3R3EA

The glutathione bound structure of yqjg, a glutathione transferase homolog from escherichia coli k-12
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
326
structure length
308
Chain Sequence
GQLIDGVWHAFRNWLTADGAPGPTGTGGFIAEKDRYHLYVSLACPWAHRTLIMRKLKGLEPFISVSVVNPLMLENGWTFDDSFPGATGDTLYQNEFLYQLYLHADPHYSGRVTVPVLWDKKNHTIVSNESAEIIRMFNTAFDALGAKAGDYYPPALQTKIDELNGWIYDTVNNGVYKAGFATSQEAYDEAVAKVFESLARLEQILGQHRYLTGNQLTEADIRLWTTLVRFDPVYVTHFKCDKHRISDYLNLYGFLRDIYQMPGIAETVNFDHIRNHYFRSHKTINPTGIISIGPWQDLDEPHGRDVRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein yqjG
publication title Crystal Structure Analysis of yqjG from Escherichia Coli K-12
rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 109
structure length 308
sequence length 326
chains with identical sequence B
ec nomenclature ec 1.8.5.7: Glutathionyl-hydroquinone reductase.
pdb deposition date 2011-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13409 GST_N_2 Glutathione S-transferase, N-terminal domain
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3r3eA02
3.40.30.130 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3r3eA01
1V40A 4FQUA 1GTIA 2CZ3A 5B7CA 3LYKA 6GSYA 4LMWA 2AB6A 1GLPA 3IR4A 2HNLA 5AN1A 1XWKA 3CRUA 3CSHA 5A4UA 1GUMA 2WDUA 2GDRA 5JCWA 1G7OA 3VI5A 5D9WA 3F6DA 3LFLA 4PGTA 3WYWA 1F2EA 4PQIA 4KAEA 3TGZA 2VD0A 1AXDA 13GSA 2JL4A 3VLNA 5ECLB 5F07A 3UAPA 3GURA 1GTUA 1AW9A 3ZFLA 5F8BA 3CRTA 3MDKA 14GSA 2F3MA 1M99A 5EY6A 3UVHA 2VCWA 5D9XA 1G6WA 4NAXA 3QAGA 4ECCA 2GSRA 1GULA 3EINA 1K0BA 2ON7A 1LBKA 4N0VA 1LJRA 4HZ2A 1PN9A 2C3NA 4Q5NA 3KJYA 3QR6A 3SWLA 4ZBBA 3L0HA 3KXOA 2C8UA 3C8EA 4PXOA 4YAPA 4PNGA 1N2AA 3M1GA 1ZL9A 3QAVA 2J9HA 3G7JA 5HFKA 2CA8A 3LQ7A 3ZFBA 2GSTA 5J5NA 2CAQA 5F0GA 1GWCA 4GF0A 4Q5QA 1OYJA 5ECOB 4KSMA 4LMVA 4JZQA 5ELGA 5LCZA 1VF1A 1GSEA 1YJ6A 3NIVA 1GTBA 1AQVA 3R2QA 5ECHB 2R6KA 4G9HA 4GTUA 1IYIA 4K0NA 2OA7A 4YQMA 5ECSA 5DCGA 3N9JA 1XW5A 5FT3A 2VCQA 3LYPA 3F63A 4QQ7A 1A0FA 1G6YA 1PL2A 1VF3A 5A4WA 1FHEA 4IBPA 1C72A 6GSUA 3IK9A 5FWGA 2AAWA 4K0GA 4MF7A 3TOTA 4YQVA 8GSSA 2X64A 3GSSA 3ZMLA 1EV9A 2PGTA 4ACSA 3CSJA 4YQUA 4E8HA 2DC5A 3IK7A 3PGTA 2N5FA 1PX6A 3P90A 4JEDA 1AQWA 4GLTA 1Z9HA 2C4JA 4ZBAA 4NHZA 1IYHA 4GSNA 1BX9A 3ERFA 2GLRA 3W8SA 4ECBA 2F8FA 5IQYA 5A5KA 2V6KA 1KBNA 4HJ2A 4IVFA 4BVXA 5DJMA 1HQOA 3AY8A 4O92A 1DUGA 3UBKA 3UARA 3GH6A 2GSQA 4PQHA 6GSSA 3VPQA 1RK4A 3HJOA 1VF2A 4KF9A 1XWGA 5D73A 1UA5A 7GSSA 3O3TA 1TU7A 12GSA 1MD3A 2HSNB 4MDCA 4EDZA 4F03A 1FW1A 5DQSA 2VO4A 2HRAA 3F6FA 4I97A 3GTUB 6GSXA 1HNBA 16GSA 4IQAA 3I69A 4KX4A 4KE3A 4BVYA 3HKRA 5ECKB 3QAWA 3CBUA 4G0LA 3IE3A 1USBA 2PVQA 4OFTA 5ECIB 4HI7A 2YCDA 4PX1A 2R5GA 1K3OA 18GSA 4O7HA 2HRKB 4F0BA 3FY7A 4AGSA 1ML6A 3M8NA 1YQ1A 3ZMKA 3KM6A 3KMOA 2D2ZA 6GSTA 2OACA 6GSVA 2YV7A 5EVOA 1PX7A 1M0UA 1E6BA 1F3BA 4Q5RA 6GSWA 1YKCA 4MF5A 3GSTA 2HSMB 4L8EA 5ECPB 4G0KA 4MZWA 2UZ8A 4EE0A 5KEJA 3VWXA 2HQTA 3O76A 3PPUA 3GUSA 1K3LA 4MK3A 3DD3A 4PURA 5F06A 10GSA 1HNCA 4WR5A 1VF4A 4ZBDA 3KMNA 2VCXA 1JLVA 3LXTA 3U6VA 5J4UA 5G5EA 4BVXB 4USSA 4GSSA 1BG5A 2C80A 2IL3A 3VK9A 5AIXA 5DALA 3ERGA 1B4PA 5AGYA 3TOUA 1PA3A 3GTUA 4G19A 1EOGA 22GSA 1K0NA 5JCUA 1TU8A 1PL1A 4IKHA 2R3XA 2WJUA 11GSA 2HRKA 1BAYA 4PTSA 3RBTA 3FR6A 2VCZA 3IC8A 4BVYB 1R5AA 5ECQB 4WR4A 4F0CA 3WD6A 2PMTA 2VCVA 3FR3A 3Q19A 4GSTA 4IS0A 4IELA 1GNWA 1U87A 4KH7A 3VURA 1M9BA 4HOJA 1JZRA 4BL7B 2HSMA 3R3EA 4YH2A 2A2SA 5ELAA 4TOPA 1YY7A 4IJIA 3UBLA 5GSSA 4KDXA 1NHYA 3LG6A 1F3AA 1GSSA 1V2AA 3VI7A 5DAKB 1AQXA 1GUHA 3FRCA 2IMIA 2VCTA 4EXJA 1EEMA 1GSDA 3LSZA 1PKWA 1HNAA 1Q4JA 3N5OA 4ISDA 3PR8A 5EL8A 4Q5FA 1GSUA 9GSSA 1MD4A 3GX0A 5DDLA 2A2RA 5ECRB 4ZB9A 2GSSA 1GLQA 4L5LA 1JLWA 1XW6A 2C3QA 1TDIA 3LXZA 4CHSA 4J2FA 4IW9A 20GSA 5DALB 1U88A 3IBHA 2LJRA 2FNOA 4IQ1A 1GNEA 1PMTA 2WB9A 2WRTA 4KGIA 1GTAA 1PGTA 1BYEA 2R4VA 4OMVA 5DJLA 4NHWA 4PUAA 1ZGNA 4ECIA 1K3YA 3LJRA 1GUKA 2CAIA 4E8EA 3DGQA 2WS2A 2OADA 1OKTA 2CVDA 3ISOA 4ZXGA 4BL7A 5A4VA 2ON5A 5GSTA 5D9VA 4IGJA 4ID0A 4DEJA 3H1NA 3M3MA 4MF6A 1B8XA 2VD1A 5ECNB 2CZ2A 1PKZA 3P8WA 5DAKA 4G10A 5AIVA 4OFMA 4KDYA 2AHEA 3I6AA 5LD0A 5FHIA 2YV9A 5ECMB 2PBJA 1B48A 3Q74A 1TW9A 4EC0A 1PD21 3D0ZA 4G0IA 5G5FA 2FHEA 1Y6EA 3M0FA 2C3TA 5AISA 3G7IA 3BBYA 4ZB6A 4OFNA 4HZ4A 4MP4A 3FYGA 5GZZB 1K0OA 1OE7A 3VPTA 4L5OA 2PERA 1EV4A 1GSFA 1EOHA 4JBBA 3HJMA 1YDKA 3MAKA 4RI6A 2NTOA 2DSAA 1U3IA 1K0CA 3CSIA 3EE2A 1M9AA 1GSYA 2GTUA 19GSA 1GSQA 2IMKA 1K0MA 1OE8A 5F05A 3KTLA 4MPGA 1K0AA 17GSA 1MTCA 4RI7A 4ECJA 5D9TA 3Q18A 1K0DA 4MPFA 4PNFA 4GCIA 5J41A 5BMUA 4KDUA 4EDYA 4YAVA 3FR9A 4ZB8A
chains in the Genus database with same CATH superfamily
1O7UA 2WVXA 4QL7A 2L6CA 1GLPA 4HEA2 2HNLA 1NM3A 1XIYA 2R2JA 2JU5A 3CSHA 2L57A 1QFNA 3F6DA 3LFLA 4PUFC 2R0PA 4TRXA 3IPZA 1T1VA 2VD0A 3FKFA 4POLA 5ECLB 5F07A 4P3YB 2GGTA 3TKQA 3FZAA 3HY2A 3RHBA 5H5SA 5F8BA 5EPFA 4F9ZA 2O85A 3CHXC 4XRDA 2VCWA 4KSOA 1X9MB 1SKSB 1G6WA 4MJBA 2OBKA 4ECCA 2GSRA 3EINA 1K0BA 2ON7A 5BMUB 3H8QA 1LJRA 3GX8A 3SWLA 2DJ2A 4N11A 4MH3A 1TK0B 3BJ5A 3L0HA 4K5SA 2IWTA 2C8UA 3TJFA 1N2AA 1ZCPA 2ES7A 5J4YA 1BF5A 1WMJA 2PPTA 2CA8A 3HCZA 1MEKA 2VKZG 2HRFA 3JCML 1H4OA 1J9BA 2HSNA 1OKDA 1GWCA 4GF0A 1XWCA 4Q5QA 3GV1A 3IHGA 5LCZA 1GTBA 4NV5A 1WOUA 2LUSA 2R6KA 5IPHA 2OA7A 1SD9A 2LQQA 3LYPA 3UL3A 5A4WA 1FHEA 4IBPA 2UV8G 2G2QA 4YQVA 1R26A 2HSYA 3MIXA 3ZMLA 2LNSA 2GS3A 1WRYA 3PGTA 1S3AA 3WT2A 1U3AA 3L9UA 5GAPD 2H1LA 5CNWA 3F0IA 4NHZA 1IYHA 4GSNA 3WGEA 4ECBA 3W8SA 2F8FA 5IQYA 5A5KA 4BVXA 4GQFA 5DJMA 5J9BA 1HQOA 3UBKA 2HSHA 2H73A 3VPQA 1RK4A 3HZ4A 1S4BP 7GSSA 3O3TA 2H74A 2C1YA 2IMDA 2NPBA 3BCKA 3F4SA 1HNBA 3LORA 3I69A 4KE3A 4BVYA 2WW2A 1T8EB 1SL2B 5CRHA 2P0GA 2F51A 4O7HA 2HRKB 3H93A 4AGSA 4NWYA 5B6MA 2YP6A 6GSVA 1PX7A 1E6BA 4Q5RA 3PH9A 1YKCA 2IIYA 2O36A 4IP1A 5ECPB 4MZWA 4EE0A 5KEJA 1SJ6A 1TJDA 1FOVA 2VLUA 3VWXA 2HQTA 4TR1B 1XOBA 2LRTA 1K3LA 4PURA 2PWJA 4YKGA 2KLXA 1HNCA 2QSIA 2QC7A 1PSQA 4EL1A 4Z2RA 3FK8A 4K5RA 4JE1A 1OVNA 3ERGA 2A4HA 2MZCA 3TJGA 4WETA 5AGYA 2CT6A 1H75A 2NVLA 22GSA 3D22A 1K0NA 5IOXA 2X8CA 4KCAA 3WT1A 2DJ1A 4IP6A 11GSA 3FMWA 2HRKA 1BAYA 4JR4A 3HD5A 1Z6NA 4V2NA 4ZL8A 4WR4A 4F0CA 3WD6A 3FR3A 3Q19A 3C1SA 2A2SA 3APSA 1XWAA 3BCIA 4TOPA 3E3EA 4TR1A 2H71A 4H86A 4NV2A 1UVZA 1XFLA 2R37A 5DAKB 1TXUA 3A3TA 4MJCA 3FRCA 3QFBC 5ENUA 1HNAA 3N5OA 1X5DA 4Q5FA 2FGXA 1GSUA 9GSSA 2E2GA 3GX0A 5DDLA 1OAZA 3ZRDA 4V2MA 1YZXA 5HR3A 1TDIA 2WVYA 3GKXA 1MDIA 2OJLA 2EFHA 1U88A 2FNOA 1GNEA 1CQGA 2WRTA 3IAS2 1OC9B 2HI7A 2R4VA 2EFDA 3M9KA 4XCSA 3LJRA 3VWVA 1Y1UA 3DGQA 2WS2A 3F4TA 5D8IA 2HYXA 5A4VA 1ZZYA 5KN1A 5D9VA 4RQXA 4IGJA 4ID0A 2VL9A 5HFIA 4PI2C 1ZMAA 3H1NA 2FD3A 3HVXA 5DAKA 2DMMA 3RPNA 3K8NA 3W6GA 2PVOC 2AUVA 3I6AA 2OT3A 5LD0A 1A2JA 3PINA 2L4QA 5HR1A 5FHIA 2XPDA 4EUYA 5ECMB 2V1MA 5H5RA 1FAAA 1TW9A 5IMDA 4AI6A 1PD21 1I5GA 3M0FA 2C3TA 5AISA 3G7IA 3BBYA 4OFNA 1F37A 1SK1A 1RW1A 2GT6A 3A5IA 1SKWB 3FYGA 1OC9A 3D4TA 2H6XA 2LNTA 1OE7A 1EV4A 1XXUA 3C73A 3UVTA 2H72A 2LRNA 3LWAA 3MAKA 3KCMA 2NTOA 4N10A 4JR6A 4K2DA 1SL0B 1U3IA 1K0CA 3QMXA 3GFKA 3F8UA 1M9AA 4CW9A 1EZKA 1YF0A 19GSA 1GSQA 2IMKA 5GAND 1OE8A 1KTEA 5F05A 2J23A 1FO5A 4RUVA 1JHBA 3RFRC 2PU9C 4GCIA 4KA0A 1Z7RA 3FR9A 4ZB8A 1XOAA 1O8XA 2X4AA 2JSYA 4G01A 1V40A 3MYDA 2RLIA 4K1FA 3QCPA 4GRFA 4K7NA 1M2DA 3D21A 3BOAA 4LMWA 2YWMA 1FG4A 1XWKA 3NOFA 4L0WA 3KIJA 3D4MA 3IDVA 2GDRA 1YEWC 1G7OA 5D9WA 4TXVA 4PGTA 1VRSD 2H1BA 2MBSA 3RHCA 5C04A 3HVVA 2DJKA 4TXOA 2K8SA 3HJPA 1AXDA 13GSA 3UOMA 4TR4A 3GURA 1AW9A 3CRTA 5EY6A 4OD7A 2DLXA 1DE2A 2GVPA 4ZL9A 4EIPA 3GKKA 1PN9A 2C3NA 2H76A 3KJYA 3QR6A 4NPBA 1BQ7A 1BEDA 2WVXB 4O5RA 5IMVA 3KXOA 3M1GA 1PQNA 1GRXA 1ZL9A 4TR3A 5J5NA 5F0GA 1XZOA 4ML6A 4X4JA 1OYJA 4KCEA 1XW9A 2ZUPA 2B1KA 4JZQA 1ZYEA 1VF1A 