13GSA

Glutathione s-transferase complexed with sulfasalazine
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
210
structure length
210
Chain Sequence
MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Ligandin (Non-Substrate) Binding Site of Human Pi Class Glutathione Transferase is Located in the Electrophile Binding Site (H-Site).
pubmed doi rcsb
molecule keywords GLUTATHIONE S-TRANSFERASE
molecule tags Transferase/transferase inhibitor
source organism Homo sapiens
total genus 85
structure length 210
sequence length 210
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1997-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 13gsA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 13gsA01
3QAVA 1GSUA 2PU9C 4O32A 4PXOA 3P7XA 1ZCPA 3RPNA 2WCIA 2YWNA 4XHMA 4XS4A 2FCHA 2X64A 3FZAA 4RI6A 2YZUA 1F37A 3L4NA 1Q4JA 5EY6A 3UVTA 4FO5A 2OADA 1HQOA 3ERWA 3ED3A 5JWOB 4BA7A 3QAGA 4GXZA 1O73A 1OYJA 2V1MA 1ERTA 3TKRA 5B8BA 1EP7A 4AF2A 3CXGA 3F3RA 2LNTA 1XWBA 2L6CA 3S9FA 2X99A 2H0GA 5G31A 1OKTA 4DSRA 5KN0A 4Q5FA 4GSNA 2FWHA 3ZTLA 1G6WA 2V6OA 1Z6MA 5DJLA 1H4OA 2PVQA 4OO4A 3IA1A 1GP1A 2CVKA 2H01A 5H5RA 1XWKA 4G19A 3O6TA 2M72A 1PX7A 4I5QA 1GWCA 5ECMB 10GSA 1NHOA 1R26A 5G30A 3F6DA 3BD2A 1DUGA 1XVQA 4KSOA 3M9KA 5A4VA 2RLIA 1SL0B 3DMLA 3VFIA 2HSYA 4GRFA 2F3MA 4G0KA 2VM2A 2C8UA 3HD5A 2FHEA 1YZXA 2NBSA 4G2EA 3QR6A 1JZOA 3EURA 2AV4A 4ILFA 3IC8A 4YQVA 2TRCP 6GSVA 4L5OA 1R7HA 1TRSA 4KGIA 2HZEA 2HT9A 3W8SA 5G2ZA 4ZILA 2REMA 3PPUA 5J4UA 5CO3A 1O8WA 2H66A 2CT6A 3ZFBA 3FHKA 1G0TA 4D73B 1NM3A 4RQXA 5CAXA 2AB6A 5ELAA 3F3QA 19GSA 1SJIA 1FVJA 1FO5A 2DJ2A 3KCMA 4PQIA 1M2DA 5J3RA 3QD9A 5F0GA 5D9TA 3QFBC 3LXTA 2NTOA 3PR8A 5EPFA 3D0ZA 3ISOA 2R5GA 3VURA 3E0UA 3ZMLA 2GT5A 5ABRA 2HZFA 4J56E 2DIYA 1LJRA 2VCTA 2L57A 1OC9B 1Z6NA 1OKDA 4EC0A 2CZ2A 3GFKA 3CSHA 5JCUA 3HDCA 2N5AA 1X5CA 2VM1A 2NVLA 4JU5A 3UARA 3FEUA 3L0HA 1TW9A 3D21A 2HRNA 3GL3A 1MD4A 4K7NA 4GSTA 4ECCA 1MEKA 2C0DA 2I9HA 3EU3A 4JR4A 1SKWB 3DVXA 3Q6OA 2C4JA 2FGXA 3LYKA 1V40A 3K8NA 1A2MA 1R5AA 2H6YA 1J08A 1DSBA 2IN3A 4RQRA 1UA5A 4MLYA 4N10A 2DBCA 4PNGA 2VD1A 5GAPD 2MMOA 1K0BA 4ZB6A 2L59A 1GLQA 1FW1A 4MPFA 4GQCA 3GKNA 2L4CA 3GHAA 5D8IA 2GSRA 2DMMA 1TK0B 1JZWA 4LA1A 1ZYQB 2FWEA 3IAM2 3FR3A 2O87A 4HZ2A 3KH9A 3US3A 5BMUA 4LMVA 4POBA 1VF3A 14GSA 2VIMA 3WYWA 1K3YA 5HR1A 4IJIA 2HLSA 3N9JA 4POKA 1GSDA 3FZ4A 4GWRA 4F03A 4TVEA 1WPIA 4XRDA 4TOPA 1EV9A 1PA3A 1GUHA 2DMLA 2YWIA 1A24A 13GSA 4K7IA 3WGEA 1UN2A 1Y25A 4HUAA 2LRTA 3TJKA 4KDYA 3HVVA 2F9SA 1ERWA 4MJAA 1A0FA 4NHZA 1YF0A 3GH6A 3EU4A 1T7PB 1FB0A 4OWYA 3HA9A 1WE0A 4MP4A 2HRKA 3I9V2 3TOUA 4CHSA 2MBTA 2WS2A 4EO3A 1SL1B 1CQGA 4K9ZA 1AQVA 3LSZA 3IK9A 2IL3A 2VL2C 1QGVA 4EL1A 4L0WA 2GQMA 3L9UA 5IM9A 3CSIA 2YP6A 3TKSC 5COHA 4ISDA 4EDYA 4MA9A 5L71A 3W8JA 1JHBA 5IMDA 3ZRDA 2C80A 1O85A 2OE1A 4ML1A 4PNFA 2H70A 1F6MC 5DQSA 4IBPA 2H0HA 3RHCA 3H1NA 4GTUA 4FYCA 1OE7A 3CTGA 5CREA 3N5OA 1QXHA 2GTUA 1E6BA 2C1YA 2F51A 5B6NA 3LEFA 1X5DA 1GTAA 1VF1A 3LWAA 1GSYA 1WRYA 1ZYEA 1T4YA 2FNOA 2H1AA 1T4ZA 4BVXB 4V2MA 3F8UA 1S3AA 2D2ZA 3KMNA 5JCWA 1BJXA 5D9XA 1G7OA 2K9FA 1KNGA 2JL4A 3HJMA 1SK2A 2LV3A 1GTUA 3C1SA 2K18A 2ON7A 4EDZA 1AC1A 2KP1A 1PRXA 2XC2A 1LU4A 3MNGA 4PURA 2ZNMA 4O7HA 1I5GA 2OE0A 2JADA 1SK0A 3MWHA 3Q74A 3IPZA 3A3TA 5KN3A 3LGCA 4K0GA 3KJYA 4PTSA 1TRUA 5F8BA 4LL1B 4PUAA 3IOSA 5A4UA 3PH9A 2MMZA 1AXDA 4IGJA 3RDWA 5G5EA 5B8AA 2FA8A 1GSFA 4LMWA 1TTZA 5ENUA 5E4WA 6GSYA 2J9HA 4MPGA 2P5QA 4EVMA 3DYRA 3A2VA 3HCZA 4D73A 4H86A 1K0MA 4QL7A 3APOA 2O89A 1RW1A 1WJKA 3J7Yk 1B9YC 4WBRD 1HNCA 2X8GA 1M7TA 3HZ8A 2DSAA 1ZZYA 4GF0A 4YAVA 1PX6A 2IFQB 2K8SA 5IO2A 3SBCA 1OC9A 2C0FA 4FYBA 4IP1A 1T3BA 2MBSA 3DD3A 1USBA 2HRAA 4KSMA 4WXTA 3D22A 1THOA 2FUG2 2K8VA 3VI5A 1TI3A 1SD8A 1FG4A 1OE8A 1PL1A 2OBIA 4NV5A 4MF5A 2YZHA 1S3DA 1A23A 2PN8A 2VCXA 3D6IA 3GUSA 3O76A 2LQOA 3J7Yb 5B6MA 1DBYA 3CRUA 3IV4A 4ACSA 4HS1A 5DALA 2QKEA 1FB6A 3UBKA 1YDKA 2B1KA 1SK1A 3TJBA 1I9DA 3LORA 3GTUB 5KN2A 3JCML 1XWCA 2I1UA 3M1GA 2FWGA 3FR9A 1KBNA 2WB9A 1V9WA 1HD2A 5ECKB 3GNJA 1AUCA 5H5QA 3GN3A 2EIRA 3WGXA 1EOGA 5ELGA 2C0GA 4KH7A 1ILOA 4IKHA 1PN9A 4TXVA 4MZCA 4V2LA 3QMXA 4TXOB 5G1KA 5IMAA 5ECPB 4MF7A 2IMEA 3IBHA 1GRXA 3OR5A 4WR5A 4F82A 4TRXA 5IMVA 1WMJA 3H79A 1MDIA 1YJ6A 2FD3A 3QOUA 6GSWA 3C7MA 1O6JA 1YEXA 3FZ9A 4N11A 1GSSA 4IQ1A 5DBQA 2DC5A 4KB3A 2H1GA 1KTEA 2PPTA 2C3QA 2VAFA 1F3AA 2F8FA 4F0BA 5J9BA 3GX0A 6GSSA 2WRTA 2LNSA 1F3BA 3O3TA 4YH2A 5HR2A 4HZ4A 3WGDA 2OACA 3LJRA 4MH2A 4ZL8A 3ZYWA 5CYYA 5CNWA 3LFLA 4ML6A 2AUVA 2KUCA 5ID2B 1BAYA 4HI7A 2AYTA 1X9WB 4ZB8A 4HQZA 3EE2A 3FZ5A 2FA4A 2VUPA 4KE3A 2B3SA 4QL9A 2CVBA 2CAIA 1B8XA 4LL4B 4HU7A 2P5RA 4AJ7A 1GL8A 1T8EB 4KDUA 2G2QA 5IPHA 4FQUA 2GQKA 4ULXA 4IN0A 2I81A 2JZTA 2A2SA 2WZ9A 2L6DA 3EINA 2B1LA 2JU5A 3F6FA 2YN1A 1QQ2A 4O92A 4E8EA 2RUFA 2GGTA 1RK4A 3H4KA 3TRPA 1OAZA 4XS1A 1W4VA 1Q98A 4PX1A 3VI7A 5LCZA 1U3IA 3E3EA 3IDVA 2H75A 2ES7A 2HSMB 1X0RA 3IRAA 1TKDB 1K0NA 12GSA 1H75A 5HR0A 4O5RA 20GSA 1XXUA 1F9MA 4BVXA 4TR3A 3ERGA 5HFGA 3WD6A 2MYGA 1TP9A 2CA8A 1YF1A 5E59A 3F0IA 1TU7A 1XPVA 5IOWA 2H6ZA 3GKMA 1WWJA 4J57E 2HQTA 2VL9A 4TR0A 5EL8A 2YV7A 2FWFA 1AQWA 3APSA 2GZPA 4CDOA 3VWUA 2B7JA 3HVSA 1M9AA 2OE3A 1TRWA 2EC4A 2M46A 2PWJA 3DKSA 1QK8A 3G7IA 7GSSA 5KN1A 3FR6A 1XOAA 5AGYA 4EE0A 5ECRB 1S3CA 4KX4A 1MTCA 2JACA 4J2FA 1SJ6A 3GIXA 5C04A 4KUNA 4OFMA 3M3MA 4KCEA 4GQFA 1TRVA 5ECLB 5FHIA 1K0OA 4V1Ap 2B6MA 4F9ZA 1Z7PA 4QQ7A 18GSA 2VOCA 1OVNA 4TR1B 5ECOB 5IQYA 1Y6EA 4K2DA 2BTOT 2R6KA 3RBTA 2X8CA 3GL5A 3GSTA 2IFQA 1B4PA 2LSTA 4IW9A 3TUEA 2ALBA 4KNDA 1JZRA 5HFKA 2IIYA 4HOJA 2A2RA 3HZ4A 5HFIA 1VGLA 2L5LA 5INYA 5IOXA 3TRXA 3R2QA 1PKWA 2K6VA 4P3YB 2DJ3A 3UAPA 2O7KA 2OJLA 3LQ7A 5ECNB 2CV4A 2HYXA 3UBLA 1Z9HA 3F4RA 5HQPA 2YOIA 1DE1A 1SU9A 1A8YA 4KDXA 1X9SB 4ECBA 1PGTA 2E0QA 3KIJA 3KD0A 2QSIA 2GVPA 1R4WA 3HJPA 2YJ7A 1V57A 3W6GA 3ME7A 4Z7XA 2R2JA 4E8HA 3GTUA 1TOFA 4K6XA 2H6XA 2DIZA 1FOVA 4G10A 1K0CA 3KEBA 2ZUPA 1B48A 1ZGNA 4K7OA 4PGTA 2GT6A 3M0FA 4BVYB 3P90A 3BJ5A 3ZVJD 1GUMA 4JEDA 4CW9A 1TXXA 3FKFA 2KLXA 3CSJA 2V2GA 1HNBA 4N30A 4ZBAA 1TI1A 4EF0A 2YANA 3BCKA 2CVDA 4TXOA 4XS6A 1B9XC 2CQ9A 4BWQA 2C0EA 3ZL5A 1ZMAA 3EMXA 3TCOA 2WFCA 4KCAA 4MABA 3UOMA 4RUVA 2LJKA 3TKSE 16GSA 3DEXA 1MDJA 2E7PA 2HXKA 2H76A 1EGOA 3TGZA 3M9JA 1IYHA 1YY7A 3QAWA 3ME8A 3G7YA 2ON5A 4OD7A 2VL2A 5CP1A 3IR4A 1FAAA 3BCIA 2F8AA 2VCWA 2GDRA 2JZSA 3FK8A 3VWVA 4NAXA 3TKSA 4DSSB 5ID2A 3DVWA 1AQXA 2ZCTA 4NHWA 1EOHA 1YEPA 3HHVA 1QFNA 4KA0A 4ZIJA 1KEBA 4Q5QA 2CX4A 2PBJA 4KW6A 4N0VA 5IIZA 3GSSA 1SYRA 2LTKA 1V2AA 1TK5B 2H30A 3TJJA 2H1DA 2UZ8A 4JRRA 4XCSA 1Z5YE 2LRCA 1XVWA 1VF2A 3G7JA 3TKQA 4K0NA 1F2EA 2EIOA 3BOAA 2DJ0A 2TIRA 2DJKA 2GSQA 2DJJA 2FY6A 1A0RP 4EUYA 2PMTA 2H19A 3G9BA 3GURA 3IHQA 5AISA 3KMOA 2HSMA 2LJAA 3L9SA 3VPTA 1A2LA 3NOFA 2IMDA 4K8MA 4IELA 4GCIA 2RM5A 4XIHA 1J9BA 1C72A 2YNXA 4AJ6A 2VCQA 4Q5RA 5JWQB 1JFUA 3H93A 1PL2A 1BEDA 3EVIA 2JZRA 3F4TA 3I6AA 4HU9A 4WF4A 2PUKC 1TJDA 1NSWA 4HJ2A 3RPPA 5GSTA 1N8JA 1GLPA 3FYGA 1EGRA 2YCDA 1XZOA 1IYIA 3HXSA 3VWXA 3BBYA 3MAKA 2G0FA 3M8NA 1SKRB 5AN1A 4TW5A 1MD3A 5A4WA 5J5NA 3FRCA 1BYEA 4TN8A 1THXA 1UC7A 5H5SA 1CQHA 1O81A 1M99A 5F06A 2XPDA 1XW6A 1VRSD 3P8WA 1EP8A 3I43A 2V41A 3I69A 4JZQA 1XW9A 3VLNA 2VD0A 4TR1A 4LLRA 1PSQA 3L78A 2L5OA 4FIWA 3V1WA 3GX8A 2IMIA 4WR4A 5CRHA 4DSQA 4PQHA 4MJEA 2M80A 3DGQA 1UVZA 1V58A 4F2IA 5DCHA 4MZWA 1GNWA 4WKWA 1JZDA 3RAZA 1GSQA 5DQYA 4F0CA 4OO5A 2B5XA 5A5KA 4JE1A 8GSSA 1ERUA 1GH2A 4PUFC 4TR4A 2RM6A 1EZKA 4V2NA 2AJQB 2GS3A 2DJ1A 5G1LA 1U3AA 1ML6A 3NZNA 1HYUA 3DRNA 3UJ1A 5CRDA 2XBIA 2JSYA 4OFTA 3A5WA 3IE3A 1K0AA 3C1RA 3Q19A 2GQLA 4BVYA 3LXZA 4NV2A 2RIIA 3TJFA 3LYPA 1SENA 4G0LA 5DCGA 1ABAA 1ERVA 1EV4A 1TDIA 4X0XA 1PD21 1ACVA 3H8QA 4HEA2 1VF4A 5JWRB 2V6KA 5DAKB 2GLRA 9GSSA 4L8EA 3GYKA 4HJMA 2YWMA 1NW2A 1YQ1A 3VPQA 1R5PA 3GKXA 6GSUA 4FH8A 2YPMA 4IJ3A 1U87A 4KAEA 4OMVA 5D73A 2FLSA 1QUWA 4MJCA 1BX9A 3TOTA 4WBJA 1M2BA 3TRQA 4ZB9A 2LJRA 5C00A 1XWAA 5D9WA 3QCPA 4ZBBA 3F4SA 3SWLA 4I8BA 4JBBA 5ECQB 2HSNB 5G5FA 4ZL9A 4DSSA 2EIQA 3VK9A 1N2AA 1OC3A 3EC3A 5D93A 3KGKA 1SJZA 3KZQA 1U6TA 1GNEA 1GTBA 2AHEA 4Q5NA 1A2JA 1SL2B 4V1Ag 4EXJA 4G9HA 5GZZB 1AW9A 3P2AA 3GMFA 1ZL9A 1K0DA 4OCFA 2HFDA 3HJOA 2GSTA 1GSEA 2Z9SA 11GSA 2LEGA 1M0UA 3TKPA 2GZYA 1YKCA 1OC8A 1FHEA 2NPBA 2LQQA 4JR6A 4X1UA 3EWLA 3PINA 2A4VA 5GSSA 2OBKA 3QPMA 1XWGA 5IMCA 1X5EA 2N5FA 3D4TA 4ZL7A 3AY8A 3WT2A 1MDKA 3DXBA 5AIVA 1YKAA 4IP6A 3HKRA 1WP0A 4XRAA 2H74A 4YAPA 5DJMA 2DLXA 2X8HA 2H71A 5DALB 3L9VA 3F9UA 4IS0A 3LG6A 1Z3EA 3F63A 2WULA 2H72A 2TRXA 4X43A 4BL7B 3CBUA 4BPYA 5LNKe 2L4QA 2CZ3A 1WIKA 2PVOC 2LUSA 2HE3A 2JSZA 1WOUA 3ZLPA 4TKYA 3ZIJA 4XS4B 17GSA 4ECIA 6GSTA 4I6XA 2O85A 3D5JA 4HQSA 4NWYA 4MH3A 1AAZA 2LRNA 2HNLA 1X9MB 1SD9A 2HRFA 1NHYA 2VLTA 3GH9A 2N5BA 4GSSA 3GA4A 3MSZA 3ZVJA 4L0UA 5D9VA 3UL3A 3KTLA 2P0GA 2VL3A 1B4QA 5ECSA 1XBSA 5FWGA 1U88A 4ECJA 1T1VA 4I2UA 2KOKA 3ZREA 4BWSA 3A2XA 3GKKA 3C71A 2J23A 3QDNA 3QFAC 2OA7A 1DE2A 1FVKA 1M2AA 5B7CA 2WJUA 4MK3A 2C3TA 3DWVA 3PGTA 3IAS2 2GZZA 5GAND 2V32A 4AGSA 3C8EA 1G7EA 4MZBA 2IMFA 2I3YA 3IC4A 3APQA 5IMZA 3DIEA 3C73A 1PMTA 1ST9A 1XFLA 2YJHA 22GSA 2O8VB 4USSA 1XIYA 5CRGA 4DVCA 4EKZA 3ERFA 4L5LA 4I2TA 2QGVA 3FW2A 3WT1A 4POLA 1PKZA 3KH7A 2QC7A 4GLTA 2R4VA 1K3LA 3IK7A 2MMAA 3NIVA 2NDOA 2HZEB 1JLWA 2B5EA 4ID0A 1JLVA 4NMUA 3VWWA 4I97A 5HR3A 3KXOA 4IQAA 3U5RE 1G6YA 2PGTA 4HDEA 1O7UA 3A2WA 2GSSA 5JCGA 5DAKA 5ECIB 3EMPA 5DVBA 5IO0A 1EEJA 2VLVA 5EVOA 1ON4A 3KP9A 1BG5A 2H0IA 2H73A 1BQ7A 5J41A 5IPGA 4DEJA 3MDKA 3UVHA 1O8XA 1W89A 1RQMA 1URMA 3HVXA 4WF5A 4MCUA 1PQNA 4XTSA 3RHBA 3Q18A 2B5YA 2HSHA 2YV9A 1LBKA 1HNAA 1QMVA 1SKSB 4ZXGA 5D96A 1GUKA 2XPEA 4NXIA 1GTIA 3UMAA 1J0FA 5IMFA 2AAWA 5F07A 2VO4A 2VCZA 2IPAA 3E9JB 5F05A 4YQUA 1XCCA 2LKUA 3KP8A 2MMNA 3FY7A 1V98A 2MZCA 1EEMA 2VLUA 2B7KA 2IWTA 3ZFLA 2IJYA 4OCEA 3ZZXA 1SYXA 3TDGA 1T00A 5FT3A 2CX3A 2YWOA 4OFNA 2WGRA 1TK8B 2BMXA 3ZMKA 2H8LA 3EYTA 3GV1A 4ZBDA 3CRTA 4KF9A 4MJBA 4RI7A 3CTFA 5KEJA 2KHPA 3R3EA 1AIUA 1XOBA 1M9BA 2RUEA 4AJ8A 3UEMA 2KP2A 4WEYA 2R3XA 2R37A 5DDLA 2C3NA 2LS5A 1E2YA 3TB2A 4YQMA 4N0ZA 2OKAA 1TU8A 3U6VA 4FYUA 3UIWA 5AIXA 4MDCA 1GULA 1EWXA 4PQ1A 3IXRA 3HY2A 4IVFA 5CRWA 2XBQA 3ZITA 3CMIA 5J9CA 2HI7A 4MF6A 2VCVA 2IMKA 3D4MA 1Z7RA 2WDUA 1ZOFA 2XHFA 4IHUA 3TJGA 3GRXA 3KM6A 4MMMA 4G0IA 4NPBA 1XW5A 2PERA 4POMA 6GSXA 2CAQA 2P31A 2HRKB 4BL7A 2H1BA 4WETA 3HYPA 3ZIVA 5ECHB 3CYNA 2I4AA 1K3OA 3KTBA 5LD0A 1A8LA 2E2GA 4K1FA 2E2MA 2BJXA
