2IMKA

Structures of an insect epsilon-class glutathione s-transferase from the malaria vector anopheles gambiae: evidence for high ddt-detoxifying activity
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
220
structure length
220
Chain Sequence
SNLVLYTLHLSPPCRAVELTAKALGLELEQKTINLLTGDHLKPEFVKLNPQHTIPVLDDNGTIITESHAIMIYLVTKYGKDDSLYPKDPVKQARVNSALHFESGVLFARMRFIFERILFFGKSDIPEDRVEYVQKSYELLEDTLVDDFVAGPTMTIADFSCISTISSIMGVVPLEQSKHPRIYAWIDRLKQLPYYEEANGGGGTDLGKFVLAKKEENAKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Epsilon-class Glutathione S-transferase
publication title Structure of an insect epsilon class glutathione S-transferase from the malaria vector Anopheles gambiae provides an explanation for the high DDT-detoxifying activity
pubmed doi rcsb
source organism Anopheles gambiae
molecule tags Transferase
total genus 83
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2006-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2imkA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2imkA01
1TW9A 1U88A 2H0IA 3IC4A 5JWOB 5DCGA 3WYWA 1PD21 16GSA 2RUFA 3N9JA 3R3EA 2VIMA 2HNLA 3KEBA 3TJGA 1Y25A 4DVCA 3C73A 4JR6A 5HR2A 3ZFLA 1GUKA 2FWFA 3KZQA 4ACSA 1JHBA 3CMIA 4IJ3A 5HR3A 3JCML 17GSA 2OBIA 6GSYA 5E4WA 5DJLA 2MMOA 4IP6A 3MNGA 2A4VA 4K9ZA 3FR9A 3IK9A 2GVPA 1XXUA 2R37A 1XWBA 3GFKA 5AN1A 4PGTA 1TXXA 4O5RA 3FHKA 1EP7A 3J7Yb 3DGQA 3IBHA 3TOUA 4MDCA 1A8YA 4EDZA 3E3EA 4FO5A 1PX6A 2PBJA 4BPYA 4YQUA 1W4VA 4I5QA 3KD0A 2HFDA 1SD8A 4WETA 5ID2B 1XW6A 3IAS2 3NOFA 3G7JA 2K8VA 2YANA 4IJIA 3TKSC 3GL3A 4ULXA 1R5AA 4D73B 1T00A 3LYPA 4K1FA 1MD4A 1KTEA 1PRXA 4NXIA 5B7CA 2WDUA 1M9BA 4JEDA 1QFNA 5HFIA 5D96A 1B8XA 2YWOA 4J57E 3ZVJD 3C8EA 2E7PA 2LRCA 1NW2A 1ST9A 18GSA 5ECRB 3CSHA 1WWJA 2HZEA 4RI7A 1V58A 3GTUB 4CHSA 1HD2A 4MJCA 2L6CA 4BVYB 1OC9A 4G0KA 5ECOB 2NBSA 3APSA 3TKRA 3TJFA 4MJEA 4O7HA 2ON5A 2OA7A 1R4WA 3FKFA 3GKNA 4DSSB 1MDKA 1X5EA 1QXHA 2AAWA 4MPGA 2CZ2A 4IW9A 1A23A 4KDXA 4AF2A 1FB0A 1NM3A 4EUYA 5G2ZA 4K7OA 4KDUA 4MPFA 1WMJA 2IL3A 1SL1B 5HFKA 5J9BA 3Q6OA 4N0ZA 1R5PA 4JR4A 3KXOA 5IOWA 2V6OA 2O8VB 2IN3A 4HDEA 2YNXA 4V2LA 5ENUA 4FYUA 2QC7A 2F51A 3VURA 2X8GA 3FYGA 3ZTLA 2MYGA 4L8EA 2G0FA 4TVEA 1VF4A 4RQXA 3FZ9A 3LJRA 5F0GA 4WEYA 1OE8A 6GSWA 5FWGA 3KTBA 1K0DA 1Z9HA 4TXOA 4ZB9A 3APQA 3A2WA 1SKWB 3VFIA 3IC8A 3D4TA 1S3AA 1EP8A 5DQYA 5CRHA 1YZXA 4GXZA 5J9CA 2HRKA 2HYXA 4POBA 3RPPA 1WRYA 1XOAA 3EWLA 4ECIA 3HZ8A 4MH3A 2HSNB 3K8NA 1GLQA 1NSWA 3GNJA 3GHAA 4LA1A 5DDLA 2H66A 2RM6A 4O32A 3P7XA 3IXRA 1YF1A 2XHFA 4TOPA 3WT1A 4KE3A 3PR8A 3F4TA 2JL4A 4H86A 4OWYA 2DC5A 1PX7A 5ECSA 2B5EA 3Q19A 4XS4A 3HHVA 2YPMA 1GSFA 5G1LA 1M0UA 1BG5A 3QCPA 2VL2A 3CSIA 4QL9A 5IPGA 4XHMA 3F3RA 4ZIJA 4TXVA 1M2AA 2DJ3A 3FZ5A 3RPNA 2V41A 4ML6A 3KP9A 4KCAA 4KAEA 3ISOA 1SJZA 4V1Ag 2B7KA 5EL8A 2GT5A 4HU9A 4E8HA 1SYRA 1K0OA 2XC2A 2GSTA 2EIQA 2OBKA 1GNEA 3ZREA 3VPTA 2EC4A 4MZCA 22GSA 4WR4A 3W8SA 1M2DA 4K7NA 4OO5A 3NIVA 4N30A 3LQ7A 4EF0A 2PMTA 1KEBA 2OE0A 4JE1A 3ZIJA 2VM1A 1H4OA 2GTUA 5DCHA 3EC3A 1LU4A 5JCGA 2FLSA 3PGTA 1YQ1A 2VCZA 1JLVA 5ECMB 6GSVA 1B9YC 2HQTA 2IFQB 5ECKB 3DWVA 5GSTA 2ON7A 2KHPA 1ML6A 2LKUA 5G1KA 1HNBA 1ABAA 2V1MA 1WPIA 4Q5RA 4KNDA 3WT2A 2RIIA 4IS0A 4I8BA 2YJ7A 5BMUA 5ELAA 1M99A 4J56E 4TR4A 2L57A 1YDKA 2PERA 5CRDA 2HSMB 2TIRA 2JZTA 1SKSB 2VCVA 2F3MA 3GRXA 1AQWA 1F9MA 1EZKA 1TDIA 4KGIA 1FB6A 2H01A 2KLXA 2CX3A 3CRTA 5ID2A 1TK0B 2NTOA 5HQPA 4YQMA 3GL5A 5CREA 3UOMA 1EWXA 1XWGA 20GSA 3PH9A 1JFUA 1GTIA 2LTKA 2DLXA 2X8CA 3HA9A 5IO2A 1A24A 5JWRB 4NHWA 1EOHA 2N5FA 3UARA 1F3BA 2IMIA 2H74A 4X43A 1KNGA 3IK7A 1B4PA 2PWJA 1K0CA 2VL3A 5IMVA 1K3OA 3GTUA 2DIZA 1J08A 3F63A 3KH7A 3F4RA 4KF9A 2H75A 7GSSA 2E0QA 1Q4JA 9GSSA 3F4SA 4EKZA 3LORA 4WF4A 1M2BA 3GYKA 4DSSA 3MDKA 5FHIA 2CVBA 2LEGA 2IMFA 2FWGA 1FW1A 4XS1A 4JU5A 3GMFA 2R2JA 2E2MA 5DVBA 14GSA 5KN1A 4ZILA 3I9V2 1JZWA 4L0WA 1HNCA 3AY8A 3BCKA 3ZITA 2HRFA 2HSHA 4XRDA 4OO4A 1ON4A 2N5BA 1BX9A 2X64A 3Q74A 2NPBA 4ZBBA 1EV4A 1V57A 3ZVJA 3EYTA 1ERTA 3HCZA 4HUAA 5JCWA 1MEKA 3ERWA 3M9JA 1A2LA 1FVJA 3E9JB 4GSSA 4MJAA 2H0HA 4HEA2 1PKWA 1DBYA 5ABRA 2L5LA 4IN0A 4TKYA 1LBKA 2V6KA 3LG6A 2IWTA 1SK0A 5D9TA 2MZCA 2YZUA 2H6XA 4LL4B 2DSAA 4OFTA 5A5KA 4GCIA 1ZCPA 2K8SA 2YWMA 3UAPA 5CRGA 4KSOA 3ME8A 3LXZA 3KGKA 5KN0A 2I4AA 3QAVA 1XW9A 5ELGA 3O76A 3Q18A 3J7Yk 5HR0A 1XIYA 2H6YA 1TRUA 2IPAA 4Z7XA 4ZL7A 2YCDA 1YKAA 1JZRA 3M1GA 1C72A 4G10A 1XFLA 3CXGA 5CAXA 5H5RA 3TUEA 4GQFA 3M8NA 5HR1A 1G6WA 1PSQA 3IDVA 1ACVA 1J0FA 5J4UA 5IMAA 2B5YA 2WZ9A 3BCIA 3LYKA 4PURA 1XWKA 5GZZB 4KB3A 2GSSA 4G2EA 2FWHA 1TI1A 4G19A 1ERUA 4EDYA 4GSTA 1S3CA 1HQOA 2CV4A 4IVFA 4FYCA 1AXDA 3HXSA 5EVOA 5GSSA 3O3TA 2OJLA 3RHBA 4ECJA 4F9ZA 4MCUA 3QD9A 1Z7PA 1PL2A 3O6TA 6GSUA 3EMPA 4EXJA 3UVTA 3KP8A 5G30A 3UBLA 5B8AA 4Q5FA 1F6MC 3TJKA 2J9HA 1K3LA 3HD5A 3IRAA 4JBBA 5D73A 2LRTA 2HLSA 2QSIA 2H30A 5ECPB 3KTLA 1THOA 3L78A 4FH8A 4TW5A 4RI6A 1AW9A 4OCFA 2GZYA 3DVWA 4V2NA 1TU8A 1FHEA 4GTUA 2IFQA 1A2JA 5KN3A 1SJIA 1GSQA 2YJHA 1EOGA 4PQHA 5A4WA 1TRVA 2FGXA 3UIWA 4LL1B 3WGDA 8GSSA 1GTUA 2MBTA 2GZZA 3LSZA 2C4JA 4I97A 5DQSA 4TN8A 4IQAA 3QOUA 1MDJA 4NWYA 3H93A 2AJQB 2WB9A 1GUMA 3G9BA 2HSMA 3US3A 4DSQA 13GSA 1LJRA 5F07A 2QGVA 4TR3A 4ECCA 2K6VA 2VD1A 1XVWA 5LD0A 2DMLA 3TJJA 3G7IA 2L4CA 4BL7A 4K0NA 3R2QA 2PUKC 1XVQA 4WBJA 2EIOA 2RLIA 2GGTA 5COHA 1H75A 1ERVA 2FD3A 4ILFA 1B48A 1VF1A 2CVKA 1MTCA 4IBPA 5D93A 3D0ZA 1WIKA 2CVDA 2MMAA 4EC0A 4GQCA 5AIVA 1AIUA 2NDOA 2XPEA 2H6ZA 1FOVA 2F9SA 1Z5YE 1XCCA 2K9FA 3WGEA 4GRFA 1GLPA 3I69A 3DYRA 1AAZA 4NMUA 6GSXA 5DBQA 4WXTA 2PU9C 3NZNA 2MBSA 5IMFA 1X9WB 3UJ1A 5DAKB 1T7PB 3FR6A 1SK1A 4E8EA 3VPQA 3VK9A 3EU3A 1OKTA 3E0UA 3ME7A 2QKEA 1TJDA 1U3AA 4BVXA 2H72A 3UVHA 1PN9A 1FVKA 3FW2A 3V1WA 2CZ3A 1YY7A 4KUNA 5E59A 1OKDA 3VWWA 5GAPD 3S9FA 1V98A 4Q5QA 2P5QA 1GH2A 1OVNA 1TP9A 4KDYA 4PNGA 4AJ6A 4XS6A 1SU9A 19GSA 3HJOA 4AJ8A 2VLVA 3H1NA 4EO3A 1AUCA 1G0TA 2GQMA 2VL9A 5C04A 1DE1A 2M72A 3GSSA 2B5XA 3GKMA 4K2DA 1N8JA 1TOFA 3EMXA 3KH9A 2H1DA 2LJRA 3APOA 3FK8A 1PGTA 3PINA 4KCEA 3A5WA 2XPDA 3FZ4A 2WGRA 1IYHA 2IMKA 4KA0A 4N11A 3P90A 1S3DA 1QQ2A 3RDWA 1TRSA 2P0GA 1BQ7A 1ERWA 1SJ6A 1EEJA 2HE3A 3N5OA 3CSJA 4PUAA 1Z6NA 3EU4A 4F0BA 2BTOT 3UL3A 2HRNA 4MP4A 4G9HA 5DALB 4KX4A 4ZB8A 3WGXA 3UEMA 4F03A 1DE2A 3GA4A 1YEPA 3TRXA 2DJ2A 1DSBA 1GNWA 4Q5NA 2H76A 3VWXA 1UC7A 3GKXA 2HZEB 3F3QA 4DEJA 1A0RP 1G7OA 2LJKA 2B3SA 2F8FA 5ECIB 1M7TA 1V9WA 1PA3A 2AUVA 5AIXA 3W6GA 4TRXA 2H1AA 4J2FA 3IHQA 2BJXA 2C8UA 1K0MA 3F0IA 4OD7A 1V2AA 1E2YA 3GV1A 1N2AA 2CA8A 2DMMA 2VM2A 1SK2A 1TK8B 1E6BA 3EVIA 2PVOC 4PQ1A 3EE2A 4KSMA 3BBYA 4GSNA 2P31A 3TKPA 3IA1A 1PMTA 2YV7A 3G7YA 4D73A 3TRPA 3TRQA 5JWQB 1ZMAA 1HYUA 1I5GA 3HVSA 3ZMKA 3DXBA 2O7KA 2PGTA 4MA9A 1OE7A 4X1UA 2C80A 3HDCA 3HYPA 2E2GA 3GX8A 5IIZA 5FT3A 2TRXA 2UZ8A 6GSSA 2ZUPA 1GTAA 2LNSA 1U6TA 2FA4A 4HI7A 3CYNA 2GLRA 2H19A 4PXOA 2O85A 1B9XC 2FHEA 4NAXA 2YWNA 4HQZA 4WKWA 4MK3A 2HXKA 4BVYA 1A0FA 2D2ZA 1X5DA 4L5OA 2OADA 3ZRDA 2GT6A 2DIYA 2C3TA 3L9VA 4HZ2A 2VL2C 2VD0A 2AB6A 3CTFA 4ZL8A 4ZL9A 1O8WA 5J5NA 3BD2A 3TKSA 1RQMA 2JZRA 3HVVA 3FY7A 4N10A 2GSRA 2OE1A 4XIHA 1J9BA 3LEFA 2GS3A 2KP2A 3A2XA 4ZBAA 4MJBA 4K8MA 5A4UA 10GSA 1PKZA 3FEUA 2FNOA 1MD3A 3TKSE 4BWSA 2CQ9A 4XCSA 3A3TA 4POMA 3M0FA 6GSTA 2LS5A 3IPZA 1TI3A 1GUHA 1GSDA 5ECLB 4XS4B 2YOIA 5G31A 3UBKA 1SL2B 1ILOA 4LMWA 3QFAC 5B6MA 2JSYA 1EV9A 5D9VA 4IP1A 1QMVA 4JRRA 1EGOA 2M80A 2XBQA 4USSA 4F82A 3HJPA 1EGRA 3KCMA 1AQVA 5H5QA 3QMXA 3TCOA 1WP0A 3ZL5A 4AJ7A 1GSEA 5LNKe 5J3RA 1Z3EA 3RAZA 5IOXA 1RW1A 4P3YB 4YQVA 3ZYWA 2PPTA 5G5FA 5IMZA 1GULA 4RUVA 2WCIA 2YWIA 1GSUA 2EIRA 3QAWA 4MZBA 4POLA 2R4VA 4WR5A 3VI5A 2VO4A 3L4NA 2KUCA 5DAKA 2WFCA 3U6VA 3F9UA 3QAGA 1UVZA 1T3BA 1GSSA 3ZZXA 4V1Ap 4PX1A 3BOAA 4RQRA 4K6XA 2HRAA 3KMOA 3L9UA 4HJMA 3P8WA 5LCZA 3OR5A 1PQNA 3VI7A 4CDOA 3VLNA 2LJAA 1GL8A 5ECNB 1CQHA 3I6AA 2I9HA 4MZWA 3PPUA 1TK5B 3SBCA 1MDIA 2GQLA 3D5JA 3TDGA 4I6XA 2VCQA 1GRXA 1HNAA 2C0DA 3KJYA 2VCXA 4MLYA 3SWLA 5G5EA 1SD9A 2B1LA 3VWUA 1SENA 2B7JA 4ZB6A 2A2SA 3M9KA 2A2RA 2LUSA 5A4VA 1A2MA 3TKQA 4GF0A 1Q98A 1GTBA 3ED3A 4IHUA 3HJMA 2GZPA 2L59A 4MF7A 2CAIA 1TKDB 4YH2A 3ERFA 2I1UA 1EEMA 1ZYEA 4ECBA 4ML1A 2K18A 1R26A 5DALA 1O73A 5JCUA 3IV4A 2OACA 3DIEA 1V40A 2L5OA 2HT9A 1UA5A 3RHCA 2FUG2 2VAFA 1A8LA 1OC8A 3GH9A 1UN2A 3GKKA 1YKCA 4YAVA 3ZLPA 2IIYA 1G7EA 3DKSA 3C1RA 2VUPA 3F8UA 2H8LA 2G2QA 3LGCA 1OC3A 1ZGNA 1VRSD 2LSTA 5L71A 4TR1B 1SYXA 5CO3A 1Y6EA 2FWEA 4X0XA 4MABA 1F37A 1CQGA 2GDRA 4PTSA 1THXA 3U5RE 4BWQA 2WJUA 1O85A 2AYTA 4EL1A 2IMEA 2WULA 4OCEA 4HZ4A 2B1KA 3MAKA 3DEXA 2H73A 2VCTA 3QPMA 4PUFC 3CTGA 5F05A 3LFLA 4HU7A 3A2VA 4O92A 3FRCA 3ZIVA 1NHOA 5IMCA 1XBSA 1ZYQB 3EURA 1B4QA 1JLWA 4QL7A 4GWRA 1O6JA 2C0EA 4G0IA 5B8BA 4K0GA 2JADA 1WOUA 3UMAA 2O87A 2FY6A 3QFBC 5KN2A 2LNTA 1XWCA 1G6YA 3ERGA 4K7IA 1QK8A 1XWAA 5GAND 2IMDA 5IMDA 3L0HA 3I43A 4NV2A 2WS2A 1VF3A 2RUEA 5IO0A 1Z6MA 4DSRA 1OYJA 3MSZA 3DRNA 2C1YA 2C0FA 1YEXA 5HFGA 2IJYA 5AISA 3H8QA 1F3AA 2VCWA 4BA7A 2CAQA 3GSTA 5AGYA 2HSYA 1OAZA 3F6DA 4IQ1A 1FG4A 3C7MA 3LWAA 2N5AA 3TJBA 3W8JA 2DBCA 1R7HA 2AV4A 5F8BA 5J41A 1DUGA 2XBIA 5CYYA 2L6DA 2I81A 4NV5A 3QR6A 1QGVA 5D9WA 4F0CA 3IR4A 2ES7A 5C00A 2B6MA 2YN1A 3GIXA 1KBNA 1YF0A 1AQXA 11GSA 1JZDA 2Z9SA 5DJMA 4NHZA 2L4QA 1XOBA 3KMNA 2VLTA 4OFMA 4MMMA 3EINA 4V2MA 5IPHA 4GLTA 1U3IA 1I9DA 2TRCP 4MF6A 2YP6A 3BJ5A 3H4KA 2PN8A 2HI7A 1T8EB 3D6IA 1QUWA 1K0AA 4I2UA 2VOCA 3CBUA 5ECQB 1JZOA 3L9SA 1ZOFA 3HZ4A 3VWVA 2MMNA 2GSQA 1T4ZA 4EE0A 2H0GA 5EY6A 2NVLA 2R6KA 3ZMLA 3GURA 1AC1A 2F8AA 3QDNA 2WRTA 2FA8A 2LV3A 1O81A 4ZBDA 1VGLA 1SL0B 2C3NA 2J23A 3IAM2 4L5LA 2H1BA 2GQKA 1ZL9A 3TGZA 4I2TA 1PL1A 2REMA 4IGJA 4MF5A 1OC9B 4PQIA 5IQYA 1SKRB 3RBTA 4FQUA 4OMVA 1USBA 3GH6A 4CW9A 1FAAA 2LQOA 3DVXA 2R5GA 3KM6A 1TU7A 1IYIA 3H79A 3D22A 4G0LA 3HVXA 2RM5A 3GX0A 2KP1A 2OE3A 3TB2A 1ZZYA 4AGSA 2CX4A 4POKA 4NPBA 5B6NA 2AHEA 1YJ6A 3P2AA 2CT6A 2R3XA 2V32A 2DJJA 1GSYA 2C0GA 5EPFA 3DD3A 1M9AA 2H71A 4ZXGA 5D8IA 1Z7RA 1T4YA 3ZFBA 3CRUA 2DJ0A 4BL7B 2JU5A 5CRWA 1K0NA 1WE0A 4HS1A 3WD6A 2VLUA 3GUSA 1GP1A 4N0VA 4OFNA 1X0RA 1URMA 4XRAA 3FZAA 4YAPA 1FO5A 2KOKA 4HJ2A 3KIJA 4ISDA 1X9MB 5H5SA 2H70A 1VF2A 2P5RA 4TXOB 4IELA 3C71A 1K0BA 4ID0A 3M3MA 3GN3A 1TTZA 1F2EA 5D9XA 1BJXA 4KH7A 2HRKB 2OKAA 3D21A 4QQ7A 4PNFA 4FYBA 2YV9A 2O89A 4F2IA 5ECHB 2C3QA 1TRWA 4KW6A 2ZCTA 1GWCA 1T1VA 5INYA 3IOSA 2ZNMA 4TR1A 1O7UA 2X99A 3HKRA 1XZOA 4BVXB 5KEJA 1X5CA 2LRNA 1K3YA 2JSZA 2MMZA 2HZFA 2YZHA 2JACA 4WBRD 2ALBA 3LXTA 2LQQA 3TOTA 1XW5A 3F6FA 3D4MA 4L0UA 2DJ1A 4MH2A 4HOJA 1BYEA 2X8HA 1O8XA 2V2GA 4XTSA 4LMVA 5F06A 1NHYA 3MWHA 4JZQA 2H1GA 4HQSA 1U87A 3FR3A 1BAYA 1WJKA 1W89A 4WF5A 5CP1A 2FCHA 2JZSA 4IKHA 2I3YA 5CNWA 3DMLA 1RK4A 4EVMA 4TR0A 2PVQA 3C1SA 3IE3A 2DJKA 2BMXA 1X9SB 4LLRA 2M46A 3HY2A 4FIWA 1BEDA 12GSA 5IM9A 1XPVA
