2IMKA

Structures of an insect epsilon-class glutathione s-transferase from the malaria vector anopheles gambiae: evidence for high ddt-detoxifying activity
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
220
structure length
220
Chain Sequence
b'SNLVLYTLHLSPPCRAVELTAKALGLELEQKTINLLTGDHLKPEFVKLNPQHTIPVLDDNGTIITESHAIMIYLVTKYGKDDSLYPKDPVKQARVNSALHFESGVLFARMRFIFERILFFGKSDIPEDRVEYVQKSYELLEDTLVDDFVAGPTMTIADFSCISTISSIMGVVPLEQSKHPRIYAWIDRLKQLPYYEEANGGGGTDLGKFVLAKKEENAKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Epsilon-class Glutathione S-transferase
publication title Structure of an insect epsilon class glutathione S-transferase from the malaria vector Anopheles gambiae provides an explanation for the high DDT-detoxifying activity
pubmed doi rcsb
source organism Anopheles gambiae
molecule tags Transferase
total genus 83
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2006-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2imkA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2imkA01
3RHCA 1S3DA 3GKMA 3E9JB 1XW9A 4Q5NA 4IVFA 4KW6A 3TJBA 2O8VB 4OFNA 2LQQA 3D6IA 2VL3A 3EMXA 1MD4A 1GSSA 2HRKB 2VD0A 3VWUA 2GSTA 3FR3A 2H1BA 3IRAA 1T00A 4WBJA 2B1KA 1EP7A 2RUEA 3G9BA 3GIXA 3QCPA 4BWQA 1ZYEA 2C4JA 1THOA 1G7EA 2PGTA 2I1UA 3HY2A 1VF4A 4PURA 1H4OA 2I9HA 2WRTA 2VL2C 2X64A 3QD9A 3EC3A 3MWHA 4DSSA 1U6TA 2Z9SA 5G1LA 4TXOB 3L0HA 2HRFA 1Q98A 1T8EB 3W8SA 5ECKB 1WE0A 3VI5A 1QGVA 3M8NA 1ZYQB 1B4QA 1V58A 1KEBA 3BD2A 3TDGA 4EKZA 2HQTA 5GSTA 1NHOA 5COHA 1FAAA 5CREA 2H8LA 2QKEA 3FKFA 5ABRA 1EWXA 1PL2A 2YZUA 2UZ8A 4K9ZA 3D0ZA 4DEJA 4PX1A 2K8SA 5HFKA 3FW2A 4N11A 2DSAA 1T4YA 5D9TA 2GZYA 4EDYA 3ZITA 4MZBA 3PINA 3KP9A 3GUSA 2H74A 2H0GA 4BL7A 2B7JA 4YQVA 1ZL9A 2P5QA 3Q18A 1U88A 3EYTA 3I9V2 3F4RA 4XS4B 2V32A 4MPFA 1VRSD 4KH7A 4AJ6A 1GRXA 8GSSA 2PU9C 5G5FA 3LWAA 5ELAA 1EV9A 3U5RE 3KTBA 1X9MB 4KCAA 2LJAA 4MF7A 3EU3A 4YAVA 4LMVA 1O8XA 2DJ1A 1EEJA 2O7KA 3IE3A 5DBQA 1LBKA 4HU9A 2AUVA 2YWMA 1M2AA 3APSA 3GKNA 4V2NA 3TKPA 4MDCA 3K8NA 2KHPA 2HRKA 4ZL9A 3DD3A 2O89A 4ID0A 4HZ2A 3DKSA 4WF4A 6GSTA 1AC1A 2MBSA 2KP2A 3C1RA 3U6VA 1UA5A 1SK1A 1IYHA 2YJ7A 3HHVA 1AW9A 1BQ7A 1EEMA 2ZNMA 4TVEA 13GSA 3M0FA 1EGRA 2PVQA 5AIXA 2XBIA 2H70A 2KLXA 4MZCA 3WYWA 1SD8A 5J41A 3PR8A 5KEJA 1JLVA 4TXOA 2RM6A 1TKDB 2AAWA 1O7UA 1TRVA 3N5OA 2C0EA 2V1MA 2HZFA 1ERUA 1HYUA 5CRGA 1FVJA 2WZ9A 4G0KA 1THXA 3H8QA 2FGXA 1DBYA 2K6VA 3LQ7A 1NM3A 1JHBA 2F3MA 4GTUA 20GSA 3EURA 2DC5A 1V2AA 2YPMA 3DWVA 4ECBA 2MMOA 2H30A 2IMFA 1XIYA 2H72A 18GSA 2WS2A 4TXVA 4TW5A 1JLWA 5J4UA 4HEA2 5D9XA 1TTZA 4XS4A 2AB6A 3ZLPA 4XCSA 3VURA 2PN8A 4YQMA 4FYUA 1RK4A 3GKKA 1K0OA 3J7Yk 1UC7A 4HQZA 2BMXA 2YP6A 3UBLA 3TJFA 3EE2A 2GGTA 4TRXA 5FT3A 2MMAA 1EOHA 2VCXA 4D73B 2FLSA 1A2MA 3HCZA 4YAPA 3ZYWA 3HVSA 2ALBA 3F8UA 4TR1B 2KP1A 2MMZA 4TR0A 4IP6A 2YJHA 3QAGA 4NV2A 2HSMB 2VLUA 5E4WA 1XOAA 2MYGA 1AQWA 2HFDA 3QAWA 3D4TA 1DE2A 1PRXA 1J08A 4MF5A 5KN1A 2M46A 4X43A 4JRRA 3RPPA 2P0GA 5CNWA 3SBCA 3FR6A 3ME7A 3CSJA 4AJ7A 4F0CA 2XC2A 2X8HA 3H4KA 4BPYA 3KTLA 4LA1A 3M9JA 1R5PA 1YF1A 3UEMA 2E2GA 4HOJA 2EC4A 2VM2A 5B8BA 1QFNA 3TGZA 2EIQA 4EUYA 3RBTA 5JWQB 2IPAA 4MPGA 1T4ZA 1XWBA 1GTAA 5FWGA 1G7OA 2LUSA 4AGSA 1JZWA 3IBHA 1TRUA 1SJIA 2K8VA 3VWVA 4ULXA 3WT2A 1KBNA 1GH2A 4JBBA 4IJ3A 1FOVA 5IMZA 5E59A 1LJRA 2QGVA 1PL1A 3IAM2 1A2JA 4TR3A 2FY6A 4PUFC 4ZXGA 2P5RA 3V1WA 1TU8A 2VIMA 3ZVJA 4X0XA 2ZUPA 3PH9A 3P7XA 2P31A 2OKAA 5G30A 5G2ZA 3H1NA 4KE3A 2LEGA 2H1GA 2C0DA 3TB2A 2GT6A 4WXTA 3TJJA 2VL2A 4D73A 5CAXA 3UAPA 2IL3A 4ACSA 2LRCA 4OFMA 4J2FA 3AY8A 5ELGA 1OKDA 2DLXA 3DMLA 3IV4A 1X5CA 2B5YA 3GFKA 2HSMA 2YN1A 3UL3A 4RQXA 4MH2A 3W6GA 4GSSA 4ZB6A 1GSUA 4AJ8A 3IK7A 3MDKA 2DBCA 2PBJA 3R3EA 3KIJA 1GUMA 2GTUA 2FCHA 2NTOA 1SYRA 4N10A 3IPZA 3A2XA 4L8EA 1F9MA 2B1LA 3IA1A 3ME8A 4K7IA 4OO4A 3I69A 1M99A 4IKHA 3ZVJD 3DVWA 2C0FA 5J9CA 1O8WA 1PX6A 2ON5A 4MABA 4YH2A 4HDEA 3BCIA 1TRSA 1GSQA 2DJ0A 3NOFA 2F8AA 3HXSA 2C3TA 6GSYA 2LV3A 1OC3A 2H6ZA 5KN2A 3H93A 3VFIA 1YKAA 5DCGA 4OMVA 3ZMLA 3CXGA 4LLRA 3TRPA 2REMA 2IMKA 2R3XA 3O3TA 5L71A 1A8LA 4KB3A 5GAPD 3RAZA 3A2WA 4FYCA 4O32A 3TKSE 4JE1A 5BMUA 2N5AA 4WKWA 1GULA 2FA8A 5H5SA 1X9WB 3GMFA 2HRAA 1X9SB 4MCUA 1OC9B 4ZB8A 3UIWA 2LJRA 1SYXA 2L59A 3UMAA 2YV7A 1UN2A 2HI7A 4KSOA 2R4VA 4JZQA 2CA8A 4IQAA 3ZZXA 17GSA 4PQHA 5FHIA 2CT6A 2YNXA 6GSXA 1Z5YE 3BCKA 3WGEA 3WGDA 3HKRA 4XHMA 2CV4A 2LQOA 1TI1A 4Z7XA 1SK2A 3I43A 2GSQA 3VI7A 3WGXA 1PSQA 1W89A 4PGTA 4E8HA 2LRNA 4TOPA 5IMVA 3EVIA 2L6DA 3M3MA 5IO2A 1PN9A 5H5RA 1YZXA 3GL5A 4ZBDA 3A2VA 4F9ZA 1Z6NA 2DIYA 4QL7A 5IOXA 1ON4A 3ZMKA 2LKUA 1MD3A 5IMFA 4HS1A 2WGRA 1N2AA 1NW2A 4JU5A 4V1Ag 5JCWA 2R6KA 3ERWA 4EVMA 3IHQA 5D73A 1YEXA 5DJMA 3TCOA 5IMCA 4KSMA 1MDKA 3APOA 5DVBA 5ECNB 2A2RA 3CSHA 2DMLA 2GZPA 1QK8A 1R5AA 3OR5A 4FYBA 3GSTA 2X8GA 1B4PA 4G19A 3US3A 4FH8A 5AISA 1M7TA 4XIHA 1DE1A 2H19A 2L57A 4I97A 1SK0A 4XRAA 2H6YA 5B7CA 3NZNA 1FO5A 4HJMA 1XVQA 4PQ1A 3F9UA 2VOCA 3TKSC 1GLPA 4J57E 1OC9A 1XBSA 4XRDA 4GCIA 5C04A 2GQLA 2FD3A 3UVTA 3KZQA 4NWYA 1OYJA 2H1DA 5ENUA 3D21A 1V40A 1SJZA 1G6WA 5EL8A 3L78A 1WMJA 2DMMA 4CW9A 1SKWB 5GSSA 4I2UA 5HR1A 1ZMAA 3QDNA 2L5LA 2N5BA 1M2DA 4AF2A 3GSSA 4LMWA 3VPQA 3DYRA 1YJ6A 3G7IA 1ACVA 1RW1A 3DEXA 4X1UA 3F6FA 2CQ9A 2PUKC 2AV4A 3IR4A 2A2SA 4GSTA 1GTBA 4FQUA 3Q6OA 5ID2B 3VWXA 1U3AA 4O5RA 1I9DA 3EWLA 3HZ4A 5B6MA 3LXZA 4N30A 1JZRA 3GURA 3EMPA 4Q5QA 4KAEA 1V9WA 5F05A 4GSNA 1JFUA 2E2MA 2IMDA 5HR2A 3FZ5A 2PWJA 1F3AA 1TI3A 4WR5A 2B3SA 4CHSA 1R26A 2N5FA 3ZTLA 6GSVA 1TDIA 3HJPA 5DALB 4GF0A 5ECOB 4ILFA 2WB9A 3FHKA 2LJKA 4KX4A 4MJCA 2OACA 5D93A 2JL4A 3LG6A 1MTCA 3KMNA 4KF9A 1TJDA 4K6XA 5HQPA 3JCML 5JWRB 5ECHB 4QQ7A 4H86A 1LU4A 3D4MA 2C80A 3PPUA 3M9KA 5LD0A 5KN0A 2GT5A 5ECSA 2QC7A 4TR4A 4XS6A 3HVXA 2L6CA 1Z6MA 2AJQB 5B8AA 1NHYA 2X99A 4IP1A 3C71A 3GX8A 1S3CA 2FWHA 5DAKB 1FG4A 1XOBA 2ON7A 5GAND 3RDWA 1PMTA 5D9VA 1Z7RA 1WOUA 3G7JA 4I5QA 4IJIA 1MDIA 2TRCP 1URMA 1M2BA 5AN1A 1DSBA 4I2TA 1TP9A 6GSWA 1PA3A 2OE3A 5IIZA 1XFLA 2VO4A 3KMOA 1FB0A 5IMAA 1H75A 1OAZA 1FB6A 2G0FA 4MK3A 2H66A 4MLYA 2PVOC 3ERGA 5ECQB 1YQ1A 2PMTA 5ID2A 5A4UA 2NPBA 4XTSA 1WIKA 4ZIJA 1SKRB 2JU5A 2TIRA 3HJMA 2OE0A 1YY7A 2FWGA 10GSA 3EINA 5IM9A 3DIEA 3GH9A 2HSHA 2H75A 3GYKA 4MJAA 1EV4A 1GP1A 4KGIA 1HD2A 2IFQB 6GSSA 1PX7A 1TW9A 4ECCA 1GL8A 4PTSA 5DQYA 3KXOA 2H76A 4HU7A 2VLTA 3WT1A 1B9XC 3F3QA 2OA7A 2LNTA 5DALA 3TKRA 4NHZA 3ZFBA 2CX4A 2C0GA 5IOWA 2FUG2 1BX9A 1YF0A 2VM1A 6GSUA 4QL9A 3FR9A 3F0IA 3C8EA 2G2QA 2XBQA 1OVNA 1VF2A 3QR6A 1BJXA 3ZFLA 2FA4A 4IHUA 3IAS2 2KOKA 2BTOT 1OKTA 1SJ6A 2J23A 1K3OA 1HNAA 4ZBAA 4EE0A 5KN3A 2V41A 3MSZA 11GSA 3DXBA 2L4QA 2CVBA 3GHAA 3P2AA 1Y25A 3MNGA 5DAKA 1ML6A 2FWFA 1AUCA 4IELA 1ERTA 1W4VA 1PGTA 2CAQA 4CDOA 4HI7A 3BBYA 4O7HA 1QUWA 1XXUA 2NVLA 3GA4A 2DJJA 1B8XA 1XW6A 3ED3A 1S3AA 1Y6EA 1YDKA 1UVZA 4IW9A 2VCWA 1WPIA 1TXXA 5D96A 3RPNA 4WF5A 4F82A 1O81A 2RM5A 3TRXA 4G9HA 1BAYA 5J3RA 4PNFA 1K3LA 4OFTA 5C00A 2A4VA 3TKQA 4DSRA 2FNOA 3UOMA 1TK0B 2JSYA 1WP0A 4WETA 1PKWA 5A4WA 3N9JA 2M80A 2PERA 2KUCA 1CQHA 1J0FA 2YWNA 5JWOB 4JR6A 1ZCPA 5DCHA 5D8IA 4PXOA 2I81A 3IOSA 1PKZA 4MZWA 4WBRD 3P8WA 1GSDA 2B5EA 3HDCA 3A5WA 2IMIA 3FEUA 22GSA 1XW5A 1WJKA 1KTEA 5A5KA 3C73A 2L5OA 3VPTA 5D9WA 4NPBA 2V6KA 3UJ1A 1K0MA 3O6TA 3Q74A 2HT9A 2CAIA 2IFQA 4KA0A 3TKSA 3LEFA 4G0IA 2LS5A 4MJEA 2D2ZA 2OBIA 1A8YA 4KDXA 4PQIA 2AHEA 3F6DA 4KNDA 3HJOA 5LNKe 4WEYA 1ERVA 3TRQA 1XWGA 2FHEA 3Q19A 1V57A 4ML1A 5J9BA 2L4CA 2LTKA 4G10A 3KH9A 4N0ZA 3I6AA 1YEPA 3FRCA 4I6XA 2IJYA 1ABAA 2NBSA 2RLIA 5JCUA 4J56E 3ZL5A 5AGYA 3LGCA 1AAZA 3F3RA 4GXZA 1K0NA 1WRYA 5F07A 1MEKA 2B7KA 1HQOA 1EGOA 1M9AA 4V2LA 2JZRA 2PPTA 4ML6A 3QPMA 3VK9A 4FIWA 4P3YB 3TOTA 3F63A 2H0IA 4EDZA 2YCDA 4ZILA 2ZCTA 1USBA 1AXDA 2VCTA 1XVWA 1XPVA 5ECLB 5HR0A 5HR3A 4F03A 1JZDA 4EF0A 2H71A 4L0UA 3TUEA 2IN3A 1Z3EA 2WJUA 2YZHA 3E3EA 3KM6A 1WWJA 2LSTA 3ISOA 1SU9A 2WCIA 2HE3A 4PUAA 2WFCA 2C8UA 3H79A 4ZBBA 3WD6A 3ZREA 2HZEB 1B9YC 2BJXA 4NXIA 1BG5A 1ZGNA 2B6MA 1XZOA 3L9SA 1T7PB 4MJBA 3F4SA 3FZ4A 2JADA 3VLNA 3P90A 2DJ3A 4EC0A 2XPEA 1FHEA 1GTIA 2MBTA 2C3QA 1J9BA 7GSSA 3W8JA 4KCEA 1M0UA 4V2MA 1TK5B 14GSA 1OE8A 2VLVA 3GTUB 1GNWA 3PGTA 1GLQA 5EY6A 2OBKA 3SWLA 2HYXA 5HFIA 4RI7A 1XWAA 2O87A 1F6MC 19GSA 2V2GA 3FZAA 1G6YA 3DVXA 3L9UA 3GX0A 3MAKA 3CMIA 1GTUA 4RUVA 4MP4A 3QAVA 1CQGA 2H6XA 2GDRA 1ZZYA 5F8BA 2HRNA 5INYA 4F0BA 2CZ2A 4GWRA 2C3NA 2AYTA 5JCGA 3TOUA 3M1GA 3IDVA 16GSA 4Q5FA 2CZ3A 1FW1A 3GKXA 5LCZA 12GSA 3CTFA 1G0TA 3FK8A 4OWYA 2GSRA 4POLA 1TRWA 3ERFA 4FO5A 2VCQA 3HD5A 2VD1A 4BVXB 2F51A 1F2EA 1A23A 3CRTA 1U3IA 2CX3A 5IPGA 4OD7A 2OE1A 2TRXA 1PD21 1A2LA 4O92A 4JR4A 1XWKA 3IXRA 1VF1A 4IS0A 1GWCA 2H73A 1C72A 1K0DA 1ERWA 1F37A 4F2IA 3ZIVA 3HA9A 3IC4A 4LL1B 1GNEA 1ILOA 3EU4A 1TU7A 4XS1A 3IK9A 3CYNA 1QMVA 2H01A 2HZEA 3LORA 2JZTA 3KD0A 4GQFA 3UBKA 2IWTA 2F8FA 1T1VA 2QSIA 2K9FA 1V98A 3LSZA 3ZRDA 1GUHA 4YQUA 1IYIA 2DIZA 1BYEA 3CRUA 3IC8A 2IMEA 2XPDA 4K1FA 4TN8A 5G31A 4DSQA 4PNGA 2R5GA 1U87A 2GQMA 2VUPA 3GTUA 1K3YA 3F4TA 1GUKA 2GVPA 3D22A 2OJLA 2E0QA 3QFBC 2HLSA 3FYGA 2C1YA 4N0VA 4KUNA 1JZOA 2LRTA 1SD9A 2J9HA 4L5OA 2DJKA 4V1Ap 4POBA 1GSEA 4NV5A 2YV9A 4RI6A 4GQCA 1BEDA 4MF6A 1SKSB 4BA7A 4ECIA 3APQA 5EVOA 5IQYA 4K7OA 3J7Yb 3GN3A 4EO3A 4KDUA 1ST9A 1A0RP 3BOAA 3G7YA 1E2YA 4NAXA 5DQSA 2H1AA 2LNSA 3TJGA 4ZL7A 2YWOA 5HFGA 2OADA 1AIUA 3LXTA 4KDYA 4MH3A 1KNGA 1O85A 4L0WA 4HQSA 1SL2B 4G2EA 3D5JA 4BVXA 2MZCA 1TOFA 3RHBA 1N8JA 4BVYB 1T3BA 1EZKA 2ES7A 1GSYA 3CTGA 1K0BA 4HUAA 4NHWA 1TK8B 4I8BA 2GS3A 5CP1A 4HJ2A 1Z9HA 3LFLA 5DDLA 9GSSA 2GZZA 2DJ2A 2YOIA 3LYKA 2EIRA 3QOUA 2HNLA 3HVVA 3QMXA 5J5NA 1AQXA 3KH7A 2JZSA 3L9VA 4JEDA 4GRFA 4HZ4A 4K0NA 2R37A 5G5EA 1ZOFA 4ECJA 5CRDA 1SL0B 2JSZA 3LYPA 4RQRA 3GV1A 2VCZA 3BJ5A 5IO0A 3QFAC 4DVCA 2GLRA 4ZL8A 2XHFA 5EPFA 2YANA 2I3YA 4GLTA 4OCEA 3DGQA 2VCVA 1I5GA 5CRWA 2YWIA 2E7PA 1R4WA 2I4AA 1O73A 3LJRA 1X5DA 3CBUA 2X8CA 1R7HA 2M72A 4LL4B 5F06A 5IMDA 4EL1A 3VWWA 1A0FA 4IQ1A 2VL9A 4WR4A 2HSYA 3GNJA 4K7NA 4OO5A 4IBPA 1XWCA 4K8MA 2HSNB 1O6JA 2VAFA 4NMUA 5A4VA 1QQ2A 1DUGA 5ECPB 1X0RA 2HXKA 3HZ8A 5G1KA 3HYPA 4TKYA 1MDJA 1FVKA 2V6OA 1EP8A 1OC8A 3KEBA 2K18A 2NDOA 4Q5RA 4MMMA 4MA9A 2EIOA 5DJLA 5ECMB 3KJYA 4K0GA 3KCMA 4USSA 2CVDA 3ZIJA 5ECIB 4BVYA 1PQNA 1M9BA 2IIYA 3L4NA 2B5XA 1GSFA 4TR1A 2CVKA 1F3BA 1VGLA 5F0GA 3S9FA 5CO3A 1A24A 1RQMA 2H0HA 4DSSB 3O76A 3CSIA 4POMA 4EXJA 4OCFA 2R2JA 3FZ9A 4K2DA 3FY7A 5AIVA 2RIIA 2GSSA 1YKCA 2MMNA 3C7MA 4BWSA 3KP8A 1K0CA 2GQKA 3E0UA 4IGJA 1AQVA 3TJKA 3A3TA 1E6BA 1QXHA 1Z7PA 3UARA 1SL1B 1HNCA 2WDUA 4ISDA 3DRNA 2WULA 1X5EA 2RUFA 3GRXA 4G0LA 5ECRB 1NSWA 2O85A 1HNBA 4L5LA 2F9SA 4POKA 5CRHA 3C1SA 1EOGA 3UVHA 5IPHA 5CYYA 3R2QA 2JACA 1SENA 1B48A 3KGKA 1K0AA 4ZB9A 5B6NA 1OE7A 3NIVA 2FWEA 4BL7B 3GL3A 4E8EA 5H5QA 1VF3A 5GZZB 1Q4JA 1XCCA 3GH6A 4IN0A
