3R3EA

The glutathione bound structure of yqjg, a glutathione transferase homolog from escherichia coli k-12
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
326
structure length
308
Chain Sequence
GQLIDGVWHAFRNWLTADGAPGPTGTGGFIAEKDRYHLYVSLACPWAHRTLIMRKLKGLEPFISVSVVNPLMLENGWTFDDSFPGATGDTLYQNEFLYQLYLHADPHYSGRVTVPVLWDKKNHTIVSNESAEIIRMFNTAFDALGAKAGDYYPPALQTKIDELNGWIYDTVNNGVYKAGFATSQEAYDEAVAKVFESLARLEQILGQHRYLTGNQLTEADIRLWTTLVRFDPVYVTHFKCDKHRISDYLNLYGFLRDIYQMPGIAETVNFDHIRNHYFRSHKTINPTGIISIGPWQDLDEPHGRDVRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein yqjG
publication title Crystal Structure Analysis of yqjG from Escherichia Coli K-12
rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 109
structure length 308
sequence length 326
chains with identical sequence B
ec nomenclature ec 1.8.5.7: Glutathionyl-hydroquinone reductase.
pdb deposition date 2011-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13409 GST_N_2 Glutathione S-transferase, N-terminal domain
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3r3eA02
3.40.30.130 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3r3eA01
4F0CA 1GTUA 4CHSA 4GSNA 1TU7A 3R2QA 4HZ4A 2GSTA 3LJRA 4ECBA 4MP4A 3VURA 1U3IA 4MF7A 5B7CA 4GSTA 1G7OA 2AAWA 3I6AA 4HOJA 3U6VA 5DCGA 4BL7B 4BL7A 3QR6A 4LMVA 5DALB 1GTAA 5DALA 3KXOA 4PNGA 5J5NA 3G7IA 2GSSA 4PUAA 5D73A 1GTIA 4ZB8A 3FR3A 5JCWA 5DJLA 1PN9A 4IGJA 2VCWA 19GSA 2AHEA 1K0MA 1HNBA 2PERA 3GTUB 1Y6EA 2R3XA 3GTUA 4K0NA 3HJOA 2C3NA 5ECHB 4IKHA 3IE3A 3KM6A 3W8SA 1GULA 3KJYA 4IQAA 4PGTA 4PX1A 3I69A 3VLNA 3IR4A 3EINA 1A0FA 5ELGA 6GSWA 4ECJA 2PGTA 2D2ZA 4NHWA 5ECQB 1FHEA 1VF1A 4F03A 2A2SA 4ZB6A 3UAPA 4KAEA 4KDXA 1YJ6A 5ECOB 1PD21 9GSSA 1KBNA 1JLVA 2NTOA 3QAVA 2WJUA 2N5FA 1VF4A 2HQTA 2CAQA 2VCZA 5LD0A 1GLQA 1RK4A 1IYHA 3M8NA 3GUSA 1EOHA 3LQ7A 2IL3A 4L8EA 5G5EA 2HSMB 2HSMA 2C8UA 2FHEA 5A4VA 1Q4JA 4PQIA 3IC8A 4Q5FA 12GSA 1M9AA 4Q5RA 5KEJA 4F0BA 1K0NA 1HQOA 3DD3A 5F0GA 3KTLA 1G6WA 2F3MA 4IBPA 1OKTA 1EEMA 4G0LA 3M0FA 3UVHA 3M3MA 2DSAA 2CAIA 4KDYA 3WYWA 3MAKA 4JBBA 1Z9HA 3PGTA 4L5OA 4O7HA 4DEJA 2VO4A 4KX4A 4YAVA 1GUHA 4MZWA 1G6YA 1GTBA 5JCUA 2C80A 3HJMA 5BMUA 1PL1A 3CSJA 2CZ3A 3LSZA 1JLWA 3VI5A 4PURA 4GTUA 3ZFLA 16GSA 5ECPB 2VD1A 5ECMB 1JZRA 3F63A 3LXZA 1ML6A 4RI6A 5AGYA 1K0OA 4MF6A 2J9HA 3GX0A 2PVQA 2GLRA 4MPGA 1PX7A 4ZBDA 4NAXA 1K0DA 4ISDA 4IVFA 5F07A 1EV4A 1LBKA 3FR6A 4QQ7A 1AW9A 1PKZA 14GSA 4WR4A 1AQXA 3CRTA 2JL4A 3SWLA 3MDKA 3LYPA 1U88A 4G0KA 1B8XA 1IYIA 2GSRA 4LMWA 4EDYA 4IW9A 1B48A 1DUGA 22GSA 4ID0A 3LFLA 4GLTA 1HNCA 4HJ2A 5A4UA 4AGSA 1VF2A 2YV7A 1MD3A 4NHZA 5EL8A 5FT3A 3NIVA 3VPQA 3ERFA 3M1GA 4MF5A 3FRCA 6GSVA 2CVDA 2A2RA 1AXDA 2VCTA 4GF0A 4EXJA 4J2FA 1YQ1A 1F3AA 5G5FA 7GSSA 1ZGNA 3BBYA 1GSEA 3VK9A 4E8EA 4EE0A 1GSYA 1K0CA 3Q19A 3TGZA 2WDUA 4ACSA 5ECIB 4IS0A 1OE7A 3LYKA 2HSNB 4TOPA 5AIXA 4YQMA 4KSMA 4YQUA 4OFNA 5GSSA 5ECRB 3O76A 5FHIA 5GZZB 1PA3A 2WB9A 5ELAA 3R3EA 5FWGA 13GSA 5A5KA 1MTCA 4PTSA 4ZB9A 2CA8A 5DQSA 2WS2A 20GSA 3QAWA 4JEDA 4K0GA 4YH2A 3D0ZA 3IK9A 2AB6A 4Q5QA 4USSA 3Q18A 5J4UA 2PBJA 2X64A 4O92A 4OFMA 2WRTA 2GSQA 3UARA 1XW6A 5F06A 5IQYA 1GUMA 5GSTA 3AY8A 1B4PA 1F2EA 2OA7A 5ECNB 3GSTA 4ZBBA 4N0VA 4MDCA 1K0AA 1NHYA 3QAGA 1TU8A 2OADA 3UBKA 3G7JA 2F8FA 1BG5A 1TDIA 4L5LA 1K3OA 3ISOA 4EDZA 3TOTA 1C72A 4IJIA 4G10A 3P90A 3LXTA 2IMKA 5D9WA 1BAYA 1OYJA 1GSSA 1OE8A 4OMVA 1E6BA 1K0BA 3VI7A 3Q74A 1V40A 5D9XA 1LJRA 1UA5A 2DC5A 1PKWA 5ECKB 1EOGA 3F6FA 1XW5A 4KGIA 5LCZA 4YAPA 3GH6A 1FW1A 6GSUA 3HKRA 2YCDA 1HNAA 5DAKB 5DAKA 3CRUA 4PQHA 5F8BA 5ECSA 4HI7A 4IQ1A 5EY6A 3PR8A 2OACA 1M0UA 1USBA 4ECIA 5AIVA 6GSSA 4BVYB 3ERGA 5ECLB 4BVYA 1EV9A 2YV9A 3RBTA 1GSFA 4I97A 3IK7A 2VCXA 4WR5A 4RI7A 3F6DA 5A4WA 5DJMA 3FY7A 4FQUA 1N2AA 3GURA 2ON7A 1GNWA 4ZBAA 2VD0A 1ZL9A 18GSA 3CSHA 3ZMKA 2C3QA 3FYGA 4BVXB 4BVXA 5EVOA 1K3LA 3H1NA 1BYEA 1AQWA 4G9HA 6GSYA 2PMTA 5J41A 1VF3A 1YY7A 4Q5NA 3CSIA 2C4JA 3WD6A 2ON5A 3GSSA 3N5OA 5D9TA 3O3TA 6GSTA 4KH7A 4G0IA 1YDKA 4ECCA 3KMNA 2CZ2A 1XWGA 3EE2A 2R5GA 5AISA 4EC0A 4KE3A 8GSSA 4YQVA 1GSUA 1PMTA 3L0HA 4GCIA 4MK3A 2R6KA 2LJRA 4G19A 17GSA 4HZ2A 2V6KA 4OFTA 3ZFBA 5AN1A 2C3TA 4KDUA 4GSSA 2HRKB 1XWKA 2HRKA 1F3BA 2IMIA 10GSA 1PGTA 1AQVA 1M9BA 3DGQA 4JZQA 1PL2A 1BX9A 1K3YA 1MD4A 1M99A 2UZ8A 4E8HA 4PXOA 1R5AA 2FNOA 3CBUA 3LG6A 4MPFA 4PNFA 3ZMLA 1GSQA 2VCVA 3P8WA 4KF9A 2VCQA 2R4VA 3TOUA 5D9VA 1GWCA 3IBHA 3VWXA 2HRAA 3UBLA 1GSDA 1GNEA 3KMOA 1TW9A 3N9JA 4ZXGA 3C8EA 2GTUA 1GLPA 3FR9A 3PPUA 1YKCA 11GSA 1V2AA 5F05A 2HNLA 2GDRA 5HFKA 1GUKA 1U87A 5DDLA 3VPTA 6GSXA 4IELA 1PX6A
chains in the Genus database with same CATH superfamily
2HYXA 4NWYA 4CHSA 5L71A 3GKKA 2GSTA 3LJRA 1WJKA 2O87A 4MF7A 1S3AA 1Z6MA 4FH8A 3GL3A 5A1NB 5CAXA 2TIRA 5J5NA 5A34A 2GT5A 5D73A 3FR3A 1PN9A 2LTKA 4FXYP 2HZEB 1OAZA 1SKSB 4K0NA 1SKRB 4MABA 4IKHA 2H1LA 1S3RA 1DSBA 3M9KA 5CRHA 1ERTA 3IR4A 2LQQA 1SJIA 2PGTA 2D2ZA 3RAZA 5ECQB 2BTOT 1M7TA 3HY2A 5CRGA 2A2SA 3UAPA 3WT2A 3MYDA 1ZMAA 3IOSA 2VM1A 2OBKA 3C73A 4JE1A 4ZB7A 3BCKA 4IP6A 4RQRA 1VF4A 1UC7A 2CVBA 5LD0A 3HDCA 2XC2A 1BQ7A 1IYHA 3M8NA 1YF1A 2HFDA 1V9WA 3FZ9A 4HEA2 4POKA 5IPGA 4TKYA 4L8EA 5G5EA 4NMUA 1M2AA 2VUPA 2L57A 4F0BA 3TKSC 3DD3A 1T7PB 3APQA 3DMLA 4IBPA 2K8SA 2ZCTA 4XRDA 3TJGA 2CAIA 4KDYA 2HSYA 2H01A 4JBBA 4KW6A 4L5OA 2OE0A 2HI7A 4KX4A 1GUHA 4KSOA 1A8LA 1XPVA 1GTBA 5BMUA 2DKHA 3C71A 2CZ3A 3LSZA 5J3RA 3SBCA 3VI5A 4WETA 4TR4A 16GSA 5ECPB 2XPEA 1Z7RA 4P3YB 3VWVA 3ZVJA 3KH9A 2GLRA 1NHOA 2DMLA 1PX7A 1TK5B 2V1MA 4ZBDA 2PVOC 1K0DA 4ZL9A 3IRAA 5F07A 4QQ7A 2C0FA 5A1NA 3EU3A 3MDKA 3VWWA 4I5QA 4HU7A 4LMWA 4GDFA 2OE3A 3TU3B 2FY6A 3GV1A 2HZEA 3HJPA 22GSA 4ID0A 2DMMA 3W8JA 2B1LA 3A3TA 4AGSA 2H70A 1J9BA 4W66A 2IIYA 1LU4A 5EL8A 1XVWA 3HVSA 1AC1A 1SYXA 3M1GA 4WKWA 6GSVA 2K18A 1WPIA 3D21A 4XHMA 4EXJA 4J2FA 4V2MA 4TW5A 2L5LA 3BBYA 2K9FA 1GSEA 1ZOFA 4DSSB 1GSYA 1K0CA 2LJKA 3GNJA 1R7HA 2WDUA 4ACSA 1SU9A 3EURA 1OE7A 2LUSA 3RPNA 3HVVA 1QQ2A 2YOIA 2HSNA 1H75A 3E0UA 3O76A 5FHIA 5GZZB 5ELAA 2LNSA 3R3EA 1XIYA 1DBYA 2MZCA 4ZB9A 4YKGA 5DQSA 2VL2C 20GSA 4JEDA 4K0GA 1TP9A 3D0ZA 3GIXA 1YEXA 3Q18A 2PBJA 3GMFA 2X64A 4O92A 2WRTA 2GSQA 5F06A 3I9V2 3KD0A 1B4PA 1F2EA 2OA7A 5ECNB 2GGTA 5CREA 1O7UA 4ZBBA 2MMOA 4MDCA 5G1KA 1YF0A 3UBKA 3G7JA 4K1FA 3HXSA 4KCEA 4TXOB 5G30A 1XCCA 1QUWA 5JWOB 1OYJA 4OMVA 2VIMA 5G1LA 1V40A 4LL1B 2B5YA 1UA5A 2DC5A 2IJYA 1EOGA 2FWHA 4KGIA 5LCZA 1BEDA 4YAPA 5J4VA 1FW1A 3ZIJA 3HKRA 2MYGA 2YCDA 5DAKB 1CQGA 3CRUA 4PQHA 1TJDA 2N5AA 4HI7A 4KUNA 4I8BA 2OACA 4HS1A 1USBA 3KTBA 1F6MC 4BVYA 1EV9A 1XBSA 4MMMA 5KOXA 5CRWA 4ICYA 5HFGA 2VCXA 4RI7A 2CX3A 3A2VA 3FY7A 4FQUA 1N2AA 1YKAA 3RPPA 5CYYA 1UN2A 4NPBA 3CSHA 18GSA 3MWHA 2HRNA 5C00A 4G2EA 4BVXB 4BIKA 3L9SA 3H1NA 3RGBC 4MH3A 4JRRA 4N11A 1SK2A 3TCOA 3F4RA 1V98A 3U5RE 4KA0A 2C0DA 3TKPA 2MMAA 4WF4A 4KE3A 4YQVA 4XS1A 5D93A 4GQCA 2LJRA 4EVMA 2HE3A 1ERWA 1OC8A 3K8NA 2JACA 2HRKB 1U3AA 2IMIA 10GSA 1PGTA 3D4TA 4JZQA 1BX9A 3GX8A 1K3YA 3EC3A 3CBUA 3LG6A 4MPFA 1GSQA 5J40A 1B4QA 1F37A 4ZIJA 3N9JA 1I5GA 2V6OA 3TJFA 1PRXA 2A2PA 1GUKA 3MNGA 2NPBA 3VPTA 4QL7A 1GL8A 4IELA 2WW1A 2VLTA 4HZ4A 1QFNA 4CDOA 1G7OA 3I6AA 4HOJA 4TVEA 5DCGA 2DBCA 4V2LA 2RUEA 3QR6A 2H8LA 4LMVA 1QGVA 5DALA 4PNGA 4POMA 5A34B 2H1GA 3IAM2 3G7IA 1WP0A 3HVNA 3TRQA 2TRXA 2VCWA 2AHEA 2P31A 3L9UA 1K0MA 1W89A 1Y6EA 1S4BP 2R3XA 3GTUA 2LRTA 2C3NA 3IE3A 3KCMA 3A5WA 4IQAA 3KJYA 3I69A 3IPZA 2FGXA 6GSWA 1RQMA 4OCEA 1G0TA 1FHEA 1T8EB 1FOVA 2PN8A 3J7Yk 4KAEA 5ECOB 3QCPA 3IHGA 1PD21 3DYRA 2NTOA 2WJUA 2N5FA 3DVWA 2EFEA 2HQTA 2CAQA 1GLQA 2OBIA 1GRXA 3OR5A 3CTGA 1DE1A 3LQ7A 2IL3A 1XXUA 2I1UA 1X5CA 3TRXA 3IAS2 5A5HA 1SL0B 2LS5A 5A4VA 4PQIA 4Q5FA 12GSA 2H6YA 4MZBA 5D96A 3GKNA 1G7EA 2H73A 1KEBA 1OKTA 1SVLA 