13GSA

Glutathione s-transferase complexed with sulfasalazine
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
210
structure length
210
Chain Sequence
MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE
publication title The Ligandin (Non-Substrate) Binding Site of Human Pi Class Glutathione Transferase is Located in the Electrophile Binding Site (H-Site).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 85
structure length 210
sequence length 210
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1997-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 13gsA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 13gsA01
1GSEA 5JCGA 4TVEA 1RK4A 3GTUA 5HR3A 4N30A 2FWHA 5IO0A 3TRXA 2I1UA 1Z9HA 3DYRA 4X43A 4ECCA 1OC9B 2MZCA 2EIOA 1OE7A 1O8WA 1X0RA 1TRVA 2WS2A 1BEDA 2GS3A 2CVBA 5DALB 1TU8A 2YJ7A 4IN0A 1SKRB 2RLIA 2HXKA 2KP2A 6GSSA 1XIYA 3EWLA 1PX7A 1Y6EA 1U3AA 4GWRA 2C0DA 3F4SA 4MABA 1E2YA 4FYCA 3KXOA 1DE2A 2PVOC 4GSNA 4E8HA 1O8XA 1JZDA 4KSMA 3TCOA 4MF7A 3IOSA 2HZEB 3HVXA 3IC4A 1QUWA 4D73A 3R3EA 5F07A 2YWMA 3APOA 2FWGA 16GSA 2JACA 3F9UA 1SL0B 1AAZA 1NSWA 4GF0A 4BL7A 1EEMA 2LKUA 2M46A 2PUKC 5ELAA 3UAPA 1F37A 5ELGA 5AIVA 1HNBA 4ZL8A 1PD21 3DKSA 3M0FA 1J0FA 2CQ9A 4OO5A 1KBNA 3FHKA 4FYUA 1ILOA 3U5RE 3C8EA 3TJFA 5KEJA 1WMJA 2GT5A 3FKFA 3PINA 3BOAA 2H66A 3IXRA 4HI7A 2XHFA 3LXTA 1C72A 4GXZA 1KEBA 2YWIA 4L5LA 2HQTA 5IMZA 1SYRA 5IQYA 1GUMA 2A4VA 3LXZA 5A4VA 20GSA 5COHA 4MDCA 3HD5A 5CNWA 4BWSA 4WR5A 3BCKA 4ML6A 3ZRDA 1J08A 4L5OA 4ID0A 3TRPA 3P2AA 4TOPA 3WGDA 3CMIA 5CP1A 4Q5FA 4PQHA 2IJYA 4XRDA 2X8CA 5HR2A 1EP7A 4OMVA 4ZB8A 4MH3A 1G7OA 1FO5A 3LQ7A 1ERVA 2CVKA 4XS4A 4F9ZA 5LNKe 17GSA 2L6CA 3ZTLA 4F2IA 2L4QA 5D9VA 1BG5A 1F2EA 2IMKA 3H93A 3FR9A 1PKZA 4V2LA 2N5FA 3WGXA 6GSUA 4GRFA 4QL9A 1EOHA 1YJ6A 1OC8A 5LCZA 3E0UA 4YAPA 1AQVA 4Z7XA 2R3XA 4FH8A 3CTFA 2YP6A 2XBIA 3D4TA 3O3TA 2HLSA 3KM6A 5J5NA 4N0VA 4YH2A 2N5BA 1AXDA 4P3YB 2YNXA 2I4AA 4MJEA 3EMXA 4G10A 1BAYA 3ZITA 5J41A 5DQYA 5HFIA 2L6DA 11GSA 3VFIA 1UN2A 5G31A 2LQOA 3GIXA 5DBQA 3F3RA 3A3TA 4NHZA 1Q4JA 1VF1A 2H01A 2HFDA 2VLUA 3ERFA 2C4JA 5IMAA 3KCMA 2LJRA 3MNGA 5DJLA 4BWQA 2PPTA 2GZPA 3Q19A 5F0GA 3KEBA 3I69A 4PQIA 4MP4A 2KP1A 2OA7A 1HNCA 4WETA 1GTUA 4V1Ag 3DEXA 1PRXA 3F0IA 4I6XA 3GKMA 6GSVA 3SBCA 5DQSA 2GVPA 2F3MA 5KN1A 2H1GA 2B6MA 3MSZA 1XBSA 2B5XA 3K8NA 13GSA 2LUSA 1EEJA 3ZFBA 2L5LA 22GSA 3ZFLA 4TR3A 2JL4A 2VL2C 4TXOB 4CW9A 3QAWA 4PTSA 5F06A 3CXGA 1Y25A 4KDXA 1XFLA 3IK9A 5HR1A 3UVHA 4MZBA 5KN0A 1G0TA 3IAS2 2O7KA 1OKTA 4V2MA 2ON5A 4G0LA 1V57A 3F6FA 2WDUA 1VF2A 4K0GA 3ME7A 4HQZA 3JCML 3AY8A 1EGRA 7GSSA 2E2GA 1YEXA 5IOXA 1EWXA 5HQPA 2CZ2A 3TB2A 3KH7A 3DRNA 3QCPA 2A2RA 2JZTA 4OO4A 2AJQB 5ECHB 5IOWA 4HS1A 3J7Yb 2EIQA 5AISA 1GULA 1UA5A 2CAQA 1M99A 4IP6A 3A2XA 6GSTA 1UC7A 5IIZA 2H1BA 2H0HA 3GTUB 5JCUA 2PERA 4KX4A 3I6AA 5JWOB 4KAEA 2IFQA 3UEMA 1GLQA 3QDNA 4IHUA 3RAZA 3TKSC 2EC4A 4USSA 2H73A 1XXUA 3L9VA 2X8GA 1F9MA 4KSOA 1Z3EA 2L4CA 1TDIA 5CREA 4KGIA 1X5DA 2DBCA 2YOIA 1B48A 1S3CA 1PL2A 2P31A 1T4ZA 4G2EA 3TKSA 1G6WA 4NV2A 2VL3A 3TRQA 3GL3A 2P0GA 1XWCA 2GSSA 4MLYA 4K2DA 2CZ3A 2C8UA 1J9BA 3GKXA 4CHSA 4H86A 1W89A 2L59A 1ZYQB 2QGVA 2KUCA 1GSUA 2QKEA 4FO5A 4WXTA 3P8WA 2YWOA 2FHEA 4MCUA 2JSZA 2K6VA 3I43A 2GSTA 3GRXA 4D73B 3GV1A 1WJKA 1M7TA 1XPVA 3ZL5A 1VRSD 3O6TA 2J23A 4X1UA 1WIKA 3TGZA 3US3A 2OE0A 9GSSA 4BL7B 3GN3A 2AV4A 3NIVA 4L8EA 5D9XA 3FZ5A 2GZZA 2N5AA 2RUFA 2CAIA 1JFUA 3CYNA 3PH9A 4KDUA 4TKYA 1O7UA 3EVIA 4EL1A 2YPMA 1SU9A 1MDJA 5HFKA 2XBQA 3IPZA 1PN9A 1HD2A 1PKWA 3FR6A 2YZHA 2MMAA 2PWJA 4DSRA 4QQ7A 3UBKA 4ZL9A 2K9FA 4KNDA 5IMVA 2NVLA 1XWKA 4G19A 2ZNMA 3IV4A 1A24A 4WBJA 1T3BA 5IPGA 3TJGA 2IN3A 3EURA 3TKRA 2K8VA 1IYHA 2CA8A 4MJBA 2M80A 3ZREA 3L78A 4MA9A 2VLTA 4OFTA 3RHCA 3P90A 3TJKA 1XOBA 2KOKA 4CDOA 2PMTA 3ZLPA 1XOAA 3HJPA 2X8HA 4ZB9A 1V58A 4J2FA 3CSIA 2OBKA 5ECOB 2LRCA 4IGJA 5AGYA 2H71A 1TI3A 3D0ZA 4IBPA 2GGTA 2ALBA 1A2JA 2GT6A 2P5QA 2VOCA 2TRCP 3BBYA 1DUGA 4EDZA 2VCXA 1EOGA 5HR0A 2F51A 2H19A 3FZAA 1NHYA 4XS4B 3HVSA 2C1YA 3M3MA 1JLVA 1GSDA 4TXVA 3H8QA 2DMMA 1S3AA 1JZOA 1M0UA 4O92A 2YCDA 3L4NA 2GQMA 5DCGA 5GSTA 5C04A 2MMOA 4O7HA 1NM3A 1EV4A 2WFCA 4JR6A 2LTKA 4TR1A 3FEUA 5ECMB 4HZ4A 4ZL7A 4ZBBA 2I3YA 1XW5A 1BYEA 2VCZA 2CX3A 4OFNA 2O8VB 4N10A 2M72A 4POKA 4G9HA 3GH9A 5L71A 5C00A 3GKKA 1EZKA 3N5OA 2VD1A 3RPNA 4RUVA 1O6JA 4GQFA 14GSA 2JSYA 1SD9A 2DLXA 4IKHA 3LYKA 5E4WA 1TK8B 1PL1A 4XS1A 1I5GA 4XCSA 4IQ1A 3GHAA 4RQRA 1PA3A 5IM9A 2P5RA 1M2AA 1SK0A 1T4YA 2NTOA 1YKAA 1E6BA 2O87A 2H30A 5H5SA 3KH9A 1RW1A 4OCFA 3VWVA 4BPYA 3DWVA 5GSSA 5GZZB 2IWTA 1FG4A 2B5YA 3LWAA 3RBTA 4MJAA 3M8NA 1Z5YE 3D4MA 2O89A 1N8JA 5ECSA 2OBIA 2V6KA 2FNOA 2L57A 2FWFA 3FR3A 3TKQA 1SJ6A 4K8MA 5CRGA 5G1KA 1CQGA 2PVQA 1SK2A 2OACA 1MDIA 4YAVA 3GH6A 4XS6A 2JZSA 3APSA 1ABAA 1THOA 4JE1A 3MAKA 2HSYA 2HNLA 2H1DA 1GRXA 4ZB6A 2DJJA 2RM6A 1S3DA 3M9JA 1ERUA 2JU5A 2WGRA 3HJOA 2LV3A 2MBTA 3F63A 4J56E 3KP8A 2H75A 3U6VA 2C0FA 2EIRA 1T1VA 2H0IA 2VD0A 2LEGA 4NAXA 5D96A 1OYJA 2LJAA 1TRWA 2YV7A 1T00A 4PUAA 1GTBA 2C3NA 5G2ZA 3IE3A 3GNJA 2B1KA 1GTAA 4BVYA 4XRAA 4KF9A 1DBYA 4LMWA 4F0CA 4HU7A 4PX1A 2VM1A 2V41A 1XVQA 1K0BA 5JWRB 3QD9A 2OJLA 5ECLB 2JADA 6GSXA 3C7MA 1FW1A 4ZBDA 2YANA 2K18A 4ZILA 3Q6OA 4YQVA 2GTUA 3VI5A 4KB3A 1TOFA 6GSYA 4DEJA 3PGTA 2HT9A 3BJ5A 2IFQB 1USBA 2H70A 4ULXA 1EGOA 2AUVA 4K9ZA 2IMDA 1XCCA 4ZXGA 2R4VA 5G5EA 2NDOA 2DIZA 4AJ8A 2DC5A 3DIEA 4HZ2A 2H76A 3EU3A 2VCVA 1GNWA 3IK7A 4ECIA 1MD4A 1GNEA 3G7YA 2HSMA 4HQSA 3A2VA 4G0IA 3FZ9A 3UL3A 1QK8A 3HHVA 1DE1A 4OD7A 2YN1A 2OADA 4YQUA 2TRXA 2WRTA 1FB6A 3KTLA 1U6TA 3VK9A 1XVWA 3ED3A 4BVXA 4GCIA 4IS0A 4WBRD 2PGTA 3R2QA 3VPQA 2I9HA 5CYYA 4ZIJA 2VLVA 2HYXA 1X5EA 3TJBA 4PQ1A 5CRWA 4OFMA 1B8XA 3GKNA 4G0KA 4WF4A 4XHMA 5KN3A 2FWEA 4Q5RA 3PPUA 4AJ6A 3ERGA 5IO2A 4N0ZA 4JR4A 1MEKA 2GZYA 1TU7A 1SYXA 12GSA 3DXBA 4NWYA 2R6KA 5A4UA 5CRHA 5J4UA 4V2NA 3UVTA 2FUG2 1A0FA 3DGQA 2FD3A 1V40A 5EPFA 3UIWA 2ES7A 3FYGA 5ENUA 4MF5A 1O81A 1A2MA 4F03A 1SJIA 3HXSA 3NZNA 3LJRA 1GSYA 2HRFA 5F05A 3LEFA 1R7HA 2HSHA 3GL5A 3MWHA 3QFAC 1K0NA 1BQ7A 1SL2B 3VWXA 3E3EA 5JCWA 5BMUA 3A5WA 4POLA 1K0CA 1A2LA 1GUHA 1YQ1A 1TI1A 5GAND 4KDYA 1M2BA 1QQ2A 1OKDA 1TP9A 2H72A 3FZ4A 3WYWA 2V2GA 5ID2A 4MMMA 2NBSA 4GLTA 1GH2A 3EINA 4K7IA 1JZRA 1F6MC 5CRDA 2H6XA 3ZYWA 2DJ3A 3HZ8A 4TRXA 4N11A 2H8LA 2FA8A 4GQCA 4RQXA 2C0GA 5EL8A 5F8BA 2V1MA 2C0EA 5G1LA 3QPMA 4KCAA 2F9SA 3CRUA 3LFLA 5E59A 3S9FA 2VIMA 3ME8A 1WPIA 3UOMA 3C1SA 2KLXA 1OE8A 2VO4A 4TR1B 4I5QA 1TKDB 3P7XA 1K0OA 4J57E 2WULA 3WT1A 2B5EA 3EC3A 4HJMA 5DAKA 1T8EB 2PBJA 3TDGA 2CVDA 5B6MA 3QR6A 4E8EA 4L0UA 1O85A 2HSNB 2WZ9A 2E2MA 2HRKA 2H6YA 4XTSA 1K3YA 3G9BA 4MK3A 2GQKA 18GSA 1Z6NA 1V2AA 4EO3A 4EXJA 3LORA 3KGKA 2BMXA 1KNGA 2I81A 4Q5QA 4EF0A 4DVCA 4MF6A 1QXHA 1Z7PA 3ZZXA 1AQXA 5D9WA 3G7JA 5H5RA 1ZGNA 2HI7A 3TKPA 5H5QA 1ML6A 4LMVA 3FW2A 1G7EA 1TXXA 2WCIA 3OR5A 3I9V2 2H1AA 2F8AA 4IW9A 1UVZA 2C3TA 1GSSA 3D6IA 1U3IA 2GQLA 4HDEA 2IMFA 4DSSA 4X0XA 1MTCA 5CO3A 1A8YA 1SKSB 5JWQB 2GSRA 3ZIJA 4POMA 4JEDA 2LJKA 4NMUA 4DSQA 1K3LA 4LLRA 5G5FA 4MZCA 1XWGA 3W6GA 4KH7A 3DVXA 4QL7A 3M1GA 4LL4B 2LNSA 4F82A 1NW2A 1WOUA 2VUPA 1TK5B 2X99A 3IBHA 2YZUA 1TW9A 2JZRA 1HNAA 3FK8A 4EKZA 2UZ8A 1SL1B 1V98A 4I2UA 4BA7A 1VGLA 2HZFA 3HY2A 3FRCA 3EE2A 4OCEA 2H0GA 2H6ZA 3RHBA 2CX4A 3CSJA 1Z6MA 4BVYB 3FY7A 5INYA 2DSAA 4IP1A 5ABRA 3N9JA 3CRTA 2VM2A 1SENA 1R4WA 4HU9A 1ZZYA 3UJ1A 2MBSA 5ECQB 5FWGA 1SKWB 4KE3A 1RQMA 2BJXA 4WR4A 1GUKA 3L0HA 1XZOA 1ON4A 1JLWA 4POBA 2L5OA 2B7KA 4NHWA 1WWJA 2X64A 3GA4A 3F4RA 3GX0A 3IR4A 3W8SA 4TR4A 1HYUA 3VWWA 1FAAA 5A4WA 1YF0A 1X9MB 3BD2A 1LJRA 1SD8A 3LGCA 4KA0A 3GUSA 1B4QA 3GURA 2LRNA 3RPPA 1TTZA 3ZIVA 4MH2A 3VI7A 2WB9A 3HA9A 4PNFA 5B8BA 2OKAA 1IYIA 4EDYA 1A0RP 2GLRA 3M9KA 1SJZA 2CV4A 2HSMB 4GSSA 4MZWA 1ZOFA 10GSA 1R5PA 3GSSA 1OAZA 4HJ2A 5ECKB 1DSBA 3C73A 3DVWA 2BTOT 4EUYA 4AF2A 2C3QA 3HZ4A 2F8FA 3WT2A 4BVXB 3HVVA 3EMPA 1XW6A 3KMNA 4GTUA 3L9UA 3L9SA 2LNTA 3APQA 2K8SA 3QOUA 1TJDA 3DMLA 1AQWA 3WGEA 3SWLA 1FVJA 4EVMA 2IMIA 3CTGA 1FOVA 2DJKA 2DMLA 1K0AA 3MDKA 4TR0A 2FLSA 5AIXA 3F4TA 3DD3A 2IIYA 1LU4A 3GFKA 4FYBA 1U88A 4K6XA 5D73A 1YZXA 1ZL9A 2LRTA 1HQOA 4KCEA 1PX6A 5J9CA 1JHBA 1AW9A 4K0NA 3EYTA 3Q74A 1U87A 3HKRA 2AHEA 1V9WA 4WKWA 2D2ZA 1Z7RA 2WJUA 1KTEA 1OC9A 3IA1A 3VWUA 3ZMLA 5EY6A 1R26A 2YWNA 5DJMA 3RDWA 2V32A 2DJ1A 2LS5A 5DALA 5D93A 4JRRA 5J3RA 3KP9A 1GP1A 4TW5A 4PURA 1NHOA 4PUFC 3TJJA 3KTBA 2QC7A 3IHQA 4NPBA 1G6YA 2GSQA 3HCZA 4LL1B 2LQQA 1PGTA 4I97A 3KMOA 1WP0A 4XIHA 1TRSA 2GDRA 4IJ3A 4FIWA 5ID2B 2V6OA 2VCWA 2VCTA 1MDKA 4YQMA 4FQUA 2LSTA 1BJXA 4ZBAA 5ECRB 5D9TA 3CSHA 2ON7A 3ZVJA 3QAVA 1M2DA 2MMNA 5LD0A 3D22A 3LSZA 2TIRA 2H74A 5DCHA 3TUEA 1GTIA 1O73A 2MMZA 2HZEA 1EP8A 4K1FA 3QFBC 2CT6A 3KD0A 4JBBA 1ACVA 4LA1A 1A8LA 3V1WA 1GL8A 2RUEA 5B8AA 3TOUA 3UBLA 4HUAA 3KZQA 4IVFA 4PNGA 4F0BA 3ERWA 4IELA 2OE3A 2REMA 4JZQA 1F3AA 3ZVJD 3EU4A 5D8IA 1ERTA 1ST9A 3HYPA 5FHIA 1FHEA 2DJ0A 2ZUPA 4NV5A 3GSTA 5DAKB 3VLNA 2ZCTA 3LYPA 1R5AA 1WE0A 2E7PA 1EV9A 2Z9SA 1XWBA 2HRKB 4ISDA 4WEYA 3IDVA 3LG6A 2R5GA 1B9YC 1QMVA 4HEA2 3TOTA 3QMXA 2XPEA 3VPTA 5EVOA 2HRAA 3F3QA 1URMA 8GSSA 2AAWA 4ACSA 5DVBA 5KN2A 5AN1A 2RM5A 1LBKA 3HDCA 4V1Ap 3D5JA 2FA4A 1OC3A 4EE0A 2IMEA 1F3BA 1GSFA 2HE3A 3IRAA 2DJ2A 2HRNA 3C1RA 1OVNA 1M9BA 4I8BA 1YKCA 1H4OA 2R37A 3HJMA 1X9WB 3PR8A 3QAGA 1XWAA 4DSSB 1X9SB 2O85A 2VL2A 1QGVA 4HOJA 2FGXA 1K0MA 3UMAA 1AIUA 1FB0A 4O5RA 1T7PB 1SK1A 1PSQA 1AUCA 1YF1A 3BCIA 2G0FA 1BX9A 4JU5A 2FCHA 2VL9A 2AYTA 2MYGA 3GX8A 1JZWA 3UARA 3A2WA 5DDLA 3J7Yk 2PN8A 2G2QA 3IC8A 4PGTA 3W8JA 1YEPA 3F6DA 1MD3A 2B7JA 2YV9A 4RI7A 3TKSE 1VF3A 1K3OA 2A2SA 4NXIA 1THXA 4IJIA 1X5CA 1ZYEA 5IMCA 3GMFA 3O76A 3KJYA 5FT3A 1QFNA 3E9JB 2DIYA 5IMFA 1H75A 3KIJA 2OE1A 1YDKA 1YY7A 1K0DA 5J9BA 1XW9A 5IPHA 1AC1A 5CAXA 1FVKA 2XPDA 2AB6A 2VAFA 1I9DA 4ILFA 3ZMKA 5IMDA 1B4PA 3Q18A 4K7NA 2NPBA 2J9HA 4L0WA 3G7IA 4Q5NA 3WD6A 5ECNB 2B1LA 5ECPB 3VURA 1VF4A 3H1NA 5B7CA 3F8UA 6GSWA 1Q98A 3GYKA 4AGSA 4MPGA 3CBUA 1WRYA 3IAM2 4PXOA 4EC0A 4ECBA 4RI6A 5B6NA 4OWYA 1GLPA 5A5KA 1ZCPA 2R2JA 3H79A 1B9XC 2VCQA 4GSTA 4I2TA 1W4VA 4TXOA 1TK0B 2IL3A 3C71A 2PU9C 1GWCA 1TRUA 2QSIA 4AJ7A 2C80A 2YJHA 19GSA 1ERWA 4ML1A 4WF5A 5GAPD 2FY6A 1PQNA 2B3SA 4O32A 4K7OA 2XC2A 4MJCA 2RIIA 4IQAA 4KUNA 1M9AA 1N2AA 4MPFA 2IPAA 4KW6A 1A23A 4ECJA 4TN8A 2KHPA 3H4KA 3D21A 5G30A 5ECIB 5HFGA 1ZMAA 3ISOA 3NOFA 1GSQA 1CQHA 1PMTA 2E0QA