chains in the Genus database with same CATH superfamily
1TW9A 1U88A 2H0IA 3IC4A 5JWOB 1M3JA 5DCGA 3WYWA 1PD21 16GSA 4Z2TA 2RUFA 3N9JA 3R3EA 2VIMA 2HNLA 3KEBA 3TJGA 1Y25A 4DVCA 3C73A 4JR6A 5HR2A 3ZFLA 1GUKA 2FWFA 3KZQA 4ACSA 1JHBA 3CMIA 4IJ3A 5HR3A 3JCML 17GSA 2OBIA 6GSYA 5E4WA 5DJLA 2MMOA 4IP6A 5BMUB 3MNGA 2A4VA 4K9ZA 3FR9A 2WVXA 3IK9A 2GVPA 1XXUA 2R37A 1XWBA 3GFKA 5AN1A 4PGTA 1TXXA 4O5RA 3FHKA 1EP7A 3J7Yb 3DGQA 3IBHA 3TOUA 4MDCA 1A8YA 4EDZA 3E3EA 4FO5A 1PX6A 2PBJA 4BPYA 4YQUA 5BRTA 1W4VA 4I5QA 3KD0A 2HFDA 2R0PA 1SD8A 4WETA 3TU3B 5ID2B 2VKZG 1XW6A 3IAS2 3NOFA 3G7JA 2K8VA 2YANA 4IJIA 3TKSC 3GL3A 4ULXA 1R5AA 4D73B 1T00A 3LYPA 4K1FA 1MD4A 1KTEA 1PRXA 4Z2RA 4NXIA 5B7CA 2WDUA 1M9BA 4JEDA 1QFNA 5HFIA 5D96A 1B8XA 2YWOA 4J57E 3ZVJD 3C8EA 2E7PA 2LRCA 1NW2A 4EIPA 1ST9A 18GSA 5ECRB 3CSHA 1WWJA 2HZEA 4RI7A 1V58A 3GTUB 4CHSA 1HD2A 4MJCA 2L6CA 4BVYB 1OC9A 3LW9A 4G0KA 5ECOB 2NBSA 3APSA 3TKRA 3TJFA 4MJEA 5A1NA 1I1IP 4O7HA 2ON5A 2OA7A 1R4WA 3FKFA 3GKNA 4DSSB 1MDKA 1X5EA 1QXHA 2AAWA 4MPGA 1PN0A 2CZ2A 4IW9A 1A23A 2QA2A 4KDXA 2X4AA 4AF2A 1FB0A 1NM3A 4EUYA 5G2ZA 4K7OA 4KDUA 4MPFA 1WMJA 2IL3A 1SL1B 5HFKA 5J9BA 3Q6OA 4N0ZA 1R5PA 4JR4A 1SVOA 1YEWC 3KXOA 5IOWA 2V6OA 2O8VB 2IN3A 5KOXA 4HDEA 2YNXA 4V2LA 5ENUA 4FYUA 2QC7A 2WW0A 2F51A 3VURA 2X8GA 3FYGA 3ZTLA 2MYGA 4L8EA 2G0FA 4TVEA 1VF4A 1PFOA 4RQXA 3FZ9A 3LJRA 5A5HA 5F0GA 4WEYA 1OE8A 6GSWA 5FWGA 3KTBA 1K0DA 1Z9HA 4TXOA 4ZB9A 3APQA 3A2WA 1SKWB 3VFIA 3IC8A 3D4TA 1S3AA 1EP8A 5DQYA 5CRHA 1YZXA 4GXZA 5J9CA 4MNNA 2HRKA 2HYXA 4POBA 3RPPA 4CY6A 1WRYA 1XOAA 3EWLA 4ECIA 3HZ8A 4MH3A 2HSNB 3K8NA 1GLQA 1NSWA 3GNJA 4EIQA 3GHAA 4LA1A 5DDLA 2H66A 2RM6A 4O32A 3P7XA 3IXRA 3RGBC 1YF1A 2XHFA 4TOPA 3WT1A 4KE3A 3PR8A 3F4TA 2JL4A 4H86A 4OWYA 2B5EA 2DC5A 1PX7A 5ECSA 3Q19A 4XS4A 3HHVA 2YPMA 1GSFA 5G1LA 1M0UA 1BG5A 3QCPA 2VL2A 3CSIA 4QL9A 5IPGA 4XHMA 3F3RA 4ZIJA 4TXVA 1M2AA 2DJ3A 3FZ5A 3RPNA 2V41A 4ICYA 4ML6A 3KP9A 4KCAA 2EFDA 4KAEA 3ISOA 1SJZA 4V1Ag 2B7KA 5EL8A 2GT5A 4HU9A 4E8HA 1SYRA 1K0OA 2XC2A 2GSTA 2EIQA 2OBKA 1GNEA 3ZREA 3VPTA 2EC4A 4MZCA 22GSA 4WR4A 1YVLA 3W8SA 1M2DA 4K7NA 4OO5A 3NIVA 4N30A 3LQ7A 4EF0A 2WVYA 2PMTA 1KEBA 1BF5A 2OE0A 4JE1A 2VM1A 1H4OA 3ZIJA 2X49A 2GTUA 5DCHA 3EC3A 1LU4A 5JCGA 2FLSA 3PGTA 1YQ1A 2VCZA 1JLVA 5ECMB 6GSVA 1B9YC 2HQTA 2IFQB 5ECKB 3DWVA 5GSTA 2ON7A 2KHPA 1FOHA 1ML6A 2LKUA 5G1KA 1HNBA 1ABAA 2V1MA 1WPIA 4Q5RA 4KNDA 3WT2A 2RIIA 4IS0A 4I8BA 2YJ7A 5BMUA 5ELAA 3A5IA 1M99A 4J56E 4TR4A 2L57A 1YDKA 2PERA 5CRDA 2HSMB 2TIRA 2JZTA 1SKSB 2VCVA 4ZB7A 2UV8G 2F3MA 3GRXA 1AQWA 1F9MA 1EZKA 1TDIA 4KGIA 1FB6A 2H01A 2KLXA 2CX3A 3CRTA 5ID2A 1TK0B 2NTOA 5HQPA 4YQMA 3GL5A 5CREA 3UOMA 1EWXA 1XWGA 20GSA 2LTKA 1JFUA 1GTIA 3PH9A 2DLXA 2X8CA 3HA9A 5IO2A 1A24A 5JWRB 4NHWA 1EOHA 2N5FA 3UARA 1F3BA 2IMIA 2H74A 4X43A 1KNGA 3IK7A 1B4PA 2PWJA 1K0CA 3MIXA 2VL3A 3CQFA 5IMVA 1K3OA 3GTUA 2DIZA 1J08A 3F63A 3KH7A 3F4RA 1SVMA 4KF9A 2H75A 7GSSA 2E0QA 1Q4JA 9GSSA 3F4SA 4EKZA 3LORA 4WF4A 1M2BA 3GYKA 4DSSA 3MDKA 5FHIA 2CVBA 2LEGA 2IMFA 2FWGA 1FW1A 4XS1A 4JU5A 3GMFA 2R2JA 2E2MA 5DVBA 14GSA 5KN1A 4ZILA 3I9V2 1JZWA 4L0WA 1HNCA 3AY8A 3BCKA 3ZITA 2HRFA 2HSHA 4XRDA 4OO4A 1ON4A 2N5BA 1BX9A 2X64A 3Q74A 2NPBA 4ZBBA 1EV4A 1V57A 3ZVJA 3EYTA 1ERTA 3HCZA 4HUAA 5JCWA 1MEKA 3ERWA 3M9JA 1A2LA 1FVJA 3E9JB 4GSSA 4MJAA 2H0HA 4HEA2 1PKWA 1DBYA 5ABRA 2QA1A 2L5LA 4IN0A 1Y1UA 4TKYA 1LBKA 2V6KA 2H1LA 3CHXC 3LG6A 2IWTA 1SK0A 5D9TA 2MZCA 2WW2A 2YZUA 2H6XA 4LL4B 2DSAA 5KOWA 4OFTA 5A5KA 4AI6A 4GCIA 1ZCPA 2K8SA 2YWMA 3UAPA 5CRGA 4KSOA 3ME8A 3LXZA 3KGKA 5KN0A 2I4AA 3QAVA 1XW9A 5ELGA 3O76A 3Q18A 3J7Yk 2EFEA 5HR0A 1XIYA 2HSNA 2H6YA 1TRUA 2IPAA 4N3ZA 4Z7XA 4ZL7A 2YCDA 1YKAA 1JZRA 3M1GA 1C72A 4G10A 1XFLA 3CXGA 5CAXA 5H5RA 4G01A 3TUEA 4GQFA 3M8NA 5HR1A 1G6WA 1PSQA 4FXYP 3IDVA 1ACVA 1J0FA 5J4UA 5IMAA 2B5YA 2WZ9A 3BCIA 2WZSA 3LYKA 4PURA 1XWKA 5GZZB 4KB3A 2GSSA 4G2EA 2FWHA 1TI1A 4G19A 1ERUA 4EDYA 4GSTA 1S3CA 1HQOA 2CV4A 4IVFA 4FYCA 1AXDA 3HXSA 5EVOA 5GSSA 3O3TA 2OJLA 3RHBA 4ECJA 4F9ZA 4O5UA 4MCUA 3QD9A 1Z7PA 1PL2A 3O6TA 6GSUA 3EMPA 2R0GA 4EXJA 3UVTA 3KP8A 5G30A 3UBLA 4AKHA 5B8AA 4Q5FA 1F6MC 3TJKA 2J9HA 1K3LA 3HD5A 3IRAA 4JBBA 5D73A 2LRTA 2HLSA 2QSIA 2H30A 5ECPB 3KTLA 1THOA 3L78A 4FH8A 4TW5A 4RI6A 1AW9A 4OCFA 2GZYA 3DVWA 2WVZA 4V2NA 1TU8A 1FHEA 2EFHA 4GTUA 2IFQA 1A2JA 5KN3A 1SJIA 1GSQA 2YJHA 1EOGA 4PQHA 5A34B 5A4WA 1TRVA 2FGXA 3UIWA 4LL1B 3WGDA 8GSSA 1GTUA 2MBTA 2GZZA 3LSZA 2C4JA 4I97A 5DQSA 4TN8A 4IQAA 3QOUA 1MDJA 4NWYA 3H93A 2AJQB 2WB9A 1GUMA 3G9BA 2HSMA 3US3A 4DSQA 13GSA 1LJRA 5F07A 2QGVA 4TR3A 4ECCA 2K6VA 2VD1A 1XVWA 5LD0A 2DMLA 4CY8A 3TJJA 3G7IA 2L4CA 4BL7A 4K0NA 3R2QA 2PUKC 1XVQA 4WBJA 2EIOA 2RLIA 2GGTA 5COHA 1H75A 1ERVA 4A5PA 2FD3A 4ILFA 1B48A 1VF1A 2CVKA 1MTCA 4IBPA 5D93A 3D0ZA 1WIKA 2CVDA 2MMAA 4EC0A 4GQCA 5AIVA 1AIUA 2NDOA 2XPEA 2H6ZA 1FOVA 2F9SA 1Z5YE 1XCCA 2K9FA 3WGEA 4GRFA 1GLPA 3I69A 3DYRA 3IHGA 1AAZA 4NMUA 6GSXA 5DBQA 4WXTA 2PU9C 3NZNA 2MBSA 5IMFA 1X9WB 1SVLA 3UJ1A 5DAKB 1T7PB 3FR6A 1SK1A 4E8EA 3VPQA 3HVNA 3VK9A 3EU3A 1OKTA 3E0UA 3ME7A 2QKEA 1TJDA 1U3AA 4BVXA 2H72A 3UVHA 1PN9A 1FVKA 3FW2A 3V1WA 2CZ3A 1YY7A 4KUNA 5E59A 1OKDA 3VWWA 5GAPD 3S9FA 1V98A 3HMJG 4Q5QA 2P5QA 1BG1A 1GH2A 1OVNA 1TP9A 4KDYA 4PNGA 4AJ6A 4XS6A 1SU9A 19GSA 3HJOA 4AJ8A 2VLVA 3H1NA 4EO3A 1AUCA 1G0TA 2GQMA 2VL9A 5C04A 1DE1A 2M72A 3GSSA 2B5XA 5J47A 3GKMA 4K2DA 1N8JA 1TOFA 3EMXA 3KH9A 3CWGA 2H1DA 2LJRA 3APOA 3FK8A 1PGTA 3PINA 4KCEA 3A5WA 2XPDA 3FMWA 4AKIA 3FZ4A 2WGRA 1IYHA 2IMKA 4KA0A 4N11A 3P90A 4AKGA 1S3DA 1QQ2A 3RDWA 1TRSA 2P0GA 1BQ7A 1ERWA 1SJ6A 1EEJA 2HE3A 3N5OA 3CSJA 4PUAA 1Z6NA 3EU4A 4F0BA 2BTOT 3UL3A 2HRNA 4MP4A 4G9HA 5DALB 4KX4A 4ZB8A 3WGXA 3UEMA 4F03A 1DE2A 3GA4A 1YEPA 3TRXA 2DJ2A 1DSBA 1GNWA 4Q5NA 2H76A 3VWXA 1UC7A 3GKXA 2HZEB 1XG8A 3F3QA 4DEJA 1A0RP 1G7OA 2LJKA 2B3SA 2F8FA 5ECIB 1M7TA 1V9WA 1PA3A 2AUVA 5AIXA 3W6GA 4TRXA 2H1AA 4J2FA 3IHQA 2BJXA 2C8UA 1K0MA 3F0IA 4OD7A 1V2AA 1E2YA 3GV1A 2WW3A 1N2AA 2CA8A 2DMMA 2VM2A 1SK2A 4HSCX 1TK8B 1E6BA 3EVIA 2PVOC 4PQ1A 3EE2A 4KSMA 3BBYA 4GSNA 2P31A 3TKPA 3IA1A 1PMTA 2YV7A 3G7YA 4D73A 3TRPA 3TRQA 5JWQB 1ZMAA 1HYUA 1I5GA 3HVSA 3ZMKA 3DXBA 2O7KA 2PGTA 4MA9A 1S3RA 1OE7A 4X1UA 2C80A 3HDCA 3HYPA 2E2GA 3GX8A 5IIZA 5FT3A 2TRXA 2UZ8A 2ZUPA 6GSSA 1GTAA 2LNSA 1U6TA 3EPTA 2FA4A 4HI7A 3CYNA 2GLRA 2H19A 4PXOA 2O85A 1B9XC 2FHEA 4NAXA 2YWNA 4HQZA 4WKWA 4MK3A 2HXKA 4BVYA 1A0FA 2D2ZA 1X5DA 4L5OA 2OADA 3ZRDA 2GT6A 2DIYA 2C3TA 3L9VA 4HZ2A 2VL2C 2VD0A 2AB6A 3CTFA 4ZL8A 4ZL9A 1O8WA 5A34A 5J5NA 3BD2A 3TKSA 1RQMA 2JZRA 3HVVA 3FY7A 4N10A 3MYDA 2GSRA 2OE1A 4XIHA 1J9BA 3LEFA 2GS3A 2KP2A 3A2XA 4ZBAA 4MJBA 4K8MA 5A4UA 10GSA 1PKZA 3FEUA 2FNOA 1MD3A 3TKSE 4BWSA 2CQ9A 4XCSA 3A3TA 4POMA 3M0FA 6GSTA 2LS5A 3IPZA 1TI3A 1GUHA 2R0CA 1GSDA 5ECLB 4XS4B 2YOIA 5G31A 3UBKA 1SL2B 4AKXB 1ILOA 2A2PA 4LMWA 3QFAC 5B6MA 2JSYA 1EV9A 5D9VA 4IP1A 1QMVA 4JRRA 1EGOA 2M80A 2XBQA 2WW1A 4USSA 4F82A 3HJPA 1EGRA 3KCMA 1AQVA 5H5QA 3QMXA 3TCOA 1WP0A 3ZL5A 4AJ7A 1GSEA 5LNKe 5J3RA 1Z3EA 3RAZA 5IOXA 1RW1A 4P3YB 4YQVA 3ZYWA 2PPTA 5G5FA 5IMZA 1GULA 4RUVA 2WCIA 2YWIA 1GSUA 2EIRA 3QAWA 4MZBA 4POLA 2R4VA 4WR5A 3VI5A 4E68A 2VO4A 3L4NA 2KUCA 5DAKA 2DKHA 2WFCA 3U6VA 3F9UA 3QAGA 1UVZA 1T3BA 1GSSA 3ZZXA 2O5VA 4V1Ap 4PX1A 3BOAA 4RQRA 4K6XA 2HRAA 3KMOA 3L9UA 4HJMA 3P8WA 4BIKA 5LCZA 3OR5A 1PQNA 3VI7A 4CDOA 5J40A 3VLNA 2LJAA 3RFRC 1GL8A 5ECNB 1CQHA 3I6AA 2I9HA 4PI0C 4MZWA 3PPUA 1TK5B 3SBCA 1MDIA 1ZYPA 2GQLA 3D5JA 3TDGA 4I6XA 2VCQA 1GRXA 1HNAA 2C0DA 3KJYA 2VCXA 4MLYA 3SWLA 5G5EA 1SD9A 2B1LA 3VWUA 1SENA 2B7JA 4ZB6A 2A2SA 3M9KA 2A2RA 2LUSA 5A4VA 1A2MA 4Z2UA 3TKQA 4GF0A 1Q98A 1GTBA 3ED3A 4IHUA 3HJMA 2GZPA 2L59A 4MF7A 2CAIA 1TKDB 1TXUA 1ZYNA 4YH2A 3ERFA 2I1UA 1EEMA 1ZYEA 4ECBA 4ML1A 2K18A 1R26A 5DALA 1O73A 5JCUA 3IV4A 2OACA 3DIEA 1V40A 2L5OA 2HT9A 1UA5A 3RHCA 2FUG2 2VAFA 4PHZC 1A8LA 1OC8A 3GH9A 1UN2A 3GKKA 1YKCA 4YAVA 3ZLPA 2IIYA 1G7EA 3DKSA 3C1RA 2VUPA 3F8UA 2H8LA 2G2QA 3LGCA 1OC3A 1ZGNA 1VRSD 2LSTA 5L71A 4TR1B 1SYXA 5CO3A 1Y6EA 2FWEA 4X0XA 4MABA 1F37A 1CQGA 2GDRA 4X4JA 4PTSA 1THXA 3U5RE 4BWQA 1N25A 2WJUA 1O85A 2AYTA 4EL1A 2IMEA 2WULA 4OCEA 4HZ4A 2B1KA 3MAKA 3DEXA 2H73A 2VCTA 3QPMA 4PUFC 3CTGA 5F05A 3LFLA 4HU7A 3A2VA 4O92A 3FRCA 3ZIVA 1NHOA 5IMCA 1XBSA 1ZYQB 3EURA 1B4QA 1JLWA 4QL7A 4GWRA 1O6JA 2C0EA 4G0IA 4YKGA 5B8BA 4K0GA 2JADA 1WOUA 3UMAA 2O87A 4K2XA 2FY6A 3QFBC 5KN2A 2LNTA 1XWCA 1G6YA 3ERGA 2OT3A 4K7IA 1QK8A 1XWAA 5GAND 2IMDA 5IMDA 3L0HA 3I43A 4NV2A 2WS2A 1VF3A 2RUEA 5IO0A 1Z6MA 4DSRA 1OYJA 3MSZA 3DRNA 2C1YA 2C0FA 1YEXA 5HFGA 2IJYA 5AISA 3H8QA 1F3AA 2VCWA 4BA7A 2CAQA 3GSTA 