4MPFA

Crystal structure of human glutathione transferase theta-2, complex with inorganic phosphate, gsh free, target efi-507257
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
243
structure length
243
Chain Sequence
GLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAILIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLGPLIGVQVPKEKVERNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLAAWRGRVEAFLGAELCQEAHSIILSILEQAAKKTLPTPSPEAYQAMLLRIARIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase theta-2
publication title Crystal Structure of Human Glutathione S-Transferase Theta-2 (Target Efi-507257)
rcsb
source organism Homo sapiens
total genus 92
structure length 243
sequence length 243
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2013-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4mpfA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4mpfA01
1GSQA 4V1Ap 5H5QA 1DE1A 5A5KA 2KHPA 2R4VA 3GKXA 4QL9A 2H72A 4XTSA 4OO5A 3TDGA 1GUHA 1VF3A 3FYGA 2LS5A 3EE2A 3RHCA 2ON7A 2LJAA 2GDRA 3CSJA 4X43A 1T7PB 2E2GA 4NWYA 3TUEA 3L9VA 1T00A 2P31A 4PQ1A 3GL5A 4GCIA 4KGIA 2O8VB 1TK0B 1TDIA 3GYKA 1AAZA 2TRXA 4TRXA 3LGCA 4HI7A 4I97A 5F05A 2FWEA 4HDEA 4TW5A 1K0BA 4V1Ag 5EL8A 4RQXA 4TXOB 4YAVA 4YQVA 1WP0A 1MEKA 3F4RA 4EO3A 3CTGA 2B3SA 3DXBA 3L4NA 1S3CA 2FNOA 4IP6A 1XWAA 2Z9SA 3F4TA 1JFUA 3KP9A 4N0ZA 1JLVA 1TJDA 2GZPA 1GULA 1BQ7A 5IO2A 1UC7A 1M2AA 1PD21 3FZ9A 4TR1A 4L5LA 4WR4A 1OKTA 1PKWA 3KH9A 1SK1A 3ZMLA 5F8BA 16GSA 4BL7B 2YANA 5ECSA 4MCUA 3HD5A 1BG5A 2B6MA 1MDIA 5D9VA 1EV9A 5ECPB 3EMPA 1AC1A 2EIRA 2VLTA 1DSBA 4POLA 3TCOA 1XPVA 4O5RA 4F2IA 1GRXA 3Q18A 3A2XA 5G1KA 2ES7A 1SKSB 1V58A 4HU9A 4L8EA 2RM5A 5DVBA 1EOGA 4GSNA 1NSWA 1N8JA 2LNTA 4GF0A 3TOUA 3ERWA 1NHYA 3C71A 10GSA 2D2ZA 2MMZA 4JE1A 5DCGA 4EKZA 3QD9A 2WCIA 5FHIA 3VPQA 2I1UA 1FO5A 2FHEA 1EOHA 4NHWA 1ZL9A 3RPNA 4HJMA 2AJQB 5D73A 1TK5B 2IJYA 5J9BA 4V2MA 4RQRA 4WF4A 4EE0A 2P0GA 5JCGA 1MD4A 2DSAA 1YF0A 1PX6A 1UVZA 2ZNMA 2ZUPA 1SL0B 4OFMA 2PBJA 5DJLA 4TR1B 3RBTA 3AY8A 3HYPA 2I81A 1A2MA 4G0IA 4O32A 4KE3A 1K0OA 1PRXA 2RIIA 3UEMA 1BX9A 5HFGA 4ECJA 3FW2A 4KB3A 2TIRA 2PU9C 3VI7A 5CO3A 5ECQB 4KA0A 1Y6EA 1GTAA 2GS3A 2HT9A 1JZWA 3FZ4A 4TXVA 4HOJA 3LXTA 6GSUA 3SBCA 3L9UA 3ZVJA 3IXRA 4F0BA 2PPTA 3G9BA 3MWHA 2VCWA 1RK4A 1ZYEA 5LCZA 3HCZA 3MSZA 2PVOC 2WRTA 2H1BA 2HSNB 5ECKB 5KN2A 1OE7A 5G5EA 3JCML 4MF7A 4IP1A 3NIVA 2LQOA 3QDNA 2V2GA 1WOUA 2GZYA 4HEA2 5C00A 1A0FA 2VCTA 3UAPA 1USBA 1F3BA 2B5EA 2OBIA 1UA5A 14GSA 4PUAA 2VOCA 1OC9A 1O85A 2IMKA 4POMA 5ENUA 4MDCA 2K8VA 4KCAA 2XPDA 1PQNA 1LJRA 1QFNA 1AQWA 1A23A 2GVPA 3A2VA 4OD7A 5IPHA 1FG4A 3O6TA 1K0MA 2B7KA 3EU4A 2DLXA 1BAYA 4J2FA 4FQUA 5ECHB 3KH7A 2O7KA 5AIXA 5HR1A 4PTSA 4YQMA 5CNWA 2H66A 2KOKA 2LTKA 1THXA 2A2RA 5LNKe 2M80A 4GTUA 1Z5YE 2H30A 4JR6A 4WR5A 3L78A 4RUVA 2H6XA 2X8GA 3MAKA 4I6XA 1FB0A 1EEMA 2VCXA 4GSTA 2HYXA 3S9FA 2AHEA 1ML6A 1O81A 1Z6MA 2E7PA 4MK3A 2PVQA 2LUSA 2GSSA 1YEXA 1WRYA 1VGLA 2C0EA 2ALBA 2VUPA 2JSYA 4Q5FA 2AUVA 3CYNA 1F37A 2VM1A 5B7CA 1S3DA 3KCMA 1B4QA 1VF4A 4IW9A 2OKAA 4L0UA 1KBNA 4XS1A 1W89A 4GWRA 1U87A 2GSTA 4AGSA 5A4VA 1MDKA 3TGZA 2B5YA 1GLQA 22GSA 2C80A 1YY7A 2XBIA 4HJ2A 3DYRA 4LA1A 5ABRA 3HJPA 2CVKA 3ZZXA 5E59A 4BA7A 4IBPA 1OC9B 1K0AA 1K3YA 1OC8A 3LSZA 2V41A 3UOMA 2HI7A 1Q4JA 3FR3A 2FD3A 5DDLA 4ML6A 3UMAA 3RDWA 3SWLA 1X0RA 2FWFA 1ZGNA 3Q19A 1BEDA 5ECMB 3F9UA 2DC5A 3A5WA 3KTLA 1OVNA 3HVXA 2GT5A 3DGQA 2YJHA 2YOIA 2FY6A 1A2JA 4K1FA 2IWTA 1GSSA 4MH2A 3IOSA 1SD9A 4TKYA 4EUYA 2HZEA 1FAAA 3I43A 4GLTA 1JZOA 2LJRA 4ZBAA 2KP2A 2C3QA 3HJMA 2LSTA 1M9BA 3ZIVA 1X9WB 2XC2A 2L57A 4L5OA 3HZ4A 1EZKA 3KP8A 2QC7A 4TR0A 3C7MA 1BYEA 2YPMA 3GA4A 1F2EA 3IDVA 2LNSA 1AW9A 4KUNA 1JZDA 3DVWA 2GT6A 3Q74A 4ZXGA 3TJGA 5CRHA 1V40A 3GUSA 1ACVA 2FLSA 5EY6A 2R6KA 3QFBC 4BVXB 1SL2B 1T3BA 2CAIA 2WS2A 4CHSA 1ZMAA 3LG6A 2C4JA 2HLSA 2E2MA 1M9AA 1KTEA 3A2WA 2BTOT 3A3TA 19GSA 1FB6A 1R26A 2C3TA 2MZCA 2RLIA 5DAKA 3CRTA 2LV3A 3KEBA 1FVJA 2WJUA 3ZYWA 1TRUA 1CQGA 4I2UA 4IJIA 2CX4A 5IQYA 1B9YC 4N30A 2B1LA 4IHUA 3IRAA 3TKSC 3TOTA 5KN3A 3HKRA 5HR3A 3Q6OA 1ZCPA 5EVOA 2QGVA 1SYXA 2JU5A 2L5OA 9GSSA 3H93A 4FYBA 3APOA 4MP4A 5DCHA 2NTOA 4ECBA 3MNGA 2AV4A 4NHZA 3UBLA 5KN0A 3VK9A 3E0UA 5LD0A 1OC3A 2YZUA 4YH2A 2JZRA 2C3NA 2H1GA 1EV4A 1O73A 3M0FA 2L4QA 3VI5A 4MMMA 2QSIA 3EC3A 2DJ1A 2VD0A 1U3AA 1R7HA 2YWNA 3GURA 1AIUA 1ZOFA 4MABA 1SU9A 3ISOA 4N10A 4PNGA 2HSHA 5CAXA 3VWUA 3ERFA 1EGOA 4YQUA 1ZYQB 4PUFC 3P8WA 5B6NA 4CW9A 4OCEA 5D93A 1GL8A 1XVWA 2YWMA 4KNDA 3GIXA 1GNEA 3UVHA 1SJ6A 3F6FA 2H01A 5ECRB 4EDZA 3C1RA 5ELAA 1HYUA 4XS6A 5HR2A 4GRFA 4K6XA 3FZ5A 5F0GA 3UBKA 1GSUA 4TN8A 2JZSA 3EU3A 3ZFBA 3L9SA 2WB9A 5F07A 3TKRA 5CREA 2GSQA 4HU7A 4EVMA 4G2EA 1QK8A 2OA7A 3F0IA 5CYYA 1VF1A 4IQAA 4LL4B 1AXDA 4WXTA 3TKSA 3FKFA 3GKNA 2G2QA 3TB2A 4MZCA 1ERTA 1Z3EA 5AN1A 5D96A 1O6JA 3GH6A 3IR4A 4PURA 3HY2A 2FWHA 1E6BA 1FVKA 1FHEA 4ECCA 2C0GA 1DE2A 3HVSA 4G0LA 4J57E 5CRDA 1HD2A 3QPMA 5GSTA 1E2YA 4G10A 3I69A 4K7OA 3N9JA 2BJXA 2C1YA 4X1UA 4FIWA 2RUFA 4D73A 2H6YA 3FZAA 3OR5A 1TW9A 2L59A 1ERWA 1M2DA 4XCSA 1B9XC 2L5LA 4WETA 1XOAA 2ON5A 2H76A 1SKWB 3PR8A 5JCUA 3GX8A 4JBBA 3EYTA 4DEJA 1SL1B 5GAND 3TRXA 5L71A 5JCWA 2H70A 4F03A 1XBSA 3ZMKA 3M3MA 1V98A 6GSWA 1XW6A 5IIZA 1THOA 5G5FA 4NMUA 1YKCA 2YNXA 3WT1A 5BMUA 4ID0A 4KX4A 2OACA 4IELA 4IVFA 3FR9A 1SJIA 1VF2A 3RHBA 1OAZA 2H0IA 3D5JA 3GN3A 5E4WA 4AJ6A 1EP7A 2CVDA 4POKA 3W8JA 1G6WA 2DIZA 3FR6A 4BVYA 3ZTLA 4NV2A 5J4UA 4ML1A 1TXXA 2X99A 4G19A 1F6MC 3IHQA 2FUG2 3E3EA 3F63A 3DVXA 5G1LA 2J9HA 1WIKA 6GSSA 3P90A 4EL1A 1Y25A 4HZ4A 1QXHA 4IS0A 4EC0A 1QQ2A 3GKKA 1WPIA 5JWOB 4Q5NA 4BWSA 2QKEA 5D9TA 3UARA 4MPFA 2GGTA 1TP9A 1K0NA 3D4MA 3W6GA 1GSDA 4QQ7A 5IOWA 2MMNA 4JZQA 5ELGA 3KXOA 3O3TA 4PGTA 2PN8A 3CSHA 1VRSD 2EIOA 4ZILA 4PX1A 3VPTA 2VL3A 1M0UA 3VWWA 3TJFA 3J7Yk 2DMMA 2HRKA 4GSSA 1HNAA 1M99A 1XCCA 3D4TA 3U6VA 3EURA 1PN9A 3VFIA 4IKHA 3GHAA 4ISDA 5IPGA 1ERVA 4JR4A 4ILFA 2PERA 3C8EA 2PMTA 2KP1A 2LKUA 3WD6A 4HS1A 2HFDA 1SK0A 2YN1A 2NPBA 1GTBA 5D8IA 4MA9A 5GSSA 2HRNA 2M72A 3HZ8A 2HSYA 3KTBA 2RM6A 4BVYB 4I5QA 4O92A 1B48A 1G0TA 3LWAA 2F3MA 4L0WA 2VD1A 3ERGA 4EF0A 1GH2A 2J23A 5IMVA 1RW1A 3E9JB 4QL7A 3BD2A 2R3XA 2JL4A 2L6CA 2YV7A 2LRNA 3GH9A 1A8LA 2FGXA 6GSXA 4ZL9A 3EINA 5IO0A 4LMVA 4TR3A 5IMDA 2OJLA 3G7JA 4J56E 1MTCA 4O7HA 1OYJA 3NZNA 2N5AA 1YQ1A 3F8UA 2K8SA 4F9ZA 1XW9A 3VWVA 3PGTA 1AUCA 1MDJA 2FCHA 4HUAA 2CT6A 2DJ2A 3BCIA 3ZLPA 3LQ7A 2H8LA 1B8XA 2YV9A 2FA4A 4HQSA 4MH3A 4BWQA 1J0FA 4XHMA 1XW5A 4KAEA 2OE1A 1XXUA 2HRKB 1U3IA 4FH8A 2HSMA 2NDOA 3CSIA 1OKDA 3GSSA 4MJAA 2RUEA 3GKMA 4I8BA 2I3YA 4K9ZA 2X8HA 2TRCP 1DUGA 2AAWA 4F0CA 2YWIA 4YAPA 4XIHA 1V9WA 2C0FA 1XWKA 2L4CA 3D0ZA 2CVBA 2IFQA 1ZZYA 2VL2C 4I2TA 1S3AA 2GLRA 2IMDA 2AB6A 3I9V2 3M1GA 1YEPA 2PGTA 4JU5A 4K7IA 4KH7A 1YDKA 1MD3A 4AF2A 3F3QA 1SKRB 4MZBA 1TKDB 1XWBA 3KMOA 3TJKA 1O8XA 5HFKA 4POBA 4V2LA 3C73A 1R5PA 1PA3A 1HQOA 1GUKA 5J9CA 2F8AA 4NPBA 1NHOA 4TOPA 3HHVA 1H4OA 3QMXA 3G7YA 2N5FA 2FA8A 3GNJA 4K7NA 5G2ZA 2IPAA 2GSRA 3IV4A 3ZREA 3VLNA 3H8QA 4ZB8A 2F51A 2IMIA 4MF6A 3QAVA 3IE3A 4XRDA 4LLRA 3H1NA 2GTUA 3WGXA 3DIEA 2WGRA 4GXZA 2K9FA 3BCKA 3R2QA 3IA1A 4TXOA 3IBHA 4PXOA 3TJBA 6GSYA 1QUWA 5DQSA 4E8HA 1ERUA 4MJEA 4N0VA 4WBJA 4ZB6A 3GTUA 1YZXA 3M8NA 2HRFA 5INYA 4GQCA 1T1VA 5GAPD 2IFQB 3GL3A 2IN3A 3WT2A 3APQA 1EEJA 4FYCA 2DJJA 4ZIJA 1YF1A 1K0DA 5IMFA 1PGTA 3M9JA 1X5DA 2VL2A 1N2AA 3ZL5A 5F06A 1U6TA 5DJMA 3TKQA 2LEGA 5KEJA 4BL7A 2HZEB 4ACSA 1TU8A 5H5SA 2ZCTA 3KJYA 1DBYA 4E8EA 2YZHA 2HQTA 3IAM2 1UN2A 2YP6A 2IMFA 4KF9A 5ECIB 3IK7A 3KIJA 4MF5A 2LRCA 1A8YA 2H0HA 17GSA 2K6VA 1T4ZA 11GSA 2I4AA 1YJ6A 2XHFA 1V2AA 6GSTA 3HXSA 4LMWA 1XOBA 2DMLA 3IK9A 4F82A 5G30A 2V6KA 4XS4A 5GZZB 2DJ3A 3DD3A 5DAKB 1O7UA 5ID2A 5ECOB 2JSZA 3UIWA 3LYPA 3HDCA 1TI1A 3WGDA 4AJ7A 1TRVA 7GSSA 2F9SA 3DKSA 3APSA 1GNWA 5J3RA 3TKSE 2VLUA 2MBSA 3CXGA 2CA8A 1YKAA 2KUCA 3GTUB 4USSA 3GFKA 2I9HA 4X0XA 5IOXA 5FWGA 2EC4A 3QOUA 1EWXA 2VAFA 1QMVA 3LYKA 4EDYA 2REMA 1K0CA 2VL9A 4OCFA 1U88A 3VWXA 2IL3A 2VCZA 2EIQA 2H75A 3TRPA 1G7EA 3GRXA 3ZIJA 4IGJA 2CZ2A 3H79A 4G0KA 1HNCA 2DJ0A 1TU7A 4ZL7A 3QAGA 5DBQA 2KLXA 1PKZA 4MZWA 1WMJA 3LJRA 1SJZA 2JZTA 1TOFA 2A4VA 5AGYA 1B4PA 5ECLB 1T8EB 4N11A 2VCQA 4NAXA 3WGEA 4WF5A 3FY7A 2CQ9A 2H0GA 2HRAA 1EP8A 2V1MA 1F9MA 5HQPA 4TVEA 3FRCA 3I6AA 4FYUA 4XS4B 4OMVA 1X5EA 3ME8A 1GP1A 2NVLA 1GUMA 5D9XA 1Z7PA 5ID2B 4Z7XA 2NBSA 2B5XA 4MJCA 4OFNA 1EGRA 1LU4A 3BJ5A 1R5AA 4ZBBA 2VLVA 5G31A 2OE0A 3FEUA 3LFLA 1Q98A 1JHBA 1TI3A 3EWLA 2YCDA 2XPEA 4PNFA 3ED3A 3UL3A 3CTFA 4IN0A 18GSA 2CZ3A 4OFTA 1LBKA 3ZITA 5COHA 1W4VA 5DALA 4KW6A 3BBYA 4PQHA 2DIYA 1XWGA 5C04A 4ZB9A 4KDXA 4DSRA 6GSVA 5J5NA 4KDYA 3IC4A 12GSA 3KGKA 3U5RE 3K8NA 3HJOA 3N5OA 3GMFA 1J08A 4WBRD 3CMIA 4OO4A 4D73B 5AISA 2XBQA 5FT3A 1X9MB 3PH9A 2PUKC 3DWVA 2IMEA 3KD0A 2X64A 3D6IA 1QGVA 2V32A 3US3A 2UZ8A 4P3YB 5KN1A 4FO5A 2AYTA 2GQLA 5B6MA 3PPUA 1AQXA 1PL2A 2CV4A 3RPPA 2L6DA 4MPGA 2H6ZA 1NM3A 5IMCA 4KSMA 2N5BA 4RI7A 2HE3A 3MDKA 1GLPA 4AJ8A 4HQZA 3L0HA 1JZRA 2CAQA 2M46A 5B8AA 2CX3A 4KCEA 3BOAA 3KZQA 2GZZA 2X8CA 3LORA 4MJBA 5J41A 4LL1B 2OADA 5ECNB 1TTZA 2E0QA 1GTUA 1ON4A 2HZFA 1Z9HA 2F8FA 3GSTA 3HVVA 1X9SB 2MBTA 3GX0A 1WE0A 3QFAC 5DALB 5A4WA 1XVQA 1SD8A 3H4KA 1SENA 3TRQA 3DMLA 3HA9A 2JADA 3J7Yb 4OWYA 2H74A 1GWCA 3QAWA 3RAZA 1AQVA 2OE3A 1A2LA 3P7XA 1O8WA 5EPFA 5D9WA 2GQKA 1T4YA 3KMNA 1G6YA 1FOVA 4MLYA 2DJKA 3M9KA 3CRUA 3O76A 8GSSA 3WYWA 3G7IA 3ZVJD 2P5RA 1WWJA 2V6OA 3D21A 1GSYA 5JWQB 5AIVA 5HR0A 2C0DA 3ZRDA 2GQMA 3QR6A 2HXKA 1SYRA 1X5CA 1J9BA 4BVXA 1M7TA 20GSA 4BPYA 1TK8B 2IIYA 13GSA 1I5GA 5CRWA 2K18A 4PQIA 1I9DA 1BJXA 3UVTA 1PX7A 2PWJA 4K0NA 1XWCA 4GQFA 2OBKA 2WZ9A 2H73A 5IMZA 4EXJA 1XIYA 5JWRB 1Z6NA 4Q5QA 4IJ3A 1ILOA 1K3OA 1URMA 2B7JA 3TJJA 4DSSA 1OE8A 4H86A 5CRGA 3UJ1A 1PMTA 4IQ1A 1ST9A 3ZFLA 3ME7A 1FW1A 1JLWA 1PSQA 4RI6A 1KEBA 4JEDA 5DQYA 3DRNA 3GV1A 5CP1A 1GTIA 1SK2A 2LQQA 2MYGA 2C8UA 3VURA 3LEFA 3V1WA 4ULXA 2JACA 1K3LA 3DEXA 2LRTA 4ZL8A 3PINA 4WKWA 2O87A 1M2BA 1TRSA 1XZOA 1IYIA 4DVCA 1C72A 2WFCA 2A2SA 4TR4A 4V2NA 3QCPA 3F6DA 4K0GA 3P2AA 5IMAA 2MMAA 2DBCA 3FK8A 1GSFA 4KDUA 5H5RA 2VCVA 2WULA 2VO4A 4K2DA 3IC8A 2H71A 5HFIA 2WDUA 3W8SA 1V57A 1A24A 2H19A 4WEYA 3CBUA 2HSMB 2HNLA 4NV5A 1XFLA 4HZ2A 4XRAA 1GSEA 4NXIA 2LJKA 2H1AA 3IPZA 1PL1A 1NW2A 4JRRA 3KM6A 4G9HA 1KNGA 3LXZA 4ECIA 3F4SA 5A4UA 1R4WA 2R2JA 3R3EA 5B8BA 2BMXA 1F3AA 3EMXA 2P5QA 2H1DA 2O85A 2G0FA 1HNBA 4DSSB 1Z7RA 1A0RP 4ZBDA 3NOFA 1CQHA 2R5GA 4Q5RA 1RQMA 3F3RA 1WJKA 2VIMA 4CDOA 2MMOA 3TKPA 5IM9A 2YJ7A 3IAS2 2R37A 2VM2A 1TRWA 1ABAA 2FWGA 3EVIA 2B1KA 3D22A 3C1SA 4KSOA 3FHKA 1G7OA 1H75A 2O89A 4K8MA 4DSQA 1IYHA 2YWOA
