OYJA 1EGOA 5B7CA 18GSA 3FZ4A 2OE3A 4TR0A 9GSSA 4YKGA 4I2UA 1TI1A 2EFEA 5GSTA 1MD4A 5CRHA 4MA9A 1M9AA 4TR1B 5DCHA 4BL7B 2WULA 4PXOA 4ULXA 3CQFA 2YPMA 3TKSC 3J7Yb 3UVHA 5IO0A 5FT3A 4KF9A 3ZIJA 2RM5A 1G6YA 4CY6A 4GSSA 1SENA 1XFLA 5JWOB 4CW9A 1HNCA 3CRUA 5LCZA 2M80A 5KOXA 2EFDA 4PURA 4GCIA 4CHSA 2B5EA 4XIHA 4GTUA 5ABRA 2WDUA 2QC7A 1LU4A 5HR0A 2H66A 2V2GA 3EU4A 2QGVA 5G2ZA 3W8SA 1TDIA 4OCFA 3DIEA 2L4QA 2WJUA 3HJMA 1FOVA 3KGKA 5IMFA 4E8EA 4ILFA 1T1VA 4DSQA 1MD3A 2V6KA 3APQA 2WGRA 2HSNB 4BA7A 5ECOB 5C00A 2R5GA 2X8HA 3GSSA 1HNAA 1SVOA 4NHWA 5JWRB 3CHXC 2VM1A 2VOCA 2HLSA 1GNEA 3EURA 3WT2A 2P31A 5AGYA 4O5QA 1B9YC 4OO4A 5ECRB 4O7HA 4YQUA 4PHZC 4TXVA 2CX4A 4K1FA 5AIXA 4YAPA 2LNTA 3ED3A 2E2MA 14GSA 2H75A 4PQHA 1G7EA 19GSA 2HSMA 3MSZA 5DAKB 1EP7A 1YJ6A 3GV1A 4RQRA 5JCUA 2NBSA 2QA1A 3GH6A 1SJ6A 3FR6A 2VCVA 3TOUA 1ML6A 2HFDA 4KH7A 1FB6A 1GLQA 4YQMA 4WXTA 16GSA 2OBKA 1FO5A 3QAVA 3G7YA 1Y1UA 3IPZA 1YQ1A 2O36A 1AUCA 1EP8A 3CYNA 2F8FA 3TU3B 3VI7A 4ZXGA 2ZNMA 3TGZA 2Z9SA 4HJ2A 3APOA 4K7OA 3TRQA 1YY7A 5KEJA 2H19A 12GSA 1XW5A 5CRGA 2LQQA 3FY7A 2FHEA 1B8XA 3IC8A 3Q18A 3CMIA 4QL7A 1LJRA 3EPTA 2R0PA 2LJRA 4K2XA 3GMFA 2EC4A 2VM2A 3CWGA 4AF2A 1TRSA 2R0CA 4NHZA 5CRWA 3FZ9A 4TXOA 2V41A 1XVQA 4FQUA 5L71A 1FW1A 4OWYA 1PRXA 7GSSA 2MMZA 2LJAA 3P8WA 4JRRA 2IN3A 3KCMA 2TRXA 1K0MA 3PH9A 1X5DA 3IV4A 2GVPA 1FOHA 5J47A 3EU3A 1TXUA 2R3XA 3UBLA 1ZMAA 4Z7XA 5CREA 1B4QA 3ZVJD 1JZWA 3QMXA 3UAPA 2C4JA 3TJKA 2QA2A 3VWWA 2WW3A 5J41A 4FYBA 2DBCA 2PPTA
chains in the Genus database with same CATH topology
2CZ2A 3EE2A 3NOFA 2PGTA 1F6MC 1SVLA 2C80A 1ERTA 3ME7A 1O85A 3LFLA 3LGCA 1X5EA 3IC4A 3F6DA 1ZZYA 4AJ7A 1F3BA 3A5IA 2R2JA 4QQ7A 4KDUA 2B5YA 4BWSA 2MZCA 4XTSA 3DMLA 17GSA 1A0FA 4ZB6A 1EV9A 4K7IA 5A5HA 2G0FA 3DWVA 2DJ3A 1GH2A 4OFNA 5B8BA 5ECMB 1SK2A 1TRWA 1SU9A 1N25A 2LRCA 2LQOA 3QFBC 5J40A 2XHFA 1S3DA 2GSQA 2LS5A 2E0QA 3KEBA 2CVDA 4V2NA 1O8WA 3HZ4A 4KNDA 4JEDA 3D4TA 2KUCA 2X8CA 4KA0A 2HRKB 1YEXA 1GTUA 2VCZA 2YP6A 1A23A 1YF0A 2I4AA 3TB2A 4MPFA 2FNOA 5B6NA 4TN8A 1U6TA 2K6VA 1G7OA 5COHA 3ZFLA 4MZCA 2IIYA 1GSUA 4L5LA 1UVZA 1B9XC 3GNJA 1XW9A 5G31A 3P90A 3Q74A 2FA4A 4G9HA 3CRTA 2YWMA 2AYTA 1E2YA 4XRDA 4OFMA 4KX4A 4L8EA 4GRFA 1EEMA 1T8EB 2B1LA 1THXA 3HYPA 3N5OA 2VCXA 1GRXA 4TR1A 4BL7A 2HSHA 3GX8A 4OMVA 4WF4A 2X8GA 2XPDA 2HSMB 3MDKA 1J08A 2VLUA 4MCUA 3D4MA 1PMTA 1ACVA 1PGTA 1PL2A 4ECCA 4G0IA 2RUFA 4L0UA 4W66A 4TKYA 4L0WA 4TRXA 2FUG2 3BD2A 1O81A 1GL8A 2DKIA 4HU7A 2EFHA 1RK4A 4WKWA 3CSHA 3GURA 1ZYQB 5J9BA 2A4HA 3F4SA 4K8MA 1SKSB 4MJAA 1WJKA 1ST9A 1WPIA 1K0DA 3HD5A 4X4JA 2ZUPA 3RPNA 4G0KA 4O5RA 4I5QA 2PBJA 1O6JA 2C1YA 2F51A 2GT6A 5IMZA 3CTFA 1OVNA 3ZMLA 2O87A 2ALBA 1EGRA 3OR5A 2FWGA 2RLIA 2HSNA 4ZB7A 1E6BA 1R5AA 6GSXA 2H6XA 2C3NA 1PX6A 5D9XA 3G7IA 4IN0A 5CAXA 1IYIA 2WRTA 5IPHA 2CZ3A 4KSMA 2K9FA 3KM6A 2V6OA 3G9BA 3I43A 2P5RA 3BBYA 3M9KA 2IWTA 4GF0A 1V58A 5CYYA 2YWNA 5DAKA 3F3RA 2LV3A 1AIUA 1ABAA 4FIWA 1YF1A 2ZCTA 1EV4A 4MF6A 2DMLA 3H1NA 5ECQB 2YANA 4O32A 3LG6A 1W89A 2N5BA 2NVLA 3DVWA 2JACA 1A2MA 2DKHA 4JBBA 1A8LA 3ZYWA 2DMMA 2HI7A 2GT5A 4GQFA 2DLXA 1FAAA 1TU7A 1YVLA 1A24A 1VF1A 2N5FA 5ID2B 2F3MA 3VURA 3HDCA 2JSYA 3C7MA 1TKDB 1F37A 1SK0A 2NDOA 3EVIA 2GSTA 4K9ZA 1YDKA 3F9UA 2P5QA 4WR5A 3D0ZA 3IR4A 5ECKB 1OC9B 4F2IA 5LNKe 4GSNA 1X9SB 1BG5A 6GSYA 4N0ZA 4MP4A 1TK5B 1A8YA 2IMIA 3AY8A 4POBA 2JSZA 1TXXA 4Q5RA 2F9SA 3IA1A 3BOAA 2HYXA 2VKZG 4POKA 5A1NB 4AKHA 2TIRA 4NV2A 3QR6A 2FD3A 2HNLA 2YWOA 2XPEA 3VFIA 4WEYA 4KAEA 2AB6A 6GSTA 3TKQA 1X9WB 2VAFA 1XWBA 2E7PA 1U88A 1GWCA 3KIJA 4WBJA 4ML6A 2IFQA 2CX3A 4Q5FA 3DRNA 1B48A 1FHEA 2FY6A 1URMA 1JLWA 1V98A 5D9WA 3F4RA 2L5OA 2QSIA 2DJKA 3F6FA 2L6CA 5HFGA 3WYWA 1T4ZA 3LYPA 2H6YA 1Z7RA 2VL9A 5D96A 1Z6MA 3UVTA 3RHCA 13GSA 3HY2A 4GDFA 2FWHA 4XHMA 4AI6A 1TI3A 1GSYA 1MTCA 1MDIA 1KBNA 3S9FA 2HRKA 5D9VA 3UJ1A 4KSOA 1A2LA 2HZFA 3VPQA 1OKTA 1XOAA 3SWLA 1SVMA 2WB9A 4XCSA 5A34B 3GHAA 1VRSD 4IVFA 4NPBA 1R7HA 3QCPA 4HQSA 4N11A 2V32A 3O3TA 4N0VA 2H73A 3F4TA 4BPYA 3KP9A 3FR9A 5J4VA 2C8UA 1T3BA 4IKHA 2RM6A 4HOJA 3WGEA 5HR3A 4K6XA 1BF5A 2VUPA 4V1Ag 3TKRA 1PX7A 2H6ZA 3F0IA 2GSSA 3ERFA 2EIQA 4PTSA 2LJKA 1SJZA 5LD0A 3GKNA 3IE3A 1BYEA 2FGXA 1SL0B 1U3IA 3IK9A 2PERA 3Q19A 2DSAA 2VL3A 2GZPA 4FO5A 3C1SA 2MMOA 3PINA 3KH9A 3N9JA 2WS2A 6GSWA 3GL3A 4PQIA 4GSTA 1PN0A 3D21A 3IRAA 1GP1A 1G6WA 1M0UA 1RQMA 1TRVA 5JCWA 4JR4A 4GXZA 4HQZA 2VL2A 4IGJA 3C73A 2VLTA 4MPGA 1PKZA 4BVYB 3A3TA 3TRPA 2X99A 4IW9A 4FYCA 2PU9C 4ZBBA 1OE7A 4CY8A 2RIIA 10GSA 5DQYA 3FMWA 4NV5A 6GSSA 4XRAA 3KD0A 3HVSA 3GSTA 2VIMA 4MJCA 3KTLA 4EE0A 1R26A 3E9JB 4OO5A 3CSJA 2CVBA 4MABA 5G30A 3FKFA 2P0GA 2NPBA 3LSZA 1BQ7A 1I9DA 3TJJA 2H1GA 4IP6A 1Z6NA 5D93A 4RQXA 4G0LA 2YNXA 3D22A 4PNGA 4YKFA 5CRDA 1DE2A 2I1UA 4MLYA 4DEJA 1CQHA 3GIXA 2OACA 4RI6A 1Z3EA 2VCTA 2A4VA 2YZUA 2KP2A 1DBYA 5CNWA 2IFQB 2DC5A 1EOGA 1CQGA 3HZ8A 3H93A 3GL5A 2O7KA 2LRTA 4I2TA 1WRYA 1HD2A 4X0XA 1ERWA 5ID2A 5J3RA 4X1UA 2GTUA 1ERUA 4POMA 3C8EA 3LQ7A 4HZ2A 2AV4A 4BVXB 1S3AA 2WFCA 1SYXA 3MAKA 1Q98A 3RBTA 2H71A 5D9TA 5HQPA 3KH7A 3DEXA 1OC9A 4J56E 3J7Yk 4F03A 2JADA 8GSSA 4JZQA 1SYRA 4WETA 3DVXA 2VD1A 3CXGA 2KHPA 2I3YA 5INYA 2KOKA 2YN1A 1WE0A 3GTUB 3TOTA 3QAGA 5ECPB 3CBUA 3NIVA 1UN2A 3GUSA 3ZFBA 3PR8A 3IHQA 3FEUA 5ELGA 5A1NA 2FCHA 4K2DA 1WMJA 1DUGA 4TVEA 4ZB9A 4LL4B 2C3QA 2DJ2A 3VK9A 1NM3A 2B3SA 3GFKA 2K8VA 4LL1B 2FWFA 1SKWB 1FVJA 1F2EA 1M2AA 1PQNA 2REMA 2AUVA 1X5CA 22GSA 1SL2B 3VWXA 2PUKC 3ZTLA 1H75A 1K0NA 1LBKA 5H5SA 1VF3A 3HXSA 2R4VA 3BJ5A 3QPMA 3C1RA 3UMAA 3TUEA 4ZIJA 1YKCA 4OCEA 1FG4A 4AKXB 1TK8B 1JHBA 2H74A 4I97A 1NHYA 20GSA 4IQ1A 1O8XA 4F0CA 1THOA 4CDOA 3TKSE 5GAND 2NTOA 1FVKA 5G5EA 3GKKA 3QAWA 4AJ6A 2L59A 4KB3A 1J9BA 5F07A 4IBPA 1BX9A 1T7PB 3I9V2 1YZXA 3UL3A 5KN3A 4JU5A 1EZKA 2EFCA 5A34A 3LYKA 1ERVA 3E3EA 2A2RA 4TR4A 1QGVA 4EVMA 3P2AA 3PGTA 2H0GA 3L0HA 3NZNA 4L5OA 1Q4JA 3LW9A 1FB0A 1JZDA 5G5FA 2KLXA 2HSYA 2UV8G 3U6VA 4ECJA 3DKSA 1OC3A 3R2QA 4IHUA 1OAZA 2K18A 1BG1A 3HJPA 1XCCA 3P7XA 1ILOA 5GAPD 2B7KA 4H86A 4KW6A 4X43A 4KE3A 1XWAA 4MZWA 2GS3A 1K0CA 2IMKA 3K8NA 3GA4A 4K5RA 5J4YA 2OA7A 3TKSA 2H0IA 1GSQA 1ZOFA 4PUAA 1W4VA 5ELAA 2OE0A 4GQCA 4LMWA 3GYKA 2X49A 5CP1A 2EIRA 4EIQA 2LKUA 1V9WA 1V2AA 3UARA 3DGQA 3IAM2 2DJ0A 2H70A 4XS6A 4ECIA 2X64A 4ZL9A 5KOWA 4MF7A 2H0HA 4GWRA 1AQVA 3IXRA 3ISOA 1V40A 3HKRA 1O7UA 3RAZA 4LLRA 2MMNA 2GQKA 3I69A 2H01A 1PKWA 4BVYA 4MDCA 1RW1A 1H4OA 1S3CA 4PNFA 5KN1A 3ZL5A 3VPTA 4EXJA 2DIYA 1VF2A 3TJGA 2I9HA 4MJEA 3ZMKA 3GKMA 5H5RA 3M0FA 1GTAA 4WF5A 4I8BA 1GTBA 1XZOA 1IYHA 1GSFA 1KTEA 1NHOA 1ZL9A 1WIKA 3KXOA 4YAVA 5GSSA 5GZZB 2CQ9A 3KMOA 1XVWA 5ECIB 3RPPA 3QOUA 3WGDA 2BMXA 1K0AA 2G2QA 1AXDA 4HJMA 1TU8A 4G01A 1XXUA 2C0FA 1X9MB 1F9MA 1ZYPA 1USBA 5IQYA 1DSBA 5ECLB 1ON4A 1QQ2A 5B6MA 6GSUA 2H8LA 3HA9A 2D2ZA 2HZEB 2FWEA 1SD9A 2CT6A 1QFNA 4ZBAA 4EL1A 1TW9A 2MBSA 1BEDA 2AJQB 4J2FA 3WD6A 5ECHB 4HDEA 4XS4B 4XS1A 4MJBA 3A2WA 2GLRA 3LJRA 4KCEA 3H79A 2AAWA 1OKDA 4BVXA 1SD8A 1X0RA 5JCGA 3BCIA 1R5PA 3IAS2 4PGTA 2B6MA 1VF4A 4FH8A 4ZL7A 2C0GA 3FZ5A 3U5RE 3FK8A 3M1GA 2K8SA 5DJLA 5HFKA 2MBTA 4JE1A 2MYGA 3GTUA 2HXKA 4HI7A 3CTGA 1TRUA 2YOIA 3M8NA 1PN9A 1A0RP 3F3QA 1GUHA 4HZ4A 4V2MA 5A4UA 3W6GA 4HUAA 4D73B 4DSSB 3HVVA 2VO4A 3HJOA 1TP9A 