5AGYA 2HSYA 1OAZA 3F6DA 4IQ1A 1FG4A 3C7MA 3LWAA 2N5AA 3TJBA 3W8JA 2DBCA 1R7HA 2AV4A 5F8BA 5J41A 1DUGA 2XBIA 5CYYA 2L6DA 2I81A 4NV5A 2WVXB 3QR6A 1QGVA 5D9WA 4F0CA 3IR4A 2ES7A 5C00A 2B6MA 2YN1A 3GIXA 1KBNA 1YF0A 1AQXA 11GSA 1JZDA 2Z9SA 5DJMA 4NHZA 4GDFA 2L4QA 1XOBA 3KMNA 2VLTA 4OFMA 4MMMA 3EINA 4V2MA 5IPHA 4GLTA 1U3IA 1I9DA 2TRCP 4MF6A 2YP6A 3BJ5A 3H4KA 2PN8A 2HI7A 1T8EB 3D6IA 1QUWA 1K0AA 4I2UA 2VOCA 3CBUA 5ECQB 1JZOA 3L9SA 1ZOFA 3HZ4A 3VWVA 2MMNA 2GSQA 1T4ZA 4EE0A 2H0GA 5EY6A 2NVLA 2R6KA 3ZMLA 3GURA 1AC1A 2F8AA 3QDNA 2WRTA 2FA8A 2LV3A 1O81A 4O5QA 4ZBDA 1VGLA 1SL0B 2C3NA 2J23A 3IAM2 4L5LA 2H1BA 2GQKA 1ZL9A 3TGZA 4I2TA 1PL1A 2REMA 4IGJA 4MF5A 1OC9B 4PQIA 5IQYA 1SKRB 3RBTA 4FQUA 4OMVA 1USBA 3GH6A 4CW9A 1FAAA 5A1NB 2LQOA 3DVXA 2R5GA 3KM6A 1TU7A 1IYIA 3H79A 1M3IA 3D22A 4G0LA 3HVXA 1S4BP 2RM5A 3GX0A 2KP1A 2OE3A 3TB2A 4K5RA 1ZZYA 4AGSA 2CX4A 4POKA 4NPBA 5B6NA 2AHEA 1YJ6A 3P2AA 2CT6A 2R3XA 2V32A 2DJJA 1GSYA 2C0GA 5EPFA 3DD3A 1M9AA 2H71A 4ZXGA 5D8IA 1Z7RA 4W66A 1T4YA 3ZFBA 3CRUA 2DJ0A 4BL7B 2JU5A 5CRWA 1K0NA 1WE0A 4HS1A 3WD6A 2VLUA 3GUSA 1GP1A 4N0VA 4OFNA 1X0RA 1URMA 4XRAA 3FZAA 4YAPA 1FO5A 2KOKA 4HJ2A 5A5HB 3KIJA 4ISDA 1X9MB 5H5SA 2H70A 1VF2A 2P5RA 4TXOB 4IELA 3C71A 1K0BA 4ID0A 3M3MA 3GN3A 1TTZA 1F2EA 5D9XA 1BJXA 4KH7A 2HRKB 2OKAA 3D21A 2EFCA 4QQ7A 4PNFA 4FYBA 2YV9A 2O89A 4F2IA 5ECHB 2C3QA 1TRWA 4KW6A 2ZCTA 4PI2C 1GWCA 1T1VA 5INYA 3IOSA 2ZNMA 4TR1A 1O7UA 2X99A 2A4HA 3HKRA 1XZOA 4QMKA 4BVXB 5KEJA 1X5CA 2LRNA 1K3YA 2JSZA 2MMZA 2HZFA 4K5SA 2YZHA 2JACA 2O36A 2DKIA 2ALBA 4WBRD 3LXTA 2LQQA 3TOTA 1XW5A 3F6FA 3D4MA 4L0UA 5J4YA 2DJ1A 4MH2A 4HOJA 1BYEA 2X8HA 1O8XA 2V2GA 4XTSA 4LMVA 5F06A 5J4VA 1NHYA 3MWHA 4JZQA 2H1GA 4HQSA 1U87A 3FR3A 1BAYA 1WJKA 1W89A 4WF5A 5CP1A 2FCHA 2JZSA 4IKHA 2I3YA 5CNWA 3DMLA 1RK4A 4EVMA 4TR0A 2PVQA 2O3EA 3C1SA 3IE3A 2DJKA 2BMXA 1X9SB 4LLRA 2M46A 3HY2A 4FIWA 1BEDA 12GSA 4YKFA 5IM9A 1XPVA
chains in the Genus database with same CATH topology
1TW9A 1U88A 2H0IA 3IC4A 5JWOB 5DCGA 3WYWA 1PD21 16GSA 4Z2TA 2RUFA 3N9JA 3R3EA 2VIMA 2HNLA 3KEBA 3TJGA 1Y25A 4DVCA 3C73A 4JR6A 5HR2A 3ZFLA 1GUKA 2FWFA 3KZQA 4ACSA 1JHBA 3CMIA 4IJ3A 5HR3A 3JCML 17GSA 2OBIA 6GSYA 5E4WA 5DJLA 2MMOA 4IP6A 5BMUB 3MNGA 2A4VA 4K9ZA 3FR9A 3IK9A 2GVPA 1XXUA 2R37A 1XWBA 3GFKA 5AN1A 4PGTA 1TXXA 4O5RA 3FHKA 1EP7A 3J7Yb 3DGQA 3IBHA 3TOUA 4MDCA 1A8YA 4EDZA 3E3EA 4FO5A 1PX6A 2PBJA 4BPYA 4YQUA 5BRTA 1W4VA 4I5QA 3KD0A 2HFDA 2R0PA 1SD8A 4WETA 3TU3B 5ID2B 2VKZG 1XW6A 3IAS2 3NOFA 3G7JA 2K8VA 2YANA 4IJIA 3TKSC 3GL3A 4ULXA 1R5AA 4D73B 1T00A 3LYPA 4K1FA 1MD4A 1KTEA 1PRXA 4Z2RA 4NXIA 5B7CA 2WDUA 1M9BA 4JEDA 1QFNA 5HFIA 5D96A 1B8XA 2YWOA 4J57E 3ZVJD 3C8EA 2E7PA 2LRCA 1NW2A 4EIPA 1ST9A 18GSA 5ECRB 3CSHA 1WWJA 2HZEA 4RI7A 1V58A 3GTUB 4CHSA 1HD2A 4MJCA 2L6CA 4BVYB 1OC9A 3LW9A 4G0KA 5ECOB 2NBSA 3APSA 3TKRA 3TJFA 4MJEA 5A1NA 4O7HA 2ON5A 2OA7A 1R4WA 3FKFA 3GKNA 4DSSB 1MDKA 1X5EA 1QXHA 2AAWA 4MPGA 1PN0A 2CZ2A 4IW9A 1A23A 2QA2A 4KDXA 2X4AA 4AF2A 1FB0A 1NM3A 4EUYA 5G2ZA 4K7OA 4KDUA 4MPFA 1WMJA 2IL3A 1SL1B 5HFKA 5J9BA 3Q6OA 4N0ZA 1R5PA 4JR4A 1SVOA 3KXOA 5IOWA 2V6OA 2O8VB 2IN3A 5KOXA 4HDEA 2YNXA 4V2LA 5ENUA 4FYUA 2QC7A 2F51A 3VURA 2X8GA 3FYGA 3ZTLA 2MYGA 4L8EA 2G0FA 4TVEA 1VF4A 4RQXA 3FZ9A 3LJRA 5A5HA 5F0GA 4WEYA 1OE8A 6GSWA 5FWGA 3KTBA 1K0DA 1Z9HA 4TXOA 4ZB9A 3APQA 3A2WA 1SKWB 3VFIA 3IC8A 3D4TA 1S3AA 1EP8A 5DQYA 5CRHA 1YZXA 4GXZA 5J9CA 4MNNA 2HRKA 2HYXA 4POBA 3RPPA 4CY6A 1WRYA 1XOAA 3EWLA 4ECIA 3HZ8A 4MH3A 2HSNB 3K8NA 1GLQA 1NSWA 3GNJA 4EIQA 3GHAA 4LA1A 5DDLA 2H66A 2RM6A 4O32A 3P7XA 3IXRA 1YF1A 2XHFA 4TOPA 3WT1A 4KE3A 3PR8A 3F4TA 2JL4A 4H86A 4OWYA 2B5EA 2DC5A 1PX7A 5ECSA 3Q19A 4XS4A 3HHVA 2YPMA 1GSFA 5G1LA 1M0UA 1BG5A 3QCPA 2VL2A 3CSIA 4QL9A 5IPGA 4XHMA 3F3RA 4ZIJA 4TXVA 1M2AA 2DJ3A 3FZ5A 3RPNA 2V41A 4ICYA 4ML6A 3KP9A 4KCAA 2EFDA 4KAEA 3ISOA 1SJZA 4V1Ag 2B7KA 5EL8A 2GT5A 4HU9A 4E8HA 1SYRA 1K0OA 2XC2A 2GSTA 2EIQA 2OBKA 1GNEA 3ZREA 3VPTA 2EC4A 4MZCA 22GSA 4WR4A 1YVLA 3W8SA 1M2DA 4K7NA 4OO5A 3NIVA 4N30A 3LQ7A 4EF0A 2PMTA 1KEBA 1BF5A 2OE0A 4JE1A 2VM1A 1H4OA 3ZIJA 2X49A 2GTUA 5DCHA 3EC3A 1LU4A 5JCGA 2FLSA 3PGTA 1YQ1A 2VCZA 1JLVA 5ECMB 6GSVA 1B9YC 2HQTA 2IFQB 5ECKB 3DWVA 5GSTA 2ON7A 2KHPA 1FOHA 1ML6A 2LKUA 5G1KA 1HNBA 1ABAA 2V1MA 1WPIA 4Q5RA 4KNDA 3WT2A 2RIIA 4IS0A 4I8BA 2YJ7A 5BMUA 5ELAA 3A5IA 1M99A 4J56E 4TR4A 2L57A 1YDKA 2PERA 5CRDA 2HSMB 2TIRA 2JZTA 1SKSB 2VCVA 4ZB7A 2UV8G 2F3MA 3GRXA 1AQWA 1F9MA 1EZKA 1TDIA 4KGIA 1FB6A 2H01A 2KLXA 2CX3A 3CRTA 5ID2A 1TK0B 2NTOA 5HQPA 4YQMA 3GL5A 5CREA 3UOMA 1EWXA 1XWGA 20GSA 2LTKA 1JFUA 1GTIA 3PH9A 2DLXA 2X8CA 3HA9A 5IO2A 1A24A 5JWRB 4NHWA 1EOHA 2N5FA 3UARA 1F3BA 2IMIA 2H74A 4X43A 1KNGA 3IK7A 1B4PA 2PWJA 1K0CA 3MIXA 2VL3A 5IMVA 1K3OA 3GTUA 2DIZA 1J08A 3F63A 3KH7A 3F4RA 1SVMA 4KF9A 2H75A 7GSSA 2E0QA 1Q4JA 9GSSA 3F4SA 4EKZA 3LORA 4WF4A 1M2BA 3GYKA 4DSSA 3MDKA 5FHIA 2CVBA 2LEGA 2IMFA 2FWGA 1FW1A 4XS1A 4JU5A 3GMFA 2R2JA 2E2MA 5DVBA 14GSA 5KN1A 4ZILA 3I9V2 1JZWA 4L0WA 1HNCA 3AY8A 3BCKA 3ZITA 2HRFA 2HSHA 4XRDA 4OO4A 1ON4A 2N5BA 1BX9A 2X64A 3Q74A 2NPBA 4ZBBA 1EV4A 1V57A 3ZVJA 3EYTA 1ERTA 3HCZA 4HUAA 5JCWA 1MEKA 3ERWA 3M9JA 1A2LA 1FVJA 3E9JB 4GSSA 4MJAA 2H0HA 4HEA2 1PKWA 1DBYA 5ABRA 2QA1A 2L5LA 4IN0A 1Y1UA 4TKYA 1LBKA 2V6KA 2H1LA 3LG6A 2IWTA 1SK0A 5D9TA 2MZCA 2YZUA 2H6XA 4LL4B 2DSAA 5KOWA 4OFTA 5A5KA 4AI6A 4GCIA 1ZCPA 2K8SA 2YWMA 3UAPA 5CRGA 4KSOA 3ME8A 3LXZA 3KGKA 5KN0A 2I4AA 3QAVA 1XW9A 5ELGA 3O76A 3Q18A 3J7Yk 2EFEA 5HR0A 1XIYA 2HSNA 2H6YA 1TRUA 2IPAA 4N3ZA 4Z7XA 4ZL7A 2YCDA 1YKAA 1JZRA 3M1GA 1C72A 4G10A 1XFLA 3CXGA 5CAXA 5H5RA 4G01A 3TUEA 4GQFA 3M8NA 5HR1A 1G6WA 1PSQA 3IDVA 1ACVA 1J0FA 5J4UA 5IMAA 2B5YA 2WZ9A 3BCIA 3LYKA 4PURA 1XWKA 5GZZB 4KB3A 2GSSA 4G2EA 2FWHA 1TI1A 4G19A 1ERUA 4EDYA 4GSTA 1S3CA 1HQOA 2CV4A 4IVFA 4FYCA 1AXDA 3HXSA 5EVOA 5GSSA 3O3TA 2OJLA 3RHBA 4ECJA 4F9ZA 4O5UA 4MCUA 3QD9A 1Z7PA 1PL2A 3O6TA 6GSUA 3EMPA 2R0GA 4EXJA 3UVTA 3KP8A 5G30A 3UBLA 4AKHA 5B8AA 4Q5FA 1F6MC 3TJKA 2J9HA 1K3LA 3HD5A 3IRAA 4JBBA 5D73A 2LRTA 2HLSA 2QSIA 2H30A 5ECPB 3KTLA 1THOA 3L78A 4FH8A 4TW5A 4RI6A 1AW9A 4OCFA 2GZYA 3DVWA 4V2NA 1TU8A 1FHEA 2EFHA 4GTUA 2IFQA 1A2JA 5KN3A 1SJIA 1GSQA 2YJHA 1EOGA 4PQHA 5A34B 5A4WA 1TRVA 2FGXA 3UIWA 4LL1B 3WGDA 8GSSA 1GTUA 2MBTA 2GZZA 3LSZA 2C4JA 4I97A 5DQSA 4TN8A 4IQAA 3QOUA 1MDJA 4NWYA 3H93A 2AJQB 2WB9A 1GUMA 3G9BA 2HSMA 3US3A 4DSQA 13GSA 1LJRA 5F07A 2QGVA 4TR3A 4ECCA 2K6VA 2VD1A 1XVWA 5LD0A 2DMLA 4CY8A 3TJJA 3G7IA 2L4CA 4BL7A 4K0NA 3R2QA 2PUKC 1XVQA 4WBJA 2EIOA 2RLIA 2GGTA 5COHA 1H75A 1ERVA 4A5PA 2FD3A 4ILFA 1B48A 1VF1A 2CVKA 1MTCA 4IBPA 5D93A 3D0ZA 1WIKA 2CVDA 2MMAA 4EC0A 4GQCA 5AIVA 1AIUA 2NDOA 2XPEA 2H6ZA 1FOVA 2F9SA 1Z5YE 1XCCA 2K9FA 3WGEA 4GRFA 1GLPA 3I69A 3DYRA 3IHGA 1AAZA 4NMUA 6GSXA 5DBQA 4WXTA 2PU9C 3NZNA 2MBSA 5IMFA 1X9WB 1SVLA 3UJ1A 5DAKB 1T7PB 3FR6A 1SK1A 4E8EA 3VPQA 3VK9A 3EU3A 1OKTA 3E0UA 3ME7A 2QKEA 1TJDA 1U3AA 4BVXA 2H72A 3UVHA 1PN9A 1FVKA 3FW2A 3V1WA 2CZ3A 1YY7A 4KUNA 5E59A 1OKDA 3VWWA 5GAPD 3S9FA 1V98A 3HMJG 4Q5QA 2P5QA 1BG1A 1GH2A 1OVNA 1TP9A 4KDYA 4PNGA 4AJ6A 4XS6A 1SU9A 19GSA 3HJOA 4AJ8A 2VLVA 3H1NA 4EO3A 1AUCA 1G0TA 2GQMA 2VL9A 5C04A 1DE1A 2M72A 3GSSA 2B5XA 5J47A 3GKMA 4K2DA 1N8JA 1TOFA 3EMXA 3KH9A 3CWGA 2H1DA 2LJRA 3APOA 3FK8A 1PGTA 3PINA 4KCEA 3A5WA 2XPDA 3FMWA 4AKIA 3FZ4A 2WGRA 1IYHA 2IMKA 4KA0A 4N11A 3P90A 4AKGA 1S3DA 1QQ2A 3RDWA 1TRSA 2P0GA 1BQ7A 1ERWA 1SJ6A 1EEJA 2HE3A 3N5OA 3CSJA 4PUAA 1Z6NA 3EU4A 4F0BA 2BTOT 3UL3A 2HRNA 4MP4A 4G9HA 5DALB 4KX4A 4ZB8A 3WGXA 3UEMA 4F03A 1DE2A 3GA4A 1YEPA 3TRXA 2DJ2A 1DSBA 1GNWA 4Q5NA 2H76A 3VWXA 1UC7A 3GKXA 2HZEB 3F3QA 4DEJA 1A0RP 1G7OA 2LJKA 2B3SA 2F8FA 5ECIB 1M7TA 1V9WA 1PA3A 2AUVA 5AIXA 3W6GA 4TRXA 2H1AA 4J2FA 3IHQA 2BJXA 2C8UA 1K0MA 3F0IA 4OD7A 1V2AA 1E2YA 3GV1A 1N2AA 2CA8A 2DMMA 2VM2A 1SK2A 1TK8B 1E6BA 3EVIA 2PVOC 4PQ1A 3EE2A 4KSMA 3BBYA 4GSNA 2P31A 3TKPA 3IA1A 1PMTA 2YV7A 3G7YA 4D73A 3TRPA 3TRQA 5JWQB 1ZMAA 1HYUA 1I5GA 3HVSA 3ZMKA 3DXBA 2O7KA 2PGTA 4MA9A 1OE7A 4X1UA 2C80A 3HDCA 3HYPA 2E2GA 3GX8A 5IIZA 5FT3A 2TRXA 2UZ8A 2ZUPA 6GSSA 1GTAA 2LNSA 1U6TA 3EPTA 2FA4A 4HI7A 3CYNA 2GLRA 2H19A 4PXOA 2O85A 1B9XC 2FHEA 4NAXA 2YWNA 4HQZA 4WKWA 4MK3A 2HXKA 4BVYA 1A0FA 2D2ZA 1X5DA 4L5OA 2OADA 3ZRDA 2GT6A 2DIYA 2C3TA 3L9VA 4HZ2A 2VL2C 2VD0A 2AB6A 3CTFA 4ZL8A 4ZL9A 1O8WA 5A34A 5J5NA 3BD2A 3TKSA 1RQMA 2JZRA 3HVVA 3FY7A 4N10A 3MYDA 2GSRA 2OE1A 4XIHA 1J9BA 3LEFA 2GS3A 2KP2A 3A2XA 4ZBAA 4MJBA 4K8MA 5A4UA 10GSA 1PKZA 3FEUA 2FNOA 1MD3A 3TKSE 4BWSA 2CQ9A 4XCSA 3A3TA 4POMA 3M0FA 6GSTA 2LS5A 3IPZA 1TI3A 1GUHA 2R0CA 1GSDA 5ECLB 4XS4B 2YOIA 5G31A 3UBKA 1SL2B 4AKXB 1ILOA 2A2PA 4LMWA 3QFAC 5B6MA 2JSYA 1EV9A 5D9VA 4IP1A 1QMVA 4JRRA 1EGOA 2M80A 2XBQA 4USSA 4F82A 3HJPA 1EGRA 3KCMA 1AQVA 5H5QA 3QMXA 3TCOA 1WP0A 3ZL5A 4AJ7A 1GSEA 5LNKe 5J3RA 1Z3EA 3RAZA 5IOXA 1RW1A 4P3YB 4YQVA 3ZYWA 2PPTA 5G5FA 5IMZA 1GULA 4RUVA 2WCIA 2YWIA 1GSUA 2EIRA 3QAWA 4MZBA 4POLA 2R4VA 4WR5A 3VI5A 4E68A 2VO4A 3L4NA 2KUCA 5DAKA 2DKHA 2WFCA 3U6VA 3F9UA 3QAGA 1UVZA 1T3BA 1GSSA 3ZZXA 2O5VA 4V1Ap 4PX1A 3BOAA 4RQRA 4K6XA 2HRAA 3KMOA 3L9UA 4HJMA 3P8WA 5LCZA 3OR5A 1PQNA 3VI7A 4CDOA 5J40A 3VLNA 2LJAA 1GL8A 5ECNB 1CQHA 3I6AA 2I9HA 4MZWA 3PPUA 1TK5B 3SBCA 1MDIA 1ZYPA 2GQLA 3D5JA 3TDGA 4I6XA 2VCQA 1GRXA 1HNAA 2C0DA 3KJYA 2VCXA 4MLYA 3SWLA 5G5EA 1SD9A 2B1LA 3VWUA 1SENA 2B7JA 4ZB6A 2A2SA 3M9KA 2A2RA 2LUSA 5A4VA 1A2MA 4Z2UA 3TKQA 4GF0A 1Q98A 1GTBA 3ED3A 4IHUA 3HJMA 2GZPA 2L59A 4MF7A 2CAIA 1TKDB 1TXUA 1ZYNA 4YH2A 3ERFA 2I1UA 1EEMA 1ZYEA 4ECBA 4ML1A 2K18A 1R26A 5DALA 1O73A 5JCUA 3IV4A 2OACA 3DIEA 1V40A 2L5OA 2HT9A 1UA5A 3RHCA 2FUG2 2VAFA 1A8LA 1OC8A 3GH9A 1UN2A 3GKKA 1YKCA 4YAVA 3ZLPA 2IIYA 1G7EA 3DKSA 3C1RA 2VUPA 