2DJJA 3R2QA 1AQVA 5ECHB 5E59A 3O6TA 1IYIA 4YQMA 4N3ZA 5FT3A 2FWHA 1A8LA 3UJ1A 2MYGA 1A0FA 4MZBA 2DJ0A 1PL2A 3IA1A 5BRTA 5FWGA 4K0GA 1ZYQB 4MF7A 5CP1A 2X64A 5IO0A 1EV9A 4PHZC 2I9HA 3CSJA 3QPMA 2E2MA 2O89A 1TXXA 3L4NA 1E2YA 3G9BA 3P90A 1SK2A 4LL4B 5JWRB 1ABAA 4MJAA 2C4JA 5C00A 4ZBAA 5JCGA 1PN0A 4FO5A 4MCUA 4IVFA 1J0FA 1A2MA 1F9MA 4O92A 4NMUA 3GH6A 3F4RA 4PQHA 4MH2A 2LSTA 3GH9A 4KF9A 1YF1A 2B7KA 4WF5A 4HU7A 2HSNB 4I2UA 1FW1A 2HRAA 3F6FA 4HUAA 4KW6A 1ON4A 2H1DA 3ZL5A 4KX4A 5ECKB 3QAWA 3UEMA 1USBA 1TRUA 2R5GA 5HR0A 4F0BA 3DEXA 3FY7A 1QMVA 1GH2A 5L71A 6GSTA 3ZVJD 2YV7A 4ICYA 4CY8A 2YNXA 3KH9A 4L8EA 2G0FA 2H6ZA 4JRRA 2UZ8A 4F2IA 4FYBA 1WPIA 4AKIA 5LNKe 1TRWA 3TCOA 5ID2A 2TRXA 1JLVA 3LXTA 3U6VA 4BVXB 4V1Ag 2C80A 2QA2A 4BPYA 5AIXA 3L9VA 5DALA 4KB3A 1M2BA 1TU8A 4TN8A 1NW2A 1AAZA 1WIKA 4IN0A 4I6XA 2L59A 3IC8A 2LEGA 5CRDA 3HXSA 4BVYB 2FA4A 4IELA 2JSZA 2FY6A 1GNWA 4KH7A 3VURA 4HOJA 1JZRA 4J57E 2N5BA 3R3EA 2DKHA 3MSZA 3F3QA 2PN8A 3CMIA 1CQHA 4IJIA 3WGDA 5GSSA 4KDXA 1NHYA 4WKWA 1WWJA 3VI7A 1TP9A 2V32A 5H5QA 4NXIA 2DMLA 4EXJA 1EEMA 1GSDA 3ZIVA 1SL1B 1G0TA 2L5LA 1YKAA 5CO3A 4XIHA 4ZB9A 1ERUA 1PFOA 2GSSA 1XW6A 2C3QA 2YJHA 4O5QA 3LXZA 4IW9A 2CQ9A 2DBCA 3KTBA 2LJRA 4IQ1A 1GTAA 4O5UA 4OMVA 5DJLA 4FXYP 1K3YA 4GQCA 2P5QA 3TJBA 4Z2TA 4A5PA 1OKTA 4ZXGA 2A4VA 2ON5A 1G7EA 1DE1A 1M2AA 1SD8A 3HMJG 4DEJA 3IV4A 3M3MA 5A1NA 4FH8A 2A2PA 3ZTLA 1SJZA 2VAFA 2QGVA 2Z9SA 4OFMA 3EPTA 4E68A 3TDGA 3D6IA 1TRSA 1BJXA 4MZCA 4AKXB 5CREA 2PBJA 2X8HA 3Q74A 3IXRA 2RUEA 5G5FA 1T3BA 2H19A 2X8GA 2XBQA 3KH7A 4PQ1A 1K0OA 4K7IA 2N5AA 2B3SA 3J7Yb 3VPTA 1BG1A 2VLTA 1THOA 2MMNA 2CX4A 3QFAC 1GSFA 1EOHA 1M3IA 4JBBA 4RI6A 2E0QA 1ZYPA 1I9DA 2H75A 2AYTA 3GL5A 1ZOFA 2GTUA 2FCHA 1ZYNA 4K2XA 3KZQA 4OO5A 4POBA 1FB0A 3KTLA 4MPGA 1K0AA 2XBIA 17GSA 5G30A 1T4YA 4ECJA 3Q18A 1JZWA 1K0DA 1MDJA 1Z7PA 4WBJA 5G2ZA 3CXGA 1TRVA 4PNFA 2MMAA 4KDUA 4YAVA 3UMAA 4WF4A 3I43A 3ME8A 3C71A 5A34A 4FQUA 3I9V2 1GTIA 2CZ3A 5B7CA 4D73A 2AB6A 4QMKA 3IR4A 2LQOA 1R5PA 1ILOA 3CRUA 5JCWA 2M80A 5IMAA 3FZ4A 3P7XA 3WYWA 2GQMA 1F2EA 4PQIA 4AJ7A 4KAEA 2KUCA 2IMEA 2V2GA 3TGZA 2KHPA 3RDWA 3TB2A 3VWWA 4K8MA 3VLNA 4AF2A 5B8BA 2OKAA 3UAPA 1O6JA 1A23A 2F8AA 4I5QA 3ZYWA 2YZUA 3SBCA 2K9FA 1GULA 3GYKA 3DIEA 2V41A 1LBKA 4HZ2A 4ILFA 4Q5NA 5HR2A 1A24A 2JZSA 3HVSA 1ST9A 4DSQA 2VM2A 3GN3A 2B1LA 3A2WA 3C8EA 4YAPA 4V1Ap 5D93A 4EKZA 2REMA 3KGKA 1S3RA 3QAVA 4O32A 3LQ7A 3ZFBA 3IC4A 1XVWA 2GSTA 1A0RP 2B5XA 4XS1A 1ERWA 1SJIA 5KOXA 1EP7A 1O73A 5ECOB 2DJ3A 1THXA 5ELGA 1GSEA 1YJ6A 2ZCTA 3NIVA 4JU5A 3C7MA 4CDOA 4G9HA 4GTUA 4K0NA 3TJJA 1B4QA 1N8JA 1V57A 4HJMA 4TXOB 2HLSA 3A2XA 4BWQA 5IMFA 3F63A 4QQ7A 1U6TA 1X0RA 1VF3A 1C72A 1QXHA 1TI3A 3IK9A 2O7KA 2AAWA 3GSSA 3RGBC 3HDCA 3EU3A 4BA7A 5J40A 2I4AA 3ZVJA 2DC5A 4G2EA 5IMZA 1SVLA 3TJKA 3E0UA 1V58A 1PX6A 5CRWA 2TIRA 1AQWA 4GLTA 2C0GA 3NZNA 2M46A 1S3DA 4CY6A 4RQRA 3ERFA 3QDNA 4L0UA 3GHAA 2B5YA 2PUKC 3AY8A 3APOA 3ZITA 2ZNMA 4MNNA 1O85A 6GSSA 1X5CA 1XWGA 5D73A 4DSSA 1UA5A 1YVLA 1EP8A 1TU7A 1DBYA 2OE1A 12GSA 1MD3A 4WXTA 3VWUA 2MMOA 3GL3A 16GSA 2GQLA 3HKRA 2ALBA 4MMMA 1A2LA 3IE3A 4X1UA 4OFTA 1FVKA 3S9FA 2YCDA 2LS5A 3TKSE 18GSA 4KNDA 1ML6A 3CTFA 4XS6A 3ZMKA 2I1UA 3KM6A 4HSCX 2D2ZA 2DIYA 1M0UA 4GDFA 5CAXA 3GSTA 1Z6MA 4G0KA 2YWNA 3PPUA 2YANA 4W66A 3GUSA 4MK3A 4J56E 3DD3A 2H1AA 10GSA 3DWVA 5IOWA 4WR5A 1VF4A 5IIZA 2KP1A 2HT9A 5J4UA 5G5EA 4K9ZA 4USSA 4GSSA 2H6YA 2IL3A 3VK9A 1QUWA 2YWOA 1B4PA 2H70A 3TOUA 2LJKA 5A5HA 1EOGA 3HVNA 1JZOA 3FZ9A 1PL1A 4WBRD 3EMPA 2R3XA 4XRAA 1LU4A 2P31A 2VCZA 4XHMA 1R5AA 3J7Yk 1M3JA 5HFGA 4IS0A 4GSTA 3ED3A 3ZREA 4AJ6A 5JWOB 1U87A 1UN2A 5DCHA 1A8YA 2H8LA 4X0XA 1GL8A 4YH2A 3ERWA 5ELAA 2RUFA 4EO3A 4N0ZA 2OE3A 2FWEA 3GKMA 1TI1A 4PI0C 3LG6A 1V2AA 1AQXA 1QGVA 5G1LA 1XVQA 4Z7XA 5J9CA 2IMIA 2GZPA 2H66A 1FVJA 3LSZA 1PKWA 1Q4JA 5ID2B 5EL8A 3F9UA 1MD4A 1ERVA 5ECRB 1TOFA 3TRXA 5JWQB 1B9YC 1JLWA 2CX3A 3P2AA 4J2FA 2WVZA 5DALB 3IBHA 2XPEA 2EIRA 2WB9A 3CYNA 4KGIA 1Y25A 2QA1A 1BYEA 2NBSA 3CQFA 4NHWA 3CTGA 1ZGNA 3IHQA 2LRCA 1GUKA 1XCCA 2RM6A 5KOWA 2CAIA 4E8EA 2HZEA 4MA9A 2FA8A 2OADA 2CVDA 2I3YA 1X9WB 1O81A 3TRPA 4GXZA 4I2TA 1B8XA 2VD1A 5ECNB 4GWRA 5IMCA 3HZ8A 2CZ2A 2BJXA 3DVWA 4AKHA 2CV4A 4ZB7A 4HU9A 2IMFA 5AIVA 2JACA 3RPPA 4KDYA 2AHEA 2KP2A 4HQSA 1N25A 2EC4A 4I8BA 5ABRA 3H4KA 1AIUA 1Y6EA 1AC1A 4HZ4A 4MP4A 2LTKA 4FIWA 5GZZB 3MWHA 4XS4B 1QQ2A 1TK5B 2FWFA 2WW3A 2DKIA 2KOKA 4POMA 3IAM2 4F82A 1Q98A 2C0DA 3ZLPA 3KP9A 4EF0A 3GRXA 1YDKA 1WE0A 1URMA 4V2LA 2DSAA 3EWLA 3CSIA 1SVOA 4HQZA 3L9SA 2XHFA 4BIKA 3V1WA 5COHA 1EWXA 2VM1A 2WZSA 1K0MA 1YEXA 2YZHA 3IOSA 5D9TA 5A1NB 2YN1A 5KN2A 4MPFA 5BMUA 3G7YA 5KN3A 4EDYA 3H79A 4TKYA 4AKGA 4POKA 1TTZA 2R0GA 1SYXA 3LYKA 2H0IA 2K6VA 6GSYA 2AV4A 4XS4A 2X99A 5AN1A 3MNGA 1VGLA 4K6XA 3TU3B 5A4UA 4AJ8A 1GUMA 2WDUA 1F6MC 2O8VB 2IJYA 3VI5A 1JZDA 4ULXA 2VL3A 2WFCA 1KNGA 2WZ9A 1XPVA 1V98A 3KD0A 1Z5YE 4FYUA 2VL2A 3EC3A 3VFIA 4FYCA 2LJAA 1YEPA 2JL4A 2HFDA 2WULA 2QKEA 5B8AA 2FLSA 3RAZA 1TK8B 1GTUA 5IM9A 3ZFLA 1SENA 3BD2A 3MDKA 2L5OA 2YJ7A 5HQPA 14GSA 2F3MA 1M99A 3UVHA 5D9XA 2H01A 3TKSA 1SK0A 4NAXA 3QAGA 3HA9A 5B6NA 2HZFA 4N0VA 1WP0A 3C1RA 3E9JB 1ERTA 2M72A 2DIZA 4ZBBA 4MJEA 5A34B 1X9SB 3IRAA 3FW2A 4D73B 4PXOA 3DMLA 4PNGA 3DKSA 4X43A 1V9WA 1RQMA 3F3RA 5J3RA 2J9HA 3G7JA 5HFKA 4OO4A 2CAQA 2VOCA 1X5EA 4KSMA 2MMZA 2IN3A 3L78A 4LMVA 2JZRA 2B6MA 5ECSA 1T4ZA 5DCGA 3N9JA 1XWBA 1XW5A 2VCQA 2F9SA 1G6YA 3GMFA 6GSUA 4IHUA 1I1IP 4K7OA 3TOTA 2B7JA 8GSSA 1NSWA 4KUNA 2PGTA 4ACSA 4YQUA 2YOIA 4E8HA 1R4WA 2E7PA 3APQA 3IK7A 2L6DA 1SU9A 2EFEA 1T00A 5IO2A 2N5FA 4ZIJA 4JEDA 4HS1A 2OE0A 2XC2A 2CVKA 1FOHA 2NDOA 3D5JA 1Z9HA 1M7TA 2IPAA 1SYRA 1BX9A 2GLRA 2V6KA 1KBNA 4HJ2A 5D96A 1DUGA 3UARA 2BMXA 2GSQA 1S3CA 3HJOA 4QL9A 1VF2A 5G31A 1Z3EA 4TR0A 2WCIA 3GIXA 4MDCA 4EDZA 4F03A 1SKRB 5DQSA 2VO4A 2O87A 3ZZXA 2K8VA 4I97A 3GTUB 2RM5A 2VLVA 6GSXA 3CWGA 3EURA 3DRNA 4IQAA 3EU4A 5KN0A 3CBUA 4G0LA 3FZ5A 2PVQA 5ECIB 2H0HA 4HI7A 3KP8A 4PX1A 2HE3A 2HRNA 1K3OA 2FUG2 1WJKA 4ML1A 5J47A 3Q6OA 1R7HA 3M8NA 1YQ1A 3DXBA 3KMOA 5DBQA 3M9JA 2OACA 2C0FA 3KEBA 5EVOA 4ZL7A 5INYA 1F3BA 6GSWA 1T7PB 4MF5A 1O8WA 4N30A 2HSMB 2LV3A 2L4CA 3O76A 3FHKA 3GA4A 5F06A 2CVBA 2B5EA 3DYRA 3ME7A 4XTSA 2AJQB 4ZBDA 3KMNA 2VCXA 1AUCA 1BG5A 1MDKA 4LLRA 3U5RE 4WEYA 4YKFA 4Z2UA 1PA3A 3GTUA 4G19A 4DSSB 5JCUA 1JFUA 4IKHA 4LA1A 2WJUA 4BWSA 2EIQA 1TKDB 3EMXA 4PTSA 3RBTA 2EIOA 3LW9A 4EVMA 3FR6A 3TKPA 3QOUA 1DSBA 4TW5A 4LL1B 5ECQB 4TVEA 3ZIJA 4OCFA 2PMTA 2VCVA 1ACVA 2WW0A 1KEBA 3WGXA 1EGRA 1M9BA 4BL7B 2HSMA 3GKNA 2IFQB 1EEJA 1FB6A 2JZTA 1YY7A 3UBLA 2GZZA 1F3AA 1GSSA 4DSRA 5J4VA 1HD2A 1GUHA 3EYTA 2VCTA 3US3A 2K18A 2FWGA 4ISDA 3PR8A 3LEFA 3UIWA 1W89A 2A2RA 2HXKA 1GLQA 4L5LA 2JADA 4MABA 1XG8A 4CHSA 20GSA 3A5WA 5CRGA 2O5VA 2VL2C 5A5HB 1PMTA 3EVIA 2GQKA 3HHVA 1PGTA 3GNJA 4PUAA 1OC8A 1HYUA 2BTOT 4ECIA 2GZYA 3TKRA 2YWIA 5G1KA 5DQYA 5IPGA 3ISOA 4IJ3A 5E4WA 4BL7A 3W8JA 2H1GA 5GSTA 2IFQA 1PRXA 3TKSC 2VIMA 2P5RA 4MF6A 1W4VA 1PKZA 3P8WA 1SVMA 4EIQA 4G10A 2TRCP 3A2VA 4OCEA 2EFCA 2YV9A 1B48A 4EC0A 2YPMA 1J08A 2VUPA 3D0ZA 4G0IA 2FHEA 3HYPA 5CYYA 4ZB6A 2V6OA 1EGOA 2RIIA 2I81A 5DVBA 2C0EA 2WW1A 4L5OA 2H30A 1QK8A 2PERA 3QD9A 3TRQA 4OWYA 2LKUA 1B9XC 3HJMA 2WGRA 1GP1A 4MLYA 2X49A 3EE2A 3FEUA 1XBSA 1GSYA 4ZILA 4HDEA 2HZEB 3LGCA 2GT5A 3TUEA 1UC7A 3OR5A 1MTCA 4RI7A 2OBIA 3DVXA 1OC3A 2O3EA 4DVCA 2MBTA 2H0GA 5J41A 2R0CA 1NHOA
chains in the Genus database with same CATH topology