chains in the Genus database with same CATH superfamily
4AKXB 3RHCA 4CY8A 1S3DA 3GKMA 3E9JB 1XW9A 2HSNA 4Q5NA 4IVFA 4KW6A 3TJBA 4PI0C 2O8VB 4OFNA 2LQQA 3D6IA 2VL3A 3EMXA 1MD4A 1GSSA 2HRKB 2VD0A 3VWUA 2GSTA 3FR3A 2H1BA 3IRAA 1T00A 4WBJA 2B1KA 1EP7A 2RUEA 3G9BA 3GIXA 3QCPA 4BWQA 1ZYEA 2C4JA 1S3RA 1THOA 2PGTA 1G7EA 2I1UA 3HY2A 1VF4A 4X4JA 4PURA 1H4OA 2I9HA 2WRTA 2VL2C 2X64A 3QD9A 3EC3A 3MWHA 4DSSA 1U6TA 2Z9SA 5G1LA 4TXOB 3L0HA 2HRFA 1Q98A 1T8EB 3W8SA 5ECKB 1WE0A 3VI5A 4CY6A 1QGVA 3M8NA 1ZYQB 1B4QA 1V58A 1KEBA 3BD2A 3TDGA 4EKZA 2HQTA 5GSTA 1NHOA 5COHA 1FAAA 5CREA 2H8LA 2QKEA 3FKFA 5ABRA 1EWXA 1PL2A 2YZUA 2UZ8A 4K9ZA 5A1NB 3D0ZA 4DEJA 4PX1A 2K8SA 5HFKA 3FW2A 4N11A 2DSAA 1T4YA 5D9TA 2GZYA 4EDYA 3ZITA 4MZBA 1S4BP 3PINA 3KP9A 3GUSA 2H74A 2H0GA 4BL7A 2B7JA 4YQVA 4EIPA 1ZL9A 2P5QA 3Q18A 1U88A 3EYTA 3I9V2 3F4RA 4XS4B 2V32A 4MPFA 1VRSD 4KH7A 4AJ6A 1GRXA 8GSSA 2PU9C 5G5FA 3LWAA 5ELAA 1EV9A 3U5RE 3KTBA 1X9MB 4KCAA 2LJAA 4MF7A 3EU3A 4YAVA 4LMVA 1O8XA 2DJ1A 1EEJA 2O7KA 3IE3A 5DBQA 1LBKA 4HU9A 2AUVA 2YWMA 1M2AA 3APSA 3GKNA 4V2NA 3TKPA 4MDCA 3K8NA 2KHPA 2HRKA 4ZL9A 3DD3A 2O89A 4ID0A 4HZ2A 3DKSA 4WF4A 6GSTA 1AC1A 2MBSA 2KP2A 3C1RA 3U6VA 1UA5A 1SK1A 1IYHA 2YJ7A 3HHVA 1AW9A 1BQ7A 1EEMA 2ZNMA 4TVEA 13GSA 3M0FA 1EGRA 2PVQA 5AIXA 2XBIA 2H70A 2KLXA 4MZCA 3WYWA 1SD8A 5J41A 3PR8A 5KEJA 2EFDA 1JLVA 4TXOA 2RM6A 1M3IA 1TKDB 4HSCX 2AAWA 1O7UA 1TRVA 3N5OA 2C0EA 2V1MA 2HZFA 1ERUA 1HYUA 5CRGA 1FVJA 2WZ9A 4G0KA 3CQFA 1THXA 3H8QA 2FGXA 1DBYA 2K6VA 3LQ7A 1NM3A 1JHBA 2F3MA 4QMKA 4GTUA 20GSA 5A1NA 3EURA 2DC5A 1V2AA 2YPMA 3DWVA 4ECBA 2MMOA 2H30A 1SVLA 2A2PA 2IMFA 1XIYA 2H72A 4AKHA 18GSA 2WS2A 4TXVA 4TW5A 1JLWA 5J4UA 4HEA2 5D9XA 1TTZA 4XS4A 2WW1A 2AB6A 3ZLPA 4XCSA 3VURA 2PN8A 4YQMA 4FYUA 1RK4A 3GKKA 2EFHA 1K0OA 2H1LA 3J7Yk 1UC7A 4HQZA 4Z2RA 2BMXA 2YP6A 3UBLA 3TJFA 3EE2A 2GGTA 4TRXA 5FT3A 2MMAA 1EOHA 2VCXA 4D73B 2FLSA 1A2MA 3HCZA 4YAPA 3ZYWA 3HVSA 2ALBA 3F8UA 4TR1B 2KP1A 2DKHA 2MMZA 4TR0A 4IP6A 2YJHA 3QAGA 4NV2A 2HSMB 4PI2C 2VLUA 5E4WA 5J4VA 1XOAA 2MYGA 1AQWA 2HFDA 3QAWA 3D4TA 1DE2A 1PRXA 1J08A 4MF5A 5KN1A 4ZB7A 2M46A 4X43A 4JRRA 3RPPA 5KOWA 2P0GA 5CNWA 3SBCA 3FR6A 3ME7A 3CSJA 4AJ7A 4F0CA 2XC2A 2X8HA 3H4KA 4BPYA 3KTLA 4LA1A 3M9JA 1R5PA 1YF1A 3UEMA 2E2GA 4HOJA 2EC4A 2VM2A 5B8BA 1QFNA 3TGZA 2EIQA 4EUYA 3RBTA 5JWQB 2IPAA 4MPGA 1T4ZA 1XWBA 1GTAA 5FWGA 1G7OA 2LUSA 4AGSA 1JZWA 3IBHA 1TRUA 1SJIA 2K8VA 3VWVA 4ULXA 3WT2A 1KBNA 1GH2A 4JBBA 4IJ3A 1FOVA 5BMUB 3EPTA 2WVZA 5IMZA 5E59A 1LJRA 2QGVA 1PL1A 3IAM2 1A2JA 4TR3A 2FY6A 4PUFC 4ZXGA 2P5RA 3V1WA 1TU8A 2VIMA 3ZVJA 4X0XA 2ZUPA 3PH9A 3P7XA 2P31A 2OKAA 5G30A 5G2ZA 3H1NA 4W66A 4KE3A 2LEGA 3MIXA 2H1GA 2C0DA 3RFRC 3TB2A 2GT6A 4WXTA 3TJJA 2VL2A 4D73A 5CAXA 3UAPA 2IL3A 4ACSA 2LRCA 4OFMA 4J2FA 3AY8A 5ELGA 1OKDA 2DLXA 3DMLA 3IV4A 1X5CA 2B5YA 3GFKA 3IHGA 2HSMA 2YN1A 3UL3A 4RQXA 4MH2A 3W6GA 4GSSA 4ZB6A 1GSUA 1BG1A 4AJ8A 3IK7A 3MDKA 2DBCA 2PBJA 3R3EA 3KIJA 1GUMA 2GTUA 2FCHA 2NTOA 1SYRA 4N10A 3IPZA 3A2XA 3CHXC 4L8EA 1F9MA 2B1LA 3IA1A 3ME8A 4K7IA 1XG8A 4OO4A 3I69A 1M99A 4IKHA 3ZVJD 3DVWA 2C0FA 5J9CA 1O8WA 1PX6A 2ON5A 4MABA 4YH2A 4HDEA 3BCIA 1TRSA 1GSQA 2DJ0A 3NOFA 2F8AA 2R0PA 3HXSA 2C3TA 6GSYA 4GDFA 2LV3A 1OC3A 1SVMA 2H6ZA 5KN2A 3H93A 3VFIA 1YKAA 5DCGA 4OMVA 3ZMLA 3CXGA 4LLRA 3TRPA 2REMA 2IMKA 2R3XA 3O3TA 5L71A 1A8LA 4KB3A 5GAPD 3RAZA 3A2WA 4FYCA 4O32A 3TKSE 4JE1A 5BMUA 2N5AA 4WKWA 1GULA 2O3EA 2FA8A 5H5SA 1X9WB 3GMFA 2HRAA 1X9SB 4MCUA 1OC9B 4ZB8A 3UIWA 2LJRA 1SYXA 2L59A 3UMAA 2YV7A 1UN2A 4BIKA 2HI7A 4KSOA 2R4VA 4JZQA 2CA8A 4IQAA 3ZZXA 17GSA 4PQHA 5FHIA 2CT6A 2YNXA 6GSXA 1Z5YE 3BCKA 3WGEA 3WGDA 3HKRA 4XHMA 2CV4A 2LQOA 1TI1A 4Z7XA 1SK2A 3I43A 2WVXB 2GSQA 3VI7A 3WGXA 1PSQA 1W89A 4PGTA 4E8HA 2LRNA 4TOPA 5IMVA 3EVIA 2L6DA 3M3MA 5IO2A 1PN9A 5H5RA 1YZXA 3GL5A 4ZBDA 3A2VA 4F9ZA 1Z6NA 2DIYA 4K5RA 4QL7A 5IOXA 1ON4A 3ZMKA 2LKUA 1MD3A 5IMFA 4G01A 4HS1A 2WGRA 1N2AA 1NW2A 4JU5A 4V1Ag 5JCWA 2R6KA 2R0CA 3ERWA 4EVMA 3IHQA 4AI6A 5D73A 1YEXA 5DJMA 3TCOA 5IMCA 4KSMA 1MDKA 3APOA 5DVBA 5ECNB 2A2RA 3CSHA 2DMLA 2WW3A 2GZPA 2X4AA 1QK8A 1R5AA 3OR5A 4FYBA 3GSTA 2X8GA 1B4PA 4G19A 3US3A 4FH8A 5AISA 1M7TA 4XIHA 1DE1A 2H19A 2L57A 4I97A 1SK0A 4XRAA 2H6YA 5B7CA 3NZNA 1FO5A 4HJMA 4O5UA 1XVQA 4PQ1A 3F9UA 2VOCA 3TKSC 1GLPA 1XBSA 1OC9A 4J57E 4XRDA 4GCIA 5C04A 2GQLA 2FD3A 3UVTA 3KZQA 4NWYA 1OYJA 2H1DA 5ENUA 3D21A 2WZSA 1V40A 1SJZA 1G6WA 5EL8A 3L78A 1WMJA 2DMMA 4CW9A 1SKWB 2O36A 5GSSA 4I2UA 4K5SA 5HR1A 1ZMAA 3QDNA 2L5LA 2N5BA 1M2DA 4AF2A 3GSSA 4LMWA 3VPQA 3DYRA 1YJ6A 2WVXA 3G7IA 1ACVA 1RW1A 3DEXA 4X1UA 3F6FA 2CQ9A 2PUKC 2WW2A 2AV4A 3IR4A 2A2SA 4GSTA 1GTBA 4FQUA 3Q6OA 5ID2B 3VWXA 1U3AA 3A5IA 4O5RA 2QA2A 1I9DA 3EWLA 2VKZG 3HZ4A 5B6MA 3LXZA 4N30A 1JZRA 3GURA 3EMPA 4Q5QA 4KAEA 1V9WA 5F05A 4GSNA 1JFUA 2E2MA 2IMDA 5HR2A 3FZ5A 2PWJA 1F3AA 1TI3A 4WR5A 2B3SA 4CHSA 1R26A 2N5FA 3ZTLA 6GSVA 1TDIA 3HJPA 5DALB 4GF0A 5ECOB 4ILFA 2WB9A 3FHKA 2LJKA 4KX4A 4MJCA 2OACA 5D93A 2JL4A 3LG6A 1MTCA 3KMNA 4KF9A 1TJDA 4K6XA 5HQPA 3JCML 5JWRB 5ECHB 4QQ7A 4H86A 1LU4A 3D4MA 2C80A 3PPUA 3M9KA 2UV8G 5LD0A 5KN0A 2GT5A 5ECSA 2QC7A 4TR4A 4XS6A 3HVXA 2L6CA 1Z6MA 2AJQB 5B8AA 1NHYA 2X99A 4IP1A 3C71A 3GX8A 1S3CA 2FWHA 5DAKB 1FG4A 1XOBA 2ON7A 5GAND 3RDWA 1PMTA 5D9VA 1Z7RA 1WOUA 3G7JA 4I5QA 4IJIA 1MDIA 2TRCP 1URMA 1M2BA 5AN1A 4EIQA 1DSBA 4I2TA 1TP9A 6GSWA 1PA3A 2OE3A 5IIZA 1XFLA 2VO4A 3KMOA 1FB0A 5IMAA 1H75A 1OAZA 1FB6A 2G0FA 4MK3A 2H66A 4MLYA 2PVOC 3ERGA 5ECQB 1YQ1A 2PMTA 5ID2A 5A4UA 2NPBA 4XTSA 1WIKA 4ZIJA 1SKRB 2JU5A 2TIRA 3HJMA 1ZYNA 2OE0A 1YY7A 2FWGA 5KOXA 10GSA 3EINA 5IM9A 5A5HB 3MYDA 3DIEA 3GH9A 2HSHA 2EFEA 2H75A 3GYKA 4MJAA 1EV4A 1N25A 1GP1A 4KGIA 1HD2A 2IFQB 6GSSA 1PX7A 1TW9A 4K2XA 4ECCA 1GL8A 4PTSA 5DQYA 3KXOA 2H76A 4HU7A 2VLTA 3WT1A 1B9XC 3F3QA 2OA7A 2LNTA 5DALA 5J47A 3TKRA 4NHZA 3ZFBA 2CX4A 2C0GA 5IOWA 2FUG2 1BX9A 1YF0A 2VM1A 2R0GA 6GSUA 4QL9A 3FR9A 3F0IA 3C8EA 3HMJG 2G2QA 2XBQA 1OVNA 1VF2A 3QR6A 1BJXA 3ZFLA 2FA4A 4IHUA 3IAS2 2KOKA 2BTOT 1OKTA 1SJ6A 2J23A 1K3OA 1HNAA 4ZBAA 4EE0A 5KN3A 2V41A 3MSZA 11GSA 4AKIA 3DXBA 2L4QA 2X49A 2CVBA 1I1IP 3GHAA 3P2AA 1Y25A 3MNGA 5DAKA 1ML6A 2FWFA 1AUCA 4IELA 1ERTA 1W4VA 1PGTA 2CAQA 4CDOA 4HI7A 3BBYA 4O7HA 1QUWA 1XXUA 2NVLA 5A34A 3GA4A 2DJJA 1B8XA 1XW6A 3ED3A 1S3AA 1Y6EA 1YDKA 1UVZA 4IW9A 2VCWA 1WPIA 1TXXA 5D96A 3RPNA 4WF5A 4F82A 1O81A 2RM5A 3TRXA 4G9HA 1BAYA 5J3RA 4PNFA 1K3LA 4OFTA 5C00A 2A4VA 3TKQA 4DSRA 2FNOA 3UOMA 1TK0B 2JSYA 1WP0A 4WETA 1PKWA 5A4WA 3N9JA 2M80A 2PERA 2KUCA 1CQHA 1J0FA 2YWNA 5JWOB 4JR6A 1ZCPA 5DCHA 5D8IA 4PXOA 2I81A 3IOSA 1PKZA 4MZWA 4WBRD 3P8WA 1GSDA 2B5EA 3HDCA 4E68A 3A5WA 2IMIA 5A5HA 3FEUA 22GSA 1XW5A 1WJKA 1KTEA 5A5KA 3C73A 2L5OA 3VPTA 5D9WA 4NPBA 2V6KA 3UJ1A 1K0MA 3O6TA 3Q74A 4O5QA 2HT9A 2CAIA 2IFQA 4KA0A 3TKSA 3LEFA 4G0IA 2LS5A 4MJEA 2D2ZA 2OBIA 1A8YA 4KDXA 4PQIA 2AHEA 3F6DA 4KNDA 3HJOA 5LNKe 4WEYA 1ERVA 3TRQA 1XWGA 2FHEA 3Q19A 1V57A 4ML1A 5J9BA 2L4CA 2LTKA 4G10A 3KH9A 4N0ZA 3I6AA 1YEPA 1Y1UA 3FRCA 4I6XA 2IJYA 1ABAA 2NBSA 2RLIA 5JCUA 4J56E 3ZL5A 5AGYA 3LGCA 1SVOA 1AAZA 3F3RA 4Z2TA 4GXZA 1K0NA 1WRYA 5F07A 1MEKA 2B7KA 1HQOA 1EGOA 1M9AA 4V2LA 2JZRA 5J40A 2PPTA 4ML6A 3QPMA 3VK9A 4FIWA 4P3YB 3TOTA 3F63A 2H0IA 4EDZA 2YCDA 4ZILA 2ZCTA 1USBA 1AXDA 2VCTA 1ZYPA 1XVWA 1XPVA 5J4YA 5ECLB 5HR0A 5HR3A 4F03A 1JZDA 4EF0A 2H71A 4L0UA 3TUEA 2IN3A 1Z3EA 2WJUA 2YZHA 3E3EA 3KM6A 1WWJA 1TXUA 2LSTA 3ISOA 1SU9A 2WCIA 2HE3A 4PUAA 2WFCA 2C8UA 3H79A 4ZBBA 3WD6A 3ZREA 2HZEB 1B9YC 2BJXA 4NXIA 1BG5A 1ZGNA 2B6MA 1XZOA 3L9SA 1T7PB 4MJBA 3F4SA 3FZ4A 2JADA 3VLNA 3P90A 2DJ3A 4EC0A 2XPEA 1FHEA 1GTIA 2MBTA 2C3QA 1J9BA 7GSSA 3W8JA 4KCEA 1M0UA 4V2MA 1TK5B 14GSA 1OE8A 3CWGA 2VLVA 3GTUB 1GNWA 3PGTA 1GLQA 5EY6A 2OBKA 3SWLA 2HYXA 5HFIA 4RI7A 1XWAA 2O87A 1F6MC 19GSA 1M3JA 2V2GA 3FZAA 1G6YA 3DVXA 3L9UA 3GX0A 3MAKA 3CMIA 1GTUA 4RUVA 4MP4A 3QAVA 1CQGA 2H6XA 2GDRA 1ZZYA 5F8BA 2HRNA 5INYA 1PFOA 4F0BA 2CZ2A 4GWRA 4ICYA 2C3NA 2AYTA 5JCGA 3TOUA 3M1GA 3IDVA 16GSA 4Q5FA 2CZ3A 1FW1A 3GKXA 5LCZA 12GSA 3CTFA 1G0TA 3FK8A 4OWYA 2GSRA 4POLA 1TRWA 3ERFA 4FO5A 2VCQA 3HD5A 2VD1A 4BVXB 2F51A 1F2EA 1A23A 3CRTA 1U3IA 4YKFA 2CX3A 5IPGA 4OD7A 2OE1A 2TRXA 1PD21 1A2LA 4O92A 4JR4A 1XWKA 3IXRA 1VF1A 4IS0A 1GWCA 2H73A 3TU3B 1C72A 1K0DA 1ERWA 1F37A 4F2IA 3ZIVA 3HA9A 3IC4A 4LL1B 1GNEA 1ILOA 3EU4A 1TU7A 4XS1A 4A5PA 3IK9A 3CYNA 1QMVA 2H01A 2HZEA 3LORA 2JZTA 3KD0A 4GQFA 3UBKA 2IWTA 2F8FA 3RGBC 1T1VA 2QSIA 2K9FA 1V98A 3LSZA 3ZRDA 1BF5A 1GUHA 4YQUA 1IYIA 2DIZA 1BYEA 3CRUA 3IC8A 2IMEA 2XPDA 4K1FA 4TN8A 5G31A 4DSQA 4PNGA 2R5GA 1U87A 2GQMA 2VUPA 2OT3A 3GTUA 1K3YA 3F4TA 2EFCA 