chains in the Genus database with same CATH superfamily
1GSQA 4V1Ap 5H5QA 1DE1A 5A5KA 2KHPA 2R4VA 3GKXA 4QL9A 2H72A 4XTSA 4OO5A 3TDGA 1GUHA 5A5HB 1VF3A 3FYGA 2LS5A 3EE2A 3RHCA 2ON7A 2LJAA 2GDRA 3CSJA 4X43A 1T7PB 2E2GA 4NWYA 3TUEA 3L9VA 1T00A 2P31A 4PQ1A 3GL5A 4GCIA 4KGIA 2O8VB 1TK0B 1TDIA 3GYKA 1AAZA 2TRXA 4TRXA 3LGCA 4HI7A 4I97A 5F05A 2FWEA 4HDEA 4TW5A 1K0BA 4V1Ag 5EL8A 4RQXA 4TXOB 4YAVA 4YQVA 1WP0A 4YKGA 1MEKA 3F4RA 4EO3A 3CTGA 2B3SA 3DXBA 3L4NA 2QA2A 1S3CA 2FNOA 4IP6A 1XWAA 2Z9SA 3F4TA 1JFUA 3KP9A 4N0ZA 1JLVA 1TJDA 2GZPA 1GULA 1BF5A 1BQ7A 5IO2A 3IHGA 1UC7A 1M2AA 1PD21 3FZ9A 4TR1A 4L5LA 4WR4A 1OKTA 1PKWA 3KH9A 1SK1A 3ZMLA 5F8BA 16GSA 4BL7B 2YANA 5ECSA 4MCUA 3HD5A 1BG5A 2B6MA 4AKXB 1MDIA 5D9VA 1EV9A 5ECPB 3EMPA 1AC1A 2EIRA 2VLTA 1DSBA 3FMWA 4POLA 3TCOA 1XPVA 4O5RA 4F2IA 1GRXA 2EFEA 3Q18A 3A2XA 2HSNA 5G1KA 2ES7A 1SKSB 1V58A 4HU9A 4L8EA 2RM5A 5DVBA 1EOGA 4GSNA 2R0GA 1NSWA 1N8JA 2LNTA 4GF0A 3TOUA 3ERWA 1NHYA 3C71A 10GSA 2D2ZA 2MMZA 4JE1A 5DCGA 4EKZA 3QD9A 2WCIA 5FHIA 3VPQA 2I1UA 1FO5A 2FHEA 1EOHA 4NHWA 1ZL9A 3RPNA 4HJMA 2AJQB 5D73A 1SVMA 1TK5B 2IJYA 5J9BA 4V2MA 4RQRA 3LW9A 4WF4A 4EE0A 2P0GA 5JCGA 1MD4A 2DSAA 1YF0A 1PX6A 1UVZA 2ZNMA 2ZUPA 1SL0B 3CQFA 4OFMA 2PBJA 5DJLA 4TR1B 3RBTA 3AY8A 3HYPA 2I81A 1A2MA 4G0IA 4O32A 4KE3A 1K0OA 1PRXA 2RIIA 3UEMA 1BX9A 2R0PA 5HFGA 4ECJA 3FW2A 4KB3A 2TIRA 2PU9C 3EPTA 3VI7A 5CO3A 5ECQB 4KA0A 1Y6EA 1GTAA 2GS3A 2HT9A 4YKFA 1JZWA 3FZ4A 4TXVA 4HOJA 1I1IP 3LXTA 6GSUA 3SBCA 3L9UA 3ZVJA 3IXRA 4F0BA 2PPTA 3G9BA 3MWHA 2VCWA 1RK4A 1ZYEA 5LCZA 3HCZA 3MSZA 2PVOC 2WRTA 2H1BA 2HSNB 5ECKB 5KN2A 1OE7A 2OT3A 5G5EA 3JCML 4MF7A 4IP1A 4MNNA 3NIVA 2LQOA 3QDNA 2V2GA 1WOUA 2GZYA 4HEA2 5C00A 1A0FA 2VCTA 3UAPA 1USBA 1F3BA 2B5EA 2OBIA 1UA5A 14GSA 4PUAA 2VOCA 1OC9A 1O85A 2IMKA 4POMA 5ENUA 4MDCA 2K8VA 4KCAA 2XPDA 1PQNA 2EFDA 1LJRA 1QFNA 1AQWA 1A23A 2GVPA 3A2VA 4OD7A 5IPHA 1FG4A 3O6TA 1K0MA 2B7KA 3EU4A 2DLXA 1BAYA 4J2FA 4FQUA 5ECHB 3KH7A 2O7KA 5AIXA 5HR1A 4PTSA 4YQMA 5CNWA 2H66A 2KOKA 2LTKA 1THXA 2A2RA 5LNKe 2M80A 4GTUA 1Z5YE 2H30A 4JR6A 4WR5A 3L78A 1PN0A 4RUVA 4PHZC 2H6XA 2X8GA 3MAKA 4I6XA 1FB0A 1EEMA 2VCXA 4GSTA 2HYXA 3S9FA 2AHEA 1ML6A 1O81A 1Z6MA 2E7PA 4MK3A 2PVQA 2LUSA 2GSSA 1BG1A 1YEXA 1WRYA 1VGLA 2C0EA 2ALBA 2VUPA 2EFCA 2JSYA 4Q5FA 2AUVA 3CYNA 1F37A 2VM1A 5B7CA 1S3DA 3KCMA 1B4QA 1VF4A 4IW9A 2OKAA 4L0UA 1KBNA 4XS1A 1W89A 4GWRA 2R0CA 1U87A 2GSTA 4AGSA 5A4VA 1MDKA 3TGZA 2B5YA 1GLQA 22GSA 2C80A 1YY7A 2XBIA 4HJ2A 3DYRA 5J47A 4LA1A 5ABRA 3HJPA 2CVKA 3ZZXA 5E59A 4BA7A 4IBPA 1OC9B 1K0AA 1K3YA 1OC8A 3LSZA 5KOXA 2V41A 5A1NA 3UOMA 2HI7A 1Q4JA 3FR3A 2FD3A 5DDLA 4ML6A 3UMAA 3RDWA 3SWLA 1X0RA 2FWFA 1ZGNA 1M3JA 3Q19A 1BEDA 5ECMB 2WW1A 3F9UA 2DC5A 3A5WA 3KTLA 1OVNA 3HVXA 2GT5A 3DGQA 2YJHA 3RFRC 2YOIA 2FY6A 1A2JA 4K1FA 2IWTA 1GSSA 4K5SA 4MH2A 3IOSA 1SD9A 4TKYA 4EUYA 2HZEA 1FAAA 3I43A 4GLTA 1JZOA 2LJRA 4ZBAA 2KP2A 2C3QA 3HJMA 2LSTA 1M9BA 3ZIVA 1X9WB 2XC2A 2L57A 4L5OA 3HZ4A 1EZKA 3KP8A 2QC7A 4TR0A 3C7MA 1BYEA 2YPMA 3GA4A 1F2EA 3IDVA 2LNSA 1AW9A 4KUNA 1JZDA 3DVWA 2GT6A 3Q74A 4ZXGA 3TJGA 5CRHA 4AKHA 2WW0A 1V40A 3GUSA 1ACVA 2FLSA 1XG8A 5EY6A 2R6KA 3QFBC 4BVXB 1SL2B 1T3BA 2CAIA 2WS2A 4CHSA 1ZMAA 3LG6A 2C4JA 2HLSA 2E2MA 1M9AA 1KTEA 3A2WA 2BTOT 3A3TA 19GSA 1FB6A 1R26A 2C3TA 2MZCA 2RLIA 5DAKA 3CRTA 2LV3A 3KEBA 1FVJA 2WJUA 3ZYWA 2WVZA 1TRUA 1CQGA 4I2UA 4IJIA 2CX4A 5IQYA 1B9YC 4N30A 2B1LA 4IHUA 3IRAA 3TKSC 3TOTA 5KN3A 3HKRA 5A34A 5HR3A 3Q6OA 1ZCPA 5EVOA 2DKIA 1SYXA 2QGVA 2JU5A 2L5OA 9GSSA 3H93A 4FYBA 3APOA 4MP4A 5DCHA 2NTOA 4ECBA 3MNGA 2AV4A 4NHZA 3UBLA 2O36A 5KN0A 3VK9A 3E0UA 5LD0A 1OC3A 2YZUA 4YH2A 2JZRA 2C3NA 2H1GA 1EV4A 1O73A 3M0FA 2L4QA 3VI5A 4MMMA 5J4YA 2QSIA 3EC3A 2DJ1A 2VD0A 1U3AA 1R7HA 2YWNA 3GURA 1AIUA 1ZOFA 4MABA 1SU9A 3ISOA 4N10A 4PNGA 2HSHA 5CAXA 3VWUA 3ERFA 1EGOA 4YQUA 1ZYQB 4PUFC 3P8WA 5B6NA 4CW9A 4OCEA 5D93A 1GL8A 1XVWA 2YWMA 4KNDA 3GIXA 1GNEA 3UVHA 1SJ6A 2O3EA 3F6FA 2H01A 5ECRB 4EDZA 3C1RA 5ELAA 1HYUA 4XS6A 5HR2A 4GRFA 4K6XA 3FZ5A 5F0GA 3UBKA 1GSUA 4TN8A 2JZSA 3EU3A 3ZFBA 3L9SA 2WB9A 5F07A 3TKRA 5CREA 2GSQA 4HU7A 4EVMA 5A34B 4G2EA 1QK8A 1M3IA 2OA7A 3F0IA 5CYYA 1VF1A 4IQAA 4LL4B 1AXDA 4WXTA 3TKSA 3FKFA 3GKNA 2G2QA 3TB2A 4MZCA 1ERTA 1Z3EA 5AN1A 5D96A 1O6JA 3GH6A 3IR4A 4PURA 3HY2A 2FWHA 1E6BA 1FVKA 1FHEA 4PI0C 4ECCA 2C0GA 1DE2A 3HVSA 4G0LA 4J57E 4E68A 5CRDA 1HD2A 3QPMA 4Z2RA 5GSTA 1E2YA 4HSCX 4G10A 3I69A 3MYDA 4K7OA 3N9JA 2BJXA 2C1YA 4X1UA 4FIWA 4AKGA 2RUFA 4D73A 2H6YA 3FZAA 3OR5A 1TW9A 2L59A 1ERWA 1M2DA 4XCSA 1B9XC 2L5LA 4WETA 1XOAA 2ON5A 2H76A 1SKWB 3PR8A 5JCUA 3GX8A 1SVLA 4JBBA 3EYTA 4DEJA 1SL1B 5GAND 3TRXA 5L71A 5JCWA 2H70A 4F03A 1XBSA 3ZMKA 3M3MA 1V98A 6GSWA 1XW6A 5IIZA 1THOA 5G5FA 4NMUA 1YKCA 2YNXA 3WT1A 4K2XA 5BMUA 4ID0A 4KX4A 2OACA 4IELA 2X4AA 4IVFA 3FR9A 1SJIA 1VF2A 3RHBA 1OAZA 2H0IA 3D5JA 3GN3A 5J40A 5E4WA 4AJ6A 1EP7A 1YEWC 2CVDA 4POKA 5BRTA 3W8JA 1G6WA 2DIZA 3FR6A 4BVYA 3ZTLA 4NV2A 5J4UA 4ML1A 1TXXA 2X99A 4G19A 1F6MC 3IHQA 2FUG2 3E3EA 3F63A 3DVXA 5G1LA 2J9HA 1WIKA 6GSSA 3P90A 4EL1A 1Y25A 4HZ4A 1QXHA 4IS0A 4EC0A 1QQ2A 3GKKA 1YVLA 1WPIA 5JWOB 4Q5NA 4BWSA 2QKEA 5D9TA 3UARA 4MPFA 2GGTA 2UV8G 1TP9A 1K0NA 4X4JA 3D4MA 3W6GA 1GSDA 4QQ7A 5IOWA 2MMNA 4JZQA 5ELGA 4EIQA 3KXOA 3O3TA 4PGTA 2PN8A 3CSHA 1VRSD 2EIOA 4ZILA 4PX1A 3VPTA 2VL3A 1M0UA 3VWWA 3TJFA 3J7Yk 2DMMA 2HRKA 4GSSA 1HNAA 1M99A 1XCCA 3D4TA 3U6VA 4W66A 3EURA 1PN9A 3VFIA 4IKHA 3GHAA 4ISDA 5IPGA 4GDFA 1ERVA 4JR4A 4ILFA 2PERA 3C8EA 2PMTA 2KP1A 2LKUA 3WD6A 4HS1A 2HFDA 1SK0A 2YN1A 2NPBA 1GTBA 4O5UA 5D8IA 4MA9A 5GSSA 2HRNA 1SVOA 2M72A 3HZ8A 5KOWA 2HSYA 3KTBA 2RM6A 4BVYB 4I5QA 4O92A 1B48A 1G0TA 3LWAA 2F3MA 4L0WA 2VD1A 3ERGA 4EF0A 1GH2A 2J23A 5IMVA 1RW1A 3E9JB 4QL7A 3BD2A 2R3XA 2JL4A 2L6CA 2YV7A 2LRNA 3GH9A 1A8LA 2FGXA 6GSXA 4ZL9A 3EINA 5IO0A 4LMVA 4TR3A 5IMDA 2OJLA 3G7JA 4J56E 1MTCA 4O7HA 1OYJA 3NZNA 2N5AA 1YQ1A 3F8UA 2K8SA 3MIXA 4F9ZA 1XW9A 3HMJG 2EFHA 1S4BP 3VWVA 3PGTA 1AUCA 1MDJA 2FCHA 4HUAA 2CT6A 2DJ2A 3BCIA 3ZLPA 3LQ7A 2H8LA 1B8XA 2YV9A 2FA4A 4HQSA 4MH3A 4BWQA 1J0FA 4XHMA 1XW5A 4KAEA 2OE1A 1XXUA 2HRKB 1U3IA 2WW2A 4FH8A 1Y1UA 2HSMA 2NDOA 3CSIA 1OKDA 3GSSA 4MJAA 2RUEA 3GKMA 4I8BA 2I3YA 4K9ZA 2X8HA 2TRCP 1DUGA 2AAWA 4FXYP 4F0CA 2YWIA 4YAPA 4XIHA 1V9WA 2C0FA 1XWKA 2L4CA 3D0ZA 2CVBA 2IFQA 1ZZYA 2VL2C 1S3RA 4I2TA 1S3AA 2GLRA 2IMDA 2AB6A 3I9V2 4AKIA 3M1GA 1YEPA 2PGTA 4JU5A 4K7IA 2O5VA 4KH7A 1YDKA 1MD3A 4AF2A 3F3QA 1SKRB 4MZBA 1TKDB 1XWBA 3KMOA 3TJKA 1O8XA 5HFKA 4POBA 4V2LA 3C73A 1R5PA 1PA3A 1HQOA 1GUKA 4N3ZA 5J9CA 2F8AA 4NPBA 1NHOA 4TOPA 3HHVA 1H4OA 3QMXA 3G7YA 4O5QA 2N5FA 2FA8A 3GNJA 4K7NA 5G2ZA 2A4HA 2IPAA 2GSRA 3IV4A 3ZREA 3VLNA 3H8QA 4ZB8A 2F51A 2IMIA 4MF6A 3QAVA 3IE3A 4XRDA 4LLRA 3H1NA 2DKHA 2GTUA 3WGXA 3DIEA 2WGRA 4GXZA 2K9FA 3BCKA 3R2QA 3IA1A 4QMKA 3IBHA 4PXOA 4TXOA 3TJBA 6GSYA 1QUWA 5DQSA 4E8HA 1ERUA 4MJEA 4N0VA 2H1LA 4WBJA 4ZB6A 5A1NB 3GTUA 1YZXA 3M8NA 2HRFA 5INYA 4GQCA 1T1VA 5GAPD 2IFQB 3GL3A 2IN3A 3WT2A 3APQA 1EEJA 4FYCA 2DJJA 4ZIJA 1YF1A 1K0DA 5IMFA 1PGTA 3M9JA 1X5DA 2VL2A 1N2AA 3ZL5A 5F06A 1U6TA 5DJMA 3TKQA 2LEGA 5KEJA 2WW3A 4BL7A 2HZEB 4ACSA 3TU3B 1TU8A 5H5SA 2ZCTA 3KJYA 1DBYA 4E8EA 2YZHA 2HQTA 3IAM2 1UN2A 2YP6A 2IMFA 4KF9A 5ECIB 3IK7A 3KIJA 4MF5A 2LRCA 1A8YA 2H0HA 17GSA 2K6VA 1T4ZA 11GSA 2I4AA 1YJ6A 2XHFA 1V2AA 6GSTA 1TXUA 3HXSA 4LMWA 1XOBA 2DMLA 3IK9A 4F82A 5G30A 2V6KA 4XS4A 5GZZB 2DJ3A 3DD3A 5DAKB 1O7UA 5ID2A 5ECOB 2JSZA 3UIWA 3LYPA 3HDCA 1TI1A 3WGDA 4AJ7A 1TRVA 7GSSA 2F9SA 3DKSA 3APSA 4CY8A 1GNWA 5J3RA 3TKSE 2VLUA 2MBSA 3CXGA 2CA8A 1YKAA 2KUCA 3GTUB 4USSA 3GFKA 2I9HA 4X0XA 5IOXA 4Z2UA 5FWGA 2EC4A 3QOUA 1EWXA 2VAFA 1QMVA 3LYKA 4EDYA 2REMA 1K0CA 2VL9A 4OCFA 1U88A 3VWXA 2IL3A 2VCZA 2EIQA 2H75A 4K5RA 3TRPA 1G7EA 3GRXA 3ZIJA 4IGJA 3RGBC 2CZ2A 3H79A 4G0KA 1HNCA 2DJ0A 1TU7A 4ZL7A 3QAGA 5DBQA 2KLXA 1PKZA 4MZWA 1WMJA 3LJRA 1SJZA 2JZTA 1TOFA 2A4VA 5AGYA 1B4PA 5ECLB 1T8EB 4N11A 2VCQA 4NAXA 3WGEA 4WF5A 3FY7A 2CQ9A 2H0GA 2HRAA 1EP8A 2V1MA 1F9MA 5HQPA 4TVEA 3FRCA 3I6AA 4FYUA 4XS4B 4OMVA 1X5EA 3ME8A 4Z2TA 1GP1A 2NVLA 1GUMA 5D9XA 1Z7PA 5ID2B 4Z7XA 2NBSA 2B5XA 4MJCA 4OFNA 1EGRA 1LU4A 3BJ5A 1R5AA 4ZBBA 2VLVA 5G31A 2OE0A 3FEUA 3LFLA 1Q98A 1JHBA 1TI3A 3EWLA 2YCDA 2XPEA 4PNFA 3ED3A 3UL3A 3CTFA 4IN0A 18GSA 2CZ3A 4OFTA 1LBKA 3ZITA 5COHA 1W4VA 5DALA 4KW6A 3BBYA 4PQHA 2DIYA 1XWGA 5C04A 4ZB9A 4KDXA 4DSRA 6GSVA 5J5NA 4KDYA 3IC4A 2A2PA 1N25A 12GSA 3KGKA 4CY6A 3U5RE 3K8NA 3HJOA 3N5OA 3GMFA 1J08A 4WBRD 3CMIA 4OO4A 4D73B 5AISA 2XBQA 5FT3A 1X9MB 3PH9A 2PUKC 3DWVA 2IMEA 3KD0A 4ICYA 2X64A 3D6IA 1QGVA 1ZYPA 2V32A 3US3A 2UZ8A 4P3YB 5KN1A 4FO5A 2AYTA 2GQLA 5B6MA 3PPUA 1AQXA 5BMUB 4A5PA 1PL2A 2CV4A 3RPPA 2L6DA 4MPGA 2H6ZA 1NM3A 5IMCA 4KSMA 