chains in the Genus database with same CATH superfamily
1GSEA 5JCGA 4TVEA 4Z2UA 5A5HA 1RK4A 3GTUA 5HR3A 4N30A 2FWHA 5IO0A 3TRXA 2I1UA 1Z9HA 1SVLA 3DYRA 4X43A 4ECCA 1OC9B 3LW9A 2MZCA 2EIOA 1OE7A 1O8WA 1X0RA 1TRVA 5A1NB 2WS2A 1BEDA 2GS3A 2CVBA 5DALB 1TU8A 2YJ7A 4IN0A 1SKRB 4PI2C 2RLIA 2HXKA 2KP2A 6GSSA 1XIYA 3EWLA 1PX7A 1Y6EA 4O5UA 1U3AA 4GWRA 2C0DA 3F4SA 4MABA 1E2YA 4FYCA 3KXOA 1DE2A 2PVOC 4GSNA 4E8HA 1O8XA 1JZDA 4KSMA 3TCOA 4MF7A 3IOSA 2HZEB 3HVXA 3IC4A 1QUWA 4D73A 3R3EA 2EFCA 5F07A 2YWMA 3APOA 2FWGA 16GSA 2JACA 3F9UA 1SL0B 1AAZA 2WW2A 1NSWA 4GF0A 3FMWA 4BL7A 1EEMA 2LKUA 2M46A 2PUKC 5ELAA 3UAPA 1F37A 5ELGA 5AIVA 1HNBA 4ZL8A 1PD21 3DKSA 4EIQA 3M0FA 1J0FA 2CQ9A 2X49A 4OO5A 1KBNA 3FHKA 4FYUA 1ILOA 3U5RE 3C8EA 3TJFA 5KEJA 1WMJA 2GT5A 3FKFA 3PINA 1SVOA 3BOAA 2H66A 3IXRA 4HI7A 2XHFA 3LXTA 1C72A 4GXZA 1KEBA 2YWIA 4L5LA 2HQTA 5IMZA 1SYRA 5IQYA 1GUMA 2A4VA 3LXZA 5J4VA 1N25A 5A4VA 20GSA 5COHA 4MDCA 3HD5A 5CNWA 4BWSA 4WR5A 3BCKA 4MNNA 4ML6A 3ZRDA 1J08A 4L5OA 4ID0A 3TRPA 3P2AA 4TOPA 3WGDA 3CMIA 5CP1A 4Q5FA 4PQHA 2IJYA 4XRDA 2X8CA 5HR2A 1EP7A 4OMVA 4ZB8A 4MH3A 1G7OA 1FO5A 3LQ7A 1ERVA 2CVKA 4XS4A 4F9ZA 5LNKe 17GSA 2L6CA 3ZTLA 4F2IA 2L4QA 5D9VA 1BG5A 1F2EA 2IMKA 3H93A 4K2XA 3FR9A 1PKZA 4V2LA 2N5FA 3WGXA 6GSUA 4GRFA 4QL9A 1EOHA 1YJ6A 1OC8A 5LCZA 3E0UA 4YAPA 1AQVA 1S3RA 4Z7XA 2R3XA 4FH8A 3CTFA 2YP6A 2XBIA 3D4TA 3O3TA 2HLSA 3KM6A 5J5NA 4N0VA 4YH2A 2N5BA 1AXDA 4P3YB 2YNXA 2I4AA 4MJEA 3EMXA 4G10A 1BAYA 3ZITA 5J41A 5DQYA 4FXYP 5HFIA 2L6DA 11GSA 3VFIA 1UN2A 4AKHA 4Z2RA 5G31A 2LQOA 3GIXA 5DBQA 3F3RA 3A3TA 4NHZA 1Q4JA 2O3EA 1VF1A 2H01A 2HFDA 2VLUA 3ERFA 2C4JA 5IMAA 3KCMA 2LJRA 3MNGA 5DJLA 4BWQA 2PPTA 2GZPA 3Q19A 5F0GA 3KEBA 3I69A 2H1LA 4PQIA 4MP4A 2KP1A 2OA7A 1HNCA 4WETA 5BRTA 1GTUA 4V1Ag 3DEXA 1PRXA 3F0IA 4I6XA 3GKMA 6GSVA 3SBCA 5DQSA 2GVPA 2F3MA 5KN1A 2H1GA 2B6MA 3MSZA 1XBSA 1FOHA 1TXUA 2B5XA 3K8NA 13GSA 2LUSA 1EEJA 3ZFBA 2L5LA 22GSA 3ZFLA 4TR3A 2JL4A 2VL2C 4TXOB 4CW9A 3QAWA 4PTSA 5F06A 3CXGA 1Y25A 4KDXA 1XFLA 3IK9A 5HR1A 3UVHA 4MZBA 5KN0A 1G0TA 3IAS2 2O7KA 1OKTA 4V2MA 2ON5A 4G0LA 1V57A 3F6FA 2WDUA 1VF2A 4K0GA 3ME7A 2R0PA 4HQZA 1I1IP 3JCML 3AY8A 1EGRA 7GSSA 2E2GA 1YEXA 5IOXA 2EFHA 1EWXA 5HQPA 2CZ2A 3TB2A 3KH7A 3DRNA 2A2RA 3QCPA 2JZTA 4OO4A 2AJQB 5ECHB 5IOWA 4HS1A 3J7Yb 2EIQA 5AISA 1GULA 2X4AA 1UA5A 2CAQA 1M99A 4IP6A 3A2XA 6GSTA 1UC7A 5IIZA 2H1BA 2H0HA 5A5HB 3GTUB 5JCUA 2PERA 4KX4A 3I6AA 5JWOB 2QA1A 4KAEA 2IFQA 3UEMA 1GLQA 3QDNA 4IHUA 3RAZA 3TKSC 2EC4A 4USSA 2H73A 1XXUA 3L9VA 2X8GA 1F9MA 4KSOA 1Z3EA 5J40A 2L4CA 1TDIA 5CREA 4KGIA 1X5DA 2DBCA 2YOIA 1B48A 1S3CA 1PL2A 2P31A 1T4ZA 4G2EA 3TKSA 1G6WA 4NV2A 2VL3A 3TRQA 3GL3A 2P0GA 1XWCA 2GSSA 4MLYA 4K2DA 2CZ3A 5KOWA 4W66A 2C8UA 1J9BA 3GKXA 4CHSA 4H86A 1W89A 2L59A 1ZYQB 2QGVA 2KUCA 1GSUA 2QKEA 4FO5A 4WXTA 3P8WA 2YWOA 2FHEA 4MCUA 2JSZA 2K6VA 3I43A 2GSTA 3GRXA 4D73B 3GV1A 1WJKA 1M7TA 1XPVA 3ZL5A 1VRSD 3O6TA 2J23A 4X1UA 1WIKA 3TGZA 3US3A 2OE0A 9GSSA 4BL7B 3GN3A 2AV4A 3NIVA 4L8EA 5D9XA 3FZ5A 2GZZA 2N5AA 2RUFA 2CAIA 1JFUA 3CYNA 3PH9A 4KDUA 4TKYA 1O7UA 3EVIA 4EL1A 2YPMA 1SU9A 1MDJA 5HFKA 2XBQA 3IPZA 1PN9A 4AKIA 1HD2A 1PKWA 3FR6A 2YZHA 2MMAA 2PWJA 4DSRA 4QQ7A 3UBKA 4AKGA 4ZL9A 2K9FA 4KNDA 5IMVA 2NVLA 1XWKA 4G19A 2ZNMA 3IV4A 1A24A 4WBJA 1T3BA 5IPGA 3TJGA 2IN3A 3EURA 3TKRA 2K8VA 1IYHA 2CA8A 4MJBA 2M80A 2DKHA 3ZREA 3L78A 4MA9A 2VLTA 4OFTA 3RHCA 3P90A 3TJKA 1XOBA 2KOKA 4CDOA 2PMTA 3ZLPA 1XOAA 3HJPA 1S4BP 2X8HA 4ZB9A 2R0CA 1V58A 4J2FA 3CSIA 2OBKA 5ECOB 2LRCA 4IGJA 5AGYA 2H71A 1TI3A 3D0ZA 4IBPA 2GGTA 2ALBA 1A2JA 2GT6A 2P5QA 2VOCA 2TRCP 3BBYA 1DUGA 4EDZA 2VCXA 1EOGA 5HR0A 2F51A 2H19A 3FZAA 1NHYA 4XS4B 3HVSA 2C1YA 3M3MA 1JLVA 1GSDA 4TXVA 1ZYNA 3H8QA 2DMMA 1S3AA 1JZOA 1M0UA 4O92A 2YCDA 3L4NA 2GQMA 5DCGA 5GSTA 5C04A 2MMOA 4O7HA 1NM3A 1EV4A 2WW1A 2WFCA 4JR6A 2LTKA 4TR1A 3FEUA 5ECMB 4HZ4A 4ICYA 4ZL7A 4ZBBA 2I3YA 1XW5A 1BYEA 2VCZA 2CX3A 4OFNA 2O8VB 4N10A 2M72A 4POKA 4G9HA 3GH9A 5L71A 5C00A 3GKKA 1EZKA 3N5OA 2VD1A 3RPNA 4RUVA 1O6JA 4GQFA 14GSA 2JSYA 1SD9A 2HSNA 1Y1UA 4QMKA 2DLXA 4IKHA 3LYKA 5E4WA 1TK8B 1PL1A 4XS1A 1I5GA 4XCSA 4ZB7A 4IQ1A 2WW3A 3GHAA 4RQRA 1PA3A 5IM9A 2P5RA 1M2AA 1SK0A 1T4YA 2NTOA 1YKAA 1E6BA 2O87A 2H30A 5H5SA 3KH9A 1RW1A 4OCFA 3VWVA 4BPYA 3DWVA 5GSSA 3CHXC 5GZZB 2IWTA 1FG4A 2B5YA 3LWAA 4K5SA 3RBTA 4MJAA 3M8NA 1Z5YE 4CY6A 3D4MA 2O89A 1N8JA 5ECSA 2OBIA 2V6KA 2FNOA 2L57A 5J4YA 2FWFA 3FR3A 3TKQA 1SJ6A 4K8MA 5CRGA 5G1KA 1CQGA 2PVQA 1SK2A 2OACA 1MDIA 4YAVA 3GH6A 2WW0A 4XS6A 2JZSA 4AI6A 3APSA 1ABAA 1THOA 4JE1A 3MAKA 2HSYA 2HNLA 2H1DA 1XG8A 1GRXA 4ZB6A 2DJJA 2RM6A 1S3DA 3M9JA 1ERUA 2JU5A 2WGRA 3HJOA 2LV3A 2WVYA 2MBTA 3F63A 4J56E 3KP8A 2H75A 3U6VA 2C0FA 2EIRA 1T1VA 2H0IA 2VD0A 2LEGA 4NAXA 5D96A 1OYJA 2LJAA 1TRWA 2YV7A 1T00A 4PUAA 1GTBA 2C3NA 5G2ZA 3IE3A 3GNJA 4YKGA 2B1KA 4A5PA 5KOXA 1GTAA 4BVYA 4XRAA 4KF9A 1DBYA 3A5IA 4LMWA 5BMUB 4F0CA 4HU7A 4PX1A 2VM1A 2V41A 1XVQA 1K0BA 5JWRB 3QD9A 2OJLA 5ECLB 2JADA 6GSXA 3C7MA 1FW1A 4ZBDA 2YANA 2K18A 4ZILA 3Q6OA 4YQVA 2GTUA 3VI5A 4KB3A 2R0GA 1TOFA 6GSYA 4DEJA 3PGTA 3RGBC 2HT9A 3BJ5A 2IFQB 1USBA 4G01A 2H70A 4ULXA 1EGOA 2AUVA 4K9ZA 2IMDA 1XCCA 4ZXGA 2R4VA 5G5EA 2NDOA 2DIZA 4AJ8A 2DC5A 3DIEA 4HZ2A 2H76A 3EU3A 2VCVA 1GNWA 3IK7A 4ECIA 1MD4A 1GNEA 3G7YA 2HSMA 4HQSA 3A2VA 4G0IA 3FZ9A 3UL3A 1QK8A 3HHVA 1DE1A 4OD7A 2YN1A 2OADA 4YQUA 2TRXA 2WRTA 1FB6A 3KTLA 1U6TA 3VK9A 1XVWA 3ED3A 4BVXA 4GCIA 2QA2A 4IS0A 4WBRD 2PGTA 3R2QA 3VPQA 2I9HA 5CYYA 4ZIJA 2VLVA 2HYXA 1X5EA 3TJBA 4PQ1A 5CRWA 4OFMA 1B8XA 3GKNA 4G0KA 4WF4A 4XHMA 5KN3A 2FWEA 4X4JA 4Q5RA 1ZYPA 3PPUA 4AJ6A 4HSCX 3ERGA 5IO2A 4N0ZA 4JR4A 1MEKA 2GZYA 1TU7A 1SYXA 12GSA 3DXBA 4NWYA 2R6KA 5A4UA 5CRHA 5J4UA 4V2NA 3UVTA 2FUG2 1BG1A 1A0FA 3DGQA 2FD3A 1V40A 5EPFA 3UIWA 2ES7A 3FYGA 5ENUA 4MF5A 1O81A 1A2MA 4F03A 1SJIA 3HXSA 3NZNA 3LJRA 1GSYA 2HRFA 5F05A 3LEFA 1R7HA 2HSHA 3GL5A 3MWHA 3QFAC 1K0NA 1BQ7A 1SL2B 3VWXA 3E3EA 5JCWA 5BMUA 3A5WA 4POLA 1K0CA 1A2LA 1GUHA 1YQ1A 1TI1A 5GAND 4KDYA 1M2BA 1QQ2A 1OKDA 1TP9A 2H72A 3FZ4A 3WYWA 2V2GA 5ID2A 4MMMA 3MYDA 2NBSA 4PHZC 4GLTA 1GH2A 3EINA 4K7IA 1JZRA 1F6MC 5CRDA 2H6XA 3ZYWA 2DJ3A 3HZ8A 4TRXA 3EPTA 4N11A 2H8LA 2FA8A 4GQCA 4RQXA 2C0GA 5EL8A 5F8BA 2V1MA 2C0EA 5G1LA 3QPMA 4KCAA 2F9SA 3CRUA 3LFLA 5E59A 2O5VA 3S9FA 2VIMA 3ME8A 1WPIA 3UOMA 2O36A 2A4HA 2KLXA 3C1SA 1OE8A 2VO4A 4TR1B 4I5QA 1TKDB 3P7XA 1K0OA 4N3ZA 4J57E 2WULA 3WT1A 2B5EA 3EC3A 4K5RA 4HJMA 5A34A 5DAKA 1T8EB 2PBJA 3TDGA 2CVDA 5B6MA 3QR6A 4E8EA 4L0UA 1O85A 2HSNB 2WZ9A 2E2MA 2HRKA 2H6YA 4XTSA 1K3YA 3G9BA 4MK3A 2GQKA 18GSA 1Z6NA 1V2AA 4EO3A 4EXJA 2VKZG 3LORA 3KGKA 4YKFA 2BMXA 1KNGA 2I81A 4Q5QA 4EF0A 4DVCA 4MF6A 1QXHA 1Z7PA 3ZZXA 1AQXA 5D9WA 3G7JA 5H5RA 1ZGNA 2HI7A 3TKPA 5H5QA 1ML6A 4LMVA 3FW2A 1G7EA 1TXXA 2WCIA 3OR5A 3I9V2 2H1AA 2F8AA 4IW9A 1UVZA 2C3TA 1GSSA 3D6IA 1U3IA 2GQLA 4HDEA 2IMFA 4DSSA 1M3IA 4X0XA 1MTCA 5CO3A 1A8YA 1SKSB 5JWQB 2GSRA 3ZIJA 4POMA 4JEDA 2LJKA 4NMUA 2OT3A 4DSQA 1K3LA 4LLRA 5G5FA 4MZCA 1XWGA 3W6GA 4KH7A 3DVXA 4QL7A 3M1GA 4LL4B 2LNSA 4F82A 1NW2A 1WOUA 2VUPA 1TK5B 2X99A 3IBHA 2YZUA 1TW9A 2JZRA 1HNAA 3FK8A 4EKZA 2UZ8A 4BIKA 1SL1B 1V98A 4I2UA 4BA7A 1VGLA 2HZFA 3HY2A 3FRCA 3EE2A 4OCEA 2H0GA 2H6ZA 3RHBA 2CX4A 3CSJA 1Z6MA 4BVYB 2WVZA 3FY7A 5INYA 2DSAA 4IP1A 2UV8G 5ABRA 3N9JA 3CRTA 2VM2A 1SENA 1R4WA 4HU9A 1ZZYA 3UJ1A 2MBSA 5ECQB 5FWGA 1SKWB 4KE3A 1RQMA 2BJXA 4WR4A 1GUKA 3L0HA 1XZOA 1ON4A 1SVMA 1JLWA 4POBA 2L5OA 2B7KA 4NHWA 1WWJA 2X64A 3GA4A 3F4RA 3GX0A 3IR4A 3W8SA 4TR4A 1HYUA 3VWWA 1FAAA 5A4WA 1YF0A 1X9MB 3BD2A 1LJRA 1SD8A 3LGCA 4KA0A 3GUSA 1B4QA 3GURA 2LRNA 3HMJG 3RPPA 1TTZA 3ZIVA 4MH2A 3VI7A 2WB9A 3HA9A 4PNFA 5B8BA 2WVXA 2OKAA 1IYIA 4EDYA 1A0RP 2EFEA 2GLRA 3M9KA 1SJZA 2CV4A 2HSMB 4GSSA 4MZWA 1ZOFA 10GSA 1R5PA 3GSSA 1OAZA 4HJ2A 5ECKB 1DSBA 3C73A 3DVWA 2BTOT 4EUYA 4AF2A 2C3QA 5J47A 3HZ4A 4EIPA 2F8FA 3WT2A 4BVXB 3HVVA 3EMPA 1XW6A 3KMNA 4GTUA 3L9UA 3L9SA 2LNTA 3APQA 2K8SA 3QOUA 1TJDA 3DMLA 1AQWA 3WGEA 3SWLA 1FVJA 4EVMA 2IMIA 3CTGA 1FOVA 2DJKA 2DMLA 1K0AA 3MDKA 4TR0A 3MIXA 2FLSA 5AIXA 3F4TA 3DD3A 2IIYA 1LU4A 3GFKA 4FYBA 1U88A 4K6XA 5D73A 1YZXA 1ZL9A 2LRTA 1HQOA 4KCEA 1PX6A 3CQFA 5J9CA 1JHBA 1AW9A 4K0NA 3EYTA 3Q74A 1U87A 3HKRA 2AHEA 1V9WA 4WKWA 2D2ZA 1Z7RA 2WJUA 1KTEA 1OC9A 3IA1A 3VWUA 3ZMLA 5EY6A 1R26A 2YWNA 5DJMA 3RDWA 2V32A 5A1NA 2DJ1A 2LS5A 5DALA 5D93A 4JRRA 5J3RA 3KP9A 1GP1A 4TW5A 4PURA 1NHOA 4PUFC 3TJJA 3KTBA 2QC7A 3IHQA 4NPBA 1G6YA 2GSQA 3HCZA 4LL1B 2LQQA 1PGTA 4Z2TA 4I97A 3KMOA 1WP0A 4XIHA 1TRSA 1YVLA 2GDRA 4FIWA 4IJ3A 5ID2B 2V6OA 2VCWA 2VCTA 1MDKA 4YQMA 4FQUA 2LSTA 1BJXA 4ZBAA 5ECRB 5D9TA 4GDFA 3CSHA 2ON7A 3ZVJA 3QAVA 1M2DA 2MMNA 5LD0A 3D22A 3LSZA 2TIRA 2H74A 5DCHA 3TUEA 1GTIA 1O73A 2MMZA 2HZEA 1EP8A 4K1FA 3QFBC 2CT6A 3KD0A 4JBBA 1ACVA 4LA1A 1A8LA 3V1WA 1GL8A 1PFOA 2RUEA 5B8AA 3TOUA 3UBLA 4HUAA 3KZQA 4IVFA 4PNGA 4F0BA 3ERWA 4IELA 2OE3A 2REMA 4JZQA 1F3AA 3ZVJD 3EU4A 