1O7UA 4QL7A 2L6CA 1GLPA 4HEA2 2HNLA 1NM3A 1XIYA 2R2JA 2JU5A 3CSHA 2L57A 1QFNA 3F6DA 3LFLA 4PUFC 2R0PA 4TRXA 3IPZA 1T1VA 2VD0A 3FKFA 4POLA 5ECLB 5F07A 4P3YB 2GGTA 3TKQA 3FZAA 3HY2A 3RHBA 5H5SA 5F8BA 5EPFA 4F9ZA 2O85A 4XRDA 2VCWA 4KSOA 1X9MB 1SKSB 1G6WA 4MJBA 2OBKA 4ECCA 2GSRA 3EINA 1K0BA 2ON7A 5BMUB 3H8QA 1LJRA 3GX8A 3SWLA 2DJ2A 4N11A 4MH3A 1TK0B 3BJ5A 3L0HA 4K5SA 2IWTA 2C8UA 3TJFA 1N2AA 1ZCPA 2ES7A 5J4YA 1BF5A 1WMJA 2PPTA 2CA8A 3HCZA 1MEKA 2VKZG 2HRFA 3JCML 1H4OA 1J9BA 2HSNA 1OKDA 1GWCA 4GF0A 1XWCA 4Q5QA 3GV1A 3IHGA 5LCZA 1GTBA 4NV5A 1WOUA 2LUSA 2R6KA 5IPHA 2OA7A 1SD9A 2LQQA 3LYPA 3UL3A 5A4WA 1FHEA 4IBPA 2UV8G 2G2QA 4YQVA 1R26A 2HSYA 3MIXA 3ZMLA 2LNSA 2GS3A 1WRYA 3PGTA 1S3AA 3WT2A 1U3AA 3L9UA 5GAPD 2H1LA 5CNWA 3F0IA 4NHZA 1IYHA 4GSNA 3WGEA 4ECBA 3W8SA 2F8FA 5IQYA 5A5KA 4BVXA 4GQFA 5DJMA 5J9BA 1HQOA 3UBKA 2HSHA 2H73A 3VPQA 1RK4A 3HZ4A 7GSSA 3O3TA 2H74A 2C1YA 2IMDA 2NPBA 3BCKA 3F4SA 1HNBA 3LORA 3I69A 4KE3A 4BVYA 1T8EB 1SL2B 5CRHA 2P0GA 2F51A 4O7HA 2HRKB 3H93A 4AGSA 4NWYA 5B6MA 2YP6A 6GSVA 1PX7A 1E6BA 4Q5RA 3PH9A 1YKCA 2IIYA 4IP1A 5ECPB 4MZWA 4EE0A 5KEJA 1SJ6A 1TJDA 1FOVA 2VLUA 3VWXA 2HQTA 4TR1B 1XOBA 2LRTA 1K3LA 4PURA 2PWJA 4YKGA 2KLXA 1HNCA 2QSIA 2QC7A 1PSQA 4EL1A 4Z2RA 3FK8A 4K5RA 4JE1A 1OVNA 3ERGA 2A4HA 2MZCA 3TJGA 4WETA 5AGYA 2CT6A 1H75A 2NVLA 22GSA 3D22A 1K0NA 5IOXA 2X8CA 4KCAA 3WT1A 2DJ1A 4IP6A 11GSA 3FMWA 2HRKA 1BAYA 4JR4A 3HD5A 1Z6NA 4V2NA 4ZL8A 4WR4A 4F0CA 3WD6A 3FR3A 3Q19A 3C1SA 2A2SA 3APSA 1XWAA 3BCIA 4TOPA 3E3EA 4TR1A 2H71A 4H86A 4NV2A 1UVZA 1XFLA 2R37A 5DAKB 1TXUA 3A3TA 4MJCA 3FRCA 3QFBC 5ENUA 1HNAA 3N5OA 1X5DA 4Q5FA 2FGXA 1GSUA 9GSSA 2E2GA 3GX0A 5DDLA 1OAZA 3ZRDA 4V2MA 1YZXA 5HR3A 1TDIA 3GKXA 1MDIA 2OJLA 2EFHA 1U88A 2FNOA 1GNEA 1CQGA 2WRTA 3IAS2 1OC9B 2HI7A 2R4VA 2EFDA 3M9KA 4XCSA 3LJRA 3VWVA 1Y1UA 3DGQA 2WS2A 3F4TA 5D8IA 2HYXA 5A4VA 1ZZYA 5KN1A 5D9VA 4RQXA 4IGJA 4ID0A 2VL9A 5HFIA 1ZMAA 3H1NA 2FD3A 3HVXA 5DAKA 2DMMA 3RPNA 3K8NA 3W6GA 2PVOC 2AUVA 3I6AA 2OT3A 5LD0A 1A2JA 3PINA 2L4QA 5HR1A 5FHIA 2XPDA 4EUYA 5ECMB 2V1MA 5H5RA 1FAAA 1TW9A 5IMDA 4AI6A 1PD21 1I5GA 3M0FA 2C3TA 5AISA 3G7IA 3BBYA 4OFNA 1F37A 1SK1A 1RW1A 2GT6A 3A5IA 1SKWB 3FYGA 1OC9A 3D4TA 2H6XA 2LNTA 1OE7A 1EV4A 1XXUA 3C73A 3UVTA 2H72A 2LRNA 3LWAA 3MAKA 3KCMA 2NTOA 4N10A 4JR6A 4K2DA 1SL0B 1U3IA 1K0CA 3QMXA 3GFKA 3F8UA 1M9AA 4CW9A 1EZKA 1YF0A 19GSA 1GSQA 2IMKA 5GAND 1OE8A 1KTEA 5F05A 2J23A 1FO5A 4RUVA 1JHBA 2PU9C 4GCIA 4KA0A 1Z7RA 3FR9A 4ZB8A 1XOAA 1O8XA 2X4AA 2JSYA 4G01A 1V40A 3MYDA 2RLIA 4K1FA 3QCPA 4GRFA 4K7NA 1M2DA 3D21A 3BOAA 4LMWA 2YWMA 1FG4A 1XWKA 3NOFA 4L0WA 3KIJA 3D4MA 3IDVA 2GDRA 1G7OA 5D9WA 4TXVA 4PGTA 1VRSD 2H1BA 2MBSA 3RHCA 5C04A 3HVVA 2DJKA 4TXOA 2K8SA 3HJPA 1AXDA 13GSA 3UOMA 4TR4A 3GURA 1AW9A 3CRTA 5EY6A 4OD7A 2DLXA 1DE2A 2GVPA 4ZL9A 4EIPA 3GKKA 1PN9A 2C3NA 2H76A 3KJYA 3QR6A 4NPBA 1BQ7A 1BEDA 4O5RA 5IMVA 3KXOA 3M1GA 1PQNA 1GRXA 1ZL9A 4TR3A 5J5NA 5F0GA 1XZOA 4ML6A 4X4JA 1OYJA 4KCEA 1XW9A 2ZUPA 2B1KA 4JZQA 1ZYEA 1VF1A 2DJJA 3R2QA 1AQVA 5ECHB 5E59A 3O6TA 1IYIA 4YQMA 4N3ZA 5FT3A 2FWHA 1A8LA 3UJ1A 2MYGA 1A0FA 4MZBA 2DJ0A 1PL2A 3IA1A 5BRTA 5FWGA 4K0GA 1ZYQB 4MF7A 5CP1A 2X64A 5IO0A 1EV9A 2I9HA 3CSJA 3QPMA 2E2MA 2O89A 1TXXA 3L4NA 1E2YA 3G9BA 3P90A 1SK2A 4LL4B 5JWRB 1ABAA 4MJAA 2C4JA 5C00A 4ZBAA 5JCGA 1PN0A 4FO5A 4MCUA 4IVFA 1J0FA 1A2MA 1F9MA 4O92A 4NMUA 3GH6A 3F4RA 4PQHA 4MH2A 2LSTA 3GH9A 4KF9A 1YF1A 2B7KA 4WF5A 4HU7A 2HSNB 4I2UA 1FW1A 2HRAA 3F6FA 4HUAA 4KW6A 1ON4A 2H1DA 3ZL5A 4KX4A 5ECKB 3QAWA 3UEMA 1USBA 1TRUA 2R5GA 5HR0A 4F0BA 3DEXA 3FY7A 1QMVA 1GH2A 5L71A 6GSTA 3ZVJD 2YV7A 4ICYA 4CY8A 2YNXA 3KH9A 4L8EA 2G0FA 2H6ZA 4JRRA 2UZ8A 4F2IA 4FYBA 1WPIA 4AKIA 5LNKe 1TRWA 3TCOA 5ID2A 2TRXA 1JLVA 3LXTA 3U6VA 4BVXB 4V1Ag 2C80A 2QA2A 4BPYA 5AIXA 3L9VA 5DALA 4KB3A 1M2BA 1TU8A 4TN8A 1NW2A 1AAZA 1WIKA 4IN0A 4I6XA 2L59A 3IC8A 2LEGA 5CRDA 3HXSA 4BVYB 2FA4A 4IELA 2JSZA 2FY6A 1GNWA 4KH7A 3VURA 4HOJA 1JZRA 4J57E 2N5BA 3R3EA 2DKHA 3MSZA 3F3QA 2PN8A 3CMIA 1CQHA 4IJIA 3WGDA 5GSSA 4KDXA 1NHYA 4WKWA 1WWJA 3VI7A 1TP9A 2V32A 5H5QA 4NXIA 2DMLA 4EXJA 1EEMA 1GSDA 3ZIVA 1SL1B 1G0TA 2L5LA 1YKAA 5CO3A 4XIHA 4ZB9A 1ERUA 2GSSA 1XW6A 2C3QA 2YJHA 4O5QA 3LXZA 4IW9A 2CQ9A 2DBCA 3KTBA 2LJRA 4IQ1A 1GTAA 4O5UA 4OMVA 5DJLA 1K3YA 4GQCA 2P5QA 3TJBA 4Z2TA 4A5PA 1OKTA 4ZXGA 2A4VA 2ON5A 1G7EA 1DE1A 1M2AA 1SD8A 3HMJG 4DEJA 3IV4A 3M3MA 5A1NA 4FH8A 2A2PA 3ZTLA 1SJZA 2VAFA 2QGVA 2Z9SA 4OFMA 3EPTA 4E68A 3TDGA 3D6IA 1TRSA 1BJXA 4MZCA 4AKXB 5CREA 2PBJA 2X8HA 3Q74A 3IXRA 2RUEA 5G5FA 1T3BA 2H19A 2X8GA 2XBQA 3KH7A 4PQ1A 1K0OA 4K7IA 2N5AA 2B3SA 3J7Yb 3VPTA 1BG1A 2VLTA 1THOA 2MMNA 2CX4A 3QFAC 1GSFA 1EOHA 4JBBA 4RI6A 2E0QA 1ZYPA 1I9DA 2H75A 2AYTA 3GL5A 1ZOFA 2GTUA 2FCHA 1ZYNA 4K2XA 3KZQA 4OO5A 4POBA 1FB0A 3KTLA 4MPGA 1K0AA 2XBIA 17GSA 5G30A 1T4YA 4ECJA 3Q18A 1JZWA 1K0DA 1MDJA 1Z7PA 4WBJA 5G2ZA 3CXGA 1TRVA 4PNFA 2MMAA 4KDUA 4YAVA 3UMAA 4WF4A 3I43A 3ME8A 3C71A 5A34A 4FQUA 3I9V2 1GTIA 2CZ3A 5B7CA 4D73A 2AB6A 4QMKA 3IR4A 2LQOA 1R5PA 1ILOA 3CRUA 5JCWA 2M80A 5IMAA 3FZ4A 3P7XA 3WYWA 2GQMA 1F2EA 4PQIA 4AJ7A 4KAEA 2KUCA 2IMEA 2V2GA 3TGZA 2KHPA 3RDWA 3TB2A 3VWWA 4K8MA 3VLNA 4AF2A 5B8BA 2OKAA 3UAPA 1O6JA 1A23A 2F8AA 4I5QA 3ZYWA 2YZUA 3SBCA 2K9FA 1GULA 3GYKA 3DIEA 2V41A 1LBKA 4HZ2A 4ILFA 4Q5NA 5HR2A 1A24A 2JZSA 3HVSA 1ST9A 4DSQA 2VM2A 3GN3A 2B1LA 3A2WA 3C8EA 4YAPA 4V1Ap 5D93A 4EKZA 2REMA 3KGKA 3QAVA 4O32A 3LQ7A 3ZFBA 3IC4A 1XVWA 2GSTA 1A0RP 2B5XA 4XS1A 1ERWA 1SJIA 5KOXA 1EP7A 1O73A 5ECOB 2DJ3A 1THXA 5ELGA 1GSEA 1YJ6A 2ZCTA 3NIVA 4JU5A 3C7MA 4CDOA 4G9HA 4GTUA 4K0NA 3TJJA 1B4QA 1N8JA 1V57A 4HJMA 4TXOB 2HLSA 3A2XA 4BWQA 5IMFA 3F63A 4QQ7A 1U6TA 1X0RA 1VF3A 1C72A 1QXHA 1TI3A 3IK9A 2O7KA 2AAWA 3GSSA 3HDCA 3EU3A 4BA7A 5J40A 2I4AA 3ZVJA 2DC5A 4G2EA 5IMZA 1SVLA 3TJKA 3E0UA 1V58A 1PX6A 5CRWA 2TIRA 1AQWA 4GLTA 2C0GA 3NZNA 2M46A 1S3DA 4CY6A 4RQRA 3ERFA 3QDNA 4L0UA 3GHAA 2B5YA 2PUKC 3AY8A 3APOA 3ZITA 2ZNMA 4MNNA 1O85A 6GSSA 1X5CA 1XWGA 5D73A 4DSSA 1UA5A 1YVLA 1EP8A 1TU7A 1DBYA 2OE1A 12GSA 1MD3A 4WXTA 3VWUA 2MMOA 3GL3A 16GSA 2GQLA 3HKRA 2ALBA 4MMMA 1A2LA 3IE3A 4X1UA 4OFTA 1FVKA 3S9FA 2YCDA 2LS5A 3TKSE 18GSA 4KNDA 1ML6A 3CTFA 4XS6A 3ZMKA 2I1UA 3KM6A 2D2ZA 2DIYA 1M0UA 4GDFA 5CAXA 3GSTA 1Z6MA 4G0KA 2YWNA 3PPUA 2YANA 4W66A 3GUSA 4MK3A 4J56E 3DD3A 2H1AA 10GSA 3DWVA 5IOWA 4WR5A 1VF4A 5IIZA 2KP1A 2HT9A 5J4UA 5G5EA 4K9ZA 4USSA 4GSSA 2H6YA 2IL3A 3VK9A 1QUWA 2YWOA 1B4PA 2H70A 3TOUA 2LJKA 5A5HA 1EOGA 1JZOA 3FZ9A 1PL1A 4WBRD 3EMPA 2R3XA 4XRAA 1LU4A 2P31A 2VCZA 4XHMA 1R5AA 3J7Yk 5HFGA 4IS0A 4GSTA 3ED3A 3ZREA 4AJ6A 5JWOB 1U87A 1UN2A 5DCHA 1A8YA 2H8LA 4X0XA 1GL8A 4YH2A 3ERWA 5ELAA 2RUFA 4EO3A 4N0ZA 2OE3A 2FWEA 3GKMA 1TI1A 3LG6A 1V2AA 1AQXA 1QGVA 5G1LA 1XVQA 4Z7XA 5J9CA 2IMIA 2GZPA 2H66A 1FVJA 3LSZA 1PKWA 1Q4JA 5ID2B 5EL8A 3F9UA 1MD4A 1ERVA 5ECRB 1TOFA 3TRXA 5JWQB 1B9YC 1JLWA 2CX3A 3P2AA 4J2FA 5DALB 3IBHA 2XPEA 2EIRA 2WB9A 3CYNA 4KGIA 1Y25A 2QA1A 1BYEA 2NBSA 4NHWA 3CTGA 1ZGNA 3IHQA 2LRCA 1GUKA 1XCCA 2RM6A 5KOWA 2CAIA 4E8EA 2HZEA 4MA9A 2FA8A 2OADA 2CVDA 2I3YA 1X9WB 1O81A 3TRPA 4GXZA 4I2TA 1B8XA 2VD1A 5ECNB 4GWRA 5IMCA 3HZ8A 2CZ2A 2BJXA 3DVWA 4AKHA 2CV4A 4ZB7A 4HU9A 2IMFA 5AIVA 2JACA 3RPPA 4KDYA 2AHEA 2KP2A 4HQSA 1N25A 2EC4A 4I8BA 5ABRA 3H4KA 1AIUA 1Y6EA 1AC1A 4HZ4A 4MP4A 2LTKA 4FIWA 5GZZB 3MWHA 4XS4B 1QQ2A 1TK5B 2FWFA 2DKIA 2KOKA 4POMA 3IAM2 4F82A 1Q98A 2C0DA 3ZLPA 3KP9A 4EF0A 3GRXA 1YDKA 1WE0A 1URMA 4V2LA 2DSAA 3EWLA 3CSIA 1SVOA 4HQZA 3L9SA 2XHFA 3V1WA 5COHA 1EWXA 2VM1A 1K0MA 1YEXA 2YZHA 3IOSA 5D9TA 5A1NB 2YN1A 5KN2A 4MPFA 5BMUA 3G7YA 5KN3A 4EDYA 3H79A 4TKYA 4AKGA 4POKA 1TTZA 2R0GA 1SYXA 3LYKA 2H0IA 2K6VA 6GSYA 2AV4A 4XS4A 2X99A 5AN1A 3MNGA 1VGLA 4K6XA 3TU3B 5A4UA 4AJ8A 1GUMA 2WDUA 1F6MC 2O8VB 2IJYA 3VI5A 1JZDA 4ULXA 2VL3A 2WFCA 1KNGA 2WZ9A 1XPVA 1V98A 3KD0A 1Z5YE 4FYUA 2VL2A 3EC3A 3VFIA 4FYCA 2LJAA 1YEPA 2JL4A 2HFDA 2WULA 2QKEA 5B8AA 2FLSA 3RAZA 1TK8B 1GTUA 5IM9A 3ZFLA 1SENA 3BD2A 3MDKA 2L5OA 2YJ7A 5HQPA 14GSA 2F3MA 1M99A 3UVHA 5D9XA 2H01A 3TKSA 1SK0A 4NAXA 3QAGA 3HA9A 