3IR4A

1.2 angstrom crystal structure of the glutaredoxin 2 (grxb) from salmonella typhimurium in complex with glutathione
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
218
structure length
218
Chain Sequence
SNAMKLYIYDHCPFCVKARMIFGLKNIPVELNVLQNDDEATPTRMIGQKMVPILQKDDSRYLPESMDIVHYVDNLDGKPLLTGKRNPAIEEWLRKVNGYVNQLLLPRFAKSAFDEFSTPAARQYFIRKKEASSGSFDNHLAHSAGLIKKIGDDLRLLDKLIVQPNAVNGELSEDDIHLFPLLRNLTLVAGIHWPTKVADYRDNMAKQTQINLLSSMAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Glutaredoxin 2
publication title 1.2 Angstrom Crystal Structure of the Glutaredoxin 2 (grxB) from Salmonella typhimurium in complex with Glutathione.
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
total genus 79
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2009-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04399 Glutaredoxin2_C Glutaredoxin 2, C terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3ir4A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3ir4A01
1THXA 9GSSA 3CBUA 4L8EA 3H79A 1NHOA 4AF2A 1FB0A 1TI3A 3F4SA 3GUSA 4GRFA 3VLNA 4Z7XA 1TOFA 1YY7A 2C0DA 12GSA 3GN3A 1QMVA 4GTUA 2VLUA 1GSYA 2R2JA 5GAND 4F0CA 2X99A 4QL9A 4N0ZA 5G2ZA 3O76A 3CRTA 3KTBA 4DSSA 5HR0A 2JZRA 1J0FA 4G0IA 2PPTA 1GTUA 3FZ5A 1YJ6A 19GSA 3S9FA 3N5OA 3M8NA 3IR4A 4GCIA 3LORA 2VAFA 3ZREA 4MF7A 5EVOA 1SL2B 1K0OA 1K0CA 5CO3A 3RBTA 3TOUA 1FOVA 3OR5A 4NAXA 2R6KA 5IOXA 1JLWA 4RQXA 3HJMA 5GZZB 2F3MA 1GTIA 1ZZYA 5DAKA 2G0FA 2E0QA 3LSZA 2KHPA 3KJYA 3C8EA 5IPHA 3GKKA 1W4VA 4MJBA 2LJAA 3HJOA 4TR3A 1XWCA 2FWGA 2VO4A 1SU9A 5GSSA 2H75A 2MMZA 1EEJA 3PH9A 1DE1A 5CREA 1FO5A 3N9JA 2H70A 4WETA 3HVXA 1SK1A 3VFIA 3J7Yb 1DUGA 5HR1A 3U6VA 4BVXA 5FWGA 4DSSB 3ZTLA 3IE3A 2IFQA 2KP2A 4D73A 3F0IA 1SL0B 1S3DA 4MJCA 2VL2C 1R5AA 2VCTA 2TIRA 4K7OA 2OBIA 8GSSA 1GUMA 2TRXA 3BJ5A 2KUCA 2WZ9A 3D5JA 1QGVA 1AQVA 1SD9A 5LCZA 2K6VA 3DIEA 3DD3A 4QQ7A 1UA5A 1O85A 1K0BA 1O8WA 2GT5A 1XCCA 1JHBA 1PSQA 3EVIA 3LXZA 2ZCTA 2B1LA 4WBJA 1EEMA 6GSSA 4Q5NA 4IN0A 2CAIA 1BQ7A 2H1AA 2LQQA 2C1YA 1JLVA 2QSIA 1BJXA 2IMDA 3QR6A 3APOA 4BVXB 2N5FA 14GSA 1K3OA 4HS1A 2QKEA 3QFBC 2HQTA 1B4PA 2IFQB 4IJ3A 4D73B 2YV9A 4KCAA 1V58A 4EXJA 2DJJA 4JR4A 1URMA 4PUFC 2NTOA 2ON7A 1BG5A 3F9UA 1ACVA 3FZ4A 2Z9SA 5IIZA 5ECQB 5B6MA 1GUHA 1XVWA 2H6XA 4N0VA 2CV4A 2J9HA 4ZILA 1HD2A 1PGTA 5CP1A 5E59A 5A5KA 2YZUA 1X9SB 1X5EA 2C8UA 2HLSA 1F6MC 4IJIA 2C4JA 4MZBA 1T1VA 3V1WA 1EP8A 2HZEA 3I6AA 4ISDA 2YOIA 2L6DA 3D4MA 1X5DA 2O87A 3M3MA 4XIHA 2L5LA 2GZPA 4N11A 4WR5A 1GULA 1XW6A 1RQMA 1H75A 2KLXA 2F8FA 1O7UA 5CRWA 4PURA 1W89A 4L0UA 1QUWA 4MH2A 3LG6A 2N5AA 2H6ZA 3E9JB 3QMXA 1VF2A 4KNDA 3UOMA 4XCSA 2MMAA 4WF5A 1JZWA 4IQAA 1NSWA 4EDZA 1A0RP 1Z7PA 2YP6A 4BPYA 1XWKA 3L78A 3ED3A 4EUYA 2H8LA 5IMZA 4I6XA 2IPAA 4GQCA 3UIWA 2R5GA 6GSTA 3FRCA 3KM6A 5DCHA 2LNSA 2A4VA 5G5EA 2NBSA 1F37A 2JACA 2CVKA 4NWYA 2M80A 1TK8B 4X43A 4XRAA 4O92A 2LRCA 2HZEB 1Z9HA 4MK3A 3TB2A 1Y25A 3Q19A 1JFUA 5D96A 1OC8A 2DJ1A 3VK9A 2BJXA 2H72A 4ZB6A 1YF1A 3HYPA 2DJKA 4OO4A 5F05A 4FO5A 1ZMAA 3F3QA 2ON5A 4WBRD 4MZWA 1XVQA 3EE2A 3Q6OA 2CVBA 1F9MA 2XPEA 5ECNB 2GLRA 3M9KA 4NPBA 4DVCA 3WD6A 2YJHA 4KX4A 2XBQA 4WKWA 1PX6A 4V2MA 2VLVA 2AV4A 3HD5A 2H66A 3FR9A 20GSA 2C3TA 2OBKA 2HRFA 1XWAA 5JCGA 4J56E 5DCGA 2WJUA 5J9BA 1FG4A 3LQ7A 1WE0A 3HXSA 1R4WA 1FHEA 1PRXA 4X1UA 1EOGA 3VPQA 2CAQA 2C0EA 2JSYA 2R37A 1Q98A 3A2XA 3U5RE 1HYUA 4HQSA 4HQZA 3H1NA 2LS5A 1A2MA 3CYNA 4KA0A 2PN8A 1TDIA 2CX3A 2HFDA 4JE1A 1SK0A 5KN2A 1THOA 3DVWA 4X0XA 3DMLA 1Y6EA 1GLQA 1J08A 3UVHA 2YANA 4GSNA 1A8LA 2AJQB 1ABAA 4MH3A 1U88A 1CQHA 2VD0A 1FAAA 4CHSA 1TK0B 3P7XA 2FHEA 3C7MA 3F4RA 4EE0A 2B3SA 2LRTA 4WF4A 2FWEA 3IXRA 1TW9A 4PQHA 3TGZA 3TJFA 1TKDB 1HQOA 4LA1A 4RI7A 3TKSE 3UVTA 1OC9A 3HDCA 1DBYA 4XRDA 3ZIVA 2GSTA 4HUAA 2I9HA 1WMJA 4MABA 5ELAA 3DRNA 3CRUA 3W8JA 2GZZA 1IYIA 3KZQA 3F63A 4ZBDA 4KCEA 4JEDA 2HRNA 5D9TA 1LJRA 4G10A 1FB6A 1R26A 2XPDA 2C3QA 1TU7A 1XXUA 2MBSA 2QC7A 1BYEA 4NHWA 2YPMA 1YQ1A 4MLYA 3CXGA 5E4WA 5JWOB 4YAVA 2VCQA 1EV4A 1T4ZA 4PXOA 2LSTA 2VIMA 4FYUA 1AIUA 3F6DA 3C1SA 2B6MA 3VURA 2HSHA 4OD7A 1GH2A 4IGJA 5C04A 3KCMA 3IK9A 2B5XA 1KTEA 2L59A 3C1RA 1YEPA 3VWUA 1RW1A 5GSTA 3TDGA 4Q5RA 3VWXA 3MDKA 2YWIA 3IC8A 1SYXA 3F8UA 4V2NA 2F8AA 1ZYEA 2R4VA 1ERWA 2C80A 2OA7A 3L0HA 2GSQA 3HKRA 5DDLA 1OC9B 1M0UA 1HNBA 3M9JA 4ID0A 2FWFA 4EC0A 3ZVJD 1S3CA 2YCDA 5HFGA 1GNEA 1M2BA 4AJ6A 4ECCA 2EIOA 4KH7A 2HI7A 1V40A 5H5QA 4IBPA 2P31A 5G31A 2IIYA 5IMDA 4K7IA 4PUAA 2I4AA 3HVVA 1EGOA 3W8SA 2A2RA 2H71A 3M0FA 1XFLA 3ME8A 3GURA 2X8CA 3GKMA 4BVYA 3Q18A 3GA4A 3GRXA 3TKSA 2C0FA 4XHMA 1ZCPA 4JZQA 5L71A 3FW2A 1ZOFA 2RM6A 1EV9A 2WS2A 5FT3A 4KSMA 2H19A 4ACSA 3DXBA 1Z5YE 1K3LA 4AJ8A 1XOAA 1AW9A 1PKZA 4ZXGA 4HJMA 3KXOA 2JZTA 2LKUA 4GSSA 2RUFA 1AQXA 1TRSA 3GYKA 1EZKA 1TTZA 2YN1A 3GL3A 3GL5A 5IMCA 1TI1A 4EF0A 3HJPA 3A2WA 4PNFA 2HRKA 2A2SA 4KW6A 1UVZA 2DMLA 4HU7A 2H01A 2CZ3A 2V1MA 4K7NA 3TRPA 2VCVA 5BMUA 3CSIA 1SJZA 4BL7A 4CW9A 1K0NA 5DBQA 4KGIA 2G2QA 3TJBA 4OMVA 2FLSA 3WT2A 4MP4A 1T8EB 2FD3A 2QGVA 1CQGA 2PMTA 3L9VA 4BVYB 2E7PA 5ID2A 1AAZA 3CSJA 2M46A 2JADA 3PINA 5ECSA 2YWNA 4P3YB 4ULXA 5CRGA 1B9XC 3DYRA 5ECPB 3MAKA 4GF0A 1OKDA 2F51A 3DWVA 5D9VA 3C73A 2WFCA 3F4TA 4G0LA 4MJAA 1X9MB 2OKAA 4RI6A 1IYHA 1T7PB 2O85A 5B6NA 1ON4A 1PN9A 3P8WA 1AUCA 2LUSA 3D22A 2WULA 1ERUA 4K0NA 4FH8A 5HQPA 5HR3A 3TJGA 2H73A 1H4OA 4MZCA 5F06A 4DSQA 5ABRA 5C00A 4EL1A 2HRKB 5IO2A 1G7EA 1RK4A 3LYKA 2R3XA 1G0TA 2VUPA 1ML6A 4TOPA 1WPIA 4HI7A 4BL7B 4TR1A 5F07A 3LFLA 4IVFA 4KUNA 4L0WA 3CMIA 3APQA 4ML1A 1EOHA 2HYXA 5D73A 4KF9A 2VLTA 1U3AA 4EO3A 1NW2A 1MDIA 5ID2B 2PVOC 1QFNA 3FY7A 4HZ2A 2GVPA 3HCZA 1OC3A 3BCKA 3GX0A 4GQFA 1ILOA 1T00A 1JZOA 2MMNA 2DJ0A 2FA8A 3ZRDA 2GQMA 4XTSA 2H0GA 2JU5A 3ERWA 5DQSA 4MPGA 1VF3A 3TKQA 2V6KA 5KN0A 2GQKA 4IP6A 3M1GA 4O5RA 3ZFBA 4N10A 4TVEA 1A23A 2OACA 3WYWA 4POKA 4RUVA 3A5WA 5G1LA 3TJKA 3R3EA 1GL8A 1YKAA 5ECLB 3ZLPA 4GLTA 1PA3A 4LMWA 4I8BA 2K9FA 3TKSC 4NHZA 4PQ1A 5HFIA 3ZYWA 1OE7A 4AJ7A 1M2AA 3QAWA 5HFKA 3KH9A 2IMFA 5G30A 4TKYA 2UZ8A 1FW1A 2PWJA 3FKFA 1GLPA 1NHYA 3TCOA 4PTSA 4TR1B 4O7HA 4ZBBA 3I43A 3QPMA 2K8SA 4J57E 4ZIJA 2LNTA 2P0GA 1O73A 4F0BA 4NMUA 2WGRA 5EPFA 4TW5A 2ZNMA 2O7KA 3H8QA 5B7CA 3E0UA 3IV4A 2DBCA 2HNLA 4ZL9A 4MJEA 2H0IA 3GX8A 1YDKA 4G0KA 3ZVJA 1WP0A 3HVSA 4EDYA 3G7YA 1SJ6A 5D93A 1XW5A 4ECBA 2VOCA 1U3IA 4YH2A 10GSA 5H5SA 5DJLA 3ERGA 4K6XA 2HSYA 1B9YC 1F3BA 4K8MA 3BCIA 3Q74A 2X8GA 3UJ1A 4TXOA 3TKRA 3D6IA 3KIJA 5CYYA 4FYBA 5J5NA 4YQVA 5LNKe 3TRXA 4HOJA 3H93A 1FVKA 4JBBA 2FWHA 3FHKA 3IDVA 2EIRA 1KNGA 1USBA 3TJJA 4K9ZA 3GMFA 4PNGA 3FR6A 1XIYA 4K2DA 1XOBA 1G6YA 2PBJA 4Q5QA 2FY6A 4ECJA 3BD2A 2L4QA 2NVLA 3G7IA 3EWLA 3GKNA 2IJYA 5HR2A 1F2EA 1E2YA 1T3BA 1GTAA 4MPFA 4JR6A 3G7JA 4IS0A 2NDOA 6GSVA 5IPGA 4V2LA 2H1DA 4WXTA 2IMIA 3PGTA 1N8JA 2B7KA 3DVXA 2IN3A 1K0MA 1WOUA 4OFMA 2VCWA 1XZOA 3IHQA 4MCUA 3ME7A 6GSXA 1PL2A 1B48A 1TXXA 5AN1A 4IHUA 2E2MA 2FA4A 2YNXA 2GT6A 3ZMLA 2JL4A 3I9V2 1MD4A 2OE3A 4TXOB 3PPUA 6GSWA 4FIWA 5KN3A 2HZFA 4YAPA 2GS3A 3P90A 2EIQA 1DSBA 4I97A 3NZNA 2OE0A 3ZMKA 5EL8A 1F3AA 2VCZA 3D21A 4USSA 1GSSA 4F2IA 1B4QA 3LWAA 2B5YA 1LU4A 1TRWA 3K8NA 2GDRA 4POBA 2B5EA 1OAZA 5J9CA 1OKTA 13GSA 3IOSA 2AHEA 2PUKC 3A2VA 3GNJA 1GTBA 5AISA 3TUEA 4TXVA 3R2QA 1GP1A 2OE1A 3APSA 3UBKA 2JZSA 5D9WA 4J2FA 1BX9A 4HU9A 4ZL7A 4MF5A 3VPTA 3NOFA 5GAPD 1GSQA 3LGCA 2B1KA 3GH9A 4E8EA 1R7HA 3UL3A 1AXDA 1SL1B 4YQMA 1U87A 1DE2A 2RUEA 3UAPA 2CX4A 1A2JA 1XBSA 2BMXA 17GSA 4LL1B 2YV7A 3GTUA 3EU3A 5ECMB 3I69A 4XS1A 5IMAA 1UC7A 2MYGA 4WR4A 2GTUA 1WJKA 5IMVA 4ZB9A 3RHBA 1TJDA 3IBHA 1SJIA 4PX1A 3SBCA 1VF4A 1I9DA 3MWHA 2MZCA 1M99A 3TRQA 2AB6A 11GSA 3PR8A 5KN1A 2XHFA 3ZZXA 2IL3A 1M2DA 3BBYA 4KDUA 1V9WA 2X64A 3SWLA 1N2AA 1X9WB 2VM2A 4MMMA 2AYTA 4OCFA 2AUVA 2KOKA 1K0DA 1WIKA 2OJLA 5ECRB 5IOWA 1KBNA 2K18A 1GWCA 1M9AA 2YWMA 4BA7A 1C72A 1E6BA 3KD0A 3O6TA 1A8YA 2H30A 4OO5A 3RPNA 1KEBA 4F82A 4EKZA 5JWRB 3EMPA 4NV5A 1WRYA 3IA1A 1SKRB 5DALA 3FK8A 3ZIJA 2V2GA 2V41A 3E3EA 5INYA 2VL9A 3IAS2 3GTUB 4G19A 2ES7A 3KTLA 1OVNA 2NPBA 2HRAA 1XWBA 1GSDA 16GSA 1K3YA 3HY2A 4POMA 4ZB8A 1O81A 3D0ZA 3GKXA 3MNGA 3RAZA 1UN2A 4GXZA 1GRXA 2REMA 3EINA 3DGQA 3LYPA 1QXHA 2BTOT 4CDOA 3FZ9A 2GQLA 2MBTA 2GSSA 1SENA 1GUKA 1V98A 1A2LA 4TR4A 3EC3A 2XBIA 4OCEA 1M9BA 1O8XA 2VD1A 5JWQB 4GWRA 5CRHA 3ZL5A 4IELA 4EVMA 1MTCA 4XS4A 3UEMA 3J7Yk 2B7JA 5ENUA 18GSA 5AIVA 3QOUA 2WRTA 1Z6NA 3ZFLA 2LTKA 1ST9A 2IMKA 5IO0A 1XW9A 5DALB 2CZ2A 1XWGA 1JZDA 5D8IA 3RDWA 2LJRA 5AGYA 2PU9C 2DJ2A 5ECOB 1MDKA 4IW9A 1ERVA 5F0GA 4DSRA 2I81A 5DAKB 4MDCA 4NV2A 3EYTA 3GFKA 1VGLA 3QFAC 4FQUA 2DMMA 2ZUPA 2H74A 2L5OA 3RHCA 1NM3A 4ECIA 4TRXA 2GZYA 2FGXA 2IWTA 22GSA 1Q4JA 5F8BA 5CRDA 4GSTA 1Z7RA 1Z3EA 5J4UA 1TP9A 3H4KA 3P2AA 4AGSA 4DEJA 2J23A 3IRAA 1G7OA 3QDNA 1HNCA 3KP9A 3HZ4A 4RQRA 2HT9A 5KEJA 3MSZA 4ZBAA 3BOAA 3IK7A 3CTFA 4LLRA 4WEYA 2V32A 2LJKA 2MMOA 4HDEA 2HE3A 1SK2A 4KDXA 4XS4B 5J3RA 2JSZA 4I2TA 3LXTA 2EC4A 5H5RA 1PL1A 2HSMA 4JRRA 2IMEA 2X8HA 2DLXA 2WCIA 3HA9A 1PX7A 5FHIA 1MD3A 1FVJA 1TU8A 2DC5A 2P5RA 3D4TA 1Z6MA 2TRCP 2CVDA 1EWXA 2GGTA 3C71A 5IQYA 2VL3A 4JU5A 3GSTA 4KB3A 3DKSA 2OADA 1JZRA 3EMXA 1A24A 2VCXA 1R5PA 1YEXA 1X0RA 3O3TA 5ECIB 3GIXA 1SKSB 1EGRA 4Q5FA 2RM5A 5JCWA 4F9ZA 1EP7A 2O8VB 5JCUA 1A0FA 5IM9A 4L5OA 5A4UA 4PGTA 1HNAA 4TR0A 4I2UA 4OFNA 2DSAA 2YZHA 3US3A 4HJ2A 5AIXA 3IC4A 2LV3A 2I1UA 3WGXA 3QAVA 1XPVA 4POLA 2L57A 1J9BA 3FYGA 1PQNA 6GSUA 1QQ2A 4NXIA 2D2ZA 4IQ1A 3NIVA 2F9SA 2H0HA 1SYRA 3WT1A 2HSMB 1ZYQB 2L6CA 2O89A 1YZXA 1WWJA 4PQIA 5CNWA 1AQWA 2LRNA 3IPZA 2N5BA 4F03A 2I3YA 3KEBA 5G5FA 2YJ7A 1SD8A 2FCHA 4QL7A 1M7TA 3QD9A 2RIIA 4V1Ag 1ERTA 3QCPA 5ELGA 2LQOA 3LJRA 4K0GA 3GHAA 2E2GA 3JCML 1B8XA 4OWYA 1PD21 3FZAA 3W6GA 5A4VA 2LEGA 2WB9A 3UBLA 3EURA 3LEFA 3L9UA 4G2EA 5B8BA 5DVBA 3L4NA 5A4WA 2C3NA 7GSSA 4LL4B 1K0AA 3ERFA 1BEDA 5DJMA 5G1KA 3GSSA 2H1BA 1VRSD 2FUG2 1GSUA 4ILFA 3ZITA 2AAWA 4KDYA 4H86A 2DIZA 4E8HA 3KH7A 1MDJA 2PERA 1V2AA 4G9HA 1SKWB 3HZ8A 3L9SA 1QK8A 3GH6A 1X5CA 4KSOA 4IP1A 3F3RA 2H76A 1VF1A 2CA8A 5IMFA 3VWWA 1ZGNA 3FEUA 4IKHA 3UARA 2GSRA 4TN8A 1T4YA 3KMOA 3VI5A 2K8VA 4I5QA 1U6TA 3A3TA 1TRVA 4MA9A 4LMVA 1OYJA 2FNOA 2KP1A 1TK5B 4YQUA 1S3AA 2H6YA 1YKCA 1PMTA 3TOTA 4K1FA 5J41A 3VWVA 2HXKA 2P5QA 3IAM2 2L4CA 1G6WA 4HZ4A 2XC2A 5ECKB 1V57A 5DQYA 4ML6A 3DEXA 4FYCA 3GV1A 2VL2A 3KP8A 3WGEA 4BWSA 2M72A 2CQ9A 1TRUA 1LBKA 4O32A 3G9BA 1ZL9A 5D9XA 2RLIA 1AC1A 6GSYA 3HHVA 3KGKA 4OFTA 2DJ3A 2DIYA 1OE8A 3QAGA 3VI7A 3WGDA 2PVQA 1BAYA 3F6FA 1O6JA 4HEA2 3AY8A 4MF6A 2H1GA 4ZL8A 4KAEA 5EY6A 1YF0A 3CTGA 5LD0A 4L5LA 3RPPA 3FR3A 1GNWA 2V6OA 3CSHA 4KE3A 3UMAA 3KMNA 2C0GA 1GSEA 2WDUA 3ISOA 1GSFA 3EU4A 2YWOA 5COHA 1PKWA 2VM1A 1I5GA 5B8AA 3TKPA 1MEKA 4V1Ap 4BWQA 4N30A 5CAXA 2CT6A 5ECHB 2HSNB 2ALBA 4XS6A 2PGTA