5D8IA 1ERTA 1ST9A 3HYPA 5FHIA 1FHEA 2DJ0A 2ZUPA 4NV5A 5A34B 1PN0A 3GSTA 5DAKB 3VLNA 2ZCTA 3LYPA 2WZSA 1R5AA 1WE0A 2E7PA 1EV9A 2Z9SA 1XWBA 2HRKB 4ISDA 4WEYA 3IDVA 3LG6A 2R5GA 1B9YC 3RFRC 1QMVA 4HEA2 3TOTA 3QMXA 2XPEA 3VPTA 5EVOA 2HRAA 3F3QA 1URMA 8GSSA 2AAWA 4ACSA 5DVBA 5KN2A 5AN1A 2RM5A 1LBKA 3HDCA 4AKXB 4V1Ap 3D5JA 2FA4A 1OC3A 1M3JA 4EE0A 2IMEA 1F3BA 1GSFA 2HE3A 3IRAA 2DJ2A 2HRNA 3C1RA 1OVNA 1M9BA 4I8BA 1YKCA 1H4OA 2R37A 3HJMA 1X9WB 3PR8A 3QAGA 1XWAA 4DSSB 1X9SB 2O85A 2VL2A 1QGVA 4HOJA 2FGXA 1K0MA 3UMAA 1AIUA 1FB0A 4O5RA 1T7PB 1SK1A 1PSQA 1AUCA 1YF1A 3BCIA 2G0FA 1BX9A 4JU5A 4PI0C 2FCHA 2VL9A 3TU3B 2AYTA 2MYGA 3GX8A 1JZWA 3UARA 3A2WA 5DDLA 3J7Yk 2PN8A 2G2QA 3IC8A 4PGTA 3W8JA 1YEPA 3F6DA 1MD3A 2B7JA 4E68A 2YV9A 4RI7A 3TKSE 1VF3A 1K3OA 2A2SA 4NXIA 1THXA 4IJIA 1X5CA 1ZYEA 5IMCA 3GMFA 3O76A 3KJYA 5FT3A 1QFNA 3E9JB 1BF5A 2DIYA 5IMFA 1H75A 3KIJA 1YEWC 2OE1A 1YDKA 1YY7A 1K0DA 5J9BA 1XW9A 5IPHA 1AC1A 5CAXA 1FVKA 2EFDA 2XPDA 2AB6A 2VAFA 3HVNA 1I9DA 4ILFA 3ZMKA 5IMDA 1B4PA 3Q18A 4K7NA 2NPBA 2J9HA 4L0WA 3G7IA 3IHGA 4Q5NA 4CY8A 3WD6A 5ECNB 2B1LA 5ECPB 3VURA 1VF4A 3H1NA 5B7CA 3F8UA 6GSWA 1Q98A 3GYKA 4AGSA 4MPGA 2WVXB 3CBUA 1WRYA 3IAM2 4PXOA 4EC0A 4ECBA 4RI6A 2DKIA 5B6NA 4OWYA 1GLPA 4O5QA 5A5KA 1ZCPA 2R2JA 3H79A 1B9XC 2VCQA 4GSTA 3CWGA 4I2TA 1W4VA 4TXOA 1TK0B 2IL3A 3C71A 2PU9C 1GWCA 1TRUA 2QSIA 4AJ7A 2C80A 2A2PA 2YJHA 19GSA 1ERWA 4ML1A 4WF5A 5GAPD 2FY6A 1PQNA 2B3SA 4O32A 4K7OA 2XC2A 4MJCA 2RIIA 4IQAA 4KUNA 1M9AA 1N2AA 4MPFA 2IPAA 4KW6A 1A23A 4ECJA 4TN8A 2KHPA 3H4KA 3D21A 5G30A 5ECIB 5HFGA 1ZMAA 3ISOA 3NOFA 1GSQA 1CQHA 1PMTA 2E0QA
chains in the Genus database with same CATH topology
1GSEA 5JCGA 4TVEA 4Z2UA 5A5HA 1RK4A 3GTUA 5HR3A 4N30A 2FWHA 5IO0A 3TRXA 2I1UA 1Z9HA 1SVLA 3DYRA 4X43A 4ECCA 1OC9B 3LW9A 2MZCA 2EIOA 1OE7A 1O8WA 1X0RA 1TRVA 5A1NB 2WS2A 1BEDA 2GS3A 2CVBA 5DALB 1TU8A 2YJ7A 4IN0A 1SKRB 2RLIA 2HXKA 2KP2A 6GSSA 1XIYA 3EWLA 1PX7A 1Y6EA 4O5UA 1U3AA 4GWRA 2C0DA 3F4SA 4MABA 1E2YA 4FYCA 3KXOA 1DE2A 2PVOC 4GSNA 4E8HA 1O8XA 1JZDA 4KSMA 3TCOA 4MF7A 3IOSA 2HZEB 3HVXA 3IC4A 1QUWA 4D73A 3R3EA 2EFCA 5F07A 2YWMA 3APOA 2FWGA 16GSA 2JACA 3F9UA 1SL0B 1AAZA 1NSWA 4GF0A 3FMWA 4BL7A 1EEMA 2LKUA 2M46A 2PUKC 5ELAA 3UAPA 1F37A 5ELGA 5AIVA 1HNBA 4ZL8A 1PD21 3DKSA 4EIQA 3M0FA 1J0FA 2CQ9A 2X49A 4OO5A 1KBNA 3FHKA 4FYUA 1ILOA 3U5RE 3C8EA 3TJFA 5KEJA 1WMJA 2GT5A 3FKFA 3PINA 1SVOA 3BOAA 2H66A 3IXRA 4HI7A 2XHFA 3LXTA 1C72A 4GXZA 1KEBA 2YWIA 4L5LA 2HQTA 5IMZA 1SYRA 5IQYA 1GUMA 2A4VA 3LXZA 5J4VA 1N25A 5A4VA 20GSA 5COHA 4MDCA 3HD5A 5CNWA 4BWSA 4WR5A 3BCKA 4MNNA 4ML6A 3ZRDA 1J08A 4L5OA 4ID0A 3TRPA 3P2AA 4TOPA 3WGDA 3CMIA 5CP1A 4Q5FA 4PQHA 2IJYA 4XRDA 2X8CA 5HR2A 1EP7A 4OMVA 4ZB8A 4MH3A 1G7OA 1FO5A 3LQ7A 1ERVA 2CVKA 4XS4A 4F9ZA 5LNKe 17GSA 2L6CA 3ZTLA 4F2IA 2L4QA 5D9VA 1BG5A 1F2EA 2IMKA 3H93A 4K2XA 3FR9A 1PKZA 4V2LA 2N5FA 3WGXA 6GSUA 4GRFA 4QL9A 1EOHA 1YJ6A 1OC8A 5LCZA 3E0UA 4YAPA 1AQVA 4Z7XA 2R3XA 4FH8A 3CTFA 2YP6A 2XBIA 3D4TA 3O3TA 2HLSA 3KM6A 5J5NA 4N0VA 4YH2A 2N5BA 1AXDA 4P3YB 2YNXA 2I4AA 4MJEA 3EMXA 4G10A 1BAYA 3ZITA 5J41A 5DQYA 5HFIA 2L6DA 11GSA 3VFIA 1UN2A 4AKHA 4Z2RA 5G31A 2LQOA 3GIXA 5DBQA 3F3RA 3A3TA 4NHZA 1Q4JA 1VF1A 2H01A 2HFDA 2VLUA 3ERFA 2C4JA 5IMAA 3KCMA 2LJRA 3MNGA 5DJLA 4BWQA 2PPTA 2GZPA 3Q19A 5F0GA 3KEBA 3I69A 2H1LA 4PQIA 4MP4A 2KP1A 2OA7A 1HNCA 4WETA 5BRTA 1GTUA 4V1Ag 3DEXA 1PRXA 3F0IA 4I6XA 3GKMA 6GSVA 3SBCA 5DQSA 2GVPA 2F3MA 5KN1A 2H1GA 2B6MA 3MSZA 1XBSA 1FOHA 1TXUA 2B5XA 3K8NA 13GSA 2LUSA 1EEJA 3ZFBA 2L5LA 22GSA 3ZFLA 4TR3A 2JL4A 2VL2C 4TXOB 4CW9A 3QAWA 4PTSA 5F06A 3CXGA 1Y25A 4KDXA 1XFLA 3IK9A 5HR1A 3UVHA 4MZBA 5KN0A 1G0TA 3IAS2 2O7KA 1OKTA 4V2MA 2ON5A 4G0LA 1V57A 3F6FA 2WDUA 1VF2A 4K0GA 3ME7A 2R0PA 4HQZA 3JCML 3AY8A 1EGRA 7GSSA 2E2GA 1YEXA 5IOXA 2EFHA 1EWXA 5HQPA 2CZ2A 3TB2A 3KH7A 3DRNA 2A2RA 3QCPA 2JZTA 4OO4A 2AJQB 5ECHB 5IOWA 4HS1A 3J7Yb 2EIQA 5AISA 1GULA 2X4AA 1UA5A 2CAQA 1M99A 4IP6A 3A2XA 6GSTA 1UC7A 5IIZA 2H1BA 2H0HA 5A5HB 3GTUB 5JCUA 2PERA 4KX4A 3I6AA 5JWOB 2QA1A 4KAEA 2IFQA 3UEMA 1GLQA 3QDNA 4IHUA 3RAZA 3TKSC 2EC4A 4USSA 2H73A 1XXUA 3L9VA 2X8GA 1F9MA 4KSOA 1Z3EA 5J40A 2L4CA 1TDIA 5CREA 4KGIA 1X5DA 2DBCA 2YOIA 1B48A 1S3CA 1PL2A 2P31A 1T4ZA 4G2EA 3TKSA 1G6WA 4NV2A 2VL3A 3TRQA 3GL3A 2P0GA 1XWCA 2GSSA 4MLYA 4K2DA 2CZ3A 5KOWA 4W66A 2C8UA 1J9BA 3GKXA 4CHSA 4H86A 1W89A 2L59A 1ZYQB 2QGVA 2KUCA 1GSUA 2QKEA 4FO5A 4WXTA 3P8WA 2YWOA 2FHEA 4MCUA 2JSZA 2K6VA 3I43A 2GSTA 3GRXA 4D73B 3GV1A 1WJKA 1M7TA 1XPVA 3ZL5A 1VRSD 3O6TA 2J23A 4X1UA 1WIKA 3TGZA 3US3A 2OE0A 9GSSA 4BL7B 3GN3A 2AV4A 3NIVA 4L8EA 5D9XA 3FZ5A 2GZZA 2N5AA 2RUFA 2CAIA 1JFUA 3CYNA 3PH9A 4KDUA 4TKYA 1O7UA 3EVIA 4EL1A 2YPMA 1SU9A 1MDJA 5HFKA 2XBQA 3IPZA 1PN9A 4AKIA 1HD2A 1PKWA 3FR6A 2YZHA 2MMAA 2PWJA 4DSRA 4QQ7A 3UBKA 4AKGA 4ZL9A 2K9FA 4KNDA 5IMVA 2NVLA 1XWKA 4G19A 2ZNMA 3IV4A 1A24A 4WBJA 1T3BA 5IPGA 3TJGA 2IN3A 3EURA 3TKRA 2K8VA 1IYHA 2CA8A 4MJBA 2M80A 2DKHA 3ZREA 3L78A 4MA9A 2VLTA 4OFTA 3RHCA 3P90A 3TJKA 1XOBA 2KOKA 4CDOA 2PMTA 3ZLPA 1XOAA 3HJPA 2X8HA 4ZB9A 2R0CA 1V58A 4J2FA 3CSIA 2OBKA 5ECOB 2LRCA 4IGJA 5AGYA 2H71A 1TI3A 3D0ZA 4IBPA 2GGTA 2ALBA 1A2JA 2GT6A 2P5QA 2VOCA 2TRCP 3BBYA 1DUGA 4EDZA 2VCXA 1EOGA 5HR0A 2F51A 2H19A 3FZAA 1NHYA 4XS4B 3HVSA 2C1YA 3M3MA 1JLVA 1GSDA 4TXVA 1ZYNA 3H8QA 2DMMA 1S3AA 1JZOA 1M0UA 4O92A 2YCDA 3L4NA 2GQMA 5DCGA 5GSTA 5C04A 2MMOA 4O7HA 1NM3A 1EV4A 2WFCA 4JR6A 2LTKA 4TR1A 3FEUA 5ECMB 4HZ4A 4ICYA 4ZL7A 4ZBBA 2I3YA 1XW5A 1BYEA 2VCZA 2CX3A 4OFNA 2O8VB 4N10A 2M72A 4POKA 4G9HA 3GH9A 5L71A 5C00A 3GKKA 1EZKA 3N5OA 2VD1A 3RPNA 4RUVA 1O6JA 4GQFA 14GSA 2JSYA 1SD9A 2HSNA 1Y1UA 4QMKA 2DLXA 4IKHA 3LYKA 5E4WA 1TK8B 1PL1A 4XS1A 1I5GA 4XCSA 4ZB7A 4IQ1A 3GHAA 4RQRA 1PA3A 5IM9A 2P5RA 1M2AA 1SK0A 1T4YA 2NTOA 1YKAA 1E6BA 2O87A 2H30A 5H5SA 3KH9A 1RW1A 4OCFA 3VWVA 4BPYA 3DWVA 5GSSA 5GZZB 2IWTA 1FG4A 2B5YA 3LWAA 4K5SA 3RBTA 4MJAA 3M8NA 1Z5YE 4CY6A 3D4MA 2O89A 1N8JA 5ECSA 2OBIA 2V6KA 2FNOA 2L57A 5J4YA 2FWFA 3FR3A 3TKQA 1SJ6A 4K8MA 5CRGA 5G1KA 1CQGA 2PVQA 1SK2A 2OACA 1MDIA 4YAVA 3GH6A 4XS6A 2JZSA 4AI6A 3APSA 1ABAA 1THOA 4JE1A 3MAKA 2HSYA 2HNLA 2H1DA 1GRXA 4ZB6A 2DJJA 2RM6A 1S3DA 3M9JA 1ERUA 2JU5A 2WGRA 3HJOA 2LV3A 2MBTA 3F63A 4J56E 3KP8A 2H75A 3U6VA 2C0FA 2EIRA 1T1VA 2H0IA 2VD0A 2LEGA 4NAXA 5D96A 1OYJA 2LJAA 1TRWA 2YV7A 1T00A 4PUAA 1GTBA 2C3NA 5G2ZA 3IE3A 3GNJA 4YKGA 2B1KA 4A5PA 5KOXA 1GTAA 4BVYA 4XRAA 4KF9A 1DBYA 3A5IA 4LMWA 5BMUB 4F0CA 4HU7A 4PX1A 2VM1A 2V41A 1XVQA 1K0BA 5JWRB 3QD9A 2OJLA 5ECLB 2JADA 6GSXA 3C7MA 1FW1A 4ZBDA 2YANA 2K18A 4ZILA 3Q6OA 4YQVA 2GTUA 3VI5A 4KB3A 2R0GA 1TOFA 6GSYA 4DEJA 3PGTA 2HT9A 3BJ5A 2IFQB 1USBA 4G01A 2H70A 4ULXA 1EGOA 2AUVA 4K9ZA 2IMDA 1XCCA 4ZXGA 2R4VA 5G5EA 2NDOA 2DIZA 4AJ8A 2DC5A 3DIEA 4HZ2A 2H76A 3EU3A 2VCVA 1GNWA 3IK7A 4ECIA 1MD4A 1GNEA 3G7YA 2HSMA 4HQSA 3A2VA 4G0IA 3FZ9A 3UL3A 1QK8A 3HHVA 1DE1A 4OD7A 2YN1A 2OADA 4YQUA 2TRXA 2WRTA 1FB6A 3KTLA 1U6TA 3VK9A 1XVWA 3ED3A 4BVXA 4GCIA 2QA2A 4IS0A 4WBRD 2PGTA 3R2QA 3VPQA 2I9HA 5CYYA 4ZIJA 2VLVA 2HYXA 1X5EA 3TJBA 4PQ1A 5CRWA 4OFMA 1B8XA 3GKNA 4G0KA 4WF4A 4XHMA 5KN3A 2FWEA 4X4JA 4Q5RA 1ZYPA 3PPUA 4AJ6A 3ERGA 5IO2A 4N0ZA 4JR4A 1MEKA 2GZYA 1TU7A 1SYXA 12GSA 3DXBA 4NWYA 2R6KA 5A4UA 5CRHA 5J4UA 4V2NA 3UVTA 2FUG2 1BG1A 1A0FA 3DGQA 2FD3A 1V40A 5EPFA 3UIWA 2ES7A 3FYGA 5ENUA 4MF5A 1O81A 1A2MA 4F03A 1SJIA 3HXSA 3NZNA 3LJRA 1GSYA 2HRFA 5F05A 3LEFA 1R7HA 2HSHA 3GL5A 3MWHA 3QFAC 1K0NA 1BQ7A 1SL2B 3VWXA 3E3EA 5JCWA 5BMUA 3A5WA 4POLA 1K0CA 1A2LA 1GUHA 1YQ1A 1TI1A 5GAND 4KDYA 1M2BA 1QQ2A 1OKDA 1TP9A 2H72A 3FZ4A 3WYWA 2V2GA 5ID2A 4MMMA 3MYDA 2NBSA 4GLTA 1GH2A 3EINA 4K7IA 1JZRA 1F6MC 5CRDA 2H6XA 3ZYWA 2DJ3A 3HZ8A 4TRXA 3EPTA 4N11A 2H8LA 2FA8A 4GQCA 4RQXA 2C0GA 5EL8A 5F8BA 2V1MA 2C0EA 5G1LA 3QPMA 4KCAA 2F9SA 3CRUA 3LFLA 5E59A 2O5VA 3S9FA 2VIMA 3ME8A 1WPIA 3UOMA 2A4HA 3C1SA 2KLXA 1OE8A 2VO4A 4TR1B 4I5QA 1TKDB 3P7XA 1K0OA 4N3ZA 4J57E 2WULA 3WT1A 2B5EA 3EC3A 4K5RA 4HJMA 5A34A 5DAKA 1T8EB 2PBJA 3TDGA 2CVDA 5B6MA 3QR6A 4E8EA 4L0UA 1O85A 2HSNB 2WZ9A 2E2MA 2HRKA 2H6YA 4XTSA 1K3YA 3G9BA 4MK3A 2GQKA 18GSA 1Z6NA 1V2AA 4EO3A 4EXJA 2VKZG 3LORA 3KGKA 4YKFA 2BMXA 1KNGA 2I81A 4Q5QA 4EF0A 4DVCA 4MF6A 1QXHA 1Z7PA 3ZZXA 1AQXA 5D9WA 3G7JA 5H5RA 1ZGNA 2HI7A 3TKPA 5H5QA 1ML6A 4LMVA 3FW2A 1G7EA 1TXXA 2WCIA 3OR5A 3I9V2 2H1AA 2F8AA 4IW9A 1UVZA 2C3TA 1GSSA 3D6IA 1U3IA 2GQLA 4HDEA 2IMFA 4DSSA 4X0XA 1MTCA 5CO3A 1A8YA 1SKSB 5JWQB 2GSRA 3ZIJA 4POMA 4JEDA 2LJKA 4NMUA 2OT3A 4DSQA 1K3LA 4LLRA 5G5FA 4MZCA 1XWGA 3W6GA 4KH7A 3DVXA 4QL7A 3M1GA 4LL4B 2LNSA 4F82A 1NW2A 1WOUA 2VUPA 1TK5B 2X99A 3IBHA 2YZUA 1TW9A 2JZRA 1HNAA 3FK8A 4EKZA 2UZ8A 1SL1B 1V98A 4I2UA 4BA7A 1VGLA 2HZFA 3HY2A 3FRCA 3EE2A 4OCEA 2H0GA 2H6ZA 3RHBA 2CX4A 3CSJA 1Z6MA 4BVYB 3FY7A 5INYA 2DSAA 4IP1A 2UV8G 5ABRA 3N9JA 3CRTA 2VM2A 1SENA 1R4WA 4HU9A 1ZZYA 3UJ1A 2MBSA 5ECQB 5FWGA 1SKWB 4KE3A 1RQMA 2BJXA 4WR4A 1GUKA 3L0HA 1XZOA 1ON4A 1SVMA 1JLWA 4POBA 2L5OA 2B7KA 4NHWA 1WWJA 2X64A 3GA4A 3F4RA 3GX0A 3IR4A 3W8SA 4TR4A 1HYUA 3VWWA 1FAAA 5A4WA 1YF0A 1X9MB 3BD2A 1LJRA 1SD8A 3LGCA 4KA0A 3GUSA 1B4QA 3GURA 2LRNA 3HMJG 3RPPA 1TTZA 3ZIVA 4MH2A 3VI7A 2WB9A 3HA9A 4PNFA 5B8BA 2OKAA 1IYIA 4EDYA 1A0RP 2EFEA 2GLRA 3M9KA 1SJZA 2CV4A 2HSMB 4GSSA 4MZWA 1ZOFA 10GSA 1R5PA 3GSSA 1OAZA 4HJ2A 5ECKB 1DSBA 3C73A 3DVWA 2BTOT 4EUYA 4AF2A 2C3QA 5J47A 3HZ4A 4EIPA 2F8FA 3WT2A 4BVXB 3HVVA 3EMPA 1XW6A 3KMNA 4GTUA 3L9UA 3L9SA 2LNTA 3APQA 2K8SA 3QOUA 1TJDA 3DMLA 1AQWA 3WGEA 3SWLA 1FVJA 4EVMA 2IMIA 3CTGA 1FOVA 2DJKA 2DMLA 1K0AA 3MDKA 4TR0A 3MIXA 2FLSA 5AIXA 3F4TA 3DD3A 2IIYA 1LU4A 3GFKA 4FYBA 1U88A 4K6XA 5D73A 1YZXA 1ZL9A 2LRTA 1HQOA 4KCEA 1PX6A 5J9CA 1JHBA 