1G7OA

Nmr solution structure of reduced e. coli glutaredoxin 2
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
215
structure length
215
Chain Sequence
b'MKLYIYDHCPYCLKARMIFGLKNIPVELHVLLNDDAETPTRMVGQKQVPILQKDDSRYMPESMDIVHYVDKLDGKPLLTGKRSPAIEEWLRKVNGYANKLLLPRFAKSAFDEFSTPAARKYFVDKKEASAGNFADLLAHSDGLIKNISDDLRALDKLIVKPNAVNGELSEDDIQLFPLLRNLTLVAGINWPSRVADYRDNMAKQTQINLLSSMAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTAREDOXIN 2
publication title Solution structure of Escherichia coli glutaredoxin-2 shows similarity to mammalian glutathione-S-transferases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 84
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2000-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04399 Glutaredoxin2_C Glutaredoxin 2, C terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1g7oA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1g7oA01
4EDZA 2VD1A 2TRCP 1XZOA 3VPQA 2PU9C 1YKCA 3M9KA 2AV4A 1ON4A 2X8CA 3EMXA 1XWKA 1WWJA 2YNXA 1MTCA 1RQMA 2FWEA 4WEYA 4TR0A 4HUAA 1R26A 4LA1A 1MDKA 4ZBAA 5IM9A 5B6NA 5J5NA 1O8WA 3KH7A 3Q19A 4ZILA 2YP6A 3P2AA 4FYCA 1ZYEA 2LQQA 3WGXA 1J08A 2EIRA 3IDVA 1T4YA 3HYPA 4XS4B 3ZTLA 3APQA 1SYXA 7GSSA 4HS1A 3BOAA 4RUVA 3HY2A 4F0BA 3GX0A 4PUFC 1QXHA 4CDOA 2CAQA 1PRXA 1HNAA 3HZ8A 1T3BA 1ZCPA 1U3IA 2CT6A 2YZHA 1F3BA 2V6KA 2MBSA 2I81A 6GSTA 1EZKA 1SJZA 1J9BA 3KD0A 2IL3A 3F4RA 5J9CA 2XBIA 1V58A 5ABRA 1UA5A 1SL0B 3IR4A 4BWSA 2C4JA 3D4MA 3KMNA 4IW9A 2WRTA 4XTSA 1WPIA 3GH6A 2VIMA 1WE0A 2HNLA 3VWXA 4YQUA 3OR5A 5J9BA 3DKSA 3FKFA 2BJXA 1YQ1A 1XW9A 4GQFA 22GSA 3TJFA 3HVSA 2VLUA 4FYUA 4DEJA 4PXOA 1GTIA 1OC3A 1BAYA 4ML6A 3N5OA 3TKPA 5JCWA 3ERWA 1CQHA 4WBJA 5IPGA 2AAWA 4DSQA 4L0UA 1TI1A 5BMUA 2YZUA 2AUVA 3UEMA 1TDIA 4IQAA 3QAWA 2YWOA 4K8MA 5GZZB 2IJYA 3C1RA 5F07A 3LJRA 5LNKe 1YF0A 2KP2A 2FWHA 3HKRA 2DJ1A 2YPMA 1AW9A 4HEA2 2ON5A 2QSIA 3HJPA 1BG5A 2E7PA 1GLPA 2DJKA 4RQXA 2K8VA 3UBLA 1TRSA 3CBUA 6GSUA 11GSA 2DJ0A 2L6DA 1F3AA 1N2AA 2V1MA 1PL2A 4N0ZA 1O8XA 5ECHB 2PN8A 2YWIA 2C0EA 2IIYA 2H70A 3ME8A 3I6AA 1R7HA 1TTZA 5GAND 4E8HA 2MMNA 3R3EA 2WULA 5J3RA 2NTOA 1XW6A 1A2LA 1DBYA 5CREA 3DXBA 2IMFA 3G7YA 3GIXA 13GSA 4K0NA 4NWYA 2WDUA 1THXA 2R6KA 4K7NA 3ZVJA 4AJ8A 4OCFA 5ECLB 2IFQB 1TRWA 2O85A 3QD9A 2G0FA 3AY8A 3WD6A 2B1KA 1GSYA 3KM6A 5C00A 3W6GA 3DEXA 2DIZA 1IYIA 3FHKA 4J56E 1SU9A 4FYBA 1EEMA 3TDGA 2OADA 3MAKA 4ZIJA 4YAVA 5JCUA 3DGQA 4TXOA 3KEBA 3GRXA 3S9FA 2PGTA 1K0MA 2GLRA 2R3XA 4XRAA 4PQHA 3LXTA 1GUHA 3LGCA 4XS4A 4TXVA 4KGIA 4BA7A 3CSHA 5DAKA 2VCTA 4GCIA 2A2SA 4OWYA 2DJ3A 2LKUA 3FZ9A 1ACVA 3QPMA 5J41A 4H86A 5F0GA 4KE3A 2O8VB 4MH2A 2FGXA 2TIRA 3ZZXA 3SBCA 3A5WA 2RLIA 2I9HA 3C73A 4NMUA 1GRXA 2IN3A 1SL1B 4KAEA 4MP4A 2H1AA 3W8SA 1XWBA 4JEDA 4EVMA 3KGKA 3TKSC 3EURA 1PX7A 3CYNA 2PERA 3GV1A 3QCPA 4PQIA 4KF9A 5G30A 3EU3A 1XCCA 4N11A 4YH2A 4JR4A 3KXOA 6GSXA 3NZNA 1LJRA 5HFKA 3UBKA 4EC0A 4NV2A 2F8AA 3GX8A 3ZFLA 4Q5FA 2R2JA 3KP9A 2HSHA 2YWNA 1O81A 1HNBA 1PMTA 4BL7B 2JL4A 1EGOA 1GLQA 3KZQA 5IMVA 1SK2A 9GSSA 3D0ZA 2R4VA 2WJUA 2OE0A 2FHEA 1PL1A 4PNFA 5KN1A 1KBNA 1M9BA 2BTOT 3VI5A 1AAZA 3TKRA 5G2ZA 1R5AA 3EC3A 3EU4A 3FZ4A 4QQ7A 2H19A 4WF5A 4XS6A 5HR0A 2KLXA 1SD9A 4K7OA 4HOJA 4KDYA 3R2QA 4GSNA 1FW1A 1K3OA 4ILFA 3GN3A 3MSZA 2HFDA 5ENUA 3L78A 3G9BA 3MDKA 2GSSA 4KSMA 1OE7A 5B7CA 5ECQB 2O7KA 4K7IA 2RM5A 3TOUA 2LUSA 4Q5RA 2CVKA 3LQ7A 3RPPA 1FB6A 2A2RA 4HZ4A 2E2GA 2B5EA 1PGTA 3UMAA 2N5AA 2M80A 1M7TA 2M46A 1LU4A 2A4VA 4KNDA 5IO2A 1EV4A 2WS2A 5B8AA 1X5EA 1A8YA 2WGRA 4POLA 2OKAA 3H4KA 2WCIA 3GKMA 2AB6A 4GSSA 4IVFA 4WF4A 1WP0A 4ZBBA 2NVLA 3RBTA 1B4PA 2E0QA 3GL3A 5DJMA 3DIEA 3FW2A 1VF4A 2P5RA 5D9XA 14GSA 4QL7A 2HXKA 1OC9B 4ZXGA 2F8FA 4GSTA 1OC8A 1O73A 2OE3A 4EO3A 5CP1A 2ZUPA 2YCDA 2PBJA 3LYKA 2ES7A 3H1NA 2HZFA 3HJOA 1T8EB 5H5RA 2C8UA 2X99A 2L6CA 4F9ZA 2H1GA 5ECNB 4IELA 2LQOA 1GUMA 2EIOA 2VLVA 5IOXA 1XIYA 1CQGA 2HZEB 1Y25A 1ERUA 2J23A 3K8NA 5E4WA 4L0WA 2FLSA 1YEPA 2L5LA 1QMVA 3WGDA 4MZWA 3LWAA 1X9SB 5HR1A 3H8QA 4IJ3A 5L71A 3L0HA 4ZB6A 4JU5A 3GL5A 2H8LA 1M99A 1F2EA 2LSTA 1AQVA 3E3EA 4BVXB 1GSEA 2JSYA 2R37A 3DRNA 3WGEA 2XHFA 2GVPA 4CHSA 3RHBA 3O3TA 2H1DA 4WR4A 3A2XA 2AHEA 1H4OA 2DJ2A 2K8SA 1V40A 1NSWA 5KN0A 3QR6A 4JRRA 1JZWA 4BL7A 3DD3A 1XW5A 2XPEA 4POKA 2I4AA 4OMVA 3C8EA 1S3CA 2C80A 17GSA 1HD2A 2CA8A 2LJRA 3F63A 2O87A 2CVBA 3WT2A 3BD2A 2YN1A 2X8GA 2YV9A 5FT3A 4ZB9A 4G0KA 5DVBA 2PMTA 3QAVA 2YWMA 1HYUA 4D73B 2RUEA 3NIVA 2L57A 4N30A 1TK8B 2H6YA 1NHYA 4MJEA 4ULXA 3UIWA 3D21A 2OE1A 2CZ2A 1KEBA 2VLTA 4G2EA 1UVZA 1YKAA 18GSA 5DQYA 2MMAA 1OKDA 2JZRA 6GSSA 3GKKA 5J4UA 3I9V2 1N8JA 1Z7RA 4G19A 6GSWA 10GSA 3HCZA 4P3YB 1GTUA 4MA9A 2GZPA 1K3LA 2HSYA 3ZMKA 2B1LA 2R5GA 2LEGA 2VD0A 4DSSB 1M2DA 3LORA 20GSA 3GKNA 1ZZYA 2O89A 3NOFA 3IK7A 3ZVJD 2GSRA 1NM3A 1K0CA 5GAPD 1B9XC 1HQOA 2J9HA 2EC4A 5DCHA 1OKTA 2XPDA 3Q74A 4ID0A 1PD21 1OC9A 1GNEA 2N5BA 1FVJA 2H75A 4ZB8A 3QDNA 1T1VA 1W89A 5EY6A 4NXIA 3I69A 2QC7A 3W8JA 3HHVA 3GTUB 1HNCA 3JCML 4I97A 3QAGA 2LS5A 1PKWA 3HZ4A 5DALA 2C0GA 3TRPA 3HJMA 5AIXA 5INYA 4TR1B 3UOMA 2H74A 1M2BA 4GF0A 4I5QA 1FB0A 2HRKB 1GTBA 2WB9A 2HSMB 5CNWA 4XRDA 2VCWA 4X1UA 3UL3A 3EINA 4BWQA 4J57E 3VLNA 5D93A 1FHEA 4MPGA 3QMXA 4HJMA 4HU7A 4HDEA 5D73A 3IAM2 2ALBA 3UJ1A 3DVXA 2VM2A 1V98A 5H5QA 2HRFA 3KIJA 4EKZA 1GL8A 4IBPA 2VL9A 3GFKA 1XPVA 4DVCA 1ZL9A 4KX4A 3VPTA 1Z9HA 5AGYA 2GTUA 1ERVA 5AN1A 1C72A 2GSQA 2CZ3A 1GWCA 1SD8A 4MCUA 3FY7A 4BVXA 1M9AA 3ZLPA 4KA0A 4OD7A 4MH3A 1AC1A 1A0RP 3PINA 1B8XA 5DQSA 2ZNMA 3I43A 3CXGA 4KDUA 2FWGA 1GULA 2IMKA 1G0TA 1AQXA 2HLSA 3C1SA 4BPYA 1T00A 1EOHA 1Z7PA 4OFNA 1SKRB 3FZAA 2RM6A 5IMFA 5ID2B 2F9SA 3VK9A 2JZTA 4LMWA 2HT9A 3KH9A 4NAXA 1K0AA 3ZYWA 3D4TA 4PNGA 1A8LA 4V1Ag 4DSRA 2YJHA 5CRGA 1DE2A 1T4ZA 3TJBA 2K9FA 3GMFA 4ZBDA 3KTLA 2C0FA 4MJAA 5D9VA 4OO4A 1AUCA 3CRTA 5IOWA 3CRUA 2FCHA 1XWAA 1JZRA 2NBSA 4AJ6A 3VI7A 4TW5A 5H5SA 5G5EA 2GS3A 1GNWA 2LRCA 4Q5QA 2MYGA 1JLWA 5IMDA 3UARA 2MBTA 1YDKA 2FA4A 2H30A 4KH7A 1A23A 1S3DA 1Z6NA 4USSA 2HI7A 4OO5A 4YAPA 5CYYA 2EIQA 5HR2A 4DSSA 4CW9A 4K1FA 4TN8A 2V2GA 1SK1A 3RAZA 4I8BA 2H0GA 1U87A 1F37A 5B8BA 1TRVA 1ILOA 1X9MB 3A2VA 2H73A 5HFGA 2KHPA 2HYXA 3HD5A 5IMAA 3C71A 3ZRDA 1GH2A 4EF0A 1JZOA 4MZBA 1GSUA 4KCEA 1Z3EA 4V2NA 3ME7A 2CVDA 1ERTA 2JACA 1K0NA 3TUEA 3FK8A 1ZMAA 4WR5A 3ISOA 3M3MA 3EYTA 3L9SA 2VCVA 2V41A 4K2DA 1FVKA 3VURA 4IQ1A 1URMA 3QOUA 1ST9A 3GTUA 1WJKA 2KUCA 1A2MA 2CQ9A 1ABAA 5B6MA 2OACA 2JZSA 1KTEA 5ECPB 2B5YA 1DE1A 3F4TA 2HQTA 1JFUA 1AQWA 2H6ZA 4XCSA 5DCGA 1ZOFA 1QUWA 4EDYA 2LNTA 1EP8A 3APSA 4ZL9A 2I1UA 1RK4A 5IQYA 5JWOB 1VF2A 3TOTA 3GURA 5FHIA 5G5FA 2FUG2 2C1YA 3Q18A 4JBBA 4ML1A 3IV4A 5EL8A 5D9TA 4TRXA 3GSSA 2VUPA 5DDLA 1YY7A 1TK0B 2X8HA 6GSYA 1SENA 1Q4JA 3GYKA 2B7JA 2RIIA 2PUKC 4HQZA 4TVEA 1PX6A 1B4QA 1FOVA 4K6XA 4KB3A 1FAAA 1O7UA 2IFQA 1X0RA 2M72A 1V2AA 4KSOA 1JZDA 1JLVA 4PQ1A 1DUGA 3TRXA 1XWGA 4XS1A 1W4VA 3IPZA 1MD4A 4BVYB 2V6OA 5D9WA 1AIUA 1WOUA 4K9ZA 2C0DA 3PGTA 1SL2B 4MDCA 4O7HA 2GDRA 3FRCA 2JSZA 4V2MA 3ERFA 5JWRB 1U6TA 4F03A 2JADA 4GXZA 3HA9A 2DMMA 1TKDB 3PR8A 3DMLA 2AYTA 4KDXA 3F9UA 4NHWA 1TI3A 3TJGA 3A2WA 3GNJA 1WIKA 1KNGA 2P0GA 4JZQA 2FD3A 3DWVA 2CX4A 3ZIVA 2ZCTA 4X0XA 3CTGA 3ZMLA 5KN3A 2WFCA 3TCOA 2YANA 5GSSA 1XVWA 2DMLA 5A5KA 1VRSD 3J7Yk 3GH9A 2QGVA 4N10A 2XC2A 4L5LA 5F06A 2P31A 5IMCA 4OCEA 16GSA 1ML6A 1A2JA 2VO4A 1A24A 2VL2A 2KP1A 4PTSA 2D2ZA 3EE2A 2FWFA 3F8UA 2OJLA 5ELAA 1E6BA 1TK5B 4AGSA 3DVWA 