1F3AA

Crystal structure of mgsta1-1 in complex with gsh
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
221
structure length
221
Chain Sequence
AGKPVLHYFNARGRMECIRWLLAAAGVEFEEKFIQSPEDLEKLKKDGNLMFDQVPMVEIDGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYSEGILDLTEMIGQLVLCPPDQREAKTALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLEVLLYVEEFDASLLTPFPLLKAFKSRISSLPNVKKFLQPGSQRKPPMDAKQIQEARKAFKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLUTATHIONE S-TRANSFERASE YA CHAIN
publication title Residue R216 and catalytic efficiency of a murine class alpha glutathione S-transferase toward benzo[a]pyrene 7(R),8(S)-diol 9(S), 10(R)-epoxide.
pubmed doi rcsb
source organism Mus musculus
total genus 83
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2000-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1f3aA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1f3aA01
4MF5A 4BVXA 1MDIA 3FZAA 2YANA 1UA5A 4DSRA 5IOXA 5DAKB 3LWAA 4GTUA 4F0CA 1SD8A 1AQWA 1B4PA 1UVZA 1SK2A 1QK8A 4TRXA 2GVPA 1HNBA 1VF1A 1GNEA 2FD3A 1QGVA 1GUMA 5F06A 2L5OA 3GMFA 4XCSA 3KMNA 18GSA 4HU9A 3RHCA 2YZHA 4NAXA 5FT3A 1LU4A 4BL7B 3GSTA 2F8AA 4H86A 2YPMA 4RUVA 5HR0A 5ECQB 4KAEA 3IPZA 2WRTA 1JZWA 1EWXA 5ENUA 1EGOA 2H6YA 4V2NA 1ABAA 2KP1A 3W6GA 2IPAA 4ECBA 1A2LA 4IP6A 4HJ2A 3CSJA 5J4UA 2YP6A 2QSIA 1JZDA 2B1KA 3ERFA 4P3YB 5G5EA 1TW9A 1A23A 2H1BA 5DVBA 2C3TA 1SJ6A 1KNGA 2FLSA 2A2RA 2CQ9A 5AGYA 4PQIA 2WZ9A 2J9HA 2BJXA 2H8LA 2HQTA 2O89A 3ZRDA 4KDUA 3W8JA 3MAKA 4ZIJA 3F8UA 1GTBA 3LEFA 5CYYA 5DCHA 2FGXA 3KEBA 1O73A 4I6XA 4PUFC 4NWYA 4WETA 13GSA 1K0CA 2NTOA 1XIYA 1OC9A 3K8NA 1YZXA 2EIRA 2X64A 1NHOA 2HRKA 4OCFA 1EEMA 2YV9A 1XXUA 2LJAA 2G0FA 4PX1A 3L9VA 4IN0A 4IELA 3RDWA 4BA7A 2C80A 3HZ8A 3GTUB 3AY8A 1JLWA 1GNWA 3R2QA 2X8HA 2R2JA 1TI3A 2MBTA 1PL1A 3F4SA 3ZYWA 2GSRA 1R7HA 1UC7A 1ZMAA 1C72A 2V6OA 4EVMA 4OFNA 4MABA 2P5QA 4BWSA 2RM6A 1QFNA 3UOMA 4MLYA 4LLRA 1K0AA 2VLUA 4K0GA 3ZMLA 4EL1A 5IMFA 3KTLA 2FA8A 5AIVA 6GSVA 3EYTA 5A5KA 4XTSA 3LG6A 4N0ZA 2C1YA 1T00A 2LRCA 1WWJA 4HI7A 3DMLA 1Z6MA 2MMZA 5B6NA 2OACA 3A2WA 4IW9A 3GH9A 3N5OA 2MMOA 3HDCA 1WIKA 5ID2A 4POLA 1YKAA 1JHBA 4HQSA 2Z9SA 4IVFA 4TR4A 1WMJA 3F4RA 3UBKA 3GURA 4ACSA 4WEYA 2PERA 3TKSC 2HXKA 4ZB6A 4N30A 2R37A 4MPGA 2E2GA 3C1SA 3ME8A 2O85A 2IIYA 2GQMA 2HI7A 5D93A 4TXVA 2CX3A 3L4NA 5AISA 1K0BA 4ID0A 5F8BA 5IOWA 16GSA 4GCIA 2H1GA 5GAND 2GTUA 3GSSA 1GSSA 1PRXA 5IMCA 4CW9A 3IE3A 1I9DA 4WF5A 4MF7A 3PPUA 2B5EA 2DC5A 4AJ8A 4KX4A 1VGLA 1CQGA 3TKPA 1JZRA 2H72A 4L0UA 2L4QA 4LL4B 3I9V2 5IO2A 1WP0A 2DSAA 4KDXA 3E9JB 3C8EA 1YF1A 5D9WA 2C3NA 4GRFA 3EMXA 1TJDA 1J0FA 4MCUA 2LEGA 3QCPA 3HD5A 5CRHA 3GX8A 4EXJA 2PU9C 3RPPA 4HEA2 4J56E 2CT6A 1AQVA 3VK9A 5CP1A 1V98A 2HZFA 2C0DA 4IJ3A 3NIVA 2JZTA 1WOUA 3CBUA 3FK8A 3ZFLA 2FWHA 3GYKA 3FYGA 2YWNA 4MK3A 5A4UA 3OR5A 4HZ2A 4KCAA 4LMVA 3TJGA 3EURA 1G6YA 2VCTA 2MZCA 5INYA 2IJYA 5EPFA 4ZB8A 2VIMA 5DALA 4YQMA 1RW1A 2K9FA 3QOUA 4NXIA 4X0XA 3APOA 1ML6A 4WR5A 4I2UA 1HQOA 2AAWA 2R4VA 3CRTA 1MEKA 1F3AA 1PA3A 3UARA 4E8EA 5FWGA 4EKZA 4JR6A 5ECMB 1O8WA 1XBSA 4GSTA 1ZOFA 2ON7A 5AN1A 1SKWB 1K0OA 1GULA 2YCDA 5IO0A 1TOFA 1FOVA 2QC7A 3BBYA 1HYUA 2L6CA 3DIEA 4L5OA 4ZL9A 2DMLA 2YNXA 3FRCA 1YJ6A 4ZBAA 2LKUA 3NZNA 1SJZA 1TI1A 1PL2A 2KLXA 3DGQA 1W4VA 1YEXA 4KGIA 4IHUA 3DD3A 2H01A 2JSYA 4K7NA 5HR3A 5D9TA 2GSQA 2DBCA 1Z5YE 1U3AA 3WGDA 2GDRA 3TKSA 4BVYA 3EVIA 4OD7A 4WBJA 2HSMB 3IHQA 5D8IA 1A24A 3O3TA 3C73A 4QL9A 4FQUA 1FB0A 1B48A 3P2AA 4MZWA 1TRVA 3CYNA 1PKWA 3HXSA 5IMDA 2L59A 4YAPA 3GKNA 3GHAA 4HS1A 4ILFA 3PR8A 3ZREA 5IMVA 3DYRA 2TIRA 3UL3A 3TKQA 2ALBA 3QMXA 2ES7A 4PURA 3RAZA 1R5PA 3DXBA 3P90A 2CZ2A 1H4OA 5FHIA 2DJ3A 2HLSA 3KJYA 2TRXA 2LQOA 1K3YA 4IS0A 2YWIA 4D73B 5H5SA 1T8EB 1XOBA 1FVJA 4MA9A 2B7KA 1Z6NA 1PMTA 5H5RA 4NHZA 1JFUA 1B9YC 2H75A 1EV4A 4V1Ap 3QAWA 4QL7A 3ZIJA 5ECIB 3CSIA 4F0BA 4L8EA 6GSXA 1O6JA 5ECPB 5DJMA 2ZNMA 2GSSA 2GQKA 1F3BA 3LXTA 4IBPA 4GSSA 1V40A 5G31A 1OKTA 2M72A 1NW2A 3E0UA 1SJIA 2VCQA 1RQMA 2VCXA 4BVXB 2VLVA 1TRWA 2NBSA 2YOIA 1U3IA 4YQVA 2E0QA 2IFQA 2WULA 3FY7A 1PX6A 3EINA 2PGTA 3I43A 4KDYA 3KMOA 1VRSD 14GSA 1SL0B 1USBA 2IMKA 2X8CA 5B7CA 1J08A 4DVCA 3GRXA 4OWYA 1PX7A 2EC4A 3IR4A 4ZXGA 2IMEA 1XFLA 2HSYA 2L6DA 1S3AA 5CNWA 2H6XA 3VI7A 1GUHA 3EC3A 3FKFA 1SL2B 3A3TA 1GRXA 4N11A 4V2LA 3F0IA 2C0GA 5HR2A 3ZFBA 2C0FA 4JRRA 1OC3A 4ZILA 2OA7A 1F6MC 3UEMA 2M80A 4RQXA 3UJ1A 1E2YA 3A5WA 2F3MA 1T1VA 4KCEA 4KH7A 1A8LA 6GSTA 3FZ4A 1UN2A 4PQ1A 3GKKA 3D22A 4ML6A 4XS4A 3C71A 1TDIA 2GS3A 5CRGA 2H1DA 3VWWA 1GLQA 3GA4A 2YV7A 3M3MA 3G7YA 3HA9A 3P7XA 3QR6A 2DMMA 3EMPA 4V1Ag 1OE8A 4NHWA 3U6VA 2O8VB 2HRKB 2VCZA 2HZEA 1XVQA 3HYPA 1PSQA 1CQHA 3HJPA 2WFCA 1GLPA 4OO4A 4MPFA 1M9BA 4EDZA 4Q5QA 4IQAA 2VCVA 5LCZA 2P31A 3HVSA 3S9FA 2KP2A 4F2IA 5IIZA 4X1UA 3IK7A 4FO5A 19GSA 5D9VA 2GLRA 4OO5A 5ECSA 4XS1A 1A0FA 3R3EA 2H76A 1EV9A 2VLTA 3LORA 2IL3A 4O7HA 3KTBA 3SBCA 3O76A 3KIJA 1GH2A 1YF0A 4YH2A 10GSA 3LYPA 2LNSA 4MZCA 1HNAA 2V6KA 2JL4A 1A2MA 5G1LA 4FYUA 1AC1A 1TK5B 1SK1A 3VWUA 3IOSA 2LJKA 1OAZA 4ZBBA 1URMA 4DEJA 2JSZA 4EDYA 3A2VA 1KEBA 2HNLA 2PUKC 2P0GA 4MDCA 5F0GA 3FEUA 1X9SB 5ID2B 4PNFA 5J9CA 2BTOT 1F9MA 2CV4A 4K7IA 1T7PB 3IV4A 1DSBA 2XPDA 2CVDA 2H6ZA 2VL9A 3Q19A 3D6IA 2LS5A 2F51A 3U5RE 4F82A 3J7Yb 3GTUA 3GNJA 1YEPA 3MWHA 3KCMA 1SKRB 1TRSA 2FA4A 5EVOA 3IRAA 3MSZA 1SKSB 3TGZA 4POBA 4PTSA 3IC8A 4I5QA 1FAAA 1SYRA 4KSOA 3L9SA 4JE1A 2HSHA 5F07A 4K8MA 1YDKA 3VURA 3W8SA 4XIHA 3GN3A 4FH8A 1VF3A 1XW6A 4WKWA 5LD0A 4IGJA 6GSSA 3GV1A 5CRDA 1N8JA 5GSTA 4HOJA 2H0GA 4CHSA 3FR9A 1Z7RA 4NV2A 2GGTA 2H0IA 1S3CA 2R5GA 3VI5A 2HE3A 4NMUA 4PXOA 2EIQA 1XW5A 3GL3A 4KA0A 5D96A 3F63A 2QGVA 3ZZXA 2DJJA 4AF2A 1OKDA 5HR1A 1ILOA 1BG5A 5DDLA 3VWVA 3UIWA 1O8XA 4WF4A 1X0RA 3BCIA 2C4JA 3QFAC 1WJKA 3J7Yk 2OE0A 4IP1A 5CREA 3GX0A 3MNGA 1GSYA 4ECIA 3HY2A 1U6TA 3DKSA 2XPEA 3QDNA 1SU9A 1Z7PA 2C0EA 3DVWA 3TJJA 4F9ZA 2M46A 4TVEA 5A4WA 2H19A 3EWLA 2YJ7A 3IAS2 1M0UA 1EEJA 2K8VA 2R3XA 3QPMA 3G7JA 1PKZA 3EE2A 3CRUA 4IKHA 3E3EA 4ULXA 3LQ7A 3EU4A 4OFMA 2LRNA 3JCML 5D73A 1TXXA 3FR6A 2MYGA 4G0IA 3ISOA 17GSA 4AGSA 2OJLA 3FW2A 2N5FA 5AIXA 1B4QA 3WD6A 4ZL8A 2RM5A 2H30A 4OCEA 3L0HA 4GLTA 5LNKe 4FIWA 1AQXA 1EP7A 2JZSA 3FZ5A 1EZKA 3KM6A 1GWCA 1FO5A 4KW6A 3FHKA 5F05A 2FCHA 2I4AA 3TRQA 3M1GA 3H93A 5IMZA 4USSA 4WBRD 4GXZA 3F6DA 1OVNA 4RI7A 2MBSA 5COHA 2BMXA 3HZ4A 2V41A 1XW9A 1SYXA 4HJMA 2JACA 2P5RA 2R6KA 5G5FA 2PMTA 3HHVA 2OADA 3ZIVA 2LTKA 3BD2A 3P8WA 4JU5A 4ZB9A 1F37A 5A4VA 2DIYA 1GSDA 1M2BA 3TKSE 2I9HA 1OC8A 2LSTA 1FVKA 12GSA 1R4WA 2WCIA 3Q6OA 5GAPD 4MP4A 2I81A 1ZCPA 1TRUA 1ZL9A 3MDKA 2CAIA 3I6AA 1AW9A 2HT9A 4E8HA 4TR1B 2B7JA 1K0MA 4K0NA 1RK4A 1X5DA 2B1LA 4I8BA 3H4KA 3M9JA 3KP9A 3C1RA 2FHEA 3ZVJA 4ECJA 3CMIA 5B6MA 3KD0A 2ON5A 3WT1A 2B5YA 4I97A 2CAQA 2O87A 3CTGA 3UBLA 1GTAA 1W89A 5C00A 5L71A 4PQHA 3F6FA 4PUAA 2OBIA 2GQLA 1GL8A 1TU7A 2VAFA 3Q74A 5ECRB 4F03A 2YJHA 3LSZA 1TKDB 1ERUA 1Y6EA 2K8SA 1J9BA 2LJRA 1BEDA 2A4VA 3M0FA 1X9WB 1ERVA 6GSWA 1VF4A 4OMVA 2IFQB 4TR3A 4EC0A 8GSSA 1FW1A 5IQYA 2HYXA 1F2EA 4KE3A 1XPVA 5DQYA 1R5AA 4POMA 3LGCA 1XWBA 4AJ6A 2KOKA 3HKRA 1O85A 1GSQA 4N10A 2IMIA 4PGTA 3ERGA 4J57E 2A2SA 4D73A 2IN3A 3UMAA 1NSWA 4TR0A 4TXOA 4K9ZA 2EIOA 4LL1B 5DCGA 4HU7A 3A2XA 2YWMA 2PPTA 4DSSA 2FNOA 3FR3A 5IMAA 2GZPA 3TKRA 1FG4A 4MH2A 5J5NA 4KNDA 3GKMA 2FWGA 1A2JA 2PVQA 4IQ1A 1V9WA 4O32A 2X8GA 1GUKA 1O7UA 1M9AA 5ECNB 4FYBA 4ISDA 1M99A 4ZL7A 2PVOC 5KEJA 5IPGA 2XBQA 3TCOA 5B8BA 3ZL5A 1XWKA 4NPBA 1SK0A 4G10A 1THXA 3V1WA 4K7OA 1GTUA 2HZEB 2XBIA 1ZYEA 3VPTA 2VUPA 1V57A 2LRTA 1X5CA 4PNGA 2H71A 3GKXA 2H70A 1HD2A 3GIXA 1K0DA 4NV5A 2V32A 3BCKA 4K1FA 2CVBA 2LUSA 2GSTA 2CZ3A 1OC9B 1NHYA 1DE1A 3HJOA 5DAKA 1XOAA 1T4YA 3ZMKA 2HRFA 3F3RA 4RI6A 1BAYA 3IK9A 2F8FA 4GF0A 3M8NA 4L5LA 3H79A 3IA1A 1PD21 3KZQA 4MF6A 1G0TA 4O92A 5KN2A 9GSSA 3PH9A 3WT2A 2YN1A 3LJRA 1ST9A 1BX9A 1XWGA 4MJEA 1T4ZA 4XRAA 4YAVA 20GSA 4XS6A 1HNCA 2WB9A 2V2GA 4KB3A 5KN1A 2JADA 4BL7A 4LMWA 2J23A 4FYCA 2X99A 5KN3A 1DBYA 1G7OA 3RBTA 4BPYA 1ERWA 2NVLA 3DRNA 5J9BA 5D9XA 2GZYA 3D5JA 6GSUA 4LA1A 5JCGA 4Q5RA 5HFIA 1XWAA 3TUEA 4Z7XA 1U88A 5ECLB 2K6VA 3TOTA 1GSFA 1FB6A 3PINA 2WGRA 3WYWA 3D4TA 3I69A 2IMDA 2FWFA 1EGRA 4TOPA 2E2MA 1H75A 2VL2C 3GL5A 4DSQA 1X5EA 4HQZA 1LBKA 1KBNA 3D4MA 3CXGA 2L5LA 2GT5A 3BOAA 2OE1A 2HRNA 5ECHB 5DBQA 4K2DA 1TP9A 4KUNA 2GZZA 1MTCA 1AUCA 3EU3A 5J3RA 5GZZB 3HVXA 2WJUA 4JBBA 2ZUPA 2IWTA 3DVXA 1BJXA 1GP1A 2PN8A 3LYKA 1QMVA 3RPNA 5HFKA 5HQPA 5G30A 4JZQA 3TJFA 3G9BA 5E4WA 2D2ZA 2AHEA 2LV3A 5J41A 1N2AA 4MZBA 22GSA 3L9UA 3N9JA 3UVTA 5ECOB 2H0HA 3F4TA 2B3SA 1PGTA 1XCCA 1EOHA 3LFLA 3VPQA 3ZVJD 5GSSA 4TN8A 2N5AA 2H74A 1MDJA 1B8XA 1SD9A 5B8AA 5EY6A 2VOCA 2LNTA 2OBKA 2HSNB 3KP8A 3PGTA 3VWXA 3DWVA 4J2FA 2CVKA 2DLXA 2AV4A 3SWLA 5KN0A 1KTEA 7GSSA 3UVHA 3ME7A 2VCWA 4YQUA 3IBHA 1A8YA 2PBJA 4O5RA 4BWQA 4JEDA 1THOA 3F9UA 1ZYQB 3VLNA 4GQFA 1JLVA 2AJQB 1EOGA 3ZITA 4G0KA 5JWRB 1ERTA 2I3YA 3Q18A 3QD9A 2DJKA 1PN9A 1WRYA 2DJ2A 3NOFA 4MJBA 4Q5FA 5C04A 3H8QA 3H1NA 2B6MA 2ZCTA 5DJLA 5DALB 4WXTA 3HCZA 5ECKB 2VD0A 1WE0A 1Q4JA 1K3LA 1DUGA 1IYHA 1TK0B 5IPHA 5IM9A 3O6TA 2REMA 4ZBDA 2UZ8A 3KXOA 1X9MB 1Y25A 4V2MA 5CAXA 1QUWA 1U87A 1YY7A 5HFGA 1AAZA 2NDOA 2JU5A 1YQ1A 5JWOB 4KF9A 2YZUA 1V2AA 2QKEA 2VO4A 3CTFA 4ECCA 1G7EA 2VL2A 2H66A 2GT6A 4POKA 3C7MA 3US3A 4HDEA 1V58A 4IJIA 2O7KA 4MJAA 2I1UA 4QQ7A 3D21A 1XWCA 5ELGA 5JCUA 1M7TA 3KH9A 2JZRA 5JWQB 4OFTA 1AIUA 2DIZA 3TB2A 2L57A 2C8UA 1OE7A 1EP8A 2PWJA 2LQQA 4BVYB 2DJ1A 1O81A 2FUG2 2XHFA 1E6BA 3G7IA 1OYJA 5CRWA 4MMMA 5CO3A 2AYTA 4CDOA 4MH3A 1ON4A 1GSUA 2CA8A 4AJ7A 2C3QA 3GFKA 5ELAA 1Q98A 4G19A 1TK8B 1WPIA 1XZOA 1TU8A 1SENA 5G2ZA 2E7PA 2RIIA 4G2EA 1VF2A 3IAM2 3ZTLA 1R26A 1NM3A 4WR4A 1ZGNA 3BJ5A 2MMNA 1I5GA 3IDVA 4K6XA 3HJMA 4EF0A 6GSYA 2DJ0A 2F9SA 3DEXA 3CSHA 3QFBC 3RHBA 4GWRA 4X43A 2VM2A 2L4CA 1YKCA 4XRDA 3M9KA 2H1AA 2H73A 4EE0A 2NPBA 3KH7A 2OE3A 1B9XC 1BYEA 5H5QA 2HRAA 4I2TA 3TRXA 1TTZA 1QXHA 3ERWA 1MDKA 2MMAA 1DE2A 3L78A 4KSMA 2N5BA 5E59A 2XC2A 2WS2A 1AXDA 4TKYA 2HSMA 3TJBA 1XVWA 1Z9HA 4TW5A 3APSA 4JR4A 4N0VA 1M2AA 1Z3EA 1ACVA 2VD1A 11GSA 3TRPA 3F3QA 4TR1A 4ML1A 1K3OA 3FZ9A 3ED3A 3WGXA 3QAGA 4HUAA 3LXZA 1G6WA 3IXRA 2V1MA 4TXOB 3TOUA 1FHEA 1QQ2A 3TDGA 2VM1A 1ZZYA 4DSSB 2WDUA 3APQA 3GUSA 4RQRA 2RUEA 1M2DA 4G0LA 1PQNA 5ABRA 1K0NA 2YWOA 2RUFA 4HZ4A 4XHMA 2VL3A 2KUCA 1SL1B 3VFIA 5EL8A 1MD3A 3TJKA 2AB6A 1T3BA 5JCWA 3IC4A 5G1KA 1A0RP 3ZLPA 4EUYA 2G2QA 4Q5NA 3KGKA 2KHPA 2HFDA 3UAPA 1S3DA 2K18A 2FWEA 4GQCA 1BQ7A 4GSNA 5BMUA 3D0ZA 1LJRA 4MJCA 1GTIA 3QAVA 2TRCP 2RLIA 2CX4A 3GH6A 1JZOA 1IYIA 2IMFA 4XS4B 4G9HA 4L0WA 1GSEA 2B5XA 2FY6A 4EO3A 3WGEA 3HVVA 1MD4A 2AUVA 5DQSA 2OKAA