chains in the Genus database with same CATH superfamily
1THXA 2UV8G 9GSSA 3CBUA 4L8EA 3TU3B 1NHOA 4AKIA 3H79A 4AF2A 1FB0A 1TI3A 3F4SA 3GUSA 4GRFA 3VLNA 4Z7XA 1TOFA 1YY7A 2C0DA 12GSA 3GN3A 1QMVA 4GTUA 2VLUA 3CQFA 1GSYA 2R2JA 5GAND 4F0CA 2X99A 4QL9A 4N0ZA 5G2ZA 3O76A 3CRTA 3KTBA 4DSSA 5HR0A 2JZRA 1J0FA 4G0IA 2PPTA 1GTUA 3FZ5A 1YJ6A 19GSA 3S9FA 3N5OA 3M8NA 3IR4A 4GCIA 3LORA 2VAFA 3ZREA 4MF7A 5EVOA 1SL2B 1K0OA 1K0CA 5CO3A 2H1LA 3RBTA 3TOUA 1FOVA 3OR5A 4NAXA 2R6KA 5IOXA 1JLWA 4RQXA 1BF5A 3HJMA 5GZZB 2F3MA 1GTIA 1ZZYA 5DAKA 2G0FA 2E0QA 3LSZA 2KHPA 2EFCA 3KJYA 3C8EA 5IPHA 3GKKA 1W4VA 4MJBA 2LJAA 3HJOA 4TR3A 1XWCA 2FWGA 2WW3A 2VO4A 1SU9A 5GSSA 2H75A 2MMZA 1EEJA 3PH9A 1DE1A 5CREA 1FO5A 3N9JA 2H70A 4WETA 3HVXA 1SK1A 3VFIA 3J7Yb 1DUGA 1I1IP 5HR1A 3U6VA 4BVXA 5FWGA 4DSSB 3ZTLA 3IE3A 2IFQA 2KP2A 4D73A 3F0IA 1SL0B 4ZB7A 1S3DA 4MJCA 2VL2C 1R5AA 2VCTA 2TIRA 4K7OA 2OBIA 8GSSA 5A5HA 1GUMA 2TRXA 3BJ5A 4W66A 2KUCA 2WZ9A 3D5JA 1QGVA 1AQVA 1SD9A 5LCZA 2K6VA 3DIEA 3DD3A 4QQ7A 1UA5A 1O85A 1K0BA 1O8WA 3A5IA 2GT5A 1XCCA 1JHBA 1PSQA 3EVIA 3LXZA 2ZCTA 2B1LA 4WBJA 1EEMA 6GSSA 4Q5NA 3RGBC 4IN0A 2CAIA 1BQ7A 2H1AA 2LQQA 2C1YA 4Z2UA 1JLVA 2QSIA 1BJXA 4Z2TA 2IMDA 3QR6A 3APOA 4BVXB 2N5FA 14GSA 1K3OA 4HS1A 2QKEA 3QFBC 2HQTA 1B4PA 2IFQB 2O5VA 4IJ3A 4D73B 2YV9A 4KCAA 1V58A 4EXJA 2DJJA 4JR4A 1URMA 4PUFC 2NTOA 2ON7A 1BG5A 3F9UA 5A5HB 1ACVA 3FZ4A 2R0GA 2Z9SA 5IIZA 5ECQB 5B6MA 5KOXA 1GUHA 1XVWA 2H6XA 4N0VA 2CV4A 2J9HA 4ZILA 1HD2A 1PGTA 5CP1A 5E59A 5A5KA 2YZUA 1X9SB 1X5EA 2C8UA 2HLSA 1F6MC 4IJIA 2C4JA 4MZBA 1T1VA 3V1WA 1EP8A 2HZEA 3I6AA 4ISDA 2YOIA 2L6DA 3D4MA 1X5DA 2O87A 5A34A 3M3MA 4XIHA 2L5LA 2GZPA 4N11A 4WR5A 1GULA 1XW6A 1RQMA 1H75A 2KLXA 2WZSA 2F8FA 1O7UA 5CRWA 4PURA 1W89A 4L0UA 1QUWA 4MH2A 3LG6A 2N5AA 2H6ZA 3E9JB 3QMXA 1VF2A 4KNDA 3UOMA 4XCSA 2MMAA 1M3JA 4WF5A 1JZWA 4IQAA 1NSWA 4EDZA 1A0RP 1Z7PA 2YP6A 4BPYA 1XWKA 3L78A 3ED3A 4EUYA 2H8LA 5IMZA 4I6XA 2IPAA 4GQCA 3UIWA 2R5GA 6GSTA 3FRCA 1N25A 3KM6A 5DCHA 2LNSA 2A4VA 5G5EA 2NBSA 1F37A 2JACA 2CVKA 4NWYA 2M80A 1TK8B 4X43A 4PI2C 4XRAA 4O92A 2LRCA 2HZEB 1Z9HA 4MK3A 3TB2A 1Y25A 3Q19A 1JFUA 5D96A 1OC8A 2DJ1A 3VK9A 2BJXA 2H72A 4ZB6A 1YF1A 3HYPA 5A34B 2DJKA 4OO4A 5F05A 4FO5A 1ZMAA 3F3QA 2ON5A 2O36A 4WBRD 4MZWA 1XVQA 3EE2A 3Q6OA 2CVBA 1F9MA 2XPEA 5ECNB 2GLRA 3M9KA 4NPBA 4DVCA 3WD6A 2WW0A 2YJHA 4KX4A 2XBQA 4WKWA 1PX6A 3EPTA 2EFEA 4V2MA 2VLVA 2AV4A 2QA2A 3HD5A 2H66A 3FR9A 20GSA 2C3TA 4PHZC 2OT3A 2OBKA 2HRFA 1XWAA 5JCGA 4J56E 5DCGA 2WJUA 5J9BA 1FG4A 3LQ7A 1WE0A 3HXSA 1R4WA 1FHEA 1PRXA 4X1UA 1EOGA 3VPQA 2CAQA 2C0EA 2JSYA 2R37A 5J47A 1Q98A 3MIXA 3A2XA 3U5RE 1HYUA 4HQSA 4HQZA 4CY6A 3H1NA 2LS5A 4HSCX 1A2MA 3CYNA 4KA0A 2PN8A 1TDIA 2CX3A 2HFDA 4JE1A 1SK0A 5KN2A 1THOA 3DVWA 4X0XA 3DMLA 1Y6EA 1GLQA 1J08A 3UVHA 2YANA 4GSNA 1A8LA 2AJQB 1ABAA 1SVOA 4MH3A 1U88A 1CQHA 2VD0A 1FAAA 4CHSA 1TK0B 4A5PA 3P7XA 2FHEA 3C7MA 3F4RA 4EE0A 2B3SA 2LRTA 5A1NA 4WF4A 2FWEA 3IXRA 1TW9A 4YKGA 4PQHA 3TGZA 3TJFA 1TKDB 1HQOA 4LA1A 4RI7A 3TKSE 3UVTA 1OC9A 3HDCA 1DBYA 4XRDA 3ZIVA 2GSTA 4HUAA 2I9HA 1WMJA 4MABA 5ELAA 3DRNA 3CRUA 3W8JA 2GZZA 1IYIA 3KZQA 3F63A 2VKZG 4ZBDA 4KCEA 4E68A 4JEDA 2HRNA 5D9TA 1LJRA 4G10A 1FB6A 1R26A 2XPDA 2C3QA 1TU7A 1XXUA 2MBSA 2DKIA 2QC7A 1BYEA 4NHWA 2YPMA 1YQ1A 4O5QA 4MLYA 3CXGA 5E4WA 5JWOB 4YAVA 2VCQA 1EV4A 1T4ZA 4PXOA 2LSTA 2VIMA 4FYUA 1AIUA 3F6DA 3C1SA 2B6MA 3VURA 2HSHA 4OD7A 1GH2A 4IGJA 5C04A 3KCMA 3IK9A 2B5XA 1KTEA 2L59A 3C1RA 5A1NB 1YEPA 3VWUA 4EIPA 1RW1A 5GSTA 3TDGA 4Q5RA 3VWXA 3MDKA 2YWIA 3IC8A 1SYXA 3F8UA 4V2NA 2F8AA 1ZYEA 2R4VA 1ERWA 2C80A 2OA7A 3L0HA 2GSQA 3HKRA 1ZYNA 5DDLA 1OC9B 1M0UA 1HNBA 3M9JA 4ID0A 2FWFA 4EC0A 3ZVJD 1S3CA 2YCDA 5HFGA 1GNEA 1M2BA 4AJ6A 4ECCA 2EIOA 4KH7A 2HI7A 1V40A 5H5QA 4IBPA 2P31A 5G31A 2IIYA 5IMDA 4K7IA 4PUAA 2I4AA 3HVVA 1EGOA 3W8SA 2A2RA 2H71A 3M0FA 1XFLA 3ME8A 3GURA 2X8CA 2X4AA 3GKMA 4BVYA 3Q18A 3GA4A 3GRXA 3TKSA 2C0FA 4XHMA 1ZCPA 4JZQA 5L71A 3FW2A 1ZOFA 2RM6A 1EV9A 2WS2A 5FT3A 4KSMA 2H19A 4MNNA 4ACSA 3DXBA 4K5RA 1Z5YE 1K3LA 4AJ8A 1XOAA 1AW9A 1PKZA 4ZXGA 4HJMA 3KXOA 2JZTA 2LKUA 4GSSA 2RUFA 1AQXA 1TRSA 3GYKA 1EZKA 5BRTA 1TTZA 2YN1A 3GL3A 3GL5A 5IMCA 1TI1A 4EF0A 3HJPA 3A2WA 4PNFA 2HRKA 2A2SA 4KW6A 1UVZA 2DMLA 4HU7A 2H01A 2CZ3A 2V1MA 4K7NA 3TRPA 2VCVA 5BMUA 3CSIA 1SJZA 4BL7A 4CW9A 1K0NA 5DBQA 4KGIA 2G2QA 3TJBA 4OMVA 2FLSA 3WT2A 4MP4A 1T8EB 2FD3A 2QGVA 1CQGA 2PMTA 3L9VA 4BVYB 2E7PA 5ID2A 1AAZA 3CSJA 2M46A 2JADA 3PINA 5ECSA 2YWNA 4P3YB 4ULXA 5CRGA 1B9XC 3DYRA 5ECPB 3MAKA 4GF0A 1OKDA 2F51A 3DWVA 5D9VA 3C73A 2WFCA 3F4TA 4G0LA 4MJAA 1X9MB 2OKAA 4RI6A 4BIKA 1IYHA 1T7PB 2O85A 5B6NA 1ON4A 5J4YA 1PN9A 3P8WA 1AUCA 2LUSA 3D22A 2WULA 1ERUA 4K0NA 4FH8A 2DKHA 5HQPA 5HR3A 3TJGA 2H73A 1H4OA 4MZCA 5F06A 4DSQA 5ABRA 5C00A 4EL1A 2HRKB 5IO2A 1G7EA 1RK4A 3LYKA 2R3XA 2A2PA 1G0TA 2VUPA 1ML6A 4TOPA 1WPIA 5BMUB 4HI7A 4BL7B 3CWGA 4TR1A 5F07A 1FOHA 3LFLA 4IVFA 4KUNA 4L0WA 3CMIA 3APQA 4ML1A 1EOHA 2HYXA 4ICYA 5D73A 4KF9A 2VLTA 1U3AA 2R0CA 4EO3A 1NW2A 1MDIA 4YKFA 2PVOC 5ID2B 1QFNA 3FY7A 4HZ2A 2GVPA 3HCZA 1OC3A 3BCKA 3GX0A 4GQFA 1ILOA 1T00A 1JZOA 2MMNA 2A4HA 2DJ0A 2FA8A 5KOWA 3ZRDA 2GQMA 4XTSA 2H0GA 2JU5A 3ERWA 5DQSA 1YVLA 4MPGA 1VF3A 3TKQA 2V6KA 5KN0A 2GQKA 4IP6A 3M1GA 3IHGA 4O5RA 3ZFBA 4N10A 4TVEA 1A23A 2OACA 3WYWA 4POKA 1PFOA 4Z2RA 4RUVA 3A5WA 5G1LA 3TJKA 3R3EA 1GL8A 1YKAA 5ECLB 3ZLPA 1TXUA 4GLTA 1PA3A 4LMWA 4I8BA 2K9FA 3TKSC 4NHZA 4PQ1A 5HFIA 3ZYWA 1OE7A 4AJ7A 1M2AA 3QAWA 5HFKA 3KH9A 2IMFA 5G30A 4TKYA 2UZ8A 1FW1A 2PWJA 3FKFA 1GLPA 4GDFA 1NHYA 3TCOA 4PTSA 4TR1B 4O7HA 4ZBBA 3I43A 3QPMA 2K8SA 4J57E 4ZIJA 2LNTA 2P0GA 1O73A 4F0BA 4NMUA 2WGRA 5EPFA 4TW5A 2ZNMA 3H8QA 2O7KA 5B7CA 3E0UA 3IV4A 2DBCA 1PN0A 2HNLA 4ZL9A 4MJEA 2H0IA 3GX8A 1YDKA 4G0KA 3ZVJA 1WP0A 5J40A 3HVSA 4EDYA 4N3ZA 3G7YA 1SJ6A 5D93A 1XW5A 4ECBA 2VOCA 1U3IA 4YH2A 4K2XA 10GSA 5H5SA 5DJLA 4CY8A 3ERGA 4K6XA 2HSYA 1B9YC 1F3BA 4K8MA 3BCIA 3Q74A 2O3EA 2X8GA 1SVLA 3UJ1A 4TXOA 3TKRA 3D6IA 3KIJA 5CYYA 4FYBA 5J5NA 4YQVA 4AKGA 5LNKe 3TRXA 4HOJA 3H93A 1FVKA 4JBBA 2FWHA 3FHKA 1ZYPA 3IDVA 2EIRA 1KNGA 1USBA 3TJJA 4K9ZA 3GMFA 4PNGA 3FR6A 1XIYA 4K2DA 1XOBA 2WVZA 1G6YA 2PBJA 2WW1A 4Q5QA 2FY6A 4ECJA 3BD2A 2L4QA 2NVLA 1SVMA 3G7IA 3EWLA 3GKNA 4FXYP 2IJYA 5HR2A 1F2EA 1E2YA 1T3BA 1GTAA 4MPFA 4JR6A 3G7JA 4IS0A 2NDOA 6GSVA 5IPGA 4V2LA 2H1DA 4WXTA 2IMIA 3PGTA 1N8JA 4QMKA 2B7KA 3DVXA 2IN3A 1K0MA 1WOUA 4OFMA 2VCWA 1XZOA 3IHQA 4MCUA 3ME7A 6GSXA 1PL2A 1B48A 4O5UA 1TXXA 5AN1A 4IHUA 2E2MA 2FA4A 2YNXA 2GT6A 3ZMLA 2JL4A 3I9V2 1MD4A 2OE3A 4TXOB 3PPUA 6GSWA 4FIWA 5KN3A 2HZFA 4YAPA 2GS3A 3P90A 2EIQA 1DSBA 4I97A 3NZNA 2OE0A 3ZMKA 5EL8A 1F3AA 2VCZA 3D21A 4USSA 1GSSA 4F2IA 1B4QA 2WW2A 3LWAA 2B5YA 1LU4A 1TRWA 3K8NA 2GDRA 4POBA 2B5EA 1OAZA 5J9CA 1OKTA 13GSA 3IOSA 2AHEA 4X4JA 2PUKC 3A2VA 3GNJA 1GTBA 5AISA 3TUEA 4TXVA 3R2QA 1GP1A 2OE1A 3APSA 3UBKA 2JZSA 5D9WA 4J2FA 1BX9A 4HU9A 4ZL7A 4MF5A 3VPTA 3NOFA 5GAPD 1GSQA 3LGCA 2B1KA 3GH9A 4E8EA 1R7HA 3UL3A 1AXDA 1SL1B 4YQMA 1U87A 1DE2A 2RUEA 3UAPA 2CX4A 1A2JA 1XBSA 2BMXA 17GSA 4LL1B 2YV7A 3GTUA 3EU3A 5ECMB 3I69A 4XS1A 5IMAA 1UC7A 2MYGA 4WR4A 2GTUA 1WJKA 5IMVA 4ZB9A 3RHBA 1TJDA 3IBHA 1SJIA 4PX1A 3SBCA 1VF4A 1Y1UA 1I9DA 3MWHA 2MZCA 1M99A 3TRQA 2AB6A 11GSA 3PR8A 5KN1A 2XHFA 3ZZXA 2IL3A 1M2DA 3BBYA 4KDUA 1V9WA 2X64A 3SWLA 1N2AA 1X9WB 2VM2A 4MMMA 2AYTA 4OCFA 2AUVA 2KOKA 1K0DA 1WIKA 5J4VA 2OJLA 1BG1A 5ECRB 5IOWA 1KBNA 2K18A 1GWCA 1M9AA 2YWMA 4BA7A 1C72A 1E6BA 3KD0A 3O6TA 1A8YA 2H30A 4OO5A 3RPNA 1KEBA 4F82A 4EKZA 5JWRB 3EMPA 4NV5A 1WRYA 3IA1A 1SKRB 5DALA 3FK8A 3ZIJA 2V2GA 2V41A 3E3EA 5INYA 2VL9A 3IAS2 3GTUB 4G19A 2ES7A 3KTLA 1OVNA 2NPBA 2HRAA 1XWBA 1GSDA 16GSA 1K3YA 3HY2A 4POMA 4ZB8A 3FMWA 1O81A 3D0ZA 3GKXA 3MNGA 3RAZA 1UN2A 4GXZA 1GRXA 2REMA 3EINA 3DGQA 3LYPA 1QXHA 2BTOT 4AI6A 3FZ9A 4CDOA 2GQLA 2MBTA 2GSSA 1SENA 4AKXB 1GUKA 1V98A 1A2LA 4TR4A 3EC3A 2XBIA 3HMJG 4OCEA 1M9BA 1O8XA 2VD1A 5JWQB 4GWRA 5CRHA 3ZL5A 1M3IA 4IELA 4EVMA 1MTCA 4XS4A 3UEMA 3J7Yk 2B7JA 5ENUA 18GSA 5AIVA 3QOUA 2WRTA 1Z6NA 3ZFLA 2LTKA 1ST9A 2IMKA 5IO0A 1XW9A 5DALB 2CZ2A 1XWGA 1JZDA 5D8IA 3RDWA 2LJRA 5AGYA 2PU9C 2DJ2A 5ECOB 1MDKA 4IW9A 1ERVA 5F0GA 4DSRA 2I81A 5DAKB 4MDCA 4NV2A 3EYTA 3GFKA 1VGLA 3QFAC 4FQUA 2DMMA 2ZUPA 2H74A 2L5OA 3RHCA 1NM3A 4ECIA 4TRXA 2GZYA 2FGXA 2IWTA 22GSA 1Q4JA 5F8BA 5CRDA 4GSTA 3MYDA 1Z7RA 1Z3EA 5J4UA 3HVNA 1TP9A 3H4KA 3P2AA 4AGSA 4DEJA 2J23A 3IRAA 1G7OA 3QDNA 1HNCA 2EFDA 3KP9A 3HZ4A 4RQRA 2HT9A 5KEJA 3MSZA 4ZBAA 3BOAA 3IK7A 3CTFA 4LLRA 4WEYA 2V32A 2LJKA 2MMOA 4HDEA 2HE3A 1SK2A 4KDXA 4XS4B 4AKHA 2JSZA 5J3RA 4I2TA 3LXTA 2EC4A 5H5RA 1PL1A 2HSMA 4JRRA 2IMEA 2X8HA 2DLXA 