4MPFA

Crystal structure of human glutathione transferase theta-2, complex with inorganic phosphate, gsh free, target efi-507257
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
243
structure length
243
Chain Sequence
GLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAILIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLGPLIGVQVPKEKVERNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLAAWRGRVEAFLGAELCQEAHSIILSILEQAAKKTLPTPSPEAYQAMLLRIARIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase theta-2
publication title Crystal Structure of Human Glutathione S-Transferase Theta-2 (Target Efi-507257)
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 92
structure length 243
sequence length 243
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2013-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4mpfA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4mpfA01
1I9DA 1ST9A 2HRKB 3KXOA 1EV9A 4K0GA 2HSNB 2PN8A 3M9JA 2PBJA 5FWGA 1XPVA 2O8VB 4FO5A 2H74A 5GZZB 2OACA 4IHUA 4Q5FA 2H8LA 2V32A 1QFNA 2IWTA 4J57E 1TI1A 1SYXA 3QOUA 3UJ1A 4AGSA 20GSA 1WWJA 1TU8A 3EMXA 1TDIA 3V1WA 3FR3A 2XBQA 4K7OA 2TIRA 5H5SA 2P31A 2H6ZA 3F4SA 2HFDA 2H1AA 4G2EA 3TOTA 4ML1A 5IO0A 1TRUA 2GQMA 2CX3A 3U6VA 1HNBA 2N5AA 3BCIA 5HR0A 4XS4B 4IVFA 4JRRA 4HZ4A 2GSQA 1R5PA 2VM2A 3FZ4A 1MTCA 1ML6A 4G9HA 4BL7B 1FW1A 2VD0A 1W89A 3C1SA 1A2JA 4NWYA 3GRXA 4IS0A 5JWQB 3ERFA 3HYPA 2H01A 1O85A 2TRXA 3WGEA 3Q6OA 1DE2A 2VCTA 4IP1A 1EOHA 1Z5YE 3GUSA 4AJ8A 3QAGA 5CAXA 3IR4A 2V41A 3LEFA 4MA9A 2G2QA 4ID0A 1UC7A 1J0FA 1ILOA 2JADA 3UEMA 2FCHA 2CX4A 4KAEA 2L57A 1TRVA 1SJZA 2A4VA 4FYUA 4BVYA 1SD9A 1THXA 2IN3A 1YZXA 4X43A 5HR2A 4KCEA 2PUKC 4WR5A 3F4TA 3GV1A 2XC2A 2REMA 3H8QA 5D9VA 4IQAA 1KEBA 3DGQA 1XXUA 3VLNA 1U3AA 1Y25A 4LA1A 3GTUB 4PQIA 1A24A 3NOFA 1PD21 1NSWA 2H6XA 4EXJA 3MSZA 1V58A 4V2LA 1YEPA 2K8VA 4YQMA 1YQ1A 2I9HA 1Z7PA 4L8EA 1SK0A 2PU9C 1V9WA 2CV4A 4TRXA 1FVKA 4ECIA 12GSA 1OE7A 4TR0A 4RUVA 4BVXB 5IMZA 1BX9A 2C1YA 2NPBA 3A2VA 1B9YC 3GX8A 3DEXA 3Q19A 3O3TA 2MMAA 2H1DA 4KSMA 1TW9A 2MMZA 3A5WA 4MLYA 2CZ2A 1GWCA 3TCOA 2XPDA 2WCIA 3LG6A 1GSQA 5G5FA 5DQYA 1EEMA 4HDEA 1QXHA 1K0BA 2OA7A 2B1KA 4IBPA 1TK5B 3ISOA 3HJMA 3TJFA 3IE3A 4KB3A 3A2WA 3ZL5A 4BWQA 5E4WA 1BQ7A 1FOVA 1QGVA 3KH9A 1JZOA 4P3YB 1M7TA 3TRPA 1ZL9A 3KMOA 2BTOT 3O6TA 3GFKA 2XHFA 5A4WA 3BCKA 4KDXA 2OE1A 1S3DA 4KGIA 2ON7A 4EC0A 2I4AA 1T4ZA 4O7HA 3UAPA 1RK4A 3UL3A 1XWAA 1AW9A 3DXBA 1HNAA 5ABRA 2NDOA 16GSA 1XOBA 3KGKA 3GKXA 3LSZA 1BJXA 1MDIA 17GSA 2QSIA 4FH8A 4X1UA 3BOAA 3CBUA 4CHSA 2KLXA 4K2DA 2TRCP 2HZEA 3M8NA 3C73A 1X5CA 3EU4A 3F8UA 4HI7A 3M0FA 1GUHA 1SKRB 2YWNA 2FNOA 2HXKA 6GSWA 4ISDA 1ABAA 3A3TA 2IMKA 3H1NA 2GZYA 4YQUA 3GURA 4JE1A 3D21A 3LGCA 3F3RA 1HNCA 1A2LA 1NM3A 3APSA 2PERA 5ENUA 1OC3A 5ECNB 5CREA 3LJRA 4LL4B 1EV4A 5G1LA 4FYCA 1TP9A 3D6IA 3VI5A 2K8SA 2H73A 10GSA 3F3QA 5IOXA 3TUEA 5JWRB 1GSSA 4IJ3A 4GSSA 3HVXA 4KA0A 3GTUA 3TGZA 4K8MA 1G6WA 4K7IA 3GKNA 1O73A 1DBYA 3UVTA 5DDLA 4YAPA 3TKPA 1LU4A 1PRXA 1QMVA 4ZBBA 1E2YA 2L6CA 1QK8A 1ZOFA 4QL9A 2OKAA 4KW6A 2IL3A 3QD9A 2MYGA 3ZMLA 4QQ7A 2DJJA 4ULXA 1H4OA 4BVXA 2YPMA 1PA3A 2H76A 1THOA 4LMWA 2O85A 5B6MA 1Q98A 3GYKA 5DJLA 2FWHA 1YDKA 3F0IA 3IDVA 2HSHA 1B4PA 2LQOA 4NV2A 5GSTA 3MWHA 2VUPA 1K0MA 2LKUA 5DBQA 4FYBA 1SL2B 2LRTA 2YN1A 2B5XA 3VURA 3M3MA 4L5LA 3IAM2 5C04A 3EE2A 2B5YA 2LRNA 4ML6A 1WJKA 2CA8A 2GQKA 1U87A 4KE3A 1EP7A 3F9UA 2H66A 1XOAA 2AJQB 2VL9A 1EOGA 1WOUA 1KBNA 3QDNA 5IMVA 2O89A 2JL4A 3HZ4A 4OFTA 1BG5A 3KH7A 2GSRA 3FZAA 3WGDA 5HFIA 4EF0A 3A2XA 3UBKA 5D73A 2HRNA 2JU5A 4OD7A 3GX0A 3KEBA 2GGTA 2KP2A 2KP1A 3G9BA 2C4JA 5ELGA 4KSOA 2WDUA 4XCSA 2AV4A 1F6MC 5DQSA 4JU5A 1TXXA 4I2UA 3R2QA 1AQVA 2FUG2 1R4WA 2JACA 3IRAA 1OC9B 5F07A 3VWWA 3IBHA 6GSXA 1ACVA 3EINA 2M46A 5ECHB 4USSA 5IPHA 1GNWA 1GSUA 3DWVA 5DCHA 2I81A 4TR3A 2LSTA 4IN0A 2I1UA 3K8NA 2F9SA 1GSDA 1M0UA 4PXOA 1TK8B 2IFQA 2VIMA 4MF7A 2CAIA 4ECJA 4HQZA 4ILFA 3EVIA 1SYRA 4GQCA 3GH9A 3RDWA 2H1GA 1T3BA 4EVMA 1GSYA 2C0GA 4BWSA 1GTBA 1BEDA 1V98A 1X5DA 1O7UA 3HY2A 3PGTA 3TKSA 3D0ZA 4KNDA 2IPAA 5EL8A 3ZTLA 1TI3A 3FY7A 2LJRA 3QAWA 1PQNA 2RM6A 5A5KA 4H86A 1OVNA 2DMMA 4D73B 3I9V2 3C8EA 3APQA 4JEDA 2FY6A 5DVBA 4RI6A 3ME7A 6GSVA 2LRCA 2LUSA 4O5RA 6GSTA 2X8GA 3FZ5A 3D4MA 3BD2A 4EKZA 1AAZA 4L5OA 4EDZA 4GLTA 1TJDA 5JCWA 5HR3A 5BMUA 4MMMA 3D4TA 4QL7A 1MDJA 2F8AA 4GQFA 4XS6A 4MF5A 1FO5A 4DSSB 1WMJA 3E9JB 3HZ8A 3MNGA 3ZIJA 3G7IA 4DVCA 4HQSA 2H70A 1XFLA 1Z9HA 1G7OA 1TU7A 2L5LA 3VPTA 1XW9A 3HCZA 2HE3A 5DAKA 1NHOA 1RW1A 3HHVA 2EC4A 2GSTA 2WZ9A 2X64A 2R4VA 1KNGA 5B7CA 6GSYA 5F06A 2GQLA 3MAKA 1X9MB 1GNEA 5CRHA 1BAYA 2JSZA 3GNJA 2I3YA 4N0ZA 4F82A 2HSMB 3P7XA 3FEUA 2MMOA 4AJ7A 4AJ6A 2BMXA 5ECRB 4EO3A 4DSRA 1AC1A 5ECQB 3WT1A 5G2ZA 2B3SA 2CVKA 2C3NA 3E0UA 2R2JA 2VCVA 5KN1A 1JHBA 5DJMA 4KH7A 2F3MA 2F8FA 2AUVA 1S3AA 2PMTA 2FA8A 5L71A 2OBIA 1M99A 2R3XA 3FZ9A 3ERGA 3TJBA 1MEKA 1HQOA 2JSYA 2A2SA 3ZREA 2WGRA 2R37A 2B1LA 4G0KA 4CDOA 5KN0A 4IJIA 3W8SA 1VGLA 4N0VA 1PL1A 3N9JA 5E59A 4O32A 2P5QA 5IM9A 3RPNA 1XZOA 4TXOB 4ZBDA 2V2GA 1DUGA 4N10A 5F05A 5CRDA 1CQGA 1LBKA 1K0CA 3HVVA 4KF9A 5F0GA 4WXTA 3FW2A 4X0XA 1G0TA 2WULA 2FD3A 1F37A 3LQ7A 2ON5A 1A23A 2HRKA 4WF5A 1PKWA 3J7Yk 1SD8A 3C71A 3DVWA 4JBBA 4TR1B 3HXSA 2HNLA 2E2GA 1A8YA 3ZIVA 2YZUA 3GA4A 4PUFC 2X99A 5EY6A 1HD2A 5IQYA 3IK9A 2IMIA 1YJ6A 1SENA 2AYTA 3ZMKA 1QQ2A 2YV7A 2V6OA 1GUMA 5H5QA 2MZCA 3LORA 1DE1A 3WGXA 2XBIA 4EE0A 3QPMA 3RPPA 2HI7A 4IP6A 4YAVA 2FA4A 2FHEA 1SKWB 2R6KA 3CSJA 4XS4A 1XW5A 1AXDA 2RM5A 1USBA 4MZCA 1PX6A 4BL7A 2J9HA 1T8EB 3UARA 2K9FA 2NBSA 5A4VA 1S3CA 3BJ5A 1MDKA 3W8JA 2GZZA 4K1FA 3D5JA 2WFCA 5ID2B 4V2MA 1GRXA 1XWKA 3GKMA 4RQXA 3G7YA 2OE0A 1ZZYA 1EZKA 2GT6A 1R5AA 1YF1A 3DKSA 3CSHA 2MBTA 5AIXA 1C72A 3LYKA 3EWLA 5G31A 1FB6A 2LNTA 3G7JA 2PPTA 5DCGA 5ECOB 2IMDA 1W4VA 4N11A 19GSA 4PURA 5ECKB 5KEJA 5IMDA 3F6FA 3EURA 2EIRA 1O81A 3KIJA 1SL0B 5EVOA 4KDUA 4ZB8A 3LXZA 4MF6A 4KDYA 5ECPB 1PGTA 4PNGA 1ZGNA 3WYWA 3ED3A 4G10A 1EP8A 1RQMA 1F9MA 4XS1A 4NMUA 5B8BA 1TRSA 2DJKA 2L4CA 2YZHA 1U6TA 2LNSA 5IOWA 6GSUA 3N5OA 3O76A 3DIEA 1VF2A 3WT2A 2HRAA 3UVHA 2VOCA 1G7EA 2E0QA 2H71A 3Q18A 4PQHA 2YWIA 2LTKA 2P5RA 3QMXA 3LYPA 4GXZA 4OCFA 5IMCA 1GLPA 1N2AA 4L0WA 1GSEA 1SJ6A 5ECMB 3HDCA 2VL2A 4J56E 5KN2A 5J9BA 4TOPA 3P2AA 4G0LA 1FVJA 2LV3A 1X5EA 3U5RE 4HEA2 4ZL8A 2CVBA 2CZ3A 5J9CA 3IC8A 2RIIA 1X9WB 5IO2A 2J23A 3LFLA 3KZQA 3GSTA 2DJ0A 3IXRA 4I6XA 5LNKe 1VF3A 1OC8A 8GSSA 3FKFA 3TJGA 3CSIA 4XHMA 4OO5A 1CQHA 4V1Ap 3EMPA 5D96A 5IMFA 4ECCA 1ZYEA 2IMFA 22GSA 1URMA 3C1RA 1T4YA 3F6DA 5HFGA 1PKZA 4ZB9A 1O6JA 3J7Yb 2DC5A 1SK2A 2B6MA 3APOA 5LD0A 3PH9A 4NXIA 11GSA 3ERWA 4I8BA 3F63A 1H75A 2KHPA 4MPFA 4MH3A 2WS2A 2VLUA 2EIOA 2PVQA 1AIUA 2VCQA 4WBJA 1XW6A 1EWXA 4J2FA 3CMIA 5AISA 2JZRA 2L59A 4POBA 4F2IA 5JCGA 5JWOB 3TJJA 1Z6NA 5HFKA 2DJ2A 2YJHA 4MJEA 1AUCA 4MABA 4ZBAA 14GSA 1T1VA 2G0FA 4EDYA 5ID2A 2RUEA 5G5EA 2VLVA 2KUCA 1XIYA 3GSSA 5COHA 4BVYB 2PWJA 3TRXA 2VCZA 1G6YA 3H4KA 4OFMA 2CAQA 3TKRA 3GHAA 1I5GA 1SU9A 2BJXA 3PINA 3ZITA 3GL3A 3SWLA 2XPEA 4E8HA 1K0DA 3AY8A 4WR4A 3KP9A 3FR9A 4EUYA 3UIWA 4NHZA 1YEXA 2YWOA 4IKHA 4TW5A 1F3BA 4TXVA 4IQ1A 3QR6A 3E3EA 1GP1A 5JCUA 1V57A 5AN1A 2ZUPA 4Q5QA 5GAND 2B5EA 4JR4A 1GULA 1ON4A 2ALBA 2HQTA 4MH2A 3TRQA 4HJMA 3DRNA 1NHYA 1GUKA 5CRWA 5GAPD 4N30A 2VAFA 4ZB6A 3DYRA 3TOUA 1SL1B 4O92A 3ZVJA 3L9UA 3ZRDA 5KN3A 5G1KA 1B48A 2L4QA 3NZNA 2DJ1A 3TKSE 2YCDA 1V2AA 3GKKA 3IC4A 2DIZA 4MZBA 2VM1A 1VF4A 4V1Ag 4F03A 2VD1A 2K6VA 1FG4A 3CTFA 1JZDA 2H72A 2H0GA 4I5QA 4NPBA 3LXTA 3GH6A 2FLSA 3CRTA 4GF0A 2Z9SA 3W6GA 3TDGA 2FWEA 2JZSA 3EU3A 4WBRD 3DVXA 7GSSA 1JLVA 1GH2A 3HA9A 5CNWA 5CP1A 2GTUA 1VF1A 2VCXA 1N8JA 2KOKA 2P0GA 4AF2A 5B8AA 3FR6A 3UOMA 4NHWA 3KD0A 4Q5RA 2L6DA 2YWMA 1B4QA 1GTAA 1ZCPA 1BYEA 5GSSA 6GSSA 1J9BA 3R3EA 2C0FA 4ZL9A 3CRUA 4LMVA 1K3OA 2QKEA 4FIWA 3IV4A 4XIHA 1LJRA 4K0NA 3DMLA 2C80A 4MDCA 3IHQA 1Q4JA 3ME8A 5H5RA 2HZEB 3H93A 3F4RA 4MZWA 1EGRA 3L9SA 3IAS2 4ECBA 1JLWA 1KTEA 2N5FA 3I69A 1K3YA 2PGTA 1F3AA 2YP6A 1F2EA 3QAVA 4NV5A 2DJ3A 4K6XA 5IIZA 4LLRA 1SK1A 4XTSA 1GTIA 3KMNA 1SJIA 1R7HA 3ZFBA 1OC9A 3GN3A 18GSA 2CVDA 4POLA 5J3RA 3H79A 1PMTA 2QGVA 4MP4A 3WD6A 1FHEA 2GT5A 2GLRA 4WF4A 4YQVA 1Z3EA 3SBCA 2FWGA 5HR1A 4ZILA 4PQ1A 3BBYA 1WIKA 2VO4A 4KUNA 3KTBA 1OE8A 2D2ZA 2M72A 2YNXA 5CRGA 3TKQA 1J08A 4XRDA 3HVSA 4TKYA 1HYUA 3RHCA 5A4UA 2GS3A 2C3TA 4MJCA 2MBSA 5ECIB 5J41A 3KTLA 4HOJA 2C0EA 2OBKA 2CT6A 3VWVA 2DIYA 4D73A 5DALB 2OADA 4GWRA 4MCUA 2OE3A 4RI7A 2V6KA 1TK0B 1PSQA 4MJBA 13GSA 1GL8A 1EGOA 4WKWA 3ZFLA 2LQQA 2ZNMA 1YY7A 2H19A 5D9TA 3HJOA 5C00A 4PNFA 3ZLPA 1A8LA 2X8CA 2ZCTA 3HKRA 5J5NA 4JZQA 4GSTA 3VK9A 4YH2A 2YJ7A 4OO4A 2DBCA 2F51A 1GSFA 2VL2C 3NIVA 2VCWA 1YKAA 1K0NA 5IMAA 5ECSA 4I97A 2H6YA 3D22A 1M2AA 2JZTA 4PUAA 5D93A 4DSSA 5AIVA 5IPGA 2PVOC 2AAWA 1ZYQB 1A0FA 1B9XC 1U88A 3TB2A 4KCAA 1UA5A 1EEJA 2E2MA 3GL5A 4LL1B 1B8XA 1WPIA 3S9FA 1T7PB 1E6BA 2YANA 1Z6MA 1M9BA 1A0RP 1WP0A 4OCEA 2VL3A 1XWBA 1QUWA 5LCZA 1K0OA 3EYTA 1TOFA 3KP8A 1VRSD 3M1GA 9GSSA 4L0UA 3RAZA 3L4NA 1PX7A 3I6AA 2WRTA 1AQXA 4IGJA 1ERWA 4ZL7A 1XWGA 4G0IA 2HZFA 4ZIJA 3P90A 3CTGA 3US3A 2H0IA 4POKA 4CW9A 5HQPA 2HSMA 3KJYA 2LJAA 1XBSA 1XVQA 2C3QA 2LEGA 1A2MA 3VWUA 3L78A 4F0BA 4ZXGA 2B7JA 2IFQB 1R26A 2LJKA 1MD3A 3UMAA 2H75A 2RLIA 4RQRA 1JFUA 3PR8A 3VI7A 1MD4A 4WETA 2MMNA 1O8WA 3IOSA 1V40A 1NW2A 3RHBA 1Y6EA 1XCCA 5F8BA 4MPGA 2RUFA 1GTUA 3M9KA 1PL2A 1O8XA 5D9XA 2E7PA 2AHEA 1M2DA 4I2TA 2X8HA 3C7MA 3DD3A 4ACSA 3JCML 4PGTA 4TXOA 1ERVA 2C0DA 4NAXA 3IK7A 3VPQA 3EC3A 4GCIA 3L0HA 3ZZXA 1ERUA 3IA1A 5G30A 4F0CA 2R5GA 1YKCA 2GSSA 3OR5A 2WB9A 2B7KA 2IJYA 4POMA 1DSBA 2H0HA 4BPYA 3PPUA 2NTOA 1JZWA 4HU7A 1OKTA 5INYA 1X9SB 5D9WA 5FT3A 1M2BA 3L9VA 4TR1A 3GIXA 4HUAA 4JR6A 4MJAA 3TKSC 4OFNA 2DMLA 2HLSA 3ZYWA 5DALA 4E8EA 3P8WA 2O7KA 4TVEA 2AB6A 4DSQA 4MK3A 1UN2A 2M80A 2VLTA 2EIQA 4HZ2A 5ECLB 5ELAA 1FAAA 4K9ZA 3FYGA 4WEYA 5DAKB 1ERTA 5B6NA 3ZVJD 2O87A 2DSAA 4KX4A 4GRFA 1TKDB 4V2NA 3CXGA 1OAZA 3QCPA 2GDRA 4TR4A 1YF0A 2N5BA 1IYHA 5J4UA 3QFAC 4OWYA 1WE0A 1XWCA 2HYXA 4GSNA 2IMEA 2GVPA 2HRFA 4DEJA 1K3LA 3TJKA 5FHIA 2YV9A 3HD5A 4IELA 4FQUA 3IPZA 2YOIA 3RBTA 1TRWA 2C8UA 1K0AA 2H30A 4G19A 1GLQA 5AGYA 2V1MA 4Z7XA 4HU9A 2HSYA 3MDKA 1XVWA 1OYJA 1OKDA 1TTZA 3UBLA 1AQWA 5EPFA 1Z7RA 3KCMA 2UZ8A 4Q5NA 2NVLA 1PN9A 4PX1A 2FGXA 2GZPA 3HJPA 3QFBC 2HT9A 1FB0A 4XRAA 4HJ2A 3VWXA 2H1BA 2L5OA 1M9AA 4HS1A 3FHKA 1WRYA 3FK8A 3I43A 4OMVA 5D8IA 4F9ZA 1UVZA 5CO3A 2K18A 2QC7A 2DLXA 4EL1A 5CYYA 2ES7A 4IW9A 2WJUA 2LS5A 3GMFA 3VFIA 4BA7A 1JZRA 2CQ9A 1ZMAA 4GTUA 4PTSA 2A2RA 4TN8A 3FRCA 4K7NA 3KM6A 3Q74A 2IIYA 2FWFA 1T00A 2OJLA 1U3IA 1SKSB 1IYIA 1X0RA 3LWAA 3CYNA