3F8UA 2H8LA 2G2QA 3LGCA 1OC3A 1ZGNA 1VRSD 2LSTA 5L71A 4TR1B 1SYXA 5CO3A 1Y6EA 2FWEA 4X0XA 4MABA 1F37A 1CQGA 2GDRA 4X4JA 4PTSA 1THXA 3U5RE 4BWQA 1N25A 2WJUA 1O85A 2AYTA 4EL1A 2IMEA 2WULA 4OCEA 4HZ4A 2B1KA 3MAKA 3DEXA 2H73A 2VCTA 3QPMA 4PUFC 3CTGA 5F05A 3LFLA 4HU7A 3A2VA 4O92A 3FRCA 3ZIVA 1NHOA 5IMCA 1XBSA 1ZYQB 3EURA 1B4QA 1JLWA 4QL7A 4GWRA 1O6JA 2C0EA 4G0IA 4YKGA 5B8BA 4K0GA 2JADA 1WOUA 3UMAA 2O87A 4K2XA 2FY6A 3QFBC 5KN2A 2LNTA 1XWCA 1G6YA 3ERGA 2OT3A 4K7IA 1QK8A 1XWAA 5GAND 2IMDA 5IMDA 3L0HA 3I43A 4NV2A 2WS2A 1VF3A 2RUEA 5IO0A 1Z6MA 4DSRA 1OYJA 3MSZA 3DRNA 2C1YA 2C0FA 1YEXA 5HFGA 2IJYA 5AISA 3H8QA 1F3AA 2VCWA 4BA7A 2CAQA 3GSTA 5AGYA 2HSYA 1OAZA 3F6DA 4IQ1A 1FG4A 3C7MA 3LWAA 2N5AA 3TJBA 3W8JA 2DBCA 1R7HA 2AV4A 5F8BA 5J41A 1DUGA 2XBIA 5CYYA 2L6DA 2I81A 4NV5A 3QR6A 1QGVA 5D9WA 4F0CA 3IR4A 2ES7A 5C00A 2B6MA 2YN1A 3GIXA 1KBNA 1YF0A 1AQXA 11GSA 1JZDA 2Z9SA 5DJMA 4NHZA 4GDFA 2L4QA 1XOBA 3KMNA 2VLTA 4OFMA 4MMMA 3EINA 4V2MA 5IPHA 4GLTA 1U3IA 1I9DA 2TRCP 4MF6A 2YP6A 3BJ5A 3H4KA 2PN8A 2HI7A 1T8EB 3D6IA 1QUWA 1K0AA 4I2UA 2VOCA 3CBUA 5ECQB 1JZOA 3L9SA 1ZOFA 3HZ4A 3VWVA 2MMNA 2GSQA 1T4ZA 4EE0A 2H0GA 5EY6A 2NVLA 2R6KA 3ZMLA 3GURA 1AC1A 2F8AA 3QDNA 2WRTA 2FA8A 2LV3A 1O81A 4O5QA 4ZBDA 1VGLA 1SL0B 2C3NA 2J23A 3IAM2 4L5LA 2H1BA 2GQKA 1ZL9A 3TGZA 4I2TA 1PL1A 2REMA 4IGJA 4MF5A 1OC9B 4PQIA 5IQYA 1SKRB 3RBTA 4FQUA 4OMVA 1USBA 3GH6A 4CW9A 1FAAA 5A1NB 2LQOA 3DVXA 2R5GA 3KM6A 1TU7A 1IYIA 3H79A 3D22A 4G0LA 3HVXA 2RM5A 3GX0A 2KP1A 2OE3A 3TB2A 4K5RA 1ZZYA 4AGSA 2CX4A 4POKA 4NPBA 5B6NA 2AHEA 1YJ6A 3P2AA 2CT6A 2R3XA 2V32A 2DJJA 1GSYA 2C0GA 5EPFA 3DD3A 1M9AA 2H71A 4ZXGA 5D8IA 1Z7RA 4W66A 1T4YA 3ZFBA 3CRUA 2DJ0A 4BL7B 2JU5A 5CRWA 1K0NA 1WE0A 4HS1A 3WD6A 2VLUA 3GUSA 1GP1A 4N0VA 4OFNA 1X0RA 1URMA 4XRAA 3FZAA 4YAPA 1FO5A 2KOKA 4HJ2A 5A5HB 3KIJA 4ISDA 1X9MB 5H5SA 2H70A 1VF2A 2P5RA 4TXOB 4IELA 3C71A 1K0BA 4ID0A 3M3MA 3GN3A 1TTZA 1F2EA 5D9XA 1BJXA 4KH7A 2HRKB 2OKAA 3D21A 2EFCA 4QQ7A 4PNFA 4FYBA 2YV9A 2O89A 4F2IA 5ECHB 2C3QA 1TRWA 4KW6A 2ZCTA 1GWCA 1T1VA 5INYA 3IOSA 2ZNMA 4TR1A 1O7UA 2X99A 2A4HA 3HKRA 1XZOA 4QMKA 4BVXB 5KEJA 1X5CA 2LRNA 1K3YA 2JSZA 2MMZA 2HZFA 4K5SA 2YZHA 2JACA 2DKIA 2ALBA 4WBRD 3LXTA 2LQQA 3TOTA 1XW5A 3F6FA 3D4MA 4L0UA 5J4YA 2DJ1A 4MH2A 4HOJA 1BYEA 2X8HA 1O8XA 2V2GA 4XTSA 4LMVA 5F06A 5J4VA 1NHYA 3MWHA 4JZQA 2H1GA 4HQSA 1U87A 3FR3A 1BAYA 1WJKA 1W89A 4WF5A 5CP1A 2FCHA 2JZSA 4IKHA 2I3YA 5CNWA 3DMLA 1RK4A 4EVMA 4TR0A 2PVQA 3C1SA 3IE3A 2DJKA 2BMXA 1X9SB 4LLRA 2M46A 3HY2A 4FIWA 1BEDA 12GSA 4YKFA 5IM9A 1XPVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TW9 A;  1U88 A;  2H0I A;  3IC4 A;  5JWO B;  5DCG A;  3WYW A;  1PD2 1;  16GS A;  2RUF A;  3N9J A;  3R3E A;  2VIM A;  2HNL A;  3KEB A;  3TJG A;  1Y25 A;  4DVC A;  3C73 A;  4JR6 A;  5HR2 A;  3ZFL A;  1GUK A;  2FWF A;  3KZQ A;  4ACS A;  1JHB A;  3CMI A;  4IJ3 A;  5HR3 A;  3JCM L;  17GS A;  2OBI A;  6GSY A;  5E4W A;  5DJL A;  2MMO A;  4IP6 A;  3MNG A;  2A4V A;  4K9Z A;  3FR9 A;  3IK9 A;  2GVP A;  1XXU A;  2R37 A;  1XWB A;  3GFK A;  5AN1 A;  4PGT A;  1TXX A;  4O5R A;  3FHK A;  1EP7 A;  3J7Y b;  3DGQ A;  3IBH A;  3TOU A;  4MDC A;  1A8Y A;  4EDZ A;  3E3E A;  4FO5 A;  1PX6 A;  2PBJ A;  4BPY A;  4YQU A;  1W4V A;  4I5Q A;  3KD0 A;  2HFD A;  1SD8 A;  4WET A;  5ID2 B;  1XW6 A;  3IAS 2;  3NOF A;  3G7J A;  2K8V A;  2YAN A;  4IJI A;  3TKS C;  3GL3 A;  4ULX A;  1R5A A;  4D73 B;  1T00 A;  3LYP A;  4K1F A;  1MD4 A;  1KTE A;  1PRX A;  4NXI A;  5B7C A;  2WDU A;  1M9B A;  4JED A;  1QFN A;  5HFI A;  5D96 A;  1B8X A;  2YWO A;  4J57 E;  3ZVJ D;  3C8E A;  2E7P A;  2LRC A;  1NW2 A;  1ST9 A;  18GS A;  5ECR B;  3CSH A;  1WWJ A;  2HZE A;  4RI7 A;  1V58 A;  3GTU B;  4CHS A;  1HD2 A;  4MJC A;  2L6C A;  4BVY B;  1OC9 A;  4G0K A;  5ECO B;  2NBS A;  3APS A;  3TKR A;  3TJF A;  4MJE A;  4O7H A;  2ON5 A;  2OA7 A;  1R4W A;  3FKF A;  3GKN A;  4DSS B;  1MDK A;  1X5E A;  1QXH A;  2AAW A;  4MPG A;  2CZ2 A;  4IW9 A;  1A23 A;  4KDX A;  4AF2 A;  1FB0 A;  1NM3 A;  4EUY A;  5G2Z A;  4K7O A;  4KDU A;  4MPF A;  1WMJ A;  2IL3 A;  1SL1 B;  5HFK A;  5J9B A;  3Q6O A;  4N0Z A;  1R5P A;  4JR4 A;  3KXO A;  5IOW A;  2V6O A;  2O8V B;  2IN3 A;  4HDE A;  2YNX A;  4V2L A;  5ENU A;  4FYU A;  2QC7 A;  2F51 A;  3VUR A;  2X8G A;  3FYG A;  3ZTL A;  2MYG A;  4L8E A;  2G0F A;  4TVE A;  1VF4 A;  4RQX A;  3FZ9 A;  3LJR A;  5F0G A;  4WEY A;  1OE8 A;  6GSW A;  5FWG A;  3KTB A;  1K0D A;  1Z9H A;  4TXO A;  4ZB9 A;  3APQ A;  3A2W A;  1SKW B;  3VFI A;  3IC8 A;  3D4T A;  1S3A A;  1EP8 A;  5DQY A;  5CRH A;  1YZX A;  4GXZ A;  5J9C A;  2HRK A;  2HYX A;  4POB A;  3RPP A;  1WRY A;  1XOA A;  3EWL A;  4ECI A;  3HZ8 A;  4MH3 A;  2HSN B;  3K8N A;  1GLQ A;  1NSW A;  3GNJ A;  3GHA A;  4LA1 A;  5DDL A;  2H66 A;  2RM6 A;  4O32 A;  3P7X A;  3IXR A;  1YF1 A;  2XHF A;  4TOP A;  3WT1 A;  4KE3 A;  3PR8 A;  3F4T A;  2JL4 A;  4H86 A;  4OWY A;  2DC5 A;  1PX7 A;  5ECS A;  2B5E A;  3Q19 A;  4XS4 A;  3HHV A;  2YPM A;  1GSF A;  5G1L A;  1M0U A;  1BG5 A;  3QCP A;  2VL2 A;  3CSI A;  4QL9 A;  5IPG A;  4XHM A;  3F3R A;  4ZIJ A;  4TXV A;  1M2A A;  2DJ3 A;  3FZ5 A;  3RPN A;  2V41 A;  4ML6 A;  3KP9 A;  4KCA A;  4KAE A;  3ISO A;  1SJZ A;  4V1A g;  2B7K A;  5EL8 A;  2GT5 A;  4HU9 A;  4E8H A;  1SYR A;  1K0O A;  2XC2 A;  2GST A;  2EIQ A;  2OBK A;  1GNE A;  3ZRE A;  3VPT A;  2EC4 A;  4MZC A;  22GS A;  4WR4 A;  3W8S A;  1M2D A;  4K7N A;  4OO5 A;  3NIV A;  4N30 A;  3LQ7 A;  4EF0 A;  2PMT A;  1KEB A;  2OE0 A;  4JE1 A;  3ZIJ A;  2VM1 A;  1H4O A;  2GTU A;  5DCH A;  3EC3 A;  1LU4 A;  5JCG A;  2FLS A;  3PGT A;  1YQ1 A;  2VCZ A;  1JLV A;  5ECM B;  6GSV A;  1B9Y C;  2HQT A;  2IFQ B;  5ECK B;  3DWV A;  5GST A;  2ON7 A;  2KHP A;  1ML6 A;  2LKU A;  5G1K A;  1HNB A;  1ABA A;  2V1M A;  1WPI A;  4Q5R A;  4KND A;  3WT2 A;  2RII A;  4IS0 A;  4I8B A;  2YJ7 A;  5BMU A;  5ELA A;  1M99 A;  4J56 E;  4TR4 A;  2L57 A;  1YDK A;  2PER A;  5CRD A;  2HSM B;  2TIR A;  2JZT A;  1SKS B;  2VCV A;  2F3M A;  3GRX A;  1AQW A;  1F9M A;  1EZK A;  1TDI A;  4KGI A;  1FB6 A;  2H01 A;  2KLX A;  2CX3 A;  3CRT A;  5ID2 A;  1TK0 B;  2NTO A;  5HQP A;  4YQM A;  3GL5 A;  5CRE A;  3UOM A;  1EWX A;  1XWG A;  20GS A;  3PH9 A;  1JFU A;  1GTI A;  2LTK A;  2DLX A;  2X8C A;  3HA9 A;  5IO2 A;  1A24 A;  5JWR B;  4NHW A;  1EOH A;  2N5F A;  3UAR A;  1F3B A;  2IMI A;  2H74 A;  4X43 A;  1KNG A;  3IK7 A;  1B4P A;  2PWJ A;  1K0C A;  2VL3 A;  5IMV A;  1K3O A;  3GTU A;  2DIZ A;  1J08 A;  3F63 A;  3KH7 A;  3F4R A;  4KF9 A;  2H75 A;  7GSS A;  2E0Q A;  1Q4J A;  9GSS A;  3F4S A;  4EKZ A;  3LOR A;  4WF4 A;  1M2B A;  3GYK A;  4DSS A;  3MDK A;  5FHI A;  2CVB A;  2LEG A;  2IMF A;  2FWG A;  1FW1 A;  4XS1 A;  4JU5 A;  3GMF A;  2R2J A;  2E2M A;  5DVB A;  14GS A;  5KN1 A;  4ZIL A;  3I9V 2;  1JZW A;  4L0W A;  1HNC A;  3AY8 A;  3BCK A;  3ZIT A;  2HRF A;  2HSH A;  4XRD A;  4OO4 A;  1ON4 A;  2N5B A;  1BX9 A;  2X64 A;  3Q74 A;  2NPB A;  4ZBB A;  1EV4 A;  1V57 A;  3ZVJ A;  3EYT A;  1ERT A;  3HCZ A;  4HUA A;  5JCW A;  1MEK A;  3ERW A;  3M9J A;  1A2L A;  1FVJ A;  3E9J B;  4GSS A;  4MJA A;  2H0H A;  4HEA 2;  1PKW A;  1DBY A;  5ABR A;  2L5L A;  4IN0 A;  4TKY A;  1LBK A;  2V6K A;  3LG6 A;  2IWT A;  1SK0 A;  5D9T A;  2MZC A;  2YZU A;  2H6X A;  4LL4 B;  2DSA A;  4OFT A;  5A5K A;  4GCI A;  1ZCP A;  2K8S A;  2YWM A;  3UAP A;  5CRG A;  4KSO A;  3ME8 A;  3LXZ A;  3KGK A;  5KN0 A;  2I4A A;  3QAV A;  1XW9 A;  5ELG A;  3O76 A;  3Q18 A;  3J7Y k;  5HR0 A;  1XIY A;  2H6Y A;  1TRU A;  2IPA A;  4Z7X A;  4ZL7 A;  2YCD A;  1YKA A;  1JZR A;  3M1G A;  1C72 A;  4G10 A;  1XFL A;  3CXG A;  5CAX A;  5H5R A;  3TUE A;  4GQF A;  3M8N A;  5HR1 A;  1G6W A;  1PSQ A;  3IDV A;  1ACV A;  1J0F A;  5J4U A;  5IMA A;  2B5Y A;  2WZ9 A;  3BCI A;  3LYK A;  4PUR A;  1XWK A;  5GZZ B;  4KB3 A;  2GSS A;  4G2E A;  2FWH A;  1TI1 A;  4G19 A;  1ERU A;  4EDY A;  4GST A;  1S3C A;  1HQO A;  2CV4 A;  4IVF A;  4FYC A;  1AXD A;  3HXS A;  5EVO A;  5GSS A;  3O3T A;  2OJL A;  3RHB A;  4ECJ A;  4F9Z A;  4MCU A;  3QD9 A;  1Z7P A;  1PL2 A;  3O6T A;  6GSU A;  3EMP A;  4EXJ A;  3UVT A;  3KP8 A;  5G30 A;  3UBL A;  5B8A A;  4Q5F A;  1F6M C;  3TJK A;  2J9H A;  1K3L A;  3HD5 A;  3IRA A;  4JBB A;  5D73 A;  2LRT A;  2HLS A;  2QSI A;  2H30 A;  5ECP B;  3KTL A;  1THO A;  3L78 A;  4FH8 A;  4TW5 A;  4RI6 A;  1AW9 A;  4OCF A;  2GZY A;  3DVW A;  4V2N A;  1TU8 A;  1FHE A;  4GTU A;  2IFQ A;  1A2J A;  5KN3 A;  1SJI A;  1GSQ A;  2YJH A;  1EOG A;  4PQH A;  5A4W A;  1TRV A;  2FGX A;  3UIW A;  4LL1 B;  3WGD A;  8GSS A;  1GTU A;  2MBT A;  2GZZ A;  3LSZ A;  2C4J A;  4I97 A;  5DQS A;  4TN8 A;  4IQA A;  3QOU A;  1MDJ A;  4NWY A;  3H93 A;  2AJQ B;  2WB9 A;  1GUM A;  3G9B A;  2HSM A;  3US3 A;  4DSQ A;  13GS A;  1LJR A;  5F07 A;  2QGV A;  4TR3 A;  4ECC A;  2K6V A;  2VD1 A;  1XVW A;  5LD0 A;  2DML A;  3TJJ A;  3G7I A;  2L4C A;  4BL7 A;  4K0N A;  3R2Q A;  2PUK C;  1XVQ A;  4WBJ A;  2EIO A;  2RLI A;  2GGT A;  5COH A;  1H75 A;  1ERV A;  2FD3 A;  4ILF A;  1B48 A;  1VF1 A;  2CVK A;  1MTC A;  4IBP A;  5D93 A;  3D0Z A;  1WIK A;  2CVD A;  2MMA A;  4EC0 A;  4GQC A;  5AIV A;  1AIU A;  2NDO A;  2XPE A;  2H6Z A;  1FOV A;  2F9S A;  1Z5Y E;  1XCC A;  2K9F A;  3WGE A;  4GRF A;  1GLP A;  3I69 A;  3DYR A;  1AAZ A;  4NMU A;  6GSX A;  5DBQ A;  4WXT A;  2PU9 C;  3NZN A;  2MBS A;  5IMF A;  1X9W B;  3UJ1 A;  5DAK B;  1T7P B;  3FR6 A;  1SK1 A;  4E8E A;  3VPQ A;  3VK9 A;  3EU3 A;  1OKT A;  3E0U A;  3ME7 A;  2QKE A;  1TJD A;  1U3A A;  4BVX A;  2H72 A;  3UVH A;  1PN9 A;  1FVK A;  3FW2 A;  3V1W A;  2CZ3 A;  1YY7 A;  4KUN A;  5E59 A;  1OKD A;  3VWW A;  5GAP D;  3S9F A;  