chains in the Genus database with same CATH superfamily
4MF5A 4BVXA 1MDIA 3FZAA 2YANA 1UA5A 4DSRA 5IOXA 5DAKB 3LWAA 4GTUA 4F0CA 1SD8A 1AQWA 1B4PA 1UVZA 1SK2A 1QK8A 4AKHA 4TRXA 2GVPA 1HNBA 1VF1A 4EIPA 1GNEA 2FD3A 1QGVA 1GUMA 5F06A 2L5OA 4O5UA 3GMFA 4XCSA 3KMNA 18GSA 2UV8G 4HU9A 3RHCA 2YZHA 4NAXA 5FT3A 1LU4A 4BL7B 3GSTA 2F8AA 4H86A 2YPMA 4RUVA 5HR0A 5ECQB 4KAEA 1PN0A 3IPZA 2WRTA 1JZWA 1EWXA 5ENUA 1EGOA 2H6YA 4V2NA 1ABAA 2KP1A 3W6GA 2IPAA 4ECBA 1A2LA 4IP6A 4HJ2A 3CSJA 5J4UA 2YP6A 2QSIA 1JZDA 2B1KA 3ERFA 4P3YB 5G5EA 1TW9A 1A23A 2H1BA 5DVBA 2C3TA 1SJ6A 1KNGA 2FLSA 2A2RA 2CQ9A 5AGYA 4PQIA 2WZ9A 2J9HA 2BJXA 2H8LA 2HQTA 2O89A 3ZRDA 4KDUA 3W8JA 3MAKA 4ZIJA 3F8UA 1GTBA 3LEFA 5CYYA 5DCHA 4AI6A 2FGXA 3KEBA 1O73A 4I6XA 4PUFC 4NWYA 4WETA 13GSA 1K0CA 2NTOA 1XIYA 1OC9A 3K8NA 1YZXA 2EIRA 2X64A 1NHOA 2HRKA 4OCFA 1EEMA 2YV9A 1XXUA 2LJAA 2G0FA 4PX1A 3L9VA 4IN0A 4IELA 3RDWA 4BA7A 2C80A 3HZ8A 3GTUB 3AY8A 1JLWA 1GNWA 3R2QA 2X8HA 2R2JA 1M3JA 1TI3A 5A1NA 2MBTA 1PL1A 3F4SA 3ZYWA 2GSRA 1R7HA 1UC7A 1ZMAA 1C72A 2V6OA 4EVMA 4OFNA 4MABA 2P5QA 4BWSA 2RM6A 1QFNA 3UOMA 4MLYA 4LLRA 1K0AA 2VLUA 4K0GA 3ZMLA 4EL1A 5IMFA 2WVZA 3KTLA 2FA8A 5AIVA 6GSVA 3EYTA 5A5KA 4N3ZA 4XTSA 3LG6A 1S4BP 4N0ZA 2C1YA 1T00A 2LRCA 1WWJA 4HI7A 3DMLA 1Z6MA 2MMZA 5B6NA 2OACA 3A2WA 4IW9A 3GH9A 3N5OA 2MMOA 3HDCA 1WIKA 5ID2A 4POLA 1YKAA 1JHBA 4HQSA 4AKXB 2Z9SA 4IVFA 4TR4A 1WMJA 3F4RA 3UBKA 3GURA 4ACSA 4WEYA 2PERA 3TKSC 2HXKA 4ZB6A 4N30A 2R37A 4MPGA 2E2GA 3C1SA 3ME8A 2O85A 2IIYA 2GQMA 2HI7A 5D93A 5KOWA 4TXVA 2CX3A 3L4NA 5AISA 1K0BA 4ID0A 5F8BA 5IOWA 16GSA 4GCIA 2H1GA 5GAND 2GTUA 3GSSA 1GSSA 1PRXA 5IMCA 4CW9A 3IE3A 1I9DA 4WF5A 4MF7A 3PPUA 2B5EA 2DC5A 4AJ8A 4KX4A 1VGLA 1CQGA 3TKPA 1JZRA 2H72A 4L0UA 2L4QA 4LL4B 3I9V2 5IO2A 1WP0A 2DSAA 4KDXA 3E9JB 3C8EA 1YF1A 5D9WA 2C3NA 4GRFA 3EMXA 4YKFA 1TJDA 1J0FA 4MCUA 2LEGA 3QCPA 3HD5A 5CRHA 3GX8A 1FOHA 4EXJA 2PU9C 3RPPA 4HEA2 4J56E 2CT6A 1AQVA 3VK9A 5CP1A 1V98A 2HZFA 2C0DA 4IJ3A 3NIVA 2JZTA 1WOUA 3HMJG 3CBUA 3FK8A 3ZFLA 2FWHA 4MNNA 3GYKA 3FYGA 2YWNA 4MK3A 5A4UA 3OR5A 2QA1A 4HZ2A 4KCAA 4LMVA 3TJGA 3EURA 1G6YA 2VCTA 2MZCA 5INYA 2IJYA 5EPFA 4ZB8A 2VIMA 5DALA 4YQMA 1RW1A 2K9FA 3QOUA 4QMKA 4NXIA 4X0XA 3APOA 1ML6A 4WR5A 4I2UA 1HQOA 3MYDA 2AAWA 1ZYPA 2R4VA 3CRTA 1MEKA 1F3AA 1PA3A 3UARA 4E8EA 5FWGA 4EKZA 4JR6A 5ECMB 1O8WA 1XBSA 2QA2A 4GSTA 1ZOFA 2ON7A 5AN1A 1SKWB 1K0OA 1GULA 2YCDA 5IO0A 1TOFA 1FOVA 5A34A 2QC7A 3BBYA 1HYUA 2L6CA 3DIEA 4L5OA 4ZL9A 2DMLA 2YNXA 3FRCA 1YJ6A 4ZBAA 2LKUA 3NZNA 1SJZA 1TI1A 1PL2A 2KLXA 3DGQA 1W4VA 1YEXA 4KGIA 4IHUA 3DD3A 2H01A 2JSYA 4K7NA 5HR3A 2WW2A 5D9TA 2GSQA 2DBCA 1Z5YE 1U3AA 3WGDA 2GDRA 3TKSA 4BVYA 3EVIA 4OD7A 4WBJA 2HSMB 3IHQA 5D8IA 1A24A 3O3TA 3C73A 4QL9A 4FQUA 1FB0A 1B48A 3P2AA 4MZWA 1TRVA 3CYNA 1PKWA 3HXSA 5IMDA 2L59A 4YAPA 3GKNA 3GHAA 2VKZG 4K2XA 4HS1A 4ILFA 3PR8A 3RFRC 4A5PA 1S3RA 3ZREA 5IMVA 3DYRA 1XG8A 2TIRA 3UL3A 3TKQA 2ALBA 4Z2UA 3QMXA 2ES7A 4PURA 3RAZA 1R5PA 3DXBA 3P90A 2CZ2A 1H4OA 5FHIA 2DJ3A 2HLSA 3KJYA 4W66A 2TRXA 2LQOA 1K3YA 4IS0A 2YWIA 4D73B 5H5SA 1T8EB 2A4HA 1XOBA 1FVJA 4MA9A 2B7KA 3RGBC 1Z6NA 1PMTA 5H5RA 4NHZA 5BMUB 1JFUA 1B9YC 2H75A 1EV4A 4V1Ap 3QAWA 5KOXA 4QL7A 3ZIJA 2R0PA 5ECIB 3CSIA 4F0BA 4L8EA 6GSXA 1O6JA 5ECPB 5DJMA 2ZNMA 2GSSA 2GQKA 1F3BA 3LXTA 4IBPA 4GSSA 1V40A 5G31A 1OKTA 2M72A 1NW2A 3E0UA 1SJIA 2VCQA 1RQMA 2VCXA 4BVXB 2VLVA 1TRWA 2NBSA 2YOIA 1U3IA 4YQVA 2E0QA 4FXYP 2IFQA 2WULA 3FY7A 1PX6A 3EINA 2PGTA 3I43A 4KDYA 3KMOA 1VRSD 14GSA 1SL0B 1USBA 2IMKA 2X8CA 5B7CA 1J08A 4DVCA 3GRXA 4OWYA 1PX7A 2EC4A 3IR4A 4ZXGA 2IMEA 1XFLA 2HSYA 2L6DA 1S3AA 5CNWA 2H6XA 3VI7A 1GUHA 3EC3A 3FKFA 1SL2B 3A3TA 1GRXA 4N11A 4V2LA 3F0IA 2C0GA 5HR2A 3ZFBA 2C0FA 4JRRA 1OC3A 4ZILA 2OA7A 1F6MC 3UEMA 2M80A 2EFEA 4RQXA 3UJ1A 1E2YA 3A5WA 2F3MA 1T1VA 4KCEA 4KH7A 1A8LA 6GSTA 3FZ4A 1UN2A 4PQ1A 3GKKA 3D22A 4ML6A 4XS4A 3C71A 1TDIA 2GS3A 1Y1UA 5CRGA 2WZSA 2H1DA 3VWWA 1GLQA 3GA4A 2YV7A 3M3MA 3G7YA 3HA9A 3P7XA 3QR6A 2DMMA 3EMPA 4V1Ag 1OE8A 1YEWC 4NHWA 2OT3A 3U6VA 2O8VB 2HRKB 2VCZA 2HZEA 1XVQA 3HYPA 1PSQA 4PI2C 3HJPA 1CQHA 2WFCA 1GLPA 2WVYA 4OO4A 4MPFA 1M9BA 4EDZA 4Q5QA 4IQAA 2VCVA 5LCZA 2P31A 3HVSA 4HSCX 3S9FA 4X4JA 2KP2A 4F2IA 5IIZA 4X1UA 5A1NB 3IK7A 4FO5A 19GSA 5D9VA 2GLRA 4OO5A 5ECSA 4XS1A 1A0FA 3R3EA 2H76A 1EV9A 2VLTA 3LORA 2IL3A 4O7HA 3KTBA 3SBCA 3O76A 3KIJA 1GH2A 1YF0A 4YH2A 10GSA 3LYPA 2LNSA 4MZCA 1HNAA 2V6KA 2JL4A 1A2MA 4CY8A 5G1LA 4FYUA 4AKGA 1AC1A 1TXUA 1TK5B 2R0CA 1SK1A 3VWUA 3IOSA 2LJKA 1OAZA 4ZBBA 1URMA 4DEJA 2JSZA 4EDYA 3A2VA 1KEBA 2HNLA 2PUKC 2P0GA 4MDCA 5F0GA 3FEUA 1X9SB 5ID2B 4PNFA 2O3EA 5J9CA 2BTOT 1F9MA 2CV4A 4K7IA 1T7PB 3IV4A 1DSBA 2XPDA 2CVDA 2H6ZA 2VL9A 3Q19A 3D6IA 2LS5A 2F51A 3U5RE 4F82A 3J7Yb 3GTUA 3GNJA 1YEPA 3MWHA 3KCMA 1SKRB 1TRSA 2FA4A 5EVOA 3IRAA 3MSZA 1SKSB 3TGZA 4POBA 4PTSA 3CHXC 3IC8A 4I5QA 1FAAA 1SYRA 4KSOA 3L9SA 4JE1A 2HSHA 5F07A 4K8MA 1YDKA 3VURA 3W8SA 4XIHA 3GN3A 4FH8A 1VF3A 1XW6A 4WKWA 5LD0A 4IGJA 6GSSA 3GV1A 5CRDA 1N8JA 5GSTA 4HOJA 2H0GA 2R0GA 4CHSA 3FR9A 2X4AA 1Z7RA 4NV2A 2GGTA 2H0IA 1S3CA 2R5GA 3VI5A 2HE3A 4NMUA 4PXOA 2EIQA 1XW5A 3GL3A 4KA0A 5D96A 4PI0C 3F63A 2WW1A 2QGVA 3ZZXA 2DJJA 4AF2A 3CWGA 1OKDA 5HR1A 1ILOA 2HSNA 1BG5A 5DDLA 3VWVA 3UIWA 1O8XA 4WF4A 1SVOA 1X0RA 3BCIA 5J4YA 2C4JA 5BRTA 3QFAC 1WJKA 3J7Yk 2OE0A 4IP1A 5CREA 3GX0A 3MNGA 1GSYA 4ECIA 3HY2A 1U6TA 3DKSA 2XPEA 3QDNA 1SU9A 1Z7PA 2DKIA 2C0EA 3DVWA 3TJJA 4F9ZA 2M46A 4TVEA 5A4WA 2H19A 3EWLA 2YJ7A 3IAS2 1M0UA 1EEJA 2K8VA 2R3XA 3QPMA 3G7JA 1PKZA 3EE2A 3CRUA 4IKHA 3E3EA 4ULXA 3LQ7A 3EU4A 4OFMA 2LRNA 3JCML 5D73A 1TXXA 2DKHA 3FR6A 2MYGA 4G0IA 3ISOA 17GSA 4AGSA 2OJLA 5A34B 3FW2A 2N5FA 5AIXA 1B4QA 3WD6A 4ZL8A 2RM5A 2H30A 4OCEA 3L0HA 4GLTA 2O36A 5LNKe 4FIWA 1AQXA 5A5HA 1EP7A 2JZSA 3FZ5A 1EZKA 1ZYNA 3KM6A 1GWCA 1FO5A 4KW6A 3FHKA 5F05A 2FCHA 2I4AA 3TRQA 3M1GA 3H93A 2H1LA 5IMZA 4USSA 4WBRD 4GXZA 3F6DA 1OVNA 4RI7A 2MBSA 5COHA 2BMXA 3HZ4A 2V41A 1XW9A 1SYXA 4HJMA 2JACA 2P5RA 2R6KA 5G5FA 2EFDA 2PMTA 3HHVA 2OADA 3ZIVA 2LTKA 3BD2A 3P8WA 4JU5A 4ZB9A 1F37A 5A4VA 2DIYA 1GSDA 1M2BA 3TKSE 2I9HA 1SVMA 1OC8A 2LSTA 1FVKA 12GSA 2WVXA 1R4WA 2WCIA 3Q6OA 5GAPD 4MP4A 2I81A 1ZCPA 1TRUA 1ZL9A 3MDKA 1BF5A 2CAIA 3I6AA 1AW9A 2HT9A 4E8HA 4TR1B 2B7JA 1K0MA 4K0NA 1RK4A 1X5DA 2B1LA 4I8BA 3H4KA 3M9JA 3KP9A 3C1RA 2FHEA 3ZVJA 4ECJA 3CMIA 5B6MA 3KD0A 2ON5A 3WT1A 2B5YA 4I97A 5J4VA 2CAQA 2O87A 3CTGA 3UBLA 4E68A 1GTAA 1W89A 5C00A 5L71A 4PQHA 3F6FA 4PUAA 2OBIA 2GQLA 1GL8A 1TU7A 2VAFA 3Q74A 5ECRB 4F03A 2YJHA 3LSZA 1TKDB 1ERUA 1Y6EA 2K8SA 1J9BA 2LJRA 1BEDA 2A4VA 3M0FA 1X9WB 1ERVA 6GSWA 4BIKA 1VF4A 4OMVA 2IFQB 4TR3A 4EC0A 8GSSA 1FW1A 5IQYA 2HYXA 1F2EA 4KE3A 1XPVA 5DQYA 1R5AA 4POMA 3LGCA 1XWBA 4AJ6A 2KOKA 3HKRA 1O85A 1GSQA 4N10A 2IMIA 4PGTA 3ERGA 4J57E 2A2SA 4D73A 2IN3A 3UMAA 1NSWA 4TR0A 4TXOA 3EPTA 4K9ZA 2EIOA 4LL1B 5DCGA 4HU7A 3A2XA 2YWMA 2PPTA 4DSSA 2FNOA 3FR3A 5IMAA 2GZPA 3TKRA 1FG4A 4MH2A 5J5NA 4KNDA 3GKMA 2FWGA 1A2JA 2PVQA 4IQ1A 1V9WA 4O32A 2X8GA 1GUKA 1O7UA 1M9AA 5ECNB 4FYBA 4ISDA 1M99A 2X49A 4ZL7A 2PVOC 5KEJA 5IPGA 2XBQA 3TCOA 5B8BA 3ZL5A 1XWKA 4NPBA 1SK0A 4G10A 1THXA 3V1WA 4K7OA 4K5SA 4CY6A 1GTUA 2HZEB 2XBIA 1ZYEA 3VPTA 2VUPA 3CQFA 1V57A 2LRTA 1X5CA 4PNGA 2H71A 3GKXA 2H70A 1I1IP 1HD2A 3GIXA 1K0DA 4NV5A 2V32A 3BCKA 4K1FA 2CVBA 2LUSA 2GSTA 2CZ3A 1OC9B 1NHYA 1DE1A 3HJOA 4AKIA 5DAKA 1XOAA 1T4YA 3ZMKA 2HRFA 3F3RA 4RI6A 1BAYA 3IK9A 2F8FA 4GF0A 3M8NA 4L5LA 3H79A 3IA1A 1PD21 3KZQA 4MF6A 1G0TA 4O92A 5KN2A 9GSSA 3PH9A 2A2PA 3WT2A 2YN1A 3LJRA 1ST9A 1BX9A 1XWGA 4MJEA 1T4ZA 4XRAA 4YAVA 20GSA 4XS6A 1HNCA 4G01A 2WB9A 2V2GA 4KB3A 5KN1A 2JADA 4BL7A 4LMWA 2J23A 4FYCA 2X99A 5KN3A 1DBYA 1G7OA 3RBTA 4BPYA 1ERWA 2NVLA 3DRNA 5J9BA 5D9XA 2GZYA 3D5JA 6GSUA 4LA1A 5JCGA 4Q5RA 5HFIA 1XWAA 3TUEA 4Z7XA 1U88A 5ECLB 2K6VA 3TOTA 1GSFA 1FB6A 3PINA 2WGRA 3WYWA 3D4TA 3I69A 2IMDA 2FWFA 1EGRA 3MIXA 5J47A 4TOPA 2E2MA 1H75A 2VL2C 3GL5A 4DSQA 1X5EA 4HQZA 1LBKA 1KBNA 3D4MA 1M3IA 3CXGA 2L5LA 2GT5A 4ICYA 3BOAA 2OE1A 2HRNA 5ECHB 5DBQA 4K2DA 1TP9A 4KUNA 2GZZA 1MTCA 1AUCA 3EU3A 5J3RA 5GZZB 3HVXA 2WJUA 4JBBA 2ZUPA 2IWTA 3DVXA 1BJXA 1GP1A 2PN8A 3LYKA 1QMVA 3RPNA 4PHZC 5HFKA 5HQPA 5G30A 4JZQA 3TJFA 3G9BA 5E4WA 2D2ZA 2AHEA 2LV3A 5J41A 1N2AA 4MZBA 22GSA 3L9UA 3N9JA 3UVTA 5ECOB 2H0HA 3F4TA 2B3SA 1BG1A 1PGTA 1XCCA 1EOHA 4Z2RA 3LFLA 3VPQA 3ZVJD 5GSSA 4TN8A 2N5AA 2H74A 1MDJA 1B8XA 1SD9A 5B8AA 5EY6A 2VOCA 2LNTA 2OBKA 2HSNB 3KP8A 3PGTA 3VWXA 3DWVA 4J2FA 2CVKA 2DLXA 2AV4A 3SWLA 5KN0A 1KTEA 7GSSA 3UVHA 3HVNA 3ME7A 2VCWA 4YQUA 3IBHA 1A8YA 2PBJA 4O5RA 4BWQA 4GDFA 4EIQA 4JEDA 1THOA 3F9UA 1ZYQB 3VLNA 4GQFA 1JLVA 2AJQB 1SVLA 1EOGA 4YKGA 3ZITA 4G0KA 5JWRB 1ERTA 2I3YA 3TU3B 3Q18A 3QD9A 2DJKA 