3UVHA 1OVNA 2EFCA 3CHXC 4KB3A 3IC4A 3PGTA 1A8YA 1T1VA 3D4MA 4DEJA 4MLYA 1XWBA 3D22A 4OO4A 2KHPA 2FWEA 2AJQB 5BMUB 1EP8A 3CSJA 2REMA 4BPYA 2AUVA 1XW9A 4PURA 4GTUA 4HQSA 2DJKA 3FHKA 1QK8A 1JZRA 1ML6A 4O5RA 1F9MA 2J9HA 2HSHA 2EIQA 4ISDA 1O8XA 4DVCA 2GQMA 5IMZA 1EV4A 3FR6A 1A2MA 1DE2A 1EWXA 1PKZA 5J4YA 1JZWA 2A4VA 14GSA 4WR4A 2DJ3A 3IHQA 1U88A 4G0KA 2QKEA 1IYIA 4L0UA 4EDYA 3UMAA 2CT6A 4FYUA 2WW3A 3UEMA 3LFLA 3NZNA 4FYBA 1J08A 3RHCA 4PI0C 1VF2A 2YV7A 1MDJA 3D5JA 1TI1A 4NHZA 3VPQA 3ERFA 3V1WA 3FRCA 3QDNA 2A2RA 1AXDA 2VCTA 2GVPA 4PI2C 4EF0A 1YQ1A 3HCZA 2XHFA 1H4OA 7GSSA 1NW2A 1ZGNA 2KOKA 4E8EA 1Y1UA 2WW0A 2R0PA 4AF2A 3DEXA 1ON4A 2QA2A 1TOFA 1A0RP 3LYKA 2HSNB 4V1Ag 3TRPA 5GSSA 3E9JB 2WB9A 1TRSA 5FWGA 5A5KA 5KN3A 2L5OA 5CO3A 1URMA 1X5EA 3ZYWA 3EPTA 4O32A 2FA4A 4YH2A 3IK9A 1O81A 3US3A 5ABRA 2WGRA 4USSA 2PU9C 1SK0A 2IMEA 3UARA 2DJ0A 1XW6A 5INYA 1VGLA 2MBSA 4OO5A 2O3EA 3GSTA 1T4YA 1K0AA 5HR2A 1N8JA 1BG5A 3ZL5A 1FAAA 4HU9A 2O8VB 4Z7XA 3TOTA 2GT6A 1C72A 4IJIA 3P90A 3KP8A 2DIYA 1BAYA 3VWUA 1XG8A 4WF5A 1OE8A 3WGXA 5B6MA 1T3BA 4PUFC 2YWIA 3Q74A 5D9XA 1WE0A 4D73A 5ECKB 2JADA 1Z5YE 3GH6A 3GFKA 2WZ9A 1ERUA 5H5SA 2VLVA 1I1IP 1BJXA 2MBTA 2X99A 2X4AA 5AIVA 6GSSA 4BVYB 3ERGA 3CQFA 3ERWA 3EMPA 3TJKA 2JZRA 3E3EA 1JHBA 2YV9A 1TK0B 3HMJG 2GZZA 5IO0A 1ERVA 1GSFA 3IK7A 2CV4A 5DJMA 1NM3A 5JCGA 5DBQA 2ON7A 2Z9SA 2N5BA 1E2YA 1ZL9A 3ZMKA 2B7JA 2C3QA 2LRNA 5EVOA 1TRUA 4MA9A 2WW2A 1XOAA 1A2LA 5IPHA 3TJJA 2PMTA 2VLUA 4Q5NA 2C4JA 2YWMA 3WD6A 4TR3A 2I3YA 4N10A 3TJBA 4G0IA 1YDKA 4ECCA 1FOHA 2OE1A 2R5GA 5KOWA 4EC0A 8GSSA 4E68A 3F9UA 3L78A 2H30A 2DIZA 2R6KA 3G9BA 4G19A 2DKIA 5IMAA 1QXHA 4HZ2A 1TXXA 3S9FA 2QC7A 2FUG2 3ZFBA 2J23A 1JFUA 1EGRA 2YZUA 1TXUA 1X9SB 3DGQA 3H79A 3LEFA 2H1DA 3H8QA 4PXOA 4GXZA 5CRDA 4KF9A 2WULA 2R0CA 3KH7A 2H66A 2G0FA 4GRFA 5D9VA 1GWCA 5CP1A 3VWXA 2HRAA 3HHVA 3KGKA 1TW9A 1O73A 1GLPA 3FR9A 1M2BA 1YKCA 1SJ6A 2HNLA 5ID2A 4JU5A 1ZYEA 3BCIA 5DDLA 4KNDA 1PX6A 4F0CA 4J57E 3R2QA 2CVKA 4HSCX 4ECBA 4TR1A 4MP4A 2NBSA 4GSTA 2AAWA 4X4JA 4XRAA 4ML1A 3U6VA 1N25A 4N3ZA 3TKQA 2X49A 2YP6A 4OD7A 4BL7A 5DALB 2IFQA 4AJ7A 3KXOA 5HQPA 3TKSE 5GAND 2GSSA 4PUAA 3ZLPA 1GTIA 4YKFA 5DJLA 1WIKA 1O6JA 1TI3A 2M80A 2PERA 4GQFA 3GTUB 3HJOA 5ECHB 5JWQB 4EO3A 2V2GA 2YWNA 1B9YC 3KM6A 1GULA 4K5RA 4PGTA 4NV5A 1EZKA 4O5UA 4ECJA 3ZRDA 2L6DA 1S3DA 4IN0A 4K6XA 2XBQA 1R4WA 2X8GA 1VF1A 4F03A 1Z3EA 2H0GA 4AKIA 5B8AA 2H6ZA 2IMFA 1M3JA 3J7Yb 4Z2TA 2FCHA 9GSSA 5HR3A 1JLVA 1M3IA 3QAVA 5DVBA 2VCZA 3UVTA 2P5QA 1EOHA 3RFRC 2YPMA 5A5HB 3FEUA 2HSMA 2C8UA 4K8MA 2FHEA 1Q4JA 3IC8A 1GH2A 2IPAA 3GN3A 1M9AA 4F82A 1K0NA 1HQOA 3KTLA 3F4SA 4NXIA 3M0FA 1A24A 1X9WB 4X0XA 2DSAA 3M3MA 3FW2A 5COHA 1JZDA 4LA1A 5IO2A 3A2WA 1Z9HA 2H0HA 2WFCA 4O7HA 2VO4A 4EIPA 3EU4A 4MZWA 1G6YA 1YZXA 3I43A 2H1AA 3HJMA 1O8WA 4ULXA 1PL1A 2H75A 5GAPD 2LSTA 1JLWA 2JZTA 3GKXA 4POBA 3ZFLA 4CY8A 4ZL7A 3LXZA 2WVXA 2O36A 4RI6A 5AGYA 2R37A 2PVQA 4MPGA 1FB6A 3LORA 1U6TA 5HFIA 3GA4A 4NAXA 3FZAA 1SVOA 3QPMA 2TRCP 4V2NA 2X8HA 3JCML 3ZZXA 2HZFA 5IMDA 1AW9A 3D6IA 2MMZA 2JL4A 4BA7A 2RUFA 1TRVA 4JR6A 2O89A 1B8XA 2H72A 2GSRA 4XCSA 1BF5A 4IW9A 2IMDA 4HDEA 4MJCA 1B48A 1MDIA 1DUGA 2OKAA 4TRXA 2B6MA 5FT3A 1X9MB 3NIVA 1SL2B 2H76A 4EIQA 3P7XA 4TN8A 3LGCA 2LJAA 2YN1A 2WCIA 1FB0A 4GF0A 2YWOA 1GP1A 4J56E 1F3AA 5G5FA 3VK9A 4K9ZA 1AAZA 3Q19A 4A5PA 2LEGA 3ZVJD 3WGEA 2XBIA 4TOPA 2YNXA 3KZQA 2PPTA 5ECRB 3EMXA 3HVXA 2HT9A 2C0EA 4PHZC 3CYNA 4ZILA 3ZIVA 2FWFA 4PTSA 1Z6NA 3QAWA 4AKGA 4IJ3A 3H4KA 1SD9A 4LL4B 2IN3A 3PH9A 3VFIA 5J4UA 3W6GA 4OFMA 4EL1A 2B5EA 1XWCA 1GUMA 5GSTA 1ZYQB 4K2XA 1AUCA 4N0VA 2KUCA 1TU8A 2O5VA 1TDIA 4L5LA 4HUAA 3KEBA 1THXA 1K3OA 4EDZA 2GZYA 5J47A 3LXTA 2RLIA 5D9WA 4XS4A 4QMKA 1GSSA 1PQNA 4H86A 1E6BA 1XWAA 1TTZA 3RHBA 4D73B 1LJRA 1XW5A 2FA8A 3A5IA 2QA1A 3IDVA 4Z2UA 5LNKe 1HNAA 2DJ1A 4AKHA 2AV4A 1SVMA 3PINA 3TKRA 2K8VA 4LLRA 4XS6A 5EY6A 3PR8A 2R0GA 1M0UA 4ECIA 5ECLB 2K6VA 4XIHA 2KP1A 3RBTA 1OC9A 4I97A 1EP7A 4WR5A 3M9JA 4MCUA 4N0ZA 2C1YA 3IA1A 4RUVA 1WOUA 3GURA 1FO5A 1GNWA 3IV4A 5HR1A 3Q6OA 1WWJA 1BYEA 1AQWA 2VKZG 2B5XA 5D8IA 6GSYA 4X1UA 3CSIA 2QSIA 3GSSA 3N5OA 3O3TA 3HZ8A 4HQZA 3MSZA 2WZSA 3QD9A 2B3SA 2CZ2A 5DQYA 1XWGA 5AISA 1KTEA 5JWRB 2I9HA 3L0HA 1PMTA 1I9DA 2H6XA 3GL5A 1HYUA 3ME8A 3ZITA 2YJ7A 17GSA 1JZOA 1A23A 5C04A 3TUEA 4OFTA 1SD8A 2C3TA 3UOMA 4KDUA 4GSSA 2NVLA 2HXKA 1M9BA 3F3QA 1MD4A 1ST9A 1O85A 2MMNA 2VCVA 3P8WA 2G2QA 2VCQA 3DVXA 2R2JA 3FMWA 1ZYNA 1PFOA 2R4VA 3ZTLA 3TOUA 3IBHA 2E7PA 3ZREA 3UBLA 4ZL8A 1ZZYA 4BWSA 4ZXGA 3PPUA 4CW9A 11GSA 1SENA 1V2AA 5ID2B 3F0IA 2GDRA 1SL1B 4WXTA 4X43A 1VRSD 3FKFA 1MDKA 2ES7A 4MNNA 1GTUA 2DLXA 4GSNA 3GH9A 1TU7A 4JR4A 3QOUA 2CX4A 4TR1B 3VURA 1U3IA 5E4WA 5B7CA 1XFLA 1HD2A 3HZ4A 2FLSA 4BL7B 2IFQB 1Q98A 1GTAA 3L4NA 2PUKC 4ZB8A 3ME7A 3DKSA 5JCWA 4IGJA 2F9SA 19GSA 2H0IA 2H74A 2L4QA 1HNBA 2P0GA 2YANA 5IOWA 2L4CA 1XVQA 1EEJA 2YJHA 3CXGA 2OT3A 3W8SA 4ILFA 4PX1A 5KN0A 3VLNA 4RQXA 2VL9A 3QFBC 1AIUA 1OKDA 3EINA 1A0FA 5ELGA 1RW1A 1SK1A 2ZUPA 4K2DA 3WT1A 4NHWA 1ACVA 2V32A 4ZB6A 3F3RA 1M2DA 4KDXA 1YJ6A 5B6NA 4IHUA 2E2MA 3UIWA 2HRFA 1KBNA 1WRYA 2L59A 1RK4A 3GUSA 2WVYA 4I6XA 3FK8A 4WBRD 2BMXA 5IOXA 2HSMB 5H5RA 3LWAA 4K5SA 1EGOA 4Q5RA 5KEJA 1PSQA 4FIWA 5F0GA 4F9ZA 1G6WA 2F3MA 2KLXA 1ILOA 1EEMA 4G0LA 3L9VA 3UJ1A 4GWRA 3MIXA 4V1Ap 3HA9A 3WYWA 3MAKA 5E59A 3F8UA 1Z7PA 4POLA 4AI6A 3GYKA 1OC3A 4YAVA 5J9CA 5JCUA 2C80A 1V58A 5IIZA 2AYTA 3KP9A 2E0QA 4PQ1A 3BOAA 4MJAA 1SKWB 2VD1A 5ECMB 3F63A 2WVXB 4F2IA 1K0OA 4MF6A 2ZNMA 3GX0A 3LW9A 3GKMA 2VL3A 4IVFA 5G2ZA 3EWLA 1FG4A 4MZCA 4HJMA 4CY6A 4K7NA 1LBKA 3CTFA 2H71A 3EYTA 3O6TA 3C7MA 5BRTA 1AQXA 3C1SA 3CRTA 3SWLA 3LYPA 1CQHA 3G7YA 1BG1A 4WBJA 2XPDA 3EVIA 1THOA 2H1BA 4OCFA 2LV3A 4GLTA 2JU5A 1HNCA 4HJ2A 5A4UA 3APSA 2RM5A 1FVKA 1KNGA 1MD3A 2M72A 2DJJA 4DSRA 2QGVA 4MF5A 2X8CA 3A2XA 2CVDA 2VOCA 2JSYA 1YEPA 5IM9A 2C0GA 3FZ4A 3DWVA 4MJBA 4EKZA 2NDOA 2A4HA 5B8BA 4EE0A 2LKUA 4DSSA 1SJZA 2O85A 3NOFA 3TGZA 5HR0A 1NSWA 3BD2A 5ECIB 4IS0A 3QMXA 1S3CA 1R26A 3F4TA 3HYPA 5AIXA 2GQKA 3GHAA 4YQMA 1YVLA 4KSMA 4YQUA 4G01A 4OFNA 2JZSA 4TR0A 1PA3A 3ED3A 4KCAA 13GSA 1R5PA 2UV8G 2RIIA 1MTCA 2RM6A 1ABAA 2E2GA 2CA8A 2WS2A 5KN2A 3H93A 4OWYA 1SYRA 5IMVA 5CNWA 2VM2A 2AB6A 4Q5QA 1A2JA 2IWTA 1ZYPA 4MH2A 5IQYA 3TKSA 3TB2A 3GRXA 2KP2A 3AY8A 2ALBA 5G31A 3FZ5A 3HD5A 2WVZA 1NHYA 3QAGA 2OADA 2F8FA 3WGDA 3DRNA 4XTSA 3ISOA 4TXOA 3DXBA 4G10A 3DIEA 1Y25A 4DSQA 2IMKA 1UVZA 4XS4B 4IP1A 1X5DA 3UL3A 4FO5A 1T00A 2OJLA 1K0BA 3VI7A 5ENUA 2FD3A 2EC4A 1PKWA 1XZOA 3F6FA 2GZPA 1W4VA 3TDGA 6GSUA 5J9BA 3CWGA 2LQOA 5DAKA 5F8BA 5ECSA 4IQ1A 2B7KA 4FYCA 4L0WA 4AJ8A 2V41A 2EIOA 3C1RA 2DJ2A 2PWJA 1MEKA 2I81A 5H5QA 2H19A 2FWGA 1OC9B 4EUYA 1FVJA 3RDWA 3F6DA 5A4WA 2LNTA 1QMVA 1ZCPA 2P5RA 4ZBAA 2VD0A 1T4ZA 4Z2RA 2JSZA 3FYGA 4BVXA 2F8AA 1K3LA 2I4AA 4G9HA 1YEWC 2EFHA 5J41A 3BJ5A 1VF3A 1YY7A 4AJ6A 1B9XC 1TRWA 2ON5A 4NV2A 5D9TA 1TK8B 1V57A 6GSTA 4KH7A 5EPFA 3CMIA 4N30A 3KMNA 5DCHA 3APOA 3EE2A 4MJEA 4O5QA 1GSUA 4GCIA 1X0RA 4MK3A 4AKXB 2F51A 2CQ9A 2EFDA 2GS3A 1XOBA 2V6KA 2YZHA 5AN1A 3IXRA 4K7IA 2VL2A 1XWKA 2HRKA 1F3BA 1AQVA 2LRCA 2M46A 1PL2A 4TXVA 1M99A 2UZ8A 2B1KA 5IMCA 5IMFA 2EIRA 4E8HA 5KN1A 1R5AA 2FNOA 2O7KA 2BJXA 4PNFA 3P2AA 1TKDB 3ZMLA 4QL9A 3KIJA 1J0FA 4BWQA 1PN0A 3QFAC 1GSDA 2GQLA 1GNEA 3KMOA 2HLSA 3C8EA 2GTUA 4ML6A 4I2TA 4K7OA 2VAFA 5F05A 1WMJA 4I2UA 5HFKA 4WEYA 2L6CA 1U87A 6GSXA
chains in the Genus database with same CATH topology