chains in the Genus database with same CATH superfamily
3QAVA 1GSUA 2PU9C 4O32A 4O5UA 4PXOA 3P7XA 1ZCPA 3RPNA 2WCIA 2YWNA 4XHMA 4XS4A 2FCHA 2X64A 3FZAA 4RI6A 2YZUA 1F37A 4EIPA 2A4HA 3L4NA 1Q4JA 5EY6A 1S4BP 3UVTA 4FO5A 2OADA 1HQOA 3ERWA 3ED3A 5JWOB 4BA7A 3QAGA 4GXZA 1O73A 1OYJA 2V1MA 1ERTA 3TKRA 1BG1A 5B8BA 1EP7A 4AF2A 3CXGA 3F3RA 2LNTA 1XWBA 2L6CA 3S9FA 2X99A 2H0GA 5G31A 1OKTA 4DSRA 5KN0A 4Q5FA 4GSNA 2FWHA 3CWGA 3ZTLA 1G6WA 2V6OA 1Z6MA 5DJLA 1H4OA 2PVQA 4OO4A 3IA1A 4AKXB 1GP1A 2CVKA 2H01A 5H5RA 1XWKA 4G19A 3O6TA 2M72A 1PX7A 4I5QA 1GWCA 5ECMB 10GSA 1NHOA 1R26A 5G30A 3F6DA 3BD2A 1DUGA 1XVQA 3FMWA 4KSOA 3M9KA 5A4VA 2RLIA 1SL0B 3DMLA 3VFIA 1YEWC 2HSYA 4K5RA 4GRFA 2F3MA 4G0KA 2VM2A 2C8UA 3HD5A 2FHEA 1YZXA 2NBSA 4G2EA 3TU3B 3QR6A 1JZOA 3EURA 2AV4A 4ILFA 3IC8A 4YQVA 2TRCP 6GSVA 4L5OA 1R7HA 1TRSA 4KGIA 2HZEA 2HT9A 3W8SA 5G2ZA 4ZILA 2REMA 3PPUA 5J4UA 5CO3A 1O8WA 2H66A 2CT6A 3ZFBA 3FHKA 1G0TA 4D73B 1NM3A 4RQXA 5CAXA 2AB6A 5ELAA 3F3QA 19GSA 1SJIA 1FVJA 1FO5A 2DJ2A 3KCMA 4PQIA 1M2DA 5J3RA 3QD9A 5F0GA 5D9TA 3QFBC 3LXTA 2NTOA 3PR8A 5EPFA 3D0ZA 3ISOA 2R5GA 3VURA 3E0UA 3ZMLA 2GT5A 5ABRA 2HZFA 4J56E 2DIYA 1LJRA 2VCTA 2L57A 1OC9B 4EIQA 1Z6NA 1OKDA 1I1IP 4EC0A 2CZ2A 3GFKA 3CSHA 5JCUA 3HDCA 2N5AA 1X5CA 2VM1A 2NVLA 4JU5A 3UARA 3FEUA 3L0HA 1TW9A 3D21A 2HRNA 3GL3A 1MD4A 4K7NA 4GSTA 4ECCA 1MEKA 2C0DA 2I9HA 3EU3A 4JR4A 1SKWB 3DVXA 2C4JA 3Q6OA 2FGXA 3LYKA 1V40A 3K8NA 1A2MA 1R5AA 2H6YA 1J08A 1DSBA 2IN3A 4RQRA 1UA5A 4MLYA 4N10A 2DBCA 4PNGA 2VD1A 5GAPD 2MMOA 1K0BA 4ZB6A 2L59A 1GLQA 1FW1A 4MPFA 4GQCA 4AI6A 3GKNA 2L4CA 3GHAA 5D8IA 2GSRA 2DMMA 1TK0B 1JZWA 4LA1A 1ZYQB 2FWEA 3IAM2 3FR3A 2O87A 4HZ2A 3KH9A 3US3A 5BMUA 4LMVA 4FXYP 4POBA 1VF3A 14GSA 2VIMA 3WYWA 1K3YA 5HR1A 4IJIA 2HLSA 3N9JA 4POKA 1GSDA 4AKHA 3FZ4A 4GWRA 4F03A 4TVEA 1WPIA 4XRDA 4TOPA 1EV9A 1PA3A 1GUHA 2DMLA 2YWIA 1A24A 13GSA 4K7IA 3WGEA 1UN2A 1Y25A 4HUAA 2LRTA 3TJKA 4KDYA 3HVVA 2F9SA 1ERWA 4MJAA 1A0FA 4NHZA 1YF0A 4K2XA 3GH6A 3EU4A 1T7PB 1FB0A 4OWYA 3HA9A 1WE0A 4MP4A 2HRKA 3I9V2 3TOUA 4CHSA 2MBTA 2WS2A 2WW2A 4EO3A 1SL1B 1CQGA 4K9ZA 1AQVA 3LSZA 3IK9A 2IL3A 2VL2C 1QGVA 4EL1A 4L0WA 2GQMA 3L9UA 5IM9A 3CSIA 2YP6A 3TKSC 5COHA 4ISDA 4EDYA 4MA9A 2OT3A 5L71A 3W8JA 1JHBA 5IMDA 3ZRDA 2C80A 1O85A 2OE1A 4ML1A 4PNFA 2H70A 1F6MC 5DQSA 4IBPA 2H0HA 3RHCA 3H1NA 4GTUA 4FYCA 1OE7A 3CTGA 5CREA 4K5SA 3N5OA 1QXHA 2GTUA 1E6BA 2C1YA 2F51A 5B6NA 3LEFA 1X5DA 1GTAA 1VF1A 3LWAA 1GSYA 1WRYA 1ZYEA 1T4YA 2FNOA 2H1AA 1T4ZA 4BVXB 4V2MA 3F8UA 1S3AA 2D2ZA 3KMNA 5JCWA 1BJXA 5D9XA 1G7OA 2K9FA 1M3IA 1KNGA 2JL4A 2WVYA 3HJMA 1SK2A 2LV3A 1GTUA 3C1SA 2K18A 2ON7A 4EDZA 1AC1A 2KP1A 1S3RA 1PRXA 2XC2A 1LU4A 3MNGA 4PURA 2ZNMA 4O7HA 1I5GA 2OE0A 2JADA 1SK0A 3MWHA 3Q74A 3IPZA 3A3TA 5KN3A 3LGCA 4K0GA 3KJYA 4PTSA 1TRUA 5F8BA 4LL1B 4PUAA 3IOSA 5A4UA 3PH9A 2MMZA 1AXDA 4IGJA 3RDWA 5G5EA 5B8AA 2FA8A 1GSFA 4LMWA 1TTZA 5ENUA 5E4WA 6GSYA 2J9HA 4MPGA 2P5QA 4EVMA 3DYRA 4PI0C 3A2VA 3HCZA 4D73A 4H86A 1K0MA 4QL7A 3APOA 1SVLA 2O89A 1RW1A 1WJKA 3J7Yk 1B9YC 4WBRD 1HNCA 2X8GA 5A34B 1M7TA 3HZ8A 2DSAA 1ZZYA 4GF0A 4YAVA 1PX6A 2WW3A 2IFQB 2K8SA 5IO2A 2DKHA 3SBCA 1OC9A 2C0FA 4FYBA 4IP1A 2DKIA 1T3BA 2MBSA 3DD3A 1USBA 2HRAA 4KSMA 4WXTA 3D22A 1THOA 2FUG2 2K8VA 3VI5A 1TI3A 1SD8A 1FG4A 1OE8A 1PL1A 3MIXA 2OBIA 4NV5A 4MF5A 2YZHA 1S3DA 1A23A 2PN8A 2VCXA 3D6IA 3GUSA 3O76A 2LQOA 3J7Yb 5B6MA 1DBYA 3CHXC 3CRUA 3IV4A 4ACSA 4HS1A 5DALA 2QKEA 1FB6A 3UBKA 1YDKA 2B1KA 1SK1A 3TJBA 1I9DA 3LORA 3GTUB 5KN2A 2VKZG 3JCML 1XWCA 2I1UA 3M1GA 2FWGA 3FR9A 1KBNA 2WB9A 1V9WA 2EFDA 1HD2A 5ECKB 3GNJA 1AUCA 5H5QA 3GN3A 2EIRA 3WGXA 1EOGA 5ELGA 2C0GA 4KH7A 1ILOA 4IKHA 2O5VA 1PN9A 4TXVA 4MZCA 4V2LA 3QMXA 4TXOB 5G1KA 5IMAA 5ECPB 4MF7A 2IMEA 3IBHA 1GRXA 3OR5A 4WR5A 4F82A 4TRXA 5IMVA 1WMJA 3H79A 1MDIA 1YJ6A 2FD3A 3QOUA 6GSWA 3C7MA 1O6JA 1YEXA 3FZ9A 4N11A 1GSSA 4IQ1A 5DBQA 2DC5A 4KB3A 2H1GA 1KTEA 2PPTA 5A1NB 2C3QA 2VAFA 1F3AA 2F8FA 4F0BA 5J9BA 3GX0A 2WW0A 6GSSA 2WRTA 2LNSA 1F3BA 3O3TA 4YH2A 5HR2A 4HZ4A 3WGDA 2OACA 3LJRA 4MH2A 4ZL8A 3ZYWA 5CYYA 5CNWA 3LFLA 4ML6A 2AUVA 2KUCA 5ID2B 1BAYA 4HI7A 2AYTA 1X9WB 4ZB8A 4HQZA 3EE2A 3FZ5A 2FA4A 2VUPA 1SVMA 4KE3A 2B3SA 4QL9A 2CVBA 2CAIA 1B8XA 4LL4B 4HU7A 2P5RA 4AJ7A 1GL8A 1T8EB 4KDUA 2G2QA 5IPHA 4FQUA 2GQKA 4ULXA 4IN0A 2I81A 2JZTA 2A2SA 2WZ9A 2L6DA 3EINA 2B1LA 2JU5A 3F6FA 2YN1A 1QQ2A 4O92A 3CQFA 4E8EA 2RUFA 2GGTA 1RK4A 3H4KA 3TRPA 1OAZA 4XS1A 1W4VA 1Q98A 4PX1A 3VI7A 5LCZA 1U3IA 3E3EA 3IDVA 2H75A 2ES7A 2HSMB 1X0RA 3IRAA 1TKDB 1K0NA 12GSA 1H75A 5HR0A 4O5RA 20GSA 1XXUA 1F9MA 4BVXA 4TR3A 3ERGA 5HFGA 3WD6A 2MYGA 1TP9A 2CA8A 1YF1A 5E59A 2H1LA 3F0IA 1TU7A 1XPVA 5IOWA 2H6ZA 3GKMA 1WWJA 4J57E 2HQTA 2VL9A 4TR0A 5EL8A 2YV7A 2FWFA 1AQWA 3APSA 2GZPA 4CDOA 3VWUA 2B7JA 3HVSA 1M9AA 4PI2C 2OE3A 5BRTA 1TRWA 2EC4A 2M46A 2PWJA 3DKSA 1QK8A 3G7IA 7GSSA 5KN1A 3FR6A 1XOAA 5AGYA 4EE0A 5ECRB 1S3CA 4KX4A 1MTCA 2JACA 4E68A 4J2FA 1SJ6A 3GIXA 5C04A 4KUNA 4OFMA 3M3MA 4KCEA 4GQFA 1TRVA 5ECLB 5FHIA 1K0OA 4V1Ap 2B6MA 4F9ZA 1Z7PA 4QQ7A 18GSA 2VOCA 1OVNA 4TR1B 5ECOB 5IQYA 1Y6EA 5A34A 2BTOT 4K2DA 2R6KA 3RBTA 2X8CA 3GL5A 3GSTA 4X4JA 2IFQA 1B4PA 2LSTA 4CY6A 4IW9A 3TUEA 2ALBA 4KNDA 1JZRA 5HFKA 5A5HB 2IIYA 4HOJA 2A2RA 3HZ4A 5HFIA 1VGLA 2L5LA 5INYA 5IOXA 3TRXA 3R2QA 1PKWA 2K6VA 4P3YB 2DJ3A 3UAPA 2O7KA 2OJLA 3LQ7A 5ECNB 4A5PA 2CV4A 2HYXA 4YKGA 3UBLA 1Z9HA 3F4RA 4Z2UA 2YOIA 5HQPA 1DE1A 1SU9A 1A8YA 4KDXA 1X9SB 4ECBA 1PGTA 2E0QA 3KIJA 3KD0A 2QSIA 2GVPA 1R4WA 3HJPA 2YJ7A 1V57A 5KOXA 3W6GA 3ME7A 4Z7XA 2R2JA 4E8HA 3GTUA 1TOFA 4K6XA 2H6XA 2DIZA 1FOVA 4G10A 1K0CA 3KEBA 2ZUPA 1B48A 4AKIA 1ZGNA 4K7OA 4PGTA 2GT6A 3M0FA 4BVYB 3P90A 3BJ5A 3ZVJD 1GUMA 4JEDA 4CW9A 1TXXA 3FKFA 2KLXA 3CSJA 2V2GA 1HNBA 4N30A 4ZBAA 1TI1A 4EF0A 2YANA 4N3ZA 3BCKA 2CVDA 4TXOA 4XS6A 3HVNA 1B9XC 2CQ9A 4BWQA 2UV8G 2C0EA 3ZL5A 1ZMAA 3EMXA 3TCOA 2WFCA 2O3EA 4KCAA 4MABA 3UOMA 4RUVA 2LJKA 3TKSE 16GSA 3DEXA 1MDJA 2E7PA 5A1NA 2HXKA 2H76A 2WZSA 1EGOA 3TGZA 3M9JA 1PN0A 1IYHA 1YY7A 3IHGA 3QAWA 3ME8A 3G7YA 2ON5A 4OD7A 2VL2A 5CP1A 3IR4A 1FAAA 3BCIA 2F8AA 2VCWA 2GDRA 4BIKA 2JZSA 3FK8A 3VWVA 4NAXA 3TKSA 4DSSB 5ID2A 3DVWA 1AQXA 2ZCTA 4NHWA 1EOHA 1YEPA 3HHVA 1QFNA 4KA0A 4ZIJA 1KEBA 4Q5QA 2CX4A 2PBJA 4KW6A 4N0VA 5IIZA 3GSSA 1SYRA 2LTKA 1V2AA 1TK5B 2H30A 3TJJA 2H1DA 2UZ8A 4JRRA 2WVXB 4XCSA 1Z5YE 2LRCA 1XVWA 1VF2A 3G7JA 4YKFA 3TKQA 2QA1A 4K0NA 1F2EA 2EIOA 3BOAA 2DJ0A 2TIRA 2DJKA 2GSQA 2DJJA 2FY6A 1ZYPA 1A0RP 4EUYA 2PMTA 2H19A 3G9BA 3GURA 3IHQA 5AISA 3KMOA 2HSMA 2LJAA 3L9SA 3VPTA 1A2LA 3NOFA 2IMDA 3RFRC 4IELA 4K8MA 4GCIA 2RM5A 4XIHA 1J9BA 1C72A 2YNXA 4AJ6A 2VCQA 4Q5RA 5JWQB 1JFUA 3H93A 1PL2A 1BEDA 3EVIA 2JZRA 3F4TA 3I6AA 4HU9A 4WF4A 2PUKC 1TJDA 1NSWA 1BF5A 4HJ2A 3RPPA 5GSTA 1N8JA 1GLPA 3FYGA 1M3JA 1EGRA 2YCDA 1XZOA 1IYIA 3HXSA 3VWXA 3BBYA 3MAKA 2G0FA 3M8NA 3MYDA 5BMUB 1SKRB 5AN1A 4TW5A 1MD3A 5A4WA 5J5NA 3FRCA 1BYEA 4TN8A 1THXA 1UC7A 4ZB7A 5H5SA 1CQHA 1O81A 1M99A 5F06A 2XPDA 1XW6A 1VRSD 3P8WA 1EP8A 3RGBC 3I43A 2V41A 3I69A 4JZQA 1XW9A 3VLNA 2VD0A 4TR1A 4LLRA 1PSQA 3L78A 2L5OA 4FIWA 3V1WA 3GX8A 4MNNA 2IMIA 4WR4A 5CRHA 1PFOA 5A5HA 2EFHA 4DSQA 4PQHA 4MJEA 2M80A 3DGQA 1UVZA 1V58A 4F2IA 5DCHA 4MZWA 1FOHA 1GNWA 4WKWA 1JZDA 3RAZA 1GSQA 5DQYA 4F0CA 4OO5A 2B5XA 5A5KA 8GSSA 4JE1A 1ERUA 1GH2A 4PUFC 4TR4A 2RM6A 1EZKA 4V2NA 2AJQB 2GS3A 2DJ1A 1ZYNA 5G1LA 1U3AA 1ML6A 3NZNA 1HYUA 3DRNA 3UJ1A 5CRDA 2XBIA 2JSYA 4OFTA 3A5IA 3A5WA 3IE3A 1K0AA 3C1RA 3Q19A 2GQLA 4BVYA 3LXZA 4NV2A 2RIIA 3TJFA 3LYPA 1SENA 4G0LA 5DCGA 1ABAA 1ERVA 1EV4A 1TDIA 4X0XA 1PD21 1ACVA 3H8QA 4HEA2 1VF4A 5JWRB 2V6KA 5DAKB 2GLRA 9GSSA 4Z2TA 4L8EA 3GYKA 4HJMA 2YWMA 1NW2A 1YQ1A 3VPQA 1R5PA 3GKXA 4W66A 3EPTA 6GSUA 4FH8A 2WW1A 2YPMA 4IJ3A 1U87A 4KAEA 4OMVA 5D73A 2FLSA 1QUWA 4MJCA 1BX9A 3TOTA 4WBJA 2R0CA 1M2BA 3TRQA 4ZB9A 4G01A 2LJRA 5C00A 1XWAA 5D9WA 3QCPA 4ZBBA 3F4SA 3SWLA 4HSCX 4I8BA 4JBBA 5ECQB 2HSNB 5G5FA 4ZL9A 4DSSA 4AKGA 2EIQA 3VK9A 2A2PA 1N2AA 1OC3A 3EC3A 5D93A 2R0PA 3KGKA 1SJZA 3KZQA 1U6TA 1GNEA 1GTBA 2AHEA 4Q5NA 1A2JA 1SL2B 4V1Ag 4EXJA 4G9HA 5GZZB 1AW9A 3P2AA 3GMFA 1ZL9A 2WVXA 1K0DA 4OCFA 2HFDA 5J4VA 3HJOA 2GSTA 1GSEA 2Z9SA 11GSA 2LEGA 1M0UA 3TKPA 2GZYA 1YKCA 1OC8A 1FHEA 2NPBA 2LQQA 4JR6A 4X1UA 3EWLA 3PINA 2A4VA 5GSSA 2OBKA 3QPMA 1XWGA 5IMCA 1X5EA 2N5FA 3D4TA 4ZL7A 3AY8A 3WT2A 1MDKA 3DXBA 5AIVA 4O5QA 1YKAA 4IP6A 3HKRA 1WP0A 4CY8A 4XRAA 2H74A 4YAPA 5DJMA 2X49A 2DLXA 2X8HA 2H71A 5DALB 3L9VA 2O36A 3F9UA 4IS0A 3LG6A 1Z3EA 3F63A 2WULA 5J40A 2H72A 2TRXA 1Y1UA 4X43A 4BL7B 3CBUA 4BPYA 5LNKe 2L4QA 2CZ3A 1WIKA 2PVOC 2LUSA 2HE3A 2JSZA 1WOUA 3ZLPA 4TKYA 3ZIJA 4XS4B 17GSA 4ECIA 6GSTA 4PHZC 4I6XA 2O85A 3D5JA 4HQSA 4NWYA 4MH3A 1AAZA 2LRNA 2HNLA 1X9MB 1SD9A 2HRFA 1NHYA 2VLTA 3GH9A 2N5BA 2EFCA 4GSSA 3GA4A 3MSZA 3ZVJA 4L0UA 5D9VA 3UL3A 3KTLA 2WVZA 2P0GA 2VL3A 1B4QA 5ECSA 1XBSA 5FWGA 1U88A 4ECJA 1T1VA 4I2UA 