chains in the Genus database with same CATH superfamily
1I9DA 1ST9A 2HRKB 3KXOA 1EV9A 4K0GA 2HSNB 2PN8A 3M9JA 2PBJA 5FWGA 1XPVA 2O8VB 4FO5A 2H74A 5GZZB 2OACA 4IHUA 4Q5FA 2H8LA 2V32A 1QFNA 2IWTA 4J57E 1TI1A 1SYXA 3QOUA 3UJ1A 4AGSA 20GSA 1WWJA 1TU8A 3EMXA 1TDIA 3V1WA 3FR3A 2XBQA 4K7OA 2TIRA 5H5SA 4X4JA 2P31A 2H6ZA 3F4SA 2HFDA 2H1AA 4G2EA 3TOTA 4ML1A 5IO0A 1TRUA 2GQMA 2CX3A 3U6VA 1HNBA 2N5AA 3BCIA 5HR0A 4XS4B 4IVFA 4JRRA 4HZ4A 2GSQA 2EFHA 1R5PA 2VM2A 3FZ4A 1MTCA 1ZYPA 1ML6A 4G9HA 4Z2UA 4BL7B 1FW1A 2VD0A 1W89A 3C1SA 1A2JA 4NWYA 3GRXA 4IS0A 5JWQB 3ERFA 3HVNA 3HYPA 2H01A 1O85A 2WVYA 2TRXA 3WGEA 2O5VA 3Q6OA 1DE2A 2VCTA 4IP1A 1EOHA 1Z5YE 3GUSA 4AJ8A 3QAGA 5CAXA 3IR4A 2V41A 3LEFA 4MA9A 2G2QA 4ID0A 1UC7A 1J0FA 2A4HA 1ILOA 2JADA 3UEMA 2FCHA 2CX4A 4KAEA 2L57A 4EIQA 1TRVA 1SJZA 4YKFA 2A4VA 4FYUA 4BVYA 1SD9A 1THXA 2IN3A 1YZXA 4X43A 5HR2A 4KCEA 2PUKC 4WR5A 3F4TA 3GV1A 2XC2A 2REMA 4YKGA 3H8QA 5D9VA 4IQAA 1KEBA 3DGQA 2A2PA 1XXUA 3VLNA 1U3AA 1Y25A 4LA1A 3GTUB 4PQIA 5J47A 1A24A 3FMWA 3NOFA 1PD21 1NSWA 2H6XA 4EXJA 2WW1A 3MSZA 1V58A 4V2LA 1YEPA 1SVOA 2K8VA 4YQMA 1YQ1A 2I9HA 1Z7PA 4L8EA 1SK0A 2PU9C 1V9WA 2CV4A 4TRXA 1FVKA 4ECIA 12GSA 1OE7A 4TR0A 4RUVA 4BVXB 5IMZA 1BX9A 2C1YA 2NPBA 4Z2RA 3A2VA 1B9YC 3GX8A 3DEXA 3Q19A 3O3TA 2MMAA 2H1DA 4KSMA 1TW9A 2MMZA 3A5WA 4MLYA 2CZ2A 1GWCA 3TCOA 2XPDA 2WCIA 3LG6A 1GSQA 5KOWA 5G5FA 5DQYA 1EEMA 4HDEA 1QXHA 1K0BA 2OA7A 2B1KA 4IBPA 1TK5B 3ISOA 3HJMA 3TJFA 3IE3A 4MNNA 4KB3A 3A2WA 3ZL5A 4BWQA 5E4WA 1BQ7A 1FOVA 1QGVA 4EIPA 3KH9A 1JZOA 4P3YB 1M7TA 3TRPA 1ZL9A 3KMOA 2BTOT 3O6TA 3GFKA 2XHFA 5A4WA 3BCKA 4KDXA 2OE1A 1S3DA 4KGIA 2ON7A 4EC0A 2I4AA 1T4ZA 4O7HA 3UAPA 1RK4A 3UL3A 1XWAA 1AW9A 3DXBA 1HNAA 5ABRA 2NDOA 16GSA 1XOBA 3KGKA 2WVZA 3GKXA 3LSZA 1BJXA 1MDIA 17GSA 2QSIA 4FH8A 4X1UA 3BOAA 3CBUA 4CHSA 2KLXA 4K2DA 3CWGA 2TRCP 2HZEA 3M8NA 3C73A 1X5CA 3EU4A 3F8UA 4HI7A 3M0FA 1GUHA 1SKRB 2YWNA 2FNOA 2HXKA 3CHXC 6GSWA 4ISDA 1S3RA 1ABAA 3A3TA 2IMKA 3H1NA 2GZYA 4YQUA 3GURA 4JE1A 3D21A 3LGCA 3F3RA 1HNCA 1A2LA 1NM3A 3APSA 2PERA 5ENUA 1OC3A 5ECNB 5CREA 3LJRA 4LL4B 1EV4A 5G1LA 4FYCA 1TP9A 3D6IA 3VI5A 2K8SA 2H73A 2EFCA 10GSA 1SVMA 3F3QA 5IOXA 3TUEA 5JWRB 1GSSA 4IJ3A 4GSSA 3HVXA 4KA0A 3GTUA 3TGZA 4K8MA 1G6WA 4K7IA 3GKNA 1O73A 1DBYA 3UVTA 5DDLA 4YAPA 3TKPA 1LU4A 1PRXA 1QMVA 4ZBBA 1E2YA 2L6CA 1QK8A 1ZOFA 4QL9A 2OKAA 4KW6A 2IL3A 3QD9A 2MYGA 3ZMLA 4QQ7A 2DJJA 4ULXA 1H4OA 4BVXA 2YPMA 2R0PA 1PA3A 2H76A 1THOA 4LMWA 2O85A 5B6MA 1Q98A 3GYKA 5DJLA 2FWHA 1YDKA 3F0IA 3IDVA 2HSHA 1B4PA 4AKHA 4HSCX 2LQOA 4NV2A 5GSTA 3MWHA 2VUPA 1K0MA 2LKUA 5DBQA 4FYBA 1SL2B 2LRTA 2YN1A 2B5XA 3VURA 3M3MA 4L5LA 3IAM2 5C04A 3EE2A 2B5YA 2LRNA 4ML6A 1WJKA 2CA8A 2GQKA 1U87A 4KE3A 1EP7A 3F9UA 2H66A 1XOAA 2AJQB 2VL9A 1EOGA 1WOUA 1KBNA 3QDNA 5IMVA 2O89A 2JL4A 3HZ4A 4OFTA 1BG5A 3KH7A 2GSRA 3FZAA 3WGDA 5BRTA 5HFIA 4EF0A 3A2XA 3UBKA 5D73A 2HRNA 2JU5A 4OD7A 3GX0A 3KEBA 2GGTA 2KP2A 2KP1A 3G9BA 2C4JA 5ELGA 4KSOA 2WDUA 1M3IA 4XCSA 2AV4A 1F6MC 5DQSA 4JU5A 1TXXA 4I2UA 3R2QA 4PI0C 1AQVA 2FUG2 1R4WA 2JACA 3IRAA 1OC9B 5F07A 3VWWA 3IBHA 6GSXA 1ACVA 3EINA 2M46A 5ECHB 4USSA 5IPHA 1GNWA 4K5SA 1GSUA 3DWVA 5DCHA 2I81A 4TR3A 2LSTA 4IN0A 2I1UA 3K8NA 2F9SA 1GSDA 1M0UA 4PXOA 1YEWC 1TK8B 2IFQA 2VIMA 4MF7A 2QA2A 2CAIA 3TU3B 4ECJA 4HQZA 4ILFA 3EVIA 1SYRA 4GQCA 3GH9A 3RDWA 2H1GA 1T3BA 4EVMA 1GSYA 2C0GA 4BWSA 1GTBA 1BEDA 1V98A 1X5DA 1O7UA 3HY2A 3PGTA 3TKSA 3D0ZA 4KNDA 2IPAA 5EL8A 3ZTLA 1TI3A 3FY7A 2WW2A 2LJRA 1Y1UA 3QAWA 1PQNA 4G01A 2RM6A 5A5KA 4H86A 4O5QA 1OVNA 2DMMA 5KOXA 4D73B 3I9V2 3C8EA 3APQA 4JEDA 2FY6A 5DVBA 4RI6A 3ME7A 6GSVA 2LRCA 1PN0A 2LUSA 4O5RA 6GSTA 2X8GA 3FZ5A 3D4MA 3BD2A 4EKZA 1AAZA 4L5OA 4EDZA 4GLTA 1TJDA 5JCWA 5HR3A 5BMUA 4MMMA 3D4TA 4QL7A 1MDJA 2F8AA 4GQFA 2R0GA 4XS6A 4MF5A 4PI2C 1FO5A 4DSSB 1WMJA 3E9JB 3HZ8A 3MNGA 3ZIJA 3G7IA 4DVCA 4HQSA 2H70A 1XFLA 1Z9HA 1G7OA 1TU7A 2L5LA 3VPTA 1XW9A 3HCZA 2HE3A 5DAKA 1NHOA 1RW1A 3HHVA 4O5UA 2EC4A 2WVXB 2GSTA 2WZ9A 2X64A 2R4VA 1KNGA 5B7CA 6GSYA 5F06A 2GQLA 3MAKA 1X9MB 1GNEA 5CRHA 1BAYA 2JSZA 3GNJA 2I3YA 4N0ZA 4F82A 2HSMB 3P7XA 3FEUA 2MMOA 4AJ7A 4AJ6A 2BMXA 5ECRB 4EO3A 4DSRA 1AC1A 5ECQB 3WT1A 5G2ZA 2B3SA 2CVKA 2C3NA 3E0UA 2X49A 2R2JA 2VCVA 5KN1A 1JHBA 5DJMA 4KH7A 2F3MA 2F8FA 2AUVA 1S3AA 2PMTA 2FA8A 5L71A 2OBIA 1M99A 2R3XA 3FZ9A 3ERGA 3TJBA 5A1NB 1MEKA 1HQOA 2JSYA 2A2SA 3ZREA 2WGRA 2R37A 2B1LA 4G0KA 4CDOA 5KN0A 4IJIA 1M3JA 3W8SA 1VGLA 4N0VA 1PL1A 3N9JA 5E59A 4O32A 2P5QA 5IM9A 1FOHA 3RPNA 1XZOA 4TXOB 4ZBDA 2V2GA 1DUGA 4N10A 5F05A 5CRDA 1CQGA 1LBKA 1K0CA 3HVVA 4KF9A 5F0GA 4WXTA 3FW2A 5A5HB 4X0XA 4CY8A 1G0TA 2WULA 5J4YA 2FD3A 1F37A 3LQ7A 2ON5A 1A23A 2HRKA 2HSNA 4WF5A 1PKWA 3J7Yk 1SD8A 3C71A 3DVWA 4JBBA 4TR1B 3HXSA 2HNLA 2E2GA 1A8YA 3ZIVA 2YZUA 3GA4A 4PUFC 2X99A 5EY6A 1HD2A 5IQYA 3IK9A 2IMIA 1YJ6A 1SENA 2AYTA 3ZMKA 1QQ2A 2YV7A 2V6OA 1GUMA 5H5QA 2MZCA 3LORA 1DE1A 3WGXA 2XBIA 4EE0A 3QPMA 3RPPA 2HI7A 4IP6A 4YAVA 2FA4A 2FHEA 1SKWB 2R6KA 3CSJA 4XS4A 1XW5A 1AXDA 2RM5A 1USBA 4MZCA 1PX6A 4ZB7A 4BL7A 2J9HA 1T8EB 3UARA 2K9FA 2NBSA 5A4VA 1S3CA 3BJ5A 1MDKA 3W8JA 2GZZA 4K1FA 3D5JA 2WFCA 5ID2B 1N25A 4V2MA 1GRXA 1XWKA 3GKMA 4RQXA 3G7YA 2OE0A 4K2XA 1ZZYA 1EZKA 2GT6A 1R5AA 1YF1A 3DKSA 3CSHA 2MBTA 5AIXA 1C72A 3LYKA 3EWLA 5G31A 1FB6A 2LNTA 3G7JA 2PPTA 5DCGA 5ECOB 2IMDA 1XG8A 1W4VA 4N11A 19GSA 4PURA 5ECKB 5KEJA 5IMDA 3F6FA 3EURA 2EIRA 1O81A 3KIJA 1SL0B 5EVOA 4KDUA 4ZB8A 3LXZA 4MF6A 4KDYA 5ECPB 1PGTA 4PNGA 1ZGNA 3WYWA 3ED3A 4G10A 4N3ZA 1EP8A 1RQMA 2WW3A 1F9MA 4XS1A 4NMUA 5B8BA 1TRSA 5A34B 2DJKA 2L4CA 2YZHA 1U6TA 2LNSA 1I1IP 5IOWA 6GSUA 3N5OA 3O76A 3DIEA 1VF2A 3WT2A 2HRAA 3UVHA 2VOCA 1G7EA 2E0QA 2H71A 3Q18A 4PQHA 2YWIA 2LTKA 2P5RA 3QMXA 3LYPA 4A5PA 4GXZA 4OCFA 5IMCA 1GLPA 1N2AA 4L0WA 1GSEA 1SJ6A 5ECMB 3HDCA 2VL2A 4J56E 5KN2A 5J9BA 4TOPA 3P2AA 4G0LA 1FVJA 2LV3A 1X5EA 3U5RE 4HEA2 4ZL8A 2CVBA 2CZ3A 5J9CA 3IC8A 2RIIA 1X9WB 5IO2A 2J23A 3LFLA 3KZQA 3GSTA 2DJ0A 3IXRA 4I6XA 5LNKe 1VF3A 1OC8A 8GSSA 3FKFA 3TJGA 3CSIA 4XHMA 4OO5A 1CQHA 4V1Ap 3EMPA 5D96A 5IMFA 4ECCA 3MYDA 1ZYEA 2IMFA 22GSA 1URMA 3C1RA 1T4YA 3F6DA 5HFGA 1PKZA 4ZB9A 1O6JA 3J7Yb 2DC5A 1SK2A 2B6MA 3APOA 5LD0A 3PH9A 4NXIA 11GSA 3ERWA 4I8BA 3F63A 1H75A 2KHPA 4MPFA 4MH3A 2WS2A 4GDFA 2VLUA 2EIOA 2PVQA 1AIUA 2VCQA 4WBJA 1XW6A 1EWXA 4J2FA 3CMIA 5AISA 4PHZC 2JZRA 2L59A 4POBA 4F2IA 5JCGA 5JWOB 3TJJA 1Z6NA 5HFKA 2DJ2A 2VKZG 2YJHA 4MJEA 1AUCA 4MABA 4ZBAA 14GSA 1T1VA 2G0FA 4EDYA 5ID2A 2RUEA 5G5EA 2VLVA 2KUCA 1XIYA 3GSSA 3RFRC 4AKIA 4CY6A 5COHA 4BVYB 2PWJA 3TRXA 2VCZA 1G6YA 3H4KA 4OFMA 2CAQA 3TKRA 3GHAA 1I5GA 1SU9A 2BJXA 3PINA 3ZITA 3GL3A 3SWLA 2XPEA 4E8HA 1K0DA 3AY8A 4WR4A 3KP9A 3FR9A 2DKIA 4EUYA 3UIWA 4NHZA 1YEXA 2YWOA 4IKHA 4TW5A 1F3BA 4TXVA 4IQ1A 3QR6A 3E3EA 1GP1A 5JCUA 1V57A 1YVLA 5AN1A 2O36A 2ZUPA 4Q5QA 5GAND 2B5EA 4JR4A 1GULA 1ON4A 2ALBA 2HQTA 4MH2A 3TRQA 4HJMA 3DRNA 1NHYA 1GUKA 5CRWA 5GAPD 4N30A 2VAFA 4ZB6A 3DYRA 3TOUA 1SL1B 4O92A 3ZVJA 3MIXA 3L9UA 3ZRDA 5KN3A 5G1KA 1B48A 2L4QA 3NZNA 2DJ1A 3TKSE 2OT3A 2YCDA 1V2AA 3GKKA 3IC4A 2DIZA 4MZBA 2VM1A 1VF4A 4V1Ag 4F03A 2VD1A 2K6VA 1FG4A 3CTFA 1JZDA 2H72A 2H0GA 4I5QA 4NPBA 3LXTA 3GH6A 2FLSA 3CRTA 4GF0A 2Z9SA 3W6GA 3TDGA 2FWEA 2JZSA 3EU3A 4WBRD 3DVXA 7GSSA 1JLVA 1GH2A 3HA9A 5CNWA 5CP1A 2GTUA 1VF1A 2VCXA 1N8JA 2KOKA 2P0GA 4AF2A 5B8AA 3FR6A 3UOMA 4NHWA 3KD0A 4Q5RA 2L6DA 2YWMA 1B4QA 1GTAA 1ZCPA 1BYEA 5GSSA 6GSSA 1J9BA 3LW9A 2WZSA 3R3EA 2C0FA 4ZL9A 3CRUA 4LMVA 1K3OA 5J40A 2QKEA 4FIWA 3IV4A 4XIHA 1LJRA 4K0NA 3DMLA 2C80A 4MDCA 3IHQA 1Q4JA 3ME8A 5H5RA 2HZEB 3H93A 3F4RA 4MZWA 1EGRA 3L9SA 3IAS2 4AI6A 4ECBA 1JLWA 1KTEA 2N5FA 3I69A 1K3YA 2PGTA 1F3AA 2YP6A 1F2EA 3QAVA 4NV5A 2DJ3A 4K6XA 1BF5A 5IIZA 4LLRA 1SK1A 4XTSA 1GTIA 3KMNA 1SJIA 3CQFA 1R7HA 3ZFBA 5J4VA 1OC9A 3GN3A 18GSA 2CVDA 4QMKA 4POLA 5J3RA 3H79A 1PMTA 2QGVA 4MP4A 3WD6A 1SVLA 1FHEA 2GT5A 2GLRA 4WF4A 4YQVA 1Z3EA 3SBCA 2FWGA 5HR1A 4ZILA 4PQ1A 3BBYA 2UV8G 1WIKA 2VO4A 4KUNA 3KTBA 1OE8A 2D2ZA 2M72A 2YNXA 1TXUA 5CRGA 3TKQA 1J08A 4FXYP 4XRDA 3HVSA 4TKYA 1HYUA 3RHCA 5A4UA 2GS3A 2C3TA 4MJCA 2MBSA 5ECIB 5J41A 3KTLA 4HOJA 2C0EA 2OBKA 2CT6A 3VWVA 2DIYA 4D73A 5DALB 2OADA 4GWRA 4MCUA 2OE3A 4RI7A 2V6KA 1TK0B 1PSQA 4MJBA 13GSA 1GL8A 1EGOA 4WKWA 3ZFLA 2LQQA 2ZNMA 1ZYNA 1YY7A 2H19A 5D9TA 3HJOA 5C00A 2QA1A 4PNFA 3ZLPA 1A8LA 2X8CA 2ZCTA 3HKRA 5J5NA 4JZQA 4GSTA 3VK9A 4YH2A 3RGBC 2YJ7A 2DBCA 2F51A 4OO4A 1GSFA 1BG1A 2VL2C 3NIVA 2VCWA 1YKAA 1K0NA 5IMAA 4E68A 5ECSA 4I97A 2H6YA 3D22A 1M2AA 2JZTA 4PUAA 5D93A 4DSSA 5AIVA 5IPGA 2PVOC 2AAWA 1ZYQB 1A0FA 1B9XC 1U88A 3TB2A 4KCAA 1UA5A 1EEJA 2E2MA 3GL5A 4LL1B 4Z2TA 1B8XA 1WPIA 3S9FA 1T7PB 1E6BA 2YANA 1Z6MA 1M9BA 1A0RP 2R0CA 1WP0A 4OCEA 2VL3A 1XWBA 1QUWA 2WVXA 