2N5BA 1ZYNA 4RI7A 2HE3A 3MDKA 1GLPA 3HVNA 4AJ8A 4HQZA 3L0HA 1JZRA 2CAQA 2M46A 5B8AA 2CX3A 4KCEA 3BOAA 3KZQA 2GZZA 2X8CA 3LORA 4MJBA 5J41A 4LL1B 2OADA 5ECNB 1TTZA 2E0QA 1GTUA 1ON4A 4BIKA 2HZFA 1Z9HA 2F8FA 3GSTA 3HVVA 1X9SB 2MBTA 3GX0A 1WE0A 3QFAC 5DALB 5A4WA 1XVQA 4PI2C 1SD8A 3H4KA 1SENA 3TRQA 3DMLA 3HA9A 2JADA 3J7Yb 4OWYA 2H74A 1GWCA 3QAWA 3RAZA 1AQVA 2OE3A 1A2LA 3P7XA 1O8WA 5EPFA 5D9WA 2WZSA 1T4YA 2GQKA 3KMNA 1G6YA 1FOVA 4ZB7A 4MLYA 2DJKA 3M9KA 3CRUA 3O76A 8GSSA 3WYWA 3G7IA 3ZVJD 2P5RA 1WWJA 2V6OA 3D21A 1GSYA 5JWQB 5AIVA 5HR0A 2C0DA 3ZRDA 3CHXC 2GQMA 2QA1A 3QR6A 2HXKA 1SYRA 1X5CA 1J9BA 4BVXA 1M7TA 20GSA 1PFOA 4BPYA 1TK8B 2IIYA 13GSA 1I5GA 5CRWA 2K18A 4PQIA 1I9DA 1BJXA 3UVTA 1PX7A 2PWJA 4K0NA 1XWCA 4GQFA 2OBKA 2WZ9A 2H73A 5IMZA 5J4VA 4EIPA 4EXJA 1XIYA 5JWRB 1Z6NA 4Q5QA 4IJ3A 1ILOA 1K3OA 1URMA 2B7JA 3TJJA 4DSSA 1OE8A 4H86A 4AI6A 5CRGA 3UJ1A 1PMTA 4IQ1A 1ST9A 3ZFLA 3ME7A 1FW1A 1JLWA 1PSQA 4RI6A 1KEBA 4G01A 4JEDA 5DQYA 3DRNA 3GV1A 3CWGA 5CP1A 1GTIA 1SK2A 2LQQA 2MYGA 2C8UA 2WVXA 3VURA 3LEFA 3V1WA 4ULXA 2JACA 1K3LA 3DEXA 2LRTA 4ZL8A 2X49A 3PINA 4WKWA 2O87A 1M2BA 1TRSA 1XZOA 1IYIA 4DVCA 1C72A 2WFCA 2A2SA 4TR4A 4V2NA 5A5HA 3QCPA 3F6DA 2WVYA 4K0GA 3P2AA 5IMAA 2MMAA 2DBCA 3FK8A 1FOHA 1GSFA 4KDUA 5H5RA 2VCVA 2WULA 2VO4A 4K2DA 3IC8A 2H71A 5HFIA 2WDUA 3W8SA 1V57A 1A24A 2H19A 4WEYA 3CBUA 2HSMB 2HNLA 4NV5A 1XFLA 4HZ2A 4XRAA 1GSEA 4NXIA 2LJKA 2H1AA 3IPZA 1PL1A 1NW2A 4JRRA 3KM6A 4G9HA 3A5IA 1KNGA 3LXZA 4ECIA 3F4SA 5A4UA 1R4WA 2R2JA 3R3EA 5B8BA 2BMXA 1F3AA 3EMXA 2P5QA 2H1DA 2O85A 2G0FA 1HNBA 4DSSB 1Z7RA 1A0RP 4ZBDA 3NOFA 1CQHA 2R5GA 4Q5RA 1RQMA 3F3RA 1WJKA 2VIMA 4CDOA 2MMOA 3TKPA 5IM9A 2YJ7A 3IAS2 2R37A 2VM2A 1TRWA 1ABAA 2FWGA 3EVIA 2B1KA 3D22A 3C1SA 4KSOA 2WVXB 2VKZG 3FHKA 1G7OA 1H75A 2O89A 4K8MA 4DSQA 1IYHA 2YWOA
chains in the Genus database with same CATH topology
1GSQA 4V1Ap 5H5QA 1DE1A 5A5KA 2KHPA 2R4VA 3GKXA 4QL9A 2H72A 4XTSA 4OO5A 3TDGA 1GUHA 5A5HB 1VF3A 3FYGA 2LS5A 3EE2A 3RHCA 2ON7A 2LJAA 2GDRA 3CSJA 4X43A 1T7PB 2E2GA 4NWYA 3TUEA 3L9VA 1T00A 2P31A 4PQ1A 3GL5A 4GCIA 4KGIA 2O8VB 1TK0B 1TDIA 3GYKA 1AAZA 2TRXA 4TRXA 3LGCA 4HI7A 4I97A 5F05A 2FWEA 4HDEA 4TW5A 1K0BA 4V1Ag 5EL8A 4RQXA 4TXOB 4YAVA 4YQVA 1WP0A 4YKGA 1MEKA 3F4RA 4EO3A 3CTGA 2B3SA 3DXBA 3L4NA 2QA2A 1S3CA 2FNOA 4IP6A 1XWAA 2Z9SA 3F4TA 1JFUA 3KP9A 4N0ZA 1JLVA 1TJDA 2GZPA 1GULA 1BF5A 1BQ7A 5IO2A 3IHGA 1UC7A 1M2AA 1PD21 3FZ9A 4TR1A 4L5LA 4WR4A 1OKTA 1PKWA 3KH9A 1SK1A 3ZMLA 5F8BA 16GSA 4BL7B 2YANA 5ECSA 4MCUA 3HD5A 1BG5A 2B6MA 4AKXB 1MDIA 5D9VA 1EV9A 5ECPB 3EMPA 1AC1A 2EIRA 2VLTA 1DSBA 3FMWA 4POLA 3TCOA 1XPVA 4O5RA 4F2IA 1GRXA 2EFEA 3Q18A 3A2XA 2HSNA 5G1KA 2ES7A 1SKSB 1V58A 4HU9A 4L8EA 2RM5A 5DVBA 1EOGA 4GSNA 2R0GA 1NSWA 1N8JA 2LNTA 4GF0A 3TOUA 3ERWA 1NHYA 3C71A 10GSA 2D2ZA 2MMZA 4JE1A 5DCGA 4EKZA 3QD9A 2WCIA 5FHIA 3VPQA 2I1UA 1FO5A 2FHEA 1EOHA 4NHWA 1ZL9A 3RPNA 4HJMA 2AJQB 5D73A 1SVMA 1TK5B 2IJYA 5J9BA 4V2MA 4RQRA 3LW9A 4WF4A 4EE0A 2P0GA 5JCGA 1MD4A 2DSAA 1YF0A 1PX6A 1UVZA 2ZNMA 2ZUPA 1SL0B 4OFMA 2PBJA 5DJLA 4TR1B 3RBTA 3AY8A 3HYPA 2I81A 1A2MA 4G0IA 4O32A 4KE3A 1K0OA 1PRXA 2RIIA 3UEMA 1BX9A 2R0PA 5HFGA 4ECJA 3FW2A 4KB3A 2TIRA 2PU9C 3EPTA 3VI7A 5CO3A 5ECQB 4KA0A 1Y6EA 1GTAA 2GS3A 2HT9A 4YKFA 1JZWA 3FZ4A 4TXVA 4HOJA 3LXTA 6GSUA 3SBCA 3L9UA 3ZVJA 3IXRA 4F0BA 2PPTA 3G9BA 3MWHA 2VCWA 1RK4A 1ZYEA 5LCZA 3HCZA 3MSZA 2PVOC 2WRTA 2H1BA 2HSNB 5ECKB 5KN2A 1OE7A 2OT3A 5G5EA 3JCML 4MF7A 4IP1A 4MNNA 3NIVA 2LQOA 3QDNA 2V2GA 1WOUA 2GZYA 4HEA2 5C00A 1A0FA 2VCTA 3UAPA 1USBA 1F3BA 2B5EA 2OBIA 1UA5A 14GSA 4PUAA 2VOCA 1OC9A 1O85A 2IMKA 4POMA 5ENUA 4MDCA 2K8VA 4KCAA 2XPDA 1PQNA 2EFDA 1LJRA 1QFNA 1AQWA 1A23A 2GVPA 3A2VA 4OD7A 5IPHA 1FG4A 3O6TA 1K0MA 2B7KA 3EU4A 2DLXA 1BAYA 4J2FA 4FQUA 5ECHB 3KH7A 2O7KA 5AIXA 5HR1A 4PTSA 4YQMA 5CNWA 2H66A 2KOKA 2LTKA 1THXA 2A2RA 5LNKe 2M80A 4GTUA 1Z5YE 2H30A 4JR6A 4WR5A 3L78A 1PN0A 4RUVA 2H6XA 2X8GA 3MAKA 4I6XA 1FB0A 1EEMA 2VCXA 4GSTA 2HYXA 3S9FA 2AHEA 1ML6A 1O81A 1Z6MA 2E7PA 4MK3A 2PVQA 2LUSA 2GSSA 1BG1A 1YEXA 1WRYA 1VGLA 2C0EA 2ALBA 2VUPA 2EFCA 2JSYA 4Q5FA 2AUVA 3CYNA 1F37A 2VM1A 5B7CA 1S3DA 3KCMA 1B4QA 1VF4A 4IW9A 2OKAA 4L0UA 1KBNA 4XS1A 1W89A 4GWRA 2R0CA 1U87A 2GSTA 4AGSA 5A4VA 1MDKA 3TGZA 2B5YA 1GLQA 22GSA 2C80A 1YY7A 2XBIA 4HJ2A 3DYRA 5J47A 4LA1A 5ABRA 3HJPA 2CVKA 3ZZXA 5E59A 4BA7A 4IBPA 1OC9B 1K0AA 1K3YA 1OC8A 3LSZA 5KOXA 2V41A 5A1NA 3UOMA 2HI7A 1Q4JA 3FR3A 2FD3A 5DDLA 4ML6A 3UMAA 3RDWA 3SWLA 1X0RA 2FWFA 1ZGNA 3Q19A 1BEDA 5ECMB 3F9UA 2DC5A 3A5WA 3KTLA 1OVNA 3HVXA 2GT5A 3DGQA 2YJHA 2YOIA 2FY6A 1A2JA 4K1FA 2IWTA 1GSSA 4K5SA 4MH2A 3IOSA 1SD9A 4TKYA 4EUYA 2HZEA 1FAAA 3I43A 4GLTA 1JZOA 2LJRA 4ZBAA 2KP2A 2C3QA 3HJMA 2LSTA 1M9BA 3ZIVA 1X9WB 2XC2A 2L57A 4L5OA 3HZ4A 1EZKA 3KP8A 2QC7A 4TR0A 3C7MA 1BYEA 2YPMA 3GA4A 1F2EA 3IDVA 2LNSA 1AW9A 4KUNA 1JZDA 3DVWA 2GT6A 3Q74A 4ZXGA 3TJGA 5CRHA 4AKHA 1V40A 3GUSA 1ACVA 2FLSA 5EY6A 2R6KA 3QFBC 4BVXB 1SL2B 1T3BA 2CAIA 2WS2A 4CHSA 1ZMAA 3LG6A 2C4JA 2HLSA 2E2MA 1M9AA 1KTEA 3A2WA 2BTOT 3A3TA 19GSA 1FB6A 1R26A 2C3TA 2MZCA 2RLIA 5DAKA 3CRTA 2LV3A 3KEBA 1FVJA 2WJUA 3ZYWA 1TRUA 1CQGA 4I2UA 4IJIA 2CX4A 5IQYA 1B9YC 4N30A 2B1LA 4IHUA 3IRAA 3TKSC 3TOTA 5KN3A 3HKRA 5A34A 5HR3A 3Q6OA 1ZCPA 5EVOA 2DKIA 1SYXA 2QGVA 2JU5A 2L5OA 9GSSA 3H93A 4FYBA 3APOA 4MP4A 5DCHA 2NTOA 4ECBA 3MNGA 2AV4A 4NHZA 3UBLA 5KN0A 3VK9A 3E0UA 5LD0A 1OC3A 2YZUA 4YH2A 2JZRA 2C3NA 2H1GA 1EV4A 1O73A 3M0FA 2L4QA 3VI5A 4MMMA 5J4YA 2QSIA 3EC3A 2DJ1A 2VD0A 1U3AA 1R7HA 2YWNA 3GURA 1AIUA 1ZOFA 4MABA 1SU9A 3ISOA 4N10A 4PNGA 2HSHA 5CAXA 3VWUA 3ERFA 1EGOA 4YQUA 1ZYQB 4PUFC 3P8WA 5B6NA 4CW9A 4OCEA 5D93A 1GL8A 1XVWA 2YWMA 4KNDA 3GIXA 1GNEA 3UVHA 1SJ6A 3F6FA 2H01A 5ECRB 4EDZA 3C1RA 5ELAA 1HYUA 4XS6A 5HR2A 4GRFA 4K6XA 3FZ5A 5F0GA 3UBKA 1GSUA 4TN8A 2JZSA 3EU3A 3ZFBA 3L9SA 2WB9A 5F07A 3TKRA 5CREA 2GSQA 4HU7A 4EVMA 5A34B 4G2EA 1QK8A 2OA7A 3F0IA 5CYYA 1VF1A 4IQAA 4LL4B 1AXDA 4WXTA 3TKSA 3FKFA 3GKNA 2G2QA 3TB2A 4MZCA 1ERTA 1Z3EA 5AN1A 5D96A 1O6JA 3GH6A 3IR4A 4PURA 3HY2A 2FWHA 1E6BA 1FVKA 1FHEA 4ECCA 2C0GA 1DE2A 3HVSA 4G0LA 4J57E 4E68A 5CRDA 1HD2A 3QPMA 4Z2RA 5GSTA 1E2YA 4G10A 3I69A 3MYDA 4K7OA 3N9JA 2BJXA 2C1YA 4X1UA 4FIWA 4AKGA 2RUFA 4D73A 2H6YA 3FZAA 3OR5A 1TW9A 2L59A 1ERWA 1M2DA 4XCSA 1B9XC 2L5LA 4WETA 1XOAA 2ON5A 2H76A 1SKWB 3PR8A 5JCUA 3GX8A 1SVLA 4JBBA 3EYTA 4DEJA 1SL1B 5GAND 3TRXA 5L71A 5JCWA 2H70A 4F03A 1XBSA 3ZMKA 3M3MA 1V98A 6GSWA 1XW6A 5IIZA 1THOA 5G5FA 4NMUA 1YKCA 2YNXA 3WT1A 4K2XA 5BMUA 4ID0A 4KX4A 2OACA 4IELA 2X4AA 4IVFA 3FR9A 1SJIA 1VF2A 3RHBA 1OAZA 2H0IA 3D5JA 3GN3A 5J40A 5E4WA 4AJ6A 1EP7A 2CVDA 4POKA 5BRTA 3W8JA 1G6WA 2DIZA 3FR6A 4BVYA 3ZTLA 4NV2A 5J4UA 4ML1A 1TXXA 2X99A 4G19A 1F6MC 3IHQA 2FUG2 3E3EA 3F63A 3DVXA 5G1LA 2J9HA 1WIKA 6GSSA 3P90A 4EL1A 1Y25A 4HZ4A 1QXHA 4IS0A 4EC0A 1QQ2A 3GKKA 1YVLA 1WPIA 5JWOB 4Q5NA 4BWSA 2QKEA 5D9TA 3UARA 4MPFA 2GGTA 2UV8G 1TP9A 1K0NA 4X4JA 3D4MA 3W6GA 1GSDA 4QQ7A 5IOWA 2MMNA 4JZQA 5ELGA 4EIQA 3KXOA 3O3TA 4PGTA 2PN8A 3CSHA 1VRSD 2EIOA 4ZILA 4PX1A 3VPTA 2VL3A 1M0UA 3VWWA 3TJFA 3J7Yk 2DMMA 2HRKA 4GSSA 1HNAA 1M99A 1XCCA 3D4TA 3U6VA 4W66A 3EURA 1PN9A 3VFIA 4IKHA 3GHAA 4ISDA 5IPGA 4GDFA 1ERVA 4JR4A 4ILFA 2PERA 3C8EA 2PMTA 2KP1A 2LKUA 3WD6A 4HS1A 2HFDA 1SK0A 2YN1A 2NPBA 1GTBA 4O5UA 5D8IA 4MA9A 5GSSA 2HRNA 1SVOA 2M72A 3HZ8A 5KOWA 2HSYA 3KTBA 2RM6A 4BVYB 4I5QA 4O92A 1B48A 1G0TA 3LWAA 2F3MA 4L0WA 2VD1A 3ERGA 4EF0A 1GH2A 2J23A 5IMVA 1RW1A 3E9JB 4QL7A 3BD2A 2R3XA 2JL4A 2L6CA 2YV7A 2LRNA 3GH9A 1A8LA 2FGXA 6GSXA 4ZL9A 3EINA 5IO0A 4LMVA 4TR3A 5IMDA 2OJLA 3G7JA 4J56E 1MTCA 4O7HA 1OYJA 3NZNA 2N5AA 1YQ1A 3F8UA 2K8SA 3MIXA 4F9ZA 1XW9A 3HMJG 2EFHA 3VWVA 3PGTA 1AUCA 1MDJA 2FCHA 4HUAA 2CT6A 2DJ2A 3BCIA 3ZLPA 3LQ7A 2H8LA 1B8XA 2YV9A 2FA4A 4HQSA 4MH3A 4BWQA 1J0FA 4XHMA 1XW5A 4KAEA 2OE1A 1XXUA 2HRKB 1U3IA 4FH8A 1Y1UA 2HSMA 2NDOA 3CSIA 1OKDA 3GSSA 4MJAA 2RUEA 3GKMA 4I8BA 2I3YA 4K9ZA 2X8HA 2TRCP 1DUGA 2AAWA 4F0CA 2YWIA 4YAPA 4XIHA 1V9WA 2C0FA 1XWKA 2L4CA 3D0ZA 2CVBA 2IFQA 1ZZYA 2VL2C 4I2TA 1S3AA 2GLRA 2IMDA 2AB6A 3I9V2 4AKIA 3M1GA 1YEPA 2PGTA 4JU5A 4K7IA 2O5VA 4KH7A 1YDKA 1MD3A 4AF2A 3F3QA 1SKRB 4MZBA 1TKDB 1XWBA 3KMOA 3TJKA 1O8XA 5HFKA 4POBA 4V2LA 3C73A 1R5PA 1PA3A 1HQOA 1GUKA 4N3ZA 5J9CA 2F8AA 4NPBA 1NHOA 4TOPA 3HHVA 1H4OA 3QMXA 3G7YA 4O5QA 2N5FA 2FA8A 3GNJA 4K7NA 5G2ZA 2A4HA 2IPAA 2GSRA 3IV4A 3ZREA 3VLNA 3H8QA 4ZB8A 2F51A 2IMIA 4MF6A 3QAVA 3IE3A 4XRDA 4LLRA 3H1NA 2DKHA 2GTUA 3WGXA 3DIEA 2WGRA 4GXZA 2K9FA 3BCKA 3R2QA 3IA1A 4QMKA 3IBHA 4PXOA 4TXOA 3TJBA 6GSYA 1QUWA 5DQSA 4E8HA 1ERUA 4MJEA 4N0VA 2H1LA 4WBJA 4ZB6A 5A1NB 3GTUA 1YZXA 3M8NA 2HRFA 5INYA 4GQCA 1T1VA 5GAPD 2IFQB 3GL3A 2IN3A 3WT2A 3APQA 1EEJA 4FYCA 2DJJA 4ZIJA 1YF1A 1K0DA 5IMFA 1PGTA 3M9JA 1X5DA 2VL2A 1N2AA 3ZL5A 5F06A 1U6TA 5DJMA 3TKQA 2LEGA 5KEJA 4BL7A 2HZEB 4ACSA 3TU3B 1TU8A 5H5SA 2ZCTA 3KJYA 1DBYA 4E8EA 2YZHA 2HQTA 3IAM2 1UN2A 2YP6A 2IMFA 4KF9A 5ECIB 3IK7A 3KIJA 4MF5A 2LRCA 1A8YA 2H0HA 17GSA 2K6VA 1T4ZA 11GSA 2I4AA 1YJ6A 2XHFA 1V2AA 6GSTA 1TXUA 3HXSA 4LMWA 1XOBA 2DMLA 3IK9A 4F82A 5G30A 2V6KA 4XS4A 5GZZB 2DJ3A 3DD3A 5DAKB 1O7UA 5ID2A 5ECOB 2JSZA 3UIWA 3LYPA 3HDCA 1TI1A 3WGDA 4AJ7A 1TRVA 7GSSA 2F9SA 3DKSA 3APSA 4CY8A 1GNWA 5J3RA 3TKSE 2VLUA 2MBSA 3CXGA 2CA8A 1YKAA 2KUCA 3GTUB 4USSA 3GFKA 2I9HA 4X0XA 5IOXA 4Z2UA 5FWGA 2EC4A 3QOUA 1EWXA 2VAFA 1QMVA 3LYKA 4EDYA 2REMA 1K0CA 2VL9A 4OCFA 1U88A 3VWXA 2IL3A 2VCZA 2EIQA 2H75A 4K5RA 3TRPA 1G7EA 3GRXA 3ZIJA 4IGJA 2CZ2A 3H79A 4G0KA 1HNCA 2DJ0A 1TU7A 4ZL7A 3QAGA 5DBQA 2KLXA 1PKZA 4MZWA 1WMJA 3LJRA 1SJZA 2JZTA 1TOFA 2A4VA 5AGYA 1B4PA 5ECLB 1T8EB 4N11A 2VCQA 4NAXA 3WGEA 4WF5A 3FY7A 2CQ9A 2H0GA 2HRAA 1EP8A 2V1MA 1F9MA 5HQPA 4TVEA 