2KOKA 3ZREA 1N25A 4BWSA 3A2XA 3HMJG 3GKKA 5KOWA 3C71A 2J23A 3QDNA 3QFAC 2OA7A 1DE2A 1FVKA 1M2AA 5B7CA 2WJUA 4MK3A 2C3TA 3DWVA 3PGTA 3IAS2 4ICYA 2GZZA 5GAND 2V32A 4AGSA 3C8EA 4GDFA 1G7EA 4MZBA 2IMFA 2I3YA 3IC4A 3APQA 5IMZA 3DIEA 3C73A 1XG8A 1PMTA 1ST9A 1XFLA 2YJHA 22GSA 2O8VB 4USSA 1XIYA 5CRGA 4DVCA 4EKZA 3ERFA 2EFEA 4L5LA 1YVLA 4I2TA 2QGVA 3FW2A 3WT1A 4POLA 1PKZA 3KH7A 2QC7A 4GLTA 2R4VA 1K3LA 3IK7A 2MMAA 3NIVA 2NDOA 2HZEB 1JLWA 2B5EA 4ID0A 2X4AA 1JLVA 4NMUA 3VWWA 4I97A 5HR3A 3KXOA 4IQAA 3U5RE 1G6YA 1SVOA 2PGTA 4HDEA 1O7UA 3A2WA 2GSSA 5JCGA 5DAKA 5ECIB 3EMPA 5DVBA 5IO0A 1EEJA 2VLVA 2R0GA 5EVOA 1ON4A 5J4YA 3KP9A 1BG5A 2H0IA 1TXUA 2H73A 1BQ7A 5J41A 5IPGA 4DEJA 3MDKA 3UVHA 1O8XA 1W89A 1RQMA 1URMA 3HVXA 4WF5A 4MCUA 1PQNA 4XTSA 3RHBA 3Q18A 2B5YA 2HSHA 2YV9A 1LBKA 1HNAA 1QMVA 1SKSB 4ZXGA 5D96A 1GUKA 2XPEA 4NXIA 1GTIA 3UMAA 1J0FA 5IMFA 2AAWA 5F07A 2VO4A 2VCZA 2IPAA 3E9JB 5F05A 4YQUA 1XCCA 2LKUA 3KP8A 2MMNA 3FY7A 1V98A 2MZCA 2QA2A 1EEMA 2VLUA 2B7KA 2IWTA 3ZFLA 2IJYA 2HSNA 4OCEA 3ZZXA 1SYXA 3TDGA 1T00A 5FT3A 2CX3A 2YWOA 4OFNA 2WGRA 1TK8B 2BMXA 3ZMKA 2H8LA 3EYTA 3GV1A 4ZBDA 3CRTA 4KF9A 4MJBA 4RI7A 3CTFA 5KEJA 2KHPA 3LW9A 3R3EA 1AIUA 1XOBA 1M9BA 2RUEA 4AJ8A 3UEMA 2KP2A 4WEYA 2R3XA 2R37A 5DDLA 2C3NA 2LS5A 1E2YA 3TB2A 4YQMA 4N0ZA 2OKAA 1TU8A 3U6VA 4FYUA 3UIWA 5AIXA 4MDCA 1GULA 1EWXA 4QMKA 4PQ1A 3IXRA 3HY2A 4IVFA 5CRWA 4Z2RA 2XBQA 3ZITA 3CMIA 5J9CA 2HI7A 4MF6A 2VCVA 2IMKA 3D4MA 1Z7RA 2WDUA 1ZOFA 2XHFA 4IHUA 3TJGA 3GRXA 3KM6A 4MMMA 5J47A 4G0IA 4NPBA 1XW5A 2PERA 4POMA 6GSXA 2CAQA 2P31A 2HRKB 4BL7A 2H1BA 4WETA 3HYPA 3ZIVA 5ECHB 3CYNA 2I4AA 1K3OA 3KTBA 5LD0A 1A8LA 2E2GA 4K1FA 2E2MA 2BJXA
chains in the Genus database with same CATH topology
3QAVA 1GSUA 2PU9C 4O32A 4O5UA 4PXOA 3P7XA 1ZCPA 3RPNA 2WCIA 2YWNA 4XHMA 4XS4A 2FCHA 2X64A 3FZAA 4RI6A 2YZUA 1F37A 4EIPA 2A4HA 3L4NA 1Q4JA 5EY6A 3UVTA 4FO5A 2OADA 1HQOA 3ERWA 3ED3A 5JWOB 4BA7A 3QAGA 4GXZA 1O73A 1OYJA 2V1MA 1ERTA 3TKRA 1BG1A 5B8BA 1EP7A 4AF2A 3CXGA 3F3RA 2LNTA 1XWBA 2L6CA 3S9FA 2X99A 2H0GA 5G31A 1OKTA 4DSRA 5KN0A 4Q5FA 4GSNA 2FWHA 3CWGA 3ZTLA 1G6WA 2V6OA 1Z6MA 5DJLA 1H4OA 2PVQA 4OO4A 3IA1A 4AKXB 1GP1A 2CVKA 2H01A 5H5RA 1XWKA 4G19A 3O6TA 2M72A 1PX7A 4I5QA 1GWCA 5ECMB 10GSA 1NHOA 1R26A 5G30A 3F6DA 3BD2A 1DUGA 1XVQA 3FMWA 4KSOA 3M9KA 5A4VA 2RLIA 1SL0B 3DMLA 3VFIA 2HSYA 4K5RA 4GRFA 2F3MA 4G0KA 2VM2A 2C8UA 3HD5A 2FHEA 1YZXA 2NBSA 4G2EA 3TU3B 3QR6A 1JZOA 3EURA 2AV4A 4ILFA 3IC8A 4YQVA 2TRCP 6GSVA 4L5OA 1R7HA 1TRSA 4KGIA 2HZEA 2HT9A 3W8SA 5G2ZA 4ZILA 2REMA 3PPUA 5J4UA 5CO3A 1O8WA 2H66A 2CT6A 3ZFBA 3FHKA 1G0TA 4D73B 1NM3A 4RQXA 5CAXA 2AB6A 5ELAA 3F3QA 19GSA 1SJIA 1FVJA 1FO5A 2DJ2A 3KCMA 4PQIA 1M2DA 5J3RA 3QD9A 5F0GA 5D9TA 3QFBC 3LXTA 2NTOA 3PR8A 5EPFA 3D0ZA 3ISOA 2R5GA 3VURA 3E0UA 3ZMLA 2GT5A 5ABRA 2HZFA 4J56E 2DIYA 1LJRA 2VCTA 2L57A 1OC9B 4EIQA 1Z6NA 1OKDA 4EC0A 2CZ2A 3GFKA 3CSHA 5JCUA 3HDCA 2N5AA 1X5CA 2VM1A 2NVLA 4JU5A 3UARA 3FEUA 3L0HA 1TW9A 3D21A 2HRNA 3GL3A 1MD4A 4K7NA 4GSTA 4ECCA 1MEKA 2C0DA 2I9HA 3EU3A 4JR4A 1SKWB 3DVXA 2C4JA 3Q6OA 2FGXA 3LYKA 1V40A 3K8NA 1A2MA 1R5AA 2H6YA 1J08A 1DSBA 2IN3A 4RQRA 1UA5A 4MLYA 4N10A 2DBCA 4PNGA 2VD1A 5GAPD 2MMOA 1K0BA 4ZB6A 2L59A 1GLQA 1FW1A 4MPFA 4GQCA 4AI6A 3GKNA 2L4CA 3GHAA 5D8IA 2GSRA 2DMMA 1TK0B 1JZWA 4LA1A 1ZYQB 2FWEA 3IAM2 3FR3A 2O87A 4HZ2A 3KH9A 3US3A 5BMUA 4LMVA 4POBA 1VF3A 14GSA 2VIMA 3WYWA 1K3YA 5HR1A 4IJIA 2HLSA 3N9JA 4POKA 1GSDA 4AKHA 3FZ4A 4GWRA 4F03A 4TVEA 1WPIA 4XRDA 4TOPA 1EV9A 1PA3A 1GUHA 2DMLA 2YWIA 1A24A 13GSA 4K7IA 3WGEA 1UN2A 1Y25A 4HUAA 2LRTA 3TJKA 4KDYA 3HVVA 2F9SA 1ERWA 4MJAA 1A0FA 4NHZA 1YF0A 4K2XA 3GH6A 3EU4A 1T7PB 1FB0A 4OWYA 3HA9A 1WE0A 4MP4A 2HRKA 3I9V2 3TOUA 4CHSA 2MBTA 2WS2A 4EO3A 1SL1B 1CQGA 4K9ZA 1AQVA 3LSZA 3IK9A 2IL3A 2VL2C 1QGVA 4EL1A 4L0WA 2GQMA 3L9UA 5IM9A 3CSIA 2YP6A 3TKSC 5COHA 4ISDA 4EDYA 4MA9A 2OT3A 5L71A 3W8JA 1JHBA 5IMDA 3ZRDA 2C80A 1O85A 2OE1A 4ML1A 4PNFA 2H70A 1F6MC 5DQSA 4IBPA 2H0HA 3RHCA 3H1NA 4GTUA 4FYCA 1OE7A 3CTGA 5CREA 4K5SA 3N5OA 1QXHA 2GTUA 1E6BA 2C1YA 2F51A 5B6NA 3LEFA 1X5DA 1GTAA 1VF1A 3LWAA 1GSYA 1WRYA 1ZYEA 1T4YA 2FNOA 2H1AA 1T4ZA 4BVXB 4V2MA 3F8UA 1S3AA 2D2ZA 3KMNA 5JCWA 1BJXA 5D9XA 1G7OA 2K9FA 1KNGA 2JL4A 3HJMA 1SK2A 2LV3A 1GTUA 3C1SA 2K18A 2ON7A 4EDZA 1AC1A 2KP1A 1PRXA 2XC2A 1LU4A 3MNGA 4PURA 2ZNMA 4O7HA 1I5GA 2OE0A 2JADA 1SK0A 3MWHA 3Q74A 3IPZA 3A3TA 5KN3A 3LGCA 4K0GA 3KJYA 4PTSA 1TRUA 5F8BA 4LL1B 4PUAA 3IOSA 5A4UA 3PH9A 2MMZA 1AXDA 4IGJA 3RDWA 5G5EA 5B8AA 2FA8A 1GSFA 4LMWA 1TTZA 5ENUA 5E4WA 6GSYA 2J9HA 4MPGA 2P5QA 4EVMA 3DYRA 3A2VA 3HCZA 4D73A 4H86A 1K0MA 4QL7A 3APOA 1SVLA 2O89A 1RW1A 1WJKA 3J7Yk 1B9YC 4WBRD 1HNCA 2X8GA 5A34B 1M7TA 3HZ8A 2DSAA 1ZZYA 4GF0A 4YAVA 1PX6A 2IFQB 2K8SA 5IO2A 2DKHA 3SBCA 1OC9A 2C0FA 4FYBA 4IP1A 2DKIA 1T3BA 2MBSA 3DD3A 1USBA 2HRAA 4KSMA 4WXTA 3D22A 1THOA 2FUG2 2K8VA 3VI5A 1TI3A 1SD8A 1FG4A 1OE8A 1PL1A 3MIXA 2OBIA 4NV5A 4MF5A 2YZHA 1S3DA 1A23A 2PN8A 2VCXA 3D6IA 3GUSA 3O76A 2LQOA 3J7Yb 5B6MA 1DBYA 3CRUA 3IV4A 4ACSA 4HS1A 5DALA 2QKEA 1FB6A 3UBKA 1YDKA 2B1KA 1SK1A 3TJBA 1I9DA 3LORA 3GTUB 5KN2A 2VKZG 3JCML 1XWCA 2I1UA 3M1GA 2FWGA 3FR9A 1KBNA 2WB9A 1V9WA 2EFDA 1HD2A 5ECKB 3GNJA 1AUCA 5H5QA 3GN3A 2EIRA 3WGXA 1EOGA 5ELGA 2C0GA 4KH7A 1ILOA 4IKHA 2O5VA 1PN9A 4TXVA 4MZCA 4V2LA 3QMXA 4TXOB 5G1KA 5IMAA 5ECPB 4MF7A 2IMEA 3IBHA 1GRXA 3OR5A 4WR5A 4F82A 4TRXA 5IMVA 1WMJA 3H79A 1MDIA 1YJ6A 2FD3A 3QOUA 6GSWA 3C7MA 1O6JA 1YEXA 3FZ9A 4N11A 1GSSA 4IQ1A 5DBQA 2DC5A 4KB3A 2H1GA 1KTEA 2PPTA 5A1NB 2C3QA 2VAFA 1F3AA 2F8FA 4F0BA 5J9BA 3GX0A 6GSSA 2WRTA 2LNSA 1F3BA 3O3TA 4YH2A 5HR2A 4HZ4A 3WGDA 2OACA 3LJRA 4MH2A 4ZL8A 3ZYWA 5CYYA 5CNWA 3LFLA 4ML6A 2AUVA 2KUCA 5ID2B 1BAYA 4HI7A 2AYTA 1X9WB 4ZB8A 4HQZA 3EE2A 3FZ5A 2FA4A 2VUPA 1SVMA 4KE3A 2B3SA 4QL9A 2CVBA 2CAIA 1B8XA 4LL4B 4HU7A 2P5RA 4AJ7A 1GL8A 1T8EB 4KDUA 2G2QA 5IPHA 4FQUA 2GQKA 4ULXA 4IN0A 2I81A 2JZTA 2A2SA 2WZ9A 2L6DA 3EINA 2B1LA 2JU5A 3F6FA 2YN1A 1QQ2A 4O92A 4E8EA 2RUFA 2GGTA 1RK4A 3H4KA 3TRPA 1OAZA 4XS1A 1W4VA 1Q98A 4PX1A 3VI7A 5LCZA 1U3IA 3E3EA 3IDVA 2H75A 2ES7A 2HSMB 1X0RA 3IRAA 1TKDB 1K0NA 12GSA 1H75A 5HR0A 4O5RA 20GSA 1XXUA 1F9MA 4BVXA 4TR3A 3ERGA 5HFGA 3WD6A 2MYGA 1TP9A 2CA8A 1YF1A 5E59A 2H1LA 3F0IA 1TU7A 1XPVA 5IOWA 2H6ZA 3GKMA 1WWJA 4J57E 2HQTA 2VL9A 4TR0A 5EL8A 2YV7A 2FWFA 1AQWA 3APSA 2GZPA 4CDOA 3VWUA 2B7JA 3HVSA 1M9AA 2OE3A 5BRTA 1TRWA 2EC4A 2M46A 2PWJA 3DKSA 1QK8A 3G7IA 7GSSA 5KN1A 3FR6A 1XOAA 5AGYA 4EE0A 5ECRB 1S3CA 4KX4A 1MTCA 2JACA 4E68A 4J2FA 1SJ6A 3GIXA 5C04A 4KUNA 4OFMA 3M3MA 4KCEA 4GQFA 1TRVA 5ECLB 5FHIA 1K0OA 4V1Ap 2B6MA 4F9ZA 1Z7PA 4QQ7A 18GSA 2VOCA 1OVNA 4TR1B 5ECOB 5IQYA 1Y6EA 5A34A 2BTOT 4K2DA 2R6KA 3RBTA 2X8CA 3GL5A 3GSTA 4X4JA 2IFQA 1B4PA 2LSTA 4CY6A 4IW9A 3TUEA 2ALBA 4KNDA 1JZRA 5HFKA 5A5HB 2IIYA 4HOJA 2A2RA 3HZ4A 5HFIA 1VGLA 2L5LA 5INYA 5IOXA 3TRXA 3R2QA 1PKWA 2K6VA 4P3YB 2DJ3A 3UAPA 2O7KA 2OJLA 3LQ7A 5ECNB 4A5PA 2CV4A 2HYXA 4YKGA 3UBLA 1Z9HA 3F4RA 4Z2UA 2YOIA 5HQPA 1DE1A 1SU9A 1A8YA 4KDXA 1X9SB 4ECBA 1PGTA 2E0QA 3KIJA 3KD0A 2QSIA 2GVPA 1R4WA 3HJPA 2YJ7A 1V57A 5KOXA 3W6GA 3ME7A 4Z7XA 2R2JA 4E8HA 3GTUA 1TOFA 4K6XA 2H6XA 2DIZA 1FOVA 4G10A 1K0CA 3KEBA 2ZUPA 1B48A 4AKIA 1ZGNA 4K7OA 4PGTA 2GT6A 3M0FA 4BVYB 3P90A 3BJ5A 3ZVJD 1GUMA 4JEDA 4CW9A 1TXXA 3FKFA 2KLXA 3CSJA 2V2GA 1HNBA 4N30A 4ZBAA 1TI1A 4EF0A 2YANA 4N3ZA 3BCKA 2CVDA 4TXOA 4XS6A 1B9XC 2CQ9A 4BWQA 2UV8G 2C0EA 3ZL5A 1ZMAA 3EMXA 3TCOA 2WFCA 4KCAA 4MABA 3UOMA 4RUVA 2LJKA 3TKSE 16GSA 3DEXA 1MDJA 2E7PA 5A1NA 2HXKA 2H76A 1EGOA 3TGZA 3M9JA 1PN0A 1IYHA 1YY7A 3IHGA 3QAWA 3ME8A 3G7YA 2ON5A 4OD7A 2VL2A 5CP1A 3IR4A 1FAAA 3BCIA 2F8AA 2VCWA 2GDRA 2JZSA 3FK8A 3VWVA 4NAXA 3TKSA 4DSSB 5ID2A 3DVWA 1AQXA 2ZCTA 4NHWA 1EOHA 1YEPA 3HHVA 1QFNA 4KA0A 4ZIJA 1KEBA 4Q5QA 2CX4A 2PBJA 4KW6A 4N0VA 5IIZA 3GSSA 1SYRA 2LTKA 1V2AA 1TK5B 2H30A 3TJJA 2H1DA 2UZ8A 4JRRA 4XCSA 1Z5YE 2LRCA 1XVWA 1VF2A 3G7JA 4YKFA 3TKQA 2QA1A 4K0NA 1F2EA 2EIOA 3BOAA 2DJ0A 2TIRA 2DJKA 2GSQA 2DJJA 2FY6A 1ZYPA 1A0RP 4EUYA 2PMTA 2H19A 3G9BA 3GURA 3IHQA 5AISA 3KMOA 2HSMA 2LJAA 3L9SA 3VPTA 1A2LA 3NOFA 2IMDA 4K8MA 4IELA 4GCIA 2RM5A 4XIHA 1J9BA 1C72A 2YNXA 4AJ6A 2VCQA 4Q5RA 5JWQB 1JFUA 3H93A 1PL2A 1BEDA 3EVIA 2JZRA 3F4TA 3I6AA 4HU9A 4WF4A 2PUKC 1TJDA 1NSWA 1BF5A 4HJ2A 3RPPA 5GSTA 1N8JA 1GLPA 3FYGA 1EGRA 2YCDA 1XZOA 1IYIA 3HXSA 3VWXA 3BBYA 3MAKA 2G0FA 3M8NA 3MYDA 5BMUB 1SKRB 5AN1A 4TW5A 1MD3A 5A4WA 5J5NA 3FRCA 1BYEA 4TN8A 1THXA 1UC7A 4ZB7A 5H5SA 1CQHA 1O81A 1M99A 5F06A 2XPDA 1XW6A 1VRSD 3P8WA 1EP8A 3I43A 2V41A 3I69A 4JZQA 1XW9A 3VLNA 2VD0A 4TR1A 4LLRA 1PSQA 3L78A 2L5OA 4FIWA 3V1WA 3GX8A 4MNNA 2IMIA 4WR4A 5CRHA 5A5HA 2EFHA 4DSQA 4PQHA 4MJEA 2M80A 3DGQA 1UVZA 1V58A 4F2IA 5DCHA 4MZWA 1FOHA 1GNWA 4WKWA 1JZDA 3RAZA 1GSQA 5DQYA 4F0CA 4OO5A 2B5XA 5A5KA 8GSSA 4JE1A 1ERUA 1GH2A 4PUFC 4TR4A 2RM6A 1EZKA 4V2NA 2AJQB 2GS3A 2DJ1A 1ZYNA 5G1LA 1U3AA 1ML6A 3NZNA 1HYUA 3DRNA 3UJ1A 5CRDA 2XBIA 2JSYA 4OFTA 3A5IA 3A5WA 3IE3A 1K0AA 3C1RA 3Q19A 2GQLA 4BVYA 3LXZA 4NV2A 2RIIA 3TJFA 3LYPA 1SENA 4G0LA 5DCGA 1ABAA 1ERVA 1EV4A 1TDIA 4X0XA 1PD21 1ACVA 3H8QA 4HEA2 1VF4A 5JWRB 2V6KA 5DAKB 2GLRA 9GSSA 4Z2TA 4L8EA 3GYKA 4HJMA 2YWMA 1NW2A 1YQ1A 3VPQA 1R5PA 3GKXA 4W66A 3EPTA 6GSUA 4FH8A 2YPMA 4IJ3A 1U87A 4KAEA 4OMVA 5D73A 2FLSA 1QUWA 4MJCA 1BX9A 3TOTA 4WBJA 2R0CA 1M2BA 3TRQA 4ZB9A 4G01A 2LJRA 5C00A 1XWAA 5D9WA 3QCPA 4ZBBA 3F4SA 3SWLA 4I8BA 4JBBA 5ECQB 2HSNB 5G5FA 4ZL9A 4DSSA 4AKGA 2EIQA 3VK9A 2A2PA 1N2AA 1OC3A 3EC3A 5D93A 2R0PA 3KGKA 1SJZA 3KZQA 1U6TA 1GNEA 1GTBA 2AHEA 4Q5NA 1A2JA 1SL2B 4V1Ag 4EXJA 4G9HA 5GZZB 1AW9A 3P2AA 3GMFA 1ZL9A 1K0DA 4OCFA 2HFDA 5J4VA 3HJOA 2GSTA 1GSEA 2Z9SA 11GSA 2LEGA 