4YH2A 4AJ8A 3KP8A 1N8JA 1HQOA 2B5XA 3ME8A 4HS1A 2VCWA 1GSEA 2YZHA 4N3ZA 4A5PA 1BJXA 1JZRA 1OE8A 3KMNA 5G1KA 1UA5A 1HYUA 5HR1A 4O92A 5EL8A 1UC7A 2LUSA 3QDNA 4K0GA 2WCIA 2L4CA 2J9HA 3MWHA 5IOWA 4IELA 2LEGA 2OBIA 3TRXA 3MNGA 4OFTA 1PL1A 2HRNA 2IMEA 3VWUA 2YV7A 4NAXA 4G2EA 3EMPA 5AIVA 2HRFA 2WZ9A 4K7NA 2H72A 3TDGA 3F8UA 3IHGA 5JWQB 2O8VB 5DCGA 3ZITA 5E4WA 1U3AA 2JU5A 4TR3A 1SKRB 11GSA 4ML1A 4MH2A 3LXZA 2GGTA 2O5VA 2GZYA 2R37A 1AQXA 5IMCA 3RDWA 2XBQA 2H76A 5KN0A 2O85A 4Z2TA 2I81A 2KP1A 4K0NA 1Y25A 1XW6A 4PQ1A 3LEFA 4EDYA 4PX1A 3UBKA 1PA3A 1ZYEA 2CAIA 4Q5NA 5H5QA 1G0TA 5DQSA 2GZZA 1NSWA 5EPFA 5HFIA 4F9ZA 3UIWA 2A2SA 2H1BA 3M3MA 2O89A 3KTBA 2L6DA 5J9CA 1QUWA 3H4KA 2N5AA 2FLSA 1MDJA 2A2PA 5EVOA 3VLNA 1XWGA 3FR3A 2PMTA 3QD9A 2DJJA 4QMKA 3GRXA 2HE3A 1M99A 5IM9A 4WBRD 4F82A 1O73A 2R0GA 1K0BA 4G19A 3FYGA 1YEPA 2IJYA 4ECBA 3CSIA 5BMUB 1Y6EA 1VGLA 4HU9A 5BRTA 2XBIA 3F63A 4EC0A 3TKPA 2CA8A 1GUKA 5IMDA 2PN8A 2RUEA 3A2XA 5HR2A 5DALA 1GNWA 2YV9A 1QXHA 2R6KA 1JZOA 4PUFC 3TJBA 3IBHA 3KZQA 4IJIA 3QFAC 1K0OA 1Z5YE 1ZYNA 1AQWA 3FHKA 1OC8A 1SJIA 3MIXA 1T00A 3FRCA 3GX0A 5IO2A 5C04A 4KDYA 4F0BA 4LMVA 3L4NA 2CVKA 1XWKA 3EC3A 4N10A 1J0FA 1M9BA 5G1LA 2GQMA 1I5GA 4ZILA 1V57A 4TOPA 3VWVA 3A5WA 4ISDA 1M2DA 3DD3A 3ZREA 2CAQA 4AGSA 3D6IA 3EINA 3HMJG 5F0GA 4USSA 1XPVA 4RI7A 3GKXA 4DVCA 4V2LA 2ON5A 3BCKA 3D5JA 4ICYA 3APSA 2JZSA 4Z2UA 4MMMA 1GUMA 4MZBA 2E2GA 2VL2C 1T4YA 2UZ8A 1XBSA 4EKZA 5IMVA 3O76A 5DDLA 2M72A 3UEMA 1F3AA 4EUYA 1B4PA 3R3EA 1K3OA 2MMAA 4I6XA 3LXTA 2OJLA 1TTZA 2C3TA 3H8QA 4IJ3A 4ZBDA 4KDXA 1PD21 5AISA 4EDZA 2YWIA 3EWLA 1NW2A 2HZEA 1M7TA 5ENUA 4DSRA 4FYUA 5ECNB 3PPUA 2LTKA 2OE1A 1KEBA 6GSVA 1YKAA 1TJDA 1GLPA 1TK0B 4WR4A 2H1DA 4N30A 5ECSA 3C71A 3Q6OA 1ZGNA 5IMAA 1WP0A 2CV4A 4XS4A 3GN3A 2OT3A 3L78A 1JFUA 3ERGA 3ZVJA 1DE1A 3E0UA 1MDKA 2BJXA 3TJFA 4HEA2 3JCML 1EEJA 3FW2A 2GDRA 3G7JA 5EY6A 5F8BA 2DIZA 5IPGA 1BAYA 1SL1B 4MK3A 4V1Ap 2LNSA 2DJ1A 1QK8A 3MYDA 5DVBA 4J57E 2TRCP 3SBCA 5KN2A 3EYTA 4E68A 4ACSA 2FA8A 4OD7A 5IOXA 2JZRA 1JLVA 5J5NA 1XWCA 2C0DA 2JZTA 2H1LA 4JR6A 3ERWA 1U87A 1N2AA 5DBQA 1AAZA 2VD0A 2BTOT 3VI5A 2EIOA 3KJYA 2B1KA 4D73A 4DSSA 3LWAA 2YJ7A 1GSSA 1EWXA 4AKIA 3IDVA 2OADA 1Z7PA 3RHBA 2M46A 4O5UA 1WOUA 2PVQA 3O6TA 4AKGA 3US3A 4IP1A 4YQVA 1HNBA 2YCDA 4KUNA 1R4WA 5AN1A 5CO3A 2IL3A 1ZCPA 5A4VA 4TXOB 4P3YB 2HT9A 5D8IA 4NXIA 1XIYA 3W8JA 2C0EA 3TCOA 4IS0A 4EF0A 5D73A 4KCAA 2JL4A 2IMFA 5DALB 1PSQA 3FZAA 3HVXA 2IMDA 3DYRA 4G10A 3I6AA 4TW5A 4K5SA 2GQLA 5FHIA 2VLVA 5J4UA 3WT1A 3IK7A 5B8AA 2J23A 3GH9A 2H1AA 1M2BA 2ON7A 5FWGA 4RUVA 4NWYA 2X4AA 2L5LA 2YJHA 3L9SA 3HCZA 2OKAA 4ID0A 3A2VA 2L57A 4ZB8A 1C72A 1MEKA 2H30A 5F06A 3V1WA 4QL9A 2XC2A 1SK1A 1XOBA 3ZZXA 4LA1A 2B7JA 4GLTA 5A5KA 4MH3A 4IQAA 4Z2RA 5F05A 5A5HB 2LRNA 2GSRA 5A4WA 4EIPA 2VCQA 3ZRDA 1GTIA 3ZLPA 1AW9A 1TOFA 3L9VA 1GULA 1K3YA 4E8HA 1KNGA 1AC1A 3DXBA 3UOMA 5BMUA 4EO3A 3L9UA 2V1MA 1WWJA 2AHEA 1K3LA 4MF5A 3EMXA 5DJMA 3IOSA 1QMVA 2F8AA 2IPAA 3LORA 4NMUA 4BWQA 4ZL8A 5E59A 2QKEA 3WGXA 2HRAA 4KGIA 4Q5QA 2LSTA 1A2JA 4MNNA 1GSDA 2HQTA 2PVOC 2PWJA 5IIZA 3HHVA 3M9JA 1Z9HA 3ZIVA 1EOHA 2ES7A 4POLA 1OYJA 1EGOA 5B7CA 18GSA 3FZ4A 2OE3A 4TR0A 9GSSA 4YKGA 4I2UA 1TI1A 2EFEA 5GSTA 1MD4A 5CRHA 4MA9A 1M9AA 4TR1B 5DCHA 4BL7B 2WULA 4PXOA 4ULXA 2YPMA 3TKSC 3J7Yb 3UVHA 5IO0A 5FT3A 4KF9A 3ZIJA 2RM5A 1G6YA 4CY6A 4GSSA 1SENA 1XFLA 5JWOB 4CW9A 1HNCA 3CRUA 5LCZA 2M80A 5KOXA 2EFDA 4PURA 4GCIA 4CHSA 2B5EA 4XIHA 4GTUA 5ABRA 2WDUA 2QC7A 1LU4A 5HR0A 2H66A 2V2GA 3EU4A 2QGVA 5G2ZA 3W8SA 1TDIA 4OCFA 3DIEA 2L4QA 2WJUA 3HJMA 1FOVA 3KGKA 5IMFA 4E8EA 4ILFA 1T1VA 4DSQA 1MD3A 2V6KA 3APQA 2WGRA 2HSNB 4BA7A 5ECOB 5C00A 2R5GA 2X8HA 3GSSA 1HNAA 1SVOA 4NHWA 5JWRB 2VM1A 2VOCA 2HLSA 1GNEA 3EURA 3WT2A 2P31A 5AGYA 4O5QA 1B9YC 4OO4A 5ECRB 4O7HA 4YQUA 4TXVA 2CX4A 4K1FA 5AIXA 4YAPA 2LNTA 3ED3A 2E2MA 14GSA 2H75A 4PQHA 1G7EA 19GSA 2HSMA 3MSZA 5DAKB 1EP7A 1YJ6A 3GV1A 4RQRA 5JCUA 2NBSA 2QA1A 3GH6A 1SJ6A 3FR6A 2VCVA 3TOUA 1ML6A 2HFDA 4KH7A 1FB6A 1GLQA 4YQMA 4WXTA 16GSA 2OBKA 1FO5A 3QAVA 3G7YA 1Y1UA 3IPZA 1YQ1A 1EP8A 1AUCA 3CYNA 2F8FA 3TU3B 3VI7A 4ZXGA 2ZNMA 3TGZA 2Z9SA 4HJ2A 3APOA 4K7OA 3TRQA 1YY7A 5KEJA 2H19A 12GSA 1XW5A 5CRGA 2LQQA 3FY7A 2FHEA 1B8XA 3IC8A 3Q18A 3CMIA 4QL7A 1LJRA 3EPTA 2R0PA 2LJRA 4K2XA 3GMFA 2EC4A 2VM2A 3CWGA 4AF2A 1TRSA 2R0CA 4NHZA 5CRWA 3FZ9A 4TXOA 2V41A 1XVQA 4FQUA 5L71A 1FW1A 4OWYA 1PRXA 7GSSA 2MMZA 2LJAA 3P8WA 4JRRA 2IN3A 3KCMA 2TRXA 1K0MA 3PH9A 1X5DA 3IV4A 2GVPA 1FOHA 5J47A 3EU3A 1TXUA 2R3XA 3UBLA 1ZMAA 4Z7XA 5CREA 1B4QA 3ZVJD 1JZWA 3QMXA 3UAPA 2C4JA 3TJKA 2QA2A 3VWWA 5J41A 4FYBA 2DBCA 2PPTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CZ2 A;  3EE2 A;  3NOF A;  2PGT A;  1F6M C;  2C80 A;  1ERT A;  3ME7 A;  1O85 A;  3LFL A;  3LGC A;  1X5E A;  3IC4 A;  3F6D A;  1ZZY A;  4AJ7 A;  1F3B A;  2R2J A;  4QQ7 A;  4KDU A;  2B5Y A;  4BWS A;  2MZC A;  4XTS A;  3DML A;  17GS A;  1A0F A;  4ZB6 A;  1EV9 A;  4K7I A;  2G0F A;  3DWV A;  2DJ3 A;  1GH2 A;  4OFN A;  5B8B A;  5ECM B;  1SK2 A;  1TRW A;  1SU9 A;  2LRC A;  2LQO A;  3QFB C;  2XHF A;  1S3D A;  2GSQ A;  2LS5 A;  2E0Q A;  3KEB A;  2CVD A;  4V2N A;  1O8W A;  3HZ4 A;  4KND A;  4JED A;  3D4T A;  2KUC A;  2X8C A;  4KA0 A;  2HRK B;  1YEX A;  1GTU A;  2VCZ A;  2YP6 A;  1A23 A;  1YF0 A;  2I4A A;  3TB2 A;  4MPF A;  2FNO A;  5B6N A;  4TN8 A;  1U6T A;  2K6V A;  1G7O A;  5COH A;  3ZFL A;  4MZC A;  2IIY A;  1GSU A;  4L5L A;  1UVZ A;  1B9X C;  3GNJ A;  1XW9 A;  5G31 A;  3P90 A;  3Q74 A;  2FA4 A;  4G9H A;  3CRT A;  2YWM A;  2AYT A;  1E2Y A;  4XRD A;  4OFM A;  4KX4 A;  4L8E A;  4GRF A;  1EEM A;  1T8E B;  2B1L A;  1THX A;  3HYP A;  3N5O A;  2VCX A;  1GRX A;  4TR1 A;  4BL7 A;  2HSH A;  3GX8 A;  4OMV A;  4WF4 A;  2X8G A;  2XPD A;  2HSM B;  3MDK A;  1J08 A;  2VLU A;  4MCU A;  3D4M A;  1PMT A;  1ACV A;  1PGT A;  1PL2 A;  4ECC A;  4G0I A;  2RUF A;  4L0U A;  4TKY A;  4L0W A;  4TRX A;  2FUG 2;  3BD2 A;  1O81 A;  1GL8 A;  4HU7 A;  1RK4 A;  4WKW A;  3CSH A;  3GUR A;  1ZYQ B;  5J9B A;  3F4S A;  1SKS B;  4K8M A;  4MJA A;  1WJK A;  1ST9 A;  1WPI A;  1K0D A;  3HD5 A;  2ZUP A;  3RPN A;  4G0K A;  4O5R A;  4I5Q A;  2PBJ A;  1O6J A;  2C1Y A;  2F51 A;  2GT6 A;  5IMZ A;  3CTF A;  1OVN A;  3ZML A;  2O87 A;  2ALB A;  1EGR A;  3OR5 A;  2FWG A;  2RLI A;  1E6B A;  1R5A A;  6GSX A;  2H6X A;  2C3N A;  1PX6 A;  5D9X A;  3G7I A;  4IN0 A;  5CAX A;  1IYI A;  2WRT A;  5IPH A;  2CZ3 A;  4KSM A;  2K9F A;  3KM6 A;  2V6O A;  3G9B A;  3I43 A;  2P5R A;  3BBY A;  3M9K A;  2IWT A;  4GF0 A;  1V58 A;  5CYY A;  2YWN A;  5DAK A;  3F3R A;  2LV3 A;  1AIU A;  1ABA A;  4FIW A;  1YF1 A;  2ZCT A;  1EV4 A;  4MF6 A;  2DML A;  3H1N A;  5ECQ B;  2YAN A;  4O32 A;  3LG6 A;  1W89 A;  2N5B A;  2NVL A;  3DVW A;  2JAC A;  1A2M A;  4JBB A;  1A8L A;  3ZYW A;  2DMM A;  2HI7 A;  2GT5 A;  4GQF A;  2DLX A;  1FAA A;  1TU7 A;  1A24 A;  1VF1 A;  2N5F A;  5ID2 B;  2F3M A;  3VUR A;  3HDC A;  2JSY A;  3C7M A;  1TKD B;  1F37 A;  1SK0 A;  2NDO A;  3EVI A;  2GST A;  4K9Z A;  1YDK A;  3F9U A;  2P5Q A;  4WR5 A;  3D0Z A;  3IR4 A;  5ECK B;  1OC9 B;  4F2I A;  5LNK e;  4GSN A;  1X9S B;  1BG5 A;  6GSY A;  4N0Z A;  4MP4 A;  1TK5 B;  1A8Y A;  2IMI A;  