5LCZA 1K0OA 3EYTA 1TOFA 3KP8A 1VRSD 3M1GA 9GSSA 4L0UA 3RAZA 3L4NA 1PX7A 3I6AA 2WRTA 1AQXA 4IGJA 1ERWA 4ZL7A 1XWGA 1S4BP 4G0IA 2HZFA 4ZIJA 3P90A 3CTGA 3US3A 2H0IA 4POKA 4CW9A 5HQPA 2HSMA 3KJYA 2LJAA 1XBSA 1XVQA 2C3QA 2LEGA 1A2MA 3VWUA 3L78A 4F0BA 2O3EA 4ZXGA 2B7JA 2IFQB 1R26A 2LJKA 1MD3A 3UMAA 2H75A 2RLIA 4RQRA 1JFUA 3PR8A 3VI7A 1MD4A 4WETA 2MMNA 1O8WA 3IOSA 1V40A 1NW2A 3RHBA 1Y6EA 1XCCA 5F8BA 4MPGA 2RUFA 1GTUA 3M9KA 1PL2A 1O8XA 5D9XA 2E7PA 5A1NA 2AHEA 1M2DA 4I2TA 4K5RA 2X8HA 2H1LA 4ICYA 3C7MA 3DD3A 4ACSA 3JCML 4PGTA 4BIKA 4TXOA 1ERVA 2C0DA 4NAXA 3IK7A 3VPQA 2EFEA 3EC3A 4GCIA 3L0HA 3ZZXA 1ERUA 3IA1A 5G30A 4F0CA 2R5GA 1YKCA 2GSSA 4W66A 3OR5A 2WB9A 2B7KA 5A5HA 2IJYA 4POMA 1DSBA 2H0HA 4BPYA 3PPUA 2NTOA 1JZWA 4HU7A 1OKTA 2DKHA 5INYA 1X9SB 5D9WA 5FT3A 5BMUB 1M2BA 3L9VA 4TR1A 3GIXA 4HUAA 4JR6A 4MJAA 3TKSC 3A5IA 4OFNA 2DMLA 2HLSA 3ZYWA 5DALA 4E8EA 3HMJG 3P8WA 2O7KA 4TVEA 2AB6A 4DSQA 4MK3A 1UN2A 2M80A 2VLTA 2EIQA 4HZ2A 2X4AA 5ECLB 4AKGA 5ELAA 1FAAA 4K9ZA 3FYGA 4WEYA 5DAKB 1ERTA 5B6NA 3ZVJD 2O87A 2DSAA 4KX4A 4GRFA 1TKDB 4V2NA 3CXGA 1OAZA 3QCPA 2GDRA 4AKXB 4TR4A 1YF0A 2N5BA 1IYHA 5J4UA 3QFAC 4OWYA 1WE0A 1XWCA 2HYXA 4GSNA 2IMEA 2GVPA 2HRFA 4DEJA 1K3LA 2EFDA 3TJKA 5FHIA 2YV9A 3HD5A 4IELA 4FQUA 3IPZA 2YOIA 3RBTA 1TRWA 2C8UA 1K0AA 2H30A 4G19A 1GLQA 5AGYA 2V1MA 4Z7XA 4HU9A 2HSYA 3MDKA 1XVWA 1OYJA 1OKDA 1TTZA 3UBLA 1AQWA 5EPFA 1Z7RA 3KCMA 2UZ8A 1PFOA 4Q5NA 2NVLA 1PN9A 4PX1A 2FGXA 2GZPA 2WW0A 3HJPA 3QFBC 2HT9A 1FB0A 4XRAA 4HJ2A 3VWXA 2H1BA 2L5OA 1M9AA 4HS1A 3FHKA 1WRYA 3FK8A 3I43A 4OMVA 5D8IA 4F9ZA 1UVZA 5CO3A 2K18A 2QC7A 2DLXA 4EL1A 5CYYA 2ES7A 4IW9A 2WJUA 2LS5A 3GMFA 3VFIA 4BA7A 1JZRA 2CQ9A 1ZMAA 4GTUA 4PTSA 2A2RA 4TN8A 3FRCA 4K7NA 5A34A 3KM6A 3Q74A 2IIYA 2FWFA 3EPTA 1T00A 2OJLA 1U3IA 1SKSB 1IYIA 1X0RA 3IHGA 3LWAA 3CYNA
chains in the Genus database with same CATH topology
1I9DA 1ST9A 2HRKB 3KXOA 1EV9A 4K0GA 2HSNB 2PN8A 3M9JA 2PBJA 5FWGA 1XPVA 2O8VB 4FO5A 2H74A 5GZZB 2OACA 4IHUA 4Q5FA 2H8LA 2V32A 1QFNA 2IWTA 4J57E 1TI1A 1SYXA 3QOUA 3UJ1A 4AGSA 20GSA 1WWJA 1TU8A 3EMXA 1TDIA 3V1WA 3FR3A 2XBQA 4K7OA 2TIRA 5H5SA 4X4JA 2P31A 2H6ZA 3F4SA 2HFDA 2H1AA 4G2EA 3TOTA 4ML1A 5IO0A 1TRUA 2GQMA 2CX3A 3U6VA 1HNBA 2N5AA 3BCIA 5HR0A 4XS4B 4IVFA 4JRRA 4HZ4A 2GSQA 2EFHA 1R5PA 2VM2A 3FZ4A 1MTCA 1ZYPA 1ML6A 4G9HA 4Z2UA 4BL7B 1FW1A 2VD0A 1W89A 3C1SA 1A2JA 4NWYA 3GRXA 4IS0A 5JWQB 3ERFA 3HYPA 2H01A 1O85A 2TRXA 3WGEA 2O5VA 3Q6OA 1DE2A 2VCTA 4IP1A 1EOHA 1Z5YE 3GUSA 4AJ8A 3QAGA 5CAXA 3IR4A 2V41A 3LEFA 4MA9A 2G2QA 4ID0A 1UC7A 1J0FA 2A4HA 1ILOA 2JADA 3UEMA 2FCHA 2CX4A 4KAEA 2L57A 4EIQA 1TRVA 1SJZA 4YKFA 2A4VA 4FYUA 4BVYA 1SD9A 1THXA 2IN3A 1YZXA 4X43A 5HR2A 4KCEA 2PUKC 4WR5A 3F4TA 3GV1A 2XC2A 2REMA 4YKGA 3H8QA 5D9VA 4IQAA 1KEBA 3DGQA 2A2PA 1XXUA 3VLNA 1U3AA 1Y25A 4LA1A 3GTUB 4PQIA 5J47A 1A24A 3FMWA 3NOFA 1PD21 1NSWA 2H6XA 4EXJA 3MSZA 1V58A 4V2LA 1YEPA 1SVOA 2K8VA 4YQMA 1YQ1A 2I9HA 1Z7PA 4L8EA 1SK0A 2PU9C 1V9WA 2CV4A 4TRXA 1FVKA 4ECIA 12GSA 1OE7A 4TR0A 4RUVA 4BVXB 5IMZA 1BX9A 2C1YA 2NPBA 4Z2RA 3A2VA 1B9YC 3GX8A 3DEXA 3Q19A 3O3TA 2MMAA 2H1DA 4KSMA 1TW9A 2MMZA 3A5WA 4MLYA 2CZ2A 1GWCA 3TCOA 2XPDA 2WCIA 3LG6A 1GSQA 5KOWA 5G5FA 5DQYA 1EEMA 4HDEA 1QXHA 1K0BA 2OA7A 2B1KA 4IBPA 1TK5B 3ISOA 3HJMA 3TJFA 3IE3A 4MNNA 4KB3A 3A2WA 3ZL5A 4BWQA 5E4WA 1BQ7A 1FOVA 1QGVA 4EIPA 3KH9A 1JZOA 4P3YB 1M7TA 3TRPA 1ZL9A 3KMOA 2BTOT 3O6TA 3GFKA 2XHFA 5A4WA 3BCKA 4KDXA 2OE1A 1S3DA 4KGIA 2ON7A 4EC0A 2I4AA 1T4ZA 4O7HA 3UAPA 1RK4A 3UL3A 1XWAA 1AW9A 3DXBA 1HNAA 5ABRA 2NDOA 16GSA 1XOBA 3KGKA 3GKXA 3LSZA 1BJXA 1MDIA 17GSA 2QSIA 4FH8A 4X1UA 3BOAA 3CBUA 4CHSA 2KLXA 4K2DA 3CWGA 2TRCP 2HZEA 3M8NA 3C73A 1X5CA 3EU4A 3F8UA 4HI7A 3M0FA 1GUHA 1SKRB 2YWNA 2FNOA 2HXKA 6GSWA 4ISDA 1ABAA 3A3TA 2IMKA 3H1NA 2GZYA 4YQUA 3GURA 4JE1A 3D21A 3LGCA 3F3RA 1HNCA 1A2LA 1NM3A 3APSA 2PERA 5ENUA 1OC3A 5ECNB 5CREA 3LJRA 4LL4B 1EV4A 5G1LA 4FYCA 1TP9A 3D6IA 3VI5A 2K8SA 2H73A 2EFCA 10GSA 1SVMA 3F3QA 5IOXA 3TUEA 5JWRB 1GSSA 4IJ3A 4GSSA 3HVXA 4KA0A 3GTUA 3TGZA 4K8MA 1G6WA 4K7IA 3GKNA 1O73A 1DBYA 3UVTA 5DDLA 4YAPA 3TKPA 1LU4A 1PRXA 1QMVA 4ZBBA 1E2YA 2L6CA 1QK8A 1ZOFA 4QL9A 2OKAA 4KW6A 2IL3A 3QD9A 2MYGA 3ZMLA 4QQ7A 2DJJA 4ULXA 1H4OA 4BVXA 2YPMA 2R0PA 1PA3A 2H76A 1THOA 4LMWA 2O85A 5B6MA 1Q98A 3GYKA 5DJLA 2FWHA 1YDKA 3F0IA 3IDVA 2HSHA 1B4PA 4AKHA 2LQOA 4NV2A 5GSTA 3MWHA 2VUPA 1K0MA 2LKUA 5DBQA 4FYBA 1SL2B 2LRTA 2YN1A 2B5XA 3VURA 3M3MA 4L5LA 3IAM2 5C04A 3EE2A 2B5YA 2LRNA 4ML6A 1WJKA 2CA8A 2GQKA 1U87A 4KE3A 1EP7A 3F9UA 2H66A 1XOAA 2AJQB 2VL9A 1EOGA 1WOUA 1KBNA 3QDNA 5IMVA 2O89A 2JL4A 3HZ4A 4OFTA 1BG5A 3KH7A 2GSRA 3FZAA 3WGDA 5BRTA 5HFIA 4EF0A 3A2XA 3UBKA 5D73A 2HRNA 2JU5A 4OD7A 3GX0A 3KEBA 2GGTA 2KP2A 2KP1A 3G9BA 2C4JA 5ELGA 4KSOA 2WDUA 4XCSA 2AV4A 1F6MC 5DQSA 4JU5A 1TXXA 4I2UA 3R2QA 1AQVA 2FUG2 1R4WA 2JACA 3IRAA 1OC9B 5F07A 3VWWA 3IBHA 6GSXA 1ACVA 3EINA 2M46A 5ECHB 4USSA 5IPHA 1GNWA 4K5SA 1GSUA 3DWVA 5DCHA 2I81A 4TR3A 2LSTA 4IN0A 2I1UA 3K8NA 2F9SA 1GSDA 1M0UA 4PXOA 1TK8B 2IFQA 2VIMA 4MF7A 2QA2A 2CAIA 3TU3B 4ECJA 4HQZA 4ILFA 3EVIA 1SYRA 4GQCA 3GH9A 3RDWA 2H1GA 1T3BA 4EVMA 1GSYA 2C0GA 4BWSA 1GTBA 1BEDA 1V98A 1X5DA 1O7UA 3HY2A 3PGTA 3TKSA 3D0ZA 4KNDA 2IPAA 5EL8A 3ZTLA 1TI3A 3FY7A 2LJRA 1Y1UA 3QAWA 1PQNA 4G01A 2RM6A 5A5KA 4H86A 4O5QA 1OVNA 2DMMA 5KOXA 4D73B 3I9V2 3C8EA 3APQA 4JEDA 2FY6A 5DVBA 4RI6A 3ME7A 6GSVA 2LRCA 1PN0A 2LUSA 4O5RA 6GSTA 2X8GA 3FZ5A 3D4MA 3BD2A 4EKZA 1AAZA 4L5OA 4EDZA 4GLTA 1TJDA 5JCWA 5HR3A 5BMUA 4MMMA 3D4TA 4QL7A 1MDJA 2F8AA 4GQFA 2R0GA 4XS6A 4MF5A 1FO5A 4DSSB 1WMJA 3E9JB 3HZ8A 3MNGA 3ZIJA 3G7IA 4DVCA 4HQSA 2H70A 1XFLA 1Z9HA 1G7OA 1TU7A 2L5LA 3VPTA 1XW9A 3HCZA 2HE3A 5DAKA 1NHOA 1RW1A 3HHVA 4O5UA 2EC4A 2GSTA 2WZ9A 2X64A 2R4VA 1KNGA 5B7CA 6GSYA 5F06A 2GQLA 3MAKA 1X9MB 1GNEA 5CRHA 1BAYA 2JSZA 3GNJA 2I3YA 4N0ZA 4F82A 2HSMB 3P7XA 3FEUA 2MMOA 4AJ7A 4AJ6A 2BMXA 5ECRB 4EO3A 4DSRA 1AC1A 5ECQB 3WT1A 5G2ZA 2B3SA 2CVKA 2C3NA 3E0UA 2X49A 2R2JA 2VCVA 5KN1A 1JHBA 5DJMA 4KH7A 2F3MA 2F8FA 2AUVA 1S3AA 2PMTA 2FA8A 5L71A 2OBIA 1M99A 2R3XA 3FZ9A 3ERGA 3TJBA 5A1NB 1MEKA 1HQOA 2JSYA 2A2SA 3ZREA 2WGRA 2R37A 2B1LA 4G0KA 4CDOA 5KN0A 4IJIA 3W8SA 1VGLA 4N0VA 1PL1A 3N9JA 5E59A 4O32A 2P5QA 5IM9A 1FOHA 3RPNA 1XZOA 4TXOB 4ZBDA 2V2GA 1DUGA 4N10A 5F05A 5CRDA 1CQGA 1LBKA 1K0CA 3HVVA 4KF9A 5F0GA 4WXTA 3FW2A 5A5HB 4X0XA 4CY8A 1G0TA 2WULA 5J4YA 2FD3A 1F37A 3LQ7A 2ON5A 1A23A 2HRKA 2HSNA 4WF5A 1PKWA 3J7Yk 1SD8A 3C71A 3DVWA 4JBBA 4TR1B 3HXSA 2HNLA 2E2GA 1A8YA 3ZIVA 2YZUA 3GA4A 4PUFC 2X99A 5EY6A 1HD2A 5IQYA 3IK9A 2IMIA 1YJ6A 1SENA 2AYTA 3ZMKA 1QQ2A 2YV7A 2V6OA 1GUMA 5H5QA 2MZCA 3LORA 1DE1A 3WGXA 2XBIA 4EE0A 3QPMA 3RPPA 2HI7A 4IP6A 4YAVA 2FA4A 2FHEA 1SKWB 2R6KA 3CSJA 4XS4A 1XW5A 1AXDA 2RM5A 1USBA 4MZCA 1PX6A 4ZB7A 4BL7A 2J9HA 1T8EB 3UARA 2K9FA 2NBSA 5A4VA 1S3CA 3BJ5A 1MDKA 3W8JA 2GZZA 4K1FA 3D5JA 2WFCA 5ID2B 1N25A 4V2MA 1GRXA 1XWKA 3GKMA 4RQXA 3G7YA 2OE0A 4K2XA 1ZZYA 1EZKA 2GT6A 1R5AA 1YF1A 3DKSA 3CSHA 2MBTA 5AIXA 1C72A 3LYKA 3EWLA 5G31A 1FB6A 2LNTA 3G7JA 2PPTA 5DCGA 5ECOB 2IMDA 1W4VA 4N11A 19GSA 4PURA 5ECKB 5KEJA 5IMDA 3F6FA 3EURA 2EIRA 1O81A 3KIJA 1SL0B 5EVOA 4KDUA 4ZB8A 3LXZA 4MF6A 4KDYA 5ECPB 1PGTA 4PNGA 1ZGNA 3WYWA 3ED3A 4G10A 4N3ZA 1EP8A 1RQMA 1F9MA 4XS1A 4NMUA 5B8BA 1TRSA 5A34B 2DJKA 2L4CA 2YZHA 1U6TA 2LNSA 5IOWA 6GSUA 3N5OA 3O76A 3DIEA 1VF2A 3WT2A 2HRAA 3UVHA 2VOCA 1G7EA 2E0QA 2H71A 3Q18A 4PQHA 2YWIA 2LTKA 2P5RA 3QMXA 3LYPA 4A5PA 4GXZA 4OCFA 5IMCA 1GLPA 1N2AA 4L0WA 1GSEA 1SJ6A 5ECMB 3HDCA 2VL2A 4J56E 5KN2A 5J9BA 4TOPA 3P2AA 4G0LA 1FVJA 2LV3A 1X5EA 3U5RE 4HEA2 4ZL8A 2CVBA 2CZ3A 5J9CA 3IC8A 2RIIA 1X9WB 5IO2A 2J23A 3LFLA 3KZQA 3GSTA 2DJ0A 3IXRA 4I6XA 5LNKe 1VF3A 1OC8A 8GSSA 3FKFA 3TJGA 3CSIA 4XHMA 4OO5A 1CQHA 4V1Ap 3EMPA 5D96A 5IMFA 4ECCA 3MYDA 1ZYEA 2IMFA 22GSA 1URMA 3C1RA 1T4YA 3F6DA 5HFGA 1PKZA 4ZB9A 1O6JA 3J7Yb 2DC5A 1SK2A 2B6MA 3APOA 5LD0A 3PH9A 4NXIA 11GSA 3ERWA 4I8BA 3F63A 1H75A 2KHPA 4MPFA 4MH3A 2WS2A 4GDFA 2VLUA 2EIOA 2PVQA 1AIUA 2VCQA 4WBJA 1XW6A 1EWXA 4J2FA 3CMIA 5AISA 2JZRA 2L59A 4POBA 4F2IA 5JCGA 5JWOB 3TJJA 1Z6NA 5HFKA 2DJ2A 2VKZG 2YJHA 4MJEA 1AUCA 4MABA 4ZBAA 14GSA 1T1VA 2G0FA 4EDYA 5ID2A 2RUEA 5G5EA 2VLVA 2KUCA 1XIYA 3GSSA 4AKIA 4CY6A 5COHA 4BVYB 2PWJA 3TRXA 2VCZA 1G6YA 3H4KA 4OFMA 2CAQA 3TKRA 3GHAA 1I5GA 1SU9A 2BJXA 3PINA 3ZITA 3GL3A 3SWLA 2XPEA 4E8HA 1K0DA 3AY8A 4WR4A 3KP9A 3FR9A 2DKIA 4EUYA 3UIWA 4NHZA 1YEXA 2YWOA 4IKHA 4TW5A 1F3BA 4TXVA 4IQ1A 3QR6A 3E3EA 1GP1A 5JCUA 1V57A 1YVLA 5AN1A 2ZUPA 4Q5QA 5GAND 2B5EA 4JR4A 1GULA 1ON4A 2ALBA 2HQTA 4MH2A 3TRQA 4HJMA 3DRNA 1NHYA 1GUKA 5CRWA 5GAPD 4N30A 2VAFA 4ZB6A 3DYRA 3TOUA 1SL1B 4O92A 3ZVJA 3MIXA 3L9UA 3ZRDA 5KN3A 5G1KA 1B48A 2L4QA 3NZNA 2DJ1A 3TKSE 2OT3A 2YCDA 1V2AA 3GKKA 3IC4A 2DIZA 4MZBA 2VM1A 1VF4A 4V1Ag 4F03A 2VD1A 2K6VA 1FG4A 3CTFA 1JZDA 2H72A 2H0GA 4I5QA 4NPBA 3LXTA 3GH6A 2FLSA 3CRTA 4GF0A 2Z9SA 3W6GA 3TDGA 2FWEA 2JZSA 3EU3A 4WBRD 3DVXA 7GSSA 1JLVA 1GH2A 3HA9A 5CNWA 5CP1A 2GTUA 1VF1A 2VCXA 1N8JA 2KOKA 2P0GA 4AF2A 5B8AA 3FR6A 3UOMA 4NHWA 3KD0A 4Q5RA 2L6DA 2YWMA 1B4QA 1GTAA 1ZCPA 1BYEA 5GSSA 3LW9A 6GSSA 1J9BA 3R3EA 2C0FA 4ZL9A 3CRUA 4LMVA 1K3OA 5J40A 2QKEA 4FIWA 3IV4A 4XIHA 1LJRA 4K0NA 3DMLA 2C80A 4MDCA 3IHQA 1Q4JA 3ME8A 5H5RA 2HZEB 3H93A 3F4RA 4MZWA 1EGRA 3L9SA 3IAS2 4AI6A 4ECBA 1JLWA 1KTEA 2N5FA 3I69A 1K3YA 2PGTA 1F3AA 2YP6A 1F2EA 3QAVA 4NV5A 2DJ3A 4K6XA 1BF5A 5IIZA 4LLRA 1SK1A 4XTSA 1GTIA 3KMNA 1SJIA 1R7HA 3ZFBA 5J4VA 1OC9A 3GN3A 18GSA 2CVDA 4QMKA 4POLA 5J3RA 3H79A 1PMTA 2QGVA 4MP4A 3WD6A 1SVLA 1FHEA 2GT5A 2GLRA 4WF4A 4YQVA 1Z3EA 3SBCA 2FWGA 5HR1A 4ZILA 4PQ1A 3BBYA 2UV8G 1WIKA 2VO4A 4KUNA 3KTBA 1OE8A 2D2ZA 2M72A 2YNXA 1TXUA 5CRGA 3TKQA 1J08A 4XRDA 