1GUKA 2GVPA 3D22A 2OJLA 2E0QA 3QFBC 2HLSA 2DKIA 3FYGA 2C1YA 4N0VA 4KUNA 1JZOA 2LRTA 4Z2UA 1SD9A 2J9HA 4L5OA 2DJKA 4V1Ap 4POBA 1GSEA 4NV5A 2YV9A 4RI6A 4GQCA 2WVYA 1BEDA 4MF6A 1SKSB 4BA7A 4ECIA 3APQA 5EVOA 5IQYA 4K7OA 3J7Yb 3GN3A 4EO3A 4KDUA 1ST9A 1A0RP 3BOAA 3G7YA 1E2YA 4NAXA 5DQSA 2H1AA 2LNSA 4PHZC 3TJGA 4YKGA 4ZL7A 2YWOA 5HFGA 2OADA 1AIUA 3LXTA 4KDYA 4MH3A 1KNGA 1O85A 4L0WA 4HQSA 4FXYP 1SL2B 4G2EA 3D5JA 1PN0A 4BVXA 2MZCA 1TOFA 3RHBA 1N8JA 4BVYB 1T3BA 5BRTA 1EZKA 2ES7A 1GSYA 3CTGA 1K0BA 4HUAA 4NHWA 1TK8B 4I8BA 5A34B 2GS3A 5CP1A 4HJ2A 1Z9HA 3LFLA 5DDLA 9GSSA 2GZZA 2DJ2A 2YOIA 3LYKA 2EIRA 2O5VA 3QOUA 2HNLA 3HVVA 3QMXA 5J5NA 1AQXA 3KH7A 2JZSA 3L9VA 4JEDA 4GRFA 4HZ4A 4K0NA 2R37A 5G5EA 1ZOFA 4ECJA 5CRDA 1SL0B 2JSZA 3LYPA 4RQRA 3GV1A 2VCZA 3BJ5A 5IO0A 3QFAC 4DVCA 2GLRA 4ZL8A 2XHFA 5EPFA 2YANA 2I3YA 4GLTA 4OCEA 3DGQA 2VCVA 1I5GA 5CRWA 2YWIA 2E7PA 1R4WA 2I4AA 1O73A 3LJRA 1X5DA 3CBUA 2X8CA 1R7HA 2M72A 4LL4B 5F06A 5IMDA 4EL1A 3VWWA 1A0FA 4IQ1A 2VL9A 2QA1A 4WR4A 2HSYA 3GNJA 4MNNA 4K7NA 4OO5A 4IBPA 1XWCA 4K8MA 2HSNB 1O6JA 2VAFA 4NMUA 5A4VA 1YVLA 1QQ2A 1DUGA 5ECPB 1X0RA 3HVNA 2HXKA 3HZ8A 5G1KA 3HYPA 4TKYA 4AKGA 1MDJA 1FVKA 2V6OA 1EP8A 1OC8A 3KEBA 2K18A 2NDOA 4Q5RA 4MMMA 4MA9A 2EIOA 5DJLA 5ECMB 3KJYA 4K0GA 3KCMA 4USSA 2CVDA 3ZIJA 5ECIB 4BVYA 1PQNA 1M9BA 2IIYA 3L4NA 1YEWC 2B5XA 1FOHA 1GSFA 4TR1A 2CVKA 1F3BA 1VGLA 5F0GA 2A4HA 5CO3A 3S9FA 1A24A 1RQMA 2H0HA 4DSSB 3O76A 3CSIA 4POMA 3LW9A 4EXJA 4OCFA 2R2JA 3FZ9A 4K2DA 3FY7A 5AIVA 2RIIA 2GSSA 1YKCA 2MMNA 3C7MA 4BWSA 3KP8A 1K0CA 2GQKA 3E0UA 4IGJA 1AQVA 3TJKA 3A3TA 1E6BA 3FMWA 1QXHA 1Z7PA 3UARA 1SL1B 1HNCA 2WDUA 4ISDA 3DRNA 2WULA 1X5EA 3GRXA 2RUFA 4G0LA 2WW0A 5ECRB 1NSWA 2O85A 1HNBA 4N3ZA 4L5LA 2F9SA 4POKA 5CRHA 3C1SA 1EOGA 3UVHA 5IPHA 5CYYA 3R2QA 2JACA 1SENA 1B48A 3KGKA 1K0AA 4ZB9A 5B6NA 1OE7A 3NIVA 2FWEA 4BL7B 3GL3A 4E8EA 5H5QA 1VF3A 5GZZB 1Q4JA 1XCCA 3GH6A 4IN0A
chains in the Genus database with same CATH topology
4AKXB 3RHCA 4CY8A 1S3DA 3GKMA 3E9JB 1XW9A 2HSNA 4Q5NA 4IVFA 4KW6A 3TJBA 2O8VB 4OFNA 2LQQA 3D6IA 2VL3A 3EMXA 1MD4A 1GSSA 2HRKB 2VD0A 3VWUA 2GSTA 3FR3A 2H1BA 3IRAA 1T00A 4WBJA 2B1KA 1EP7A 2RUEA 3G9BA 3GIXA 3QCPA 4BWQA 1ZYEA 2C4JA 1THOA 1G7EA 2PGTA 2I1UA 3HY2A 1VF4A 4X4JA 4PURA 1H4OA 2I9HA 2WRTA 2VL2C 2X64A 3QD9A 3EC3A 3MWHA 4DSSA 1U6TA 2Z9SA 5G1LA 4TXOB 3L0HA 2HRFA 1Q98A 1T8EB 3W8SA 5ECKB 1WE0A 3VI5A 4CY6A 1QGVA 3M8NA 1ZYQB 1B4QA 1V58A 1KEBA 3BD2A 3TDGA 4EKZA 2HQTA 5GSTA 1NHOA 5COHA 1FAAA 5CREA 2H8LA 2QKEA 3FKFA 5ABRA 1EWXA 1PL2A 2YZUA 2UZ8A 4K9ZA 5A1NB 3D0ZA 4DEJA 4PX1A 2K8SA 5HFKA 3FW2A 4N11A 2DSAA 1T4YA 5D9TA 2GZYA 4EDYA 3ZITA 4MZBA 3PINA 3KP9A 3GUSA 2H74A 2H0GA 4BL7A 2B7JA 4YQVA 4EIPA 1ZL9A 2P5QA 3Q18A 1U88A 3EYTA 3I9V2 3F4RA 4XS4B 2V32A 4MPFA 1VRSD 4KH7A 4AJ6A 1GRXA 8GSSA 2PU9C 5G5FA 3LWAA 5ELAA 1EV9A 3U5RE 3KTBA 1X9MB 4KCAA 2LJAA 4MF7A 3EU3A 4YAVA 4LMVA 1O8XA 2DJ1A 1EEJA 2O7KA 3IE3A 5DBQA 1LBKA 4HU9A 2AUVA 2YWMA 1M2AA 3APSA 3GKNA 4V2NA 3TKPA 4MDCA 3K8NA 2KHPA 2HRKA 4ZL9A 3DD3A 2O89A 4ID0A 4HZ2A 3DKSA 4WF4A 6GSTA 1AC1A 2MBSA 2KP2A 3C1RA 3U6VA 1UA5A 1SK1A 1IYHA 2YJ7A 3HHVA 1AW9A 1BQ7A 1EEMA 2ZNMA 4TVEA 13GSA 3M0FA 1EGRA 2PVQA 5AIXA 2XBIA 2H70A 2KLXA 4MZCA 3WYWA 1SD8A 5J41A 3PR8A 5KEJA 2EFDA 1JLVA 4TXOA 2RM6A 1TKDB 2AAWA 1O7UA 1TRVA 3N5OA 2C0EA 2V1MA 2HZFA 1ERUA 1HYUA 5CRGA 1FVJA 2WZ9A 4G0KA 1THXA 3H8QA 2FGXA 1DBYA 2K6VA 3LQ7A 1NM3A 1JHBA 2F3MA 4QMKA 4GTUA 20GSA 5A1NA 3EURA 2DC5A 1V2AA 2YPMA 3DWVA 4ECBA 2MMOA 2H30A 1SVLA 2A2PA 2IMFA 1XIYA 2H72A 4AKHA 18GSA 2WS2A 4TXVA 4TW5A 1JLWA 5J4UA 4HEA2 5D9XA 1TTZA 4XS4A 2AB6A 3ZLPA 4XCSA 3VURA 2PN8A 4YQMA 4FYUA 1RK4A 3GKKA 2EFHA 1K0OA 2H1LA 3J7Yk 1UC7A 4HQZA 4Z2RA 2BMXA 2YP6A 3UBLA 3TJFA 3EE2A 2GGTA 4TRXA 5FT3A 2MMAA 1EOHA 2VCXA 4D73B 2FLSA 1A2MA 3HCZA 4YAPA 3ZYWA 3HVSA 2ALBA 3F8UA 4TR1B 2KP1A 2DKHA 2MMZA 4TR0A 4IP6A 2YJHA 3QAGA 4NV2A 2HSMB 2VLUA 5E4WA 5J4VA 1XOAA 2MYGA 1AQWA 2HFDA 3QAWA 3D4TA 1DE2A 1PRXA 1J08A 4MF5A 5KN1A 4ZB7A 2M46A 4X43A 4JRRA 3RPPA 5KOWA 2P0GA 5CNWA 3SBCA 3FR6A 3ME7A 3CSJA 4AJ7A 4F0CA 2XC2A 2X8HA 3H4KA 4BPYA 3KTLA 4LA1A 3M9JA 1R5PA 1YF1A 3UEMA 2E2GA 4HOJA 2EC4A 2VM2A 5B8BA 1QFNA 3TGZA 2EIQA 4EUYA 3RBTA 5JWQB 2IPAA 4MPGA 1T4ZA 1XWBA 1GTAA 5FWGA 1G7OA 2LUSA 4AGSA 1JZWA 3IBHA 1TRUA 1SJIA 2K8VA 3VWVA 4ULXA 3WT2A 1KBNA 1GH2A 4JBBA 4IJ3A 1FOVA 5BMUB 3EPTA 5IMZA 5E59A 1LJRA 2QGVA 1PL1A 3IAM2 1A2JA 4TR3A 2FY6A 4PUFC 4ZXGA 2P5RA 3V1WA 1TU8A 2VIMA 3ZVJA 4X0XA 2ZUPA 3PH9A 3P7XA 2P31A 2OKAA 5G30A 5G2ZA 3H1NA 4W66A 4KE3A 2LEGA 3MIXA 2H1GA 2C0DA 3TB2A 2GT6A 4WXTA 3TJJA 2VL2A 4D73A 5CAXA 3UAPA 2IL3A 4ACSA 2LRCA 4OFMA 4J2FA 3AY8A 5ELGA 1OKDA 2DLXA 3DMLA 3IV4A 1X5CA 2B5YA 3GFKA 3IHGA 2HSMA 2YN1A 3UL3A 4RQXA 4MH2A 3W6GA 4GSSA 4ZB6A 1GSUA 1BG1A 4AJ8A 3IK7A 3MDKA 2DBCA 2PBJA 3R3EA 3KIJA 1GUMA 2GTUA 2FCHA 2NTOA 1SYRA 4N10A 3IPZA 3A2XA 4L8EA 1F9MA 2B1LA 3IA1A 3ME8A 4K7IA 4OO4A 3I69A 1M99A 4IKHA 3ZVJD 3DVWA 2C0FA 5J9CA 1O8WA 1PX6A 2ON5A 4MABA 4YH2A 4HDEA 3BCIA 1TRSA 1GSQA 2DJ0A 3NOFA 2F8AA 2R0PA 3HXSA 2C3TA 6GSYA 4GDFA 2LV3A 1OC3A 1SVMA 2H6ZA 5KN2A 3H93A 3VFIA 1YKAA 5DCGA 4OMVA 3ZMLA 3CXGA 4LLRA 3TRPA 2REMA 2IMKA 2R3XA 3O3TA 5L71A 1A8LA 4KB3A 5GAPD 3RAZA 3A2WA 4FYCA 4O32A 3TKSE 4JE1A 5BMUA 2N5AA 4WKWA 1GULA 2FA8A 5H5SA 1X9WB 3GMFA 2HRAA 1X9SB 4MCUA 1OC9B 4ZB8A 3UIWA 2LJRA 1SYXA 2L59A 3UMAA 2YV7A 1UN2A 2HI7A 4KSOA 2R4VA 4JZQA 2CA8A 4IQAA 3ZZXA 17GSA 4PQHA 5FHIA 2CT6A 2YNXA 6GSXA 1Z5YE 3BCKA 3WGEA 3WGDA 3HKRA 4XHMA 2CV4A 2LQOA 1TI1A 4Z7XA 1SK2A 3I43A 2GSQA 3VI7A 3WGXA 1PSQA 1W89A 4PGTA 4E8HA 2LRNA 4TOPA 5IMVA 3EVIA 2L6DA 3M3MA 5IO2A 1PN9A 5H5RA 1YZXA 3GL5A 4ZBDA 3A2VA 4F9ZA 1Z6NA 2DIYA 4K5RA 4QL7A 5IOXA 1ON4A 3ZMKA 2LKUA 1MD3A 5IMFA 4G01A 4HS1A 2WGRA 1N2AA 1NW2A 4JU5A 4V1Ag 5JCWA 2R6KA 2R0CA 3ERWA 4EVMA 3IHQA 4AI6A 5D73A 1YEXA 5DJMA 3TCOA 5IMCA 4KSMA 1MDKA 3APOA 5DVBA 5ECNB 2A2RA 3CSHA 2DMLA 2GZPA 2X4AA 1QK8A 1R5AA 3OR5A 4FYBA 3GSTA 2X8GA 1B4PA 4G19A 3US3A 4FH8A 5AISA 1M7TA 4XIHA 1DE1A 2H19A 2L57A 4I97A 1SK0A 4XRAA 2H6YA 5B7CA 3NZNA 1FO5A 4HJMA 4O5UA 1XVQA 4PQ1A 3F9UA 2VOCA 3TKSC 1GLPA 1XBSA 1OC9A 4J57E 4XRDA 4GCIA 5C04A 2GQLA 2FD3A 3UVTA 3KZQA 4NWYA 1OYJA 2H1DA 5ENUA 3D21A 1V40A 1SJZA 1G6WA 5EL8A 3L78A 1WMJA 2DMMA 4CW9A 1SKWB 5GSSA 4I2UA 4K5SA 5HR1A 1ZMAA 3QDNA 2L5LA 2N5BA 1M2DA 4AF2A 3GSSA 4LMWA 3VPQA 3DYRA 1YJ6A 3G7IA 1ACVA 1RW1A 3DEXA 4X1UA 3F6FA 2CQ9A 2PUKC 2AV4A 3IR4A 2A2SA 4GSTA 1GTBA 4FQUA 3Q6OA 5ID2B 3VWXA 1U3AA 3A5IA 4O5RA 2QA2A 1I9DA 3EWLA 2VKZG 3HZ4A 5B6MA 3LXZA 4N30A 1JZRA 3GURA 3EMPA 4Q5QA 4KAEA 1V9WA 5F05A 4GSNA 1JFUA 2E2MA 2IMDA 5HR2A 3FZ5A 2PWJA 1F3AA 1TI3A 4WR5A 2B3SA 4CHSA 1R26A 2N5FA 3ZTLA 6GSVA 1TDIA 3HJPA 5DALB 4GF0A 5ECOB 4ILFA 2WB9A 3FHKA 2LJKA 4KX4A 4MJCA 2OACA 5D93A 2JL4A 3LG6A 1MTCA 3KMNA 4KF9A 1TJDA 4K6XA 5HQPA 3JCML 5JWRB 5ECHB 4QQ7A 4H86A 1LU4A 3D4MA 2C80A 3PPUA 3M9KA 2UV8G 5LD0A 5KN0A 2GT5A 5ECSA 2QC7A 4TR4A 4XS6A 3HVXA 2L6CA 1Z6MA 2AJQB 5B8AA 1NHYA 2X99A 4IP1A 3C71A 3GX8A 1S3CA 2FWHA 5DAKB 1FG4A 1XOBA 2ON7A 5GAND 3RDWA 1PMTA 5D9VA 1Z7RA 1WOUA 3G7JA 4I5QA 4IJIA 1MDIA 2TRCP 1URMA 1M2BA 5AN1A 4EIQA 1DSBA 4I2TA 1TP9A 6GSWA 1PA3A 2OE3A 5IIZA 1XFLA 2VO4A 3KMOA 1FB0A 5IMAA 1H75A 1OAZA 1FB6A 2G0FA 4MK3A 2H66A 4MLYA 2PVOC 3ERGA 5ECQB 1YQ1A 2PMTA 5ID2A 5A4UA 2NPBA 4XTSA 1WIKA 4ZIJA 1SKRB 2JU5A 2TIRA 3HJMA 1ZYNA 2OE0A 1YY7A 2FWGA 5KOXA 10GSA 3EINA 5IM9A 5A5HB 3MYDA 3DIEA 3GH9A 2HSHA 2EFEA 2H75A 3GYKA 4MJAA 1EV4A 1N25A 1GP1A 4KGIA 1HD2A 2IFQB 6GSSA 1PX7A 1TW9A 4K2XA 4ECCA 1GL8A 4PTSA 5DQYA 3KXOA 2H76A 4HU7A 2VLTA 3WT1A 1B9XC 3F3QA 2OA7A 2LNTA 5DALA 5J47A 3TKRA 4NHZA 3ZFBA 2CX4A 2C0GA 5IOWA 2FUG2 1BX9A 1YF0A 2VM1A 2R0GA 6GSUA 4QL9A 3FR9A 3F0IA 3C8EA 3HMJG 2G2QA 2XBQA 1OVNA 1VF2A 3QR6A 1BJXA 3ZFLA 2FA4A 4IHUA 3IAS2 2KOKA 2BTOT 1OKTA 1SJ6A 2J23A 1K3OA 1HNAA 4ZBAA 4EE0A 5KN3A 2V41A 3MSZA 11GSA 4AKIA 3DXBA 2L4QA 2X49A 2CVBA 3GHAA 3P2AA 1Y25A 3MNGA 5DAKA 1ML6A 2FWFA 1AUCA 4IELA 1ERTA 1W4VA 1PGTA 2CAQA 4CDOA 4HI7A 3BBYA 4O7HA 1QUWA 1XXUA 2NVLA 5A34A 3GA4A 2DJJA 1B8XA 1XW6A 3ED3A 1S3AA 1Y6EA 1YDKA 1UVZA 4IW9A 2VCWA 1WPIA 1TXXA 5D96A 3RPNA 4WF5A 4F82A 1O81A 2RM5A 3TRXA 4G9HA 1BAYA 5J3RA 4PNFA 1K3LA 4OFTA 5C00A 2A4VA 3TKQA 4DSRA 2FNOA 3UOMA 1TK0B 2JSYA 1WP0A 4WETA 1PKWA 5A4WA 3N9JA 2M80A 2PERA 2KUCA 1CQHA 1J0FA 2YWNA 5JWOB 4JR6A 1ZCPA 5DCHA 5D8IA 4PXOA 2I81A 3IOSA 1PKZA 4MZWA 4WBRD 3P8WA 1GSDA 2B5EA 3HDCA 4E68A 3A5WA 2IMIA 5A5HA 3FEUA 22GSA 1XW5A 1WJKA 1KTEA 5A5KA 3C73A 2L5OA 3VPTA 5D9WA 4NPBA 2V6KA 3UJ1A 1K0MA 3O6TA 3Q74A 4O5QA 2HT9A 2CAIA 2IFQA 4KA0A 3TKSA 3LEFA 4G0IA 2LS5A 4MJEA 2D2ZA 2OBIA 1A8YA 4KDXA 4PQIA 2AHEA 3F6DA 4KNDA 3HJOA 5LNKe 4WEYA 1ERVA 3TRQA 1XWGA 2FHEA 3Q19A 1V57A 4ML1A 5J9BA 2L4CA 2LTKA 4G10A 3KH9A 4N0ZA 3I6AA 1YEPA 1Y1UA 3FRCA 4I6XA 2IJYA 1ABAA 2NBSA 2RLIA 5JCUA 4J56E 3ZL5A 5AGYA 3LGCA 1SVOA 1AAZA 3F3RA 4Z2TA 4GXZA 1K0NA 1WRYA 5F07A 1MEKA 2B7KA 1HQOA 1EGOA 1M9AA 4V2LA 2JZRA 5J40A 2PPTA 4ML6A 3QPMA 3VK9A 4FIWA 4P3YB 3TOTA 3F63A 2H0IA 4EDZA 2YCDA 4ZILA 2ZCTA 1USBA 1AXDA 2VCTA 1ZYPA 1XVWA 1XPVA 5J4YA 5ECLB 5HR0A 5HR3A 4F03A 1JZDA 4EF0A 2H71A 4L0UA 3TUEA 2IN3A 1Z3EA 2WJUA 2YZHA 3E3EA 3KM6A 1WWJA 1TXUA 2LSTA 3ISOA 1SU9A 2WCIA 2HE3A 4PUAA 2WFCA 2C8UA 3H79A 4ZBBA 3WD6A 3ZREA 2HZEB 1B9YC 2BJXA 4NXIA 1BG5A 1ZGNA 2B6MA 1XZOA 3L9SA 1T7PB 4MJBA 3F4SA 3FZ4A 2JADA 3VLNA 3P90A 2DJ3A 4EC0A 2XPEA 1FHEA 1GTIA 2MBTA 2C3QA 1J9BA 7GSSA 3W8JA 4KCEA 1M0UA 4V2MA 1TK5B 14GSA 1OE8A 3CWGA 2VLVA 3GTUB 1GNWA 3PGTA 1GLQA 5EY6A 2OBKA 3SWLA 2HYXA 5HFIA 4RI7A 1XWAA 2O87A 1F6MC 19GSA 2V2GA 3FZAA 1G6YA 3DVXA 3L9UA 3GX0A 3MAKA 3CMIA 1GTUA 4RUVA 4MP4A 3QAVA 1CQGA 2H6XA 2GDRA 1ZZYA 5F8BA 2HRNA 5INYA 4F0BA 2CZ2A 4GWRA 