3AY8 A;  4POB A;  2JSZ A;  1TXX A;  4Q5R A;  2F9S A;  3IA1 A;  3BOA A;  2HYX A;  4POK A;  2TIR A;  4NV2 A;  3QR6 A;  2FD3 A;  2HNL A;  2YWO A;  2XPE A;  3VFI A;  4WEY A;  4KAE A;  2AB6 A;  6GST A;  3TKQ A;  1X9W B;  2VAF A;  1XWB A;  2E7P A;  1U88 A;  1GWC A;  3KIJ A;  4WBJ A;  4ML6 A;  2IFQ A;  2CX3 A;  4Q5F A;  3DRN A;  1B48 A;  1FHE A;  2FY6 A;  1URM A;  1JLW A;  1V98 A;  5D9W A;  3F4R A;  2L5O A;  2QSI A;  2DJK A;  3F6F A;  2L6C A;  5HFG A;  3WYW A;  1T4Z A;  3LYP A;  2H6Y A;  1Z7R A;  2VL9 A;  5D96 A;  1Z6M A;  3UVT A;  3RHC A;  13GS A;  3HY2 A;  2FWH A;  4XHM A;  1TI3 A;  1GSY A;  1MTC A;  1MDI A;  1KBN A;  3S9F A;  2HRK A;  5D9V A;  3UJ1 A;  4KSO A;  1A2L A;  2HZF A;  3VPQ A;  1OKT A;  1XOA A;  3SWL A;  2WB9 A;  4XCS A;  3GHA A;  1VRS D;  4IVF A;  4NPB A;  1R7H A;  3QCP A;  4HQS A;  4N11 A;  2V32 A;  3O3T A;  4N0V A;  2H73 A;  3F4T A;  4BPY A;  3KP9 A;  3FR9 A;  2C8U A;  1T3B A;  4IKH A;  2RM6 A;  4HOJ A;  3WGE A;  5HR3 A;  4K6X A;  2VUP A;  4V1A g;  3TKR A;  1PX7 A;  2H6Z A;  3F0I A;  2GSS A;  3ERF A;  2EIQ A;  4PTS A;  2LJK A;  1SJZ A;  5LD0 A;  3GKN A;  3IE3 A;  1BYE A;  2FGX A;  1SL0 B;  1U3I A;  3IK9 A;  2PER A;  3Q19 A;  2DSA A;  2VL3 A;  2GZP A;  4FO5 A;  3C1S A;  2MMO A;  3PIN A;  3KH9 A;  3N9J A;  2WS2 A;  6GSW A;  3GL3 A;  4PQI A;  4GST A;  3D21 A;  3IRA A;  1GP1 A;  1G6W A;  1M0U A;  1RQM A;  1TRV A;  5JCW A;  4JR4 A;  4GXZ A;  4HQZ A;  2VL2 A;  4IGJ A;  3C73 A;  2VLT A;  4MPG A;  1PKZ A;  4BVY B;  3A3T A;  3TRP A;  2X99 A;  4IW9 A;  4FYC A;  2PU9 C;  4ZBB A;  1OE7 A;  2RII A;  10GS A;  5DQY A;  4NV5 A;  6GSS A;  4XRA A;  3KD0 A;  3HVS A;  3GST A;  2VIM A;  4MJC A;  3KTL A;  4EE0 A;  1R26 A;  3E9J B;  4OO5 A;  3CSJ A;  2CVB A;  4MAB A;  5G30 A;  3FKF A;  2P0G A;  2NPB A;  3LSZ A;  1BQ7 A;  1I9D A;  3TJJ A;  2H1G A;  4IP6 A;  1Z6N A;  5D93 A;  4RQX A;  4G0L A;  2YNX A;  3D22 A;  4PNG A;  5CRD A;  1DE2 A;  2I1U A;  4MLY A;  4DEJ A;  1CQH A;  3GIX A;  2OAC A;  4RI6 A;  1Z3E A;  2VCT A;  2A4V A;  2YZU A;  2KP2 A;  1DBY A;  5CNW A;  2IFQ B;  2DC5 A;  1EOG A;  1CQG A;  3HZ8 A;  3H93 A;  3GL5 A;  2O7K A;  2LRT A;  4I2T A;  1WRY A;  1HD2 A;  4X0X A;  1ERW A;  5ID2 A;  5J3R A;  4X1U A;  2GTU A;  1ERU A;  4POM A;  3C8E A;  3LQ7 A;  4HZ2 A;  2AV4 A;  4BVX B;  1S3A A;  2WFC A;  1SYX A;  3MAK A;  1Q98 A;  3RBT A;  2H71 A;  5D9T A;  5HQP A;  3KH7 A;  3DEX A;  1OC9 A;  4J56 E;  3J7Y k;  4F03 A;  2JAD A;  8GSS A;  4JZQ A;  1SYR A;  4WET A;  3DVX A;  2VD1 A;  3CXG A;  2KHP A;  2I3Y A;  5INY A;  2KOK A;  2YN1 A;  1WE0 A;  3GTU B;  3TOT A;  3QAG A;  5ECP B;  3CBU A;  3NIV A;  1UN2 A;  3GUS A;  3ZFB A;  3PR8 A;  3IHQ A;  3FEU A;  5ELG A;  4K2D A;  2FCH A;  1WMJ A;  1DUG A;  4TVE A;  4ZB9 A;  4LL4 B;  2C3Q A;  2DJ2 A;  3VK9 A;  1NM3 A;  2B3S A;  3GFK A;  2K8V A;  4LL1 B;  2FWF A;  1SKW B;  1FVJ A;  1F2E A;  1M2A A;  1PQN A;  2REM A;  2AUV A;  1X5C A;  22GS A;  1SL2 B;  3VWX A;  2PUK C;  3ZTL A;  1H75 A;  1K0N A;  1LBK A;  5H5S A;  1VF3 A;  3HXS A;  2R4V A;  3BJ5 A;  3QPM A;  3C1R A;  3UMA A;  3TUE A;  4ZIJ A;  1YKC A;  4OCE A;  1FG4 A;  1TK8 B;  1JHB A;  2H74 A;  4I97 A;  1NHY A;  20GS A;  4IQ1 A;  1O8X A;  4F0C A;  1THO A;  4CDO A;  3TKS E;  5GAN D;  2NTO A;  1FVK A;  5G5E A;  3GKK A;  3QAW A;  4AJ6 A;  2L59 A;  4KB3 A;  1J9B A;  5F07 A;  4IBP A;  1BX9 A;  1T7P B;  3I9V 2;  1YZX A;  3UL3 A;  5KN3 A;  4JU5 A;  1EZK A;  3LYK A;  1ERV A;  3E3E A;  2A2R A;  4TR4 A;  1QGV A;  4EVM A;  3P2A A;  3PGT A;  2H0G A;  3L0H A;  3NZN A;  4L5O A;  1Q4J A;  1FB0 A;  1JZD A;  5G5F A;  2KLX A;  2HSY A;  3U6V A;  4ECJ A;  3DKS A;  1OC3 A;  3R2Q A;  4IHU A;  1OAZ A;  2K18 A;  3HJP A;  1XCC A;  3P7X A;  1ILO A;  5GAP D;  2B7K A;  4H86 A;  4KW6 A;  4X43 A;  4KE3 A;  1XWA A;  4MZW A;  2GS3 A;  1K0C A;  2IMK A;  3K8N A;  3GA4 A;  2OA7 A;  3TKS A;  2H0I A;  1GSQ A;  1ZOF A;  4PUA A;  1W4V A;  5ELA A;  2OE0 A;  4GQC A;  4LMW A;  3GYK A;  5CP1 A;  2EIR A;  2LKU A;  1V9W A;  1V2A A;  3UAR A;  3DGQ A;  3IAM 2;  2DJ0 A;  2H70 A;  4XS6 A;  4ECI A;  2X64 A;  4ZL9 A;  4MF7 A;  2H0H A;  4GWR A;  1AQV A;  3IXR A;  3ISO A;  1V40 A;  3HKR A;  1O7U A;  3RAZ A;  4LLR A;  2MMN A;  2GQK A;  3I69 A;  2H01 A;  1PKW A;  4BVY A;  4MDC A;  1RW1 A;  1H4O A;  1S3C A;  4PNF A;  5KN1 A;  3ZL5 A;  3VPT A;  4EXJ A;  2DIY A;  1VF2 A;  3TJG A;  2I9H A;  4MJE A;  3ZMK A;  3GKM A;  5H5R A;  3M0F A;  1GTA A;  4WF5 A;  4I8B A;  1GTB A;  1XZO A;  1IYH A;  1GSF A;  1KTE A;  1NHO A;  1ZL9 A;  1WIK A;  3KXO A;  4YAV A;  5GSS A;  5GZZ B;  2CQ9 A;  3KMO A;  1XVW A;  5ECI B;  3RPP A;  3QOU A;  3WGD A;  2BMX A;  1K0A A;  2G2Q A;  1AXD A;  4HJM A;  1TU8 A;  1XXU A;  2C0F A;  1X9M B;  1F9M A;  1USB A;  5IQY A;  1DSB A;  5ECL B;  1ON4 A;  1QQ2 A;  5B6M A;  6GSU A;  2H8L A;  3HA9 A;  2D2Z A;  2HZE B;  2FWE A;  1SD9 A;  2CT6 A;  1QFN A;  4ZBA A;  4EL1 A;  1TW9 A;  2MBS A;  1BED A;  2AJQ B;  4J2F A;  3WD6 A;  5ECH B;  4HDE A;  4XS4 B;  4XS1 A;  4MJB A;  3A2W A;  2GLR A;  3LJR A;  4KCE A;  3H79 A;  2AAW A;  1OKD A;  4BVX A;  1SD8 A;  1X0R A;  5JCG A;  3BCI A;  1R5P A;  3IAS 2;  4PGT A;  2B6M A;  1VF4 A;  4FH8 A;  4ZL7 A;  2C0G A;  3FZ5 A;  3U5R E;  3FK8 A;  3M1G A;  2K8S A;  5DJL A;  5HFK A;  2MBT A;  4JE1 A;  2MYG A;  3GTU A;  2HXK A;  4HI7 A;  3CTG A;  1TRU A;  2YOI A;  3M8N A;  1PN9 A;  1A0R P;  3F3Q A;  1GUH A;  4HZ4 A;  4V2M A;  5A4U A;  3W6G A;  4HUA A;  4D73 B;  4DSS B;  3HVV A;  2VO4 A;  3HJO A;  1TP9 A;  4YH2 A;  4AJ8 A;  3KP8 A;  1N8J A;  1HQO A;  2B5X A;  3ME8 A;  4HS1 A;  2VCW A;  1GSE A;  2YZH A;  1BJX A;  1JZR A;  1OE8 A;  3KMN A;  5G1K A;  1UA5 A;  1HYU A;  5HR1 A;  4O92 A;  5EL8 A;  1UC7 A;  2LUS A;  3QDN A;  4K0G A;  2WCI A;  2L4C A;  2J9H A;  3MWH A;  5IOW A;  4IEL A;  2LEG A;  2OBI A;  3TRX A;  3MNG A;  4OFT A;  1PL1 A;  2HRN A;  2IME A;  3VWU A;  2YV7 A;  4NAX A;  4G2E A;  3EMP A;  5AIV A;  2HRF A;  2WZ9 A;  4K7N A;  2H72 A;  3TDG A;  3F8U A;  5JWQ B;  2O8V B;  5DCG A;  3ZIT A;  5E4W A;  1U3A A;  2JU5 A;  4TR3 A;  1SKR B;  11GS A;  4ML1 A;  4MH2 A;  3LXZ A;  2GGT A;  2GZY A;  2R37 A;  1AQX A;  5IMC A;  3RDW A;  2XBQ A;  2H76 A;  5KN0 A;  2O85 A;  2I81 A;  2KP1 A;  4K0N A;  1Y25 A;  1XW6 A;  4PQ1 A;  3LEF A;  4EDY A;  4PX1 A;  3UBK A;  1PA3 A;  1ZYE A;  2CAI A;  4Q5N A;  5H5Q A;  1G0T A;  5DQS A;  2GZZ A;  1NSW A;  5EPF A;  5HFI A;  4F9Z A;  3UIW A;  2A2S A;  2H1B A;  3M3M A;  2O89 A;  3KTB A;  2L6D A;  5J9C A;  1QUW A;  3H4K A;  2N5A A;  2FLS A;  1MDJ A;  5EVO A;  3VLN A;  1XWG A;  3FR3 A;  2PMT A;  3QD9 A;  2DJJ A;  3GRX A;  2HE3 A;  1M99 A;  5IM9 A;  4WBR D;  4F82 A;  1O73 A;  1K0B A;  4G19 A;  3FYG A;  1YEP A;  2IJY A;  4ECB A;  3CSI A;  1Y6E A;  1VGL A;  4HU9 A;  2XBI A;  3F63 A;  4EC0 A;  3TKP A;  2CA8 A;  1GUK A;  5IMD A;  2PN8 A;  2RUE A;  3A2X A;  5HR2 A;  5DAL A;  1GNW A;  2YV9 A;  1QXH A;  2R6K A;  1JZO A;  4PUF C;  3TJB A;  3IBH A;  3KZQ A;  4IJI A;  3QFA C;  1K0O A;  1Z5Y E;  1AQW A;  3FHK A;  1OC8 A;  1SJI A;  1T00 A;  3FRC A;  3GX0 A;  5IO2 A;  5C04 A;  4KDY A;  4F0B A;  4LMV A;  3L4N A;  2CVK A;  1XWK A;  3EC3 A;  4N10 A;  1J0F A;  