2HYXA 4NWYA 4CHSA 5L71A 3GKKA 2GSTA 3LJRA 1WJKA 2O87A 4MF7A 1S3AA 1Z6MA 4FH8A 3GL3A 5A1NB 5CAXA 2TIRA 5J5NA 5A34A 2GT5A 5D73A 3FR3A 1PN9A 2LTKA 2HZEB 1OAZA 1SKSB 4K0NA 1SKRB 4MABA 4IKHA 2H1LA 1DSBA 3M9KA 5CRHA 1ERTA 3IR4A 2LQQA 1SJIA 2PGTA 2D2ZA 3RAZA 5ECQB 2BTOT 1M7TA 3HY2A 5CRGA 2A2SA 3UAPA 3WT2A 3MYDA 1ZMAA 3IOSA 2VM1A 2OBKA 3C73A 4JE1A 4ZB7A 3BCKA 4IP6A 4RQRA 1VF4A 1UC7A 2CVBA 5LD0A 3HDCA 2XC2A 1BQ7A 1IYHA 3M8NA 1YF1A 2HFDA 1V9WA 3FZ9A 4HEA2 4POKA 5IPGA 4TKYA 4L8EA 5G5EA 4NMUA 1M2AA 2VUPA 2L57A 4F0BA 3TKSC 3DD3A 1T7PB 3APQA 3DMLA 4IBPA 2K8SA 2ZCTA 4XRDA 3TJGA 2CAIA 4KDYA 2HSYA 2H01A 4JBBA 4KW6A 4L5OA 2OE0A 2HI7A 4KX4A 1GUHA 4KSOA 1A8LA 1XPVA 1GTBA 5BMUA 2DKHA 3C71A 2CZ3A 3LSZA 5J3RA 3SBCA 3VI5A 4WETA 4TR4A 16GSA 5ECPB 2XPEA 1Z7RA 4P3YB 3VWVA 3ZVJA 3KH9A 2GLRA 1NHOA 2DMLA 1PX7A 1TK5B 2V1MA 4ZBDA 2PVOC 1K0DA 4ZL9A 3IRAA 5F07A 4QQ7A 2C0FA 5A1NA 3EU3A 3MDKA 3VWWA 4I5QA 4HU7A 4LMWA 4GDFA 2OE3A 3TU3B 2FY6A 3GV1A 2HZEA 3HJPA 22GSA 4ID0A 2DMMA 3W8JA 2B1LA 3A3TA 4AGSA 2H70A 1J9BA 4W66A 2IIYA 1LU4A 5EL8A 1XVWA 3HVSA 1AC1A 1SYXA 3M1GA 4WKWA 6GSVA 2K18A 1WPIA 3D21A 4XHMA 4EXJA 4J2FA 4V2MA 4TW5A 2L5LA 3BBYA 2K9FA 1GSEA 1ZOFA 4DSSB 1GSYA 1K0CA 2LJKA 3GNJA 1R7HA 2WDUA 4ACSA 1SU9A 3EURA 1OE7A 2LUSA 3RPNA 3HVVA 1QQ2A 2YOIA 2HSNA 1H75A 3E0UA 3O76A 5FHIA 5GZZB 5ELAA 2LNSA 3R3EA 1XIYA 1DBYA 2MZCA 4ZB9A 4YKGA 5DQSA 2VL2C 20GSA 4JEDA 4K0GA 1TP9A 3D0ZA 3GIXA 1YEXA 3Q18A 2PBJA 3GMFA 2X64A 4O92A 2WRTA 2GSQA 5F06A 3I9V2 3KD0A 1B4PA 1F2EA 2OA7A 5ECNB 2GGTA 5CREA 1O7UA 4ZBBA 2MMOA 4MDCA 5G1KA 1YF0A 3UBKA 3G7JA 4K1FA 3HXSA 4KCEA 4TXOB 5G30A 1XCCA 1QUWA 5JWOB 1OYJA 4OMVA 2VIMA 5G1LA 1V40A 4LL1B 2B5YA 1UA5A 2DC5A 2IJYA 1EOGA 2FWHA 4KGIA 5LCZA 1BEDA 4YAPA 5J4VA 1FW1A 3ZIJA 3HKRA 2MYGA 2YCDA 5DAKB 1CQGA 3CRUA 4PQHA 1TJDA 2N5AA 4HI7A 4KUNA 4I8BA 2OACA 4HS1A 1USBA 3KTBA 1F6MC 4BVYA 1EV9A 1XBSA 4MMMA 5KOXA 5CRWA 4ICYA 5HFGA 2VCXA 4RI7A 2CX3A 3A2VA 3FY7A 4FQUA 1N2AA 1YKAA 3RPPA 5CYYA 1UN2A 4NPBA 3CSHA 3MWHA 18GSA 2HRNA 5C00A 4G2EA 4BVXB 3L9SA 3H1NA 4MH3A 4JRRA 4N11A 1SK2A 3TCOA 3F4RA 1V98A 3U5RE 4KA0A 2C0DA 3TKPA 2MMAA 4WF4A 4KE3A 4YQVA 4XS1A 5D93A 4GQCA 2LJRA 4EVMA 2HE3A 1ERWA 1OC8A 3K8NA 2JACA 2HRKB 1U3AA 2IMIA 10GSA 1PGTA 3D4TA 4JZQA 1BX9A 3GX8A 1K3YA 3EC3A 3CBUA 3LG6A 4MPFA 1GSQA 5J40A 1B4QA 1F37A 4ZIJA 3N9JA 1I5GA 2V6OA 3TJFA 1PRXA 2A2PA 1GUKA 3MNGA 2NPBA 3VPTA 4QL7A 1GL8A 4IELA 2VLTA 4HZ4A 1QFNA 4CDOA 1G7OA 3I6AA 4HOJA 4TVEA 5DCGA 2DBCA 4V2LA 2RUEA 3QR6A 2H8LA 4LMVA 1QGVA 5DALA 4PNGA 4POMA 5A34B 2H1GA 3IAM2 3G7IA 1WP0A 3TRQA 2TRXA 2VCWA 2AHEA 2P31A 3L9UA 1K0MA 1W89A 1Y6EA 2R3XA 3GTUA 2LRTA 2C3NA 3IE3A 3KCMA 3A5WA 4IQAA 3KJYA 3I69A 3IPZA 2FGXA 6GSWA 1RQMA 4OCEA 1G0TA 1FHEA 1T8EB 1FOVA 2PN8A 3J7Yk 4KAEA 5ECOB 3QCPA 3IHGA 1PD21 3DYRA 2NTOA 2WJUA 2N5FA 3DVWA 2EFEA 2HQTA 2CAQA 1GLQA 2OBIA 1GRXA 3OR5A 3CTGA 1DE1A 3LQ7A 2IL3A 1XXUA 2I1UA 1X5CA 3TRXA 3IAS2 5A5HA 1SL0B 2LS5A 5A4VA 4PQIA 4Q5FA 12GSA 2H6YA 4MZBA 5D96A 3GKNA 1G7EA 2H73A 1KEBA 1OKTA 1SVLA 3UVHA 1OVNA 2EFCA 4KB3A 3IC4A 3PGTA 1A8YA 1T1VA 3D4MA 4DEJA 4MLYA 1XWBA 3D22A 4OO4A 2KHPA 2FWEA 2AJQB 5BMUB 1EP8A 3CSJA 2REMA 4BPYA 2AUVA 1XW9A 4PURA 4GTUA 4HQSA 2DJKA 3FHKA 1QK8A 1JZRA 1ML6A 4O5RA 1F9MA 2J9HA 2HSHA 2EIQA 4ISDA 1O8XA 4DVCA 2GQMA 5IMZA 1EV4A 3FR6A 1A2MA 1DE2A 1EWXA 1PKZA 5J4YA 1JZWA 2A4VA 14GSA 4WR4A 2DJ3A 3IHQA 1U88A 4G0KA 2QKEA 1IYIA 4L0UA 4EDYA 3UMAA 2CT6A 4FYUA 3UEMA 3LFLA 3NZNA 4FYBA 1J08A 3RHCA 1VF2A 2YV7A 1MDJA 3D5JA 1TI1A 4NHZA 3VPQA 3ERFA 3V1WA 3FRCA 3QDNA 2A2RA 1AXDA 2VCTA 2GVPA 4EF0A 1YQ1A 3HCZA 2XHFA 1H4OA 7GSSA 1NW2A 1ZGNA 2KOKA 4E8EA 1Y1UA 2R0PA 4AF2A 3DEXA 1ON4A 2QA2A 1TOFA 1A0RP 3LYKA 2HSNB 4V1Ag 3TRPA 5GSSA 3E9JB 2WB9A 1TRSA 5FWGA 5A5KA 5KN3A 2L5OA 5CO3A 1URMA 1X5EA 3ZYWA 3EPTA 4O32A 2FA4A 4YH2A 3IK9A 1O81A 3US3A 5ABRA 2WGRA 4USSA 2PU9C 1SK0A 2IMEA 3UARA 2DJ0A 1XW6A 5INYA 1VGLA 2MBSA 4OO5A 3GSTA 1T4YA 1K0AA 5HR2A 1N8JA 1BG5A 3ZL5A 1FAAA 4HU9A 2O8VB 4Z7XA 3TOTA 2GT6A 1C72A 4IJIA 3P90A 3KP8A 2DIYA 1BAYA 3VWUA 4WF5A 1OE8A 3WGXA 5B6MA 1T3BA 4PUFC 2YWIA 3Q74A 5D9XA 1WE0A 4D73A 5ECKB 2JADA 1Z5YE 3GH6A 3GFKA 2WZ9A 1ERUA 5H5SA 2VLVA 1BJXA 2MBTA 2X99A 2X4AA 5AIVA 6GSSA 4BVYB 3ERGA 3ERWA 3EMPA 3TJKA 2JZRA 3E3EA 1JHBA 2YV9A 1TK0B 3HMJG 2GZZA 5IO0A 1ERVA 1GSFA 3IK7A 2CV4A 5DJMA 1NM3A 5JCGA 5DBQA 2ON7A 2Z9SA 2N5BA 1E2YA 1ZL9A 3ZMKA 2B7JA 2C3QA 2LRNA 5EVOA 1TRUA 4MA9A 1XOAA 1A2LA 5IPHA 3TJJA 2PMTA 2VLUA 4Q5NA 2C4JA 2YWMA 3WD6A 4TR3A 2I3YA 4N10A 3TJBA 4G0IA 1YDKA 4ECCA 1FOHA 2OE1A 2R5GA 5KOWA 4EC0A 8GSSA 4E68A 3F9UA 3L78A 2H30A 2DIZA 2R6KA 3G9BA 4G19A 2DKIA 5IMAA 1QXHA 4HZ2A 1TXXA 3S9FA 2QC7A 2FUG2 3ZFBA 2J23A 1JFUA 1EGRA 2YZUA 1TXUA 1X9SB 3DGQA 3H79A 3LEFA 2H1DA 3H8QA 4PXOA 4GXZA 5CRDA 4KF9A 2WULA 2R0CA 3KH7A 2H66A 2G0FA 4GRFA 5D9VA 1GWCA 5CP1A 3VWXA 2HRAA 3HHVA 3KGKA 1TW9A 1O73A 1GLPA 3FR9A 1M2BA 1YKCA 1SJ6A 2HNLA 5ID2A 4JU5A 1ZYEA 3BCIA 5DDLA 4KNDA 1PX6A 4F0CA 4J57E 3R2QA 2CVKA 4TR1A 4ECBA 4MP4A 2NBSA 4GSTA 2AAWA 4X4JA 4XRAA 4ML1A 3U6VA 1N25A 4N3ZA 3TKQA 2X49A 2YP6A 4OD7A 4BL7A 5DALB 2IFQA 4AJ7A 3KXOA 5HQPA 3TKSE 5GAND 2GSSA 4PUAA 3ZLPA 1GTIA 4YKFA 5DJLA 1WIKA 1O6JA 1TI3A 2M80A 2PERA 4GQFA 3GTUB 3HJOA 5ECHB 5JWQB 4EO3A 2V2GA 2YWNA 1B9YC 3KM6A 1GULA 4K5RA 4PGTA 4NV5A 1EZKA 4O5UA 4ECJA 3ZRDA 2L6DA 1S3DA 4IN0A 4K6XA 2XBQA 1R4WA 2X8GA 1VF1A 4F03A 1Z3EA 2H0GA 4AKIA 5B8AA 2H6ZA 2IMFA 3J7Yb 4Z2TA 2FCHA 9GSSA 5HR3A 1JLVA 3QAVA 5DVBA 2VCZA 3UVTA 2P5QA 1EOHA 2YPMA 5A5HB 3FEUA 2HSMA 2C8UA 4K8MA 2FHEA 1Q4JA 3IC8A 1GH2A 2IPAA 3GN3A 1M9AA 4F82A 1K0NA 1HQOA 3KTLA 3F4SA 4NXIA 3M0FA 1A24A 1X9WB 4X0XA 3M3MA 2DSAA 3FW2A 5COHA 1JZDA 4LA1A 5IO2A 3A2WA 1Z9HA 2H0HA 2WFCA 4O7HA 2VO4A 4EIPA 3EU4A 4MZWA 1G6YA 1YZXA 3I43A 2H1AA 3HJMA 1O8WA 4ULXA 1PL1A 2H75A 5GAPD 2LSTA 1JLWA 2JZTA 3GKXA 4POBA 3ZFLA 4CY8A 4ZL7A 3LXZA 4RI6A 5AGYA 2R37A 2PVQA 4MPGA 1FB6A 3LORA 1U6TA 5HFIA 3GA4A 4NAXA 3FZAA 1SVOA 3QPMA 2TRCP 4V2NA 2X8HA 3JCML 3ZZXA 2HZFA 5IMDA 1AW9A 3D6IA 2MMZA 2JL4A 4BA7A 2RUFA 1TRVA 4JR6A 2O89A 1B8XA 2H72A 2GSRA 4XCSA 1BF5A 4IW9A 2IMDA 4HDEA 4MJCA 1B48A 1MDIA 1DUGA 2OKAA 4TRXA 2B6MA 5FT3A 1X9MB 3NIVA 1SL2B 2H76A 4EIQA 3P7XA 4TN8A 3LGCA 2LJAA 2YN1A 2WCIA 1FB0A 4GF0A 2YWOA 1GP1A 4J56E 1F3AA 5G5FA 3VK9A 4K9ZA 1AAZA 3Q19A 4A5PA 2LEGA 3ZVJD 3WGEA 2XBIA 4TOPA 2YNXA 3KZQA 2PPTA 5ECRB 3EMXA 3HVXA 2HT9A 2C0EA 3CYNA 4ZILA 3ZIVA 2FWFA 4PTSA 1Z6NA 3QAWA 4AKGA 4IJ3A 3H4KA 1SD9A 4LL4B 2IN3A 3PH9A 3VFIA 5J4UA 3W6GA 4OFMA 4EL1A 2B5EA 1XWCA 1GUMA 5GSTA 1ZYQB 4K2XA 1AUCA 4N0VA 2KUCA 1TU8A 2O5VA 1TDIA 4L5LA 4HUAA 3KEBA 1THXA 1K3OA 4EDZA 2GZYA 5J47A 3LXTA 2RLIA 5D9WA 4XS4A 4QMKA 1GSSA 1PQNA 4H86A 1E6BA 1XWAA 1TTZA 3RHBA 4D73B 1LJRA 1XW5A 2FA8A 3A5IA 2QA1A 3IDVA 4Z2UA 5LNKe 1HNAA 2DJ1A 4AKHA 2AV4A 1SVMA 3PINA 3TKRA 2K8VA 4LLRA 4XS6A 5EY6A 3PR8A 2R0GA 1M0UA 4ECIA 5ECLB 2K6VA 4XIHA 2KP1A 3RBTA 1OC9A 4I97A 1EP7A 4WR5A 3M9JA 4MCUA 4N0ZA 2C1YA 3IA1A 4RUVA 1WOUA 3GURA 1FO5A 1GNWA 3IV4A 5HR1A 3Q6OA 1WWJA 1BYEA 1AQWA 2VKZG 2B5XA 5D8IA 6GSYA 4X1UA 3CSIA 2QSIA 3GSSA 3N5OA 3O3TA 3HZ8A 4HQZA 3MSZA 3QD9A 2B3SA 2CZ2A 5DQYA 1XWGA 5AISA 1KTEA 5JWRB 2I9HA 3L0HA 1PMTA 1I9DA 2H6XA 3GL5A 3ME8A 1HYUA 3ZITA 2YJ7A 17GSA 1JZOA 1A23A 5C04A 3TUEA 4OFTA 1SD8A 2C3TA 3UOMA 4KDUA 4GSSA 2NVLA 2HXKA 1M9BA 3F3QA 1MD4A 1ST9A 1O85A 2MMNA 2VCVA 3P8WA 2G2QA 2VCQA 3DVXA 2R2JA 3FMWA 1ZYNA 2R4VA 3ZTLA 3TOUA 3IBHA 2E7PA 3ZREA 3UBLA 4ZL8A 1ZZYA 4BWSA 4ZXGA 3PPUA 4CW9A 11GSA 1SENA 1V2AA 5ID2B 3F0IA 2GDRA 1SL1B 4WXTA 4X43A 1VRSD 3FKFA 1MDKA 2ES7A 4MNNA 1GTUA 2DLXA 4GSNA 3GH9A 1TU7A 4JR4A 3QOUA 2CX4A 4TR1B 3VURA 1U3IA 5E4WA 5B7CA 1XFLA 1HD2A 3HZ4A 2FLSA 4BL7B 2IFQB 1Q98A 1GTAA 3L4NA 2PUKC 4ZB8A 3ME7A 3DKSA 5JCWA 4IGJA 2F9SA 19GSA 2H0IA 2H74A 2L4QA 1HNBA 2P0GA 2YANA 5IOWA 2L4CA 1XVQA 1EEJA 2YJHA 3CXGA 2OT3A 3W8SA 4ILFA 4PX1A 5KN0A 3VLNA 4RQXA 2VL9A 3QFBC 1AIUA 1OKDA 3EINA 1A0FA 5ELGA 1RW1A 1SK1A 2ZUPA 4K2DA 3WT1A 4NHWA 1ACVA 2V32A 4ZB6A 3F3RA 1M2DA 4KDXA 1YJ6A 5B6NA 4IHUA 2E2MA 3UIWA 2HRFA 1KBNA 1WRYA 2L59A 