3HVSA 4TKYA 1HYUA 3RHCA 5A4UA 2GS3A 2C3TA 4MJCA 2MBSA 5ECIB 5J41A 3KTLA 4HOJA 2C0EA 2OBKA 2CT6A 3VWVA 2DIYA 4D73A 5DALB 2OADA 4GWRA 4MCUA 2OE3A 4RI7A 2V6KA 1TK0B 1PSQA 4MJBA 13GSA 1GL8A 1EGOA 4WKWA 3ZFLA 2LQQA 2ZNMA 1ZYNA 1YY7A 2H19A 5D9TA 3HJOA 5C00A 2QA1A 4PNFA 3ZLPA 1A8LA 2X8CA 2ZCTA 3HKRA 5J5NA 4JZQA 4GSTA 3VK9A 4YH2A 2YJ7A 4OO4A 2DBCA 2F51A 1GSFA 1BG1A 2VL2C 3NIVA 2VCWA 1YKAA 1K0NA 5IMAA 4E68A 5ECSA 4I97A 2H6YA 3D22A 1M2AA 2JZTA 4PUAA 5D93A 4DSSA 5AIVA 5IPGA 2PVOC 2AAWA 1ZYQB 1A0FA 1B9XC 1U88A 3TB2A 4KCAA 1UA5A 1EEJA 2E2MA 3GL5A 4LL1B 4Z2TA 1B8XA 1WPIA 3S9FA 1T7PB 1E6BA 2YANA 1Z6MA 1M9BA 1A0RP 2R0CA 1WP0A 4OCEA 2VL3A 1XWBA 1QUWA 5LCZA 1K0OA 3EYTA 1TOFA 3KP8A 1VRSD 3M1GA 9GSSA 4L0UA 3RAZA 3L4NA 1PX7A 3I6AA 2WRTA 1AQXA 4IGJA 1ERWA 4ZL7A 1XWGA 4G0IA 2HZFA 4ZIJA 3P90A 3CTGA 3US3A 2H0IA 4POKA 4CW9A 5HQPA 2HSMA 3KJYA 2LJAA 1XBSA 1XVQA 2C3QA 2LEGA 1A2MA 3VWUA 3L78A 4F0BA 4ZXGA 2B7JA 2IFQB 1R26A 2LJKA 1MD3A 3UMAA 2H75A 2RLIA 4RQRA 1JFUA 3PR8A 3VI7A 1MD4A 4WETA 2MMNA 1O8WA 3IOSA 1V40A 1NW2A 3RHBA 1Y6EA 1XCCA 5F8BA 4MPGA 2RUFA 1GTUA 3M9KA 1PL2A 1O8XA 5D9XA 2E7PA 5A1NA 2AHEA 1M2DA 4I2TA 4K5RA 2X8HA 2H1LA 4ICYA 3C7MA 3DD3A 4ACSA 3JCML 4PGTA 4TXOA 1ERVA 2C0DA 4NAXA 3IK7A 3VPQA 2EFEA 3EC3A 4GCIA 3L0HA 3ZZXA 1ERUA 3IA1A 5G30A 4F0CA 2R5GA 1YKCA 2GSSA 4W66A 3OR5A 2WB9A 2B7KA 5A5HA 2IJYA 4POMA 1DSBA 2H0HA 4BPYA 3PPUA 2NTOA 1JZWA 4HU7A 1OKTA 2DKHA 5INYA 1X9SB 5D9WA 5FT3A 5BMUB 1M2BA 3L9VA 4TR1A 3GIXA 4HUAA 4JR6A 4MJAA 3TKSC 3A5IA 4OFNA 2DMLA 2HLSA 3ZYWA 5DALA 4E8EA 3HMJG 3P8WA 2O7KA 4TVEA 2AB6A 4DSQA 4MK3A 1UN2A 2M80A 2VLTA 2EIQA 4HZ2A 2X4AA 5ECLB 4AKGA 5ELAA 1FAAA 4K9ZA 3FYGA 4WEYA 5DAKB 1ERTA 5B6NA 3ZVJD 2O87A 2DSAA 4KX4A 4GRFA 1TKDB 4V2NA 3CXGA 1OAZA 3QCPA 2GDRA 4AKXB 4TR4A 1YF0A 2N5BA 1IYHA 5J4UA 3QFAC 4OWYA 1WE0A 1XWCA 2HYXA 4GSNA 2IMEA 2GVPA 2HRFA 4DEJA 1K3LA 2EFDA 3TJKA 5FHIA 2YV9A 3HD5A 4IELA 4FQUA 3IPZA 2YOIA 3RBTA 1TRWA 2C8UA 1K0AA 2H30A 4G19A 1GLQA 5AGYA 2V1MA 4Z7XA 4HU9A 2HSYA 3MDKA 1XVWA 1OYJA 1OKDA 1TTZA 3UBLA 1AQWA 5EPFA 1Z7RA 3KCMA 2UZ8A 4Q5NA 2NVLA 1PN9A 4PX1A 2FGXA 2GZPA 3HJPA 3QFBC 2HT9A 1FB0A 4XRAA 4HJ2A 3VWXA 2H1BA 2L5OA 1M9AA 4HS1A 3FHKA 1WRYA 3FK8A 3I43A 4OMVA 5D8IA 4F9ZA 1UVZA 5CO3A 2K18A 2QC7A 2DLXA 4EL1A 5CYYA 2ES7A 4IW9A 2WJUA 2LS5A 3GMFA 3VFIA 4BA7A 1JZRA 2CQ9A 1ZMAA 4GTUA 4PTSA 2A2RA 4TN8A 3FRCA 4K7NA 5A34A 3KM6A 3Q74A 2IIYA 2FWFA 3EPTA 1T00A 2OJLA 1U3IA 1SKSB 1IYIA 1X0RA 3IHGA 3LWAA 3CYNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I9D A;  1ST9 A;  2HRK B;  3KXO A;  1EV9 A;  4K0G A;  2HSN B;  2PN8 A;  3M9J A;  2PBJ A;  5FWG A;  1XPV A;  2O8V B;  4FO5 A;  2H74 A;  5GZZ B;  2OAC A;  4IHU A;  4Q5F A;  2H8L A;  2V32 A;  1QFN A;  2IWT A;  4J57 E;  1TI1 A;  1SYX A;  3QOU A;  3UJ1 A;  4AGS A;  20GS A;  1WWJ A;  1TU8 A;  3EMX A;  1TDI A;  3V1W A;  3FR3 A;  2XBQ A;  4K7O A;  2TIR A;  5H5S A;  2P31 A;  2H6Z A;  3F4S A;  2HFD A;  2H1A A;  4G2E A;  3TOT A;  4ML1 A;  5IO0 A;  1TRU A;  2GQM A;  2CX3 A;  3U6V A;  1HNB A;  2N5A A;  3BCI A;  5HR0 A;  4XS4 B;  4IVF A;  4JRR A;  4HZ4 A;  2GSQ A;  1R5P A;  2VM2 A;  3FZ4 A;  1MTC A;  1ML6 A;  4G9H A;  4BL7 B;  1FW1 A;  2VD0 A;  1W89 A;  3C1S A;  1A2J A;  4NWY A;  3GRX A;  4IS0 A;  5JWQ B;  3ERF A;  3HYP A;  2H01 A;  1O85 A;  2TRX A;  3WGE A;  3Q6O A;  1DE2 A;  2VCT A;  4IP1 A;  1EOH A;  1Z5Y E;  3GUS A;  4AJ8 A;  3QAG A;  5CAX A;  3IR4 A;  2V41 A;  3LEF A;  4MA9 A;  2G2Q A;  4ID0 A;  1UC7 A;  1J0F A;  1ILO A;  2JAD A;  3UEM A;  2FCH A;  2CX4 A;  4KAE A;  2L57 A;  1TRV A;  1SJZ A;  2A4V A;  4FYU A;  4BVY A;  1SD9 A;  1THX A;  2IN3 A;  1YZX A;  4X43 A;  5HR2 A;  4KCE A;  2PUK C;  4WR5 A;  3F4T A;  3GV1 A;  2XC2 A;  2REM A;  3H8Q A;  5D9V A;  4IQA A;  1KEB A;  3DGQ A;  1XXU A;  3VLN A;  1U3A A;  1Y25 A;  4LA1 A;  3GTU B;  4PQI A;  1A24 A;  3NOF A;  1PD2 1;  1NSW A;  2H6X A;  4EXJ A;  3MSZ A;  1V58 A;  4V2L A;  1YEP A;  2K8V A;  4YQM A;  1YQ1 A;  2I9H A;  1Z7P A;  4L8E A;  1SK0 A;  2PU9 C;  1V9W A;  2CV4 A;  4TRX A;  1FVK A;  4ECI A;  12GS A;  1OE7 A;  4TR0 A;  4RUV A;  4BVX B;  5IMZ A;  1BX9 A;  2C1Y A;  2NPB A;  3A2V A;  1B9Y C;  3GX8 A;  3DEX A;  3Q19 A;  3O3T A;  2MMA A;  2H1D A;  4KSM A;  1TW9 A;  2MMZ A;  3A5W A;  4MLY A;  2CZ2 A;  1GWC A;  3TCO A;  2XPD A;  2WCI A;  3LG6 A;  1GSQ A;  5G5F A;  5DQY A;  1EEM A;  4HDE A;  1QXH A;  1K0B A;  2OA7 A;  2B1K A;  4IBP A;  1TK5 B;  3ISO A;  3HJM A;  3TJF A;  3IE3 A;  4KB3 A;  3A2W A;  3ZL5 A;  4BWQ A;  5E4W A;  1BQ7 A;  1FOV A;  1QGV A;  3KH9 A;  1JZO A;  4P3Y B;  1M7T A;  3TRP A;  1ZL9 A;  3KMO A;  2BTO T;  3O6T A;  3GFK A;  2XHF A;  5A4W A;  3BCK A;  4KDX A;  2OE1 A;  1S3D A;  4KGI A;  2ON7 A;  4EC0 A;  2I4A A;  1T4Z A;  4O7H A;  3UAP A;  1RK4 A;  3UL3 A;  1XWA A;  1AW9 A;  3DXB A;  1HNA A;  5ABR A;  2NDO A;  16GS A;  1XOB A;  3KGK A;  3GKX A;  3LSZ A;  1BJX A;  1MDI A;  17GS A;  2QSI A;  4FH8 A;  4X1U A;  3BOA A;  3CBU A;  4CHS A;  2KLX A;  4K2D A;  2TRC P;  2HZE A;  3M8N A;  3C73 A;  1X5C A;  3EU4 A;  3F8U A;  4HI7 A;  3M0F A;  1GUH A;  1SKR B;  2YWN A;  2FNO A;  2HXK A;  6GSW A;  4ISD A;  1ABA A;  3A3T A;  2IMK A;  3H1N A;  2GZY A;  4YQU A;  3GUR A;  4JE1 A;  3D21 A;  3LGC A;  3F3R A;  1HNC A;  1A2L A;  1NM3 A;  3APS A;  2PER A;  5ENU A;  1OC3 A;  5ECN B;  5CRE A;  3LJR A;  4LL4 B;  1EV4 A;  5G1L A;  4FYC A;  1TP9 A;  3D6I A;  3VI5 A;  2K8S A;  2H73 A;  10GS A;  3F3Q A;  5IOX A;  3TUE A;  5JWR B;  1GSS A;  4IJ3 A;  4GSS A;  3HVX A;  4KA0 A;  3GTU A;  3TGZ A;  4K8M A;  1G6W A;  4K7I A;  3GKN A;  1O73 A;  1DBY A;  3UVT A;  5DDL A;  4YAP A;  3TKP A;  1LU4 A;  1PRX A;  1QMV A;  4ZBB A;  1E2Y A;  2L6C A;  1QK8 A;  1ZOF A;  4QL9 A;  2OKA A;  4KW6 A;  2IL3 A;  3QD9 A;  2MYG A;  3ZML A;  4QQ7 A;  2DJJ A;  4ULX A;  1H4O A;  4BVX A;  2YPM A;  1PA3 A;  2H76 A;  1THO A;  4LMW A;  2O85 A;  5B6M A;  1Q98 A;  3GYK A;  5DJL A;  2FWH A;  1YDK A;  3F0I A;  3IDV A;  2HSH A;  1B4P A;  2LQO A;  4NV2 A;  5GST A;  3MWH A;  2VUP A;  1K0M A;  2LKU A;  5DBQ A;  4FYB A;  1SL2 B;  2LRT A;  2YN1 A;  2B5X A;  3VUR A;  3M3M A;  4L5L A;  3IAM 2;  5C04 A;  3EE2 A;  2B5Y A;  2LRN A;  4ML6 A;  1WJK A;  2CA8 A;  2GQK A;  1U87 A;  4KE3 A;  1EP7 A;  3F9U A;  2H66 A;  1XOA A;  2AJQ B;  2VL9 A;  1EOG A;  1WOU A;  1KBN A;  3QDN A;  5IMV A;  2O89 A;  2JL4 A;  3HZ4 A;  4OFT A;  1BG5 A;  3KH7 A;  2GSR A;  3FZA A;  3WGD A;  5HFI A;  4EF0 A;  3A2X A;  3UBK A;  5D73 A;  2HRN A;  2JU5 A;  4OD7 A;  3GX0 A;  3KEB A;  2GGT A;  2KP2 A;  2KP1 A;  3G9B A;  2C4J A;  5ELG A;  4KSO A;  2WDU A;  4XCS A;  2AV4 A;  1F6M C;  5DQS A;  4JU5 A;  1TXX A;  4I2U A;  3R2Q A;  1AQV A;  2FUG 2;  1R4W A;  2JAC A;  3IRA A;  1OC9 B;  5F07 A;  3VWW A;  3IBH A;  6GSX A;  1ACV A;  3EIN A;  2M46 A;  5ECH B;  4USS A;  5IPH A;  1GNW A;  1GSU A;  3DWV A;  5DCH A;  2I81 A;  4TR3 A;  2LST A;  4IN0 A;  2I1U A;  3K8N A;  2F9S A;  1GSD A;  1M0U A;  4PXO A;  1TK8 B;  2IFQ A;  2VIM A;  4MF7 A;  2CAI A;  4ECJ A;  4HQZ A;  4ILF A;  3EVI A;  1SYR A;  4GQC A;  3GH9 A;  3RDW A;  2H1G A;  1T3B A;  4EVM A;  1GSY A;  2C0G A;  4BWS A;  1GTB A;  1BED A;  1V98 A;  1X5D A;  1O7U A;  3HY2 A;  3PGT A;  3TKS A;  3D0Z A;  4KND A;  2IPA A;  5EL8 A;  3ZTL A;  1TI3 A;  3FY7 A;  2LJR A;  3QAW A;  1PQN A;  2RM6 A;  5A5K A;  4H86 A;  1OVN A;  2DMM A;  4D73 B;  3I9V 2;  3C8E A;  3APQ A;  4JED A;  2FY6 A;  5DVB A;  4RI6 A;  3ME7 A;  6GSV A;  2LRC A;  2LUS A;  4O5R A;  6GST A;  2X8G A;  3FZ5 A;  3D4M A;  3BD2 A;  4EKZ A;  1AAZ A;  4L5O A;  4EDZ A;  4GLT A;  1TJD A;  5JCW A;  5HR3 A;  5BMU A;  4MMM A;  3D4T A;  4QL7 A;  1MDJ A;  2F8A A;  4GQF A;  4XS6 A;  4MF5 A;  1FO5 A;  4DSS B;  1WMJ A;  3E9J B;  3HZ8 A;  3MNG A;  3ZIJ A;  3G7I A;  4DVC A;  4HQS A;  2H70 A;  1XFL A;  1Z9H A;  1G7O A;  1TU7 A;  2L5L A;  3VPT A;  1XW9 A;  3HCZ A;  2HE3 A;  5DAK A;  1NHO A;  1RW1 A;  3HHV A;  2EC4 A;  2GST A;  2WZ9 A;  2X64 A;  2R4V A;  1KNG A;  5B7C A;  6GSY A;  5F06 A;  2GQL A;  3MAK A;  1X9M B;  1GNE A;  5CRH A;  1BAY A;  2JSZ A;  3GNJ A;  2I3Y A;  4N0Z A;  4F82 A;  2HSM B;  3P7X A;  3FEU A;  2MMO A;  4AJ7 A;  4AJ6 A;  2BMX A;  5ECR B;  4EO3 A;  4DSR A;  1AC1 A;  5ECQ B;  3WT1 A;  5G2Z A;  2B3S A;  2CVK A;  2C3N A;  3E0U A;  2R2J A;  2VCV A;  5KN1 A;  1JHB A;  5DJM A;  4KH7 A;  2F3M A;  2F8F A;  2AUV A;  1S3A A;  2PMT A;  2FA8 A;  5L71 A;  2OBI A;  1M99 A;  2R3X A;  3FZ9 A;  3ERG A;  3TJB A;  1MEK A;  1HQO A;  2JSY A;  2A2S A;  3ZRE A;  2WGR A;  2R37 A;  2B1L A;  4G0K A;  4CDO A;  5KN0 A;  4IJI A;  3W8S A;  1VGL A;  4N0V A;  1PL1 A;  3N9J A;  5E59 A;  4O32 A;  2P5Q A;  5IM9 A;  3RPN A;  1XZO A;  4TXO B;  4ZBD A;  2V2G A;  1DUG A;  4N10 A;  5F05 A;  5CRD A;  1CQG A;  1LBK A;  1K0C A;  3HVV A;  4KF9 A;  5F0G A;  4WXT A;  3FW2 A;  4X0X A;  1G0T A;  2WUL A;  2FD3 A;  1F37 A;  3LQ7 A;  2ON5 A;  1A23 A;  2HRK A;  4WF5 A;  1PKW A;  3J7Y k;  1SD8 A;  3C71 A;  3DVW A;  4JBB A;  4TR1 B;  3HXS A;  2HNL A;  2E2G A;  1A8Y A;  3ZIV A;  2YZU A;  3GA4 A;  4PUF C;  2X99 A;  5EY6 A;  1HD2 A;  5IQY A;  3IK9 A;  2IMI A;  1YJ6 A;  1SEN A;  2AYT A;  3ZMK A;  1QQ2 A;  2YV7 A;  2V6O A;  1GUM A;  5H5Q A;  2MZC A;  3LOR A;  1DE1 A;  3WGX A;  2XBI A;  4EE0 A;  3QPM A;  3RPP A;  2HI7 A;  4IP6 A;  4YAV A;  2FA4 A;  2FHE A;  1SKW B;  2R6K A;  3CSJ A;  4XS4 A;  1XW5 A;  1AXD A;  2RM5 A;  1USB A;  4MZC A;  1PX6 A;  4BL7 A;  2J9H A;  1T8E B;  3UAR A;  2K9F A;  2NBS A;  5A4V A;  1S3C A;  3BJ5 A;  1MDK A;  3W8J A;  2GZZ A;  4K1F A;  3D5J A;  2WFC A;  5ID2 B;  4V2M A;  1GRX A;  1XWK A;  3GKM A;  4RQX A;  3G7Y A;  2OE0 A;  1ZZY