1M9B A;  5G1L A;  2GQM A;  1I5G A;  4ZIL A;  1V57 A;  4TOP A;  3VWV A;  3A5W A;  4ISD A;  1M2D A;  3DD3 A;  3ZRE A;  2CAQ A;  4AGS A;  3D6I A;  3EIN A;  5F0G A;  4USS A;  1XPV A;  4RI7 A;  3GKX A;  4DVC A;  4V2L A;  2ON5 A;  3BCK A;  3D5J A;  3APS A;  2JZS A;  4MMM A;  1GUM A;  4MZB A;  2E2G A;  2VL2 C;  1T4Y A;  2UZ8 A;  1XBS A;  4EKZ A;  5IMV A;  3O76 A;  5DDL A;  2M72 A;  3UEM A;  1F3A A;  4EUY A;  1B4P A;  3R3E A;  1K3O A;  2MMA A;  4I6X A;  3LXT A;  2OJL A;  1TTZ A;  2C3T A;  3H8Q A;  4IJ3 A;  4ZBD A;  4KDX A;  1PD2 1;  5AIS A;  4EDZ A;  2YWI A;  3EWL A;  1NW2 A;  2HZE A;  1M7T A;  5ENU A;  4DSR A;  4FYU A;  5ECN B;  3PPU A;  2LTK A;  2OE1 A;  1KEB A;  6GSV A;  1YKA A;  1TJD A;  1GLP A;  1TK0 B;  4WR4 A;  2H1D A;  4N30 A;  5ECS A;  3C71 A;  3Q6O A;  1ZGN A;  5IMA A;  1WP0 A;  2CV4 A;  4XS4 A;  3GN3 A;  3L78 A;  1JFU A;  3ERG A;  3ZVJ A;  1DE1 A;  3E0U A;  1MDK A;  2BJX A;  3TJF A;  4HEA 2;  3JCM L;  1EEJ A;  3FW2 A;  2GDR A;  3G7J A;  5EY6 A;  5F8B A;  2DIZ A;  5IPG A;  1BAY A;  1SL1 B;  4MK3 A;  4V1A p;  2LNS A;  2DJ1 A;  1QK8 A;  5DVB A;  4J57 E;  2TRC P;  3SBC A;  5KN2 A;  3EYT A;  4ACS A;  2FA8 A;  4OD7 A;  5IOX A;  2JZR A;  1JLV A;  5J5N A;  1XWC A;  2C0D A;  2JZT A;  4JR6 A;  3ERW A;  1U87 A;  1N2A A;  5DBQ A;  1AAZ A;  2VD0 A;  2BTO T;  3VI5 A;  2EIO A;  3KJY A;  2B1K A;  4D73 A;  4DSS A;  3LWA A;  2YJ7 A;  1GSS A;  1EWX A;  3IDV A;  2OAD A;  1Z7P A;  3RHB A;  2M46 A;  1WOU A;  2PVQ A;  3O6T A;  3US3 A;  4IP1 A;  4YQV A;  1HNB A;  2YCD A;  4KUN A;  1R4W A;  5AN1 A;  5CO3 A;  2IL3 A;  1ZCP A;  5A4V A;  4TXO B;  4P3Y B;  2HT9 A;  5D8I A;  4NXI A;  1XIY A;  3W8J A;  2C0E A;  3TCO A;  4IS0 A;  4EF0 A;  5D73 A;  4KCA A;  2JL4 A;  2IMF A;  5DAL B;  1PSQ A;  3FZA A;  3HVX A;  2IMD A;  3DYR A;  4G10 A;  3I6A A;  4TW5 A;  2GQL A;  5FHI A;  2VLV A;  5J4U A;  3WT1 A;  3IK7 A;  5B8A A;  2J23 A;  3GH9 A;  2H1A A;  1M2B A;  2ON7 A;  5FWG A;  4RUV A;  4NWY A;  2L5L A;  2YJH A;  3L9S A;  3HCZ A;  2OKA A;  4ID0 A;  3A2V A;  2L57 A;  4ZB8 A;  1C72 A;  1MEK A;  2H30 A;  5F06 A;  3V1W A;  4QL9 A;  2XC2 A;  1SK1 A;  1XOB A;  3ZZX A;  4LA1 A;  2B7J A;  4GLT A;  5A5K A;  4MH3 A;  4IQA A;  5F05 A;  2LRN A;  2GSR A;  5A4W A;  2VCQ A;  3ZRD A;  1GTI A;  3ZLP A;  1AW9 A;  1TOF A;  3L9V A;  1GUL A;  1K3Y A;  4E8H A;  1KNG A;  1AC1 A;  3DXB A;  3UOM A;  5BMU A;  4EO3 A;  3L9U A;  2V1M A;  1WWJ A;  2AHE A;  1K3L A;  4MF5 A;  3EMX A;  5DJM A;  3IOS A;  1QMV A;  2F8A A;  2IPA A;  3LOR A;  4NMU A;  4BWQ A;  4ZL8 A;  5E59 A;  2QKE A;  3WGX A;  2HRA A;  4KGI A;  4Q5Q A;  2LST A;  1A2J A;  1GSD A;  2HQT A;  2PVO C;  2PWJ A;  5IIZ A;  3HHV A;  3M9J A;  1Z9H A;  3ZIV A;  1EOH A;  2ES7 A;  4POL A;  1OYJ A;  1EGO A;  5B7C A;  18GS A;  3FZ4 A;  2OE3 A;  4TR0 A;  9GSS A;  4I2U A;  1TI1 A;  5GST A;  1MD4 A;  5CRH A;  4MA9 A;  1M9A A;  4TR1 B;  5DCH A;  4BL7 B;  2WUL A;  4PXO A;  4ULX A;  2YPM A;  3TKS C;  3J7Y b;  3UVH A;  5IO0 A;  5FT3 A;  4KF9 A;  3ZIJ A;  2RM5 A;  1G6Y A;  4GSS A;  1SEN A;  1XFL A;  5JWO B;  4CW9 A;  1HNC A;  3CRU A;  5LCZ A;  2M80 A;  4PUR A;  4GCI A;  4CHS A;  2B5E A;  4XIH A;  4GTU A;  5ABR A;  2WDU A;  2QC7 A;  1LU4 A;  5HR0 A;  2H66 A;  2V2G A;  3EU4 A;  2QGV A;  5G2Z A;  3W8S A;  1TDI A;  4OCF A;  3DIE A;  2L4Q A;  2WJU A;  3HJM A;  1FOV A;  3KGK A;  5IMF A;  4E8E A;  4ILF A;  1T1V A;  4DSQ A;  1MD3 A;  2V6K A;  3APQ A;  2WGR A;  2HSN B;  4BA7 A;  5ECO B;  5C00 A;  2R5G A;  2X8H A;  3GSS A;  1HNA A;  4NHW A;  5JWR B;  2VM1 A;  2VOC A;  2HLS A;  1GNE A;  3EUR A;  3WT2 A;  2P31 A;  5AGY A;  1B9Y C;  4OO4 A;  5ECR B;  4O7H A;  4YQU A;  4TXV A;  2CX4 A;  4K1F A;  5AIX A;  4YAP A;  2LNT A;  3ED3 A;  2E2M A;  14GS A;  2H75 A;  4PQH A;  1G7E A;  19GS A;  2HSM A;  3MSZ A;  5DAK B;  1EP7 A;  1YJ6 A;  3GV1 A;  4RQR A;  5JCU A;  2NBS A;  3GH6 A;  1SJ6 A;  3FR6 A;  2VCV A;  3TOU A;  1ML6 A;  2HFD A;  4KH7 A;  1FB6 A;  1GLQ A;  4YQM A;  4WXT A;  16GS A;  2OBK A;  1FO5 A;  3QAV A;  3G7Y A;  3IPZ A;  1YQ1 A;  1EP8 A;  1AUC A;  3CYN A;  2F8F A;  3VI7 A;  4ZXG A;  2ZNM A;  3TGZ A;  2Z9S A;  4HJ2 A;  4K7O A;  3APO A;  3TRQ A;  1YY7 A;  5KEJ A;  2H19 A;  12GS A;  1XW5 A;  5CRG A;  2LQQ A;  3FY7 A;  2FHE A;  1B8X A;  3IC8 A;  3Q18 A;  3CMI A;  4QL7 A;  1LJR A;  2LJR A;  3GMF A;  2EC4 A;  2VM2 A;  4AF2 A;  1TRS A;  4NHZ A;  5CRW A;  3FZ9 A;  4TXO A;  2V41 A;  1XVQ A;  4FQU A;  5L71 A;  1FW1 A;  4OWY A;  1PRX A;  7GSS A;  2MMZ A;  2LJA A;  3P8W A;  4JRR A;  2IN3 A;  3KCM A;  2TRX A;  1K0M A;  3PH9 A;  1X5D A;  3IV4 A;  2GVP A;  3EU3 A;  2R3X A;  3UBL A;  1ZMA A;  4Z7X A;  5CRE A;  1B4Q A;  3ZVJ D;  1JZW A;  3QMX A;  3UAP A;  2C4J A;  3TJK A;  3VWW A;  5J41 A;  4FYB A;  2DBC A;  2PPT A; 
#chains in the Genus database with same CATH topology
 2CZ2 A;  3EE2 A;  3NOF A;  2PGT A;  1F6M C;  1SVL A;  2C80 A;  1ERT A;  3ME7 A;  1O85 A;  3LFL A;  3LGC A;  1X5E A;  3IC4 A;  3F6D A;  1ZZY A;  4AJ7 A;  1F3B A;  3A5I A;  2R2J A;  4QQ7 A;  4KDU A;  2B5Y A;  4BWS A;  2MZC A;  4XTS A;  3DML A;  17GS A;  1A0F A;  4ZB6 A;  1EV9 A;  4K7I A;  5A5H A;  2G0F A;  3DWV A;  2DJ3 A;  1GH2 A;  4OFN A;  5B8B A;  5ECM B;  2WZS A;  1SK2 A;  1TRW A;  1SU9 A;  1N25 A;  2LRC A;  2LQO A;  3QFB C;  5J40 A;  2XHF A;  1S3D A;  2GSQ A;  2LS5 A;  2E0Q A;  3KEB A;  2CVD A;  4V2N A;  1O8W A;  3HZ4 A;  4KND A;  4JED A;  3D4T A;  2KUC A;  2X8C A;  4KA0 A;  2HRK B;  1YEX A;  1GTU A;  2VCZ A;  2YP6 A;  1A23 A;  1YF0 A;  2I4A A;  3TB2 A;  4MPF A;  2FNO A;  5B6N A;  4TN8 A;  1U6T A;  2K6V A;  1G7O A;  5COH A;  3ZFL A;  4MZC A;  2IIY A;  1GSU A;  4L5L A;  1UVZ A;  1B9X C;  3GNJ A;  1XW9 A;  5G31 A;  3P90 A;  3Q74 A;  2FA4 A;  4G9H A;  3CRT A;  2YWM A;  2AYT A;  1E2Y A;  4XRD A;  4OFM A;  4KX4 A;  4L8E A;  4GRF A;  1EEM A;  1T8E B;  2B1L A;  1THX A;  3HYP A;  3N5O A;  2VCX A;  1GRX A;  4TR1 A;  4BL7 A;  2HSH A;  3GX8 A;  4OMV A;  4WF4 A;  2X8G A;  2XPD A;  2HSM B;  3MDK A;  1J08 A;  2VLU A;  4MCU A;  3D4M A;  1PMT A;  1ACV A;  1PGT A;  1PL2 A;  4ECC A;  4G0I A;  2RUF A;  4L0U A;  4W66 A;  4TKY A;  4L0W A;  4TRX A;  2FUG 2;  3BD2 A;  1O81 A;  1GL8 A;  2DKI A;  4HU7 A;  2EFH A;  1RK4 A;  4WKW A;  3CSH A;  3GUR A;  1ZYQ B;  5J9B A;  2A4H A;  3F4S A;  4K8M A;  1SKS B;  4MJA A;  1WJK A;  1ST9 A;  1WPI A;  1K0D A;  3HD5 A;  4X4J A;  2ZUP A;  3RPN A;  4G0K A;  4O5R A;  4I5Q A;  2PBJ A;  1O6J A;  2C1Y A;  2F51 A;  2GT6 A;  5IMZ A;  3CTF A;  1OVN A;  3ZML A;  2O87 A;  2ALB A;  1EGR A;  3OR5 A;  2FWG A;  2RLI A;  2HSN A;  4ZB7 A;  1E6B A;  1R5A A;  6GSX A;  2H6X A;  2C3N A;  1PX6 A;  5D9X A;  3G7I A;  4IN0 A;  5CAX A;  1IYI A;  2WRT A;  5IPH A;  2CZ3 A;  4KSM A;  2K9F A;  3KM6 A;  2V6O A;  3G9B A;  3I43 A;  2P5R A;  3BBY A;  3M9K A;  2IWT A;  4GF0 A;  1V58 A;  5CYY A;  2YWN A;  5DAK A;  2WW0 A;  3F3R A;  2LV3 A;  1AIU A;  1ABA A;  4FIW A;  1YF1 A;  2ZCT A;  1EV4 A;  4MF6 A;  2DML A;  3H1N A;  5ECQ B;  2YAN A;  4O32 A;  3LG6 A;  1W89 A;  2N5B A;  2NVL A;  3DVW A;  2JAC A;  1A2M A;  2DKH A;  4JBB A;  1A8L A;  3ZYW A;  2DMM A;  2HI7 A;  2GT5 A;  4GQF A;  2DLX A;  1FAA A;  1TU7 