1RK4A 3GUSA 4I6XA 3FK8A 4WBRD 2BMXA 5IOXA 2HSMB 5H5RA 3LWAA 4K5SA 1EGOA 4Q5RA 5KEJA 1PSQA 4FIWA 5F0GA 4F9ZA 1G6WA 2F3MA 2KLXA 1ILOA 1EEMA 4G0LA 3L9VA 3UJ1A 4GWRA 3MIXA 4V1Ap 3HA9A 3WYWA 3MAKA 5E59A 3F8UA 1Z7PA 4POLA 4AI6A 3GYKA 1OC3A 4YAVA 5J9CA 5JCUA 2C80A 1V58A 5IIZA 2AYTA 3KP9A 2E0QA 4PQ1A 3BOAA 4MJAA 1SKWB 2VD1A 5ECMB 3F63A 4F2IA 1K0OA 4MF6A 2ZNMA 3GX0A 3LW9A 3GKMA 2VL3A 4IVFA 5G2ZA 3EWLA 1FG4A 4MZCA 4HJMA 4CY6A 4K7NA 1LBKA 3CTFA 2H71A 3EYTA 3O6TA 3C7MA 5BRTA 1AQXA 3C1SA 3CRTA 3SWLA 3LYPA 1CQHA 3G7YA 1BG1A 4WBJA 2XPDA 3EVIA 1THOA 2H1BA 4OCFA 2LV3A 4GLTA 2JU5A 1HNCA 4HJ2A 5A4UA 3APSA 2RM5A 1FVKA 1KNGA 1MD3A 2M72A 2DJJA 4DSRA 2QGVA 4MF5A 2X8CA 3A2XA 2CVDA 2VOCA 2JSYA 1YEPA 5IM9A 2C0GA 3FZ4A 3DWVA 4MJBA 4EKZA 2NDOA 2A4HA 5B8BA 4EE0A 2LKUA 4DSSA 1SJZA 2O85A 3NOFA 3TGZA 5HR0A 1NSWA 3BD2A 5ECIB 4IS0A 3QMXA 1S3CA 1R26A 3F4TA 3HYPA 5AIXA 2GQKA 3GHAA 4YQMA 1YVLA 4KSMA 4YQUA 4G01A 4OFNA 2JZSA 4TR0A 1PA3A 3ED3A 4KCAA 13GSA 1R5PA 2UV8G 2RIIA 1MTCA 2RM6A 1ABAA 2E2GA 2CA8A 2WS2A 5KN2A 3H93A 4OWYA 1SYRA 5IMVA 5CNWA 2VM2A 2AB6A 4Q5QA 1A2JA 2IWTA 1ZYPA 4MH2A 5IQYA 3TKSA 3TB2A 3GRXA 2KP2A 3AY8A 2ALBA 5G31A 3FZ5A 3HD5A 1NHYA 3QAGA 2OADA 2F8FA 3WGDA 3DRNA 4XTSA 3ISOA 4TXOA 3DXBA 4G10A 3DIEA 1Y25A 4DSQA 2IMKA 1UVZA 4XS4B 4IP1A 1X5DA 3UL3A 4FO5A 1T00A 2OJLA 1K0BA 3VI7A 5ENUA 2FD3A 2EC4A 1PKWA 1XZOA 3F6FA 2GZPA 1W4VA 3TDGA 6GSUA 5J9BA 3CWGA 2LQOA 5DAKA 5F8BA 5ECSA 4IQ1A 2B7KA 4FYCA 4L0WA 4AJ8A 2V41A 2EIOA 3C1RA 2DJ2A 2PWJA 1MEKA 2I81A 5H5QA 2H19A 2FWGA 1OC9B 4EUYA 1FVJA 3RDWA 3F6DA 5A4WA 2LNTA 1QMVA 1ZCPA 2P5RA 4ZBAA 2VD0A 1T4ZA 4Z2RA 2JSZA 3FYGA 4BVXA 2F8AA 1K3LA 2I4AA 4G9HA 2EFHA 5J41A 3BJ5A 1VF3A 1YY7A 4AJ6A 1B9XC 1TRWA 2ON5A 4NV2A 5D9TA 1TK8B 1V57A 6GSTA 4KH7A 5EPFA 3CMIA 4N30A 3KMNA 5DCHA 3APOA 3EE2A 4MJEA 4O5QA 1GSUA 4GCIA 1X0RA 4MK3A 4AKXB 2F51A 2CQ9A 2EFDA 2GS3A 1XOBA 2V6KA 2YZHA 5AN1A 3IXRA 4K7IA 2VL2A 1XWKA 2HRKA 1F3BA 1AQVA 2LRCA 2M46A 1PL2A 4TXVA 1M99A 2UZ8A 2B1KA 5IMCA 5IMFA 2EIRA 4E8HA 5KN1A 1R5AA 2FNOA 2O7KA 2BJXA 4PNFA 3P2AA 1TKDB 3ZMLA 4QL9A 3KIJA 1J0FA 4BWQA 1PN0A 3QFAC 1GSDA 2GQLA 1GNEA 3KMOA 2HLSA 3C8EA 2GTUA 4ML6A 4I2TA 4K7OA 2VAFA 5F05A 1WMJA 4I2UA 5HFKA 4WEYA 2L6CA 1U87A 6GSXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F0C A;  1GTU A;  4CHS A;  4GSN A;  1TU7 A;  3R2Q A;  4HZ4 A;  2GST A;  3LJR A;  4ECB A;  4MP4 A;  3VUR A;  1U3I A;  4MF7 A;  5B7C A;  4GST A;  1G7O A;  2AAW A;  3I6A A;  4HOJ A;  3U6V A;  5DCG A;  4BL7 B;  4BL7 A;  3QR6 A;  4LMV A;  5DAL B;  1GTA A;  5DAL A;  3KXO A;  4PNG A;  5J5N A;  3G7I A;  2GSS A;  4PUA A;  5D73 A;  1GTI A;  4ZB8 A;  3FR3 A;  5JCW A;  5DJL A;  1PN9 A;  4IGJ A;  2VCW A;  19GS A;  2AHE A;  1K0M A;  1HNB A;  2PER A;  3GTU B;  1Y6E A;  2R3X A;  3GTU A;  4K0N A;  3HJO A;  2C3N A;  5ECH B;  4IKH A;  3IE3 A;  3KM6 A;  3W8S A;  1GUL A;  3KJY A;  4IQA A;  4PGT A;  4PX1 A;  3I69 A;  3VLN A;  3IR4 A;  3EIN A;  1A0F A;  5ELG A;  6GSW A;  4ECJ A;  2PGT A;  2D2Z A;  4NHW A;  5ECQ B;  1FHE A;  1VF1 A;  4F03 A;  2A2S A;  4ZB6 A;  3UAP A;  4KAE A;  4KDX A;  1YJ6 A;  5ECO B;  1PD2 1;  9GSS A;  1KBN A;  1JLV A;  2NTO A;  3QAV A;  2WJU A;  2N5F A;  1VF4 A;  2HQT A;  2CAQ A;  2VCZ A;  5LD0 A;  1GLQ A;  1RK4 A;  1IYH A;  3M8N A;  3GUS A;  1EOH A;  3LQ7 A;  2IL3 A;  4L8E A;  5G5E A;  2HSM B;  2HSM A;  2C8U A;  2FHE A;  5A4V A;  1Q4J A;  4PQI A;  3IC8 A;  4Q5F A;  12GS A;  1M9A A;  4Q5R A;  5KEJ A;  4F0B A;  1K0N A;  1HQO A;  3DD3 A;  5F0G A;  3KTL A;  1G6W A;  2F3M A;  4IBP A;  1OKT A;  1EEM A;  4G0L A;  3M0F A;  3UVH A;  3M3M A;  2DSA A;  2CAI A;  4KDY A;  3WYW A;  3MAK A;  4JBB A;  1Z9H A;  3PGT A;  4L5O A;  4O7H A;  4DEJ A;  2VO4 A;  4KX4 A;  4YAV A;  1GUH A;  4MZW A;  1G6Y A;  1GTB A;  5JCU A;  2C80 A;  3HJM A;  5BMU A;  1PL1 A;  3CSJ A;  2CZ3 A;  3LSZ A;  1JLW A;  3VI5 A;  4PUR A;  4GTU A;  3ZFL A;  16GS A;  5ECP B;  2VD1 A;  5ECM B;  1JZR A;  3F63 A;  3LXZ A;  1ML6 A;  4RI6 A;  5AGY A;  1K0O A;  4MF6 A;  2J9H A;  3GX0 A;  2PVQ A;  2GLR A;  4MPG A;  1PX7 A;  4ZBD A;  4NAX A;  1K0D A;  4ISD A;  4IVF A;  5F07 A;  1EV4 A;  1LBK A;  3FR6 A;  4QQ7 A;  1AW9 A;  1PKZ A;  14GS A;  4WR4 A;  1AQX A;  3CRT A;  2JL4 A;  3SWL A;  3MDK A;  3LYP A;  1U88 A;  4G0K A;  1B8X A;  1IYI A;  2GSR A;  4LMW A;  4EDY A;  4IW9 A;  1B48 A;  1DUG A;  22GS A;  4ID0 A;  3LFL A;  4GLT A;  1HNC A;  4HJ2 A;  5A4U A;  4AGS A;  1VF2 A;  2YV7 A;  1MD3 A;  4NHZ A;  5EL8 A;  5FT3 A;  3NIV A;  3VPQ A;  3ERF A;  3M1G A;  4MF5 A;  3FRC A;  6GSV A;  2CVD A;  2A2R A;  1AXD A;  2VCT A;  4GF0 A;  4EXJ A;  4J2F A;  1YQ1 A;  1F3A A;  5G5F A;  7GSS A;  1ZGN A;  3BBY A;  1GSE A;  3VK9 A;  4E8E A;  4EE0 A;  1GSY A;  1K0C A;  3Q19 A;  3TGZ A;  2WDU A;  4ACS A;  5ECI B;  4IS0 A;  1OE7 A;  3LYK A;  2HSN B;  4TOP A;  5AIX A;  4YQM A;  4KSM A;  4YQU A;  4OFN A;  5GSS A;  5ECR B;  3O76 A;  5FHI A;  5GZZ B;  1PA3 A;  2WB9 A;  5ELA A;  3R3E A;  5FWG A;  13GS A;  5A5K A;  1MTC A;  4PTS A;  4ZB9 A;  2CA8 A;  5DQS A;  2WS2 A;  20GS A;  3QAW A;  4JED A;  4K0G A;  4YH2 A;  3D0Z A;  3IK9 A;  2AB6 A;  4Q5Q A;  4USS A;  3Q18 A;  5J4U A;  2PBJ A;  2X64 A;  4O92 A;  4OFM A;  2WRT A;  2GSQ A;  3UAR A;  1XW6 A;  5F06 A;  5IQY A;  1GUM A;  5GST A;  3AY8 A;  1B4P A;  1F2E A;  2OA7 A;  5ECN B;  3GST A;  4ZBB A;  4N0V A;  4MDC A;  1K0A A;  1NHY A;  3QAG A;  1TU8 A;  2OAD A;  3UBK A;  3G7J A;  2F8F A;  1BG5 A;  1TDI A;  4L5L A;  1K3O A;  3ISO A;  4EDZ A;  3TOT A;  1C72 A;  4IJI A;  4G10 A;  3P90 A;  3LXT A;  2IMK A;  5D9W A;  1BAY A;  1OYJ A;  1GSS A;  1OE8 A;  4OMV A;  1E6B A;  1K0B A;  3VI7 A;  3Q74 A;  1V40 A;  5D9X A;  1LJR A;  1UA5 A;  2DC5 A;  1PKW A;  5ECK B;  1EOG A;  3F6F A;  1XW5 A;  4KGI A;  5LCZ A;  4YAP A;  3GH6 A;  1FW1 A;  6GSU A;  3HKR A;  2YCD A;  1HNA A;  5DAK B;  5DAK A;  3CRU A;  4PQH A;  5F8B A;  5ECS A;  4HI7 A;  4IQ1 A;  5EY6 A;  3PR8 A;  2OAC A;  1M0U A;  1USB A;  4ECI A;  5AIV A;  6GSS A;  4BVY B;  3ERG A;  5ECL B;  4BVY A;  1EV9 A;  2YV9 A;  3RBT A;  1GSF A;  4I97 A;  3IK7 A;  2VCX A;  4WR5 A;  4RI7 A;  3F6D A;  5A4W A;  5DJM A;  3FY7 A;  4FQU A;  1N2A A;  3GUR A;  2ON7 A;  1GNW A;  4ZBA A;  2VD0 A;  1ZL9 A;  18GS A;  3CSH A;  3ZMK A;  2C3Q A;  3FYG A;  4BVX B;  4BVX A;  5EVO A;  1K3L A;  3H1N A;  1BYE A;  1AQW A;  4G9H A;  6GSY A;  2PMT A;  5J41 A;  1VF3 A;  1YY7 A;  4Q5N A;  3CSI A;  2C4J A;  3WD6 A;  2ON5 A;  3GSS A;  3N5O A;  5D9T A;  3O3T A;  6GST A;  4KH7 A;  4G0I A;  1YDK A;  4ECC A;  3KMN A;  2CZ2 A;  1XWG A;  3EE2 A;  2R5G A;  5AIS A;  4EC0 A;  4KE3 A;  8GSS A;  4YQV A;  1GSU A;  1PMT A;  3L0H A;  4GCI A;  4MK3 A;  2R6K A;  2LJR A;  4G19 A;  17GS A;  4HZ2 A;  2V6K A;  4OFT A;  3ZFB A;  5AN1 A;  2C3T A;  4KDU A;  4GSS A;  2HRK B;  1XWK A;  2HRK A;  1F3B A;  2IMI A;  10GS A;  1PGT A;  1AQV A;  1M9B A;  3DGQ A;  4JZQ A;  1PL2 A;  1BX9 A;  1K3Y A;  1MD4 A;  1M99 A;  2UZ8 A;  4E8H A;  4PXO A;  1R5A A;  2FNO A;  3CBU A;  3LG6 A;  4MPF A;  4PNF A;  3ZML A;  1GSQ A;  2VCV A;  3P8W A;  4KF9 A;  2VCQ A;  2R4V A;  3TOU A;  5D9V A;  1GWC A;  3IBH A;  3VWX A;  2HRA A;  3UBL A;  1GSD A;  1GNE A;  3KMO A;  1TW9 A;  3N9J A;  4ZXG A;  3C8E A;  2GTU A;  1GLP A;  3FR9 A;  3PPU A;  1YKC A;  11GS A;  1V2A A;  5F05 A;  2HNL A;  2GDR A;  5HFK A;  1GUK A;  1U87 A;  5DDL A;  3VPT A;  6GSX A;  4IEL A;  1PX6 A; 
#chains in the Genus database with same CATH topology