4ICYA 2C3NA 2AYTA 5JCGA 3TOUA 3M1GA 3IDVA 16GSA 4Q5FA 2CZ3A 1FW1A 3GKXA 5LCZA 12GSA 3CTFA 1G0TA 3FK8A 4OWYA 2GSRA 4POLA 1TRWA 3ERFA 4FO5A 2VCQA 3HD5A 2VD1A 4BVXB 2F51A 1F2EA 1A23A 3CRTA 1U3IA 4YKFA 2CX3A 5IPGA 4OD7A 2OE1A 2TRXA 1PD21 1A2LA 4O92A 4JR4A 1XWKA 3IXRA 1VF1A 4IS0A 1GWCA 2H73A 3TU3B 1C72A 1K0DA 1ERWA 1F37A 4F2IA 3ZIVA 3HA9A 3IC4A 4LL1B 1GNEA 1ILOA 3EU4A 1TU7A 4XS1A 4A5PA 3IK9A 3CYNA 1QMVA 2H01A 3LORA 2HZEA 2JZTA 3KD0A 4GQFA 3UBKA 2IWTA 2F8FA 1T1VA 2QSIA 2K9FA 1V98A 3LSZA 3ZRDA 1BF5A 1GUHA 4YQUA 1IYIA 2DIZA 1BYEA 3CRUA 3IC8A 2IMEA 2XPDA 4K1FA 4TN8A 5G31A 4DSQA 4PNGA 2R5GA 1U87A 2GQMA 2VUPA 2OT3A 3GTUA 1K3YA 3F4TA 2EFCA 1GUKA 2GVPA 3D22A 2OJLA 2E0QA 3QFBC 2HLSA 2DKIA 3FYGA 2C1YA 4N0VA 4KUNA 1JZOA 2LRTA 4Z2UA 1SD9A 2J9HA 4L5OA 2DJKA 4V1Ap 4POBA 1GSEA 4NV5A 2YV9A 4RI6A 4GQCA 1BEDA 4MF6A 1SKSB 4BA7A 4ECIA 3APQA 5EVOA 5IQYA 4K7OA 3J7Yb 3GN3A 4EO3A 4KDUA 1ST9A 1A0RP 3BOAA 3G7YA 1E2YA 4NAXA 5DQSA 2H1AA 2LNSA 3TJGA 4YKGA 4ZL7A 2YWOA 5HFGA 2OADA 1AIUA 3LXTA 4KDYA 4MH3A 1KNGA 1O85A 4L0WA 4HQSA 1SL2B 4G2EA 3D5JA 1PN0A 4BVXA 2MZCA 1TOFA 3RHBA 1N8JA 4BVYB 1T3BA 5BRTA 1EZKA 2ES7A 1GSYA 3CTGA 1K0BA 4HUAA 4NHWA 1TK8B 4I8BA 5A34B 2GS3A 5CP1A 4HJ2A 1Z9HA 3LFLA 5DDLA 9GSSA 2GZZA 2DJ2A 2YOIA 3LYKA 2EIRA 2O5VA 3QOUA 2HNLA 3HVVA 3QMXA 5J5NA 1AQXA 3KH7A 2JZSA 3L9VA 4JEDA 4GRFA 4HZ4A 4K0NA 2R37A 5G5EA 1ZOFA 4ECJA 5CRDA 1SL0B 2JSZA 3LYPA 4RQRA 3GV1A 2VCZA 3BJ5A 5IO0A 3QFAC 4DVCA 2GLRA 4ZL8A 2XHFA 5EPFA 2YANA 2I3YA 4GLTA 4OCEA 3DGQA 2VCVA 1I5GA 5CRWA 2YWIA 2E7PA 1R4WA 2I4AA 1O73A 3LJRA 1X5DA 3CBUA 2X8CA 1R7HA 2M72A 4LL4B 5F06A 5IMDA 4EL1A 3VWWA 1A0FA 4IQ1A 2VL9A 2QA1A 4WR4A 2HSYA 3GNJA 4MNNA 4K7NA 4OO5A 4IBPA 1XWCA 4K8MA 2HSNB 1O6JA 2VAFA 4NMUA 5A4VA 1YVLA 1QQ2A 1DUGA 5ECPB 1X0RA 2HXKA 3HZ8A 5G1KA 3HYPA 4TKYA 4AKGA 1MDJA 1FVKA 2V6OA 1EP8A 1OC8A 3KEBA 2K18A 2NDOA 4Q5RA 4MMMA 4MA9A 2EIOA 5DJLA 5ECMB 3KJYA 4K0GA 3KCMA 4USSA 2CVDA 3ZIJA 5ECIB 4BVYA 1PQNA 1M9BA 2IIYA 3L4NA 2B5XA 1FOHA 1GSFA 4TR1A 2CVKA 1F3BA 1VGLA 5F0GA 2A4HA 5CO3A 3S9FA 1A24A 1RQMA 2H0HA 4DSSB 3O76A 3CSIA 4POMA 3LW9A 4EXJA 4OCFA 2R2JA 3FZ9A 4K2DA 3FY7A 5AIVA 2RIIA 2GSSA 1YKCA 2MMNA 3C7MA 4BWSA 3KP8A 1K0CA 2GQKA 3E0UA 4IGJA 1AQVA 3TJKA 3A3TA 1E6BA 3FMWA 1QXHA 1Z7PA 3UARA 1SL1B 1HNCA 2WDUA 4ISDA 3DRNA 2WULA 1X5EA 2RUFA 3GRXA 4G0LA 5ECRB 1NSWA 2O85A 1HNBA 4N3ZA 4L5LA 2F9SA 4POKA 5CRHA 3C1SA 1EOGA 3UVHA 5IPHA 5CYYA 3R2QA 2JACA 1SENA 1B48A 3KGKA 1K0AA 4ZB9A 5B6NA 1OE7A 3NIVA 2FWEA 4BL7B 3GL3A 4E8EA 5H5QA 1VF3A 5GZZB 1Q4JA 1XCCA 3GH6A 4IN0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RHC A;  1S3D A;  3GKM A;  3E9J B;  1XW9 A;  4Q5N A;  4IVF A;  4KW6 A;  3TJB A;  2O8V B;  4OFN A;  2LQQ A;  3D6I A;  2VL3 A;  3EMX A;  1MD4 A;  1GSS A;  2HRK B;  2VD0 A;  3VWU A;  2GST A;  3FR3 A;  2H1B A;  3IRA A;  1T00 A;  4WBJ A;  2B1K A;  1EP7 A;  2RUE A;  3G9B A;  3GIX A;  3QCP A;  4BWQ A;  1ZYE A;  2C4J A;  1THO A;  1G7E A;  2PGT A;  2I1U A;  3HY2 A;  1VF4 A;  4PUR A;  1H4O A;  2I9H A;  2WRT A;  2VL2 C;  2X64 A;  3QD9 A;  3EC3 A;  3MWH A;  4DSS A;  1U6T A;  2Z9S A;  5G1L A;  4TXO B;  3L0H A;  2HRF A;  1Q98 A;  1T8E B;  3W8S A;  5ECK B;  1WE0 A;  3VI5 A;  1QGV A;  3M8N A;  1ZYQ B;  1B4Q A;  1V58 A;  1KEB A;  3BD2 A;  3TDG A;  4EKZ A;  2HQT A;  5GST A;  1NHO A;  5COH A;  1FAA A;  5CRE A;  2H8L A;  2QKE A;  3FKF A;  5ABR A;  1EWX A;  1PL2 A;  2YZU A;  2UZ8 A;  4K9Z A;  3D0Z A;  4DEJ A;  4PX1 A;  2K8S A;  5HFK A;  3FW2 A;  4N11 A;  2DSA A;  1T4Y A;  5D9T A;  2GZY A;  4EDY A;  3ZIT A;  4MZB A;  3PIN A;  3KP9 A;  3GUS A;  2H74 A;  2H0G A;  4BL7 A;  2B7J A;  4YQV A;  1ZL9 A;  2P5Q A;  3Q18 A;  1U88 A;  3EYT A;  3I9V 2;  3F4R A;  4XS4 B;  2V32 A;  4MPF A;  1VRS D;  4KH7 A;  4AJ6 A;  1GRX A;  8GSS A;  2PU9 C;  5G5F A;  3LWA A;  5ELA A;  1EV9 A;  3U5R E;  3KTB A;  1X9M B;  4KCA A;  2LJA A;  4MF7 A;  3EU3 A;  4YAV A;  4LMV A;  1O8X A;  2DJ1 A;  1EEJ A;  2O7K A;  3IE3 A;  5DBQ A;  1LBK A;  4HU9 A;  2AUV A;  2YWM A;  1M2A A;  3APS A;  3GKN A;  4V2N A;  3TKP A;  4MDC A;  3K8N A;  2KHP A;  2HRK A;  4ZL9 A;  3DD3 A;  2O89 A;  4ID0 A;  4HZ2 A;  3DKS A;  4WF4 A;  6GST A;  1AC1 A;  2MBS A;  2KP2 A;  3C1R A;  3U6V A;  1UA5 A;  1SK1 A;  1IYH A;  2YJ7 A;  3HHV A;  1AW9 A;  1BQ7 A;  1EEM A;  2ZNM A;  4TVE A;  13GS A;  3M0F A;  1EGR A;  2PVQ A;  5AIX A;  2XBI A;  2H70 A;  2KLX A;  4MZC A;  3WYW A;  1SD8 A;  5J41 A;  3PR8 A;  5KEJ A;  1JLV A;  4TXO A;  2RM6 A;  1TKD B;  2AAW A;  1O7U A;  1TRV A;  3N5O A;  2C0E A;  2V1M A;  2HZF A;  1ERU A;  1HYU A;  5CRG A;  1FVJ A;  2WZ9 A;  4G0K A;  1THX A;  3H8Q A;  2FGX A;  1DBY A;  2K6V A;  3LQ7 A;  1NM3 A;  1JHB A;  2F3M A;  4GTU A;  20GS A;  3EUR A;  2DC5 A;  1V2A A;  2YPM A;  3DWV A;  4ECB A;  2MMO A;  2H30 A;  2IMF A;  1XIY A;  2H72 A;  18GS A;  2WS2 A;  4TXV A;  4TW5 A;  1JLW A;  5J4U A;  4HEA 2;  5D9X A;  1TTZ A;  4XS4 A;  2AB6 A;  3ZLP A;  4XCS A;  3VUR A;  2PN8 A;  4YQM A;  4FYU A;  1RK4 A;  3GKK A;  1K0O A;  3J7Y k;  1UC7 A;  4HQZ A;  2BMX A;  2YP6 A;  3UBL A;  3TJF A;  3EE2 A;  2GGT A;  4TRX A;  5FT3 A;  2MMA A;  1EOH A;  2VCX A;  4D73 B;  2FLS A;  1A2M A;  3HCZ A;  4YAP A;  3ZYW A;  3HVS A;  2ALB A;  3F8U A;  4TR1 B;  2KP1 A;  2MMZ A;  4TR0 A;  4IP6 A;  2YJH A;  3QAG A;  4NV2 A;  2HSM B;  2VLU A;  5E4W A;  1XOA A;  2MYG A;  1AQW A;  2HFD A;  3QAW A;  3D4T A;  1DE2 A;  1PRX A;  1J08 A;  4MF5 A;  5KN1 A;  2M46 A;  4X43 A;  4JRR A;  3RPP A;  2P0G A;  5CNW A;  3SBC A;  3FR6 A;  3ME7 A;  3CSJ A;  4AJ7 A;  4F0C A;  2XC2 A;  2X8H A;  3H4K A;  4BPY A;  3KTL A;  4LA1 A;  3M9J A;  1R5P A;  1YF1 A;  3UEM A;  2E2G A;  4HOJ A;  2EC4 A;  2VM2 A;  5B8B A;  1QFN A;  3TGZ A;  2EIQ A;  4EUY A;  3RBT A;  5JWQ B;  2IPA A;  4MPG A;  1T4Z A;  1XWB A;  1GTA A;  5FWG A;  1G7O A;  2LUS A;  4AGS A;  1JZW A;  3IBH A;  1TRU A;  1SJI A;  2K8V A;  3VWV A;  4ULX A;  3WT2 A;  1KBN A;  1GH2 A;  4JBB A;  4IJ3 A;  1FOV A;  5IMZ A;  5E59 A;  1LJR A;  2QGV A;  1PL1 A;  3IAM 2;  1A2J A;  4TR3 A;  2FY6 A;  4PUF C;  4ZXG A;  2P5R A;  3V1W A;  1TU8 A;  2VIM A;  3ZVJ A;  4X0X A;  2ZUP A;  3PH9 A;  3P7X A;  2P31 A;  2OKA A;  5G30 A;  5G2Z A;  3H1N A;  4KE3 A;  2LEG A;  2H1G A;  2C0D A;  3TB2 A;  2GT6 A;  4WXT A;  3TJJ A;  2VL2 A;  4D73 A;  5CAX A;  3UAP A;  2IL3 A;  4ACS A;  2LRC A;  4OFM A;  4J2F A;  3AY8 A;  5ELG A;  1OKD A;  2DLX A;  3DML A;  3IV4 A;  1X5C A;  2B5Y A;  3GFK A;  2HSM A;  2YN1 A;  3UL3 A;  4RQX A;  4MH2 A;  3W6G A;  4GSS A;  4ZB6 A;  1GSU A;  4AJ8 A;  3IK7 A;  3MDK A;  2DBC A;  2PBJ A;  3R3E A;  3KIJ A;  1GUM A;  2GTU A;  2FCH A;  2NTO A;  1SYR A;  4N10 A;  3IPZ A;  3A2X A;  4L8E A;  1F9M A;  2B1L A;  3IA1 A;  3ME8 A;  4K7I A;  4OO4 A;  3I69 A;  1M99 A;  4IKH A;  3ZVJ D;  3DVW A;  2C0F A;  5J9C A;  1O8W A;  1PX6 A;  2ON5 A;  4MAB A;  4YH2 A;  4HDE A;  3BCI A;  1TRS A;  1GSQ A;  2DJ0 A;  3NOF A;  2F8A A;  3HXS A;  2C3T A;  6GSY A;  2LV3 A;  1OC3 A;  2H6Z A;  5KN2 A;  3H93 A;  3VFI A;  1YKA A;  5DCG A;  4OMV A;  3ZML A;  3CXG A;  4LLR A;  3TRP A;  2REM A;  2IMK A;  2R3X A;  3O3T A;  5L71 A;  1A8L A;  4KB3 A;  5GAP D;  3RAZ A;  3A2W A;  4FYC A;  4O32 A;  3TKS E;  4JE1 A;  5BMU A;  2N5A A;  4WKW A;  1GUL A;  2FA8 A;  5H5S A;  1X9W B;  3GMF A;  2HRA A;  1X9S B;  4MCU A;  1OC9 B;  4ZB8 A;  3UIW A;  2LJR A;  1SYX A;  2L59 A;  3UMA A;  2YV7 A;  1UN2 A;  2HI7 A;  4KSO A;  2R4V A;  4JZQ A;  2CA8 A;  4IQA A;  3ZZX A;  17GS A;  4PQH A;  5FHI A;  2CT6 A;  2YNX A;  6GSX A;  1Z5Y E;  3BCK A;  3WGE A;  3WGD A;  3HKR A;  4XHM A;  2CV4 A;  2LQO A;  1TI1 A;  4Z7X A;  1SK2 A;  3I43 A;  2GSQ A;  3VI7 A;  3WGX A;  1PSQ A;  1W89 A;  4PGT A;  4E8H A;  2LRN A;  4TOP A;  5IMV A;  3EVI A;  2L6D A;  3M3M A;  5IO2 A;  1PN9 A;  5H5R A;  1YZX A;  3GL5 A;  4ZBD A;  3A2V A;  4F9Z A;  1Z6N A;  2DIY A;  4QL7 A;  5IOX A;  1ON4 A;  3ZMK A;  2LKU A;  1MD3 A;  5IMF A;  4HS1 A;  2WGR A;  1N2A A;  1NW2 A;  4JU5 A;  4V1A g;  5JCW A;  2R6K A;  3ERW A;  4EVM A;  3IHQ A;  5D73 A;  1YEX A;  5DJM A;  3TCO A;  5IMC A;  4KSM A;  1MDK A;  3APO A;  5DVB A;  5ECN B;  2A2R A;  3CSH A;  2DML A;  2GZP A;  1QK8 A;  1R5A A;  3OR5 A;  4FYB A;  3GST A;  2X8G A;  1B4P A;  4G19 A;  3US3 A;  4FH8 A;  5AIS A;  1M7T A;  4XIH A;  1DE1 A;  2H19 A;  2L57 A;  4I97 A;  1SK0 A;  4XRA A;  2H6Y A;  5B7C A;  3NZN A;  1FO5 A;  4HJM A;  1XVQ A;  4PQ1 A;  3F9U A;  2VOC A;  3TKS C;  1GLP A;  4J57 E;  1OC9 A;  1XBS A;  4XRD A;  4GCI A;  5C04 A;  2GQL A;  2FD3 A;  3UVT A;  3KZQ A;  4NWY A;  1OYJ A;  2H1D A;  5ENU A;  3D21 A;  1V40 A;  1SJZ A;  1G6W A;  5EL8 A;  3L78 A;  1WMJ A;  2DMM A;  4CW9 A;  1SKW B;  5GSS A;  4I2U A;  5HR1 A;  1ZMA A;  3QDN A;  2L5L A;  2N5B A;  1M2D A;  4AF2 A;  3GSS A;  4LMW A;  3VPQ A;  3DYR A;  1YJ6 A;  3G7I A;  1ACV A;  1RW1 A;  3DEX A;  4X1U A;  3F6F A;  2CQ9 A;  2PUK C;  2AV4 A;  3IR4 A;  2A2S A;  4GST A;  1GTB A;  4FQU A;  3Q6O A;  5ID2 B;  3VWX A;  1U3A A;  4O5R A;  1I9D A;  3EWL A;  3HZ4 A;  5B6M A;  3LXZ A;  4N30 A;  1JZR A;  3GUR A;  3EMP A;  4Q5Q A;  4KAE A;  1V9W A;  5F05 A;  4GSN A;  1JFU A;  2E2M A;  2IMD A;  5HR2 A;  3FZ5 A;  2PWJ A;  1F3A A;  1TI3 A;  4WR5 A;  2B3S A;  4CHS A;  1R26 A;  2N5F A;  3ZTL A;  6GSV A;  1TDI A;  3HJP A;  5DAL B;  4GF0 A;  5ECO B;  4ILF A;  2WB9 A;  3FHK A;  2LJK A;  4KX4 A;  4MJC A;  2OAC A;  5D93 A;  2JL4 A;  3LG6 A;  1MTC A;  3KMN A;  4KF9 A;  1TJD A;  4K6X A;  5HQP A;  3JCM L;  5JWR B;  5ECH B;  4QQ7 A;  4H86 A;  1LU4 A;  3D4M A;  2C80 A;  3PPU A;  3M9K A;  5LD0 A;  5KN0 A;  2GT5 A;  5ECS A;  2QC7 A;  4TR4 A;  4XS6 A;  3HVX A;  2L6C A;  1Z6M A;  2AJQ B;  5B8A A;  