1O6JA 3KMOA 4I2TA 3IRAA 3VWWA 3FR6A 3E0UA 3ZITA 4RI6A 2GT5A 2JU5A 2PWJA 1K0BA 4XIHA 1NW2A 2K6VA 5KEJA 2BMXA 3U5RE 1Q98A 2B3SA 1MDJA 4GQCA 3A3TA 4LL1B 3CTFA 2H76A 4POBA 2REMA 1EEJA 4POMA 1PA3A 3BCIA 3F3RA 4FQUA 3IK9A 4LMVA 3D6IA 1G6WA 3M0FA 1U88A 4IKHA 4O32A 4TXOB 1Z6MA 5EPFA 1TU8A 3U6VA 4HJ2A 5CRWA 5E59A 1XVQA 5ECSA 2LRNA 2Z9SA 3TKQA 1OVNA 3O76A 1O85A 5ECRB 2B5XA 1QGVA 1DSBA 4IHUA 3ZL5A 3GSTA 5F05A 2L4QA 1UN2A 2XBQA 2LNSA 4ECBA 5CRHA 2I3YA 4PGTA 5DAKB 3HDCA 2GGTA 5KN2A 1JHBA 2GZYA 3QFAC 3FZ5A 3LG6A 1QK8A 4IP6A 3M8NA 2HE3A 3FR9A 3EMPA 4IP1A 1THOA 1GTAA 5A4WA 2YV7A 3UVTA 2OBKA 3TRQA 1PSQA 1XFLA 3PPUA 2IMIA 5ECOB 2MMOA 1BYEA 3V1WA 6GSVA 5CRDA 4MPFA 5EVOA 1X9WB 4ZL7A 2VCXA 3US3A 3L9VA 4BVYA 4TKYA 8GSSA 3HXSA 3IOSA 3APOA 4HI7A 3CMIA 1IYHA 2HSNB 3FYGA 3IC4A 2DC5A 1PKZA 5F8BA 4EE0A 4G10A 3IC8A 4IJIA 4AF2A 1VGLA 1GSQA 2C3QA 2WZ9A 2MMZA 2LTKA 2ON7A 5IPHA 2X64A 2GZZA 5D96A 3L9UA 4TR4A 4I2UA 1X5CA 3WYWA 2CX3A 4O92A 3IAS2 4JE1A 3M1GA 1GSDA 2VCZA 5G1KA 2L4CA 1PN9A 2HZEA 2IMEA 4ECIA 1G7OA 5ECIB 3IBHA 4ACSA 2K18A 1T7PB 5G31A 3N9JA 3BJ5A 3BBYA 1XOBA 4AJ7A 3H79A 1EWXA 1MEKA 4FH8A 3EVIA 1YF1A 3GA4A 1MDIA 5AISA 2GQLA 1TOFA 4L5OA 5IO0A 4K0GA 2HRAA 4ECCA 2GSTA 1GSSA 3E9JB 4XHMA 4E8EA 5HR3A 2N5FA 1BX9A 1SK0A 3IE3A 5JCGA 5COHA 2B6MA 2AJQB 4KUNA 1SYRA 1SKSB 4FIWA 4HQSA 4LL4B 4WETA 1RW1A 2H66A 3M9JA 3TJKA 1PQNA 2OBIA 3LYPA 1J0FA 3WT1A 1TXXA 1XWCA 1FG4A 3ERGA 1GUKA 2YOIA 1H75A 5DBQA 4G9HA 4FO5A 4HU9A 4RI7A 3O6TA 4MMMA 3DYRA 3F0IA 1TU7A 4F0CA 5IMZA 1NHOA 1BJXA 4YQVA 4D73A 3D5JA 4GWRA 1LBKA 3RPNA 3PH9A 4IS0A 3IHQA 4MK3A 2DLXA 3LXZA 4EUYA 5A4UA 5C04A 5HQPA 1OYJA 2CV4A 1YEXA 3F6FA 1GSFA 2F3MA 1X5DA 3KP8A 4QL9A 3P7XA 1FO5A 4OFTA 4V1Ap 4J2FA 3RDWA 4IN0A 12GSA 2VCQA 1U3AA 1XOAA 2GQKA 3KJYA 3VFIA 4F82A 5D8IA 4MABA 3TKSE 4EXJA 5LCZA 2IWTA 2IMDA 2YJ7A 1G7EA 4MF6A 4O5RA 1GP1A 1TJDA 4PURA 3EWLA 2H0IA 1EGRA 4G0IA 2HRNA 2CAIA 3CSJA 3MWHA 2B7KA 1K0OA 3FEUA 3TJJA 2MZCA 1UC7A 1WMJA 3IA1A 1BEDA 2TRXA 2LJAA 3UAPA 1SKWB 5A4VA 4EL1A 3HVVA 5ECKB 1OE8A 2GQMA 3QFBC 2QKEA 4GLTA 2F51A 3LEFA 2LV3A 2V32A 3F3QA 4OFMA 5AIVA 5FWGA 2FNOA 3P90A 2PVOC 1EV9A 1K3YA 5DJLA 4HZ2A 2H0HA 4TR1A 2G2QA 3C7MA 1QFNA 3D22A 2HRKA 3TKSA 2HSMA 2DBCA 4F2IA 4WXTA 1YZXA 3LFLA 3FR3A 1TP9A 2FY6A 3HVXA 4KCAA 1USBA 2H72A 2DSAA 4GRFA 2DIYA 1YJ6A 1BQ7A 3H93A 3F4SA 4NV5A 3MNGA 3TB2A 5HFIA 5GSTA 1M2AA 1Z5YE 1MD3A 3GUSA 3UVHA 2C3TA 3CSIA 4MF5A 5CAXA 3G7IA 5ELGA 3ZREA 2FA8A 1R4WA 4JR6A 1I9DA 2VOCA 1OAZA 3F6DA 3Q6OA 3LSZA 3ZIJA 1VF3A 1F6MC 2P5QA 2VL3A 2LRTA 1XXUA 5LD0A 3BCKA 19GSA 2KOKA 1EOGA 3RHCA 2IPAA 1ERWA 1V57A 2GT6A 1WRYA 4YQMA 4GTUA 4G0LA 1QQ2A 1S3AA 4WBRD 1ZYQB 1SJIA 2C3NA 1B9YC 4NPBA 4RQRA 2RUFA 2VL2C 3GKXA 2NDOA 1SJ6A 4WKWA 5ID2A 2DJJA 2VAFA 3G7JA 1VF1A 2H1BA 5ECMB 3ZFBA 4ISDA 2H01A 3GHAA 1Y6EA 4ECJA 1F9MA 1TRUA 3KCMA 4MLYA 4IGJA 3L4NA 2VM1A 3KTBA 2E2MA 5IIZA 2UZ8A 4Q5NA 1I5GA 4I6XA 1A0FA 4MZCA 2PPTA 5DALB 1K0DA 1EP7A 2LJKA 1V9WA 4X43A 4LLRA 4NHZA 1R5PA 4MJCA 1M0UA 1E2YA 3ED3A 4V2LA 2H71A 1TW9A 1ZGNA 2OA7A 3TGZA 2PVQA 4TOPA 4N0VA 4PUAA 1G6YA 3VWVA 3VWUA 2NPBA 4KW6A 1XBSA 1B48A 4Z7XA 2L59A 3SWLA 4ZL8A 2H6XA 5CO3A 3J7Yb 3IXRA 3P8WA 1AXDA 4TR3A 2L5OA 5G1LA 4MF7A 4PX1A 4MJBA 4L8EA 5JWQB
chains in the Genus database with same CATH superfamily
4EDZA 2VD1A 2TRCP 1XZOA 3VPQA 2PU9C 1YKCA 3M9KA 2AV4A 1ON4A 2X8CA 3EMXA 1XWKA 1WWJA 2YNXA 1MTCA 1RQMA 2FWEA 4WEYA 4TR0A 4HUAA 1R26A 4LA1A 1MDKA 4ZBAA 5IM9A 5B6NA 5J5NA 1O8WA 3KH7A 3Q19A 4ZILA 2YP6A 3P2AA 4FYCA 1ZYEA 2LQQA 3WGXA 1J08A 2EIRA 3IDVA 1T4YA 3HYPA 4XS4B 3ZTLA 3APQA 1SYXA 7GSSA 4HS1A 3BOAA 4RUVA 3HY2A 4F0BA 3GX0A 4PUFC 1QXHA 4PI2C 4CDOA 2CAQA 1PRXA 1HNAA 3HZ8A 1T3BA 1ZCPA 1U3IA 2CT6A 2YZHA 1F3BA 2V6KA 2MBSA 2I81A 6GSTA 1EZKA 4EIQA 1SJZA 1J9BA 3KD0A 2IL3A 3F4RA 5J9CA 2XBIA 1V58A 5ABRA 1UA5A 1SL0B 4Z2UA 3MYDA 3IR4A 4BWSA 2C4JA 3D4MA 3KMNA 4IW9A 2WRTA 4XTSA 1WPIA 3GH6A 2VIMA 1WE0A 2HNLA 3VWXA 4YQUA 3OR5A 5J9BA 4X4JA 3DKSA 3FKFA 2BJXA 1YQ1A 1XW9A 4GQFA 22GSA 3TJFA 3HVSA 2VLUA 4FYUA 4DEJA 4PXOA 1GTIA 1OC3A 1BAYA 4ML6A 3N5OA 4FXYP 3TKPA 5JCWA 3ERWA 1CQHA 4WBJA 5IPGA 2AAWA 4DSQA 4L0UA 1TI1A 5BMUA 2YZUA 4ZB7A 2AUVA 3UEMA 2R0GA 1TDIA 4IQAA 3QAWA 2R0PA 2YWOA 4K8MA 5GZZB 2IJYA 3C1RA 5F07A 3LJRA 5LNKe 1YF0A 2KP2A 2FWHA 3HKRA 2DJ1A 2YPMA 1AW9A 4HEA2 2ON5A 2QSIA 3HJPA 1BG5A 2E7PA 1GLPA 2DJKA 4RQXA 2K8VA 3UBLA 1TRSA 3CBUA 6GSUA 11GSA 2DJ0A 2L6DA 1F3AA 1N2AA 2V1MA 1PL2A 4N0ZA 1O8XA 5ECHB 2PN8A 2YWIA 2C0EA 2IIYA 2H70A 3ME8A 3I6AA 4PHZC 1R7HA 1TTZA 4AKXB 5GAND 4E8HA 2MMNA 3R3EA 2WULA 5J3RA 2NTOA 1XW6A 1A2LA 1DBYA 5CREA 3DXBA 2IMFA 2R0CA 3G7YA 3GIXA 13GSA 4K0NA 4NWYA 2WDUA 1THXA 2R6KA 4K7NA 3ZVJA 4AJ8A 1TXUA 4OCFA 5ECLB 2IFQB 1TRWA 2O85A 3QD9A 2G0FA 3AY8A 3WD6A 2B1KA 1GSYA 3KM6A 5C00A 3W6GA 3DEXA 2DIZA 1IYIA 3FHKA 4J56E 1SU9A 4FYBA 1EEMA 3MIXA 3TDGA 2OADA 3MAKA 4ZIJA 4YAVA 5JCUA 3DGQA 4TXOA 3KEBA 3GRXA 3S9FA 2PGTA 1K0MA 2GLRA 2R3XA 5A5HB 4XRAA 4PQHA 3LXTA 1GUHA 3LGCA 4XS4A 4TXVA 4KGIA 4BA7A 3CSHA 5DAKA 2DKHA 2VCTA 4GCIA 2A2SA 4OWYA 2QA1A 2DJ3A 2LKUA 3FZ9A 1ACVA 2O3EA 3QPMA 5J41A 4H86A 5F0GA 4KE3A 2O8VB 4MH2A 2FGXA 2TIRA 3ZZXA 3SBCA 5BRTA 3A5WA 2RLIA 2I9HA 3C73A 4YKGA 4NMUA 1GRXA 2IN3A 1SL1B 4KAEA 4MP4A 2H1AA 3W8SA 1XWBA 4JEDA 4EVMA 3KGKA 3TKSC 3EURA 1PX7A 3CYNA 2PERA 3GV1A 3QCPA 1M3JA 4E68A 4PQIA 4KF9A 5A34A 5G30A 3EU3A 1XCCA 4N11A 4YH2A 2HSNA 4JR4A 3KXOA 6GSXA 3NZNA 1LJRA 5HFKA 3UBKA 4EC0A 4NV2A 2F8AA 3GX8A 3ZFLA 4Q5FA 1I1IP 2R2JA 3KP9A 2HSHA 2YWNA 2VKZG 1O81A 1HNBA 1PMTA 4BL7B 2JL4A 1EGOA 1GLQA 3KZQA 5IMVA 1SK2A 9GSSA 3D0ZA 2R4VA 2WJUA 2OE0A 2FHEA 1PL1A 4PNFA 5KN1A 1KBNA 1M9BA 2WVXB 2BTOT 3VI5A 1AAZA 3TKRA 5G2ZA 3LW9A 1R5AA 3EC3A 3EU4A 2WVZA 3FZ4A 4QQ7A 2H19A 4WF5A 4XS6A 5HR0A 2KLXA 1SD9A 4K7OA 4HOJA 4KDYA 3R2QA 4GSNA 1FW1A 1K3OA 4ILFA 3GN3A 4HSCX 3MSZA 2HFDA 5ENUA 3L78A 3G9BA 3MDKA 2GSSA 4KSMA 1OE7A 5B7CA 1YEWC 5ECQB 2O7KA 4K7IA 2RM5A 2WZSA 3TOUA 2LUSA 4Q5RA 2CVKA 3LQ7A 3RPPA 1FB6A 2A2RA 4HZ4A 2E2GA 2B5EA 1PGTA 3UMAA 2N5AA 2M80A 1M7TA 2M46A 5J4YA 1LU4A 4O5UA 2DKIA 2A4VA 4KNDA 5IO2A 1EV4A 2WS2A 5B8AA 1X5EA 1A8YA 2WGRA 4POLA 2OKAA 3H4KA 4CY8A 2WCIA 3GKMA 2AB6A 4GSSA 4IVFA 4WF4A 1WP0A 4AKIA 4ZBBA 2NVLA 3CWGA 3RBTA 1B4PA 2E0QA 3GL3A 5DJMA 3DIEA 3FW2A 1VF4A 2P5RA 5D9XA 14GSA 4QL7A 2HXKA 1OC9B 4ZXGA 2F8FA 4GSTA 1OC8A 1O73A 2OE3A 5A5HA 4EO3A 5CP1A 2ZUPA 2YCDA 2PBJA 3LYKA 2ES7A 3H1NA 1FOHA 2HZFA 3HJOA 1T8EB 5H5RA 2C8UA 2X99A 2L6CA 4F9ZA 2H1GA 5ECNB 4IELA 2LQOA 1GUMA 3CHXC 2EIOA 2VLVA 5IOXA 1XIYA 1CQGA 2HZEB 1Y25A 1ERUA 2J23A 3K8NA 5E4WA 4L0WA 2FLSA 1YEPA 2L5LA 1QMVA 3WGDA 4MZWA 3LWAA 1X9SB 5HR1A 3H8QA 4IJ3A 5L71A 3L0HA 4ZB6A 4JU5A 3GL5A 2H8LA 1M99A 1F2EA 2LSTA 1AQVA 3E3EA 4BVXB 5J4VA 1GSEA 1SVLA 2JSYA 2R37A 3DRNA 3WGEA 2XHFA 2GVPA 4CHSA 3RHBA 1PN0A 3O3TA 2H1DA 4WR4A 3A2XA 2O36A 2AHEA 1H4OA 2DJ2A 2K8SA 1V40A 1NSWA 5KN0A 3QR6A 4JRRA 1JZWA 4BL7A 3DD3A 1XW5A 2XPEA 4POKA 2I4AA 4OMVA 2WVXA 3CQFA 3C8EA 1S3CA 2C80A 17GSA 1HD2A 2CA8A 2LJRA 3F63A 2O87A 2CVBA 3WT2A 3BD2A 2YN1A 2X8GA 2YV9A 5FT3A 2EFCA 4ZB9A 4G0KA 4A5PA 5DVBA 2PMTA 3QAVA 2YWMA 1HYUA 4D73B 2RUEA 3NIVA 4ICYA 2L57A 4N30A 1TK8B 2QA2A 2H6YA 3HVNA 1NHYA 4MJEA 4ULXA 3UIWA 3D21A 2OE1A 2CZ2A 1KEBA 2VLTA 4G2EA 1UVZA 1YKAA 18GSA 5DQYA 2MMAA 1OKDA 2JZRA 6GSSA 3GKKA 5J4UA 3I9V2 1N8JA 1Z7RA 4G19A 6GSWA 10GSA 3HCZA 4P3YB 1GTUA 4MA9A 2GZPA 1K3LA 2HSYA 3ZMKA 2B1LA 2R5GA 2LEGA 2VD0A 4DSSB 1M2DA 3RFRC 3LORA 