A;  1YVL A;  1A24 A;  1VF1 A;  2N5F A;  5ID2 B;  2F3M A;  3VUR A;  3HDC A;  2JSY A;  3C7M A;  1TKD B;  1F37 A;  1SK0 A;  2NDO A;  3EVI A;  4PI0 C;  2GST A;  4K9Z A;  1YDK A;  3F9U A;  2P5Q A;  4WR5 A;  3D0Z A;  3IR4 A;  5ECK B;  1OC9 B;  4F2I A;  5LNK e;  4GSN A;  1X9S B;  1BG5 A;  6GSY A;  4N0Z A;  4MP4 A;  1TK5 B;  1A8Y A;  4HSC X;  2IMI A;  3AY8 A;  4POB A;  2JSZ A;  1TXX A;  4Q5R A;  2F9S A;  3IA1 A;  3BOA A;  2HYX A;  2VKZ G;  1S4B P;  4POK A;  5A1N B;  4AKH A;  2TIR A;  4NV2 A;  3QR6 A;  2FD3 A;  2HNL A;  2YWO A;  2XPE A;  2WW2 A;  3VFI A;  4WEY A;  4KAE A;  2AB6 A;  6GST A;  3TKQ A;  1X9W B;  2VAF A;  1XWB A;  2E7P A;  1U88 A;  1GWC A;  3KIJ A;  4WBJ A;  4ML6 A;  2IFQ A;  2CX3 A;  4Q5F A;  3DRN A;  1B48 A;  1FHE A;  2FY6 A;  1URM A;  1JLW A;  1V98 A;  5D9W A;  3F4R A;  2L5O A;  2QSI A;  2DJK A;  3F6F A;  2L6C A;  5HFG A;  3WYW A;  1T4Z A;  3LYP A;  2H6Y A;  1Z7R A;  2VL9 A;  5D96 A;  1Z6M A;  3UVT A;  3RHC A;  13GS A;  3HY2 A;  4GDF A;  2FWH A;  4XHM A;  4AI6 A;  1TI3 A;  1GSY A;  1MTC A;  1MDI A;  1KBN A;  3S9F A;  2HRK A;  5D9V A;  3UJ1 A;  4KSO A;  1A2L A;  2HZF A;  3VPQ A;  1OKT A;  1XOA A;  3SWL A;  1SVM A;  2WB9 A;  4XCS A;  5A34 B;  3GHA A;  1VRS D;  4BIK A;  4IVF A;  4NPB A;  1R7H A;  3QCP A;  4HQS A;  4N11 A;  2V32 A;  3O3T A;  4N0V A;  2H73 A;  3F4T A;  4BPY A;  3KP9 A;  3FR9 A;  5J4V A;  2C8U A;  1T3B A;  4IKH A;  2RM6 A;  4HOJ A;  3WGE A;  5HR3 A;  4K6X A;  1BF5 A;  2VUP A;  4V1A g;  3TKR A;  1PX7 A;  2H6Z A;  3F0I A;  2GSS A;  3ERF A;  2EIQ A;  4PTS A;  2LJK A;  1SJZ A;  5LD0 A;  3GKN A;  3IE3 A;  1BYE A;  2FGX A;  1SL0 B;  2WVX B;  1U3I A;  3IK9 A;  2PER A;  3Q19 A;  2DSA A;  2VL3 A;  2GZP A;  4FO5 A;  3C1S A;  2MMO A;  3PIN A;  3KH9 A;  3N9J A;  2WS2 A;  6GSW A;  3GL3 A;  4PQI A;  4GST A;  1PN0 A;  3D21 A;  3IRA A;  1GP1 A;  1G6W A;  1M0U A;  1RQM A;  1TRV A;  5JCW A;  4JR4 A;  4GXZ A;  4HQZ A;  2VL2 A;  4IGJ A;  3C73 A;  2VLT A;  4MPG A;  1PKZ A;  4BVY B;  3A3T A;  3TRP A;  2X99 A;  4IW9 A;  4FYC A;  2PU9 C;  4ZBB A;  1OE7 A;  4CY8 A;  2RII A;  10GS A;  5DQY A;  3FMW A;  4NV5 A;  6GSS A;  4XRA A;  3KD0 A;  3HVS A;  3GST A;  1S3R A;  2VIM A;  4MJC A;  3KTL A;  4EE0 A;  1R26 A;  3E9J B;  4OO5 A;  2WW1 A;  3CSJ A;  2CVB A;  4MAB A;  5G30 A;  3FKF A;  2P0G A;  2NPB A;  3LSZ A;  1BQ7 A;  1I9D A;  1M3J A;  2H1G A;  4IP6 A;  3TJJ A;  1Z6N A;  5D93 A;  4RQX A;  4G0L A;  2YNX A;  3D22 A;  4PNG A;  4YKF A;  5CRD A;  1DE2 A;  2I1U A;  4MLY A;  4DEJ A;  1CQH A;  3GIX A;  2OAC A;  4RI6 A;  1Z3E A;  2VCT A;  2WVZ A;  2A4V A;  2YZU A;  2KP2 A;  1DBY A;  5CNW A;  2IFQ B;  2DC5 A;  1EOG A;  1CQG A;  3HZ8 A;  3H93 A;  3GL5 A;  2O7K A;  2LRT A;  4I2T A;  1WRY A;  1HD2 A;  4X0X A;  1ERW A;  5ID2 A;  5J3R A;  4X1U A;  2GTU A;  1ERU A;  4POM A;  3C8E A;  3LQ7 A;  4HZ2 A;  2AV4 A;  4BVX B;  1S3A A;  2WFC A;  1SYX A;  3MAK A;  1Q98 A;  3RBT A;  2H71 A;  5D9T A;  5HQP A;  3KH7 A;  3DEX A;  1OC9 A;  4J56 E;  3J7Y k;  4F03 A;  2JAD A;  8GSS A;  4JZQ A;  1SYR A;  4WET A;  3DVX A;  2VD1 A;  3CXG A;  2KHP A;  2I3Y A;  5INY A;  2KOK A;  2YN1 A;  1WE0 A;  3GTU B;  3TOT A;  3QAG A;  5ECP B;  3CBU A;  3NIV A;  1UN2 A;  3GUS A;  3ZFB A;  3PR8 A;  3IHQ A;  3FEU A;  5ELG A;  5A1N A;  2FCH A;  4K2D A;  1WMJ A;  1DUG A;  4TVE A;  4ZB9 A;  4LL4 B;  2C3Q A;  2DJ2 A;  3VK9 A;  1NM3 A;  2B3S A;  3GFK A;  2K8V A;  4LL1 B;  2FWF A;  1SKW B;  1FVJ A;  1F2E A;  1M2A A;  1PQN A;  2REM A;  2AUV A;  1X5C A;  22GS A;  1SL2 B;  3VWX A;  2PUK C;  3ZTL A;  1H75 A;  1K0N A;  1LBK A;  1YEW C;  5H5S A;  1VF3 A;  3HXS A;  2R4V A;  3BJ5 A;  3QPM A;  3C1R A;  3UMA A;  3TUE A;  4ZIJ A;  1YKC A;  4OCE A;  1FG4 A;  4AKX B;  1TK8 B;  1JHB A;  2H74 A;  4I97 A;  1NHY A;  20GS A;  4IQ1 A;  1O8X A;  4F0C A;  1THO A;  4CDO A;  3TKS E;  5GAN D;  2NTO A;  1FVK A;  5G5E A;  3GKK A;  3QAW A;  4AJ6 A;  2L59 A;  4KB3 A;  1J9B A;  5F07 A;  4IBP A;  1BX9 A;  1T7P B;  3I9V 2;  1YZX A;  3UL3 A;  5KN3 A;  4JU5 A;  1EZK A;  2EFC A;  5A34 A;  3LYK A;  1ERV A;  3E3E A;  2A2R A;  4TR4 A;  1QGV A;  4EVM A;  3P2A A;  3PGT A;  2H0G A;  3L0H A;  3NZN A;  4L5O A;  1Q4J A;  3LW9 A;  1FB0 A;  1JZD A;  5G5F A;  2KLX A;  2HSY A;  2UV8 G;  3U6V A;  4ECJ A;  3DKS A;  1OC3 A;  3R2Q A;  4IHU A;  1OAZ A;  2K18 A;  1BG1 A;  3HJP A;  1XCC A;  3P7X A;  1ILO A;  5GAP D;  2B7K A;  4H86 A;  4KW6 A;  4X43 A;  4KE3 A;  1XWA A;  4MZW A;  2GS3 A;  1K0C A;  2IMK A;  3K8N A;  3GA4 A;  4K5R A;  5J4Y A;  2OA7 A;  2WVX A;  3TKS A;  2H0I A;  1GSQ A;  1ZOF A;  4PUA A;  1W4V A;  5ELA A;  2OE0 A;  4GQC A;  4LMW A;  3GYK A;  2X49 A;  5CP1 A;  2EIR A;  4EIQ A;  2LKU A;  1V9W A;  1V2A A;  3UAR A;  3DGQ A;  3IAM 2;  2DJ0 A;  2H70 A;  4XS6 A;  4ECI A;  2X64 A;  4ZL9 A;  5KOW A;  4MF7 A;  2H0H A;  4GWR A;  1AQV A;  3IXR A;  3ISO A;  1V40 A;  3HKR A;  1O7U A;  3RAZ A;  4LLR A;  2MMN A;  2GQK A;  3I69 A;  2H01 A;  1PKW A;  4BVY A;  4MDC A;  1RW1 A;  1H4O A;  1S3C A;  4PNF A;  5KN1 A;  3ZL5 A;  3VPT A;  4EXJ A;  2DIY A;  1VF2 A;  3TJG A;  2I9H A;  4MJE A;  3ZMK A;  3GKM A;  5H5R A;  3M0F A;  1GTA A;  4WF5 A;  4I8B A;  1GTB A;  1XZO A;  1IYH A;  1GSF A;  1KTE A;  1NHO A;  1ZL9 A;  1WIK A;  3KXO A;  4YAV A;  5GSS A;  5GZZ B;  2CQ9 A;  3KMO A;  1XVW A;  5ECI B;  3RPP A;  3QOU A;  3WGD A;  2BMX A;  1K0A A;  2G2Q A;  1AXD A;  4HJM A;  1TU8 A;  4G01 A;  1XXU A;  2C0F A;  1X9M B;  1F9M A;  1ZYP A;  1USB A;  5IQY A;  1DSB A;  5ECL B;  1ON4 A;  1QQ2 A;  5B6M A;  6GSU A;  2H8L A;  3HA9 A;  2D2Z A;  2HZE B;  2FWE A;  1SD9 A;  2CT6 A;  1QFN A;  4ZBA A;  4EL1 A;  1TW9 A;  1I1I P;  2MBS A;  1BED A;  2AJQ B;  4J2F A;  3WD6 A;  5ECH B;  4HDE A;  4XS4 B;  4XS1 A;  4MJB A;  3A2W A;  2GLR A;  3LJR A;  4KCE A;  1XG8 A;  3H79 A;  2AAW A;  1OKD A;  4BVX A;  1SD8 A;  1X0R A;  5JCG A;  3BCI A;  1R5P A;  3IAS 2;  4PGT A;  2B6M A;  1VF4 A;  4FH8 A;  4ZL7 A;  2C0G A;  3FZ5 A;  3U5R E;  3FK8 A;  3M1G A;  2K8S A;  5DJL A;  5HFK A;  2MBT A;  4JE1 A;  2MYG A;  3GTU A;  2HXK A;  4HI7 A;  3CTG A;  1TRU A;  2YOI A;  3M8N A;  1PN9 A;  1A0R P;  3F3Q A;  1GUH A;  4HZ4 A;  4V2M A;  5A4U A;  3W6G A;  4HUA A;  4D73 B;  4DSS B;  3HVV A;  2VO4 A;  3HJO A;  1TP9 A;  4YH2 A;  4AJ8 A;  3KP8 A;  1N8J A;  1HQO A;  2B5X A;  3ME8 A;  4HS1 A;  2VCW A;  1GSE A;  2YZH A;  4N3Z A;  4A5P A;  1BJX A;  1JZR A;  1OE8 A;  3KMN A;  5G1K A;  1UA5 A;  1HYU A;  5HR1 A;  3RGB C;  4O92 A;  5EL8 A;  1UC7 A;  2LUS A;  3QDN A;  4K0G A;  2WCI A;  2L4C A;  2J9H A;  3MWH A;  5IOW A;  4IEL A;  2LEG A;  2OBI A;  3TRX A;  3MNG A;  4OFT A;  1PL1 A;  2HRN A;  2IME A;  3VWU A;  2YV7 A;  4NAX A;  4G2E A;  3EMP A;  5AIV A;  2HRF A;  2WZ9 A;  4K7N A;  2H72 A;  3TDG A;  3F8U A;  3IHG A;  5JWQ B;  2O8V B;  5DCG A;  3ZIT A;  5E4W A;  1U3A A;  2JU5 A;  4TR3 A;  1SKR B;  11GS A;  4ML1 A;  4MH2 A;  3LXZ A;  2GGT A;  2O5V A;  2GZY A;  2R37 A;  1AQX A;  5IMC A;  3RDW A;  2XBQ A;  2H76 A;  5KN0 A;  2O85 A;  4Z2T A;  2I81 A;  2KP1 A;  4K0N A;  1Y25 A;  1XW6 A;  4PQ1 A;  3LEF A;  4EDY A;  4PX1 A;  3UBK A;  1PA3 A;  1ZYE A;  2CAI A;  4Q5N A;  5H5Q A;  1G0T A;  5DQS A;  2GZZ A;  1NSW