1V98 A;  4Q5Q A;  2P5Q A;  1GH2 A;  1OVN A;  1TP9 A;  4KDY A;  4PNG A;  4AJ6 A;  4XS6 A;  1SU9 A;  19GS A;  3HJO A;  4AJ8 A;  2VLV A;  3H1N A;  4EO3 A;  1AUC A;  1G0T A;  2GQM A;  2VL9 A;  5C04 A;  1DE1 A;  2M72 A;  3GSS A;  2B5X A;  3GKM A;  4K2D A;  1N8J A;  1TOF A;  3EMX A;  3KH9 A;  2H1D A;  2LJR A;  3APO A;  3FK8 A;  1PGT A;  3PIN A;  4KCE A;  3A5W A;  2XPD A;  3FZ4 A;  2WGR A;  1IYH A;  2IMK A;  4KA0 A;  4N11 A;  3P90 A;  1S3D A;  1QQ2 A;  3RDW A;  1TRS A;  2P0G A;  1BQ7 A;  1ERW A;  1SJ6 A;  1EEJ A;  2HE3 A;  3N5O A;  3CSJ A;  4PUA A;  1Z6N A;  3EU4 A;  4F0B A;  2BTO T;  3UL3 A;  2HRN A;  4MP4 A;  4G9H A;  5DAL B;  4KX4 A;  4ZB8 A;  3WGX A;  3UEM A;  4F03 A;  1DE2 A;  3GA4 A;  1YEP A;  3TRX A;  2DJ2 A;  1DSB A;  1GNW A;  4Q5N A;  2H76 A;  3VWX A;  1UC7 A;  3GKX A;  2HZE B;  3F3Q A;  4DEJ A;  1A0R P;  1G7O A;  2LJK A;  2B3S A;  2F8F A;  5ECI B;  1M7T A;  1V9W A;  1PA3 A;  2AUV A;  5AIX A;  3W6G A;  4TRX A;  2H1A A;  4J2F A;  3IHQ A;  2BJX A;  2C8U A;  1K0M A;  3F0I A;  4OD7 A;  1V2A A;  1E2Y A;  3GV1 A;  1N2A A;  2CA8 A;  2DMM A;  2VM2 A;  1SK2 A;  1TK8 B;  1E6B A;  3EVI A;  2PVO C;  4PQ1 A;  3EE2 A;  4KSM A;  3BBY A;  4GSN A;  2P31 A;  3TKP A;  3IA1 A;  1PMT A;  2YV7 A;  3G7Y A;  4D73 A;  3TRP A;  3TRQ A;  5JWQ B;  1ZMA A;  1HYU A;  1I5G A;  3HVS A;  3ZMK A;  3DXB A;  2O7K A;  2PGT A;  4MA9 A;  1OE7 A;  4X1U A;  2C80 A;  3HDC A;  3HYP A;  2E2G A;  3GX8 A;  5IIZ A;  5FT3 A;  2TRX A;  2UZ8 A;  6GSS A;  2ZUP A;  1GTA A;  2LNS A;  1U6T A;  2FA4 A;  4HI7 A;  3CYN A;  2GLR A;  2H19 A;  4PXO A;  2O85 A;  1B9X C;  2FHE A;  4NAX A;  2YWN A;  4HQZ A;  4WKW A;  4MK3 A;  2HXK A;  4BVY A;  1A0F A;  2D2Z A;  1X5D A;  4L5O A;  2OAD A;  3ZRD A;  2GT6 A;  2DIY A;  2C3T A;  3L9V A;  4HZ2 A;  2VL2 C;  2VD0 A;  2AB6 A;  3CTF A;  4ZL8 A;  4ZL9 A;  1O8W A;  5J5N A;  3BD2 A;  3TKS A;  1RQM A;  2JZR A;  3HVV A;  3FY7 A;  4N10 A;  2GSR A;  2OE1 A;  4XIH A;  1J9B A;  3LEF A;  2GS3 A;  2KP2 A;  3A2X A;  4ZBA A;  4MJB A;  4K8M A;  5A4U A;  10GS A;  1PKZ A;  3FEU A;  2FNO A;  1MD3 A;  3TKS E;  4BWS A;  2CQ9 A;  4XCS A;  3A3T A;  4POM A;  3M0F A;  6GST A;  2LS5 A;  3IPZ A;  1TI3 A;  1GUH A;  1GSD A;  5ECL B;  4XS4 B;  2YOI A;  5G31 A;  3UBK A;  1SL2 B;  1ILO A;  4LMW A;  3QFA C;  5B6M A;  2JSY A;  1EV9 A;  5D9V A;  4IP1 A;  1QMV A;  4JRR A;  1EGO A;  2M80 A;  2XBQ A;  4USS A;  4F82 A;  3HJP A;  1EGR A;  3KCM A;  1AQV A;  5H5Q A;  3QMX A;  3TCO A;  1WP0 A;  3ZL5 A;  4AJ7 A;  1GSE A;  5LNK e;  5J3R A;  1Z3E A;  3RAZ A;  5IOX A;  1RW1 A;  4P3Y B;  4YQV A;  3ZYW A;  2PPT A;  5G5F A;  5IMZ A;  1GUL A;  4RUV A;  2WCI A;  2YWI A;  1GSU A;  2EIR A;  3QAW A;  4MZB A;  4POL A;  2R4V A;  4WR5 A;  3VI5 A;  2VO4 A;  3L4N A;  2KUC A;  5DAK A;  2WFC A;  3U6V A;  3F9U A;  3QAG A;  1UVZ A;  1T3B A;  1GSS A;  3ZZX A;  4V1A p;  4PX1 A;  3BOA A;  4RQR A;  4K6X A;  2HRA A;  3KMO A;  3L9U A;  4HJM A;  3P8W A;  5LCZ A;  3OR5 A;  1PQN A;  3VI7 A;  4CDO A;  3VLN A;  2LJA A;  1GL8 A;  5ECN B;  1CQH A;  3I6A A;  2I9H A;  4MZW A;  3PPU A;  1TK5 B;  3SBC A;  1MDI A;  2GQL A;  3D5J A;  3TDG A;  4I6X A;  2VCQ A;  1GRX A;  1HNA A;  2C0D A;  3KJY A;  2VCX A;  4MLY A;  3SWL A;  5G5E A;  1SD9 A;  2B1L A;  3VWU A;  1SEN A;  2B7J A;  4ZB6 A;  2A2S A;  3M9K A;  2A2R A;  2LUS A;  5A4V A;  1A2M A;  3TKQ A;  4GF0 A;  1Q98 A;  1GTB A;  3ED3 A;  4IHU A;  3HJM A;  2GZP A;  2L59 A;  4MF7 A;  2CAI A;  1TKD B;  4YH2 A;  3ERF A;  2I1U A;  1EEM A;  1ZYE A;  4ECB A;  4ML1 A;  2K18 A;  1R26 A;  5DAL A;  1O73 A;  5JCU A;  3IV4 A;  2OAC A;  3DIE A;  1V40 A;  2L5O A;  2HT9 A;  1UA5 A;  3RHC A;  2FUG 2;  2VAF A;  1A8L A;  1OC8 A;  3GH9 A;  1UN2 A;  3GKK A;  1YKC A;  4YAV A;  3ZLP A;  2IIY A;  1G7E A;  3DKS A;  3C1R A;  2VUP A;  3F8U A;  2H8L A;  2G2Q A;  3LGC A;  1OC3 A;  1ZGN A;  1VRS D;  2LST A;  5L71 A;  4TR1 B;  1SYX A;  5CO3 A;  1Y6E A;  2FWE A;  4X0X A;  4MAB A;  1F37 A;  1CQG A;  2GDR A;  4PTS A;  1THX A;  3U5R E;  4BWQ A;  2WJU A;  1O85 A;  2AYT A;  4EL1 A;  2IME A;  2WUL A;  4OCE A;  4HZ4 A;  2B1K A;  3MAK A;  3DEX A;  2H73 A;  2VCT A;  3QPM A;  4PUF C;  3CTG A;  5F05 A;  3LFL A;  4HU7 A;  3A2V A;  4O92 A;  3FRC A;  3ZIV A;  1NHO A;  5IMC A;  1XBS A;  1ZYQ B;  3EUR A;  1B4Q A;  1JLW A;  4QL7 A;  4GWR A;  1O6J A;  2C0E A;  4G0I A;  5B8B A;  4K0G A;  2JAD A;  1WOU A;  3UMA A;  2O87 A;  2FY6 A;  3QFB C;  5KN2 A;  2LNT A;  1XWC A;  1G6Y A;  3ERG A;  4K7I A;  1QK8 A;  1XWA A;  5GAN D;  2IMD A;  5IMD A;  3L0H A;  3I43 A;  4NV2 A;  2WS2 A;  1VF3 A;  2RUE A;  5IO0 A;  1Z6M A;  4DSR A;  1OYJ A;  3MSZ A;  3DRN A;  2C1Y A;  2C0F A;  1YEX A;  5HFG A;  2IJY A;  5AIS A;  3H8Q A;  1F3A A;  2VCW A;  4BA7 A;  2CAQ A;  3GST A;  5AGY A;  2HSY A;  1OAZ A;  3F6D A;  4IQ1 A;  1FG4 A;  3C7M A;  3LWA A;  2N5A A;  3TJB A;  3W8J A;  2DBC A;  1R7H A;  2AV4 A;  5F8B A;  5J41 A;  1DUG A;  2XBI A;  5CYY A;  2L6D A;  2I81 A;  4NV5 A;  3QR6 A;  1QGV A;  5D9W A;  4F0C A;  3IR4 A;  2ES7 A;  5C00 A;  2B6M A;  2YN1 A;  3GIX A;  1KBN A;  1YF0 A;  1AQX A;  11GS A;  1JZD A;  2Z9S A;  5DJM A;  4NHZ A;  2L4Q A;  1XOB A;  3KMN A;  2VLT A;  4OFM A;  4MMM A;  3EIN A;  4V2M A;  5IPH A;  4GLT A;  1U3I A;  1I9D A;  2TRC P;  4MF6 A;  2YP6 A;  3BJ5 A;  3H4K A;  2PN8 A;  2HI7 A;  1T8E B;  3D6I A;  1QUW A;  1K0A A;  4I2U A;  2VOC A;  3CBU A;  5ECQ B;  1JZO A;  3L9S A;  1ZOF A;  3HZ4 A;  3VWV A;  2MMN A;  2GSQ A;  1T4Z A;  4EE0 A;  2H0G A;  5EY6 A;  2NVL A;  2R6K A;  3ZML A;  3GUR A;  1AC1 A;  2F8A A;  3QDN A;  2WRT A;  2FA8 A;  2LV3 A;  1O81 A;  4ZBD A;  1VGL A;  1SL0 B;  2C3N A;  2J23 A;  3IAM 2;  4L5L A;  2H1B A;  2GQK A;  1ZL9 A;  3TGZ A;  4I2T A;  1PL1 A;  2REM A;  4IGJ A;  4MF5 A;  1OC9 B;  4PQI A;  5IQY A;  1SKR B;  3RBT A;  4FQU A;  4OMV A;  1USB A;  3GH6 A;  4CW9 A;  1FAA A;  2LQO A;  3DVX A;  2R5G A;  3KM6 A;  1TU7 A;  1IYI A;  3H79 A;  3D22 A;  4G0L A;  3HVX A;  2RM5 A;  3GX0 A;  2KP1 A;  2OE3 A;  3TB2 A;  1ZZY A;  4AGS A;  2CX4 A;  4POK A;  4NPB A;  5B6N A;  2AHE A;  1YJ6 A;  3P2A A;  2CT6 A;  2R3X A;  2V32 A;  2DJJ A;  1GSY A;  2C0G A;  5EPF A;  3DD3 A;  1M9A A;  2H71 A;  4ZXG A;  5D8I A;  1Z7R A;  1T4Y A;  3ZFB A;  3CRU A;  2DJ0 A;  4BL7 B;  2JU5 A;  5CRW A;  1K0N A;  1WE0 A;  4HS1 A;  3WD6 A;  2VLU A;  3GUS A;  1GP1 A;  4N0V A;  4OFN A;  1X0R A;  1URM A;  4XRA A;  3FZA A;  4YAP A;  1FO5 A;  2KOK A;  4HJ2 A;  3KIJ A;  4ISD A;  1X9M B;  5H5S A;  2H70 A;  1VF2 A;  2P5R A;  4TXO B;  4IEL A;  3C71 A;  1K0B A;  4ID0 A;  3M3M A;  3GN3 A;  1TTZ A;  1F2E A;  5D9X A;  1BJX A;  4KH7 A;  2HRK B;  2OKA A;  3D21 A;  4QQ7 A;  4PNF A;  4FYB A;  2YV9 A;  2O89 A;  4F2I A;  5ECH B;  2C3Q A;  1TRW A;  4KW6 A;  2ZCT A;  1GWC A;  1T1V A;  5INY A;  3IOS A;  2ZNM A;  4TR1 A;  1O7U A;  2X99 A;  3HKR A;  1XZO A;  4BVX B;  5KEJ A;  1X5C A;  2LRN A;  1K3Y A;  2JSZ A;  2MMZ A;  2HZF A;  2YZH A;  2JAC A;  4WBR D;  2ALB A;  3LXT A;  2LQQ A;  3TOT A;  1XW5 A;  3F6F A;  3D4M A;  4L0U A;  2DJ1 A;  4MH2 A;  4HOJ A;  1BYE A;  2X8H A;  1O8X A;  2V2G A;  4XTS A;  4LMV A;  5F06 A;  1NHY A;  3MWH A;  4JZQ A;  2H1G A;  4HQS A;  1U87 A;  3FR3 A;  1BAY A;  1WJK A;  1W89 A;  4WF5 A;  5CP1 A;  2FCH A;  2JZS A;  4IKH A;  2I3Y A;  5CNW A;  3DML A;  1RK4 A;  4EVM A;  4TR0 A;  2PVQ A;  3C1S A;  3IE3 A;  2DJK A;  2BMX A;  1X9S B;  4LLR A;  2M46 A;  3HY2 A;  4FIW A;  1BED A;  12GS A;  5IM9 A;  1XPV A; 
#chains in the Genus database with same CATH topology
 1TW9 A;  1U88 A;  2H0I A;  3IC4 A;  5JWO B;  1M3J A;  5DCG A;  3WYW A;  1PD2 1;  16GS A;  4Z2T A;  2RUF A;  3N9J A;  3R3E A;  2VIM A;  2HNL A;  3KEB A;  3TJG A;  1Y25 A;  4DVC A;  3C73 A;  4JR6 A;  5HR2 A;  3ZFL A;  1GUK A;  2FWF A;  3KZQ A;  4ACS A;  1JHB A;  3CMI A;  4IJ3 A;  5HR3 A;  3JCM L;  17GS A;  2OBI A;  6GSY A;  5E4W A;  5DJL A;  2MMO A;  4IP6 A;  5BMU B;  3MNG A;  2A4V A;  4K9Z A;  3FR9 A;  2WVX A;  3IK9 A;  2GVP A;  1XXU A;  2R37 A;  1XWB A;  3GFK A;  5AN1 A;  4PGT A;  1TXX A;  4O5R A;  3FHK A;  1EP7 A;  3J7Y b;  3DGQ A;  3IBH A;  3TOU A;  4MDC A;  1A8Y A;  4EDZ A;  3E3E A;  4FO5 A;  1PX6 A;  2PBJ A;  4BPY A;  4YQU A;  5BRT A;  1W4V A;  4I5Q A;  3KD0 A;  2HFD A;  2R0P A;  1SD8 A;  4WET A;  3TU3 B;  5ID2 B;  2VKZ G;  1XW6 A;  3IAS 2;  3NOF A;  3G7J A;  2K8V A;  2YAN A;  4IJI A;  3TKS C;  3GL3 A;  4ULX A;  1R5A A;  4D73 B;  1T00 A;  3LYP A;  4K1F A;  1MD4 A;  1KTE A;  1PRX A;  4Z2R A;  4NXI A;  5B7C A;  2WDU A;  1M9B A;  4JED A;  1QFN A;  5HFI A;  5D96 A;  1B8X A;  2YWO A;  4J57 E;  3ZVJ D;  3C8E A;  2E7P A;  2LRC A;  1NW2 A;  4EIP A;  1ST9 A;  18GS A;  5ECR B;  3CSH A;  1WWJ A;  2HZE A;  4RI7 A;  1V58 A;  3GTU B;  4CHS A;  1HD2 A;  4MJC A;  2L6C A;  4BVY B;  1OC9 A;  3LW9 A;  4G0K A;  5ECO B;  2NBS A;  3APS A;  3TKR A;  3TJF A;  4MJE A;  5A1N A;  1I1I P;  4O7H A;  2ON5 A;  2OA7 A;  1R4W A;  3FKF A;  3GKN A;  4DSS B;  1MDK A;  1X5E A;  1QXH A;  2AAW A;  4MPG A;  1PN0 A;  2CZ2 A;  4IW9 A;  1A23 A;  2QA2 A;  4KDX A;  2X4A A;  4AF2 A;  1FB0 A;  1NM3 A;  4EUY A;  5G2Z A;  4K7O A;  4KDU A;  4MPF A;  1WMJ A;  2IL3 A;  1SL1 B;  5HFK A;  5J9B A;  3Q6O A;  4N0Z A;  1R5P A;  4JR4 A;  1SVO A;  1YEW C;  3KXO A;  5IOW A;  2V6O A;  2O8V B;  2IN3 A;  5KOX A;  4HDE A;  2YNX A;  4V2L A;  5ENU A;  4FYU A;  2QC7 A;  2WW0 A;  2F51 A;  3VUR A;  2X8G A;  3FYG A;  3ZTL A;  2MYG A;  4L8E A;  2G0F A;  4TVE A;  1VF4 A;  1PFO A;  4RQX A;  3FZ9 A;  3LJR A;  5A5H A;  5F0G A;  4WEY A;  1OE8 A;  6GSW A;  5FWG A;  3KTB A;  1K0D A;  1Z9H A;  4TXO A;  4ZB9 A;  3APQ A;  3A2W A;  1SKW B;  3VFI A;  3IC8 A;  3D4T