20GSA 4YKFA 3GKNA 1ZZYA 2O89A 3NOFA 3IK7A 3ZVJD 2GSRA 1NM3A 1K0CA 5GAPD 5J47A 1HQOA 1B9XC 2J9HA 2EC4A 5DCHA 1OKTA 2XPDA 3Q74A 4ID0A 1PD21 1OC9A 1GNEA 2N5BA 1FVJA 1SVOA 4ZB8A 2H75A 3QDNA 1T1VA 2OT3A 1W89A 5EY6A 4NXIA 3I69A 2QC7A 3W8JA 3HHVA 3GTUB 1HNCA 3JCML 4I97A 3QAGA 2LS5A 1PKWA 3HZ4A 5DALA 2C0GA 3TRPA 3HJMA 5AIXA 5INYA 4TR1B 3UOMA 2H74A 1M2BA 4GF0A 4I5QA 1FB0A 2HRKB 1GTBA 2WB9A 2HSMB 5CNWA 4XRDA 2VCWA 4X1UA 3UL3A 3EINA 4BWQA 4J57E 3VLNA 5D93A 1FHEA 4MPGA 3QMXA 4HJMA 4HU7A 2WVYA 4HDEA 5D73A 3IAM2 2ALBA 3UJ1A 3DVXA 2VM2A 1V98A 5H5QA 2HRFA 3KIJA 4EKZA 1GL8A 4IBPA 2VL9A 3GFKA 1XPVA 4DVCA 1ZL9A 4KX4A 3VPTA 1Z9HA 5AGYA 2GTUA 1ERVA 5AN1A 1C72A 2GSQA 2CZ3A 1GWCA 1SD8A 4MCUA 3FY7A 4BVXA 5KOXA 1M9AA 3ZLPA 4AI6A 4KA0A 4OD7A 4MH3A 1AC1A 1A0RP 3PINA 1B8XA 5DQSA 2ZNMA 3I43A 3CXGA 4KDUA 2FWGA 1GULA 4G01A 2IMKA 1G0TA 1AQXA 2HLSA 3C1SA 4Z2TA 4BPYA 1T00A 1EOHA 1Z7PA 4OFNA 1SKRB 3FZAA 2RM6A 5IMFA 5ID2B 2F9SA 3VK9A 2JZTA 4LMWA 2HT9A 3KH9A 4NAXA 1K0AA 3ZYWA 3FMWA 3D4TA 4PNGA 1A8LA 4V1Ag 4DSRA 2YJHA 5CRGA 1DE2A 1T4ZA 3TJBA 2K9FA 2WW3A 3GMFA 4ZBDA 3KTLA 2C0FA 4MJAA 5D9VA 4OO4A 1AUCA 2WW2A 3CRTA 5IOWA 3CRUA 2FCHA 1XWAA 1JZRA 2NBSA 4AJ6A 3VI7A 4TW5A 5H5SA 4AKGA 5G5EA 2GS3A 1GNWA 2LRCA 4Q5QA 2MYGA 1JLWA 4PI0C 5IMDA 3UARA 2MBTA 1YDKA 2FA4A 2H30A 4KH7A 1A23A 1S3DA 1Z6NA 4USSA 2HI7A 4OO5A 4YAPA 5CYYA 2EIQA 5HR2A 4DSSA 4CW9A 4K1FA 4TN8A 2V2GA 1SK1A 3RAZA 4I8BA 2H0GA 1U87A 1F37A 5B8BA 1TRVA 1ILOA 1X9MB 3A2VA 2H73A 5HFGA 2KHPA 2HYXA 3HD5A 5IMAA 3C71A 3ZRDA 1GH2A 4EF0A 1JZOA 4MZBA 1GSUA 4KCEA 1Z3EA 4V2NA 3ME7A 2CVDA 1ERTA 2JACA 1K0NA 3TUEA 3FK8A 1ZMAA 4WR5A 3ISOA 3M3MA 3EYTA 3L9SA 2VCVA 2V41A 4K2DA 1FVKA 3VURA 4IQ1A 1URMA 3QOUA 1ST9A 3GTUA 1WJKA 2KUCA 1A2MA 2CQ9A 1ABAA 5B6MA 2OACA 2JZSA 1S4BP 1KTEA 5ECPB 2B5YA 1DE1A 3F4TA 2HQTA 1JFUA 1AQWA 2H6ZA 4XCSA 5DCGA 1ZOFA 1QUWA 4EDYA 2LNTA 1EP8A 3APSA 4ZL9A 2I1UA 1RK4A 5IQYA 5JWOB 1VF2A 3TOTA 3GURA 5FHIA 5G5FA 2FUG2 2C1YA 3Q18A 4JBBA 4ML1A 3IV4A 5EL8A 5D9TA 4TRXA 3GSSA 2VUPA 5DDLA 1YY7A 1TK0B 2X8HA 6GSYA 2A2PA 1SENA 1Q4JA 3GYKA 2B7JA 2RIIA 2PUKC 4HQZA 4TVEA 1S3RA 1PX6A 1B4QA 1FOVA 4K6XA 4KB3A 1FAAA 1O7UA 2IFQA 1X0RA 2WW0A 2M72A 1V2AA 4KSOA 1SVMA 1JZDA 1JLVA 4PQ1A 1DUGA 3TRXA 1XWGA 4XS1A 1W4VA 3IPZA 1MD4A 4BVYB 2V6OA 5D9WA 1AIUA 1WOUA 4K2XA 4K9ZA 2C0DA 3PGTA 1SL2B 4MDCA 4O7HA 2GDRA 3FRCA 2JSZA 4V2MA 3ERFA 5JWRB 1U6TA 4F03A 2JADA 4GXZA 3HA9A 2DMMA 1TKDB 3PR8A 1BF5A 3DMLA 3IHGA 2AYTA 4KDXA 3F9UA 4NHWA 1TI3A 3TJGA 3A2WA 3GNJA 1WIKA 1KNGA 2P0GA 4JZQA 5A1NB 2FD3A 3DWVA 2CX4A 3ZIVA 2ZCTA 4X0XA 3CTGA 3ZMLA 5KN3A 2WFCA 3TCOA 2YANA 5GSSA 1XVWA 2DMLA 5A5KA 1VRSD 3J7Yk 3GH9A 2QGVA 4N10A 2XC2A 4L5LA 5F06A 2P31A 5IMCA 4OCEA 2H1LA 16GSA 1ML6A 1A2JA 2VO4A 1A24A 2VL2A 5KOWA 2KP1A 4PTSA 2D2ZA 3EE2A 2FWFA 3F8UA 2OJLA 5ELAA 1E6BA 1TK5B 4AGSA 3DVWA 1O6JA 3KMOA 4I2TA 3IRAA 3VWWA 3FR6A 3E0UA 3ZITA 4RI6A 2GT5A 2JU5A 2PWJA 1K0BA 4XIHA 1NW2A 2K6VA 5KEJA 2BMXA 3U5RE 1Q98A 2B3SA 1M3IA 1MDJA 4GQCA 3A3TA 4LL1B 3CTFA 2H76A 4POBA 2REMA 1EEJA 4POMA 1PA3A 3BCIA 4EIPA 3F3RA 4FQUA 3IK9A 4LMVA 3D6IA 1G6WA 3M0FA 1U88A 4IKHA 4O32A 4TXOB 1Z6MA 5EPFA 1TU8A 3U6VA 4HJ2A 5CRWA 5E59A 4N3ZA 1XVQA 5ECSA 2LRNA 2Z9SA 3TKQA 1OVNA 3O76A 1O85A 5ECRB 2B5XA 1QGVA 1DSBA 4IHUA 3ZL5A 3GSTA 5F05A 2L4QA 1UN2A 2XBQA 2LNSA 4ECBA 5CRHA 2I3YA 4PGTA 5DAKB 3HDCA 2O5VA 2GGTA 5KN2A 1JHBA 2GZYA 1Y1UA 3QFAC 3FZ5A 3LG6A 1QK8A 4IP6A 3M8NA 2HE3A 3FR9A 3EMPA 4IP1A 1THOA 1GTAA 5A4WA 2YV7A 3UVTA 3TU3B 2OBKA 3TRQA 1PSQA 1XFLA 3PPUA 2IMIA 5ECOB 2MMOA 1BYEA 3V1WA 6GSVA 5CRDA 4MPFA 5EVOA 1X9WB 4ZL7A 4O5QA 2VCXA 3US3A 3L9VA 4BVYA 4TKYA 8GSSA 3HXSA 3IOSA 4Z2RA 5A34B 3APOA 4HI7A 3CMIA 1IYHA 1ZYPA 2HSNB 3FYGA 3IC4A 2DC5A 5J40A 1PKZA 5F8BA 4W66A 4EE0A 4G10A 3IC8A 4IJIA 4AF2A 1VGLA 1GSQA 2C3QA 2WZ9A 2MMZA 2LTKA 2ON7A 5IPHA 2X64A 4K5RA 2GZZA 5D96A 5A1NA 3L9UA 4TR4A 4I2UA 1X5CA 3WYWA 2CX3A 4O92A 3IAS2 4JE1A 3M1GA 1GSDA 2VCZA 5G1KA 2L4CA 1PN9A 2HZEA 2IMEA 4ECIA 1G7OA 5ECIB 4CY6A 3IBHA 4ACSA 2K18A 1T7PB 5G31A 3N9JA 3BJ5A 3BBYA 1XOBA 4AJ7A 3H79A 1EWXA 1MEKA 4FH8A 3EVIA 1YF1A 3GA4A 1MDIA 5AISA 3HMJG 4GDFA 2GQLA 1TOFA 4QMKA 4L5OA 1BG1A 5IO0A 4K0GA 2HRAA 4ECCA 2GSTA 1GSSA 3E9JB 4XHMA 4E8EA 5HR3A 2N5FA 1BX9A 1SK0A 3IE3A 5JCGA 5COHA 2B6MA 2AJQB 4KUNA 1SYRA 1SKSB 4FIWA 4HQSA 4LL4B 3EPTA 4WETA 1RW1A 2H66A 3M9JA 3TJKA 1PQNA 2OBIA 3LYPA 1J0FA 3WT1A 1TXXA 1XWCA 1FG4A 3ERGA 1GUKA 2YOIA 1H75A 5DBQA 4G9HA 1N25A 4FO5A 4HU9A 4RI7A 3O6TA 4MMMA 3DYRA 3F0IA 1TU7A 4F0CA 5IMZA 1NHOA 1BJXA 4YQVA 4D73A 3D5JA 4GWRA 1LBKA 3RPNA 3PH9A 4IS0A 3IHQA 4MK3A 2DLXA 3LXZA 4EUYA 5A4UA 5C04A 5HQPA 1OYJA 2CV4A 1YEXA 3F6FA 1GSFA 2F3MA 1X5DA 3RGBC 3KP8A 4QL9A 3P7XA 1FO5A 4OFTA 4V1Ap 4J2FA 3RDWA 4IN0A 12GSA 2VCQA 1U3AA 1XOAA 2GQKA 3KJYA 3VFIA 4F82A 5D8IA 4MABA 3TKSE 4EXJA 5LCZA 2IWTA 2IMDA 2YJ7A 1G7EA 4MF6A 4O5RA 1GP1A 2EFHA 1TJDA 4PURA 3EWLA 2H0IA 1EGRA 4G0IA 3A5IA 2HRNA 2CAIA 3CSJA 3MWHA 2B7KA 1K0OA 3FEUA 3TJJA 2MZCA 1UC7A 1WMJA 3IA1A 1BEDA 2TRXA 2LJAA 3UAPA 1SKWB 5A4VA 4EL1A 3HVVA 5ECKB 1OE8A 2GQMA 3QFBC 2QKEA 4GLTA 2F51A 3LEFA 2LV3A 2V32A 3F3QA 4OFMA 5AIVA 5FWGA 2FNOA 3P90A 2PVOC 1EV9A 4MNNA 1K3YA 5DJLA 4HZ2A 2H0HA 4TR1A 2G2QA 3C7MA 1QFNA 3D22A 2HRKA 3TKSA 2HSMA 2DBCA 4F2IA 4WXTA 1XG8A 1YZXA 3LFLA 3FR3A 1TP9A 2FY6A 3HVXA 4KCAA 1USBA 2H72A 2DSAA 4GRFA 2DIYA 1YJ6A 1BQ7A 3H93A 3F4SA 4NV5A 3MNGA 3TB2A 5HFIA 5GSTA 1M2AA 1Z5YE 1MD3A 3GUSA 2WW1A 3UVHA 2C3TA 3CSIA 4MF5A 5CAXA 3G7IA 1ZYNA 5ELGA 3ZREA 2FA8A 1R4WA 4JR6A 1I9DA 4K5SA 2VOCA 1OAZA 3F6DA 3Q6OA 3LSZA 3ZIJA 1VF3A 1F6MC 2UV8G 2P5QA 2VL3A 2A4HA 2LRTA 1XXUA 5LD0A 3BCKA 19GSA 2KOKA 1EOGA 3RHCA 2IPAA 1ERWA 1V57A 2GT6A 1WRYA 4YQMA 4GTUA 4G0LA 1QQ2A 1S3AA 4WBRD 1ZYQB 1SJIA 2C3NA 1B9YC 4AKHA 4NPBA 4RQRA 2RUFA 4BIKA 2VL2C 3GKXA 2EFDA 2NDOA 5BMUB 1SJ6A 4WKWA 5ID2A 2DJJA 2VAFA 3G7JA 1VF1A 2H1BA 5ECMB 3ZFBA 4ISDA 2H01A 3GHAA 1Y6EA 4ECJA 1YVLA 1F9MA 1TRUA 3KCMA 4MLYA 4IGJA 3L4NA 2VM1A 3KTBA 2E2MA 5IIZA 2UZ8A 4Q5NA 1I5GA 4I6XA 1A0FA 2X4AA 4MZCA 2PPTA 5DALB 1K0DA 1EP7A 2LJKA 1V9WA 4X43A 4LLRA 4NHZA 1R5PA 4MJCA 1M0UA 1E2YA 3ED3A 4V2LA 2H71A 1TW9A 1ZGNA 2OA7A 3TGZA 2PVQA 4TOPA 4N0VA 4PUAA 1G6YA 3VWVA 3VWUA 2NPBA 4KW6A 1XBSA 1B48A 4Z7XA 2L59A 3SWLA 4ZL8A 1PFOA 2H6XA 5CO3A 2EFEA 3J7Yb 3IXRA 3P8WA 1AXDA 4TR3A 2L5OA 5G1LA 4MF7A 4PX1A 4MJBA 2X49A 4L8EA 5JWQB
chains in the Genus database with same CATH topology