1AW9A 4K0NA 3EYTA 3Q74A 1U87A 3HKRA 2AHEA 1V9WA 4WKWA 2D2ZA 1Z7RA 2WJUA 1KTEA 1OC9A 3IA1A 3VWUA 3ZMLA 5EY6A 1R26A 2YWNA 5DJMA 3RDWA 2V32A 5A1NA 2DJ1A 2LS5A 5DALA 5D93A 4JRRA 5J3RA 3KP9A 1GP1A 4TW5A 4PURA 1NHOA 4PUFC 3TJJA 3KTBA 2QC7A 3IHQA 4NPBA 1G6YA 2GSQA 3HCZA 4LL1B 2LQQA 1PGTA 4Z2TA 4I97A 3KMOA 1WP0A 4XIHA 1TRSA 1YVLA 2GDRA 4FIWA 4IJ3A 5ID2B 2V6OA 2VCWA 2VCTA 1MDKA 4YQMA 4FQUA 2LSTA 1BJXA 4ZBAA 5ECRB 5D9TA 4GDFA 3CSHA 2ON7A 3ZVJA 3QAVA 1M2DA 2MMNA 5LD0A 3D22A 3LSZA 2TIRA 2H74A 5DCHA 3TUEA 1GTIA 1O73A 2MMZA 2HZEA 1EP8A 4K1FA 3QFBC 2CT6A 3KD0A 4JBBA 1ACVA 4LA1A 1A8LA 3V1WA 1GL8A 2RUEA 5B8AA 3TOUA 3UBLA 4HUAA 3KZQA 4IVFA 4PNGA 4F0BA 3ERWA 4IELA 2OE3A 2REMA 4JZQA 1F3AA 3ZVJD 3EU4A 5D8IA 1ERTA 1ST9A 3HYPA 5FHIA 1FHEA 2DJ0A 2ZUPA 4NV5A 5A34B 1PN0A 3GSTA 5DAKB 3VLNA 2ZCTA 3LYPA 1R5AA 1WE0A 2E7PA 1EV9A 2Z9SA 1XWBA 2HRKB 4ISDA 4WEYA 3IDVA 3LG6A 2R5GA 1B9YC 1QMVA 4HEA2 3TOTA 3QMXA 2XPEA 3VPTA 5EVOA 2HRAA 3F3QA 1URMA 8GSSA 2AAWA 4ACSA 5DVBA 5KN2A 5AN1A 2RM5A 1LBKA 3HDCA 4AKXB 4V1Ap 3D5JA 2FA4A 1OC3A 4EE0A 2IMEA 1F3BA 1GSFA 2HE3A 3IRAA 2DJ2A 2HRNA 3C1RA 1OVNA 1M9BA 4I8BA 1YKCA 1H4OA 2R37A 3HJMA 1X9WB 3PR8A 3QAGA 1XWAA 4DSSB 1X9SB 2O85A 2VL2A 1QGVA 4HOJA 2FGXA 1K0MA 3UMAA 1AIUA 1FB0A 4O5RA 1T7PB 1SK1A 1PSQA 1AUCA 1YF1A 3BCIA 2G0FA 1BX9A 4JU5A 2FCHA 2VL9A 3TU3B 2AYTA 2MYGA 3GX8A 1JZWA 3UARA 3A2WA 5DDLA 3J7Yk 2PN8A 2G2QA 3IC8A 4PGTA 3W8JA 1YEPA 3F6DA 1MD3A 2B7JA 4E68A 2YV9A 4RI7A 3TKSE 1VF3A 1K3OA 2A2SA 4NXIA 1THXA 4IJIA 1X5CA 1ZYEA 5IMCA 3GMFA 3O76A 3KJYA 5FT3A 1QFNA 3E9JB 1BF5A 2DIYA 5IMFA 1H75A 3KIJA 2OE1A 1YDKA 1YY7A 1K0DA 5J9BA 1XW9A 5IPHA 1AC1A 5CAXA 1FVKA 2EFDA 2XPDA 2AB6A 2VAFA 1I9DA 4ILFA 3ZMKA 5IMDA 1B4PA 3Q18A 4K7NA 2NPBA 2J9HA 4L0WA 3G7IA 3IHGA 4Q5NA 4CY8A 3WD6A 5ECNB 2B1LA 5ECPB 3VURA 1VF4A 3H1NA 5B7CA 3F8UA 6GSWA 1Q98A 3GYKA 4AGSA 4MPGA 3CBUA 1WRYA 3IAM2 4PXOA 4EC0A 4ECBA 4RI6A 2DKIA 5B6NA 4OWYA 1GLPA 4O5QA 5A5KA 1ZCPA 2R2JA 3H79A 1B9XC 2VCQA 4GSTA 3CWGA 4I2TA 1W4VA 4TXOA 1TK0B 2IL3A 3C71A 2PU9C 1GWCA 1TRUA 2QSIA 4AJ7A 2C80A 2A2PA 2YJHA 19GSA 1ERWA 4ML1A 4WF5A 5GAPD 2FY6A 1PQNA 2B3SA 4O32A 4K7OA 2XC2A 4MJCA 2RIIA 4IQAA 4KUNA 1M9AA 1N2AA 4MPFA 2IPAA 4KW6A 1A23A 4ECJA 4TN8A 2KHPA 3H4KA 3D21A 5G30A 5ECIB 5HFGA 1ZMAA 3ISOA 3NOFA 1GSQA 1CQHA 1PMTA 2E0QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GSE A;  5JCG A;  4TVE A;  1RK4 A;  3GTU A;  5HR3 A;  4N30 A;  2FWH A;  5IO0 A;  3TRX A;  2I1U A;  1Z9H A;  3DYR A;  4X43 A;  4ECC A;  1OC9 B;  2MZC A;  2EIO A;  1OE7 A;  1O8W A;  1X0R A;  1TRV A;  2WS2 A;  1BED A;  2GS3 A;  2CVB A;  5DAL B;  1TU8 A;  2YJ7 A;  4IN0 A;  1SKR B;  2RLI A;  2HXK A;  2KP2 A;  6GSS A;  1XIY A;  3EWL A;  1PX7 A;  1Y6E A;  1U3A A;  4GWR A;  2C0D A;  3F4S A;  4MAB A;  1E2Y A;  4FYC A;  3KXO A;  1DE2 A;  2PVO C;  4GSN A;  4E8H A;  1O8X A;  1JZD A;  4KSM A;  3TCO A;  4MF7 A;  3IOS A;  2HZE B;  3HVX A;  3IC4 A;  1QUW A;  4D73 A;  3R3E A;  5F07 A;  2YWM A;  3APO A;  2FWG A;  16GS A;  2JAC A;  3F9U A;  1SL0 B;  1AAZ A;  1NSW A;  4GF0 A;  4BL7 A;  1EEM A;  2LKU A;  2M46 A;  2PUK C;  5ELA A;  3UAP A;  1F37 A;  5ELG A;  5AIV A;  1HNB A;  4ZL8 A;  1PD2 1;  3DKS A;  3M0F A;  1J0F A;  2CQ9 A;  4OO5 A;  1KBN A;  3FHK A;  4FYU A;  1ILO A;  3U5R E;  3C8E A;  3TJF A;  5KEJ A;  1WMJ A;  2GT5 A;  3FKF A;  3PIN A;  3BOA A;  2H66 A;  3IXR A;  4HI7 A;  2XHF A;  3LXT A;  1C72 A;  4GXZ A;  1KEB A;  2YWI A;  4L5L A;  2HQT A;  5IMZ A;  1SYR A;  5IQY A;  1GUM A;  2A4V A;  3LXZ A;  5A4V A;  20GS A;  5COH A;  4MDC A;  3HD5 A;  5CNW A;  4BWS A;  4WR5 A;  3BCK A;  4ML6 A;  3ZRD A;  1J08 A;  4L5O A;  4ID0 A;  3TRP A;  3P2A A;  4TOP A;  3WGD A;  3CMI A;  5CP1 A;  4Q5F A;  4PQH A;  2IJY A;  4XRD A;  2X8C A;  5HR2 A;  1EP7 A;  4OMV A;  4ZB8 A;  4MH3 A;  1G7O A;  1FO5 A;  3LQ7 A;  1ERV A;  2CVK A;  4XS4 A;  4F9Z A;  5LNK e;  17GS A;  2L6C A;  3ZTL A;  4F2I A;  2L4Q A;  5D9V A;  1BG5 A;  1F2E A;  2IMK A;  3H93 A;  3FR9 A;  1PKZ A;  4V2L A;  2N5F A;  3WGX A;  6GSU A;  4GRF A;  4QL9 A;  1EOH A;  1YJ6 A;  1OC8 A;  5LCZ A;  3E0U A;  4YAP A;  1AQV A;  4Z7X A;  2R3X A;  4FH8 A;  3CTF A;  2YP6 A;  2XBI A;  3D4T A;  3O3T A;  2HLS A;  3KM6 A;  5J5N A;  4N0V A;  4YH2 A;  2N5B A;  1AXD A;  4P3Y B;  2YNX A;  2I4A A;  4MJE A;  3EMX A;  4G10 A;  1BAY A;  3ZIT A;  5J41 A;  5DQY A;  5HFI A;  2L6D A;  11GS A;  3VFI A;  1UN2 A;  5G31 A;  2LQO A;  3GIX A;  5DBQ A;  3F3R A;  3A3T A;  4NHZ A;  1Q4J A;  1VF1 A;  2H01 A;  2HFD A;  2VLU A;  3ERF A;  2C4J A;  5IMA A;  3KCM A;  2LJR A;  3MNG A;  5DJL A;  4BWQ A;  2PPT A;  2GZP A;  3Q19 A;  5F0G A;  3KEB A;  3I69 A;  4PQI A;  4MP4 A;  2KP1 A;  2OA7 A;  1HNC A;  4WET A;  1GTU A;  4V1A g;  3DEX A;  1PRX A;  3F0I A;  4I6X A;  3GKM A;  6GSV A;  3SBC A;  5DQS A;  2GVP A;  2F3M A;  5KN1 A;  2H1G A;  2B6M A;  3MSZ A;  1XBS A;  2B5X A;  3K8N A;  13GS A;  2LUS A;  1EEJ A;  3ZFB A;  2L5L A;  22GS A;  3ZFL A;  4TR3 A;  2JL4 A;  2VL2 C;  4TXO B;  4CW9 A;  3QAW A;  4PTS A;  5F06 A;  3CXG A;  1Y25 A;  4KDX A;  1XFL A;  3IK9 A;  5HR1 A;  3UVH A;  4MZB A;  5KN0 A;  1G0T A;  3IAS 2;  2O7K A;  1OKT A;  4V2M A;  2ON5 A;  4G0L A;  1V57 A;  3F6F A;  2WDU A;  1VF2 A;  4K0G A;  3ME7 A;  4HQZ A;  3JCM L;  3AY8 A;  1EGR A;  7GSS A;  2E2G A;  1YEX A;  5IOX A;  1EWX A;  5HQP A;  2CZ2 A;  3TB2 A;  3KH7 A;  3DRN A;  3QCP A;  2A2R A;  2JZT A;  4OO4 A;  2AJQ B;  5ECH B;  5IOW A;  4HS1 A;  3J7Y b;  2EIQ A;  5AIS A;  1GUL A;  1UA5 A;  2CAQ A;  1M99 A;  4IP6 A;  3A2X A;  6GST A;  1UC7 A;  5IIZ A;  2H1B A;  2H0H A;  3GTU B;  5JCU A;  2PER A;  4KX4 A;  3I6A A;  5JWO B;  4KAE A;  2IFQ A;  3UEM A;  1GLQ A;  3QDN A;  4IHU A;  3RAZ A;  3TKS C;  2EC4 A;  4USS A;  2H73 A;  1XXU A;  3L9V A;  2X8G A;  1F9M A;  4KSO A;  1Z3E A;  2L4C A;  1TDI A;  5CRE A;  4KGI A;  1X5D A;  2DBC A;  2YOI A;  1B48 A;  1S3C A;  1PL2 A;  2P31 A;  1T4Z A;  4G2E A;  3TKS A;  1G6W A;  4NV2 A;  2VL3 A;  3TRQ A;  3GL3 A;  2P0G A;  1XWC A;  2GSS A;  4MLY A;  4K2D A;  2CZ3 A;  2C8U A;  1J9B A;  3GKX A;  4CHS A;  4H86 A;  1W89 A;  2L59 A;  1ZYQ B;  2QGV A;  2KUC A;  1GSU A;  2QKE A;  4FO5 A;  4WXT A;  3P8W A;  2YWO A;  2FHE A;  4MCU A;  2JSZ A;  2K6V A;  3I43 A;  2GST A;  3GRX A;  4D73 B;  3GV1 A;  1WJK A;  1M7T A;  1XPV A;  3ZL5 A;  1VRS D;  3O6T A;  2J23 A;  4X1U A;  1WIK A;  3TGZ A;  3US3 A;  2OE0 A;  9GSS A;  4BL7 B;  3GN3 A;  2AV4 A;  3NIV A;  4L8E A;  5D9X A;  3FZ5 A;  2GZZ A;  2N5A A;  2RUF A;  2CAI A;  1JFU A;  3CYN A;  3PH9 A;  4KDU A;  4TKY A;  1O7U A;  3EVI A;  4EL1 A;  2YPM A;  1SU9 A;  1MDJ A;  5HFK A;  2XBQ A;  3IPZ A;  1PN9 A;  1HD2 A;  1PKW A;  3FR6 A;  2YZH A;  2MMA A;  2PWJ A;  4DSR A;  4QQ7 A;  3UBK A;  4ZL9 A;  2K9F A;  4KND A;  5IMV A;  2NVL A;  1XWK A;  4G19 A;  2ZNM A;  3IV4 A;  1A24 A;  4WBJ A;  1T3B A;  5IPG A;  3TJG A;  2IN3 A;  3EUR A;  3TKR A;  2K8V A;  1IYH A;  2CA8 A;  4MJB A;  2M80 A;  3ZRE A;  3L78 A;  4MA9 A;  2VLT A;  4OFT A;  3RHC A;  3P90 A;  3TJK A;  1XOB A;  2KOK A;  4CDO A;  2PMT A;  3ZLP A;  1XOA A;  3HJP A;  2X8H A;  4ZB9 A;  1V58 A;  4J2F A;  3CSI A;  2OBK A;  5ECO B;  2LRC A;  4IGJ A;  5AGY A;  2H71 A;  1TI3 A;  3D0Z A;  4IBP A;  2GGT A;  2ALB A;  1A2J A;  2GT6 A;  2P5Q A;  2VOC A;  2TRC P;  3BBY A;  1DUG A;  4EDZ A;  2VCX A;  1EOG A;  5HR0 A;  2F51 A;  2H19 A;  3FZA A;  1NHY A;  4XS4 B;  3HVS A;  2C1Y A;  3M3M A;  1JLV A;  1GSD A;  4TXV A;  3H8Q A;  2DMM A;  1S3A A;  1JZO A;  1M0U A;  4O92 A;  2YCD A;  3L4N A;  2GQM A;  5DCG A;  5GST A;  5C04 A;  2MMO A;  4O7H A;  1NM3 A;  1EV4 A;  2WFC A;  4JR6 A;  2LTK A;  4TR1 A;  3FEU A;  5ECM B;  4HZ4 A;  4ZL7 A;  4ZBB A;  2I3Y A;  1XW5 A;  1BYE A;  2VCZ A;  2CX3 A;  4OFN A;  2O8V B;  4N10 A;  2M72 A;  4POK A;  4G9H A;  3GH9 A;  5L71 A;  5C00 A;  3GKK A;  1EZK A;  3N5O A;  2VD1 A;  3RPN A;  4RUV A;  1O6J A;  4GQF A;  14GS A;  2JSY A;  1SD9 A;  2DLX A;  4IKH A;  3LYK A;  5E4W A;  1TK8 B;  1PL1 A;  4XS1 A;  1I5G A;  4XCS A;  4IQ1 A;  3GHA A;  4RQR A;  1PA3 A;  5IM9 A;  2P5R A;  1M2A A;  1SK0 A;  1T4Y A;  2NTO A;  1YKA A;  1E6B A;  2O87 A;  2H30 A;  5H5S A;  3KH9 A;  1RW1 A;  4OCF A;  3VWV A;  4BPY A;  3DWV A;  5GSS A;  5GZZ B;  2IWT A;  1FG4 A;  2B5Y A;  3LWA A;  3RBT A;  4MJA A;  3M8N A;  1Z5Y E;  3D4M A;  2O89 A;  1N8J A;  5ECS A;  2OBI A;  2V6K A;  2FNO A;  2L57 A;  2FWF A;  3FR3 A;  3TKQ A;  1SJ6 A;  4K8M A;  5CRG A;  5G1K A;  1CQG A;  2PVQ A;  1SK2 A;  2OAC A;  1MDI A;  4YAV A;  3GH6 A;  4XS6 A;  2JZS A;  3APS A;  1ABA A;  1THO A;  4JE1 A;  3MAK A;  2HSY A;  2HNL A;  2H1D A;  1GRX A;  4ZB6 A;  2DJJ A;  2RM6 A;  1S3D A;  3M9J A;  1ERU A;  2JU5 A;  2WGR A;  3HJO A;  2LV3 A;  2MBT A;  3F63 A;  4J56 E;  3KP8 A;  2H75 A;  3U6V A;  2C0F A;  2EIR A;  1T1V A;  2H0I A;  2VD0 A;  2LEG A;  4NAX A;  5D96 A;  1OYJ A;  2LJA A;  1TRW A;  2YV7 A;  1T00 A;  4PUA A;  1GTB A;  2C3N A;  5G2Z A;  3IE3 A;  3GNJ A;  2B1K A;  1GTA A;  4BVY A;  4XRA A;  4KF9 A;  1DBY A;  4LMW A;  4F0C A;  4HU7 A;  4PX1 A;  2VM1 A;  2V41 A;  1XVQ A;  1K0B A;  5JWR B;  3QD9 A;  2OJL A;  5ECL B;  2JAD A;  6GSX A;  3C7M A;  1FW1 A;  4ZBD A;  2YAN A;  2K18 A;  4ZIL A;  3Q6O A;  4YQV A;  2GTU A;  3VI5 A;  4KB3 A;  1TOF A;  6GSY A;  4DEJ A;  3PGT A;  2HT9 A;  3BJ5 A;  2IFQ B;  1USB A;  2H70 A;  4ULX A;  1EGO A;  2AUV A;  4K9Z A;  2IMD A;  1XCC A;  4ZXG A;  2R4V A;  5G5E A;  2NDO A;  2DIZ A;  4AJ8 A;  2DC5 A;  3DIE A;  4HZ2 A;  2H76 A;  3EU3 A;  2VCV A;  1GNW A;  3IK7 A;  4ECI A;  1MD4 A;  1GNE A;  3G7Y A;  2HSM A;  4HQS A;  3A2V A;  4G0I A;  3FZ9 A;  3UL3 A;  1QK8 