 2HYX A;  4NWY A;  4CHS A;  5L71 A;  3GKK A;  2GST A;  3LJR A;  1WJK A;  2O87 A;  4MF7 A;  1S3A A;  1Z6M A;  4FH8 A;  3GL3 A;  5A1N B;  5CAX A;  2TIR A;  5J5N A;  5A34 A;  2GT5 A;  5D73 A;  3FR3 A;  1PN9 A;  2LTK A;  4FXY P;  2HZE B;  1OAZ A;  1SKS B;  4K0N A;  1SKR B;  4MAB A;  4IKH A;  2H1L A;  1S3R A;  1DSB A;  3M9K A;  5CRH A;  1ERT A;  3IR4 A;  2LQQ A;  1SJI A;  2PGT A;  2D2Z A;  3RAZ A;  5ECQ B;  2BTO T;  1M7T A;  3HY2 A;  5CRG A;  2A2S A;  3UAP A;  3WT2 A;  3MYD A;  1ZMA A;  3IOS A;  2VM1 A;  2OBK A;  3C73 A;  4JE1 A;  4ZB7 A;  3BCK A;  4IP6 A;  4RQR A;  1VF4 A;  1UC7 A;  2CVB A;  5LD0 A;  3HDC A;  2XC2 A;  1BQ7 A;  1IYH A;  3M8N A;  1YF1 A;  2HFD A;  1V9W A;  3FZ9 A;  4HEA 2;  4POK A;  5IPG A;  4TKY A;  4L8E A;  5G5E A;  4NMU A;  1M2A A;  2VUP A;  2L57 A;  4F0B A;  3TKS C;  3DD3 A;  1T7P B;  3APQ A;  3DML A;  4IBP A;  2K8S A;  2ZCT A;  4XRD A;  3TJG A;  2CAI A;  4KDY A;  2HSY A;  2H01 A;  4JBB A;  4KW6 A;  4L5O A;  2OE0 A;  2HI7 A;  4KX4 A;  1GUH A;  4KSO A;  1A8L A;  1XPV A;  1GTB A;  5BMU A;  2DKH A;  3C71 A;  2CZ3 A;  3LSZ A;  5J3R A;  3SBC A;  3VI5 A;  4WET A;  4TR4 A;  16GS A;  5ECP B;  2XPE A;  1Z7R A;  4P3Y B;  3VWV A;  3ZVJ A;  3KH9 A;  2GLR A;  1NHO A;  2DML A;  1PX7 A;  1TK5 B;  2V1M A;  4ZBD A;  2PVO C;  1K0D A;  4ZL9 A;  3IRA A;  5F07 A;  4QQ7 A;  2C0F A;  5A1N A;  3EU3 A;  3MDK A;  3VWW A;  4I5Q A;  4HU7 A;  4LMW A;  4GDF A;  2OE3 A;  3TU3 B;  2FY6 A;  3GV1 A;  2HZE A;  3HJP A;  22GS A;  4ID0 A;  2DMM A;  3W8J A;  2B1L A;  3A3T A;  4AGS A;  2H70 A;  1J9B A;  4W66 A;  2IIY A;  1LU4 A;  5EL8 A;  1XVW A;  3HVS A;  1AC1 A;  1SYX A;  3M1G A;  4WKW A;  6GSV A;  2K18 A;  1WPI A;  3D21 A;  4XHM A;  4EXJ A;  4J2F A;  4V2M A;  4TW5 A;  2L5L A;  3BBY A;  2K9F A;  1GSE A;  1ZOF A;  4DSS B;  1GSY A;  1K0C A;  2LJK A;  3GNJ A;  1R7H A;  2WDU A;  4ACS A;  1SU9 A;  3EUR A;  1OE7 A;  2LUS A;  3RPN A;  3HVV A;  1QQ2 A;  2YOI A;  2HSN A;  1H75 A;  3E0U A;  3O76 A;  5FHI A;  5GZZ B;  5ELA A;  2LNS A;  3R3E A;  1XIY A;  1DBY A;  2MZC A;  4ZB9 A;  4YKG A;  5DQS A;  2VL2 C;  20GS A;  4JED A;  4K0G A;  1TP9 A;  3D0Z A;  3GIX A;  1YEX A;  3Q18 A;  2PBJ A;  3GMF A;  2X64 A;  4O92 A;  2WRT A;  2GSQ A;  5F06 A;  3I9V 2;  3KD0 A;  1B4P A;  1F2E A;  2OA7 A;  5ECN B;  2GGT A;  5CRE A;  1O7U A;  4ZBB A;  2MMO A;  4MDC A;  5G1K A;  1YF0 A;  3UBK A;  3G7J A;  4K1F A;  3HXS A;  4KCE A;  4TXO B;  5G30 A;  1XCC A;  1QUW A;  5JWO B;  1OYJ A;  4OMV A;  2VIM A;  5G1L A;  1V40 A;  4LL1 B;  2B5Y A;  1UA5 A;  2DC5 A;  2IJY A;  1EOG A;  2FWH A;  4KGI A;  5LCZ A;  1BED A;  4YAP A;  5J4V A;  1FW1 A;  3ZIJ A;  3HKR A;  2MYG A;  2YCD A;  5DAK B;  1CQG A;  3CRU A;  4PQH A;  1TJD A;  2N5A A;  4HI7 A;  4KUN A;  4I8B A;  2OAC A;  4HS1 A;  1USB A;  3KTB A;  1F6M C;  4BVY A;  1EV9 A;  1XBS A;  4MMM A;  5KOX A;  5CRW A;  4ICY A;  5HFG A;  2VCX A;  4RI7 A;  2CX3 A;  3A2V A;  3FY7 A;  4FQU A;  1N2A A;  1YKA A;  3RPP A;  5CYY A;  1UN2 A;  4NPB A;  3CSH A;  18GS A;  3MWH A;  2HRN A;  5C00 A;  4G2E A;  4BVX B;  4BIK A;  3L9S A;  3H1N A;  3RGB C;  4MH3 A;  4JRR A;  4N11 A;  1SK2 A;  3TCO A;  3F4R A;  1V98 A;  3U5R E;  4KA0 A;  2C0D A;  3TKP A;  2MMA A;  4WF4 A;  4KE3 A;  4YQV A;  4XS1 A;  5D93 A;  4GQC A;  2LJR A;  4EVM A;  2HE3 A;  1ERW A;  1OC8 A;  3K8N A;  2JAC A;  2HRK B;  1U3A A;  2IMI A;  10GS A;  1PGT A;  3D4T A;  4JZQ A;  1BX9 A;  3GX8 A;  1K3Y A;  3EC3 A;  3CBU A;  3LG6 A;  4MPF A;  1GSQ A;  5J40 A;  1B4Q A;  1F37 A;  4ZIJ A;  3N9J A;  1I5G A;  2V6O A;  3TJF A;  1PRX A;  2A2P A;  1GUK A;  3MNG A;  2NPB A;  3VPT A;  4QL7 A;  1GL8 A;  4IEL A;  2WW1 A;  2VLT A;  4HZ4 A;  1QFN A;  4CDO A;  1G7O A;  3I6A A;  4HOJ A;  4TVE A;  5DCG A;  2DBC A;  4V2L A;  2RUE A;  3QR6 A;  2H8L A;  4LMV A;  1QGV A;  5DAL A;  4PNG A;  4POM A;  5A34 B;  2H1G A;  3IAM 2;  3G7I A;  1WP0 A;  3HVN A;  3TRQ A;  2TRX A;  2VCW A;  2AHE A;  2P31 A;  3L9U A;  1K0M A;  1W89 A;  1Y6E A;  1S4B P;  2R3X A;  3GTU A;  2LRT A;  2C3N A;  3IE3 A;  3KCM A;  3A5W A;  4IQA A;  3KJY A;  3I69 A;  3IPZ A;  2FGX A;  6GSW A;  1RQM A;  4OCE A;  1G0T A;  1FHE A;  1T8E B;  1FOV A;  2PN8 A;  3J7Y k;  4KAE A;  5ECO B;  3QCP A;  3IHG A;  1PD2 1;  3DYR A;  2NTO A;  2WJU A;  2N5F A;  3DVW A;  2EFE A;  2HQT A;  2CAQ A;  1GLQ A;  2OBI A;  1GRX A;  3OR5 A;  3CTG A;  1DE1 A;  3LQ7 A;  2IL3 A;  1XXU A;  2I1U A;  1X5C A;  3TRX A;  3IAS 2;  5A5H A;  1SL0 B;  2LS5 A;  5A4V A;  4PQI A;  4Q5F A;  12GS A;  2H6Y A;  4MZB A;  5D96 A;  3GKN A;  1G7E A;  2H73 A;  1KEB A;  1OKT A;  1SVL A;  3UVH A;  1OVN A;  2EFC A;  3CHX C;  4KB3 A;  3IC4 A;  3PGT A;  1A8Y A;  1T1V A;  3D4M A;  4DEJ A;  4MLY A;  1XWB A;  3D22 A;  4OO4 A;  2KHP A;  2FWE A;  2AJQ B;  5BMU B;  1EP8 A;  3CSJ A;  2REM A;  4BPY A;  2AUV A;  1XW9 A;  4PUR A;  4GTU A;  4HQS A;  2DJK A;  3FHK A;  1QK8 A;  1JZR A;  1ML6 A;  4O5R A;  1F9M A;  2J9H A;  2HSH A;  2EIQ A;  4ISD A;  1O8X A;  4DVC A;  2GQM A;  5IMZ A;  1EV4 A;  3FR6 A;  1A2M A;  1DE2 A;  1EWX A;  1PKZ A;  5J4Y A;  1JZW A;  2A4V A;  14GS A;  4WR4 A;  2DJ3 A;  3IHQ A;  1U88 A;  4G0K A;  2QKE A;  1IYI A;  4L0U A;  4EDY A;  3UMA A;  2CT6 A;  4FYU A;  2WW3 A;  3UEM A;  3LFL A;  3NZN A;  4FYB A;  1J08 A;  3RHC A;  4PI0 C;  1VF2 A;  2YV7 A;  1MDJ A;  3D5J A;  1TI1 A;  4NHZ A;  3VPQ A;  3ERF A;  3V1W A;  3FRC A;  3QDN A;  2A2R A;  1AXD A;  2VCT A;  2GVP A;  4PI2 C;  4EF0 A;  1YQ1 A;  3HCZ A;  2XHF A;  1H4O A;  7GSS A;  1NW2 A;  1ZGN A;  2KOK A;  4E8E A;  1Y1U A;  2WW0 A;  2R0P A;  4AF2 A;  3DEX A;  1ON4 A;  2QA2 A;  1TOF A;  1A0R P;  3LYK A;  2HSN B;  4V1A g;  3TRP A;  5GSS A;  3E9J B;  2WB9 A;  1TRS A;  5FWG A;  5A5K A;  5KN3 A;  2L5O A;  5CO3 A;  1URM A;  1X5E A;  3ZYW A;  3EPT A;  4O32 A;  2FA4 A;  4YH2 A;  3IK9 A;  1O81 A;  3US3 A;  5ABR A;  2WGR A;  4USS A;  2PU9 C;  1SK0 A;  2IME A;  3UAR A;  2DJ0 A;  1XW6 A;  5INY A;  1VGL A;  2MBS A;  4OO5 A;  2O3E A;  3GST A;  1T4Y A;  1K0A A;  5HR2 A;  1N8J A;  1BG5 A;  3ZL5 A;  1FAA A;  4HU9 A;  2O8V B;  4Z7X A;  3TOT A;  2GT6 A;  1C72 A;  4IJI A;  3P90 A;  3KP8 A;  2DIY A;  1BAY A;  3VWU A;  1XG8 A;  4WF5 A;  1OE8 A;  3WGX A;  5B6M A;  1T3B A;  4PUF C;  2YWI A;  3Q74 A;  5D9X A;  1WE0 A;  4D73 A;  5ECK B;  2JAD A;  1Z5Y E;  3GH6 A;  3GFK A;  2WZ9 A;  1ERU A;  5H5S A;  2VLV A;  1I1I P;  1BJX A;  2MBT A;  2X99 A;  2X4A A;  5AIV A;  6GSS A;  4BVY B;  3ERG A;  3CQF A;  3ERW A;  3EMP A;  3TJK A;  2JZR A;  3E3E A;  1JHB A;  2YV9 A;  1TK0 B;  3HMJ G;  2GZZ A;  5IO0 A;  1ERV A;  1GSF A;  3IK7 A;  2CV4 A;  5DJM A;  1NM3 A;  5JCG A;  5DBQ A;  2ON7 A;  2Z9S A;  2N5B A;  1E2Y A;  1ZL9 A;  3ZMK A;  2B7J A;  2C3Q A;  2LRN A;  5EVO A;  1TRU A;  4MA9 A;  2WW2 A;  1XOA A;  1A2L A;  5IPH A;  3TJJ A;  2PMT A;  2VLU A;  4Q5N A;  2C4J A;  2YWM A;  3WD6 A;  4TR3 A;  2I3Y A;  4N10 A;  3TJB A;  4G0I A;  1YDK A;  4ECC A;  1FOH A;  2OE1 A;  2R5G A;  5KOW A;  4EC0 A;  8GSS A;  4E68 A;  3F9U A;  3L78 A;  2H30 A;  2DIZ A;  2R6K A;  3G9B A;  4G19 A;  2DKI A;  5IMA A;  1QXH A;  4HZ2 A;  1TXX A;  3S9F A;  2QC7 A;  2FUG 2;  3ZFB A;  2J23 A;  1JFU A;  1EGR A;  2YZU A;  1TXU A;  1X9S B;  3DGQ A;  3H79 A;  3LEF A;  2H1D A;  3H8Q A;  4PXO A;  4GXZ A;  5CRD A;  4KF9 A;  2WUL A;  2R0C A;  3KH7 A;  2H66 A;  2G0F A;  4GRF A;  5D9V A;  1GWC A;  5CP1 A;  3VWX A;  2HRA A;  3HHV A;  3KGK A;  1TW9 A;  1O73 A;  1GLP A;  3FR9 A;  1M2B A;  1YKC A;  1SJ6 A;  2HNL A;  5ID2 A;  4JU5 A;  1ZYE A;  3BCI A;  5DDL A;  4KND A;  1PX6 A;  4F0C A;  4J57 E;  3R2Q A;  2CVK A;  4HSC X;  4ECB A;  4TR1 A;  4MP4 A;  2NBS A;  4GST A;  2AAW A;  4X4J A;  4XRA A;  4ML1 A;  3U6V A;  1N25 A;  4N3Z A;  3TKQ A;  2X49 A;  2YP6 A;  4OD7 A;  4BL7 A;  5DAL B;  2IFQ A;  4AJ7 A;  3KXO A;  5HQP A;  3TKS E;  5GAN D;  2GSS A;  4PUA A;  3ZLP A;  1GTI A;  4YKF A;  5DJL A;  1WIK A;  1O6J A;  1TI3 A;  2M80 A;  2PER A;  4GQF A;  3GTU B;  3HJO A;  5ECH B;  