4EDZA 2VD1A 2TRCP 1XZOA 3VPQA 2PU9C 1YKCA 3M9KA 2AV4A 1ON4A 2X8CA 3EMXA 1XWKA 1WWJA 2YNXA 1MTCA 1RQMA 2FWEA 4WEYA 4TR0A 4HUAA 1R26A 4LA1A 1MDKA 4ZBAA 5IM9A 5B6NA 5J5NA 1O8WA 3KH7A 3Q19A 4ZILA 2YP6A 3P2AA 4FYCA 1ZYEA 2LQQA 3WGXA 1J08A 2EIRA 3IDVA 1T4YA 3HYPA 4XS4B 3ZTLA 3APQA 1SYXA 7GSSA 4HS1A 3BOAA 4RUVA 3HY2A 4F0BA 3GX0A 4PUFC 1QXHA 4CDOA 2CAQA 1PRXA 1HNAA 3HZ8A 1T3BA 1ZCPA 1U3IA 2CT6A 2YZHA 1F3BA 2V6KA 2MBSA 2I81A 6GSTA 1EZKA 4EIQA 1SJZA 1J9BA 3KD0A 2IL3A 3F4RA 5J9CA 2XBIA 1V58A 5ABRA 1UA5A 1SL0B 4Z2UA 3MYDA 3IR4A 4BWSA 2C4JA 3D4MA 3KMNA 4IW9A 2WRTA 4XTSA 1WPIA 3GH6A 2VIMA 1WE0A 2HNLA 3VWXA 4YQUA 3OR5A 5J9BA 4X4JA 3DKSA 3FKFA 2BJXA 1YQ1A 1XW9A 4GQFA 22GSA 3TJFA 3HVSA 2VLUA 4FYUA 4DEJA 4PXOA 1GTIA 1OC3A 1BAYA 4ML6A 3N5OA 3TKPA 5JCWA 3ERWA 1CQHA 4WBJA 5IPGA 2AAWA 4DSQA 4L0UA 1TI1A 5BMUA 2YZUA 4ZB7A 2AUVA 3UEMA 2R0GA 1TDIA 4IQAA 3QAWA 2R0PA 2YWOA 4K8MA 5GZZB 2IJYA 3C1RA 5F07A 3LJRA 5LNKe 1YF0A 2KP2A 2FWHA 3HKRA 2DJ1A 2YPMA 1AW9A 4HEA2 2ON5A 2QSIA 3HJPA 1BG5A 2E7PA 1GLPA 2DJKA 4RQXA 2K8VA 3UBLA 1TRSA 3CBUA 6GSUA 11GSA 2DJ0A 2L6DA 1F3AA 1N2AA 2V1MA 1PL2A 4N0ZA 1O8XA 5ECHB 2PN8A 2YWIA 2C0EA 2IIYA 2H70A 3ME8A 3I6AA 1R7HA 1TTZA 4AKXB 5GAND 4E8HA 2MMNA 3R3EA 2WULA 5J3RA 2NTOA 1XW6A 1A2LA 1DBYA 5CREA 3DXBA 2IMFA 2R0CA 3G7YA 3GIXA 13GSA 4K0NA 4NWYA 2WDUA 1THXA 2R6KA 4K7NA 3ZVJA 4AJ8A 1TXUA 4OCFA 5ECLB 2IFQB 1TRWA 2O85A 3QD9A 2G0FA 3AY8A 3WD6A 2B1KA 1GSYA 3KM6A 5C00A 3W6GA 3DEXA 2DIZA 1IYIA 3FHKA 4J56E 1SU9A 4FYBA 1EEMA 3MIXA 3TDGA 2OADA 3MAKA 4ZIJA 4YAVA 5JCUA 3DGQA 4TXOA 3KEBA 3GRXA 3S9FA 2PGTA 1K0MA 2GLRA 2R3XA 5A5HB 4XRAA 4PQHA 3LXTA 1GUHA 3LGCA 4XS4A 4TXVA 4KGIA 4BA7A 3CSHA 5DAKA 2DKHA 2VCTA 4GCIA 2A2SA 4OWYA 2QA1A 2DJ3A 2LKUA 3FZ9A 1ACVA 3QPMA 5J41A 4H86A 5F0GA 4KE3A 2O8VB 4MH2A 2FGXA 2TIRA 3ZZXA 3SBCA 5BRTA 3A5WA 2RLIA 2I9HA 3C73A 4YKGA 4NMUA 1GRXA 2IN3A 1SL1B 4KAEA 4MP4A 2H1AA 3W8SA 1XWBA 4JEDA 4EVMA 3KGKA 3TKSC 3EURA 1PX7A 3CYNA 2PERA 3GV1A 3QCPA 4E68A 4PQIA 4KF9A 5A34A 5G30A 3EU3A 1XCCA 4N11A 4YH2A 2HSNA 4JR4A 3KXOA 6GSXA 3NZNA 1LJRA 5HFKA 3UBKA 4EC0A 4NV2A 2F8AA 3GX8A 3ZFLA 4Q5FA 2R2JA 3KP9A 2HSHA 2YWNA 2VKZG 1O81A 1HNBA 1PMTA 4BL7B 2JL4A 1EGOA 1GLQA 3KZQA 5IMVA 1SK2A 9GSSA 3D0ZA 2R4VA 2WJUA 2OE0A 2FHEA 1PL1A 4PNFA 5KN1A 1KBNA 1M9BA 2BTOT 3VI5A 1AAZA 3TKRA 5G2ZA 3LW9A 1R5AA 3EC3A 3EU4A 3FZ4A 4QQ7A 2H19A 4WF5A 4XS6A 5HR0A 2KLXA 1SD9A 4K7OA 4HOJA 4KDYA 3R2QA 4GSNA 1FW1A 1K3OA 4ILFA 3GN3A 3MSZA 2HFDA 5ENUA 3L78A 3G9BA 3MDKA 2GSSA 4KSMA 1OE7A 5B7CA 5ECQB 2O7KA 4K7IA 2RM5A 3TOUA 2LUSA 4Q5RA 2CVKA 3LQ7A 3RPPA 1FB6A 2A2RA 4HZ4A 2E2GA 2B5EA 1PGTA 3UMAA 2N5AA 2M80A 1M7TA 2M46A 5J4YA 1LU4A 4O5UA 2DKIA 2A4VA 4KNDA 5IO2A 1EV4A 2WS2A 5B8AA 1X5EA 1A8YA 2WGRA 4POLA 2OKAA 3H4KA 4CY8A 2WCIA 3GKMA 2AB6A 4GSSA 4IVFA 4WF4A 1WP0A 4AKIA 4ZBBA 2NVLA 3CWGA 3RBTA 1B4PA 2E0QA 3GL3A 5DJMA 3DIEA 3FW2A 1VF4A 2P5RA 5D9XA 14GSA 4QL7A 2HXKA 1OC9B 4ZXGA 2F8FA 4GSTA 1OC8A 1O73A 2OE3A 5A5HA 4EO3A 5CP1A 2ZUPA 2YCDA 2PBJA 3LYKA 2ES7A 3H1NA 1FOHA 2HZFA 3HJOA 1T8EB 5H5RA 2C8UA 2X99A 2L6CA 4F9ZA 2H1GA 5ECNB 4IELA 2LQOA 1GUMA 2EIOA 2VLVA 5IOXA 1XIYA 1CQGA 2HZEB 1Y25A 1ERUA 2J23A 3K8NA 5E4WA 4L0WA 2FLSA 1YEPA 2L5LA 1QMVA 3WGDA 4MZWA 3LWAA 1X9SB 5HR1A 3H8QA 4IJ3A 5L71A 3L0HA 4ZB6A 4JU5A 3GL5A 2H8LA 1M99A 1F2EA 2LSTA 1AQVA 3E3EA 4BVXB 5J4VA 1GSEA 1SVLA 2JSYA 2R37A 3DRNA 3WGEA 2XHFA 2GVPA 4CHSA 3RHBA 1PN0A 3O3TA 2H1DA 4WR4A 3A2XA 2AHEA 1H4OA 2DJ2A 2K8SA 1V40A 1NSWA 5KN0A 3QR6A 4JRRA 1JZWA 4BL7A 3DD3A 1XW5A 2XPEA 4POKA 2I4AA 4OMVA 3C8EA 1S3CA 2C80A 17GSA 1HD2A 2CA8A 2LJRA 3F63A 2O87A 2CVBA 3WT2A 3BD2A 2YN1A 2X8GA 2YV9A 5FT3A 2EFCA 4ZB9A 4G0KA 4A5PA 5DVBA 2PMTA 3QAVA 2YWMA 1HYUA 4D73B 2RUEA 3NIVA 4ICYA 2L57A 4N30A 1TK8B 2QA2A 2H6YA 1NHYA 4MJEA 4ULXA 3UIWA 3D21A 2OE1A 2CZ2A 1KEBA 2VLTA 4G2EA 1UVZA 1YKAA 18GSA 5DQYA 2MMAA 1OKDA 2JZRA 6GSSA 3GKKA 5J4UA 3I9V2 1N8JA 1Z7RA 4G19A 6GSWA 10GSA 3HCZA 4P3YB 1GTUA 4MA9A 2GZPA 1K3LA 2HSYA 3ZMKA 2B1LA 2R5GA 2LEGA 2VD0A 4DSSB 1M2DA 3LORA 20GSA 4YKFA 3GKNA 1ZZYA 2O89A 3NOFA 3IK7A 3ZVJD 2GSRA 1NM3A 1K0CA 5GAPD 5J47A 1HQOA 1B9XC 2J9HA 2EC4A 5DCHA 1OKTA 2XPDA 3Q74A 4ID0A 1PD21 1OC9A 1GNEA 2N5BA 1FVJA 1SVOA 4ZB8A 2H75A 3QDNA 1T1VA 2OT3A 1W89A 5EY6A 4NXIA 3I69A 2QC7A 3W8JA 3HHVA 3GTUB 1HNCA 3JCML 4I97A 3QAGA 2LS5A 1PKWA 3HZ4A 5DALA 2C0GA 3TRPA 3HJMA 5AIXA 5INYA 4TR1B 3UOMA 2H74A 1M2BA 4GF0A 4I5QA 1FB0A 2HRKB 1GTBA 2WB9A 2HSMB 5CNWA 4XRDA 2VCWA 4X1UA 3UL3A 3EINA 4BWQA 4J57E 3VLNA 5D93A 1FHEA 4MPGA 3QMXA 4HJMA 4HU7A 4HDEA 5D73A 3IAM2 2ALBA 3UJ1A 3DVXA 2VM2A 1V98A 5H5QA 2HRFA 3KIJA 4EKZA 1GL8A 4IBPA 2VL9A 3GFKA 1XPVA 4DVCA 1ZL9A 4KX4A 3VPTA 1Z9HA 5AGYA 2GTUA 1ERVA 5AN1A 1C72A 2GSQA 2CZ3A 1GWCA 1SD8A 4MCUA 3FY7A 4BVXA 5KOXA 1M9AA 3ZLPA 4AI6A 4KA0A 4OD7A 4MH3A 1AC1A 1A0RP 3PINA 1B8XA 5DQSA 2ZNMA 3I43A 3CXGA 4KDUA 2FWGA 1GULA 4G01A 2IMKA 1G0TA 1AQXA 2HLSA 3C1SA 4Z2TA 4BPYA 1T00A 1EOHA 1Z7PA 4OFNA 1SKRB 3FZAA 2RM6A 5IMFA 5ID2B 2F9SA 3VK9A 2JZTA 4LMWA 2HT9A 3KH9A 4NAXA 1K0AA 3ZYWA 3FMWA 3D4TA 4PNGA 1A8LA 4V1Ag 4DSRA 2YJHA 5CRGA 1DE2A 1T4ZA 3TJBA 2K9FA 3GMFA 4ZBDA 3KTLA 2C0FA 4MJAA 5D9VA 4OO4A 1AUCA 3CRTA 5IOWA 3CRUA 2FCHA 1XWAA 1JZRA 2NBSA 4AJ6A 3VI7A 4TW5A 5H5SA 4AKGA 5G5EA 2GS3A 1GNWA 2LRCA 4Q5QA 2MYGA 1JLWA 5IMDA 3UARA 2MBTA 1YDKA 2FA4A 2H30A 4KH7A 1A23A 1S3DA 1Z6NA 4USSA 2HI7A 4OO5A 4YAPA 5CYYA 2EIQA 5HR2A 4DSSA 4CW9A 4K1FA 4TN8A 2V2GA 1SK1A 3RAZA 4I8BA 2H0GA 1U87A 1F37A 5B8BA 1TRVA 1ILOA 1X9MB 3A2VA 2H73A 5HFGA 2KHPA 2HYXA 3HD5A 5IMAA 3C71A 3ZRDA 1GH2A 4EF0A 1JZOA 4MZBA 1GSUA 4KCEA 1Z3EA 4V2NA 3ME7A 2CVDA 1ERTA 2JACA 1K0NA 3TUEA 3FK8A 1ZMAA 4WR5A 3ISOA 3M3MA 3EYTA 3L9SA 2VCVA 2V41A 4K2DA 1FVKA 3VURA 4IQ1A 1URMA 3QOUA 1ST9A 3GTUA 1WJKA 2KUCA 1A2MA 2CQ9A 1ABAA 5B6MA 2OACA 2JZSA 1KTEA 5ECPB 2B5YA 1DE1A 3F4TA 2HQTA 1JFUA 1AQWA 2H6ZA 4XCSA 5DCGA 1ZOFA 1QUWA 4EDYA 2LNTA 1EP8A 3APSA 4ZL9A 2I1UA 1RK4A 5IQYA 5JWOB 1VF2A 3TOTA 3GURA 5FHIA 5G5FA 2FUG2 2C1YA 3Q18A 4JBBA 4ML1A 3IV4A 5EL8A 5D9TA 4TRXA 3GSSA 2VUPA 5DDLA 1YY7A 1TK0B 2X8HA 6GSYA 2A2PA 1SENA 1Q4JA 3GYKA 2B7JA 2RIIA 2PUKC 4HQZA 4TVEA 1PX6A 1B4QA 1FOVA 4K6XA 4KB3A 1FAAA 1O7UA 2IFQA 1X0RA 2M72A 1V2AA 4KSOA 1SVMA 1JZDA 1JLVA 4PQ1A 1DUGA 3TRXA 1XWGA 4XS1A 1W4VA 3IPZA 1MD4A 4BVYB 2V6OA 5D9WA 1AIUA 1WOUA 4K2XA 4K9ZA 2C0DA 3PGTA 1SL2B 4MDCA 4O7HA 2GDRA 3FRCA 2JSZA 4V2MA 3ERFA 5JWRB 1U6TA 4F03A 2JADA 4GXZA 3HA9A 2DMMA 1TKDB 3PR8A 1BF5A 3DMLA 3IHGA 2AYTA 4KDXA 3F9UA 4NHWA 1TI3A 3TJGA 3A2WA 3GNJA 1WIKA 1KNGA 2P0GA 4JZQA 5A1NB 2FD3A 3DWVA 2CX4A 3ZIVA 2ZCTA 4X0XA 3CTGA 3ZMLA 5KN3A 2WFCA 3TCOA 2YANA 5GSSA 1XVWA 2DMLA 5A5KA 1VRSD 3J7Yk 3GH9A 2QGVA 4N10A 2XC2A 4L5LA 5F06A 2P31A 5IMCA 4OCEA 2H1LA 16GSA 1ML6A 1A2JA 2VO4A 1A24A 2VL2A 5KOWA 2KP1A 4PTSA 2D2ZA 3EE2A 2FWFA 3F8UA 2OJLA 5ELAA 1E6BA 1TK5B 4AGSA 3DVWA 1O6JA 3KMOA 4I2TA 3IRAA 3VWWA 3FR6A 3E0UA 3ZITA 4RI6A 2GT5A 2JU5A 2PWJA 1K0BA 4XIHA 1NW2A 2K6VA 5KEJA 2BMXA 3U5RE 1Q98A 2B3SA 1MDJA 4GQCA 3A3TA 4LL1B 3CTFA 2H76A 4POBA 2REMA 1EEJA 4POMA 1PA3A 3BCIA 4EIPA 3F3RA 4FQUA 3IK9A 4LMVA 3D6IA 1G6WA 3M0FA 1U88A 4IKHA 4O32A 4TXOB 1Z6MA 5EPFA 1TU8A 3U6VA 4HJ2A 5CRWA 5E59A 4N3ZA 1XVQA 5ECSA 2LRNA 2Z9SA 3TKQA 1OVNA 3O76A 1O85A 5ECRB 2B5XA 1QGVA 1DSBA 4IHUA 3ZL5A 3GSTA 5F05A 2L4QA 1UN2A 2XBQA 2LNSA 4ECBA 5CRHA 2I3YA 4PGTA 5DAKB 3HDCA 2O5VA 2GGTA 5KN2A 1JHBA 2GZYA 1Y1UA 3QFAC 3FZ5A 3LG6A 1QK8A 4IP6A 3M8NA 2HE3A 3FR9A 3EMPA 4IP1A 1THOA 1GTAA 5A4WA 2YV7A 3UVTA 3TU3B 2OBKA 3TRQA 1PSQA 1XFLA 3PPUA 2IMIA 5ECOB 2MMOA 1BYEA 3V1WA 6GSVA 5CRDA 4MPFA 5EVOA 1X9WB 4ZL7A 4O5QA 2VCXA 3US3A 3L9VA 4BVYA 4TKYA 8GSSA 3HXSA 3IOSA 4Z2RA 5A34B 3APOA 4HI7A 3CMIA 1IYHA 1ZYPA 2HSNB 3FYGA 3IC4A 2DC5A 5J40A 1PKZA 5F8BA 4W66A 4EE0A 4G10A 3IC8A 4IJIA 4AF2A 1VGLA 1GSQA 2C3QA 2WZ9A 2MMZA 2LTKA 2ON7A 5IPHA 2X64A 4K5RA 2GZZA 5D96A 5A1NA 3L9UA 4TR4A 4I2UA 1X5CA 3WYWA 2CX3A 4O92A 3IAS2 4JE1A 3M1GA 1GSDA 2VCZA 5G1KA 2L4CA 1PN9A 2HZEA 2IMEA 4ECIA 1G7OA 5ECIB 4CY6A 3IBHA 4ACSA 2K18A 1T7PB 5G31A 3N9JA 3BJ5A 3BBYA 1XOBA 4AJ7A 3H79A 1EWXA 1MEKA 4FH8A 3EVIA 1YF1A 3GA4A 1MDIA 5AISA 3HMJG 4GDFA 2GQLA 1TOFA 4QMKA 4L5OA 1BG1A 5IO0A 4K0GA 2HRAA 4ECCA 2GSTA 1GSSA 3E9JB 4XHMA 4E8EA 5HR3A 2N5FA 1BX9A 1SK0A 3IE3A 5JCGA 5COHA 2B6MA 2AJQB 4KUNA 1SYRA 1SKSB 4FIWA 4HQSA 4LL4B 3EPTA 4WETA 1RW1A 2H66A 3M9JA 3TJKA 1PQNA 2OBIA 3LYPA 1J0FA 3WT1A 1TXXA 1XWCA 1FG4A 3ERGA 1GUKA 2YOIA 1H75A 5DBQA 4G9HA 1N25A 4FO5A 4HU9A 4RI7A 3O6TA 4MMMA 3DYRA 3F0IA 