A;  1EZK A;  2GT6 A;  1R5A A;  1YF1 A;  3DKS A;  3CSH A;  2MBT A;  5AIX A;  1C72 A;  3LYK A;  3EWL A;  5G31 A;  1FB6 A;  2LNT A;  3G7J A;  2PPT A;  5DCG A;  5ECO B;  2IMD A;  1W4V A;  4N11 A;  19GS A;  4PUR A;  5ECK B;  5KEJ A;  5IMD A;  3F6F A;  3EUR A;  2EIR A;  1O81 A;  3KIJ A;  1SL0 B;  5EVO A;  4KDU A;  4ZB8 A;  3LXZ A;  4MF6 A;  4KDY A;  5ECP B;  1PGT A;  4PNG A;  1ZGN A;  3WYW A;  3ED3 A;  4G10 A;  1EP8 A;  1RQM A;  1F9M A;  4XS1 A;  4NMU A;  5B8B A;  1TRS A;  2DJK A;  2L4C A;  2YZH A;  1U6T A;  2LNS A;  5IOW A;  6GSU A;  3N5O A;  3O76 A;  3DIE A;  1VF2 A;  3WT2 A;  2HRA A;  3UVH A;  2VOC A;  1G7E A;  2E0Q A;  2H71 A;  3Q18 A;  4PQH A;  2YWI A;  2LTK A;  2P5R A;  3QMX A;  3LYP A;  4GXZ A;  4OCF A;  5IMC A;  1GLP A;  1N2A A;  4L0W A;  1GSE A;  1SJ6 A;  5ECM B;  3HDC A;  2VL2 A;  4J56 E;  5KN2 A;  5J9B A;  4TOP A;  3P2A A;  4G0L A;  1FVJ A;  2LV3 A;  1X5E A;  3U5R E;  4HEA 2;  4ZL8 A;  2CVB A;  2CZ3 A;  5J9C A;  3IC8 A;  2RII A;  1X9W B;  5IO2 A;  2J23 A;  3LFL A;  3KZQ A;  3GST A;  2DJ0 A;  3IXR A;  4I6X A;  5LNK e;  1VF3 A;  1OC8 A;  8GSS A;  3FKF A;  3TJG A;  3CSI A;  4XHM A;  4OO5 A;  1CQH A;  4V1A p;  3EMP A;  5D96 A;  5IMF A;  4ECC A;  1ZYE A;  2IMF A;  22GS A;  1URM A;  3C1R A;  1T4Y A;  3F6D A;  5HFG A;  1PKZ A;  4ZB9 A;  1O6J A;  3J7Y b;  2DC5 A;  1SK2 A;  2B6M A;  3APO A;  5LD0 A;  3PH9 A;  4NXI A;  11GS A;  3ERW A;  4I8B A;  3F63 A;  1H75 A;  2KHP A;  4MPF A;  4MH3 A;  2WS2 A;  2VLU A;  2EIO A;  2PVQ A;  1AIU A;  2VCQ A;  4WBJ A;  1XW6 A;  1EWX A;  4J2F A;  3CMI A;  5AIS A;  2JZR A;  2L59 A;  4POB A;  4F2I A;  5JCG A;  5JWO B;  3TJJ A;  1Z6N A;  5HFK A;  2DJ2 A;  2YJH A;  4MJE A;  1AUC A;  4MAB A;  4ZBA A;  14GS A;  1T1V A;  2G0F A;  4EDY A;  5ID2 A;  2RUE A;  5G5E A;  2VLV A;  2KUC A;  1XIY A;  3GSS A;  5COH A;  4BVY B;  2PWJ A;  3TRX A;  2VCZ A;  1G6Y A;  3H4K A;  4OFM A;  2CAQ A;  3TKR A;  3GHA A;  1I5G A;  1SU9 A;  2BJX A;  3PIN A;  3ZIT A;  3GL3 A;  3SWL A;  2XPE A;  4E8H A;  1K0D A;  3AY8 A;  4WR4 A;  3KP9 A;  3FR9 A;  4EUY A;  3UIW A;  4NHZ A;  1YEX A;  2YWO A;  4IKH A;  4TW5 A;  1F3B A;  4TXV A;  4IQ1 A;  3QR6 A;  3E3E A;  1GP1 A;  5JCU A;  1V57 A;  5AN1 A;  2ZUP A;  4Q5Q A;  5GAN D;  2B5E A;  4JR4 A;  1GUL A;  1ON4 A;  2ALB A;  2HQT A;  4MH2 A;  3TRQ A;  4HJM A;  3DRN A;  1NHY A;  1GUK A;  5CRW A;  5GAP D;  4N30 A;  2VAF A;  4ZB6 A;  3DYR A;  3TOU A;  1SL1 B;  4O92 A;  3ZVJ A;  3L9U A;  3ZRD A;  5KN3 A;  5G1K A;  1B48 A;  2L4Q A;  3NZN A;  2DJ1 A;  3TKS E;  2YCD A;  1V2A A;  3GKK A;  3IC4 A;  2DIZ A;  4MZB A;  2VM1 A;  1VF4 A;  4V1A g;  4F03 A;  2VD1 A;  2K6V A;  1FG4 A;  3CTF A;  1JZD A;  2H72 A;  2H0G A;  4I5Q A;  4NPB A;  3LXT A;  3GH6 A;  2FLS A;  3CRT A;  4GF0 A;  2Z9S A;  3W6G A;  3TDG A;  2FWE A;  2JZS A;  3EU3 A;  4WBR D;  3DVX A;  7GSS A;  1JLV A;  1GH2 A;  3HA9 A;  5CNW A;  5CP1 A;  2GTU A;  1VF1 A;  2VCX A;  1N8J A;  2KOK A;  2P0G A;  4AF2 A;  5B8A A;  3FR6 A;  3UOM A;  4NHW A;  3KD0 A;  4Q5R A;  2L6D A;  2YWM A;  1B4Q A;  1GTA A;  1ZCP A;  1BYE A;  5GSS A;  6GSS A;  1J9B A;  3R3E A;  2C0F A;  4ZL9 A;  3CRU A;  4LMV A;  1K3O A;  2QKE A;  4FIW A;  3IV4 A;  4XIH A;  1LJR A;  4K0N A;  3DML A;  2C80 A;  4MDC A;  3IHQ A;  1Q4J A;  3ME8 A;  5H5R A;  2HZE B;  3H93 A;  3F4R A;  4MZW A;  1EGR A;  3L9S A;  3IAS 2;  4ECB A;  1JLW A;  1KTE A;  2N5F A;  3I69 A;  1K3Y A;  2PGT A;  1F3A A;  2YP6 A;  1F2E A;  3QAV A;  4NV5 A;  2DJ3 A;  4K6X A;  5IIZ A;  4LLR A;  1SK1 A;  4XTS A;  1GTI A;  3KMN A;  1SJI A;  1R7H A;  3ZFB A;  1OC9 A;  3GN3 A;  18GS A;  2CVD A;  4POL A;  5J3R A;  3H79 A;  1PMT A;  2QGV A;  4MP4 A;  3WD6 A;  1FHE A;  2GT5 A;  2GLR A;  4WF4 A;  4YQV A;  1Z3E A;  3SBC A;  2FWG A;  5HR1 A;  4ZIL A;  4PQ1 A;  3BBY A;  1WIK A;  2VO4 A;  4KUN A;  3KTB A;  1OE8 A;  2D2Z A;  2M72 A;  2YNX A;  5CRG A;  3TKQ A;  1J08 A;  4XRD A;  3HVS A;  4TKY A;  1HYU A;  3RHC A;  5A4U A;  2GS3 A;  2C3T A;  4MJC A;  2MBS A;  5ECI B;  5J41 A;  3KTL A;  4HOJ A;  2C0E A;  2OBK A;  2CT6 A;  3VWV A;  2DIY A;  4D73 A;  5DAL B;  2OAD A;  4GWR A;  4MCU A;  2OE3 A;  4RI7 A;  2V6K A;  1TK0 B;  1PSQ A;  4MJB A;  13GS A;  1GL8 A;  1EGO A;  4WKW A;  3ZFL A;  2LQQ A;  2ZNM A;  1YY7 A;  2H19 A;  5D9T A;  3HJO A;  5C00 A;  4PNF A;  3ZLP A;  1A8L A;  2X8C A;  2ZCT A;  3HKR A;  5J5N A;  4JZQ A;  4GST A;  3VK9 A;  4YH2 A;  2YJ7 A;  4OO4 A;  2DBC A;  2F51 A;  1GSF A;  2VL2 C;  3NIV A;  2VCW A;  1YKA A;  1K0N A;  5IMA A;  5ECS A;  4I97 A;  2H6Y A;  3D22 A;  1M2A A;  2JZT A;  4PUA A;  5D93 A;  4DSS A;  5AIV A;  5IPG A;  2PVO C;  2AAW A;  1ZYQ B;  1A0F A;  1B9X C;  1U88 A;  3TB2 A;  4KCA A;  1UA5 A;  1EEJ A;  2E2M A;  3GL5 A;  4LL1 B;  1B8X A;  1WPI A;  3S9F A;  1T7P B;  1E6B A;  2YAN A;  1Z6M A;  1M9B A;  1A0R P;  1WP0 A;  4OCE A;  2VL3 A;  1XWB A;  1QUW A;  5LCZ A;  1K0O A;  3EYT A;  1TOF A;  3KP8 A;  1VRS D;  3M1G A;  9GSS A;  4L0U A;  3RAZ A;  3L4N A;  1PX7 A;  3I6A A;  2WRT A;  1AQX A;  4IGJ A;  1ERW A;  4ZL7 A;  1XWG A;  4G0I A;  2HZF A;  4ZIJ A;  3P90 A;  3CTG A;  3US3 A;  2H0I A;  4POK A;  4CW9 A;  5HQP A;  2HSM A;  3KJY A;  2LJA A;  1XBS A;  1XVQ A;  2C3Q A;  2LEG A;  1A2M A;  3VWU A;  3L78 A;  4F0B A;  4ZXG A;  2B7J A;  2IFQ B;  1R26 A;  2LJK A;  1MD3 A;  3UMA A;  2H75 A;  2RLI A;  4RQR A;  1JFU A;  3PR8 A;  3VI7 A;  1MD4 A;  4WET A;  2MMN A;  1O8W A;  3IOS A;  1V40 A;  1NW2 A;  3RHB A;  1Y6E A;  1XCC A;  5F8B A;  4MPG A;  2RUF A;  1GTU A;  3M9K A;  1PL2 A;  1O8X A;  5D9X A;  2E7P A;  2AHE A;  1M2D A;  4I2T A;  2X8H A;  3C7M A;  3DD3 A;  4ACS A;  3JCM L;  4PGT A;  4TXO A;  1ERV A;  2C0D A;  4NAX A;  3IK7 A;  3VPQ A;  3EC3 A;  4GCI A;  3L0H A;  3ZZX A;  1ERU A;  3IA1 A;  5G30 A;  4F0C A;  2R5G A;  1YKC A;  2GSS A;  3OR5 A;  2WB9 A;  2B7K A;  2IJY A;  4POM A;  1DSB A;  2H0H A;  4BPY A;  3PPU A;  2NTO A;  1JZW A;  4HU7 A;  1OKT A;  5INY A;  1X9S B;  5D9W A;  5FT3 A;  1M2B A;  3L9V A;  4TR1 A;  3GIX A;  4HUA A;  4JR6 A;  4MJA A;  3TKS C;  4OFN A;  2DML A;  2HLS A;  3ZYW A;  5DAL A;  4E8E A;  3P8W A;  2O7K A;  4TVE A;  2AB6 A;  4DSQ A;  4MK3 A;  1UN2 A;  2M80 A;  2VLT A;  2EIQ A;  4HZ2 A;  5ECL B;  5ELA A;  1FAA A;  4K9Z A;  3FYG A;  4WEY A;  5DAK B;  1ERT A;  5B6N A;  3ZVJ D;  2O87 A;  2DSA A;  4KX4 A;  4GRF A;  1TKD B;  4V2N A;  3CXG A;  1OAZ A;  3QCP A;  2GDR A;  4TR4 A;  1YF0 A;  2N5B A;  1IYH A;  5J4U A;  3QFA C;  4OWY A;  1WE0 A;  1XWC A;  2HYX A;  4GSN A;  2IME A;  2GVP A;  2HRF A;  4DEJ A;  1K3L A;  3TJK A;  5FHI A;  2YV9 A;  3HD5 A;  4IEL A;  4FQU A;  3IPZ A;  2YOI A;  3RBT A;  1TRW A;  2C8U A;  1K0A A;  2H30 A;  4G19 A;  1GLQ A;  5AGY A;  2V1M A;  4Z7X A;  4HU9 A;  2HSY A;  3MDK A;  1XVW A;  1OYJ A;  1OKD A;  1TTZ A;  3UBL A;  1AQW A;  5EPF A;  1Z7R A;  3KCM A;  2UZ8 A;  4Q5N A;  2NVL A;  1PN9 A;  4PX1 A;  2FGX A;  2GZP A;  3HJP A;  3QFB C;  2HT9 A;  1FB0 A;  4XRA A;  4HJ2 A;  3VWX A;  2H1B A;  2L5O A;  1M9A A;  4HS1 A;  3FHK A;  1WRY A;  3FK8 A;  3I43 A;  4OMV A;  5D8I A;  4F9Z A;  1UVZ A;  5CO3 A;  2K18 A;  2QC7 A;  2DLX A;  4EL1 A;  5CYY A;  2ES7 A;  4IW9 A;  2WJU A;  2LS5 A;  3GMF A;  3VFI A;  4BA7 A;  1JZR A;  2CQ9 A;  1ZMA A;  4GTU A;  4PTS A;  2A2R A;  4TN8 A;  3FRC A;  4K7N A;  3KM6 A;  3Q74 A;  2IIY A;  2FWF A;  1T00 A;  2OJL A;  1U3I A;  1SKS B;  1IYI A;  1X0R A;  3LWA A;  3CYN A; 
#chains in the Genus database with same CATH topology
 1I9D A;  1ST9 A;  2HRK B;  3KXO A;  1EV9 A;  4K0G A;  2HSN B;  2PN8 A;  3M9J A;  2PBJ A;  5FWG A;  1XPV A;  2O8V B;  4FO5 A;  2H74 A;  5GZZ B;  2OAC A;  4IHU A;  4Q5F A;  2H8L A;  2V32 A;  1QFN A;  2IWT A;  4J57 E;  1TI1 A;  1SYX A;  3QOU A;  3UJ1 A;  4AGS A;  20GS A;  1WWJ A;  1TU8 A;  3EMX A;  1TDI A;  3V1W A;  3FR3 A;  2XBQ A;  4K7O A;  2TIR A;  5H5S A;  4X4J A;  2P31 A;  2H6Z A;  3F4S A;  2HFD A;  2H1A A;  4G2E A;  3TOT A;  4ML1 A;  5IO0 A;  1TRU A;  2GQM A;  2CX3 A;  3U6V A;  1HNB A;  2N5A A;  3BCI A;  5HR0 A;  4XS4 B;  4IVF A;  4JRR A;  4HZ4 A;  2GSQ A;  2EFH A;  1R5P A;  2VM2 A;  3FZ4 A;  1MTC A;  1ZYP A;  1ML6 A;  4G9H A;  4Z2U A;  4BL7 B;  1FW1 A;  2VD0 A;  1W89 A;  3C1S A;  1A2J A;  4NWY A;  3GRX A;  4IS0 A;  5JWQ B;  3ERF A;  3HVN A;  3HYP A;  2H01 A;  1O85 A;  2WVY A;  2TRX A;  3WGE A;  2O5V A;  3Q6O A;  1DE2 A;  2VCT A;  4IP1 A;  1EOH A;  1Z5Y E;  3GUS A;  4AJ8 A;  3QAG A;  5CAX A;  3IR4 A;  2V41 A;  3LEF A;  4MA9 A;  2G2Q A;  4ID0 A;  1UC7 A;  1J0F A;  2A4H A;  1ILO A;  2JAD A;  3UEM A;  2FCH A;  2CX4 A;  4KAE A;  2L57 A;  4EIQ A;  1TRV A;  1SJZ A;  4YKF A;  2A4V A;  4FYU A;  4BVY A;  1SD9 A;  1THX A;  2IN3 A;  1YZX A;  4X43 A;  5HR2 A;  4KCE A;  2PUK C;  4WR5 A;  3F4T A;  3GV1 A;  2XC2 A;  2REM A;  4YKG A;  3H8Q A;  5D9V A;  4IQA A;  1KEB A;  3DGQ A;  2A2P A;  1XXU A;  3VLN A;  1U3A A;  1Y25 A;  4LA1 A;  3GTU B;  4PQI A;  5J47 A;  1A24 A;  3FMW A;  3NOF A;  1PD2 1;  1NSW A;  2H6X A;  4EXJ A;  2WW1 A;  3MSZ A;  1V58 A;  4V2L A;  1YEP A;  1SVO A;  2K8V A;  4YQM A;  1YQ1 A;  2I9H A;  1Z7P A;  4L8E A;  1SK0 A;  2PU9 C;  1V9W A;  2CV4 A;  4TRX A;  1FVK A;  4ECI A;  12GS A;  1OE7 A;  4TR0 A;  4RUV A;  4BVX B;  5IMZ A;  1BX9 A;  2C1Y A;  2NPB A;  4Z2R A;  3A2V A;  1B9Y C;  3GX8 A;  3DEX A;  3Q19 A;  3O3T A;  2MMA A;  2H1D A;  4KSM A;  1TW9 A;  2MMZ A;  3A5W A;  4MLY A;  2CZ2 A;  1GWC A;  3TCO A;  2XPD A;  2WCI A;  3LG6 A;  1GSQ A;  5KOW A;  5G5F A;  5DQY A;  1EEM A;  4HDE A;  1QXH A;  1K0B A;  2OA7 A;  2B1K A;  4IBP A;  1TK5 B;  3ISO A;  3HJM A;  3TJF A;  3IE3 A;  4MNN A;  4KB3 A;  3A2W A;  3ZL5 A;  4BWQ A;  5E4W A;  1BQ7 