A;  3HHV A;  1DE1 A;  4OD7 A;  2YN1 A;  2OAD A;  4YQU A;  2TRX A;  2WRT A;  1FB6 A;  3KTL A;  1U6T A;  3VK9 A;  1XVW A;  3ED3 A;  4BVX A;  4GCI A;  4IS0 A;  4WBR D;  2PGT A;  3R2Q A;  3VPQ A;  2I9H A;  5CYY A;  4ZIJ A;  2VLV A;  2HYX A;  1X5E A;  3TJB A;  4PQ1 A;  5CRW A;  4OFM A;  1B8X A;  3GKN A;  4G0K A;  4WF4 A;  4XHM A;  5KN3 A;  2FWE A;  4Q5R A;  3PPU A;  4AJ6 A;  3ERG A;  5IO2 A;  4N0Z A;  4JR4 A;  1MEK A;  2GZY A;  1TU7 A;  1SYX A;  12GS A;  3DXB A;  4NWY A;  2R6K A;  5A4U A;  5CRH A;  5J4U A;  4V2N A;  3UVT A;  2FUG 2;  1A0F A;  3DGQ A;  2FD3 A;  1V40 A;  5EPF A;  3UIW A;  2ES7 A;  3FYG A;  5ENU A;  4MF5 A;  1O81 A;  1A2M A;  4F03 A;  1SJI A;  3HXS A;  3NZN A;  3LJR A;  1GSY A;  2HRF A;  5F05 A;  3LEF A;  1R7H A;  2HSH A;  3GL5 A;  3MWH A;  3QFA C;  1K0N A;  1BQ7 A;  1SL2 B;  3VWX A;  3E3E A;  5JCW A;  5BMU A;  3A5W A;  4POL A;  1K0C A;  1A2L A;  1GUH A;  1YQ1 A;  1TI1 A;  5GAN D;  4KDY A;  1M2B A;  1QQ2 A;  1OKD A;  1TP9 A;  2H72 A;  3FZ4 A;  3WYW A;  2V2G A;  5ID2 A;  4MMM A;  2NBS A;  4GLT A;  1GH2 A;  3EIN A;  4K7I A;  1JZR A;  1F6M C;  5CRD A;  2H6X A;  3ZYW A;  2DJ3 A;  3HZ8 A;  4TRX A;  4N11 A;  2H8L A;  2FA8 A;  4GQC A;  4RQX A;  2C0G A;  5EL8 A;  5F8B A;  2V1M A;  2C0E A;  5G1L A;  3QPM A;  4KCA A;  2F9S A;  3CRU A;  3LFL A;  5E59 A;  3S9F A;  2VIM A;  3ME8 A;  1WPI A;  3UOM A;  3C1S A;  2KLX A;  1OE8 A;  2VO4 A;  4TR1 B;  4I5Q A;  1TKD B;  3P7X A;  1K0O A;  4J57 E;  2WUL A;  3WT1 A;  2B5E A;  3EC3 A;  4HJM A;  5DAK A;  1T8E B;  2PBJ A;  3TDG A;  2CVD A;  5B6M A;  3QR6 A;  4E8E A;  4L0U A;  1O85 A;  2HSN B;  2WZ9 A;  2E2M A;  2HRK A;  2H6Y A;  4XTS A;  1K3Y A;  3G9B A;  4MK3 A;  2GQK A;  18GS A;  1Z6N A;  1V2A A;  4EO3 A;  4EXJ A;  3LOR A;  3KGK A;  2BMX A;  1KNG A;  2I81 A;  4Q5Q A;  4EF0 A;  4DVC A;  4MF6 A;  1QXH A;  1Z7P A;  3ZZX A;  1AQX A;  5D9W A;  3G7J A;  5H5R A;  1ZGN A;  2HI7 A;  3TKP A;  5H5Q A;  1ML6 A;  4LMV A;  3FW2 A;  1G7E A;  1TXX A;  2WCI A;  3OR5 A;  3I9V 2;  2H1A A;  2F8A A;  4IW9 A;  1UVZ A;  2C3T A;  1GSS A;  3D6I A;  1U3I A;  2GQL A;  4HDE A;  2IMF A;  4DSS A;  4X0X A;  1MTC A;  5CO3 A;  1A8Y A;  1SKS B;  5JWQ B;  2GSR A;  3ZIJ A;  4POM A;  4JED A;  2LJK A;  4NMU A;  4DSQ A;  1K3L A;  4LLR A;  5G5F A;  4MZC A;  1XWG A;  3W6G A;  4KH7 A;  3DVX A;  4QL7 A;  3M1G A;  4LL4 B;  2LNS A;  4F82 A;  1NW2 A;  1WOU A;  2VUP A;  1TK5 B;  2X99 A;  3IBH A;  2YZU A;  1TW9 A;  2JZR A;  1HNA A;  3FK8 A;  4EKZ A;  2UZ8 A;  1SL1 B;  1V98 A;  4I2U A;  4BA7 A;  1VGL A;  2HZF A;  3HY2 A;  3FRC A;  3EE2 A;  4OCE A;  2H0G A;  2H6Z A;  3RHB A;  2CX4 A;  3CSJ A;  1Z6M A;  4BVY B;  3FY7 A;  5INY A;  2DSA A;  4IP1 A;  5ABR A;  3N9J A;  3CRT A;  2VM2 A;  1SEN A;  1R4W A;  4HU9 A;  1ZZY A;  3UJ1 A;  2MBS A;  5ECQ B;  5FWG A;  1SKW B;  4KE3 A;  1RQM A;  2BJX A;  4WR4 A;  1GUK A;  3L0H A;  1XZO A;  1ON4 A;  1JLW A;  4POB A;  2L5O A;  2B7K A;  4NHW A;  1WWJ A;  2X64 A;  3GA4 A;  3F4R A;  3GX0 A;  3IR4 A;  3W8S A;  4TR4 A;  1HYU A;  3VWW A;  1FAA A;  5A4W A;  1YF0 A;  1X9M B;  3BD2 A;  1LJR A;  1SD8 A;  3LGC A;  4KA0 A;  3GUS A;  1B4Q A;  3GUR A;  2LRN A;  3RPP A;  1TTZ A;  3ZIV A;  4MH2 A;  3VI7 A;  2WB9 A;  3HA9 A;  4PNF A;  5B8B A;  2OKA A;  1IYI A;  4EDY A;  1A0R P;  2GLR A;  3M9K A;  1SJZ A;  2CV4 A;  2HSM B;  4GSS A;  4MZW A;  1ZOF A;  10GS A;  1R5P A;  3GSS A;  1OAZ A;  4HJ2 A;  5ECK B;  1DSB A;  3C73 A;  3DVW A;  2BTO T;  4EUY A;  4AF2 A;  2C3Q A;  3HZ4 A;  2F8F A;  3WT2 A;  4BVX B;  3HVV A;  3EMP A;  1XW6 A;  3KMN A;  4GTU A;  3L9U A;  3L9S A;  2LNT A;  3APQ A;  2K8S A;  3QOU A;  1TJD A;  3DML A;  1AQW A;  3WGE A;  3SWL A;  1FVJ A;  4EVM A;  2IMI A;  3CTG A;  1FOV A;  2DJK A;  2DML A;  1K0A A;  3MDK A;  4TR0 A;  2FLS A;  5AIX A;  3F4T A;  3DD3 A;  2IIY A;  1LU4 A;  3GFK A;  4FYB A;  1U88 A;  4K6X A;  5D73 A;  1YZX A;  1ZL9 A;  2LRT A;  1HQO A;  4KCE A;  1PX6 A;  5J9C A;  1JHB A;  1AW9 A;  4K0N A;  3EYT A;  3Q74 A;  1U87 A;  3HKR A;  2AHE A;  1V9W A;  4WKW A;  2D2Z A;  1Z7R A;  2WJU A;  1KTE A;  1OC9 A;  3IA1 A;  3VWU A;  3ZML A;  5EY6 A;  1R26 A;  2YWN A;  5DJM A;  3RDW A;  2V32 A;  2DJ1 A;  2LS5 A;  5DAL A;  5D93 A;  4JRR A;  5J3R A;  3KP9 A;  1GP1 A;  4TW5 A;  4PUR A;  1NHO A;  4PUF C;  3TJJ A;  3KTB A;  2QC7 A;  3IHQ A;  4NPB A;  1G6Y A;  2GSQ A;  3HCZ A;  4LL1 B;  2LQQ A;  1PGT A;  4I97 A;  3KMO A;  1WP0 A;  4XIH A;  1TRS A;  2GDR A;  4IJ3 A;  4FIW A;  5ID2 B;  2V6O A;  2VCW A;  2VCT A;  1MDK A;  4YQM A;  4FQU A;  2LST A;  1BJX A;  4ZBA A;  5ECR B;  5D9T A;  3CSH A;  2ON7 A;  3ZVJ A;  3QAV A;  1M2D A;  2MMN A;  5LD0 A;  3D22 A;  3LSZ A;  2TIR A;  2H74 A;  5DCH A;  3TUE A;  1GTI A;  1O73 A;  2MMZ A;  2HZE A;  1EP8 A;  4K1F A;  3QFB C;  2CT6 A;  3KD0 A;  4JBB A;  1ACV A;  4LA1 A;  1A8L A;  3V1W A;  1GL8 A;  2RUE A;  5B8A A;  3TOU A;  3UBL A;  4HUA A;  3KZQ A;  4IVF A;  4PNG A;  4F0B A;  3ERW A;  4IEL A;  2OE3 A;  2REM A;  4JZQ A;  1F3A A;  3ZVJ D;  3EU4 A;  5D8I A;  1ERT A;  1ST9 A;  3HYP A;  5FHI A;  1FHE A;  2DJ0 A;  2ZUP A;  4NV5 A;  3GST A;  5DAK B;  3VLN A;  2ZCT A;  3LYP A;  1R5A A;  1WE0 A;  2E7P A;  1EV9 A;  2Z9S A;  1XWB A;  2HRK B;  4ISD A;  4WEY A;  3IDV A;  3LG6 A;  2R5G A;  1B9Y C;  1QMV A;  4HEA 2;  3TOT A;  3QMX A;  2XPE A;  3VPT A;  5EVO A;  2HRA A;  3F3Q A;  1URM A;  8GSS A;  2AAW A;  4ACS A;  5DVB A;  5KN2 A;  5AN1 A;  2RM5 A;  1LBK A;  3HDC A;  4V1A p;  3D5J A;  2FA4 A;  1OC3 A;  4EE0 A;  2IME A;  1F3B A;  1GSF A;  2HE3 A;  3IRA A;  2DJ2 A;  2HRN A;  3C1R A;  1OVN A;  1M9B A;  4I8B A;  1YKC A;  1H4O A;  2R37 A;  3HJM A;  1X9W B;  3PR8 A;  3QAG A;  1XWA A;  4DSS B;  1X9S B;  2O85 A;  2VL2 A;  1QGV A;  4HOJ A;  2FGX A;  1K0M A;  3UMA A;  1AIU A;  1FB0 A;  4O5R A;  1T7P B;  1SK1 A;  1PSQ A;  1AUC A;  1YF1 A;  3BCI A;  2G0F A;  1BX9 A;  4JU5 A;  2FCH A;  2VL9 A;  2AYT A;  2MYG A;  3GX8 A;  1JZW A;  3UAR A;  3A2W A;  5DDL A;  3J7Y k;  2PN8 A;  2G2Q A;  3IC8 A;  4PGT A;  3W8J A;  1YEP A;  3F6D A;  1MD3 A;  2B7J A;  2YV9 A;  4RI7 A;  3TKS E;  1VF3 A;  1K3O A;  2A2S A;  4NXI A;  1THX A;  4IJI A;  1X5C A;  1ZYE A;  5IMC A;  3GMF A;  3O76 A;  3KJY A;  5FT3 A;  1QFN A;  3E9J B;  2DIY A;  5IMF A;  1H75 A;  3KIJ A;  2OE1 A;  1YDK A;  1YY7 A;  1K0D A;  5J9B A;  1XW9 A;  5IPH A;  1AC1 A;  5CAX A;  1FVK A;  2XPD A;  2AB6 A;  2VAF A;  1I9D A;  4ILF A;  3ZMK A;  5IMD A;  1B4P A;  3Q18 A;  4K7N A;  2NPB A;  2J9H A;  4L0W A;  3G7I A;  4Q5N A;  3WD6 A;  5ECN B;  2B1L A;  5ECP B;  3VUR A;  1VF4 A;  3H1N A;  5B7C A;  3F8U A;  6GSW A;  1Q98 A;  3GYK A;  4AGS A;  4MPG A;  3CBU A;  1WRY A;  3IAM 2;  4PXO A;  4EC0 A;  4ECB A;  4RI6 A;  5B6N A;  4OWY A;  1GLP A;  5A5K A;  1ZCP A;  2R2J A;  3H79 A;  1B9X C;  2VCQ A;  4GST A;  4I2T A;  1W4V A;  4TXO A;  1TK0 B;  2IL3 A;  3C71 A;  2PU9 C;  1GWC A;  1TRU A;  2QSI A;  4AJ7 A;  2C80 A;  2YJH A;  19GS A;  1ERW A;  4ML1 A;  4WF5 A;  5GAP D;  2FY6 A;  1PQN A;  2B3S A;  4O32 A;  4K7O A;  2XC2 A;  4MJC A;  2RII A;  4IQA A;  4KUN A;  1M9A A;  1N2A A;  4MPF A;  2IPA A;  4KW6 A;  1A23 A;  4ECJ A;  4TN8 A;  2KHP A;  3H4K A;  3D21 A;  5G30 A;  5ECI B;  5HFG A;  1ZMA A;  3ISO A;  3NOF A;  1GSQ A;  1CQH A;  1PMT A;  2E0Q A; 
#chains in the Genus database with same CATH topology
 1GSE A;  5JCG A;  4TVE A;  4Z2U A;  5A5H A;  1RK4 A;  3GTU A;  5HR3 A;  4N30 A;  2FWH A;  5IO0 A;  3TRX A;  2I1U A;  1Z9H A;  1SVL A;  3DYR A;  4X43 A;  4ECC A;  1OC9 B;  3LW9 A;  2MZC A;  2EIO A;  1OE7 A;  1O8W A;  1X0R A;  1TRV A;  5A1N B;  2WS2 A;  1BED A;  2GS3 A;  2CVB A;  5DAL B;  1TU8 A;  2YJ7 A;  4IN0 A;  1SKR B;  4PI2 C;  2RLI A;  2HXK A;  2KP2 A;  6GSS A;  1XIY A;  3EWL A;  1PX7 A;  1Y6E A;  4O5U A;  1U3A A;  4GWR A;  2C0D A;  3F4S A;  4MAB A;  1E2Y A;  4FYC A;  3KXO A;  1DE2 A;  2PVO C;  4GSN A;  4E8H A;  1O8X A;  1JZD A;  4KSM A;  3TCO A;  4MF7 A;  3IOS A;  2HZE B;  3HVX A;  3IC4 A;  1QUW A;  4D73 A;  3R3E A;  2EFC A;  5F07 A;  2YWM A;  3APO A;  2FWG A;  16GS A;  2JAC A;  3F9U A;  1SL0 B;  1AAZ A;  2WW2 A;  1NSW A;  4GF0 A;  3FMW A;  4BL7 A;  1EEM A;  2LKU A;  2M46 A;  2PUK C;  5ELA A;  3UAP A;  1F37 A;  5ELG A;  5AIV A;  1HNB A;  4ZL8 A;  1PD2 1;  3DKS A;  4EIQ A;  3M0F A;  1J0F A;  2CQ9 A;  2X49 A;  4OO5 A;  1KBN A;  3FHK A;  4FYU A;  1ILO A;  3U5R E;  3C8E A;  3TJF A;  5KEJ A;  1WMJ A;  2GT5 A;  3FKF A;  3PIN A;  1SVO A;  3BOA A;  2H66 A;  3IXR A;  4HI7 A;  2XHF A;  3LXT A;  1C72 A;  4GXZ A;  1KEB A;  2YWI A;  4L5L A;  2HQT A;  5IMZ A;  1SYR A;  5IQY A;  1GUM A;  2A4V A;  3LXZ A;  5J4V A;  1N25 A;  5A4V A;  20GS A;  5COH A;  4MDC A;  3HD5 A;  5CNW A;  4BWS A;  4WR5 A;  3BCK A;  4MNN A;  4ML6 A;  3ZRD A;  1J08 A;  4L5O A;  4ID0 A;  3TRP A;  3P2A A;  4TOP A;  3WGD A;  3CMI A;  5CP1 A;  4Q5F A;  4PQH A;  2IJY A;  4XRD A;  2X8C A;  5HR2 A;  1EP7 A;  4OMV A;  4ZB8 A;  4MH3 A;  1G7O A;  1FO5 A;  3LQ7 A;  1ERV A;  2CVK A;  4XS4 A;  4F9Z A;  5LNK e;  17GS A;  2L6C A;  3ZTL A;  4F2I A;  2L4Q A;  5D9V A;  1BG5 A;  1F2E A;  2IMK A;  3H93 A;  4K2X A;  3FR9 A;  1PKZ A;  4V2L A;  2N5F A;  3WGX A;  6GSU A;  4GRF A;  4QL9 A;  1EOH A;  1YJ6 A;  1OC8 A;  5LCZ A;  3E0U A;  4YAP A;  1AQV A;  1S3R A;  4Z7X A;  2R3X A;  4FH8 A;  3CTF A;  2YP6 A;  2XBI A;  3D4T A;  3O3T A;  2HLS A;  3KM6 A;  5J5N A;  4N0V A;  4YH2 A;  2N5B A;  1AXD A;  4P3Y B;  2YNX A;  2I4A A;  4MJE A;  3EMX A;  4G10 A;  1BAY A;  3ZIT A;  5J41 A;  5DQY A;  4FXY P;  5HFI A;  2L6D A;  11GS A;  3VFI A;  1UN2 A;  4AKH A;  4Z2R A;  5G31 A;  2LQO A;  3GIX A;  5DBQ A;  