1TU7A 4F0CA 5IMZA 1NHOA 1BJXA 4YQVA 4D73A 3D5JA 4GWRA 1LBKA 3RPNA 3PH9A 4IS0A 3IHQA 4MK3A 2DLXA 3LXZA 4EUYA 5A4UA 5C04A 5HQPA 1OYJA 2CV4A 1YEXA 3F6FA 1GSFA 2F3MA 1X5DA 3KP8A 4QL9A 3P7XA 1FO5A 4OFTA 4V1Ap 4J2FA 3RDWA 4IN0A 12GSA 2VCQA 1U3AA 1XOAA 2GQKA 3KJYA 3VFIA 4F82A 5D8IA 4MABA 3TKSE 4EXJA 5LCZA 2IWTA 2IMDA 2YJ7A 1G7EA 4MF6A 4O5RA 1GP1A 2EFHA 1TJDA 4PURA 3EWLA 2H0IA 1EGRA 4G0IA 3A5IA 2HRNA 2CAIA 3CSJA 3MWHA 2B7KA 1K0OA 3FEUA 3TJJA 2MZCA 1UC7A 1WMJA 3IA1A 1BEDA 2TRXA 2LJAA 3UAPA 1SKWB 5A4VA 4EL1A 3HVVA 5ECKB 1OE8A 2GQMA 3QFBC 2QKEA 4GLTA 2F51A 3LEFA 2LV3A 2V32A 3F3QA 4OFMA 5AIVA 5FWGA 2FNOA 3P90A 2PVOC 1EV9A 4MNNA 1K3YA 5DJLA 4HZ2A 2H0HA 4TR1A 2G2QA 3C7MA 1QFNA 3D22A 2HRKA 3TKSA 2HSMA 2DBCA 4F2IA 4WXTA 1YZXA 3LFLA 3FR3A 1TP9A 2FY6A 3HVXA 4KCAA 1USBA 2H72A 2DSAA 4GRFA 2DIYA 1YJ6A 1BQ7A 3H93A 3F4SA 4NV5A 3MNGA 3TB2A 5HFIA 5GSTA 1M2AA 1Z5YE 1MD3A 3GUSA 3UVHA 2C3TA 3CSIA 4MF5A 5CAXA 3G7IA 1ZYNA 5ELGA 3ZREA 2FA8A 1R4WA 4JR6A 1I9DA 4K5SA 2VOCA 1OAZA 3F6DA 3Q6OA 3LSZA 3ZIJA 1VF3A 1F6MC 2UV8G 2P5QA 2VL3A 2A4HA 2LRTA 1XXUA 5LD0A 3BCKA 19GSA 2KOKA 1EOGA 3RHCA 2IPAA 1ERWA 1V57A 2GT6A 1WRYA 4YQMA 4GTUA 4G0LA 1QQ2A 1S3AA 4WBRD 1ZYQB 1SJIA 2C3NA 1B9YC 4AKHA 4NPBA 4RQRA 2RUFA 2VL2C 3GKXA 2EFDA 2NDOA 5BMUB 1SJ6A 4WKWA 5ID2A 2DJJA 2VAFA 3G7JA 1VF1A 2H1BA 5ECMB 3ZFBA 4ISDA 2H01A 3GHAA 1Y6EA 4ECJA 1YVLA 1F9MA 1TRUA 3KCMA 4MLYA 4IGJA 3L4NA 2VM1A 3KTBA 2E2MA 5IIZA 2UZ8A 4Q5NA 1I5GA 4I6XA 1A0FA 2X4AA 4MZCA 2PPTA 5DALB 1K0DA 1EP7A 2LJKA 1V9WA 4X43A 4LLRA 4NHZA 1R5PA 4MJCA 1M0UA 1E2YA 3ED3A 4V2LA 2H71A 1TW9A 1ZGNA 2OA7A 3TGZA 2PVQA 4TOPA 4N0VA 4PUAA 1G6YA 3VWVA 3VWUA 2NPBA 4KW6A 1XBSA 1B48A 4Z7XA 2L59A 3SWLA 4ZL8A 2H6XA 5CO3A 2EFEA 3J7Yb 3IXRA 3P8WA 1AXDA 4TR3A 2L5OA 5G1LA 4MF7A 4PX1A 4MJBA 2X49A 4L8EA 5JWQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EDZ A;  2VD1 A;  2TRC P;  1XZO A;  3VPQ A;  2PU9 C;  1YKC A;  3M9K A;  2AV4 A;  1ON4 A;  2X8C A;  3EMX A;  1XWK A;  1WWJ A;  2YNX A;  1MTC A;  1RQM A;  2FWE A;  4WEY A;  4TR0 A;  4HUA A;  1R26 A;  4LA1 A;  1MDK A;  4ZBA A;  5IM9 A;  5B6N A;  5J5N A;  1O8W A;  3KH7 A;  3Q19 A;  4ZIL A;  2YP6 A;  3P2A A;  4FYC A;  1ZYE A;  2LQQ A;  3WGX A;  1J08 A;  2EIR A;  3IDV A;  1T4Y A;  3HYP A;  4XS4 B;  3ZTL A;  3APQ A;  1SYX A;  7GSS A;  4HS1 A;  3BOA A;  4RUV A;  3HY2 A;  4F0B A;  3GX0 A;  4PUF C;  1QXH A;  4CDO A;  2CAQ A;  1PRX A;  1HNA A;  3HZ8 A;  1T3B A;  1ZCP A;  1U3I A;  2CT6 A;  2YZH A;  1F3B A;  2V6K A;  2MBS A;  2I81 A;  6GST A;  1EZK A;  1SJZ A;  1J9B A;  3KD0 A;  2IL3 A;  3F4R A;  5J9C A;  2XBI A;  1V58 A;  5ABR A;  1UA5 A;  1SL0 B;  3IR4 A;  4BWS A;  2C4J A;  3D4M A;  3KMN A;  4IW9 A;  2WRT A;  4XTS A;  1WPI A;  3GH6 A;  2VIM A;  1WE0 A;  2HNL A;  3VWX A;  4YQU A;  3OR5 A;  5J9B A;  3DKS A;  3FKF A;  2BJX A;  1YQ1 A;  1XW9 A;  4GQF A;  22GS A;  3TJF A;  3HVS A;  2VLU A;  4FYU A;  4DEJ A;  4PXO A;  1GTI A;  1OC3 A;  1BAY A;  4ML6 A;  3N5O A;  3TKP A;  5JCW A;  3ERW A;  1CQH A;  4WBJ A;  5IPG A;  2AAW A;  4DSQ A;  4L0U A;  1TI1 A;  5BMU A;  2YZU A;  2AUV A;  3UEM A;  1TDI A;  4IQA A;  3QAW A;  2YWO A;  4K8M A;  5GZZ B;  2IJY A;  3C1R A;  5F07 A;  3LJR A;  5LNK e;  1YF0 A;  2KP2 A;  2FWH A;  3HKR A;  2DJ1 A;  2YPM A;  1AW9 A;  4HEA 2;  2ON5 A;  2QSI A;  3HJP A;  1BG5 A;  2E7P A;  1GLP A;  2DJK A;  4RQX A;  2K8V A;  3UBL A;  1TRS A;  3CBU A;  6GSU A;  11GS A;  2DJ0 A;  2L6D A;  1F3A A;  1N2A A;  2V1M A;  1PL2 A;  4N0Z A;  1O8X A;  5ECH B;  2PN8 A;  2YWI A;  2C0E A;  2IIY A;  2H70 A;  3ME8 A;  3I6A A;  1R7H A;  1TTZ A;  5GAN D;  4E8H A;  2MMN A;  3R3E A;  2WUL A;  5J3R A;  2NTO A;  1XW6 A;  1A2L A;  1DBY A;  5CRE A;  3DXB A;  2IMF A;  3G7Y A;  3GIX A;  13GS A;  4K0N A;  4NWY A;  2WDU A;  1THX A;  2R6K A;  4K7N A;  3ZVJ A;  4AJ8 A;  4OCF A;  5ECL B;  2IFQ B;  1TRW A;  2O85 A;  3QD9 A;  2G0F A;  3AY8 A;  3WD6 A;  2B1K A;  1GSY A;  3KM6 A;  5C00 A;  3W6G A;  3DEX A;  2DIZ A;  1IYI A;  3FHK A;  4J56 E;  1SU9 A;  4FYB A;  1EEM A;  3TDG A;  2OAD A;  3MAK A;  4ZIJ A;  4YAV A;  5JCU A;  3DGQ A;  4TXO A;  3KEB A;  3GRX A;  3S9F A;  2PGT A;  1K0M A;  2GLR A;  2R3X A;  4XRA A;  4PQH A;  3LXT A;  1GUH A;  3LGC A;  4XS4 A;  4TXV A;  4KGI A;  4BA7 A;  3CSH A;  5DAK A;  2VCT A;  4GCI A;  2A2S A;  4OWY A;  2DJ3 A;  2LKU A;  3FZ9 A;  1ACV A;  3QPM A;  5J41 A;  4H86 A;  5F0G A;  4KE3 A;  2O8V B;  4MH2 A;  2FGX A;  2TIR A;  3ZZX A;  3SBC A;  3A5W A;  2RLI A;  2I9H A;  3C73 A;  4NMU A;  1GRX A;  2IN3 A;  1SL1 B;  4KAE A;  4MP4 A;  2H1A A;  3W8S A;  1XWB A;  4JED A;  4EVM A;  3KGK A;  3TKS C;  3EUR A;  1PX7 A;  3CYN A;  2PER A;  3GV1 A;  3QCP A;  4PQI A;  4KF9 A;  5G30 A;  3EU3 A;  1XCC A;  4N11 A;  4YH2 A;  4JR4 A;  3KXO A;  6GSX A;  3NZN A;  1LJR A;  5HFK A;  3UBK A;  4EC0 A;  4NV2 A;  2F8A A;  3GX8 A;  3ZFL A;  4Q5F A;  2R2J A;  3KP9 A;  2HSH A;  2YWN A;  1O81 A;  1HNB A;  1PMT A;  4BL7 B;  2JL4 A;  1EGO A;  1GLQ A;  3KZQ A;  5IMV A;  1SK2 A;  9GSS A;  3D0Z A;  2R4V A;  2WJU A;  2OE0 A;  2FHE A;  1PL1 A;  4PNF A;  5KN1 A;  1KBN A;  1M9B A;  2BTO T;  3VI5 A;  1AAZ A;  3TKR A;  5G2Z A;  1R5A A;  3EC3 A;  3EU4 A;  3FZ4 A;  4QQ7 A;  2H19 A;  4WF5 A;  4XS6 A;  5HR0 A;  2KLX A;  1SD9 A;  4K7O A;  4HOJ A;  4KDY A;  3R2Q A;  4GSN A;  1FW1 A;  1K3O A;  4ILF A;  3GN3 A;  3MSZ A;  2HFD A;  5ENU A;  3L78 A;  3G9B A;  3MDK A;  2GSS A;  4KSM A;  1OE7 A;  5B7C A;  5ECQ B;  2O7K A;  4K7I A;  2RM5 A;  3TOU A;  2LUS A;  4Q5R A;  2CVK A;  3LQ7 A;  3RPP A;  1FB6 A;  2A2R A;  4HZ4 A;  2E2G A;  2B5E A;  1PGT A;  3UMA A;  2N5A A;  2M80 A;  1M7T A;  2M46 A;  1LU4 A;  2A4V A;  4KND A;  5IO2 A;  1EV4 A;  2WS2 A;  5B8A A;  1X5E A;  1A8Y A;  2WGR A;  4POL A;  2OKA A;  3H4K A;  2WCI A;  3GKM A;  2AB6 A;  4GSS A;  4IVF A;  4WF4 A;  1WP0 A;  4ZBB A;  2NVL A;  3RBT A;  1B4P A;  2E0Q A;  3GL3 A;  5DJM A;  3DIE A;  3FW2 A;  1VF4 A;  2P5R A;  5D9X A;  14GS A;  4QL7 A;  2HXK A;  1OC9 B;  4ZXG A;  2F8F A;  4GST A;  1OC8 A;  1O73 A;  2OE3 A;  4EO3 A;  5CP1 A;  2ZUP A;  2YCD A;  2PBJ A;  3LYK A;  2ES7 A;  3H1N A;  2HZF A;  3HJO A;  1T8E B;  5H5R A;  2C8U A;  2X99 A;  2L6C A;  4F9Z A;  2H1G A;  5ECN B;  4IEL A;  2LQO A;  1GUM A;  2EIO A;  2VLV A;  5IOX A;  1XIY A;  1CQG A;  2HZE B;  1Y25 A;  1ERU A;  2J23 A;  3K8N A;  5E4W A;  4L0W A;  2FLS A;  1YEP A;  2L5L A;  1QMV A;  3WGD A;  4MZW A;  3LWA A;  1X9S B;  5HR1 A;  3H8Q A;  4IJ3 A;  5L71 A;  3L0H A;  4ZB6 A;  4JU5 A;  3GL5 A;  2H8L A;  1M99 A;  1F2E A;  2LST A;  1AQV A;  3E3E A;  4BVX B;  1GSE A;  2JSY A;  2R37 A;  3DRN A;  3WGE A;  2XHF A;  2GVP A;  4CHS A;  3RHB A;  3O3T A;  2H1D A;  4WR4 A;  3A2X A;  2AHE A;  1H4O A;  2DJ2 A;  2K8S A;  1V40 A;  1NSW A;  5KN0 A;  3QR6 A;  4JRR A;  1JZW A;  4BL7 A;  3DD3 A;  1XW5 A;  2XPE A;  4POK A;  2I4A A;  4OMV A;  3C8E A;  1S3C A;  2C80 A;  17GS A;  1HD2 A;  2CA8 A;  2LJR A;  3F63 A;  2O87 A;  2CVB A;  3WT2 A;  3BD2 A;  2YN1 A;  2X8G A;  2YV9 A;  5FT3 A;  4ZB9 A;  4G0K A;  5DVB A;  2PMT A;  3QAV A;  2YWM A;  1HYU A;  4D73 B;  2RUE A;  3NIV A;  2L57 A;  4N30 A;  1TK8 B;  2H6Y A;  1NHY A;  4MJE A;  4ULX A;  3UIW A;  3D21 A;  2OE1 A;  2CZ2 A;  1KEB A;  2VLT A;  4G2E A;  1UVZ A;  1YKA A;  18GS A;  5DQY A;  2MMA A;  1OKD A;  2JZR A;  6GSS A;  3GKK A;  5J4U A;  3I9V 2;  1N8J A;  1Z7R A;  4G19 A;  6GSW A;  10GS A;  3HCZ A;  4P3Y