5B6NA 2HZFA 4N0VA 1WP0A 3C1RA 3E9JB 1ERTA 2M72A 2DIZA 4ZBBA 4MJEA 5A34B 1X9SB 3IRAA 3FW2A 4D73B 4PXOA 3DMLA 4PNGA 3DKSA 4X43A 1V9WA 1RQMA 3F3RA 5J3RA 2J9HA 3G7JA 5HFKA 4OO4A 2CAQA 2VOCA 1X5EA 4KSMA 2MMZA 2IN3A 3L78A 4LMVA 2JZRA 2B6MA 5ECSA 1T4ZA 5DCGA 3N9JA 1XWBA 1XW5A 2VCQA 2F9SA 1G6YA 3GMFA 6GSUA 4IHUA 4K7OA 3TOTA 2B7JA 8GSSA 1NSWA 4KUNA 2PGTA 4ACSA 4YQUA 2YOIA 4E8HA 1R4WA 2E7PA 3APQA 3IK7A 2L6DA 1SU9A 2EFEA 1T00A 5IO2A 2N5FA 4ZIJA 4JEDA 4HS1A 2OE0A 2XC2A 2CVKA 1FOHA 2NDOA 3D5JA 1Z9HA 1M7TA 2IPAA 1SYRA 1BX9A 2GLRA 2V6KA 1KBNA 4HJ2A 5D96A 1DUGA 3UARA 2BMXA 2GSQA 1S3CA 3HJOA 4QL9A 1VF2A 5G31A 1Z3EA 4TR0A 2WCIA 3GIXA 4MDCA 4EDZA 4F03A 1SKRB 5DQSA 2VO4A 2O87A 3ZZXA 2K8VA 4I97A 3GTUB 2RM5A 2VLVA 6GSXA 3CWGA 3EURA 3DRNA 4IQAA 3EU4A 5KN0A 3CBUA 4G0LA 3FZ5A 2PVQA 5ECIB 2H0HA 4HI7A 3KP8A 4PX1A 2HE3A 2HRNA 1K3OA 2FUG2 1WJKA 4ML1A 5J47A 3Q6OA 1R7HA 3M8NA 1YQ1A 3DXBA 3KMOA 5DBQA 3M9JA 2OACA 2C0FA 3KEBA 5EVOA 4ZL7A 5INYA 1F3BA 6GSWA 1T7PB 4MF5A 1O8WA 4N30A 2HSMB 2LV3A 2L4CA 3O76A 3FHKA 3GA4A 5F06A 2CVBA 2B5EA 3DYRA 3ME7A 4XTSA 2AJQB 4ZBDA 3KMNA 2VCXA 1AUCA 1BG5A 1MDKA 4LLRA 3U5RE 4WEYA 4YKFA 4Z2UA 1PA3A 3GTUA 4G19A 4DSSB 5JCUA 1JFUA 4IKHA 4LA1A 2WJUA 4BWSA 2EIQA 1TKDB 3EMXA 4PTSA 3RBTA 2EIOA 3LW9A 4EVMA 3FR6A 3TKPA 3QOUA 1DSBA 4TW5A 4LL1B 5ECQB 4TVEA 3ZIJA 4OCFA 2PMTA 2VCVA 1ACVA 1KEBA 3WGXA 1EGRA 1M9BA 4BL7B 2HSMA 3GKNA 2IFQB 1EEJA 1FB6A 2JZTA 1YY7A 3UBLA 2GZZA 1F3AA 1GSSA 4DSRA 5J4VA 1HD2A 1GUHA 3EYTA 2VCTA 3US3A 2K18A 2FWGA 4ISDA 3PR8A 3LEFA 3UIWA 1W89A 2A2RA 2HXKA 1GLQA 4L5LA 2JADA 4MABA 4CHSA 20GSA 3A5WA 5CRGA 2O5VA 2VL2C 5A5HB 1PMTA 3EVIA 2GQKA 3HHVA 1PGTA 3GNJA 4PUAA 1OC8A 1HYUA 2BTOT 4ECIA 2GZYA 3TKRA 2YWIA 5G1KA 5DQYA 5IPGA 3ISOA 4IJ3A 5E4WA 4BL7A 3W8JA 2H1GA 5GSTA 2IFQA 1PRXA 3TKSC 2VIMA 2P5RA 4MF6A 1W4VA 1PKZA 3P8WA 1SVMA 4EIQA 4G10A 2TRCP 3A2VA 4OCEA 2EFCA 2YV9A 1B48A 4EC0A 2YPMA 1J08A 2VUPA 3D0ZA 4G0IA 2FHEA 3HYPA 5CYYA 4ZB6A 2V6OA 1EGOA 2RIIA 2I81A 5DVBA 2C0EA 4L5OA 2H30A 1QK8A 2PERA 3QD9A 3TRQA 4OWYA 2LKUA 1B9XC 3HJMA 2WGRA 1GP1A 4MLYA 2X49A 3EE2A 3FEUA 1XBSA 1GSYA 4ZILA 4HDEA 2HZEB 3LGCA 2GT5A 3TUEA 1UC7A 3OR5A 1MTCA 4RI7A 2OBIA 3DVXA 1OC3A 4DVCA 2MBTA 2H0GA 5J41A 2R0CA 1NHOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V40 A;  4FQU A;  1GTI A;  2CZ3 A;  5B7C A;  3LYK A;  6GSY A;  4LMW A;  2AB6 A;  1GLP A;  3IR4 A;  2HNL A;  5AN1 A;  1XWK A;  3CRU A;  3CSH A;  5A4U A;  1GUM A;  2WDU A;  2GDR A;  5JCW A;  1G7O A;  3VI5 A;  5D9W A;  3F6D A;  3LFL A;  4PGT A;  3WYW A;  1F2E A;  4PQI A;  4KAE A;  3TGZ A;  2VD0 A;  1AXD A;  13GS A;  2JL4 A;  3VLN A;  5ECL B;  5F07 A;  3UAP A;  3GUR A;  1GTU A;  1AW9 A;  3ZFL A;  5F8B A;  3CRT A;  3MDK A;  14GS A;  2F3M A;  1M99 A;  5EY6 A;  3UVH A;  2VCW A;  5D9X A;  1G6W A;  4NAX A;  3QAG A;  4ECC A;  2GSR A;  1GUL A;  3EIN A;  1K0B A;  2ON7 A;  1LBK A;  4N0V A;  1LJR A;  4HZ2 A;  1PN9 A;  2C3N A;  4Q5N A;  3KJY A;  3QR6 A;  3SWL A;  4ZBB A;  3L0H A;  3KXO A;  2C8U A;  3C8E A;  4PXO A;  4YAP A;  4PNG A;  1N2A A;  3M1G A;  1ZL9 A;  3QAV A;  2J9H A;  3G7J A;  5HFK A;  2CA8 A;  3LQ7 A;  3ZFB A;  2GST A;  5J5N A;  2CAQ A;  5F0G A;  1GWC A;  4GF0 A;  4Q5Q A;  1OYJ A;  5ECO B;  4KSM A;  4LMV A;  4JZQ A;  5ELG A;  5LCZ A;  1VF1 A;  1GSE A;  1YJ6 A;  3NIV A;  1GTB A;  1AQV A;  3R2Q A;  5ECH B;  2R6K A;  4G9H A;  4GTU A;  1IYI A;  4K0N A;  2OA7 A;  4YQM A;  5ECS A;  5DCG A;  3N9J A;  1XW5 A;  5FT3 A;  2VCQ A;  3LYP A;  3F63 A;  4QQ7 A;  1A0F A;  1G6Y A;  1PL2 A;  1VF3 A;  5A4W A;  1FHE A;  4IBP A;  1C72 A;  6GSU A;  3IK9 A;  5FWG A;  2AAW A;  4K0G A;  4MF7 A;  3TOT A;  4YQV A;  8GSS A;  2X64 A;  3GSS A;  3ZML A;  1EV9 A;  2PGT A;  4ACS A;  3CSJ A;  4YQU A;  4E8H A;  2DC5 A;  3IK7 A;  3PGT A;  2N5F A;  1PX6 A;  3P90 A;  4JED A;  1AQW A;  4GLT A;  1Z9H A;  2C4J A;  4ZBA A;  4NHZ A;  1IYH A;  4GSN A;  1BX9 A;  3ERF A;  2GLR A;  3W8S A;  4ECB A;  2F8F A;  5IQY A;  5A5K A;  2V6K A;  1KBN A;  4HJ2 A;  4IVF A;  4BVX A;  5DJM A;  1HQO A;  3AY8 A;  4O92 A;  1DUG A;  3UBK A;  3UAR A;  3GH6 A;  2GSQ A;  4PQH A;  6GSS A;  3VPQ A;  1RK4 A;  3HJO A;  1VF2 A;  4KF9 A;  1XWG A;  5D73 A;  1UA5 A;  7GSS A;  3O3T A;  1TU7 A;  12GS A;  1MD3 A;  2HSN B;  4MDC A;  4EDZ A;  4F03 A;  1FW1 A;  5DQS A;  2VO4 A;  2HRA A;  3F6F A;  4I97 A;  3GTU B;  6GSX A;  1HNB A;  16GS A;  4IQA A;  3I69 A;  4KX4 A;  4KE3 A;  4BVY A;  3HKR A;  5ECK B;  3QAW A;  3CBU A;  4G0L A;  3IE3 A;  1USB A;  2PVQ A;  4OFT A;  5ECI B;  4HI7 A;  2YCD A;  4PX1 A;  2R5G A;  1K3O A;  18GS A;  4O7H A;  2HRK B;  4F0B A;  3FY7 A;  4AGS A;  1ML6 A;  3M8N A;  1YQ1 A;  3ZMK A;  3KM6 A;  3KMO A;  2D2Z A;  6GST A;  2OAC A;  6GSV A;  2YV7 A;  5EVO A;  1PX7 A;  1M0U A;  1E6B A;  1F3B A;  4Q5R A;  6GSW A;  1YKC A;  4MF5 A;  3GST A;  2HSM B;  4L8E A;  5ECP B;  4G0K A;  4MZW A;  2UZ8 A;  4EE0 A;  5KEJ A;  3VWX A;  2HQT A;  3O76 A;  3PPU A;  3GUS A;  1K3L A;  4MK3 A;  3DD3 A;  4PUR A;  5F06 A;  10GS A;  1HNC A;  4WR5 A;  1VF4 A;  4ZBD A;  3KMN A;  2VCX A;  1JLV A;  3LXT A;  3U6V A;  5J4U A;  5G5E A;  4BVX B;  4USS A;  4GSS A;  1BG5 A;  2C80 A;  2IL3 A;  3VK9 A;  5AIX A;  5DAL A;  3ERG A;  1B4P A;  5AGY A;  3TOU A;  1PA3 A;  3GTU A;  4G19 A;  1EOG A;  22GS A;  1K0N A;  5JCU A;  1TU8 A;  1PL1 A;  4IKH A;  2R3X A;  2WJU A;  11GS A;  2HRK A;  1BAY A;  4PTS A;  3RBT A;  3FR6 A;  2VCZ A;  3IC8 A;  4BVY B;  1R5A A;  5ECQ B;  4WR4 A;  4F0C A;  3WD6 A;  2PMT A;  2VCV A;  3FR3 A;  3Q19 A;  4GST A;  4IS0 A;  4IEL A;  1GNW A;  1U87 A;  4KH7 A;  3VUR A;  1M9B A;  4HOJ A;  1JZR A;  4BL7 B;  2HSM A;  3R3E A;  4YH2 A;  2A2S A;  5ELA A;  4TOP A;  1YY7 A;  4IJI A;  3UBL A;  5GSS A;  4KDX A;  1NHY A;  3LG6 A;  1F3A A;  1GSS A;  1V2A A;  3VI7 A;  5DAK B;  1AQX A;  1GUH A;  3FRC A;  2IMI A;  2VCT A;  4EXJ A;  1EEM A;  1GSD A;  3LSZ A;  1PKW A;  1HNA A;  1Q4J A;  3N5O A;  4ISD A;  3PR8 A;  5EL8 A;  4Q5F A;  1GSU A;  9GSS A;  1MD4 A;  3GX0 A;  5DDL A;  2A2R A;  5ECR B;  4ZB9 A;  2GSS A;  1GLQ A;  4L5L A;  1JLW A;  1XW6 A;  2C3Q A;  1TDI A;  3LXZ A;  4CHS A;  4J2F A;  4IW9 A;  20GS A;  5DAL B;  1U88 A;  3IBH A;  2LJR A;  2FNO A;  4IQ1 A;  1GNE A;  1PMT A;  2WB9 A;  2WRT A;  4KGI A;  1GTA A;  1PGT A;  1BYE A;  2R4V A;  4OMV A;  5DJL A;  4NHW A;  4PUA A;  1ZGN A;  4ECI A;  1K3Y A;  3LJR A;  1GUK A;  2CAI A;  4E8E A;  3DGQ A;  2WS2 A;  2OAD A;  1OKT A;  2CVD A;  3ISO A;  4ZXG A;  4BL7 A;  5A4V A;  2ON5 A;  5GST A;  5D9V A;  4IGJ A;  4ID0 A;  4DEJ A;  3H1N A;  3M3M A;  4MF6 A;  1B8X A;  2VD1 A;  5ECN B;  2CZ2 A;  1PKZ A;  3P8W A;  5DAK A;  4G10 A;  5AIV A;  4OFM A;  4KDY A;  2AHE A;  3I6A A;  5LD0 A;  5FHI A;  2YV9 A;  5ECM B;  2PBJ A;  1B48 A;  3Q74 A;  1TW9 A;  4EC0 A;  1PD2 1;  3D0Z A;  4G0I A;  5G5F A;  2FHE A;  1Y6E A;  3M0F A;  2C3T A;  5AIS A;  3G7I A;  3BBY A;  4ZB6 A;  4OFN A;  4HZ4 A;  4MP4 A;  3FYG A;  5GZZ B;  1K0O A;  1OE7 A;  3VPT A;  4L5O A;  2PER A;  1EV4 A;  1GSF A;  1EOH A;  4JBB A;  3HJM A;  1YDK A;  3MAK A;  4RI6 A;  2NTO A;  2DSA A;  1U3I A;  1K0C A;  3CSI A;  3EE2 A;  1M9A A;  1GSY A;  2GTU A;  19GS A;  1GSQ A;  2IMK A;  1K0M A;  1OE8 A;  5F05 A;  3KTL A;  4MPG A;  1K0A A;  17GS A;  1MTC A;  4RI7 A;  4ECJ A;  5D9T A;  3Q18 A;  1K0D A;  4MPF A;  4PNF A;  4GCI A;  5J41 A;  5BMU A;  4KDU A;  4EDY A;  4YAV A;  3FR9 A;  4ZB8 A; 
#chains in the Genus database with same CATH topology