A;  1S3A A;  1EP8 A;  5DQY A;  5CRH A;  1YZX A;  4GXZ A;  5J9C A;  4MNN A;  2HRK A;  2HYX A;  4POB A;  3RPP A;  4CY6 A;  1WRY A;  1XOA A;  3EWL A;  4ECI A;  3HZ8 A;  4MH3 A;  2HSN B;  3K8N A;  1GLQ A;  1NSW A;  3GNJ A;  4EIQ A;  3GHA A;  4LA1 A;  5DDL A;  2H66 A;  2RM6 A;  4O32 A;  3P7X A;  3IXR A;  3RGB C;  1YF1 A;  2XHF A;  4TOP A;  3WT1 A;  4KE3 A;  3PR8 A;  3F4T A;  2JL4 A;  4H86 A;  4OWY A;  2B5E A;  2DC5 A;  1PX7 A;  5ECS A;  3Q19 A;  4XS4 A;  3HHV A;  2YPM A;  1GSF A;  5G1L A;  1M0U A;  1BG5 A;  3QCP A;  2VL2 A;  3CSI A;  4QL9 A;  5IPG A;  4XHM A;  3F3R A;  4ZIJ A;  4TXV A;  1M2A A;  2DJ3 A;  3FZ5 A;  3RPN A;  2V41 A;  4ICY A;  4ML6 A;  3KP9 A;  4KCA A;  2EFD A;  4KAE A;  3ISO A;  1SJZ A;  4V1A g;  2B7K A;  5EL8 A;  2GT5 A;  4HU9 A;  4E8H A;  1SYR A;  1K0O A;  2XC2 A;  2GST A;  2EIQ A;  2OBK A;  1GNE A;  3ZRE A;  3VPT A;  2EC4 A;  4MZC A;  22GS A;  4WR4 A;  1YVL A;  3W8S A;  1M2D A;  4K7N A;  4OO5 A;  3NIV A;  4N30 A;  3LQ7 A;  4EF0 A;  2WVY A;  2PMT A;  1KEB A;  1BF5 A;  2OE0 A;  4JE1 A;  2VM1 A;  1H4O A;  3ZIJ A;  2X49 A;  2GTU A;  5DCH A;  3EC3 A;  1LU4 A;  5JCG A;  2FLS A;  3PGT A;  1YQ1 A;  2VCZ A;  1JLV A;  5ECM B;  6GSV A;  1B9Y C;  2HQT A;  2IFQ B;  5ECK B;  3DWV A;  5GST A;  2ON7 A;  2KHP A;  1FOH A;  1ML6 A;  2LKU A;  5G1K A;  1HNB A;  1ABA A;  2V1M A;  1WPI A;  4Q5R A;  4KND A;  3WT2 A;  2RII A;  4IS0 A;  4I8B A;  2YJ7 A;  5BMU A;  5ELA A;  3A5I A;  1M99 A;  4J56 E;  4TR4 A;  2L57 A;  1YDK A;  2PER A;  5CRD A;  2HSM B;  2TIR A;  2JZT A;  1SKS B;  2VCV A;  4ZB7 A;  2UV8 G;  2F3M A;  3GRX A;  1AQW A;  1F9M A;  1EZK A;  1TDI A;  4KGI A;  1FB6 A;  2H01 A;  2KLX A;  2CX3 A;  3CRT A;  5ID2 A;  1TK0 B;  2NTO A;  5HQP A;  4YQM A;  3GL5 A;  5CRE A;  3UOM A;  1EWX A;  1XWG A;  20GS A;  2LTK A;  1JFU A;  1GTI A;  3PH9 A;  2DLX A;  2X8C A;  3HA9 A;  5IO2 A;  1A24 A;  5JWR B;  4NHW A;  1EOH A;  2N5F A;  3UAR A;  1F3B A;  2IMI A;  2H74 A;  4X43 A;  1KNG A;  3IK7 A;  1B4P A;  2PWJ A;  1K0C A;  3MIX A;  2VL3 A;  3CQF A;  5IMV A;  1K3O A;  3GTU A;  2DIZ A;  1J08 A;  3F63 A;  3KH7 A;  3F4R A;  1SVM A;  4KF9 A;  2H75 A;  7GSS A;  2E0Q A;  1Q4J A;  9GSS A;  3F4S A;  4EKZ A;  3LOR A;  4WF4 A;  1M2B A;  3GYK A;  4DSS A;  3MDK A;  5FHI A;  2CVB A;  2LEG A;  2IMF A;  2FWG A;  1FW1 A;  4XS1 A;  4JU5 A;  3GMF A;  2R2J A;  2E2M A;  5DVB A;  14GS A;  5KN1 A;  4ZIL A;  3I9V 2;  1JZW A;  4L0W A;  1HNC A;  3AY8 A;  3BCK A;  3ZIT A;  2HRF A;  2HSH A;  4XRD A;  4OO4 A;  1ON4 A;  2N5B A;  1BX9 A;  2X64 A;  3Q74 A;  2NPB A;  4ZBB A;  1EV4 A;  1V57 A;  3ZVJ A;  3EYT A;  1ERT A;  3HCZ A;  4HUA A;  5JCW A;  1MEK A;  3ERW A;  3M9J A;  1A2L A;  1FVJ A;  3E9J B;  4GSS A;  4MJA A;  2H0H A;  4HEA 2;  1PKW A;  1DBY A;  5ABR A;  2QA1 A;  2L5L A;  4IN0 A;  1Y1U A;  4TKY A;  1LBK A;  2V6K A;  2H1L A;  3CHX C;  3LG6 A;  2IWT A;  1SK0 A;  5D9T A;  2MZC A;  2WW2 A;  2YZU A;  2H6X A;  4LL4 B;  2DSA A;  5KOW A;  4OFT A;  5A5K A;  4AI6 A;  4GCI A;  1ZCP A;  2K8S A;  2YWM A;  3UAP A;  5CRG A;  4KSO A;  3ME8 A;  3LXZ A;  3KGK A;  5KN0 A;  2I4A A;  3QAV A;  1XW9 A;  5ELG A;  3O76 A;  3Q18 A;  3J7Y k;  2EFE A;  5HR0 A;  1XIY A;  2HSN A;  2H6Y A;  1TRU A;  2IPA A;  4N3Z A;  4Z7X A;  4ZL7 A;  2YCD A;  1YKA A;  1JZR A;  3M1G A;  1C72 A;  4G10 A;  1XFL A;  3CXG A;  5CAX A;  5H5R A;  4G01 A;  3TUE A;  4GQF A;  3M8N A;  5HR1 A;  1G6W A;  1PSQ A;  4FXY P;  3IDV A;  1ACV A;  1J0F A;  5J4U A;  5IMA A;  2B5Y A;  2WZ9 A;  3BCI A;  2WZS A;  3LYK A;  4PUR A;  1XWK A;  5GZZ B;  4KB3 A;  2GSS A;  4G2E A;  2FWH A;  1TI1 A;  4G19 A;  1ERU A;  4EDY A;  4GST A;  1S3C A;  1HQO A;  2CV4 A;  4IVF A;  4FYC A;  1AXD A;  3HXS A;  5EVO A;  5GSS A;  3O3T A;  2OJL A;  3RHB A;  4ECJ A;  4F9Z A;  4O5U A;  4MCU A;  3QD9 A;  1Z7P A;  1PL2 A;  3O6T A;  6GSU A;  3EMP A;  2R0G A;  4EXJ A;  3UVT A;  3KP8 A;  5G30 A;  3UBL A;  4AKH A;  5B8A A;  4Q5F A;  1F6M C;  3TJK A;  2J9H A;  1K3L A;  3HD5 A;  3IRA A;  4JBB A;  5D73 A;  2LRT A;  2HLS A;  2QSI A;  2H30 A;  5ECP B;  3KTL A;  1THO A;  3L78 A;  4FH8 A;  4TW5 A;  4RI6 A;  1AW9 A;  4OCF A;  2GZY A;  3DVW A;  2WVZ A;  4V2N A;  1TU8 A;  1FHE A;  2EFH A;  4GTU A;  2IFQ A;  1A2J A;  5KN3 A;  1SJI A;  1GSQ A;  2YJH A;  1EOG A;  4PQH A;  5A34 B;  5A4W A;  1TRV A;  2FGX A;  3UIW A;  4LL1 B;  3WGD A;  8GSS A;  1GTU A;  2MBT A;  2GZZ A;  3LSZ A;  2C4J A;  4I97 A;  5DQS A;  4TN8 A;  4IQA A;  3QOU A;  1MDJ A;  4NWY A;  3H93 A;  2AJQ B;  2WB9 A;  1GUM A;  3G9B A;  2HSM A;  3US3 A;  4DSQ A;  13GS A;  1LJR A;  5F07 A;  2QGV A;  4TR3 A;  4ECC A;  2K6V A;  2VD1 A;  1XVW A;  5LD0 A;  2DML A;  4CY8 A;  3TJJ A;  3G7I A;  2L4C A;  4BL7 A;  4K0N A;  3R2Q A;  2PUK C;  1XVQ A;  4WBJ A;  2EIO A;  2RLI A;  2GGT A;  5COH A;  1H75 A;  1ERV A;  4A5P A;  2FD3 A;  4ILF A;  1B48 A;  1VF1 A;  2CVK A;  1MTC A;  4IBP A;  5D93 A;  3D0Z A;  1WIK A;  2CVD A;  2MMA A;  4EC0 A;  4GQC A;  5AIV A;  1AIU A;  2NDO A;  2XPE A;  2H6Z A;  1FOV A;  2F9S A;  1Z5Y E;  1XCC A;  2K9F A;  3WGE A;  4GRF A;  1GLP A;  3I69 A;  3DYR A;  3IHG A;  1AAZ A;  4NMU A;  6GSX A;  5DBQ A;  4WXT A;  2PU9 C;  3NZN A;  2MBS A;  5IMF A;  1X9W B;  1SVL A;  3UJ1 A;  5DAK B;  1T7P B;  3FR6 A;  1SK1 A;  4E8E A;  3VPQ A;  3HVN A;  3VK9 A;  3EU3 A;  1OKT A;  3E0U A;  3ME7 A;  2QKE A;  1TJD A;  1U3A A;  4BVX A;  2H72 A;  3UVH A;  1PN9 A;  1FVK A;  3FW2 A;  3V1W A;  2CZ3 A;  1YY7 A;  4KUN A;  5E59 A;  1OKD A;  3VWW A;  5GAP D;  3S9F A;  1V98 A;  3HMJ G;  4Q5Q A;  2P5Q A;  1BG1 A;  1GH2 A;  1OVN A;  1TP9 A;  4KDY A;  4PNG A;  4AJ6 A;  4XS6 A;  1SU9 A;  19GS A;  3HJO A;  4AJ8 A;  2VLV A;  3H1N A;  4EO3 A;  1AUC A;  1G0T A;  2GQM A;  2VL9 A;  5C04 A;  1DE1 A;  2M72 A;  3GSS A;  2B5X A;  5J47 A;  3GKM A;  4K2D A;  1N8J A;  1TOF A;  3EMX A;  3KH9 A;  3CWG A;  2H1D A;  2LJR A;  3APO A;  3FK8 A;  1PGT A;  3PIN A;  4KCE A;  3A5W A;  2XPD A;  3FMW A;  4AKI A;  3FZ4 A;  2WGR A;  1IYH A;  2IMK A;  4KA0 A;  4N11 A;  3P90 A;  4AKG A;  1S3D A;  1QQ2 A;  3RDW A;  1TRS A;  2P0G A;  1BQ7 A;  1ERW A;  1SJ6 A;  1EEJ A;  2HE3 A;  3N5O A;  3CSJ A;  4PUA A;  1Z6N A;  3EU4 A;  4F0B A;  2BTO T;  3UL3 A;  2HRN A;  4MP4 A;  4G9H A;  5DAL B;  4KX4 A;  4ZB8 A;  3WGX A;  3UEM A;  4F03 A;  1DE2 A;  3GA4 A;  1YEP A;  3TRX A;  2DJ2 A;  1DSB A;  1GNW A;  4Q5N A;  2H76 A;  3VWX A;  1UC7 A;  3GKX A;  2HZE B;  1XG8 A;  3F3Q A;  4DEJ A;  1A0R P;  1G7O A;  2LJK A;  2B3S A;  2F8F A;  5ECI B;  1M7T A;  1V9W A;  1PA3 A;  2AUV A;  5AIX A;  3W6G A;  4TRX A;  2H1A A;  4J2F A;  3IHQ A;  2BJX A;  2C8U A;  1K0M A;  3F0I A;  4OD7 A;  1V2A A;  1E2Y A;  3GV1 A;  2WW3 A;  1N2A A;  2CA8 A;  2DMM A;  2VM2 A;  1SK2 A;  4HSC X;  1TK8 B;  1E6B A;  3EVI A;  2PVO C;  4PQ1 A;  3EE2 A;  4KSM A;  3BBY A;  4GSN A;  2P31 A;  3TKP A;  3IA1 A;  1PMT A;  2YV7 A;  3G7Y A;  4D73 A;  3TRP A;  3TRQ A;  5JWQ B;  1ZMA A;  1HYU A;  1I5G A;  3HVS A;  3ZMK A;  3DXB A;  2O7K A;  2PGT A;  4MA9 A;  1S3R A;  1OE7 A;  4X1U A;  2C80 A;  3HDC A;  3HYP A;  2E2G A;  3GX8 A;  5IIZ A;  5FT3 A;  2TRX A;  2UZ8 A;  2ZUP A;  6GSS A;  1GTA A;  2LNS A;  1U6T A;  3EPT A;  2FA4 A;  4HI7 A;  3CYN A;  2GLR A;  2H19 A;  4PXO A;  2O85 A;  1B9X C;  2FHE A;  4NAX A;  2YWN A;  4HQZ A;  4WKW A;  4MK3 A;  2HXK A;  4BVY A;  1A0F A;  2D2Z A;  1X5D A;  4L5O A;  2OAD A;  3ZRD A;  2GT6 A;  2DIY A;  2C3T A;  3L9V A;  4HZ2 A;  2VL2 C;  2VD0 A;  2AB6 A;  3CTF A;  4ZL8 A;  4ZL9 A;  1O8W A;  5A34 A;  5J5N A;  3BD2 A;  3TKS A;  1RQM A;  2JZR A;  3HVV A;  3FY7 A;  4N10 A;  3MYD A;  2GSR A;  2OE1 A;  4XIH A;  1J9B A;  3LEF A;  2GS3 A;  2KP2 A;  3A2X A;  4ZBA A;  4MJB A;  4K8M A;  5A4U A;  10GS A;  1PKZ A;  3FEU A;  2FNO A;  1MD3 A;  3TKS E;  4BWS A;  2CQ9 A;  4XCS A;  3A3T A;  4POM A;  3M0F A;  6GST A;  2LS5 A;  3IPZ A;  1TI3 A;  1GUH A;  2R0C A;  1GSD A;  5ECL B;  4XS4 B;  2YOI A;  5G31 A;  3UBK A;  1SL2 B;  4AKX B;  1ILO A;  2A2P A;  4LMW A;  3QFA C;  5B6M A;  2JSY A;  1EV9 A;  5D9V A;  4IP1 A;  1QMV A;  4JRR A;  1EGO A;  2M80 A;  2XBQ A;  2WW1 A;  4USS A;  4F82 A;  3HJP A;  1EGR A;  3KCM A;  1AQV A;  5H5Q A;  3QMX A;  3TCO A;  1WP0 A;  3ZL5 A;  4AJ7 A;  1GSE A;  5LNK e;  5J3R A;  1Z3E A;  3RAZ A;  5IOX A;  1RW1 A;  4P3Y B;  4YQV A;  3ZYW A;  2PPT A;  5G5F A;  5IMZ A;  1GUL A;  4RUV A;  2WCI A;  2YWI A;  1GSU A;  2EIR A;  3QAW A;  4MZB A;  4POL A;  2R4V A;  4WR5 A;  3VI5 A;  4E68 A;  2VO4 A;  3L4N A;  2KUC A;  5DAK A;  2DKH A;  2WFC A;  3U6V A;  3F9U A;  3QAG A;  1UVZ A;  1T3B A;  1GSS A;  3ZZX A;  2O5V A;  4V1A p;  4PX1 A;  3BOA A;  4RQR A;  4K6X A;  2HRA A;  3KMO A;  3L9U A;  4HJM A;  3P8W A;  4BIK A;  5LCZ A;  3OR5 A;  1PQN A;  3VI7 A;  4CDO A;  5J40 A;  3VLN A;  2LJA A;  3RFR C;  1GL8 A;  5ECN B;  1CQH A;  3I6A A;  2I9H A;  4PI0 C;  4MZW A;  3PPU A;  1TK5 B;  3SBC A;  1MDI A;  1ZYP A;  2GQL A;  3D5J A;  3TDG A;  4I6X A;  2VCQ A;  1GRX A;  1HNA A;  2C0D A;  3KJY A;  2VCX A;  4MLY A;  3SWL A;  5G5E A;  1SD9 A;  2B1L A;  3VWU A;  1SEN A;  2B7J A;  4ZB6 A;  2A2S A;  3M9K A;  2A2R A;  2LUS A;  5A4V A;  1A2M A;  4Z2U A;  3TKQ A;  4GF0 A;  1Q98 A;  1GTB A;  3ED3 A;  4IHU A;  3HJM A;  2GZP A;  2L59 A;  4MF7 A;  2CAI A;  1TKD B;  1TXU A;  1ZYN A;  4YH2 A;  3ERF A;  2I1U A;  1EEM A;  1ZYE A;  4ECB A;  4ML1 A;  2K18 A;  1R26 A;  5DAL A;  1O73 A;  5JCU A;  3IV4 A;  2OAC A;  3DIE A;  1V40 A;  2L5O A;  2HT9 A;  1UA5 A;  3RHC A;  2FUG 2;  2VAF A;  4PHZ C;  1A8L A;  1OC8 A;  3GH9 A;  1UN2 A;  3GKK A;  1YKC A;  4YAV A;  3ZLP A;  2IIY A;  1G7E A;  3DKS A;  3C1R A;  2VUP A;  3F8U A;  2H8L A;  2G2Q A;  3LGC A;  1OC3 