2WCIA 3RFRC 3HA9A 1PX7A 5FHIA 1MD3A 1FVJA 1TU8A 2DC5A 2P5RA 3D4TA 1Z6MA 2WVYA 2TRCP 2CVDA 1EWXA 2GGTA 3C71A 5IQYA 2VL3A 4JU5A 3GSTA 4KB3A 3DKSA 2OADA 1JZRA 3EMXA 1A24A 2VCXA 1R5PA 1YEXA 1X0RA 3O3TA 5ECIB 3GIXA 1SKSB 1EGRA 4Q5FA 4EIQA 2RM5A 5JCWA 4F9ZA 1EP7A 2WVXA 2O8VB 5JCUA 1A0FA 5IM9A 4L5OA 5A4UA 4PGTA 1HNAA 4TR0A 2QA1A 4I2UA 4OFNA 2DSAA 2YZHA 3US3A 4HJ2A 5AIXA 3IC4A 2LV3A 2I1UA 3WGXA 3QAVA 1XPVA 1YEWC 4POLA 2L57A 1J9BA 3FYGA 1PQNA 6GSUA 1QQ2A 2R0PA 4NXIA 2D2ZA 4IQ1A 3NIVA 2F9SA 2H0HA 1SYRA 3WT1A 2HSMB 1ZYQB 2L6CA 2O89A 1YZXA 1WWJA 4PQIA 5CNWA 1AQWA 2LRNA 3IPZA 2N5BA 4K5SA 4F03A 2I3YA 3KEBA 5G5FA 2YJ7A 1SD8A 3LW9A 2FCHA 4QL7A 1M7TA 3QD9A 2RIIA 4V1Ag 1ERTA 3QCPA 5ELGA 2LQOA 3LJRA 4K0GA 3GHAA 2E2GA 2WVXB 3JCML 1B8XA 4OWYA 1PD21 3FZAA 3W6GA 5A4VA 2LEGA 1S3RA 2WB9A 3UBLA 3EURA 3LEFA 3L9UA 4G2EA 5B8BA 5DVBA 3L4NA 5A4WA 2C3NA 7GSSA 4LL4B 1K0AA 3ERFA 1BEDA 5DJMA 5G1KA 3GSSA 2H1BA 2X49A 1VRSD 2FUG2 1GSUA 4G01A 4ILFA 3ZITA 2AAWA 4KDYA 2DIZA 4H86A 4E8HA 3KH7A 1MDJA 2PERA 1V2AA 4G9HA 1SKWB 3HZ8A 3L9SA 1QK8A 3GH6A 1X5CA 4KSOA 4IP1A 3F3RA 2H76A 1VF1A 2CA8A 5IMFA 3VWWA 1ZGNA 3FEUA 4IKHA 3UARA 2GSRA 4TN8A 1T4YA 3KMOA 3VI5A 2K8VA 4I5QA 1U6TA 3A3TA 1TRVA 4MA9A 3CHXC 4LMVA 1OYJA 2FNOA 2KP1A 1XG8A 1TK5B 4YQUA 1S3AA 2H6YA 1YKCA 1PMTA 1S4BP 3TOTA 4K1FA 5J41A 3VWVA 2HXKA 2P5QA 3IAM2 2HSNA 2L4CA 1G6WA 4HZ4A 2XC2A 5ECKB 1V57A 5DQYA 4ML6A 3DEXA 4FYCA 3GV1A 2VL2A 3KP8A 3WGEA 4BWSA 2M72A 2CQ9A 1TRUA 1LBKA 4O32A 3G9BA 1ZL9A 5D9XA 2RLIA 1AC1A 6GSYA 3HHVA 3KGKA 4OFTA 2DJ3A 2DIYA 1OE8A 3QAGA 3VI7A 3WGDA 2PVQA 1BAYA 3F6FA 1O6JA 4HEA2 3AY8A 2EFHA 4MF6A 2H1GA 4ZL8A 4KAEA 5EY6A 1YF0A 3CTGA 5LD0A 4L5LA 3RPPA 3FR3A 1GNWA 2V6OA 3CSHA 4KE3A 3UMAA 3KMNA 2C0GA 1GSEA 2WDUA 3ISOA 1GSFA 3EU4A 2YWOA 5COHA 1PKWA 2VM1A 1I5GA 5B8AA 3TKPA 1MEKA 4V1Ap 4BWQA 4N30A 5CAXA 2CT6A 5ECHB 2HSNB 2ALBA 4XS6A 4PI0C 2PGTA
chains in the Genus database with same CATH topology
1THXA 2UV8G 9GSSA 3CBUA 4L8EA 3TU3B 1NHOA 4AKIA 3H79A 4AF2A 1FB0A 1TI3A 3F4SA 3GUSA 4GRFA 3VLNA 4Z7XA 1TOFA 1YY7A 2C0DA 12GSA 3GN3A 1QMVA 4GTUA 2VLUA 1GSYA 2R2JA 5GAND 4F0CA 2X99A 4QL9A 4N0ZA 5G2ZA 3O76A 3CRTA 3KTBA 4DSSA 5HR0A 2JZRA 1J0FA 4G0IA 2PPTA 1GTUA 3FZ5A 1YJ6A 19GSA 3S9FA 3N5OA 3M8NA 3IR4A 4GCIA 3LORA 2VAFA 3ZREA 4MF7A 5EVOA 1SL2B 1K0OA 1K0CA 5CO3A 2H1LA 3RBTA 3TOUA 1FOVA 3OR5A 4NAXA 2R6KA 5IOXA 1JLWA 4RQXA 1BF5A 3HJMA 5GZZB 2F3MA 1GTIA 1ZZYA 5DAKA 2G0FA 2E0QA 3LSZA 2KHPA 2EFCA 3KJYA 3C8EA 5IPHA 3GKKA 1W4VA 4MJBA 2LJAA 3HJOA 4TR3A 1XWCA 2FWGA 2VO4A 1SU9A 5GSSA 2H75A 2MMZA 1EEJA 3PH9A 1DE1A 5CREA 1FO5A 3N9JA 2H70A 4WETA 3HVXA 1SK1A 3VFIA 3J7Yb 1DUGA 5HR1A 3U6VA 4BVXA 5FWGA 4DSSB 3ZTLA 3IE3A 2IFQA 2KP2A 4D73A 3F0IA 1SL0B 4ZB7A 1S3DA 4MJCA 2VL2C 1R5AA 2VCTA 2TIRA 4K7OA 2OBIA 8GSSA 5A5HA 1GUMA 2TRXA 3BJ5A 4W66A 2KUCA 2WZ9A 3D5JA 1QGVA 1AQVA 1SD9A 5LCZA 2K6VA 3DIEA 3DD3A 4QQ7A 1UA5A 1O85A 1K0BA 1O8WA 3A5IA 2GT5A 1XCCA 1JHBA 1PSQA 3EVIA 3LXZA 2ZCTA 2B1LA 4WBJA 1EEMA 6GSSA 4Q5NA 4IN0A 2CAIA 1BQ7A 2H1AA 2LQQA 2C1YA 4Z2UA 1JLVA 2QSIA 1BJXA 4Z2TA 2IMDA 3QR6A 3APOA 4BVXB 2N5FA 14GSA 1K3OA 4HS1A 2QKEA 3QFBC 2HQTA 1B4PA 2IFQB 2O5VA 4IJ3A 4D73B 2YV9A 4KCAA 1V58A 4EXJA 2DJJA 4JR4A 1URMA 4PUFC 2NTOA 2ON7A 1BG5A 3F9UA 5A5HB 1ACVA 3FZ4A 2R0GA 2Z9SA 5IIZA 5ECQB 5B6MA 5KOXA 1GUHA 1XVWA 2H6XA 4N0VA 2CV4A 2J9HA 4ZILA 1HD2A 1PGTA 5CP1A 5E59A 5A5KA 2YZUA 1X9SB 1X5EA 2C8UA 2HLSA 1F6MC 4IJIA 2C4JA 4MZBA 1T1VA 3V1WA 1EP8A 2HZEA 3I6AA 4ISDA 2YOIA 2L6DA 3D4MA 1X5DA 2O87A 5A34A 3M3MA 4XIHA 2L5LA 2GZPA 4N11A 4WR5A 1GULA 1XW6A 1RQMA 1H75A 2KLXA 2F8FA 1O7UA 5CRWA 4PURA 1W89A 4L0UA 1QUWA 4MH2A 3LG6A 2N5AA 2H6ZA 3E9JB 3QMXA 1VF2A 4KNDA 3UOMA 4XCSA 2MMAA 4WF5A 1JZWA 4IQAA 1NSWA 4EDZA 1A0RP 1Z7PA 2YP6A 4BPYA 1XWKA 3L78A 3ED3A 4EUYA 2H8LA 5IMZA 4I6XA 2IPAA 4GQCA 3UIWA 2R5GA 6GSTA 3FRCA 1N25A 3KM6A 5DCHA 2LNSA 2A4VA 5G5EA 2NBSA 1F37A 2JACA 2CVKA 4NWYA 2M80A 1TK8B 4X43A 4XRAA 4O92A 2LRCA 2HZEB 1Z9HA 4MK3A 3TB2A 1Y25A 3Q19A 1JFUA 5D96A 1OC8A 2DJ1A 3VK9A 2BJXA 2H72A 4ZB6A 1YF1A 3HYPA 5A34B 2DJKA 4OO4A 5F05A 4FO5A 1ZMAA 3F3QA 2ON5A 4WBRD 4MZWA 1XVQA 3EE2A 3Q6OA 2CVBA 1F9MA 2XPEA 5ECNB 2GLRA 3M9KA 4NPBA 4DVCA 3WD6A 2YJHA 4KX4A 2XBQA 4WKWA 1PX6A 3EPTA 2EFEA 4V2MA 2VLVA 2AV4A 2QA2A 3HD5A 2H66A 3FR9A 20GSA 2C3TA 2OT3A 2OBKA 2HRFA 1XWAA 5JCGA 4J56E 5DCGA 2WJUA 5J9BA 1FG4A 3LQ7A 1WE0A 3HXSA 1R4WA 1FHEA 1PRXA 4X1UA 1EOGA 3VPQA 2CAQA 2C0EA 2JSYA 2R37A 5J47A 1Q98A 3MIXA 3A2XA 3U5RE 1HYUA 4HQSA 4HQZA 4CY6A 3H1NA 2LS5A 1A2MA 3CYNA 4KA0A 2PN8A 1TDIA 2CX3A 2HFDA 4JE1A 1SK0A 5KN2A 1THOA 3DVWA 4X0XA 3DMLA 1Y6EA 1GLQA 1J08A 3UVHA 2YANA 4GSNA 1A8LA 2AJQB 1ABAA 1SVOA 4MH3A 1U88A 1CQHA 2VD0A 1FAAA 4CHSA 1TK0B 4A5PA 3P7XA 2FHEA 3C7MA 3F4RA 4EE0A 2B3SA 2LRTA 5A1NA 4WF4A 2FWEA 3IXRA 1TW9A 4YKGA 4PQHA 3TGZA 3TJFA 1TKDB 1HQOA 4LA1A 4RI7A 3TKSE 3UVTA 1OC9A 3HDCA 1DBYA 4XRDA 3ZIVA 2GSTA 4HUAA 2I9HA 1WMJA 4MABA 5ELAA 3DRNA 3CRUA 3W8JA 2GZZA 1IYIA 3KZQA 3F63A 2VKZG 4ZBDA 4KCEA 4E68A 4JEDA 2HRNA 5D9TA 1LJRA 4G10A 1FB6A 1R26A 2XPDA 2C3QA 1TU7A 1XXUA 2MBSA 2DKIA 2QC7A 1BYEA 4NHWA 2YPMA 1YQ1A 4O5QA 4MLYA 3CXGA 5E4WA 5JWOB 4YAVA 2VCQA 1EV4A 1T4ZA 4PXOA 2LSTA 2VIMA 4FYUA 1AIUA 3F6DA 3C1SA 2B6MA 3VURA 2HSHA 4OD7A 1GH2A 4IGJA 5C04A 3KCMA 3IK9A 2B5XA 1KTEA 2L59A 3C1RA 5A1NB 1YEPA 3VWUA 4EIPA 1RW1A 5GSTA 3TDGA 4Q5RA 3VWXA 3MDKA 2YWIA 3IC8A 1SYXA 3F8UA 4V2NA 2F8AA 1ZYEA 2R4VA 1ERWA 2C80A 2OA7A 3L0HA 2GSQA 3HKRA 1ZYNA 5DDLA 1OC9B 1M0UA 1HNBA 3M9JA 4ID0A 2FWFA 4EC0A 3ZVJD 1S3CA 2YCDA 5HFGA 1GNEA 1M2BA 4AJ6A 4ECCA 2EIOA 4KH7A 2HI7A 1V40A 5H5QA 4IBPA 2P31A 5G31A 2IIYA 5IMDA 4K7IA 4PUAA 2I4AA 3HVVA 1EGOA 3W8SA 2A2RA 2H71A 3M0FA 1XFLA 3ME8A 3GURA 2X8CA 2X4AA 3GKMA 4BVYA 3Q18A 3GA4A 3GRXA 3TKSA 2C0FA 4XHMA 1ZCPA 4JZQA 5L71A 3FW2A 1ZOFA 2RM6A 1EV9A 2WS2A 5FT3A 4KSMA 2H19A 4MNNA 4ACSA 3DXBA 4K5RA 1Z5YE 1K3LA 4AJ8A 1XOAA 1AW9A 1PKZA 4ZXGA 4HJMA 3KXOA 2JZTA 2LKUA 4GSSA 2RUFA 1AQXA 1TRSA 3GYKA 1EZKA 5BRTA 1TTZA 2YN1A 3GL3A 3GL5A 5IMCA 1TI1A 4EF0A 3HJPA 3A2WA 4PNFA 2HRKA 2A2SA 4KW6A 1UVZA 2DMLA 4HU7A 2H01A 2CZ3A 2V1MA 4K7NA 3TRPA 2VCVA 5BMUA 3CSIA 1SJZA 4BL7A 4CW9A 1K0NA 5DBQA 4KGIA 2G2QA 3TJBA 4OMVA 2FLSA 3WT2A 4MP4A 1T8EB 2FD3A 2QGVA 1CQGA 2PMTA 3L9VA 4BVYB 2E7PA 5ID2A 1AAZA 3CSJA 2M46A 2JADA 3PINA 5ECSA 2YWNA 4P3YB 4ULXA 5CRGA 1B9XC 3DYRA 5ECPB 3MAKA 4GF0A 1OKDA 2F51A 3DWVA 5D9VA 3C73A 2WFCA 3F4TA 4G0LA 4MJAA 1X9MB 2OKAA 4RI6A 1IYHA 1T7PB 2O85A 5B6NA 1ON4A 5J4YA 1PN9A 3P8WA 1AUCA 2LUSA 3D22A 2WULA 1ERUA 4K0NA 4FH8A 2DKHA 5HQPA 5HR3A 3TJGA 2H73A 1H4OA 4MZCA 5F06A 4DSQA 5ABRA 5C00A 4EL1A 2HRKB 5IO2A 1G7EA 1RK4A 3LYKA 2R3XA 2A2PA 1G0TA 2VUPA 1ML6A 4TOPA 1WPIA 5BMUB 4HI7A 4BL7B 3CWGA 4TR1A 5F07A 1FOHA 3LFLA 4IVFA 4KUNA 4L0WA 3CMIA 3APQA 4ML1A 1EOHA 2HYXA 4ICYA 5D73A 4KF9A 2VLTA 1U3AA 2R0CA 4EO3A 1NW2A 1MDIA 4YKFA 2PVOC 5ID2B 1QFNA 3FY7A 4HZ2A 2GVPA 3HCZA 1OC3A 3BCKA 3GX0A 4GQFA 1ILOA 1T00A 1JZOA 2MMNA 2A4HA 2DJ0A 2FA8A 5KOWA 3ZRDA 2GQMA 4XTSA 2H0GA 2JU5A 3ERWA 5DQSA 1YVLA 4MPGA 1VF3A 3TKQA 2V6KA 5KN0A 2GQKA 4IP6A 3M1GA 3IHGA 4O5RA 3ZFBA 4N10A 4TVEA 1A23A 2OACA 3WYWA 4POKA 4Z2RA 4RUVA 3A5WA 5G1LA 3TJKA 3R3EA 1GL8A 1YKAA 5ECLB 3ZLPA 1TXUA 4GLTA 1PA3A 4LMWA 4I8BA 2K9FA 3TKSC 4NHZA 4PQ1A 5HFIA 3ZYWA 1OE7A 4AJ7A 1M2AA 3QAWA 5HFKA 3KH9A 2IMFA 5G30A 4TKYA 2UZ8A 1FW1A 2PWJA 3FKFA 1GLPA 4GDFA 1NHYA 3TCOA 4PTSA 4TR1B 4O7HA 4ZBBA 3I43A 3QPMA 2K8SA 4J57E 4ZIJA 2LNTA 2P0GA 1O73A 4F0BA 4NMUA 2WGRA 5EPFA 4TW5A 2ZNMA 3H8QA 2O7KA 5B7CA 3E0UA 3IV4A 2DBCA 1PN0A 2HNLA 4ZL9A 4MJEA 2H0IA 3GX8A 1YDKA 4G0KA 3ZVJA 1WP0A 5J40A 3HVSA 4EDYA 4N3ZA 3G7YA 1SJ6A 5D93A 1XW5A 4ECBA 2VOCA 1U3IA 4YH2A 4K2XA 10GSA 5H5SA 5DJLA 4CY8A 3ERGA 4K6XA 2HSYA 1B9YC 1F3BA 4K8MA 3BCIA 3Q74A 2X8GA 1SVLA 3UJ1A 4TXOA 3TKRA 3D6IA 3KIJA 5CYYA 4FYBA 5J5NA 4YQVA 4AKGA 5LNKe 3TRXA 4HOJA 3H93A 1FVKA 4JBBA 2FWHA 3FHKA 1ZYPA 3IDVA 2EIRA 1KNGA 1USBA 3TJJA 4K9ZA 3GMFA 4PNGA 3FR6A 1XIYA 4K2DA 1XOBA 1G6YA 2PBJA 4Q5QA 2FY6A 4ECJA 3BD2A 2L4QA 2NVLA 1SVMA 3G7IA 3EWLA 3GKNA 2IJYA 5HR2A 1F2EA 1E2YA 1T3BA 1GTAA 4MPFA 4JR6A 3G7JA 4IS0A 2NDOA 6GSVA 5IPGA 4V2LA 2H1DA 4WXTA 2IMIA 3PGTA 1N8JA 4QMKA 2B7KA 3DVXA 2IN3A 1K0MA 1WOUA 4OFMA 2VCWA 1XZOA 3IHQA 4MCUA 3ME7A 6GSXA 1PL2A 1B48A 4O5UA 1TXXA 5AN1A 4IHUA 2E2MA 2FA4A 2YNXA 2GT6A 3ZMLA 2JL4A 3I9V2 1MD4A 2OE3A 4TXOB 3PPUA 6GSWA 4FIWA 5KN3A 2HZFA 4YAPA 2GS3A 3P90A 2EIQA 1DSBA 4I97A 3NZNA 2OE0A 3ZMKA 5EL8A 1F3AA 2VCZA 3D21A 4USSA 1GSSA 4F2IA 1B4QA 3LWAA 2B5YA 1LU4A 1TRWA 3K8NA 2GDRA 4POBA 2B5EA 1OAZA 5J9CA 1OKTA 13GSA 3IOSA 2AHEA 4X4JA 2PUKC 3A2VA 3GNJA 1GTBA 5AISA 3TUEA 4TXVA 3R2QA 1GP1A 2OE1A 3APSA 3UBKA 2JZSA 5D9WA 4J2FA 1BX9A 4HU9A 4ZL7A 4MF5A 3VPTA 3NOFA 5GAPD 1GSQA 3LGCA 2B1KA 3GH9A 4E8EA 1R7HA 3UL3A 1AXDA 1SL1B 4YQMA 1U87A 1DE2A 2RUEA 3UAPA 2CX4A 1A2JA 1XBSA 2BMXA 17GSA 4LL1B 2YV7A 3GTUA 3EU3A 5ECMB 3I69A 4XS1A 5IMAA 1UC7A 2MYGA 4WR4A 2GTUA 1WJKA 5IMVA 4ZB9A 3RHBA 1TJDA 3IBHA 1SJIA 4PX1A 3SBCA 1VF4A 1Y1UA 1I9DA 3MWHA 2MZCA 1M99A 3TRQA 2AB6A 11GSA 3PR8A 5KN1A 2XHFA 3ZZXA 2IL3A 1M2DA 3BBYA 4KDUA 1V9WA 2X64A 3SWLA 1N2AA 1X9WB 2VM2A 4MMMA 2AYTA 4OCFA 2AUVA 2KOKA 1K0DA 1WIKA 5J4VA 2OJLA 1BG1A 5ECRB 5IOWA 1KBNA 2K18A 1GWCA 1M9AA 2YWMA 4BA7A 1C72A 1E6BA 3KD0A 3O6TA 1A8YA 2H30A 4OO5A 3RPNA 1KEBA 4F82A 4EKZA 5JWRB 3EMPA 4NV5A 1WRYA 3IA1A 1SKRB 5DALA 3FK8A 3ZIJA 2V2GA 2V41A 3E3EA 5INYA 2VL9A 3IAS2 3GTUB 4G19A 2ES7A 3KTLA 1OVNA 2NPBA 2HRAA 1XWBA 1GSDA 16GSA 1K3YA 3HY2A 4POMA 4ZB8A 3FMWA 1O81A 3D0ZA 3GKXA 3MNGA 3RAZA 1UN2A 4GXZA 1GRXA 2REMA 3EINA 3DGQA 3LYPA 1QXHA 2BTOT 4AI6A 3FZ9A 4CDOA 2GQLA 2MBTA 2GSSA 1SENA 4AKXB 1GUKA 1V98A 1A2LA 4TR4A 3EC3A 2XBIA 3HMJG 4OCEA 1M9BA 1O8XA 2VD1A 5JWQB 