 1O7U A;  2WVX A;  4QL7 A;  2L6C A;  1GLP A;  4HEA 2;  2HNL A;  1NM3 A;  1XIY A;  2R2J A;  2JU5 A;  3CSH A;  2L57 A;  1QFN A;  3F6D A;  3LFL A;  4PUF C;  2R0P A;  4TRX A;  3IPZ A;  1T1V A;  2VD0 A;  3FKF A;  4POL A;  5ECL B;  5F07 A;  4P3Y B;  2GGT A;  3TKQ A;  3FZA A;  3HY2 A;  3RHB A;  5H5S A;  5F8B A;  5EPF A;  4F9Z A;  2O85 A;  3CHX C;  4XRD A;  2VCW A;  4KSO A;  1X9M B;  1SKS B;  1G6W A;  4MJB A;  2OBK A;  4ECC A;  2GSR A;  3EIN A;  1K0B A;  2ON7 A;  5BMU B;  3H8Q A;  1LJR A;  3GX8 A;  3SWL A;  2DJ2 A;  4N11 A;  4MH3 A;  1TK0 B;  3BJ5 A;  3L0H A;  4K5S A;  2IWT A;  2C8U A;  3TJF A;  1N2A A;  1ZCP A;  2ES7 A;  5J4Y A;  1BF5 A;  1WMJ A;  2PPT A;  2CA8 A;  3HCZ A;  1MEK A;  2VKZ G;  2HRF A;  3JCM L;  1H4O A;  1J9B A;  2HSN A;  1OKD A;  1GWC A;  4GF0 A;  1XWC A;  4Q5Q A;  3GV1 A;  3IHG A;  5LCZ A;  1GTB A;  4NV5 A;  1WOU A;  2LUS A;  2R6K A;  5IPH A;  2OA7 A;  1SD9 A;  2LQQ A;  3LYP A;  3UL3 A;  5A4W A;  1FHE A;  4IBP A;  2UV8 G;  2G2Q A;  4YQV A;  1R26 A;  2HSY A;  3MIX A;  3ZML A;  2LNS A;  2GS3 A;  1WRY A;  3PGT A;  1S3A A;  3WT2 A;  1U3A A;  3L9U A;  5GAP D;  2H1L A;  5CNW A;  3F0I A;  4NHZ A;  1IYH A;  4GSN A;  3WGE A;  4ECB A;  3W8S A;  2F8F A;  5IQY A;  5A5K A;  4BVX A;  4GQF A;  5DJM A;  5J9B A;  1HQO A;  3UBK A;  2HSH A;  2H73 A;  3VPQ A;  1RK4 A;  3HZ4 A;  1S4B P;  7GSS A;  3O3T A;  2H74 A;  2C1Y A;  2IMD A;  2NPB A;  3BCK A;  3F4S A;  1HNB A;  3LOR A;  3I69 A;  4KE3 A;  4BVY A;  2WW2 A;  1T8E B;  1SL2 B;  5CRH A;  2P0G A;  2F51 A;  4O7H A;  2HRK B;  3H93 A;  4AGS A;  4NWY A;  5B6M A;  2YP6 A;  6GSV A;  1PX7 A;  1E6B A;  4Q5R A;  3PH9 A;  1YKC A;  2IIY A;  2O36 A;  4IP1 A;  5ECP B;  4MZW A;  4EE0 A;  5KEJ A;  1SJ6 A;  1TJD A;  1FOV A;  2VLU A;  3VWX A;  2HQT A;  4TR1 B;  1XOB A;  2LRT A;  1K3L A;  4PUR A;  2PWJ A;  4YKG A;  2KLX A;  1HNC A;  2QSI A;  2QC7 A;  1PSQ A;  4EL1 A;  4Z2R A;  3FK8 A;  4K5R A;  4JE1 A;  1OVN A;  3ERG A;  2A4H A;  2MZC A;  3TJG A;  4WET A;  5AGY A;  2CT6 A;  1H75 A;  2NVL A;  22GS A;  3D22 A;  1K0N A;  5IOX A;  2X8C A;  4KCA A;  3WT1 A;  2DJ1 A;  4IP6 A;  11GS A;  3FMW A;  2HRK A;  1BAY A;  4JR4 A;  3HD5 A;  1Z6N A;  4V2N A;  4ZL8 A;  4WR4 A;  4F0C A;  3WD6 A;  3FR3 A;  3Q19 A;  3C1S A;  2A2S A;  3APS A;  1XWA A;  3BCI A;  4TOP A;  3E3E A;  4TR1 A;  2H71 A;  4H86 A;  4NV2 A;  1UVZ A;  1XFL A;  2R37 A;  5DAK B;  1TXU A;  3A3T A;  4MJC A;  3FRC A;  3QFB C;  5ENU A;  1HNA A;  3N5O A;  1X5D A;  4Q5F A;  2FGX A;  1GSU A;  9GSS A;  2E2G A;  3GX0 A;  5DDL A;  1OAZ A;  3ZRD A;  4V2M A;  1YZX A;  5HR3 A;  1TDI A;  2WVY A;  3GKX A;  1MDI A;  2OJL A;  2EFH A;  1U88 A;  2FNO A;  1GNE A;  1CQG A;  2WRT A;  3IAS 2;  1OC9 B;  2HI7 A;  2R4V A;  2EFD A;  3M9K A;  4XCS A;  3LJR A;  3VWV A;  1Y1U A;  3DGQ A;  2WS2 A;  3F4T A;  5D8I A;  2HYX A;  5A4V A;  1ZZY A;  5KN1 A;  5D9V A;  4RQX A;  4IGJ A;  4ID0 A;  2VL9 A;  5HFI A;  4PI2 C;  1ZMA A;  3H1N A;  2FD3 A;  3HVX A;  5DAK A;  2DMM A;  3RPN A;  3K8N A;  3W6G A;  2PVO C;  2AUV A;  3I6A A;  2OT3 A;  5LD0 A;  1A2J A;  3PIN A;  2L4Q A;  5HR1 A;  5FHI A;  2XPD A;  4EUY A;  5ECM B;  2V1M A;  5H5R A;  1FAA A;  1TW9 A;  5IMD A;  4AI6 A;  1PD2 1;  1I5G A;  3M0F A;  2C3T A;  5AIS A;  3G7I A;  3BBY A;  4OFN A;  1F37 A;  1SK1 A;  1RW1 A;  2GT6 A;  3A5I A;  1SKW B;  3FYG A;  1OC9 A;  3D4T A;  2H6X A;  2LNT A;  1OE7 A;  1EV4 A;  1XXU A;  3C73 A;  3UVT A;  2H72 A;  2LRN A;  3LWA A;  3MAK A;  3KCM A;  2NTO A;  4N10 A;  4JR6 A;  4K2D A;  1SL0 B;  1U3I A;  1K0C A;  3QMX A;  3GFK A;  3F8U A;  1M9A A;  4CW9 A;  1EZK A;  1YF0 A;  19GS A;  1GSQ A;  2IMK A;  5GAN D;  1OE8 A;  1KTE A;  5F05 A;  2J23 A;  1FO5 A;  4RUV A;  1JHB A;  3RFR C;  2PU9 C;  4GCI A;  4KA0 A;  1Z7R A;  3FR9 A;  4ZB8 A;  1XOA A;  1O8X A;  2X4A A;  2JSY A;  4G01 A;  1V40 A;  3MYD A;  2RLI A;  4K1F A;  3QCP A;  4GRF A;  4K7N A;  1M2D A;  3D21 A;  3BOA A;  4LMW A;  2YWM A;  1FG4 A;  1XWK A;  3NOF A;  4L0W A;  3KIJ A;  3D4M A;  3IDV A;  2GDR A;  1YEW C;  1G7O A;  5D9W A;  4TXV A;  4PGT A;  1VRS D;  2H1B A;  2MBS A;  3RHC A;  5C04 A;  3HVV A;  2DJK A;  4TXO A;  2K8S A;  3HJP A;  1AXD A;  13GS A;  3UOM A;  4TR4 A;  3GUR A;  1AW9 A;  3CRT A;  5EY6 A;  4OD7 A;  2DLX A;  1DE2 A;  2GVP A;  4ZL9 A;  4EIP A;  3GKK A;  1PN9 A;  2C3N A;  2H76 A;  3KJY A;  3QR6 A;  4NPB A;  1BQ7 A;  1BED A;  2WVX B;  4O5R A;  5IMV A;  3KXO A;  3M1G A;  1PQN A;  1GRX A;  1ZL9 A;  4TR3 A;  5J5N A;  5F0G A;  1XZO A;  4ML6 A;  4X4J A;  1OYJ A;  4KCE A;  1XW9 A;  2ZUP A;  2B1K A;  4JZQ A;  1ZYE A;  1VF1 A;  2DJJ A;  3R2Q A;  1AQV A;  5ECH B;  5E59 A;  3O6T A;  1IYI A;  4YQM A;  4N3Z A;  5FT3 A;  2FWH A;  1A8L A;  3UJ1 A;  2MYG A;  1A0F A;  4MZB A;  2DJ0 A;  1PL2 A;  3IA1 A;  5BRT A;  5FWG A;  4K0G A;  1ZYQ B;  4MF7 A;  5CP1 A;  2X64 A;  5IO0 A;  1EV9 A;  4PHZ C;  2I9H A;  3CSJ A;  3QPM A;  2E2M A;  2O89 A;  1TXX A;  3L4N A;  1E2Y A;  3G9B A;  3P90 A;  1SK2 A;  4LL4 B;  5JWR B;  1ABA A;  4MJA A;  2C4J A;  5C00 A;  4ZBA A;  5JCG A;  1PN0 A;  4FO5 A;  4MCU A;  4IVF A;  1J0F A;  1A2M A;  1F9M A;  4O92 A;  4NMU A;  3GH6 A;  3F4R A;  4PQH A;  4MH2 A;  2LST A;  3GH9 A;  4KF9 A;  1YF1 A;  2B7K A;  4WF5 A;  4HU7 A;  2HSN B;  4I2U A;  1FW1 A;  2HRA A;  3F6F A;  4HUA A;  4KW6 A;  1ON4 A;  2H1D A;  3ZL5 A;  4KX4 A;  5ECK B;  3QAW A;  3UEM A;  1USB A;  1TRU A;  2R5G A;  5HR0 A;  4F0B A;  3DEX A;  3FY7 A;  1QMV A;  1GH2 A;  5L71 A;  6GST A;  3ZVJ D;  2YV7 A;  4ICY A;  4CY8 A;  2YNX A;  3KH9 A;  4L8E A;  2G0F A;  2H6Z A;  4JRR A;  2UZ8 A;  4F2I A;  4FYB A;  1WPI A;  4AKI A;  5LNK e;  1TRW A;  3TCO A;  5ID2 A;  2TRX A;  1JLV A;  3LXT A;  3U6V A;  4BVX B;  4V1A g;  2C80 A;  2QA2 A;  4BPY A;  5AIX A;  3L9V A;  5DAL A;  4KB3 A;  1M2B A;  1TU8 A;  4TN8 A;  1NW2 A;  1AAZ A;  1WIK A;  4IN0 A;  4I6X A;  2L59 A;  3IC8 A;  2LEG A;  5CRD A;  3HXS A;  4BVY B;  2FA4 A;  4IEL A;  2JSZ A;  2FY6 A;  1GNW A;  4KH7 A;  3VUR A;  4HOJ A;  1JZR A;  4J57 E;  2N5B A;  3R3E A;  2DKH A;  3MSZ A;  3F3Q A;  2PN8 A;  3CMI A;  1CQH A;  4IJI A;  3WGD A;  5GSS A;  4KDX A;  1NHY A;  4WKW A;  1WWJ A;  3VI7 A;  1TP9 A;  2V32 A;  5H5Q A;  4NXI A;  2DML A;  4EXJ A;  1EEM A;  1GSD A;  3ZIV A;  1SL1 B;  1G0T A;  2L5L A;  1YKA A;  5CO3 A;  4XIH A;  4ZB9 A;  1ERU A;  1PFO A;  2GSS A;  1XW6 A;  2C3Q A;  2YJH A;  4O5Q A;  3LXZ A;  4IW9 A;  2CQ9 A;  2DBC A;  3KTB A;  2LJR A;  4IQ1 A;  1GTA A;  4O5U A;  4OMV A;  5DJL A;  4FXY P;  1K3Y A;  4GQC A;  2P5Q A;  3TJB A;  4Z2T A;  4A5P A;  1OKT A;  4ZXG A;  2A4V A;  2ON5 A;  1G7E A;  1DE1 A;  1M2A A;  1SD8 A;  3HMJ G;  4DEJ A;  3IV4 A;  3M3M A;  5A1N A;  4FH8 A;  2A2P A;  3ZTL A;  1SJZ A;  2VAF A;  2QGV A;  2Z9S A;  4OFM A;  3EPT A;  4E68 A;  3TDG A;  3D6I A;  1TRS A;  1BJX A;  4MZC A;  4AKX B;  5CRE A;  2PBJ A;  2X8H A;  3Q74 A;  3IXR A;  2RUE A;  5G5F A;  1T3B A;  2H19 A;  2X8G A;  2XBQ A;  3KH7 A;  4PQ1 A;  1K0O A;  4K7I A;  2N5A A;  2B3S A;  3J7Y b;  3VPT A;  1BG1 A;  2VLT A;  1THO A;  2MMN A;  2CX4 A;  3QFA C;  1GSF A;  1EOH A;  1M3I A;  4JBB A;  4RI6 A;  2E0Q A;  1ZYP A;  1I9D A;  2H75 A;  2AYT A;  3GL5 A;  1ZOF A;  2GTU A;  2FCH A;  1ZYN A;  4K2X A;  3KZQ A;  4OO5 A;  4POB A;  1FB0 A;  3KTL A;  4MPG A;  1K0A A;  2XBI A;  17GS A;  5G30 A;  1T4Y A;  4ECJ A;  3Q18 A;  1JZW A;  1K0D A;  1MDJ A;  1Z7P A;  4WBJ A;  5G2Z A;  3CXG A;  1TRV A;  4PNF A;  2MMA A;  4KDU A;  4YAV A;  3UMA A;  4WF4 A;  3I43 A;  3ME8 A;  3C71 A;  5A34 A;  4FQU A;  3I9V 2;  1GTI A;  2CZ3 A;  5B7C A;  4D73 A;  2AB6 A;  4QMK A;  3IR4 A;  2LQO A;  1R5P A;  1ILO A;  3CRU A;  5JCW A;  2M80 A;  5IMA A;  3FZ4 A;  3P7X A;  3WYW A;  2GQM A;  1F2E A;  4PQI A;  4AJ7 A;  4KAE A;  2KUC A;  2IME A;  2V2G A;  3TGZ A;  2KHP A;  3RDW A;  3TB2 A;  3VWW A;  4K8M A;  3VLN A;  4AF2 A;  5B8B A;  2OKA A;  3UAP A;  1O6J A;  1A23 A;  2F8A A;  4I5Q A;  3ZYW A;  2YZU A;  3SBC A;  2K9F A;  1GUL A;  3GYK A;  