1PN9A 1WRYA 2DJ2A 3NOFA 4MJBA 4Q5FA 1PFOA 5C04A 3H8QA 3H1NA 2B6MA 2ZCTA 5DJLA 5DALB 4WXTA 3HCZA 5ECKB 2VD0A 1WE0A 1Q4JA 1K3LA 1DUGA 1IYHA 1TK0B 5IPHA 5IM9A 3FMWA 3O6TA 2REMA 4ZBDA 2UZ8A 3KXOA 1X9MB 1Y25A 4V2MA 5CAXA 1QUWA 1U87A 1YY7A 5HFGA 1AAZA 2NDOA 3IHGA 5A5HB 2JU5A 1YQ1A 5JWOB 4KF9A 2YZUA 1V2AA 2QKEA 2VO4A 3CTFA 4ECCA 1G7EA 2VL2A 2O5VA 2H66A 2GT6A 4POKA 3C7MA 3US3A 4HDEA 1V58A 4IJIA 2O7KA 4MJAA 2I1UA 4QQ7A 3D21A 1XWCA 5ELGA 5JCUA 1M7TA 3KH9A 2JZRA 5JWQB 4OFTA 1AIUA 2DIZA 3TB2A 2L57A 3A5IA 2C8UA 1OE7A 1EP8A 4ZB7A 2WW3A 2LQQA 2PWJA 4BVYB 2DJ1A 1O81A 2FUG2 2XHFA 1E6BA 3G7IA 1OYJA 5CRWA 4MMMA 5CO3A 4K5RA 2AYTA 2WVXB 4CDOA 4MH3A 1ON4A 1GSUA 2CA8A 4AJ7A 2C3QA 3GFKA 2WW0A 5ELAA 1Q98A 4G19A 1TK8B 1WPIA 1XZOA 1TU8A 1SENA 5G2ZA 2E7PA 2RIIA 4G2EA 1VF2A 3IAM2 3ZTLA 1R26A 1NM3A 4WR4A 5J40A 1ZGNA 3BJ5A 2MMNA 1I5GA 3IDVA 4K6XA 3HJMA 4EF0A 6GSYA 2DJ0A 2F9SA 3DEXA 3CSHA 3QFBC 3RHBA 4GWRA 4X43A 2VM2A 2L4CA 1YKCA 4XRDA 3M9KA 2H1AA 2H73A 4EE0A 2NPBA 3KH7A 2OE3A 1B9XC 1BYEA 5H5QA 2HRAA 4I2TA 3TRXA 1TTZA 1QXHA 3ERWA 4Z2TA 1MDKA 4O5QA 2MMAA 1DE2A 3L78A 4KSMA 2N5BA 5E59A 2XC2A 2WS2A 1AXDA 4TKYA 2HSMA 3TJBA 1XVWA 1Z9HA 4TW5A 3APSA 4JR4A 4N0VA 1M2AA 1Z3EA 1ACVA 2VD1A 11GSA 3TRPA 3F3QA 4TR1A 4ML1A 1K3OA 3FZ9A 3ED3A 3WGXA 3QAGA 4HUAA 3LXZA 1G6WA 2EFCA 3IXRA 2V1MA 4TXOB 3TOUA 1FHEA 1N25A 1QQ2A 3TDGA 2VM1A 2EFHA 1ZZYA 4DSSB 2WDUA 3APQA 3GUSA 4RQRA 2RUEA 1M2DA 4G0LA 1PQNA 5ABRA 1K0NA 2YWOA 2RUFA 4HZ4A 4XHMA 2VL3A 2KUCA 1SL1B 3VFIA 5EL8A 1MD3A 3TJKA 2AB6A 1T3BA 5JCWA 3IC4A 5G1KA 1A0RP 3ZLPA 4EUYA 2G2QA 4Q5NA 3KGKA 2KHPA 2HFDA 3UAPA 1S3DA 2K18A 2FWEA 3LW9A 4GQCA 1BQ7A 4GSNA 5BMUA 3D0ZA 1LJRA 4MJCA 1GTIA 3QAVA 2TRCP 2RLIA 2CX4A 3GH6A 1YVLA 1JZOA 1IYIA 2IMFA 4XS4B 4G9HA 4L0WA 1GSEA 2B5XA 2FY6A 4EO3A 3WGEA 3HVVA 1MD4A 2AUVA 5DQSA 2OKAA
chains in the Genus database with same CATH topology
4MF5A 4BVXA 1MDIA 3FZAA 2YANA 1UA5A 4DSRA 5IOXA 5DAKB 3LWAA 4GTUA 4F0CA 1SD8A 1AQWA 1B4PA 1UVZA 1SK2A 1QK8A 4AKHA 4TRXA 2GVPA 1HNBA 1VF1A 4EIPA 1GNEA 2FD3A 1QGVA 1GUMA 5F06A 2L5OA 4O5UA 3GMFA 4XCSA 3KMNA 18GSA 2UV8G 4HU9A 3RHCA 2YZHA 4NAXA 5FT3A 1LU4A 4BL7B 3GSTA 2F8AA 4H86A 2YPMA 4RUVA 5HR0A 5ECQB 4KAEA 1PN0A 3IPZA 2WRTA 1JZWA 1EWXA 5ENUA 1EGOA 2H6YA 4V2NA 1ABAA 2KP1A 3W6GA 2IPAA 4ECBA 1A2LA 4IP6A 4HJ2A 3CSJA 5J4UA 2YP6A 2QSIA 1JZDA 2B1KA 3ERFA 4P3YB 5G5EA 1TW9A 1A23A 2H1BA 5DVBA 2C3TA 1SJ6A 1KNGA 2FLSA 2A2RA 2CQ9A 5AGYA 4PQIA 2WZ9A 2J9HA 2BJXA 2H8LA 2HQTA 2O89A 3ZRDA 4KDUA 3W8JA 3MAKA 4ZIJA 3F8UA 1GTBA 3LEFA 5CYYA 5DCHA 4AI6A 2FGXA 3KEBA 1O73A 4I6XA 4PUFC 4NWYA 4WETA 13GSA 1K0CA 2NTOA 1XIYA 1OC9A 3K8NA 1YZXA 2EIRA 2X64A 1NHOA 2HRKA 4OCFA 1EEMA 2YV9A 1XXUA 2LJAA 2G0FA 4PX1A 3L9VA 4IN0A 4IELA 3RDWA 4BA7A 2C80A 3HZ8A 3GTUB 3AY8A 1JLWA 1GNWA 3R2QA 2X8HA 2R2JA 1TI3A 5A1NA 2MBTA 1PL1A 3F4SA 3ZYWA 2GSRA 1R7HA 1UC7A 1ZMAA 1C72A 2V6OA 4EVMA 4OFNA 4MABA 2P5QA 4BWSA 2RM6A 1QFNA 3UOMA 4MLYA 4LLRA 1K0AA 2VLUA 4K0GA 3ZMLA 4EL1A 5IMFA 3KTLA 2FA8A 5AIVA 6GSVA 3EYTA 5A5KA 4N3ZA 4XTSA 3LG6A 4N0ZA 2C1YA 1T00A 2LRCA 1WWJA 4HI7A 3DMLA 1Z6MA 2MMZA 5B6NA 2OACA 3A2WA 4IW9A 3GH9A 3N5OA 2MMOA 3HDCA 1WIKA 5ID2A 4POLA 1YKAA 1JHBA 4HQSA 4AKXB 2Z9SA 4IVFA 4TR4A 1WMJA 3F4RA 3UBKA 3GURA 4ACSA 4WEYA 2PERA 3TKSC 2HXKA 4ZB6A 4N30A 2R37A 4MPGA 2E2GA 3C1SA 3ME8A 2O85A 2IIYA 2GQMA 2HI7A 5D93A 5KOWA 4TXVA 2CX3A 3L4NA 5AISA 1K0BA 4ID0A 5F8BA 5IOWA 16GSA 4GCIA 2H1GA 5GAND 2GTUA 3GSSA 1GSSA 1PRXA 5IMCA 4CW9A 3IE3A 1I9DA 4WF5A 4MF7A 3PPUA 2B5EA 2DC5A 4AJ8A 4KX4A 1VGLA 1CQGA 3TKPA 1JZRA 2H72A 4L0UA 2L4QA 4LL4B 3I9V2 5IO2A 1WP0A 2DSAA 4KDXA 3E9JB 3C8EA 1YF1A 5D9WA 2C3NA 4GRFA 3EMXA 4YKFA 1TJDA 1J0FA 4MCUA 2LEGA 3QCPA 3HD5A 5CRHA 3GX8A 1FOHA 4EXJA 2PU9C 3RPPA 4HEA2 4J56E 2CT6A 1AQVA 3VK9A 5CP1A 1V98A 2HZFA 2C0DA 4IJ3A 3NIVA 2JZTA 1WOUA 3HMJG 3CBUA 3FK8A 3ZFLA 2FWHA 4MNNA 3GYKA 3FYGA 2YWNA 4MK3A 5A4UA 3OR5A 2QA1A 4HZ2A 4KCAA 4LMVA 3TJGA 3EURA 1G6YA 2VCTA 2MZCA 5INYA 2IJYA 5EPFA 4ZB8A 2VIMA 5DALA 4YQMA 1RW1A 2K9FA 3QOUA 4QMKA 4NXIA 4X0XA 3APOA 1ML6A 4WR5A 4I2UA 1HQOA 3MYDA 2AAWA 1ZYPA 2R4VA 3CRTA 1MEKA 1F3AA 1PA3A 3UARA 4E8EA 5FWGA 4EKZA 4JR6A 5ECMB 1O8WA 1XBSA 2QA2A 4GSTA 1ZOFA 2ON7A 5AN1A 1SKWB 1K0OA 1GULA 2YCDA 5IO0A 1TOFA 1FOVA 5A34A 2QC7A 3BBYA 1HYUA 2L6CA 3DIEA 4L5OA 4ZL9A 2DMLA 2YNXA 3FRCA 1YJ6A 4ZBAA 2LKUA 3NZNA 1SJZA 1TI1A 1PL2A 2KLXA 3DGQA 1W4VA 1YEXA 4KGIA 4IHUA 3DD3A 2H01A 2JSYA 4K7NA 5HR3A 5D9TA 2GSQA 2DBCA 1Z5YE 1U3AA 3WGDA 2GDRA 3TKSA 4BVYA 3EVIA 4OD7A 4WBJA 2HSMB 3IHQA 5D8IA 1A24A 3O3TA 3C73A 4QL9A 4FQUA 1FB0A 1B48A 3P2AA 4MZWA 1TRVA 3CYNA 1PKWA 3HXSA 5IMDA 2L59A 4YAPA 3GKNA 3GHAA 2VKZG 4K2XA 4HS1A 4ILFA 3PR8A 4A5PA 3ZREA 5IMVA 3DYRA 2TIRA 3UL3A 3TKQA 2ALBA 4Z2UA 3QMXA 2ES7A 4PURA 3RAZA 1R5PA 3DXBA 3P90A 2CZ2A 1H4OA 5FHIA 2DJ3A 2HLSA 3KJYA 4W66A 2TRXA 2LQOA 1K3YA 4IS0A 2YWIA 4D73B 5H5SA 1T8EB 2A4HA 1XOBA 1FVJA 4MA9A 2B7KA 1Z6NA 1PMTA 5H5RA 4NHZA 5BMUB 1JFUA 1B9YC 2H75A 1EV4A 4V1Ap 3QAWA 5KOXA 4QL7A 3ZIJA 2R0PA 5ECIB 3CSIA 4F0BA 4L8EA 6GSXA 1O6JA 5ECPB 5DJMA 2ZNMA 2GSSA 2GQKA 1F3BA 3LXTA 4IBPA 4GSSA 1V40A 5G31A 1OKTA 2M72A 1NW2A 3E0UA 1SJIA 2VCQA 1RQMA 2VCXA 4BVXB 2VLVA 1TRWA 2NBSA 2YOIA 1U3IA 4YQVA 2E0QA 2IFQA 2WULA 3FY7A 1PX6A 3EINA 2PGTA 3I43A 4KDYA 3KMOA 1VRSD 14GSA 1SL0B 1USBA 2IMKA 2X8CA 5B7CA 1J08A 4DVCA 3GRXA 4OWYA 1PX7A 2EC4A 3IR4A 4ZXGA 2IMEA 1XFLA 2HSYA 2L6DA 1S3AA 5CNWA 2H6XA 3VI7A 1GUHA 3EC3A 3FKFA 1SL2B 3A3TA 1GRXA 4N11A 4V2LA 3F0IA 2C0GA 5HR2A 3ZFBA 2C0FA 4JRRA 1OC3A 4ZILA 2OA7A 1F6MC 3UEMA 2M80A 2EFEA 4RQXA 3UJ1A 1E2YA 3A5WA 2F3MA 1T1VA 4KCEA 4KH7A 1A8LA 6GSTA 3FZ4A 1UN2A 4PQ1A 3GKKA 3D22A 4ML6A 4XS4A 3C71A 1TDIA 2GS3A 1Y1UA 5CRGA 2H1DA 3VWWA 1GLQA 3GA4A 2YV7A 3M3MA 3G7YA 3HA9A 3P7XA 3QR6A 2DMMA 3EMPA 4V1Ag 1OE8A 4NHWA 2OT3A 3U6VA 2O8VB 2HRKB 2VCZA 2HZEA 1XVQA 3HYPA 1PSQA 3HJPA 1CQHA 2WFCA 1GLPA 4OO4A 4MPFA 1M9BA 4EDZA 4Q5QA 4IQAA 2VCVA 5LCZA 2P31A 3HVSA 3S9FA 4X4JA 2KP2A 4F2IA 5IIZA 4X1UA 5A1NB 3IK7A 4FO5A 19GSA 5D9VA 2GLRA 4OO5A 5ECSA 4XS1A 1A0FA 3R3EA 2H76A 1EV9A 2VLTA 3LORA 2IL3A 4O7HA 3KTBA 3SBCA 3O76A 3KIJA 1GH2A 1YF0A 4YH2A 10GSA 3LYPA 2LNSA 4MZCA 1HNAA 2V6KA 2JL4A 1A2MA 4CY8A 5G1LA 4FYUA 4AKGA 1AC1A 1TXUA 1TK5B 2R0CA 1SK1A 3VWUA 3IOSA 2LJKA 1OAZA 4ZBBA 1URMA 4DEJA 2JSZA 4EDYA 3A2VA 1KEBA 2HNLA 2PUKC 2P0GA 4MDCA 5F0GA 3FEUA 1X9SB 5ID2B 4PNFA 5J9CA 2BTOT 1F9MA 2CV4A 4K7IA 1T7PB 3IV4A 1DSBA 2XPDA 2CVDA 2H6ZA 2VL9A 3Q19A 3D6IA 2LS5A 2F51A 3U5RE 4F82A 3J7Yb 3GTUA 3GNJA 1YEPA 3MWHA 3KCMA 1SKRB 1TRSA 2FA4A 5EVOA 3IRAA 3MSZA 1SKSB 3TGZA 4POBA 4PTSA 3IC8A 4I5QA 1FAAA 1SYRA 4KSOA 3L9SA 4JE1A 2HSHA 5F07A 4K8MA 1YDKA 3VURA 3W8SA 4XIHA 3GN3A 4FH8A 1VF3A 1XW6A 4WKWA 5LD0A 4IGJA 6GSSA 3GV1A 5CRDA 1N8JA 5GSTA 4HOJA 2H0GA 2R0GA 4CHSA 3FR9A 2X4AA 1Z7RA 4NV2A 2GGTA 2H0IA 1S3CA 2R5GA 3VI5A 2HE3A 4NMUA 4PXOA 2EIQA 1XW5A 3GL3A 4KA0A 5D96A 3F63A 2QGVA 3ZZXA 2DJJA 4AF2A 3CWGA 1OKDA 5HR1A 1ILOA 2HSNA 1BG5A 5DDLA 3VWVA 3UIWA 1O8XA 4WF4A 1SVOA 1X0RA 3BCIA 5J4YA 2C4JA 5BRTA 3QFAC 1WJKA 3J7Yk 2OE0A 4IP1A 5CREA 3GX0A 3MNGA 1GSYA 4ECIA 3HY2A 1U6TA 3DKSA 2XPEA 3QDNA 1SU9A 1Z7PA 2DKIA 2C0EA 3DVWA 3TJJA 4F9ZA 2M46A 4TVEA 5A4WA 2H19A 3EWLA 2YJ7A 3IAS2 1M0UA 1EEJA 2K8VA 2R3XA 3QPMA 3G7JA 1PKZA 3EE2A 3CRUA 4IKHA 3E3EA 4ULXA 3LQ7A 3EU4A 4OFMA 2LRNA 3JCML 5D73A 1TXXA 2DKHA 3FR6A 2MYGA 4G0IA 3ISOA 17GSA 4AGSA 2OJLA 5A34B 3FW2A 2N5FA 5AIXA 1B4QA 3WD6A 4ZL8A 2RM5A 2H30A 4OCEA 3L0HA 4GLTA 5LNKe 4FIWA 1AQXA 5A5HA 1EP7A 2JZSA 3FZ5A 1EZKA 1ZYNA 3KM6A 1GWCA 1FO5A 4KW6A 3FHKA 5F05A 2FCHA 2I4AA 3TRQA 3M1GA 3H93A 2H1LA 5IMZA 4USSA 4WBRD 4GXZA 3F6DA 1OVNA 4RI7A 2MBSA 5COHA 2BMXA 3HZ4A 2V41A 1XW9A 1SYXA 4HJMA 2JACA 2P5RA 2R6KA 5G5FA 2EFDA 2PMTA 3HHVA 2OADA 3ZIVA 2LTKA 3BD2A 3P8WA 4JU5A 4ZB9A 1F37A 5A4VA 2DIYA 1GSDA 1M2BA 3TKSE 2I9HA 1SVMA 1OC8A 2LSTA 1FVKA 12GSA 1R4WA 2WCIA 3Q6OA 5GAPD 4MP4A 2I81A 1ZCPA 1TRUA 1ZL9A 3MDKA 1BF5A 2CAIA 3I6AA 1AW9A 2HT9A 4E8HA 4TR1B 2B7JA 1K0MA 4K0NA 1RK4A 1X5DA 2B1LA 4I8BA 3H4KA 3M9JA 3KP9A 3C1RA 2FHEA 3ZVJA 4ECJA 3CMIA 5B6MA 3KD0A 2ON5A 3WT1A 2B5YA 4I97A 5J4VA 2CAQA 2O87A 3CTGA 3UBLA 4E68A 1GTAA 1W89A 5C00A 5L71A 4PQHA 3F6FA 4PUAA 2OBIA 2GQLA 1GL8A 1TU7A 2VAFA 3Q74A 5ECRB 4F03A 2YJHA 3LSZA 1TKDB 1ERUA 1Y6EA 2K8SA 1J9BA 2LJRA 1BEDA 2A4VA 3M0FA 1X9WB 1ERVA 6GSWA 1VF4A 4OMVA 2IFQB 4TR3A 4EC0A 8GSSA 1FW1A 5IQYA 2HYXA 1F2EA 4KE3A 1XPVA 5DQYA 1R5AA 4POMA 3LGCA 1XWBA 4AJ6A 2KOKA 3HKRA 1O85A 1GSQA 4N10A 2IMIA 4PGTA 3ERGA 4J57E 2A2SA 4D73A 2IN3A 3UMAA 1NSWA 4TR0A 4TXOA 3EPTA 4K9ZA 2EIOA 4LL1B 5DCGA 4HU7A 3A2XA 2YWMA 2PPTA 4DSSA 2FNOA 3FR3A 5IMAA 2GZPA 3TKRA 1FG4A 4MH2A 5J5NA 4KNDA 3GKMA 2FWGA 1A2JA 2PVQA 4IQ1A 1V9WA 4O32A 2X8GA 1GUKA 1O7UA 1M9AA 5ECNB 4FYBA 4ISDA 1M99A 2X49A 4ZL7A 2PVOC 5KEJA 5IPGA 2XBQA 3TCOA 5B8BA 3ZL5A 1XWKA 4NPBA 1SK0A 4G10A 1THXA 3V1WA 4K7OA 4K5SA 4CY6A 1GTUA 2HZEB 2XBIA 1ZYEA 3VPTA 2VUPA 1V57A 2LRTA 1X5CA 4PNGA 2H71A 3GKXA 2H70A 1HD2A 3GIXA 1K0DA 4NV5A 2V32A 3BCKA 4K1FA 2CVBA 2LUSA 2GSTA 2CZ3A 1OC9B 1NHYA 1DE1A 3HJOA 4AKIA 5DAKA 1XOAA 1T4YA 3ZMKA 2HRFA 3F3RA 4RI6A 1BAYA 3IK9A 2F8FA 4GF0A 3M8NA 4L5LA 3H79A 3IA1A 1PD21 3KZQA 4MF6A 1G0TA 4O92A 5KN2A 9GSSA 3PH9A 2A2PA 3WT2A 2YN1A 3LJRA 1ST9A 1BX9A 1XWGA 4MJEA 1T4ZA 4XRAA 4YAVA 20GSA 4XS6A 1HNCA 4G01A 2WB9A 2V2GA 4KB3A 5KN1A 2JADA 4BL7A 4LMWA 2J23A 4FYCA 2X99A 5KN3A 1DBYA 1G7OA 3RBTA 4BPYA 1ERWA 2NVLA 3DRNA 5J9BA 5D9XA 2GZYA 3D5JA 6GSUA 4LA1A 5JCGA 4Q5RA 5HFIA 1XWAA 3TUEA 4Z7XA 1U88A 5ECLB 2K6VA 3TOTA 1GSFA 1FB6A 3PINA 2WGRA 3WYWA 3D4TA 3I69A 2IMDA 2FWFA 1EGRA 3MIXA 5J47A 4TOPA 2E2MA 1H75A 2VL2C 3GL5A 4DSQA 1X5EA 4HQZA 1LBKA 1KBNA 3D4MA 3CXGA 2L5LA 2GT5A 4ICYA 3BOAA 2OE1A 2HRNA 5ECHB 5DBQA 