4GWRA 5CRHA 3ZL5A 4IELA 4EVMA 1MTCA 4XS4A 3UEMA 3J7Yk 2B7JA 5ENUA 18GSA 5AIVA 3QOUA 2WRTA 1Z6NA 3ZFLA 2LTKA 1ST9A 2IMKA 5IO0A 1XW9A 5DALB 2CZ2A 1XWGA 1JZDA 5D8IA 3RDWA 2LJRA 5AGYA 2PU9C 2DJ2A 5ECOB 1MDKA 4IW9A 1ERVA 5F0GA 4DSRA 2I81A 5DAKB 4MDCA 4NV2A 3EYTA 3GFKA 1VGLA 3QFAC 4FQUA 2DMMA 2ZUPA 2H74A 2L5OA 3RHCA 1NM3A 4ECIA 4TRXA 2GZYA 2FGXA 2IWTA 22GSA 1Q4JA 5F8BA 5CRDA 4GSTA 3MYDA 1Z7RA 1Z3EA 5J4UA 1TP9A 3H4KA 3P2AA 4AGSA 4DEJA 2J23A 3IRAA 1G7OA 3QDNA 1HNCA 2EFDA 3KP9A 3HZ4A 4RQRA 2HT9A 5KEJA 3MSZA 4ZBAA 3BOAA 3IK7A 3CTFA 4LLRA 4WEYA 2V32A 2LJKA 2MMOA 4HDEA 2HE3A 1SK2A 4KDXA 4XS4B 4AKHA 2JSZA 5J3RA 4I2TA 3LXTA 2EC4A 5H5RA 1PL1A 2HSMA 4JRRA 2IMEA 2X8HA 2DLXA 2WCIA 3HA9A 1PX7A 5FHIA 1MD3A 1FVJA 1TU8A 2DC5A 2P5RA 3D4TA 1Z6MA 2TRCP 2CVDA 1EWXA 2GGTA 3C71A 5IQYA 2VL3A 4JU5A 3GSTA 4KB3A 3DKSA 2OADA 1JZRA 3EMXA 1A24A 2VCXA 1R5PA 1YEXA 1X0RA 3O3TA 5ECIB 3GIXA 1SKSB 1EGRA 4Q5FA 4EIQA 2RM5A 5JCWA 4F9ZA 1EP7A 2O8VB 5JCUA 1A0FA 5IM9A 4L5OA 5A4UA 4PGTA 1HNAA 4TR0A 2QA1A 4I2UA 4OFNA 2DSAA 2YZHA 3US3A 4HJ2A 5AIXA 3IC4A 2LV3A 2I1UA 3WGXA 3QAVA 1XPVA 4POLA 2L57A 1J9BA 3FYGA 1PQNA 6GSUA 1QQ2A 2R0PA 4NXIA 2D2ZA 4IQ1A 3NIVA 2F9SA 2H0HA 1SYRA 3WT1A 2HSMB 1ZYQB 2L6CA 2O89A 1YZXA 1WWJA 4PQIA 5CNWA 1AQWA 2LRNA 3IPZA 2N5BA 4K5SA 4F03A 2I3YA 3KEBA 5G5FA 2YJ7A 1SD8A 3LW9A 2FCHA 4QL7A 1M7TA 3QD9A 2RIIA 4V1Ag 1ERTA 3QCPA 5ELGA 2LQOA 3LJRA 4K0GA 3GHAA 2E2GA 3JCML 1B8XA 4OWYA 1PD21 3FZAA 3W6GA 5A4VA 2LEGA 2WB9A 3UBLA 3EURA 3LEFA 3L9UA 4G2EA 5B8BA 5DVBA 3L4NA 5A4WA 2C3NA 7GSSA 4LL4B 1K0AA 3ERFA 1BEDA 5DJMA 5G1KA 3GSSA 2H1BA 2X49A 1VRSD 2FUG2 1GSUA 4G01A 4ILFA 3ZITA 2AAWA 4KDYA 2DIZA 4H86A 4E8HA 3KH7A 1MDJA 2PERA 1V2AA 4G9HA 1SKWB 3HZ8A 3L9SA 1QK8A 3GH6A 1X5CA 4KSOA 4IP1A 3F3RA 2H76A 1VF1A 2CA8A 5IMFA 3VWWA 1ZGNA 3FEUA 4IKHA 3UARA 2GSRA 4TN8A 1T4YA 3KMOA 3VI5A 2K8VA 4I5QA 1U6TA 3A3TA 1TRVA 4MA9A 4LMVA 1OYJA 2FNOA 2KP1A 1TK5B 4YQUA 1S3AA 2H6YA 1YKCA 1PMTA 3TOTA 4K1FA 5J41A 3VWVA 2HXKA 2P5QA 3IAM2 2HSNA 2L4CA 1G6WA 4HZ4A 2XC2A 5ECKB 1V57A 5DQYA 4ML6A 3DEXA 4FYCA 3GV1A 2VL2A 3KP8A 3WGEA 4BWSA 2M72A 2CQ9A 1TRUA 1LBKA 4O32A 3G9BA 1ZL9A 5D9XA 2RLIA 1AC1A 6GSYA 3HHVA 3KGKA 4OFTA 2DJ3A 2DIYA 1OE8A 3QAGA 3VI7A 3WGDA 2PVQA 1BAYA 3F6FA 1O6JA 4HEA2 3AY8A 2EFHA 4MF6A 2H1GA 4ZL8A 4KAEA 5EY6A 1YF0A 3CTGA 5LD0A 4L5LA 3RPPA 3FR3A 1GNWA 2V6OA 3CSHA 4KE3A 3UMAA 3KMNA 2C0GA 1GSEA 2WDUA 3ISOA 1GSFA 3EU4A 2YWOA 5COHA 1PKWA 2VM1A 1I5GA 5B8AA 3TKPA 1MEKA 4V1Ap 4BWQA 4N30A 5CAXA 2CT6A 5ECHB 2HSNB 2ALBA 4XS6A 2PGTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1THX A;  9GSS A;  3CBU A;  4L8E A;  3H79 A;  1NHO A;  4AF2 A;  1FB0 A;  1TI3 A;  3F4S A;  3GUS A;  4GRF A;  3VLN A;  4Z7X A;  1TOF A;  1YY7 A;  2C0D A;  12GS A;  3GN3 A;  1QMV A;  4GTU A;  2VLU A;  1GSY A;  2R2J A;  5GAN D;  4F0C A;  2X99 A;  4QL9 A;  4N0Z A;  5G2Z A;  3O76 A;  3CRT A;  3KTB A;  4DSS A;  5HR0 A;  2JZR A;  1J0F A;  4G0I A;  2PPT A;  1GTU A;  3FZ5 A;  1YJ6 A;  19GS A;  3S9F A;  3N5O A;  3M8N A;  3IR4 A;  4GCI A;  3LOR A;  2VAF A;  3ZRE A;  4MF7 A;  5EVO A;  1SL2 B;  1K0O A;  1K0C A;  5CO3 A;  3RBT A;  3TOU A;  1FOV A;  3OR5 A;  4NAX A;  2R6K A;  5IOX A;  1JLW A;  4RQX A;  3HJM A;  5GZZ B;  2F3M A;  1GTI A;  1ZZY A;  5DAK A;  2G0F A;  2E0Q A;  3LSZ A;  2KHP A;  3KJY A;  3C8E A;  5IPH A;  3GKK A;  1W4V A;  4MJB A;  2LJA A;  3HJO A;  4TR3 A;  1XWC A;  2FWG A;  2VO4 A;  1SU9 A;  5GSS A;  2H75 A;  2MMZ A;  1EEJ A;  3PH9 A;  1DE1 A;  5CRE A;  1FO5 A;  3N9J A;  2H70 A;  4WET A;  3HVX A;  1SK1 A;  3VFI A;  3J7Y b;  1DUG A;  5HR1 A;  3U6V A;  4BVX A;  5FWG A;  4DSS B;  3ZTL A;  3IE3 A;  2IFQ A;  2KP2 A;  4D73 A;  3F0I A;  1SL0 B;  1S3D A;  4MJC A;  2VL2 C;  1R5A A;  2VCT A;  2TIR A;  4K7O A;  2OBI A;  8GSS A;  1GUM A;  2TRX A;  3BJ5 A;  2KUC A;  2WZ9 A;  3D5J A;  1QGV A;  1AQV A;  1SD9 A;  5LCZ A;  2K6V A;  3DIE A;  3DD3 A;  4QQ7 A;  1UA5 A;  1O85 A;  1K0B A;  1O8W A;  2GT5 A;  1XCC A;  1JHB A;  1PSQ A;  3EVI A;  3LXZ A;  2ZCT A;  2B1L A;  4WBJ A;  1EEM A;  6GSS A;  4Q5N A;  4IN0 A;  2CAI A;  1BQ7 A;  2H1A A;  2LQQ A;  2C1Y A;  1JLV A;  2QSI A;  1BJX A;  2IMD A;  3QR6 A;  3APO A;  4BVX B;  2N5F A;  14GS A;  1K3O A;  4HS1 A;  2QKE A;  3QFB C;  2HQT A;  1B4P A;  2IFQ B;  4IJ3 A;  4D73 B;  2YV9 A;  4KCA A;  1V58 A;  4EXJ A;  2DJJ A;  4JR4 A;  1URM A;  4PUF C;  2NTO A;  2ON7 A;  1BG5 A;  3F9U A;  1ACV A;  3FZ4 A;  2Z9S A;  5IIZ A;  5ECQ B;  5B6M A;  1GUH A;  1XVW A;  2H6X A;  4N0V A;  2CV4 A;  2J9H A;  4ZIL A;  1HD2 A;  1PGT A;  5CP1 A;  5E59 A;  5A5K A;  2YZU A;  1X9S B;  1X5E A;  2C8U A;  2HLS A;  1F6M C;  4IJI A;  2C4J A;  4MZB A;  1T1V A;  3V1W A;  1EP8 A;  2HZE A;  3I6A A;  4ISD A;  2YOI A;  2L6D A;  3D4M A;  1X5D A;  2O87 A;  3M3M A;  4XIH A;  2L5L A;  2GZP A;  4N11 A;  4WR5 A;  1GUL A;  1XW6 A;  1RQM A;  1H75 A;  2KLX A;  2F8F A;  1O7U A;  5CRW A;  4PUR A;  1W89 A;  4L0U A;  1QUW A;  4MH2 A;  3LG6 A;  2N5A A;  2H6Z A;  3E9J B;  3QMX A;  1VF2 A;  4KND A;  3UOM A;  4XCS A;  2MMA A;  4WF5 A;  1JZW A;  4IQA A;  1NSW A;  4EDZ A;  1A0R P;  1Z7P A;  2YP6 A;  4BPY A;  1XWK A;  3L78 A;  3ED3 A;  4EUY A;  2H8L A;  5IMZ A;  4I6X A;  2IPA A;  4GQC A;  3UIW A;  2R5G A;  6GST A;  3FRC A;  3KM6 A;  5DCH A;  2LNS A;  2A4V A;  5G5E A;  2NBS A;  1F37 A;  2JAC A;  2CVK A;  4NWY A;  2M80 A;  1TK8 B;  4X43 A;  4XRA A;  4O92 A;  2LRC A;  2HZE B;  1Z9H A;  4MK3 A;  3TB2 A;  1Y25 A;  3Q19 A;  1JFU A;  5D96 A;  1OC8 A;  2DJ1 A;  3VK9 A;  2BJX A;  2H72 A;  4ZB6 A;  1YF1 A;  3HYP A;  2DJK A;  4OO4 A;  5F05 A;  4FO5 A;  1ZMA A;  3F3Q A;  2ON5 A;  4WBR D;  4MZW A;  1XVQ A;  3EE2 A;  3Q6O A;  2CVB A;  1F9M A;  2XPE A;  5ECN B;  2GLR A;  3M9K A;  4NPB A;  4DVC A;  3WD6 A;  2YJH A;  4KX4 A;  2XBQ A;  4WKW A;  1PX6 A;  4V2M A;  2VLV A;  2AV4 A;  3HD5 A;  2H66 A;  3FR9 A;  20GS A;  2C3T A;  2OBK A;  2HRF A;  1XWA A;  5JCG A;  4J56 E;  5DCG A;  2WJU A;  5J9B A;  1FG4 A;  3LQ7 A;  1WE0 A;  3HXS A;  1R4W A;  1FHE A;  1PRX A;  4X1U A;  1EOG A;  3VPQ A;  2CAQ A;  2C0E A;  2JSY A;  2R37 A;  1Q98 A;  3A2X A;  3U5R E;  1HYU A;  4HQS A;  4HQZ A;  3H1N A;  2LS5 A;  1A2M A;  3CYN A;  4KA0 A;  2PN8 A;  1TDI A;  2CX3 A;  2HFD A;  4JE1 A;  1SK0 A;  5KN2 A;  1THO A;  3DVW A;  4X0X A;  3DML A;  1Y6E A;  1GLQ A;  1J08 A;  3UVH A;  2YAN A;  4GSN A;  1A8L A;  2AJQ B;  1ABA A;  4MH3 A;  1U88 A;  1CQH A;  2VD0 A;  1FAA A;  4CHS A;  1TK0 B;  3P7X A;  2FHE A;  3C7M A;  3F4R A;  4EE0 A;  2B3S A;  2LRT A;  4WF4 A;  2FWE A;  3IXR A;  1TW9 A;  4PQH A;  3TGZ A;  3TJF A;  1TKD B;  1HQO A;  4LA1 A;  4RI7 A;  3TKS E;  3UVT A;  1OC9 A;  3HDC A;  1DBY A;  4XRD A;  3ZIV A;  2GST A;  4HUA A;  2I9H A;  1WMJ A;  4MAB A;  5ELA A;  3DRN A;  3CRU A;  3W8J A;  2GZZ A;  1IYI A;  3KZQ A;  3F63 A;  4ZBD A;  4KCE A;  4JED A;  2HRN A;  5D9T A;  1LJR A;  4G10 A;  1FB6 A;  1R26 A;  2XPD A;  2C3Q A;  1TU7 A;  1XXU A;  2MBS A;  2QC7 A;  1BYE A;  4NHW A;  2YPM A;  1YQ1 A;  4MLY A;  3CXG A;  5E4W A;  5JWO B;  4YAV A;  2VCQ A;  1EV4 A;  1T4Z A;  4PXO A;  2LST A;  2VIM A;  4FYU A;  1AIU A;  3F6D A;  3C1S A;  2B6M A;  3VUR A;  2HSH A;  4OD7 A;  1GH2 A;  4IGJ A;  5C04 A;  3KCM A;  3IK9 A;  2B5X A;  1KTE A;  2L59 A;  3C1R A;  1YEP A;  3VWU A;  1RW1 A;  5GST A;  3TDG A;  4Q5R A;  3VWX A;  3MDK A;  2YWI A;  3IC8 A;  1SYX A;  3F8U A;  4V2N A;  2F8A A;  1ZYE A;  2R4V A;  1ERW A;  2C80 A;  2OA7 A;  3L0H A;  2GSQ A;  3HKR A;  5DDL A;  1OC9 B;  1M0U A;  1HNB A;  3M9J A;  4ID0 A;  2FWF A;  4EC0 A;  3ZVJ D;  1S3C A;  2YCD A;  5HFG A;  1GNE A;  1M2B A;  4AJ6 A;  4ECC A;  2EIO A;  4KH7 A;  2HI7 A;  1V40 A;  5H5Q A;  4IBP A;  2P31 A;  5G31 A;  2IIY A;  5IMD A;  4K7I A;  4PUA A;  2I4A A;  3HVV A;  1EGO A;  3W8S A;  2A2R A;  2H71 A;  3M0F A;  1XFL A;  3ME8 A;  3GUR A;  2X8C A;  3GKM A;  4BVY A;  3Q18 A;  3GA4 A;  3GRX A;  3TKS A;  2C0F A;  4XHM A;  1ZCP A;  4JZQ A;  5L71 A;  3FW2 A;  1ZOF A;  2RM6 A;  1EV9 A;  2WS2 A;  5FT3 A;  4KSM A;  2H19 A;  4ACS A;  3DXB A;  1Z5Y E;  1K3L A;  4AJ8 A;  1XOA A;  1AW9 A;  1PKZ A;  4ZXG A;  4HJM A;  3KXO A;  2JZT A;  2LKU A;  4GSS A;  2RUF A;  1AQX A;  1TRS A;  3GYK A;  1EZK A;  1TTZ A;  2YN1 A;  3GL3 A;  3GL5 A;  5IMC A;  1TI1 A;  4EF0 A;  3HJP A;  3A2W A;  4PNF A;  2HRK A;  2A2S A;  4KW6 A;  1UVZ A;  2DML A;  4HU7 A;  2H01 A;  2CZ3 A;  2V1M A;  4K7N A;  3TRP A;  2VCV A;  5BMU A;  3CSI A;  1SJZ A;  4BL7 A;  4CW9 A;  1K0N A;  5DBQ A;  4KGI A;  2G2Q A;  3TJB A;  4OMV A;  2FLS A;  3WT2 A;  4MP4 A;  1T8E B;  2FD3 A;  2QGV A;  1CQG A;  2PMT A;  3L9V A;  4BVY B;  2E7P A;  5ID2 A;  1AAZ A;  3CSJ A;  2M46 A;  2JAD A;  3PIN A;  5ECS A;  2YWN A;  4P3Y B;  4ULX A;  5CRG A;  1B9X C;  3DYR A;  5ECP B;  3MAK A;  4GF0 A;  1OKD A;  2F51 A;  3DWV A;  5D9V A;  3C73 A;  2WFC A;  3F4T A;  4G0L A;  4MJA A;  1X9M B;  2OKA A;  4RI6 A;  1IYH A;  1T7P B;  2O85 A;  5B6N A;  1ON4 A;  1PN9 A;  3P8W A;  1AUC A;  2LUS A;  3D22 A;  2WUL A;  1ERU A;  4K0N A;  4FH8 A;  5HQP A;  5HR3 A;  3TJG A;  2H73 A;  1H4O A;  4MZC A;  5F06 A;  4DSQ A;  5ABR A;  5C00 A;  4EL1 A;  2HRK B;  5IO2 A;  1G7E A;  1RK4 A;  3LYK A;  2R3X A;  1G0T A;  2VUP A;  1ML6 A;  4TOP A;  1WPI A;  4HI7 A;  4BL7 B;  4TR1 A;  5F07 A;  3LFL A;  4IVF A;  4KUN A;  4L0W A;  3CMI A;  3APQ A;  4ML1 A;  1EOH A;  2HYX A;  5D73 A;  4KF9 A;  2VLT A;  1U3A A;  4EO3 A;  1NW2 A;  1MDI A;  5ID2 B;  2PVO C;  1QFN A;  3FY7 A;  4HZ2 A;  2GVP A;  3HCZ A;  1OC3 A;  3BCK A;  3GX0 A;  4GQF A;  1ILO A;  1T00 A;  1JZO A;  2MMN A;  2DJ0 A;  2FA8 A;  3ZRD A;  2GQM A;  4XTS A;  2H0G A;  2JU5 A;  3ERW A;  5DQS A;  4MPG A;  1VF3 A;  