A;  5EPF A;  5HFI A;  4F9Z A;  3UIW A;  2A2S A;  2H1B A;  3M3M A;  2O89 A;  3KTB A;  2L6D A;  5J9C A;  1QUW A;  3H4K A;  2N5A A;  2FLS A;  1MDJ A;  2A2P A;  5EVO A;  3VLN A;  1XWG A;  3FR3 A;  2PMT A;  3QD9 A;  2DJJ A;  4QMK A;  3GRX A;  2HE3 A;  1M99 A;  3HVN A;  5IM9 A;  4WBR D;  4F82 A;  1O73 A;  2R0G A;  1K0B A;  4G19 A;  3FYG A;  1YEP A;  2IJY A;  4ECB A;  3CSI A;  5BMU B;  1Y6E A;  1VGL A;  4HU9 A;  5BRT A;  2XBI A;  3F63 A;  4EC0 A;  3TKP A;  2CA8 A;  1GUK A;  5IMD A;  2PN8 A;  2RUE A;  3A2X A;  5HR2 A;  5DAL A;  1GNW A;  2YV9 A;  1QXH A;  2R6K A;  1JZO A;  4PUF C;  1PFO A;  3TJB A;  3IBH A;  3KZQ A;  4IJI A;  3QFA C;  1K0O A;  1Z5Y E;  1ZYN A;  1AQW A;  3FHK A;  1OC8 A;  1SJI A;  3MIX A;  3RFR C;  1T00 A;  3FRC A;  3GX0 A;  5IO2 A;  5C04 A;  4KDY A;  4F0B A;  4LMV A;  3L4N A;  2CVK A;  1XWK A;  3EC3 A;  4N10 A;  1J0F A;  1M9B A;  5G1L A;  2GQM A;  1I5G A;  4ZIL A;  1V57 A;  4TOP A;  3VWV A;  3A5W A;  4ISD A;  1M2D A;  3DD3 A;  3ZRE A;  2CAQ A;  4AGS A;  3D6I A;  3EIN A;  3HMJ G;  5F0G A;  4USS A;  1XPV A;  4RI7 A;  3GKX A;  4DVC A;  4V2L A;  2ON5 A;  3BCK A;  3D5J A;  4ICY A;  3APS A;  2JZS A;  4Z2U A;  4MMM A;  1GUM A;  4MZB A;  2E2G A;  2VL2 C;  1T4Y A;  2UZ8 A;  1XBS A;  4EKZ A;  5IMV A;  3O76 A;  5DDL A;  2M72 A;  3UEM A;  1F3A A;  4EUY A;  1B4P A;  3R3E A;  1K3O A;  2MMA A;  4I6X A;  3LXT A;  2OJL A;  1TTZ A;  2C3T A;  3H8Q A;  4IJ3 A;  4ZBD A;  4KDX A;  1PD2 1;  5AIS A;  4EDZ A;  2YWI A;  3EWL A;  1NW2 A;  2HZE A;  1M7T A;  5ENU A;  4DSR A;  4FYU A;  5ECN B;  3PPU A;  2LTK A;  2OE1 A;  1KEB A;  6GSV A;  1YKA A;  1TJD A;  1GLP A;  1TK0 B;  4WR4 A;  2H1D A;  4N30 A;  5ECS A;  3C71 A;  3Q6O A;  1ZGN A;  5IMA A;  1WP0 A;  1M3I A;  2CV4 A;  4XS4 A;  3GN3 A;  2OT3 A;  3L78 A;  1JFU A;  3ERG A;  3ZVJ A;  1DE1 A;  3E0U A;  1MDK A;  2BJX A;  3TJF A;  4HEA 2;  3JCM L;  1EEJ A;  3FW2 A;  2GDR A;  3G7J A;  5EY6 A;  5F8B A;  2DIZ A;  5IPG A;  1BAY A;  1SL1 B;  4MK3 A;  4V1A p;  2LNS A;  2DJ1 A;  1QK8 A;  3MYD A;  5DVB A;  2WVY A;  4J57 E;  2TRC P;  3SBC A;  5KN2 A;  3EYT A;  4E68 A;  4ACS A;  2FA8 A;  4OD7 A;  5IOX A;  2JZR A;  1JLV A;  5J5N A;  1XWC A;  2C0D A;  4PI2 C;  2JZT A;  2H1L A;  4JR6 A;  3ERW A;  1U87 A;  1N2A A;  5DBQ A;  1AAZ A;  2VD0 A;  2BTO T;  3VI5 A;  2EIO A;  3KJY A;  2B1K A;  4D73 A;  4DSS A;  3LWA A;  2YJ7 A;  1GSS A;  1EWX A;  4AKI A;  3IDV A;  2OAD A;  1Z7P A;  3RHB A;  2M46 A;  4O5U A;  1WOU A;  2PVQ A;  3O6T A;  4AKG A;  3US3 A;  4IP1 A;  4YQV A;  1HNB A;  2YCD A;  4KUN A;  1R4W A;  5AN1 A;  5CO3 A;  2IL3 A;  1ZCP A;  5A4V A;  4TXO B;  4P3Y B;  2HT9 A;  5D8I A;  4NXI A;  1XIY A;  3W8J A;  2C0E A;  3TCO A;  4IS0 A;  4EF0 A;  5D73 A;  4KCA A;  2JL4 A;  2IMF A;  5DAL B;  1PSQ A;  3FZA A;  3HVX A;  2IMD A;  3DYR A;  4G10 A;  3I6A A;  4TW5 A;  4K5S A;  2GQL A;  5FHI A;  2VLV A;  5J4U A;  3WT1 A;  3IK7 A;  5B8A A;  2J23 A;  3GH9 A;  2H1A A;  1M2B A;  2ON7 A;  5FWG A;  4RUV A;  4NWY A;  2X4A A;  2L5L A;  2YJH A;  3L9S A;  3HCZ A;  2OKA A;  4ID0 A;  3A2V A;  2L57 A;  4ZB8 A;  1C72 A;  1MEK A;  2H30 A;  5F06 A;  3V1W A;  4QL9 A;  2XC2 A;  2O3E A;  1SK1 A;  1XOB A;  3ZZX A;  4LA1 A;  2B7J A;  4GLT A;  5A5K A;  4MH3 A;  4IQA A;  4Z2R A;  5F05 A;  5A5H B;  2LRN A;  2GSR A;  5A4W A;  4EIP A;  2VCQ A;  3ZRD A;  1GTI A;  3ZLP A;  1AW9 A;  1TOF A;  3L9V A;  1GUL A;  1K3Y A;  4FXY P;  4E8H A;  1KNG A;  1AC1 A;  3DXB A;  3UOM A;  5BMU A;  4EO3 A;  3L9U A;  2V1M A;  1WWJ A;  2AHE A;  1K3L A;  4MF5 A;  3EMX A;  5DJM A;  3IOS A;  1QMV A;  2F8A A;  2IPA A;  3LOR A;  4NMU A;  4BWQ A;  4ZL8 A;  5E59 A;  2QKE A;  3WGX A;  2HRA A;  4KGI A;  4Q5Q A;  2LST A;  1A2J A;  4MNN A;  1GSD A;  2HQT A;  2PVO C;  2PWJ A;  5IIZ A;  3HHV A;  3M9J A;  1Z9H A;  3ZIV A;  1EOH A;  2ES7 A;  4POL A;  1OYJ A;  1EGO A;  5B7C A;  18GS A;  3FZ4 A;  2OE3 A;  4TR0 A;  9GSS A;  4YKG A;  4I2U A;  1TI1 A;  2EFE A;  5GST A;  1MD4 A;  5CRH A;  4MA9 A;  1M9A A;  4TR1 B;  5DCH A;  4BL7 B;  2WUL A;  4PXO A;  4ULX A;  3CQF A;  2YPM A;  3TKS C;  3J7Y b;  3UVH A;  5IO0 A;  5FT3 A;  4KF9 A;  3ZIJ A;  2RM5 A;  1G6Y A;  4CY6 A;  4GSS A;  1SEN A;  1XFL A;  5JWO B;  4CW9 A;  1HNC A;  3CRU A;  5LCZ A;  2M80 A;  5KOX A;  2EFD A;  4PUR A;  4GCI A;  4CHS A;  2B5E A;  4XIH A;  4GTU A;  5ABR A;  2WDU A;  2QC7 A;  1LU4 A;  5HR0 A;  2H66 A;  2V2G A;  3EU4 A;  2QGV A;  5G2Z A;  3W8S A;  1TDI A;  4OCF A;  3DIE A;  2L4Q A;  2WJU A;  3HJM A;  1FOV A;  3KGK A;  5IMF A;  4E8E A;  4ILF A;  1T1V A;  4DSQ A;  1MD3 A;  2V6K A;  3APQ A;  2WGR A;  2HSN B;  4BA7 A;  5ECO B;  5C00 A;  2R5G A;  2X8H A;  3GSS A;  1HNA A;  1SVO A;  4NHW A;  5JWR B;  3CHX C;  2VM1 A;  2VOC A;  2HLS A;  1GNE A;  3EUR A;  3WT2 A;  2P31 A;  5AGY A;  4O5Q A;  1B9Y C;  4OO4 A;  5ECR B;  4O7H A;  4YQU A;  4PHZ C;  4TXV A;  2CX4 A;  4K1F A;  5AIX A;  4YAP A;  2LNT A;  3ED3 A;  2E2M A;  14GS A;  2H75 A;  4PQH A;  1G7E A;  19GS A;  2HSM A;  3MSZ A;  5DAK B;  1EP7 A;  1YJ6 A;  3GV1 A;  4RQR A;  5JCU A;  2NBS A;  2QA1 A;  3GH6 A;  1SJ6 A;  3FR6 A;  2VCV A;  3TOU A;  1ML6 A;  2HFD A;  4KH7 A;  1FB6 A;  1GLQ A;  4YQM A;  4WXT A;  16GS A;  2OBK A;  1FO5 A;  3QAV A;  3G7Y A;  1Y1U A;  3IPZ A;  1YQ1 A;  2O36 A;  1AUC A;  1EP8 A;  3CYN A;  2F8F A;  3TU3 B;  3VI7 A;  4ZXG A;  2ZNM A;  3TGZ A;  2Z9S A;  4HJ2 A;  3APO A;  4K7O A;  3TRQ A;  1YY7 A;  5KEJ A;  2H19 A;  12GS A;  1XW5 A;  5CRG A;  2LQQ A;  3FY7 A;  2FHE A;  1B8X A;  3IC8 A;  3Q18 A;  3CMI A;  4QL7 A;  1LJR A;  3EPT A;  2R0P A;  2LJR A;  4K2X A;  3GMF A;  2EC4 A;  2VM2 A;  3CWG A;  4AF2 A;  1TRS A;  2R0C A;  4NHZ A;  5CRW A;  3FZ9 A;  4TXO A;  2V41 A;  1XVQ A;  4FQU A;  5L71 A;  1FW1 A;  4OWY A;  1PRX A;  7GSS A;  2MMZ A;  2LJA A;  3P8W A;  4JRR A;  2IN3 A;  3KCM A;  2TRX A;  1K0M A;  3PH9 A;  1X5D A;  3IV4 A;  2GVP A;  1FOH A;  5J47 A;  3EU3 A;  1TXU A;  2R3X A;  3UBL A;  1ZMA A;  4Z7X A;  5CRE A;  1B4Q A;  3ZVJ D;  1JZW A;  3QMX A;  3UAP A;  2C4J A;  3TJK A;  2QA2 A;  3VWW A;  2WW3 A;  5J41 A;  4FYB A;  2DBC A;  2PPT A; 
#chains in the Genus database with same CATH homology