3DIE A;  2V41 A;  1LBK A;  4HZ2 A;  4ILF A;  4Q5N A;  5HR2 A;  1A24 A;  2JZS A;  3HVS A;  1ST9 A;  4DSQ A;  2VM2 A;  3GN3 A;  2B1L A;  3A2W A;  3C8E A;  4YAP A;  4V1A p;  5D93 A;  4EKZ A;  2REM A;  3KGK A;  1S3R A;  3QAV A;  4O32 A;  3LQ7 A;  3ZFB A;  3IC4 A;  1XVW A;  2GST A;  1A0R P;  2B5X A;  4XS1 A;  1ERW A;  1SJI A;  5KOX A;  1EP7 A;  1O73 A;  5ECO B;  2DJ3 A;  1THX A;  5ELG A;  1GSE A;  1YJ6 A;  2ZCT A;  3NIV A;  4JU5 A;  3C7M A;  4CDO A;  4G9H A;  4GTU A;  4K0N A;  3TJJ A;  1B4Q A;  1N8J A;  1V57 A;  4HJM A;  4TXO B;  2HLS A;  3A2X A;  4BWQ A;  5IMF A;  3F63 A;  4QQ7 A;  1U6T A;  1X0R A;  1VF3 A;  1C72 A;  1QXH A;  1TI3 A;  3IK9 A;  2O7K A;  2AAW A;  3GSS A;  3RGB C;  3HDC A;  3EU3 A;  4BA7 A;  5J40 A;  2I4A A;  3ZVJ A;  2DC5 A;  4G2E A;  5IMZ A;  1SVL A;  3TJK A;  3E0U A;  1V58 A;  1PX6 A;  5CRW A;  2TIR A;  1AQW A;  4GLT A;  2C0G A;  3NZN A;  2M46 A;  1S3D A;  4CY6 A;  4RQR A;  3ERF A;  3QDN A;  4L0U A;  3GHA A;  2B5Y A;  2PUK C;  3AY8 A;  3APO A;  3ZIT A;  2ZNM A;  4MNN A;  1O85 A;  6GSS A;  1X5C A;  1XWG A;  5D73 A;  4DSS A;  1UA5 A;  1YVL A;  1EP8 A;  1TU7 A;  1DBY A;  2OE1 A;  12GS A;  1MD3 A;  4WXT A;  3VWU A;  2MMO A;  3GL3 A;  16GS A;  2GQL A;  3HKR A;  2ALB A;  4MMM A;  1A2L A;  3IE3 A;  4X1U A;  4OFT A;  1FVK A;  3S9F A;  2YCD A;  2LS5 A;  3TKS E;  18GS A;  4KND A;  1ML6 A;  3CTF A;  4XS6 A;  3ZMK A;  2I1U A;  3KM6 A;  4HSC X;  2D2Z A;  2DIY A;  1M0U A;  4GDF A;  5CAX A;  3GST A;  1Z6M A;  4G0K A;  2YWN A;  3PPU A;  2YAN A;  4W66 A;  3GUS A;  4MK3 A;  4J56 E;  3DD3 A;  2H1A A;  10GS A;  3DWV A;  5IOW A;  4WR5 A;  1VF4 A;  5IIZ A;  2KP1 A;  2HT9 A;  5J4U A;  5G5E A;  4K9Z A;  4USS A;  4GSS A;  2H6Y A;  2IL3 A;  3VK9 A;  1QUW A;  2YWO A;  1B4P A;  2H70 A;  3TOU A;  2LJK A;  5A5H A;  1EOG A;  3HVN A;  1JZO A;  3FZ9 A;  1PL1 A;  4WBR D;  3EMP A;  2R3X A;  4XRA A;  1LU4 A;  2P31 A;  2VCZ A;  4XHM A;  1R5A A;  3J7Y k;  1M3J A;  5HFG A;  4IS0 A;  4GST A;  3ED3 A;  3ZRE A;  4AJ6 A;  5JWO B;  1U87 A;  1UN2 A;  5DCH A;  1A8Y A;  2H8L A;  4X0X A;  1GL8 A;  4YH2 A;  3ERW A;  5ELA A;  2RUF A;  4EO3 A;  4N0Z A;  2OE3 A;  2FWE A;  3GKM A;  1TI1 A;  4PI0 C;  3LG6 A;  1V2A A;  1AQX A;  1QGV A;  5G1L A;  1XVQ A;  4Z7X A;  5J9C A;  2IMI A;  2GZP A;  2H66 A;  1FVJ A;  3LSZ A;  1PKW A;  1Q4J A;  5ID2 B;  5EL8 A;  3F9U A;  1MD4 A;  1ERV A;  5ECR B;  1TOF A;  3TRX A;  5JWQ B;  1B9Y C;  1JLW A;  2CX3 A;  3P2A A;  4J2F A;  2WVZ A;  5DAL B;  3IBH A;  2XPE A;  2EIR A;  2WB9 A;  3CYN A;  4KGI A;  1Y25 A;  2QA1 A;  1BYE A;  2NBS A;  3CQF A;  4NHW A;  3CTG A;  1ZGN A;  3IHQ A;  2LRC A;  1GUK A;  1XCC A;  2RM6 A;  5KOW A;  2CAI A;  4E8E A;  2HZE A;  4MA9 A;  2FA8 A;  2OAD A;  2CVD A;  2I3Y A;  1X9W B;  1O81 A;  3TRP A;  4GXZ A;  4I2T A;  1B8X A;  2VD1 A;  5ECN B;  4GWR A;  5IMC A;  3HZ8 A;  2CZ2 A;  2BJX A;  3DVW A;  4AKH A;  2CV4 A;  4ZB7 A;  4HU9 A;  2IMF A;  5AIV A;  2JAC A;  3RPP A;  4KDY A;  2AHE A;  2KP2 A;  4HQS A;  1N25 A;  2EC4 A;  4I8B A;  5ABR A;  3H4K A;  1AIU A;  1Y6E A;  1AC1 A;  4HZ4 A;  4MP4 A;  2LTK A;  4FIW A;  5GZZ B;  3MWH A;  4XS4 B;  1QQ2 A;  1TK5 B;  2FWF A;  2WW3 A;  2DKI A;  2KOK A;  4POM A;  3IAM 2;  4F82 A;  1Q98 A;  2C0D A;  3ZLP A;  3KP9 A;  4EF0 A;  3GRX A;  1YDK A;  1WE0 A;  1URM A;  4V2L A;  2DSA A;  3EWL A;  3CSI A;  1SVO A;  4HQZ A;  3L9S A;  2XHF A;  4BIK A;  3V1W A;  5COH A;  1EWX A;  2VM1 A;  2WZS A;  1K0M A;  1YEX A;  2YZH A;  3IOS A;  5D9T A;  5A1N B;  2YN1 A;  5KN2 A;  4MPF A;  5BMU A;  3G7Y A;  5KN3 A;  4EDY A;  3H79 A;  4TKY A;  4AKG A;  4POK A;  1TTZ A;  2R0G A;  1SYX A;  3LYK A;  2H0I A;  2K6V A;  6GSY A;  2AV4 A;  4XS4 A;  2X99 A;  5AN1 A;  3MNG A;  1VGL A;  4K6X A;  3TU3 B;  5A4U A;  4AJ8 A;  1GUM A;  2WDU A;  1F6M C;  2O8V B;  2IJY A;  3VI5 A;  1JZD A;  4ULX A;  2VL3 A;  2WFC A;  1KNG A;  2WZ9 A;  1XPV A;  1V98 A;  3KD0 A;  1Z5Y E;  4FYU A;  2VL2 A;  3EC3 A;  3VFI A;  4FYC A;  2LJA A;  1YEP A;  2JL4 A;  2HFD A;  2WUL A;  2QKE A;  5B8A A;  2FLS A;  3RAZ A;  1TK8 B;  1GTU A;  5IM9 A;  3ZFL A;  1SEN A;  3BD2 A;  3MDK A;  2L5O A;  2YJ7 A;  5HQP A;  14GS A;  2F3M A;  1M99 A;  3UVH A;  5D9X A;  2H01 A;  3TKS A;  1SK0 A;  4NAX A;  3QAG A;  3HA9 A;  5B6N A;  2HZF A;  4N0V A;  1WP0 A;  3C1R A;  3E9J B;  1ERT A;  2M72 A;  2DIZ A;  4ZBB A;  4MJE A;  5A34 B;  1X9S B;  3IRA A;  3FW2 A;  4D73 B;  4PXO A;  3DML A;  4PNG A;  3DKS A;  4X43 A;  1V9W A;  1RQM A;  3F3R A;  5J3R A;  2J9H A;  3G7J A;  5HFK A;  4OO4 A;  2CAQ A;  2VOC A;  1X5E A;  4KSM A;  2MMZ A;  2IN3 A;  3L78 A;  4LMV A;  2JZR A;  2B6M A;  5ECS A;  1T4Z A;  5DCG A;  3N9J A;  1XWB A;  1XW5 A;  2VCQ A;  2F9S A;  1G6Y A;  3GMF A;  6GSU A;  4IHU A;  1I1I P;  4K7O A;  3TOT A;  2B7J A;  8GSS A;  1NSW A;  4KUN A;  2PGT A;  4ACS A;  4YQU A;  2YOI A;  4E8H A;  1R4W A;  2E7P A;  3APQ A;  3IK7 A;  2L6D A;  1SU9 A;  2EFE A;  1T00 A;  5IO2 A;  2N5F A;  4ZIJ A;  4JED A;  4HS1 A;  2OE0 A;  2XC2 A;  2CVK A;  1FOH A;  2NDO A;  3D5J A;  1Z9H A;  1M7T A;  2IPA A;  1SYR A;  1BX9 A;  2GLR A;  2V6K A;  1KBN A;  4HJ2 A;  5D96 A;  1DUG A;  3UAR A;  2BMX A;  2GSQ A;  1S3C A;  3HJO A;  4QL9 A;  1VF2 A;  5G31 A;  1Z3E A;  4TR0 A;  2WCI A;  3GIX A;  4MDC A;  4EDZ A;  4F03 A;  1SKR B;  5DQS A;  2VO4 A;  2O87 A;  3ZZX A;  2K8V A;  4I97 A;  3GTU B;  2RM5 A;  2VLV A;  6GSX A;  3CWG A;  3EUR A;  3DRN A;  4IQA A;  3EU4 A;  5KN0 A;  3CBU A;  4G0L A;  3FZ5 A;  2PVQ A;  5ECI B;  2H0H A;  4HI7 A;  3KP8 A;  4PX1 A;  2HE3 A;  2HRN A;  1K3O A;  2FUG 2;  1WJK A;  4ML1 A;  5J47 A;  3Q6O A;  1R7H A;  3M8N A;  1YQ1 A;  3DXB A;  3KMO A;  5DBQ A;  3M9J A;  2OAC A;  2C0F A;  3KEB A;  5EVO A;  4ZL7 A;  5INY A;  1F3B A;  6GSW A;  1T7P B;  4MF5 A;  1O8W A;  4N30 A;  2HSM B;  2LV3 A;  2L4C A;  3O76 A;  3FHK A;  3GA4 A;  5F06 A;  2CVB A;  2B5E A;  3DYR A;  3ME7 A;  4XTS A;  2AJQ B;  4ZBD A;  3KMN A;  2VCX A;  1AUC A;  1BG5 A;  1MDK A;  4LLR A;  3U5R E;  4WEY A;  4YKF A;  4Z2U A;  1PA3 A;  3GTU A;  4G19 A;  4DSS B;  5JCU A;  1JFU A;  4IKH A;  4LA1 A;  2WJU A;  4BWS A;  2EIQ A;  1TKD B;  3EMX A;  4PTS A;  3RBT A;  2EIO A;  3LW9 A;  4EVM A;  3FR6 A;  3TKP A;  3QOU A;  1DSB A;  4TW5 A;  4LL1 B;  5ECQ B;  4TVE A;  3ZIJ A;  4OCF A;  2PMT A;  2VCV A;  1ACV A;  2WW0 A;  1KEB A;  3WGX A;  1EGR A;  1M9B A;  4BL7 B;  2HSM A;  3GKN A;  2IFQ B;  1EEJ A;  1FB6 A;  2JZT A;  1YY7 A;  3UBL A;  2GZZ A;  1F3A A;  1GSS A;  4DSR A;  5J4V A;  1HD2 A;  1GUH A;  3EYT A;  2VCT A;  3US3 A;  2K18 A;  2FWG A;  4ISD A;  3PR8 A;  3LEF A;  3UIW A;  1W89 A;  2A2R A;  2HXK A;  1GLQ A;  4L5L A;  2JAD A;  4MAB A;  1XG8 A;  4CHS A;  20GS A;  3A5W A;  5CRG A;  2O5V A;  2VL2 C;  5A5H B;  1PMT A;  3EVI A;  2GQK A;  3HHV A;  1PGT A;  3GNJ A;  4PUA A;  1OC8 A;  1HYU A;  2BTO T;  4ECI A;  2GZY A;  3TKR A;  2YWI A;  5G1K A;  5DQY A;  5IPG A;  3ISO A;  4IJ3 A;  5E4W A;  4BL7 A;  3W8J A;  2H1G A;  5GST A;  2IFQ A;  1PRX A;  3TKS C;  2VIM A;  2P5R A;  4MF6 A;  1W4V A;  1PKZ A;  3P8W A;  1SVM A;  4EIQ A;  4G10 A;  2TRC P;  3A2V A;  4OCE A;  2EFC A;  2YV9 A;  1B48 A;  4EC0 A;  2YPM A;  1J08 A;  2VUP A;  3D0Z A;  4G0I A;  2FHE A;  3HYP A;  5CYY A;  4ZB6 A;  2V6O A;  1EGO A;  2RII A;  2I81 A;  5DVB A;  2C0E A;  2WW1 A;  4L5O A;  2H30 A;  1QK8 A;  2PER A;  3QD9 A;  3TRQ A;  4OWY A;  2LKU A;  1B9X C;  3HJM A;  2WGR A;  1GP1 A;  4MLY A;  2X49 A;  3EE2 A;  3FEU A;  1XBS A;  1GSY A;  4ZIL A;  4HDE A;  2HZE B;  3LGC A;  2GT5 A;  3TUE A;  1UC7 A;  3OR5 A;  1MTC A;  4RI7 A;  2OBI A;  3DVX A;  1OC3 A;  2O3E A;  4DVC A;  2MBT A;  2H0G A;  5J41 A;  2R0C A;  1NHO A; 
#chains in the Genus database with same CATH homology