5JWQ B;  4EO3 A;  2V2G A;  2YWN A;  1B9Y C;  3KM6 A;  1GUL A;  4K5R A;  4PGT A;  4NV5 A;  1EZK A;  4O5U A;  4ECJ A;  3ZRD A;  2L6D A;  1S3D A;  4IN0 A;  4K6X A;  2XBQ A;  1R4W A;  2X8G A;  1VF1 A;  4F03 A;  1Z3E A;  2H0G A;  4AKI A;  5B8A A;  2H6Z A;  2IMF A;  1M3J A;  3J7Y b;  4Z2T A;  2FCH A;  9GSS A;  5HR3 A;  1JLV A;  1M3I A;  3QAV A;  5DVB A;  2VCZ A;  3UVT A;  2P5Q A;  1EOH A;  3RFR C;  2YPM A;  5A5H B;  3FEU A;  2HSM A;  2C8U A;  4K8M A;  2FHE A;  1Q4J A;  3IC8 A;  1GH2 A;  2IPA A;  3GN3 A;  1M9A A;  4F82 A;  1K0N A;  1HQO A;  3KTL A;  3F4S A;  4NXI A;  3M0F A;  1A24 A;  1X9W B;  4X0X A;  2DSA A;  3M3M A;  3FW2 A;  5COH A;  1JZD A;  4LA1 A;  5IO2 A;  3A2W A;  1Z9H A;  2H0H A;  2WFC A;  4O7H A;  2VO4 A;  4EIP A;  3EU4 A;  4MZW A;  1G6Y A;  1YZX A;  3I43 A;  2H1A A;  3HJM A;  1O8W A;  4ULX A;  1PL1 A;  2H75 A;  5GAP D;  2LST A;  1JLW A;  2JZT A;  3GKX A;  4POB A;  3ZFL A;  4CY8 A;  4ZL7 A;  3LXZ A;  2WVX A;  2O36 A;  4RI6 A;  5AGY A;  2R37 A;  2PVQ A;  4MPG A;  1FB6 A;  3LOR A;  1U6T A;  5HFI A;  3GA4 A;  4NAX A;  3FZA A;  1SVO A;  3QPM A;  2TRC P;  4V2N A;  2X8H A;  3JCM L;  3ZZX A;  2HZF A;  5IMD A;  1AW9 A;  3D6I A;  2MMZ A;  2JL4 A;  4BA7 A;  2RUF A;  1TRV A;  4JR6 A;  2O89 A;  1B8X A;  2H72 A;  2GSR A;  4XCS A;  1BF5 A;  4IW9 A;  2IMD A;  4HDE A;  4MJC A;  1B48 A;  1MDI A;  1DUG A;  2OKA A;  4TRX A;  2B6M A;  5FT3 A;  1X9M B;  3NIV A;  1SL2 B;  2H76 A;  4EIQ A;  3P7X A;  4TN8 A;  3LGC A;  2LJA A;  2YN1 A;  2WCI A;  1FB0 A;  4GF0 A;  2YWO A;  1GP1 A;  4J56 E;  1F3A A;  5G5F A;  3VK9 A;  4K9Z A;  1AAZ A;  3Q19 A;  4A5P A;  2LEG A;  3ZVJ D;  3WGE A;  2XBI A;  4TOP A;  2YNX A;  3KZQ A;  2PPT A;  5ECR B;  3EMX A;  3HVX A;  2HT9 A;  2C0E A;  4PHZ C;  3CYN A;  4ZIL A;  3ZIV A;  2FWF A;  4PTS A;  1Z6N A;  3QAW A;  4AKG A;  4IJ3 A;  3H4K A;  1SD9 A;  4LL4 B;  2IN3 A;  3PH9 A;  3VFI A;  5J4U A;  3W6G A;  4OFM A;  4EL1 A;  2B5E A;  1XWC A;  1GUM A;  5GST A;  1ZYQ B;  4K2X A;  1AUC A;  4N0V A;  2KUC A;  1TU8 A;  2O5V A;  1TDI A;  4L5L A;  4HUA A;  3KEB A;  1THX A;  1K3O A;  4EDZ A;  2GZY A;  5J47 A;  3LXT A;  2RLI A;  5D9W A;  4XS4 A;  4QMK A;  1GSS A;  1PQN A;  4H86 A;  1E6B A;  1XWA A;  1TTZ A;  3RHB A;  4D73 B;  1LJR A;  1XW5 A;  2FA8 A;  3A5I A;  2QA1 A;  3IDV A;  4Z2U A;  5LNK e;  1HNA A;  2DJ1 A;  4AKH A;  2AV4 A;  1SVM A;  3PIN A;  3TKR A;  2K8V A;  4LLR A;  4XS6 A;  5EY6 A;  3PR8 A;  2R0G A;  1M0U A;  4ECI A;  5ECL B;  2K6V A;  4XIH A;  2KP1 A;  3RBT A;  1OC9 A;  4I97 A;  1EP7 A;  4WR5 A;  3M9J A;  4MCU A;  4N0Z A;  2C1Y A;  3IA1 A;  4RUV A;  1WOU A;  3GUR A;  1FO5 A;  1GNW A;  3IV4 A;  5HR1 A;  3Q6O A;  1WWJ A;  1BYE A;  1AQW A;  2VKZ G;  2B5X A;  5D8I A;  6GSY A;  4X1U A;  3CSI A;  2QSI A;  3GSS A;  3N5O A;  3O3T A;  3HZ8 A;  4HQZ A;  3MSZ A;  2WZS A;  3QD9 A;  2B3S A;  2CZ2 A;  5DQY A;  1XWG A;  5AIS A;  1KTE A;  5JWR B;  2I9H A;  3L0H A;  1PMT A;  1I9D A;  2H6X A;  3GL5 A;  1HYU A;  3ME8 A;  3ZIT A;  2YJ7 A;  17GS A;  1JZO A;  1A23 A;  5C04 A;  3TUE A;  4OFT A;  1SD8 A;  2C3T A;  3UOM A;  4KDU A;  4GSS A;  2NVL A;  2HXK A;  1M9B A;  3F3Q A;  1MD4 A;  1ST9 A;  1O85 A;  2MMN A;  2VCV A;  3P8W A;  2G2Q A;  2VCQ A;  3DVX A;  2R2J A;  3FMW A;  1ZYN A;  1PFO A;  2R4V A;  3ZTL A;  3TOU A;  3IBH A;  2E7P A;  3ZRE A;  3UBL A;  4ZL8 A;  1ZZY A;  4BWS A;  4ZXG A;  3PPU A;  4CW9 A;  11GS A;  1SEN A;  1V2A A;  5ID2 B;  3F0I A;  2GDR A;  1SL1 B;  4WXT A;  4X43 A;  1VRS D;  3FKF A;  1MDK A;  2ES7 A;  4MNN A;  1GTU A;  2DLX A;  4GSN A;  3GH9 A;  1TU7 A;  4JR4 A;  3QOU A;  2CX4 A;  4TR1 B;  3VUR A;  1U3I A;  5E4W A;  5B7C A;  1XFL A;  1HD2 A;  3HZ4 A;  2FLS A;  4BL7 B;  2IFQ B;  1Q98 A;  1GTA A;  3L4N A;  2PUK C;  4ZB8 A;  3ME7 A;  3DKS A;  5JCW A;  4IGJ A;  2F9S A;  19GS A;  2H0I A;  2H74 A;  2L4Q A;  1HNB A;  2P0G A;  2YAN A;  5IOW A;  2L4C A;  1XVQ A;  1EEJ A;  2YJH A;  3CXG A;  2OT3 A;  3W8S A;  4ILF A;  4PX1 A;  5KN0 A;  3VLN A;  4RQX A;  2VL9 A;  3QFB C;  1AIU A;  1OKD A;  3EIN A;  1A0F A;  5ELG A;  1RW1 A;  1SK1 A;  2ZUP A;  4K2D A;  3WT1 A;  4NHW A;  1ACV A;  2V32 A;  4ZB6 A;  3F3R A;  1M2D A;  4KDX A;  1YJ6 A;  5B6N A;  4IHU A;  2E2M A;  3UIW A;  2HRF A;  1KBN A;  1WRY A;  2L59 A;  1RK4 A;  3GUS A;  2WVY A;  4I6X A;  3FK8 A;  4WBR D;  2BMX A;  5IOX A;  2HSM B;  5H5R A;  3LWA A;  4K5S A;  1EGO A;  4Q5R A;  5KEJ A;  1PSQ A;  4FIW A;  5F0G A;  4F9Z A;  1G6W A;  2F3M A;  2KLX A;  1ILO A;  1EEM A;  4G0L A;  3L9V A;  3UJ1 A;  4GWR A;  3MIX A;  4V1A p;  3HA9 A;  3WYW A;  3MAK A;  5E59 A;  3F8U A;  1Z7P A;  4POL A;  4AI6 A;  3GYK A;  1OC3 A;  4YAV A;  5J9C A;  5JCU A;  2C80 A;  1V58 A;  5IIZ A;  2AYT A;  3KP9 A;  2E0Q A;  4PQ1 A;  3BOA A;  4MJA A;  1SKW B;  2VD1 A;  5ECM B;  3F63 A;  2WVX B;  4F2I A;  1K0O A;  4MF6 A;  2ZNM A;  3GX0 A;  3LW9 A;  3GKM A;  2VL3 A;  4IVF A;  5G2Z A;  3EWL A;  1FG4 A;  4MZC A;  4HJM A;  4CY6 A;  4K7N A;  1LBK A;  3CTF A;  2H71 A;  3EYT A;  3O6T A;  3C7M A;  5BRT A;  1AQX A;  3C1S A;  3CRT A;  3SWL A;  3LYP A;  1CQH A;  3G7Y A;  1BG1 A;  4WBJ A;  2XPD A;  3EVI A;  1THO A;  2H1B A;  4OCF A;  2LV3 A;  4GLT A;  2JU5 A;  1HNC A;  4HJ2 A;  5A4U A;  3APS A;  2RM5 A;  1FVK A;  1KNG A;  1MD3 A;  2M72 A;  2DJJ A;  4DSR A;  2QGV A;  4MF5 A;  2X8C A;  3A2X A;  2CVD A;  2VOC A;  2JSY A;  1YEP A;  5IM9 A;  2C0G A;  3FZ4 A;  3DWV A;  4MJB A;  4EKZ A;  2NDO A;  2A4H A;  5B8B A;  4EE0 A;  2LKU A;  4DSS A;  1SJZ A;  2O85 A;  3NOF A;  3TGZ A;  5HR0 A;  1NSW A;  3BD2 A;  5ECI B;  4IS0 A;  3QMX A;  1S3C A;  1R26 A;  3F4T A;  3HYP A;  5AIX A;  2GQK A;  3GHA A;  4YQM A;  1YVL A;  4KSM A;  4YQU A;  4G01 A;  4OFN A;  2JZS A;  4TR0 A;  1PA3 A;  3ED3 A;  4KCA A;  13GS A;  1R5P A;  2UV8 G;  2RII A;  1MTC A;  2RM6 A;  1ABA A;  2E2G A;  2CA8 A;  2WS2 A;  5KN2 A;  3H93 A;  4OWY A;  1SYR A;  5IMV A;  5CNW A;  2VM2 A;  2AB6 A;  4Q5Q A;  1A2J A;  2IWT A;  1ZYP A;  4MH2 A;  5IQY A;  3TKS A;  3TB2 A;  3GRX A;  2KP2 A;  3AY8 A;  2ALB A;  5G31 A;  3FZ5 A;  3HD5 A;  2WVZ A;  1NHY A;  3QAG A;  2OAD A;  2F8F A;  3WGD A;  3DRN A;  4XTS A;  3ISO A;  4TXO A;  3DXB A;  4G10 A;  3DIE A;  1Y25 A;  4DSQ A;  2IMK A;  1UVZ A;  4XS4 B;  4IP1 A;  1X5D A;  3UL3 A;  4FO5 A;  1T00 A;  2OJL A;  1K0B A;  3VI7 A;  5ENU A;  2FD3 A;  2EC4 A;  1PKW A;  1XZO A;  3F6F A;  2GZP A;  1W4V A;  3TDG A;  6GSU A;  5J9B A;  3CWG A;  2LQO A;  5DAK A;  5F8B A;  5ECS A;  4IQ1 A;  2B7K A;  4FYC A;  4L0W A;  4AJ8 A;  2V41 A;  2EIO A;  3C1R A;  2DJ2 A;  2PWJ A;  1MEK A;  2I81 A;  5H5Q A;  2H19 A;  2FWG A;  1OC9 B;  4EUY A;  1FVJ A;  3RDW A;  3F6D A;  5A4W A;  2LNT A;  1QMV A;  1ZCP A;  2P5R A;  4ZBA A;  2VD0 A;  1T4Z A;  4Z2R A;  2JSZ A;  3FYG A;  4BVX A;  2F8A A;  1K3L A;  2I4A A;  4G9H A;  1YEW C;  2EFH A;  5J41 A;  3BJ5 A;  1VF3 A;  1YY7 A;  4AJ6 A;  1B9X C;  1TRW A;  2ON5 A;  4NV2 A;  5D9T A;  1TK8 B;  1V57 A;  6GST A;  4KH7 A;  5EPF A;  3CMI A;  4N30 A;  3KMN A;  5DCH A;  3APO A;  3EE2 A;  4MJE A;  4O5Q A;  1GSU A;  4GCI A;  1X0R A;  4MK3 A;  4AKX B;  2F51 A;  2CQ9 A;  2EFD A;  2GS3 A;  1XOB A;  2V6K A;  2YZH A;  5AN1 A;  3IXR A;  4K7I A;  2VL2 A;  1XWK A;  2HRK A;  1F3B A;  1AQV A;  2LRC A;  2M46 A;  1PL2 A;  4TXV A;  1M99 A;  2UZ8 A;  2B1K A;  5IMC A;  5IMF A;  2EIR A;  4E8H A;  5KN1 A;  1R5A A;  2FNO A;  2O7K A;  2BJX A;  4PNF A;  3P2A A;  1TKD B;  3ZML A;  4QL9 A;  3KIJ A;  1J0F A;  4BWQ A;  1PN0 A;  3QFA C;  1GSD A;  2GQL A;  1GNE A;  3KMO A;  2HLS A;  3C8E A;  2GTU A;  4ML6 A;  4I2T A;  4K7O A;  2VAF A;  5F05 A;  1WMJ A;  4I2U A;  5HFK A;  4WEY A;  2L6C A;  1U87 A;  6GSX A; 
#chains in the Genus database with same CATH homology