3TKQ A;  2V6K A;  5KN0 A;  2GQK A;  4IP6 A;  3M1G A;  4O5R A;  3ZFB A;  4N10 A;  4TVE A;  1A23 A;  2OAC A;  3WYW A;  4POK A;  4RUV A;  3A5W A;  5G1L A;  3TJK A;  3R3E A;  1GL8 A;  1YKA A;  5ECL B;  3ZLP A;  4GLT A;  1PA3 A;  4LMW A;  4I8B A;  2K9F A;  3TKS C;  4NHZ A;  4PQ1 A;  5HFI A;  3ZYW A;  1OE7 A;  4AJ7 A;  1M2A A;  3QAW A;  5HFK A;  3KH9 A;  2IMF A;  5G30 A;  4TKY A;  2UZ8 A;  1FW1 A;  2PWJ A;  3FKF A;  1GLP A;  1NHY A;  3TCO A;  4PTS A;  4TR1 B;  4O7H A;  4ZBB A;  3I43 A;  3QPM A;  2K8S A;  4J57 E;  4ZIJ A;  2LNT A;  2P0G A;  1O73 A;  4F0B A;  4NMU A;  2WGR A;  5EPF A;  4TW5 A;  2ZNM A;  2O7K A;  3H8Q A;  5B7C A;  3E0U A;  3IV4 A;  2DBC A;  2HNL A;  4ZL9 A;  4MJE A;  2H0I A;  3GX8 A;  1YDK A;  4G0K A;  3ZVJ A;  1WP0 A;  3HVS A;  4EDY A;  3G7Y A;  1SJ6 A;  5D93 A;  1XW5 A;  4ECB A;  2VOC A;  1U3I A;  4YH2 A;  10GS A;  5H5S A;  5DJL A;  3ERG A;  4K6X A;  2HSY A;  1B9Y C;  1F3B A;  4K8M A;  3BCI A;  3Q74 A;  2X8G A;  3UJ1 A;  4TXO A;  3TKR A;  3D6I A;  3KIJ A;  5CYY A;  4FYB A;  5J5N A;  4YQV A;  5LNK e;  3TRX A;  4HOJ A;  3H93 A;  1FVK A;  4JBB A;  2FWH A;  3FHK A;  3IDV A;  2EIR A;  1KNG A;  1USB A;  3TJJ A;  4K9Z A;  3GMF A;  4PNG A;  3FR6 A;  1XIY A;  4K2D A;  1XOB A;  1G6Y A;  2PBJ A;  4Q5Q A;  2FY6 A;  4ECJ A;  3BD2 A;  2L4Q A;  2NVL A;  3G7I A;  3EWL A;  3GKN A;  2IJY A;  5HR2 A;  1F2E A;  1E2Y A;  1T3B A;  1GTA A;  4MPF A;  4JR6 A;  3G7J A;  4IS0 A;  2NDO A;  6GSV A;  5IPG A;  4V2L A;  2H1D A;  4WXT A;  2IMI A;  3PGT A;  1N8J A;  2B7K A;  3DVX A;  2IN3 A;  1K0M A;  1WOU A;  4OFM A;  2VCW A;  1XZO A;  3IHQ A;  4MCU A;  3ME7 A;  6GSX A;  1PL2 A;  1B48 A;  1TXX A;  5AN1 A;  4IHU A;  2E2M A;  2FA4 A;  2YNX A;  2GT6 A;  3ZML A;  2JL4 A;  3I9V 2;  1MD4 A;  2OE3 A;  4TXO B;  3PPU A;  6GSW A;  4FIW A;  5KN3 A;  2HZF A;  4YAP A;  2GS3 A;  3P90 A;  2EIQ A;  1DSB A;  4I97 A;  3NZN A;  2OE0 A;  3ZMK A;  5EL8 A;  1F3A A;  2VCZ A;  3D21 A;  4USS A;  1GSS A;  4F2I A;  1B4Q A;  3LWA A;  2B5Y A;  1LU4 A;  1TRW A;  3K8N A;  2GDR A;  4POB A;  2B5E A;  1OAZ A;  5J9C A;  1OKT A;  13GS A;  3IOS A;  2AHE A;  2PUK C;  3A2V A;  3GNJ A;  1GTB A;  5AIS A;  3TUE A;  4TXV A;  3R2Q A;  1GP1 A;  2OE1 A;  3APS A;  3UBK A;  2JZS A;  5D9W A;  4J2F A;  1BX9 A;  4HU9 A;  4ZL7 A;  4MF5 A;  3VPT A;  3NOF A;  5GAP D;  1GSQ A;  3LGC A;  2B1K A;  3GH9 A;  4E8E A;  1R7H A;  3UL3 A;  1AXD A;  1SL1 B;  4YQM A;  1U87 A;  1DE2 A;  2RUE A;  3UAP A;  2CX4 A;  1A2J A;  1XBS A;  2BMX A;  17GS A;  4LL1 B;  2YV7 A;  3GTU A;  3EU3 A;  5ECM B;  3I69 A;  4XS1 A;  5IMA A;  1UC7 A;  2MYG A;  4WR4 A;  2GTU A;  1WJK A;  5IMV A;  4ZB9 A;  3RHB A;  1TJD A;  3IBH A;  1SJI A;  4PX1 A;  3SBC A;  1VF4 A;  1I9D A;  3MWH A;  2MZC A;  1M99 A;  3TRQ A;  2AB6 A;  11GS A;  3PR8 A;  5KN1 A;  2XHF A;  3ZZX A;  2IL3 A;  1M2D A;  3BBY A;  4KDU A;  1V9W A;  2X64 A;  3SWL A;  1N2A A;  1X9W B;  2VM2 A;  4MMM A;  2AYT A;  4OCF A;  2AUV A;  2KOK A;  1K0D A;  1WIK A;  2OJL A;  5ECR B;  5IOW A;  1KBN A;  2K18 A;  1GWC A;  1M9A A;  2YWM A;  4BA7 A;  1C72 A;  1E6B A;  3KD0 A;  3O6T A;  1A8Y A;  2H30 A;  4OO5 A;  3RPN A;  1KEB A;  4F82 A;  4EKZ A;  5JWR B;  3EMP A;  4NV5 A;  1WRY A;  3IA1 A;  1SKR B;  5DAL A;  3FK8 A;  3ZIJ A;  2V2G A;  2V41 A;  3E3E A;  5INY A;  2VL9 A;  3IAS 2;  3GTU B;  4G19 A;  2ES7 A;  3KTL A;  1OVN A;  2NPB A;  2HRA A;  1XWB A;  1GSD A;  16GS A;  1K3Y A;  3HY2 A;  4POM A;  4ZB8 A;  1O81 A;  3D0Z A;  3GKX A;  3MNG A;  3RAZ A;  1UN2 A;  4GXZ A;  1GRX A;  2REM A;  3EIN A;  3DGQ A;  3LYP A;  1QXH A;  2BTO T;  4CDO A;  3FZ9 A;  2GQL A;  2MBT A;  2GSS A;  1SEN A;  1GUK A;  1V98 A;  1A2L A;  4TR4 A;  3EC3 A;  2XBI A;  4OCE A;  1M9B A;  1O8X A;  2VD1 A;  5JWQ B;  4GWR A;  5CRH A;  3ZL5 A;  4IEL A;  4EVM A;  1MTC A;  4XS4 A;  3UEM A;  3J7Y k;  2B7J A;  5ENU A;  18GS A;  5AIV A;  3QOU A;  2WRT A;  1Z6N A;  3ZFL A;  2LTK A;  1ST9 A;  2IMK A;  5IO0 A;  1XW9 A;  5DAL B;  2CZ2 A;  1XWG A;  1JZD A;  5D8I A;  3RDW A;  2LJR A;  5AGY A;  2PU9 C;  2DJ2 A;  5ECO B;  1MDK A;  4IW9 A;  1ERV A;  5F0G A;  4DSR A;  2I81 A;  5DAK B;  4MDC A;  4NV2 A;  3EYT A;  3GFK A;  1VGL A;  3QFA C;  4FQU A;  2DMM A;  2ZUP A;  2H74 A;  2L5O A;  3RHC A;  1NM3 A;  4ECI A;  4TRX A;  2GZY A;  2FGX A;  2IWT A;  22GS A;  1Q4J A;  5F8B A;  5CRD A;  4GST A;  1Z7R A;  1Z3E A;  5J4U A;  1TP9 A;  3H4K A;  3P2A A;  4AGS A;  4DEJ A;  2J23 A;  3IRA A;  1G7O A;  3QDN A;  1HNC A;  3KP9 A;  3HZ4 A;  4RQR A;  2HT9 A;  5KEJ A;  3MSZ A;  4ZBA A;  3BOA A;  3IK7 A;  3CTF A;  4LLR A;  4WEY A;  2V32 A;  2LJK A;  2MMO A;  4HDE A;  2HE3 A;  1SK2 A;  4KDX A;  4XS4 B;  5J3R A;  2JSZ A;  4I2T A;  3LXT A;  2EC4 A;  5H5R A;  1PL1 A;  2HSM A;  4JRR A;  2IME A;  2X8H A;  2DLX A;  2WCI A;  3HA9 A;  1PX7 A;  5FHI A;  1MD3 A;  1FVJ A;  1TU8 A;  2DC5 A;  2P5R A;  3D4T A;  1Z6M A;  2TRC P;  2CVD A;  1EWX A;  2GGT A;  3C71 A;  5IQY A;  2VL3 A;  4JU5 A;  3GST A;  4KB3 A;  3DKS A;  2OAD A;  1JZR A;  3EMX A;  1A24 A;  2VCX A;  1R5P A;  1YEX A;  1X0R A;  3O3T A;  5ECI B;  3GIX A;  1SKS B;  1EGR A;  4Q5F A;  2RM5 A;  5JCW A;  4F9Z A;  1EP7 A;  2O8V B;  5JCU A;  1A0F A;  5IM9 A;  4L5O A;  5A4U A;  4PGT A;  1HNA A;  4TR0 A;  4I2U A;  4OFN A;  2DSA A;  2YZH A;  3US3 A;  4HJ2 A;  5AIX A;  3IC4 A;  2LV3 A;  2I1U A;  3WGX A;  3QAV A;  1XPV A;  4POL A;  2L57 A;  1J9B A;  3FYG A;  1PQN A;  6GSU A;  1QQ2 A;  4NXI A;  2D2Z A;  4IQ1 A;  3NIV A;  2F9S A;  2H0H A;  1SYR A;  3WT1 A;  2HSM B;  1ZYQ B;  2L6C A;  2O89 A;  1YZX A;  1WWJ A;  4PQI A;  5CNW A;  1AQW A;  2LRN A;  3IPZ A;  2N5B A;  4F03 A;  2I3Y A;  3KEB A;  5G5F A;  2YJ7 A;  1SD8 A;  2FCH A;  4QL7 A;  1M7T A;  3QD9 A;  2RII A;  4V1A g;  1ERT A;  3QCP A;  5ELG A;  2LQO A;  3LJR A;  4K0G A;  3GHA A;  2E2G A;  3JCM L;  1B8X A;  4OWY A;  1PD2 1;  3FZA A;  3W6G A;  5A4V A;  2LEG A;  2WB9 A;  3UBL A;  3EUR A;  3LEF A;  3L9U A;  4G2E A;  5B8B A;  5DVB A;  3L4N A;  5A4W A;  2C3N A;  7GSS A;  4LL4 B;  1K0A A;  3ERF A;  1BED A;  5DJM A;  5G1K A;  3GSS A;  2H1B A;  1VRS D;  2FUG 2;  1GSU A;  4ILF A;  3ZIT A;  2AAW A;  4KDY A;  4H86 A;  2DIZ A;  4E8H A;  3KH7 A;  1MDJ A;  2PER A;  1V2A A;  4G9H A;  1SKW B;  3HZ8 A;  3L9S A;  1QK8 A;  3GH6 A;  1X5C A;  4KSO A;  4IP1 A;  3F3R A;  2H76 A;  1VF1 A;  2CA8 A;  5IMF A;  3VWW A;  1ZGN A;  3FEU A;  4IKH A;  3UAR A;  2GSR A;  4TN8 A;  1T4Y A;  3KMO A;  3VI5 A;  2K8V A;  4I5Q A;  1U6T A;  3A3T A;  1TRV A;  4MA9 A;  4LMV A;  1OYJ A;  2FNO A;  2KP1 A;  1TK5 B;  4YQU A;  1S3A A;  2H6Y A;  1YKC A;  1PMT A;  3TOT A;  4K1F A;  5J41 A;  3VWV A;  2HXK A;  2P5Q A;  3IAM 2;  2L4C A;  1G6W A;  4HZ4 A;  2XC2 A;  5ECK B;  1V57 A;  5DQY A;  4ML6 A;  3DEX A;  4FYC A;  3GV1 A;  2VL2 A;  3KP8 A;  3WGE A;  4BWS A;  2M72 A;  2CQ9 A;  1TRU A;  1LBK A;  4O32 A;  3G9B A;  1ZL9 A;  5D9X A;  2RLI A;  1AC1 A;  6GSY A;  3HHV A;  3KGK A;  4OFT A;  2DJ3 A;  2DIY A;  1OE8 A;  3QAG A;  3VI7 A;  3WGD A;  2PVQ A;  1BAY A;  3F6F A;  1O6J A;  4HEA 2;  3AY8 A;  4MF6 A;  2H1G A;  4ZL8 A;  4KAE A;  5EY6 A;  1YF0 A;  3CTG A;  5LD0 A;  4L5L A;  3RPP A;  3FR3 A;  1GNW A;  2V6O A;  3CSH A;  4KE3 A;  3UMA A;  3KMN A;  2C0G A;  1GSE A;  2WDU A;  3ISO A;  1GSF A;  3EU4 A;  2YWO A;  5COH A;  1PKW A;  2VM1 A;  1I5G A;  5B8A A;  3TKP A;  1MEK A;  4V1A p;  4BWQ A;  4N30 A;  5CAX A;  2CT6 A;  5ECH B;  2HSN B;  2ALB A;  4XS6 A;  2PGT A; 
#chains in the Genus database with same CATH topology
 1THX A;  2UV8 G;  9GSS A;  3CBU A;  4L8E A;  3TU3 B;  1NHO A;  4AKI A;  3H79 A;  4AF2 A;  1FB0 A;  1TI3 A;  3F4S A;  3GUS A;  4GRF A;  3VLN A;  4Z7X A;  1TOF A;  1YY7 A;  2C0D A;  12GS A;  3GN3 A;  1QMV A;  4GTU A;  2VLU A;  3CQF A;  1GSY A;  2R2J A;  5GAN D;  4F0C A;  2X99 A;  4QL9 A;  4N0Z A;  5G2Z A;  3O76 A;  3CRT A;  3KTB A;  4DSS A;  5HR0 A;  2JZR A;  1J0F A;  4G0I A;  2PPT A;  1GTU A;  3FZ5 A;  1YJ6 A;  19GS A;  3S9F A;  3N5O A;  3M8N A;  3IR4 A;  4GCI A;  3LOR A;  2VAF A;  3ZRE A;  4MF7 A;  5EVO A;  1SL2 B;  1K0O A;  1K0C A;  5CO3 A;  2H1L A;  3RBT A;  3TOU A;  1FOV A;  3OR5 A;  4NAX A;  2R6K A;  5IOX A;  1JLW A;  4RQX A;  1BF5 A;  3HJM A;  5GZZ B;  2F3M A;  1GTI A;  1ZZY A;  5DAK A;  2G0F A;  2E0Q A;  3LSZ A;  2KHP A;  2EFC A;  3KJY A;  3C8E A;  5IPH A;  3GKK A;  1W4V A;  4MJB A;  2LJA A;  3HJO A;  4TR3 A;  1XWC A;  2FWG A;  2WW3 A;  2VO4 A;  1SU9 A;  5GSS A;  2H75 A;  2MMZ A;  1EEJ A;  3PH9 A;  1DE1 A;  5CRE A;  1FO5 A;  3N9J A;  2H70 A;  4WET A;  3HVX A;  1SK1 A;  3VFI A;  3J7Y b;  1DUG A;  1I1I P;  5HR1 A;  3U6V A;  4BVX A;  5FWG A;  4DSS B;  3ZTL A;  3IE3 A;  2IFQ A;  2KP2 A;  4D73 A;  3F0I A;  1SL0 B;  4ZB7 A;  1S3D A;  4MJC A;  2VL2 C;  1R5A A;  2VCT A;  2TIR A;  4K7O A;  2OBI A;  8GSS A;  5A5H A;  1GUM A;  2TRX A;  3BJ5 A;  4W66 A;  2KUC A;  2WZ9 A;  3D5J A;  1QGV A;  1AQV A;  1SD9 A;  5LCZ A;  2K6V A;  3DIE A;  3DD3 A;  4QQ7 A;  1UA5 A;  1O85 A;  1K0B A;  1O8W A;  3A5I A;  2GT5 A;  1XCC A;  1JHB A;  1PSQ A;  3EVI A;  3LXZ A;  2ZCT A;  2B1L A;  4WBJ A;  1EEM A;  6GSS A;  4Q5N A;  3RGB C;  4IN0 A;  2CAI A;  1BQ7 A;  2H1A A;  2LQQ A;  2C1Y A;  4Z2U A;  1JLV A;  2QSI A;  1BJX A;  4Z2T A;  2IMD A;  3QR6 A;  3APO A;  4BVX B;  2N5F A;  14GS A;  1K3O A;  4HS1 A;  2QKE A;  3QFB C;  2HQT A;  1B4P A;  2IFQ B;  2O5V A;  4IJ3 A;  4D73 B;  2YV9 A;  4KCA A;  1V58 A;  4EXJ A;  2DJJ A;  4JR4 A;  1URM A;  4PUF C;  2NTO A;  2ON7 A;  1BG5 A;  3F9U A;  5A5H B;  1ACV A;  3FZ4 A;  2R0G A;  2Z9S A;  5IIZ A;  5ECQ B;  5B6M A;  5KOX A;  1GUH A;  1XVW A;  2H6X A;  4N0V A;  2CV4 A;  2J9H A;  4ZIL A;  1HD2 A;  