B;  1GTU A;  4MA9 A;  2GZP A;  1K3L A;  2HSY A;  3ZMK A;  2B1L A;  2R5G A;  2LEG A;  2VD0 A;  4DSS B;  1M2D A;  3LOR A;  20GS A;  3GKN A;  1ZZY A;  2O89 A;  3NOF A;  3IK7 A;  3ZVJ D;  2GSR A;  1NM3 A;  1K0C A;  5GAP D;  1B9X C;  1HQO A;  2J9H A;  2EC4 A;  5DCH A;  1OKT A;  2XPD A;  3Q74 A;  4ID0 A;  1PD2 1;  1OC9 A;  1GNE A;  2N5B A;  1FVJ A;  2H75 A;  4ZB8 A;  3QDN A;  1T1V A;  1W89 A;  5EY6 A;  4NXI A;  3I69 A;  2QC7 A;  3W8J A;  3HHV A;  3GTU B;  1HNC A;  3JCM L;  4I97 A;  3QAG A;  2LS5 A;  1PKW A;  3HZ4 A;  5DAL A;  2C0G A;  3TRP A;  3HJM A;  5AIX A;  5INY A;  4TR1 B;  3UOM A;  2H74 A;  1M2B A;  4GF0 A;  4I5Q A;  1FB0 A;  2HRK B;  1GTB A;  2WB9 A;  2HSM B;  5CNW A;  4XRD A;  2VCW A;  4X1U A;  3UL3 A;  3EIN A;  4BWQ A;  4J57 E;  3VLN A;  5D93 A;  1FHE A;  4MPG A;  3QMX A;  4HJM A;  4HU7 A;  4HDE A;  5D73 A;  3IAM 2;  2ALB A;  3UJ1 A;  3DVX A;  2VM2 A;  1V98 A;  5H5Q A;  2HRF A;  3KIJ A;  4EKZ A;  1GL8 A;  4IBP A;  2VL9 A;  3GFK A;  1XPV A;  4DVC A;  1ZL9 A;  4KX4 A;  3VPT A;  1Z9H A;  5AGY A;  2GTU A;  1ERV A;  5AN1 A;  1C72 A;  2GSQ A;  2CZ3 A;  1GWC A;  1SD8 A;  4MCU A;  3FY7 A;  4BVX A;  1M9A A;  3ZLP A;  4KA0 A;  4OD7 A;  4MH3 A;  1AC1 A;  1A0R P;  3PIN A;  1B8X A;  5DQS A;  2ZNM A;  3I43 A;  3CXG A;  4KDU A;  2FWG A;  1GUL A;  2IMK A;  1G0T A;  1AQX A;  2HLS A;  3C1S A;  4BPY A;  1T00 A;  1EOH A;  1Z7P A;  4OFN A;  1SKR B;  3FZA A;  2RM6 A;  5IMF A;  5ID2 B;  2F9S A;  3VK9 A;  2JZT A;  4LMW A;  2HT9 A;  3KH9 A;  4NAX A;  1K0A A;  3ZYW A;  3D4T A;  4PNG A;  1A8L A;  4V1A g;  4DSR A;  2YJH A;  5CRG A;  1DE2 A;  1T4Z A;  3TJB A;  2K9F A;  3GMF A;  4ZBD A;  3KTL A;  2C0F A;  4MJA A;  5D9V A;  4OO4 A;  1AUC A;  3CRT A;  5IOW A;  3CRU A;  2FCH A;  1XWA A;  1JZR A;  2NBS A;  4AJ6 A;  3VI7 A;  4TW5 A;  5H5S A;  5G5E A;  2GS3 A;  1GNW A;  2LRC A;  4Q5Q A;  2MYG A;  1JLW A;  5IMD A;  3UAR A;  2MBT A;  1YDK A;  2FA4 A;  2H30 A;  4KH7 A;  1A23 A;  1S3D A;  1Z6N A;  4USS A;  2HI7 A;  4OO5 A;  4YAP A;  5CYY A;  2EIQ A;  5HR2 A;  4DSS A;  4CW9 A;  4K1F A;  4TN8 A;  2V2G A;  1SK1 A;  3RAZ A;  4I8B A;  2H0G A;  1U87 A;  1F37 A;  5B8B A;  1TRV A;  1ILO A;  1X9M B;  3A2V A;  2H73 A;  5HFG A;  2KHP A;  2HYX A;  3HD5 A;  5IMA A;  3C71 A;  3ZRD A;  1GH2 A;  4EF0 A;  1JZO A;  4MZB A;  1GSU A;  4KCE A;  1Z3E A;  4V2N A;  3ME7 A;  2CVD A;  1ERT A;  2JAC A;  1K0N A;  3TUE A;  3FK8 A;  1ZMA A;  4WR5 A;  3ISO A;  3M3M A;  3EYT A;  3L9S A;  2VCV A;  2V41 A;  4K2D A;  1FVK A;  3VUR A;  4IQ1 A;  1URM A;  3QOU A;  1ST9 A;  3GTU A;  1WJK A;  2KUC A;  1A2M A;  2CQ9 A;  1ABA A;  5B6M A;  2OAC A;  2JZS A;  1KTE A;  5ECP B;  2B5Y A;  1DE1 A;  3F4T A;  2HQT A;  1JFU A;  1AQW A;  2H6Z A;  4XCS A;  5DCG A;  1ZOF A;  1QUW A;  4EDY A;  2LNT A;  1EP8 A;  3APS A;  4ZL9 A;  2I1U A;  1RK4 A;  5IQY A;  5JWO B;  1VF2 A;  3TOT A;  3GUR A;  5FHI A;  5G5F A;  2FUG 2;  2C1Y A;  3Q18 A;  4JBB A;  4ML1 A;  3IV4 A;  5EL8 A;  5D9T A;  4TRX A;  3GSS A;  2VUP A;  5DDL A;  1YY7 A;  1TK0 B;  2X8H A;  6GSY A;  1SEN A;  1Q4J A;  3GYK A;  2B7J A;  2RII A;  2PUK C;  4HQZ A;  4TVE A;  1PX6 A;  1B4Q A;  1FOV A;  4K6X A;  4KB3 A;  1FAA A;  1O7U A;  2IFQ A;  1X0R A;  2M72 A;  1V2A A;  4KSO A;  1JZD A;  1JLV A;  4PQ1 A;  1DUG A;  3TRX A;  1XWG A;  4XS1 A;  1W4V A;  3IPZ A;  1MD4 A;  4BVY B;  2V6O A;  5D9W A;  1AIU A;  1WOU A;  4K9Z A;  2C0D A;  3PGT A;  1SL2 B;  4MDC A;  4O7H A;  2GDR A;  3FRC A;  2JSZ A;  4V2M A;  3ERF A;  5JWR B;  1U6T A;  4F03 A;  2JAD A;  4GXZ A;  3HA9 A;  2DMM A;  1TKD B;  3PR8 A;  3DML A;  2AYT A;  4KDX A;  3F9U A;  4NHW A;  1TI3 A;  3TJG A;  3A2W A;  3GNJ A;  1WIK A;  1KNG A;  2P0G A;  4JZQ A;  2FD3 A;  3DWV A;  2CX4 A;  3ZIV A;  2ZCT A;  4X0X A;  3CTG A;  3ZML A;  5KN3 A;  2WFC A;  3TCO A;  2YAN A;  5GSS A;  1XVW A;  2DML A;  5A5K A;  1VRS D;  3J7Y k;  3GH9 A;  2QGV A;  4N10 A;  2XC2 A;  4L5L A;  5F06 A;  2P31 A;  5IMC A;  4OCE A;  16GS A;  1ML6 A;  1A2J A;  2VO4 A;  1A24 A;  2VL2 A;  2KP1 A;  4PTS A;  2D2Z A;  3EE2 A;  2FWF A;  3F8U A;  2OJL A;  5ELA A;  1E6B A;  1TK5 B;  4AGS A;  3DVW A;  1O6J A;  3KMO A;  4I2T A;  3IRA A;  3VWW A;  3FR6 A;  3E0U A;  3ZIT A;  4RI6 A;  2GT5 A;  2JU5 A;  2PWJ A;  1K0B A;  4XIH A;  1NW2 A;  2K6V A;  5KEJ A;  2BMX A;  3U5R E;  1Q98 A;  2B3S A;  1MDJ A;  4GQC A;  3A3T A;  4LL1 B;  3CTF A;  2H76 A;  4POB A;  2REM A;  1EEJ A;  4POM A;  1PA3 A;  3BCI A;  3F3R A;  4FQU A;  3IK9 A;  4LMV A;  3D6I A;  1G6W A;  3M0F A;  1U88 A;  4IKH A;  4O32 A;  4TXO B;  1Z6M A;  5EPF A;  1TU8 A;  3U6V A;  4HJ2 A;  5CRW A;  5E59 A;  1XVQ A;  5ECS A;  2LRN A;  2Z9S A;  3TKQ A;  1OVN A;  3O76 A;  1O85 A;  5ECR B;  2B5X A;  1QGV A;  1DSB A;  4IHU A;  3ZL5 A;  3GST A;  5F05 A;  2L4Q A;  1UN2 A;  2XBQ A;  2LNS A;  4ECB A;  5CRH A;  2I3Y A;  4PGT A;  5DAK B;  3HDC A;  2GGT A;  5KN2 A;  1JHB A;  2GZY A;  3QFA C;  3FZ5 A;  3LG6 A;  1QK8 A;  4IP6 A;  3M8N A;  2HE3 A;  3FR9 A;  3EMP A;  4IP1 A;  1THO A;  1GTA A;  5A4W A;  2YV7 A;  3UVT A;  2OBK A;  3TRQ A;  1PSQ A;  1XFL A;  3PPU A;  2IMI A;  5ECO B;  2MMO A;  1BYE A;  3V1W A;  6GSV A;  5CRD A;  4MPF A;  5EVO A;  1X9W B;  4ZL7 A;  2VCX A;  3US3 A;  3L9V A;  4BVY A;  4TKY A;  8GSS A;  3HXS A;  3IOS A;  3APO A;  4HI7 A;  3CMI A;  1IYH A;  2HSN B;  3FYG A;  3IC4 A;  2DC5 A;  1PKZ A;  5F8B A;  4EE0 A;  4G10 A;  3IC8 A;  4IJI A;  4AF2 A;  1VGL A;  1GSQ A;  2C3Q A;  2WZ9 A;  2MMZ A;  2LTK A;  2ON7 A;  5IPH A;  2X64 A;  2GZZ A;  5D96 A;  3L9U A;  4TR4 A;  4I2U A;  1X5C A;  3WYW A;  2CX3 A;  4O92 A;  3IAS 2;  4JE1 A;  3M1G A;  1GSD A;  2VCZ A;  5G1K A;  2L4C A;  1PN9 A;  2HZE A;  2IME A;  4ECI A;  1G7O A;  5ECI B;  3IBH A;  4ACS A;  2K18 A;  1T7P B;  5G31 A;  3N9J A;  3BJ5 A;  3BBY A;  1XOB A;  4AJ7 A;  3H79 A;  1EWX A;  1MEK A;  4FH8 A;  3EVI A;  1YF1 A;  3GA4 A;  1MDI A;  5AIS A;  2GQL A;  1TOF A;  4L5O A;  5IO0 A;  4K0G A;  2HRA A;  4ECC A;  2GST A;  1GSS A;  3E9J B;  4XHM A;  4E8E A;  5HR3 A;  2N5F A;  1BX9 A;  1SK0 A;  3IE3 A;  5JCG A;  5COH A;  2B6M A;  2AJQ B;  4KUN A;  1SYR A;  1SKS B;  4FIW A;  4HQS A;  4LL4 B;  4WET A;  1RW1 A;  2H66 A;  3M9J A;  3TJK A;  1PQN A;  2OBI A;  3LYP A;  1J0F A;  3WT1 A;  1TXX A;  1XWC A;  1FG4 A;  3ERG A;  1GUK A;  2YOI A;  1H75 A;  5DBQ A;  4G9H A;  4FO5 A;  4HU9 A;  4RI7 A;  3O6T A;  4MMM A;  3DYR A;  3F0I A;  1TU7 A;  4F0C A;  5IMZ A;  1NHO A;  1BJX A;  4YQV A;  4D73 A;  3D5J A;  4GWR A;  1LBK A;  3RPN A;  3PH9 A;  4IS0 A;  3IHQ A;  4MK3 A;  2DLX A;  3LXZ A;  4EUY A;  5A4U A;  5C04 A;  5HQP A;  1OYJ A;  2CV4 A;  1YEX A;  3F6F A;  1GSF A;  2F3M A;  1X5D A;  3KP8 A;  4QL9 A;  3P7X A;  1FO5 A;  4OFT A;  4V1A p;  4J2F A;  3RDW A;  4IN0 A;  12GS A;  2VCQ A;  1U3A A;  1XOA A;  2GQK A;  3KJY A;  3VFI A;  4F82 A;  5D8I A;  4MAB A;  3TKS E;  4EXJ A;  5LCZ A;  2IWT A;  2IMD A;  2YJ7 A;  1G7E A;  4MF6 A;  4O5R A;  1GP1 A;  1TJD A;  4PUR A;  3EWL A;  2H0I A;  1EGR A;  4G0I A;  2HRN A;  2CAI A;  3CSJ A;  3MWH A;  2B7K A;  1K0O A;  3FEU A;  3TJJ A;  2MZC A;  1UC7 A;  1WMJ A;  3IA1 A;  1BED A;  2TRX A;  2LJA A;  3UAP A;  1SKW B;  5A4V A;  4EL1 A;  3HVV A;  5ECK B;  1OE8 A;  2GQM A;  3QFB C;  2QKE A;  4GLT A;  2F51 A;  3LEF A;  2LV3 A;  2V32 A;  3F3Q A;  4OFM A;  5AIV A;  5FWG A;  2FNO A;  3P90 A;  2PVO C;  1EV9 A;  1K3Y A;  5DJL A;  4HZ2 A;  2H0H A;  