 1O7U A;  4QL7 A;  2L6C A;  1GLP A;  4HEA 2;  2HNL A;  1NM3 A;  1XIY A;  2R2J A;  2JU5 A;  3CSH A;  2L57 A;  1QFN A;  3F6D A;  3LFL A;  4PUF C;  2R0P A;  4TRX A;  3IPZ A;  1T1V A;  2VD0 A;  3FKF A;  4POL A;  5ECL B;  5F07 A;  4P3Y B;  2GGT A;  3TKQ A;  3FZA A;  3HY2 A;  3RHB A;  5H5S A;  5F8B A;  5EPF A;  4F9Z A;  2O85 A;  4XRD A;  2VCW A;  4KSO A;  1X9M B;  1SKS B;  1G6W A;  4MJB A;  2OBK A;  4ECC A;  2GSR A;  3EIN A;  1K0B A;  2ON7 A;  5BMU B;  3H8Q A;  1LJR A;  3GX8 A;  3SWL A;  2DJ2 A;  4N11 A;  4MH3 A;  1TK0 B;  3BJ5 A;  3L0H A;  4K5S A;  2IWT A;  2C8U A;  3TJF A;  1N2A A;  1ZCP A;  2ES7 A;  5J4Y A;  1BF5 A;  1WMJ A;  2PPT A;  2CA8 A;  3HCZ A;  1MEK A;  2VKZ G;  2HRF A;  3JCM L;  1H4O A;  1J9B A;  2HSN A;  1OKD A;  1GWC A;  4GF0 A;  1XWC A;  4Q5Q A;  3GV1 A;  3IHG A;  5LCZ A;  1GTB A;  4NV5 A;  1WOU A;  2LUS A;  2R6K A;  5IPH A;  2OA7 A;  1SD9 A;  2LQQ A;  3LYP A;  3UL3 A;  5A4W A;  1FHE A;  4IBP A;  2UV8 G;  2G2Q A;  4YQV A;  1R26 A;  2HSY A;  3MIX A;  3ZML A;  2LNS A;  2GS3 A;  1WRY A;  3PGT A;  1S3A A;  3WT2 A;  1U3A A;  3L9U A;  5GAP D;  2H1L A;  5CNW A;  3F0I A;  4NHZ A;  1IYH A;  4GSN A;  3WGE A;  4ECB A;  3W8S A;  2F8F A;  5IQY A;  5A5K A;  4BVX A;  4GQF A;  5DJM A;  5J9B A;  1HQO A;  3UBK A;  2HSH A;  2H73 A;  3VPQ A;  1RK4 A;  3HZ4 A;  7GSS A;  3O3T A;  2H74 A;  2C1Y A;  2IMD A;  2NPB A;  3BCK A;  3F4S A;  1HNB A;  3LOR A;  3I69 A;  4KE3 A;  4BVY A;  1T8E B;  1SL2 B;  5CRH A;  2P0G A;  2F51 A;  4O7H A;  2HRK B;  3H93 A;  4AGS A;  4NWY A;  5B6M A;  2YP6 A;  6GSV A;  1PX7 A;  1E6B A;  4Q5R A;  3PH9 A;  1YKC A;  2IIY A;  4IP1 A;  5ECP B;  4MZW A;  4EE0 A;  5KEJ A;  1SJ6 A;  1TJD A;  1FOV A;  2VLU A;  3VWX A;  2HQT A;  4TR1 B;  1XOB A;  2LRT A;  1K3L A;  4PUR A;  2PWJ A;  4YKG A;  2KLX A;  1HNC A;  2QSI A;  2QC7 A;  1PSQ A;  4EL1 A;  4Z2R A;  3FK8 A;  4K5R A;  4JE1 A;  1OVN A;  3ERG A;  2A4H A;  2MZC A;  3TJG A;  4WET A;  5AGY A;  2CT6 A;  1H75 A;  2NVL A;  22GS A;  3D22 A;  1K0N A;  5IOX A;  2X8C A;  4KCA A;  3WT1 A;  2DJ1 A;  4IP6 A;  11GS A;  3FMW A;  2HRK A;  1BAY A;  4JR4 A;  3HD5 A;  1Z6N A;  4V2N A;  4ZL8 A;  4WR4 A;  4F0C A;  3WD6 A;  3FR3 A;  3Q19 A;  3C1S A;  2A2S A;  3APS A;  1XWA A;  3BCI A;  4TOP A;  3E3E A;  4TR1 A;  2H71 A;  4H86 A;  4NV2 A;  1UVZ A;  1XFL A;  2R37 A;  5DAK B;  1TXU A;  3A3T A;  4MJC A;  3FRC A;  3QFB C;  5ENU A;  1HNA A;  3N5O A;  1X5D A;  4Q5F A;  2FGX A;  1GSU A;  9GSS A;  2E2G A;  3GX0 A;  5DDL A;  1OAZ A;  3ZRD A;  4V2M A;  1YZX A;  5HR3 A;  1TDI A;  3GKX A;  1MDI A;  2OJL A;  2EFH A;  1U88 A;  2FNO A;  1GNE A;  1CQG A;  2WRT A;  3IAS 2;  1OC9 B;  2HI7 A;  2R4V A;  2EFD A;  3M9K A;  4XCS A;  3LJR A;  3VWV A;  1Y1U A;  3DGQ A;  2WS2 A;  3F4T A;  5D8I A;  2HYX A;  5A4V A;  1ZZY A;  5KN1 A;  5D9V A;  4RQX A;  4IGJ A;  4ID0 A;  2VL9 A;  5HFI A;  1ZMA A;  3H1N A;  2FD3 A;  3HVX A;  5DAK A;  2DMM A;  3RPN A;  3K8N A;  3W6G A;  2PVO C;  2AUV A;  3I6A A;  2OT3 A;  5LD0 A;  1A2J A;  3PIN A;  2L4Q A;  5HR1 A;  5FHI A;  2XPD A;  4EUY A;  5ECM B;  2V1M A;  5H5R A;  1FAA A;  1TW9 A;  5IMD A;  4AI6 A;  1PD2 1;  1I5G A;  3M0F A;  2C3T A;  5AIS A;  3G7I A;  3BBY A;  4OFN A;  1F37 A;  1SK1 A;  1RW1 A;  2GT6 A;  3A5I A;  1SKW B;  3FYG A;  1OC9 A;  3D4T A;  2H6X A;  2LNT A;  1OE7 A;  1EV4 A;  1XXU A;  3C73 A;  3UVT A;  2H72 A;  2LRN A;  3LWA A;  3MAK A;  3KCM A;  2NTO A;  4N10 A;  4JR6 A;  4K2D A;  1SL0 B;  1U3I A;  1K0C A;  3QMX A;  3GFK A;  3F8U A;  1M9A A;  4CW9 A;  1EZK A;  1YF0 A;  19GS A;  1GSQ A;  2IMK A;  5GAN D;  1OE8 A;  1KTE A;  5F05 A;  2J23 A;  1FO5 A;  4RUV A;  1JHB A;  2PU9 C;  4GCI A;  4KA0 A;  1Z7R A;  3FR9 A;  4ZB8 A;  1XOA A;  1O8X A;  2X4A A;  2JSY A;  4G01 A;  1V40 A;  3MYD A;  2RLI A;  4K1F A;  3QCP A;  4GRF A;  4K7N A;  1M2D A;  3D21 A;  3BOA A;  4LMW A;  2YWM A;  1FG4 A;  1XWK A;  3NOF A;  4L0W A;  3KIJ A;  3D4M A;  3IDV A;  2GDR A;  1G7O A;  5D9W A;  4TXV A;  4PGT A;  1VRS D;  2H1B A;  2MBS A;  3RHC A;  5C04 A;  3HVV A;  2DJK A;  4TXO A;  2K8S A;  3HJP A;  1AXD A;  13GS A;  3UOM A;  4TR4 A;  3GUR A;  1AW9 A;  3CRT A;  5EY6 A;  4OD7 A;  2DLX A;  1DE2 A;  2GVP A;  4ZL9 A;  4EIP A;  3GKK A;  1PN9 A;  2C3N A;  2H76 A;  3KJY A;  3QR6 A;  4NPB A;  1BQ7 A;  1BED A;  4O5R A;  5IMV A;  3KXO A;  3M1G A;  1PQN A;  1GRX A;  1ZL9 A;  4TR3 A;  5J5N A;  5F0G A;  1XZO A;  4ML6 A;  4X4J A;  1OYJ A;  4KCE A;  1XW9 A;  2ZUP A;  2B1K A;  4JZQ A;  1ZYE A;  1VF1 A;  2DJJ A;  3R2Q A;  1AQV A;  5ECH B;  5E59 A;  3O6T A;  1IYI A;  4YQM A;  4N3Z A;  5FT3 A;  2FWH A;  1A8L A;  3UJ1 A;  2MYG A;  1A0F A;  4MZB A;  2DJ0 A;  1PL2 A;  3IA1 A;  5BRT A;  5FWG A;  4K0G A;  1ZYQ B;  4MF7 A;  5CP1 A;  2X64 A;  5IO0 A;  1EV9 A;  2I9H A;  3CSJ A;  3QPM A;  2E2M A;  2O89 A;  1TXX A;  3L4N A;  1E2Y A;  3G9B A;  3P90 A;  1SK2 A;  4LL4 B;  5JWR B;  1ABA A;  4MJA A;  2C4J A;  5C00 A;  4ZBA A;  5JCG A;  1PN0 A;  4FO5 A;  4MCU A;  4IVF A;  1J0F A;  1A2M A;  1F9M A;  4O92 A;  4NMU A;  3GH6 A;  3F4R A;  4PQH A;  4MH2 A;  2LST A;  3GH9 A;  4KF9 A;  1YF1 A;  2B7K A;  4WF5 A;  4HU7 A;  2HSN B;  4I2U A;  1FW1 A;  2HRA A;  3F6F A;  4HUA A;  4KW6 A;  1ON4 A;  2H1D A;  3ZL5 A;  4KX4 A;  5ECK B;  3QAW A;  3UEM A;  1USB A;  1TRU A;  2R5G A;  5HR0 A;  4F0B A;  3DEX A;  3FY7 A;  1QMV A;  1GH2 A;  5L71 A;  6GST A;  3ZVJ D;  2YV7 A;  4ICY A;  4CY8 A;  2YNX A;  3KH9 A;  4L8E A;  2G0F A;  2H6Z A;  4JRR A;  2UZ8 A;  4F2I A;  4FYB A;  1WPI A;  4AKI A;  5LNK e;  1TRW A;  3TCO A;  5ID2 A;  2TRX A;  1JLV A;  3LXT A;  3U6V A;  4BVX B;  4V1A g;  2C80 A;  2QA2 A;  4BPY A;  5AIX A;  3L9V A;  5DAL A;  4KB3 A;  1M2B A;  1TU8 A;  4TN8 A;  1NW2 A;  1AAZ A;  1WIK A;  4IN0 A;  4I6X A;  2L59 A;  3IC8 A;  2LEG A;  5CRD A;  3HXS A;  4BVY B;  2FA4 A;  4IEL A;  2JSZ A;  2FY6 A;  1GNW A;  4KH7 A;  3VUR A;  4HOJ A;  1JZR A;  4J57 E;  2N5B A;  3R3E A;  2DKH A;  3MSZ A;  3F3Q A;  2PN8 A;  3CMI A;  1CQH A;  4IJI A;  3WGD A;  5GSS A;  4KDX A;  1NHY A;  4WKW A;  1WWJ A;  3VI7 A;  1TP9 A;  2V32 A;  5H5Q A;  4NXI A;  2DML A;  4EXJ A;  1EEM A;  1GSD A;  3ZIV A;  1SL1 B;  1G0T A;  2L5L A;  1YKA A;  5CO3 A;  4XIH A;  4ZB9 A;  1ERU A;  2GSS A;  1XW6 A;  2C3Q A;  2YJH A;  4O5Q A;  3LXZ A;  4IW9 A;  2CQ9 A;  2DBC A;  3KTB A;  2LJR A;  4IQ1 A;  1GTA A;  4O5U A;  4OMV A;  5DJL A;  1K3Y A;  4GQC A;  2P5Q A;  3TJB A;  4Z2T A;  4A5P A;  1OKT A;  4ZXG A;  2A4V A;  2ON5 A;  1G7E A;  1DE1 A;  1M2A A;  1SD8 A;  3HMJ G;  4DEJ A;  3IV4 A;  3M3M A;  5A1N A;  4FH8 A;  2A2P A;  3ZTL A;  1SJZ A;  2VAF A;  2QGV A;  2Z9S A;  4OFM A;  3EPT A;  4E68 A;  3TDG A;  3D6I A;  1TRS A;  1BJX A;  4MZC A;  4AKX B;  5CRE A;  2PBJ A;  2X8H A;  3Q74 A;  3IXR A;  2RUE A;  5G5F A;  1T3B A;  2H19 A;  2X8G A;  2XBQ A;  3KH7 A;  4PQ1 A;  1K0O A;  4K7I A;  2N5A A;  2B3S A;  3J7Y b;  3VPT A;  1BG1 A;  2VLT A;  1THO A;  2MMN A;  2CX4 A;  3QFA C;  1GSF A;  1EOH A;  4JBB A;  4RI6 A;  2E0Q A;  1ZYP A;  1I9D A;  2H75 A;  2AYT A;  3GL5 A;  1ZOF A;  2GTU A;  2FCH A;  1ZYN A;  4K2X A;  3KZQ A;  4OO5 A;  4POB A;  1FB0 A;  3KTL A;  4MPG A;  1K0A A;  2XBI A;  17GS A;  5G30 A;  1T4Y A;  4ECJ A;  3Q18 A;  1JZW A;  1K0D A;  1MDJ A;  1Z7P A;  4WBJ A;  5G2Z A;  3CXG A;  1TRV A;  4PNF A;  2MMA A;  4KDU A;  4YAV A;  3UMA A;  4WF4 A;  3I43 A;  3ME8 A;  3C71 A;  5A34 A;  4FQU A;  3I9V 2;  1GTI A;  2CZ3 A;  5B7C A;  4D73 A;  2AB6 A;  4QMK A;  3IR4 A;  2LQO A;  1R5P A;  1ILO A;  3CRU A;  5JCW A;  2M80 A;  5IMA A;  3FZ4 A;  3P7X A;  3WYW A;  2GQM A;  1F2E A;  4PQI A;  4AJ7 A;  4KAE A;  2KUC A;  2IME A;  2V2G A;  3TGZ A;  2KHP A;  3RDW A;  3TB2 A;  3VWW A;  4K8M A;  