3F3R A;  3A3T A;  4NHZ A;  1Q4J A;  2O3E A;  1VF1 A;  2H01 A;  2HFD A;  2VLU A;  3ERF A;  2C4J A;  5IMA A;  3KCM A;  2LJR A;  3MNG A;  5DJL A;  4BWQ A;  2PPT A;  2GZP A;  3Q19 A;  5F0G A;  3KEB A;  3I69 A;  2H1L A;  4PQI A;  4MP4 A;  2KP1 A;  2OA7 A;  1HNC A;  4WET A;  5BRT A;  1GTU A;  4V1A g;  3DEX A;  1PRX A;  3F0I A;  4I6X A;  3GKM A;  6GSV A;  3SBC A;  5DQS A;  2GVP A;  2F3M A;  5KN1 A;  2H1G A;  2B6M A;  3MSZ A;  1XBS A;  1FOH A;  1TXU A;  2B5X A;  3K8N A;  13GS A;  2LUS A;  1EEJ A;  3ZFB A;  2L5L A;  22GS A;  3ZFL A;  4TR3 A;  2JL4 A;  2VL2 C;  4TXO B;  4CW9 A;  3QAW A;  4PTS A;  5F06 A;  3CXG A;  1Y25 A;  4KDX A;  1XFL A;  3IK9 A;  5HR1 A;  3UVH A;  4MZB A;  5KN0 A;  1G0T A;  3IAS 2;  2O7K A;  1OKT A;  4V2M A;  2ON5 A;  4G0L A;  1V57 A;  3F6F A;  2WDU A;  1VF2 A;  4K0G A;  3ME7 A;  2R0P A;  4HQZ A;  1I1I P;  3JCM L;  3AY8 A;  1EGR A;  7GSS A;  2E2G A;  1YEX A;  5IOX A;  2EFH A;  1EWX A;  5HQP A;  2CZ2 A;  3TB2 A;  3KH7 A;  3DRN A;  2A2R A;  3QCP A;  2JZT A;  4OO4 A;  2AJQ B;  5ECH B;  5IOW A;  4HS1 A;  3J7Y b;  2EIQ A;  5AIS A;  1GUL A;  2X4A A;  1UA5 A;  2CAQ A;  1M99 A;  4IP6 A;  3A2X A;  6GST A;  1UC7 A;  5IIZ A;  2H1B A;  2H0H A;  5A5H B;  3GTU B;  5JCU A;  2PER A;  4KX4 A;  3I6A A;  5JWO B;  2QA1 A;  4KAE A;  2IFQ A;  3UEM A;  1GLQ A;  3QDN A;  4IHU A;  3RAZ A;  3TKS C;  2EC4 A;  4USS A;  2H73 A;  1XXU A;  3L9V A;  2X8G A;  1F9M A;  4KSO A;  1Z3E A;  5J40 A;  2L4C A;  1TDI A;  5CRE A;  4KGI A;  1X5D A;  2DBC A;  2YOI A;  1B48 A;  1S3C A;  1PL2 A;  2P31 A;  1T4Z A;  4G2E A;  3TKS A;  1G6W A;  4NV2 A;  2VL3 A;  3TRQ A;  3GL3 A;  2P0G A;  1XWC A;  2GSS A;  4MLY A;  4K2D A;  2CZ3 A;  5KOW A;  4W66 A;  2C8U A;  1J9B A;  3GKX A;  4CHS A;  4H86 A;  1W89 A;  2L59 A;  1ZYQ B;  2QGV A;  2KUC A;  1GSU A;  2QKE A;  4FO5 A;  4WXT A;  3P8W A;  2YWO A;  2FHE A;  4MCU A;  2JSZ A;  2K6V A;  3I43 A;  2GST A;  3GRX A;  4D73 B;  3GV1 A;  1WJK A;  1M7T A;  1XPV A;  3ZL5 A;  1VRS D;  3O6T A;  2J23 A;  4X1U A;  1WIK A;  3TGZ A;  3US3 A;  2OE0 A;  9GSS A;  4BL7 B;  3GN3 A;  2AV4 A;  3NIV A;  4L8E A;  5D9X A;  3FZ5 A;  2GZZ A;  2N5A A;  2RUF A;  2CAI A;  1JFU A;  3CYN A;  3PH9 A;  4KDU A;  4TKY A;  1O7U A;  3EVI A;  4EL1 A;  2YPM A;  1SU9 A;  1MDJ A;  5HFK A;  2XBQ A;  3IPZ A;  1PN9 A;  4AKI A;  1HD2 A;  1PKW A;  3FR6 A;  2YZH A;  2MMA A;  2PWJ A;  4DSR A;  4QQ7 A;  3UBK A;  4AKG A;  4ZL9 A;  2K9F A;  4KND A;  5IMV A;  2NVL A;  1XWK A;  4G19 A;  2ZNM A;  3IV4 A;  1A24 A;  4WBJ A;  1T3B A;  5IPG A;  3TJG A;  2IN3 A;  3EUR A;  3TKR A;  2K8V A;  1IYH A;  2CA8 A;  4MJB A;  2M80 A;  2DKH A;  3ZRE A;  3L78 A;  4MA9 A;  2VLT A;  4OFT A;  3RHC A;  3P90 A;  3TJK A;  1XOB A;  2KOK A;  4CDO A;  2PMT A;  3ZLP A;  1XOA A;  3HJP A;  1S4B P;  2X8H A;  4ZB9 A;  2R0C A;  1V58 A;  4J2F A;  3CSI A;  2OBK A;  5ECO B;  2LRC A;  4IGJ A;  5AGY A;  2H71 A;  1TI3 A;  3D0Z A;  4IBP A;  2GGT A;  2ALB A;  1A2J A;  2GT6 A;  2P5Q A;  2VOC A;  2TRC P;  3BBY A;  1DUG A;  4EDZ A;  2VCX A;  1EOG A;  5HR0 A;  2F51 A;  2H19 A;  3FZA A;  1NHY A;  4XS4 B;  3HVS A;  2C1Y A;  3M3M A;  1JLV A;  1GSD A;  4TXV A;  1ZYN A;  3H8Q A;  2DMM A;  1S3A A;  1JZO A;  1M0U A;  4O92 A;  2YCD A;  3L4N A;  2GQM A;  5DCG A;  5GST A;  5C04 A;  2MMO A;  4O7H A;  1NM3 A;  1EV4 A;  2WW1 A;  2WFC A;  4JR6 A;  2LTK A;  4TR1 A;  3FEU A;  5ECM B;  4HZ4 A;  4ICY A;  4ZL7 A;  4ZBB A;  2I3Y A;  1XW5 A;  1BYE A;  2VCZ A;  2CX3 A;  4OFN A;  2O8V B;  4N10 A;  2M72 A;  4POK A;  4G9H A;  3GH9 A;  5L71 A;  5C00 A;  3GKK A;  1EZK A;  3N5O A;  2VD1 A;  3RPN A;  4RUV A;  1O6J A;  4GQF A;  14GS A;  2JSY A;  1SD9 A;  2HSN A;  1Y1U A;  4QMK A;  2DLX A;  4IKH A;  3LYK A;  5E4W A;  1TK8 B;  1PL1 A;  4XS1 A;  1I5G A;  4XCS A;  4ZB7 A;  4IQ1 A;  2WW3 A;  3GHA A;  4RQR A;  1PA3 A;  5IM9 A;  2P5R A;  1M2A A;  1SK0 A;  1T4Y A;  2NTO A;  1YKA A;  1E6B A;  2O87 A;  2H30 A;  5H5S A;  3KH9 A;  1RW1 A;  4OCF A;  3VWV A;  4BPY A;  3DWV A;  5GSS A;  3CHX C;  5GZZ B;  2IWT A;  1FG4 A;  2B5Y A;  3LWA A;  4K5S A;  3RBT A;  4MJA A;  3M8N A;  1Z5Y E;  4CY6 A;  3D4M A;  2O89 A;  1N8J A;  5ECS A;  2OBI A;  2V6K A;  2FNO A;  2L57 A;  5J4Y A;  2FWF A;  3FR3 A;  3TKQ A;  1SJ6 A;  4K8M A;  5CRG A;  5G1K A;  1CQG A;  2PVQ A;  1SK2 A;  2OAC A;  1MDI A;  4YAV A;  3GH6 A;  2WW0 A;  4XS6 A;  2JZS A;  4AI6 A;  3APS A;  1ABA A;  1THO A;  4JE1 A;  3MAK A;  2HSY A;  2HNL A;  2H1D A;  1XG8 A;  1GRX A;  4ZB6 A;  2DJJ A;  2RM6 A;  1S3D A;  3M9J A;  1ERU A;  2JU5 A;  2WGR A;  3HJO A;  2LV3 A;  2WVY A;  2MBT A;  3F63 A;  4J56 E;  3KP8 A;  2H75 A;  3U6V A;  2C0F A;  2EIR A;  1T1V A;  2H0I A;  2VD0 A;  2LEG A;  4NAX A;  5D96 A;  1OYJ A;  2LJA A;  1TRW A;  2YV7 A;  1T00 A;  4PUA A;  1GTB A;  2C3N A;  5G2Z A;  3IE3 A;  3GNJ A;  4YKG A;  2B1K A;  4A5P A;  5KOX A;  1GTA A;  4BVY A;  4XRA A;  4KF9 A;  1DBY A;  3A5I A;  4LMW A;  5BMU B;  4F0C A;  4HU7 A;  4PX1 A;  2VM1 A;  2V41 A;  1XVQ A;  1K0B A;  5JWR B;  3QD9 A;  2OJL A;  5ECL B;  2JAD A;  6GSX A;  3C7M A;  1FW1 A;  4ZBD A;  2YAN A;  2K18 A;  4ZIL A;  3Q6O A;  4YQV A;  2GTU A;  3VI5 A;  4KB3 A;  2R0G A;  1TOF A;  6GSY A;  4DEJ A;  3PGT A;  3RGB C;  2HT9 A;  3BJ5 A;  2IFQ B;  1USB A;  4G01 A;  2H70 A;  4ULX A;  1EGO A;  2AUV A;  4K9Z A;  2IMD A;  1XCC A;  4ZXG A;  2R4V A;  5G5E A;  2NDO A;  2DIZ A;  4AJ8 A;  2DC5 A;  3DIE A;  4HZ2 A;  2H76 A;  3EU3 A;  2VCV A;  1GNW A;  3IK7 A;  4ECI A;  1MD4 A;  1GNE A;  3G7Y A;  2HSM A;  4HQS A;  3A2V A;  4G0I A;  3FZ9 A;  3UL3 A;  1QK8 A;  3HHV A;  1DE1 A;  4OD7 A;  2YN1 A;  2OAD A;  4YQU A;  2TRX A;  2WRT A;  1FB6 A;  3KTL A;  1U6T A;  3VK9 A;  1XVW A;  3ED3 A;  4BVX A;  4GCI A;  2QA2 A;  4IS0 A;  4WBR D;  2PGT A;  3R2Q A;  3VPQ A;  2I9H A;  5CYY A;  4ZIJ A;  2VLV A;  2HYX A;  1X5E A;  3TJB A;  4PQ1 A;  5CRW A;  4OFM A;  1B8X A;  3GKN A;  4G0K A;  4WF4 A;  4XHM A;  5KN3 A;  2FWE A;  4X4J A;  4Q5R A;  1ZYP A;  3PPU A;  4AJ6 A;  4HSC X;  3ERG A;  5IO2 A;  4N0Z A;  4JR4 A;  1MEK A;  2GZY A;  1TU7 A;  1SYX A;  12GS A;  3DXB A;  4NWY A;  2R6K A;  5A4U A;  5CRH A;  5J4U A;  4V2N A;  3UVT A;  2FUG 2;  1BG1 A;  1A0F A;  3DGQ A;  2FD3 A;  1V40 A;  5EPF A;  3UIW A;  2ES7 A;  3FYG A;  5ENU A;  4MF5 A;  1O81 A;  1A2M A;  4F03 A;  1SJI A;  3HXS A;  3NZN A;  3LJR A;  1GSY A;  2HRF A;  5F05 A;  3LEF A;  1R7H A;  2HSH A;  3GL5 A;  3MWH A;  3QFA C;  1K0N A;  1BQ7 A;  1SL2 B;  3VWX A;  3E3E A;  5JCW A;  5BMU A;  3A5W A;  4POL A;  1K0C A;  1A2L A;  1GUH A;  1YQ1 A;  1TI1 A;  5GAN D;  4KDY A;  1M2B A;  1QQ2 A;  1OKD A;  1TP9 A;  2H72 A;  3FZ4 A;  3WYW A;  2V2G A;  5ID2 A;  4MMM A;  3MYD A;  2NBS A;  4PHZ C;  4GLT A;  1GH2 A;  3EIN A;  4K7I A;  1JZR A;  1F6M C;  5CRD A;  2H6X A;  3ZYW A;  2DJ3 A;  3HZ8 A;  4TRX A;  3EPT A;  4N11 A;  2H8L A;  2FA8 A;  4GQC A;  4RQX A;  2C0G A;  5EL8 A;  5F8B A;  2V1M A;  2C0E A;  5G1L A;  3QPM A;  4KCA A;  2F9S A;  3CRU A;  3LFL A;  5E59 A;  2O5V A;  3S9F A;  2VIM A;  3ME8 A;  1WPI A;  3UOM A;  2O36 A;  2A4H A;  2KLX A;  3C1S A;  1OE8 A;  2VO4 A;  4TR1 B;  4I5Q A;  1TKD B;  3P7X A;  1K0O A;  4N3Z A;  4J57 E;  2WUL A;  3WT1 A;  2B5E A;  3EC3 A;  4K5R A;  4HJM A;  5A34 A;  5DAK A;  1T8E B;  2PBJ A;  3TDG A;  2CVD A;  5B6M A;  3QR6 A;  4E8E A;  4L0U A;  1O85 A;  2HSN B;  2WZ9 A;  2E2M A;  2HRK A;  2H6Y A;  4XTS A;  1K3Y A;  3G9B A;  4MK3 A;  2GQK A;  18GS A;  1Z6N A;  1V2A A;  4EO3 A;  4EXJ A;  2VKZ G;  3LOR A;  3KGK A;  4YKF A;  2BMX A;  1KNG A;  2I81 A;  4Q5Q A;  4EF0 A;  4DVC A;  4MF6 A;  1QXH A;  1Z7P A;  3ZZX A;  1AQX A;  5D9W A;  3G7J A;  5H5R A;  1ZGN A;  2HI7 A;  3TKP A;  5H5Q A;  1ML6 A;  4LMV A;  3FW2 A;  1G7E A;  1TXX A;  2WCI A;  3OR5 A;  3I9V 2;  2H1A A;  2F8A A;  4IW9 A;  1UVZ A;  2C3T A;  1GSS A;  3D6I A;  1U3I A;  2GQL A;  4HDE A;  2IMF A;  4DSS A;  1M3I A;  4X0X A;  1MTC A;  5CO3 A;  1A8Y A;  1SKS B;  5JWQ B;  2GSR A;  3ZIJ A;  4POM A;  4JED A;  2LJK A;  4NMU A;  2OT3 A;  4DSQ A;  1K3L A;  4LLR A;  5G5F A;  4MZC A;  1XWG A;  3W6G A;  4KH7 A;  3DVX A;  4QL7 A;  3M1G A;  4LL4 B;  2LNS A;  4F82 A;  1NW2 A;  1WOU A;  2VUP A;  1TK5 B;  2X99 A;  3IBH A;  2YZU A;  1TW9 A;  2JZR A;  1HNA A;  3FK8 A;  4EKZ A;  2UZ8 A;  4BIK A;  1SL1 B;  1V98 A;  4I2U A;  4BA7 A;  1VGL A;  2HZF A;  3HY2 A;  3FRC A;  3EE2 A;  4OCE A;  2H0G A;  2H6Z A;  3RHB A;  2CX4 A;  3CSJ A;  1Z6M A;  4BVY B;  2WVZ A;  3FY7 A;  5INY A;  2DSA A;  4IP1 A;  2UV8 G;  5ABR A;  3N9J A;  3CRT A;  2VM2 A;  1SEN A;  1R4W A;  4HU9 A;  1ZZY A;  3UJ1 A;  2MBS A;  5ECQ B;  5FWG A;  1SKW B;  4KE3 A;  1RQM A;  2BJX A;  4WR4 A;  1GUK A;  3L0H A;  1XZO A;  1ON4 A;  1SVM A;  1JLW A;  4POB A;  2L5O A;  2B7K A;  4NHW A;  1WWJ A;  2X64 A;  3GA4 A;  3F4R A;  3GX0 A;  3IR4 A;  3W8S A;  4TR4 A;  1HYU A;  3VWW A;  1FAA A;  5A4W A;  1YF0 A;  1X9M B;  3BD2 A;  1LJR A;  1SD8 A;  3LGC A;  4KA0 A;  3GUS A;  1B4Q A;  3GUR A;  2LRN A;  3HMJ G;  3RPP A;  1TTZ A;  3ZIV A;  4MH2 A;  3VI7 A;  2WB9 A;  3HA9 A;  4PNF A;  5B8B A;  2WVX A;  2OKA A;  1IYI A;  4EDY A;  1A0R P;  2EFE A;  2GLR A;  3M9K A;  1SJZ A;  2CV4 A;  2HSM B;  4GSS A;  4MZW A;  1ZOF A;  10GS A;  1R5P A;  3GSS A;  1OAZ A;  4HJ2 A;  5ECK B;  1DSB A;  3C73 A;  3DVW A;  2BTO T;  4EUY A;  4AF2 A;  2C3Q A;  5J47 A;  3HZ4 A;  4EIP A;  2F8F A;  3WT2 A;  4BVX B;  3HVV A;  3EMP A;  1XW6 A;  3KMN A;  4GTU A;  3L9U A;  3L9S A;  2LNT A;  3APQ A;  2K8S A;  3QOU A;  1TJD A;  3DML A;  1AQW A;  3WGE A;  3SWL A;  1FVJ A;  4EVM A;  2IMI A;  3CTG A;  1FOV A;  2DJK A;  2DML A;  1K0A A;  3MDK