 2HYX A;  4NWY A;  4CHS A;  5L71 A;  3GKK A;  2GST A;  3LJR A;  1WJK A;  2O87 A;  4MF7 A;  1S3A A;  1Z6M A;  4FH8 A;  3GL3 A;  5A1N B;  5CAX A;  2TIR A;  5J5N A;  5A34 A;  2GT5 A;  5D73 A;  3FR3 A;  1PN9 A;  2LTK A;  2HZE B;  1OAZ A;  1SKS B;  4K0N A;  1SKR B;  4MAB A;  4IKH A;  2H1L A;  1DSB A;  3M9K A;  5CRH A;  1ERT A;  3IR4 A;  2LQQ A;  1SJI A;  2PGT A;  2D2Z A;  3RAZ A;  5ECQ B;  2BTO T;  1M7T A;  3HY2 A;  5CRG A;  2A2S A;  3UAP A;  3WT2 A;  3MYD A;  1ZMA A;  3IOS A;  2VM1 A;  2OBK A;  3C73 A;  4JE1 A;  4ZB7 A;  3BCK A;  4IP6 A;  4RQR A;  1VF4 A;  1UC7 A;  2CVB A;  5LD0 A;  3HDC A;  2XC2 A;  1BQ7 A;  1IYH A;  3M8N A;  1YF1 A;  2HFD A;  1V9W A;  3FZ9 A;  4HEA 2;  4POK A;  5IPG A;  4TKY A;  4L8E A;  5G5E A;  4NMU A;  1M2A A;  2VUP A;  2L57 A;  4F0B A;  3TKS C;  3DD3 A;  1T7P B;  3APQ A;  3DML A;  4IBP A;  2K8S A;  2ZCT A;  4XRD A;  3TJG A;  2CAI A;  4KDY A;  2HSY A;  2H01 A;  4JBB A;  4KW6 A;  4L5O A;  2OE0 A;  2HI7 A;  4KX4 A;  1GUH A;  4KSO A;  1A8L A;  1XPV A;  1GTB A;  5BMU A;  2DKH A;  3C71 A;  2CZ3 A;  3LSZ A;  5J3R A;  3SBC A;  3VI5 A;  4WET A;  4TR4 A;  16GS A;  5ECP B;  2XPE A;  1Z7R A;  4P3Y B;  3VWV A;  3ZVJ A;  3KH9 A;  2GLR A;  1NHO A;  2DML A;  1PX7 A;  1TK5 B;  2V1M A;  4ZBD A;  2PVO C;  1K0D A;  4ZL9 A;  3IRA A;  5F07 A;  4QQ7 A;  2C0F A;  5A1N A;  3EU3 A;  3MDK A;  3VWW A;  4I5Q A;  4HU7 A;  4LMW A;  4GDF A;  2OE3 A;  3TU3 B;  2FY6 A;  3GV1 A;  2HZE A;  3HJP A;  22GS A;  4ID0 A;  2DMM A;  3W8J A;  2B1L A;  3A3T A;  4AGS A;  2H70 A;  1J9B A;  4W66 A;  2IIY A;  1LU4 A;  5EL8 A;  1XVW A;  3HVS A;  1AC1 A;  1SYX A;  3M1G A;  4WKW A;  6GSV A;  2K18 A;  1WPI A;  3D21 A;  4XHM A;  4EXJ A;  4J2F A;  4V2M A;  4TW5 A;  2L5L A;  3BBY A;  2K9F A;  1GSE A;  1ZOF A;  4DSS B;  1GSY A;  1K0C A;  2LJK A;  3GNJ A;  1R7H A;  2WDU A;  4ACS A;  1SU9 A;  3EUR A;  1OE7 A;  2LUS A;  3RPN A;  3HVV A;  1QQ2 A;  2YOI A;  2HSN A;  1H75 A;  3E0U A;  3O76 A;  5FHI A;  5GZZ B;  5ELA A;  2LNS A;  3R3E A;  1XIY A;  1DBY A;  2MZC A;  4ZB9 A;  4YKG A;  5DQS A;  2VL2 C;  20GS A;  4JED A;  4K0G A;  1TP9 A;  3D0Z A;  3GIX A;  1YEX A;  3Q18 A;  2PBJ A;  3GMF A;  2X64 A;  4O92 A;  2WRT A;  2GSQ A;  5F06 A;  3I9V 2;  3KD0 A;  1B4P A;  1F2E A;  2OA7 A;  5ECN B;  2GGT A;  5CRE A;  1O7U A;  4ZBB A;  2MMO A;  4MDC A;  5G1K A;  1YF0 A;  3UBK A;  3G7J A;  4K1F A;  3HXS A;  4KCE A;  4TXO B;  5G30 A;  1XCC A;  1QUW A;  5JWO B;  1OYJ A;  4OMV A;  2VIM A;  5G1L A;  1V40 A;  4LL1 B;  2B5Y A;  1UA5 A;  2DC5 A;  2IJY A;  1EOG A;  2FWH A;  4KGI A;  5LCZ A;  1BED A;  4YAP A;  5J4V A;  1FW1 A;  3ZIJ A;  3HKR A;  2MYG A;  2YCD A;  5DAK B;  1CQG A;  3CRU A;  4PQH A;  1TJD A;  2N5A A;  4HI7 A;  4KUN A;  4I8B A;  2OAC A;  4HS1 A;  1USB A;  3KTB A;  1F6M C;  4BVY A;  1EV9 A;  1XBS A;  4MMM A;  5KOX A;  5CRW A;  4ICY A;  5HFG A;  2VCX A;  4RI7 A;  2CX3 A;  3A2V A;  3FY7 A;  4FQU A;  1N2A A;  1YKA A;  3RPP A;  5CYY A;  1UN2 A;  4NPB A;  3CSH A;  3MWH A;  18GS A;  2HRN A;  5C00 A;  4G2E A;  4BVX B;  3L9S A;  3H1N A;  4MH3 A;  4JRR A;  4N11 A;  1SK2 A;  3TCO A;  3F4R A;  1V98 A;  3U5R E;  4KA0 A;  2C0D A;  3TKP A;  2MMA A;  4WF4 A;  4KE3 A;  4YQV A;  4XS1 A;  5D93 A;  4GQC A;  2LJR A;  4EVM A;  2HE3 A;  1ERW A;  1OC8 A;  3K8N A;  2JAC A;  2HRK B;  1U3A A;  2IMI A;  10GS A;  1PGT A;  3D4T A;  4JZQ A;  1BX9 A;  3GX8 A;  1K3Y A;  3EC3 A;  3CBU A;  3LG6 A;  4MPF A;  1GSQ A;  5J40 A;  1B4Q A;  1F37 A;  4ZIJ A;  3N9J A;  1I5G A;  2V6O A;  3TJF A;  1PRX A;  2A2P A;  1GUK A;  3MNG A;  2NPB A;  3VPT A;  4QL7 A;  1GL8 A;  4IEL A;  2VLT A;  4HZ4 A;  1QFN A;  4CDO A;  1G7O A;  3I6A A;  4HOJ A;  4TVE A;  5DCG A;  2DBC A;  4V2L A;  2RUE A;  3QR6 A;  2H8L A;  4LMV A;  1QGV A;  5DAL A;  4PNG A;  4POM A;  5A34 B;  2H1G A;  3IAM 2;  3G7I A;  1WP0 A;  3TRQ A;  2TRX A;  2VCW A;  2AHE A;  2P31 A;  3L9U A;  1K0M A;  1W89 A;  1Y6E A;  2R3X A;  3GTU A;  2LRT A;  2C3N A;  3IE3 A;  3KCM A;  3A5W A;  4IQA A;  3KJY A;  3I69 A;  3IPZ A;  2FGX A;  6GSW A;  1RQM A;  4OCE A;  1G0T A;  1FHE A;  1T8E B;  1FOV A;  2PN8 A;  3J7Y k;  4KAE A;  5ECO B;  3QCP A;  3IHG A;  1PD2 1;  3DYR A;  2NTO A;  2WJU A;  2N5F A;  3DVW A;  2EFE A;  2HQT A;  2CAQ A;  1GLQ A;  2OBI A;  1GRX A;  3OR5 A;  3CTG A;  1DE1 A;  3LQ7 A;  2IL3 A;  1XXU A;  2I1U A;  1X5C A;  3TRX A;  3IAS 2;  5A5H A;  1SL0 B;  2LS5 A;  5A4V A;  4PQI A;  4Q5F A;  12GS A;  2H6Y A;  4MZB A;  5D96 A;  3GKN A;  1G7E A;  2H73 A;  1KEB A;  1OKT A;  1SVL A;  3UVH A;  1OVN A;  2EFC A;  4KB3 A;  3IC4 A;  3PGT A;  1A8Y A;  1T1V A;  3D4M A;  4DEJ A;  4MLY A;  1XWB A;  3D22 A;  4OO4 A;  2KHP A;  2FWE A;  2AJQ B;  5BMU B;  1EP8 A;  3CSJ A;  2REM A;  4BPY A;  2AUV A;  1XW9 A;  4PUR A;  4GTU A;  4HQS A;  2DJK A;  3FHK A;  1QK8 A;  1JZR A;  1ML6 A;  4O5R A;  1F9M A;  2J9H A;  2HSH A;  2EIQ A;  4ISD A;  1O8X A;  4DVC A;  2GQM A;  5IMZ A;  1EV4 A;  3FR6 A;  1A2M A;  1DE2 A;  1EWX A;  1PKZ A;  5J4Y A;  1JZW A;  2A4V A;  14GS A;  4WR4 A;  2DJ3 A;  3IHQ A;  1U88 A;  4G0K A;  2QKE A;  1IYI A;  4L0U A;  4EDY A;  3UMA A;  2CT6 A;  4FYU A;  3UEM A;  3LFL A;  3NZN A;  4FYB A;  1J08 A;  3RHC A;  1VF2 A;  2YV7 A;  1MDJ A;  3D5J A;  1TI1 A;  4NHZ A;  3VPQ A;  3ERF A;  3V1W A;  3FRC A;  3QDN A;  2A2R A;  1AXD A;  2VCT A;  2GVP A;  4EF0 A;  1YQ1 A;  3HCZ A;  2XHF A;  1H4O A;  7GSS A;  1NW2 A;  1ZGN A;  2KOK A;  4E8E A;  1Y1U A;  2R0P A;  4AF2 A;  3DEX A;  1ON4 A;  2QA2 A;  1TOF A;  1A0R P;  3LYK A;  2HSN B;  4V1A g;  3TRP A;  5GSS A;  3E9J B;  2WB9 A;  1TRS A;  5FWG A;  5A5K A;  5KN3 A;  2L5O A;  5CO3 A;  1URM A;  1X5E A;  3ZYW A;  3EPT A;  4O32 A;  2FA4 A;  4YH2 A;  3IK9 A;  1O81 A;  3US3 A;  5ABR A;  2WGR A;  4USS A;  2PU9 C;  1SK0 A;  2IME A;  3UAR A;  2DJ0 A;  1XW6 A;  5INY A;  1VGL A;  2MBS A;  4OO5 A;  3GST A;  1T4Y A;  1K0A A;  5HR2 A;  1N8J A;  1BG5 A;  3ZL5 A;  1FAA A;  4HU9 A;  2O8V B;  4Z7X A;  3TOT A;  2GT6 A;  1C72 A;  4IJI A;  3P90 A;  3KP8 A;  2DIY A;  1BAY A;  3VWU A;  4WF5 A;  1OE8 A;  3WGX A;  5B6M A;  1T3B A;  4PUF C;  2YWI A;  3Q74 A;  5D9X A;  1WE0 A;  4D73 A;  5ECK B;  2JAD A;  1Z5Y E;  3GH6 A;  3GFK A;  2WZ9 A;  1ERU A;  5H5S A;  2VLV A;  1BJX A;  2MBT A;  2X99 A;  2X4A A;  5AIV A;  6GSS A;  4BVY B;  3ERG A;  3ERW A;  3EMP A;  3TJK A;  2JZR A;  3E3E A;  1JHB A;  2YV9 A;  1TK0 B;  3HMJ G;  2GZZ A;  5IO0 A;  1ERV A;  1GSF A;  3IK7 A;  2CV4 A;  5DJM A;  1NM3 A;  5JCG A;  5DBQ A;  2ON7 A;  2Z9S A;  2N5B A;  1E2Y A;  1ZL9 A;  3ZMK A;  2B7J A;  2C3Q A;  2LRN A;  5EVO A;  1TRU A;  4MA9 A;  1XOA A;  1A2L A;  5IPH A;  3TJJ A;  2PMT A;  2VLU A;  4Q5N A;  2C4J A;  2YWM A;  3WD6 A;  4TR3 A;  2I3Y A;  4N10 A;  3TJB A;  4G0I A;  1YDK A;  4ECC A;  1FOH A;  2OE1 A;  2R5G A;  5KOW A;  4EC0 A;  8GSS A;  4E68 A;  3F9U A;  3L78 A;  2H30 A;  2DIZ A;  2R6K A;  3G9B A;  4G19 A;  2DKI A;  5IMA A;  1QXH A;  4HZ2 A;  1TXX A;  3S9F A;  2QC7 A;  2FUG 2;  3ZFB A;  2J23 A;  1JFU A;  1EGR A;  2YZU A;  1TXU A;  1X9S B;  3DGQ A;  3H79 A;  3LEF A;  2H1D A;  3H8Q A;  4PXO A;  4GXZ A;  5CRD A;  4KF9 A;  2WUL A;  2R0C A;  3KH7 A;  2H66 A;  2G0F A;  4GRF A;  5D9V A;  1GWC A;  5CP1 A;  3VWX A;  2HRA A;  3HHV A;  3KGK A;  1TW9 A;  1O73 A;  1GLP A;  3FR9 A;  1M2B A;  1YKC A;  1SJ6 A;  2HNL A;  5ID2 A;  4JU5 A;  1ZYE A;  3BCI A;  5DDL A;  4KND A;  1PX6 A;  4F0C A;  4J57 E;  3R2Q A;  2CVK A;  4TR1 A;  4ECB A;  4MP4 A;  2NBS A;  4GST A;  2AAW A;  4X4J A;  4XRA A;  4ML1 A;  3U6V A;  1N25 A;  4N3Z A;  3TKQ A;  2X49 A;  2YP6 A;  4OD7 A;  4BL7 A;  5DAL B;  2IFQ A;  4AJ7 A;  3KXO A;  5HQP A;  3TKS E;  5GAN D;  2GSS A;  4PUA A;  3ZLP A;  1GTI A;  