3FRCA 3I6AA 4FYUA 4XS4B 4OMVA 1X5EA 3ME8A 4Z2TA 1GP1A 2NVLA 1GUMA 5D9XA 1Z7PA 5ID2B 4Z7XA 2NBSA 2B5XA 4MJCA 4OFNA 1EGRA 1LU4A 3BJ5A 1R5AA 4ZBBA 2VLVA 5G31A 2OE0A 3FEUA 3LFLA 1Q98A 1JHBA 1TI3A 3EWLA 2YCDA 2XPEA 4PNFA 3ED3A 3UL3A 3CTFA 4IN0A 18GSA 2CZ3A 4OFTA 1LBKA 3ZITA 5COHA 1W4VA 5DALA 4KW6A 3BBYA 4PQHA 2DIYA 1XWGA 5C04A 4ZB9A 4KDXA 4DSRA 6GSVA 5J5NA 4KDYA 3IC4A 2A2PA 1N25A 12GSA 3KGKA 4CY6A 3U5RE 3K8NA 3HJOA 3N5OA 3GMFA 1J08A 4WBRD 3CMIA 4OO4A 4D73B 5AISA 2XBQA 5FT3A 1X9MB 3PH9A 2PUKC 3DWVA 2IMEA 3KD0A 4ICYA 2X64A 3D6IA 1QGVA 1ZYPA 2V32A 3US3A 2UZ8A 4P3YB 5KN1A 4FO5A 2AYTA 2GQLA 5B6MA 3PPUA 1AQXA 5BMUB 4A5PA 1PL2A 2CV4A 3RPPA 2L6DA 4MPGA 2H6ZA 1NM3A 5IMCA 4KSMA 2N5BA 1ZYNA 4RI7A 2HE3A 3MDKA 1GLPA 4AJ8A 4HQZA 3L0HA 1JZRA 2CAQA 2M46A 5B8AA 2CX3A 4KCEA 3BOAA 3KZQA 2GZZA 2X8CA 3LORA 4MJBA 5J41A 4LL1B 2OADA 5ECNB 1TTZA 2E0QA 1GTUA 1ON4A 2HZFA 1Z9HA 2F8FA 3GSTA 3HVVA 1X9SB 2MBTA 3GX0A 1WE0A 3QFAC 5DALB 5A4WA 1XVQA 1SD8A 3H4KA 1SENA 3TRQA 3DMLA 3HA9A 2JADA 3J7Yb 4OWYA 2H74A 1GWCA 3QAWA 3RAZA 1AQVA 2OE3A 1A2LA 3P7XA 1O8WA 5EPFA 5D9WA 2GQKA 1T4YA 3KMNA 1G6YA 1FOVA 4ZB7A 4MLYA 2DJKA 3M9KA 3CRUA 3O76A 8GSSA 3WYWA 3G7IA 3ZVJD 2P5RA 1WWJA 2V6OA 3D21A 1GSYA 5JWQB 5AIVA 5HR0A 2C0DA 3ZRDA 2GQMA 2QA1A 3QR6A 2HXKA 1SYRA 1X5CA 1J9BA 4BVXA 1M7TA 20GSA 4BPYA 1TK8B 2IIYA 13GSA 1I5GA 5CRWA 2K18A 4PQIA 1I9DA 1BJXA 3UVTA 1PX7A 2PWJA 4K0NA 1XWCA 4GQFA 2OBKA 2WZ9A 2H73A 5IMZA 5J4VA 4EIPA 4EXJA 1XIYA 5JWRB 1Z6NA 4Q5QA 4IJ3A 1ILOA 1K3OA 1URMA 2B7JA 3TJJA 4DSSA 1OE8A 4H86A 4AI6A 5CRGA 3UJ1A 1PMTA 4IQ1A 1ST9A 3ZFLA 3ME7A 1FW1A 1JLWA 1PSQA 4RI6A 1KEBA 4G01A 4JEDA 5DQYA 3DRNA 3GV1A 3CWGA 5CP1A 1GTIA 1SK2A 2LQQA 2MYGA 2C8UA 3VURA 3LEFA 3V1WA 4ULXA 2JACA 1K3LA 3DEXA 2LRTA 4ZL8A 2X49A 3PINA 4WKWA 2O87A 1M2BA 1TRSA 1XZOA 1IYIA 4DVCA 1C72A 2WFCA 2A2SA 4TR4A 4V2NA 5A5HA 3QCPA 3F6DA 4K0GA 3P2AA 5IMAA 2MMAA 2DBCA 3FK8A 1FOHA 1GSFA 4KDUA 5H5RA 2VCVA 2WULA 2VO4A 4K2DA 3IC8A 2H71A 5HFIA 2WDUA 3W8SA 1V57A 1A24A 2H19A 4WEYA 3CBUA 2HSMB 2HNLA 4NV5A 1XFLA 4HZ2A 4XRAA 1GSEA 4NXIA 2LJKA 2H1AA 3IPZA 1PL1A 1NW2A 4JRRA 3KM6A 4G9HA 3A5IA 1KNGA 3LXZA 4ECIA 3F4SA 5A4UA 1R4WA 2R2JA 3R3EA 5B8BA 2BMXA 1F3AA 3EMXA 2P5QA 2H1DA 2O85A 2G0FA 1HNBA 4DSSB 1Z7RA 1A0RP 4ZBDA 3NOFA 1CQHA 2R5GA 4Q5RA 1RQMA 3F3RA 1WJKA 2VIMA 4CDOA 2MMOA 3TKPA 5IM9A 2YJ7A 3IAS2 2R37A 2VM2A 1TRWA 1ABAA 2FWGA 3EVIA 2B1KA 3D22A 3C1SA 4KSOA 2VKZG 3FHKA 1G7OA 1H75A 2O89A 4K8MA 4DSQA 1IYHA 2YWOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GSQ A;  4V1A p;  5H5Q A;  1DE1 A;  5A5K A;  2KHP A;  2R4V A;  3GKX A;  4QL9 A;  2H72 A;  4XTS A;  4OO5 A;  3TDG A;  1GUH A;  1VF3 A;  3FYG A;  2LS5 A;  3EE2 A;  3RHC A;  2ON7 A;  2LJA A;  2GDR A;  3CSJ A;  4X43 A;  1T7P B;  2E2G A;  4NWY A;  3TUE A;  3L9V A;  1T00 A;  2P31 A;  4PQ1 A;  3GL5 A;  4GCI A;  4KGI A;  2O8V B;  1TK0 B;  1TDI A;  3GYK A;  1AAZ A;  2TRX A;  4TRX A;  3LGC A;  4HI7 A;  4I97 A;  5F05 A;  2FWE A;  4HDE A;  4TW5 A;  1K0B A;  4V1A g;  5EL8 A;  4RQX A;  4TXO B;  4YAV A;  4YQV A;  1WP0 A;  1MEK A;  3F4R A;  4EO3 A;  3CTG A;  2B3S A;  3DXB A;  3L4N A;  1S3C A;  2FNO A;  4IP6 A;  1XWA A;  2Z9S A;  3F4T A;  1JFU A;  3KP9 A;  4N0Z A;  1JLV A;  1TJD A;  2GZP A;  1GUL A;  1BQ7 A;  5IO2 A;  1UC7 A;  1M2A A;  1PD2 1;  3FZ9 A;  4TR1 A;  4L5L A;  4WR4 A;  1OKT A;  1PKW A;  3KH9 A;  1SK1 A;  3ZML A;  5F8B A;  16GS A;  4BL7 B;  2YAN A;  5ECS A;  4MCU A;  3HD5 A;  1BG5 A;  2B6M A;  1MDI A;  5D9V A;  1EV9 A;  5ECP B;  3EMP A;  1AC1 A;  2EIR A;  2VLT A;  1DSB A;  4POL A;  3TCO A;  1XPV A;  4O5R A;  4F2I A;  1GRX A;  3Q18 A;  3A2X A;  5G1K A;  2ES7 A;  1SKS B;  1V58 A;  4HU9 A;  4L8E A;  2RM5 A;  5DVB A;  1EOG A;  4GSN A;  1NSW A;  1N8J A;  2LNT A;  4GF0 A;  3TOU A;  3ERW A;  1NHY A;  3C71 A;  10GS A;  2D2Z A;  2MMZ A;  4JE1 A;  5DCG A;  4EKZ A;  3QD9 A;  2WCI A;  5FHI A;  3VPQ A;  2I1U A;  1FO5 A;  2FHE A;  1EOH A;  4NHW A;  1ZL9 A;  3RPN A;  4HJM A;  2AJQ B;  5D73 A;  1TK5 B;  2IJY A;  5J9B A;  4V2M A;  4RQR A;  4WF4 A;  4EE0 A;  2P0G A;  5JCG A;  1MD4 A;  2DSA A;  1YF0 A;  1PX6 A;  1UVZ A;  2ZNM A;  2ZUP A;  1SL0 B;  4OFM A;  2PBJ A;  5DJL A;  4TR1 B;  3RBT A;  3AY8 A;  3HYP A;  2I81 A;  1A2M A;  4G0I A;  4O32 A;  4KE3 A;  1K0O A;  1PRX A;  2RII A;  3UEM A;  1BX9 A;  5HFG A;  4ECJ A;  3FW2 A;  4KB3 A;  2TIR A;  2PU9 C;  3VI7 A;  5CO3 A;  5ECQ B;  4KA0 A;  1Y6E A;  1GTA A;  2GS3 A;  2HT9 A;  1JZW A;  3FZ4 A;  4TXV A;  4HOJ A;  3LXT A;  6GSU A;  3SBC A;  3L9U A;  3ZVJ A;  3IXR A;  4F0B A;  2PPT A;  3G9B A;  3MWH A;  2VCW A;  1RK4 A;  1ZYE A;  5LCZ A;  3HCZ A;  3MSZ A;  2PVO C;  2WRT A;  2H1B A;  2HSN B;  5ECK B;  5KN2 A;  1OE7 A;  5G5E A;  3JCM L;  4MF7 A;  4IP1 A;  3NIV A;  2LQO A;  3QDN A;  2V2G A;  1WOU A;  2GZY A;  4HEA 2;  5C00 A;  1A0F A;  2VCT A;  3UAP A;  1USB A;  1F3B A;  2B5E A;  2OBI A;  1UA5 A;  14GS A;  4PUA A;  2VOC A;  1OC9 A;  1O85 A;  2IMK A;  4POM A;  5ENU A;  4MDC A;  2K8V A;  4KCA A;  2XPD A;  1PQN A;  1LJR A;  1QFN A;  1AQW A;  1A23 A;  2GVP A;  3A2V A;  4OD7 A;  5IPH A;  1FG4 A;  3O6T A;  1K0M A;  2B7K A;  3EU4 A;  2DLX A;  1BAY A;  4J2F A;  4FQU A;  5ECH B;  3KH7 A;  2O7K A;  5AIX A;  5HR1 A;  4PTS A;  4YQM A;  5CNW A;  2H66 A;  2KOK A;  2LTK A;  1THX A;  2A2R A;  5LNK e;  2M80 A;  4GTU A;  1Z5Y E;  2H30 A;  4JR6 A;  4WR5 A;  3L78 A;  4RUV A;  2H6X A;  2X8G A;  3MAK A;  4I6X A;  1FB0 A;  1EEM A;  2VCX A;  4GST A;  2HYX A;  3S9F A;  2AHE A;  1ML6 A;  1O81 A;  1Z6M A;  2E7P A;  4MK3 A;  2PVQ A;  2LUS A;  2GSS A;  1YEX A;  1WRY A;  1VGL A;  2C0E A;  2ALB A;  2VUP A;  2JSY A;  4Q5F A;  2AUV A;  3CYN A;  1F37 A;  2VM1 A;  5B7C A;  1S3D A;  3KCM A;  1B4Q A;  1VF4 A;  4IW9 A;  2OKA A;  4L0U A;  1KBN A;  4XS1 A;  1W89 A;  4GWR A;  1U87 A;  2GST A;  4AGS A;  5A4V A;  1MDK A;  3TGZ A;  2B5Y A;  1GLQ A;  22GS A;  2C80 A;  1YY7 A;  2XBI A;  4HJ2 A;  3DYR A;  4LA1 A;  5ABR A;  3HJP A;  2CVK A;  3ZZX A;  5E59 A;  4BA7 A;  4IBP A;  1OC9 B;  1K0A A;  1K3Y A;  1OC8 A;  3LSZ A;  2V41 A;  3UOM A;  2HI7 A;  1Q4J A;  3FR3 A;  2FD3 A;  5DDL A;  4ML6 A;  3UMA A;  3RDW A;  3SWL A;  1X0R A;  2FWF A;  1ZGN A;  3Q19 A;  1BED A;  5ECM B;  3F9U A;  2DC5 A;  3A5W A;  3KTL A;  1OVN A;  3HVX A;  2GT5 A;  3DGQ A;  2YJH A;  2YOI A;  2FY6 A;  1A2J A;  4K1F A;  2IWT A;  1GSS A;  4MH2 A;  3IOS A;  1SD9 A;  4TKY A;  4EUY A;  2HZE A;  1FAA A;  3I43 A;  4GLT A;  1JZO A;  2LJR A;  4ZBA A;  2KP2 A;  2C3Q A;  3HJM A;  2LST A;  1M9B A;  3ZIV A;  1X9W B;  2XC2 A;  2L57 A;  4L5O A;  3HZ4 A;  1EZK A;  3KP8 A;  2QC7 A;  4TR0 A;  3C7M A;  1BYE A;  2YPM A;  3GA4 A;  1F2E A;  3IDV A;  2LNS A;  1AW9 A;  4KUN A;  1JZD A;  3DVW A;  2GT6 A;  3Q74 A;  4ZXG A;  3TJG A;  5CRH A;  1V40 A;  3GUS A;  1ACV A;  2FLS A;  5EY6 A;  2R6K A;  3QFB C;  4BVX B;  1SL2 B;  1T3B A;  2CAI A;  2WS2 A;  4CHS A;  1ZMA A;  3LG6 A;  2C4J A;  2HLS A;  2E2M A;  1M9A A;  1KTE A;  3A2W A;  2BTO T;  3A3T A;  19GS A;  1FB6 A;  1R26 A;  2C3T A;  2MZC A;  2RLI A;  5DAK A;  3CRT A;  2LV3 A;  3KEB A;  1FVJ A;  2WJU A;  3ZYW A;  1TRU A;  1CQG A;  4I2U A;  4IJI A;  2CX4 A;  5IQY A;  1B9Y C;  4N30 A;  2B1L A;  4IHU A;  3IRA A;  3TKS C;  3TOT A;  5KN3 A;  3HKR A;  5HR3 A;  3Q6O A;  1ZCP A;  5EVO A;  2QGV A;  1SYX A;  2JU5 A;  2L5O A;  9GSS A;  3H93 A;  4FYB A;  3APO A;  4MP4 A;  5DCH A;  2NTO A;  4ECB A;  3MNG A;  2AV4 A;  4NHZ A;  3UBL A;  5KN0 A;  3VK9 A;  3E0U A;  5LD0 A;  1OC3 A;  2YZU A;  4YH2 A;  2JZR A;  2C3N A;  2H1G A;  1EV4 A;  1O73 A;  3M0F A;  2L4Q A;  3VI5 A;  4MMM A;  2QSI A;  3EC3 A;  2DJ1 A;  2VD0 A;  1U3A A;  1R7H A;  2YWN A;  3GUR A;  1AIU A;  1ZOF A;  4MAB A;  1SU9 A;  3ISO A;  4N10 A;  4PNG A;  2HSH A;  5CAX A;  3VWU A;  3ERF A;  1EGO A;  4YQU A;  1ZYQ B;  4PUF C;  3P8W A;  5B6N A;  4CW9 A;  4OCE A;  5D93 A;  1GL8 A;  1XVW A;  2YWM A;  4KND A;  3GIX A;  1GNE A;  3UVH A;  1SJ6 A;  3F6F A;  2H01 A;  5ECR B;  4EDZ A;  3C1R A;  5ELA A;  1HYU A;  4XS6 A;  5HR2 A;  4GRF A;  4K6X A;  3FZ5 A;  5F0G A;  3UBK A;  1GSU A;  4TN8 A;  2JZS A;  3EU3 A;  3ZFB A;  3L9S A;  2WB9 A;  5F07 A;  3TKR A;  5CRE A;  2GSQ A;  4HU7 A;  4EVM A;  4G2E A;  1QK8 A;  2OA7 A;  3F0I A;  5CYY A;  1VF1 A;  4IQA A;  4LL4 B;  1AXD A;  4WXT A;  3TKS A;  3FKF A;  3GKN A;  2G2Q A;  3TB2 A;  4MZC A;  1ERT A;  1Z3E A;  5AN1 A;  5D96 A;  1O6J A;  3GH6 A;  3IR4 A;  4PUR A;  3HY2 A;  2FWH A;  1E6B A;  1FVK A;  1FHE A;  4ECC A;  2C0G A;  1DE2 A;  3HVS A;  4G0L A;  4J57 E;  5CRD A;  1HD2 A;  3QPM A;  5GST A;  1E2Y A;  4G10 A;  3I69 A;  4K7O A;  3N9J A;  2BJX A;  2C1Y A;  4X1U A;  4FIW A;  2RUF A;  4D73 A;  2H6Y A;  3FZA A;  3OR5 A;  1TW9 A;  2L59 A;  1ERW A;  1M2D A;  4XCS A;  1B9X C;  2L5L A;  4WET A;  1XOA A;  2ON5 A;  2H76 A;  1SKW B;  3PR8 A;  5JCU A;  3GX8 A;  4JBB A;  3EYT A;  4DEJ A;  1SL1 B;  5GAN D;  3TRX A;  5L71 A;  5JCW A;  2H70 A;  4F03 A;  1XBS A;  3ZMK A;  3M3M A;  1V98 A;  6GSW A;  1XW6 A;  5IIZ A;  1THO A;  5G5F A;  4NMU A;  1YKC A;  2YNX A;  3WT1 A;  5BMU A;  4ID0 A;  4KX4 A;  2OAC A;  4IEL A;  4IVF A;  3FR9 A;  1SJI A;  1VF2 A;  3RHB A;  1OAZ A;  2H0I A;  3D5J A;  3GN3 A;  5E4W A;  4AJ6 A;  1EP7 A;  2CVD A;  4POK A;  3W8J A;  1G6W A;  2DIZ A;  3FR6 A;  4BVY A;  3ZTL A;  4NV2 A;  5J4U A;  4ML1 A;  1TXX A;  2X99 A;  4G19 A;  1F6M C;  3IHQ A;  2FUG 2;  3E3E A;  3F63 A;  3DVX A;  5G1L A;  2J9H A;  1WIK A;  6GSS A;  3P90 A;  4EL1 A;  1Y25 A;  4HZ4 A;  1QXH A;  4IS0 A;  4EC0 A;  1QQ2 A;  3GKK A;  1WPI A;  5JWO B;  4Q5N A;  4BWS A;  2QKE A;  5D9T A;  3UAR A;  4MPF A;  2GGT A;  1TP9 A;  1K0N A;  3D4M A;  