1M0UA 3TKPA 2GZYA 1YKCA 1OC8A 1FHEA 2NPBA 2LQQA 4JR6A 4X1UA 3EWLA 3PINA 2A4VA 5GSSA 2OBKA 3QPMA 1XWGA 5IMCA 1X5EA 2N5FA 3D4TA 4ZL7A 3AY8A 3WT2A 1MDKA 3DXBA 5AIVA 4O5QA 1YKAA 4IP6A 3HKRA 1WP0A 4CY8A 4XRAA 2H74A 4YAPA 5DJMA 2X49A 2DLXA 2X8HA 2H71A 5DALB 3L9VA 3F9UA 4IS0A 3LG6A 1Z3EA 3F63A 2WULA 5J40A 2H72A 2TRXA 1Y1UA 4X43A 4BL7B 3CBUA 4BPYA 5LNKe 2L4QA 2CZ3A 1WIKA 2PVOC 2LUSA 2HE3A 2JSZA 1WOUA 3ZLPA 4TKYA 3ZIJA 4XS4B 17GSA 4ECIA 6GSTA 4I6XA 2O85A 3D5JA 4HQSA 4NWYA 4MH3A 1AAZA 2LRNA 2HNLA 1X9MB 1SD9A 2HRFA 1NHYA 2VLTA 3GH9A 2N5BA 2EFCA 4GSSA 3GA4A 3MSZA 3ZVJA 4L0UA 5D9VA 3UL3A 3KTLA 2P0GA 2VL3A 1B4QA 5ECSA 1XBSA 5FWGA 1U88A 4ECJA 1T1VA 4I2UA 2KOKA 3ZREA 1N25A 4BWSA 3A2XA 3HMJG 3GKKA 5KOWA 3C71A 2J23A 3QDNA 3QFAC 2OA7A 1DE2A 1FVKA 1M2AA 5B7CA 2WJUA 4MK3A 2C3TA 3DWVA 3PGTA 3IAS2 4ICYA 2GZZA 5GAND 2V32A 4AGSA 3C8EA 4GDFA 1G7EA 4MZBA 2IMFA 2I3YA 3IC4A 3APQA 5IMZA 3DIEA 3C73A 1PMTA 1ST9A 1XFLA 2YJHA 22GSA 2O8VB 4USSA 1XIYA 5CRGA 4DVCA 4EKZA 3ERFA 2EFEA 4L5LA 1YVLA 4I2TA 2QGVA 3FW2A 3WT1A 4POLA 1PKZA 3KH7A 2QC7A 4GLTA 2R4VA 1K3LA 3IK7A 2MMAA 3NIVA 2NDOA 2HZEB 1JLWA 2B5EA 4ID0A 2X4AA 1JLVA 4NMUA 3VWWA 4I97A 5HR3A 3KXOA 4IQAA 3U5RE 1G6YA 1SVOA 2PGTA 4HDEA 1O7UA 3A2WA 2GSSA 5JCGA 5DAKA 5ECIB 3EMPA 5DVBA 5IO0A 1EEJA 2VLVA 2R0GA 5EVOA 1ON4A 5J4YA 3KP9A 1BG5A 2H0IA 1TXUA 2H73A 1BQ7A 5J41A 5IPGA 4DEJA 3MDKA 3UVHA 1O8XA 1W89A 1RQMA 1URMA 3HVXA 4WF5A 4MCUA 1PQNA 4XTSA 3RHBA 3Q18A 2B5YA 2HSHA 2YV9A 1LBKA 1HNAA 1QMVA 1SKSB 4ZXGA 5D96A 1GUKA 2XPEA 4NXIA 1GTIA 3UMAA 1J0FA 5IMFA 2AAWA 5F07A 2VO4A 2VCZA 2IPAA 3E9JB 5F05A 4YQUA 1XCCA 2LKUA 3KP8A 2MMNA 3FY7A 1V98A 2MZCA 2QA2A 1EEMA 2VLUA 2B7KA 2IWTA 3ZFLA 2IJYA 2HSNA 4OCEA 3ZZXA 1SYXA 3TDGA 1T00A 5FT3A 2CX3A 2YWOA 4OFNA 2WGRA 1TK8B 2BMXA 3ZMKA 2H8LA 3EYTA 3GV1A 4ZBDA 3CRTA 4KF9A 4MJBA 4RI7A 3CTFA 5KEJA 2KHPA 3LW9A 3R3EA 1AIUA 1XOBA 1M9BA 2RUEA 4AJ8A 3UEMA 2KP2A 4WEYA 2R3XA 2R37A 5DDLA 2C3NA 2LS5A 1E2YA 3TB2A 4YQMA 4N0ZA 2OKAA 1TU8A 3U6VA 4FYUA 3UIWA 5AIXA 4MDCA 1GULA 1EWXA 4QMKA 4PQ1A 3IXRA 3HY2A 4IVFA 5CRWA 4Z2RA 2XBQA 3ZITA 3CMIA 5J9CA 2HI7A 4MF6A 2VCVA 2IMKA 3D4MA 1Z7RA 2WDUA 1ZOFA 2XHFA 4IHUA 3TJGA 3GRXA 3KM6A 4MMMA 5J47A 4G0IA 4NPBA 1XW5A 2PERA 4POMA 6GSXA 2CAQA 2P31A 2HRKB 4BL7A 2H1BA 4WETA 3HYPA 3ZIVA 5ECHB 3CYNA 2I4AA 1K3OA 3KTBA 5LD0A 1A8LA 2E2GA 4K1FA 2E2MA 2BJXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QAV A;  1GSU A;  2PU9 C;  4O32 A;  4PXO A;  3P7X A;  1ZCP A;  3RPN A;  2WCI A;  2YWN A;  4XHM A;  4XS4 A;  2FCH A;  2X64 A;  3FZA A;  4RI6 A;  2YZU A;  1F37 A;  3L4N A;  1Q4J A;  5EY6 A;  3UVT A;  4FO5 A;  2OAD A;  1HQO A;  3ERW A;  3ED3 A;  5JWO B;  4BA7 A;  3QAG A;  4GXZ A;  1O73 A;  1OYJ A;  2V1M A;  1ERT A;  3TKR A;  5B8B A;  1EP7 A;  4AF2 A;  3CXG A;  3F3R A;  2LNT A;  1XWB A;  2L6C A;  3S9F A;  2X99 A;  2H0G A;  5G31 A;  1OKT A;  4DSR A;  5KN0 A;  4Q5F A;  4GSN A;  2FWH A;  3ZTL A;  1G6W A;  2V6O A;  1Z6M A;  5DJL A;  1H4O A;  2PVQ A;  4OO4 A;  3IA1 A;  1GP1 A;  2CVK A;  2H01 A;  5H5R A;  1XWK A;  4G19 A;  3O6T A;  2M72 A;  1PX7 A;  4I5Q A;  1GWC A;  5ECM B;  10GS A;  1NHO A;  1R26 A;  5G30 A;  3F6D A;  3BD2 A;  1DUG A;  1XVQ A;  4KSO A;  3M9K A;  5A4V A;  2RLI A;  1SL0 B;  3DML A;  3VFI A;  2HSY A;  4GRF A;  2F3M A;  4G0K A;  2VM2 A;  2C8U A;  3HD5 A;  2FHE A;  1YZX A;  2NBS A;  4G2E A;  3QR6 A;  1JZO A;  3EUR A;  2AV4 A;  4ILF A;  3IC8 A;  4YQV A;  2TRC P;  6GSV A;  4L5O A;  1R7H A;  1TRS A;  4KGI A;  2HZE A;  2HT9 A;  3W8S A;  5G2Z A;  4ZIL A;  2REM A;  3PPU A;  5J4U A;  5CO3 A;  1O8W A;  2H66 A;  2CT6 A;  3ZFB A;  3FHK A;  1G0T A;  4D73 B;  1NM3 A;  4RQX A;  5CAX A;  2AB6 A;  5ELA A;  3F3Q A;  19GS A;  1SJI A;  1FVJ A;  1FO5 A;  2DJ2 A;  3KCM A;  4PQI A;  1M2D A;  5J3R A;  3QD9 A;  5F0G A;  5D9T A;  3QFB C;  3LXT A;  2NTO A;  3PR8 A;  5EPF A;  3D0Z A;  3ISO A;  2R5G A;  3VUR A;  3E0U A;  3ZML A;  2GT5 A;  5ABR A;  2HZF A;  4J56 E;  2DIY A;  1LJR A;  2VCT A;  2L57 A;  1OC9 B;  1Z6N A;  1OKD A;  4EC0 A;  2CZ2 A;  3GFK A;  3CSH A;  5JCU A;  3HDC A;  2N5A A;  1X5C A;  2VM1 A;  2NVL A;  4JU5 A;  3UAR A;  3FEU A;  3L0H A;  1TW9 A;  3D21 A;  2HRN A;  3GL3 A;  1MD4 A;  4K7N A;  4GST A;  4ECC A;  1MEK A;  2C0D A;  2I9H A;  3EU3 A;  4JR4 A;  1SKW B;  3DVX A;  3Q6O A;  2C4J A;  2FGX A;  3LYK A;  1V40 A;  3K8N A;  1A2M A;  1R5A A;  2H6Y A;  1J08 A;  1DSB A;  2IN3 A;  4RQR A;  1UA5 A;  4MLY A;  4N10 A;  2DBC A;  4PNG A;  2VD1 A;  5GAP D;  2MMO A;  1K0B A;  4ZB6 A;  2L59 A;  1GLQ A;  1FW1 A;  4MPF A;  4GQC A;  3GKN A;  2L4C A;  3GHA A;  5D8I A;  2GSR A;  2DMM A;  1TK0 B;  1JZW A;  4LA1 A;  1ZYQ B;  2FWE A;  3IAM 2;  3FR3 A;  2O87 A;  4HZ2 A;  3KH9 A;  3US3 A;  5BMU A;  4LMV A;  4POB A;  1VF3 A;  14GS A;  2VIM A;  3WYW A;  1K3Y A;  5HR1 A;  4IJI A;  2HLS A;  3N9J A;  4POK A;  1GSD A;  3FZ4 A;  4GWR A;  4F03 A;  4TVE A;  1WPI A;  4XRD A;  4TOP A;  1EV9 A;  1PA3 A;  1GUH A;  2DML A;  2YWI A;  1A24 A;  13GS A;  4K7I A;  3WGE A;  1UN2 A;  1Y25 A;  4HUA A;  2LRT A;  3TJK A;  4KDY A;  3HVV A;  2F9S A;  1ERW A;  4MJA A;  1A0F A;  4NHZ A;  1YF0 A;  3GH6 A;  3EU4 A;  1T7P B;  1FB0 A;  4OWY A;  3HA9 A;  1WE0 A;  4MP4 A;  2HRK A;  3I9V 2;  3TOU A;  4CHS A;  2MBT A;  2WS2 A;  4EO3 A;  1SL1 B;  1CQG A;  4K9Z A;  1AQV A;  3LSZ A;  3IK9 A;  2IL3 A;  2VL2 C;  1QGV A;  4EL1 A;  4L0W A;  2GQM A;  3L9U A;  5IM9 A;  3CSI A;  2YP6 A;  3TKS C;  5COH A;  4ISD A;  4EDY A;  4MA9 A;  5L71 A;  3W8J A;  1JHB A;  5IMD A;  3ZRD A;  2C80 A;  1O85 A;  2OE1 A;  4ML1 A;  4PNF A;  2H70 A;  1F6M C;  5DQS A;  4IBP A;  2H0H A;  3RHC A;  3H1N A;  4GTU A;  4FYC A;  1OE7 A;  3CTG A;  5CRE A;  3N5O A;  1QXH A;  2GTU A;  1E6B A;  2C1Y A;  2F51 A;  5B6N A;  3LEF A;  1X5D A;  1GTA A;  1VF1 A;  3LWA A;  1GSY A;  1WRY A;  1ZYE A;  1T4Y A;  2FNO A;  2H1A A;  1T4Z A;  4BVX B;  4V2M A;  3F8U A;  1S3A A;  2D2Z A;  3KMN A;  5JCW A;  1BJX A;  5D9X A;  1G7O A;  2K9F A;  1KNG A;  2JL4 A;  3HJM A;  1SK2 A;  2LV3 A;  1GTU A;  3C1S A;  2K18 A;  2ON7 A;  4EDZ A;  1AC1 A;  2KP1 A;  1PRX A;  2XC2 A;  1LU4 A;  3MNG A;  4PUR A;  2ZNM A;  4O7H A;  1I5G A;  2OE0 A;  2JAD A;  1SK0 A;  3MWH A;  3Q74 A;  3IPZ A;  3A3T A;  5KN3 A;  3LGC A;  4K0G A;  3KJY A;  4PTS A;  1TRU A;  5F8B A;  4LL1 B;  4PUA A;  3IOS A;  5A4U A;  3PH9 A;  2MMZ A;  1AXD A;  4IGJ A;  3RDW A;  5G5E A;  5B8A A;  2FA8 A;  1GSF A;  4LMW A;  1TTZ A;  5ENU A;  5E4W A;  6GSY A;  2J9H A;  4MPG A;  2P5Q A;  4EVM A;  3DYR A;  3A2V A;  3HCZ A;  4D73 A;  4H86 A;  1K0M A;  4QL7 A;  3APO A;  2O89 A;  1RW1 A;  1WJK A;  3J7Y k;  1B9Y C;  4WBR D;  1HNC A;  2X8G A;  1M7T A;  3HZ8 A;  2DSA A;  1ZZY A;  4GF0 A;  4YAV A;  1PX6 A;  2IFQ B;  2K8S A;  5IO2 A;  3SBC A;  1OC9 A;  2C0F A;  4FYB A;  4IP1 A;  1T3B A;  2MBS A;  3DD3 A;  1USB A;  2HRA A;  4KSM A;  4WXT A;  3D22 A;  1THO A;  2FUG 2;  2K8V A;  3VI5 A;  1TI3 A;  1SD8 A;  1FG4 A;  1OE8 A;  1PL1 A;  2OBI A;  4NV5 A;  4MF5 A;  2YZH A;  1S3D A;  1A23 A;  2PN8 A;  2VCX A;  3D6I A;  3GUS A;  3O76 A;  2LQO A;  3J7Y b;  5B6M A;  1DBY A;  3CRU A;  3IV4 A;  4ACS A;  4HS1 A;  5DAL A;  2QKE A;  1FB6 A;  3UBK A;  1YDK A;  2B1K A;  1SK1 A;  3TJB A;  1I9D A;  3LOR A;  3GTU B;  5KN2 A;  3JCM L;  1XWC A;  2I1U A;  3M1G A;  2FWG A;  3FR9 A;  1KBN A;  2WB9 A;  1V9W A;  1HD2 A;  5ECK B;  3GNJ A;  1AUC A;  5H5Q A;  3GN3 A;  2EIR A;  3WGX A;  1EOG A;  5ELG A;  2C0G A;  4KH7 A;  1ILO A;  4IKH A;  1PN9 A;  4TXV A;  4MZC A;  4V2L A;  3QMX A;  4TXO B;  5G1K A;  5IMA A;  5ECP B;  4MF7 A;  2IME A;  3IBH A;  1GRX A;  3OR5 A;  4WR5 A;  4F82 A;  4TRX A;  5IMV A;  1WMJ A;  3H79 A;  1MDI A;  1YJ6 A;  2FD3 A;  3QOU A;  6GSW A;  3C7M A;  1O6J A;  1YEX A;  3FZ9 A;  4N11 A;  1GSS A;  4IQ1 A;  5DBQ A;  2DC5 A;  4KB3 A;  2H1G A;  1KTE A;  2PPT A;  2C3Q A;  2VAF A;  1F3A A;  2F8F A;  4F0B A;  5J9B A;  3GX0 A;  6GSS A;  2WRT A;  2LNS A;  1F3B A;  3O3T A;  4YH2 A;  5HR2 A;  4HZ4 A;  3WGD A;  2OAC A;  3LJR A;  4MH2 A;  4ZL8 A;  3ZYW A;  5CYY A;  5CNW A;  3LFL A;  4ML6 A;  2AUV A;  2KUC A;  5ID2 B;  1BAY A;  4HI7 A;  2AYT A;  1X9W B;  4ZB8 A;  4HQZ A;  3EE2 A;  3FZ5 A;  2FA4 A;  2VUP A;  4KE3 A;  2B3S A;  4QL9 A;  2CVB A;  2CAI A;  1B8X A;  4LL4 B;  4HU7 A;  2P5R A;  4AJ7 A;  1GL8 A;  1T8E B;  4KDU A;  2G2Q A;  5IPH A;  4FQU A;  2GQK A;  4ULX A;  4IN0 A;  2I81 A;  2JZT A;  2A2S A;  2WZ9 A;  2L6D A;  3EIN A;  2B1L A;  2JU5 A;  3F6F A;  2YN1 A;  1QQ2 A;  4O92 A;  4E8E A;  2RUF A;  2GGT A;  1RK4 A;  3H4K A;  3TRP A;  1OAZ A;  4XS1 A;  1W4V A;  1Q98 A;  4PX1 A;  3VI7 A;  5LCZ A;  1U3I A;  3E3E A;  3IDV A;  2H75 A;  2ES7 A;  2HSM B;  1X0R A;  3IRA A;  1TKD B;  1K0N A;  12GS A;  1H75 A;  5HR0 A;  4O5R A;  20GS A;  1XXU A;  1F9M A;  4BVX A;  4TR3 A;  3ERG A;  5HFG A;  3WD6 A;  2MYG A;  1TP9 A;  2CA8 A;  1YF1 A;  5E59 A;  3F0I A;  1TU7 A;  1XPV A;  5IOW A;  2H6Z A;  3GKM A;  1WWJ A;  4J57 E;  2HQT A;  2VL9 A;  4TR0 A;  5EL8 A;  2YV7 A;  2FWF A;  1AQW A;  3APS A;  2GZP A;  4CDO A;  3VWU A;  2B7J A;  3HVS A;  1M9A A;  2OE3 A;  1TRW A;  2EC4 A;  2M46 A;  2PWJ A;  3DKS A;  1QK8 A;  3G7I A;  7GSS A;  5KN1 A;  3FR6 A;  1XOA A;  5AGY A;  4EE0 A;  5ECR B;  1S3C A;  4KX4 A;  1MTC A;  2JAC A;  4J2F A;  1SJ6 A;  3GIX A;  5C04 A;  4KUN A;  4OFM A;  3M3M A;  4KCE A;  4GQF A;  1TRV A;  5ECL B;  5FHI A;  1K0O A;  4V1A p;  2B6M A;  4F9Z A;  1Z7P A;  4QQ7 A;  18GS A;  2VOC A;  1OVN A;  4TR1 B;  5ECO B;  5IQY A;  1Y6E A;  4K2D A;  2BTO T;  2R6K A;  3RBT A;  2X8C A;  3GL5 A;  3GST A;  2IFQ A;  1B4P A;  2LST A;  4IW9 A;  3TUE A;  2ALB A;  4KND