4K2DA 1TP9A 4KUNA 2GZZA 1MTCA 1AUCA 3EU3A 5J3RA 5GZZB 3HVXA 2WJUA 4JBBA 2ZUPA 2IWTA 3DVXA 1BJXA 1GP1A 2PN8A 3LYKA 1QMVA 3RPNA 5HFKA 5HQPA 5G30A 4JZQA 3TJFA 3G9BA 5E4WA 2D2ZA 2AHEA 2LV3A 5J41A 1N2AA 4MZBA 22GSA 3L9UA 3N9JA 3UVTA 5ECOB 2H0HA 3F4TA 2B3SA 1BG1A 1PGTA 1XCCA 1EOHA 4Z2RA 3LFLA 3VPQA 3ZVJD 5GSSA 4TN8A 2N5AA 2H74A 1MDJA 1B8XA 1SD9A 5B8AA 5EY6A 2VOCA 2LNTA 2OBKA 2HSNB 3KP8A 3PGTA 3VWXA 3DWVA 4J2FA 2CVKA 2DLXA 2AV4A 3SWLA 5KN0A 1KTEA 7GSSA 3UVHA 3ME7A 2VCWA 4YQUA 3IBHA 1A8YA 2PBJA 4O5RA 4BWQA 4GDFA 4EIQA 4JEDA 1THOA 3F9UA 1ZYQB 3VLNA 4GQFA 1JLVA 2AJQB 1SVLA 1EOGA 4YKGA 3ZITA 4G0KA 5JWRB 1ERTA 2I3YA 3TU3B 3Q18A 3QD9A 2DJKA 1PN9A 1WRYA 2DJ2A 3NOFA 4MJBA 4Q5FA 5C04A 3H8QA 3H1NA 2B6MA 2ZCTA 5DJLA 5DALB 4WXTA 3HCZA 5ECKB 2VD0A 1WE0A 1Q4JA 1K3LA 1DUGA 1IYHA 1TK0B 5IPHA 5IM9A 3FMWA 3O6TA 2REMA 4ZBDA 2UZ8A 3KXOA 1X9MB 1Y25A 4V2MA 5CAXA 1QUWA 1U87A 1YY7A 5HFGA 1AAZA 2NDOA 3IHGA 5A5HB 2JU5A 1YQ1A 5JWOB 4KF9A 2YZUA 1V2AA 2QKEA 2VO4A 3CTFA 4ECCA 1G7EA 2VL2A 2O5VA 2H66A 2GT6A 4POKA 3C7MA 3US3A 4HDEA 1V58A 4IJIA 2O7KA 4MJAA 2I1UA 4QQ7A 3D21A 1XWCA 5ELGA 5JCUA 3KH9A 1M7TA 2JZRA 5JWQB 4OFTA 1AIUA 2DIZA 3TB2A 2L57A 3A5IA 2C8UA 1OE7A 1EP8A 4ZB7A 2LQQA 2PWJA 4BVYB 2DJ1A 1O81A 2FUG2 2XHFA 1E6BA 3G7IA 1OYJA 5CRWA 4MMMA 5CO3A 4K5RA 2AYTA 4CDOA 4MH3A 1ON4A 1GSUA 2CA8A 4AJ7A 2C3QA 3GFKA 5ELAA 1Q98A 4G19A 1TK8B 1WPIA 1XZOA 1TU8A 1SENA 5G2ZA 2E7PA 2RIIA 4G2EA 1VF2A 3IAM2 3ZTLA 1R26A 1NM3A 4WR4A 5J40A 1ZGNA 3BJ5A 2MMNA 1I5GA 3IDVA 4K6XA 3HJMA 4EF0A 6GSYA 2DJ0A 2F9SA 3DEXA 3CSHA 3QFBC 3RHBA 4GWRA 4X43A 2VM2A 2L4CA 1YKCA 4XRDA 3M9KA 2H1AA 2H73A 4EE0A 2NPBA 3KH7A 2OE3A 1B9XC 1BYEA 5H5QA 2HRAA 4I2TA 3TRXA 1TTZA 1QXHA 3ERWA 4Z2TA 1MDKA 4O5QA 2MMAA 1DE2A 3L78A 4KSMA 2N5BA 5E59A 2XC2A 2WS2A 1AXDA 4TKYA 2HSMA 3TJBA 1XVWA 1Z9HA 4TW5A 3APSA 4JR4A 4N0VA 1M2AA 1Z3EA 1ACVA 2VD1A 11GSA 3TRPA 3F3QA 4TR1A 4ML1A 1K3OA 3FZ9A 3ED3A 3WGXA 3QAGA 4HUAA 3LXZA 1G6WA 2EFCA 3IXRA 2V1MA 4TXOB 3TOUA 1FHEA 1N25A 1QQ2A 3TDGA 2VM1A 2EFHA 1ZZYA 4DSSB 2WDUA 3APQA 3GUSA 4RQRA 2RUEA 1M2DA 4G0LA 1PQNA 5ABRA 1K0NA 2YWOA 2RUFA 4HZ4A 4XHMA 2VL3A 2KUCA 1SL1B 3VFIA 5EL8A 1MD3A 3TJKA 2AB6A 1T3BA 5JCWA 3IC4A 5G1KA 1A0RP 3ZLPA 4EUYA 2G2QA 4Q5NA 3KGKA 2KHPA 2HFDA 3UAPA 1S3DA 2K18A 2FWEA 3LW9A 4GQCA 1BQ7A 4GSNA 5BMUA 3D0ZA 1LJRA 4MJCA 1GTIA 3QAVA 2TRCP 2RLIA 2CX4A 3GH6A 1YVLA 1JZOA 1IYIA 2IMFA 4XS4B 4G9HA 4L0WA 1GSEA 2B5XA 2FY6A 4EO3A 3WGEA 3HVVA 1MD4A 2AUVA 5DQSA 2OKAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MF5 A;  4BVX A;  1MDI A;  3FZA A;  2YAN A;  1UA5 A;  4DSR A;  5IOX A;  5DAK B;  3LWA A;  4GTU A;  4F0C A;  1SD8 A;  1AQW A;  1B4P A;  1UVZ A;  1SK2 A;  1QK8 A;  4TRX A;  2GVP A;  1HNB A;  1VF1 A;  1GNE A;  2FD3 A;  1QGV A;  1GUM A;  5F06 A;  2L5O A;  3GMF A;  4XCS A;  3KMN A;  18GS A;  4HU9 A;  3RHC A;  2YZH A;  4NAX A;  5FT3 A;  1LU4 A;  4BL7 B;  3GST A;  2F8A A;  4H86 A;  2YPM A;  4RUV A;  5HR0 A;  5ECQ B;  4KAE A;  3IPZ A;  2WRT A;  1JZW A;  1EWX A;  5ENU A;  1EGO A;  2H6Y A;  4V2N A;  1ABA A;  2KP1 A;  3W6G A;  2IPA A;  4ECB A;  1A2L A;  4IP6 A;  4HJ2 A;  3CSJ A;  5J4U A;  2YP6 A;  2QSI A;  1JZD A;  2B1K A;  3ERF A;  4P3Y B;  5G5E A;  1TW9 A;  1A23 A;  2H1B A;  5DVB A;  2C3T A;  1SJ6 A;  1KNG A;  2FLS A;  2A2R A;  2CQ9 A;  5AGY A;  4PQI A;  2WZ9 A;  2J9H A;  2BJX A;  2H8L A;  2HQT A;  2O89 A;  3ZRD A;  4KDU A;  3W8J A;  3MAK A;  4ZIJ A;  3F8U A;  1GTB A;  3LEF A;  5CYY A;  5DCH A;  2FGX A;  3KEB A;  1O73 A;  4I6X A;  4PUF C;  4NWY A;  4WET A;  13GS A;  1K0C A;  2NTO A;  1XIY A;  1OC9 A;  3K8N A;  1YZX A;  2EIR A;  2X64 A;  1NHO A;  2HRK A;  4OCF A;  1EEM A;  2YV9 A;  1XXU A;  2LJA A;  2G0F A;  4PX1 A;  3L9V A;  4IN0 A;  4IEL A;  3RDW A;  4BA7 A;  2C80 A;  3HZ8 A;  3GTU B;  3AY8 A;  1JLW A;  1GNW A;  3R2Q A;  2X8H A;  2R2J A;  1TI3 A;  2MBT A;  1PL1 A;  3F4S A;  3ZYW A;  2GSR A;  1R7H A;  1UC7 A;  1ZMA A;  1C72 A;  2V6O A;  4EVM A;  4OFN A;  4MAB A;  2P5Q A;  4BWS A;  2RM6 A;  1QFN A;  3UOM A;  4MLY A;  4LLR A;  1K0A A;  2VLU A;  4K0G A;  3ZML A;  4EL1 A;  5IMF A;  3KTL A;  2FA8 A;  5AIV A;  6GSV A;  3EYT A;  5A5K A;  4XTS A;  3LG6 A;  4N0Z A;  2C1Y A;  1T00 A;  2LRC A;  1WWJ A;  4HI7 A;  3DML A;  1Z6M A;  2MMZ A;  5B6N A;  2OAC A;  3A2W A;  4IW9 A;  3GH9 A;  3N5O A;  2MMO A;  3HDC A;  1WIK A;  5ID2 A;  4POL A;  1YKA A;  1JHB A;  4HQS A;  2Z9S A;  4IVF A;  4TR4 A;  1WMJ A;  3F4R A;  3UBK A;  3GUR A;  4ACS A;  4WEY A;  2PER A;  3TKS C;  2HXK A;  4ZB6 A;  4N30 A;  2R37 A;  4MPG A;  2E2G A;  3C1S A;  3ME8 A;  2O85 A;  2IIY A;  2GQM A;  2HI7 A;  5D93 A;  4TXV A;  2CX3 A;  3L4N A;  5AIS A;  1K0B A;  4ID0 A;  5F8B A;  5IOW A;  16GS A;  4GCI A;  2H1G A;  5GAN D;  2GTU A;  3GSS A;  1GSS A;  1PRX A;  5IMC A;  4CW9 A;  3IE3 A;  1I9D A;  4WF5 A;  4MF7 A;  3PPU A;  2B5E A;  2DC5 A;  4AJ8 A;  4KX4 A;  1VGL A;  1CQG A;  3TKP A;  1JZR A;  2H72 A;  4L0U A;  2L4Q A;  4LL4 B;  3I9V 2;  5IO2 A;  1WP0 A;  2DSA A;  4KDX A;  3E9J B;  3C8E A;  1YF1 A;  5D9W A;  2C3N A;  4GRF A;  3EMX A;  1TJD A;  1J0F A;  4MCU A;  2LEG A;  3QCP A;  3HD5 A;  5CRH A;  3GX8 A;  4EXJ A;  2PU9 C;  3RPP A;  4HEA 2;  4J56 E;  2CT6 A;  1AQV A;  3VK9 A;  5CP1 A;  1V98 A;  2HZF A;  2C0D A;  4IJ3 A;  3NIV A;  2JZT A;  1WOU A;  3CBU A;  3FK8 A;  3ZFL A;  2FWH A;  3GYK A;  3FYG A;  2YWN A;  4MK3 A;  5A4U A;  3OR5 A;  4HZ2 A;  4KCA A;  4LMV A;  3TJG A;  3EUR A;  1G6Y A;  2VCT A;  2MZC A;  5INY A;  2IJY A;  5EPF A;  4ZB8 A;  2VIM A;  5DAL A;  4YQM A;  1RW1 A;  2K9F A;  3QOU A;  4NXI A;  4X0X A;  3APO A;  1ML6 A;  4WR5 A;  4I2U A;  1HQO A;  2AAW A;  2R4V A;  3CRT A;  1MEK A;  1F3A A;  1PA3 A;  3UAR A;  4E8E A;  5FWG A;  4EKZ A;  4JR6 A;  5ECM B;  1O8W A;  1XBS A;  4GST A;  1ZOF A;  2ON7 A;  5AN1 A;  1SKW B;  1K0O A;  1GUL A;  2YCD A;  5IO0 A;  1TOF A;  1FOV A;  2QC7 A;  3BBY A;  1HYU A;  2L6C A;  3DIE A;  4L5O A;  4ZL9 A;  2DML A;  2YNX A;  3FRC A;  1YJ6 A;  4ZBA A;  2LKU A;  3NZN A;  1SJZ A;  1TI1 A;  1PL2 A;  2KLX A;  3DGQ A;  1W4V A;  1YEX A;  4KGI A;  4IHU A;  3DD3 A;  2H01 A;  2JSY A;  4K7N A;  5HR3 A;  5D9T A;  2GSQ A;  2DBC A;  1Z5Y E;  1U3A A;  3WGD A;  2GDR A;  3TKS A;  4BVY A;  3EVI A;  4OD7 A;  4WBJ A;  2HSM B;  3IHQ A;  5D8I A;  1A24 A;  3O3T A;  3C73 A;  4QL9 A;  4FQU A;  1FB0 A;  1B48 A;  3P2A A;  4MZW A;  1TRV A;  3CYN A;  1PKW A;  3HXS A;  5IMD A;  2L59 A;  4YAP A;  3GKN A;  3GHA A;  4HS1 A;  4ILF A;  3PR8 A;  3ZRE A;  5IMV A;  3DYR A;  2TIR A;  3UL3 A;  3TKQ A;  2ALB A;  3QMX A;  2ES7 A;  4PUR A;  3RAZ A;  1R5P A;  3DXB A;  3P90 A;  2CZ2 A;  1H4O A;  5FHI A;  2DJ3 A;  2HLS A;  3KJY A;  2TRX A;  2LQO A;  1K3Y A;  4IS0 A;  2YWI A;  4D73 B;  5H5S A;  1T8E B;  1XOB A;  1FVJ A;  4MA9 A;  2B7K A;  1Z6N A;  1PMT A;  5H5R A;  4NHZ A;  1JFU A;  1B9Y C;  2H75 A;  1EV4 A;  4V1A p;  3QAW A;  4QL7 A;  3ZIJ A;  5ECI B;  3CSI A;  4F0B A;  4L8E A;  6GSX A;  1O6J A;  5ECP B;  5DJM A;  2ZNM A;  2GSS A;  2GQK A;  1F3B A;  3LXT A;  4IBP A;  4GSS A;  1V40 A;  5G31 A;  1OKT A;  2M72 A;  1NW2 A;  3E0U A;  1SJI A;  2VCQ A;  1RQM A;  2VCX A;  4BVX B;  2VLV A;  1TRW A;  2NBS A;  2YOI A;  1U3I A;  4YQV A;  2E0Q A;  2IFQ A;  2WUL A;  3FY7 A;  1PX6 A;  3EIN A;  2PGT A;  3I43 A;  4KDY A;  3KMO A;  1VRS D;  14GS A;  1SL0 B;  1USB A;  2IMK A;  2X8C A;  5B7C A;  1J08 A;  4DVC A;  3GRX A;  4OWY A;  1PX7 A;  2EC4 A;  3IR4 A;  4ZXG A;  2IME A;  1XFL A;  2HSY A;  2L6D A;  1S3A A;  5CNW A;  2H6X A;  3VI7 A;  1GUH A;  3EC3 A;  3FKF A;  1SL2 B;  3A3T A;  1GRX A;  4N11 A;  4V2L A;  3F0I A;  2C0G A;  5HR2 A;  3ZFB A;  2C0F A;  4JRR A;  1OC3 A;  4ZIL A;  2OA7 A;  1F6M C;  3UEM A;  2M80 A;  4RQX A;  3UJ1 A;  1E2Y A;  3A5W A;  2F3M A;  1T1V A;  4KCE A;  4KH7 A;  1A8L A;  6GST A;  3FZ4 A;  1UN2 A;  4PQ1 A;  3GKK A;  3D22 A;  4ML6 A;  4XS4 A;  3C71 A;  1TDI A;  2GS3 A;  5CRG A;  2H1D A;  3VWW A;  1GLQ A;  3GA4 A;  2YV7 A;  3M3M A;  3G7Y A;  3HA9 A;  3P7X A;  3QR6 A;  2DMM A;  3EMP A;  4V1A g;  1OE8 A;  4NHW A;  3U6V A;  2O8V B;  2HRK B;  2VCZ A;  2HZE A;  1XVQ A;  3HYP A;  1PSQ A;  1CQH A;  3HJP A;  2WFC A;  1GLP A;  4OO4 A;  4MPF A;  1M9B A;  4EDZ A;  4Q5Q A;  4IQA A;  2VCV A;  5LCZ A;  2P31 A;  3HVS A;  3S9F A;  2KP2 A;  4F2I A;  5IIZ A;  4X1U A;  3IK7 A;  4FO5 A;  19GS A;  5D9V A;  2GLR A;  4OO5 A;  5ECS A;  4XS1 A;  1A0F A;  3R3E A;  2H76 A;  1EV9 A;  2VLT A;  3LOR A;  2IL3 A;  4O7H A;  3KTB A;  3SBC A;  3O76 A;  3KIJ A;  1GH2 A;  1YF0 A;  4YH2 A;  10GS A;  3LYP A;  2LNS A;  4MZC A;  1HNA A;  2V6K A;  2JL4 A;  1A2M A;  5G1L A;  4FYU A;  1AC1 A;  1TK5 B;  1SK1 A;  3VWU A;  3IOS A;  2LJK A;  1OAZ A;  4ZBB A;  1URM A;  4DEJ A;  2JSZ A;  4EDY A;  3A2V A;  1KEB A;  2HNL A;  2PUK C;  2P0G A;  4MDC A;  5F0G A;  3FEU A;  1X9S B;  5ID2 B;  4PNF A;  5J9C A;  2BTO T;  1F9M A;  2CV4 A;  4K7I A;  1T7P B;  3IV4 A;  1DSB A;  2XPD A;  2CVD A;  2H6Z A;  2VL9 A;  3Q19 A;  3D6I A;  2LS5 A;  2F51 A;  3U5R E;  4F82 A;  3J7Y b;  3GTU A;  3GNJ A;  1YEP A;  3MWH A;  3KCM A;  1SKR B;  1TRS A;  2FA4 A;  5EVO A;  3IRA A;  3MSZ A;  1SKS B;  3TGZ A;  4POB A;  4PTS A;  3IC8 A;  4I5Q A;  1FAA A;  1SYR A;  4KSO A;  3L9S A;  4JE1 A;  2HSH A;  5F07 A;  4K8M A;  1YDK A;  3VUR A;  3W8S A;  4XIH A;  3GN3 A;  4FH8 A;  1VF3 A;  1XW6 A;  4WKW A;  5LD0 A;  4IGJ A;  6GSS A;  3GV1 A;  5CRD A;  1N8J A;  5GST A;  4HOJ A;  2H0G A;  4CHS A;  3FR9 A;  1Z7R A;  4NV2 A;  2GGT A;  2H0I A;  1S3C A;  2R5G A;  3VI5 A;  2HE3 A;  4NMU A;  4PXO A;  2EIQ A;  1XW5 A;  3GL3 A;  4KA0 A;  5D96 A;  3F63 A;  2QGV A;  3ZZX A;  2DJJ A;  4AF2 A;  1OKD A;  5HR1 