1PGT A;  5CP1 A;  5E59 A;  5A5K A;  2YZU A;  1X9S B;  1X5E A;  2C8U A;  2HLS A;  1F6M C;  4IJI A;  2C4J A;  4MZB A;  1T1V A;  3V1W A;  1EP8 A;  2HZE A;  3I6A A;  4ISD A;  2YOI A;  2L6D A;  3D4M A;  1X5D A;  2O87 A;  5A34 A;  3M3M A;  4XIH A;  2L5L A;  2GZP A;  4N11 A;  4WR5 A;  1GUL A;  1XW6 A;  1RQM A;  1H75 A;  2KLX A;  2WZS A;  2F8F A;  1O7U A;  5CRW A;  4PUR A;  1W89 A;  4L0U A;  1QUW A;  4MH2 A;  3LG6 A;  2N5A A;  2H6Z A;  3E9J B;  3QMX A;  1VF2 A;  4KND A;  3UOM A;  4XCS A;  2MMA A;  1M3J A;  4WF5 A;  1JZW A;  4IQA A;  1NSW A;  4EDZ A;  1A0R P;  1Z7P A;  2YP6 A;  4BPY A;  1XWK A;  3L78 A;  3ED3 A;  4EUY A;  2H8L A;  5IMZ A;  4I6X A;  2IPA A;  4GQC A;  3UIW A;  2R5G A;  6GST A;  3FRC A;  1N25 A;  3KM6 A;  5DCH A;  2LNS A;  2A4V A;  5G5E A;  2NBS A;  1F37 A;  2JAC A;  2CVK A;  4NWY A;  2M80 A;  1TK8 B;  4X43 A;  4PI2 C;  4XRA A;  4O92 A;  2LRC A;  2HZE B;  1Z9H A;  4MK3 A;  3TB2 A;  1Y25 A;  3Q19 A;  1JFU A;  5D96 A;  1OC8 A;  2DJ1 A;  3VK9 A;  2BJX A;  2H72 A;  4ZB6 A;  1YF1 A;  3HYP A;  5A34 B;  2DJK A;  4OO4 A;  5F05 A;  4FO5 A;  1ZMA A;  3F3Q A;  2ON5 A;  2O36 A;  4WBR D;  4MZW A;  1XVQ A;  3EE2 A;  3Q6O A;  2CVB A;  1F9M A;  2XPE A;  5ECN B;  2GLR A;  3M9K A;  4NPB A;  4DVC A;  3WD6 A;  2WW0 A;  2YJH A;  4KX4 A;  2XBQ A;  4WKW A;  1PX6 A;  3EPT A;  2EFE A;  4V2M A;  2VLV A;  2AV4 A;  2QA2 A;  3HD5 A;  2H66 A;  3FR9 A;  20GS A;  2C3T A;  4PHZ C;  2OT3 A;  2OBK A;  2HRF A;  1XWA A;  5JCG A;  4J56 E;  5DCG A;  2WJU A;  5J9B A;  1FG4 A;  3LQ7 A;  1WE0 A;  3HXS A;  1R4W A;  1FHE A;  1PRX A;  4X1U A;  1EOG A;  3VPQ A;  2CAQ A;  2C0E A;  2JSY A;  2R37 A;  5J47 A;  1Q98 A;  3MIX A;  3A2X A;  3U5R E;  1HYU A;  4HQS A;  4HQZ A;  4CY6 A;  3H1N A;  2LS5 A;  4HSC X;  1A2M A;  3CYN A;  4KA0 A;  2PN8 A;  1TDI A;  2CX3 A;  2HFD A;  4JE1 A;  1SK0 A;  5KN2 A;  1THO A;  3DVW A;  4X0X A;  3DML A;  1Y6E A;  1GLQ A;  1J08 A;  3UVH A;  2YAN A;  4GSN A;  1A8L A;  2AJQ B;  1ABA A;  1SVO A;  4MH3 A;  1U88 A;  1CQH A;  2VD0 A;  1FAA A;  4CHS A;  1TK0 B;  4A5P A;  3P7X A;  2FHE A;  3C7M A;  3F4R A;  4EE0 A;  2B3S A;  2LRT A;  5A1N A;  4WF4 A;  2FWE A;  3IXR A;  1TW9 A;  4YKG A;  4PQH A;  3TGZ A;  3TJF A;  1TKD B;  1HQO A;  4LA1 A;  4RI7 A;  3TKS E;  3UVT A;  1OC9 A;  3HDC A;  1DBY A;  4XRD A;  3ZIV A;  2GST A;  4HUA A;  2I9H A;  1WMJ A;  4MAB A;  5ELA A;  3DRN A;  3CRU A;  3W8J A;  2GZZ A;  1IYI A;  3KZQ A;  3F63 A;  2VKZ G;  4ZBD A;  4KCE A;  4E68 A;  4JED A;  2HRN A;  5D9T A;  1LJR A;  4G10 A;  1FB6 A;  1R26 A;  2XPD A;  2C3Q A;  1TU7 A;  1XXU A;  2MBS A;  2DKI A;  2QC7 A;  1BYE A;  4NHW A;  2YPM A;  1YQ1 A;  4O5Q A;  4MLY A;  3CXG A;  5E4W A;  5JWO B;  4YAV A;  2VCQ A;  1EV4 A;  1T4Z A;  4PXO A;  2LST A;  2VIM A;  4FYU A;  1AIU A;  3F6D A;  3C1S A;  2B6M A;  3VUR A;  2HSH A;  4OD7 A;  1GH2 A;  4IGJ A;  5C04 A;  3KCM A;  3IK9 A;  2B5X A;  1KTE A;  2L59 A;  3C1R A;  5A1N B;  1YEP A;  3VWU A;  4EIP A;  1RW1 A;  5GST A;  3TDG A;  4Q5R A;  3VWX A;  3MDK A;  2YWI A;  3IC8 A;  1SYX A;  3F8U A;  4V2N A;  2F8A A;  1ZYE A;  2R4V A;  1ERW A;  2C80 A;  2OA7 A;  3L0H A;  2GSQ A;  3HKR A;  1ZYN A;  5DDL A;  1OC9 B;  1M0U A;  1HNB A;  3M9J A;  4ID0 A;  2FWF A;  4EC0 A;  3ZVJ D;  1S3C A;  2YCD A;  5HFG A;  1GNE A;  1M2B A;  4AJ6 A;  4ECC A;  2EIO A;  4KH7 A;  2HI7 A;  1V40 A;  5H5Q A;  4IBP A;  2P31 A;  5G31 A;  2IIY A;  5IMD A;  4K7I A;  4PUA A;  2I4A A;  3HVV A;  1EGO A;  3W8S A;  2A2R A;  2H71 A;  3M0F A;  1XFL A;  3ME8 A;  3GUR A;  2X8C A;  2X4A A;  3GKM A;  4BVY A;  3Q18 A;  3GA4 A;  3GRX A;  3TKS A;  2C0F A;  4XHM A;  1ZCP A;  4JZQ A;  5L71 A;  3FW2 A;  1ZOF A;  2RM6 A;  1EV9 A;  2WS2 A;  5FT3 A;  4KSM A;  2H19 A;  4MNN A;  4ACS A;  3DXB A;  4K5R A;  1Z5Y E;  1K3L A;  4AJ8 A;  1XOA A;  1AW9 A;  1PKZ A;  4ZXG A;  4HJM A;  3KXO A;  2JZT A;  2LKU A;  4GSS A;  2RUF A;  1AQX A;  1TRS A;  3GYK A;  1EZK A;  5BRT A;  1TTZ A;  2YN1 A;  3GL3 A;  3GL5 A;  5IMC A;  1TI1 A;  4EF0 A;  3HJP A;  3A2W A;  4PNF A;  2HRK A;  2A2S A;  4KW6 A;  1UVZ A;  2DML A;  4HU7 A;  2H01 A;  2CZ3 A;  2V1M A;  4K7N A;  3TRP A;  2VCV A;  5BMU A;  3CSI A;  1SJZ A;  4BL7 A;  4CW9 A;  1K0N A;  5DBQ A;  4KGI A;  2G2Q A;  3TJB A;  4OMV A;  2FLS A;  3WT2 A;  4MP4 A;  1T8E B;  2FD3 A;  2QGV A;  1CQG A;  2PMT A;  3L9V A;  4BVY B;  2E7P A;  5ID2 A;  1AAZ A;  3CSJ A;  2M46 A;  2JAD A;  3PIN A;  5ECS A;  2YWN A;  4P3Y B;  4ULX A;  5CRG A;  1B9X C;  3DYR A;  5ECP B;  3MAK A;  4GF0 A;  1OKD A;  2F51 A;  3DWV A;  5D9V A;  3C73 A;  2WFC A;  3F4T A;  4G0L A;  4MJA A;  1X9M B;  2OKA A;  4RI6 A;  4BIK A;  1IYH A;  1T7P B;  2O85 A;  5B6N A;  1ON4 A;  5J4Y A;  1PN9 A;  3P8W A;  1AUC A;  2LUS A;  3D22 A;  2WUL A;  1ERU A;  4K0N A;  4FH8 A;  2DKH A;  5HQP A;  5HR3 A;  3TJG A;  2H73 A;  1H4O A;  4MZC A;  5F06 A;  4DSQ A;  5ABR A;  5C00 A;  4EL1 A;  2HRK B;  5IO2 A;  1G7E A;  1RK4 A;  3LYK A;  2R3X A;  2A2P A;  1G0T A;  2VUP A;  1ML6 A;  4TOP A;  1WPI A;  5BMU B;  4HI7 A;  4BL7 B;  3CWG A;  4TR1 A;  5F07 A;  1FOH A;  3LFL A;  4IVF A;  4KUN A;  4L0W A;  3CMI A;  3APQ A;  4ML1 A;  1EOH A;  2HYX A;  4ICY A;  5D73 A;  4KF9 A;  2VLT A;  1U3A A;  2R0C A;  4EO3 A;  1NW2 A;  1MDI A;  4YKF A;  2PVO C;  5ID2 B;  1QFN A;  3FY7 A;  4HZ2 A;  2GVP A;  3HCZ A;  1OC3 A;  3BCK A;  3GX0 A;  4GQF A;  1ILO A;  1T00 A;  1JZO A;  2MMN A;  2A4H A;  2DJ0 A;  2FA8 A;  5KOW A;  3ZRD A;  2GQM A;  4XTS A;  2H0G A;  2JU5 A;  3ERW A;  5DQS A;  1YVL A;  4MPG A;  1VF3 A;  3TKQ A;  2V6K A;  5KN0 A;  2GQK A;  4IP6 A;  3M1G A;  3IHG A;  4O5R A;  3ZFB A;  4N10 A;  4TVE A;  1A23 A;  2OAC A;  3WYW A;  4POK A;  1PFO A;  4Z2R A;  4RUV A;  3A5W A;  5G1L A;  3TJK A;  3R3E A;  1GL8 A;  1YKA A;  5ECL B;  3ZLP A;  1TXU A;  4GLT A;  1PA3 A;  4LMW A;  4I8B A;  2K9F A;  3TKS C;  4NHZ A;  4PQ1 A;  5HFI A;  3ZYW A;  1OE7 A;  4AJ7 A;  1M2A A;  3QAW A;  5HFK A;  3KH9 A;  2IMF A;  5G30 A;  4TKY A;  2UZ8 A;  1FW1 A;  2PWJ A;  3FKF A;  1GLP A;  4GDF A;  1NHY A;  3TCO A;  4PTS A;  4TR1 B;  4O7H A;  4ZBB A;  3I43 A;  3QPM A;  2K8S A;  4J57 E;  4ZIJ A;  2LNT A;  2P0G A;  1O73 A;  4F0B A;  4NMU A;  2WGR A;  5EPF A;  4TW5 A;  2ZNM A;  3H8Q A;  2O7K A;  5B7C A;  3E0U A;  3IV4 A;  2DBC A;  1PN0 A;  2HNL A;  4ZL9 A;  4MJE A;  2H0I A;  3GX8 A;  1YDK A;  4G0K A;  3ZVJ A;  1WP0 A;  5J40 A;  3HVS A;  4EDY A;  4N3Z A;  3G7Y A;  1SJ6 A;  5D93 A;  1XW5 A;  4ECB A;  2VOC A;  1U3I A;  4YH2 A;  4K2X A;  10GS A;  5H5S A;  5DJL A;  4CY8 A;  3ERG A;  4K6X A;  2HSY A;  1B9Y C;  1F3B A;  4K8M A;  3BCI A;  3Q74 A;  2O3E A;  2X8G A;  1SVL A;  3UJ1 A;  4TXO A;  3TKR A;  3D6I A;  3KIJ A;  5CYY A;  4FYB A;  5J5N A;  4YQV A;  4AKG A;  5LNK e;  3TRX A;  4HOJ A;  3H93 A;  1FVK A;  4JBB A;  2FWH A;  3FHK A;  1ZYP A;  3IDV A;  2EIR A;  1KNG A;  1USB A;  3TJJ A;  4K9Z A;  3GMF A;  4PNG A;  3FR6 A;  1XIY A;  4K2D A;  1XOB A;  2WVZ A;  1G6Y A;  2PBJ A;  2WW1 A;  4Q5Q A;  2FY6 A;  4ECJ A;  3BD2 A;  2L4Q A;  2NVL A;  1SVM A;  3G7I A;  3EWL A;  3GKN A;  4FXY P;  2IJY A;  5HR2 A;  1F2E A;  1E2Y A;  1T3B A;  1GTA A;  4MPF A;  4JR6 A;  3G7J A;  4IS0 A;  2NDO A;  6GSV A;  5IPG A;  4V2L A;  2H1D A;  4WXT A;  2IMI A;  3PGT A;  1N8J A;  4QMK A;  2B7K A;  3DVX A;  2IN3 A;  1K0M A;  1WOU A;  4OFM A;  2VCW A;  1XZO A;  3IHQ A;  4MCU A;  3ME7 A;  6GSX A;  1PL2 A;  1B48 A;  4O5U A;  1TXX A;  5AN1 A;  4IHU A;  2E2M A;  2FA4 A;  2YNX A;  2GT6 A;  3ZML A;  2JL4 A;  3I9V 2;  1MD4 A;  2OE3 A;  4TXO B;  3PPU A;  6GSW A;  4FIW A;  5KN3 A;  2HZF A;  4YAP A;  2GS3 A;  3P90 A;  2EIQ A;  1DSB A;  4I97 A;  3NZN A;  2OE0 A;  3ZMK A;  5EL8 A;  1F3A A;  2VCZ A;  3D21 A;  4USS A;  1GSS A;  4F2I A;  1B4Q A;  2WW2 A;  3LWA A;  2B5Y A;  1LU4 A;  1TRW A;  3K8N A;  2GDR A;  4POB A;  2B5E A;  1OAZ A;  5J9C A;  1OKT A;  13GS A;  3IOS A;  2AHE A;  4X4J A;  2PUK C;  3A2V A;  3GNJ A;  1GTB A;  5AIS A;  3TUE A;  4TXV A;  3R2Q A;  1GP1 A;  2OE1 A;  3APS A;  3UBK A;  2JZS A;  5D9W A;  4J2F A;  1BX9 A;  4HU9 A;  4ZL7 A;  4MF5 A;  3VPT A;  3NOF A;  5GAP D;  1GSQ A;  3LGC A;  2B1K A;  3GH9 A;  4E8E A;  1R7H A;  3UL3 A;  1AXD A;  1SL1 B;  4YQM A;  1U87 A;  1DE2 A;  2RUE A;  3UAP A;  2CX4 A;  1A2J A;  1XBS A;  2BMX A;  17GS A;  4LL1 B;  2YV7 A;  3GTU A;  3EU3 A;  5ECM B;  3I69 A;  4XS1 A;  5IMA A;  1UC7 A;  2MYG A;  4WR4 A;  2GTU A;  1WJK A;  5IMV A;  4ZB9 A;  3RHB A;  1TJD A;  3IBH A;  1SJI A;  4PX1 A;  3SBC A;  1VF4 A;  1Y1U A;  1I9D A;  3MWH A;  2MZC A;  1M99 A;  3TRQ A;  2AB6 A;  11GS A;  3PR8 A;  5KN1 A;  2XHF A;  3ZZX A;  2IL3 A;  1M2D A;  3BBY A;  4KDU A;  1V9W A;  2X64 A;  3SWL A;  1N2A A;  1X9W B;  2VM2 A;  4MMM A;  2AYT A;  4OCF A;  2AUV A;  2KOK A;  1K0D A;  1WIK A;  5J4V A;  2OJL A;  1BG1 A;  5ECR B;  5IOW A;  1KBN A;  2K18 A;  1GWC A;  1M9A A;  2YWM A;  4BA7 A;  1C72 A;  1E6B A;  3KD0 A;  3O6T A;  1A8Y A;  2H30 A;  4OO5 A;  3RPN A;  1KEB A;  4F82 A;  4EKZ A;  5JWR B;  3EMP A;  4NV5 A;  1WRY A;  3IA1 A;  1SKR B;  5DAL A;  3FK8 A;  3ZIJ A;  2V2G A;  2V41 A;  3E3E A;  5INY A;  2VL9 A;  3IAS 2;  3GTU B;  4G19 A;  2ES7 A;  3KTL A;  1OVN A;  2NPB A;  2HRA A;  1XWB A;  1GSD A;  16GS A;  1K3Y A;  3HY2 A;  4POM A;  4ZB8 A;  3FMW A;  1O81 A;  3D0Z A;  3GKX A;  3MNG A;  3RAZ A;  1UN2 A;  4GXZ A;  1GRX A;  2REM A;  3EIN A;  3DGQ A;  3LYP A;  1QXH A;  2BTO T;  4AI6 A;  3FZ9 A;  4CDO A;  2GQL A;  2MBT A;  2GSS A;  1SEN A;  4AKX B;  1GUK A;  1V98 A;  1A2L A;  4TR4 A;  3EC3 A;  2XBI A;  3HMJ G;  4OCE A;  1M9B A;  1O8X A;  2VD1 A;  5JWQ B;  4GWR A;  5CRH A;  3ZL5 A;  1M3I A;  4IEL A;  4EVM A;  1MTC A;  4XS4 