 2CZ2 A;  3EE2 A;  3NOF A;  2PGT A;  1F6M C;  1SVL A;  2C80 A;  1ERT A;  3ME7 A;  1O85 A;  3LFL A;  3LGC A;  1X5E A;  3IC4 A;  3F6D A;  1ZZY A;  4AJ7 A;  1F3B A;  3A5I A;  2R2J A;  4QQ7 A;  4KDU A;  2B5Y A;  4BWS A;  2MZC A;  4XTS A;  3DML A;  17GS A;  1A0F A;  4ZB6 A;  1EV9 A;  4K7I A;  5A5H A;  2G0F A;  3DWV A;  2DJ3 A;  1GH2 A;  4OFN A;  5B8B A;  5ECM B;  1SK2 A;  1TRW A;  1SU9 A;  1N25 A;  2LRC A;  2LQO A;  3QFB C;  5J40 A;  2XHF A;  1S3D A;  2GSQ A;  2LS5 A;  2E0Q A;  3KEB A;  2CVD A;  4V2N A;  1O8W A;  3HZ4 A;  4KND A;  4JED A;  3D4T A;  2KUC A;  2X8C A;  4KA0 A;  2HRK B;  1YEX A;  1GTU A;  2VCZ A;  2YP6 A;  1A23 A;  1YF0 A;  2I4A A;  3TB2 A;  4MPF A;  2FNO A;  5B6N A;  4TN8 A;  1U6T A;  2K6V A;  1G7O A;  5COH A;  3ZFL A;  4MZC A;  2IIY A;  1GSU A;  4L5L A;  1UVZ A;  1B9X C;  3GNJ A;  1XW9 A;  5G31 A;  3P90 A;  3Q74 A;  2FA4 A;  4G9H A;  3CRT A;  2YWM A;  2AYT A;  1E2Y A;  4XRD A;  4OFM A;  4KX4 A;  4L8E A;  4GRF A;  1EEM A;  1T8E B;  2B1L A;  1THX A;  3HYP A;  3N5O A;  2VCX A;  1GRX A;  4TR1 A;  4BL7 A;  2HSH A;  3GX8 A;  4OMV A;  4WF4 A;  2X8G A;  2XPD A;  2HSM B;  3MDK A;  1J08 A;  2VLU A;  4MCU A;  3D4M A;  1PMT A;  1ACV A;  1PGT A;  1PL2 A;  4ECC A;  4G0I A;  2RUF A;  4L0U A;  4W66 A;  4TKY A;  4L0W A;  4TRX A;  2FUG 2;  3BD2 A;  1O81 A;  1GL8 A;  2DKI A;  4HU7 A;  2EFH A;  1RK4 A;  4WKW A;  3CSH A;  3GUR A;  1ZYQ B;  5J9B A;  2A4H A;  3F4S A;  4K8M A;  1SKS B;  4MJA A;  1WJK A;  1ST9 A;  1WPI A;  1K0D A;  3HD5 A;  4X4J A;  2ZUP A;  3RPN A;  4G0K A;  4O5R A;  4I5Q A;  2PBJ A;  1O6J A;  2C1Y A;  2F51 A;  2GT6 A;  5IMZ A;  3CTF A;  1OVN A;  3ZML A;  2O87 A;  2ALB A;  1EGR A;  3OR5 A;  2FWG A;  2RLI A;  2HSN A;  4ZB7 A;  1E6B A;  1R5A A;  6GSX A;  2H6X A;  2C3N A;  1PX6 A;  5D9X A;  3G7I A;  4IN0 A;  5CAX A;  1IYI A;  2WRT A;  5IPH A;  2CZ3 A;  4KSM A;  2K9F A;  3KM6 A;  2V6O A;  3G9B A;  3I43 A;  2P5R A;  3BBY A;  3M9K A;  2IWT A;  4GF0 A;  1V58 A;  5CYY A;  2YWN A;  5DAK A;  3F3R A;  2LV3 A;  1AIU A;  1ABA A;  4FIW A;  1YF1 A;  2ZCT A;  1EV4 A;  4MF6 A;  2DML A;  3H1N A;  5ECQ B;  2YAN A;  4O32 A;  3LG6 A;  1W89 A;  2N5B A;  2NVL A;  3DVW A;  2JAC A;  1A2M A;  2DKH A;  4JBB A;  1A8L A;  3ZYW A;  2DMM A;  2HI7 A;  2GT5 A;  4GQF A;  2DLX A;  1FAA A;  1TU7 A;  1YVL A;  1A24 A;  1VF1 A;  2N5F A;  5ID2 B;  2F3M A;  3VUR A;  3HDC A;  2JSY A;  3C7M A;  1TKD B;  1F37 A;  1SK0 A;  2NDO A;  3EVI A;  2GST A;  4K9Z A;  1YDK A;  3F9U A;  2P5Q A;  4WR5 A;  3D0Z A;  3IR4 A;  5ECK B;  1OC9 B;  4F2I A;  5LNK e;  4GSN A;  1X9S B;  1BG5 A;  6GSY A;  4N0Z A;  4MP4 A;  1TK5 B;  1A8Y A;  2IMI A;  3AY8 A;  4POB A;  2JSZ A;  1TXX A;  4Q5R A;  2F9S A;  3IA1 A;  3BOA A;  2HYX A;  2VKZ G;  4POK A;  5A1N B;  4AKH A;  2TIR A;  4NV2 A;  3QR6 A;  2FD3 A;  2HNL A;  2YWO A;  2XPE A;  3VFI A;  4WEY A;  4KAE A;  2AB6 A;  6GST A;  3TKQ A;  1X9W B;  2VAF A;  1XWB A;  2E7P A;  1U88 A;  1GWC A;  3KIJ A;  4WBJ A;  4ML6 A;  2IFQ A;  2CX3 A;  4Q5F A;  3DRN A;  1B48 A;  1FHE A;  2FY6 A;  1URM A;  1JLW A;  1V98 A;  5D9W A;  3F4R A;  2L5O A;  2QSI A;  2DJK A;  3F6F A;  2L6C A;  5HFG A;  3WYW A;  1T4Z A;  3LYP A;  2H6Y A;  1Z7R A;  2VL9 A;  5D96 A;  1Z6M A;  3UVT A;  3RHC A;  13GS A;  3HY2 A;  4GDF A;  2FWH A;  4XHM A;  4AI6 A;  1TI3 A;  1GSY A;  1MTC A;  1MDI A;  1KBN A;  3S9F A;  2HRK A;  5D9V A;  3UJ1 A;  4KSO A;  1A2L A;  2HZF A;  3VPQ A;  1OKT A;  1XOA A;  3SWL A;  1SVM A;  2WB9 A;  4XCS A;  5A34 B;  3GHA A;  1VRS D;  4IVF A;  4NPB A;  1R7H A;  3QCP A;  4HQS A;  4N11 A;  2V32 A;  3O3T A;  4N0V A;  2H73 A;  3F4T A;  4BPY A;  3KP9 A;  3FR9 A;  5J4V A;  2C8U A;  1T3B A;  4IKH A;  2RM6 A;  4HOJ A;  3WGE A;  5HR3 A;  4K6X A;  1BF5 A;  2VUP A;  4V1A g;  3TKR A;  1PX7 A;  2H6Z A;  3F0I A;  2GSS A;  3ERF A;  2EIQ A;  4PTS A;  2LJK A;  1SJZ A;  5LD0 A;  3GKN A;  3IE3 A;  1BYE A;  2FGX A;  1SL0 B;  1U3I A;  3IK9 A;  2PER A;  3Q19 A;  2DSA A;  2VL3 A;  2GZP A;  4FO5 A;  3C1S A;  2MMO A;  3PIN A;  3KH9 A;  3N9J A;  2WS2 A;  6GSW A;  3GL3 A;  4PQI A;  4GST A;  1PN0 A;  3D21 A;  3IRA A;  1GP1 A;  1G6W A;  1M0U A;  1RQM A;  1TRV A;  5JCW A;  4JR4 A;  4GXZ A;  4HQZ A;  2VL2 A;  4IGJ A;  3C73 A;  2VLT A;  4MPG A;  1PKZ A;  4BVY B;  3A3T A;  3TRP A;  2X99 A;  4IW9 A;  4FYC A;  2PU9 C;  4ZBB A;  1OE7 A;  4CY8 A;  2RII A;  10GS A;  5DQY A;  3FMW A;  4NV5 A;  6GSS A;  4XRA A;  3KD0 A;  3HVS A;  3GST A;  2VIM A;  4MJC A;  3KTL A;  4EE0 A;  1R26 A;  3E9J B;  4OO5 A;  3CSJ A;  2CVB A;  4MAB A;  5G30 A;  3FKF A;  2P0G A;  2NPB A;  3LSZ A;  1BQ7 A;  1I9D A;  3TJJ A;  2H1G A;  4IP6 A;  1Z6N A;  5D93 A;  4RQX A;  4G0L A;  2YNX A;  3D22 A;  4PNG A;  4YKF A;  5CRD A;  1DE2 A;  2I1U A;  4MLY A;  4DEJ A;  1CQH A;  3GIX A;  2OAC A;  4RI6 A;  1Z3E A;  2VCT A;  2A4V A;  2YZU A;  2KP2 A;  1DBY A;  5CNW A;  2IFQ B;  2DC5 A;  1EOG A;  1CQG A;  3HZ8 A;  3H93 A;  3GL5 A;  2O7K A;  2LRT A;  4I2T A;  1WRY A;  1HD2 A;  4X0X A;  1ERW A;  5ID2 A;  5J3R A;  4X1U A;  2GTU A;  1ERU A;  4POM A;  3C8E A;  3LQ7 A;  4HZ2 A;  2AV4 A;  4BVX B;  1S3A A;  2WFC A;  1SYX A;  3MAK A;  1Q98 A;  3RBT A;  2H71 A;  5D9T A;  5HQP A;  3KH7 A;  3DEX A;  1OC9 A;  4J56 E;  3J7Y k;  4F03 A;  2JAD A;  8GSS A;  4JZQ A;  1SYR A;  4WET A;  3DVX A;  2VD1 A;  3CXG A;  2KHP A;  2I3Y A;  5INY A;  2KOK A;  2YN1 A;  1WE0 A;  3GTU B;  3TOT A;  3QAG A;  5ECP B;  3CBU A;  3NIV A;  1UN2 A;  3GUS A;  3ZFB A;  3PR8 A;  3IHQ A;  3FEU A;  5ELG A;  5A1N A;  2FCH A;  4K2D A;  1WMJ A;  1DUG A;  4TVE A;  4ZB9 A;  4LL4 B;  2C3Q A;  2DJ2 A;  3VK9 A;  1NM3 A;  2B3S A;  3GFK A;  2K8V A;  4LL1 B;  2FWF A;  1SKW B;  1FVJ A;  1F2E A;  1M2A A;  1PQN A;  2REM A;  2AUV A;  1X5C A;  22GS A;  1SL2 B;  3VWX A;  2PUK C;  3ZTL A;  1H75 A;  1K0N A;  1LBK A;  5H5S A;  1VF3 A;  3HXS A;  2R4V A;  3BJ5 A;  3QPM A;  3C1R A;  3UMA A;  3TUE A;  4ZIJ A;  1YKC A;  4OCE A;  1FG4 A;  4AKX B;  1TK8 B;  1JHB A;  2H74 A;  4I97 A;  1NHY A;  20GS A;  4IQ1 A;  1O8X A;  4F0C A;  1THO A;  4CDO A;  3TKS E;  5GAN D;  2NTO A;  1FVK A;  5G5E A;  3GKK A;  3QAW A;  4AJ6 A;  2L59 A;  4KB3 A;  1J9B A;  5F07 A;  4IBP A;  1BX9 A;  1T7P B;  3I9V 2;  1YZX A;  3UL3 A;  5KN3 A;  4JU5 A;  1EZK A;  2EFC A;  5A34 A;  3LYK A;  1ERV A;  3E3E A;  2A2R A;  4TR4 A;  1QGV A;  4EVM A;  3P2A A;  3PGT A;  2H0G A;  3L0H A;  3NZN A;  4L5O A;  1Q4J A;  3LW9 A;  1FB0 A;  1JZD A;  5G5F A;  2KLX A;  2HSY A;  2UV8 G;  3U6V A;  4ECJ A;  3DKS A;  1OC3 A;  3R2Q A;  4IHU A;  1OAZ A;  2K18 A;  1BG1 A;  3HJP A;  1XCC A;  3P7X A;  1ILO A;  5GAP D;  2B7K A;  4H86 A;  4KW6 A;  4X43 A;  4KE3 A;  1XWA A;  4MZW A;  2GS3 A;  1K0C A;  2IMK A;  3K8N A;  3GA4 A;  4K5R A;  5J4Y A;  2OA7 A;  3TKS A;  2H0I A;  1GSQ A;  1ZOF A;  4PUA A;  1W4V A;  5ELA A;  2OE0 A;  4GQC A;  4LMW A;  3GYK A;  2X49 A;  5CP1 A;  2EIR A;  4EIQ A;  2LKU A;  1V9W A;  1V2A A;  3UAR A;  3DGQ A;  3IAM 2;  2DJ0 A;  2H70 A;  4XS6 A;  4ECI A;  2X64 A;  4ZL9 A;  5KOW A;  4MF7 A;  2H0H A;  4GWR A;  1AQV A;  3IXR A;  3ISO A;  1V40 A;  3HKR A;  1O7U A;  3RAZ A;  4LLR A;  2MMN A;  2GQK A;  3I69 A;  2H01 A;  1PKW A;  4BVY A;  4MDC A;  1RW1 A;  1H4O A;  1S3C A;  4PNF A;  5KN1 A;  3ZL5 A;  3VPT A;  4EXJ A;  2DIY A;  1VF2 A;  3TJG A;  2I9H A;  4MJE A;  3ZMK A;  3GKM A;  5H5R A;  3M0F A;  1GTA A;  4WF5 A;  4I8B A;  1GTB A;  1XZO A;  1IYH A;  1GSF A;  1KTE A;  1NHO A;  1ZL9 A;  1WIK A;  3KXO A;  4YAV A;  5GSS A;  5GZZ B;  2CQ9 A;  3KMO A;  1XVW A;  5ECI B;  3RPP A;  3QOU A;  3WGD A;  2BMX A;  1K0A A;  2G2Q A;  1AXD A;  4HJM A;  1TU8 A;  4G01 A;  1XXU A;  2C0F A;  1X9M B;  1F9M A;  1ZYP A;  1USB A;  5IQY A;  1DSB A;  5ECL B;  1ON4 A;  1QQ2 A;  5B6M A;  6GSU A;  2H8L A;  3HA9 A;  2D2Z A;  2HZE B;  2FWE A;  1SD9 A;  2CT6 A;  1QFN A;  4ZBA A;  4EL1 A;  1TW9 A;  2MBS A;  1BED A;  2AJQ B;  4J2F A;  3WD6 A;  5ECH B;  4HDE A;  4XS4 B;  4XS1 A;  4MJB A;  3A2W A;  2GLR A;  3LJR A;  4KCE A;  3H79 A;  2AAW A;  1OKD A;  4BVX A;  1SD8 A;  1X0R A;  5JCG A;  3BCI A;  1R5P A;  3IAS 2;  4PGT A;  2B6M A;  1VF4 A;  4FH8 A;  4ZL7 A;  2C0G A;  3FZ5 A;  3U5R E;  3FK8 A;  3M1G A;  2K8S A;  5DJL A;  5HFK A;  2MBT A;  