3W6G A;  1GSD A;  4QQ7 A;  5IOW A;  2MMN A;  4JZQ A;  5ELG A;  3KXO A;  3O3T A;  4PGT A;  2PN8 A;  3CSH A;  1VRS D;  2EIO A;  4ZIL A;  4PX1 A;  3VPT A;  2VL3 A;  1M0U A;  3VWW A;  3TJF A;  3J7Y k;  2DMM A;  2HRK A;  4GSS A;  1HNA A;  1M99 A;  1XCC A;  3D4T A;  3U6V A;  3EUR A;  1PN9 A;  3VFI A;  4IKH A;  3GHA A;  4ISD A;  5IPG A;  1ERV A;  4JR4 A;  4ILF A;  2PER A;  3C8E A;  2PMT A;  2KP1 A;  2LKU A;  3WD6 A;  4HS1 A;  2HFD A;  1SK0 A;  2YN1 A;  2NPB A;  1GTB A;  5D8I A;  4MA9 A;  5GSS A;  2HRN A;  2M72 A;  3HZ8 A;  2HSY A;  3KTB A;  2RM6 A;  4BVY B;  4I5Q A;  4O92 A;  1B48 A;  1G0T A;  3LWA A;  2F3M A;  4L0W A;  2VD1 A;  3ERG A;  4EF0 A;  1GH2 A;  2J23 A;  5IMV A;  1RW1 A;  3E9J B;  4QL7 A;  3BD2 A;  2R3X A;  2JL4 A;  2L6C A;  2YV7 A;  2LRN A;  3GH9 A;  1A8L A;  2FGX A;  6GSX A;  4ZL9 A;  3EIN A;  5IO0 A;  4LMV A;  4TR3 A;  5IMD A;  2OJL A;  3G7J A;  4J56 E;  1MTC A;  4O7H A;  1OYJ A;  3NZN A;  2N5A A;  1YQ1 A;  3F8U A;  2K8S A;  4F9Z A;  1XW9 A;  3VWV A;  3PGT A;  1AUC A;  1MDJ A;  2FCH A;  4HUA A;  2CT6 A;  2DJ2 A;  3BCI A;  3ZLP A;  3LQ7 A;  2H8L A;  1B8X A;  2YV9 A;  2FA4 A;  4HQS A;  4MH3 A;  4BWQ A;  1J0F A;  4XHM A;  1XW5 A;  4KAE A;  2OE1 A;  1XXU A;  2HRK B;  1U3I A;  4FH8 A;  2HSM A;  2NDO A;  3CSI A;  1OKD A;  3GSS A;  4MJA A;  2RUE A;  3GKM A;  4I8B A;  2I3Y A;  4K9Z A;  2X8H A;  2TRC P;  1DUG A;  2AAW A;  4F0C A;  2YWI A;  4YAP A;  4XIH A;  1V9W A;  2C0F A;  1XWK A;  2L4C A;  3D0Z A;  2CVB A;  2IFQ A;  1ZZY A;  2VL2 C;  4I2T A;  1S3A A;  2GLR A;  2IMD A;  2AB6 A;  3I9V 2;  3M1G A;  1YEP A;  2PGT A;  4JU5 A;  4K7I A;  4KH7 A;  1YDK A;  1MD3 A;  4AF2 A;  3F3Q A;  1SKR B;  4MZB A;  1TKD B;  1XWB A;  3KMO A;  3TJK A;  1O8X A;  5HFK A;  4POB A;  4V2L A;  3C73 A;  1R5P A;  1PA3 A;  1HQO A;  1GUK A;  5J9C A;  2F8A A;  4NPB A;  1NHO A;  4TOP A;  3HHV A;  1H4O A;  3QMX A;  3G7Y A;  2N5F A;  2FA8 A;  3GNJ A;  4K7N A;  5G2Z A;  2IPA A;  2GSR A;  3IV4 A;  3ZRE A;  3VLN A;  3H8Q A;  4ZB8 A;  2F51 A;  2IMI A;  4MF6 A;  3QAV A;  3IE3 A;  4XRD A;  4LLR A;  3H1N A;  2GTU A;  3WGX A;  3DIE A;  2WGR A;  4GXZ A;  2K9F A;  3BCK A;  3R2Q A;  3IA1 A;  4TXO A;  3IBH A;  4PXO A;  3TJB A;  6GSY A;  1QUW A;  5DQS A;  4E8H A;  1ERU A;  4MJE A;  4N0V A;  4WBJ A;  4ZB6 A;  3GTU A;  1YZX A;  3M8N A;  2HRF A;  5INY A;  4GQC A;  1T1V A;  5GAP D;  2IFQ B;  3GL3 A;  2IN3 A;  3WT2 A;  3APQ A;  1EEJ A;  4FYC A;  2DJJ A;  4ZIJ A;  1YF1 A;  1K0D A;  5IMF A;  1PGT A;  3M9J A;  1X5D A;  2VL2 A;  1N2A A;  3ZL5 A;  5F06 A;  1U6T A;  5DJM A;  3TKQ A;  2LEG A;  5KEJ A;  4BL7 A;  2HZE B;  4ACS A;  1TU8 A;  5H5S A;  2ZCT A;  3KJY A;  1DBY A;  4E8E A;  2YZH A;  2HQT A;  3IAM 2;  1UN2 A;  2YP6 A;  2IMF A;  4KF9 A;  5ECI B;  3IK7 A;  3KIJ A;  4MF5 A;  2LRC A;  1A8Y A;  2H0H A;  17GS A;  2K6V A;  1T4Z A;  11GS A;  2I4A A;  1YJ6 A;  2XHF A;  1V2A A;  6GST A;  3HXS A;  4LMW A;  1XOB A;  2DML A;  3IK9 A;  4F82 A;  5G30 A;  2V6K A;  4XS4 A;  5GZZ B;  2DJ3 A;  3DD3 A;  5DAK B;  1O7U A;  5ID2 A;  5ECO B;  2JSZ A;  3UIW A;  3LYP A;  3HDC A;  1TI1 A;  3WGD A;  4AJ7 A;  1TRV A;  7GSS A;  2F9S A;  3DKS A;  3APS A;  1GNW A;  5J3R A;  3TKS E;  2VLU A;  2MBS A;  3CXG A;  2CA8 A;  1YKA A;  2KUC A;  3GTU B;  4USS A;  3GFK A;  2I9H A;  4X0X A;  5IOX A;  5FWG A;  2EC4 A;  3QOU A;  1EWX A;  2VAF A;  1QMV A;  3LYK A;  4EDY A;  2REM A;  1K0C A;  2VL9 A;  4OCF A;  1U88 A;  3VWX A;  2IL3 A;  2VCZ A;  2EIQ A;  2H75 A;  3TRP A;  1G7E A;  3GRX A;  3ZIJ A;  4IGJ A;  2CZ2 A;  3H79 A;  4G0K A;  1HNC A;  2DJ0 A;  1TU7 A;  4ZL7 A;  3QAG A;  5DBQ A;  2KLX A;  1PKZ A;  4MZW A;  1WMJ A;  3LJR A;  1SJZ A;  2JZT A;  1TOF A;  2A4V A;  5AGY A;  1B4P A;  5ECL B;  1T8E B;  4N11 A;  2VCQ A;  4NAX A;  3WGE A;  4WF5 A;  3FY7 A;  2CQ9 A;  2H0G A;  2HRA A;  1EP8 A;  2V1M A;  1F9M A;  5HQP A;  4TVE A;  3FRC A;  3I6A A;  4FYU A;  4XS4 B;  4OMV A;  1X5E A;  3ME8 A;  1GP1 A;  2NVL A;  1GUM A;  5D9X A;  1Z7P A;  5ID2 B;  4Z7X A;  2NBS A;  2B5X A;  4MJC A;  4OFN A;  1EGR A;  1LU4 A;  3BJ5 A;  1R5A A;  4ZBB A;  2VLV A;  5G31 A;  2OE0 A;  3FEU A;  3LFL A;  1Q98 A;  1JHB A;  1TI3 A;  3EWL A;  2YCD A;  2XPE A;  4PNF A;  3ED3 A;  3UL3 A;  3CTF A;  4IN0 A;  18GS A;  2CZ3 A;  4OFT A;  1LBK A;  3ZIT A;  5COH A;  1W4V A;  5DAL A;  4KW6 A;  3BBY A;  4PQH A;  2DIY A;  1XWG A;  5C04 A;  4ZB9 A;  4KDX A;  4DSR A;  6GSV A;  5J5N A;  4KDY A;  3IC4 A;  12GS A;  3KGK A;  3U5R E;  3K8N A;  3HJO A;  3N5O A;  3GMF A;  1J08 A;  4WBR D;  3CMI A;  4OO4 A;  4D73 B;  5AIS A;  2XBQ A;  5FT3 A;  1X9M B;  3PH9 A;  2PUK C;  3DWV A;  2IME A;  3KD0 A;  2X64 A;  3D6I A;  1QGV A;  2V32 A;  3US3 A;  2UZ8 A;  4P3Y B;  5KN1 A;  4FO5 A;  2AYT A;  2GQL A;  5B6M A;  3PPU A;  1AQX A;  1PL2 A;  2CV4 A;  3RPP A;  2L6D A;  4MPG A;  2H6Z A;  1NM3 A;  5IMC A;  4KSM A;  2N5B A;  4RI7 A;  2HE3 A;  3MDK A;  1GLP A;  4AJ8 A;  4HQZ A;  3L0H A;  1JZR A;  2CAQ A;  2M46 A;  5B8A A;  2CX3 A;  4KCE A;  3BOA A;  3KZQ A;  2GZZ A;  2X8C A;  3LOR A;  4MJB A;  5J41 A;  4LL1 B;  2OAD A;  5ECN B;  1TTZ A;  2E0Q A;  1GTU A;  1ON4 A;  2HZF A;  1Z9H A;  2F8F A;  3GST A;  3HVV A;  1X9S B;  2MBT A;  3GX0 A;  1WE0 A;  3QFA C;  5DAL B;  5A4W A;  1XVQ A;  1SD8 A;  3H4K A;  1SEN A;  3TRQ A;  3DML A;  3HA9 A;  2JAD A;  3J7Y b;  4OWY A;  2H74 A;  1GWC A;  3QAW A;  3RAZ A;  1AQV A;  2OE3 A;  1A2L A;  3P7X A;  1O8W A;  5EPF A;  5D9W A;  2GQK A;  1T4Y A;  3KMN A;  1G6Y A;  1FOV A;  4MLY A;  2DJK A;  3M9K A;  3CRU A;  3O76 A;  8GSS A;  3WYW A;  3G7I A;  3ZVJ D;  2P5R A;  1WWJ A;  2V6O A;  3D21 A;  1GSY A;  5JWQ B;  5AIV A;  5HR0 A;  2C0D A;  3ZRD A;  2GQM A;  3QR6 A;  2HXK A;  1SYR A;  1X5C A;  1J9B A;  4BVX A;  1M7T A;  20GS A;  4BPY A;  1TK8 B;  2IIY A;  13GS A;  1I5G A;  5CRW A;  2K18 A;  4PQI A;  1I9D A;  1BJX A;  3UVT A;  1PX7 A;  2PWJ A;  4K0N A;  1XWC A;  4GQF A;  2OBK A;  2WZ9 A;  2H73 A;  5IMZ A;  4EXJ A;  1XIY A;  5JWR B;  1Z6N A;  4Q5Q A;  4IJ3 A;  1ILO A;  1K3O A;  1URM A;  2B7J A;  3TJJ A;  4DSS A;  1OE8 A;  4H86 A;  5CRG A;  3UJ1 A;  1PMT A;  4IQ1 A;  1ST9 A;  3ZFL A;  3ME7 A;  1FW1 A;  1JLW A;  1PSQ A;  4RI6 A;  1KEB A;  4JED A;  5DQY A;  3DRN A;  3GV1 A;  5CP1 A;  1GTI A;  1SK2 A;  2LQQ A;  2MYG A;  2C8U A;  3VUR A;  3LEF A;  3V1W A;  4ULX A;  2JAC A;  1K3L A;  3DEX A;  2LRT A;  4ZL8 A;  3PIN A;  4WKW A;  2O87 A;  1M2B A;  1TRS A;  1XZO A;  1IYI A;  4DVC A;  1C72 A;  2WFC A;  2A2S A;  4TR4 A;  4V2N A;  3QCP A;  3F6D A;  4K0G A;  3P2A A;  5IMA A;  2MMA A;  2DBC A;  3FK8 A;  1GSF A;  4KDU A;  5H5R A;  2VCV A;  2WUL A;  2VO4 A;  4K2D A;  3IC8 A;  2H71 A;  5HFI A;  2WDU A;  3W8S A;  1V57 A;  1A24 A;  2H19 A;  4WEY A;  3CBU A;  2HSM B;  2HNL A;  4NV5 A;  1XFL A;  4HZ2 A;  4XRA A;  1GSE A;  4NXI A;  2LJK A;  2H1A A;  3IPZ A;  1PL1 A;  1NW2 A;  4JRR A;  3KM6 A;  4G9H A;  1KNG A;  3LXZ A;  4ECI A;  3F4S A;  5A4U A;  1R4W A;  2R2J A;  3R3E A;  5B8B A;  2BMX A;  1F3A A;  3EMX A;  2P5Q A;  2H1D A;  2O85 A;  2G0F A;  1HNB A;  4DSS B;  1Z7R A;  1A0R P;  4ZBD A;  3NOF A;  1CQH A;  2R5G A;  4Q5R A;  1RQM A;  3F3R A;  1WJK A;  2VIM A;  4CDO A;  2MMO A;  3TKP A;  5IM9 A;  2YJ7 A;  3IAS 2;  2R37 A;  2VM2 A;  1TRW A;  1ABA A;  2FWG A;  3EVI A;  2B1K A;  3D22 A;  3C1S A;  4KSO A;  3FHK A;  1G7O A;  1H75 A;  2O89 A;  4K8M A;  4DSQ A;  1IYH A;  2YWO A; 
#chains in the Genus database with same CATH topology
 1GSQ A;  4V1A p;  5H5Q A;  1DE1 A;  5A5K A;  2KHP A;  2R4V A;  3GKX A;  4QL9 A;  2H72 A;  4XTS A;  4OO5 A;  3TDG A;  1GUH A;  5A5H B;  1VF3 A;  3FYG A;  2LS5 A;  3EE2 A;  3RHC A;  2ON7 A;  2LJA A;  2GDR A;  3CSJ A;  4X43 A;  1T7P B;  2E2G A;  4NWY A;  3TUE A;  3L9V A;  1T00 A;  2P31 A;  4PQ1 A;  3GL5 A;  4GCI A;  4KGI A;  2O8V B;  1TK0 B;  1TDI A;  3GYK A;  1AAZ A;  2TRX A;  4TRX A;  3LGC A;  4HI7 A;  4I97 A;  5F05 A;  2FWE A;  4HDE A;  4TW5 A;  1K0B A;  4V1A g;  5EL8 A;  4RQX A;  4TXO B;  4YAV A;  4YQV A;  1WP0 A;  4YKG A;  1MEK A;  3F4R A;  4EO3 A;  3CTG A;  2B3S A;  3DXB A;  3L4N A;  2QA2 A;  1S3C A;  2FNO A;  4IP6 A;  1XWA A;  2Z9S A;  3F4T A;  1JFU A;  3KP9 A;  4N0Z A;  1JLV A;  1TJD A;  2GZP A;  1GUL A;  1BF5 A;  1BQ7 A;  5IO2 A;  3IHG A;  1UC7 A;  1M2A A;  1PD2 1;  3FZ9 A;  4TR1 A;  4L5L A;  4WR4 A;  1OKT A;  1PKW A;  3KH9 A;  1SK1 A;  3ZML A;  5F8B A;  16GS A;  4BL7 B;  2YAN A;  5ECS A;  4MCU A;  3HD5 A;  1BG5 A;  2B6M A;  4AKX B;  1MDI A;  5D9V A;  1EV9 A;  5ECP B;  3EMP A;  1AC1 A;  2EIR A;  2VLT A;  1DSB A;  3FMW A;  4POL A;  3TCO A;  1XPV A;  4O5R A;  4F2I A;  1GRX A;  2EFE A;  3Q18 A;  3A2X A;  2HSN A;  5G1K A;  2ES7 A;  1SKS B;  1V58 A;  4HU9 A;  4L8E A;  2RM5 A;  5DVB A;  1EOG A;  4GSN A;  2R0G A;  1NSW A;  1N8J A;  2LNT A;  4GF0 A;  3TOU A;  3ERW A;  1NHY A;  3C71 A;  10GS A;  2D2Z A;  2MMZ A;  4JE1 A;  5DCG A;  4EKZ A;  3QD9 A;  2WCI A;  5FHI A;  3VPQ A;  2I1U A;  1FO5 A;  2FHE A;  1EOH A;  4NHW A;  1ZL9 A;  3RPN A;  4HJM A;  2AJQ B;  5D73 A;  1SVM A;  1TK5 B;  2IJY A;  5J9B A;  4V2M A;  4RQR A;  3LW9 A;  4WF4 A;  4EE0 A;  2P0G A;  5JCG A;  1MD4 A;  2DSA A;  1YF0 A;  1PX6 A;  1UVZ A;  2ZNM A;  2ZUP A;  1SL0 B;  3CQF A;  4OFM A;  2PBJ A;  5DJL A;  4TR1 B;  3RBT A;  3AY8 A;  3HYP A;  2I81 A;  1A2M A;  4G0I A;  4O32 A;  4KE3 A;  1K0O A;  1PRX A;  2RII A;  3UEM A;  1BX9 A;  2R0P A;  5HFG A;  4ECJ A;  3FW2 A;  4KB3 A;  2TIR A;  2PU9 C;  3EPT A;  3VI7 A;  5CO3 A;  5ECQ B;  4KA0 A;  1Y6E A;  1GTA A;  2GS3 A;  2HT9 A;  4YKF A;  1JZW A;  3FZ4 A;  4TXV A;  4HOJ A;  1I1I P;  3LXT A;  6GSU A;  3SBC A;  3L9U A;  3ZVJ A;  3IXR A;  