4TR1 A;  2G2Q A;  3C7M A;  1QFN A;  3D22 A;  2HRK A;  3TKS A;  2HSM A;  2DBC A;  4F2I A;  4WXT A;  1YZX A;  3LFL A;  3FR3 A;  1TP9 A;  2FY6 A;  3HVX A;  4KCA A;  1USB A;  2H72 A;  2DSA A;  4GRF A;  2DIY A;  1YJ6 A;  1BQ7 A;  3H93 A;  3F4S A;  4NV5 A;  3MNG A;  3TB2 A;  5HFI A;  5GST A;  1M2A A;  1Z5Y E;  1MD3 A;  3GUS A;  3UVH A;  2C3T A;  3CSI A;  4MF5 A;  5CAX A;  3G7I A;  5ELG A;  3ZRE A;  2FA8 A;  1R4W A;  4JR6 A;  1I9D A;  2VOC A;  1OAZ A;  3F6D A;  3Q6O A;  3LSZ A;  3ZIJ A;  1VF3 A;  1F6M C;  2P5Q A;  2VL3 A;  2LRT A;  1XXU A;  5LD0 A;  3BCK A;  19GS A;  2KOK A;  1EOG A;  3RHC A;  2IPA A;  1ERW A;  1V57 A;  2GT6 A;  1WRY A;  4YQM A;  4GTU A;  4G0L A;  1QQ2 A;  1S3A A;  4WBR D;  1ZYQ B;  1SJI A;  2C3N A;  1B9Y C;  4NPB A;  4RQR A;  2RUF A;  2VL2 C;  3GKX A;  2NDO A;  1SJ6 A;  4WKW A;  5ID2 A;  2DJJ A;  2VAF A;  3G7J A;  1VF1 A;  2H1B A;  5ECM B;  3ZFB A;  4ISD A;  2H01 A;  3GHA A;  1Y6E A;  4ECJ A;  1F9M A;  1TRU A;  3KCM A;  4MLY A;  4IGJ A;  3L4N A;  2VM1 A;  3KTB A;  2E2M A;  5IIZ A;  2UZ8 A;  4Q5N A;  1I5G A;  4I6X A;  1A0F A;  4MZC A;  2PPT A;  5DAL B;  1K0D A;  1EP7 A;  2LJK A;  1V9W A;  4X43 A;  4LLR A;  4NHZ A;  1R5P A;  4MJC A;  1M0U A;  1E2Y A;  3ED3 A;  4V2L A;  2H71 A;  1TW9 A;  1ZGN A;  2OA7 A;  3TGZ A;  2PVQ A;  4TOP A;  4N0V A;  4PUA A;  1G6Y A;  3VWV A;  3VWU A;  2NPB A;  4KW6 A;  1XBS A;  1B48 A;  4Z7X A;  2L59 A;  3SWL A;  4ZL8 A;  2H6X A;  5CO3 A;  3J7Y b;  3IXR A;  3P8W A;  1AXD A;  4TR3 A;  2L5O A;  5G1L A;  4MF7 A;  4PX1 A;  4MJB A;  4L8E A;  5JWQ B; 
#chains in the Genus database with same CATH topology
 4EDZ A;  2VD1 A;  2TRC P;  1XZO A;  3VPQ A;  2PU9 C;  1YKC A;  3M9K A;  2AV4 A;  1ON4 A;  2X8C A;  3EMX A;  1XWK A;  1WWJ A;  2YNX A;  1MTC A;  1RQM A;  2FWE A;  4WEY A;  4TR0 A;  4HUA A;  1R26 A;  4LA1 A;  1MDK A;  4ZBA A;  5IM9 A;  5B6N A;  5J5N A;  1O8W A;  3KH7 A;  3Q19 A;  4ZIL A;  2YP6 A;  3P2A A;  4FYC A;  1ZYE A;  2LQQ A;  3WGX A;  1J08 A;  2EIR A;  3IDV A;  1T4Y A;  3HYP A;  4XS4 B;  3ZTL A;  3APQ A;  1SYX A;  7GSS A;  4HS1 A;  3BOA A;  4RUV A;  3HY2 A;  4F0B A;  3GX0 A;  4PUF C;  1QXH A;  4PI2 C;  4CDO A;  2CAQ A;  1PRX A;  1HNA A;  3HZ8 A;  1T3B A;  1ZCP A;  1U3I A;  2CT6 A;  2YZH A;  1F3B A;  2V6K A;  2MBS A;  2I81 A;  6GST A;  1EZK A;  4EIQ A;  1SJZ A;  1J9B A;  3KD0 A;  2IL3 A;  3F4R A;  5J9C A;  2XBI A;  1V58 A;  5ABR A;  1UA5 A;  1SL0 B;  4Z2U A;  3MYD A;  3IR4 A;  4BWS A;  2C4J A;  3D4M A;  3KMN A;  4IW9 A;  2WRT A;  4XTS A;  1WPI A;  3GH6 A;  2VIM A;  1WE0 A;  2HNL A;  3VWX A;  4YQU A;  3OR5 A;  5J9B A;  4X4J A;  3DKS A;  3FKF A;  2BJX A;  1YQ1 A;  1XW9 A;  4GQF A;  22GS A;  3TJF A;  3HVS A;  2VLU A;  4FYU A;  4DEJ A;  4PXO A;  1GTI A;  1OC3 A;  1BAY A;  4ML6 A;  3N5O A;  4FXY P;  3TKP A;  5JCW A;  3ERW A;  1CQH A;  4WBJ A;  5IPG A;  2AAW A;  4DSQ A;  4L0U A;  1TI1 A;  5BMU A;  2YZU A;  4ZB7 A;  2AUV A;  3UEM A;  2R0G A;  1TDI A;  4IQA A;  3QAW A;  2R0P A;  2YWO A;  4K8M A;  5GZZ B;  2IJY A;  3C1R A;  5F07 A;  3LJR A;  5LNK e;  1YF0 A;  2KP2 A;  2FWH A;  3HKR A;  2DJ1 A;  2YPM A;  1AW9 A;  4HEA 2;  2ON5 A;  2QSI A;  3HJP A;  1BG5 A;  2E7P A;  1GLP A;  2DJK A;  4RQX A;  2K8V A;  3UBL A;  1TRS A;  3CBU A;  6GSU A;  11GS A;  2DJ0 A;  2L6D A;  1F3A A;  1N2A A;  2V1M A;  1PL2 A;  4N0Z A;  1O8X A;  5ECH B;  2PN8 A;  2YWI A;  2C0E A;  2IIY A;  2H70 A;  3ME8 A;  3I6A A;  4PHZ C;  1R7H A;  1TTZ A;  4AKX B;  5GAN D;  4E8H A;  2MMN A;  3R3E A;  2WUL A;  5J3R A;  2NTO A;  1XW6 A;  1A2L A;  1DBY A;  5CRE A;  3DXB A;  2IMF A;  2R0C A;  3G7Y A;  3GIX A;  13GS A;  4K0N A;  4NWY A;  2WDU A;  1THX A;  2R6K A;  4K7N A;  3ZVJ A;  4AJ8 A;  1TXU A;  4OCF A;  5ECL B;  2IFQ B;  1TRW A;  2O85 A;  3QD9 A;  2G0F A;  3AY8 A;  3WD6 A;  2B1K A;  1GSY A;  3KM6 A;  5C00 A;  3W6G A;  3DEX A;  2DIZ A;  1IYI A;  3FHK A;  4J56 E;  1SU9 A;  4FYB A;  1EEM A;  3MIX A;  3TDG A;  2OAD A;  3MAK A;  4ZIJ A;  4YAV A;  5JCU A;  3DGQ A;  4TXO A;  3KEB A;  3GRX A;  3S9F A;  2PGT A;  1K0M A;  2GLR A;  2R3X A;  5A5H B;  4XRA A;  4PQH A;  3LXT A;  1GUH A;  3LGC A;  4XS4 A;  4TXV A;  4KGI A;  4BA7 A;  3CSH A;  5DAK A;  2DKH A;  2VCT A;  4GCI A;  2A2S A;  4OWY A;  2QA1 A;  2DJ3 A;  2LKU A;  3FZ9 A;  1ACV A;  2O3E A;  3QPM A;  5J41 A;  4H86 A;  5F0G A;  4KE3 A;  2O8V B;  4MH2 A;  2FGX A;  2TIR A;  3ZZX A;  3SBC A;  5BRT A;  3A5W A;  2RLI A;  2I9H A;  3C73 A;  4YKG A;  4NMU A;  1GRX A;  2IN3 A;  1SL1 B;  4KAE A;  4MP4 A;  2H1A A;  3W8S A;  1XWB A;  4JED A;  4EVM A;  3KGK A;  3TKS C;  3EUR A;  1PX7 A;  3CYN A;  2PER A;  3GV1 A;  3QCP A;  1M3J A;  4E68 A;  4PQI A;  4KF9 A;  5A34 A;  5G30 A;  3EU3 A;  1XCC A;  4N11 A;  4YH2 A;  2HSN A;  4JR4 A;  3KXO A;  6GSX A;  3NZN A;  1LJR A;  5HFK A;  3UBK A;  4EC0 A;  4NV2 A;  2F8A A;  3GX8 A;  3ZFL A;  4Q5F A;  1I1I P;  2R2J A;  3KP9 A;  2HSH A;  2YWN A;  2VKZ G;  1O81 A;  1HNB A;  1PMT A;  4BL7 B;  2JL4 A;  1EGO A;  1GLQ A;  3KZQ A;  5IMV A;  1SK2 A;  9GSS A;  3D0Z A;  2R4V A;  2WJU A;  2OE0 A;  2FHE A;  1PL1 A;  4PNF A;  5KN1 A;  1KBN A;  1M9B A;  2WVX B;  2BTO T;  3VI5 A;  1AAZ A;  3TKR A;  5G2Z A;  3LW9 A;  1R5A A;  3EC3 A;  3EU4 A;  2WVZ A;  3FZ4 A;  4QQ7 A;  2H19 A;  4WF5 A;  4XS6 A;  5HR0 A;  2KLX A;  1SD9 A;  4K7O A;  4HOJ A;  4KDY A;  3R2Q A;  4GSN A;  1FW1 A;  1K3O A;  4ILF A;  3GN3 A;  4HSC X;  3MSZ A;  2HFD A;  5ENU A;  3L78 A;  3G9B A;  3MDK A;  2GSS A;  4KSM A;  1OE7 A;  5B7C A;  1YEW C;  5ECQ B;  2O7K A;  4K7I A;  2RM5 A;  2WZS A;  3TOU A;  2LUS A;  4Q5R A;  2CVK A;  3LQ7 A;  3RPP A;  1FB6 A;  2A2R A;  4HZ4 A;  2E2G A;  2B5E A;  1PGT A;  3UMA A;  2N5A A;  2M80 A;  1M7T A;  2M46 A;  5J4Y A;  1LU4 A;  4O5U A;  2DKI A;  2A4V A;  4KND A;  5IO2 A;  1EV4 A;  2WS2 A;  5B8A A;  1X5E A;  1A8Y A;  2WGR A;  4POL A;  2OKA A;  3H4K A;  4CY8 A;  2WCI A;  3GKM A;  2AB6 A;  4GSS A;  4IVF A;  4WF4 A;  1WP0 A;  4AKI A;  4ZBB A;  2NVL A;  3CWG A;  3RBT A;  1B4P A;  2E0Q A;  3GL3 A;  5DJM A;  3DIE A;  3FW2 A;  1VF4 A;  2P5R A;  5D9X A;  14GS A;  4QL7 A;  2HXK A;  1OC9 B;  4ZXG A;  2F8F A;  4GST A;  1OC8 A;  1O73 A;  2OE3 A;  5A5H A;  4EO3 A;  5CP1 A;  2ZUP A;  2YCD A;  2PBJ A;  3LYK A;  2ES7 A;  3H1N A;  1FOH A;  2HZF A;  3HJO A;  1T8E B;  5H5R A;  2C8U A;  2X99 A;  2L6C A;  4F9Z A;  2H1G A;  5ECN B;  4IEL A;  2LQO A;  1GUM A;  3CHX C;  2EIO A;  2VLV A;  5IOX A;  1XIY A;  1CQG A;  2HZE B;  1Y25 A;  1ERU A;  2J23 A;  3K8N A;  5E4W A;  4L0W A;  2FLS A;  1YEP A;  2L5L A;  1QMV A;  3WGD A;  4MZW A;  3LWA A;  1X9S B;  5HR1 A;  3H8Q A;  4IJ3 A;  5L71 A;  3L0H A;  4ZB6 A;  4JU5 A;  3GL5 A;  2H8L A;  1M99 A;  1F2E A;  2LST A;  1AQV A;  3E3E A;  4BVX B;  5J4V A;  1GSE A;  1SVL A;  2JSY A;  2R37 A;  3DRN A;  3WGE A;  2XHF A;  2GVP A;  4CHS A;  3RHB A;  1PN0 A;  3O3T A;  2H1D A;  4WR4 A;  3A2X A;  2O36 A;  2AHE A;  1H4O A;  2DJ2 A;  2K8S A;  1V40 A;  1NSW A;  5KN0 A;  3QR6 A;  4JRR A;  1JZW A;  4BL7 A;  3DD3 A;  1XW5 A;  2XPE A;  4POK A;  2I4A A;  4OMV A;  2WVX A;  3CQF A;  3C8E A;  1S3C A;  2C80 A;  17GS A;  1HD2 A;  2CA8 A;  2LJR A;  3F63 A;  2O87 A;  2CVB A;  3WT2 A;  3BD2 A;  2YN1 A;  2X8G A;  2YV9 A;  5FT3 A;  2EFC A;  4ZB9 A;  4G0K A;  4A5P A;  5DVB A;  2PMT A;  3QAV A;  2YWM A;  1HYU A;  4D73 B;  2RUE A;  3NIV A;  4ICY A;  2L57 A;  4N30 A;  1TK8 B;  2QA2 A;  2H6Y