1NHY A;  2X99 A;  4IP1 A;  3C71 A;  3GX8 A;  1S3C A;  2FWH A;  5DAK B;  1FG4 A;  1XOB A;  2ON7 A;  5GAN D;  3RDW A;  1PMT A;  5D9V A;  1Z7R A;  1WOU A;  3G7J A;  4I5Q A;  4IJI A;  1MDI A;  2TRC P;  1URM A;  1M2B A;  5AN1 A;  1DSB A;  4I2T A;  1TP9 A;  6GSW A;  1PA3 A;  2OE3 A;  5IIZ A;  1XFL A;  2VO4 A;  3KMO A;  1FB0 A;  5IMA A;  1H75 A;  1OAZ A;  1FB6 A;  2G0F A;  4MK3 A;  2H66 A;  4MLY A;  2PVO C;  3ERG A;  5ECQ B;  1YQ1 A;  2PMT A;  5ID2 A;  5A4U A;  2NPB A;  4XTS A;  1WIK A;  4ZIJ A;  1SKR B;  2JU5 A;  2TIR A;  3HJM A;  2OE0 A;  1YY7 A;  2FWG A;  10GS A;  3EIN A;  5IM9 A;  3DIE A;  3GH9 A;  2HSH A;  2H75 A;  3GYK A;  4MJA A;  1EV4 A;  1GP1 A;  4KGI A;  1HD2 A;  2IFQ B;  6GSS A;  1PX7 A;  1TW9 A;  4ECC A;  1GL8 A;  4PTS A;  5DQY A;  3KXO A;  2H76 A;  4HU7 A;  2VLT A;  3WT1 A;  1B9X C;  3F3Q A;  2OA7 A;  2LNT A;  5DAL A;  3TKR A;  4NHZ A;  3ZFB A;  2CX4 A;  2C0G A;  5IOW A;  2FUG 2;  1BX9 A;  1YF0 A;  2VM1 A;  6GSU A;  4QL9 A;  3FR9 A;  3F0I A;  3C8E A;  2G2Q A;  2XBQ A;  1OVN A;  1VF2 A;  3QR6 A;  1BJX A;  3ZFL A;  2FA4 A;  4IHU A;  3IAS 2;  2KOK A;  2BTO T;  1OKT A;  1SJ6 A;  2J23 A;  1K3O A;  1HNA A;  4ZBA A;  4EE0 A;  5KN3 A;  2V41 A;  3MSZ A;  11GS A;  3DXB A;  2L4Q A;  2CVB A;  3GHA A;  3P2A A;  1Y25 A;  3MNG A;  5DAK A;  1ML6 A;  2FWF A;  1AUC A;  4IEL A;  1ERT A;  1W4V A;  1PGT A;  2CAQ A;  4CDO A;  4HI7 A;  3BBY A;  4O7H A;  1QUW A;  1XXU A;  2NVL A;  3GA4 A;  2DJJ A;  1B8X A;  1XW6 A;  3ED3 A;  1S3A A;  1Y6E A;  1YDK A;  1UVZ A;  4IW9 A;  2VCW A;  1WPI A;  1TXX A;  5D96 A;  3RPN A;  4WF5 A;  4F82 A;  1O81 A;  2RM5 A;  3TRX A;  4G9H A;  1BAY A;  5J3R A;  4PNF A;  1K3L A;  4OFT A;  5C00 A;  2A4V A;  3TKQ A;  4DSR A;  2FNO A;  3UOM A;  1TK0 B;  2JSY A;  1WP0 A;  4WET A;  1PKW A;  5A4W A;  3N9J A;  2M80 A;  2PER A;  2KUC A;  1CQH A;  1J0F A;  2YWN A;  5JWO B;  4JR6 A;  1ZCP A;  5DCH A;  5D8I A;  4PXO A;  2I81 A;  3IOS A;  1PKZ A;  4MZW A;  4WBR D;  3P8W A;  1GSD A;  2B5E A;  3HDC A;  3A5W A;  2IMI A;  3FEU A;  22GS A;  1XW5 A;  1WJK A;  1KTE A;  5A5K A;  3C73 A;  2L5O A;  3VPT A;  5D9W A;  4NPB A;  2V6K A;  3UJ1 A;  1K0M A;  3O6T A;  3Q74 A;  2HT9 A;  2CAI A;  2IFQ A;  4KA0 A;  3TKS A;  3LEF A;  4G0I A;  2LS5 A;  4MJE A;  2D2Z A;  2OBI A;  1A8Y A;  4KDX A;  4PQI A;  2AHE A;  3F6D A;  4KND A;  3HJO A;  5LNK e;  4WEY A;  1ERV A;  3TRQ A;  1XWG A;  2FHE A;  3Q19 A;  1V57 A;  4ML1 A;  5J9B A;  2L4C A;  2LTK A;  4G10 A;  3KH9 A;  4N0Z A;  3I6A A;  1YEP A;  3FRC A;  4I6X A;  2IJY A;  1ABA A;  2NBS A;  2RLI A;  5JCU A;  4J56 E;  3ZL5 A;  5AGY A;  3LGC A;  1AAZ A;  3F3R A;  4GXZ A;  1K0N A;  1WRY A;  5F07 A;  1MEK A;  2B7K A;  1HQO A;  1EGO A;  1M9A A;  4V2L A;  2JZR A;  2PPT A;  4ML6 A;  3QPM A;  3VK9 A;  4FIW A;  4P3Y B;  3TOT A;  3F63 A;  2H0I A;  4EDZ A;  2YCD A;  4ZIL A;  2ZCT A;  1USB A;  1AXD A;  2VCT A;  1XVW A;  1XPV A;  5ECL B;  5HR0 A;  5HR3 A;  4F03 A;  1JZD A;  4EF0 A;  2H71 A;  4L0U A;  3TUE A;  2IN3 A;  1Z3E A;  2WJU A;  2YZH A;  3E3E A;  3KM6 A;  1WWJ A;  2LST A;  3ISO A;  1SU9 A;  2WCI A;  2HE3 A;  4PUA A;  2WFC A;  2C8U A;  3H79 A;  4ZBB A;  3WD6 A;  3ZRE A;  2HZE B;  1B9Y C;  2BJX A;  4NXI A;  1BG5 A;  1ZGN A;  2B6M A;  1XZO A;  3L9S A;  1T7P B;  4MJB A;  3F4S A;  3FZ4 A;  2JAD A;  3VLN A;  3P90 A;  2DJ3 A;  4EC0 A;  2XPE A;  1FHE A;  1GTI A;  2MBT A;  2C3Q A;  1J9B A;  7GSS A;  3W8J A;  4KCE A;  1M0U A;  4V2M A;  1TK5 B;  14GS A;  1OE8 A;  2VLV A;  3GTU B;  1GNW A;  3PGT A;  1GLQ A;  5EY6 A;  2OBK A;  3SWL A;  2HYX A;  5HFI A;  4RI7 A;  1XWA A;  2O87 A;  1F6M C;  19GS A;  2V2G A;  3FZA A;  1G6Y A;  3DVX A;  3L9U A;  3GX0 A;  3MAK A;  3CMI A;  1GTU A;  4RUV A;  4MP4 A;  3QAV A;  1CQG A;  2H6X A;  2GDR A;  1ZZY A;  5F8B A;  2HRN A;  5INY A;  4F0B A;  2CZ2 A;  4GWR A;  2C3N A;  2AYT A;  5JCG A;  3TOU A;  3M1G A;  3IDV A;  16GS A;  4Q5F A;  2CZ3 A;  1FW1 A;  3GKX A;  5LCZ A;  12GS A;  3CTF A;  1G0T A;  3FK8 A;  4OWY A;  2GSR A;  4POL A;  1TRW A;  3ERF A;  4FO5 A;  2VCQ A;  3HD5 A;  2VD1 A;  4BVX B;  2F51 A;  1F2E A;  1A23 A;  3CRT A;  1U3I A;  2CX3 A;  5IPG A;  4OD7 A;  2OE1 A;  2TRX A;  1PD2 1;  1A2L A;  4O92 A;  4JR4 A;  1XWK A;  3IXR A;  1VF1 A;  4IS0 A;  1GWC A;  2H73 A;  1C72 A;  1K0D A;  1ERW A;  1F37 A;  4F2I A;  3ZIV A;  3HA9 A;  3IC4 A;  4LL1 B;  1GNE A;  1ILO A;  3EU4 A;  1TU7 A;  4XS1 A;  3IK9 A;  3CYN A;  1QMV A;  2H01 A;  2HZE A;  3LOR A;  2JZT A;  3KD0 A;  4GQF A;  3UBK A;  2IWT A;  2F8F A;  1T1V A;  2QSI A;  2K9F A;  1V98 A;  3LSZ A;  3ZRD A;  1GUH A;  4YQU A;  1IYI A;  2DIZ A;  1BYE A;  3CRU A;  3IC8 A;  2IME A;  2XPD A;  4K1F A;  4TN8 A;  5G31 A;  4DSQ A;  4PNG A;  2R5G A;  1U87 A;  2GQM A;  2VUP A;  3GTU A;  1K3Y A;  3F4T A;  1GUK A;  2GVP A;  3D22 A;  2OJL A;  2E0Q A;  3QFB C;  2HLS A;  3FYG A;  2C1Y A;  4N0V A;  4KUN A;  1JZO A;  2LRT A;  1SD9 A;  2J9H A;  4L5O A;  2DJK A;  4V1A p;  4POB A;  1GSE A;  4NV5 A;  2YV9 A;  4RI6 A;  4GQC A;  1BED A;  4MF6 A;  1SKS B;  4BA7 A;  4ECI A;  3APQ A;  5EVO A;  5IQY A;  4K7O A;  3J7Y b;  3GN3 A;  4EO3 A;  4KDU A;  1ST9 A;  1A0R P;  3BOA A;  3G7Y A;  1E2Y A;  4NAX A;  5DQS A;  2H1A A;  2LNS A;  3TJG A;  4ZL7 A;  2YWO A;  5HFG A;  2OAD A;  1AIU A;  3LXT A;  4KDY A;  4MH3 A;  1KNG A;  1O85 A;  4L0W A;  4HQS A;  1SL2 B;  4G2E A;  3D5J A;  4BVX A;  2MZC A;  1TOF A;  3RHB A;  1N8J A;  4BVY B;  1T3B A;  1EZK A;  2ES7 A;  1GSY A;  3CTG A;  1K0B A;  4HUA A;  4NHW A;  1TK8 B;  4I8B A;  2GS3 A;  5CP1 A;  4HJ2 A;  1Z9H A;  3LFL A;  5DDL A;  9GSS A;  2GZZ A;  2DJ2 A;  2YOI A;  3LYK A;  2EIR A;  3QOU A;  2HNL A;  3HVV A;  3QMX A;  5J5N A;  1AQX A;  3KH7 A;  2JZS A;  3L9V A;  4JED A;  4GRF A;  4HZ4 A;  4K0N A;  2R37 A;  5G5E A;  1ZOF A;  4ECJ A;  5CRD A;  1SL0 B;  2JSZ A;  3LYP A;  4RQR A;  3GV1 A;  2VCZ A;  3BJ5 A;  5IO0 A;  3QFA C;  4DVC A;  2GLR A;  4ZL8 A;  2XHF A;  5EPF A;  2YAN A;  2I3Y A;  4GLT A;  4OCE A;  3DGQ A;  2VCV A;  1I5G A;  5CRW A;  2YWI A;  2E7P A;  1R4W A;  2I4A A;  1O73 A;  3LJR A;  1X5D A;  3CBU A;  2X8C A;  1R7H A;  2M72 A;  4LL4 B;  5F06 A;  5IMD A;  4EL1 A;  3VWW A;  1A0F A;  4IQ1 A;  2VL9 A;  4WR4 A;  2HSY A;  3GNJ A;  4K7N A;  4OO5 A;  4IBP A;  1XWC A;  4K8M A;  2HSN B;  1O6J A;  2VAF A;  4NMU A;  5A4V A;  1QQ2 A;  1DUG A;  5ECP B;  1X0R A;  2HXK A;  3HZ8 A;  5G1K A;  3HYP A;  4TKY A;  1MDJ A;  1FVK A;  2V6O A;  1EP8 A;  1OC8 A;  3KEB A;  2K18 A;  2NDO A;  4Q5R A;  4MMM A;  4MA9 A;  2EIO A;  5DJL A;  5ECM B;  3KJY A;  4K0G A;  3KCM A;  4USS A;  2CVD A;  3ZIJ A;  5ECI B;  4BVY A;  1PQN A;  1M9B A;  2IIY A;  3L4N A;  2B5X A;  1GSF A;  4TR1 A;  2CVK A;  1F3B A;  1VGL A;  5F0G A;  3S9F A;  5CO3 A;  1A24 A;  1RQM A;  2H0H A;  4DSS B;  3O76 A;  3CSI A;  4POM A;  4EXJ A;  4OCF A;  2R2J A;  3FZ9 A;  4K2D A;  3FY7 A;  5AIV A;  2RII A;  2GSS A;  1YKC A;  2MMN A;  3C7M A;  4BWS A;  3KP8 A;  1K0C A;  2GQK A;  3E0U A;  4IGJ A;  1AQV A;  3TJK A;  3A3T A;  1E6B A;  1QXH A;  1Z7P A;  3UAR A;  1SL1 B;  1HNC A;  2WDU A;  4ISD A;  3DRN A;  2WUL A;  1X5E A;  2RUF A;  3GRX A;  4G0L A;  5ECR B;  1NSW A;  2O85 A;  1HNB A;  4L5L A;  2F9S A;  4POK A;  5CRH A;  3C1S A;  1EOG A;  3UVH A;  5IPH A;  5CYY A;  3R2Q A;  2JAC A;  1SEN A;  1B48 A;  3KGK A;  1K0A A;  4ZB9 A;  5B6N A;  1OE7 A;  3NIV A;  2FWE A;  4BL7 B;  3GL3 A;  4E8E A;  5H5Q A;  1VF3 A;  5GZZ B;  1Q4J A;  1XCC A;  3GH6 A;  4IN0 A; 
#chains in the Genus database with same CATH topology
 4AKX B;  3RHC A;  4CY8 A;  1S3D A;  3GKM A;  3E9J B;  1XW9 A;  2HSN A;  4Q5N A;  4IVF A;  4KW6 A;  3TJB A;  4PI0 C;  2O8V B;  4OFN A;  2LQQ A;  3D6I A;  2VL3 A;  3EMX A;  1MD4 A;  1GSS A;  2HRK B;  2VD0 A;  3VWU A;  2GST A;  3FR3 A;  2H1B A;  3IRA A;  1T00 A;  4WBJ A;  2B1K A;  1EP7 A;  2RUE A;  3G9B A;  3GIX A;  3QCP A;  4BWQ A;  1ZYE A;  2C4J A;  1S3R A;  1THO A;  2PGT A;  1G7E A;  2I1U A;  3HY2 A;  1VF4 A;  4X4J A;  4PUR A;  1H4O A;  2I9H A;  2WRT A;  2VL2 C;  2X64 A;  3QD9 A;  3EC3 A;  3MWH A;  4DSS A;  1U6T A;  2Z9S A;  5G1L A;  4TXO B;  3L0H A;  2HRF A;  1Q98 A;  1T8E B;  3W8S A;  5ECK B;  1WE0 A;  3VI5 A;  4CY6 A;  1QGV A;  3M8N A;  1ZYQ B;  1B4Q A;  1V58 A;  1KEB A;  3BD2 A;  3TDG A;  4EKZ A;  2HQT A;  5GST A;  1NHO A;  5COH A;  1FAA A;  5CRE A;  2H8L A;  2QKE A;  3FKF A;  5ABR A;  1EWX A;  1PL2 A;  2YZU A;  2UZ8 A;  4K9Z A;  5A1N B;  3D0Z A;  4DEJ A;  4PX1 A;  2K8S A;  5HFK A;  3FW2 A;  4N11 A;  2DSA A;  1T4Y A;  5D9T A;  2GZY A;  4EDY A;  3ZIT A;  4MZB A;  1S4B P;  3PIN A;  3KP9 A;  3GUS A;  2H74 A;  2H0G A;  4BL7 A;  2B7J A;  4YQV A;  4EIP A;  1ZL9 A;  2P5Q A;  3Q18 A;  1U88 A;  3EYT A;  3I9V 2;  3F4R A;  4XS4 B;  2V32 A;  4MPF A;  1VRS D;  4KH7 A;  4AJ6 A;  1GRX A;  8GSS A;  2PU9 C;  5G5F A;  3LWA A;  5ELA A;  1EV9 A;  3U5R E;  3KTB A;  1X9M B;  4KCA A;  2LJA A;  4MF7 A;  3EU3 A;  4YAV A;  4LMV A;  1O8X A;  2DJ1 A;  1EEJ A;  2O7K A;  3IE3 A;  5DBQ A;  1LBK A;  4HU9 A;  2AUV A;  2YWM A;  1M2A A;  3APS A;  3GKN A;  4V2N A;  3TKP A;  4MDC A;  3K8N A;  2KHP A;  2HRK A;  4ZL9 A;  3DD3 A;  2O89 A;  4ID0 A;  4HZ2 A;  3DKS A;  4WF4 A;  6GST A;  1AC1 A;  2MBS A;  2KP2 A;  3C1R A;  3U6V A;  1UA5 A;  1SK1 A;  1IYH A;  2YJ7 A;  3HHV A;  1AW9 A;  1BQ7 A;  1EEM A;  2ZNM A;  4TVE A;  13GS A;  3M0F A;  1EGR A;  2PVQ A;  5AIX A;  2XBI A;  2H70 A;  2KLX A;  4MZC A;  3WYW A;  1SD8 A;  5J41 A;  3PR8 A;  5KEJ A;  2EFD A;  1JLV A;  4TXO A;  2RM6 A;  1M3I A;  1TKD B;  4HSC X;  2AAW A;  1O7U A;  1TRV A;  3N5O A;  2C0E A;  2V1M A;  2HZF A;  1ERU A;  1HYU A;  5CRG A;  1FVJ A;  2WZ9 A;  4G0K A;  3CQF