4JE1 A;  2MYG A;  3GTU A;  2HXK A;  4HI7 A;  3CTG A;  1TRU A;  2YOI A;  3M8N A;  1PN9 A;  1A0R P;  3F3Q A;  1GUH A;  4HZ4 A;  4V2M A;  5A4U A;  3W6G A;  4HUA A;  4D73 B;  4DSS B;  3HVV A;  2VO4 A;  3HJO A;  1TP9 A;  4YH2 A;  4AJ8 A;  3KP8 A;  1N8J A;  1HQO A;  2B5X A;  3ME8 A;  4HS1 A;  2VCW A;  1GSE A;  2YZH A;  4N3Z A;  4A5P A;  1BJX A;  1JZR A;  1OE8 A;  3KMN A;  5G1K A;  1UA5 A;  1HYU A;  5HR1 A;  4O92 A;  5EL8 A;  1UC7 A;  2LUS A;  3QDN A;  4K0G A;  2WCI A;  2L4C A;  2J9H A;  3MWH A;  5IOW A;  4IEL A;  2LEG A;  2OBI A;  3TRX A;  3MNG A;  4OFT A;  1PL1 A;  2HRN A;  2IME A;  3VWU A;  2YV7 A;  4NAX A;  4G2E A;  3EMP A;  5AIV A;  2HRF A;  2WZ9 A;  4K7N A;  2H72 A;  3TDG A;  3F8U A;  3IHG A;  5JWQ B;  2O8V B;  5DCG A;  3ZIT A;  5E4W A;  1U3A A;  2JU5 A;  4TR3 A;  1SKR B;  11GS A;  4ML1 A;  4MH2 A;  3LXZ A;  2GGT A;  2O5V A;  2GZY A;  2R37 A;  1AQX A;  5IMC A;  3RDW A;  2XBQ A;  2H76 A;  5KN0 A;  2O85 A;  4Z2T A;  2I81 A;  2KP1 A;  4K0N A;  1Y25 A;  1XW6 A;  4PQ1 A;  3LEF A;  4EDY A;  4PX1 A;  3UBK A;  1PA3 A;  1ZYE A;  2CAI A;  4Q5N A;  5H5Q A;  1G0T A;  5DQS A;  2GZZ A;  1NSW A;  5EPF A;  5HFI A;  4F9Z A;  3UIW A;  2A2S A;  2H1B A;  3M3M A;  2O89 A;  3KTB A;  2L6D A;  5J9C A;  1QUW A;  3H4K A;  2N5A A;  2FLS A;  1MDJ A;  2A2P A;  5EVO A;  3VLN A;  1XWG A;  3FR3 A;  2PMT A;  3QD9 A;  2DJJ A;  4QMK A;  3GRX A;  2HE3 A;  1M99 A;  5IM9 A;  4WBR D;  4F82 A;  1O73 A;  2R0G A;  1K0B A;  4G19 A;  3FYG A;  1YEP A;  2IJY A;  4ECB A;  3CSI A;  5BMU B;  1Y6E A;  1VGL A;  4HU9 A;  5BRT A;  2XBI A;  3F63 A;  4EC0 A;  3TKP A;  2CA8 A;  1GUK A;  5IMD A;  2PN8 A;  2RUE A;  3A2X A;  5HR2 A;  5DAL A;  1GNW A;  2YV9 A;  1QXH A;  2R6K A;  1JZO A;  4PUF C;  3TJB A;  3IBH A;  3KZQ A;  4IJI A;  3QFA C;  1K0O A;  1Z5Y E;  1ZYN A;  1AQW A;  3FHK A;  1OC8 A;  1SJI A;  3MIX A;  1T00 A;  3FRC A;  3GX0 A;  5IO2 A;  5C04 A;  4KDY A;  4F0B A;  4LMV A;  3L4N A;  2CVK A;  1XWK A;  3EC3 A;  4N10 A;  1J0F A;  1M9B A;  5G1L A;  2GQM A;  1I5G A;  4ZIL A;  1V57 A;  4TOP A;  3VWV A;  3A5W A;  4ISD A;  1M2D A;  3DD3 A;  3ZRE A;  2CAQ A;  4AGS A;  3D6I A;  3EIN A;  3HMJ G;  5F0G A;  4USS A;  1XPV A;  4RI7 A;  3GKX A;  4DVC A;  4V2L A;  2ON5 A;  3BCK A;  3D5J A;  4ICY A;  3APS A;  2JZS A;  4Z2U A;  4MMM A;  1GUM A;  4MZB A;  2E2G A;  2VL2 C;  1T4Y A;  2UZ8 A;  1XBS A;  4EKZ A;  5IMV A;  3O76 A;  5DDL A;  2M72 A;  3UEM A;  1F3A A;  4EUY A;  1B4P A;  3R3E A;  1K3O A;  2MMA A;  4I6X A;  3LXT A;  2OJL A;  1TTZ A;  2C3T A;  3H8Q A;  4IJ3 A;  4ZBD A;  4KDX A;  1PD2 1;  5AIS A;  4EDZ A;  2YWI A;  3EWL A;  1NW2 A;  2HZE A;  1M7T A;  5ENU A;  4DSR A;  4FYU A;  5ECN B;  3PPU A;  2LTK A;  2OE1 A;  1KEB A;  6GSV A;  1YKA A;  1TJD A;  1GLP A;  1TK0 B;  4WR4 A;  2H1D A;  4N30 A;  5ECS A;  3C71 A;  3Q6O A;  1ZGN A;  5IMA A;  1WP0 A;  2CV4 A;  4XS4 A;  3GN3 A;  2OT3 A;  3L78 A;  1JFU A;  3ERG A;  3ZVJ A;  1DE1 A;  3E0U A;  1MDK A;  2BJX A;  3TJF A;  4HEA 2;  3JCM L;  1EEJ A;  3FW2 A;  2GDR A;  3G7J A;  5EY6 A;  5F8B A;  2DIZ A;  5IPG A;  1BAY A;  1SL1 B;  4MK3 A;  4V1A p;  2LNS A;  2DJ1 A;  1QK8 A;  3MYD A;  5DVB A;  4J57 E;  2TRC P;  3SBC A;  5KN2 A;  3EYT A;  4E68 A;  4ACS A;  2FA8 A;  4OD7 A;  5IOX A;  2JZR A;  1JLV A;  5J5N A;  1XWC A;  2C0D A;  2JZT A;  2H1L A;  4JR6 A;  3ERW A;  1U87 A;  1N2A A;  5DBQ A;  1AAZ A;  2VD0 A;  2BTO T;  3VI5 A;  2EIO A;  3KJY A;  2B1K A;  4D73 A;  4DSS A;  3LWA A;  2YJ7 A;  1GSS A;  1EWX A;  4AKI A;  3IDV A;  2OAD A;  1Z7P A;  3RHB A;  2M46 A;  4O5U A;  1WOU A;  2PVQ A;  3O6T A;  4AKG A;  3US3 A;  4IP1 A;  4YQV A;  1HNB A;  2YCD A;  4KUN A;  1R4W A;  5AN1 A;  5CO3 A;  2IL3 A;  1ZCP A;  5A4V A;  4TXO B;  4P3Y B;  2HT9 A;  5D8I A;  4NXI A;  1XIY A;  3W8J A;  2C0E A;  3TCO A;  4IS0 A;  4EF0 A;  5D73 A;  4KCA A;  2JL4 A;  2IMF A;  5DAL B;  1PSQ A;  3FZA A;  3HVX A;  2IMD A;  3DYR A;  4G10 A;  3I6A A;  4TW5 A;  4K5S A;  2GQL A;  5FHI A;  2VLV A;  5J4U A;  3WT1 A;  3IK7 A;  5B8A A;  2J23 A;  3GH9 A;  2H1A A;  1M2B A;  2ON7 A;  5FWG A;  4RUV A;  4NWY A;  2X4A A;  2L5L A;  2YJH A;  3L9S A;  3HCZ A;  2OKA A;  4ID0 A;  3A2V A;  2L57 A;  4ZB8 A;  1C72 A;  1MEK A;  2H30 A;  5F06 A;  3V1W A;  4QL9 A;  2XC2 A;  1SK1 A;  1XOB A;  3ZZX A;  4LA1 A;  2B7J A;  4GLT A;  5A5K A;  4MH3 A;  4IQA A;  4Z2R A;  5F05 A;  5A5H B;  2LRN A;  2GSR A;  5A4W A;  4EIP A;  2VCQ A;  3ZRD A;  1GTI A;  3ZLP A;  1AW9 A;  1TOF A;  3L9V A;  1GUL A;  1K3Y A;  4E8H A;  1KNG A;  1AC1 A;  3DXB A;  3UOM A;  5BMU A;  4EO3 A;  3L9U A;  2V1M A;  1WWJ A;  2AHE A;  1K3L A;  4MF5 A;  3EMX A;  5DJM A;  3IOS A;  1QMV A;  2F8A A;  2IPA A;  3LOR A;  4NMU A;  4BWQ A;  4ZL8 A;  5E59 A;  2QKE A;  3WGX A;  2HRA A;  4KGI A;  4Q5Q A;  2LST A;  1A2J A;  4MNN A;  1GSD A;  2HQT A;  2PVO C;  2PWJ A;  5IIZ A;  3HHV A;  3M9J A;  1Z9H A;  3ZIV A;  1EOH A;  2ES7 A;  4POL A;  1OYJ A;  1EGO A;  5B7C A;  18GS A;  3FZ4 A;  2OE3 A;  4TR0 A;  9GSS A;  4YKG A;  4I2U A;  1TI1 A;  2EFE A;  5GST A;  1MD4 A;  5CRH A;  4MA9 A;  1M9A A;  4TR1 B;  5DCH A;  4BL7 B;  2WUL A;  4PXO A;  4ULX A;  2YPM A;  3TKS C;  3J7Y b;  3UVH A;  5IO0 A;  5FT3 A;  4KF9 A;  3ZIJ A;  2RM5 A;  1G6Y A;  4CY6 A;  4GSS A;  1SEN A;  1XFL A;  5JWO B;  4CW9 A;  1HNC A;  3CRU A;  5LCZ A;  2M80 A;  5KOX A;  2EFD A;  4PUR A;  4GCI A;  4CHS A;  2B5E A;  4XIH A;  4GTU A;  5ABR A;  2WDU A;  2QC7 A;  1LU4 A;  5HR0 A;  2H66 A;  2V2G A;  3EU4 A;  2QGV A;  5G2Z A;  3W8S A;  1TDI A;  4OCF A;  3DIE A;  2L4Q A;  2WJU A;  3HJM A;  1FOV A;  3KGK A;  5IMF A;  4E8E A;  4ILF A;  1T1V A;  4DSQ A;  1MD3 A;  2V6K A;  3APQ A;  2WGR A;  2HSN B;  4BA7 A;  5ECO B;  5C00 A;  2R5G A;  2X8H A;  3GSS A;  1HNA A;  1SVO A;  4NHW A;  5JWR B;  2VM1 A;  2VOC A;  2HLS A;  1GNE A;  3EUR A;  3WT2 A;  2P31 A;  5AGY A;  4O5Q A;  1B9Y C;  4OO4 A;  5ECR B;  4O7H A;  4YQU A;  4TXV A;  2CX4 A;  4K1F A;  5AIX A;  4YAP A;  2LNT A;  3ED3 A;  2E2M A;  14GS A;  2H75 A;  4PQH A;  1G7E A;  19GS A;  2HSM A;  3MSZ A;  5DAK B;  1EP7 A;  1YJ6 A;  3GV1 A;  4RQR A;  5JCU A;  2NBS A;  2QA1 A;  3GH6 A;  1SJ6 A;  3FR6 A;  2VCV A;  3TOU A;  1ML6 A;  2HFD A;  4KH7 A;  1FB6 A;  1GLQ A;  4YQM A;  4WXT A;  16GS A;  2OBK A;  1FO5 A;  3QAV A;  3G7Y A;  1Y1U A;  3IPZ A;  1YQ1 A;  1EP8 A;  1AUC A;  3CYN A;  2F8F A;  3TU3 B;  3VI7 A;  4ZXG A;  2ZNM A;  3TGZ A;  2Z9S A;  4HJ2 A;  3APO A;  4K7O A;  3TRQ A;  1YY7 A;  5KEJ A;  2H19 A;  12GS A;  1XW5 A;  5CRG A;  2LQQ A;  3FY7 A;  2FHE A;  1B8X A;  3IC8 A;  3Q18 A;  3CMI A;  4QL7 A;  1LJR A;  3EPT A;  2R0P A;  2LJR A;  4K2X A;  3GMF A;  2EC4 A;  2VM2 A;  3CWG A;  4AF2 A;  1TRS A;  2R0C A;  4NHZ A;  5CRW A;  3FZ9 A;  4TXO A;  2V41 A;  1XVQ A;  4FQU A;  5L71 A;  1FW1 A;  4OWY A;  1PRX A;  7GSS A;  2MMZ A;  2LJA A;  3P8W A;  4JRR A;  2IN3 A;  3KCM A;  2TRX A;  1K0M A;  3PH9 A;  1X5D A;  3IV4 A;  2GVP A;  1FOH A;  5J47 A;  3EU3 A;  1TXU A;  2R3X A;  3UBL A;  1ZMA A;  4Z7X A;  5CRE A;  1B4Q A;  3ZVJ D;  1JZW A;  3QMX A;  3UAP A;  2C4J A;  3TJK A;  2QA2 A;  3VWW A;  5J41 A;  4FYB A;  2DBC A;  2PPT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...