A;  1ILO A;  1BG5 A;  5DDL A;  3VWV A;  3UIW A;  1O8X A;  4WF4 A;  1X0R A;  3BCI A;  2C4J A;  3QFA C;  1WJK A;  3J7Y k;  2OE0 A;  4IP1 A;  5CRE A;  3GX0 A;  3MNG A;  1GSY A;  4ECI A;  3HY2 A;  1U6T A;  3DKS A;  2XPE A;  3QDN A;  1SU9 A;  1Z7P A;  2C0E A;  3DVW A;  3TJJ A;  4F9Z A;  2M46 A;  4TVE A;  5A4W A;  2H19 A;  3EWL A;  2YJ7 A;  3IAS 2;  1M0U A;  1EEJ A;  2K8V A;  2R3X A;  3QPM A;  3G7J A;  1PKZ A;  3EE2 A;  3CRU A;  4IKH A;  3E3E A;  4ULX A;  3LQ7 A;  3EU4 A;  4OFM A;  2LRN A;  3JCM L;  5D73 A;  1TXX A;  3FR6 A;  2MYG A;  4G0I A;  3ISO A;  17GS A;  4AGS A;  2OJL A;  3FW2 A;  2N5F A;  5AIX A;  1B4Q A;  3WD6 A;  4ZL8 A;  2RM5 A;  2H30 A;  4OCE A;  3L0H A;  4GLT A;  5LNK e;  4FIW A;  1AQX A;  1EP7 A;  2JZS A;  3FZ5 A;  1EZK A;  3KM6 A;  1GWC A;  1FO5 A;  4KW6 A;  3FHK A;  5F05 A;  2FCH A;  2I4A A;  3TRQ A;  3M1G A;  3H93 A;  5IMZ A;  4USS A;  4WBR D;  4GXZ A;  3F6D A;  1OVN A;  4RI7 A;  2MBS A;  5COH A;  2BMX A;  3HZ4 A;  2V41 A;  1XW9 A;  1SYX A;  4HJM A;  2JAC A;  2P5R A;  2R6K A;  5G5F A;  2PMT A;  3HHV A;  2OAD A;  3ZIV A;  2LTK A;  3BD2 A;  3P8W A;  4JU5 A;  4ZB9 A;  1F37 A;  5A4V A;  2DIY A;  1GSD A;  1M2B A;  3TKS E;  2I9H A;  1OC8 A;  2LST A;  1FVK A;  12GS A;  1R4W A;  2WCI A;  3Q6O A;  5GAP D;  4MP4 A;  2I81 A;  1ZCP A;  1TRU A;  1ZL9 A;  3MDK A;  2CAI A;  3I6A A;  1AW9 A;  2HT9 A;  4E8H A;  4TR1 B;  2B7J A;  1K0M A;  4K0N A;  1RK4 A;  1X5D A;  2B1L A;  4I8B A;  3H4K A;  3M9J A;  3KP9 A;  3C1R A;  2FHE A;  3ZVJ A;  4ECJ A;  3CMI A;  5B6M A;  3KD0 A;  2ON5 A;  3WT1 A;  2B5Y A;  4I97 A;  2CAQ A;  2O87 A;  3CTG A;  3UBL A;  1GTA A;  1W89 A;  5C00 A;  5L71 A;  4PQH A;  3F6F A;  4PUA A;  2OBI A;  2GQL A;  1GL8 A;  1TU7 A;  2VAF A;  3Q74 A;  5ECR B;  4F03 A;  2YJH A;  3LSZ A;  1TKD B;  1ERU A;  1Y6E A;  2K8S A;  1J9B A;  2LJR A;  1BED A;  2A4V A;  3M0F A;  1X9W B;  1ERV A;  6GSW A;  1VF4 A;  4OMV A;  2IFQ B;  4TR3 A;  4EC0 A;  8GSS A;  1FW1 A;  5IQY A;  2HYX A;  1F2E A;  4KE3 A;  1XPV A;  5DQY A;  1R5A A;  4POM A;  3LGC A;  1XWB A;  4AJ6 A;  2KOK A;  3HKR A;  1O85 A;  1GSQ A;  4N10 A;  2IMI A;  4PGT A;  3ERG A;  4J57 E;  2A2S A;  4D73 A;  2IN3 A;  3UMA A;  1NSW A;  4TR0 A;  4TXO A;  4K9Z A;  2EIO A;  4LL1 B;  5DCG A;  4HU7 A;  3A2X A;  2YWM A;  2PPT A;  4DSS A;  2FNO A;  3FR3 A;  5IMA A;  2GZP A;  3TKR A;  1FG4 A;  4MH2 A;  5J5N A;  4KND A;  3GKM A;  2FWG A;  1A2J A;  2PVQ A;  4IQ1 A;  1V9W A;  4O32 A;  2X8G A;  1GUK A;  1O7U A;  1M9A A;  5ECN B;  4FYB A;  4ISD A;  1M99 A;  4ZL7 A;  2PVO C;  5KEJ A;  5IPG A;  2XBQ A;  3TCO A;  5B8B A;  3ZL5 A;  1XWK A;  4NPB A;  1SK0 A;  4G10 A;  1THX A;  3V1W A;  4K7O A;  1GTU A;  2HZE B;  2XBI A;  1ZYE A;  3VPT A;  2VUP A;  1V57 A;  2LRT A;  1X5C A;  4PNG A;  2H71 A;  3GKX A;  2H70 A;  1HD2 A;  3GIX A;  1K0D A;  4NV5 A;  2V32 A;  3BCK A;  4K1F A;  2CVB A;  2LUS A;  2GST A;  2CZ3 A;  1OC9 B;  1NHY A;  1DE1 A;  3HJO A;  5DAK A;  1XOA A;  1T4Y A;  3ZMK A;  2HRF A;  3F3R A;  4RI6 A;  1BAY A;  3IK9 A;  2F8F A;  4GF0 A;  3M8N A;  4L5L A;  3H79 A;  3IA1 A;  1PD2 1;  3KZQ A;  4MF6 A;  1G0T A;  4O92 A;  5KN2 A;  9GSS A;  3PH9 A;  3WT2 A;  2YN1 A;  3LJR A;  1ST9 A;  1BX9 A;  1XWG A;  4MJE A;  1T4Z A;  4XRA A;  4YAV A;  20GS A;  4XS6 A;  1HNC A;  2WB9 A;  2V2G A;  4KB3 A;  5KN1 A;  2JAD A;  4BL7 A;  4LMW A;  2J23 A;  4FYC A;  2X99 A;  5KN3 A;  1DBY A;  1G7O A;  3RBT A;  4BPY A;  1ERW A;  2NVL A;  3DRN A;  5J9B A;  5D9X A;  2GZY A;  3D5J A;  6GSU A;  4LA1 A;  5JCG A;  4Q5R A;  5HFI A;  1XWA A;  3TUE A;  4Z7X A;  1U88 A;  5ECL B;  2K6V A;  3TOT A;  1GSF A;  1FB6 A;  3PIN A;  2WGR A;  3WYW A;  3D4T A;  3I69 A;  2IMD A;  2FWF A;  1EGR A;  4TOP A;  2E2M A;  1H75 A;  2VL2 C;  3GL5 A;  4DSQ A;  1X5E A;  4HQZ A;  1LBK A;  1KBN A;  3D4M A;  3CXG A;  2L5L A;  2GT5 A;  3BOA A;  2OE1 A;  2HRN A;  5ECH B;  5DBQ A;  4K2D A;  1TP9 A;  4KUN A;  2GZZ A;  1MTC A;  1AUC A;  3EU3 A;  5J3R A;  5GZZ B;  3HVX A;  2WJU A;  4JBB A;  2ZUP A;  2IWT A;  3DVX A;  1BJX A;  1GP1 A;  2PN8 A;  3LYK A;  1QMV A;  3RPN A;  5HFK A;  5HQP A;  5G30 A;  4JZQ A;  3TJF A;  3G9B A;  5E4W A;  2D2Z A;  2AHE A;  2LV3 A;  5J41 A;  1N2A A;  4MZB A;  22GS A;  3L9U A;  3N9J A;  3UVT A;  5ECO B;  2H0H A;  3F4T A;  2B3S A;  1PGT A;  1XCC A;  1EOH A;  3LFL A;  3VPQ A;  3ZVJ D;  5GSS A;  4TN8 A;  2N5A A;  2H74 A;  1MDJ A;  1B8X A;  1SD9 A;  5B8A A;  5EY6 A;  2VOC A;  2LNT A;  2OBK A;  2HSN B;  3KP8 A;  3PGT A;  3VWX A;  3DWV A;  4J2F A;  2CVK A;  2DLX A;  2AV4 A;  3SWL A;  5KN0 A;  1KTE A;  7GSS A;  3UVH A;  3ME7 A;  2VCW A;  4YQU A;  3IBH A;  1A8Y A;  2PBJ A;  4O5R A;  4BWQ A;  4JED A;  1THO A;  3F9U A;  1ZYQ B;  3VLN A;  4GQF A;  1JLV A;  2AJQ B;  1EOG A;  3ZIT A;  4G0K A;  5JWR B;  1ERT A;  2I3Y A;  3Q18 A;  3QD9 A;  2DJK A;  1PN9 A;  1WRY A;  2DJ2 A;  3NOF A;  4MJB A;  4Q5F A;  5C04 A;  3H8Q A;  3H1N A;  2B6M A;  2ZCT A;  5DJL A;  5DAL B;  4WXT A;  3HCZ A;  5ECK B;  2VD0 A;  1WE0 A;  1Q4J A;  1K3L A;  1DUG A;  1IYH A;  1TK0 B;  5IPH A;  5IM9 A;  3O6T A;  2REM A;  4ZBD A;  2UZ8 A;  3KXO A;  1X9M B;  1Y25 A;  4V2M A;  5CAX A;  1QUW A;  1U87 A;  1YY7 A;  5HFG A;  1AAZ A;  2NDO A;  2JU5 A;  1YQ1 A;  5JWO B;  4KF9 A;  2YZU A;  1V2A A;  2QKE A;  2VO4 A;  3CTF A;  4ECC A;  1G7E A;  2VL2 A;  2H66 A;  2GT6 A;  4POK A;  3C7M A;  3US3 A;  4HDE A;  1V58 A;  4IJI A;  2O7K A;  4MJA A;  2I1U A;  4QQ7 A;  3D21 A;  1XWC A;  5ELG A;  5JCU A;  1M7T A;  3KH9 A;  2JZR A;  5JWQ B;  4OFT A;  1AIU A;  2DIZ A;  3TB2 A;  2L57 A;  2C8U A;  1OE7 A;  1EP8 A;  2PWJ A;  2LQQ A;  4BVY B;  2DJ1 A;  1O81 A;  2FUG 2;  2XHF A;  1E6B A;  3G7I A;  1OYJ A;  5CRW A;  4MMM A;  5CO3 A;  2AYT A;  4CDO A;  4MH3 A;  1ON4 A;  1GSU A;  2CA8 A;  4AJ7 A;  2C3Q A;  3GFK A;  5ELA A;  1Q98 A;  4G19 A;  1TK8 B;  1WPI A;  1XZO A;  1TU8 A;  1SEN A;  5G2Z A;  2E7P A;  2RII A;  4G2E A;  1VF2 A;  3IAM 2;  3ZTL A;  1R26 A;  1NM3 A;  4WR4 A;  1ZGN A;  3BJ5 A;  2MMN A;  1I5G A;  3IDV A;  4K6X A;  3HJM A;  4EF0 A;  6GSY A;  2DJ0 A;  2F9S A;  3DEX A;  3CSH A;  3QFB C;  3RHB A;  4GWR A;  4X43 A;  2VM2 A;  2L4C A;  1YKC A;  4XRD A;  3M9K A;  2H1A A;  2H73 A;  4EE0 A;  2NPB A;  3KH7 A;  2OE3 A;  1B9X C;  1BYE A;  5H5Q A;  2HRA A;  4I2T A;  3TRX A;  1TTZ A;  1QXH A;  3ERW A;  1MDK A;  2MMA A;  1DE2 A;  3L78 A;  4KSM A;  2N5B A;  5E59 A;  2XC2 A;  2WS2 A;  1AXD A;  4TKY A;  2HSM A;  3TJB A;  1XVW A;  1Z9H A;  4TW5 A;  3APS A;  4JR4 A;  4N0V A;  1M2A A;  1Z3E A;  1ACV A;  2VD1 A;  11GS A;  3TRP A;  3F3Q A;  4TR1 A;  4ML1 A;  1K3O A;  3FZ9 A;  3ED3 A;  3WGX A;  3QAG A;  4HUA A;  3LXZ A;  1G6W A;  3IXR A;  2V1M A;  4TXO B;  3TOU A;  1FHE A;  1QQ2 A;  3TDG A;  2VM1 A;  1ZZY A;  4DSS B;  2WDU A;  3APQ A;  3GUS A;  4RQR A;  2RUE A;  1M2D A;  4G0L A;  1PQN A;  5ABR A;  1K0N A;  2YWO A;  2RUF A;  4HZ4 A;  4XHM A;  2VL3 A;  2KUC A;  1SL1 B;  3VFI A;  5EL8 A;  1MD3 A;  3TJK A;  2AB6 A;  1T3B A;  5JCW A;  3IC4 A;  5G1K A;  1A0R P;  3ZLP A;  4EUY A;  2G2Q A;  4Q5N A;  3KGK A;  2KHP A;  2HFD A;  3UAP A;  1S3D A;  2K18 A;  2FWE A;  4GQC A;  1BQ7 A;  4GSN A;  5BMU A;  3D0Z A;  1LJR A;  4MJC A;  1GTI A;  3QAV A;  2TRC P;  2RLI A;  2CX4 A;  3GH6 A;  1JZO A;  1IYI A;  2IMF A;  4XS4 B;  4G9H A;  4L0W A;  1GSE A;  2B5X A;  2FY6 A;  4EO3 A;  3WGE A;  3HVV A;  1MD4 A;  2AUV A;  5DQS A;  2OKA A; 
#chains in the Genus database with same CATH topology
 4MF5 A;  4BVX A;  1MDI A;  3FZA A;  2YAN A;  1UA5 A;  4DSR A;  5IOX A;  5DAK B;  3LWA A;  4GTU A;  4F0C A;  1SD8 A;  1AQW A;  1B4P A;  1UVZ A;  1SK2 A;  1QK8 A;  4AKH A;  4TRX A;  2GVP A;  1HNB A;  1VF1 A;  4EIP A;  1GNE A;  2FD3 A;  1QGV A;  1GUM A;  5F06 A;  2L5O A;  4O5U A;  3GMF A;  4XCS A;  3KMN A;  18GS A;  2UV8 G;  4HU9 A;  3RHC A;  2YZH A;  4NAX A;  5FT3 A;  1LU4 A;  4BL7 B;  3GST A;  2F8A A;  4H86 A;  2YPM A;  4RUV A;  5HR0 A;  5ECQ B;  4KAE A;  1PN0 A;  3IPZ A;  2WRT A;  1JZW A;  1EWX A;  5ENU A;  1EGO A;  2H6Y A;  4V2N A;  1ABA A;  2KP1 A;  3W6G A;  2IPA A;  4ECB A;  1A2L A;  4IP6 A;  4HJ2 A;  3CSJ A;  5J4U A;  2YP6 A;  2QSI A;  1JZD A;  2B1K A;  3ERF A;  4P3Y B;  5G5E A;  1TW9 A;  1A23 A;  2H1B A;  5DVB A;  2C3T A;  1SJ6 A;  1KNG A;  2FLS A;  2A2R A;  2CQ9 A;  5AGY A;  4PQI A;  2WZ9 A;  2J9H A;  2BJX A;  2H8L A;  2HQT A;  2O89 A;  3ZRD A;  4KDU A;  3W8J A;  3MAK A;  4ZIJ A;  3F8U A;  1GTB A;  3LEF A;  5CYY A;  5DCH A;  4AI6 A;  2FGX A;  3KEB A;  1O73 A;  4I6X A;  4PUF C;  4NWY A;  4WET A;  13GS A;  1K0C A;  2NTO A;  1XIY A;  1OC9 A;  3K8N A;  1YZX A;  2EIR A;  2X64 A;  1NHO A;  2HRK A;  4OCF A;  1EEM A;  2YV9 A;  1XXU A;  2LJA A;  2G0F A;  4PX1 A;  3L9V A;  4IN0 A;  4IEL A;  3RDW A;  4BA7 A;  2C80 A;  3HZ8 A;  3GTU B;  3AY8 A;  1JLW A;  1GNW A;  3R2Q A;  2X8H A;  2R2J A;  1M3J A;  1TI3 A;  5A1N A;  2MBT A;  1PL1 A;  3F4S A;  3ZYW A;  2GSR A;  1R7H A;  1UC7 A;  1ZMA A;  1C72 A;  2V6O A;  4EVM A;  4OFN A;  4MAB A;  2P5Q A;  4BWS A;  2RM6 A;  1QFN A;  3UOM A;  4MLY A;  4LLR A;  1K0A A;  2VLU A;  4K0G A;  3ZML A;  4EL1 A;  5IMF A;  2WVZ A;  3KTL A;  2FA8 A;  5AIV A;  6GSV A;  3EYT A;  5A5K A;  4N3Z A;  4XTS A;  3LG6 A;  1S4B P;  4N0Z A;  2C1Y A;  1T00 A;  2LRC A;  1WWJ A;  4HI7 A;  3DML A;  1Z6M A;  2MMZ A;  5B6N A;  2OAC A;  3A2W A;  4IW9 A;  3GH9 A;  3N5O A;  2MMO A;  3HDC A;  1WIK A;  5ID2 A;  4POL A;  1YKA A;  1JHB A;  4HQS A;  4AKX B;  2Z9S A;  4IVF A;  4TR4 A;  1WMJ A;  3F4R A;  3UBK A;  3GUR A;  4ACS A;  4WEY A;  2PER A;  3TKS C;  2HXK A;  4ZB6 A;  4N30 A;  2R37 A;  4MPG A;  2E2G A;  3C1S A;  3ME8 A;  2O85 A;  2IIY