A;  1THX A;  3H8Q A;  2FGX A;  1DBY A;  2K6V A;  3LQ7 A;  1NM3 A;  1JHB A;  2F3M A;  4QMK A;  4GTU A;  20GS A;  5A1N A;  3EUR A;  2DC5 A;  1V2A A;  2YPM A;  3DWV A;  4ECB A;  2MMO A;  2H30 A;  1SVL A;  2A2P A;  2IMF A;  1XIY A;  2H72 A;  4AKH A;  18GS A;  2WS2 A;  4TXV A;  4TW5 A;  1JLW A;  5J4U A;  4HEA 2;  5D9X A;  1TTZ A;  4XS4 A;  2WW1 A;  2AB6 A;  3ZLP A;  4XCS A;  3VUR A;  2PN8 A;  4YQM A;  4FYU A;  1RK4 A;  3GKK A;  2EFH A;  1K0O A;  2H1L A;  3J7Y k;  1UC7 A;  4HQZ A;  4Z2R A;  2BMX A;  2YP6 A;  3UBL A;  3TJF A;  3EE2 A;  2GGT A;  4TRX A;  5FT3 A;  2MMA A;  1EOH A;  2VCX A;  4D73 B;  2FLS A;  1A2M A;  3HCZ A;  4YAP A;  3ZYW A;  3HVS A;  2ALB A;  3F8U A;  4TR1 B;  2KP1 A;  2DKH A;  2MMZ A;  4TR0 A;  4IP6 A;  2YJH A;  3QAG A;  4NV2 A;  2HSM B;  4PI2 C;  2VLU A;  5E4W A;  5J4V A;  1XOA A;  2MYG A;  1AQW A;  2HFD A;  3QAW A;  3D4T A;  1DE2 A;  1PRX A;  1J08 A;  4MF5 A;  5KN1 A;  4ZB7 A;  2M46 A;  4X43 A;  4JRR A;  3RPP A;  5KOW A;  2P0G A;  5CNW A;  3SBC A;  3FR6 A;  3ME7 A;  3CSJ A;  4AJ7 A;  4F0C A;  2XC2 A;  2X8H A;  3H4K A;  4BPY A;  3KTL A;  4LA1 A;  3M9J A;  1R5P A;  1YF1 A;  3UEM A;  2E2G A;  4HOJ A;  2EC4 A;  2VM2 A;  5B8B A;  1QFN A;  3TGZ A;  2EIQ A;  4EUY A;  3RBT A;  5JWQ B;  2IPA A;  4MPG A;  1T4Z A;  1XWB A;  1GTA A;  5FWG A;  1G7O A;  2LUS A;  4AGS A;  1JZW A;  3IBH A;  1TRU A;  1SJI A;  2K8V A;  3VWV A;  4ULX A;  3WT2 A;  1KBN A;  1GH2 A;  4JBB A;  4IJ3 A;  1FOV A;  5BMU B;  3EPT A;  2WVZ A;  5IMZ A;  5E59 A;  1LJR A;  2QGV A;  1PL1 A;  3IAM 2;  1A2J A;  4TR3 A;  2FY6 A;  4PUF C;  4ZXG A;  2P5R A;  3V1W A;  1TU8 A;  2VIM A;  3ZVJ A;  4X0X A;  2ZUP A;  3PH9 A;  3P7X A;  2P31 A;  2OKA A;  5G30 A;  5G2Z A;  3H1N A;  4W66 A;  4KE3 A;  2LEG A;  3MIX A;  2H1G A;  2C0D A;  3RFR C;  3TB2 A;  2GT6 A;  4WXT A;  3TJJ A;  2VL2 A;  4D73 A;  5CAX A;  3UAP A;  2IL3 A;  4ACS A;  2LRC A;  4OFM A;  4J2F A;  3AY8 A;  5ELG A;  1OKD A;  2DLX A;  3DML A;  3IV4 A;  1X5C A;  2B5Y A;  3GFK A;  3IHG A;  2HSM A;  2YN1 A;  3UL3 A;  4RQX A;  4MH2 A;  3W6G A;  4GSS A;  4ZB6 A;  1GSU A;  1BG1 A;  4AJ8 A;  3IK7 A;  3MDK A;  2DBC A;  2PBJ A;  3R3E A;  3KIJ A;  1GUM A;  2GTU A;  2FCH A;  2NTO A;  1SYR A;  4N10 A;  3IPZ A;  3A2X A;  3CHX C;  4L8E A;  1F9M A;  2B1L A;  3IA1 A;  3ME8 A;  4K7I A;  1XG8 A;  4OO4 A;  3I69 A;  1M99 A;  4IKH A;  3ZVJ D;  3DVW A;  2C0F A;  5J9C A;  1O8W A;  1PX6 A;  2ON5 A;  4MAB A;  4YH2 A;  4HDE A;  3BCI A;  1TRS A;  1GSQ A;  2DJ0 A;  3NOF A;  2F8A A;  2R0P A;  3HXS A;  2C3T A;  6GSY A;  4GDF A;  2LV3 A;  1OC3 A;  1SVM A;  2H6Z A;  5KN2 A;  3H93 A;  3VFI A;  1YKA A;  5DCG A;  4OMV A;  3ZML A;  3CXG A;  4LLR A;  3TRP A;  2REM A;  2IMK A;  2R3X A;  3O3T A;  5L71 A;  1A8L A;  4KB3 A;  5GAP D;  3RAZ A;  3A2W A;  4FYC A;  4O32 A;  3TKS E;  4JE1 A;  5BMU A;  2N5A A;  4WKW A;  1GUL A;  2O3E A;  2FA8 A;  5H5S A;  1X9W B;  3GMF A;  2HRA A;  1X9S B;  4MCU A;  1OC9 B;  4ZB8 A;  3UIW A;  2LJR A;  1SYX A;  2L59 A;  3UMA A;  2YV7 A;  1UN2 A;  4BIK A;  2HI7 A;  4KSO A;  2R4V A;  4JZQ A;  2CA8 A;  4IQA A;  3ZZX A;  17GS A;  4PQH A;  5FHI A;  2CT6 A;  2YNX A;  6GSX A;  1Z5Y E;  3BCK A;  3WGE A;  3WGD A;  3HKR A;  4XHM A;  2CV4 A;  2LQO A;  1TI1 A;  4Z7X A;  1SK2 A;  3I43 A;  2WVX B;  2GSQ A;  3VI7 A;  3WGX A;  1PSQ A;  1W89 A;  4PGT A;  4E8H A;  2LRN A;  4TOP A;  5IMV A;  3EVI A;  2L6D A;  3M3M A;  5IO2 A;  1PN9 A;  5H5R A;  1YZX A;  3GL5 A;  4ZBD A;  3A2V A;  4F9Z A;  1Z6N A;  2DIY A;  4K5R A;  4QL7 A;  5IOX A;  1ON4 A;  3ZMK A;  2LKU A;  1MD3 A;  5IMF A;  4G01 A;  4HS1 A;  2WGR A;  1N2A A;  1NW2 A;  4JU5 A;  4V1A g;  5JCW A;  2R6K A;  2R0C A;  3ERW A;  4EVM A;  3IHQ A;  4AI6 A;  5D73 A;  1YEX A;  5DJM A;  3TCO A;  5IMC A;  4KSM A;  1MDK A;  3APO A;  5DVB A;  5ECN B;  2A2R A;  3CSH A;  2DML A;  2WW3 A;  2GZP A;  2X4A A;  1QK8 A;  1R5A A;  3OR5 A;  4FYB A;  3GST A;  2X8G A;  1B4P A;  4G19 A;  3US3 A;  4FH8 A;  5AIS A;  1M7T A;  4XIH A;  1DE1 A;  2H19 A;  2L57 A;  4I97 A;  1SK0 A;  4XRA A;  2H6Y A;  5B7C A;  3NZN A;  1FO5 A;  4HJM A;  4O5U A;  1XVQ A;  4PQ1 A;  3F9U A;  2VOC A;  3TKS C;  1GLP A;  1XBS A;  1OC9 A;  4J57 E;  4XRD A;  4GCI A;  5C04 A;  2GQL A;  2FD3 A;  3UVT A;  3KZQ A;  4NWY A;  1OYJ A;  2H1D A;  5ENU A;  3D21 A;  2WZS A;  1V40 A;  1SJZ A;  1G6W A;  5EL8 A;  3L78 A;  1WMJ A;  2DMM A;  4CW9 A;  1SKW B;  2O36 A;  5GSS A;  4I2U A;  4K5S A;  5HR1 A;  1ZMA A;  3QDN A;  2L5L A;  2N5B A;  1M2D A;  4AF2 A;  3GSS A;  4LMW A;  3VPQ A;  3DYR A;  1YJ6 A;  2WVX A;  3G7I A;  1ACV A;  1RW1 A;  3DEX A;  4X1U A;  3F6F A;  2CQ9 A;  2PUK C;  2WW2 A;  2AV4 A;  3IR4 A;  2A2S A;  4GST A;  1GTB A;  4FQU A;  3Q6O A;  5ID2 B;  3VWX A;  1U3A A;  3A5I A;  4O5R A;  2QA2 A;  1I9D A;  3EWL A;  2VKZ G;  3HZ4 A;  5B6M A;  3LXZ A;  4N30 A;  1JZR A;  3GUR A;  3EMP A;  4Q5Q A;  4KAE A;  1V9W A;  5F05 A;  4GSN A;  1JFU A;  2E2M A;  2IMD A;  5HR2 A;  3FZ5 A;  2PWJ A;  1F3A A;  1TI3 A;  4WR5 A;  2B3S A;  4CHS A;  1R26 A;  2N5F A;  3ZTL A;  6GSV A;  1TDI A;  3HJP A;  5DAL B;  4GF0 A;  5ECO B;  4ILF A;  2WB9 A;  3FHK A;  2LJK A;  4KX4 A;  4MJC A;  2OAC A;  5D93 A;  2JL4 A;  3LG6 A;  1MTC A;  3KMN A;  4KF9 A;  1TJD A;  4K6X A;  5HQP A;  3JCM L;  5JWR B;  5ECH B;  4QQ7 A;  4H86 A;  1LU4 A;  3D4M A;  2C80 A;  3PPU A;  3M9K A;  2UV8 G;  5LD0 A;  5KN0 A;  2GT5 A;  5ECS A;  2QC7 A;  4TR4 A;  4XS6 A;  3HVX A;  2L6C A;  1Z6M A;  2AJQ B;  5B8A A;  1NHY A;  2X99 A;  4IP1 A;  3C71 A;  3GX8 A;  1S3C A;  2FWH A;  5DAK B;  1FG4 A;  1XOB A;  2ON7 A;  5GAN D;  3RDW A;  1PMT A;  5D9V A;  1Z7R A;  1WOU A;  3G7J A;  4I5Q A;  4IJI A;  1MDI A;  2TRC P;  1URM A;  1M2B A;  5AN1 A;  4EIQ A;  1DSB A;  4I2T A;  1TP9 A;  6GSW A;  1PA3 A;  2OE3 A;  5IIZ A;  1XFL A;  2VO4 A;  3KMO A;  1FB0 A;  5IMA A;  1H75 A;  1OAZ A;  1FB6 A;  2G0F A;  4MK3 A;  2H66 A;  4MLY A;  2PVO C;  3ERG A;  5ECQ B;  1YQ1 A;  2PMT A;  5ID2 A;  5A4U A;  2NPB A;  4XTS A;  1WIK A;  4ZIJ A;  1SKR B;  2JU5 A;  2TIR A;  3HJM A;  1ZYN A;  2OE0 A;  1YY7 A;  2FWG A;  5KOX A;  10GS A;  3EIN A;  5IM9 A;  5A5H B;  3MYD A;  3DIE A;  3GH9 A;  2HSH A;  2EFE A;  2H75 A;  3GYK A;  4MJA A;  1EV4 A;  1N25 A;  1GP1 A;  4KGI A;  1HD2 A;  2IFQ B;  6GSS A;  1PX7 A;  1TW9 A;  4K2X A;  4ECC A;  1GL8 A;  4PTS A;  5DQY A;  3KXO A;  2H76 A;  4HU7 A;  2VLT A;  3WT1 A;  1B9X C;  3F3Q A;  2OA7 A;  2LNT A;  5DAL A;  5J47 A;  3TKR A;  4NHZ A;  3ZFB A;  2CX4 A;  2C0G A;  5IOW A;  2FUG 2;  1BX9 A;  1YF0 A;  2VM1 A;  2R0G A;  6GSU A;  4QL9 A;  3FR9 A;  3F0I A;  3C8E A;  3HMJ G;  2G2Q A;  2XBQ A;  1OVN A;  1VF2 A;  3QR6 A;  1BJX A;  3ZFL A;  2FA4 A;  4IHU A;  3IAS 2;  2KOK A;  2BTO T;  1OKT A;  1SJ6 A;  2J23 A;  1K3O A;  1HNA A;  4ZBA A;  4EE0 A;  5KN3 A;  2V41 A;  3MSZ A;  11GS A;  4AKI A;  3DXB A;  2L4Q A;  2X49 A;  2CVB A;  1I1I P;  3GHA A;  3P2A A;  1Y25 A;  3MNG A;  5DAK A;  1ML6 A;  2FWF A;  1AUC A;  4IEL A;  1ERT A;  1W4V A;  1PGT A;  2CAQ A;  4CDO A;  4HI7 A;  3BBY A;  4O7H A;  1QUW A;  1XXU A;  2NVL A;  5A34 A;  3GA4 A;  2DJJ A;  1B8X A;  1XW6 A;  3ED3 A;  1S3A A;  1Y6E A;  1YDK A;  1UVZ A;  4IW9 A;  2VCW A;  1WPI A;  1TXX A;  5D96 A;  3RPN A;  4WF5 A;  4F82 A;  1O81 A;  2RM5 A;  3TRX A;  4G9H A;  1BAY A;  5J3R A;  4PNF A;  1K3L A;  4OFT A;  5C00 A;  2A4V A;  3TKQ A;  4DSR A;  2FNO A;  3UOM A;  1TK0 B;  2JSY A;  1WP0 A;  4WET A;  1PKW A;  5A4W A;  3N9J A;  2M80 A;  2PER A;  2KUC A;  1CQH A;  1J0F A;  2YWN A;  5JWO B;  4JR6 A;  1ZCP A;  5DCH A;  5D8I A;  4PXO A;  2I81 A;  3IOS A;  1PKZ A;  4MZW A;  4WBR D;  3P8W A;  1GSD A;  2B5E A;  3HDC A;  4E68 A;  3A5W A;  2IMI A;  5A5H A;  3FEU A;  22GS A;  1XW5 A;  1WJK A;  1KTE A;  5A5K A;  3C73 A;  2L5O A;  3VPT A;  5D9W A;  4NPB A;  2V6K A;  3UJ1 A;  1K0M A;  3O6T A;  3Q74 A;  4O5Q A;  2HT9 A;  2CAI A;  2IFQ A;  4KA0 A;  3TKS A;  3LEF A;  4G0I A;  2LS5 A;  4MJE A;  2D2Z A;  2OBI A;  1A8Y A;  4KDX A;  4PQI A;  2AHE A;  3F6D A;  4KND A;  3HJO A;  5LNK e;  4WEY A;  1ERV A;  3TRQ A;  1XWG A;  2FHE A;  3Q19 A;  1V57 A;  4ML1 A;  5J9B A;  2L4C A;  2LTK A;  4G10 A;  3KH9 A;  4N0Z A;  3I6A A;  1YEP A;  1Y1U A;  3FRC A;  4I6X A;  2IJY A;  1ABA A;  2NBS A;  2RLI A;  5JCU A;  4J56 E;  3ZL5 A;  5AGY A;  3LGC A;  1SVO A;  1AAZ A;  3F3R A;  4Z2T A;  4GXZ A;  1K0N A;  1WRY A;  5F07 A;  1MEK A;  2B7K A;  1HQO A;  1EGO A;  1M9A A;  4V2L A;  2JZR A;  5J40 A;  2PPT A;  4ML6 A;  3QPM A;  3VK9 A;  4FIW A;  4P3Y B;  3TOT A;  3F63 A;  2H0I A;  4EDZ A;  2YCD A;  4ZIL A;  2ZCT A;  1USB A;  1AXD A;  2VCT A;  1ZYP A;  1XVW A;  1XPV A;  5J4Y A;  5ECL B;  5HR0 A;  5HR3 A;  4F03 A;  1JZD A;  4EF0 A;  2H71 A;  4L0U A;  3TUE A;  2IN3 A;  1Z3E A;  2WJU A;  2YZH A;  3E3E A;  3KM6 A;  1WWJ A;  1TXU A;  2LST A;  3ISO A;  1SU9 A;  2WCI A;  2HE3 A;  4PUA A;  2WFC A;  2C8U A;  3H79 A;  4ZBB A;  3WD6 A;  3ZRE A;  2HZE B;  1B9Y C;  2BJX A;  4NXI A;  1BG5 A;  1ZGN A;  2B6M A;  1XZO A;  3L9S A;  1T7P B;  4MJB A;  3F4S A;  3FZ4 A;  2JAD A;  3VLN A;  3P90 A;  2DJ3 A;  4EC0 A;  2XPE A;  1FHE A;  1GTI A;  2MBT A;  2C3Q A;  1J9B A;  7GSS A;  3W8J A;  4KCE A;  1M0U A;  4V2M A;  1TK5 B;  14GS A;  1OE8 A;  3CWG A;  2VLV A;  3GTU B;  1GNW A;  3PGT A;  1GLQ A;  5EY6 A;  2OBK A;  3SWL A;  2HYX A;  5HFI A;  4RI7 A;  1XWA A;  2O87 A;  1F6M C;  19GS A;  1M3J A;  2V2G A;  3FZA A;  1G6Y A;  3DVX A;  3L9U A;  3GX0 A;  3MAK A;  3CMI A;  1GTU A;  4RUV A;  4MP4 A;  3QAV A;  1CQG A;  2H6X A;  2GDR A;  1ZZY A;  5F8B A;  2HRN A;  5INY A;  1PFO A;  4F0B A;  2CZ2 A;  4GWR A;  4ICY A;  2C3N A;  2AYT A;  5JCG A;  3TOU A;  