3VLN A;  4AF2 A;  5B8B A;  2OKA A;  3UAP A;  1O6J A;  1A23 A;  2F8A A;  4I5Q A;  3ZYW A;  2YZU A;  3SBC A;  2K9F A;  1GUL A;  3GYK A;  3DIE A;  2V41 A;  1LBK A;  4HZ2 A;  4ILF A;  4Q5N A;  5HR2 A;  1A24 A;  2JZS A;  3HVS A;  1ST9 A;  4DSQ A;  2VM2 A;  3GN3 A;  2B1L A;  3A2W A;  3C8E A;  4YAP A;  4V1A p;  5D93 A;  4EKZ A;  2REM A;  3KGK A;  3QAV A;  4O32 A;  3LQ7 A;  3ZFB A;  3IC4 A;  1XVW A;  2GST A;  1A0R P;  2B5X A;  4XS1 A;  1ERW A;  1SJI A;  5KOX A;  1EP7 A;  1O73 A;  5ECO B;  2DJ3 A;  1THX A;  5ELG A;  1GSE A;  1YJ6 A;  2ZCT A;  3NIV A;  4JU5 A;  3C7M A;  4CDO A;  4G9H A;  4GTU A;  4K0N A;  3TJJ A;  1B4Q A;  1N8J A;  1V57 A;  4HJM A;  4TXO B;  2HLS A;  3A2X A;  4BWQ A;  5IMF A;  3F63 A;  4QQ7 A;  1U6T A;  1X0R A;  1VF3 A;  1C72 A;  1QXH A;  1TI3 A;  3IK9 A;  2O7K A;  2AAW A;  3GSS A;  3HDC A;  3EU3 A;  4BA7 A;  5J40 A;  2I4A A;  3ZVJ A;  2DC5 A;  4G2E A;  5IMZ A;  1SVL A;  3TJK A;  3E0U A;  1V58 A;  1PX6 A;  5CRW A;  2TIR A;  1AQW A;  4GLT A;  2C0G A;  3NZN A;  2M46 A;  1S3D A;  4CY6 A;  4RQR A;  3ERF A;  3QDN A;  4L0U A;  3GHA A;  2B5Y A;  2PUK C;  3AY8 A;  3APO A;  3ZIT A;  2ZNM A;  4MNN A;  1O85 A;  6GSS A;  1X5C A;  1XWG A;  5D73 A;  4DSS A;  1UA5 A;  1YVL A;  1EP8 A;  1TU7 A;  1DBY A;  2OE1 A;  12GS A;  1MD3 A;  4WXT A;  3VWU A;  2MMO A;  3GL3 A;  16GS A;  2GQL A;  3HKR A;  2ALB A;  4MMM A;  1A2L A;  3IE3 A;  4X1U A;  4OFT A;  1FVK A;  3S9F A;  2YCD A;  2LS5 A;  3TKS E;  18GS A;  4KND A;  1ML6 A;  3CTF A;  4XS6 A;  3ZMK A;  2I1U A;  3KM6 A;  2D2Z A;  2DIY A;  1M0U A;  4GDF A;  5CAX A;  3GST A;  1Z6M A;  4G0K A;  2YWN A;  3PPU A;  2YAN A;  4W66 A;  3GUS A;  4MK3 A;  4J56 E;  3DD3 A;  2H1A A;  10GS A;  3DWV A;  5IOW A;  4WR5 A;  1VF4 A;  5IIZ A;  2KP1 A;  2HT9 A;  5J4U A;  5G5E A;  4K9Z A;  4USS A;  4GSS A;  2H6Y A;  2IL3 A;  3VK9 A;  1QUW A;  2YWO A;  1B4P A;  2H70 A;  3TOU A;  2LJK A;  5A5H A;  1EOG A;  1JZO A;  3FZ9 A;  1PL1 A;  4WBR D;  3EMP A;  2R3X A;  4XRA A;  1LU4 A;  2P31 A;  2VCZ A;  4XHM A;  1R5A A;  3J7Y k;  5HFG A;  4IS0 A;  4GST A;  3ED3 A;  3ZRE A;  4AJ6 A;  5JWO B;  1U87 A;  1UN2 A;  5DCH A;  1A8Y A;  2H8L A;  4X0X A;  1GL8 A;  4YH2 A;  3ERW A;  5ELA A;  2RUF A;  4EO3 A;  4N0Z A;  2OE3 A;  2FWE A;  3GKM A;  1TI1 A;  3LG6 A;  1V2A A;  1AQX A;  1QGV A;  5G1L A;  1XVQ A;  4Z7X A;  5J9C A;  2IMI A;  2GZP A;  2H66 A;  1FVJ A;  3LSZ A;  1PKW A;  1Q4J A;  5ID2 B;  5EL8 A;  3F9U A;  1MD4 A;  1ERV A;  5ECR B;  1TOF A;  3TRX A;  5JWQ B;  1B9Y C;  1JLW A;  2CX3 A;  3P2A A;  4J2F A;  5DAL B;  3IBH A;  2XPE A;  2EIR A;  2WB9 A;  3CYN A;  4KGI A;  1Y25 A;  2QA1 A;  1BYE A;  2NBS A;  4NHW A;  3CTG A;  1ZGN A;  3IHQ A;  2LRC A;  1GUK A;  1XCC A;  2RM6 A;  5KOW A;  2CAI A;  4E8E A;  2HZE A;  4MA9 A;  2FA8 A;  2OAD A;  2CVD A;  2I3Y A;  1X9W B;  1O81 A;  3TRP A;  4GXZ A;  4I2T A;  1B8X A;  2VD1 A;  5ECN B;  4GWR A;  5IMC A;  3HZ8 A;  2CZ2 A;  2BJX A;  3DVW A;  4AKH A;  2CV4 A;  4ZB7 A;  4HU9 A;  2IMF A;  5AIV A;  2JAC A;  3RPP A;  4KDY A;  2AHE A;  2KP2 A;  4HQS A;  1N25 A;  2EC4 A;  4I8B A;  5ABR A;  3H4K A;  1AIU A;  1Y6E A;  1AC1 A;  4HZ4 A;  4MP4 A;  2LTK A;  4FIW A;  5GZZ B;  3MWH A;  4XS4 B;  1QQ2 A;  1TK5 B;  2FWF A;  2DKI A;  2KOK A;  4POM A;  3IAM 2;  4F82 A;  1Q98 A;  2C0D A;  3ZLP A;  3KP9 A;  4EF0 A;  3GRX A;  1YDK A;  1WE0 A;  1URM A;  4V2L A;  2DSA A;  3EWL A;  3CSI A;  1SVO A;  4HQZ A;  3L9S A;  2XHF A;  3V1W A;  5COH A;  1EWX A;  2VM1 A;  1K0M A;  1YEX A;  2YZH A;  3IOS A;  5D9T A;  5A1N B;  2YN1 A;  5KN2 A;  4MPF A;  5BMU A;  3G7Y A;  5KN3 A;  4EDY A;  3H79 A;  4TKY A;  4AKG A;  4POK A;  1TTZ A;  2R0G A;  1SYX A;  3LYK A;  2H0I A;  2K6V A;  6GSY A;  2AV4 A;  4XS4 A;  2X99 A;  5AN1 A;  3MNG A;  1VGL A;  4K6X A;  3TU3 B;  5A4U A;  4AJ8 A;  1GUM A;  2WDU A;  1F6M C;  2O8V B;  2IJY A;  3VI5 A;  1JZD A;  4ULX A;  2VL3 A;  2WFC A;  1KNG A;  2WZ9 A;  1XPV A;  1V98 A;  3KD0 A;  1Z5Y E;  4FYU A;  2VL2 A;  3EC3 A;  3VFI A;  4FYC A;  2LJA A;  1YEP A;  2JL4 A;  2HFD A;  2WUL A;  2QKE A;  5B8A A;  2FLS A;  3RAZ A;  1TK8 B;  1GTU A;  5IM9 A;  3ZFL A;  1SEN A;  3BD2 A;  3MDK A;  2L5O A;  2YJ7 A;  5HQP A;  14GS A;  2F3M A;  1M99 A;  3UVH A;  5D9X A;  2H01 A;  3TKS A;  1SK0 A;  4NAX A;  3QAG A;  3HA9 A;  5B6N A;  2HZF A;  4N0V A;  1WP0 A;  3C1R A;  3E9J B;  1ERT A;  2M72 A;  2DIZ A;  4ZBB A;  4MJE A;  5A34 B;  1X9S B;  3IRA A;  3FW2 A;  4D73 B;  4PXO A;  3DML A;  4PNG A;  3DKS A;  4X43 A;  1V9W A;  1RQM A;  3F3R A;  5J3R A;  2J9H A;  3G7J A;  5HFK A;  4OO4 A;  2CAQ A;  2VOC A;  1X5E A;  4KSM A;  2MMZ A;  2IN3 A;  3L78 A;  4LMV A;  2JZR A;  2B6M A;  5ECS A;  1T4Z A;  5DCG A;  3N9J A;  1XWB A;  1XW5 A;  2VCQ A;  2F9S A;  1G6Y A;  3GMF A;  6GSU A;  4IHU A;  4K7O A;  3TOT A;  2B7J A;  8GSS A;  1NSW A;  4KUN A;  2PGT A;  4ACS A;  4YQU A;  2YOI A;  4E8H A;  1R4W A;  2E7P A;  3APQ A;  3IK7 A;  2L6D A;  1SU9 A;  2EFE A;  1T00 A;  5IO2 A;  2N5F A;  4ZIJ A;  4JED A;  4HS1 A;  2OE0 A;  2XC2 A;  2CVK A;  1FOH A;  2NDO A;  3D5J A;  1Z9H A;  1M7T A;  2IPA A;  1SYR A;  1BX9 A;  2GLR A;  2V6K A;  1KBN A;  4HJ2 A;  5D96 A;  1DUG A;  3UAR A;  2BMX A;  2GSQ A;  1S3C A;  3HJO A;  4QL9 A;  1VF2 A;  5G31 A;  1Z3E A;  4TR0 A;  2WCI A;  3GIX A;  4MDC A;  4EDZ A;  4F03 A;  1SKR B;  5DQS A;  2VO4 A;  2O87 A;  3ZZX A;  2K8V A;  4I97 A;  3GTU B;  2RM5 A;  2VLV A;  6GSX A;  3CWG A;  3EUR A;  3DRN A;  4IQA A;  3EU4 A;  5KN0 A;  3CBU A;  4G0L A;  3FZ5 A;  2PVQ A;  5ECI B;  2H0H A;  4HI7 A;  3KP8 A;  4PX1 A;  2HE3 A;  2HRN A;  1K3O A;  2FUG 2;  1WJK A;  4ML1 A;  5J47 A;  3Q6O A;  1R7H A;  3M8N A;  1YQ1 A;  3DXB A;  3KMO A;  5DBQ A;  3M9J A;  2OAC A;  2C0F A;  3KEB A;  5EVO A;  4ZL7 A;  5INY A;  1F3B A;  6GSW A;  1T7P B;  4MF5 A;  1O8W A;  4N30 A;  2HSM B;  2LV3 A;  2L4C A;  3O76 A;  3FHK A;  3GA4 A;  5F06 A;  2CVB A;  2B5E A;  3DYR A;  3ME7 A;  4XTS A;  2AJQ B;  4ZBD A;  3KMN A;  2VCX A;  1AUC A;  1BG5 A;  1MDK A;  4LLR A;  3U5R E;  4WEY A;  4YKF A;  4Z2U A;  1PA3 A;  3GTU A;  4G19 A;  4DSS B;  5JCU A;  1JFU A;  4IKH A;  4LA1 A;  2WJU A;  4BWS A;  2EIQ A;  1TKD B;  3EMX A;  4PTS A;  3RBT A;  2EIO A;  3LW9 A;  4EVM A;  3FR6 A;  3TKP A;  3QOU A;  1DSB A;  4TW5 A;  4LL1 B;  5ECQ B;  4TVE A;  3ZIJ A;  4OCF A;  2PMT A;  2VCV A;  1ACV A;  1KEB A;  3WGX A;  1EGR A;  1M9B A;  4BL7 B;  2HSM A;  3GKN A;  2IFQ B;  1EEJ A;  1FB6 A;  2JZT A;  1YY7 A;  3UBL A;  2GZZ A;  1F3A A;  1GSS A;  4DSR A;  5J4V A;  1HD2 A;  1GUH A;  3EYT A;  2VCT A;  3US3 A;  2K18 A;  2FWG A;  4ISD A;  3PR8 A;  3LEF A;  3UIW A;  1W89 A;  2A2R A;  2HXK A;  1GLQ A;  4L5L A;  2JAD A;  4MAB A;  4CHS A;  20GS A;  3A5W A;  5CRG A;  2O5V A;  2VL2 C;  5A5H B;  1PMT A;  3EVI A;  2GQK A;  3HHV A;  1PGT A;  3GNJ A;  4PUA A;  1OC8 A;  1HYU A;  2BTO T;  4ECI A;  2GZY A;  3TKR A;  2YWI A;  5G1K A;  5DQY A;  5IPG A;  3ISO A;  4IJ3 A;  5E4W A;  4BL7 A;  3W8J A;  2H1G A;  5GST A;  2IFQ A;  1PRX A;  3TKS C;  2VIM A;  2P5R A;  4MF6 A;  1W4V A;  1PKZ A;  3P8W A;  1SVM A;  4EIQ A;  4G10 A;  2TRC P;  3A2V A;  4OCE A;  2EFC A;  2YV9 A;  1B48 A;  4EC0 A;  2YPM A;  1J08 A;  2VUP A;  3D0Z A;  4G0I A;  2FHE A;  3HYP A;  5CYY A;  4ZB6 A;  2V6O A;  1EGO A;  2RII A;  2I81 A;  5DVB A;  2C0E A;  4L5O A;  2H30 A;  1QK8 A;  2PER A;  3QD9 A;  3TRQ A;  4OWY A;  2LKU A;  1B9X C;  3HJM A;  2WGR A;  1GP1 A;  4MLY A;  2X49 A;  3EE2 A;  3FEU A;  1XBS A;  1GSY A;  4ZIL A;  4HDE A;  2HZE B;  3LGC A;  2GT5 A;  3TUE A;  1UC7 A;  3OR5 A;  1MTC A;  4RI7 A;  2OBI A;  3DVX A;  1OC3 A;  4DVC A;  2MBT A;  2H0G A;  5J41 A;  2R0C A;  1NHO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...