A;  1JZR A;  5HFK A;  2IIY A;  4HOJ A;  2A2R A;  3HZ4 A;  5HFI A;  1VGL A;  2L5L A;  5INY A;  5IOX A;  3TRX A;  3R2Q A;  1PKW A;  2K6V A;  4P3Y B;  2DJ3 A;  3UAP A;  2O7K A;  2OJL A;  3LQ7 A;  5ECN B;  2CV4 A;  2HYX A;  3UBL A;  1Z9H A;  3F4R A;  5HQP A;  2YOI A;  1DE1 A;  1SU9 A;  1A8Y A;  4KDX A;  1X9S B;  4ECB A;  1PGT A;  2E0Q A;  3KIJ A;  3KD0 A;  2QSI A;  2GVP A;  1R4W A;  3HJP A;  2YJ7 A;  1V57 A;  3W6G A;  3ME7 A;  4Z7X A;  2R2J A;  4E8H A;  3GTU A;  1TOF A;  4K6X A;  2H6X A;  2DIZ A;  1FOV A;  4G10 A;  1K0C A;  3KEB A;  2ZUP A;  1B48 A;  1ZGN A;  4K7O A;  4PGT A;  2GT6 A;  3M0F A;  4BVY B;  3P90 A;  3BJ5 A;  3ZVJ D;  1GUM A;  4JED A;  4CW9 A;  1TXX A;  3FKF A;  2KLX A;  3CSJ A;  2V2G A;  1HNB A;  4N30 A;  4ZBA A;  1TI1 A;  4EF0 A;  2YAN A;  3BCK A;  2CVD A;  4TXO A;  4XS6 A;  1B9X C;  2CQ9 A;  4BWQ A;  2C0E A;  3ZL5 A;  1ZMA A;  3EMX A;  3TCO A;  2WFC A;  4KCA A;  4MAB A;  3UOM A;  4RUV A;  2LJK A;  3TKS E;  16GS A;  3DEX A;  1MDJ A;  2E7P A;  2HXK A;  2H76 A;  1EGO A;  3TGZ A;  3M9J A;  1IYH A;  1YY7 A;  3QAW A;  3ME8 A;  3G7Y A;  2ON5 A;  4OD7 A;  2VL2 A;  5CP1 A;  3IR4 A;  1FAA A;  3BCI A;  2F8A A;  2VCW A;  2GDR A;  2JZS A;  3FK8 A;  3VWV A;  4NAX A;  3TKS A;  4DSS B;  5ID2 A;  3DVW A;  1AQX A;  2ZCT A;  4NHW A;  1EOH A;  1YEP A;  3HHV A;  1QFN A;  4KA0 A;  4ZIJ A;  1KEB A;  4Q5Q A;  2CX4 A;  2PBJ A;  4KW6 A;  4N0V A;  5IIZ A;  3GSS A;  1SYR A;  2LTK A;  1V2A A;  1TK5 B;  2H30 A;  3TJJ A;  2H1D A;  2UZ8 A;  4JRR A;  4XCS A;  1Z5Y E;  2LRC A;  1XVW A;  1VF2 A;  3G7J A;  3TKQ A;  4K0N A;  1F2E A;  2EIO A;  3BOA A;  2DJ0 A;  2TIR A;  2DJK A;  2GSQ A;  2DJJ A;  2FY6 A;  1A0R P;  4EUY A;  2PMT A;  2H19 A;  3G9B A;  3GUR A;  3IHQ A;  5AIS A;  3KMO A;  2HSM A;  2LJA A;  3L9S A;  3VPT A;  1A2L A;  3NOF A;  2IMD A;  4K8M A;  4IEL A;  4GCI A;  2RM5 A;  4XIH A;  1J9B A;  1C72 A;  2YNX A;  4AJ6 A;  2VCQ A;  4Q5R A;  5JWQ B;  1JFU A;  3H93 A;  1PL2 A;  1BED A;  3EVI A;  2JZR A;  3F4T A;  3I6A A;  4HU9 A;  4WF4 A;  2PUK C;  1TJD A;  1NSW A;  4HJ2 A;  3RPP A;  5GST A;  1N8J A;  1GLP A;  3FYG A;  1EGR A;  2YCD A;  1XZO A;  1IYI A;  3HXS A;  3VWX A;  3BBY A;  3MAK A;  2G0F A;  3M8N A;  1SKR B;  5AN1 A;  4TW5 A;  1MD3 A;  5A4W A;  5J5N A;  3FRC A;  1BYE A;  4TN8 A;  1THX A;  1UC7 A;  5H5S A;  1CQH A;  1O81 A;  1M99 A;  5F06 A;  2XPD A;  1XW6 A;  1VRS D;  3P8W A;  1EP8 A;  3I43 A;  2V41 A;  3I69 A;  4JZQ A;  1XW9 A;  3VLN A;  2VD0 A;  4TR1 A;  4LLR A;  1PSQ A;  3L78 A;  2L5O A;  4FIW A;  3V1W A;  3GX8 A;  2IMI A;  4WR4 A;  5CRH A;  4DSQ A;  4PQH A;  4MJE A;  2M80 A;  3DGQ A;  1UVZ A;  1V58 A;  4F2I A;  5DCH A;  4MZW A;  1GNW A;  4WKW A;  1JZD A;  3RAZ A;  1GSQ A;  5DQY A;  4F0C A;  4OO5 A;  2B5X A;  5A5K A;  4JE1 A;  8GSS A;  1ERU A;  1GH2 A;  4PUF C;  4TR4 A;  2RM6 A;  1EZK A;  4V2N A;  2AJQ B;  2GS3 A;  2DJ1 A;  5G1L A;  1U3A A;  1ML6 A;  3NZN A;  1HYU A;  3DRN A;  3UJ1 A;  5CRD A;  2XBI A;  2JSY A;  4OFT A;  3A5W A;  3IE3 A;  1K0A A;  3C1R A;  3Q19 A;  2GQL A;  4BVY A;  3LXZ A;  4NV2 A;  2RII A;  3TJF A;  3LYP A;  1SEN A;  4G0L A;  5DCG A;  1ABA A;  1ERV A;  1EV4 A;  1TDI A;  4X0X A;  1PD2 1;  1ACV A;  3H8Q A;  4HEA 2;  1VF4 A;  5JWR B;  2V6K A;  5DAK B;  2GLR A;  9GSS A;  4L8E A;  3GYK A;  4HJM A;  2YWM A;  1NW2 A;  1YQ1 A;  3VPQ A;  1R5P A;  3GKX A;  6GSU A;  4FH8 A;  2YPM A;  4IJ3 A;  1U87 A;  4KAE A;  4OMV A;  5D73 A;  2FLS A;  1QUW A;  4MJC A;  1BX9 A;  3TOT A;  4WBJ A;  1M2B A;  3TRQ A;  4ZB9 A;  2LJR A;  5C00 A;  1XWA A;  5D9W A;  3QCP A;  4ZBB A;  3F4S A;  3SWL A;  4I8B A;  4JBB A;  5ECQ B;  2HSN B;  5G5F A;  4ZL9 A;  4DSS A;  2EIQ A;  3VK9 A;  1N2A A;  1OC3 A;  3EC3 A;  5D93 A;  3KGK A;  1SJZ A;  3KZQ A;  1U6T A;  1GNE A;  1GTB A;  2AHE A;  4Q5N A;  1A2J A;  1SL2 B;  4V1A g;  4EXJ A;  4G9H A;  5GZZ B;  1AW9 A;  3P2A A;  3GMF A;  1ZL9 A;  1K0D A;  4OCF A;  2HFD A;  3HJO A;  2GST A;  1GSE A;  2Z9S A;  11GS A;  2LEG A;  1M0U A;  3TKP A;  2GZY A;  1YKC A;  1OC8 A;  1FHE A;  2NPB A;  2LQQ A;  4JR6 A;  4X1U A;  3EWL A;  3PIN A;  2A4V A;  5GSS A;  2OBK A;  3QPM A;  1XWG A;  5IMC A;  1X5E A;  2N5F A;  3D4T A;  4ZL7 A;  3AY8 A;  3WT2 A;  1MDK A;  3DXB A;  5AIV A;  1YKA A;  4IP6 A;  3HKR A;  1WP0 A;  4XRA A;  2H74 A;  4YAP A;  5DJM A;  2DLX A;  2X8H A;  2H71 A;  5DAL B;  3L9V A;  3F9U A;  4IS0 A;  3LG6 A;  1Z3E A;  3F63 A;  2WUL A;  2H72 A;  2TRX A;  4X43 A;  4BL7 B;  3CBU A;  4BPY A;  5LNK e;  2L4Q A;  2CZ3 A;  1WIK A;  2PVO C;  2LUS A;  2HE3 A;  2JSZ A;  1WOU A;  3ZLP A;  4TKY A;  3ZIJ A;  4XS4 B;  17GS A;  4ECI A;  6GST A;  4I6X A;  2O85 A;  3D5J A;  4HQS A;  4NWY A;  4MH3 A;  1AAZ A;  2LRN A;  2HNL A;  1X9M B;  1SD9 A;  2HRF A;  1NHY A;  2VLT A;  3GH9 A;  2N5B A;  4GSS A;  3GA4 A;  3MSZ A;  3ZVJ A;  4L0U A;  5D9V A;  3UL3 A;  3KTL A;  2P0G A;  2VL3 A;  1B4Q A;  5ECS A;  1XBS A;  5FWG A;  1U88 A;  4ECJ A;  1T1V A;  4I2U A;  2KOK A;  3ZRE A;  4BWS A;  3A2X A;  3GKK A;  3C71 A;  2J23 A;  3QDN A;  3QFA C;  2OA7 A;  1DE2 A;  1FVK A;  1M2A A;  5B7C A;  2WJU A;  4MK3 A;  2C3T A;  3DWV A;  3PGT A;  3IAS 2;  2GZZ A;  5GAN D;  2V32 A;  4AGS A;  3C8E A;  1G7E A;  4MZB A;  2IMF A;  2I3Y A;  3IC4 A;  3APQ A;  5IMZ A;  3DIE A;  3C73 A;  1PMT A;  1ST9 A;  1XFL A;  2YJH A;  22GS A;  2O8V B;  4USS A;  1XIY A;  5CRG A;  4DVC A;  4EKZ A;  3ERF A;  4L5L A;  4I2T A;  2QGV A;  3FW2 A;  3WT1 A;  4POL A;  1PKZ A;  3KH7 A;  2QC7 A;  4GLT A;  2R4V A;  1K3L A;  3IK7 A;  2MMA A;  3NIV A;  2NDO A;  2HZE B;  1JLW A;  2B5E A;  4ID0 A;  1JLV A;  4NMU A;  3VWW A;  4I97 A;  5HR3 A;  3KXO A;  4IQA A;  3U5R E;  1G6Y A;  2PGT A;  4HDE A;  1O7U A;  3A2W A;  2GSS A;  5JCG A;  5DAK A;  5ECI B;  3EMP A;  5DVB A;  5IO0 A;  1EEJ A;  2VLV A;  5EVO A;  1ON4 A;  3KP9 A;  1BG5 A;  2H0I A;  2H73 A;  1BQ7 A;  5J41 A;  5IPG A;  4DEJ A;  3MDK A;  3UVH A;  1O8X A;  1W89 A;  1RQM A;  1URM A;  3HVX A;  4WF5 A;  4MCU A;  1PQN A;  4XTS A;  3RHB A;  3Q18 A;  2B5Y A;  2HSH A;  2YV9 A;  1LBK A;  1HNA A;  1QMV A;  1SKS B;  4ZXG A;  5D96 A;  1GUK A;  2XPE A;  4NXI A;  1GTI A;  3UMA A;  1J0F A;  5IMF A;  2AAW A;  5F07 A;  2VO4 A;  2VCZ A;  2IPA A;  3E9J B;  5F05 A;  4YQU A;  1XCC A;  2LKU A;  3KP8 A;  2MMN A;  3FY7 A;  1V98 A;  2MZC A;  1EEM A;  2VLU A;  2B7K A;  2IWT A;  3ZFL A;  2IJY A;  4OCE A;  3ZZX A;  1SYX A;  3TDG A;  1T00 A;  5FT3 A;  2CX3 A;  2YWO A;  4OFN A;  2WGR A;  1TK8 B;  2BMX A;  3ZMK A;  2H8L A;  3EYT A;  3GV1 A;  4ZBD A;  3CRT A;  4KF9 A;  4MJB A;  4RI7 A;  3CTF A;  5KEJ A;  2KHP A;  3R3E A;  1AIU A;  1XOB A;  1M9B A;  2RUE A;  4AJ8 A;  3UEM A;  2KP2 A;  4WEY A;  2R3X A;  2R37 A;  5DDL A;  2C3N A;  2LS5 A;  1E2Y A;  3TB2 A;  4YQM A;  4N0Z A;  2OKA A;  1TU8 A;  3U6V A;  4FYU A;  3UIW A;  5AIX A;  4MDC A;  1GUL A;  1EWX A;  4PQ1 A;  3IXR A;  3HY2 A;  4IVF A;  5CRW A;  2XBQ A;  3ZIT A;  3CMI A;  5J9C A;  2HI7 A;  4MF6 A;  2VCV A;  2IMK A;  3D4M A;  1Z7R A;  2WDU A;  1ZOF A;  2XHF A;  4IHU A;  3TJG A;  3GRX A;  3KM6 A;  4MMM A;  4G0I A;  4NPB A;  1XW5 A;  2PER A;  4POM A;  6GSX A;  2CAQ A;  2P31 A;  2HRK B;  4BL7 A;  2H1B A;  4WET A;  3HYP A;  3ZIV A;  5ECH B;  3CYN A;  2I4A A;  1K3O A;  3KTB A;  5LD0 A;  1A8L A;  2E2G A;  4K1F A;  2E2M A;  2BJX A; 
#chains in the Genus database with same CATH topology
 3QAV A;  1GSU A;  2PU9 C;  4O32 A;  4O5U A;  4PXO A;  3P7X A;  1ZCP A;  3RPN A;  2WCI A;  2YWN A;  4XHM A;  4XS4 A;  2FCH A;  2X64 A;  3FZA A;  4RI6 A;  2YZU A;  1F37 A;  4EIP A;  2A4H A;  3L4N A;  1Q4J A;  5EY6 A;  1S4B P;  3UVT A;  4FO5 A;  2OAD A;  1HQO A;  3ERW A;  3ED3 A;  5JWO B;  4BA7 A;  3QAG A;  4GXZ A;  1O73 A;  1OYJ A;  2V1M A;  1ERT A;  3TKR A;  1BG1 A;  5B8B A;  1EP7 A;  4AF2 A;  3CXG A;  3F3R A;  2LNT A;  1XWB A;  2L6C A;  3S9F A;  2X99 A;  2H0G A;  5G31 A;  1OKT A;  4DSR A;  5KN0 A;  4Q5F A;  4GSN A;  2FWH A;  3CWG A;  3ZTL A;  1G6W A;  2V6O A;  1Z6M A;  5DJL A;  1H4O A;  2PVQ A;  4OO4 A;  3IA1 A;  4AKX B;  1GP1 A;  2CVK A;  2H01 A;  5H5R A;  1XWK A;  4G19 A;  3O6T A;  2M72 A;  1PX7 A;  4I5Q A;  1GWC A;  5ECM B;  10GS A;  1NHO A;  1R26 A;  5G30 A;  3F6D A;  3BD2 A;  1DUG A;  1XVQ A;  3FMW A;  4KSO A;  3M9K A;  5A4V A;  2RLI A;  1SL0 B;  3DML A;  3VFI A;  1YEW C;  2HSY A;  4K5R A;  4GRF A;  2F3M A;  4G0K A;  2VM2 A;  2C8U A;  3HD5 A;  2FHE A;  1YZX A;  2NBS A;  4G2E A;  3TU3 B;  3QR6 A;  1JZO A;  3EUR A;  2AV4 A;  4ILF A;  3IC8 A;  4YQV A;  2TRC P;  6GSV A;  4L5O A;  1R7H A;  1TRS A;  4KGI A;  2HZE A;  2HT9 A;  3W8S A;  5G2Z A;  4ZIL A;  2REM A;  3PPU A;  5J4U A;  5CO3 A;  1O8W A;  2H66 A;  2CT6 A;  3ZFB A;  3FHK A;  1G0T A;  4D73 B;  1NM3 A;  4RQX A;  5CAX A;  2AB6 A;  5ELA A;  3F3Q A;  19GS A;  1SJI A;  1FVJ A;  1FO5 A;  2DJ2 A;  3KCM A;  4PQI A;  1M2D A;  5J3R A;  3QD9 A;  5F0G A;  5D9T A;  3QFB C;  3LXT A;  2NTO A;  3PR8 A;  5EPF A;  3D0Z A;  3ISO A;  2R5G A;  3VUR A;  3E0U A;  3ZML A;  2GT5 A;  5ABR A;  2HZF A;  4J56 E;  2DIY A;  1LJR A;  2VCT A;  2L57 A;  1OC9 B;  4EIQ A;  1Z6N A;  1OKD A;  1I1I P;  4EC0 A;  2CZ2 A;  3GFK A;  3CSH A;  5JCU A;  3HDC A;  2N5A A;  1X5C A;  2VM1 A;  2NVL A;  4JU5 A;  3UAR A;  3FEU A;  3L0H A;  1TW9 A;  3D21 A;  2HRN A;  3GL3 A;  1MD4 A;  4K7N A;  4GST A;  4ECC A;  1MEK A;  2C0D A;  2I9H A;  3EU3 A;  4JR4 A;  1SKW B;  3DVX A;  2C4J A;  3Q6O A;  2FGX A;  3LYK A;  1V40 A;  3K8N A;  1A2M A;  1R5A A;  2H6Y A;  1J08 A;  1DSB A;  2IN3 A;  4RQR A;  1UA5 A;  4MLY A;  4N10 A;  2DBC A;  4PNG A;  2VD1 A;  5GAP D;  2MMO A;  1K0B A;  4ZB6 A;  2L59 A;  1GLQ A;  