4F0B A;  2PPT A;  3G9B A;  3MWH A;  2VCW A;  1RK4 A;  1ZYE A;  5LCZ A;  3HCZ A;  3MSZ A;  2PVO C;  2WRT A;  2H1B A;  2HSN B;  5ECK B;  5KN2 A;  1OE7 A;  2OT3 A;  5G5E A;  3JCM L;  4MF7 A;  4IP1 A;  4MNN A;  3NIV A;  2LQO A;  3QDN A;  2V2G A;  1WOU A;  2GZY A;  4HEA 2;  5C00 A;  1A0F A;  2VCT A;  3UAP A;  1USB A;  1F3B A;  2B5E A;  2OBI A;  1UA5 A;  14GS A;  4PUA A;  2VOC A;  1OC9 A;  1O85 A;  2IMK A;  4POM A;  5ENU A;  4MDC A;  2K8V A;  4KCA A;  2XPD A;  1PQN A;  2EFD A;  1LJR A;  1QFN A;  1AQW A;  1A23 A;  2GVP A;  3A2V A;  4OD7 A;  5IPH A;  1FG4 A;  3O6T A;  1K0M A;  2B7K A;  3EU4 A;  2DLX A;  1BAY A;  4J2F A;  4FQU A;  5ECH B;  3KH7 A;  2O7K A;  5AIX A;  5HR1 A;  4PTS A;  4YQM A;  5CNW A;  2H66 A;  2KOK A;  2LTK A;  1THX A;  2A2R A;  5LNK e;  2M80 A;  4GTU A;  1Z5Y E;  2H30 A;  4JR6 A;  4WR5 A;  3L78 A;  1PN0 A;  4RUV A;  4PHZ C;  2H6X A;  2X8G A;  3MAK A;  4I6X A;  1FB0 A;  1EEM A;  2VCX A;  4GST A;  2HYX A;  3S9F A;  2AHE A;  1ML6 A;  1O81 A;  1Z6M A;  2E7P A;  4MK3 A;  2PVQ A;  2LUS A;  2GSS A;  1BG1 A;  1YEX A;  1WRY A;  1VGL A;  2C0E A;  2ALB A;  2VUP A;  2EFC A;  2JSY A;  4Q5F A;  2AUV A;  3CYN A;  1F37 A;  2VM1 A;  5B7C A;  1S3D A;  3KCM A;  1B4Q A;  1VF4 A;  4IW9 A;  2OKA A;  4L0U A;  1KBN A;  4XS1 A;  1W89 A;  4GWR A;  2R0C A;  1U87 A;  2GST A;  4AGS A;  5A4V A;  1MDK A;  3TGZ A;  2B5Y A;  1GLQ A;  22GS A;  2C80 A;  1YY7 A;  2XBI A;  4HJ2 A;  3DYR A;  5J47 A;  4LA1 A;  5ABR A;  3HJP A;  2CVK A;  3ZZX A;  5E59 A;  4BA7 A;  4IBP A;  1OC9 B;  1K0A A;  1K3Y A;  1OC8 A;  3LSZ A;  5KOX A;  2V41 A;  5A1N A;  3UOM A;  2HI7 A;  1Q4J A;  3FR3 A;  2FD3 A;  5DDL A;  4ML6 A;  3UMA A;  3RDW A;  3SWL A;  1X0R A;  2FWF A;  1ZGN A;  1M3J A;  3Q19 A;  1BED A;  5ECM B;  2WW1 A;  3F9U A;  2DC5 A;  3A5W A;  3KTL A;  1OVN A;  3HVX A;  2GT5 A;  3DGQ A;  2YJH A;  3RFR C;  2YOI A;  2FY6 A;  1A2J A;  4K1F A;  2IWT A;  1GSS A;  4K5S A;  4MH2 A;  3IOS A;  1SD9 A;  4TKY A;  4EUY A;  2HZE A;  1FAA A;  3I43 A;  4GLT A;  1JZO A;  2LJR A;  4ZBA A;  2KP2 A;  2C3Q A;  3HJM A;  2LST A;  1M9B A;  3ZIV A;  1X9W B;  2XC2 A;  2L57 A;  4L5O A;  3HZ4 A;  1EZK A;  3KP8 A;  2QC7 A;  4TR0 A;  3C7M A;  1BYE A;  2YPM A;  3GA4 A;  1F2E A;  3IDV A;  2LNS A;  1AW9 A;  4KUN A;  1JZD A;  3DVW A;  2GT6 A;  3Q74 A;  4ZXG A;  3TJG A;  5CRH A;  4AKH A;  2WW0 A;  1V40 A;  3GUS A;  1ACV A;  2FLS A;  1XG8 A;  5EY6 A;  2R6K A;  3QFB C;  4BVX B;  1SL2 B;  1T3B A;  2CAI A;  2WS2 A;  4CHS A;  1ZMA A;  3LG6 A;  2C4J A;  2HLS A;  2E2M A;  1M9A A;  1KTE A;  3A2W A;  2BTO T;  3A3T A;  19GS A;  1FB6 A;  1R26 A;  2C3T A;  2MZC A;  2RLI A;  5DAK A;  3CRT A;  2LV3 A;  3KEB A;  1FVJ A;  2WJU A;  3ZYW A;  2WVZ A;  1TRU A;  1CQG A;  4I2U A;  4IJI A;  2CX4 A;  5IQY A;  1B9Y C;  4N30 A;  2B1L A;  4IHU A;  3IRA A;  3TKS C;  3TOT A;  5KN3 A;  3HKR A;  5A34 A;  5HR3 A;  3Q6O A;  1ZCP A;  5EVO A;  2DKI A;  1SYX A;  2QGV A;  2JU5 A;  2L5O A;  9GSS A;  3H93 A;  4FYB A;  3APO A;  4MP4 A;  5DCH A;  2NTO A;  4ECB A;  3MNG A;  2AV4 A;  4NHZ A;  3UBL A;  2O36 A;  5KN0 A;  3VK9 A;  3E0U A;  5LD0 A;  1OC3 A;  2YZU A;  4YH2 A;  2JZR A;  2C3N A;  2H1G A;  1EV4 A;  1O73 A;  3M0F A;  2L4Q A;  3VI5 A;  4MMM A;  5J4Y A;  2QSI A;  3EC3 A;  2DJ1 A;  2VD0 A;  1U3A A;  1R7H A;  2YWN A;  3GUR A;  1AIU A;  1ZOF A;  4MAB A;  1SU9 A;  3ISO A;  4N10 A;  4PNG A;  2HSH A;  5CAX A;  3VWU A;  3ERF A;  1EGO A;  4YQU A;  1ZYQ B;  4PUF C;  3P8W A;  5B6N A;  4CW9 A;  4OCE A;  5D93 A;  1GL8 A;  1XVW A;  2YWM A;  4KND A;  3GIX A;  1GNE A;  3UVH A;  1SJ6 A;  2O3E A;  3F6F A;  2H01 A;  5ECR B;  4EDZ A;  3C1R A;  5ELA A;  1HYU A;  4XS6 A;  5HR2 A;  4GRF A;  4K6X A;  3FZ5 A;  5F0G A;  3UBK A;  1GSU A;  4TN8 A;  2JZS A;  3EU3 A;  3ZFB A;  3L9S A;  2WB9 A;  5F07 A;  3TKR A;  5CRE A;  2GSQ A;  4HU7 A;  4EVM A;  5A34 B;  4G2E A;  1QK8 A;  1M3I A;  2OA7 A;  3F0I A;  5CYY A;  1VF1 A;  4IQA A;  4LL4 B;  1AXD A;  4WXT A;  3TKS A;  3FKF A;  3GKN A;  2G2Q A;  3TB2 A;  4MZC A;  1ERT A;  1Z3E A;  5AN1 A;  5D96 A;  1O6J A;  3GH6 A;  3IR4 A;  4PUR A;  3HY2 A;  2FWH A;  1E6B A;  1FVK A;  1FHE A;  4PI0 C;  4ECC A;  2C0G A;  1DE2 A;  3HVS A;  4G0L A;  4J57 E;  4E68 A;  5CRD A;  1HD2 A;  3QPM A;  4Z2R A;  5GST A;  1E2Y A;  4HSC X;  4G10 A;  3I69 A;  3MYD A;  4K7O A;  3N9J A;  2BJX A;  2C1Y A;  4X1U A;  4FIW A;  4AKG A;  2RUF A;  4D73 A;  2H6Y A;  3FZA A;  3OR5 A;  1TW9 A;  2L59 A;  1ERW A;  1M2D A;  4XCS A;  1B9X C;  2L5L A;  4WET A;  1XOA A;  2ON5 A;  2H76 A;  1SKW B;  3PR8 A;  5JCU A;  3GX8 A;  1SVL A;  4JBB A;  3EYT A;  4DEJ A;  1SL1 B;  5GAN D;  3TRX A;  5L71 A;  5JCW A;  2H70 A;  4F03 A;  1XBS A;  3ZMK A;  3M3M A;  1V98 A;  6GSW A;  1XW6 A;  5IIZ A;  1THO A;  5G5F A;  4NMU A;  1YKC A;  2YNX A;  3WT1 A;  4K2X A;  5BMU A;  4ID0 A;  4KX4 A;  2OAC A;  4IEL A;  2X4A A;  4IVF A;  3FR9 A;  1SJI A;  1VF2 A;  3RHB A;  1OAZ A;  2H0I A;  3D5J A;  3GN3 A;  5J40 A;  5E4W A;  4AJ6 A;  1EP7 A;  1YEW C;  2CVD A;  4POK A;  5BRT A;  3W8J A;  1G6W A;  2DIZ A;  3FR6 A;  4BVY A;  3ZTL A;  4NV2 A;  5J4U A;  4ML1 A;  1TXX A;  2X99 A;  4G19 A;  1F6M C;  3IHQ A;  2FUG 2;  3E3E A;  3F63 A;  3DVX A;  5G1L A;  2J9H A;  1WIK A;  6GSS A;  3P90 A;  4EL1 A;  1Y25 A;  4HZ4 A;  1QXH A;  4IS0 A;  4EC0 A;  1QQ2 A;  3GKK A;  1YVL A;  1WPI A;  5JWO B;  4Q5N A;  4BWS A;  2QKE A;  5D9T A;  3UAR A;  4MPF A;  2GGT A;  2UV8 G;  1TP9 A;  1K0N A;  4X4J A;  3D4M A;  3W6G A;  1GSD A;  4QQ7 A;  5IOW A;  2MMN A;  4JZQ A;  5ELG A;  4EIQ A;  3KXO A;  3O3T A;  4PGT A;  2PN8 A;  3CSH A;  1VRS D;  2EIO A;  4ZIL A;  4PX1 A;  3VPT A;  2VL3 A;  1M0U A;  3VWW A;  3TJF A;  3J7Y k;  2DMM A;  2HRK A;  4GSS A;  1HNA A;  1M99 A;  1XCC A;  3D4T A;  3U6V A;  4W66 A;  3EUR A;  1PN9 A;  3VFI A;  4IKH A;  3GHA A;  4ISD A;  5IPG A;  4GDF A;  1ERV A;  4JR4 A;  4ILF A;  2PER A;  3C8E A;  2PMT A;  2KP1 A;  2LKU A;  3WD6 A;  4HS1 A;  2HFD A;  1SK0 A;  2YN1 A;  2NPB A;  1GTB A;  4O5U A;  5D8I A;  4MA9 A;  5GSS A;  2HRN A;  1SVO A;  2M72 A;  3HZ8 A;  5KOW A;  2HSY A;  3KTB A;  2RM6 A;  4BVY B;  4I5Q A;  4O92 A;  1B48 A;  1G0T A;  3LWA A;  2F3M A;  4L0W A;  2VD1 A;  3ERG A;  4EF0 A;  1GH2 A;  2J23 A;  5IMV A;  1RW1 A;  3E9J B;  4QL7 A;  3BD2 A;  2R3X A;  2JL4 A;  2L6C A;  2YV7 A;  2LRN A;  3GH9 A;  1A8L A;  2FGX A;  6GSX A;  4ZL9 A;  3EIN A;  5IO0 A;  4LMV A;  4TR3 A;  5IMD A;  2OJL A;  3G7J A;  4J56 E;  1MTC A;  4O7H A;  1OYJ A;  3NZN A;  2N5A A;  1YQ1 A;  3F8U A;  2K8S A;  3MIX A;  4F9Z A;  1XW9 A;  3HMJ G;  2EFH A;  1S4B P;  3VWV A;  3PGT A;  1AUC A;  1MDJ A;  2FCH A;  4HUA A;  2CT6 A;  2DJ2 A;  3BCI A;  3ZLP A;  3LQ7 A;  2H8L A;  1B8X A;  2YV9 A;  2FA4 A;  4HQS A;  4MH3 A;  4BWQ A;  1J0F A;  4XHM A;  1XW5 A;  4KAE A;  2OE1 A;  1XXU A;  2HRK B;  1U3I A;  2WW2 A;  4FH8 A;  1Y1U A;  2HSM A;  2NDO A;  3CSI A;  1OKD A;  3GSS A;  4MJA A;  2RUE A;  3GKM A;  4I8B A;  2I3Y A;  4K9Z A;  2X8H A;  2TRC P;  1DUG A;  2AAW A;  4FXY P;  4F0C A;  2YWI A;  4YAP A;  4XIH A;  1V9W A;  2C0F A;  1XWK A;  2L4C A;  3D0Z A;  2CVB A;  2IFQ A;  1ZZY A;  2VL2 C;  1S3R A;  4I2T A;  1S3A A;  2GLR A;  2IMD A;  2AB6 A;  3I9V 2;  4AKI A;  3M1G A;  1YEP A;  2PGT A;  4JU5 A;  4K7I A;  2O5V A;  4KH7 A;  1YDK A;  1MD3 A;  4AF2 A;  3F3Q A;  1SKR B;  4MZB A;  1TKD B;  1XWB A;  3KMO A;  3TJK A;  1O8X A;  5HFK A;  4POB A;  4V2L A;  3C73 A;  1R5P A;  1PA3 A;  1HQO A;  1GUK A;  4N3Z A;  5J9C A;  2F8A A;  4NPB A;  1NHO A;  4TOP A;  3HHV A;  1H4O A;  3QMX A;  3G7Y A;  4O5Q A;  2N5F A;  2FA8 A;  3GNJ A;  4K7N A;  5G2Z A;  2A4H A;  2IPA A;  2GSR A;  3IV4 A;  3ZRE A;  3VLN A;  3H8Q A;  4ZB8 A;  2F51 A;  2IMI A;  4MF6 A;  3QAV A;  3IE3 A;  4XRD A;  4LLR A;  3H1N A;  2DKH A;  2GTU A;  3WGX A;  3DIE A;  2WGR A;  4GXZ A;  2K9F A;  3BCK A;  3R2Q A;  3IA1 A;  4QMK A;  3IBH A;  4PXO A;  4TXO A;  3TJB A;  6GSY A;  1QUW A;  5DQS A;  4E8H A;  1ERU A;  4MJE A;  4N0V A;  2H1L A;  4WBJ A;  4ZB6 A;  5A1N B;  3GTU A;  1YZX A;  3M8N A;  2HRF A;  5INY A;  4GQC A;  1T1V A;  5GAP D;  2IFQ B;  3GL3 A;  2IN3 A;  3WT2 A;  3APQ A;  1EEJ A;  4FYC A;  2DJJ A;  4ZIJ A;  1YF1 A;  1K0D A;  5IMF A;  1PGT A;  3M9J A;  1X5D A;  2VL2 A;  1N2A A;  3ZL5 A;  5F06 A;  1U6T A;  5DJM A;  3TKQ A;  2LEG A;  5KEJ A;  2WW3 A;  4BL7 A;  2HZE B;  4ACS A;  3TU3 B;  1TU8 A;  5H5S A;  2ZCT A;  3KJY A;  1DBY A;  4E8E A;  2YZH A;  2HQT A;  3IAM 2;  1UN2 A;  2YP6 A;  2IMF A;  4KF9 A;  5ECI B;  3IK7 A;  3KIJ A;  4MF5 A;  2LRC A;  1A8Y A;  2H0H A;  17GS A;  2K6V A;  1T4Z A;  11GS A;  2I4A A;  1YJ6 A;  2XHF A;  1V2A A;  6GST A;  1TXU A;  3HXS A;  4LMW A;  1XOB A;  2DML A;  3IK9 A;  4F82 A;  5G30 A;  2V6K A;  4XS4 A;  5GZZ B;  2DJ3 A;  3DD3 A;  5DAK B;  1O7U A;  5ID2 A;  5ECO B;  2JSZ A;  3UIW A;  3LYP A;  3HDC A;  1TI1 A;  3WGD A;  4AJ7 A;  1TRV A;  7GSS A;  2F9S A;  3DKS A;  3APS A;  4CY8 A;  1GNW A;  5J3R A;  3TKS E;  2VLU A;  2MBS A;  3CXG A;  2CA8 A;  1YKA A;  2KUC A;  3GTU B;  4USS A;  3GFK A;  2I9H A;  4X0X A;  5IOX A;  4Z2U A;  5FWG A;  2EC4 A;  3QOU A;  1EWX A;  2VAF A;  1QMV A;  3LYK A;  4EDY A;  2REM A;  1K0C A;  2VL9 A;  4OCF A;  1U88 A;  3VWX A;  2IL3 A;  2VCZ A;  2EIQ A;  2H75 A;  4K5R A;  3TRP A;  1G7E A;  3GRX A;  3ZIJ A;  4IGJ A;  3RGB C;  2CZ2 A;  3H79 A;  4G0K A;  1HNC A;  2DJ0 A;  1TU7 A;  4ZL7 A;  3QAG A;  5DBQ A;  2KLX A;  1PKZ A;  4MZW A;  1WMJ A;  3LJR A;  1SJZ A;  2JZT A;  1TOF A;  2A4V A;  5AGY A;  1B4P A;  5ECL B;  1T8E B;  4N11 A;  2VCQ A;  4NAX A;  3WGE A;  4WF5 A;  3FY7 A;  2CQ9 A;  2H0G A;  2HRA A;  1EP8 A;  2V1M A;  1F9M A;  