A;  3UEM A;  3J7Y k;  2B7J A;  5ENU A;  18GS A;  5AIV A;  3QOU A;  2WRT A;  1Z6N A;  3ZFL A;  2LTK A;  1ST9 A;  2IMK A;  5IO0 A;  1XW9 A;  5DAL B;  2CZ2 A;  1XWG A;  1JZD A;  5D8I A;  3RDW A;  2LJR A;  5AGY A;  2PU9 C;  2DJ2 A;  5ECO B;  1MDK A;  4IW9 A;  1ERV A;  5F0G A;  4DSR A;  2I81 A;  5DAK B;  4MDC A;  4NV2 A;  3EYT A;  3GFK A;  1VGL A;  3QFA C;  4FQU A;  2DMM A;  2ZUP A;  2H74 A;  2L5O A;  3RHC A;  1NM3 A;  4ECI A;  4TRX A;  2GZY A;  2FGX A;  2IWT A;  22GS A;  1Q4J A;  5F8B A;  5CRD A;  4GST A;  3MYD A;  1Z7R A;  1Z3E A;  5J4U A;  3HVN A;  1TP9 A;  3H4K A;  3P2A A;  4AGS A;  4DEJ A;  2J23 A;  3IRA A;  1G7O A;  3QDN A;  1HNC A;  2EFD A;  3KP9 A;  3HZ4 A;  4RQR A;  2HT9 A;  5KEJ A;  3MSZ A;  4ZBA A;  3BOA A;  3IK7 A;  3CTF A;  4LLR A;  4WEY A;  2V32 A;  2LJK A;  2MMO A;  4HDE A;  2HE3 A;  1SK2 A;  4KDX A;  4XS4 B;  4AKH A;  2JSZ A;  5J3R A;  4I2T A;  3LXT A;  2EC4 A;  5H5R A;  1PL1 A;  2HSM A;  4JRR A;  2IME A;  2X8H A;  2DLX A;  2WCI A;  3RFR C;  3HA9 A;  1PX7 A;  5FHI A;  1MD3 A;  1FVJ A;  1TU8 A;  2DC5 A;  2P5R A;  3D4T A;  1Z6M A;  2WVY A;  2TRC P;  2CVD A;  1EWX A;  2GGT A;  3C71 A;  5IQY A;  2VL3 A;  4JU5 A;  3GST A;  4KB3 A;  3DKS A;  2OAD A;  1JZR A;  3EMX A;  1A24 A;  2VCX A;  1R5P A;  1YEX A;  1X0R A;  3O3T A;  5ECI B;  3GIX A;  1SKS B;  1EGR A;  4Q5F A;  4EIQ A;  2RM5 A;  5JCW A;  4F9Z A;  1EP7 A;  2WVX A;  2O8V B;  5JCU A;  1A0F A;  5IM9 A;  4L5O A;  5A4U A;  4PGT A;  1HNA A;  4TR0 A;  2QA1 A;  4I2U A;  4OFN A;  2DSA A;  2YZH A;  3US3 A;  4HJ2 A;  5AIX A;  3IC4 A;  2LV3 A;  2I1U A;  3WGX A;  3QAV A;  1XPV A;  1YEW C;  4POL A;  2L57 A;  1J9B A;  3FYG A;  1PQN A;  6GSU A;  1QQ2 A;  2R0P A;  4NXI A;  2D2Z A;  4IQ1 A;  3NIV A;  2F9S A;  2H0H A;  1SYR A;  3WT1 A;  2HSM B;  1ZYQ B;  2L6C A;  2O89 A;  1YZX A;  1WWJ A;  4PQI A;  5CNW A;  1AQW A;  2LRN A;  3IPZ A;  2N5B A;  4K5S A;  4F03 A;  2I3Y A;  3KEB A;  5G5F A;  2YJ7 A;  1SD8 A;  3LW9 A;  2FCH A;  4QL7 A;  1M7T A;  3QD9 A;  2RII A;  4V1A g;  1ERT A;  3QCP A;  5ELG A;  2LQO A;  3LJR A;  4K0G A;  3GHA A;  2E2G A;  2WVX B;  3JCM L;  1B8X A;  4OWY A;  1PD2 1;  3FZA A;  3W6G A;  5A4V A;  2LEG A;  1S3R A;  2WB9 A;  3UBL A;  3EUR A;  3LEF A;  3L9U A;  4G2E A;  5B8B A;  5DVB A;  3L4N A;  5A4W A;  2C3N A;  7GSS A;  4LL4 B;  1K0A A;  3ERF A;  1BED A;  5DJM A;  5G1K A;  3GSS A;  2H1B A;  2X49 A;  1VRS D;  2FUG 2;  1GSU A;  4G01 A;  4ILF A;  3ZIT A;  2AAW A;  4KDY A;  2DIZ A;  4H86 A;  4E8H A;  3KH7 A;  1MDJ A;  2PER A;  1V2A A;  4G9H A;  1SKW B;  3HZ8 A;  3L9S A;  1QK8 A;  3GH6 A;  1X5C A;  4KSO A;  4IP1 A;  3F3R A;  2H76 A;  1VF1 A;  2CA8 A;  5IMF A;  3VWW A;  1ZGN A;  3FEU A;  4IKH A;  3UAR A;  2GSR A;  4TN8 A;  1T4Y A;  3KMO A;  3VI5 A;  2K8V A;  4I5Q A;  1U6T A;  3A3T A;  1TRV A;  4MA9 A;  3CHX C;  4LMV A;  1OYJ A;  2FNO A;  2KP1 A;  1XG8 A;  1TK5 B;  4YQU A;  1S3A A;  2H6Y A;  1YKC A;  1PMT A;  1S4B P;  3TOT A;  4K1F A;  5J41 A;  3VWV A;  2HXK A;  2P5Q A;  3IAM 2;  2HSN A;  2L4C A;  1G6W A;  4HZ4 A;  2XC2 A;  5ECK B;  1V57 A;  5DQY A;  4ML6 A;  3DEX A;  4FYC A;  3GV1 A;  2VL2 A;  3KP8 A;  3WGE A;  4BWS A;  2M72 A;  2CQ9 A;  1TRU A;  1LBK A;  4O32 A;  3G9B A;  1ZL9 A;  5D9X A;  2RLI A;  1AC1 A;  6GSY A;  3HHV A;  3KGK A;  4OFT A;  2DJ3 A;  2DIY A;  1OE8 A;  3QAG A;  3VI7 A;  3WGD A;  2PVQ A;  1BAY A;  3F6F A;  1O6J A;  4HEA 2;  3AY8 A;  2EFH A;  4MF6 A;  2H1G A;  4ZL8 A;  4KAE A;  5EY6 A;  1YF0 A;  3CTG A;  5LD0 A;  4L5L A;  3RPP A;  3FR3 A;  1GNW A;  2V6O A;  3CSH A;  4KE3 A;  3UMA A;  3KMN A;  2C0G A;  1GSE A;  2WDU A;  3ISO A;  1GSF A;  3EU4 A;  2YWO A;  5COH A;  1PKW A;  2VM1 A;  1I5G A;  5B8A A;  3TKP A;  1MEK A;  4V1A p;  4BWQ A;  4N30 A;  5CAX A;  2CT6 A;  5ECH B;  2HSN B;  2ALB A;  4XS6 A;  4PI0 C;  2PGT A; 
#chains in the Genus database with same CATH homology
 1THX A;  2UV8 G;  9GSS A;  3CBU A;  4L8E A;  3TU3 B;  1NHO A;  4AKI A;  3H79 A;  4AF2 A;  1FB0 A;  1TI3 A;  3F4S A;  3GUS A;  4GRF A;  3VLN A;  4Z7X A;  1TOF A;  1YY7 A;  2C0D A;  12GS A;  3GN3 A;  1QMV A;  4GTU A;  2VLU A;  1GSY A;  2R2J A;  5GAN D;  4F0C A;  2X99 A;  4QL9 A;  4N0Z A;  5G2Z A;  3O76 A;  3CRT A;  3KTB A;  4DSS A;  5HR0 A;  2JZR A;  1J0F A;  4G0I A;  2PPT A;  1GTU A;  3FZ5 A;  1YJ6 A;  19GS A;  3S9F A;  3N5O A;  3M8N A;  3IR4 A;  4GCI A;  3LOR A;  2VAF A;  3ZRE A;  4MF7 A;  5EVO A;  1SL2 B;  1K0O A;  1K0C A;  5CO3 A;  2H1L A;  3RBT A;  3TOU A;  1FOV A;  3OR5 A;  4NAX A;  2R6K A;  5IOX A;  1JLW A;  4RQX A;  1BF5 A;  3HJM A;  5GZZ B;  2F3M A;  1GTI A;  1ZZY A;  5DAK A;  2G0F A;  2E0Q A;  3LSZ A;  2KHP A;  2EFC A;  3KJY A;  3C8E A;  5IPH A;  3GKK A;  1W4V A;  4MJB A;  2LJA A;  3HJO A;  4TR3 A;  1XWC A;  2FWG A;  2VO4 A;  1SU9 A;  5GSS A;  2H75 A;  2MMZ A;  1EEJ A;  3PH9 A;  1DE1 A;  5CRE A;  1FO5 A;  3N9J A;  2H70 A;  4WET A;  3HVX A;  1SK1 A;  3VFI A;  3J7Y b;  1DUG A;  5HR1 A;  3U6V A;  4BVX A;  5FWG A;  4DSS B;  3ZTL A;  3IE3 A;  2IFQ A;  2KP2 A;  4D73 A;  3F0I A;  1SL0 B;  4ZB7 A;  1S3D A;  4MJC A;  2VL2 C;  1R5A A;  2VCT A;  2TIR A;  4K7O A;  2OBI A;  8GSS A;  5A5H A;  1GUM A;  2TRX A;  3BJ5 A;  4W66 A;  2KUC A;  2WZ9 A;  3D5J A;  1QGV A;  1AQV A;  1SD9 A;  5LCZ A;  2K6V A;  3DIE A;  3DD3 A;  4QQ7 A;  1UA5 A;  1O85 A;  1K0B A;  1O8W A;  3A5I A;  2GT5 A;  1XCC A;  1JHB A;  1PSQ A;  3EVI A;  3LXZ A;  2ZCT A;  2B1L A;  4WBJ A;  1EEM A;  6GSS A;  4Q5N A;  4IN0 A;  2CAI A;  1BQ7 A;  2H1A A;  2LQQ A;  2C1Y A;  4Z2U A;  1JLV A;  2QSI A;  1BJX A;  4Z2T A;  2IMD A;  3QR6 A;  3APO A;  4BVX B;  2N5F A;  14GS A;  1K3O A;  4HS1 A;  2QKE A;  3QFB C;  2HQT A;  1B4P A;  2IFQ B;  2O5V A;  4IJ3 A;  4D73 B;  2YV9 A;  4KCA A;  1V58 A;  4EXJ A;  2DJJ A;  4JR4 A;  1URM A;  4PUF C;  2NTO A;  2ON7 A;  1BG5 A;  3F9U A;  5A5H B;  1ACV A;  3FZ4 A;  2R0G A;  2Z9S A;  5IIZ A;  5ECQ B;  5B6M A;  5KOX A;  1GUH A;  1XVW A;  2H6X A;  4N0V A;  2CV4 A;  2J9H A;  4ZIL A;  1HD2 A;  1PGT A;  5CP1 A;  5E59 A;  5A5K A;  2YZU A;  1X9S B;  1X5E A;  2C8U A;  2HLS A;  1F6M C;  4IJI A;  2C4J A;  4MZB A;  1T1V A;  3V1W A;  1EP8 A;  2HZE A;  3I6A A;  4ISD A;  2YOI A;  2L6D A;  3D4M A;  1X5D A;  2O87 A;  5A34 A;  3M3M A;  4XIH A;  2L5L A;  2GZP A;  4N11 A;  4WR5 A;  1GUL A;  1XW6 A;  1RQM A;  1H75 A;  2KLX A;  2F8F A;  1O7U A;  5CRW A;  4PUR A;  1W89 A;  4L0U A;  1QUW A;  4MH2 A;  3LG6 A;  2N5A A;  2H6Z A;  3E9J B;  3QMX A;  1VF2 A;  4KND A;  3UOM A;  4XCS A;  2MMA A;  4WF5 A;  1JZW A;  4IQA A;  1NSW A;  4EDZ A;  1A0R P;  1Z7P A;  2YP6 A;  4BPY A;  1XWK A;  3L78 A;  3ED3 A;  4EUY A;  2H8L A;  5IMZ A;  4I6X A;  2IPA A;  4GQC A;  3UIW A;  2R5G A;  6GST A;  3FRC A;  1N25 A;  3KM6 A;  5DCH A;  2LNS A;  2A4V A;  5G5E A;  2NBS A;  1F37 A;  2JAC A;  2CVK A;  4NWY A;  2M80 A;  1TK8 B;  4X43 A;  4XRA A;  4O92 A;  2LRC A;  2HZE B;  1Z9H A;  4MK3 A;  3TB2 A;  1Y25 A;  3Q19 A;  1JFU A;  5D96 A;  1OC8 A;  2DJ1 A;  3VK9 A;  2BJX A;  2H72 A;  4ZB6 A;  1YF1 A;  3HYP A;  5A34 B;  2DJK A;  4OO4 A;  5F05 A;  4FO5 A;  1ZMA A;  3F3Q A;  2ON5 A;  4WBR D;  4MZW A;  1XVQ A;  3EE2 A;  3Q6O A;  2CVB A;  1F9M A;  2XPE A;  5ECN B;  2GLR A;  3M9K A;  4NPB A;  4DVC A;  3WD6 A;  2YJH A;  4KX4 A;  2XBQ A;  4WKW A;  1PX6 A;  3EPT A;  2EFE A;  4V2M A;  2VLV A;  2AV4 A;  2QA2 A;  3HD5 A;  2H66 A;  3FR9 A;  20GS A;  2C3T A;  2OT3 A;  2OBK A;  2HRF A;  1XWA A;  5JCG A;  4J56 E;  5DCG A;  2WJU A;  5J9B A;  1FG4 A;  3LQ7 A;  1WE0 A;  3HXS A;  1R4W A;  1FHE A;  1PRX A;  4X1U A;  1EOG A;  3VPQ A;  2CAQ A;  2C0E A;  2JSY A;  2R37 A;  5J47 A;  1Q98 A;  3MIX A;  3A2X A;  3U5R E;  1HYU A;  4HQS A;  4HQZ A;  4CY6 A;  3H1N A;  2LS5 A;  1A2M A;  3CYN A;  4KA0 A;  2PN8 A;  1TDI A;  2CX3 A;  2HFD A;  4JE1 A;  1SK0 A;  5KN2 A;  1THO A;  3DVW A;  4X0X A;  3DML A;  1Y6E A;  1GLQ A;  1J08 A;  3UVH A;  2YAN A;  4GSN A;  1A8L A;  2AJQ B;  1ABA A;  1SVO A;  4MH3 A;  1U88 A;  1CQH A;  2VD0 A;  1FAA A;  4CHS A;  1TK0 B;  4A5P A;  3P7X A;  2FHE A;  3C7M A;  3F4R A;  4EE0 A;  2B3S A;  2LRT A;  5A1N A;  4WF4 A;  2FWE A;  3IXR A;  1TW9 A;  4YKG A;  4PQH A;  3TGZ A;  3TJF A;  1TKD B;  1HQO A;  4LA1 A;  4RI7 A;  3TKS E;  3UVT A;  1OC9 A;  3HDC A;  1DBY A;  4XRD A;  3ZIV A;  2GST A;  4HUA A;  2I9H A;  1WMJ A;  4MAB A;  5ELA A;  3DRN A;  3CRU A;  3W8J A;  2GZZ A;  1IYI A;  3KZQ A;  3F63 A;  2VKZ G;  4ZBD A;  4KCE A;  4E68 A;  4JED A;  2HRN A;  5D9T A;  1LJR A;  4G10 A;  1FB6 A;  1R26 A;  2XPD A;  2C3Q A;  1TU7 A;  1XXU A;  2MBS A;  2DKI A;  2QC7 A;  1BYE A;  4NHW A;  2YPM A;  1YQ1 A;  4O5Q A;  4MLY A;  3CXG A;  5E4W A;  5JWO B;  4YAV A;  2VCQ A;  1EV4 A;  1T4Z A;  4PXO A;  2LST A;  2VIM A;  4FYU A;  1AIU A;  3F6D A;  3C1S A;  2B6M A;  3VUR A;  2HSH A;  4OD7 A;  1GH2 A;  4IGJ A;  5C04 A;  3KCM A;  3IK9 A;  2B5X A;  1KTE A;  2L59 A;  3C1R A;  5A1N B;  1YEP A;  3VWU A;  4EIP A;  1RW1 A;  5GST A;  3TDG A;  4Q5R A;  3VWX A;  3MDK A;  2YWI A;  3IC8 A;  1SYX A;  3F8U A;  4V2N A;  2F8A A;  1ZYE A;  2R4V A;  1ERW A;  2C80 A;  2OA7 A;  3L0H A;  2GSQ A;  3HKR A;  1ZYN A;  5DDL A;  1OC9 B;  1M0U A;  1HNB A;  3M9J A;  4ID0 A;  2FWF A;  4EC0 A;  3ZVJ D;  1S3C A;  2YCD A;  5HFG A;  1GNE A;  1M2B A;  4AJ6 A;  4ECC A;  2EIO A;  4KH7 A;  2HI7 A;  1V40 A;  5H5Q A;  4IBP A;  2P31 A;  5G31 A;  2IIY A;  5IMD A;  4K7I A;  4PUA A;  2I4A A;  3HVV A;  1EGO A;  3W8S A;  2A2R A;  2H71 A;  3M0F A;  1XFL A;  3ME8 A;  3GUR A;  2X8C A;  2X4A A;  3GKM A;  4BVY A;  3Q18 A;  3GA4 A;  3GRX A;  3TKS A;  2C0F A;  4XHM A;  1ZCP A;  4JZQ A;  5L71 A;  3FW2 A;  1ZOF A;  2RM6 A;  1EV9 A;  2WS2 