A;  1ZGN A;  1VRS D;  2LST A;  5L71 A;  4TR1 B;  1SYX A;  5CO3 A;  1Y6E A;  2FWE A;  4X0X A;  4MAB A;  1F37 A;  1CQG A;  2GDR A;  4X4J A;  4PTS A;  1THX A;  3U5R E;  4BWQ A;  1N25 A;  2WJU A;  1O85 A;  2AYT A;  4EL1 A;  2IME A;  2WUL A;  4OCE A;  4HZ4 A;  2B1K A;  3MAK A;  3DEX A;  2H73 A;  2VCT A;  3QPM A;  4PUF C;  3CTG A;  5F05 A;  3LFL A;  4HU7 A;  3A2V A;  4O92 A;  3FRC A;  3ZIV A;  1NHO A;  5IMC A;  1XBS A;  1ZYQ B;  3EUR A;  1B4Q A;  1JLW A;  4QL7 A;  4GWR A;  1O6J A;  2C0E A;  4G0I A;  4YKG A;  5B8B A;  4K0G A;  2JAD A;  1WOU A;  3UMA A;  2O87 A;  4K2X A;  2FY6 A;  3QFB C;  5KN2 A;  2LNT A;  1XWC A;  1G6Y A;  3ERG A;  2OT3 A;  4K7I A;  1QK8 A;  1XWA A;  5GAN D;  2IMD A;  5IMD A;  3L0H A;  3I43 A;  4NV2 A;  2WS2 A;  1VF3 A;  2RUE A;  5IO0 A;  1Z6M A;  4DSR A;  1OYJ A;  3MSZ A;  3DRN A;  2C1Y A;  2C0F A;  1YEX A;  5HFG A;  2IJY A;  5AIS A;  3H8Q A;  1F3A A;  2VCW A;  4BA7 A;  2CAQ A;  3GST A;  5AGY A;  2HSY A;  1OAZ A;  3F6D A;  4IQ1 A;  1FG4 A;  3C7M A;  3LWA A;  2N5A A;  3TJB A;  3W8J A;  2DBC A;  1R7H A;  2AV4 A;  5F8B A;  5J41 A;  1DUG A;  2XBI A;  5CYY A;  2L6D A;  2I81 A;  4NV5 A;  2WVX B;  3QR6 A;  1QGV A;  5D9W A;  4F0C A;  3IR4 A;  2ES7 A;  5C00 A;  2B6M A;  2YN1 A;  3GIX A;  1KBN A;  1YF0 A;  1AQX A;  11GS A;  1JZD A;  2Z9S A;  5DJM A;  4NHZ A;  4GDF A;  2L4Q A;  1XOB A;  3KMN A;  2VLT A;  4OFM A;  4MMM A;  3EIN A;  4V2M A;  5IPH A;  4GLT A;  1U3I A;  1I9D A;  2TRC P;  4MF6 A;  2YP6 A;  3BJ5 A;  3H4K A;  2PN8 A;  2HI7 A;  1T8E B;  3D6I A;  1QUW A;  1K0A A;  4I2U A;  2VOC A;  3CBU A;  5ECQ B;  1JZO A;  3L9S A;  1ZOF A;  3HZ4 A;  3VWV A;  2MMN A;  2GSQ A;  1T4Z A;  4EE0 A;  2H0G A;  5EY6 A;  2NVL A;  2R6K A;  3ZML A;  3GUR A;  1AC1 A;  2F8A A;  3QDN A;  2WRT A;  2FA8 A;  2LV3 A;  1O81 A;  4O5Q A;  4ZBD A;  1VGL A;  1SL0 B;  2C3N A;  2J23 A;  3IAM 2;  4L5L A;  2H1B A;  2GQK A;  1ZL9 A;  3TGZ A;  4I2T A;  1PL1 A;  2REM A;  4IGJ A;  4MF5 A;  1OC9 B;  4PQI A;  5IQY A;  1SKR B;  3RBT A;  4FQU A;  4OMV A;  1USB A;  3GH6 A;  4CW9 A;  1FAA A;  5A1N B;  2LQO A;  3DVX A;  2R5G A;  3KM6 A;  1TU7 A;  1IYI A;  3H79 A;  1M3I A;  3D22 A;  4G0L A;  3HVX A;  1S4B P;  2RM5 A;  3GX0 A;  2KP1 A;  2OE3 A;  3TB2 A;  4K5R A;  1ZZY A;  4AGS A;  2CX4 A;  4POK A;  4NPB A;  5B6N A;  2AHE A;  1YJ6 A;  3P2A A;  2CT6 A;  2R3X A;  2V32 A;  2DJJ A;  1GSY A;  2C0G A;  5EPF A;  3DD3 A;  1M9A A;  2H71 A;  4ZXG A;  5D8I A;  1Z7R A;  4W66 A;  1T4Y A;  3ZFB A;  3CRU A;  2DJ0 A;  4BL7 B;  2JU5 A;  5CRW A;  1K0N A;  1WE0 A;  4HS1 A;  3WD6 A;  2VLU A;  3GUS A;  1GP1 A;  4N0V A;  4OFN A;  1X0R A;  1URM A;  4XRA A;  3FZA A;  4YAP A;  1FO5 A;  2KOK A;  4HJ2 A;  5A5H B;  3KIJ A;  4ISD A;  1X9M B;  5H5S A;  2H70 A;  1VF2 A;  2P5R A;  4TXO B;  4IEL A;  3C71 A;  1K0B A;  4ID0 A;  3M3M A;  3GN3 A;  1TTZ A;  1F2E A;  5D9X A;  1BJX A;  4KH7 A;  2HRK B;  2OKA A;  3D21 A;  2EFC A;  4QQ7 A;  4PNF A;  4FYB A;  2YV9 A;  2O89 A;  4F2I A;  5ECH B;  2C3Q A;  1TRW A;  4KW6 A;  2ZCT A;  4PI2 C;  1GWC A;  1T1V A;  5INY A;  3IOS A;  2ZNM A;  4TR1 A;  1O7U A;  2X99 A;  2A4H A;  3HKR A;  1XZO A;  4QMK A;  4BVX B;  5KEJ A;  1X5C A;  2LRN A;  1K3Y A;  2JSZ A;  2MMZ A;  2HZF A;  4K5S A;  2YZH A;  2JAC A;  2O36 A;  2DKI A;  2ALB A;  4WBR D;  3LXT A;  2LQQ A;  3TOT A;  1XW5 A;  3F6F A;  3D4M A;  4L0U A;  5J4Y A;  2DJ1 A;  4MH2 A;  4HOJ A;  1BYE A;  2X8H A;  1O8X A;  2V2G A;  4XTS A;  4LMV A;  5F06 A;  5J4V A;  1NHY A;  3MWH A;  4JZQ A;  2H1G A;  4HQS A;  1U87 A;  3FR3 A;  1BAY A;  1WJK A;  1W89 A;  4WF5 A;  5CP1 A;  2FCH A;  2JZS A;  4IKH A;  2I3Y A;  5CNW A;  3DML A;  1RK4 A;  4EVM A;  4TR0 A;  2PVQ A;  2O3E A;  3C1S A;  3IE3 A;  2DJK A;  2BMX A;  1X9S B;  4LLR A;  2M46 A;  3HY2 A;  4FIW A;  1BED A;  12GS A;  4YKF A;  5IM9 A;  1XPV A; 
#chains in the Genus database with same CATH homology
 1TW9 A;  1U88 A;  2H0I A;  3IC4 A;  5JWO B;  5DCG A;  3WYW A;  1PD2 1;  16GS A;  4Z2T A;  2RUF A;  3N9J A;  3R3E A;  2VIM A;  2HNL A;  3KEB A;  3TJG A;  1Y25 A;  4DVC A;  3C73 A;  4JR6 A;  5HR2 A;  3ZFL A;  1GUK A;  2FWF A;  3KZQ A;  4ACS A;  1JHB A;  3CMI A;  4IJ3 A;  5HR3 A;  3JCM L;  17GS A;  2OBI A;  6GSY A;  5E4W A;  5DJL A;  2MMO A;  4IP6 A;  5BMU B;  3MNG A;  2A4V A;  4K9Z A;  3FR9 A;  3IK9 A;  2GVP A;  1XXU A;  2R37 A;  1XWB A;  3GFK A;  5AN1 A;  4PGT A;  1TXX A;  4O5R A;  3FHK A;  1EP7 A;  3J7Y b;  3DGQ A;  3IBH A;  3TOU A;  4MDC A;  1A8Y A;  4EDZ A;  3E3E A;  4FO5 A;  1PX6 A;  2PBJ A;  4BPY A;  4YQU A;  5BRT A;  1W4V A;  4I5Q A;  3KD0 A;  2HFD A;  2R0P A;  1SD8 A;  4WET A;  3TU3 B;  5ID2 B;  2VKZ G;  1XW6 A;  3IAS 2;  3NOF A;  3G7J A;  2K8V A;  2YAN A;  4IJI A;  3TKS C;  3GL3 A;  4ULX A;  1R5A A;  4D73 B;  1T00 A;  3LYP A;  4K1F A;  1MD4 A;  1KTE A;  1PRX A;  4Z2R A;  4NXI A;  5B7C A;  2WDU A;  1M9B A;  4JED A;  1QFN A;  5HFI A;  5D96 A;  1B8X A;  2YWO A;  4J57 E;  3ZVJ D;  3C8E A;  2E7P A;  2LRC A;  1NW2 A;  4EIP A;  1ST9 A;  18GS A;  5ECR B;  3CSH A;  1WWJ A;  2HZE A;  4RI7 A;  1V58 A;  3GTU B;  4CHS A;  1HD2 A;  4MJC A;  2L6C A;  4BVY B;  1OC9 A;  3LW9 A;  4G0K A;  5ECO B;  2NBS A;  3APS A;  3TKR A;  3TJF A;  4MJE A;  5A1N A;  4O7H A;  2ON5 A;  2OA7 A;  1R4W A;  3FKF A;  3GKN A;  4DSS B;  1MDK A;  1X5E A;  1QXH A;  2AAW A;  4MPG A;  1PN0 A;  2CZ2 A;  4IW9 A;  1A23 A;  2QA2 A;  4KDX A;  2X4A A;  4AF2 A;  1FB0 A;  1NM3 A;  4EUY A;  5G2Z A;  4K7O A;  4KDU A;  4MPF A;  1WMJ A;  2IL3 A;  1SL1 B;  5HFK A;  5J9B A;  3Q6O A;  4N0Z A;  1R5P A;  4JR4 A;  1SVO A;  3KXO A;  5IOW A;  2V6O A;  2O8V B;  2IN3 A;  5KOX A;  4HDE A;  2YNX A;  4V2L A;  5ENU A;  4FYU A;  2QC7 A;  2F51 A;  3VUR A;  2X8G A;  3FYG A;  3ZTL A;  2MYG A;  4L8E A;  2G0F A;  4TVE A;  1VF4 A;  4RQX A;  3FZ9 A;  3LJR A;  5A5H A;  5F0G A;  4WEY A;  1OE8 A;  6GSW A;  5FWG A;  3KTB A;  1K0D A;  1Z9H A;  4TXO A;  4ZB9 A;  3APQ A;  3A2W A;  1SKW B;  3VFI A;  3IC8 A;  3D4T A;  1S3A A;  1EP8 A;  5DQY A;  5CRH A;  1YZX A;  4GXZ A;  5J9C A;  4MNN A;  2HRK A;  2HYX A;  4POB A;  3RPP A;  4CY6 A;  1WRY A;  1XOA A;  3EWL A;  4ECI A;  3HZ8 A;  4MH3 A;  2HSN B;  3K8N A;  1GLQ A;  1NSW A;  3GNJ A;  4EIQ A;  3GHA A;  4LA1 A;  5DDL A;  2H66 A;  2RM6 A;  4O32 A;  3P7X A;  3IXR A;  1YF1 A;  2XHF A;  4TOP A;  3WT1 A;  4KE3 A;  3PR8 A;  3F4T A;  2JL4 A;  4H86 A;  4OWY A;  2B5E A;  2DC5 A;  1PX7 A;  5ECS A;  3Q19 A;  4XS4 A;  3HHV A;  2YPM A;  1GSF A;  5G1L A;  1M0U A;  1BG5 A;  3QCP A;  2VL2 A;  3CSI A;  4QL9 A;  5IPG A;  4XHM A;  3F3R A;  4ZIJ A;  4TXV A;  1M2A A;  2DJ3 A;  3FZ5 A;  3RPN A;  2V41 A;  4ICY A;  4ML6 A;  3KP9 A;  4KCA A;  2EFD A;  4KAE A;  3ISO A;  1SJZ A;  4V1A g;  2B7K A;  5EL8 A;  2GT5 A;  4HU9 A;  4E8H A;  1SYR A;  1K0O A;  2XC2 A;  2GST A;  2EIQ A;  2OBK A;  1GNE A;  3ZRE A;  3VPT A;  2EC4 A;  4MZC A;  22GS A;  4WR4 A;  1YVL A;  3W8S A;  1M2D A;  4K7N A;  4OO5 A;  3NIV A;  4N30 A;  3LQ7 A;  4EF0 A;  2PMT A;  1KEB A;  1BF5 A;  2OE0 A;  4JE1 A;  2VM1 A;  1H4O A;  3ZIJ A;  2X49 A;  2GTU A;  5DCH A;  3EC3 A;  1LU4 A;  5JCG A;  2FLS A;  3PGT A;  1YQ1 A;  2VCZ A;  1JLV A;  5ECM B;  6GSV A;  1B9Y C;  2HQT A;  2IFQ B;  5ECK B;  3DWV A;  5GST A;  2ON7 A;  2KHP A;  1FOH A;  1ML6 A;  2LKU A;  5G1K A;  1HNB A;  1ABA A;  2V1M A;  1WPI A;  4Q5R A;  4KND A;  3WT2 A;  2RII A;  4IS0 A;  4I8B A;  2YJ7 A;  5BMU A;  5ELA A;  3A5I A;  1M99 A;  4J56 E;  4TR4 A;  2L57 A;  1YDK A;  2PER A;  5CRD A;  2HSM B;  2TIR A;  2JZT A;  1SKS B;  2VCV A;  4ZB7 A;  2UV8 G;  2F3M A;  3GRX A;  1AQW A;  1F9M A;  1EZK A;  1TDI A;  4KGI A;  1FB6 A;  2H01 A;  2KLX A;  2CX3 A;  3CRT A;  5ID2 A;  1TK0 B;  2NTO A;  5HQP A;  4YQM A;  3GL5 A;  5CRE A;  3UOM A;  1EWX A;  1XWG A;  20GS A;  2LTK A;  1JFU A;  1GTI A;  3PH9 A;  2DLX A;  2X8C A;  3HA9 A;  5IO2 A;  1A24 A;  5JWR B;  4NHW A;  1EOH A;  2N5F A;  3UAR A;  1F3B A;  2IMI A;  2H74 A;  4X43 A;  1KNG A;  3IK7 A;  1B4P A;  2PWJ A;  1K0C A;  3MIX A;  2VL3 A;  5IMV A;  1K3O A;  3GTU A;  2DIZ A;  1J08 A;  3F63 A;  3KH7 A;  3F4R A;  1SVM A;  4KF9 A;  2H75 A;  7GSS A;  2E0Q A;  1Q4J A;  9GSS A;  3F4S A;  4EKZ A;  3LOR A;  4WF4 A;  1M2B A;  3GYK A;  4DSS A;  3MDK A;  5FHI A;  2CVB A;  2LEG A;  2IMF A;  2FWG A;  1FW1 A;  4XS1 A;  4JU5 A;  3GMF A;  2R2J A;  2E2M A;  5DVB A;  14GS A;  5KN1 A;  4ZIL A;  3I9V 2;  1JZW A;  4L0W A;  1HNC A;  3AY8 A;  3BCK A;  3ZIT A;  2HRF A;  2HSH A;  4XRD A;  4OO4 A;  1ON4 A;  2N5B A;  1BX9 A;  2X64 A;  3Q74 A;  2NPB A;  4ZBB A;  1EV4 A;  1V57 A;  3ZVJ A;  3EYT A;  1ERT A;  3HCZ A;  4HUA A;  5JCW A;  1MEK A;  3ERW A;  3M9J A;  1A2L A;  1FVJ A;  3E9J B;  4GSS A;  4MJA A;  2H0H A;  4HEA 2;  1PKW A;  1DBY A;  5ABR A;  2QA1 A;  2L5L A;  4IN0 A;  1Y1U A;  4TKY A;  1LBK A;  2V6K A;  2H1L A;  3LG6 A;  2IWT A;  1SK0 A;  5D9T A;  2MZC A;  2YZU A;  2H6X A;  4LL4 B;  2DSA A;  5KOW A;  4OFT A;  5A5K A;  4AI6 A;  4GCI A;  1ZCP A;  2K8S A;  2YWM A;  3UAP A;  5CRG A;  4KSO A;  3ME8 A;  3LXZ A;  3KGK A;  5KN0 A;  2I4A A;  3QAV A;  1XW9 A;  5ELG A;  3O76 A;  3Q18 A;  3J7Y k;  2EFE A;  5HR0 A;  1XIY A;  2HSN A;  2H6Y A;  1TRU A;  2IPA A;  4N3Z A;  4Z7X A;  4ZL7 A;  2YCD A;  1YKA A;  1JZR A;  3M1G A;  1C72 A;  4G10 A;  1XFL A;  3CXG A;  5CAX A;  5H5R A;  4G01 A;  3TUE A;  4GQF A;  3M8N A;  5HR1 A;  1G6W A;  1PSQ A;  3IDV A;  1ACV A;  1J0F A;  5J4U A;  5IMA A;  2B5Y A;  2WZ9 A;  3BCI A;  3LYK A;  4PUR A;  1XWK A;  5GZZ B;  4KB3 A;  2GSS A;  4G2E A;  2FWH A;  1TI1 A;  4G19 A;  1ERU A;  4EDY A;  4GST A;  1S3C A;  1HQO A;  2CV4 A;  4IVF A;  4FYC A;  1AXD A;  3HXS A;  5EVO A;  5GSS A;  