A;  2GQM A;  2HI7 A;  5D93 A;  5KOW A;  4TXV A;  2CX3 A;  3L4N A;  5AIS A;  1K0B A;  4ID0 A;  5F8B A;  5IOW A;  16GS A;  4GCI A;  2H1G A;  5GAN D;  2GTU A;  3GSS A;  1GSS A;  1PRX A;  5IMC A;  4CW9 A;  3IE3 A;  1I9D A;  4WF5 A;  4MF7 A;  3PPU A;  2B5E A;  2DC5 A;  4AJ8 A;  4KX4 A;  1VGL A;  1CQG A;  3TKP A;  1JZR A;  2H72 A;  4L0U A;  2L4Q A;  4LL4 B;  3I9V 2;  5IO2 A;  1WP0 A;  2DSA A;  4KDX A;  3E9J B;  3C8E A;  1YF1 A;  5D9W A;  2C3N A;  4GRF A;  3EMX A;  4YKF A;  1TJD A;  1J0F A;  4MCU A;  2LEG A;  3QCP A;  3HD5 A;  5CRH A;  3GX8 A;  1FOH A;  4EXJ A;  2PU9 C;  3RPP A;  4HEA 2;  4J56 E;  2CT6 A;  1AQV A;  3VK9 A;  5CP1 A;  1V98 A;  2HZF A;  2C0D A;  4IJ3 A;  3NIV A;  2JZT A;  1WOU A;  3HMJ G;  3CBU A;  3FK8 A;  3ZFL A;  2FWH A;  4MNN A;  3GYK A;  3FYG A;  2YWN A;  4MK3 A;  5A4U A;  3OR5 A;  2QA1 A;  4HZ2 A;  4KCA A;  4LMV A;  3TJG A;  3EUR A;  1G6Y A;  2VCT A;  2MZC A;  5INY A;  2IJY A;  5EPF A;  4ZB8 A;  2VIM A;  5DAL A;  4YQM A;  1RW1 A;  2K9F A;  3QOU A;  4QMK A;  4NXI A;  4X0X A;  3APO A;  1ML6 A;  4WR5 A;  4I2U A;  1HQO A;  3MYD A;  2AAW A;  1ZYP A;  2R4V A;  3CRT A;  1MEK A;  1F3A A;  1PA3 A;  3UAR A;  4E8E A;  5FWG A;  4EKZ A;  4JR6 A;  5ECM B;  1O8W A;  1XBS A;  2QA2 A;  4GST A;  1ZOF A;  2ON7 A;  5AN1 A;  1SKW B;  1K0O A;  1GUL A;  2YCD A;  5IO0 A;  1TOF A;  1FOV A;  5A34 A;  2QC7 A;  3BBY A;  1HYU A;  2L6C A;  3DIE A;  4L5O A;  4ZL9 A;  2DML A;  2YNX A;  3FRC A;  1YJ6 A;  4ZBA A;  2LKU A;  3NZN A;  1SJZ A;  1TI1 A;  1PL2 A;  2KLX A;  3DGQ A;  1W4V A;  1YEX A;  4KGI A;  4IHU A;  3DD3 A;  2H01 A;  2JSY A;  4K7N A;  5HR3 A;  2WW2 A;  5D9T A;  2GSQ A;  2DBC A;  1Z5Y E;  1U3A A;  3WGD A;  2GDR A;  3TKS A;  4BVY A;  3EVI A;  4OD7 A;  4WBJ A;  2HSM B;  3IHQ A;  5D8I A;  1A24 A;  3O3T A;  3C73 A;  4QL9 A;  4FQU A;  1FB0 A;  1B48 A;  3P2A A;  4MZW A;  1TRV A;  3CYN A;  1PKW A;  3HXS A;  5IMD A;  2L59 A;  4YAP A;  3GKN A;  3GHA A;  2VKZ G;  4K2X A;  4HS1 A;  4ILF A;  3PR8 A;  3RFR C;  4A5P A;  1S3R A;  3ZRE A;  5IMV A;  3DYR A;  1XG8 A;  2TIR A;  3UL3 A;  3TKQ A;  2ALB A;  4Z2U A;  3QMX A;  2ES7 A;  4PUR A;  3RAZ A;  1R5P A;  3DXB A;  3P90 A;  2CZ2 A;  1H4O A;  5FHI A;  2DJ3 A;  2HLS A;  3KJY A;  4W66 A;  2TRX A;  2LQO A;  1K3Y A;  4IS0 A;  2YWI A;  4D73 B;  5H5S A;  1T8E B;  2A4H A;  1XOB A;  1FVJ A;  4MA9 A;  2B7K A;  3RGB C;  1Z6N A;  1PMT A;  5H5R A;  4NHZ A;  5BMU B;  1JFU A;  1B9Y C;  2H75 A;  1EV4 A;  4V1A p;  3QAW A;  5KOX A;  4QL7 A;  3ZIJ A;  2R0P A;  5ECI B;  3CSI A;  4F0B A;  4L8E A;  6GSX A;  1O6J A;  5ECP B;  5DJM A;  2ZNM A;  2GSS A;  2GQK A;  1F3B A;  3LXT A;  4IBP A;  4GSS A;  1V40 A;  5G31 A;  1OKT A;  2M72 A;  1NW2 A;  3E0U A;  1SJI A;  2VCQ A;  1RQM A;  2VCX A;  4BVX B;  2VLV A;  1TRW A;  2NBS A;  2YOI A;  1U3I A;  4YQV A;  2E0Q A;  4FXY P;  2IFQ A;  2WUL A;  3FY7 A;  1PX6 A;  3EIN A;  2PGT A;  3I43 A;  4KDY A;  3KMO A;  1VRS D;  14GS A;  1SL0 B;  1USB A;  2IMK A;  2X8C A;  5B7C A;  1J08 A;  4DVC A;  3GRX A;  4OWY A;  1PX7 A;  2EC4 A;  3IR4 A;  4ZXG A;  2IME A;  1XFL A;  2HSY A;  2L6D A;  1S3A A;  5CNW A;  2H6X A;  3VI7 A;  1GUH A;  3EC3 A;  3FKF A;  1SL2 B;  3A3T A;  1GRX A;  4N11 A;  4V2L A;  3F0I A;  2C0G A;  5HR2 A;  3ZFB A;  2C0F A;  4JRR A;  1OC3 A;  4ZIL A;  2OA7 A;  1F6M C;  3UEM A;  2M80 A;  2EFE A;  4RQX A;  3UJ1 A;  1E2Y A;  3A5W A;  2F3M A;  1T1V A;  4KCE A;  4KH7 A;  1A8L A;  6GST A;  3FZ4 A;  1UN2 A;  4PQ1 A;  3GKK A;  3D22 A;  4ML6 A;  4XS4 A;  3C71 A;  1TDI A;  2GS3 A;  1Y1U A;  5CRG A;  2WZS A;  2H1D A;  3VWW A;  1GLQ A;  3GA4 A;  2YV7 A;  3M3M A;  3G7Y A;  3HA9 A;  3P7X A;  3QR6 A;  2DMM A;  3EMP A;  4V1A g;  1OE8 A;  1YEW C;  4NHW A;  2OT3 A;  3U6V A;  2O8V B;  2HRK B;  2VCZ A;  2HZE A;  1XVQ A;  3HYP A;  1PSQ A;  4PI2 C;  3HJP A;  1CQH A;  2WFC A;  1GLP A;  2WVY A;  4OO4 A;  4MPF A;  1M9B A;  4EDZ A;  4Q5Q A;  4IQA A;  2VCV A;  5LCZ A;  2P31 A;  3HVS A;  4HSC X;  3S9F A;  4X4J A;  2KP2 A;  4F2I A;  5IIZ A;  4X1U A;  5A1N B;  3IK7 A;  4FO5 A;  19GS A;  5D9V A;  2GLR A;  4OO5 A;  5ECS A;  4XS1 A;  1A0F A;  3R3E A;  2H76 A;  1EV9 A;  2VLT A;  3LOR A;  2IL3 A;  4O7H A;  3KTB A;  3SBC A;  3O76 A;  3KIJ A;  1GH2 A;  1YF0 A;  4YH2 A;  10GS A;  3LYP A;  2LNS A;  4MZC A;  1HNA A;  2V6K A;  2JL4 A;  1A2M A;  4CY8 A;  5G1L A;  4FYU A;  4AKG A;  1AC1 A;  1TXU A;  1TK5 B;  2R0C A;  1SK1 A;  3VWU A;  3IOS A;  2LJK A;  1OAZ A;  4ZBB A;  1URM A;  4DEJ A;  2JSZ A;  4EDY A;  3A2V A;  1KEB A;  2HNL A;  2PUK C;  2P0G A;  4MDC A;  5F0G A;  3FEU A;  1X9S B;  5ID2 B;  4PNF A;  2O3E A;  5J9C A;  2BTO T;  1F9M A;  2CV4 A;  4K7I A;  1T7P B;  3IV4 A;  1DSB A;  2XPD A;  2CVD A;  2H6Z A;  2VL9 A;  3Q19 A;  3D6I A;  2LS5 A;  2F51 A;  3U5R E;  4F82 A;  3J7Y b;  3GTU A;  3GNJ A;  1YEP A;  3MWH A;  3KCM A;  1SKR B;  1TRS A;  2FA4 A;  5EVO A;  3IRA A;  3MSZ A;  1SKS B;  3TGZ A;  4POB A;  4PTS A;  3CHX C;  3IC8 A;  4I5Q A;  1FAA A;  1SYR A;  4KSO A;  3L9S A;  4JE1 A;  2HSH A;  5F07 A;  4K8M A;  1YDK A;  3VUR A;  3W8S A;  4XIH A;  3GN3 A;  4FH8 A;  1VF3 A;  1XW6 A;  4WKW A;  5LD0 A;  4IGJ A;  6GSS A;  3GV1 A;  5CRD A;  1N8J A;  5GST A;  4HOJ A;  2H0G A;  2R0G A;  4CHS A;  3FR9 A;  2X4A A;  1Z7R A;  4NV2 A;  2GGT A;  2H0I A;  1S3C A;  2R5G A;  3VI5 A;  2HE3 A;  4NMU A;  4PXO A;  2EIQ A;  1XW5 A;  3GL3 A;  4KA0 A;  5D96 A;  4PI0 C;  3F63 A;  2WW1 A;  2QGV A;  3ZZX A;  2DJJ A;  4AF2 A;  3CWG A;  1OKD A;  5HR1 A;  1ILO A;  2HSN A;  1BG5 A;  5DDL A;  3VWV A;  3UIW A;  1O8X A;  4WF4 A;  1SVO A;  1X0R A;  3BCI A;  5J4Y A;  2C4J A;  5BRT A;  3QFA C;  1WJK A;  3J7Y k;  2OE0 A;  4IP1 A;  5CRE A;  3GX0 A;  3MNG A;  1GSY A;  4ECI A;  3HY2 A;  1U6T A;  3DKS A;  2XPE A;  3QDN A;  1SU9 A;  1Z7P A;  2DKI A;  2C0E A;  3DVW A;  3TJJ A;  4F9Z A;  2M46 A;  4TVE A;  5A4W A;  2H19 A;  3EWL A;  2YJ7 A;  3IAS 2;  1M0U A;  1EEJ A;  2K8V A;  2R3X A;  3QPM A;  3G7J A;  1PKZ A;  3EE2 A;  3CRU A;  4IKH A;  3E3E A;  4ULX A;  3LQ7 A;  3EU4 A;  4OFM A;  2LRN A;  3JCM L;  5D73 A;  1TXX A;  2DKH A;  3FR6 A;  2MYG A;  4G0I A;  3ISO A;  17GS A;  4AGS A;  2OJL A;  5A34 B;  3FW2 A;  2N5F A;  5AIX A;  1B4Q A;  3WD6 A;  4ZL8 A;  2RM5 A;  2H30 A;  4OCE A;  3L0H A;  4GLT A;  2O36 A;  5LNK e;  4FIW A;  1AQX A;  5A5H A;  1EP7 A;  2JZS A;  3FZ5 A;  1EZK A;  1ZYN A;  3KM6 A;  1GWC A;  1FO5 A;  4KW6 A;  3FHK A;  5F05 A;  2FCH A;  2I4A A;  3TRQ A;  3M1G A;  3H93 A;  2H1L A;  5IMZ A;  4USS A;  4WBR D;  4GXZ A;  3F6D A;  1OVN A;  4RI7 A;  2MBS A;  5COH A;  2BMX A;  3HZ4 A;  2V41 A;  1XW9 A;  1SYX A;  4HJM A;  2JAC A;  2P5R A;  2R6K A;  5G5F A;  2EFD A;  2PMT A;  3HHV A;  2OAD A;  3ZIV A;  2LTK A;  3BD2 A;  3P8W A;  4JU5 A;  4ZB9 A;  1F37 A;  5A4V A;  2DIY A;  1GSD A;  1M2B A;  3TKS E;  2I9H A;  1SVM A;  1OC8 A;  2LST A;  1FVK A;  12GS A;  2WVX A;  1R4W A;  2WCI A;  3Q6O A;  5GAP D;  4MP4 A;  2I81 A;  1ZCP A;  1TRU A;  1ZL9 A;  3MDK A;  1BF5 A;  2CAI A;  3I6A A;  1AW9 A;  2HT9 A;  4E8H A;  4TR1 B;  2B7J A;  1K0M A;  4K0N A;  1RK4 A;  1X5D A;  2B1L A;  4I8B A;  3H4K A;  3M9J A;  3KP9 A;  3C1R A;  2FHE A;  3ZVJ A;  4ECJ A;  3CMI A;  5B6M A;  3KD0 A;  2ON5 A;  3WT1 A;  2B5Y A;  4I97 A;  5J4V A;  2CAQ A;  2O87 A;  3CTG A;  3UBL A;  4E68 A;  1GTA A;  1W89 A;  5C00 A;  5L71 A;  4PQH A;  3F6F A;  4PUA A;  2OBI A;  2GQL A;  1GL8 A;  1TU7 A;  2VAF A;  3Q74 A;  5ECR B;  4F03 A;  2YJH A;  3LSZ A;  1TKD B;  1ERU A;  1Y6E A;  2K8S A;  1J9B A;  2LJR A;  1BED A;  2A4V A;  3M0F A;  1X9W B;  1ERV A;  6GSW A;  4BIK A;  1VF4 A;  4OMV A;  2IFQ B;  4TR3 A;  4EC0 A;  8GSS A;  1FW1 A;  5IQY A;  2HYX A;  1F2E A;  4KE3 A;  1XPV A;  5DQY A;  1R5A A;  4POM A;  3LGC A;  1XWB A;  4AJ6 A;  2KOK A;  3HKR A;  1O85 A;  1GSQ A;  4N10 A;  2IMI A;  4PGT A;  3ERG A;  4J57 E;  2A2S A;  4D73 A;  2IN3 A;  3UMA A;  1NSW A;  4TR0 A;  4TXO A;  3EPT A;  4K9Z A;  2EIO A;  4LL1 B;  5DCG A;  4HU7 A;  3A2X A;  2YWM A;  2PPT A;  4DSS A;  2FNO A;  3FR3 A;  5IMA A;  2GZP A;  3TKR A;  1FG4 A;  4MH2 A;  5J5N A;  4KND A;  3GKM A;  2FWG A;  1A2J A;  2PVQ A;  4IQ1 A;  1V9W A;  4O32 A;  2X8G A;  1GUK A;  1O7U A;  1M9A A;  5ECN B;  4FYB A;  4ISD A;  1M99 A;  2X49 A;  4ZL7 A;  2PVO C;  5KEJ A;  5IPG A;  2XBQ A;  3TCO A;  5B8B A;  3ZL5 A;  1XWK A;  4NPB A;  1SK0 A;  4G10 A;  1THX A;  3V1W A;  4K7O A;  4K5S A;  4CY6 A;  1GTU A;  2HZE B;  2XBI A;  1ZYE A;  3VPT A;  2VUP A;  3CQF A;  1V57 A;  2LRT A;  1X5C A;  4PNG A;  2H71 A;  3GKX A;  2H70 A;  1I1I P;  1HD2 A;  3GIX A;  1K0D A;  4NV5 A;  2V32 A;  3BCK A;  4K1F A;  2CVB A;  2LUS A;  2GST A;  2CZ3 A;  1OC9 B;  1NHY A;  1DE1 A;  3HJO A;  4AKI A;  5DAK A;  1XOA A;  1T4Y A;  3ZMK A;  2HRF A;  3F3R A;  4RI6 A;  1BAY A;  3IK9 A;  2F8F A;  4GF0 A;  3M8N A;  4L5L A;  3H79 A;  3IA1 A;  1PD2 1;  3KZQ A;  4MF6 A;  1G0T A;  4O92 A;  5KN2 A;  9GSS A;  3PH9 A;  2A2P A;  3WT2 A;  2YN1 A;  3LJR A;  1ST9 A;  1BX9 A;  1XWG A;  4MJE A;  1T4Z A;  4XRA A;  4YAV A;  20GS A;  4XS6 A;  1HNC A;  4G01 A;  2WB9 A;  2V2G A;  4KB3 A;  5KN1 A;  2JAD A;  4BL7 A;  4LMW A;  2J23 A;  4FYC A;  2X99 A;  5KN3 A;  1DBY A;  1G7O A;  3RBT A;  4BPY A;  1ERW A;  2NVL A;  3DRN A;  5J9B A;  5D9X A;  2GZY A;  3D5J A;  6GSU A;  4LA1 A;  5JCG A;  4Q5R A;  5HFI A;  1XWA A;  3TUE A;  4Z7X A;  1U88 A;  5ECL B;  2K6V A;  3TOT A;  1GSF A;  1FB6 A;  3PIN A;  2WGR A;  3WYW A;  3D4T A;  3I69 A;  2IMD A;  2FWF A;  1EGR A;  3MIX A;  5J47 A;  4TOP A;  2E2M A;  1H75 A;  2VL2 C;  3GL5 A;  4DSQ A;  1X5E A;  4HQZ A;  1LBK A;  1KBN A;  3D4M A;  1M3I A;  3CXG A;  2L5L A;  2GT5 A;  4ICY