A;  5FT3 A;  4KSM A;  2H19 A;  4MNN A;  4ACS A;  3DXB A;  4K5R A;  1Z5Y E;  1K3L A;  4AJ8 A;  1XOA A;  1AW9 A;  1PKZ A;  4ZXG A;  4HJM A;  3KXO A;  2JZT A;  2LKU A;  4GSS A;  2RUF A;  1AQX A;  1TRS A;  3GYK A;  1EZK A;  5BRT A;  1TTZ A;  2YN1 A;  3GL3 A;  3GL5 A;  5IMC A;  1TI1 A;  4EF0 A;  3HJP A;  3A2W A;  4PNF A;  2HRK A;  2A2S A;  4KW6 A;  1UVZ A;  2DML A;  4HU7 A;  2H01 A;  2CZ3 A;  2V1M A;  4K7N A;  3TRP A;  2VCV A;  5BMU A;  3CSI A;  1SJZ A;  4BL7 A;  4CW9 A;  1K0N A;  5DBQ A;  4KGI A;  2G2Q A;  3TJB A;  4OMV A;  2FLS A;  3WT2 A;  4MP4 A;  1T8E B;  2FD3 A;  2QGV A;  1CQG A;  2PMT A;  3L9V A;  4BVY B;  2E7P A;  5ID2 A;  1AAZ A;  3CSJ A;  2M46 A;  2JAD A;  3PIN A;  5ECS A;  2YWN A;  4P3Y B;  4ULX A;  5CRG A;  1B9X C;  3DYR A;  5ECP B;  3MAK A;  4GF0 A;  1OKD A;  2F51 A;  3DWV A;  5D9V A;  3C73 A;  2WFC A;  3F4T A;  4G0L A;  4MJA A;  1X9M B;  2OKA A;  4RI6 A;  1IYH A;  1T7P B;  2O85 A;  5B6N A;  1ON4 A;  5J4Y A;  1PN9 A;  3P8W A;  1AUC A;  2LUS A;  3D22 A;  2WUL A;  1ERU A;  4K0N A;  4FH8 A;  2DKH A;  5HQP A;  5HR3 A;  3TJG A;  2H73 A;  1H4O A;  4MZC A;  5F06 A;  4DSQ A;  5ABR A;  5C00 A;  4EL1 A;  2HRK B;  5IO2 A;  1G7E A;  1RK4 A;  3LYK A;  2R3X A;  2A2P A;  1G0T A;  2VUP A;  1ML6 A;  4TOP A;  1WPI A;  5BMU B;  4HI7 A;  4BL7 B;  3CWG A;  4TR1 A;  5F07 A;  1FOH A;  3LFL A;  4IVF A;  4KUN A;  4L0W A;  3CMI A;  3APQ A;  4ML1 A;  1EOH A;  2HYX A;  4ICY A;  5D73 A;  4KF9 A;  2VLT A;  1U3A A;  2R0C A;  4EO3 A;  1NW2 A;  1MDI A;  4YKF A;  2PVO C;  5ID2 B;  1QFN A;  3FY7 A;  4HZ2 A;  2GVP A;  3HCZ A;  1OC3 A;  3BCK A;  3GX0 A;  4GQF A;  1ILO A;  1T00 A;  1JZO A;  2MMN A;  2A4H A;  2DJ0 A;  2FA8 A;  5KOW A;  3ZRD A;  2GQM A;  4XTS A;  2H0G A;  2JU5 A;  3ERW A;  5DQS A;  1YVL A;  4MPG A;  1VF3 A;  3TKQ A;  2V6K A;  5KN0 A;  2GQK A;  4IP6 A;  3M1G A;  3IHG A;  4O5R A;  3ZFB A;  4N10 A;  4TVE A;  1A23 A;  2OAC A;  3WYW A;  4POK A;  4Z2R A;  4RUV A;  3A5W A;  5G1L A;  3TJK A;  3R3E A;  1GL8 A;  1YKA A;  5ECL B;  3ZLP A;  1TXU A;  4GLT A;  1PA3 A;  4LMW A;  4I8B A;  2K9F A;  3TKS C;  4NHZ A;  4PQ1 A;  5HFI A;  3ZYW A;  1OE7 A;  4AJ7 A;  1M2A A;  3QAW A;  5HFK A;  3KH9 A;  2IMF A;  5G30 A;  4TKY A;  2UZ8 A;  1FW1 A;  2PWJ A;  3FKF A;  1GLP A;  4GDF A;  1NHY A;  3TCO A;  4PTS A;  4TR1 B;  4O7H A;  4ZBB A;  3I43 A;  3QPM A;  2K8S A;  4J57 E;  4ZIJ A;  2LNT A;  2P0G A;  1O73 A;  4F0B A;  4NMU A;  2WGR A;  5EPF A;  4TW5 A;  2ZNM A;  3H8Q A;  2O7K A;  5B7C A;  3E0U A;  3IV4 A;  2DBC A;  1PN0 A;  2HNL A;  4ZL9 A;  4MJE A;  2H0I A;  3GX8 A;  1YDK A;  4G0K A;  3ZVJ A;  1WP0 A;  5J40 A;  3HVS A;  4EDY A;  4N3Z A;  3G7Y A;  1SJ6 A;  5D93 A;  1XW5 A;  4ECB A;  2VOC A;  1U3I A;  4YH2 A;  4K2X A;  10GS A;  5H5S A;  5DJL A;  4CY8 A;  3ERG A;  4K6X A;  2HSY A;  1B9Y C;  1F3B A;  4K8M A;  3BCI A;  3Q74 A;  2X8G A;  1SVL A;  3UJ1 A;  4TXO A;  3TKR A;  3D6I A;  3KIJ A;  5CYY A;  4FYB A;  5J5N A;  4YQV A;  4AKG A;  5LNK e;  3TRX A;  4HOJ A;  3H93 A;  1FVK A;  4JBB A;  2FWH A;  3FHK A;  1ZYP A;  3IDV A;  2EIR A;  1KNG A;  1USB A;  3TJJ A;  4K9Z A;  3GMF A;  4PNG A;  3FR6 A;  1XIY A;  4K2D A;  1XOB A;  1G6Y A;  2PBJ A;  4Q5Q A;  2FY6 A;  4ECJ A;  3BD2 A;  2L4Q A;  2NVL A;  1SVM A;  3G7I A;  3EWL A;  3GKN A;  2IJY A;  5HR2 A;  1F2E A;  1E2Y A;  1T3B A;  1GTA A;  4MPF A;  4JR6 A;  3G7J A;  4IS0 A;  2NDO A;  6GSV A;  5IPG A;  4V2L A;  2H1D A;  4WXT A;  2IMI A;  3PGT A;  1N8J A;  4QMK A;  2B7K A;  3DVX A;  2IN3 A;  1K0M A;  1WOU A;  4OFM A;  2VCW A;  1XZO A;  3IHQ A;  4MCU A;  3ME7 A;  6GSX A;  1PL2 A;  1B48 A;  4O5U A;  1TXX A;  5AN1 A;  4IHU A;  2E2M A;  2FA4 A;  2YNX A;  2GT6 A;  3ZML A;  2JL4 A;  3I9V 2;  1MD4 A;  2OE3 A;  4TXO B;  3PPU A;  6GSW A;  4FIW A;  5KN3 A;  2HZF A;  4YAP A;  2GS3 A;  3P90 A;  2EIQ A;  1DSB A;  4I97 A;  3NZN A;  2OE0 A;  3ZMK A;  5EL8 A;  1F3A A;  2VCZ A;  3D21 A;  4USS A;  1GSS A;  4F2I A;  1B4Q A;  3LWA A;  2B5Y A;  1LU4 A;  1TRW A;  3K8N A;  2GDR A;  4POB A;  2B5E A;  1OAZ A;  5J9C A;  1OKT A;  13GS A;  3IOS A;  2AHE A;  4X4J A;  2PUK C;  3A2V A;  3GNJ A;  1GTB A;  5AIS A;  3TUE A;  4TXV A;  3R2Q A;  1GP1 A;  2OE1 A;  3APS A;  3UBK A;  2JZS A;  5D9W A;  4J2F A;  1BX9 A;  4HU9 A;  4ZL7 A;  4MF5 A;  3VPT A;  3NOF A;  5GAP D;  1GSQ A;  3LGC A;  2B1K A;  3GH9 A;  4E8E A;  1R7H A;  3UL3 A;  1AXD A;  1SL1 B;  4YQM A;  1U87 A;  1DE2 A;  2RUE A;  3UAP A;  2CX4 A;  1A2J A;  1XBS A;  2BMX A;  17GS A;  4LL1 B;  2YV7 A;  3GTU A;  3EU3 A;  5ECM B;  3I69 A;  4XS1 A;  5IMA A;  1UC7 A;  2MYG A;  4WR4 A;  2GTU A;  1WJK A;  5IMV A;  4ZB9 A;  3RHB A;  1TJD A;  3IBH A;  1SJI A;  4PX1 A;  3SBC A;  1VF4 A;  1Y1U A;  1I9D A;  3MWH A;  2MZC A;  1M99 A;  3TRQ A;  2AB6 A;  11GS A;  3PR8 A;  5KN1 A;  2XHF A;  3ZZX A;  2IL3 A;  1M2D A;  3BBY A;  4KDU A;  1V9W A;  2X64 A;  3SWL A;  1N2A A;  1X9W B;  2VM2 A;  4MMM A;  2AYT A;  4OCF A;  2AUV A;  2KOK A;  1K0D A;  1WIK A;  5J4V A;  2OJL A;  1BG1 A;  5ECR B;  5IOW A;  1KBN A;  2K18 A;  1GWC A;  1M9A A;  2YWM A;  4BA7 A;  1C72 A;  1E6B A;  3KD0 A;  3O6T A;  1A8Y A;  2H30 A;  4OO5 A;  3RPN A;  1KEB A;  4F82 A;  4EKZ A;  5JWR B;  3EMP A;  4NV5 A;  1WRY A;  3IA1 A;  1SKR B;  5DAL A;  3FK8 A;  3ZIJ A;  2V2G A;  2V41 A;  3E3E A;  5INY A;  2VL9 A;  3IAS 2;  3GTU B;  4G19 A;  2ES7 A;  3KTL A;  1OVN A;  2NPB A;  2HRA A;  1XWB A;  1GSD A;  16GS A;  1K3Y A;  3HY2 A;  4POM A;  4ZB8 A;  3FMW A;  1O81 A;  3D0Z A;  3GKX A;  3MNG A;  3RAZ A;  1UN2 A;  4GXZ A;  1GRX A;  2REM A;  3EIN A;  3DGQ A;  3LYP A;  1QXH A;  2BTO T;  4AI6 A;  3FZ9 A;  4CDO A;  2GQL A;  2MBT A;  2GSS A;  1SEN A;  4AKX B;  1GUK A;  1V98 A;  1A2L A;  4TR4 A;  3EC3 A;  2XBI A;  3HMJ G;  4OCE A;  1M9B A;  1O8X A;  2VD1 A;  5JWQ B;  4GWR A;  5CRH A;  3ZL5 A;  4IEL A;  4EVM A;  1MTC A;  4XS4 A;  3UEM A;  3J7Y k;  2B7J A;  5ENU A;  18GS A;  5AIV A;  3QOU A;  2WRT A;  1Z6N A;  3ZFL A;  2LTK A;  1ST9 A;  2IMK A;  5IO0 A;  1XW9 A;  5DAL B;  2CZ2 A;  1XWG A;  1JZD A;  5D8I A;  3RDW A;  2LJR A;  5AGY A;  2PU9 C;  2DJ2 A;  5ECO B;  1MDK A;  4IW9 A;  1ERV A;  5F0G A;  4DSR A;  2I81 A;  5DAK B;  4MDC A;  4NV2 A;  3EYT A;  3GFK A;  1VGL A;  3QFA C;  4FQU A;  2DMM A;  2ZUP A;  2H74 A;  2L5O A;  3RHC A;  1NM3 A;  4ECI A;  4TRX A;  2GZY A;  2FGX A;  2IWT A;  22GS A;  1Q4J A;  5F8B A;  5CRD A;  4GST A;  3MYD A;  1Z7R A;  1Z3E A;  5J4U A;  1TP9 A;  3H4K A;  3P2A A;  4AGS A;  4DEJ A;  2J23 A;  3IRA A;  1G7O A;  3QDN A;  1HNC A;  2EFD A;  3KP9 A;  3HZ4 A;  4RQR A;  2HT9 A;  5KEJ A;  3MSZ A;  4ZBA A;  3BOA A;  3IK7 A;  3CTF A;  4LLR A;  4WEY A;  2V32 A;  2LJK A;  2MMO A;  4HDE A;  2HE3 A;  1SK2 A;  4KDX A;  4XS4 B;  4AKH A;  2JSZ A;  5J3R A;  4I2T A;  3LXT A;  2EC4 A;  5H5R A;  1PL1 A;  2HSM A;  4JRR A;  2IME A;  2X8H A;  2DLX A;  2WCI A;  3HA9 A;  1PX7 A;  5FHI A;  1MD3 A;  1FVJ A;  1TU8 A;  2DC5 A;  2P5R A;  3D4T A;  1Z6M A;  2TRC P;  2CVD A;  1EWX A;  2GGT A;  3C71 A;  5IQY A;  2VL3 A;  4JU5 A;  3GST A;  4KB3 A;  3DKS A;  2OAD A;  1JZR A;  3EMX A;  1A24 A;  2VCX A;  1R5P A;  1YEX A;  1X0R A;  3O3T A;  5ECI B;  3GIX A;  1SKS B;  1EGR A;  4Q5F A;  4EIQ A;  2RM5 A;  5JCW A;  4F9Z A;  1EP7 A;  2O8V B;  5JCU A;  1A0F A;  5IM9 A;  4L5O A;  5A4U A;  4PGT A;  1HNA A;  4TR0 A;  2QA1 A;  4I2U A;  4OFN A;  2DSA A;  2YZH A;  3US3 A;  4HJ2 A;  5AIX A;  3IC4 A;  2LV3 A;  2I1U A;  3WGX A;  3QAV A;  1XPV A;  4POL A;  2L57 A;  1J9B A;  3FYG A;  1PQN A;  6GSU A;  1QQ2 A;  2R0P A;  4NXI A;  2D2Z A;  4IQ1 A;  3NIV A;  2F9S A;  2H0H A;  1SYR A;  3WT1 A;  2HSM B;  1ZYQ B;  2L6C A;  2O89 A;  1YZX A;  1WWJ A;  4PQI A;  5CNW A;  1AQW A;  2LRN A;  3IPZ A;  2N5B A;  4K5S A;  4F03 A;  2I3Y A;  3KEB A;  5G5F A;  2YJ7 A;  1SD8 A;  3LW9 A;  2FCH A;  4QL7 A;  1M7T A;  3QD9 A;  2RII A;  4V1A g;  1ERT A;  3QCP A;  5ELG A;  2LQO A;  3LJR A;  4K0G A;  3GHA A;  2E2G A;  3JCM L;  1B8X A;  4OWY A;  1PD2 1;  3FZA A;  3W6G A;  5A4V A;  2LEG A;  2WB9 A;  3UBL A;  3EUR A;  3LEF A;  3L9U A;  4G2E A;  5B8B A;  5DVB A;  3L4N A;  5A4W A;  2C3N A;  7GSS A;  4LL4 B;  1K0A A;  3ERF A;  1BED A;  5DJM A;  5G1K A;  3GSS A;  2H1B A;  2X49 A;  1VRS D;  2FUG 2;  1GSU A;  4G01 A;  4ILF A;  3ZIT A;  2AAW A;  4KDY A;  2DIZ A;  4H86 A;  4E8H A;  3KH7 A;  1MDJ A;  2PER A;  1V2A A;  4G9H A;  1SKW B;  3HZ8 A;  3L9S A;  1QK8 A;  3GH6 A;  1X5C A;  4KSO A;  4IP1 A;  3F3R A;  2H76 A;  1VF1 A;  2CA8 A;  5IMF A;  3VWW A;  1ZGN A;  3FEU A;  4IKH A;  3UAR A;  2GSR A;  4TN8 A;  1T4Y A;  3KMO A;  3VI5 A;  2K8V A;  4I5Q A;  1U6T A;  3A3T A;  1TRV A;  4MA9 A;  4LMV A;  1OYJ A;  2FNO A;  2KP1 A;  1TK5 B;  4YQU A;  1S3A A;  2H6Y A;  1YKC A;  1PMT A;  3TOT A;  4K1F A;  5J41 A;  3VWV A;  2HXK A;  2P5Q A;  3IAM 2;  2HSN A;  2L4C A;  1G6W A;  4HZ4 A;  2XC2 A;  5ECK B;  1V57 A;  5DQY A;  4ML6 A;  3DEX A;  4FYC A;  3GV1 A;  2VL2 A;  3KP8 A;  3WGE A;  4BWS A;  2M72 A;  2CQ9 A;  1TRU A;  1LBK A;  4O32 A;  3G9B A;  1ZL9 A;  5D9X A;  2RLI A;  1AC1 A;  6GSY A;  3HHV A;  3KGK A;  4OFT A;  2DJ3 A;  2DIY A;  1OE8 A;  3QAG A;  3VI7 A;  3WGD A;  2PVQ A;  1BAY A;  3F6F A;  1O6J A;  4HEA 2;  3AY8 A;  2EFH A;  4MF6 A;  2H1G A;  4ZL8 A;  4KAE A;  5EY6 A;  1YF0 A;  3CTG A;  5LD0 A;  4L5L A;  3RPP A;  3FR3 A;  1GNW A;  2V6O A;  3CSH A;  4KE3 A;  3UMA A;  3KMN A;  2C0G A;  1GSE A;  2WDU A;  3ISO A;  1GSF A;  3EU4 A;  2YWO A;  5COH A;  1PKW A;  2VM1 A;  1I5G A;  5B8A A;  3TKP A;  1MEK A;  4V1A p;  4BWQ A;  4N30 A;  5CAX A;  2CT6 A;  5ECH B;  2HSN B;  2ALB A;  4XS6 A;  2PGT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...