3M1G A;  3IDV A;  16GS A;  4Q5F A;  2CZ3 A;  1FW1 A;  3GKX A;  5LCZ A;  12GS A;  3CTF A;  1G0T A;  3FK8 A;  4OWY A;  2GSR A;  4POL A;  1TRW A;  3ERF A;  4FO5 A;  2VCQ A;  3HD5 A;  2VD1 A;  4BVX B;  2F51 A;  1F2E A;  1A23 A;  3CRT A;  1U3I A;  4YKF A;  2CX3 A;  5IPG A;  4OD7 A;  2OE1 A;  2TRX A;  1PD2 1;  1A2L A;  4O92 A;  4JR4 A;  1XWK A;  3IXR A;  1VF1 A;  4IS0 A;  1GWC A;  2H73 A;  3TU3 B;  1C72 A;  1K0D A;  1ERW A;  1F37 A;  4F2I A;  3ZIV A;  3HA9 A;  3IC4 A;  4LL1 B;  1GNE A;  1ILO A;  3EU4 A;  1TU7 A;  4XS1 A;  4A5P A;  3IK9 A;  3CYN A;  1QMV A;  2H01 A;  2HZE A;  3LOR A;  2JZT A;  3KD0 A;  4GQF A;  3UBK A;  2IWT A;  2F8F A;  3RGB C;  1T1V A;  2QSI A;  2K9F A;  1V98 A;  3LSZ A;  3ZRD A;  1BF5 A;  1GUH A;  4YQU A;  1IYI A;  2DIZ A;  1BYE A;  3CRU A;  3IC8 A;  2IME A;  2XPD A;  4K1F A;  4TN8 A;  5G31 A;  4DSQ A;  4PNG A;  2R5G A;  1U87 A;  2GQM A;  2VUP A;  2OT3 A;  3GTU A;  1K3Y A;  3F4T A;  2EFC A;  1GUK A;  2GVP A;  3D22 A;  2OJL A;  2E0Q A;  3QFB C;  2HLS A;  2DKI A;  3FYG A;  2C1Y A;  4N0V A;  4KUN A;  1JZO A;  2LRT A;  4Z2U A;  1SD9 A;  2J9H A;  4L5O A;  2DJK A;  4V1A p;  4POB A;  1GSE A;  4NV5 A;  2YV9 A;  4RI6 A;  4GQC A;  2WVY A;  1BED A;  4MF6 A;  1SKS B;  4BA7 A;  4ECI A;  3APQ A;  5EVO A;  5IQY A;  4K7O A;  3J7Y b;  3GN3 A;  4EO3 A;  4KDU A;  1ST9 A;  1A0R P;  3BOA A;  3G7Y A;  1E2Y A;  4NAX A;  5DQS A;  2H1A A;  2LNS A;  4PHZ C;  3TJG A;  4YKG A;  4ZL7 A;  2YWO A;  5HFG A;  2OAD A;  1AIU A;  3LXT A;  4KDY A;  4MH3 A;  1KNG A;  1O85 A;  4L0W A;  4HQS A;  4FXY P;  1SL2 B;  4G2E A;  3D5J A;  1PN0 A;  4BVX A;  2MZC A;  1TOF A;  3RHB A;  1N8J A;  4BVY B;  1T3B A;  5BRT A;  1EZK A;  2ES7 A;  1GSY A;  3CTG A;  1K0B A;  4HUA A;  4NHW A;  1TK8 B;  4I8B A;  5A34 B;  2GS3 A;  5CP1 A;  4HJ2 A;  1Z9H A;  3LFL A;  5DDL A;  9GSS A;  2GZZ A;  2DJ2 A;  2YOI A;  3LYK A;  2EIR A;  2O5V A;  3QOU A;  2HNL A;  3HVV A;  3QMX A;  5J5N A;  1AQX A;  3KH7 A;  2JZS A;  3L9V A;  4JED A;  4GRF A;  4HZ4 A;  4K0N A;  2R37 A;  5G5E A;  1ZOF A;  4ECJ A;  5CRD A;  1SL0 B;  2JSZ A;  3LYP A;  4RQR A;  3GV1 A;  2VCZ A;  3BJ5 A;  5IO0 A;  3QFA C;  4DVC A;  2GLR A;  4ZL8 A;  2XHF A;  5EPF A;  2YAN A;  2I3Y A;  4GLT A;  4OCE A;  3DGQ A;  2VCV A;  1I5G A;  5CRW A;  2YWI A;  2E7P A;  1R4W A;  2I4A A;  1O73 A;  3LJR A;  1X5D A;  3CBU A;  2X8C A;  1R7H A;  2M72 A;  4LL4 B;  5F06 A;  5IMD A;  4EL1 A;  3VWW A;  1A0F A;  4IQ1 A;  2VL9 A;  2QA1 A;  4WR4 A;  2HSY A;  3GNJ A;  4MNN A;  4K7N A;  4OO5 A;  4IBP A;  1XWC A;  4K8M A;  2HSN B;  1O6J A;  2VAF A;  4NMU A;  5A4V A;  1YVL A;  1QQ2 A;  1DUG A;  5ECP B;  1X0R A;  3HVN A;  2HXK A;  3HZ8 A;  5G1K A;  3HYP A;  4TKY A;  4AKG A;  1MDJ A;  1FVK A;  2V6O A;  1EP8 A;  1OC8 A;  3KEB A;  2K18 A;  2NDO A;  4Q5R A;  4MMM A;  4MA9 A;  2EIO A;  5DJL A;  5ECM B;  3KJY A;  4K0G A;  3KCM A;  4USS A;  2CVD A;  3ZIJ A;  5ECI B;  4BVY A;  1PQN A;  1M9B A;  2IIY A;  3L4N A;  1YEW C;  2B5X A;  1FOH A;  1GSF A;  4TR1 A;  2CVK A;  1F3B A;  1VGL A;  5F0G A;  2A4H A;  5CO3 A;  3S9F A;  1A24 A;  1RQM A;  2H0H A;  4DSS B;  3O76 A;  3CSI A;  4POM A;  3LW9 A;  4EXJ A;  4OCF A;  2R2J A;  3FZ9 A;  4K2D A;  3FY7 A;  5AIV A;  2RII A;  2GSS A;  1YKC A;  2MMN A;  3C7M A;  4BWS A;  3KP8 A;  1K0C A;  2GQK A;  3E0U A;  4IGJ A;  1AQV A;  3TJK A;  3A3T A;  1E6B A;  3FMW A;  1QXH A;  1Z7P A;  3UAR A;  1SL1 B;  1HNC A;  2WDU A;  4ISD A;  3DRN A;  2WUL A;  1X5E A;  3GRX A;  2RUF A;  4G0L A;  2WW0 A;  5ECR B;  1NSW A;  2O85 A;  1HNB A;  4N3Z A;  4L5L A;  2F9S A;  4POK A;  5CRH A;  3C1S A;  1EOG A;  3UVH A;  5IPH A;  5CYY A;  3R2Q A;  2JAC A;  1SEN A;  1B48 A;  3KGK A;  1K0A A;  4ZB9 A;  5B6N A;  1OE7 A;  3NIV A;  2FWE A;  4BL7 B;  3GL3 A;  4E8E A;  5H5Q A;  1VF3 A;  5GZZ B;  1Q4J A;  1XCC A;  3GH6 A;  4IN0 A; 
#chains in the Genus database with same CATH homology
 4AKX B;  3RHC A;  4CY8 A;  1S3D A;  3GKM A;  3E9J B;  1XW9 A;  2HSN A;  4Q5N A;  4IVF A;  4KW6 A;  3TJB A;  2O8V B;  4OFN A;  2LQQ A;  3D6I A;  2VL3 A;  3EMX A;  1MD4 A;  1GSS A;  2HRK B;  2VD0 A;  3VWU A;  2GST A;  3FR3 A;  2H1B A;  3IRA A;  1T00 A;  4WBJ A;  2B1K A;  1EP7 A;  2RUE A;  3G9B A;  3GIX A;  3QCP A;  4BWQ A;  1ZYE A;  2C4J A;  1THO A;  1G7E A;  2PGT A;  2I1U A;  3HY2 A;  1VF4 A;  4X4J A;  4PUR A;  1H4O A;  2I9H A;  2WRT A;  2VL2 C;  2X64 A;  3QD9 A;  3EC3 A;  3MWH A;  4DSS A;  1U6T A;  2Z9S A;  5G1L A;  4TXO B;  3L0H A;  2HRF A;  1Q98 A;  1T8E B;  3W8S A;  5ECK B;  1WE0 A;  3VI5 A;  4CY6 A;  1QGV A;  3M8N A;  1ZYQ B;  1B4Q A;  1V58 A;  1KEB A;  3BD2 A;  3TDG A;  4EKZ A;  2HQT A;  5GST A;  1NHO A;  5COH A;  1FAA A;  5CRE A;  2H8L A;  2QKE A;  3FKF A;  5ABR A;  1EWX A;  1PL2 A;  2YZU A;  2UZ8 A;  4K9Z A;  5A1N B;  3D0Z A;  4DEJ A;  4PX1 A;  2K8S A;  5HFK A;  3FW2 A;  4N11 A;  2DSA A;  1T4Y A;  5D9T A;  2GZY A;  4EDY A;  3ZIT A;  4MZB A;  3PIN A;  3KP9 A;  3GUS A;  2H74 A;  2H0G A;  4BL7 A;  2B7J A;  4YQV A;  4EIP A;  1ZL9 A;  2P5Q A;  3Q18 A;  1U88 A;  3EYT A;  3I9V 2;  3F4R A;  4XS4 B;  2V32 A;  4MPF A;  1VRS D;  4KH7 A;  4AJ6 A;  1GRX A;  8GSS A;  2PU9 C;  5G5F A;  3LWA A;  5ELA A;  1EV9 A;  3U5R E;  3KTB A;  1X9M B;  4KCA A;  2LJA A;  4MF7 A;  3EU3 A;  4YAV A;  4LMV A;  1O8X A;  2DJ1 A;  1EEJ A;  2O7K A;  3IE3 A;  5DBQ A;  1LBK A;  4HU9 A;  2AUV A;  2YWM A;  1M2A A;  3APS A;  3GKN A;  4V2N A;  3TKP A;  4MDC A;  3K8N A;  2KHP A;  2HRK A;  4ZL9 A;  3DD3 A;  2O89 A;  4ID0 A;  4HZ2 A;  3DKS A;  4WF4 A;  6GST A;  1AC1 A;  2MBS A;  2KP2 A;  3C1R A;  3U6V A;  1UA5 A;  1SK1 A;  1IYH A;  2YJ7 A;  3HHV A;  1AW9 A;  1BQ7 A;  1EEM A;  2ZNM A;  4TVE A;  13GS A;  3M0F A;  1EGR A;  2PVQ A;  5AIX A;  2XBI A;  2H70 A;  2KLX A;  4MZC A;  3WYW A;  1SD8 A;  5J41 A;  3PR8 A;  5KEJ A;  2EFD A;  1JLV A;  4TXO A;  2RM6 A;  1TKD B;  2AAW A;  1O7U A;  1TRV A;  3N5O A;  2C0E A;  2V1M A;  2HZF A;  1ERU A;  1HYU A;  5CRG A;  1FVJ A;  2WZ9 A;  4G0K A;  1THX A;  3H8Q A;  2FGX A;  1DBY A;  2K6V A;  3LQ7 A;  1NM3 A;  1JHB A;  2F3M A;  4QMK A;  4GTU A;  20GS A;  5A1N A;  3EUR A;  2DC5 A;  1V2A A;  2YPM A;  3DWV A;  4ECB A;  2MMO A;  2H30 A;  1SVL A;  2A2P A;  2IMF A;  1XIY A;  2H72 A;  4AKH A;  18GS A;  2WS2 A;  4TXV A;  4TW5 A;  1JLW A;  5J4U A;  4HEA 2;  5D9X A;  1TTZ A;  4XS4 A;  2AB6 A;  3ZLP A;  4XCS A;  3VUR A;  2PN8 A;  4YQM A;  4FYU A;  1RK4 A;  3GKK A;  2EFH A;  1K0O A;  2H1L A;  3J7Y k;  1UC7 A;  4HQZ A;  4Z2R A;  2BMX A;  2YP6 A;  3UBL A;  3TJF A;  3EE2 A;  2GGT A;  4TRX A;  5FT3 A;  2MMA A;  1EOH A;  2VCX A;  4D73 B;  2FLS A;  1A2M A;  3HCZ A;  4YAP A;  3ZYW A;  3HVS A;  2ALB A;  3F8U A;  4TR1 B;  2KP1 A;  2DKH A;  2MMZ A;  4TR0 A;  4IP6 A;  2YJH A;  3QAG A;  4NV2 A;  2HSM B;  2VLU A;  5E4W A;  5J4V A;  1XOA A;  2MYG A;  1AQW A;  2HFD A;  3QAW A;  3D4T A;  1DE2 A;  1PRX A;  1J08 A;  4MF5 A;  5KN1 A;  4ZB7 A;  2M46 A;  4X43 A;  4JRR A;  3RPP A;  5KOW A;  2P0G A;  5CNW A;  3SBC A;  3FR6 A;  3ME7 A;  3CSJ A;  4AJ7 A;  4F0C A;  2XC2 A;  2X8H A;  3H4K A;  4BPY A;  3KTL A;  4LA1 A;  3M9J A;  1R5P A;  1YF1 A;  3UEM A;  2E2G A;  4HOJ A;  2EC4 A;  2VM2 A;  5B8B A;  1QFN A;  3TGZ A;  2EIQ A;  4EUY A;  3RBT A;  5JWQ B;  2IPA A;  4MPG A;  1T4Z A;  1XWB A;  1GTA A;  5FWG A;  1G7O A;  2LUS A;  4AGS A;  1JZW A;  3IBH A;  1TRU A;  1SJI A;  2K8V A;  3VWV A;  4ULX A;  3WT2 A;  1KBN A;  1GH2 A;  4JBB A;  4IJ3 A;  1FOV A;  5BMU B;  3EPT A;  5IMZ A;  5E59 A;  1LJR A;  2QGV A;  1PL1 A;  3IAM 2;  1A2J A;  4TR3 A;  2FY6 A;  4PUF C;  4ZXG A;  2P5R A;  3V1W A;  1TU8 A;  2VIM A;  3ZVJ A;  4X0X A;  2ZUP A;  3PH9 A;  3P7X A;  2P31 A;  2OKA A;  5G30 A;  5G2Z A;  3H1N A;  4W66 A;  4KE3 A;  2LEG A;  3MIX A;  2H1G A;  2C0D A;  3TB2 A;  2GT6 A;  4WXT A;  3TJJ A;  2VL2 A;  4D73 A;  5CAX A;  3UAP A;  2IL3 A;  4ACS A;  2LRC A;  4OFM A;  4J2F A;  3AY8 A;  5ELG A;  1OKD A;  2DLX A;  3DML A;  3IV4 A;  1X5C A;  2B5Y A;  3GFK A;  3IHG A;  2HSM A;  2YN1 A;  3UL3 A;  4RQX A;  4MH2 A;  3W6G A;  4GSS A;  4ZB6 A;  1GSU A;  1BG1 A;  4AJ8 A;  3IK7 A;  3MDK A;  2DBC A;  2PBJ A;  3R3E A;  3KIJ A;  1GUM A;  2GTU A;  2FCH A;  2NTO A;  1SYR A;  4N10 A;  3IPZ A;  3A2X A;  4L8E A;  1F9M A;  2B1L A;  3IA1 A;  3ME8 A;  4K7I A;  4OO4 A;  3I69 A;  1M99 A;  4IKH A;  3ZVJ D;  3DVW A;  2C0F A;  5J9C A;  1O8W A;  1PX6 A;  2ON5 A;  4MAB A;  4YH2 A;  4HDE A;  3BCI A;  1TRS A;  1GSQ A;  2DJ0 A;  3NOF A;  2F8A A;  2R0P A;  3HXS A;  2C3T A;  6GSY A;  4GDF A;  2LV3 A;  1OC3 A;  1SVM A;  2H6Z A;  5KN2 A;  3H93 A;  3VFI A;  1YKA A;  5DCG A;  4OMV A;  3ZML A;  3CXG A;  4LLR A;  3TRP A;  2REM A;  2IMK A;  2R3X A;  3O3T A;  5L71 A;  1A8L A;  4KB3 A;  5GAP D;  3RAZ A;  3A2W A;  4FYC A;  4O32 A;  3TKS E;  4JE1 A;  5BMU A;  2N5A A;  4WKW A;  1GUL A;  2FA8 A;  5H5S A;  1X9W B;  3GMF A;  2HRA A;  1X9S B;  4MCU A;  1OC9 B;  4ZB8 A;  3UIW A;  2LJR A;  1SYX A;  2L59 A;  3UMA A;  2YV7 A;  1UN2 A;  2HI7 A;  4KSO A;  2R4V A;  4JZQ A;  2CA8 A;  4IQA A;  3ZZX A;  17GS A;  4PQH A;  5FHI A;  2CT6 A;  2YNX A;  6GSX A;  1Z5Y E;  3BCK A;  3WGE A;  3WGD A;  3HKR A;  4XHM A;  2CV4 A;  2LQO A;  1TI1 A;  4Z7X A;  1SK2 A;  3I43 A;  2GSQ A;  3VI7 A;  3WGX A;  1PSQ A;  1W89 A;  4PGT A;  4E8H A;  2LRN A;  4TOP A;  5IMV A;  3EVI A;  2L6D A;  3M3M A;  5IO2 A;  1PN9 A;  5H5R A;  1YZX A;  3GL5 A;  4ZBD A;  3A2V A;  4F9Z A;  1Z6N A;  2DIY A;  4K5R A;  4QL7 A;  5IOX A;  1ON4 A;  3ZMK A;  2LKU A;  1MD3 A;  5IMF A;  4G01 A;  4HS1 A;  2WGR A;  1N2A A;  1NW2 A;  4JU5 A;  4V1A g;  5JCW A;  2R6K A;  2R0C A;  3ERW A;  4EVM A;  3IHQ A;  4AI6 A;  5D73 A;  1YEX A;  5DJM A;  