1FW1 A;  4MPF A;  4GQC A;  4AI6 A;  3GKN A;  2L4C A;  3GHA A;  5D8I A;  2GSR A;  2DMM A;  1TK0 B;  1JZW A;  4LA1 A;  1ZYQ B;  2FWE A;  3IAM 2;  3FR3 A;  2O87 A;  4HZ2 A;  3KH9 A;  3US3 A;  5BMU A;  4LMV A;  4FXY P;  4POB A;  1VF3 A;  14GS A;  2VIM A;  3WYW A;  1K3Y A;  5HR1 A;  4IJI A;  2HLS A;  3N9J A;  4POK A;  1GSD A;  4AKH A;  3FZ4 A;  4GWR A;  4F03 A;  4TVE A;  1WPI A;  4XRD A;  4TOP A;  1EV9 A;  1PA3 A;  1GUH A;  2DML A;  2YWI A;  1A24 A;  13GS A;  4K7I A;  3WGE A;  1UN2 A;  1Y25 A;  4HUA A;  2LRT A;  3TJK A;  4KDY A;  3HVV A;  2F9S A;  1ERW A;  4MJA A;  1A0F A;  4NHZ A;  1YF0 A;  4K2X A;  3GH6 A;  3EU4 A;  1T7P B;  1FB0 A;  4OWY A;  3HA9 A;  1WE0 A;  4MP4 A;  2HRK A;  3I9V 2;  3TOU A;  4CHS A;  2MBT A;  2WS2 A;  2WW2 A;  4EO3 A;  1SL1 B;  1CQG A;  4K9Z A;  1AQV A;  3LSZ A;  3IK9 A;  2IL3 A;  2VL2 C;  1QGV A;  4EL1 A;  4L0W A;  2GQM A;  3L9U A;  5IM9 A;  3CSI A;  2YP6 A;  3TKS C;  5COH A;  4ISD A;  4EDY A;  4MA9 A;  2OT3 A;  5L71 A;  3W8J A;  1JHB A;  5IMD A;  3ZRD A;  2C80 A;  1O85 A;  2OE1 A;  4ML1 A;  4PNF A;  2H70 A;  1F6M C;  5DQS A;  4IBP A;  2H0H A;  3RHC A;  3H1N A;  4GTU A;  4FYC A;  1OE7 A;  3CTG A;  5CRE A;  4K5S A;  3N5O A;  1QXH A;  2GTU A;  1E6B A;  2C1Y A;  2F51 A;  5B6N A;  3LEF A;  1X5D A;  1GTA A;  1VF1 A;  3LWA A;  1GSY A;  1WRY A;  1ZYE A;  1T4Y A;  2FNO A;  2H1A A;  1T4Z A;  4BVX B;  4V2M A;  3F8U A;  1S3A A;  2D2Z A;  3KMN A;  5JCW A;  1BJX A;  5D9X A;  1G7O A;  2K9F A;  1M3I A;  1KNG A;  2JL4 A;  2WVY A;  3HJM A;  1SK2 A;  2LV3 A;  1GTU A;  3C1S A;  2K18 A;  2ON7 A;  4EDZ A;  1AC1 A;  2KP1 A;  1S3R A;  1PRX A;  2XC2 A;  1LU4 A;  3MNG A;  4PUR A;  2ZNM A;  4O7H A;  1I5G A;  2OE0 A;  2JAD A;  1SK0 A;  3MWH A;  3Q74 A;  3IPZ A;  3A3T A;  5KN3 A;  3LGC A;  4K0G A;  3KJY A;  4PTS A;  1TRU A;  5F8B A;  4LL1 B;  4PUA A;  3IOS A;  5A4U A;  3PH9 A;  2MMZ A;  1AXD A;  4IGJ A;  3RDW A;  5G5E A;  5B8A A;  2FA8 A;  1GSF A;  4LMW A;  1TTZ A;  5ENU A;  5E4W A;  6GSY A;  2J9H A;  4MPG A;  2P5Q A;  4EVM A;  3DYR A;  4PI0 C;  3A2V A;  3HCZ A;  4D73 A;  4H86 A;  1K0M A;  4QL7 A;  3APO A;  1SVL A;  2O89 A;  1RW1 A;  1WJK A;  3J7Y k;  1B9Y C;  4WBR D;  1HNC A;  2X8G A;  5A34 B;  1M7T A;  3HZ8 A;  2DSA A;  1ZZY A;  4GF0 A;  4YAV A;  1PX6 A;  2WW3 A;  2IFQ B;  2K8S A;  5IO2 A;  2DKH A;  3SBC A;  1OC9 A;  2C0F A;  4FYB A;  4IP1 A;  2DKI A;  1T3B A;  2MBS A;  3DD3 A;  1USB A;  2HRA A;  4KSM A;  4WXT A;  3D22 A;  1THO A;  2FUG 2;  2K8V A;  3VI5 A;  1TI3 A;  1SD8 A;  1FG4 A;  1OE8 A;  1PL1 A;  3MIX A;  2OBI A;  4NV5 A;  4MF5 A;  2YZH A;  1S3D A;  1A23 A;  2PN8 A;  2VCX A;  3D6I A;  3GUS A;  3O76 A;  2LQO A;  3J7Y b;  5B6M A;  1DBY A;  3CHX C;  3CRU A;  3IV4 A;  4ACS A;  4HS1 A;  5DAL A;  2QKE A;  1FB6 A;  3UBK A;  1YDK A;  2B1K A;  1SK1 A;  3TJB A;  1I9D A;  3LOR A;  3GTU B;  5KN2 A;  2VKZ G;  3JCM L;  1XWC A;  2I1U A;  3M1G A;  2FWG A;  3FR9 A;  1KBN A;  2WB9 A;  1V9W A;  2EFD A;  1HD2 A;  5ECK B;  3GNJ A;  1AUC A;  5H5Q A;  3GN3 A;  2EIR A;  3WGX A;  1EOG A;  5ELG A;  2C0G A;  4KH7 A;  1ILO A;  4IKH A;  2O5V A;  1PN9 A;  4TXV A;  4MZC A;  4V2L A;  3QMX A;  4TXO B;  5G1K A;  5IMA A;  5ECP B;  4MF7 A;  2IME A;  3IBH A;  1GRX A;  3OR5 A;  4WR5 A;  4F82 A;  4TRX A;  5IMV A;  1WMJ A;  3H79 A;  1MDI A;  1YJ6 A;  2FD3 A;  3QOU A;  6GSW A;  3C7M A;  1O6J A;  1YEX A;  3FZ9 A;  4N11 A;  1GSS A;  4IQ1 A;  5DBQ A;  2DC5 A;  4KB3 A;  2H1G A;  1KTE A;  2PPT A;  5A1N B;  2C3Q A;  2VAF A;  1F3A A;  2F8F A;  4F0B A;  5J9B A;  3GX0 A;  2WW0 A;  6GSS A;  2WRT A;  2LNS A;  1F3B A;  3O3T A;  4YH2 A;  5HR2 A;  4HZ4 A;  3WGD A;  2OAC A;  3LJR A;  4MH2 A;  4ZL8 A;  3ZYW A;  5CYY A;  5CNW A;  3LFL A;  4ML6 A;  2AUV A;  2KUC A;  5ID2 B;  1BAY A;  4HI7 A;  2AYT A;  1X9W B;  4ZB8 A;  4HQZ A;  3EE2 A;  3FZ5 A;  2FA4 A;  2VUP A;  1SVM A;  4KE3 A;  2B3S A;  4QL9 A;  2CVB A;  2CAI A;  1B8X A;  4LL4 B;  4HU7 A;  2P5R A;  4AJ7 A;  1GL8 A;  1T8E B;  4KDU A;  2G2Q A;  5IPH A;  4FQU A;  2GQK A;  4ULX A;  4IN0 A;  2I81 A;  2JZT A;  2A2S A;  2WZ9 A;  2L6D A;  3EIN A;  2B1L A;  2JU5 A;  3F6F A;  2YN1 A;  1QQ2 A;  4O92 A;  3CQF A;  4E8E A;  2RUF A;  2GGT A;  1RK4 A;  3H4K A;  3TRP A;  1OAZ A;  4XS1 A;  1W4V A;  1Q98 A;  4PX1 A;  3VI7 A;  5LCZ A;  1U3I A;  3E3E A;  3IDV A;  2H75 A;  2ES7 A;  2HSM B;  1X0R A;  3IRA A;  1TKD B;  1K0N A;  12GS A;  1H75 A;  5HR0 A;  4O5R A;  20GS A;  1XXU A;  1F9M A;  4BVX A;  4TR3 A;  3ERG A;  5HFG A;  3WD6 A;  2MYG A;  1TP9 A;  2CA8 A;  1YF1 A;  5E59 A;  2H1L A;  3F0I A;  1TU7 A;  1XPV A;  5IOW A;  2H6Z A;  3GKM A;  1WWJ A;  4J57 E;  2HQT A;  2VL9 A;  4TR0 A;  5EL8 A;  2YV7 A;  2FWF A;  1AQW A;  3APS A;  2GZP A;  4CDO A;  3VWU A;  2B7J A;  3HVS A;  1M9A A;  4PI2 C;  2OE3 A;  5BRT A;  1TRW A;  2EC4 A;  2M46 A;  2PWJ A;  3DKS A;  1QK8 A;  3G7I A;  7GSS A;  5KN1 A;  3FR6 A;  1XOA A;  5AGY A;  4EE0 A;  5ECR B;  1S3C A;  4KX4 A;  1MTC A;  2JAC A;  4E68 A;  4J2F A;  1SJ6 A;  3GIX A;  5C04 A;  4KUN A;  4OFM A;  3M3M A;  4KCE A;  4GQF A;  1TRV A;  5ECL B;  5FHI A;  1K0O A;  4V1A p;  2B6M A;  4F9Z A;  1Z7P A;  4QQ7 A;  18GS A;  2VOC A;  1OVN A;  4TR1 B;  5ECO B;  5IQY A;  1Y6E A;  5A34 A;  2BTO T;  4K2D A;  2R6K A;  3RBT A;  2X8C A;  3GL5 A;  3GST A;  4X4J A;  2IFQ A;  1B4P A;  2LST A;  4CY6 A;  4IW9 A;  3TUE A;  2ALB A;  4KND A;  1JZR A;  5HFK A;  5A5H B;  2IIY A;  4HOJ A;  2A2R A;  3HZ4 A;  5HFI A;  1VGL A;  2L5L A;  5INY A;  5IOX A;  3TRX A;  3R2Q A;  1PKW A;  2K6V A;  4P3Y B;  2DJ3 A;  3UAP A;  2O7K A;  2OJL A;  3LQ7 A;  5ECN B;  4A5P A;  2CV4 A;  2HYX A;  4YKG A;  3UBL A;  1Z9H A;  3F4R A;  4Z2U A;  2YOI A;  5HQP A;  1DE1 A;  1SU9 A;  1A8Y A;  4KDX A;  1X9S B;  4ECB A;  1PGT A;  2E0Q A;  3KIJ A;  3KD0 A;  2QSI A;  2GVP A;  1R4W A;  3HJP A;  2YJ7 A;  1V57 A;  5KOX A;  3W6G A;  3ME7 A;  4Z7X A;  2R2J A;  4E8H A;  3GTU A;  1TOF A;  4K6X A;  2H6X A;  2DIZ A;  1FOV A;  4G10 A;  1K0C A;  3KEB A;  2ZUP A;  1B48 A;  4AKI A;  1ZGN A;  4K7O A;  4PGT A;  2GT6 A;  3M0F A;  4BVY B;  3P90 A;  3BJ5 A;  3ZVJ D;  1GUM A;  4JED A;  4CW9 A;  1TXX A;  3FKF A;  2KLX A;  3CSJ A;  2V2G A;  1HNB A;  4N30 A;  4ZBA A;  1TI1 A;  4EF0 A;  2YAN A;  4N3Z A;  3BCK A;  2CVD A;  4TXO A;  4XS6 A;  3HVN A;  1B9X C;  2CQ9 A;  4BWQ A;  2UV8 G;  2C0E A;  3ZL5 A;  1ZMA A;  3EMX A;  3TCO A;  2WFC A;  2O3E A;  4KCA A;  4MAB A;  3UOM A;  4RUV A;  2LJK A;  3TKS E;  16GS A;  3DEX A;  1MDJ A;  2E7P A;  5A1N A;  2HXK A;  2H76 A;  2WZS A;  1EGO A;  3TGZ A;  3M9J A;  1PN0 A;  1IYH A;  1YY7 A;  3IHG A;  3QAW A;  3ME8 A;  3G7Y A;  2ON5 A;  4OD7 A;  2VL2 A;  5CP1 A;  3IR4 A;  1FAA A;  3BCI A;  2F8A A;  2VCW A;  2GDR A;  4BIK A;  2JZS A;  3FK8 A;  3VWV A;  4NAX A;  3TKS A;  4DSS B;  5ID2 A;  3DVW A;  1AQX A;  2ZCT A;  4NHW A;  1EOH A;  1YEP A;  3HHV A;  1QFN A;  4KA0 A;  4ZIJ A;  1KEB A;  4Q5Q A;  2CX4 A;  2PBJ A;  4KW6 A;  4N0V A;  5IIZ A;  3GSS A;  1SYR A;  2LTK A;  1V2A A;  1TK5 B;  2H30 A;  3TJJ A;  2H1D A;  2UZ8 A;  4JRR A;  2WVX B;  4XCS A;  1Z5Y E;  2LRC A;  1XVW A;  1VF2 A;  3G7J A;  4YKF A;  3TKQ A;  2QA1 A;  4K0N A;  1F2E A;  2EIO A;  3BOA A;  2DJ0 A;  2TIR A;  2DJK A;  2GSQ A;  2DJJ A;  2FY6 A;  1ZYP A;  1A0R P;  4EUY A;  2PMT A;  2H19 A;  3G9B A;  3GUR A;  3IHQ A;  5AIS A;  3KMO A;  2HSM A;  2LJA A;  3L9S A;  3VPT A;  1A2L A;  3NOF A;  2IMD A;  3RFR C;  4IEL A;  4K8M A;  4GCI A;  2RM5 A;  4XIH A;  1J9B A;  1C72 A;  2YNX A;  4AJ6 A;  2VCQ A;  4Q5R A;  5JWQ B;  1JFU A;  3H93 A;  1PL2 A;  1BED A;  3EVI A;  2JZR A;  3F4T A;  3I6A A;  4HU9 A;  4WF4 A;  2PUK C;  1TJD A;  1NSW A;  1BF5 A;  4HJ2 A;  3RPP A;  5GST A;  1N8J A;  1GLP A;  3FYG A;  1M3J A;  1EGR A;  2YCD A;  1XZO A;  1IYI A;  3HXS A;  3VWX A;  3BBY A;  3MAK A;  2G0F A;  3M8N A;  3MYD A;  5BMU B;  1SKR B;  5AN1 A;  4TW5 A;  1MD3 A;  5A4W A;  5J5N A;  3FRC A;  1BYE A;  4TN8 A;  1THX A;  1UC7 A;  4ZB7 A;  5H5S A;  1CQH A;  1O81 A;  1M99 A;  5F06 A;  2XPD A;  1XW6 A;  1VRS D;  3P8W A;  1EP8 A;  3RGB C;  3I43 A;  2V41 A;  3I69 A;  4JZQ A;  1XW9 A;  3VLN A;  2VD0 A;  4TR1 A;  4LLR A;  1PSQ A;  3L78 A;  2L5O A;  4FIW A;  3V1W A;  3GX8 A;  4MNN A;  2IMI A;  4WR4 A;  5CRH A;  1PFO A;  5A5H A;  2EFH A;  4DSQ A;  4PQH A;  4MJE A;  2M80 A;  3DGQ A;  1UVZ A;  1V58 A;  4F2I A;  5DCH A;  4MZW A;  1FOH A;  1GNW A;  4WKW A;  1JZD A;  3RAZ A;  1GSQ A;  5DQY A;  4F0C A;  4OO5 A;  2B5X A;  5A5K A;  8GSS A;  4JE1 A;  1ERU A;  1GH2 A;  4PUF C;  4TR4 A;  2RM6 A;  1EZK A;  4V2N A;  2AJQ B;  2GS3 A;  2DJ1 A;  1ZYN A;  5G1L A;  1U3A A;  1ML6 A;  3NZN A;  1HYU A;  3DRN A;  3UJ1 A;  5CRD A;  2XBI A;  2JSY A;  4OFT A;  3A5I A;  3A5W A;  3IE3 A;  1K0A A;  3C1R A;  3Q19 A;  2GQL A;  4BVY A;  3LXZ A;  4NV2 A;  2RII A;  3TJF A;  3LYP A;  1SEN A;  4G0L A;  5DCG A;  1ABA A;  1ERV A;  1EV4 A;  1TDI A;  4X0X A;  1PD2 1;  1ACV A;  3H8Q A;  4HEA 2;  1VF4 A;  5JWR B;  2V6K A;  5DAK B;  2GLR A;  9GSS A;  4Z2T A;  4L8E A;  3GYK A;  4HJM A;  2YWM A;  1NW2 A;  1YQ1 A;  3VPQ A;  1R5P A;  3GKX A;  4W66 A;  3EPT A;  6GSU A;  4FH8 A;  2WW1 A;  2YPM A;  4IJ3 A;  1U87 A;  4KAE A;  4OMV A;  5D73 A;  2FLS A;  1QUW A;  4MJC A;  1BX9 A;  3TOT A;  4WBJ A;  2R0C A;  1M2B A;  3TRQ A;  4ZB9 A;  4G01 A;  2LJR A;  5C00 A;  1XWA A;  5D9W A;  3QCP A;  4ZBB A;  3F4S A;  3SWL A;  4HSC X;  4I8B A;  4JBB A;  5ECQ B;  2HSN B;  5G5F A;  4ZL9 A;  4DSS A;  4AKG A;  2EIQ A;  3VK9 A;  2A2P A;  1N2A A;  1OC3 A;  3EC3 A;  5D93 A;  2R0P A;  3KGK A;  1SJZ A;  3KZQ A;  1U6T A;  1GNE A;  1GTB A;  2AHE A;  4Q5N A;  1A2J