A;  3BOA A;  2OE1 A;  2HRN A;  5ECH B;  5DBQ A;  4K2D A;  1TP9 A;  4KUN A;  2GZZ A;  1MTC A;  1AUC A;  3EU3 A;  5J3R A;  5GZZ B;  3HVX A;  2WJU A;  4JBB A;  2ZUP A;  2IWT A;  3DVX A;  1BJX A;  1GP1 A;  2PN8 A;  3LYK A;  1QMV A;  3RPN A;  4PHZ C;  5HFK A;  5HQP A;  5G30 A;  4JZQ A;  3TJF A;  3G9B A;  5E4W A;  2D2Z A;  2AHE A;  2LV3 A;  5J41 A;  1N2A A;  4MZB A;  22GS A;  3L9U A;  3N9J A;  3UVT A;  5ECO B;  2H0H A;  3F4T A;  2B3S A;  1BG1 A;  1PGT A;  1XCC A;  1EOH A;  4Z2R A;  3LFL A;  3VPQ A;  3ZVJ D;  5GSS A;  4TN8 A;  2N5A A;  2H74 A;  1MDJ A;  1B8X A;  1SD9 A;  5B8A A;  5EY6 A;  2VOC A;  2LNT A;  2OBK A;  2HSN B;  3KP8 A;  3PGT A;  3VWX A;  3DWV A;  4J2F A;  2CVK A;  2DLX A;  2AV4 A;  3SWL A;  5KN0 A;  1KTE A;  7GSS A;  3UVH A;  3HVN A;  3ME7 A;  2VCW A;  4YQU A;  3IBH A;  1A8Y A;  2PBJ A;  4O5R A;  4BWQ A;  4GDF A;  4EIQ A;  4JED A;  1THO A;  3F9U A;  1ZYQ B;  3VLN A;  4GQF A;  1JLV A;  2AJQ B;  1SVL A;  1EOG A;  4YKG A;  3ZIT A;  4G0K A;  5JWR B;  1ERT A;  2I3Y A;  3TU3 B;  3Q18 A;  3QD9 A;  2DJK A;  1PN9 A;  1WRY A;  2DJ2 A;  3NOF A;  4MJB A;  4Q5F A;  1PFO A;  5C04 A;  3H8Q A;  3H1N A;  2B6M A;  2ZCT A;  5DJL A;  5DAL B;  4WXT A;  3HCZ A;  5ECK B;  2VD0 A;  1WE0 A;  1Q4J A;  1K3L A;  1DUG A;  1IYH A;  1TK0 B;  5IPH A;  5IM9 A;  3FMW A;  3O6T A;  2REM A;  4ZBD A;  2UZ8 A;  3KXO A;  1X9M B;  1Y25 A;  4V2M A;  5CAX A;  1QUW A;  1U87 A;  1YY7 A;  5HFG A;  1AAZ A;  2NDO A;  3IHG A;  5A5H B;  2JU5 A;  1YQ1 A;  5JWO B;  4KF9 A;  2YZU A;  1V2A A;  2QKE A;  2VO4 A;  3CTF A;  4ECC A;  1G7E A;  2VL2 A;  2O5V A;  2H66 A;  2GT6 A;  4POK A;  3C7M A;  3US3 A;  4HDE A;  1V58 A;  4IJI A;  2O7K A;  4MJA A;  2I1U A;  4QQ7 A;  3D21 A;  1XWC A;  5ELG A;  5JCU A;  1M7T A;  3KH9 A;  2JZR A;  5JWQ B;  4OFT A;  1AIU A;  2DIZ A;  3TB2 A;  2L57 A;  3A5I A;  2C8U A;  1OE7 A;  1EP8 A;  4ZB7 A;  2WW3 A;  2LQQ A;  2PWJ A;  4BVY B;  2DJ1 A;  1O81 A;  2FUG 2;  2XHF A;  1E6B A;  3G7I A;  1OYJ A;  5CRW A;  4MMM A;  5CO3 A;  4K5R A;  2AYT A;  2WVX B;  4CDO A;  4MH3 A;  1ON4 A;  1GSU A;  2CA8 A;  4AJ7 A;  2C3Q A;  3GFK A;  2WW0 A;  5ELA A;  1Q98 A;  4G19 A;  1TK8 B;  1WPI A;  1XZO A;  1TU8 A;  1SEN A;  5G2Z A;  2E7P A;  2RII A;  4G2E A;  1VF2 A;  3IAM 2;  3ZTL A;  1R26 A;  1NM3 A;  4WR4 A;  5J40 A;  1ZGN A;  3BJ5 A;  2MMN A;  1I5G A;  3IDV A;  4K6X A;  3HJM A;  4EF0 A;  6GSY A;  2DJ0 A;  2F9S A;  3DEX A;  3CSH A;  3QFB C;  3RHB A;  4GWR A;  4X43 A;  2VM2 A;  2L4C A;  1YKC A;  4XRD A;  3M9K A;  2H1A A;  2H73 A;  4EE0 A;  2NPB A;  3KH7 A;  2OE3 A;  1B9X C;  1BYE A;  5H5Q A;  2HRA A;  4I2T A;  3TRX A;  1TTZ A;  1QXH A;  3ERW A;  4Z2T A;  1MDK A;  4O5Q A;  2MMA A;  1DE2 A;  3L78 A;  4KSM A;  2N5B A;  5E59 A;  2XC2 A;  2WS2 A;  1AXD A;  4TKY A;  2HSM A;  3TJB A;  1XVW A;  1Z9H A;  4TW5 A;  3APS A;  4JR4 A;  4N0V A;  1M2A A;  1Z3E A;  1ACV A;  2VD1 A;  11GS A;  3TRP A;  3F3Q A;  4TR1 A;  4ML1 A;  1K3O A;  3FZ9 A;  3ED3 A;  3WGX A;  3QAG A;  4HUA A;  3LXZ A;  1G6W A;  2EFC A;  3IXR A;  2V1M A;  4TXO B;  3TOU A;  1FHE A;  1N25 A;  1QQ2 A;  3TDG A;  2VM1 A;  2EFH A;  1ZZY A;  4DSS B;  2WDU A;  3APQ A;  3GUS A;  4RQR A;  2RUE A;  1M2D A;  4G0L A;  1PQN A;  5ABR A;  1K0N A;  2YWO A;  2RUF A;  4HZ4 A;  4XHM A;  2VL3 A;  2KUC A;  1SL1 B;  3VFI A;  5EL8 A;  1MD3 A;  3TJK A;  2AB6 A;  1T3B A;  5JCW A;  3IC4 A;  5G1K A;  1A0R P;  3ZLP A;  4EUY A;  2G2Q A;  4Q5N A;  3KGK A;  2KHP A;  2HFD A;  3UAP A;  1S3D A;  2K18 A;  2FWE A;  3LW9 A;  4GQC A;  1BQ7 A;  4GSN A;  5BMU A;  3D0Z A;  1LJR A;  4MJC A;  1GTI A;  3QAV A;  2TRC P;  2RLI A;  2CX4 A;  3GH6 A;  1YVL A;  1JZO A;  1IYI A;  2IMF A;  4XS4 B;  4G9H A;  4L0W A;  1GSE A;  2B5X A;  2FY6 A;  4EO3 A;  3WGE A;  3HVV A;  1MD4 A;  2AUV A;  5DQS A;  2OKA A; 
#chains in the Genus database with same CATH homology
 4MF5 A;  4BVX A;  1MDI A;  3FZA A;  2YAN A;  1UA5 A;  4DSR A;  5IOX A;  5DAK B;  3LWA A;  4GTU A;  4F0C A;  1SD8 A;  1AQW A;  1B4P A;  1UVZ A;  1SK2 A;  1QK8 A;  4AKH A;  4TRX A;  2GVP A;  1HNB A;  1VF1 A;  4EIP A;  1GNE A;  2FD3 A;  1QGV A;  1GUM A;  5F06 A;  2L5O A;  4O5U A;  3GMF A;  4XCS A;  3KMN A;  18GS A;  2UV8 G;  4HU9 A;  3RHC A;  2YZH A;  4NAX A;  5FT3 A;  1LU4 A;  4BL7 B;  3GST A;  2F8A A;  4H86 A;  2YPM A;  4RUV A;  5HR0 A;  5ECQ B;  4KAE A;  1PN0 A;  3IPZ A;  2WRT A;  1JZW A;  1EWX A;  5ENU A;  1EGO A;  2H6Y A;  4V2N A;  1ABA A;  2KP1 A;  3W6G A;  2IPA A;  4ECB A;  1A2L A;  4IP6 A;  4HJ2 A;  3CSJ A;  5J4U A;  2YP6 A;  2QSI A;  1JZD A;  2B1K A;  3ERF A;  4P3Y B;  5G5E A;  1TW9 A;  1A23 A;  2H1B A;  5DVB A;  2C3T A;  1SJ6 A;  1KNG A;  2FLS A;  2A2R A;  2CQ9 A;  5AGY A;  4PQI A;  2WZ9 A;  2J9H A;  2BJX A;  2H8L A;  2HQT A;  2O89 A;  3ZRD A;  4KDU A;  3W8J A;  3MAK A;  4ZIJ A;  3F8U A;  1GTB A;  3LEF A;  5CYY A;  5DCH A;  4AI6 A;  2FGX A;  3KEB A;  1O73 A;  4I6X A;  4PUF C;  4NWY A;  4WET A;  13GS A;  1K0C A;  2NTO A;  1XIY A;  1OC9 A;  3K8N A;  1YZX A;  2EIR A;  2X64 A;  1NHO A;  2HRK A;  4OCF A;  1EEM A;  2YV9 A;  1XXU A;  2LJA A;  2G0F A;  4PX1 A;  3L9V A;  4IN0 A;  4IEL A;  3RDW A;  4BA7 A;  2C80 A;  3HZ8 A;  3GTU B;  3AY8 A;  1JLW A;  1GNW A;  3R2Q A;  2X8H A;  2R2J A;  1TI3 A;  5A1N A;  2MBT A;  1PL1 A;  3F4S A;  3ZYW A;  2GSR A;  1R7H A;  1UC7 A;  1ZMA A;  1C72 A;  2V6O A;  4EVM A;  4OFN A;  4MAB A;  2P5Q A;  4BWS A;  2RM6 A;  1QFN A;  3UOM A;  4MLY A;  4LLR A;  1K0A A;  2VLU A;  4K0G A;  3ZML A;  4EL1 A;  5IMF A;  3KTL A;  2FA8 A;  5AIV A;  6GSV A;  3EYT A;  5A5K A;  4N3Z A;  4XTS A;  3LG6 A;  4N0Z A;  2C1Y A;  1T00 A;  2LRC A;  1WWJ A;  4HI7 A;  3DML A;  1Z6M A;  2MMZ A;  5B6N A;  2OAC A;  3A2W A;  4IW9 A;  3GH9 A;  3N5O A;  2MMO A;  3HDC A;  1WIK A;  5ID2 A;  4POL A;  1YKA A;  1JHB A;  4HQS A;  4AKX B;  2Z9S A;  4IVF A;  4TR4 A;  1WMJ A;  3F4R A;  3UBK A;  3GUR A;  4ACS A;  4WEY A;  2PER A;  3TKS C;  2HXK A;  4ZB6 A;  4N30 A;  2R37 A;  4MPG A;  2E2G A;  3C1S A;  3ME8 A;  2O85 A;  2IIY A;  2GQM A;  2HI7 A;  5D93 A;  5KOW A;  4TXV A;  2CX3 A;  3L4N A;  5AIS A;  1K0B A;  4ID0 A;  5F8B A;  5IOW A;  16GS A;  4GCI A;  2H1G A;  5GAN D;  2GTU A;  3GSS A;  1GSS A;  1PRX A;  5IMC A;  4CW9 A;  3IE3 A;  1I9D A;  4WF5 A;  4MF7 A;  3PPU A;  2B5E A;  2DC5 A;  4AJ8 A;  4KX4 A;  1VGL A;  1CQG A;  3TKP A;  1JZR A;  2H72 A;  4L0U A;  2L4Q A;  4LL4 B;  3I9V 2;  5IO2 A;  1WP0 A;  2DSA A;  4KDX A;  3E9J B;  3C8E A;  1YF1 A;  5D9W A;  2C3N A;  4GRF A;  3EMX A;  4YKF A;  1TJD A;  1J0F A;  4MCU A;  2LEG A;  3QCP A;  3HD5 A;  5CRH A;  3GX8 A;  1FOH A;  4EXJ A;  2PU9 C;  3RPP A;  4HEA 2;  4J56 E;  2CT6 A;  1AQV A;  3VK9 A;  5CP1 A;  1V98 A;  2HZF A;  2C0D A;  4IJ3 A;  3NIV A;  2JZT A;  1WOU A;  3HMJ G;  3CBU A;  3FK8 A;  3ZFL A;  2FWH A;  4MNN A;  3GYK A;  3FYG A;  2YWN A;  4MK3 A;  5A4U A;  3OR5 A;  2QA1 A;  4HZ2 A;  4KCA A;  4LMV A;  3TJG A;  3EUR A;  1G6Y A;  2VCT A;  2MZC A;  5INY A;  2IJY A;  5EPF A;  4ZB8 A;  2VIM A;  5DAL A;  4YQM A;  1RW1 A;  2K9F A;  3QOU A;  4QMK A;  4NXI A;  4X0X A;  3APO A;  1ML6 A;  4WR5 A;  4I2U A;  1HQO A;  3MYD A;  2AAW A;  1ZYP A;  2R4V A;  3CRT A;  1MEK A;  1F3A A;  1PA3 A;  3UAR A;  4E8E A;  5FWG A;  4EKZ A;  4JR6 A;  5ECM B;  1O8W A;  1XBS A;  2QA2 A;  4GST A;  1ZOF A;  2ON7 A;  5AN1 A;  1SKW B;  1K0O A;  1GUL A;  2YCD A;  5IO0 A;  1TOF A;  1FOV A;  5A34 A;  2QC7 A;  3BBY A;  1HYU A;  2L6C A;  3DIE A;  4L5O A;  4ZL9 A;  2DML A;  2YNX A;  3FRC A;  1YJ6 A;  4ZBA A;  2LKU A;  3NZN A;  1SJZ A;  1TI1 A;  1PL2 A;  2KLX A;  3DGQ A;  1W4V A;  1YEX A;  4KGI A;  4IHU A;  3DD3 A;  2H01 A;  2JSY A;  4K7N A;  5HR3 A;  5D9T A;  2GSQ A;  2DBC A;  1Z5Y E;  1U3A A;  3WGD A;  2GDR A;  3TKS A;  4BVY A;  3EVI A;  4OD7 A;  4WBJ A;  2HSM B;  3IHQ A;  5D8I A;  1A24 A;  3O3T A;  3C73 A;  4QL9 A;  4FQU A;  1FB0 A;  1B48 A;  3P2A A;  4MZW A;  1TRV A;  3CYN A;  1PKW A;  3HXS A;  5IMD A;  2L59 A;  4YAP A;  3GKN A;  3GHA A;  2VKZ G;  4K2X A;  4HS1 A;  4ILF A;  3PR8 A;  4A5P A;  3ZRE A;  5IMV A;  3DYR A;  2TIR A;  3UL3 A;  3TKQ A;  2ALB A;  4Z2U A;  3QMX A;  2ES7 A;  4PUR A;  3RAZ A;  1R5P A;  3DXB A;  3P90 A;  2CZ2 A;  1H4O A;  5FHI A;  2DJ3 A;  2HLS A;  3KJY A;  4W66 A;  2TRX A;  2LQO A;  1K3Y A;  4IS0 A;  2YWI A;  4D73 B;  5H5S A;  1T8E B;  2A4H A;  1XOB A;  1FVJ A;  4MA9 A;  2B7K A;  1Z6N A;  1PMT A;  5H5R A;  4NHZ A;  5BMU B;  1JFU A;  1B9Y C;  2H75 A;  1EV4 A;  4V1A p;  3QAW A;  5KOX A;  4QL7 A;  3ZIJ A;  2R0P A;  5ECI B;  3CSI A;  4F0B A;  4L8E A;  6GSX A;  1O6J A;  5ECP B;  5DJM A;  2ZNM A;  2GSS A;  2GQK A;  1F3B A;  3LXT A;  4IBP A;  4GSS A;  1V40 A;  5G31 A;  1OKT A;  2M72 A;  1NW2 A;  3E0U A;  1SJI A;  2VCQ A;  1RQM A;  2VCX A;  4BVX B;  2VLV A;  1TRW A;  2NBS A;  2YOI A;  1U3I A;  4YQV A;  2E0Q A;  2IFQ A;  2WUL A;  3FY7 A;  1PX6 A;  3EIN A;  2PGT A;  3I43 A;  4KDY A;  3KMO A;  1VRS D;  14GS A;  1SL0 B;  1USB A;  2IMK A;  2X8C A;  5B7C A;  1J08 A;  4DVC A;  3GRX A;  4OWY A;  1PX7 A;  2EC4 A;  3IR4 A;  4ZXG A;  2IME A;  1XFL A;  2HSY A;  2L6D A;  1S3A A;  5CNW A;  2H6X A;  3VI7 A;  1GUH A;  3EC3 A;  3FKF A;  1SL2 B;  3A3T A;  1GRX A;  4N11 A;  4V2L A;  3F0I A;  2C0G A;  5HR2 A;  3ZFB A;  2C0F A;  4JRR A;  1OC3 A;  4ZIL A;  2OA7 A;  1F6M C;  3UEM A;  2M80 A;  2EFE A;  4RQX A;  3UJ1 A;  1E2Y A;  3A5W A;  2F3M A;  1T1V A;  4KCE A;  4KH7 A;  1A8L A;  6GST A;  3FZ4 A;  1UN2 A;  4PQ1 A;  3GKK A;  3D22 A;  4ML6 A;  4XS4 A;  3C71 A;  1TDI A;  2GS3 A;  1Y1U A;  5CRG A;  2H1D A;  3VWW A;  1GLQ A;  3GA4 A;  2YV7 A;  3M3M A;  3G7Y A;  3HA9 A;  3P7X A;  3QR6 A;  2DMM