A;  4TR0 A;  3MIX A;  2FLS A;  5AIX A;  3F4T A;  3DD3 A;  2IIY A;  1LU4 A;  3GFK A;  4FYB A;  1U88 A;  4K6X A;  5D73 A;  1YZX A;  1ZL9 A;  2LRT A;  1HQO A;  4KCE A;  1PX6 A;  3CQF A;  5J9C A;  1JHB A;  1AW9 A;  4K0N A;  3EYT A;  3Q74 A;  1U87 A;  3HKR A;  2AHE A;  1V9W A;  4WKW A;  2D2Z A;  1Z7R A;  2WJU A;  1KTE A;  1OC9 A;  3IA1 A;  3VWU A;  3ZML A;  5EY6 A;  1R26 A;  2YWN A;  5DJM A;  3RDW A;  2V32 A;  5A1N A;  2DJ1 A;  2LS5 A;  5DAL A;  5D93 A;  4JRR A;  5J3R A;  3KP9 A;  1GP1 A;  4TW5 A;  4PUR A;  1NHO A;  4PUF C;  3TJJ A;  3KTB A;  2QC7 A;  3IHQ A;  4NPB A;  1G6Y A;  2GSQ A;  3HCZ A;  4LL1 B;  2LQQ A;  1PGT A;  4Z2T A;  4I97 A;  3KMO A;  1WP0 A;  4XIH A;  1TRS A;  1YVL A;  2GDR A;  4FIW A;  4IJ3 A;  5ID2 B;  2V6O A;  2VCW A;  2VCT A;  1MDK A;  4YQM A;  4FQU A;  2LST A;  1BJX A;  4ZBA A;  5ECR B;  5D9T A;  4GDF A;  3CSH A;  2ON7 A;  3ZVJ A;  3QAV A;  1M2D A;  2MMN A;  5LD0 A;  3D22 A;  3LSZ A;  2TIR A;  2H74 A;  5DCH A;  3TUE A;  1GTI A;  1O73 A;  2MMZ A;  2HZE A;  1EP8 A;  4K1F A;  3QFB C;  2CT6 A;  3KD0 A;  4JBB A;  1ACV A;  4LA1 A;  1A8L A;  3V1W A;  1GL8 A;  1PFO A;  2RUE A;  5B8A A;  3TOU A;  3UBL A;  4HUA A;  3KZQ A;  4IVF A;  4PNG A;  4F0B A;  3ERW A;  4IEL A;  2OE3 A;  2REM A;  4JZQ A;  1F3A A;  3ZVJ D;  3EU4 A;  5D8I A;  1ERT A;  1ST9 A;  3HYP A;  5FHI A;  1FHE A;  2DJ0 A;  2ZUP A;  4NV5 A;  5A34 B;  1PN0 A;  3GST A;  5DAK B;  3VLN A;  2ZCT A;  3LYP A;  2WZS A;  1R5A A;  1WE0 A;  2E7P A;  1EV9 A;  2Z9S A;  1XWB A;  2HRK B;  4ISD A;  4WEY A;  3IDV A;  3LG6 A;  2R5G A;  1B9Y C;  3RFR C;  1QMV A;  4HEA 2;  3TOT A;  3QMX A;  2XPE A;  3VPT A;  5EVO A;  2HRA A;  3F3Q A;  1URM A;  8GSS A;  2AAW A;  4ACS A;  5DVB A;  5KN2 A;  5AN1 A;  2RM5 A;  1LBK A;  3HDC A;  4AKX B;  4V1A p;  3D5J A;  2FA4 A;  1OC3 A;  1M3J A;  4EE0 A;  2IME A;  1F3B A;  1GSF A;  2HE3 A;  3IRA A;  2DJ2 A;  2HRN A;  3C1R A;  1OVN A;  1M9B A;  4I8B A;  1YKC A;  1H4O A;  2R37 A;  3HJM A;  1X9W B;  3PR8 A;  3QAG A;  1XWA A;  4DSS B;  1X9S B;  2O85 A;  2VL2 A;  1QGV A;  4HOJ A;  2FGX A;  1K0M A;  3UMA A;  1AIU A;  1FB0 A;  4O5R A;  1T7P B;  1SK1 A;  1PSQ A;  1AUC A;  1YF1 A;  3BCI A;  2G0F A;  1BX9 A;  4JU5 A;  4PI0 C;  2FCH A;  2VL9 A;  3TU3 B;  2AYT A;  2MYG A;  3GX8 A;  1JZW A;  3UAR A;  3A2W A;  5DDL A;  3J7Y k;  2PN8 A;  2G2Q A;  3IC8 A;  4PGT A;  3W8J A;  1YEP A;  3F6D A;  1MD3 A;  2B7J A;  4E68 A;  2YV9 A;  4RI7 A;  3TKS E;  1VF3 A;  1K3O A;  2A2S A;  4NXI A;  1THX A;  4IJI A;  1X5C A;  1ZYE A;  5IMC A;  3GMF A;  3O76 A;  3KJY A;  5FT3 A;  1QFN A;  3E9J B;  1BF5 A;  2DIY A;  5IMF A;  1H75 A;  3KIJ A;  1YEW C;  2OE1 A;  1YDK A;  1YY7 A;  1K0D A;  5J9B A;  1XW9 A;  5IPH A;  1AC1 A;  5CAX A;  1FVK A;  2EFD A;  2XPD A;  2AB6 A;  2VAF A;  3HVN A;  1I9D A;  4ILF A;  3ZMK A;  5IMD A;  1B4P A;  3Q18 A;  4K7N A;  2NPB A;  2J9H A;  4L0W A;  3G7I A;  3IHG A;  4Q5N A;  4CY8 A;  3WD6 A;  5ECN B;  2B1L A;  5ECP B;  3VUR A;  1VF4 A;  3H1N A;  5B7C A;  3F8U A;  6GSW A;  1Q98 A;  3GYK A;  4AGS A;  4MPG A;  2WVX B;  3CBU A;  1WRY A;  3IAM 2;  4PXO A;  4EC0 A;  4ECB A;  4RI6 A;  2DKI A;  5B6N A;  4OWY A;  1GLP A;  4O5Q A;  5A5K A;  1ZCP A;  2R2J A;  3H79 A;  1B9X C;  2VCQ A;  4GST A;  3CWG A;  4I2T A;  1W4V A;  4TXO A;  1TK0 B;  2IL3 A;  3C71 A;  2PU9 C;  1GWC A;  1TRU A;  2QSI A;  4AJ7 A;  2C80 A;  2A2P A;  2YJH A;  19GS A;  1ERW A;  4ML1 A;  4WF5 A;  5GAP D;  2FY6 A;  1PQN A;  2B3S A;  4O32 A;  4K7O A;  2XC2 A;  4MJC A;  2RII A;  4IQA A;  4KUN A;  1M9A A;  1N2A A;  4MPF A;  2IPA A;  4KW6 A;  1A23 A;  4ECJ A;  4TN8 A;  2KHP A;  3H4K A;  3D21 A;  5G30 A;  5ECI B;  5HFG A;  1ZMA A;  3ISO A;  3NOF A;  1GSQ A;  1CQH A;  1PMT A;  2E0Q A; 
#chains in the Genus database with same CATH homology
 1GSE A;  5JCG A;  4TVE A;  4Z2U A;  5A5H A;  1RK4 A;  3GTU A;  5HR3 A;  4N30 A;  2FWH A;  5IO0 A;  3TRX A;  2I1U A;  1Z9H A;  1SVL A;  3DYR A;  4X43 A;  4ECC A;  1OC9 B;  3LW9 A;  2MZC A;  2EIO A;  1OE7 A;  1O8W A;  1X0R A;  1TRV A;  5A1N B;  2WS2 A;  1BED A;  2GS3 A;  2CVB A;  5DAL B;  1TU8 A;  2YJ7 A;  4IN0 A;  1SKR B;  2RLI A;  2HXK A;  2KP2 A;  6GSS A;  1XIY A;  3EWL A;  1PX7 A;  1Y6E A;  4O5U A;  1U3A A;  4GWR A;  2C0D A;  3F4S A;  4MAB A;  1E2Y A;  4FYC A;  3KXO A;  1DE2 A;  2PVO C;  4GSN A;  4E8H A;  1O8X A;  1JZD A;  4KSM A;  3TCO A;  4MF7 A;  3IOS A;  2HZE B;  3HVX A;  3IC4 A;  1QUW A;  4D73 A;  3R3E A;  2EFC A;  5F07 A;  2YWM A;  3APO A;  2FWG A;  16GS A;  2JAC A;  3F9U A;  1SL0 B;  1AAZ A;  1NSW A;  4GF0 A;  3FMW A;  4BL7 A;  1EEM A;  2LKU A;  2M46 A;  2PUK C;  5ELA A;  3UAP A;  1F37 A;  5ELG A;  5AIV A;  1HNB A;  4ZL8 A;  1PD2 1;  3DKS A;  4EIQ A;  3M0F A;  1J0F A;  2CQ9 A;  2X49 A;  4OO5 A;  1KBN A;  3FHK A;  4FYU A;  1ILO A;  3U5R E;  3C8E A;  3TJF A;  5KEJ A;  1WMJ A;  2GT5 A;  3FKF A;  3PIN A;  1SVO A;  3BOA A;  2H66 A;  3IXR A;  4HI7 A;  2XHF A;  3LXT A;  1C72 A;  4GXZ A;  1KEB A;  2YWI A;  4L5L A;  2HQT A;  5IMZ A;  1SYR A;  5IQY A;  1GUM A;  2A4V A;  3LXZ A;  5J4V A;  1N25 A;  5A4V A;  20GS A;  5COH A;  4MDC A;  3HD5 A;  5CNW A;  4BWS A;  4WR5 A;  3BCK A;  4MNN A;  4ML6 A;  3ZRD A;  1J08 A;  4L5O A;  4ID0 A;  3TRP A;  3P2A A;  4TOP A;  3WGD A;  3CMI A;  5CP1 A;  4Q5F A;  4PQH A;  2IJY A;  4XRD A;  2X8C A;  5HR2 A;  1EP7 A;  4OMV A;  4ZB8 A;  4MH3 A;  1G7O A;  1FO5 A;  3LQ7 A;  1ERV A;  2CVK A;  4XS4 A;  4F9Z A;  5LNK e;  17GS A;  2L6C A;  3ZTL A;  4F2I A;  2L4Q A;  5D9V A;  1BG5 A;  1F2E A;  2IMK A;  3H93 A;  4K2X A;  3FR9 A;  1PKZ A;  4V2L A;  2N5F A;  3WGX A;  6GSU A;  4GRF A;  4QL9 A;  1EOH A;  1YJ6 A;  1OC8 A;  5LCZ A;  3E0U A;  4YAP A;  1AQV A;  4Z7X A;  2R3X A;  4FH8 A;  3CTF A;  2YP6 A;  2XBI A;  3D4T A;  3O3T A;  2HLS A;  3KM6 A;  5J5N A;  4N0V A;  4YH2 A;  2N5B A;  1AXD A;  4P3Y B;  2YNX A;  2I4A A;  4MJE A;  3EMX A;  4G10 A;  1BAY A;  3ZIT A;  5J41 A;  5DQY A;  5HFI A;  2L6D A;  11GS A;  3VFI A;  1UN2 A;  4AKH A;  4Z2R A;  5G31 A;  2LQO A;  3GIX A;  5DBQ A;  3F3R A;  3A3T A;  4NHZ A;  1Q4J A;  1VF1 A;  2H01 A;  2HFD A;  2VLU A;  3ERF A;  2C4J A;  5IMA A;  3KCM A;  2LJR A;  3MNG A;  5DJL A;  4BWQ A;  2PPT A;  2GZP A;  3Q19 A;  5F0G A;  3KEB A;  3I69 A;  2H1L A;  4PQI A;  4MP4 A;  2KP1 A;  2OA7 A;  1HNC A;  4WET A;  5BRT A;  1GTU A;  4V1A g;  3DEX A;  1PRX A;  3F0I A;  4I6X A;  3GKM A;  6GSV A;  3SBC A;  5DQS A;  2GVP A;  2F3M A;  5KN1 A;  2H1G A;  2B6M A;  3MSZ A;  1XBS A;  1FOH A;  1TXU A;  2B5X A;  3K8N A;  13GS A;  2LUS A;  1EEJ A;  3ZFB A;  2L5L A;  22GS A;  3ZFL A;  4TR3 A;  2JL4 A;  2VL2 C;  4TXO B;  4CW9 A;  3QAW A;  4PTS A;  5F06 A;  3CXG A;  1Y25 A;  4KDX A;  1XFL A;  3IK9 A;  5HR1 A;  3UVH A;  4MZB A;  5KN0 A;  1G0T A;  3IAS 2;  2O7K A;  1OKT A;  4V2M A;  2ON5 A;  4G0L A;  1V57 A;  3F6F A;  2WDU A;  1VF2 A;  4K0G A;  3ME7 A;  2R0P A;  4HQZ A;  3JCM L;  3AY8 A;  1EGR A;  7GSS A;  2E2G A;  1YEX A;  5IOX A;  2EFH A;  1EWX A;  5HQP A;  2CZ2 A;  3TB2 A;  3KH7 A;  3DRN A;  2A2R A;  3QCP A;  2JZT A;  4OO4 A;  2AJQ B;  5ECH B;  5IOW A;  4HS1 A;  3J7Y b;  2EIQ A;  5AIS A;  1GUL A;  2X4A A;  1UA5 A;  2CAQ A;  1M99 A;  4IP6 A;  3A2X A;  6GST A;  1UC7 A;  5IIZ A;  2H1B A;  2H0H A;  5A5H B;  3GTU B;  5JCU A;  2PER A;  4KX4 A;  3I6A A;  5JWO B;  2QA1 A;  4KAE A;  2IFQ A;  3UEM A;  1GLQ A;  3QDN A;  4IHU A;  3RAZ A;  3TKS C;  2EC4 A;  4USS A;  2H73 A;  1XXU A;  3L9V A;  2X8G A;  1F9M A;  4KSO A;  1Z3E A;  5J40 A;  2L4C A;  1TDI A;  5CRE A;  4KGI A;  1X5D A;  2DBC A;  2YOI A;  1B48 A;  1S3C A;  1PL2 A;  2P31 A;  1T4Z A;  4G2E A;  3TKS A;  1G6W A;  4NV2 A;  2VL3 A;  3TRQ A;  3GL3 A;  2P0G A;  1XWC A;  2GSS A;  4MLY A;  4K2D A;  2CZ3 A;  5KOW A;  4W66 A;  2C8U A;  1J9B A;  3GKX A;  4CHS A;  4H86 A;  1W89 A;  2L59 A;  1ZYQ B;  2QGV A;  2KUC A;  1GSU A;  2QKE A;  4FO5 A;  4WXT A;  3P8W A;  2YWO A;  2FHE A;  4MCU A;  2JSZ A;  2K6V A;  3I43 A;  2GST A;  3GRX A;  4D73 B;  3GV1 A;  1WJK A;  1M7T A;  1XPV A;  3ZL5 A;  1VRS D;  3O6T A;  2J23 A;  4X1U A;  1WIK A;  3TGZ A;  3US3 A;  2OE0 A;  9GSS A;  4BL7 B;  3GN3 A;  2AV4 A;  3NIV A;  4L8E A;  5D9X A;  3FZ5 A;  2GZZ A;  2N5A A;  2RUF A;  2CAI A;  1JFU A;  3CYN A;  3PH9 A;  4KDU A;  4TKY A;  1O7U A;  3EVI A;  4EL1 A;  2YPM A;  1SU9 A;  1MDJ A;  5HFK A;  2XBQ A;  3IPZ A;  1PN9 A;  4AKI A;  1HD2 A;  1PKW A;  3FR6 A;  2YZH A;  2MMA A;  2PWJ A;  4DSR A;  4QQ7 A;  3UBK A;  4AKG A;  4ZL9 A;  2K9F A;  4KND A;  5IMV A;  2NVL A;  1XWK A;  4G19 A;  2ZNM A;  3IV4 A;  1A24 A;  4WBJ A;  1T3B A;  5IPG A;  3TJG A;  2IN3 A;  3EUR A;  3TKR A;  2K8V A;  1IYH A;  2CA8 A;  4MJB A;  2M80 A;  2DKH A;  3ZRE A;  3L78 A;  4MA9 A;  2VLT A;  4OFT A;  3RHC A;  3P90 A;  3TJK A;  1XOB A;  2KOK A;  4CDO A;  2PMT A;  3ZLP A;  1XOA A;  3HJP A;  2X8H A;  4ZB9 A;  2R0C A;  1V58 A;  4J2F A;  3CSI A;  2OBK A;  5ECO B;  2LRC A;  4IGJ A;  5AGY A;  2H71 A;  1TI3 A;  3D0Z A;  4IBP A;  2GGT A;  2ALB A;  1A2J A;  2GT6 A;  2P5Q A;  2VOC A;  2TRC P;  3BBY A;  1DUG A;  4EDZ A;  2VCX A;  1EOG A;  5HR0 A;  2F51 A;  2H19 A;  3FZA A;  1NHY A;  4XS4 B;  3HVS A;  2C1Y A;  3M3M A;  1JLV A;  1GSD A;  4TXV A;  1ZYN A;  3H8Q A;  2DMM A;  1S3A A;  1JZO A;  1M0U A;  4O92 A;  2YCD A;  3L4N A;  2GQM A;  5DCG A;  5GST A;  5C04 A;  2MMO A;  4O7H A;  1NM3 A;  1EV4 A;  2WFC A;  4JR6 A;  2LTK A;  4TR1 A;  3FEU A;  5ECM B;  4HZ4 A;  4ICY A;  4ZL7 A;  4ZBB A;  2I3Y A;  1XW5 A;  1BYE A;  2VCZ A;  2CX3 A;  4OFN A;  2O8V B;  4N10 A;  2M72 A;  4POK A;  4G9H A;  3GH9 A;  5L71 A;  5C00 A;  3GKK A;  1EZK A;  