A;  1FOV A;  1QGV A;  4EIP A;  3KH9 A;  1JZO A;  4P3Y B;  1M7T A;  3TRP A;  1ZL9 A;  3KMO A;  2BTO T;  3O6T A;  3GFK A;  2XHF A;  5A4W A;  3BCK A;  4KDX A;  2OE1 A;  1S3D A;  4KGI A;  2ON7 A;  4EC0 A;  2I4A A;  1T4Z A;  4O7H A;  3UAP A;  1RK4 A;  3UL3 A;  1XWA A;  1AW9 A;  3DXB A;  1HNA A;  5ABR A;  2NDO A;  16GS A;  1XOB A;  3KGK A;  2WVZ A;  3GKX A;  3LSZ A;  1BJX A;  1MDI A;  17GS A;  2QSI A;  4FH8 A;  4X1U A;  3BOA A;  3CBU A;  4CHS A;  2KLX A;  4K2D A;  3CWG A;  2TRC P;  2HZE A;  3M8N A;  3C73 A;  1X5C A;  3EU4 A;  3F8U A;  4HI7 A;  3M0F A;  1GUH A;  1SKR B;  2YWN A;  2FNO A;  2HXK A;  3CHX C;  6GSW A;  4ISD A;  1S3R A;  1ABA A;  3A3T A;  2IMK A;  3H1N A;  2GZY A;  4YQU A;  3GUR A;  4JE1 A;  3D21 A;  3LGC A;  3F3R A;  1HNC A;  1A2L A;  1NM3 A;  3APS A;  2PER A;  5ENU A;  1OC3 A;  5ECN B;  5CRE A;  3LJR A;  4LL4 B;  1EV4 A;  5G1L A;  4FYC A;  1TP9 A;  3D6I A;  3VI5 A;  2K8S A;  2H73 A;  2EFC A;  10GS A;  1SVM A;  3F3Q A;  5IOX A;  3TUE A;  5JWR B;  1GSS A;  4IJ3 A;  4GSS A;  3HVX A;  4KA0 A;  3GTU A;  3TGZ A;  4K8M A;  1G6W A;  4K7I A;  3GKN A;  1O73 A;  1DBY A;  3UVT A;  5DDL A;  4YAP A;  3TKP A;  1LU4 A;  1PRX A;  1QMV A;  4ZBB A;  1E2Y A;  2L6C A;  1QK8 A;  1ZOF A;  4QL9 A;  2OKA A;  4KW6 A;  2IL3 A;  3QD9 A;  2MYG A;  3ZML A;  4QQ7 A;  2DJJ A;  4ULX A;  1H4O A;  4BVX A;  2YPM A;  2R0P A;  1PA3 A;  2H76 A;  1THO A;  4LMW A;  2O85 A;  5B6M A;  1Q98 A;  3GYK A;  5DJL A;  2FWH A;  1YDK A;  3F0I A;  3IDV A;  2HSH A;  1B4P A;  4AKH A;  4HSC X;  2LQO A;  4NV2 A;  5GST A;  3MWH A;  2VUP A;  1K0M A;  2LKU A;  5DBQ A;  4FYB A;  1SL2 B;  2LRT A;  2YN1 A;  2B5X A;  3VUR A;  3M3M A;  4L5L A;  3IAM 2;  5C04 A;  3EE2 A;  2B5Y A;  2LRN A;  4ML6 A;  1WJK A;  2CA8 A;  2GQK A;  1U87 A;  4KE3 A;  1EP7 A;  3F9U A;  2H66 A;  1XOA A;  2AJQ B;  2VL9 A;  1EOG A;  1WOU A;  1KBN A;  3QDN A;  5IMV A;  2O89 A;  2JL4 A;  3HZ4 A;  4OFT A;  1BG5 A;  3KH7 A;  2GSR A;  3FZA A;  3WGD A;  5BRT A;  5HFI A;  4EF0 A;  3A2X A;  3UBK A;  5D73 A;  2HRN A;  2JU5 A;  4OD7 A;  3GX0 A;  3KEB A;  2GGT A;  2KP2 A;  2KP1 A;  3G9B A;  2C4J A;  5ELG A;  4KSO A;  2WDU A;  1M3I A;  4XCS A;  2AV4 A;  1F6M C;  5DQS A;  4JU5 A;  1TXX A;  4I2U A;  3R2Q A;  4PI0 C;  1AQV A;  2FUG 2;  1R4W A;  2JAC A;  3IRA A;  1OC9 B;  5F07 A;  3VWW A;  3IBH A;  6GSX A;  1ACV A;  3EIN A;  2M46 A;  5ECH B;  4USS A;  5IPH A;  1GNW A;  4K5S A;  1GSU A;  3DWV A;  5DCH A;  2I81 A;  4TR3 A;  2LST A;  4IN0 A;  2I1U A;  3K8N A;  2F9S A;  1GSD A;  1M0U A;  4PXO A;  1YEW C;  1TK8 B;  2IFQ A;  2VIM A;  4MF7 A;  2QA2 A;  2CAI A;  3TU3 B;  4ECJ A;  4HQZ A;  4ILF A;  3EVI A;  1SYR A;  4GQC A;  3GH9 A;  3RDW A;  2H1G A;  1T3B A;  4EVM A;  1GSY A;  2C0G A;  4BWS A;  1GTB A;  1BED A;  1V98 A;  1X5D A;  1O7U A;  3HY2 A;  3PGT A;  3TKS A;  3D0Z A;  4KND A;  2IPA A;  5EL8 A;  3ZTL A;  1TI3 A;  3FY7 A;  2WW2 A;  2LJR A;  1Y1U A;  3QAW A;  1PQN A;  4G01 A;  2RM6 A;  5A5K A;  4H86 A;  4O5Q A;  1OVN A;  2DMM A;  5KOX A;  4D73 B;  3I9V 2;  3C8E A;  3APQ A;  4JED A;  2FY6 A;  5DVB A;  4RI6 A;  3ME7 A;  6GSV A;  2LRC A;  1PN0 A;  2LUS A;  4O5R A;  6GST A;  2X8G A;  3FZ5 A;  3D4M A;  3BD2 A;  4EKZ A;  1AAZ A;  4L5O A;  4EDZ A;  4GLT A;  1TJD A;  5JCW A;  5HR3 A;  5BMU A;  4MMM A;  3D4T A;  4QL7 A;  1MDJ A;  2F8A A;  4GQF A;  2R0G A;  4XS6 A;  4MF5 A;  4PI2 C;  1FO5 A;  4DSS B;  1WMJ A;  3E9J B;  3HZ8 A;  3MNG A;  3ZIJ A;  3G7I A;  4DVC A;  4HQS A;  2H70 A;  1XFL A;  1Z9H A;  1G7O A;  1TU7 A;  2L5L A;  3VPT A;  1XW9 A;  3HCZ A;  2HE3 A;  5DAK A;  1NHO A;  1RW1 A;  3HHV A;  4O5U A;  2EC4 A;  2WVX B;  2GST A;  2WZ9 A;  2X64 A;  2R4V A;  1KNG A;  5B7C A;  6GSY A;  5F06 A;  2GQL A;  3MAK A;  1X9M B;  1GNE A;  5CRH A;  1BAY A;  2JSZ A;  3GNJ A;  2I3Y A;  4N0Z A;  4F82 A;  2HSM B;  3P7X A;  3FEU A;  2MMO A;  4AJ7 A;  4AJ6 A;  2BMX A;  5ECR B;  4EO3 A;  4DSR A;  1AC1 A;  5ECQ B;  3WT1 A;  5G2Z A;  2B3S A;  2CVK A;  2C3N A;  3E0U A;  2X49 A;  2R2J A;  2VCV A;  5KN1 A;  1JHB A;  5DJM A;  4KH7 A;  2F3M A;  2F8F A;  2AUV A;  1S3A A;  2PMT A;  2FA8 A;  5L71 A;  2OBI A;  1M99 A;  2R3X A;  3FZ9 A;  3ERG A;  3TJB A;  5A1N B;  1MEK A;  1HQO A;  2JSY A;  2A2S A;  3ZRE A;  2WGR A;  2R37 A;  2B1L A;  4G0K A;  4CDO A;  5KN0 A;  4IJI A;  1M3J A;  3W8S A;  1VGL A;  4N0V A;  1PL1 A;  3N9J A;  5E59 A;  4O32 A;  2P5Q A;  5IM9 A;  1FOH A;  3RPN A;  1XZO A;  4TXO B;  4ZBD A;  2V2G A;  1DUG A;  4N10 A;  5F05 A;  5CRD A;  1CQG A;  1LBK A;  1K0C A;  3HVV A;  4KF9 A;  5F0G A;  4WXT A;  3FW2 A;  5A5H B;  4X0X A;  4CY8 A;  1G0T A;  2WUL A;  5J4Y A;  2FD3 A;  1F37 A;  3LQ7 A;  2ON5 A;  1A23 A;  2HRK A;  2HSN A;  4WF5 A;  1PKW A;  3J7Y k;  1SD8 A;  3C71 A;  3DVW A;  4JBB A;  4TR1 B;  3HXS A;  2HNL A;  2E2G A;  1A8Y A;  3ZIV A;  2YZU A;  3GA4 A;  4PUF C;  2X99 A;  5EY6 A;  1HD2 A;  5IQY A;  3IK9 A;  2IMI A;  1YJ6 A;  1SEN A;  2AYT A;  3ZMK A;  1QQ2 A;  2YV7 A;  2V6O A;  1GUM A;  5H5Q A;  2MZC A;  3LOR A;  1DE1 A;  3WGX A;  2XBI A;  4EE0 A;  3QPM A;  3RPP A;  2HI7 A;  4IP6 A;  4YAV A;  2FA4 A;  2FHE A;  1SKW B;  2R6K A;  3CSJ A;  4XS4 A;  1XW5 A;  1AXD A;  2RM5 A;  1USB A;  4MZC A;  1PX6 A;  4ZB7 A;  4BL7 A;  2J9H A;  1T8E B;  3UAR A;  2K9F A;  2NBS A;  5A4V A;  1S3C A;  3BJ5 A;  1MDK A;  3W8J A;  2GZZ A;  4K1F A;  3D5J A;  2WFC A;  5ID2 B;  1N25 A;  4V2M A;  1GRX A;  1XWK A;  3GKM A;  4RQX A;  3G7Y A;  2OE0 A;  4K2X A;  1ZZY A;  1EZK A;  2GT6 A;  1R5A A;  1YF1 A;  3DKS A;  3CSH A;  2MBT A;  5AIX A;  1C72 A;  3LYK A;  3EWL A;  5G31 A;  1FB6 A;  2LNT A;  3G7J A;  2PPT A;  5DCG A;  5ECO B;  2IMD A;  1XG8 A;  1W4V A;  4N11 A;  19GS A;  4PUR A;  5ECK B;  5KEJ A;  5IMD A;  3F6F A;  3EUR A;  2EIR A;  1O81 A;  3KIJ A;  1SL0 B;  5EVO A;  4KDU A;  4ZB8 A;  3LXZ A;  4MF6 A;  4KDY A;  5ECP B;  1PGT A;  4PNG A;  1ZGN A;  3WYW A;  3ED3 A;  4G10 A;  4N3Z A;  1EP8 A;  1RQM A;  2WW3 A;  1F9M A;  4XS1 A;  4NMU A;  5B8B A;  1TRS A;  5A34 B;  2DJK A;  2L4C A;  2YZH A;  1U6T A;  2LNS A;  1I1I P;  5IOW A;  6GSU A;  3N5O A;  3O76 A;  3DIE A;  1VF2 A;  3WT2 A;  2HRA A;  3UVH A;  2VOC A;  1G7E A;  2E0Q A;  2H71 A;  3Q18 A;  4PQH A;  2YWI A;  2LTK A;  2P5R A;  3QMX A;  3LYP A;  4A5P A;  4GXZ A;  4OCF A;  5IMC A;  1GLP A;  1N2A A;  4L0W A;  1GSE A;  1SJ6 A;  5ECM B;  3HDC A;  2VL2 A;  4J56 E;  5KN2 A;  5J9B A;  4TOP A;  3P2A A;  4G0L A;  1FVJ A;  2LV3 A;  1X5E A;  3U5R E;  4HEA 2;  4ZL8 A;  2CVB A;  2CZ3 A;  5J9C A;  3IC8 A;  2RII A;  1X9W B;  5IO2 A;  2J23 A;  3LFL A;  3KZQ A;  3GST A;  2DJ0 A;  3IXR A;  4I6X A;  5LNK e;  1VF3 A;  1OC8 A;  8GSS A;  3FKF A;  3TJG A;  3CSI A;  4XHM A;  4OO5 A;  1CQH A;  4V1A p;  3EMP A;  5D96 A;  5IMF A;  4ECC A;  3MYD A;  1ZYE A;  2IMF A;  22GS A;  1URM A;  3C1R A;  1T4Y A;  3F6D A;  5HFG A;  1PKZ A;  4ZB9 A;  1O6J A;  3J7Y b;  2DC5 A;  1SK2 A;  2B6M A;  3APO A;  5LD0 A;  3PH9 A;  4NXI A;  11GS A;  3ERW A;  4I8B A;  3F63 A;  1H75 A;  2KHP A;  4MPF A;  4MH3 A;  2WS2 A;  4GDF A;  2VLU A;  2EIO A;  2PVQ A;  1AIU A;  2VCQ A;  4WBJ A;  1XW6 A;  1EWX A;  4J2F A;  3CMI A;  5AIS A;  4PHZ C;  2JZR A;  2L59 A;  4POB A;  4F2I A;  5JCG A;  5JWO B;  3TJJ A;  1Z6N A;  5HFK A;  2DJ2 A;  2VKZ G;  2YJH A;  4MJE A;  1AUC A;  4MAB A;  4ZBA A;  14GS A;  1T1V A;  2G0F A;  4EDY A;  5ID2 A;  2RUE A;  5G5E A;  2VLV A;  2KUC A;  1XIY A;  3GSS A;  3RFR C;  4AKI A;  4CY6 A;  5COH A;  4BVY B;  2PWJ A;  3TRX A;  2VCZ A;  1G6Y A;  3H4K A;  4OFM A;  2CAQ A;  3TKR A;  3GHA A;  1I5G A;  1SU9 A;  2BJX A;  3PIN A;  3ZIT A;  3GL3 A;  3SWL A;  2XPE A;  4E8H A;  1K0D A;  3AY8 A;  4WR4 A;  3KP9 A;  3FR9 A;  2DKI A;  4EUY A;  3UIW A;  4NHZ A;  1YEX A;  2YWO A;  4IKH A;  4TW5 A;  1F3B A;  4TXV A;  4IQ1 A;  3QR6 A;  3E3E A;  1GP1 A;  5JCU A;  1V57 A;  1YVL A;  5AN1 A;  2O36 A;  2ZUP A;  4Q5Q A;  5GAN D;  2B5E A;  4JR4 A;  1GUL A;  1ON4 A;  2ALB A;  2HQT A;  4MH2 A;  3TRQ A;  4HJM A;  3DRN A;  1NHY A;  1GUK A;  5CRW A;  5GAP D;  4N30 A;  2VAF A;  4ZB6 A;  3DYR A;  3TOU A;  1SL1 B;  4O92 A;  3ZVJ A;  3MIX A;  3L9U A;  3ZRD A;  5KN3 A;  5G1K A;  1B48 A;  2L4Q A;  3NZN A;  2DJ1 A;  3TKS E;  2OT3 A;  2YCD A;  1V2A A;  3GKK A;  3IC4 A;  2DIZ A;  4MZB A;  2VM1 A;  1VF4 A;  4V1A g;  4F03 A;  2VD1 A;  2K6V A;  1FG4 A;  3CTF A;  1JZD A;  2H72 A;  2H0G A;  4I5Q A;  4NPB A;  3LXT A;  3GH6 A;  2FLS A;  3CRT A;  4GF0 A;  2Z9S A;  3W6G A;  3TDG A;  2FWE A;  2JZS A;  3EU3 A;  4WBR D;  3DVX A;  7GSS A;  1JLV A;  1GH2 A;  3HA9 A;  5CNW A;  5CP1 A;  2GTU A;  1VF1 A;  2VCX A;  1N8J A;  2KOK A;  2P0G A;  4AF2 A;  5B8A A;  3FR6 A;  3UOM A;  4NHW A;  3KD0 A;  4Q5R A;  2L6D A;  2YWM A;  1B4Q A;  1GTA A;  1ZCP A;  1BYE A;  5GSS A;  6GSS A;  1J9B A;  3LW9 A;  2WZS A;  3R3E A;  2C0F A;  4ZL9 A;  3CRU A;  4LMV A;  1K3O A;  5J40 A;  2QKE A;  4FIW A;  3IV4 A;  4XIH A;  1LJR A;  4K0N A;  3DML A;  2C80 A;  4MDC A;  3IHQ A;  1Q4J A;  3ME8 A;  5H5R A;  2HZE B;  3H93 A;  3F4R A;  4MZW A;  1EGR A;  3L9S A;  3IAS 2;  4AI6 A;  4ECB A;  1JLW A;  1KTE A;  2N5F A;  3I69 A;  1K3Y A;  2PGT A;  1F3A A;  2YP6 A;  1F2E A;  3QAV A;  4NV5 A;  2DJ3 A;  4K6X A;  1BF5 A;  5IIZ A;  4LLR A;  1SK1 A;  4XTS A;  1GTI A;  3KMN A;  1SJI A;  3CQF A;  1R7H A;  3ZFB A;  5J4V A;  1OC9 A;  3GN3 A;  18GS A;  2CVD A;  4QMK A;  4POL A;  5J3R A;  3H79 A;  1PMT A;  2QGV A;  4MP4 A;  3WD6 A;  1SVL A;  1FHE A;  2GT5 A;  2GLR A;  4WF4 A;  4YQV A;  1Z3E A;  3SBC A;  2FWG A;  5HR1 A;  4ZIL A;  4PQ1 A;  3BBY A;  2UV8 G;  1WIK A;  2VO4 A;  4KUN A;  3KTB A;  1OE8 A;  2D2Z A;  2M72 A;  2YNX A;  1TXU A;  5CRG