5HQP A;  4TVE A;  3FRC A;  3I6A A;  4FYU A;  4XS4 B;  4OMV A;  1X5E A;  3ME8 A;  4Z2T A;  1GP1 A;  2NVL A;  1GUM A;  5D9X A;  1Z7P A;  5ID2 B;  4Z7X A;  2NBS A;  2B5X A;  4MJC A;  4OFN A;  1EGR A;  1LU4 A;  3BJ5 A;  1R5A A;  4ZBB A;  2VLV A;  5G31 A;  2OE0 A;  3FEU A;  3LFL A;  1Q98 A;  1JHB A;  1TI3 A;  3EWL A;  2YCD A;  2XPE A;  4PNF A;  3ED3 A;  3UL3 A;  3CTF A;  4IN0 A;  18GS A;  2CZ3 A;  4OFT A;  1LBK A;  3ZIT A;  5COH A;  1W4V A;  5DAL A;  4KW6 A;  3BBY A;  4PQH A;  2DIY A;  1XWG A;  5C04 A;  4ZB9 A;  4KDX A;  4DSR A;  6GSV A;  5J5N A;  4KDY A;  3IC4 A;  2A2P A;  1N25 A;  12GS A;  3KGK A;  4CY6 A;  3U5R E;  3K8N A;  3HJO A;  3N5O A;  3GMF A;  1J08 A;  4WBR D;  3CMI A;  4OO4 A;  4D73 B;  5AIS A;  2XBQ A;  5FT3 A;  1X9M B;  3PH9 A;  2PUK C;  3DWV A;  2IME A;  3KD0 A;  4ICY A;  2X64 A;  3D6I A;  1QGV A;  1ZYP A;  2V32 A;  3US3 A;  2UZ8 A;  4P3Y B;  5KN1 A;  4FO5 A;  2AYT A;  2GQL A;  5B6M A;  3PPU A;  1AQX A;  5BMU B;  4A5P A;  1PL2 A;  2CV4 A;  3RPP A;  2L6D A;  4MPG A;  2H6Z A;  1NM3 A;  5IMC A;  4KSM A;  2N5B A;  1ZYN A;  4RI7 A;  2HE3 A;  3MDK A;  1GLP A;  3HVN A;  4AJ8 A;  4HQZ A;  3L0H A;  1JZR A;  2CAQ A;  2M46 A;  5B8A A;  2CX3 A;  4KCE A;  3BOA A;  3KZQ A;  2GZZ A;  2X8C A;  3LOR A;  4MJB A;  5J41 A;  4LL1 B;  2OAD A;  5ECN B;  1TTZ A;  2E0Q A;  1GTU A;  1ON4 A;  4BIK A;  2HZF A;  1Z9H A;  2F8F A;  3GST A;  3HVV A;  1X9S B;  2MBT A;  3GX0 A;  1WE0 A;  3QFA C;  5DAL B;  5A4W A;  1XVQ A;  4PI2 C;  1SD8 A;  3H4K A;  1SEN A;  3TRQ A;  3DML A;  3HA9 A;  2JAD A;  3J7Y b;  4OWY A;  2H74 A;  1GWC A;  3QAW A;  3RAZ A;  1AQV A;  2OE3 A;  1A2L A;  3P7X A;  1O8W A;  5EPF A;  5D9W A;  2WZS A;  1T4Y A;  2GQK A;  3KMN A;  1G6Y A;  1FOV A;  4ZB7 A;  4MLY A;  2DJK A;  3M9K A;  3CRU A;  3O76 A;  8GSS A;  3WYW A;  3G7I A;  3ZVJ D;  2P5R A;  1WWJ A;  2V6O A;  3D21 A;  1GSY A;  5JWQ B;  5AIV A;  5HR0 A;  2C0D A;  3ZRD A;  3CHX C;  2GQM A;  2QA1 A;  3QR6 A;  2HXK A;  1SYR A;  1X5C A;  1J9B A;  4BVX A;  1M7T A;  20GS A;  1PFO A;  4BPY A;  1TK8 B;  2IIY A;  13GS A;  1I5G A;  5CRW A;  2K18 A;  4PQI A;  1I9D A;  1BJX A;  3UVT A;  1PX7 A;  2PWJ A;  4K0N A;  1XWC A;  4GQF A;  2OBK A;  2WZ9 A;  2H73 A;  5IMZ A;  5J4V A;  4EIP A;  4EXJ A;  1XIY A;  5JWR B;  1Z6N A;  4Q5Q A;  4IJ3 A;  1ILO A;  1K3O A;  1URM A;  2B7J A;  3TJJ A;  4DSS A;  1OE8 A;  4H86 A;  4AI6 A;  5CRG A;  3UJ1 A;  1PMT A;  4IQ1 A;  1ST9 A;  3ZFL A;  3ME7 A;  1FW1 A;  1JLW A;  1PSQ A;  4RI6 A;  1KEB A;  4G01 A;  4JED A;  5DQY A;  3DRN A;  3GV1 A;  3CWG A;  5CP1 A;  1GTI A;  1SK2 A;  2LQQ A;  2MYG A;  2C8U A;  2WVX A;  3VUR A;  3LEF A;  3V1W A;  4ULX A;  2JAC A;  1K3L A;  3DEX A;  2LRT A;  4ZL8 A;  2X49 A;  3PIN A;  4WKW A;  2O87 A;  1M2B A;  1TRS A;  1XZO A;  1IYI A;  4DVC A;  1C72 A;  2WFC A;  2A2S A;  4TR4 A;  4V2N A;  5A5H A;  3QCP A;  3F6D A;  2WVY A;  4K0G A;  3P2A A;  5IMA A;  2MMA A;  2DBC A;  3FK8 A;  1FOH A;  1GSF A;  4KDU A;  5H5R A;  2VCV A;  2WUL A;  2VO4 A;  4K2D A;  3IC8 A;  2H71 A;  5HFI A;  2WDU A;  3W8S A;  1V57 A;  1A24 A;  2H19 A;  4WEY A;  3CBU A;  2HSM B;  2HNL A;  4NV5 A;  1XFL A;  4HZ2 A;  4XRA A;  1GSE A;  4NXI A;  2LJK A;  2H1A A;  3IPZ A;  1PL1 A;  1NW2 A;  4JRR A;  3KM6 A;  4G9H A;  3A5I A;  1KNG A;  3LXZ A;  4ECI A;  3F4S A;  5A4U A;  1R4W A;  2R2J A;  3R3E A;  5B8B A;  2BMX A;  1F3A A;  3EMX A;  2P5Q A;  2H1D A;  2O85 A;  2G0F A;  1HNB A;  4DSS B;  1Z7R A;  1A0R P;  4ZBD A;  3NOF A;  1CQH A;  2R5G A;  4Q5R A;  1RQM A;  3F3R A;  1WJK A;  2VIM A;  4CDO A;  2MMO A;  3TKP A;  5IM9 A;  2YJ7 A;  3IAS 2;  2R37 A;  2VM2 A;  1TRW A;  1ABA A;  2FWG A;  3EVI A;  2B1K A;  3D22 A;  3C1S A;  4KSO A;  2WVX B;  2VKZ G;  3FHK A;  1G7O A;  1H75 A;  2O89 A;  4K8M A;  4DSQ A;  1IYH A;  2YWO A; 
#chains in the Genus database with same CATH homology
 1GSQ A;  4V1A p;  5H5Q A;  1DE1 A;  5A5K A;  2KHP A;  2R4V A;  3GKX A;  4QL9 A;  2H72 A;  4XTS A;  4OO5 A;  3TDG A;  1GUH A;  5A5H B;  1VF3 A;  3FYG A;  2LS5 A;  3EE2 A;  3RHC A;  2ON7 A;  2LJA A;  2GDR A;  3CSJ A;  4X43 A;  1T7P B;  2E2G A;  4NWY A;  3TUE A;  3L9V A;  1T00 A;  2P31 A;  4PQ1 A;  3GL5 A;  4GCI A;  4KGI A;  2O8V B;  1TK0 B;  1TDI A;  3GYK A;  1AAZ A;  2TRX A;  4TRX A;  3LGC A;  4HI7 A;  4I97 A;  5F05 A;  2FWE A;  4HDE A;  4TW5 A;  1K0B A;  4V1A g;  5EL8 A;  4RQX A;  4TXO B;  4YAV A;  4YQV A;  1WP0 A;  4YKG A;  1MEK A;  3F4R A;  4EO3 A;  3CTG A;  2B3S A;  3DXB A;  3L4N A;  2QA2 A;  1S3C A;  2FNO A;  4IP6 A;  1XWA A;  2Z9S A;  3F4T A;  1JFU A;  3KP9 A;  4N0Z A;  1JLV A;  1TJD A;  2GZP A;  1GUL A;  1BF5 A;  1BQ7 A;  5IO2 A;  3IHG A;  1UC7 A;  1M2A A;  1PD2 1;  3FZ9 A;  4TR1 A;  4L5L A;  4WR4 A;  1OKT A;  1PKW A;  3KH9 A;  1SK1 A;  3ZML A;  5F8B A;  16GS A;  4BL7 B;  2YAN A;  5ECS A;  4MCU A;  3HD5 A;  1BG5 A;  2B6M A;  4AKX B;  1MDI A;  5D9V A;  1EV9 A;  5ECP B;  3EMP A;  1AC1 A;  2EIR A;  2VLT A;  1DSB A;  3FMW A;  4POL A;  3TCO A;  1XPV A;  4O5R A;  4F2I A;  1GRX A;  2EFE A;  3Q18 A;  3A2X A;  2HSN A;  5G1K A;  2ES7 A;  1SKS B;  1V58 A;  4HU9 A;  4L8E A;  2RM5 A;  5DVB A;  1EOG A;  4GSN A;  2R0G A;  1NSW A;  1N8J A;  2LNT A;  4GF0 A;  3TOU A;  3ERW A;  1NHY A;  3C71 A;  10GS A;  2D2Z A;  2MMZ A;  4JE1 A;  5DCG A;  4EKZ A;  3QD9 A;  2WCI A;  5FHI A;  3VPQ A;  2I1U A;  1FO5 A;  2FHE A;  1EOH A;  4NHW A;  1ZL9 A;  3RPN A;  4HJM A;  2AJQ B;  5D73 A;  1SVM A;  1TK5 B;  2IJY A;  5J9B A;  4V2M A;  4RQR A;  3LW9 A;  4WF4 A;  4EE0 A;  2P0G A;  5JCG A;  1MD4 A;  2DSA A;  1YF0 A;  1PX6 A;  1UVZ A;  2ZNM A;  2ZUP A;  1SL0 B;  4OFM A;  2PBJ A;  5DJL A;  4TR1 B;  3RBT A;  3AY8 A;  3HYP A;  2I81 A;  1A2M A;  4G0I A;  4O32 A;  4KE3 A;  1K0O A;  1PRX A;  2RII A;  3UEM A;  1BX9 A;  2R0P A;  5HFG A;  4ECJ A;  3FW2 A;  4KB3 A;  2TIR A;  2PU9 C;  3EPT A;  3VI7 A;  5CO3 A;  5ECQ B;  4KA0 A;  1Y6E A;  1GTA A;  2GS3 A;  2HT9 A;  4YKF A;  1JZW A;  3FZ4 A;  4TXV A;  4HOJ A;  3LXT A;  6GSU A;  3SBC A;  3L9U A;  3ZVJ A;  3IXR A;  4F0B A;  2PPT A;  3G9B A;  3MWH A;  2VCW A;  1RK4 A;  1ZYE A;  5LCZ A;  3HCZ A;  3MSZ A;  2PVO C;  2WRT A;  2H1B A;  2HSN B;  5ECK B;  5KN2 A;  1OE7 A;  2OT3 A;  5G5E A;  3JCM L;  4MF7 A;  4IP1 A;  4MNN A;  3NIV A;  2LQO A;  3QDN A;  2V2G A;  1WOU A;  2GZY A;  4HEA 2;  5C00 A;  1A0F A;  2VCT A;  3UAP A;  1USB A;  1F3B A;  2B5E A;  2OBI A;  1UA5 A;  14GS A;  4PUA A;  2VOC A;  1OC9 A;  1O85 A;  2IMK A;  4POM A;  5ENU A;  4MDC A;  2K8V A;  4KCA A;  2XPD A;  1PQN A;  2EFD A;  1LJR A;  1QFN A;  1AQW A;  1A23 A;  2GVP A;  3A2V A;  4OD7 A;  5IPH A;  1FG4 A;  3O6T A;  1K0M A;  2B7K A;  3EU4 A;  2DLX A;  1BAY A;  4J2F A;  4FQU A;  5ECH B;  3KH7 A;  2O7K A;  5AIX A;  5HR1 A;  4PTS A;  4YQM A;  5CNW A;  2H66 A;  2KOK A;  2LTK A;  1THX A;  2A2R A;  5LNK e;  2M80 A;  4GTU A;  1Z5Y E;  2H30 A;  4JR6 A;  4WR5 A;  3L78 A;  1PN0 A;  4RUV A;  2H6X A;  2X8G A;  3MAK A;  4I6X A;  1FB0 A;  1EEM A;  2VCX A;  4GST A;  2HYX A;  3S9F A;  2AHE A;  1ML6 A;  1O81 A;  1Z6M A;  2E7P A;  4MK3 A;  2PVQ A;  2LUS A;  2GSS A;  1BG1 A;  1YEX A;  1WRY A;  1VGL A;  2C0E A;  2ALB A;  2VUP A;  2EFC A;  2JSY A;  4Q5F A;  2AUV A;  3CYN A;  1F37 A;  2VM1 A;  5B7C A;  1S3D A;  3KCM A;  1B4Q A;  1VF4 A;  4IW9 A;  2OKA A;  4L0U A;  1KBN A;  4XS1 A;  1W89 A;  4GWR A;  2R0C A;  1U87 A;  2GST A;  4AGS A;  5A4V A;  1MDK A;  3TGZ A;  2B5Y A;  1GLQ A;  22GS A;  2C80 A;  1YY7 A;  2XBI A;  4HJ2 A;  3DYR A;  5J47 A;  4LA1 A;  5ABR A;  3HJP A;  2CVK A;  3ZZX A;  5E59 A;  4BA7 A;  4IBP A;  1OC9 B;  1K0A A;  1K3Y A;  1OC8 A;  3LSZ A;  5KOX A;  2V41 A;  5A1N A;  3UOM A;  2HI7 A;  1Q4J A;  3FR3 A;  2FD3 A;  5DDL A;  4ML6 A;  3UMA A;  3RDW A;  3SWL A;  1X0R A;  2FWF A;  1ZGN A;  3Q19 A;  1BED A;  5ECM B;  3F9U A;  2DC5 A;  3A5W A;  3KTL A;  1OVN A;  3HVX A;  2GT5 A;  3DGQ A;  2YJH A;  2YOI A;  2FY6 A;  1A2J A;  4K1F A;  2IWT A;  1GSS A;  4K5S A;  4MH2 A;  3IOS A;  1SD9 A;  4TKY A;  4EUY A;  2HZE A;  1FAA A;  3I43 A;  4GLT A;  1JZO A;  2LJR A;  4ZBA A;  2KP2 A;  2C3Q A;  3HJM A;  2LST A;  1M9B A;  3ZIV A;  1X9W B;  2XC2 A;  2L57 A;  4L5O A;  3HZ4 A;  1EZK A;  3KP8 A;  2QC7 A;  4TR0 A;  3C7M A;  1BYE A;  2YPM A;  3GA4 A;  1F2E A;  3IDV A;  2LNS A;  1AW9 A;  4KUN A;  1JZD A;  3DVW A;  2GT6 A;  3Q74 A;  4ZXG A;  3TJG A;  5CRH A;  4AKH A;  1V40 A;  3GUS A;  1ACV A;  2FLS A;  5EY6 A;  2R6K A;  3QFB C;  4BVX B;  1SL2 B;  1T3B A;  2CAI A;  2WS2 A;  4CHS A;  1ZMA A;  3LG6 A;  2C4J A;  2HLS A;  2E2M A;  1M9A A;  1KTE A;  3A2W A;  2BTO T;  3A3T A;  19GS A;  1FB6 A;  1R26 A;  2C3T A;  2MZC A;  2RLI A;  5DAK A;  3CRT A;  2LV3 A;  3KEB A;  1FVJ A;  2WJU A;  3ZYW A;  1TRU A;  1CQG A;  4I2U A;  4IJI A;  2CX4 A;  5IQY A;  1B9Y C;  4N30 A;  2B1L A;  4IHU A;  3IRA A;  3TKS C;  3TOT A;  5KN3 A;  3HKR A;  5A34 A;  5HR3 A;  3Q6O A;  1ZCP A;  5EVO A;  2DKI A;  1SYX A;  2QGV A;  2JU5 A;  2L5O A;  9GSS A;  3H93 A;  4FYB A;  3APO A;  4MP4 A;  5DCH A;  2NTO A;  4ECB A;  3MNG A;  2AV4 A;  4NHZ A;  3UBL A;  5KN0 A;  3VK9 A;  3E0U A;  5LD0 A;  1OC3 A;  2YZU A;  4YH2 A;  2JZR A;  2C3N A;  2H1G A;  1EV4 A;  1O73 A;  3M0F A;  2L4Q A;  3VI5 A;  4MMM A;  5J4Y A;  2QSI A;  3EC3 A;  2DJ1 A;  2VD0 A;  1U3A A;  1R7H A;  2YWN A;  3GUR A;  1AIU A;  1ZOF A;  4MAB A;  1SU9 A;  3ISO A;  4N10 A;  4PNG A;  2HSH A;  5CAX A;  3VWU A;  3ERF A;  1EGO A;  4YQU A;  1ZYQ B;  4PUF C;  3P8W A;  5B6N A;  4CW9 A;  4OCE A;  5D93 A;  1GL8 A;  1XVW A;  2YWM A;  4KND A;  3GIX A;  1GNE A;  3UVH A;  1SJ6 A;  3F6F A;  2H01 A;  5ECR B;  4EDZ A;  3C1R A;  5ELA A;  1HYU A;  4XS6 