A;  1SL2 B;  4V1A g;  4EXJ A;  4G9H A;  5GZZ B;  1AW9 A;  3P2A A;  3GMF A;  1ZL9 A;  2WVX A;  1K0D A;  4OCF A;  2HFD A;  5J4V A;  3HJO A;  2GST A;  1GSE A;  2Z9S A;  11GS A;  2LEG A;  1M0U A;  3TKP A;  2GZY A;  1YKC A;  1OC8 A;  1FHE A;  2NPB A;  2LQQ A;  4JR6 A;  4X1U A;  3EWL A;  3PIN A;  2A4V A;  5GSS A;  2OBK A;  3QPM A;  1XWG A;  5IMC A;  1X5E A;  2N5F A;  3D4T A;  4ZL7 A;  3AY8 A;  3WT2 A;  1MDK A;  3DXB A;  5AIV A;  4O5Q A;  1YKA A;  4IP6 A;  3HKR A;  1WP0 A;  4CY8 A;  4XRA A;  2H74 A;  4YAP A;  5DJM A;  2X49 A;  2DLX A;  2X8H A;  2H71 A;  5DAL B;  3L9V A;  2O36 A;  3F9U A;  4IS0 A;  3LG6 A;  1Z3E A;  3F63 A;  2WUL A;  5J40 A;  2H72 A;  2TRX A;  1Y1U A;  4X43 A;  4BL7 B;  3CBU A;  4BPY A;  5LNK e;  2L4Q A;  2CZ3 A;  1WIK A;  2PVO C;  2LUS A;  2HE3 A;  2JSZ A;  1WOU A;  3ZLP A;  4TKY A;  3ZIJ A;  4XS4 B;  17GS A;  4ECI A;  6GST A;  4PHZ C;  4I6X A;  2O85 A;  3D5J A;  4HQS A;  4NWY A;  4MH3 A;  1AAZ A;  2LRN A;  2HNL A;  1X9M B;  1SD9 A;  2HRF A;  1NHY A;  2VLT A;  3GH9 A;  2N5B A;  2EFC A;  4GSS A;  3GA4 A;  3MSZ A;  3ZVJ A;  4L0U A;  5D9V A;  3UL3 A;  3KTL A;  2WVZ A;  2P0G A;  2VL3 A;  1B4Q A;  5ECS A;  1XBS A;  5FWG A;  1U88 A;  4ECJ A;  1T1V A;  4I2U A;  2KOK A;  3ZRE A;  1N25 A;  4BWS A;  3A2X A;  3HMJ G;  3GKK A;  5KOW A;  3C71 A;  2J23 A;  3QDN A;  3QFA C;  2OA7 A;  1DE2 A;  1FVK A;  1M2A A;  5B7C A;  2WJU A;  4MK3 A;  2C3T A;  3DWV A;  3PGT A;  3IAS 2;  4ICY A;  2GZZ A;  5GAN D;  2V32 A;  4AGS A;  3C8E A;  4GDF A;  1G7E A;  4MZB A;  2IMF A;  2I3Y A;  3IC4 A;  3APQ A;  5IMZ A;  3DIE A;  3C73 A;  1XG8 A;  1PMT A;  1ST9 A;  1XFL A;  2YJH A;  22GS A;  2O8V B;  4USS A;  1XIY A;  5CRG A;  4DVC A;  4EKZ A;  3ERF A;  2EFE A;  4L5L A;  1YVL A;  4I2T A;  2QGV A;  3FW2 A;  3WT1 A;  4POL A;  1PKZ A;  3KH7 A;  2QC7 A;  4GLT A;  2R4V A;  1K3L A;  3IK7 A;  2MMA A;  3NIV A;  2NDO A;  2HZE B;  1JLW A;  2B5E A;  4ID0 A;  2X4A A;  1JLV A;  4NMU A;  3VWW A;  4I97 A;  5HR3 A;  3KXO A;  4IQA A;  3U5R E;  1G6Y A;  1SVO A;  2PGT A;  4HDE A;  1O7U A;  3A2W A;  2GSS A;  5JCG A;  5DAK A;  5ECI B;  3EMP A;  5DVB A;  5IO0 A;  1EEJ A;  2VLV A;  2R0G A;  5EVO A;  1ON4 A;  5J4Y A;  3KP9 A;  1BG5 A;  2H0I A;  1TXU A;  2H73 A;  1BQ7 A;  5J41 A;  5IPG A;  4DEJ A;  3MDK A;  3UVH A;  1O8X A;  1W89 A;  1RQM A;  1URM A;  3HVX A;  4WF5 A;  4MCU A;  1PQN A;  4XTS A;  3RHB A;  3Q18 A;  2B5Y A;  2HSH A;  2YV9 A;  1LBK A;  1HNA A;  1QMV A;  1SKS B;  4ZXG A;  5D96 A;  1GUK A;  2XPE A;  4NXI A;  1GTI A;  3UMA A;  1J0F A;  5IMF A;  2AAW A;  5F07 A;  2VO4 A;  2VCZ A;  2IPA A;  3E9J B;  5F05 A;  4YQU A;  1XCC A;  2LKU A;  3KP8 A;  2MMN A;  3FY7 A;  1V98 A;  2MZC A;  2QA2 A;  1EEM A;  2VLU A;  2B7K A;  2IWT A;  3ZFL A;  2IJY A;  2HSN A;  4OCE A;  3ZZX A;  1SYX A;  3TDG A;  1T00 A;  5FT3 A;  2CX3 A;  2YWO A;  4OFN A;  2WGR A;  1TK8 B;  2BMX A;  3ZMK A;  2H8L A;  3EYT A;  3GV1 A;  4ZBD A;  3CRT A;  4KF9 A;  4MJB A;  4RI7 A;  3CTF A;  5KEJ A;  2KHP A;  3LW9 A;  3R3E A;  1AIU A;  1XOB A;  1M9B A;  2RUE A;  4AJ8 A;  3UEM A;  2KP2 A;  4WEY A;  2R3X A;  2R37 A;  5DDL A;  2C3N A;  2LS5 A;  1E2Y A;  3TB2 A;  4YQM A;  4N0Z A;  2OKA A;  1TU8 A;  3U6V A;  4FYU A;  3UIW A;  5AIX A;  4MDC A;  1GUL A;  1EWX A;  4QMK A;  4PQ1 A;  3IXR A;  3HY2 A;  4IVF A;  5CRW A;  4Z2R A;  2XBQ A;  3ZIT A;  3CMI A;  5J9C A;  2HI7 A;  4MF6 A;  2VCV A;  2IMK A;  3D4M A;  1Z7R A;  2WDU A;  1ZOF A;  2XHF A;  4IHU A;  3TJG A;  3GRX A;  3KM6 A;  4MMM A;  5J47 A;  4G0I A;  4NPB A;  1XW5 A;  2PER A;  4POM A;  6GSX A;  2CAQ A;  2P31 A;  2HRK B;  4BL7 A;  2H1B A;  4WET A;  3HYP A;  3ZIV A;  5ECH B;  3CYN A;  2I4A A;  1K3O A;  3KTB A;  5LD0 A;  1A8L A;  2E2G A;  4K1F A;  2E2M A;  2BJX A; 
#chains in the Genus database with same CATH homology
 3QAV A;  1GSU A;  2PU9 C;  4O32 A;  4O5U A;  4PXO A;  3P7X A;  1ZCP A;  3RPN A;  2WCI A;  2YWN A;  4XHM A;  4XS4 A;  2FCH A;  2X64 A;  3FZA A;  4RI6 A;  2YZU A;  1F37 A;  4EIP A;  2A4H A;  3L4N A;  1Q4J A;  5EY6 A;  3UVT A;  4FO5 A;  2OAD A;  1HQO A;  3ERW A;  3ED3 A;  5JWO B;  4BA7 A;  3QAG A;  4GXZ A;  1O73 A;  1OYJ A;  2V1M A;  1ERT A;  3TKR A;  1BG1 A;  5B8B A;  1EP7 A;  4AF2 A;  3CXG A;  3F3R A;  2LNT A;  1XWB A;  2L6C A;  3S9F A;  2X99 A;  2H0G A;  5G31 A;  1OKT A;  4DSR A;  5KN0 A;  4Q5F A;  4GSN A;  2FWH A;  3CWG A;  3ZTL A;  1G6W A;  2V6O A;  1Z6M A;  5DJL A;  1H4O A;  2PVQ A;  4OO4 A;  3IA1 A;  4AKX B;  1GP1 A;  2CVK A;  2H01 A;  5H5R A;  1XWK A;  4G19 A;  3O6T A;  2M72 A;  1PX7 A;  4I5Q A;  1GWC A;  5ECM B;  10GS A;  1NHO A;  1R26 A;  5G30 A;  3F6D A;  3BD2 A;  1DUG A;  1XVQ A;  3FMW A;  4KSO A;  3M9K A;  5A4V A;  2RLI A;  1SL0 B;  3DML A;  3VFI A;  2HSY A;  4K5R A;  4GRF A;  2F3M A;  4G0K A;  2VM2 A;  2C8U A;  3HD5 A;  2FHE A;  1YZX A;  2NBS A;  4G2E A;  3TU3 B;  3QR6 A;  1JZO A;  3EUR A;  2AV4 A;  4ILF A;  3IC8 A;  4YQV A;  2TRC P;  6GSV A;  4L5O A;  1R7H A;  1TRS A;  4KGI A;  2HZE A;  2HT9 A;  3W8S A;  5G2Z A;  4ZIL A;  2REM A;  3PPU A;  5J4U A;  5CO3 A;  1O8W A;  2H66 A;  2CT6 A;  3ZFB A;  3FHK A;  1G0T A;  4D73 B;  1NM3 A;  4RQX A;  5CAX A;  2AB6 A;  5ELA A;  3F3Q A;  19GS A;  1SJI A;  1FVJ A;  1FO5 A;  2DJ2 A;  3KCM A;  4PQI A;  1M2D A;  5J3R A;  3QD9 A;  5F0G A;  5D9T A;  3QFB C;  3LXT A;  2NTO A;  3PR8 A;  5EPF A;  3D0Z A;  3ISO A;  2R5G A;  3VUR A;  3E0U A;  3ZML A;  2GT5 A;  5ABR A;  2HZF A;  4J56 E;  2DIY A;  1LJR A;  2VCT A;  2L57 A;  1OC9 B;  4EIQ A;  1Z6N A;  1OKD A;  4EC0 A;  2CZ2 A;  3GFK A;  3CSH A;  5JCU A;  3HDC A;  2N5A A;  1X5C A;  2VM1 A;  2NVL A;  4JU5 A;  3UAR A;  3FEU A;  3L0H A;  1TW9 A;  3D21 A;  2HRN A;  3GL3 A;  1MD4 A;  4K7N A;  4GST A;  4ECC A;  1MEK A;  2C0D A;  2I9H A;  3EU3 A;  4JR4 A;  1SKW B;  3DVX A;  2C4J A;  3Q6O A;  2FGX A;  3LYK A;  1V40 A;  3K8N A;  1A2M A;  1R5A A;  2H6Y A;  1J08 A;  1DSB A;  2IN3 A;  4RQR A;  1UA5 A;  4MLY A;  4N10 A;  2DBC A;  4PNG A;  2VD1 A;  5GAP D;  2MMO A;  1K0B A;  4ZB6 A;  2L59 A;  1GLQ A;  1FW1 A;  4MPF A;  4GQC A;  4AI6 A;  3GKN A;  2L4C A;  3GHA A;  5D8I A;  2GSR A;  2DMM A;  1TK0 B;  1JZW A;  4LA1 A;  1ZYQ B;  2FWE A;  3IAM 2;  3FR3 A;  2O87 A;  4HZ2 A;  3KH9 A;  3US3 A;  5BMU A;  4LMV A;  4POB A;  1VF3 A;  14GS A;  2VIM A;  3WYW A;  1K3Y A;  5HR1 A;  4IJI A;  2HLS A;  3N9J A;  4POK A;  1GSD A;  4AKH A;  3FZ4 A;  4GWR A;  4F03 A;  4TVE A;  1WPI A;  4XRD A;  4TOP A;  1EV9 A;  1PA3 A;  1GUH A;  2DML A;  2YWI A;  1A24 A;  13GS A;  4K7I A;  3WGE A;  1UN2 A;  1Y25 A;  4HUA A;  2LRT A;  3TJK A;  4KDY A;  3HVV A;  2F9S A;  1ERW A;  4MJA A;  1A0F A;  4NHZ A;  1YF0 A;  4K2X A;  3GH6 A;  3EU4 A;  1T7P B;  1FB0 A;  4OWY A;  3HA9 A;  1WE0 A;  4MP4 A;  2HRK A;  3I9V 2;  3TOU A;  4CHS A;  2MBT A;  2WS2 A;  4EO3 A;  1SL1 B;  1CQG A;  4K9Z A;  1AQV A;  3LSZ A;  3IK9 A;  2IL3 A;  2VL2 C;  1QGV A;  4EL1 A;  4L0W A;  2GQM A;  3L9U A;  5IM9 A;  3CSI A;  2YP6 A;  3TKS C;  5COH A;  4ISD A;  4EDY A;  4MA9 A;  2OT3 A;  5L71 A;  3W8J A;  1JHB A;  5IMD A;  3ZRD A;  2C80 A;  1O85 A;  2OE1 A;  4ML1 A;  4PNF A;  2H70 A;  1F6M C;  5DQS A;  4IBP A;  2H0H A;  3RHC A;  3H1N A;  4GTU A;  4FYC A;  1OE7 A;  3CTG A;  5CRE A;  4K5S A;  3N5O A;  1QXH A;  2GTU A;  1E6B A;  2C1Y A;  2F51 A;  5B6N A;  3LEF A;  1X5D A;  1GTA A;  1VF1 A;  3LWA A;  1GSY A;  1WRY A;  1ZYE A;  1T4Y A;  2FNO A;  2H1A A;  1T4Z A;  4BVX B;  4V2M A;  3F8U A;  1S3A A;  2D2Z A;  3KMN A;  5JCW A;  1BJX A;  5D9X A;  1G7O A;  2K9F A;  1KNG A;  2JL4 A;  3HJM A;  1SK2 A;  2LV3 A;  1GTU A;  3C1S A;  2K18 A;  2ON7 A;  4EDZ A;  1AC1 A;  2KP1 A;  1PRX A;  2XC2 A;  1LU4 A;  3MNG A;  4PUR A;  2ZNM A;  4O7H A;  1I5G A;  2OE0 A;  2JAD A;  1SK0 A;  3MWH A;  3Q74 A;  3IPZ A;  3A3T A;  5KN3 A;  3LGC A;  4K0G A;  3KJY A;  4PTS A;  1TRU A;  5F8B A;  4LL1 B;  4PUA A;  3IOS A;  5A4U A;  3PH9 A;  2MMZ A;  1AXD A;  4IGJ A;  3RDW A;  5G5E A;  5B8A A;  2FA8 A;  1GSF A;  4LMW A;  1TTZ A;  5ENU A;  5E4W A;  6GSY A;  2J9H A;  4MPG A;  2P5Q A;  4EVM A;  3DYR A;  3A2V A;  3HCZ A;  4D73 A;  4H86 A;  1K0M A;  4QL7 A;  3APO A;  1SVL A;  2O89 A;  1RW1 A;  1WJK A;  3J7Y k;  1B9Y C;  4WBR D;  1HNC A;  2X8G A;  5A34 B;  1M7T A;  3HZ8 A;  2DSA A;  1ZZY A;  4GF0 A;  4YAV A;  1PX6 A;  2IFQ B;  2K8S A;  5IO2 A;  2DKH A;  3SBC A;  1OC9 A;  2C0F A;  4FYB A;  4IP1 A;  2DKI A;  1T3B A;  2MBS A;  3DD3 A;  1USB A;  2HRA A;  4KSM A;  4WXT A;  3D22 A;  1THO A;  2FUG 2;  2K8V A;  3VI5 A;  1TI3 A;  1SD8 A;  1FG4 A;  1OE8 A;  1PL1 A;  3MIX A;  2OBI A;  4NV5 A;  4MF5 A;  2YZH A;  1S3D A;  1A23 A;  2PN8 A;  2VCX A;  3D6I A;  3GUS A;  3O76 A;  2LQO A;  3J7Y b;  5B6M A;  1DBY A;  3CRU A;  3IV4 A;  4ACS A;  4HS1 A;  5DAL A;  2QKE A;  1FB6 A;  3UBK A;  1YDK A;  2B1K A;  1SK1 A;  3TJB A;  1I9D A;  3LOR A;  3GTU B;  5KN2 A;  2VKZ G;  3JCM L;  1XWC A;  2I1U A;  3M1G A;  2FWG A;  3FR9 A;  1KBN A;  2WB9 A;  1V9W A;  2EFD A;  1HD2 A;  5ECK B;  3GNJ A;  1AUC A;  5H5Q A;  3GN3 A;  2EIR A;  3WGX A;  1EOG A;  5ELG A;  2C0G A;  4KH7 A;  1ILO A;  4IKH A;  2O5V A;  1PN9 A;  4TXV A;  4MZC A;  4V2L A;  3QMX A;  4TXO B;  5G1K A;  5IMA A;  5ECP B;  4MF7 A;  2IME A;  3IBH A;  1GRX A;  3OR5 A;  4WR5 A;  4F82 A;  4TRX A;  5IMV A;  1WMJ A;  3H79 A;  1MDI A;  1YJ6 A;  2FD3 A;  3QOU A;  6GSW A;  3C7M A;  1O6J A;  1YEX A;  3FZ9 A;  4N11 A;  1GSS A;  4IQ1 A;  5DBQ A;  2DC5 A;  4KB3 A;  2H1G A;  1KTE A;  2PPT A;  5A1N B;  2C3Q A;  2VAF A;  1F3A A;  2F8F A;  4F0B A;  5J9B A;  3GX0 A;  6GSS A;  2WRT A;  2LNS A;  1F3B A;  3O3T A;  4YH2 A;  5HR2 A;  4HZ4 A;  