A;  3TKQ A;  1J08 A;  4FXY P;  4XRD A;  3HVS A;  4TKY A;  1HYU A;  3RHC A;  5A4U A;  2GS3 A;  2C3T A;  4MJC A;  2MBS A;  5ECI B;  5J41 A;  3KTL A;  4HOJ A;  2C0E A;  2OBK A;  2CT6 A;  3VWV A;  2DIY A;  4D73 A;  5DAL B;  2OAD A;  4GWR A;  4MCU A;  2OE3 A;  4RI7 A;  2V6K A;  1TK0 B;  1PSQ A;  4MJB A;  13GS A;  1GL8 A;  1EGO A;  4WKW A;  3ZFL A;  2LQQ A;  2ZNM A;  1ZYN A;  1YY7 A;  2H19 A;  5D9T A;  3HJO A;  5C00 A;  2QA1 A;  4PNF A;  3ZLP A;  1A8L A;  2X8C A;  2ZCT A;  3HKR A;  5J5N A;  4JZQ A;  4GST A;  3VK9 A;  4YH2 A;  3RGB C;  2YJ7 A;  2DBC A;  2F51 A;  4OO4 A;  1GSF A;  1BG1 A;  2VL2 C;  3NIV A;  2VCW A;  1YKA A;  1K0N A;  5IMA A;  4E68 A;  5ECS A;  4I97 A;  2H6Y A;  3D22 A;  1M2A A;  2JZT A;  4PUA A;  5D93 A;  4DSS A;  5AIV A;  5IPG A;  2PVO C;  2AAW A;  1ZYQ B;  1A0F A;  1B9X C;  1U88 A;  3TB2 A;  4KCA A;  1UA5 A;  1EEJ A;  2E2M A;  3GL5 A;  4LL1 B;  4Z2T A;  1B8X A;  1WPI A;  3S9F A;  1T7P B;  1E6B A;  2YAN A;  1Z6M A;  1M9B A;  1A0R P;  2R0C A;  1WP0 A;  4OCE A;  2VL3 A;  1XWB A;  1QUW A;  2WVX A;  5LCZ A;  1K0O A;  3EYT A;  1TOF A;  3KP8 A;  1VRS D;  3M1G A;  9GSS A;  4L0U A;  3RAZ A;  3L4N A;  1PX7 A;  3I6A A;  2WRT A;  1AQX A;  4IGJ A;  1ERW A;  4ZL7 A;  1XWG A;  1S4B P;  4G0I A;  2HZF A;  4ZIJ A;  3P90 A;  3CTG A;  3US3 A;  2H0I A;  4POK A;  4CW9 A;  5HQP A;  2HSM A;  3KJY A;  2LJA A;  1XBS A;  1XVQ A;  2C3Q A;  2LEG A;  1A2M A;  3VWU A;  3L78 A;  4F0B A;  2O3E A;  4ZXG A;  2B7J A;  2IFQ B;  1R26 A;  2LJK A;  1MD3 A;  3UMA A;  2H75 A;  2RLI A;  4RQR A;  1JFU A;  3PR8 A;  3VI7 A;  1MD4 A;  4WET A;  2MMN A;  1O8W A;  3IOS A;  1V40 A;  1NW2 A;  3RHB A;  1Y6E A;  1XCC A;  5F8B A;  4MPG A;  2RUF A;  1GTU A;  3M9K A;  1PL2 A;  1O8X A;  5D9X A;  2E7P A;  5A1N A;  2AHE A;  1M2D A;  4I2T A;  4K5R A;  2X8H A;  2H1L A;  4ICY A;  3C7M A;  3DD3 A;  4ACS A;  3JCM L;  4PGT A;  4BIK A;  4TXO A;  1ERV A;  2C0D A;  4NAX A;  3IK7 A;  3VPQ A;  2EFE A;  3EC3 A;  4GCI A;  3L0H A;  3ZZX A;  1ERU A;  3IA1 A;  5G30 A;  4F0C A;  2R5G A;  1YKC A;  2GSS A;  4W66 A;  3OR5 A;  2WB9 A;  2B7K A;  5A5H A;  2IJY A;  4POM A;  1DSB A;  2H0H A;  4BPY A;  3PPU A;  2NTO A;  1JZW A;  4HU7 A;  1OKT A;  2DKH A;  5INY A;  1X9S B;  5D9W A;  5FT3 A;  5BMU B;  1M2B A;  3L9V A;  4TR1 A;  3GIX A;  4HUA A;  4JR6 A;  4MJA A;  3TKS C;  3A5I A;  4OFN A;  2DML A;  2HLS A;  3ZYW A;  5DAL A;  4E8E A;  3HMJ G;  3P8W A;  2O7K A;  4TVE A;  2AB6 A;  4DSQ A;  4MK3 A;  1UN2 A;  2M80 A;  2VLT A;  2EIQ A;  4HZ2 A;  2X4A A;  5ECL B;  4AKG A;  5ELA A;  1FAA A;  4K9Z A;  3FYG A;  4WEY A;  5DAK B;  1ERT A;  5B6N A;  3ZVJ D;  2O87 A;  2DSA A;  4KX4 A;  4GRF A;  1TKD B;  4V2N A;  3CXG A;  1OAZ A;  3QCP A;  2GDR A;  4AKX B;  4TR4 A;  1YF0 A;  2N5B A;  1IYH A;  5J4U A;  3QFA C;  4OWY A;  1WE0 A;  1XWC A;  2HYX A;  4GSN A;  2IME A;  2GVP A;  2HRF A;  4DEJ A;  1K3L A;  2EFD A;  3TJK A;  5FHI A;  2YV9 A;  3HD5 A;  4IEL A;  4FQU A;  3IPZ A;  2YOI A;  3RBT A;  1TRW A;  2C8U A;  1K0A A;  2H30 A;  4G19 A;  1GLQ A;  5AGY A;  2V1M A;  4Z7X A;  4HU9 A;  2HSY A;  3MDK A;  1XVW A;  1OYJ A;  1OKD A;  1TTZ A;  3UBL A;  1AQW A;  5EPF A;  1Z7R A;  3KCM A;  2UZ8 A;  1PFO A;  4Q5N A;  2NVL A;  1PN9 A;  4PX1 A;  2FGX A;  2GZP A;  2WW0 A;  3HJP A;  3QFB C;  2HT9 A;  1FB0 A;  4XRA A;  4HJ2 A;  3VWX A;  2H1B A;  2L5O A;  1M9A A;  4HS1 A;  3FHK A;  1WRY A;  3FK8 A;  3I43 A;  4OMV A;  5D8I A;  4F9Z A;  1UVZ A;  5CO3 A;  2K18 A;  2QC7 A;  2DLX A;  4EL1 A;  5CYY A;  2ES7 A;  4IW9 A;  2WJU A;  2LS5 A;  3GMF A;  3VFI A;  4BA7 A;  1JZR A;  2CQ9 A;  1ZMA A;  4GTU A;  4PTS A;  2A2R A;  4TN8 A;  3FRC A;  4K7N A;  5A34 A;  3KM6 A;  3Q74 A;  2IIY A;  2FWF A;  3EPT A;  1T00 A;  2OJL A;  1U3I A;  1SKS B;  1IYI A;  1X0R A;  3IHG A;  3LWA A;  3CYN A; 
#chains in the Genus database with same CATH homology
 1I9D A;  1ST9 A;  2HRK B;  3KXO A;  1EV9 A;  4K0G A;  2HSN B;  2PN8 A;  3M9J A;  2PBJ A;  5FWG A;  1XPV A;  2O8V B;  4FO5 A;  2H74 A;  5GZZ B;  2OAC A;  4IHU A;  4Q5F A;  2H8L A;  2V32 A;  1QFN A;  2IWT A;  4J57 E;  1TI1 A;  1SYX A;  3QOU A;  3UJ1 A;  4AGS A;  20GS A;  1WWJ A;  1TU8 A;  3EMX A;  1TDI A;  3V1W A;  3FR3 A;  2XBQ A;  4K7O A;  2TIR A;  5H5S A;  4X4J A;  2P31 A;  2H6Z A;  3F4S A;  2HFD A;  2H1A A;  4G2E A;  3TOT A;  4ML1 A;  5IO0 A;  1TRU A;  2GQM A;  2CX3 A;  3U6V A;  1HNB A;  2N5A A;  3BCI A;  5HR0 A;  4XS4 B;  4IVF A;  4JRR A;  4HZ4 A;  2GSQ A;  2EFH A;  1R5P A;  2VM2 A;  3FZ4 A;  1MTC A;  1ZYP A;  1ML6 A;  4G9H A;  4Z2U A;  4BL7 B;  1FW1 A;  2VD0 A;  1W89 A;  3C1S A;  1A2J A;  4NWY A;  3GRX A;  4IS0 A;  5JWQ B;  3ERF A;  3HYP A;  2H01 A;  1O85 A;  2TRX A;  3WGE A;  2O5V A;  3Q6O A;  1DE2 A;  2VCT A;  4IP1 A;  1EOH A;  1Z5Y E;  3GUS A;  4AJ8 A;  3QAG A;  5CAX A;  3IR4 A;  2V41 A;  3LEF A;  4MA9 A;  2G2Q A;  4ID0 A;  1UC7 A;  1J0F A;  2A4H A;  1ILO A;  2JAD A;  3UEM A;  2FCH A;  2CX4 A;  4KAE A;  2L57 A;  4EIQ A;  1TRV A;  1SJZ A;  4YKF A;  2A4V A;  4FYU A;  4BVY A;  1SD9 A;  1THX A;  2IN3 A;  1YZX A;  4X43 A;  5HR2 A;  4KCE A;  2PUK C;  4WR5 A;  3F4T A;  3GV1 A;  2XC2 A;  2REM A;  4YKG A;  3H8Q A;  5D9V A;  4IQA A;  1KEB A;  3DGQ A;  2A2P A;  1XXU A;  3VLN A;  1U3A A;  1Y25 A;  4LA1 A;  3GTU B;  4PQI A;  5J47 A;  1A24 A;  3FMW A;  3NOF A;  1PD2 1;  1NSW A;  2H6X A;  4EXJ A;  3MSZ A;  1V58 A;  4V2L A;  1YEP A;  1SVO A;  2K8V A;  4YQM A;  1YQ1 A;  2I9H A;  1Z7P A;  4L8E A;  1SK0 A;  2PU9 C;  1V9W A;  2CV4 A;  4TRX A;  1FVK A;  4ECI A;  12GS A;  1OE7 A;  4TR0 A;  4RUV A;  4BVX B;  5IMZ A;  1BX9 A;  2C1Y A;  2NPB A;  4Z2R A;  3A2V A;  1B9Y C;  3GX8 A;  3DEX A;  3Q19 A;  3O3T A;  2MMA A;  2H1D A;  4KSM A;  1TW9 A;  2MMZ A;  3A5W A;  4MLY A;  2CZ2 A;  1GWC A;  3TCO A;  2XPD A;  2WCI A;  3LG6 A;  1GSQ A;  5KOW A;  5G5F A;  5DQY A;  1EEM A;  4HDE A;  1QXH A;  1K0B A;  2OA7 A;  2B1K A;  4IBP A;  1TK5 B;  3ISO A;  3HJM A;  3TJF A;  3IE3 A;  4MNN A;  4KB3 A;  3A2W A;  3ZL5 A;  4BWQ A;  5E4W A;  1BQ7 A;  1FOV A;  1QGV A;  4EIP A;  3KH9 A;  1JZO A;  4P3Y B;  1M7T A;  3TRP A;  1ZL9 A;  3KMO A;  2BTO T;  3O6T A;  3GFK A;  2XHF A;  5A4W A;  3BCK A;  4KDX A;  2OE1 A;  1S3D A;  4KGI A;  2ON7 A;  4EC0 A;  2I4A A;  1T4Z A;  4O7H A;  3UAP A;  1RK4 A;  3UL3 A;  1XWA A;  1AW9 A;  3DXB A;  1HNA A;  5ABR A;  2NDO A;  16GS A;  1XOB A;  3KGK A;  3GKX A;  3LSZ A;  1BJX A;  1MDI A;  17GS A;  2QSI A;  4FH8 A;  4X1U A;  3BOA A;  3CBU A;  4CHS A;  2KLX A;  4K2D A;  3CWG A;  2TRC P;  2HZE A;  3M8N A;  3C73 A;  1X5C A;  3EU4 A;  3F8U A;  4HI7 A;  3M0F A;  1GUH A;  1SKR B;  2YWN A;  2FNO A;  2HXK A;  6GSW A;  4ISD A;  1ABA A;  3A3T A;  2IMK A;  3H1N A;  2GZY A;  4YQU A;  3GUR A;  4JE1 A;  3D21 A;  3LGC A;  3F3R A;  1HNC A;  1A2L A;  1NM3 A;  3APS A;  2PER A;  5ENU A;  1OC3 A;  5ECN B;  5CRE A;  3LJR A;  4LL4 B;  1EV4 A;  5G1L A;  4FYC A;  1TP9 A;  3D6I A;  3VI5 A;  2K8S A;  2H73 A;  2EFC A;  10GS A;  1SVM A;  3F3Q A;  5IOX A;  3TUE A;  5JWR B;  1GSS A;  4IJ3 A;  4GSS A;  3HVX A;  4KA0 A;  3GTU A;  3TGZ A;  4K8M A;  1G6W A;  4K7I A;  3GKN A;  1O73 A;  1DBY A;  3UVT A;  5DDL A;  4YAP A;  3TKP A;  1LU4 A;  1PRX A;  1QMV A;  4ZBB A;  1E2Y A;  2L6C A;  1QK8 A;  1ZOF A;  4QL9 A;  2OKA A;  4KW6 A;  2IL3 A;  3QD9 A;  2MYG A;  3ZML A;  4QQ7 A;  2DJJ A;  4ULX A;  1H4O A;  4BVX A;  2YPM A;  2R0P A;  1PA3 A;  2H76 A;  1THO A;  4LMW A;  2O85 A;  5B6M A;  1Q98 A;  3GYK A;  5DJL A;  2FWH A;  1YDK A;  3F0I A;  3IDV A;  2HSH A;  1B4P A;  4AKH A;  2LQO A;  4NV2 A;  5GST A;  3MWH A;  2VUP A;  1K0M A;  2LKU A;  5DBQ A;  4FYB A;  1SL2 B;  2LRT A;  2YN1 A;  2B5X A;  3VUR A;  3M3M A;  4L5L A;  3IAM 2;  5C04 A;  3EE2 A;  2B5Y A;  2LRN A;  4ML6 A;  1WJK A;  2CA8 A;  2GQK A;  1U87 A;  4KE3 A;  1EP7 A;  3F9U A;  2H66 A;  1XOA A;  2AJQ B;  2VL9 A;  1EOG A;  1WOU A;  1KBN A;  3QDN A;  5IMV A;  2O89 A;  2JL4 A;  3HZ4 A;  4OFT A;  1BG5 A;  3KH7 A;  2GSR A;  3FZA A;  3WGD A;  5BRT A;  5HFI A;  4EF0 A;  3A2X A;  3UBK A;  5D73 A;  2HRN A;  2JU5 A;  4OD7 A;  3GX0 A;  3KEB A;  2GGT A;  2KP2 A;  2KP1 A;  3G9B A;  2C4J A;  5ELG A;  4KSO A;  2WDU A;  4XCS A;  2AV4 A;  1F6M C;  5DQS A;  4JU5 A;  1TXX A;  4I2U A;  3R2Q A;  1AQV A;  2FUG 2;  1R4W A;  2JAC A;  3IRA A;  1OC9 B;  5F07 A;  3VWW A;  3IBH A;  6GSX A;  1ACV A;  3EIN A;  2M46 A;  5ECH B;  4USS A;  5IPH A;  1GNW A;  4K5S A;  1GSU A;  3DWV A;  5DCH A;  2I81 A;  4TR3 A;  2LST A;  4IN0 A;  2I1U A;  3K8N A;  2F9S A;  1GSD A;  1M0U A;  4PXO A;  1TK8 B;  2IFQ A;  2VIM A;  4MF7 A;  2QA2 A;  2CAI A;  3TU3 B;  4ECJ A;  4HQZ A;  4ILF A;  3EVI A;  1SYR A;  4GQC A;  3GH9 A;  3RDW A;  2H1G A;  1T3B A;  4EVM A;  1GSY A;  2C0G A;  4BWS A;  1GTB A;  1BED A;  1V98 A;  1X5D A;  1O7U A;  3HY2 A;  3PGT A;  3TKS A;  3D0Z A;  4KND A;  2IPA A;  5EL8 A;  3ZTL A;  1TI3 A;  3FY7 A;  2LJR A;  1Y1U A;  3QAW A;  1PQN A;  4G01 A;  2RM6 A;  5A5K A;  4H86 A;  4O5Q A;  1OVN A;  2DMM A;  5KOX A;  4D73 B;  3I9V 2;  3C8E A;  3APQ A;  4JED A;  2FY6 A;  5DVB A;  4RI6 A;  3ME7 A;  6GSV A;  2LRC A;  1PN0 A;  2LUS A;  4O5R A;  6GST A;  2X8G A;  3FZ5 A;  3D4M A;  3BD2 A;  4EKZ A;  1AAZ A;  4L5O A;  4EDZ A;  4GLT A;  1TJD A;  5JCW A;  5HR3 A;  5BMU A;  4MMM A;  3D4T A;  4QL7 A;  1MDJ A;  2F8A A;  4GQF A;  2R0G A;  4XS6 A;  4MF5 A;  1FO5 A;  4DSS B;  1WMJ A;  3E9J B;  3HZ8 A;  3MNG A;  3ZIJ A;  3G7I A;  4DVC A;  4HQS A;  2H70 A;  1XFL A;  1Z9H A;  1G7O A;  1TU7 A;  2L5L A;  3VPT A;  1XW9 A;  3HCZ A;  2HE3 A;  5DAK A;  1NHO A;  1RW1 A;  3HHV A;  4O5U A;  2EC4 A;  2GST A;  2WZ9 A;  2X64 A;  2R4V A;  1KNG A;  5B7C