3TCO A;  5IMC A;  4KSM A;  1MDK A;  3APO A;  5DVB A;  5ECN B;  2A2R A;  3CSH A;  2DML A;  2GZP A;  2X4A A;  1QK8 A;  1R5A A;  3OR5 A;  4FYB A;  3GST A;  2X8G A;  1B4P A;  4G19 A;  3US3 A;  4FH8 A;  5AIS A;  1M7T A;  4XIH A;  1DE1 A;  2H19 A;  2L57 A;  4I97 A;  1SK0 A;  4XRA A;  2H6Y A;  5B7C A;  3NZN A;  1FO5 A;  4HJM A;  4O5U A;  1XVQ A;  4PQ1 A;  3F9U A;  2VOC A;  3TKS C;  1GLP A;  1XBS A;  1OC9 A;  4J57 E;  4XRD A;  4GCI A;  5C04 A;  2GQL A;  2FD3 A;  3UVT A;  3KZQ A;  4NWY A;  1OYJ A;  2H1D A;  5ENU A;  3D21 A;  1V40 A;  1SJZ A;  1G6W A;  5EL8 A;  3L78 A;  1WMJ A;  2DMM A;  4CW9 A;  1SKW B;  5GSS A;  4I2U A;  4K5S A;  5HR1 A;  1ZMA A;  3QDN A;  2L5L A;  2N5B A;  1M2D A;  4AF2 A;  3GSS A;  4LMW A;  3VPQ A;  3DYR A;  1YJ6 A;  3G7I A;  1ACV A;  1RW1 A;  3DEX A;  4X1U A;  3F6F A;  2CQ9 A;  2PUK C;  2AV4 A;  3IR4 A;  2A2S A;  4GST A;  1GTB A;  4FQU A;  3Q6O A;  5ID2 B;  3VWX A;  1U3A A;  3A5I A;  4O5R A;  2QA2 A;  1I9D A;  3EWL A;  2VKZ G;  3HZ4 A;  5B6M A;  3LXZ A;  4N30 A;  1JZR A;  3GUR A;  3EMP A;  4Q5Q A;  4KAE A;  1V9W A;  5F05 A;  4GSN A;  1JFU A;  2E2M A;  2IMD A;  5HR2 A;  3FZ5 A;  2PWJ A;  1F3A A;  1TI3 A;  4WR5 A;  2B3S A;  4CHS A;  1R26 A;  2N5F A;  3ZTL A;  6GSV A;  1TDI A;  3HJP A;  5DAL B;  4GF0 A;  5ECO B;  4ILF A;  2WB9 A;  3FHK A;  2LJK A;  4KX4 A;  4MJC A;  2OAC A;  5D93 A;  2JL4 A;  3LG6 A;  1MTC A;  3KMN A;  4KF9 A;  1TJD A;  4K6X A;  5HQP A;  3JCM L;  5JWR B;  5ECH B;  4QQ7 A;  4H86 A;  1LU4 A;  3D4M A;  2C80 A;  3PPU A;  3M9K A;  2UV8 G;  5LD0 A;  5KN0 A;  2GT5 A;  5ECS A;  2QC7 A;  4TR4 A;  4XS6 A;  3HVX A;  2L6C A;  1Z6M A;  2AJQ B;  5B8A A;  1NHY A;  2X99 A;  4IP1 A;  3C71 A;  3GX8 A;  1S3C A;  2FWH A;  5DAK B;  1FG4 A;  1XOB A;  2ON7 A;  5GAN D;  3RDW A;  1PMT A;  5D9V A;  1Z7R A;  1WOU A;  3G7J A;  4I5Q A;  4IJI A;  1MDI A;  2TRC P;  1URM A;  1M2B A;  5AN1 A;  4EIQ A;  1DSB A;  4I2T A;  1TP9 A;  6GSW A;  1PA3 A;  2OE3 A;  5IIZ A;  1XFL A;  2VO4 A;  3KMO A;  1FB0 A;  5IMA A;  1H75 A;  1OAZ A;  1FB6 A;  2G0F A;  4MK3 A;  2H66 A;  4MLY A;  2PVO C;  3ERG A;  5ECQ B;  1YQ1 A;  2PMT A;  5ID2 A;  5A4U A;  2NPB A;  4XTS A;  1WIK A;  4ZIJ A;  1SKR B;  2JU5 A;  2TIR A;  3HJM A;  1ZYN A;  2OE0 A;  1YY7 A;  2FWG A;  5KOX A;  10GS A;  3EIN A;  5IM9 A;  5A5H B;  3MYD A;  3DIE A;  3GH9 A;  2HSH A;  2EFE A;  2H75 A;  3GYK A;  4MJA A;  1EV4 A;  1N25 A;  1GP1 A;  4KGI A;  1HD2 A;  2IFQ B;  6GSS A;  1PX7 A;  1TW9 A;  4K2X A;  4ECC A;  1GL8 A;  4PTS A;  5DQY A;  3KXO A;  2H76 A;  4HU7 A;  2VLT A;  3WT1 A;  1B9X C;  3F3Q A;  2OA7 A;  2LNT A;  5DAL A;  5J47 A;  3TKR A;  4NHZ A;  3ZFB A;  2CX4 A;  2C0G A;  5IOW A;  2FUG 2;  1BX9 A;  1YF0 A;  2VM1 A;  2R0G A;  6GSU A;  4QL9 A;  3FR9 A;  3F0I A;  3C8E A;  3HMJ G;  2G2Q A;  2XBQ A;  1OVN A;  1VF2 A;  3QR6 A;  1BJX A;  3ZFL A;  2FA4 A;  4IHU A;  3IAS 2;  2KOK A;  2BTO T;  1OKT A;  1SJ6 A;  2J23 A;  1K3O A;  1HNA A;  4ZBA A;  4EE0 A;  5KN3 A;  2V41 A;  3MSZ A;  11GS A;  4AKI A;  3DXB A;  2L4Q A;  2X49 A;  2CVB A;  3GHA A;  3P2A A;  1Y25 A;  3MNG A;  5DAK A;  1ML6 A;  2FWF A;  1AUC A;  4IEL A;  1ERT A;  1W4V A;  1PGT A;  2CAQ A;  4CDO A;  4HI7 A;  3BBY A;  4O7H A;  1QUW A;  1XXU A;  2NVL A;  5A34 A;  3GA4 A;  2DJJ A;  1B8X A;  1XW6 A;  3ED3 A;  1S3A A;  1Y6E A;  1YDK A;  1UVZ A;  4IW9 A;  2VCW A;  1WPI A;  1TXX A;  5D96 A;  3RPN A;  4WF5 A;  4F82 A;  1O81 A;  2RM5 A;  3TRX A;  4G9H A;  1BAY A;  5J3R A;  4PNF A;  1K3L A;  4OFT A;  5C00 A;  2A4V A;  3TKQ A;  4DSR A;  2FNO A;  3UOM A;  1TK0 B;  2JSY A;  1WP0 A;  4WET A;  1PKW A;  5A4W A;  3N9J A;  2M80 A;  2PER A;  2KUC A;  1CQH A;  1J0F A;  2YWN A;  5JWO B;  4JR6 A;  1ZCP A;  5DCH A;  5D8I A;  4PXO A;  2I81 A;  3IOS A;  1PKZ A;  4MZW A;  4WBR D;  3P8W A;  1GSD A;  2B5E A;  3HDC A;  4E68 A;  3A5W A;  2IMI A;  5A5H A;  3FEU A;  22GS A;  1XW5 A;  1WJK A;  1KTE A;  5A5K A;  3C73 A;  2L5O A;  3VPT A;  5D9W A;  4NPB A;  2V6K A;  3UJ1 A;  1K0M A;  3O6T A;  3Q74 A;  4O5Q A;  2HT9 A;  2CAI A;  2IFQ A;  4KA0 A;  3TKS A;  3LEF A;  4G0I A;  2LS5 A;  4MJE A;  2D2Z A;  2OBI A;  1A8Y A;  4KDX A;  4PQI A;  2AHE A;  3F6D A;  4KND A;  3HJO A;  5LNK e;  4WEY A;  1ERV A;  3TRQ A;  1XWG A;  2FHE A;  3Q19 A;  1V57 A;  4ML1 A;  5J9B A;  2L4C A;  2LTK A;  4G10 A;  3KH9 A;  4N0Z A;  3I6A A;  1YEP A;  1Y1U A;  3FRC A;  4I6X A;  2IJY A;  1ABA A;  2NBS A;  2RLI A;  5JCU A;  4J56 E;  3ZL5 A;  5AGY A;  3LGC A;  1SVO A;  1AAZ A;  3F3R A;  4Z2T A;  4GXZ A;  1K0N A;  1WRY A;  5F07 A;  1MEK A;  2B7K A;  1HQO A;  1EGO A;  1M9A A;  4V2L A;  2JZR A;  5J40 A;  2PPT A;  4ML6 A;  3QPM A;  3VK9 A;  4FIW A;  4P3Y B;  3TOT A;  3F63 A;  2H0I A;  4EDZ A;  2YCD A;  4ZIL A;  2ZCT A;  1USB A;  1AXD A;  2VCT A;  1ZYP A;  1XVW A;  1XPV A;  5J4Y A;  5ECL B;  5HR0 A;  5HR3 A;  4F03 A;  1JZD A;  4EF0 A;  2H71 A;  4L0U A;  3TUE A;  2IN3 A;  1Z3E A;  2WJU A;  2YZH A;  3E3E A;  3KM6 A;  1WWJ A;  1TXU A;  2LST A;  3ISO A;  1SU9 A;  2WCI A;  2HE3 A;  4PUA A;  2WFC A;  2C8U A;  3H79 A;  4ZBB A;  3WD6 A;  3ZRE A;  2HZE B;  1B9Y C;  2BJX A;  4NXI A;  1BG5 A;  1ZGN A;  2B6M A;  1XZO A;  3L9S A;  1T7P B;  4MJB A;  3F4S A;  3FZ4 A;  2JAD A;  3VLN A;  3P90 A;  2DJ3 A;  4EC0 A;  2XPE A;  1FHE A;  1GTI A;  2MBT A;  2C3Q A;  1J9B A;  7GSS A;  3W8J A;  4KCE A;  1M0U A;  4V2M A;  1TK5 B;  14GS A;  1OE8 A;  3CWG A;  2VLV A;  3GTU B;  1GNW A;  3PGT A;  1GLQ A;  5EY6 A;  2OBK A;  3SWL A;  2HYX A;  5HFI A;  4RI7 A;  1XWA A;  2O87 A;  1F6M C;  19GS A;  2V2G A;  3FZA A;  1G6Y A;  3DVX A;  3L9U A;  3GX0 A;  3MAK A;  3CMI A;  1GTU A;  4RUV A;  4MP4 A;  3QAV A;  1CQG A;  2H6X A;  2GDR A;  1ZZY A;  5F8B A;  2HRN A;  5INY A;  4F0B A;  2CZ2 A;  4GWR A;  4ICY A;  2C3N A;  2AYT A;  5JCG A;  3TOU A;  3M1G A;  3IDV A;  16GS A;  4Q5F A;  2CZ3 A;  1FW1 A;  3GKX A;  5LCZ A;  12GS A;  3CTF A;  1G0T A;  3FK8 A;  4OWY A;  2GSR A;  4POL A;  1TRW A;  3ERF A;  4FO5 A;  2VCQ A;  3HD5 A;  2VD1 A;  4BVX B;  2F51 A;  1F2E A;  1A23 A;  3CRT A;  1U3I A;  4YKF A;  2CX3 A;  5IPG A;  4OD7 A;  2OE1 A;  2TRX A;  1PD2 1;  1A2L A;  4O92 A;  4JR4 A;  1XWK A;  3IXR A;  1VF1 A;  4IS0 A;  1GWC A;  2H73 A;  3TU3 B;  1C72 A;  1K0D A;  1ERW A;  1F37 A;  4F2I A;  3ZIV A;  3HA9 A;  3IC4 A;  4LL1 B;  1GNE A;  1ILO A;  3EU4 A;  1TU7 A;  4XS1 A;  4A5P A;  3IK9 A;  3CYN A;  1QMV A;  2H01 A;  3LOR A;  2HZE A;  2JZT A;  3KD0 A;  4GQF A;  3UBK A;  2IWT A;  2F8F A;  1T1V A;  2QSI A;  2K9F A;  1V98 A;  3LSZ A;  3ZRD A;  1BF5 A;  1GUH A;  4YQU A;  1IYI A;  2DIZ A;  1BYE A;  3CRU A;  3IC8 A;  2IME A;  2XPD A;  4K1F A;  4TN8 A;  5G31 A;  4DSQ A;  4PNG A;  2R5G A;  1U87 A;  2GQM A;  2VUP A;  2OT3 A;  3GTU A;  1K3Y A;  3F4T A;  2EFC A;  1GUK A;  2GVP A;  3D22 A;  2OJL A;  2E0Q A;  3QFB C;  2HLS A;  2DKI A;  3FYG A;  2C1Y A;  4N0V A;  4KUN A;  1JZO A;  2LRT A;  4Z2U A;  1SD9 A;  2J9H A;  4L5O A;  2DJK A;  4V1A p;  4POB A;  1GSE A;  4NV5 A;  2YV9 A;  4RI6 A;  4GQC A;  1BED A;  4MF6 A;  1SKS B;  4BA7 A;  4ECI A;  3APQ A;  5EVO A;  5IQY A;  4K7O A;  3J7Y b;  3GN3 A;  4EO3 A;  4KDU A;  1ST9 A;  1A0R P;  3BOA A;  3G7Y A;  1E2Y A;  4NAX A;  5DQS A;  2H1A A;  2LNS A;  3TJG A;  4YKG A;  4ZL7 A;  2YWO A;  5HFG A;  2OAD A;  1AIU A;  3LXT A;  4KDY A;  4MH3 A;  1KNG A;  1O85 A;  4L0W A;  4HQS A;  1SL2 B;  4G2E A;  3D5J A;  1PN0 A;  4BVX A;  2MZC A;  1TOF A;  3RHB A;  1N8J A;  4BVY B;  1T3B A;  5BRT A;  1EZK A;  2ES7 A;  1GSY A;  3CTG A;  1K0B A;  4HUA A;  4NHW A;  1TK8 B;  4I8B A;  5A34 B;  2GS3 A;  5CP1 A;  4HJ2 A;  1Z9H A;  3LFL A;  5DDL A;  9GSS A;  2GZZ A;  2DJ2 A;  2YOI A;  3LYK A;  2EIR A;  2O5V A;  3QOU A;  2HNL A;  3HVV A;  3QMX A;  5J5N A;  1AQX A;  3KH7 A;  2JZS A;  3L9V A;  4JED A;  4GRF A;  4HZ4 A;  4K0N A;  2R37 A;  5G5E A;  1ZOF A;  4ECJ A;  5CRD A;  1SL0 B;  2JSZ A;  3LYP A;  4RQR A;  3GV1 A;  2VCZ A;  3BJ5 A;  5IO0 A;  3QFA C;  4DVC A;  2GLR A;  4ZL8 A;  2XHF A;  5EPF A;  2YAN A;  2I3Y A;  4GLT A;  4OCE A;  3DGQ A;  2VCV A;  1I5G A;  5CRW A;  2YWI A;  2E7P A;  1R4W A;  2I4A A;  1O73 A;  3LJR A;  1X5D A;  3CBU A;  2X8C A;  1R7H A;  2M72 A;  4LL4 B;  5F06 A;  5IMD A;  4EL1 A;  3VWW A;  1A0F A;  4IQ1 A;  2VL9 A;  2QA1 A;  4WR4 A;  2HSY A;  3GNJ A;  4MNN A;  4K7N A;  4OO5 A;  4IBP A;  1XWC A;  4K8M A;  2HSN B;  1O6J A;  2VAF A;  4NMU A;  5A4V A;  1YVL A;  1QQ2 A;  1DUG A;  5ECP B;  1X0R A;  2HXK A;  3HZ8 A;  5G1K A;  3HYP A;  4TKY A;  4AKG A;  1MDJ A;  1FVK A;  2V6O A;  1EP8 A;  1OC8 A;  3KEB A;  2K18 A;  2NDO A;  4Q5R A;  4MMM A;  4MA9 A;  2EIO A;  5DJL A;  5ECM B;  3KJY A;  4K0G A;  3KCM A;  4USS A;  2CVD A;  3ZIJ A;  5ECI B;  4BVY A;  1PQN A;  1M9B A;  2IIY A;  3L4N A;  2B5X A;  1FOH A;  1GSF A;  4TR1 A;  2CVK A;  1F3B A;  1VGL A;  5F0G A;  2A4H A;  5CO3 A;  3S9F A;  1A24 A;  1RQM A;  2H0H A;  4DSS B;  3O76 A;  3CSI A;  4POM A;  3LW9 A;  4EXJ A;  4OCF A;  2R2J A;  3FZ9 A;  4K2D A;  3FY7 A;  5AIV A;  2RII A;  2GSS A;  1YKC A;  2MMN A;  3C7M A;  4BWS A;  3KP8 A;  1K0C A;  2GQK A;  3E0U A;  4IGJ A;  1AQV A;  3TJK A;  3A3T A;  1E6B A;  3FMW A;  1QXH A;  1Z7P A;  3UAR A;  1SL1 B;  1HNC A;  2WDU A;  4ISD A;  3DRN A;  2WUL A;  1X5E A;  2RUF A;  3GRX A;  4G0L A;  5ECR B;  1NSW A;  2O85 A;  1HNB A;  4N3Z A;  4L5L A;  2F9S A;  4POK A;  5CRH A;  3C1S A;  1EOG A;  3UVH A;  5IPH A;  5CYY A;  3R2Q A;  2JAC A;  1SEN A;  1B48 A;  3KGK A;  1K0A A;  4ZB9 A;  5B6N A;  1OE7 A;  3NIV A;  2FWE A;  4BL7 B;  3GL3 A;  4E8E A;  5H5Q A;  1VF3 A;  5GZZ B;  1Q4J A;  1XCC A;  3GH6 A;  4IN0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...