3N5O A;  2VD1 A;  3RPN A;  4RUV A;  1O6J A;  4GQF A;  14GS A;  2JSY A;  1SD9 A;  2HSN A;  1Y1U A;  4QMK A;  2DLX A;  4IKH A;  3LYK A;  5E4W A;  1TK8 B;  1PL1 A;  4XS1 A;  1I5G A;  4XCS A;  4ZB7 A;  4IQ1 A;  3GHA A;  4RQR A;  1PA3 A;  5IM9 A;  2P5R A;  1M2A A;  1SK0 A;  1T4Y A;  2NTO A;  1YKA A;  1E6B A;  2O87 A;  2H30 A;  5H5S A;  3KH9 A;  1RW1 A;  4OCF A;  3VWV A;  4BPY A;  3DWV A;  5GSS A;  5GZZ B;  2IWT A;  1FG4 A;  2B5Y A;  3LWA A;  4K5S A;  3RBT A;  4MJA A;  3M8N A;  1Z5Y E;  4CY6 A;  3D4M A;  2O89 A;  1N8J A;  5ECS A;  2OBI A;  2V6K A;  2FNO A;  2L57 A;  5J4Y A;  2FWF A;  3FR3 A;  3TKQ A;  1SJ6 A;  4K8M A;  5CRG A;  5G1K A;  1CQG A;  2PVQ A;  1SK2 A;  2OAC A;  1MDI A;  4YAV A;  3GH6 A;  4XS6 A;  2JZS A;  4AI6 A;  3APS A;  1ABA A;  1THO A;  4JE1 A;  3MAK A;  2HSY A;  2HNL A;  2H1D A;  1GRX A;  4ZB6 A;  2DJJ A;  2RM6 A;  1S3D A;  3M9J A;  1ERU A;  2JU5 A;  2WGR A;  3HJO A;  2LV3 A;  2MBT A;  3F63 A;  4J56 E;  3KP8 A;  2H75 A;  3U6V A;  2C0F A;  2EIR A;  1T1V A;  2H0I A;  2VD0 A;  2LEG A;  4NAX A;  5D96 A;  1OYJ A;  2LJA A;  1TRW A;  2YV7 A;  1T00 A;  4PUA A;  1GTB A;  2C3N A;  5G2Z A;  3IE3 A;  3GNJ A;  4YKG A;  2B1K A;  4A5P A;  5KOX A;  1GTA A;  4BVY A;  4XRA A;  4KF9 A;  1DBY A;  3A5I A;  4LMW A;  5BMU B;  4F0C A;  4HU7 A;  4PX1 A;  2VM1 A;  2V41 A;  1XVQ A;  1K0B A;  5JWR B;  3QD9 A;  2OJL A;  5ECL B;  2JAD A;  6GSX A;  3C7M A;  1FW1 A;  4ZBD A;  2YAN A;  2K18 A;  4ZIL A;  3Q6O A;  4YQV A;  2GTU A;  3VI5 A;  4KB3 A;  2R0G A;  1TOF A;  6GSY A;  4DEJ A;  3PGT A;  2HT9 A;  3BJ5 A;  2IFQ B;  1USB A;  4G01 A;  2H70 A;  4ULX A;  1EGO A;  2AUV A;  4K9Z A;  2IMD A;  1XCC A;  4ZXG A;  2R4V A;  5G5E A;  2NDO A;  2DIZ A;  4AJ8 A;  2DC5 A;  3DIE A;  4HZ2 A;  2H76 A;  3EU3 A;  2VCV A;  1GNW A;  3IK7 A;  4ECI A;  1MD4 A;  1GNE A;  3G7Y A;  2HSM A;  4HQS A;  3A2V A;  4G0I A;  3FZ9 A;  3UL3 A;  1QK8 A;  3HHV A;  1DE1 A;  4OD7 A;  2YN1 A;  2OAD A;  4YQU A;  2TRX A;  2WRT A;  1FB6 A;  3KTL A;  1U6T A;  3VK9 A;  1XVW A;  3ED3 A;  4BVX A;  4GCI A;  2QA2 A;  4IS0 A;  4WBR D;  2PGT A;  3R2Q A;  3VPQ A;  2I9H A;  5CYY A;  4ZIJ A;  2VLV A;  2HYX A;  1X5E A;  3TJB A;  4PQ1 A;  5CRW A;  4OFM A;  1B8X A;  3GKN A;  4G0K A;  4WF4 A;  4XHM A;  5KN3 A;  2FWE A;  4X4J A;  4Q5R A;  1ZYP A;  3PPU A;  4AJ6 A;  3ERG A;  5IO2 A;  4N0Z A;  4JR4 A;  1MEK A;  2GZY A;  1TU7 A;  1SYX A;  12GS A;  3DXB A;  4NWY A;  2R6K A;  5A4U A;  5CRH A;  5J4U A;  4V2N A;  3UVT A;  2FUG 2;  1BG1 A;  1A0F A;  3DGQ A;  2FD3 A;  1V40 A;  5EPF A;  3UIW A;  2ES7 A;  3FYG A;  5ENU A;  4MF5 A;  1O81 A;  1A2M A;  4F03 A;  1SJI A;  3HXS A;  3NZN A;  3LJR A;  1GSY A;  2HRF A;  5F05 A;  3LEF A;  1R7H A;  2HSH A;  3GL5 A;  3MWH A;  3QFA C;  1K0N A;  1BQ7 A;  1SL2 B;  3VWX A;  3E3E A;  5JCW A;  5BMU A;  3A5W A;  4POL A;  1K0C A;  1A2L A;  1GUH A;  1YQ1 A;  1TI1 A;  5GAN D;  4KDY A;  1M2B A;  1QQ2 A;  1OKD A;  1TP9 A;  2H72 A;  3FZ4 A;  3WYW A;  2V2G A;  5ID2 A;  4MMM A;  3MYD A;  2NBS A;  4GLT A;  1GH2 A;  3EIN A;  4K7I A;  1JZR A;  1F6M C;  5CRD A;  2H6X A;  3ZYW A;  2DJ3 A;  3HZ8 A;  4TRX A;  3EPT A;  4N11 A;  2H8L A;  2FA8 A;  4GQC A;  4RQX A;  2C0G A;  5EL8 A;  5F8B A;  2V1M A;  2C0E A;  5G1L A;  3QPM A;  4KCA A;  2F9S A;  3CRU A;  3LFL A;  5E59 A;  2O5V A;  3S9F A;  2VIM A;  3ME8 A;  1WPI A;  3UOM A;  2A4H A;  3C1S A;  2KLX A;  1OE8 A;  2VO4 A;  4TR1 B;  4I5Q A;  1TKD B;  3P7X A;  1K0O A;  4N3Z A;  4J57 E;  2WUL A;  3WT1 A;  2B5E A;  3EC3 A;  4K5R A;  4HJM A;  5A34 A;  5DAK A;  1T8E B;  2PBJ A;  3TDG A;  2CVD A;  5B6M A;  3QR6 A;  4E8E A;  4L0U A;  1O85 A;  2HSN B;  2WZ9 A;  2E2M A;  2HRK A;  2H6Y A;  4XTS A;  1K3Y A;  3G9B A;  4MK3 A;  2GQK A;  18GS A;  1Z6N A;  1V2A A;  4EO3 A;  4EXJ A;  2VKZ G;  3LOR A;  3KGK A;  4YKF A;  2BMX A;  1KNG A;  2I81 A;  4Q5Q A;  4EF0 A;  4DVC A;  4MF6 A;  1QXH A;  1Z7P A;  3ZZX A;  1AQX A;  5D9W A;  3G7J A;  5H5R A;  1ZGN A;  2HI7 A;  3TKP A;  5H5Q A;  1ML6 A;  4LMV A;  3FW2 A;  1G7E A;  1TXX A;  2WCI A;  3OR5 A;  3I9V 2;  2H1A A;  2F8A A;  4IW9 A;  1UVZ A;  2C3T A;  1GSS A;  3D6I A;  1U3I A;  2GQL A;  4HDE A;  2IMF A;  4DSS A;  4X0X A;  1MTC A;  5CO3 A;  1A8Y A;  1SKS B;  5JWQ B;  2GSR A;  3ZIJ A;  4POM A;  4JED A;  2LJK A;  4NMU A;  2OT3 A;  4DSQ A;  1K3L A;  4LLR A;  5G5F A;  4MZC A;  1XWG A;  3W6G A;  4KH7 A;  3DVX A;  4QL7 A;  3M1G A;  4LL4 B;  2LNS A;  4F82 A;  1NW2 A;  1WOU A;  2VUP A;  1TK5 B;  2X99 A;  3IBH A;  2YZU A;  1TW9 A;  2JZR A;  1HNA A;  3FK8 A;  4EKZ A;  2UZ8 A;  1SL1 B;  1V98 A;  4I2U A;  4BA7 A;  1VGL A;  2HZF A;  3HY2 A;  3FRC A;  3EE2 A;  4OCE A;  2H0G A;  2H6Z A;  3RHB A;  2CX4 A;  3CSJ A;  1Z6M A;  4BVY B;  3FY7 A;  5INY A;  2DSA A;  4IP1 A;  2UV8 G;  5ABR A;  3N9J A;  3CRT A;  2VM2 A;  1SEN A;  1R4W A;  4HU9 A;  1ZZY A;  3UJ1 A;  2MBS A;  5ECQ B;  5FWG A;  1SKW B;  4KE3 A;  1RQM A;  2BJX A;  4WR4 A;  1GUK A;  3L0H A;  1XZO A;  1ON4 A;  1SVM A;  1JLW A;  4POB A;  2L5O A;  2B7K A;  4NHW A;  1WWJ A;  2X64 A;  3GA4 A;  3F4R A;  3GX0 A;  3IR4 A;  3W8S A;  4TR4 A;  1HYU A;  3VWW A;  1FAA A;  5A4W A;  1YF0 A;  1X9M B;  3BD2 A;  1LJR A;  1SD8 A;  3LGC A;  4KA0 A;  3GUS A;  1B4Q A;  3GUR A;  2LRN A;  3HMJ G;  3RPP A;  1TTZ A;  3ZIV A;  4MH2 A;  3VI7 A;  2WB9 A;  3HA9 A;  4PNF A;  5B8B A;  2OKA A;  1IYI A;  4EDY A;  1A0R P;  2EFE A;  2GLR A;  3M9K A;  1SJZ A;  2CV4 A;  2HSM B;  4GSS A;  4MZW A;  1ZOF A;  10GS A;  1R5P A;  3GSS A;  1OAZ A;  4HJ2 A;  5ECK B;  1DSB A;  3C73 A;  3DVW A;  2BTO T;  4EUY A;  4AF2 A;  2C3Q A;  5J47 A;  3HZ4 A;  4EIP A;  2F8F A;  3WT2 A;  4BVX B;  3HVV A;  3EMP A;  1XW6 A;  3KMN A;  4GTU A;  3L9U A;  3L9S A;  2LNT A;  3APQ A;  2K8S A;  3QOU A;  1TJD A;  3DML A;  1AQW A;  3WGE A;  3SWL A;  1FVJ A;  4EVM A;  2IMI A;  3CTG A;  1FOV A;  2DJK A;  2DML A;  1K0A A;  3MDK A;  4TR0 A;  3MIX A;  2FLS A;  5AIX A;  3F4T A;  3DD3 A;  2IIY A;  1LU4 A;  3GFK A;  4FYB A;  1U88 A;  4K6X A;  5D73 A;  1YZX A;  1ZL9 A;  2LRT A;  1HQO A;  4KCE A;  1PX6 A;  5J9C A;  1JHB A;  1AW9 A;  4K0N A;  3EYT A;  3Q74 A;  1U87 A;  3HKR A;  2AHE A;  1V9W A;  4WKW A;  2D2Z A;  1Z7R A;  2WJU A;  1KTE A;  1OC9 A;  3IA1 A;  3VWU A;  3ZML A;  5EY6 A;  1R26 A;  2YWN A;  5DJM A;  3RDW A;  2V32 A;  5A1N A;  2DJ1 A;  2LS5 A;  5DAL A;  5D93 A;  4JRR A;  5J3R A;  3KP9 A;  1GP1 A;  4TW5 A;  4PUR A;  1NHO A;  4PUF C;  3TJJ A;  3KTB A;  2QC7 A;  3IHQ A;  4NPB A;  1G6Y A;  2GSQ A;  3HCZ A;  4LL1 B;  2LQQ A;  1PGT A;  4Z2T A;  4I97 A;  3KMO A;  1WP0 A;  4XIH A;  1TRS A;  1YVL A;  2GDR A;  4FIW A;  4IJ3 A;  5ID2 B;  2V6O A;  2VCW A;  2VCT A;  1MDK A;  4YQM A;  4FQU A;  2LST A;  1BJX A;  4ZBA A;  5ECR B;  5D9T A;  4GDF A;  3CSH A;  2ON7 A;  3ZVJ A;  3QAV A;  1M2D A;  2MMN A;  5LD0 A;  3D22 A;  3LSZ A;  2TIR A;  2H74 A;  5DCH A;  3TUE A;  1GTI A;  1O73 A;  2MMZ A;  2HZE A;  1EP8 A;  4K1F A;  3QFB C;  2CT6 A;  3KD0 A;  4JBB A;  1ACV A;  4LA1 A;  1A8L A;  3V1W A;  1GL8 A;  2RUE A;  5B8A A;  3TOU A;  3UBL A;  4HUA A;  3KZQ A;  4IVF A;  4PNG A;  4F0B A;  3ERW A;  4IEL A;  2OE3 A;  2REM A;  4JZQ A;  1F3A A;  3ZVJ D;  3EU4 A;  5D8I A;  1ERT A;  1ST9 A;  3HYP A;  5FHI A;  1FHE A;  2DJ0 A;  2ZUP A;  4NV5 A;  5A34 B;  1PN0 A;  3GST A;  5DAK B;  3VLN A;  2ZCT A;  3LYP A;  1R5A A;  1WE0 A;  2E7P A;  1EV9 A;  2Z9S A;  1XWB A;  2HRK B;  4ISD A;  4WEY A;  3IDV A;  3LG6 A;  2R5G A;  1B9Y C;  1QMV A;  4HEA 2;  3TOT A;  3QMX A;  2XPE A;  3VPT A;  5EVO A;  2HRA A;  3F3Q A;  1URM A;  8GSS A;  2AAW A;  4ACS A;  5DVB A;  5KN2 A;  5AN1 A;  2RM5 A;  1LBK A;  3HDC A;  4AKX B;  4V1A p;  3D5J A;  2FA4 A;  1OC3 A;  4EE0 A;  2IME A;  1F3B A;  1GSF A;  2HE3 A;  3IRA A;  2DJ2 A;  2HRN A;  3C1R A;  1OVN A;  1M9B A;  4I8B A;  1YKC A;  1H4O A;  2R37 A;  3HJM A;  1X9W B;  3PR8 A;  3QAG A;  1XWA A;  4DSS B;  1X9S B;  2O85 A;  2VL2 A;  1QGV A;  4HOJ A;  2FGX A;  1K0M A;  3UMA A;  1AIU A;  1FB0 A;  4O5R A;  1T7P B;  1SK1 A;  1PSQ A;  1AUC A;  1YF1 A;  3BCI A;  2G0F A;  1BX9 A;  4JU5 A;  2FCH A;  2VL9 A;  3TU3 B;  2AYT A;  2MYG A;  3GX8 A;  1JZW A;  3UAR A;  3A2W A;  5DDL A;  3J7Y k;  2PN8 A;  2G2Q A;  3IC8 A;  4PGT A;  3W8J A;  1YEP A;  3F6D A;  1MD3 A;  2B7J A;  4E68 A;  2YV9 A;  4RI7 A;  3TKS E;  1VF3 A;  1K3O A;  2A2S A;  4NXI A;  1THX A;  4IJI A;  1X5C A;  1ZYE A;  5IMC A;  3GMF A;  3O76 A;  3KJY A;  5FT3 A;  1QFN A;  3E9J B;  1BF5 A;  2DIY A;  5IMF A;  1H75 A;  3KIJ A;  2OE1 A;  1YDK A;  1YY7 A;  1K0D A;  5J9B A;  1XW9 A;  5IPH A;  1AC1 A;  5CAX A;  1FVK A;  2EFD A;  2XPD A;  2AB6 A;  2VAF A;  1I9D A;  4ILF A;  3ZMK A;  5IMD A;  1B4P A;  3Q18 A;  4K7N A;  2NPB A;  2J9H A;  4L0W A;  3G7I A;  3IHG A;  4Q5N A;  4CY8 A;  3WD6 A;  5ECN B;  2B1L A;  5ECP B;  3VUR A;  1VF4 A;  3H1N A;  5B7C A;  3F8U A;  6GSW A;  1Q98 A;  3GYK A;  4AGS A;  4MPG A;  3CBU A;  1WRY A;  3IAM 2;  4PXO A;  4EC0 A;  4ECB A;  4RI6 A;  2DKI A;  5B6N A;  4OWY A;  1GLP A;  4O5Q A;  5A5K A;  1ZCP A;  2R2J A;  3H79 A;  1B9X C;  2VCQ A;  4GST A;  3CWG A;  4I2T A;  1W4V A;  4TXO A;  1TK0 B;  2IL3 A;  3C71 A;  2PU9 C;  1GWC A;  1TRU A;  2QSI A;  4AJ7 A;  2C80 A;  2A2P A;  2YJH A;  19GS A;  1ERW A;  4ML1 A;  4WF5 A;  5GAP D;  2FY6 A;  1PQN A;  2B3S A;  4O32 A;  4K7O A;  2XC2 A;  4MJC A;  2RII A;  4IQA A;  4KUN A;  1M9A A;  1N2A A;  4MPF A;  2IPA A;  4KW6 A;  1A23 A;  4ECJ A;  4TN8 A;  2KHP A;  3H4K A;  3D21 A;  5G30 A;  5ECI B;  5HFG A;  1ZMA A;  3ISO A;  3NOF A;  1GSQ A;  1CQH A;  1PMT A;  2E0Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...