A;  6GSY A;  5F06 A;  2GQL A;  3MAK A;  1X9M B;  1GNE A;  5CRH A;  1BAY A;  2JSZ A;  3GNJ A;  2I3Y A;  4N0Z A;  4F82 A;  2HSM B;  3P7X A;  3FEU A;  2MMO A;  4AJ7 A;  4AJ6 A;  2BMX A;  5ECR B;  4EO3 A;  4DSR A;  1AC1 A;  5ECQ B;  3WT1 A;  5G2Z A;  2B3S A;  2CVK A;  2C3N A;  3E0U A;  2X49 A;  2R2J A;  2VCV A;  5KN1 A;  1JHB A;  5DJM A;  4KH7 A;  2F3M A;  2F8F A;  2AUV A;  1S3A A;  2PMT A;  2FA8 A;  5L71 A;  2OBI A;  1M99 A;  2R3X A;  3FZ9 A;  3ERG A;  3TJB A;  5A1N B;  1MEK A;  1HQO A;  2JSY A;  2A2S A;  3ZRE A;  2WGR A;  2R37 A;  2B1L A;  4G0K A;  4CDO A;  5KN0 A;  4IJI A;  3W8S A;  1VGL A;  4N0V A;  1PL1 A;  3N9J A;  5E59 A;  4O32 A;  2P5Q A;  5IM9 A;  1FOH A;  3RPN A;  1XZO A;  4TXO B;  4ZBD A;  2V2G A;  1DUG A;  4N10 A;  5F05 A;  5CRD A;  1CQG A;  1LBK A;  1K0C A;  3HVV A;  4KF9 A;  5F0G A;  4WXT A;  3FW2 A;  5A5H B;  4X0X A;  4CY8 A;  1G0T A;  2WUL A;  5J4Y A;  2FD3 A;  1F37 A;  3LQ7 A;  2ON5 A;  1A23 A;  2HRK A;  2HSN A;  4WF5 A;  1PKW A;  3J7Y k;  1SD8 A;  3C71 A;  3DVW A;  4JBB A;  4TR1 B;  3HXS A;  2HNL A;  2E2G A;  1A8Y A;  3ZIV A;  2YZU A;  3GA4 A;  4PUF C;  2X99 A;  5EY6 A;  1HD2 A;  5IQY A;  3IK9 A;  2IMI A;  1YJ6 A;  1SEN A;  2AYT A;  3ZMK A;  1QQ2 A;  2YV7 A;  2V6O A;  1GUM A;  5H5Q A;  2MZC A;  3LOR A;  1DE1 A;  3WGX A;  2XBI A;  4EE0 A;  3QPM A;  3RPP A;  2HI7 A;  4IP6 A;  4YAV A;  2FA4 A;  2FHE A;  1SKW B;  2R6K A;  3CSJ A;  4XS4 A;  1XW5 A;  1AXD A;  2RM5 A;  1USB A;  4MZC A;  1PX6 A;  4ZB7 A;  4BL7 A;  2J9H A;  1T8E B;  3UAR A;  2K9F A;  2NBS A;  5A4V A;  1S3C A;  3BJ5 A;  1MDK A;  3W8J A;  2GZZ A;  4K1F A;  3D5J A;  2WFC A;  5ID2 B;  1N25 A;  4V2M A;  1GRX A;  1XWK A;  3GKM A;  4RQX A;  3G7Y A;  2OE0 A;  4K2X A;  1ZZY A;  1EZK A;  2GT6 A;  1R5A A;  1YF1 A;  3DKS A;  3CSH A;  2MBT A;  5AIX A;  1C72 A;  3LYK A;  3EWL A;  5G31 A;  1FB6 A;  2LNT A;  3G7J A;  2PPT A;  5DCG A;  5ECO B;  2IMD A;  1W4V A;  4N11 A;  19GS A;  4PUR A;  5ECK B;  5KEJ A;  5IMD A;  3F6F A;  3EUR A;  2EIR A;  1O81 A;  3KIJ A;  1SL0 B;  5EVO A;  4KDU A;  4ZB8 A;  3LXZ A;  4MF6 A;  4KDY A;  5ECP B;  1PGT A;  4PNG A;  1ZGN A;  3WYW A;  3ED3 A;  4G10 A;  4N3Z A;  1EP8 A;  1RQM A;  1F9M A;  4XS1 A;  4NMU A;  5B8B A;  1TRS A;  5A34 B;  2DJK A;  2L4C A;  2YZH A;  1U6T A;  2LNS A;  5IOW A;  6GSU A;  3N5O A;  3O76 A;  3DIE A;  1VF2 A;  3WT2 A;  2HRA A;  3UVH A;  2VOC A;  1G7E A;  2E0Q A;  2H71 A;  3Q18 A;  4PQH A;  2YWI A;  2LTK A;  2P5R A;  3QMX A;  3LYP A;  4A5P A;  4GXZ A;  4OCF A;  5IMC A;  1GLP A;  1N2A A;  4L0W A;  1GSE A;  1SJ6 A;  5ECM B;  3HDC A;  2VL2 A;  4J56 E;  5KN2 A;  5J9B A;  4TOP A;  3P2A A;  4G0L A;  1FVJ A;  2LV3 A;  1X5E A;  3U5R E;  4HEA 2;  4ZL8 A;  2CVB A;  2CZ3 A;  5J9C A;  3IC8 A;  2RII A;  1X9W B;  5IO2 A;  2J23 A;  3LFL A;  3KZQ A;  3GST A;  2DJ0 A;  3IXR A;  4I6X A;  5LNK e;  1VF3 A;  1OC8 A;  8GSS A;  3FKF A;  3TJG A;  3CSI A;  4XHM A;  4OO5 A;  1CQH A;  4V1A p;  3EMP A;  5D96 A;  5IMF A;  4ECC A;  3MYD A;  1ZYE A;  2IMF A;  22GS A;  1URM A;  3C1R A;  1T4Y A;  3F6D A;  5HFG A;  1PKZ A;  4ZB9 A;  1O6J A;  3J7Y b;  2DC5 A;  1SK2 A;  2B6M A;  3APO A;  5LD0 A;  3PH9 A;  4NXI A;  11GS A;  3ERW A;  4I8B A;  3F63 A;  1H75 A;  2KHP A;  4MPF A;  4MH3 A;  2WS2 A;  4GDF A;  2VLU A;  2EIO A;  2PVQ A;  1AIU A;  2VCQ A;  4WBJ A;  1XW6 A;  1EWX A;  4J2F A;  3CMI A;  5AIS A;  2JZR A;  2L59 A;  4POB A;  4F2I A;  5JCG A;  5JWO B;  3TJJ A;  1Z6N A;  5HFK A;  2DJ2 A;  2VKZ G;  2YJH A;  4MJE A;  1AUC A;  4MAB A;  4ZBA A;  14GS A;  1T1V A;  2G0F A;  4EDY A;  5ID2 A;  2RUE A;  5G5E A;  2VLV A;  2KUC A;  1XIY A;  3GSS A;  4AKI A;  4CY6 A;  5COH A;  4BVY B;  2PWJ A;  3TRX A;  2VCZ A;  1G6Y A;  3H4K A;  4OFM A;  2CAQ A;  3TKR A;  3GHA A;  1I5G A;  1SU9 A;  2BJX A;  3PIN A;  3ZIT A;  3GL3 A;  3SWL A;  2XPE A;  4E8H A;  1K0D A;  3AY8 A;  4WR4 A;  3KP9 A;  3FR9 A;  2DKI A;  4EUY A;  3UIW A;  4NHZ A;  1YEX A;  2YWO A;  4IKH A;  4TW5 A;  1F3B A;  4TXV A;  4IQ1 A;  3QR6 A;  3E3E A;  1GP1 A;  5JCU A;  1V57 A;  1YVL A;  5AN1 A;  2ZUP A;  4Q5Q A;  5GAN D;  2B5E A;  4JR4 A;  1GUL A;  1ON4 A;  2ALB A;  2HQT A;  4MH2 A;  3TRQ A;  4HJM A;  3DRN A;  1NHY A;  1GUK A;  5CRW A;  5GAP D;  4N30 A;  2VAF A;  4ZB6 A;  3DYR A;  3TOU A;  1SL1 B;  4O92 A;  3ZVJ A;  3MIX A;  3L9U A;  3ZRD A;  5KN3 A;  5G1K A;  1B48 A;  2L4Q A;  3NZN A;  2DJ1 A;  3TKS E;  2OT3 A;  2YCD A;  1V2A A;  3GKK A;  3IC4 A;  2DIZ A;  4MZB A;  2VM1 A;  1VF4 A;  4V1A g;  4F03 A;  2VD1 A;  2K6V A;  1FG4 A;  3CTF A;  1JZD A;  2H72 A;  2H0G A;  4I5Q A;  4NPB A;  3LXT A;  3GH6 A;  2FLS A;  3CRT A;  4GF0 A;  2Z9S A;  3W6G A;  3TDG A;  2FWE A;  2JZS A;  3EU3 A;  4WBR D;  3DVX A;  7GSS A;  1JLV A;  1GH2 A;  3HA9 A;  5CNW A;  5CP1 A;  2GTU A;  1VF1 A;  2VCX A;  1N8J A;  2KOK A;  2P0G A;  4AF2 A;  5B8A A;  3FR6 A;  3UOM A;  4NHW A;  3KD0 A;  4Q5R A;  2L6D A;  2YWM A;  1B4Q A;  1GTA A;  1ZCP A;  1BYE A;  5GSS A;  3LW9 A;  6GSS A;  1J9B A;  3R3E A;  2C0F A;  4ZL9 A;  3CRU A;  4LMV A;  1K3O A;  5J40 A;  2QKE A;  4FIW A;  3IV4 A;  4XIH A;  1LJR A;  4K0N A;  3DML A;  2C80 A;  4MDC A;  3IHQ A;  1Q4J A;  3ME8 A;  5H5R A;  2HZE B;  3H93 A;  3F4R A;  4MZW A;  1EGR A;  3L9S A;  3IAS 2;  4AI6 A;  4ECB A;  1JLW A;  1KTE A;  2N5F A;  3I69 A;  1K3Y A;  2PGT A;  1F3A A;  2YP6 A;  1F2E A;  3QAV A;  4NV5 A;  2DJ3 A;  4K6X A;  1BF5 A;  5IIZ A;  4LLR A;  1SK1 A;  4XTS A;  1GTI A;  3KMN A;  1SJI A;  1R7H A;  3ZFB A;  5J4V A;  1OC9 A;  3GN3 A;  18GS A;  2CVD A;  4QMK A;  4POL A;  5J3R A;  3H79 A;  1PMT A;  2QGV A;  4MP4 A;  3WD6 A;  1SVL A;  1FHE A;  2GT5 A;  2GLR A;  4WF4 A;  4YQV A;  1Z3E A;  3SBC A;  2FWG A;  5HR1 A;  4ZIL A;  4PQ1 A;  3BBY A;  2UV8 G;  1WIK A;  2VO4 A;  4KUN A;  3KTB A;  1OE8 A;  2D2Z A;  2M72 A;  2YNX A;  1TXU A;  5CRG A;  3TKQ A;  1J08 A;  4XRD A;  3HVS A;  4TKY A;  1HYU A;  3RHC A;  5A4U A;  2GS3 A;  2C3T A;  4MJC A;  2MBS A;  5ECI B;  5J41 A;  3KTL A;  4HOJ A;  2C0E A;  2OBK A;  2CT6 A;  3VWV A;  2DIY A;  4D73 A;  5DAL B;  2OAD A;  4GWR A;  4MCU A;  2OE3 A;  4RI7 A;  2V6K A;  1TK0 B;  1PSQ A;  4MJB A;  13GS A;  1GL8 A;  1EGO A;  4WKW A;  3ZFL A;  2LQQ A;  2ZNM A;  1ZYN A;  1YY7 A;  2H19 A;  5D9T A;  3HJO A;  5C00 A;  2QA1 A;  4PNF A;  3ZLP A;  1A8L A;  2X8C A;  2ZCT A;  3HKR A;  5J5N A;  4JZQ A;  4GST A;  3VK9 A;  4YH2 A;  2YJ7 A;  4OO4 A;  2DBC A;  2F51 A;  1GSF A;  1BG1 A;  2VL2 C;  3NIV A;  2VCW A;  1YKA A;  1K0N A;  5IMA A;  4E68 A;  5ECS A;  4I97 A;  2H6Y A;  3D22 A;  1M2A A;  2JZT A;  4PUA A;  5D93 A;  4DSS A;  5AIV A;  5IPG A;  2PVO C;  2AAW A;  1ZYQ B;  1A0F A;  1B9X C;  1U88 A;  3TB2 A;  4KCA A;  1UA5 A;  1EEJ A;  2E2M A;  3GL5 A;  4LL1 B;  4Z2T A;  1B8X A;  1WPI A;  3S9F A;  1T7P B;  1E6B A;  2YAN A;  1Z6M A;  1M9B A;  1A0R P;  2R0C A;  1WP0 A;  4OCE A;  2VL3 A;  1XWB A;  1QUW A;  5LCZ A;  1K0O A;  3EYT A;  1TOF A;  3KP8 A;  1VRS D;  3M1G A;  9GSS A;  4L0U A;  3RAZ A;  3L4N A;  1PX7 A;  3I6A A;  2WRT A;  1AQX A;  4IGJ A;  1ERW A;  4ZL7 A;  1XWG A;  4G0I A;  2HZF A;  4ZIJ A;  3P90 A;  3CTG A;  3US3 A;  2H0I A;  4POK A;  4CW9 A;  5HQP A;  2HSM A;  3KJY A;  2LJA A;  1XBS A;  1XVQ A;  2C3Q A;  2LEG A;  1A2M A;  3VWU A;  3L78 A;  4F0B A;  4ZXG A;  2B7J A;  2IFQ B;  1R26 A;  2LJK A;  1MD3 A;  3UMA A;  2H75 A;  2RLI A;  4RQR A;  1JFU A;  3PR8 A;  3VI7 A;  1MD4 A;  4WET A;  2MMN A;  1O8W A;  3IOS A;  1V40 A;  1NW2 A;  3RHB A;  1Y6E A;  1XCC A;  5F8B A;  4MPG A;  2RUF A;  1GTU A;  3M9K A;  1PL2 A;  1O8X A;  5D9X A;  2E7P A;  5A1N A;  2AHE A;  1M2D A;  4I2T A;  4K5R A;  2X8H A;  2H1L A;  4ICY A;  3C7M A;  3DD3 A;  4ACS A;  3JCM L;  4PGT A;  4TXO A;  1ERV A;  2C0D A;  4NAX A;  3IK7 A;  3VPQ A;  2EFE A;  3EC3 A;  4GCI A;  3L0H A;  3ZZX A;  1ERU A;  3IA1 A;  5G30 A;  4F0C A;  2R5G A;  1YKC A;  2GSS A;  4W66 A;  3OR5 A;  2WB9 A;  2B7K A;  5A5H A;  2IJY A;  4POM A;  1DSB A;  2H0H A;  4BPY A;  3PPU A;  2NTO A;  1JZW A;  4HU7 A;  1OKT A;  2DKH A;  5INY A;  1X9S B;  5D9W A;  5FT3 A;  5BMU B;  1M2B A;  3L9V A;  4TR1 A;  3GIX A;  4HUA A;  4JR6 A;  4MJA A;  3TKS C;  3A5I A;  4OFN A;  2DML A;  2HLS A;  3ZYW A;  5DAL A;  4E8E A;  3HMJ G;  3P8W A;  2O7K A;  4TVE A;  2AB6 A;  4DSQ A;  4MK3 A;  1UN2 A;  2M80 A;  2VLT A;  2EIQ A;  4HZ2 A;  2X4A A;  5ECL B;  4AKG A;  5ELA A;  1FAA A;  4K9Z A;  3FYG A;  4WEY A;  5DAK B;  1ERT A;  5B6N A;  3ZVJ D;  2O87 A;  2DSA A;  4KX4 A;  4GRF A;  1TKD B;  4V2N A;  3CXG A;  1OAZ A;  3QCP A;  2GDR A;  4AKX B;  4TR4 A;  1YF0 A;  2N5B A;  1IYH A;  5J4U A;  3QFA C;  4OWY A;  1WE0 A;  1XWC A;  2HYX A;  4GSN A;  2IME A;  2GVP A;  2HRF A;  4DEJ A;  1K3L A;  2EFD A;  3TJK A;  5FHI A;  2YV9 A;  3HD5 A;  4IEL A;  4FQU A;  3IPZ A;  2YOI A;  3RBT A;  1TRW A;  2C8U A;  1K0A A;  2H30 A;  4G19 A;  1GLQ A;  5AGY A;  2V1M A;  4Z7X A;  4HU9 A;  2HSY A;  3MDK A;  1XVW A;  1OYJ A;  1OKD A;  1TTZ A;  3UBL A;  1AQW A;  5EPF A;  1Z7R A;  3KCM A;  2UZ8 A;  4Q5N A;  2NVL A;  1PN9 A;  4PX1 A;  2FGX A;  2GZP A;  3HJP A;  3QFB C;  2HT9 A;  1FB0 A;  4XRA A;  4HJ2 A;  3VWX A;  2H1B A;  2L5O A;  1M9A A;  4HS1 A;  3FHK A;  1WRY A;  3FK8 A;  3I43 A;  4OMV A;  5D8I A;  4F9Z A;  1UVZ A;  5CO3 A;  2K18 A;  2QC7 A;  2DLX A;  4EL1 A;  5CYY A;  2ES7 A;  4IW9 A;  2WJU A;  2LS5 A;  3GMF A;  3VFI A;  4BA7 A;  1JZR A;  2CQ9 A;  1ZMA A;  4GTU A;  4PTS A;  2A2R A;  4TN8 A;  3FRC A;  4K7N A;  5A34 A;  3KM6 A;  3Q74 A;  2IIY A;  2FWF A;  3EPT A;  1T00 A;  2OJL A;  1U3I A;  1SKS B;  1IYI A;  1X0R A;  3IHG A;  3LWA A;  3CYN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...