A;  5HR2 A;  4GRF A;  4K6X A;  3FZ5 A;  5F0G A;  3UBK A;  1GSU A;  4TN8 A;  2JZS A;  3EU3 A;  3ZFB A;  3L9S A;  2WB9 A;  5F07 A;  3TKR A;  5CRE A;  2GSQ A;  4HU7 A;  4EVM A;  5A34 B;  4G2E A;  1QK8 A;  2OA7 A;  3F0I A;  5CYY A;  1VF1 A;  4IQA A;  4LL4 B;  1AXD A;  4WXT A;  3TKS A;  3FKF A;  3GKN A;  2G2Q A;  3TB2 A;  4MZC A;  1ERT A;  1Z3E A;  5AN1 A;  5D96 A;  1O6J A;  3GH6 A;  3IR4 A;  4PUR A;  3HY2 A;  2FWH A;  1E6B A;  1FVK A;  1FHE A;  4ECC A;  2C0G A;  1DE2 A;  3HVS A;  4G0L A;  4J57 E;  4E68 A;  5CRD A;  1HD2 A;  3QPM A;  4Z2R A;  5GST A;  1E2Y A;  4G10 A;  3I69 A;  3MYD A;  4K7O A;  3N9J A;  2BJX A;  2C1Y A;  4X1U A;  4FIW A;  4AKG A;  2RUF A;  4D73 A;  2H6Y A;  3FZA A;  3OR5 A;  1TW9 A;  2L59 A;  1ERW A;  1M2D A;  4XCS A;  1B9X C;  2L5L A;  4WET A;  1XOA A;  2ON5 A;  2H76 A;  1SKW B;  3PR8 A;  5JCU A;  3GX8 A;  1SVL A;  4JBB A;  3EYT A;  4DEJ A;  1SL1 B;  5GAN D;  3TRX A;  5L71 A;  5JCW A;  2H70 A;  4F03 A;  1XBS A;  3ZMK A;  3M3M A;  1V98 A;  6GSW A;  1XW6 A;  5IIZ A;  1THO A;  5G5F A;  4NMU A;  1YKC A;  2YNX A;  3WT1 A;  4K2X A;  5BMU A;  4ID0 A;  4KX4 A;  2OAC A;  4IEL A;  2X4A A;  4IVF A;  3FR9 A;  1SJI A;  1VF2 A;  3RHB A;  1OAZ A;  2H0I A;  3D5J A;  3GN3 A;  5J40 A;  5E4W A;  4AJ6 A;  1EP7 A;  2CVD A;  4POK A;  5BRT A;  3W8J A;  1G6W A;  2DIZ A;  3FR6 A;  4BVY A;  3ZTL A;  4NV2 A;  5J4U A;  4ML1 A;  1TXX A;  2X99 A;  4G19 A;  1F6M C;  3IHQ A;  2FUG 2;  3E3E A;  3F63 A;  3DVX A;  5G1L A;  2J9H A;  1WIK A;  6GSS A;  3P90 A;  4EL1 A;  1Y25 A;  4HZ4 A;  1QXH A;  4IS0 A;  4EC0 A;  1QQ2 A;  3GKK A;  1YVL A;  1WPI A;  5JWO B;  4Q5N A;  4BWS A;  2QKE A;  5D9T A;  3UAR A;  4MPF A;  2GGT A;  2UV8 G;  1TP9 A;  1K0N A;  4X4J A;  3D4M A;  3W6G A;  1GSD A;  4QQ7 A;  5IOW A;  2MMN A;  4JZQ A;  5ELG A;  4EIQ A;  3KXO A;  3O3T A;  4PGT A;  2PN8 A;  3CSH A;  1VRS D;  2EIO A;  4ZIL A;  4PX1 A;  3VPT A;  2VL3 A;  1M0U A;  3VWW A;  3TJF A;  3J7Y k;  2DMM A;  2HRK A;  4GSS A;  1HNA A;  1M99 A;  1XCC A;  3D4T A;  3U6V A;  4W66 A;  3EUR A;  1PN9 A;  3VFI A;  4IKH A;  3GHA A;  4ISD A;  5IPG A;  4GDF A;  1ERV A;  4JR4 A;  4ILF A;  2PER A;  3C8E A;  2PMT A;  2KP1 A;  2LKU A;  3WD6 A;  4HS1 A;  2HFD A;  1SK0 A;  2YN1 A;  2NPB A;  1GTB A;  4O5U A;  5D8I A;  4MA9 A;  5GSS A;  2HRN A;  1SVO A;  2M72 A;  3HZ8 A;  5KOW A;  2HSY A;  3KTB A;  2RM6 A;  4BVY B;  4I5Q A;  4O92 A;  1B48 A;  1G0T A;  3LWA A;  2F3M A;  4L0W A;  2VD1 A;  3ERG A;  4EF0 A;  1GH2 A;  2J23 A;  5IMV A;  1RW1 A;  3E9J B;  4QL7 A;  3BD2 A;  2R3X A;  2JL4 A;  2L6C A;  2YV7 A;  2LRN A;  3GH9 A;  1A8L A;  2FGX A;  6GSX A;  4ZL9 A;  3EIN A;  5IO0 A;  4LMV A;  4TR3 A;  5IMD A;  2OJL A;  3G7J A;  4J56 E;  1MTC A;  4O7H A;  1OYJ A;  3NZN A;  2N5A A;  1YQ1 A;  3F8U A;  2K8S A;  3MIX A;  4F9Z A;  1XW9 A;  3HMJ G;  2EFH A;  3VWV A;  3PGT A;  1AUC A;  1MDJ A;  2FCH A;  4HUA A;  2CT6 A;  2DJ2 A;  3BCI A;  3ZLP A;  3LQ7 A;  2H8L A;  1B8X A;  2YV9 A;  2FA4 A;  4HQS A;  4MH3 A;  4BWQ A;  1J0F A;  4XHM A;  1XW5 A;  4KAE A;  2OE1 A;  1XXU A;  2HRK B;  1U3I A;  4FH8 A;  1Y1U A;  2HSM A;  2NDO A;  3CSI A;  1OKD A;  3GSS A;  4MJA A;  2RUE A;  3GKM A;  4I8B A;  2I3Y A;  4K9Z A;  2X8H A;  2TRC P;  1DUG A;  2AAW A;  4F0C A;  2YWI A;  4YAP A;  4XIH A;  1V9W A;  2C0F A;  1XWK A;  2L4C A;  3D0Z A;  2CVB A;  2IFQ A;  1ZZY A;  2VL2 C;  4I2T A;  1S3A A;  2GLR A;  2IMD A;  2AB6 A;  3I9V 2;  4AKI A;  3M1G A;  1YEP A;  2PGT A;  4JU5 A;  4K7I A;  2O5V A;  4KH7 A;  1YDK A;  1MD3 A;  4AF2 A;  3F3Q A;  1SKR B;  4MZB A;  1TKD B;  1XWB A;  3KMO A;  3TJK A;  1O8X A;  5HFK A;  4POB A;  4V2L A;  3C73 A;  1R5P A;  1PA3 A;  1HQO A;  1GUK A;  4N3Z A;  5J9C A;  2F8A A;  4NPB A;  1NHO A;  4TOP A;  3HHV A;  1H4O A;  3QMX A;  3G7Y A;  4O5Q A;  2N5F A;  2FA8 A;  3GNJ A;  4K7N A;  5G2Z A;  2A4H A;  2IPA A;  2GSR A;  3IV4 A;  3ZRE A;  3VLN A;  3H8Q A;  4ZB8 A;  2F51 A;  2IMI A;  4MF6 A;  3QAV A;  3IE3 A;  4XRD A;  4LLR A;  3H1N A;  2DKH A;  2GTU A;  3WGX A;  3DIE A;  2WGR A;  4GXZ A;  2K9F A;  3BCK A;  3R2Q A;  3IA1 A;  4QMK A;  3IBH A;  4PXO A;  4TXO A;  3TJB A;  6GSY A;  1QUW A;  5DQS A;  4E8H A;  1ERU A;  4MJE A;  4N0V A;  2H1L A;  4WBJ A;  4ZB6 A;  5A1N B;  3GTU A;  1YZX A;  3M8N A;  2HRF A;  5INY A;  4GQC A;  1T1V A;  5GAP D;  2IFQ B;  3GL3 A;  2IN3 A;  3WT2 A;  3APQ A;  1EEJ A;  4FYC A;  2DJJ A;  4ZIJ A;  1YF1 A;  1K0D A;  5IMF A;  1PGT A;  3M9J A;  1X5D A;  2VL2 A;  1N2A A;  3ZL5 A;  5F06 A;  1U6T A;  5DJM A;  3TKQ A;  2LEG A;  5KEJ A;  4BL7 A;  2HZE B;  4ACS A;  3TU3 B;  1TU8 A;  5H5S A;  2ZCT A;  3KJY A;  1DBY A;  4E8E A;  2YZH A;  2HQT A;  3IAM 2;  1UN2 A;  2YP6 A;  2IMF A;  4KF9 A;  5ECI B;  3IK7 A;  3KIJ A;  4MF5 A;  2LRC A;  1A8Y A;  2H0H A;  17GS A;  2K6V A;  1T4Z A;  11GS A;  2I4A A;  1YJ6 A;  2XHF A;  1V2A A;  6GST A;  1TXU A;  3HXS A;  4LMW A;  1XOB A;  2DML A;  3IK9 A;  4F82 A;  5G30 A;  2V6K A;  4XS4 A;  5GZZ B;  2DJ3 A;  3DD3 A;  5DAK B;  1O7U A;  5ID2 A;  5ECO B;  2JSZ A;  3UIW A;  3LYP A;  3HDC A;  1TI1 A;  3WGD A;  4AJ7 A;  1TRV A;  7GSS A;  2F9S A;  3DKS A;  3APS A;  4CY8 A;  1GNW A;  5J3R A;  3TKS E;  2VLU A;  2MBS A;  3CXG A;  2CA8 A;  1YKA A;  2KUC A;  3GTU B;  4USS A;  3GFK A;  2I9H A;  4X0X A;  5IOX A;  4Z2U A;  5FWG A;  2EC4 A;  3QOU A;  1EWX A;  2VAF A;  1QMV A;  3LYK A;  4EDY A;  2REM A;  1K0C A;  2VL9 A;  4OCF A;  1U88 A;  3VWX A;  2IL3 A;  2VCZ A;  2EIQ A;  2H75 A;  4K5R A;  3TRP A;  1G7E A;  3GRX A;  3ZIJ A;  4IGJ A;  2CZ2 A;  3H79 A;  4G0K A;  1HNC A;  2DJ0 A;  1TU7 A;  4ZL7 A;  3QAG A;  5DBQ A;  2KLX A;  1PKZ A;  4MZW A;  1WMJ A;  3LJR A;  1SJZ A;  2JZT A;  1TOF A;  2A4V A;  5AGY A;  1B4P A;  5ECL B;  1T8E B;  4N11 A;  2VCQ A;  4NAX A;  3WGE A;  4WF5 A;  3FY7 A;  2CQ9 A;  2H0G A;  2HRA A;  1EP8 A;  2V1M A;  1F9M A;  5HQP A;  4TVE A;  3FRC A;  3I6A A;  4FYU A;  4XS4 B;  4OMV A;  1X5E A;  3ME8 A;  4Z2T A;  1GP1 A;  2NVL A;  1GUM A;  5D9X A;  1Z7P A;  5ID2 B;  4Z7X A;  2NBS A;  2B5X A;  4MJC A;  4OFN A;  1EGR A;  1LU4 A;  3BJ5 A;  1R5A A;  4ZBB A;  2VLV A;  5G31 A;  2OE0 A;  3FEU A;  3LFL A;  1Q98 A;  1JHB A;  1TI3 A;  3EWL A;  2YCD A;  2XPE A;  4PNF A;  3ED3 A;  3UL3 A;  3CTF A;  4IN0 A;  18GS A;  2CZ3 A;  4OFT A;  1LBK A;  3ZIT A;  5COH A;  1W4V A;  5DAL A;  4KW6 A;  3BBY A;  4PQH A;  2DIY A;  1XWG A;  5C04 A;  4ZB9 A;  4KDX A;  4DSR A;  6GSV A;  5J5N A;  4KDY A;  3IC4 A;  2A2P A;  1N25 A;  12GS A;  3KGK A;  4CY6 A;  3U5R E;  3K8N A;  3HJO A;  3N5O A;  3GMF A;  1J08 A;  4WBR D;  3CMI A;  4OO4 A;  4D73 B;  5AIS A;  2XBQ A;  5FT3 A;  1X9M B;  3PH9 A;  2PUK C;  3DWV A;  2IME A;  3KD0 A;  4ICY A;  2X64 A;  3D6I A;  1QGV A;  1ZYP A;  2V32 A;  3US3 A;  2UZ8 A;  4P3Y B;  5KN1 A;  4FO5 A;  2AYT A;  2GQL A;  5B6M A;  3PPU A;  1AQX A;  5BMU B;  4A5P A;  1PL2 A;  2CV4 A;  3RPP A;  2L6D A;  4MPG A;  2H6Z A;  1NM3 A;  5IMC A;  4KSM A;  2N5B A;  1ZYN A;  4RI7 A;  2HE3 A;  3MDK A;  1GLP A;  4AJ8 A;  4HQZ A;  3L0H A;  1JZR A;  2CAQ A;  2M46 A;  5B8A A;  2CX3 A;  4KCE A;  3BOA A;  3KZQ A;  2GZZ A;  2X8C A;  3LOR A;  4MJB A;  5J41 A;  4LL1 B;  2OAD A;  5ECN B;  1TTZ A;  2E0Q A;  1GTU A;  1ON4 A;  2HZF A;  1Z9H A;  2F8F A;  3GST A;  3HVV A;  1X9S B;  2MBT A;  3GX0 A;  1WE0 A;  3QFA C;  5DAL B;  5A4W A;  1XVQ A;  1SD8 A;  3H4K A;  1SEN A;  3TRQ A;  3DML A;  3HA9 A;  2JAD A;  3J7Y b;  4OWY A;  2H74 A;  1GWC A;  3QAW A;  3RAZ A;  1AQV A;  2OE3 A;  1A2L A;  3P7X A;  1O8W A;  5EPF A;  5D9W A;  2GQK A;  1T4Y A;  3KMN A;  1G6Y A;  1FOV A;  4ZB7 A;  4MLY A;  2DJK A;  3M9K A;  3CRU A;  3O76 A;  8GSS A;  3WYW A;  3G7I A;  3ZVJ D;  2P5R A;  1WWJ A;  2V6O A;  3D21 A;  1GSY A;  5JWQ B;  5AIV A;  5HR0 A;  2C0D A;  3ZRD A;  2GQM A;  2QA1 A;  3QR6 A;  2HXK A;  1SYR A;  1X5C A;  1J9B A;  4BVX A;  1M7T A;  20GS A;  4BPY A;  1TK8 B;  2IIY A;  13GS A;  1I5G A;  5CRW A;  2K18 A;  4PQI A;  1I9D A;  1BJX A;  3UVT A;  1PX7 A;  2PWJ A;  4K0N A;  1XWC A;  4GQF A;  2OBK A;  2WZ9 A;  2H73 A;  5IMZ A;  5J4V A;  4EIP A;  4EXJ A;  1XIY A;  5JWR B;  1Z6N A;  4Q5Q A;  4IJ3 A;  1ILO A;  1K3O A;  1URM A;  2B7J A;  3TJJ A;  4DSS A;  1OE8 A;  4H86 A;  4AI6 A;  5CRG A;  3UJ1 A;  1PMT A;  4IQ1 A;  1ST9 A;  3ZFL A;  3ME7 A;  1FW1 A;  1JLW A;  1PSQ A;  4RI6 A;  1KEB A;  4G01 A;  4JED A;  5DQY A;  3DRN A;  3GV1 A;  3CWG A;  5CP1 A;  1GTI A;  1SK2 A;  2LQQ A;  2MYG A;  2C8U A;  3VUR A;  3LEF A;  3V1W A;  4ULX A;  2JAC A;  1K3L A;  3DEX A;  2LRT A;  4ZL8 A;  2X49 A;  3PIN A;  4WKW A;  2O87 A;  1M2B A;  1TRS A;  1XZO A;  1IYI A;  4DVC A;  1C72 A;  2WFC A;  2A2S A;  4TR4 A;  4V2N A;  5A5H A;  3QCP A;  3F6D A;  4K0G A;  3P2A A;  5IMA A;  2MMA A;  2DBC A;  3FK8 A;  1FOH A;  1GSF A;  4KDU A;  5H5R A;  2VCV A;  2WUL A;  2VO4 A;  4K2D A;  3IC8 A;  2H71 A;  5HFI A;  2WDU A;  3W8S A;  1V57 A;  1A24 A;  2H19 A;  4WEY A;  3CBU A;  2HSM B;  2HNL A;  4NV5 A;  1XFL A;  4HZ2 A;  4XRA A;  1GSE A;  4NXI A;  2LJK A;  2H1A A;  3IPZ A;  1PL1 A;  1NW2 A;  4JRR A;  3KM6 A;  4G9H A;  3A5I A;  1KNG A;  3LXZ A;  4ECI A;  3F4S A;  5A4U A;  1R4W A;  2R2J A;  3R3E A;  5B8B A;  2BMX A;  1F3A A;  3EMX A;  2P5Q A;  2H1D A;  2O85 A;  2G0F A;  1HNB A;  4DSS B;  1Z7R A;  1A0R P;  4ZBD A;  3NOF A;  1CQH A;  2R5G A;  4Q5R A;  1RQM A;  3F3R A;  1WJK A;  2VIM A;  4CDO A;  2MMO A;  3TKP A;  5IM9 A;  2YJ7 A;  3IAS 2;  2R37 A;  2VM2 A;  1TRW A;  1ABA A;  2FWG A;  3EVI A;  2B1K A;  3D22 A;  3C1S A;  4KSO A;  2VKZ G;  3FHK A;  1G7O A;  1H75 A;  2O89 A;  4K8M A;  4DSQ A;  1IYH A;  2YWO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...