3O3T A;  2OJL A;  3RHB A;  4ECJ A;  4F9Z A;  4O5U A;  4MCU A;  3QD9 A;  1Z7P A;  1PL2 A;  3O6T A;  6GSU A;  3EMP A;  2R0G A;  4EXJ A;  3UVT A;  3KP8 A;  5G30 A;  3UBL A;  4AKH A;  5B8A A;  4Q5F A;  1F6M C;  3TJK A;  2J9H A;  1K3L A;  3HD5 A;  3IRA A;  4JBB A;  5D73 A;  2LRT A;  2HLS A;  2QSI A;  2H30 A;  5ECP B;  3KTL A;  1THO A;  3L78 A;  4FH8 A;  4TW5 A;  4RI6 A;  1AW9 A;  4OCF A;  2GZY A;  3DVW A;  4V2N A;  1TU8 A;  1FHE A;  2EFH A;  4GTU A;  2IFQ A;  1A2J A;  5KN3 A;  1SJI A;  1GSQ A;  2YJH A;  1EOG A;  4PQH A;  5A34 B;  5A4W A;  1TRV A;  2FGX A;  3UIW A;  4LL1 B;  3WGD A;  8GSS A;  1GTU A;  2MBT A;  2GZZ A;  3LSZ A;  2C4J A;  4I97 A;  5DQS A;  4TN8 A;  4IQA A;  3QOU A;  1MDJ A;  4NWY A;  3H93 A;  2AJQ B;  2WB9 A;  1GUM A;  3G9B A;  2HSM A;  3US3 A;  4DSQ A;  13GS A;  1LJR A;  5F07 A;  2QGV A;  4TR3 A;  4ECC A;  2K6V A;  2VD1 A;  1XVW A;  5LD0 A;  2DML A;  4CY8 A;  3TJJ A;  3G7I A;  2L4C A;  4BL7 A;  4K0N A;  3R2Q A;  2PUK C;  1XVQ A;  4WBJ A;  2EIO A;  2RLI A;  2GGT A;  5COH A;  1H75 A;  1ERV A;  4A5P A;  2FD3 A;  4ILF A;  1B48 A;  1VF1 A;  2CVK A;  1MTC A;  4IBP A;  5D93 A;  3D0Z A;  1WIK A;  2CVD A;  2MMA A;  4EC0 A;  4GQC A;  5AIV A;  1AIU A;  2NDO A;  2XPE A;  2H6Z A;  1FOV A;  2F9S A;  1Z5Y E;  1XCC A;  2K9F A;  3WGE A;  4GRF A;  1GLP A;  3I69 A;  3DYR A;  3IHG A;  1AAZ A;  4NMU A;  6GSX A;  5DBQ A;  4WXT A;  2PU9 C;  3NZN A;  2MBS A;  5IMF A;  1X9W B;  1SVL A;  3UJ1 A;  5DAK B;  1T7P B;  3FR6 A;  1SK1 A;  4E8E A;  3VPQ A;  3VK9 A;  3EU3 A;  1OKT A;  3E0U A;  3ME7 A;  2QKE A;  1TJD A;  1U3A A;  4BVX A;  2H72 A;  3UVH A;  1PN9 A;  1FVK A;  3FW2 A;  3V1W A;  2CZ3 A;  1YY7 A;  4KUN A;  5E59 A;  1OKD A;  3VWW A;  5GAP D;  3S9F A;  1V98 A;  3HMJ G;  4Q5Q A;  2P5Q A;  1BG1 A;  1GH2 A;  1OVN A;  1TP9 A;  4KDY A;  4PNG A;  4AJ6 A;  4XS6 A;  1SU9 A;  19GS A;  3HJO A;  4AJ8 A;  2VLV A;  3H1N A;  4EO3 A;  1AUC A;  1G0T A;  2GQM A;  2VL9 A;  5C04 A;  1DE1 A;  2M72 A;  3GSS A;  2B5X A;  5J47 A;  3GKM A;  4K2D A;  1N8J A;  1TOF A;  3EMX A;  3KH9 A;  3CWG A;  2H1D A;  2LJR A;  3APO A;  3FK8 A;  1PGT A;  3PIN A;  4KCE A;  3A5W A;  2XPD A;  3FMW A;  4AKI A;  3FZ4 A;  2WGR A;  1IYH A;  2IMK A;  4KA0 A;  4N11 A;  3P90 A;  4AKG A;  1S3D A;  1QQ2 A;  3RDW A;  1TRS A;  2P0G A;  1BQ7 A;  1ERW A;  1SJ6 A;  1EEJ A;  2HE3 A;  3N5O A;  3CSJ A;  4PUA A;  1Z6N A;  3EU4 A;  4F0B A;  2BTO T;  3UL3 A;  2HRN A;  4MP4 A;  4G9H A;  5DAL B;  4KX4 A;  4ZB8 A;  3WGX A;  3UEM A;  4F03 A;  1DE2 A;  3GA4 A;  1YEP A;  3TRX A;  2DJ2 A;  1DSB A;  1GNW A;  4Q5N A;  2H76 A;  3VWX A;  1UC7 A;  3GKX A;  2HZE B;  3F3Q A;  4DEJ A;  1A0R P;  1G7O A;  2LJK A;  2B3S A;  2F8F A;  5ECI B;  1M7T A;  1V9W A;  1PA3 A;  2AUV A;  5AIX A;  3W6G A;  4TRX A;  2H1A A;  4J2F A;  3IHQ A;  2BJX A;  2C8U A;  1K0M A;  3F0I A;  4OD7 A;  1V2A A;  1E2Y A;  3GV1 A;  1N2A A;  2CA8 A;  2DMM A;  2VM2 A;  1SK2 A;  1TK8 B;  1E6B A;  3EVI A;  2PVO C;  4PQ1 A;  3EE2 A;  4KSM A;  3BBY A;  4GSN A;  2P31 A;  3TKP A;  3IA1 A;  1PMT A;  2YV7 A;  3G7Y A;  4D73 A;  3TRP A;  3TRQ A;  5JWQ B;  1ZMA A;  1HYU A;  1I5G A;  3HVS A;  3ZMK A;  3DXB A;  2O7K A;  2PGT A;  4MA9 A;  1OE7 A;  4X1U A;  2C80 A;  3HDC A;  3HYP A;  2E2G A;  3GX8 A;  5IIZ A;  5FT3 A;  2TRX A;  2UZ8 A;  2ZUP A;  6GSS A;  1GTA A;  2LNS A;  1U6T A;  3EPT A;  2FA4 A;  4HI7 A;  3CYN A;  2GLR A;  2H19 A;  4PXO A;  2O85 A;  1B9X C;  2FHE A;  4NAX A;  2YWN A;  4HQZ A;  4WKW A;  4MK3 A;  2HXK A;  4BVY A;  1A0F A;  2D2Z A;  1X5D A;  4L5O A;  2OAD A;  3ZRD A;  2GT6 A;  2DIY A;  2C3T A;  3L9V A;  4HZ2 A;  2VL2 C;  2VD0 A;  2AB6 A;  3CTF A;  4ZL8 A;  4ZL9 A;  1O8W A;  5A34 A;  5J5N A;  3BD2 A;  3TKS A;  1RQM A;  2JZR A;  3HVV A;  3FY7 A;  4N10 A;  3MYD A;  2GSR A;  2OE1 A;  4XIH A;  1J9B A;  3LEF A;  2GS3 A;  2KP2 A;  3A2X A;  4ZBA A;  4MJB A;  4K8M A;  5A4U A;  10GS A;  1PKZ A;  3FEU A;  2FNO A;  1MD3 A;  3TKS E;  4BWS A;  2CQ9 A;  4XCS A;  3A3T A;  4POM A;  3M0F A;  6GST A;  2LS5 A;  3IPZ A;  1TI3 A;  1GUH A;  2R0C A;  1GSD A;  5ECL B;  4XS4 B;  2YOI A;  5G31 A;  3UBK A;  1SL2 B;  4AKX B;  1ILO A;  2A2P A;  4LMW A;  3QFA C;  5B6M A;  2JSY A;  1EV9 A;  5D9V A;  4IP1 A;  1QMV A;  4JRR A;  1EGO A;  2M80 A;  2XBQ A;  4USS A;  4F82 A;  3HJP A;  1EGR A;  3KCM A;  1AQV A;  5H5Q A;  3QMX A;  3TCO A;  1WP0 A;  3ZL5 A;  4AJ7 A;  1GSE A;  5LNK e;  5J3R A;  1Z3E A;  3RAZ A;  5IOX A;  1RW1 A;  4P3Y B;  4YQV A;  3ZYW A;  2PPT A;  5G5F A;  5IMZ A;  1GUL A;  4RUV A;  2WCI A;  2YWI A;  1GSU A;  2EIR A;  3QAW A;  4MZB A;  4POL A;  2R4V A;  4WR5 A;  3VI5 A;  4E68 A;  2VO4 A;  3L4N A;  2KUC A;  5DAK A;  2DKH A;  2WFC A;  3U6V A;  3F9U A;  3QAG A;  1UVZ A;  1T3B A;  1GSS A;  3ZZX A;  2O5V A;  4V1A p;  4PX1 A;  3BOA A;  4RQR A;  4K6X A;  2HRA A;  3KMO A;  3L9U A;  4HJM A;  3P8W A;  5LCZ A;  3OR5 A;  1PQN A;  3VI7 A;  4CDO A;  5J40 A;  3VLN A;  2LJA A;  1GL8 A;  5ECN B;  1CQH A;  3I6A A;  2I9H A;  4MZW A;  3PPU A;  1TK5 B;  3SBC A;  1MDI A;  1ZYP A;  2GQL A;  3D5J A;  3TDG A;  4I6X A;  2VCQ A;  1GRX A;  1HNA A;  2C0D A;  3KJY A;  2VCX A;  4MLY A;  3SWL A;  5G5E A;  1SD9 A;  2B1L A;  3VWU A;  1SEN A;  2B7J A;  4ZB6 A;  2A2S A;  3M9K A;  2A2R A;  2LUS A;  5A4V A;  1A2M A;  4Z2U A;  3TKQ A;  4GF0 A;  1Q98 A;  1GTB A;  3ED3 A;  4IHU A;  3HJM A;  2GZP A;  2L59 A;  4MF7 A;  2CAI A;  1TKD B;  1TXU A;  1ZYN A;  4YH2 A;  3ERF A;  2I1U A;  1EEM A;  1ZYE A;  4ECB A;  4ML1 A;  2K18 A;  1R26 A;  5DAL A;  1O73 A;  5JCU A;  3IV4 A;  2OAC A;  3DIE A;  1V40 A;  2L5O A;  2HT9 A;  1UA5 A;  3RHC A;  2FUG 2;  2VAF A;  1A8L A;  1OC8 A;  3GH9 A;  1UN2 A;  3GKK A;  1YKC A;  4YAV A;  3ZLP A;  2IIY A;  1G7E A;  3DKS A;  3C1R A;  2VUP A;  3F8U A;  2H8L A;  2G2Q A;  3LGC A;  1OC3 A;  1ZGN A;  1VRS D;  2LST A;  5L71 A;  4TR1 B;  1SYX A;  5CO3 A;  1Y6E A;  2FWE A;  4X0X A;  4MAB A;  1F37 A;  1CQG A;  2GDR A;  4X4J A;  4PTS A;  1THX A;  3U5R E;  4BWQ A;  1N25 A;  2WJU A;  1O85 A;  2AYT A;  4EL1 A;  2IME A;  2WUL A;  4OCE A;  4HZ4 A;  2B1K A;  3MAK A;  3DEX A;  2H73 A;  2VCT A;  3QPM A;  4PUF C;  3CTG A;  5F05 A;  3LFL A;  4HU7 A;  3A2V A;  4O92 A;  3FRC A;  3ZIV A;  1NHO A;  5IMC A;  1XBS A;  1ZYQ B;  3EUR A;  1B4Q A;  1JLW A;  4QL7 A;  4GWR A;  1O6J A;  2C0E A;  4G0I A;  4YKG A;  5B8B A;  4K0G A;  2JAD A;  1WOU A;  3UMA A;  2O87 A;  4K2X A;  2FY6 A;  3QFB C;  5KN2 A;  2LNT A;  1XWC A;  1G6Y A;  3ERG A;  2OT3 A;  4K7I A;  1QK8 A;  1XWA A;  5GAN D;  2IMD A;  5IMD A;  3L0H A;  3I43 A;  4NV2 A;  2WS2 A;  1VF3 A;  2RUE A;  5IO0 A;  1Z6M A;  4DSR A;  1OYJ A;  3MSZ A;  3DRN A;  2C1Y A;  2C0F A;  1YEX A;  5HFG A;  2IJY A;  5AIS A;  3H8Q A;  1F3A A;  2VCW A;  4BA7 A;  2CAQ A;  3GST A;  5AGY A;  2HSY A;  1OAZ A;  3F6D A;  4IQ1 A;  1FG4 A;  3C7M A;  3LWA A;  2N5A A;  3TJB A;  3W8J A;  2DBC A;  1R7H A;  2AV4 A;  5F8B A;  5J41 A;  1DUG A;  2XBI A;  5CYY A;  2L6D A;  2I81 A;  4NV5 A;  3QR6 A;  1QGV A;  5D9W A;  4F0C A;  3IR4 A;  2ES7 A;  5C00 A;  2B6M A;  2YN1 A;  3GIX A;  1KBN A;  1YF0 A;  1AQX A;  11GS A;  1JZD A;  2Z9S A;  5DJM A;  4NHZ A;  4GDF A;  2L4Q A;  1XOB A;  3KMN A;  2VLT A;  4OFM A;  4MMM A;  3EIN A;  4V2M A;  5IPH A;  4GLT A;  1U3I A;  1I9D A;  2TRC P;  4MF6 A;  2YP6 A;  3BJ5 A;  3H4K A;  2PN8 A;  2HI7 A;  1T8E B;  3D6I A;  1QUW A;  1K0A A;  4I2U A;  2VOC A;  3CBU A;  5ECQ B;  1JZO A;  3L9S A;  1ZOF A;  3HZ4 A;  3VWV A;  2MMN A;  2GSQ A;  1T4Z A;  4EE0 A;  2H0G A;  5EY6 A;  2NVL A;  2R6K A;  3ZML A;  3GUR A;  1AC1 A;  2F8A A;  3QDN A;  2WRT A;  2FA8 A;  2LV3 A;  1O81 A;  4O5Q A;  4ZBD A;  1VGL A;  1SL0 B;  2C3N A;  2J23 A;  3IAM 2;  4L5L A;  2H1B A;  2GQK A;  1ZL9 A;  3TGZ A;  4I2T A;  1PL1 A;  2REM A;  4IGJ A;  4MF5 A;  1OC9 B;  4PQI A;  5IQY A;  1SKR B;  3RBT A;  4FQU A;  4OMV A;  1USB A;  3GH6 A;  4CW9 A;  1FAA A;  5A1N B;  2LQO A;  3DVX A;  2R5G A;  3KM6 A;  1TU7 A;  1IYI A;  3H79 A;  3D22 A;  4G0L A;  3HVX A;  2RM5 A;  3GX0 A;  2KP1 A;  2OE3 A;  3TB2 A;  4K5R A;  1ZZY A;  4AGS A;  2CX4 A;  4POK A;  4NPB A;  5B6N A;  2AHE A;  1YJ6 A;  3P2A A;  2CT6 A;  2R3X A;  2V32 A;  2DJJ A;  1GSY A;  2C0G A;  5EPF A;  3DD3 A;  1M9A A;  2H71 A;  4ZXG A;  5D8I A;  1Z7R A;  4W66 A;  1T4Y A;  3ZFB A;  3CRU A;  2DJ0 A;  4BL7 B;  2JU5 A;  5CRW A;  1K0N A;  1WE0 A;  4HS1 A;  3WD6 A;  2VLU A;  3GUS A;  1GP1 A;  4N0V A;  4OFN A;  1X0R A;  1URM A;  4XRA A;  3FZA A;  4YAP A;  1FO5 A;  2KOK A;  4HJ2 A;  5A5H B;  3KIJ A;  4ISD A;  1X9M B;  5H5S A;  2H70 A;  1VF2 A;  2P5R A;  4TXO B;  4IEL A;  3C71 A;  1K0B A;  4ID0 A;  3M3M A;  3GN3 A;  1TTZ A;  1F2E A;  5D9X A;  1BJX A;  4KH7 A;  2HRK B;  2OKA A;  3D21 A;  2EFC A;  4QQ7 A;  4PNF A;  4FYB A;  2YV9 A;  2O89 A;  4F2I A;  5ECH B;  2C3Q A;  1TRW A;  4KW6 A;  2ZCT A;  1GWC A;  1T1V A;  5INY A;  3IOS A;  2ZNM A;  4TR1 A;  1O7U A;  2X99 A;  2A4H A;  3HKR A;  1XZO A;  4QMK A;  4BVX B;  5KEJ A;  1X5C A;  2LRN A;  1K3Y A;  2JSZ A;  2MMZ A;  2HZF A;  4K5S A;  2YZH A;  2JAC A;  2DKI A;  2ALB A;  4WBR D;  3LXT A;  2LQQ A;  3TOT A;  1XW5 A;  3F6F A;  3D4M A;  4L0U A;  5J4Y A;  2DJ1 A;  4MH2 A;  4HOJ A;  1BYE A;  2X8H A;  1O8X A;  2V2G A;  4XTS A;  4LMV A;  5F06 A;  5J4V A;  1NHY A;  3MWH A;  4JZQ A;  2H1G A;  4HQS A;  1U87 A;  3FR3 A;  1BAY A;  1WJK A;  1W89 A;  4WF5 A;  5CP1 A;  2FCH A;  2JZS A;  4IKH A;  2I3Y A;  5CNW A;  3DML A;  1RK4 A;  4EVM A;  4TR0 A;  2PVQ A;  3C1S A;  3IE3 A;  2DJK A;  2BMX A;  1X9S B;  4LLR A;  2M46 A;  3HY2 A;  4FIW A;  1BED A;  12GS A;  4YKF A;  5IM9 A;  1XPV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...