4YKF A;  5DJL A;  1WIK A;  1O6J A;  1TI3 A;  2M80 A;  2PER A;  4GQF A;  3GTU B;  3HJO A;  5ECH B;  5JWQ B;  4EO3 A;  2V2G A;  2YWN A;  1B9Y C;  3KM6 A;  1GUL A;  4K5R A;  4PGT A;  4NV5 A;  1EZK A;  4O5U A;  4ECJ A;  3ZRD A;  2L6D A;  1S3D A;  4IN0 A;  4K6X A;  2XBQ A;  1R4W A;  2X8G A;  1VF1 A;  4F03 A;  1Z3E A;  2H0G A;  4AKI A;  5B8A A;  2H6Z A;  2IMF A;  3J7Y b;  4Z2T A;  2FCH A;  9GSS A;  5HR3 A;  1JLV A;  3QAV A;  5DVB A;  2VCZ A;  3UVT A;  2P5Q A;  1EOH A;  2YPM A;  5A5H B;  3FEU A;  2HSM A;  2C8U A;  4K8M A;  2FHE A;  1Q4J A;  3IC8 A;  1GH2 A;  2IPA A;  3GN3 A;  1M9A A;  4F82 A;  1K0N A;  1HQO A;  3KTL A;  3F4S A;  4NXI A;  3M0F A;  1A24 A;  1X9W B;  4X0X A;  3M3M A;  2DSA A;  3FW2 A;  5COH A;  1JZD A;  4LA1 A;  5IO2 A;  3A2W A;  1Z9H A;  2H0H A;  2WFC A;  4O7H A;  2VO4 A;  4EIP A;  3EU4 A;  4MZW A;  1G6Y A;  1YZX A;  3I43 A;  2H1A A;  3HJM A;  1O8W A;  4ULX A;  1PL1 A;  2H75 A;  5GAP D;  2LST A;  1JLW A;  2JZT A;  3GKX A;  4POB A;  3ZFL A;  4CY8 A;  4ZL7 A;  3LXZ A;  4RI6 A;  5AGY A;  2R37 A;  2PVQ A;  4MPG A;  1FB6 A;  3LOR A;  1U6T A;  5HFI A;  3GA4 A;  4NAX A;  3FZA A;  1SVO A;  3QPM A;  2TRC P;  4V2N A;  2X8H A;  3JCM L;  3ZZX A;  2HZF A;  5IMD A;  1AW9 A;  3D6I A;  2MMZ A;  2JL4 A;  4BA7 A;  2RUF A;  1TRV A;  4JR6 A;  2O89 A;  1B8X A;  2H72 A;  2GSR A;  4XCS A;  1BF5 A;  4IW9 A;  2IMD A;  4HDE A;  4MJC A;  1B48 A;  1MDI A;  1DUG A;  2OKA A;  4TRX A;  2B6M A;  5FT3 A;  1X9M B;  3NIV A;  1SL2 B;  2H76 A;  4EIQ A;  3P7X A;  4TN8 A;  3LGC A;  2LJA A;  2YN1 A;  2WCI A;  1FB0 A;  4GF0 A;  2YWO A;  1GP1 A;  4J56 E;  1F3A A;  5G5F A;  3VK9 A;  4K9Z A;  1AAZ A;  3Q19 A;  4A5P A;  2LEG A;  3ZVJ D;  3WGE A;  2XBI A;  4TOP A;  2YNX A;  3KZQ A;  2PPT A;  5ECR B;  3EMX A;  3HVX A;  2HT9 A;  2C0E A;  3CYN A;  4ZIL A;  3ZIV A;  2FWF A;  4PTS A;  1Z6N A;  3QAW A;  4AKG A;  4IJ3 A;  3H4K A;  1SD9 A;  4LL4 B;  2IN3 A;  3PH9 A;  3VFI A;  5J4U A;  3W6G A;  4OFM A;  4EL1 A;  2B5E A;  1XWC A;  1GUM A;  5GST A;  1ZYQ B;  4K2X A;  1AUC A;  4N0V A;  2KUC A;  1TU8 A;  2O5V A;  1TDI A;  4L5L A;  4HUA A;  3KEB A;  1THX A;  1K3O A;  4EDZ A;  2GZY A;  5J47 A;  3LXT A;  2RLI A;  5D9W A;  4XS4 A;  4QMK A;  1GSS A;  1PQN A;  4H86 A;  1E6B A;  1XWA A;  1TTZ A;  3RHB A;  4D73 B;  1LJR A;  1XW5 A;  2FA8 A;  3A5I A;  2QA1 A;  3IDV A;  4Z2U A;  5LNK e;  1HNA A;  2DJ1 A;  4AKH A;  2AV4 A;  1SVM A;  3PIN A;  3TKR A;  2K8V A;  4LLR A;  4XS6 A;  5EY6 A;  3PR8 A;  2R0G A;  1M0U A;  4ECI A;  5ECL B;  2K6V A;  4XIH A;  2KP1 A;  3RBT A;  1OC9 A;  4I97 A;  1EP7 A;  4WR5 A;  3M9J A;  4MCU A;  4N0Z A;  2C1Y A;  3IA1 A;  4RUV A;  1WOU A;  3GUR A;  1FO5 A;  1GNW A;  3IV4 A;  5HR1 A;  3Q6O A;  1WWJ A;  1BYE A;  1AQW A;  2VKZ G;  2B5X A;  5D8I A;  6GSY A;  4X1U A;  3CSI A;  2QSI A;  3GSS A;  3N5O A;  3O3T A;  3HZ8 A;  4HQZ A;  3MSZ A;  3QD9 A;  2B3S A;  2CZ2 A;  5DQY A;  1XWG A;  5AIS A;  1KTE A;  5JWR B;  2I9H A;  3L0H A;  1PMT A;  1I9D A;  2H6X A;  3GL5 A;  3ME8 A;  1HYU A;  3ZIT A;  2YJ7 A;  17GS A;  1JZO A;  1A23 A;  5C04 A;  3TUE A;  4OFT A;  1SD8 A;  2C3T A;  3UOM A;  4KDU A;  4GSS A;  2NVL A;  2HXK A;  1M9B A;  3F3Q A;  1MD4 A;  1ST9 A;  1O85 A;  2MMN A;  2VCV A;  3P8W A;  2G2Q A;  2VCQ A;  3DVX A;  2R2J A;  3FMW A;  1ZYN A;  2R4V A;  3ZTL A;  3TOU A;  3IBH A;  2E7P A;  3ZRE A;  3UBL A;  4ZL8 A;  1ZZY A;  4BWS A;  4ZXG A;  3PPU A;  4CW9 A;  11GS A;  1SEN A;  1V2A A;  5ID2 B;  3F0I A;  2GDR A;  1SL1 B;  4WXT A;  4X43 A;  1VRS D;  3FKF A;  1MDK A;  2ES7 A;  4MNN A;  1GTU A;  2DLX A;  4GSN A;  3GH9 A;  1TU7 A;  4JR4 A;  3QOU A;  2CX4 A;  4TR1 B;  3VUR A;  1U3I A;  5E4W A;  5B7C A;  1XFL A;  1HD2 A;  3HZ4 A;  2FLS A;  4BL7 B;  2IFQ B;  1Q98 A;  1GTA A;  3L4N A;  2PUK C;  4ZB8 A;  3ME7 A;  3DKS A;  5JCW A;  4IGJ A;  2F9S A;  19GS A;  2H0I A;  2H74 A;  2L4Q A;  1HNB A;  2P0G A;  2YAN A;  5IOW A;  2L4C A;  1XVQ A;  1EEJ A;  2YJH A;  3CXG A;  2OT3 A;  3W8S A;  4ILF A;  4PX1 A;  5KN0 A;  3VLN A;  4RQX A;  2VL9 A;  3QFB C;  1AIU A;  1OKD A;  3EIN A;  1A0F A;  5ELG A;  1RW1 A;  1SK1 A;  2ZUP A;  4K2D A;  3WT1 A;  4NHW A;  1ACV A;  2V32 A;  4ZB6 A;  3F3R A;  1M2D A;  4KDX A;  1YJ6 A;  5B6N A;  4IHU A;  2E2M A;  3UIW A;  2HRF A;  1KBN A;  1WRY A;  2L59 A;  1RK4 A;  3GUS A;  4I6X A;  3FK8 A;  4WBR D;  2BMX A;  5IOX A;  2HSM B;  5H5R A;  3LWA A;  4K5S A;  1EGO A;  4Q5R A;  5KEJ A;  1PSQ A;  4FIW A;  5F0G A;  4F9Z A;  1G6W A;  2F3M A;  2KLX A;  1ILO A;  1EEM A;  4G0L A;  3L9V A;  3UJ1 A;  4GWR A;  3MIX A;  4V1A p;  3HA9 A;  3WYW A;  3MAK A;  5E59 A;  3F8U A;  1Z7P A;  4POL A;  4AI6 A;  3GYK A;  1OC3 A;  4YAV A;  5J9C A;  5JCU A;  2C80 A;  1V58 A;  5IIZ A;  2AYT A;  3KP9 A;  2E0Q A;  4PQ1 A;  3BOA A;  4MJA A;  1SKW B;  2VD1 A;  5ECM B;  3F63 A;  4F2I A;  1K0O A;  4MF6 A;  2ZNM A;  3GX0 A;  3LW9 A;  3GKM A;  2VL3 A;  4IVF A;  5G2Z A;  3EWL A;  1FG4 A;  4MZC A;  4HJM A;  4CY6 A;  4K7N A;  1LBK A;  3CTF A;  2H71 A;  3EYT A;  3O6T A;  3C7M A;  5BRT A;  1AQX A;  3C1S A;  3CRT A;  3SWL A;  3LYP A;  1CQH A;  3G7Y A;  1BG1 A;  4WBJ A;  2XPD A;  3EVI A;  1THO A;  2H1B A;  4OCF A;  2LV3 A;  4GLT A;  2JU5 A;  1HNC A;  4HJ2 A;  5A4U A;  3APS A;  2RM5 A;  1FVK A;  1KNG A;  1MD3 A;  2M72 A;  2DJJ A;  4DSR A;  2QGV A;  4MF5 A;  2X8C A;  3A2X A;  2CVD A;  2VOC A;  2JSY A;  1YEP A;  5IM9 A;  2C0G A;  3FZ4 A;  3DWV A;  4MJB A;  4EKZ A;  2NDO A;  2A4H A;  5B8B A;  4EE0 A;  2LKU A;  4DSS A;  1SJZ A;  2O85 A;  3NOF A;  3TGZ A;  5HR0 A;  1NSW A;  3BD2 A;  5ECI B;  4IS0 A;  3QMX A;  1S3C A;  1R26 A;  3F4T A;  3HYP A;  5AIX A;  2GQK A;  3GHA A;  4YQM A;  1YVL A;  4KSM A;  4YQU A;  4G01 A;  4OFN A;  2JZS A;  4TR0 A;  1PA3 A;  3ED3 A;  4KCA A;  13GS A;  1R5P A;  2UV8 G;  2RII A;  1MTC A;  2RM6 A;  1ABA A;  2E2G A;  2CA8 A;  2WS2 A;  5KN2 A;  3H93 A;  4OWY A;  1SYR A;  5IMV A;  5CNW A;  2VM2 A;  2AB6 A;  4Q5Q A;  1A2J A;  2IWT A;  1ZYP A;  4MH2 A;  5IQY A;  3TKS A;  3TB2 A;  3GRX A;  2KP2 A;  3AY8 A;  2ALB A;  5G31 A;  3FZ5 A;  3HD5 A;  1NHY A;  3QAG A;  2OAD A;  2F8F A;  3WGD A;  3DRN A;  4XTS A;  3ISO A;  4TXO A;  3DXB A;  4G10 A;  3DIE A;  1Y25 A;  4DSQ A;  2IMK A;  1UVZ A;  4XS4 B;  4IP1 A;  1X5D A;  3UL3 A;  4FO5 A;  1T00 A;  2OJL A;  1K0B A;  3VI7 A;  5ENU A;  2FD3 A;  2EC4 A;  1PKW A;  1XZO A;  3F6F A;  2GZP A;  1W4V A;  3TDG A;  6GSU A;  5J9B A;  3CWG A;  2LQO A;  5DAK A;  5F8B A;  5ECS A;  4IQ1 A;  2B7K A;  4FYC A;  4L0W A;  4AJ8 A;  2V41 A;  2EIO A;  3C1R A;  2DJ2 A;  2PWJ A;  1MEK A;  2I81 A;  5H5Q A;  2H19 A;  2FWG A;  1OC9 B;  4EUY A;  1FVJ A;  3RDW A;  3F6D A;  5A4W A;  2LNT A;  1QMV A;  1ZCP A;  2P5R A;  4ZBA A;  2VD0 A;  1T4Z A;  4Z2R A;  2JSZ A;  3FYG A;  4BVX A;  2F8A A;  1K3L A;  2I4A A;  4G9H A;  2EFH A;  5J41 A;  3BJ5 A;  1VF3 A;  1YY7 A;  4AJ6 A;  1B9X C;  1TRW A;  2ON5 A;  4NV2 A;  5D9T A;  1TK8 B;  1V57 A;  6GST A;  4KH7 A;  5EPF A;  3CMI A;  4N30 A;  3KMN A;  5DCH A;  3APO A;  3EE2 A;  4MJE A;  4O5Q A;  1GSU A;  4GCI A;  1X0R A;  4MK3 A;  4AKX B;  2F51 A;  2CQ9 A;  2EFD A;  2GS3 A;  1XOB A;  2V6K A;  2YZH A;  5AN1 A;  3IXR A;  4K7I A;  2VL2 A;  1XWK A;  2HRK A;  1F3B A;  1AQV A;  2LRC A;  2M46 A;  1PL2 A;  4TXV A;  1M99 A;  2UZ8 A;  2B1K A;  5IMC A;  5IMF A;  2EIR A;  4E8H A;  5KN1 A;  1R5A A;  2FNO A;  2O7K A;  2BJX A;  4PNF A;  3P2A A;  1TKD B;  3ZML A;  4QL9 A;  3KIJ A;  1J0F A;  4BWQ A;  1PN0 A;  3QFA C;  1GSD A;  2GQL A;  1GNE A;  3KMO A;  2HLS A;  3C8E A;  2GTU A;  4ML6 A;  4I2T A;  4K7O A;  2VAF A;  5F05 A;  1WMJ A;  4I2U A;  5HFK A;  4WEY A;  2L6C A;  1U87 A;  6GSX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...