3WGD A;  2OAC A;  3LJR A;  4MH2 A;  4ZL8 A;  3ZYW A;  5CYY A;  5CNW A;  3LFL A;  4ML6 A;  2AUV A;  2KUC A;  5ID2 B;  1BAY A;  4HI7 A;  2AYT A;  1X9W B;  4ZB8 A;  4HQZ A;  3EE2 A;  3FZ5 A;  2FA4 A;  2VUP A;  1SVM A;  4KE3 A;  2B3S A;  4QL9 A;  2CVB A;  2CAI A;  1B8X A;  4LL4 B;  4HU7 A;  2P5R A;  4AJ7 A;  1GL8 A;  1T8E B;  4KDU A;  2G2Q A;  5IPH A;  4FQU A;  2GQK A;  4ULX A;  4IN0 A;  2I81 A;  2JZT A;  2A2S A;  2WZ9 A;  2L6D A;  3EIN A;  2B1L A;  2JU5 A;  3F6F A;  2YN1 A;  1QQ2 A;  4O92 A;  4E8E A;  2RUF A;  2GGT A;  1RK4 A;  3H4K A;  3TRP A;  1OAZ A;  4XS1 A;  1W4V A;  1Q98 A;  4PX1 A;  3VI7 A;  5LCZ A;  1U3I A;  3E3E A;  3IDV A;  2H75 A;  2ES7 A;  2HSM B;  1X0R A;  3IRA A;  1TKD B;  1K0N A;  12GS A;  1H75 A;  5HR0 A;  4O5R A;  20GS A;  1XXU A;  1F9M A;  4BVX A;  4TR3 A;  3ERG A;  5HFG A;  3WD6 A;  2MYG A;  1TP9 A;  2CA8 A;  1YF1 A;  5E59 A;  2H1L A;  3F0I A;  1TU7 A;  1XPV A;  5IOW A;  2H6Z A;  3GKM A;  1WWJ A;  4J57 E;  2HQT A;  2VL9 A;  4TR0 A;  5EL8 A;  2YV7 A;  2FWF A;  1AQW A;  3APS A;  2GZP A;  4CDO A;  3VWU A;  2B7J A;  3HVS A;  1M9A A;  2OE3 A;  5BRT A;  1TRW A;  2EC4 A;  2M46 A;  2PWJ A;  3DKS A;  1QK8 A;  3G7I A;  7GSS A;  5KN1 A;  3FR6 A;  1XOA A;  5AGY A;  4EE0 A;  5ECR B;  1S3C A;  4KX4 A;  1MTC A;  2JAC A;  4E68 A;  4J2F A;  1SJ6 A;  3GIX A;  5C04 A;  4KUN A;  4OFM A;  3M3M A;  4KCE A;  4GQF A;  1TRV A;  5ECL B;  5FHI A;  1K0O A;  4V1A p;  2B6M A;  4F9Z A;  1Z7P A;  4QQ7 A;  18GS A;  2VOC A;  1OVN A;  4TR1 B;  5ECO B;  5IQY A;  1Y6E A;  5A34 A;  2BTO T;  4K2D A;  2R6K A;  3RBT A;  2X8C A;  3GL5 A;  3GST A;  4X4J A;  2IFQ A;  1B4P A;  2LST A;  4CY6 A;  4IW9 A;  3TUE A;  2ALB A;  4KND A;  1JZR A;  5HFK A;  5A5H B;  2IIY A;  4HOJ A;  2A2R A;  3HZ4 A;  5HFI A;  1VGL A;  2L5L A;  5INY A;  5IOX A;  3TRX A;  3R2Q A;  1PKW A;  2K6V A;  4P3Y B;  2DJ3 A;  3UAP A;  2O7K A;  2OJL A;  3LQ7 A;  5ECN B;  4A5P A;  2CV4 A;  2HYX A;  4YKG A;  3UBL A;  1Z9H A;  3F4R A;  4Z2U A;  2YOI A;  5HQP A;  1DE1 A;  1SU9 A;  1A8Y A;  4KDX A;  1X9S B;  4ECB A;  1PGT A;  2E0Q A;  3KIJ A;  3KD0 A;  2QSI A;  2GVP A;  1R4W A;  3HJP A;  2YJ7 A;  1V57 A;  5KOX A;  3W6G A;  3ME7 A;  4Z7X A;  2R2J A;  4E8H A;  3GTU A;  1TOF A;  4K6X A;  2H6X A;  2DIZ A;  1FOV A;  4G10 A;  1K0C A;  3KEB A;  2ZUP A;  1B48 A;  4AKI A;  1ZGN A;  4K7O A;  4PGT A;  2GT6 A;  3M0F A;  4BVY B;  3P90 A;  3BJ5 A;  3ZVJ D;  1GUM A;  4JED A;  4CW9 A;  1TXX A;  3FKF A;  2KLX A;  3CSJ A;  2V2G A;  1HNB A;  4N30 A;  4ZBA A;  1TI1 A;  4EF0 A;  2YAN A;  4N3Z A;  3BCK A;  2CVD A;  4TXO A;  4XS6 A;  1B9X C;  2CQ9 A;  4BWQ A;  2UV8 G;  2C0E A;  3ZL5 A;  1ZMA A;  3EMX A;  3TCO A;  2WFC A;  4KCA A;  4MAB A;  3UOM A;  4RUV A;  2LJK A;  3TKS E;  16GS A;  3DEX A;  1MDJ A;  2E7P A;  5A1N A;  2HXK A;  2H76 A;  1EGO A;  3TGZ A;  3M9J A;  1PN0 A;  1IYH A;  1YY7 A;  3IHG A;  3QAW A;  3ME8 A;  3G7Y A;  2ON5 A;  4OD7 A;  2VL2 A;  5CP1 A;  3IR4 A;  1FAA A;  3BCI A;  2F8A A;  2VCW A;  2GDR A;  2JZS A;  3FK8 A;  3VWV A;  4NAX A;  3TKS A;  4DSS B;  5ID2 A;  3DVW A;  1AQX A;  2ZCT A;  4NHW A;  1EOH A;  1YEP A;  3HHV A;  1QFN A;  4KA0 A;  4ZIJ A;  1KEB A;  4Q5Q A;  2CX4 A;  2PBJ A;  4KW6 A;  4N0V A;  5IIZ A;  3GSS A;  1SYR A;  2LTK A;  1V2A A;  1TK5 B;  2H30 A;  3TJJ A;  2H1D A;  2UZ8 A;  4JRR A;  4XCS A;  1Z5Y E;  2LRC A;  1XVW A;  1VF2 A;  3G7J A;  4YKF A;  3TKQ A;  2QA1 A;  4K0N A;  1F2E A;  2EIO A;  3BOA A;  2DJ0 A;  2TIR A;  2DJK A;  2GSQ A;  2DJJ A;  2FY6 A;  1ZYP A;  1A0R P;  4EUY A;  2PMT A;  2H19 A;  3G9B A;  3GUR A;  3IHQ A;  5AIS A;  3KMO A;  2HSM A;  2LJA A;  3L9S A;  3VPT A;  1A2L A;  3NOF A;  2IMD A;  4K8M A;  4IEL A;  4GCI A;  2RM5 A;  4XIH A;  1J9B A;  1C72 A;  2YNX A;  4AJ6 A;  2VCQ A;  4Q5R A;  5JWQ B;  1JFU A;  3H93 A;  1PL2 A;  1BED A;  3EVI A;  2JZR A;  3F4T A;  3I6A A;  4HU9 A;  4WF4 A;  2PUK C;  1TJD A;  1NSW A;  1BF5 A;  4HJ2 A;  3RPP A;  5GST A;  1N8J A;  1GLP A;  3FYG A;  1EGR A;  2YCD A;  1XZO A;  1IYI A;  3HXS A;  3VWX A;  3BBY A;  3MAK A;  2G0F A;  3M8N A;  3MYD A;  5BMU B;  1SKR B;  5AN1 A;  4TW5 A;  1MD3 A;  5A4W A;  5J5N A;  3FRC A;  1BYE A;  4TN8 A;  1THX A;  1UC7 A;  4ZB7 A;  5H5S A;  1CQH A;  1O81 A;  1M99 A;  5F06 A;  2XPD A;  1XW6 A;  1VRS D;  3P8W A;  1EP8 A;  3I43 A;  2V41 A;  3I69 A;  4JZQ A;  1XW9 A;  3VLN A;  2VD0 A;  4TR1 A;  4LLR A;  1PSQ A;  3L78 A;  2L5O A;  4FIW A;  3V1W A;  3GX8 A;  4MNN A;  2IMI A;  4WR4 A;  5CRH A;  5A5H A;  2EFH A;  4DSQ A;  4PQH A;  4MJE A;  2M80 A;  3DGQ A;  1UVZ A;  1V58 A;  4F2I A;  5DCH A;  4MZW A;  1FOH A;  1GNW A;  4WKW A;  1JZD A;  3RAZ A;  1GSQ A;  5DQY A;  4F0C A;  4OO5 A;  2B5X A;  5A5K A;  8GSS A;  4JE1 A;  1ERU A;  1GH2 A;  4PUF C;  4TR4 A;  2RM6 A;  1EZK A;  4V2N A;  2AJQ B;  2GS3 A;  2DJ1 A;  1ZYN A;  5G1L A;  1U3A A;  1ML6 A;  3NZN A;  1HYU A;  3DRN A;  3UJ1 A;  5CRD A;  2XBI A;  2JSY A;  4OFT A;  3A5I A;  3A5W A;  3IE3 A;  1K0A A;  3C1R A;  3Q19 A;  2GQL A;  4BVY A;  3LXZ A;  4NV2 A;  2RII A;  3TJF A;  3LYP A;  1SEN A;  4G0L A;  5DCG A;  1ABA A;  1ERV A;  1EV4 A;  1TDI A;  4X0X A;  1PD2 1;  1ACV A;  3H8Q A;  4HEA 2;  1VF4 A;  5JWR B;  2V6K A;  5DAK B;  2GLR A;  9GSS A;  4Z2T A;  4L8E A;  3GYK A;  4HJM A;  2YWM A;  1NW2 A;  1YQ1 A;  3VPQ A;  1R5P A;  3GKX A;  4W66 A;  3EPT A;  6GSU A;  4FH8 A;  2YPM A;  4IJ3 A;  1U87 A;  4KAE A;  4OMV A;  5D73 A;  2FLS A;  1QUW A;  4MJC A;  1BX9 A;  3TOT A;  4WBJ A;  2R0C A;  1M2B A;  3TRQ A;  4ZB9 A;  4G01 A;  2LJR A;  5C00 A;  1XWA A;  5D9W A;  3QCP A;  4ZBB A;  3F4S A;  3SWL A;  4I8B A;  4JBB A;  5ECQ B;  2HSN B;  5G5F A;  4ZL9 A;  4DSS A;  4AKG A;  2EIQ A;  3VK9 A;  2A2P A;  1N2A A;  1OC3 A;  3EC3 A;  5D93 A;  2R0P A;  3KGK A;  1SJZ A;  3KZQ A;  1U6T A;  1GNE A;  1GTB A;  2AHE A;  4Q5N A;  1A2J A;  1SL2 B;  4V1A g;  4EXJ A;  4G9H A;  5GZZ B;  1AW9 A;  3P2A A;  3GMF A;  1ZL9 A;  1K0D A;  4OCF A;  2HFD A;  5J4V A;  3HJO A;  2GST A;  1GSE A;  2Z9S A;  11GS A;  2LEG A;  1M0U A;  3TKP A;  2GZY A;  1YKC A;  1OC8 A;  1FHE A;  2NPB A;  2LQQ A;  4JR6 A;  4X1U A;  3EWL A;  3PIN A;  2A4V A;  5GSS A;  2OBK A;  3QPM A;  1XWG A;  5IMC A;  1X5E A;  2N5F A;  3D4T A;  4ZL7 A;  3AY8 A;  3WT2 A;  1MDK A;  3DXB A;  5AIV A;  4O5Q A;  1YKA A;  4IP6 A;  3HKR A;  1WP0 A;  4CY8 A;  4XRA A;  2H74 A;  4YAP A;  5DJM A;  2X49 A;  2DLX A;  2X8H A;  2H71 A;  5DAL B;  3L9V A;  3F9U A;  4IS0 A;  3LG6 A;  1Z3E A;  3F63 A;  2WUL A;  5J40 A;  2H72 A;  2TRX A;  1Y1U A;  4X43 A;  4BL7 B;  3CBU A;  4BPY A;  5LNK e;  2L4Q A;  2CZ3 A;  1WIK A;  2PVO C;  2LUS A;  2HE3 A;  2JSZ A;  1WOU A;  3ZLP A;  4TKY A;  3ZIJ A;  4XS4 B;  17GS A;  4ECI A;  6GST A;  4I6X A;  2O85 A;  3D5J A;  4HQS A;  4NWY A;  4MH3 A;  1AAZ A;  2LRN A;  2HNL A;  1X9M B;  1SD9 A;  2HRF A;  1NHY A;  2VLT A;  3GH9 A;  2N5B A;  2EFC A;  4GSS A;  3GA4 A;  3MSZ A;  3ZVJ A;  4L0U A;  5D9V A;  3UL3 A;  3KTL A;  2P0G A;  2VL3 A;  1B4Q A;  5ECS A;  1XBS A;  5FWG A;  1U88 A;  4ECJ A;  1T1V A;  4I2U A;  2KOK A;  3ZRE A;  1N25 A;  4BWS A;  3A2X A;  3HMJ G;  3GKK A;  5KOW A;  3C71 A;  2J23 A;  3QDN A;  3QFA C;  2OA7 A;  1DE2 A;  1FVK A;  1M2A A;  5B7C A;  2WJU A;  4MK3 A;  2C3T A;  3DWV A;  3PGT A;  3IAS 2;  4ICY A;  2GZZ A;  5GAN D;  2V32 A;  4AGS A;  3C8E A;  4GDF A;  1G7E A;  4MZB A;  2IMF A;  2I3Y A;  3IC4 A;  3APQ A;  5IMZ A;  3DIE A;  3C73 A;  1PMT A;  1ST9 A;  1XFL A;  2YJH A;  22GS A;  2O8V B;  4USS A;  1XIY A;  5CRG A;  4DVC A;  4EKZ A;  3ERF A;  2EFE A;  4L5L A;  1YVL A;  4I2T A;  2QGV A;  3FW2 A;  3WT1 A;  4POL A;  1PKZ A;  3KH7 A;  2QC7 A;  4GLT A;  2R4V A;  1K3L A;  3IK7 A;  2MMA A;  3NIV A;  2NDO A;  2HZE B;  1JLW A;  2B5E A;  4ID0 A;  2X4A A;  1JLV A;  4NMU A;  3VWW A;  4I97 A;  5HR3 A;  3KXO A;  4IQA A;  3U5R E;  1G6Y A;  1SVO A;  2PGT A;  4HDE A;  1O7U A;  3A2W A;  2GSS A;  5JCG A;  5DAK A;  5ECI B;  3EMP A;  5DVB A;  5IO0 A;  1EEJ A;  2VLV A;  2R0G A;  5EVO A;  1ON4 A;  5J4Y A;  3KP9 A;  1BG5 A;  2H0I A;  1TXU A;  2H73 A;  1BQ7 A;  5J41 A;  5IPG A;  4DEJ A;  3MDK A;  3UVH A;  1O8X A;  1W89 A;  1RQM A;  1URM A;  3HVX A;  4WF5 A;  4MCU A;  1PQN A;  4XTS A;  3RHB A;  3Q18 A;  2B5Y A;  2HSH A;  2YV9 A;  1LBK A;  1HNA A;  1QMV A;  1SKS B;  4ZXG A;  5D96 A;  1GUK A;  2XPE A;  4NXI A;  1GTI A;  3UMA A;  1J0F A;  5IMF A;  2AAW A;  5F07 A;  2VO4 A;  2VCZ A;  2IPA A;  3E9J B;  5F05 A;  4YQU A;  1XCC A;  2LKU A;  3KP8 A;  2MMN A;  3FY7 A;  1V98 A;  2MZC A;  2QA2 A;  1EEM A;  2VLU A;  2B7K A;  2IWT A;  3ZFL A;  2IJY A;  2HSN A;  4OCE A;  3ZZX A;  1SYX A;  3TDG A;  1T00 A;  5FT3 A;  2CX3 A;  2YWO A;  4OFN A;  2WGR A;  1TK8 B;  2BMX A;  3ZMK A;  2H8L A;  3EYT A;  3GV1 A;  4ZBD A;  3CRT A;  4KF9 A;  4MJB A;  4RI7 A;  3CTF A;  5KEJ A;  2KHP A;  3LW9 A;  3R3E A;  1AIU A;  1XOB A;  1M9B A;  2RUE A;  4AJ8 A;  3UEM A;  2KP2 A;  4WEY A;  2R3X A;  2R37 A;  5DDL A;  2C3N A;  2LS5 A;  1E2Y A;  3TB2 A;  4YQM A;  4N0Z A;  2OKA A;  1TU8 A;  3U6V A;  4FYU A;  3UIW A;  5AIX A;  4MDC A;  1GUL A;  1EWX A;  4QMK A;  4PQ1 A;  3IXR A;  3HY2 A;  4IVF A;  5CRW A;  4Z2R A;  2XBQ A;  3ZIT A;  3CMI A;  5J9C A;  2HI7 A;  4MF6 A;  2VCV A;  2IMK A;  3D4M A;  1Z7R A;  2WDU A;  1ZOF A;  2XHF A;  4IHU A;  3TJG A;  3GRX A;  3KM6 A;  4MMM A;  5J47 A;  4G0I A;  4NPB A;  1XW5 A;  2PER A;  4POM A;  6GSX A;  2CAQ A;  2P31 A;  2HRK B;  4BL7 A;  2H1B A;  4WET A;  3HYP A;  3ZIV A;  5ECH B;  3CYN A;  2I4A A;  1K3O A;  3KTB A;  5LD0 A;  1A8L A;  2E2G A;  4K1F A;  2E2M A;  2BJX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...