A;  3EMP A;  4V1A g;  1OE8 A;  4NHW A;  2OT3 A;  3U6V A;  2O8V B;  2HRK B;  2VCZ A;  2HZE A;  1XVQ A;  3HYP A;  1PSQ A;  3HJP A;  1CQH A;  2WFC A;  1GLP A;  4OO4 A;  4MPF A;  1M9B A;  4EDZ A;  4Q5Q A;  4IQA A;  2VCV A;  5LCZ A;  2P31 A;  3HVS A;  3S9F A;  4X4J A;  2KP2 A;  4F2I A;  5IIZ A;  4X1U A;  5A1N B;  3IK7 A;  4FO5 A;  19GS A;  5D9V A;  2GLR A;  4OO5 A;  5ECS A;  4XS1 A;  1A0F A;  3R3E A;  2H76 A;  1EV9 A;  2VLT A;  3LOR A;  2IL3 A;  4O7H A;  3KTB A;  3SBC A;  3O76 A;  3KIJ A;  1GH2 A;  1YF0 A;  4YH2 A;  10GS A;  3LYP A;  2LNS A;  4MZC A;  1HNA A;  2V6K A;  2JL4 A;  1A2M A;  4CY8 A;  5G1L A;  4FYU A;  4AKG A;  1AC1 A;  1TXU A;  1TK5 B;  2R0C A;  1SK1 A;  3VWU A;  3IOS A;  2LJK A;  1OAZ A;  4ZBB A;  1URM A;  4DEJ A;  2JSZ A;  4EDY A;  3A2V A;  1KEB A;  2HNL A;  2PUK C;  2P0G A;  4MDC A;  5F0G A;  3FEU A;  1X9S B;  5ID2 B;  4PNF A;  5J9C A;  2BTO T;  1F9M A;  2CV4 A;  4K7I A;  1T7P B;  3IV4 A;  1DSB A;  2XPD A;  2CVD A;  2H6Z A;  2VL9 A;  3Q19 A;  3D6I A;  2LS5 A;  2F51 A;  3U5R E;  4F82 A;  3J7Y b;  3GTU A;  3GNJ A;  1YEP A;  3MWH A;  3KCM A;  1SKR B;  1TRS A;  2FA4 A;  5EVO A;  3IRA A;  3MSZ A;  1SKS B;  3TGZ A;  4POB A;  4PTS A;  3IC8 A;  4I5Q A;  1FAA A;  1SYR A;  4KSO A;  3L9S A;  4JE1 A;  2HSH A;  5F07 A;  4K8M A;  1YDK A;  3VUR A;  3W8S A;  4XIH A;  3GN3 A;  4FH8 A;  1VF3 A;  1XW6 A;  4WKW A;  5LD0 A;  4IGJ A;  6GSS A;  3GV1 A;  5CRD A;  1N8J A;  5GST A;  4HOJ A;  2H0G A;  2R0G A;  4CHS A;  3FR9 A;  2X4A A;  1Z7R A;  4NV2 A;  2GGT A;  2H0I A;  1S3C A;  2R5G A;  3VI5 A;  2HE3 A;  4NMU A;  4PXO A;  2EIQ A;  1XW5 A;  3GL3 A;  4KA0 A;  5D96 A;  3F63 A;  2QGV A;  3ZZX A;  2DJJ A;  4AF2 A;  3CWG A;  1OKD A;  5HR1 A;  1ILO A;  2HSN A;  1BG5 A;  5DDL A;  3VWV A;  3UIW A;  1O8X A;  4WF4 A;  1SVO A;  1X0R A;  3BCI A;  5J4Y A;  2C4J A;  5BRT A;  3QFA C;  1WJK A;  3J7Y k;  2OE0 A;  4IP1 A;  5CRE A;  3GX0 A;  3MNG A;  1GSY A;  4ECI A;  3HY2 A;  1U6T A;  3DKS A;  2XPE A;  3QDN A;  1SU9 A;  1Z7P A;  2DKI A;  2C0E A;  3DVW A;  3TJJ A;  4F9Z A;  2M46 A;  4TVE A;  5A4W A;  2H19 A;  3EWL A;  2YJ7 A;  3IAS 2;  1M0U A;  1EEJ A;  2K8V A;  2R3X A;  3QPM A;  3G7J A;  1PKZ A;  3EE2 A;  3CRU A;  4IKH A;  3E3E A;  4ULX A;  3LQ7 A;  3EU4 A;  4OFM A;  2LRN A;  3JCM L;  5D73 A;  1TXX A;  2DKH A;  3FR6 A;  2MYG A;  4G0I A;  3ISO A;  17GS A;  4AGS A;  2OJL A;  5A34 B;  3FW2 A;  2N5F A;  5AIX A;  1B4Q A;  3WD6 A;  4ZL8 A;  2RM5 A;  2H30 A;  4OCE A;  3L0H A;  4GLT A;  5LNK e;  4FIW A;  1AQX A;  5A5H A;  1EP7 A;  2JZS A;  3FZ5 A;  1EZK A;  1ZYN A;  3KM6 A;  1GWC A;  1FO5 A;  4KW6 A;  3FHK A;  5F05 A;  2FCH A;  2I4A A;  3TRQ A;  3M1G A;  3H93 A;  2H1L A;  5IMZ A;  4USS A;  4WBR D;  4GXZ A;  3F6D A;  1OVN A;  4RI7 A;  2MBS A;  5COH A;  2BMX A;  3HZ4 A;  2V41 A;  1XW9 A;  1SYX A;  4HJM A;  2JAC A;  2P5R A;  2R6K A;  5G5F A;  2EFD A;  2PMT A;  3HHV A;  2OAD A;  3ZIV A;  2LTK A;  3BD2 A;  3P8W A;  4JU5 A;  4ZB9 A;  1F37 A;  5A4V A;  2DIY A;  1GSD A;  1M2B A;  3TKS E;  2I9H A;  1SVM A;  1OC8 A;  2LST A;  1FVK A;  12GS A;  1R4W A;  2WCI A;  3Q6O A;  5GAP D;  4MP4 A;  2I81 A;  1ZCP A;  1TRU A;  1ZL9 A;  3MDK A;  1BF5 A;  2CAI A;  3I6A A;  1AW9 A;  2HT9 A;  4E8H A;  4TR1 B;  2B7J A;  1K0M A;  4K0N A;  1RK4 A;  1X5D A;  2B1L A;  4I8B A;  3H4K A;  3M9J A;  3KP9 A;  3C1R A;  2FHE A;  3ZVJ A;  4ECJ A;  3CMI A;  5B6M A;  3KD0 A;  2ON5 A;  3WT1 A;  2B5Y A;  4I97 A;  5J4V A;  2CAQ A;  2O87 A;  3CTG A;  3UBL A;  4E68 A;  1GTA A;  1W89 A;  5C00 A;  5L71 A;  4PQH A;  3F6F A;  4PUA A;  2OBI A;  2GQL A;  1GL8 A;  1TU7 A;  2VAF A;  3Q74 A;  5ECR B;  4F03 A;  2YJH A;  3LSZ A;  1TKD B;  1ERU A;  1Y6E A;  2K8S A;  1J9B A;  2LJR A;  1BED A;  2A4V A;  3M0F A;  1X9W B;  1ERV A;  6GSW A;  1VF4 A;  4OMV A;  2IFQ B;  4TR3 A;  4EC0 A;  8GSS A;  1FW1 A;  5IQY A;  2HYX A;  1F2E A;  4KE3 A;  1XPV A;  5DQY A;  1R5A A;  4POM A;  3LGC A;  1XWB A;  4AJ6 A;  2KOK A;  3HKR A;  1O85 A;  1GSQ A;  4N10 A;  2IMI A;  4PGT A;  3ERG A;  4J57 E;  2A2S A;  4D73 A;  2IN3 A;  3UMA A;  1NSW A;  4TR0 A;  4TXO A;  3EPT A;  4K9Z A;  2EIO A;  4LL1 B;  5DCG A;  4HU7 A;  3A2X A;  2YWM A;  2PPT A;  4DSS A;  2FNO A;  3FR3 A;  5IMA A;  2GZP A;  3TKR A;  1FG4 A;  4MH2 A;  5J5N A;  4KND A;  3GKM A;  2FWG A;  1A2J A;  2PVQ A;  4IQ1 A;  1V9W A;  4O32 A;  2X8G A;  1GUK A;  1O7U A;  1M9A A;  5ECN B;  4FYB A;  4ISD A;  1M99 A;  2X49 A;  4ZL7 A;  2PVO C;  5KEJ A;  5IPG A;  2XBQ A;  3TCO A;  5B8B A;  3ZL5 A;  1XWK A;  4NPB A;  1SK0 A;  4G10 A;  1THX A;  3V1W A;  4K7O A;  4K5S A;  4CY6 A;  1GTU A;  2HZE B;  2XBI A;  1ZYE A;  3VPT A;  2VUP A;  1V57 A;  2LRT A;  1X5C A;  4PNG A;  2H71 A;  3GKX A;  2H70 A;  1HD2 A;  3GIX A;  1K0D A;  4NV5 A;  2V32 A;  3BCK A;  4K1F A;  2CVB A;  2LUS A;  2GST A;  2CZ3 A;  1OC9 B;  1NHY A;  1DE1 A;  3HJO A;  4AKI A;  5DAK A;  1XOA A;  1T4Y A;  3ZMK A;  2HRF A;  3F3R A;  4RI6 A;  1BAY A;  3IK9 A;  2F8F A;  4GF0 A;  3M8N A;  4L5L A;  3H79 A;  3IA1 A;  1PD2 1;  3KZQ A;  4MF6 A;  1G0T A;  4O92 A;  5KN2 A;  9GSS A;  3PH9 A;  2A2P A;  3WT2 A;  2YN1 A;  3LJR A;  1ST9 A;  1BX9 A;  1XWG A;  4MJE A;  1T4Z A;  4XRA A;  4YAV A;  20GS A;  4XS6 A;  1HNC A;  4G01 A;  2WB9 A;  2V2G A;  4KB3 A;  5KN1 A;  2JAD A;  4BL7 A;  4LMW A;  2J23 A;  4FYC A;  2X99 A;  5KN3 A;  1DBY A;  1G7O A;  3RBT A;  4BPY A;  1ERW A;  2NVL A;  3DRN A;  5J9B A;  5D9X A;  2GZY A;  3D5J A;  6GSU A;  4LA1 A;  5JCG A;  4Q5R A;  5HFI A;  1XWA A;  3TUE A;  4Z7X A;  1U88 A;  5ECL B;  2K6V A;  3TOT A;  1GSF A;  1FB6 A;  3PIN A;  2WGR A;  3WYW A;  3D4T A;  3I69 A;  2IMD A;  2FWF A;  1EGR A;  3MIX A;  5J47 A;  4TOP A;  2E2M A;  1H75 A;  2VL2 C;  3GL5 A;  4DSQ A;  1X5E A;  4HQZ A;  1LBK A;  1KBN A;  3D4M A;  3CXG A;  2L5L A;  2GT5 A;  4ICY A;  3BOA A;  2OE1 A;  2HRN A;  5ECH B;  5DBQ A;  4K2D A;  1TP9 A;  4KUN A;  2GZZ A;  1MTC A;  1AUC A;  3EU3 A;  5J3R A;  5GZZ B;  3HVX A;  2WJU A;  4JBB A;  2ZUP A;  2IWT A;  3DVX A;  1BJX A;  1GP1 A;  2PN8 A;  3LYK A;  1QMV A;  3RPN A;  5HFK A;  5HQP A;  5G30 A;  4JZQ A;  3TJF A;  3G9B A;  5E4W A;  2D2Z A;  2AHE A;  2LV3 A;  5J41 A;  1N2A A;  4MZB A;  22GS A;  3L9U A;  3N9J A;  3UVT A;  5ECO B;  2H0H A;  3F4T A;  2B3S A;  1BG1 A;  1PGT A;  1XCC A;  1EOH A;  4Z2R A;  3LFL A;  3VPQ A;  3ZVJ D;  5GSS A;  4TN8 A;  2N5A A;  2H74 A;  1MDJ A;  1B8X A;  1SD9 A;  5B8A A;  5EY6 A;  2VOC A;  2LNT A;  2OBK A;  2HSN B;  3KP8 A;  3PGT A;  3VWX A;  3DWV A;  4J2F A;  2CVK A;  2DLX A;  2AV4 A;  3SWL A;  5KN0 A;  1KTE A;  7GSS A;  3UVH A;  3ME7 A;  2VCW A;  4YQU A;  3IBH A;  1A8Y A;  2PBJ A;  4O5R A;  4BWQ A;  4GDF A;  4EIQ A;  4JED A;  1THO A;  3F9U A;  1ZYQ B;  3VLN A;  4GQF A;  1JLV A;  2AJQ B;  1SVL A;  1EOG A;  4YKG A;  3ZIT A;  4G0K A;  5JWR B;  1ERT A;  2I3Y A;  3TU3 B;  3Q18 A;  3QD9 A;  2DJK A;  1PN9 A;  1WRY A;  2DJ2 A;  3NOF A;  4MJB A;  4Q5F A;  5C04 A;  3H8Q A;  3H1N A;  2B6M A;  2ZCT A;  5DJL A;  5DAL B;  4WXT A;  3HCZ A;  5ECK B;  2VD0 A;  1WE0 A;  1Q4J A;  1K3L A;  1DUG A;  1IYH A;  1TK0 B;  5IPH A;  5IM9 A;  3FMW A;  3O6T A;  2REM A;  4ZBD A;  2UZ8 A;  3KXO A;  1X9M B;  1Y25 A;  4V2M A;  5CAX A;  1QUW A;  1U87 A;  1YY7 A;  5HFG A;  1AAZ A;  2NDO A;  3IHG A;  5A5H B;  2JU5 A;  1YQ1 A;  5JWO B;  4KF9 A;  2YZU A;  1V2A A;  2QKE A;  2VO4 A;  3CTF A;  4ECC A;  1G7E A;  2VL2 A;  2O5V A;  2H66 A;  2GT6 A;  4POK A;  3C7M A;  3US3 A;  4HDE A;  1V58 A;  4IJI A;  2O7K A;  4MJA A;  2I1U A;  4QQ7 A;  3D21 A;  1XWC A;  5ELG A;  5JCU A;  3KH9 A;  1M7T A;  2JZR A;  5JWQ B;  4OFT A;  1AIU A;  2DIZ A;  3TB2 A;  2L57 A;  3A5I A;  2C8U A;  1OE7 A;  1EP8 A;  4ZB7 A;  2LQQ A;  2PWJ A;  4BVY B;  2DJ1 A;  1O81 A;  2FUG 2;  2XHF A;  1E6B A;  3G7I A;  1OYJ A;  5CRW A;  4MMM A;  5CO3 A;  4K5R A;  2AYT A;  4CDO A;  4MH3 A;  1ON4 A;  1GSU A;  2CA8 A;  4AJ7 A;  2C3Q A;  3GFK A;  5ELA A;  1Q98 A;  4G19 A;  1TK8 B;  1WPI A;  1XZO A;  1TU8 A;  1SEN A;  5G2Z A;  2E7P A;  2RII A;  4G2E A;  1VF2 A;  3IAM 2;  3ZTL A;  1R26 A;  1NM3 A;  4WR4 A;  5J40 A;  1ZGN A;  3BJ5 A;  2MMN A;  1I5G A;  3IDV A;  4K6X A;  3HJM A;  4EF0 A;  6GSY A;  2DJ0 A;  2F9S A;  3DEX A;  3CSH A;  3QFB C;  3RHB A;  4GWR A;  4X43 A;  2VM2 A;  2L4C A;  1YKC A;  4XRD A;  3M9K A;  2H1A A;  2H73 A;  4EE0 A;  2NPB A;  3KH7 A;  2OE3 A;  1B9X C;  1BYE A;  5H5Q A;  2HRA A;  4I2T A;  3TRX A;  1TTZ A;  1QXH A;  3ERW A;  4Z2T A;  1MDK A;  4O5Q A;  2MMA A;  1DE2 A;  3L78 A;  4KSM A;  2N5B A;  5E59 A;  2XC2 A;  2WS2 A;  1AXD A;  4TKY A;  2HSM A;  3TJB A;  1XVW A;  1Z9H A;  4TW5 A;  3APS A;  4JR4 A;  4N0V A;  1M2A A;  1Z3E A;  1ACV A;  2VD1 A;  11GS A;  3TRP A;  3F3Q A;  4TR1 A;  4ML1 A;  1K3O A;  3FZ9 A;  3ED3 A;  3WGX A;  3QAG A;  4HUA A;  3LXZ A;  1G6W A;  2EFC A;  3IXR A;  2V1M A;  4TXO B;  3TOU A;  1FHE A;  1N25 A;  1QQ2 A;  3TDG A;  2VM1 A;  2EFH A;  1ZZY A;  4DSS B;  2WDU A;  3APQ A;  3GUS A;  4RQR A;  2RUE A;  1M2D A;  4G0L A;  1PQN A;  5ABR A;  1K0N A;  2YWO A;  2RUF A;  4HZ4 A;  4XHM A;  2VL3 A;  2KUC A;  1SL1 B;  3VFI A;  5EL8 A;  1MD3 A;  3TJK A;  2AB6 A;  1T3B A;  5JCW A;  3IC4 A;  5G1K A;  1A0R P;  3ZLP A;  4EUY A;  2G2Q A;  4Q5N A;  3KGK A;  2KHP A;  2HFD A;  3UAP A;  1S3D A;  2K18 A;  2FWE A;  3LW9 A;  4GQC A;  1BQ7 A;  4GSN A;  5BMU A;  3D0Z A;  1LJR A;  4MJC A;  1GTI A;  3QAV A;  2TRC P;  2RLI A;  2CX4 A;  3GH6 A;  1YVL A;  1JZO A;  1IYI A;  2IMF A;  4XS4 B;  4G9H A;  4L0W A;  1GSE A;  2B5X A;  2FY6 A;  4EO3 A;  3WGE A;  3HVV A;  1MD4 A;  2AUV A;  5DQS A;  2OKA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...