A;  3HVN A;  1NHY A;  4MJE A;  4ULX A;  3UIW A;  3D21 A;  2OE1 A;  2CZ2 A;  1KEB A;  2VLT A;  4G2E A;  1UVZ A;  1YKA A;  18GS A;  5DQY A;  2MMA A;  1OKD A;  2JZR A;  6GSS A;  3GKK A;  5J4U A;  3I9V 2;  1N8J A;  1Z7R A;  4G19 A;  6GSW A;  10GS A;  3HCZ A;  4P3Y B;  1GTU A;  4MA9 A;  2GZP A;  1K3L A;  2HSY A;  3ZMK A;  2B1L A;  2R5G A;  2LEG A;  2VD0 A;  4DSS B;  1M2D A;  3RFR C;  3LOR A;  20GS A;  4YKF A;  3GKN A;  1ZZY A;  2O89 A;  3NOF A;  3IK7 A;  3ZVJ D;  2GSR A;  1NM3 A;  1K0C A;  5GAP D;  5J47 A;  1HQO A;  1B9X C;  2J9H A;  2EC4 A;  5DCH A;  1OKT A;  2XPD A;  3Q74 A;  4ID0 A;  1PD2 1;  1OC9 A;  1GNE A;  2N5B A;  1FVJ A;  1SVO A;  4ZB8 A;  2H75 A;  3QDN A;  1T1V A;  2OT3 A;  1W89 A;  5EY6 A;  4NXI A;  3I69 A;  2QC7 A;  3W8J A;  3HHV A;  3GTU B;  1HNC A;  3JCM L;  4I97 A;  3QAG A;  2LS5 A;  1PKW A;  3HZ4 A;  5DAL A;  2C0G A;  3TRP A;  3HJM A;  5AIX A;  5INY A;  4TR1 B;  3UOM A;  2H74 A;  1M2B A;  4GF0 A;  4I5Q A;  1FB0 A;  2HRK B;  1GTB A;  2WB9 A;  2HSM B;  5CNW A;  4XRD A;  2VCW A;  4X1U A;  3UL3 A;  3EIN A;  4BWQ A;  4J57 E;  3VLN A;  5D93 A;  1FHE A;  4MPG A;  3QMX A;  4HJM A;  4HU7 A;  2WVY A;  4HDE A;  5D73 A;  3IAM 2;  2ALB A;  3UJ1 A;  3DVX A;  2VM2 A;  1V98 A;  5H5Q A;  2HRF A;  3KIJ A;  4EKZ A;  1GL8 A;  4IBP A;  2VL9 A;  3GFK A;  1XPV A;  4DVC A;  1ZL9 A;  4KX4 A;  3VPT A;  1Z9H A;  5AGY A;  2GTU A;  1ERV A;  5AN1 A;  1C72 A;  2GSQ A;  2CZ3 A;  1GWC A;  1SD8 A;  4MCU A;  3FY7 A;  4BVX A;  5KOX A;  1M9A A;  3ZLP A;  4AI6 A;  4KA0 A;  4OD7 A;  4MH3 A;  1AC1 A;  1A0R P;  3PIN A;  1B8X A;  5DQS A;  2ZNM A;  3I43 A;  3CXG A;  4KDU A;  2FWG A;  1GUL A;  4G01 A;  2IMK A;  1G0T A;  1AQX A;  2HLS A;  3C1S A;  4Z2T A;  4BPY A;  1T00 A;  1EOH A;  1Z7P A;  4OFN A;  1SKR B;  3FZA A;  2RM6 A;  5IMF A;  5ID2 B;  2F9S A;  3VK9 A;  2JZT A;  4LMW A;  2HT9 A;  3KH9 A;  4NAX A;  1K0A A;  3ZYW A;  3FMW A;  3D4T A;  4PNG A;  1A8L A;  4V1A g;  4DSR A;  2YJH A;  5CRG A;  1DE2 A;  1T4Z A;  3TJB A;  2K9F A;  2WW3 A;  3GMF A;  4ZBD A;  3KTL A;  2C0F A;  4MJA A;  5D9V A;  4OO4 A;  1AUC A;  2WW2 A;  3CRT A;  5IOW A;  3CRU A;  2FCH A;  1XWA A;  1JZR A;  2NBS A;  4AJ6 A;  3VI7 A;  4TW5 A;  5H5S A;  4AKG A;  5G5E A;  2GS3 A;  1GNW A;  2LRC A;  4Q5Q A;  2MYG A;  1JLW A;  4PI0 C;  5IMD A;  3UAR A;  2MBT A;  1YDK A;  2FA4 A;  2H30 A;  4KH7 A;  1A23 A;  1S3D A;  1Z6N A;  4USS A;  2HI7 A;  4OO5 A;  4YAP A;  5CYY A;  2EIQ A;  5HR2 A;  4DSS A;  4CW9 A;  4K1F A;  4TN8 A;  2V2G A;  1SK1 A;  3RAZ A;  4I8B A;  2H0G A;  1U87 A;  1F37 A;  5B8B A;  1TRV A;  1ILO A;  1X9M B;  3A2V A;  2H73 A;  5HFG A;  2KHP A;  2HYX A;  3HD5 A;  5IMA A;  3C71 A;  3ZRD A;  1GH2 A;  4EF0 A;  1JZO A;  4MZB A;  1GSU A;  4KCE A;  1Z3E A;  4V2N A;  3ME7 A;  2CVD A;  1ERT A;  2JAC A;  1K0N A;  3TUE A;  3FK8 A;  1ZMA A;  4WR5 A;  3ISO A;  3M3M A;  3EYT A;  3L9S A;  2VCV A;  2V41 A;  4K2D A;  1FVK A;  3VUR A;  4IQ1 A;  1URM A;  3QOU A;  1ST9 A;  3GTU A;  1WJK A;  2KUC A;  1A2M A;  2CQ9 A;  1ABA A;  5B6M A;  2OAC A;  2JZS A;  1S4B P;  1KTE A;  5ECP B;  2B5Y A;  1DE1 A;  3F4T A;  2HQT A;  1JFU A;  1AQW A;  2H6Z A;  4XCS A;  5DCG A;  1ZOF A;  1QUW A;  4EDY A;  2LNT A;  1EP8 A;  3APS A;  4ZL9 A;  2I1U A;  1RK4 A;  5IQY A;  5JWO B;  1VF2 A;  3TOT A;  3GUR A;  5FHI A;  5G5F A;  2FUG 2;  2C1Y A;  3Q18 A;  4JBB A;  4ML1 A;  3IV4 A;  5EL8 A;  5D9T A;  4TRX A;  3GSS A;  2VUP A;  5DDL A;  1YY7 A;  1TK0 B;  2X8H A;  6GSY A;  2A2P A;  1SEN A;  1Q4J A;  3GYK A;  2B7J A;  2RII A;  2PUK C;  4HQZ A;  4TVE A;  1S3R A;  1PX6 A;  1B4Q A;  1FOV A;  4K6X A;  4KB3 A;  1FAA A;  1O7U A;  2IFQ A;  1X0R A;  2WW0 A;  2M72 A;  1V2A A;  4KSO A;  1SVM A;  1JZD A;  1JLV A;  4PQ1 A;  1DUG A;  3TRX A;  1XWG A;  4XS1 A;  1W4V A;  3IPZ A;  1MD4 A;  4BVY B;  2V6O A;  5D9W A;  1AIU A;  1WOU A;  4K2X A;  4K9Z A;  2C0D A;  3PGT A;  1SL2 B;  4MDC A;  4O7H A;  2GDR A;  3FRC A;  2JSZ A;  4V2M A;  3ERF A;  5JWR B;  1U6T A;  4F03 A;  2JAD A;  4GXZ A;  3HA9 A;  2DMM A;  1TKD B;  3PR8 A;  1BF5 A;  3DML A;  3IHG A;  2AYT A;  4KDX A;  3F9U A;  4NHW A;  1TI3 A;  3TJG A;  3A2W A;  3GNJ A;  1WIK A;  1KNG A;  2P0G A;  4JZQ A;  5A1N B;  2FD3 A;  3DWV A;  2CX4 A;  3ZIV A;  2ZCT A;  4X0X A;  3CTG A;  3ZML A;  5KN3 A;  2WFC A;  3TCO A;  2YAN A;  5GSS A;  1XVW A;  2DML A;  5A5K A;  1VRS D;  3J7Y k;  3GH9 A;  2QGV A;  4N10 A;  2XC2 A;  4L5L A;  5F06 A;  2P31 A;  5IMC A;  4OCE A;  2H1L A;  16GS A;  1ML6 A;  1A2J A;  2VO4 A;  1A24 A;  2VL2 A;  5KOW A;  2KP1 A;  4PTS A;  2D2Z A;  3EE2 A;  2FWF A;  3F8U A;  2OJL A;  5ELA A;  1E6B A;  1TK5 B;  4AGS A;  3DVW A;  1O6J A;  3KMO A;  4I2T A;  3IRA A;  3VWW A;  3FR6 A;  3E0U A;  3ZIT A;  4RI6 A;  2GT5 A;  2JU5 A;  2PWJ A;  1K0B A;  4XIH A;  1NW2 A;  2K6V A;  5KEJ A;  2BMX A;  3U5R E;  1Q98 A;  2B3S A;  1M3I A;  1MDJ A;  4GQC A;  3A3T A;  4LL1 B;  3CTF A;  2H76 A;  4POB A;  2REM A;  1EEJ A;  4POM A;  1PA3 A;  3BCI A;  4EIP A;  3F3R A;  4FQU A;  3IK9 A;  4LMV A;  3D6I A;  1G6W A;  3M0F A;  1U88 A;  4IKH A;  4O32 A;  4TXO B;  1Z6M A;  5EPF A;  1TU8 A;  3U6V A;  4HJ2 A;  5CRW A;  5E59 A;  4N3Z A;  1XVQ A;  5ECS A;  2LRN A;  2Z9S A;  3TKQ A;  1OVN A;  3O76 A;  1O85 A;  5ECR B;  2B5X A;  1QGV A;  1DSB A;  4IHU A;  3ZL5 A;  3GST A;  5F05 A;  2L4Q A;  1UN2 A;  2XBQ A;  2LNS A;  4ECB A;  5CRH A;  2I3Y A;  4PGT A;  5DAK B;  3HDC A;  2O5V A;  2GGT A;  5KN2 A;  1JHB A;  2GZY A;  1Y1U A;  3QFA C;  3FZ5 A;  3LG6 A;  1QK8 A;  4IP6 A;  3M8N A;  2HE3 A;  3FR9 A;  3EMP A;  4IP1 A;  1THO A;  1GTA A;  5A4W A;  2YV7 A;  3UVT A;  3TU3 B;  2OBK A;  3TRQ A;  1PSQ A;  1XFL A;  3PPU A;  2IMI A;  5ECO B;  2MMO A;  1BYE A;  3V1W A;  6GSV A;  5CRD A;  4MPF A;  5EVO A;  1X9W B;  4ZL7 A;  4O5Q A;  2VCX A;  3US3 A;  3L9V A;  4BVY A;  4TKY A;  8GSS A;  3HXS A;  3IOS A;  4Z2R A;  5A34 B;  3APO A;  4HI7 A;  3CMI A;  1IYH A;  1ZYP A;  2HSN B;  3FYG A;  3IC4 A;  2DC5 A;  5J40 A;  1PKZ A;  5F8B A;  4W66 A;  4EE0 A;  4G10 A;  3IC8 A;  4IJI A;  4AF2 A;  1VGL A;  1GSQ A;  2C3Q A;  2WZ9 A;  2MMZ A;  2LTK A;  2ON7 A;  5IPH A;  2X64 A;  4K5R A;  2GZZ A;  5D96 A;  5A1N A;  3L9U A;  4TR4 A;  4I2U A;  1X5C A;  3WYW A;  2CX3 A;  4O92 A;  3IAS 2;  4JE1 A;  3M1G A;  1GSD A;  2VCZ A;  5G1K A;  2L4C A;  1PN9 A;  2HZE A;  2IME A;  4ECI A;  1G7O A;  5ECI B;  4CY6 A;  3IBH A;  4ACS A;  2K18 A;  1T7P B;  5G31 A;  3N9J A;  3BJ5 A;  3BBY A;  1XOB A;  4AJ7 A;  3H79 A;  1EWX A;  1MEK A;  4FH8 A;  3EVI A;  1YF1 A;  3GA4 A;  1MDI A;  5AIS A;  3HMJ G;  4GDF A;  2GQL A;  1TOF A;  4QMK A;  4L5O A;  1BG1 A;  5IO0 A;  4K0G A;  2HRA A;  4ECC A;  2GST A;  1GSS A;  3E9J B;  4XHM A;  4E8E A;  5HR3 A;  2N5F A;  1BX9 A;  1SK0 A;  3IE3 A;  5JCG A;  5COH A;  2B6M A;  2AJQ B;  4KUN A;  1SYR A;  1SKS B;  4FIW A;  4HQS A;  4LL4 B;  3EPT A;  4WET A;  1RW1 A;  2H66 A;  3M9J A;  3TJK A;  1PQN A;  2OBI A;  3LYP A;  1J0F A;  3WT1 A;  1TXX A;  1XWC A;  1FG4 A;  3ERG A;  1GUK A;  2YOI A;  1H75 A;  5DBQ A;  4G9H A;  1N25 A;  4FO5 A;  4HU9 A;  4RI7 A;  3O6T A;  4MMM A;  3DYR A;  3F0I A;  1TU7 A;  4F0C A;  5IMZ A;  1NHO A;  1BJX A;  4YQV A;  4D73 A;  3D5J A;  4GWR A;  1LBK A;  3RPN A;  3PH9 A;  4IS0 A;  3IHQ A;  4MK3 A;  2DLX A;  3LXZ A;  4EUY A;  5A4U A;  5C04 A;  5HQP A;  1OYJ A;  2CV4 A;  1YEX A;  3F6F A;  1GSF A;  2F3M A;  1X5D A;  3RGB C;  3KP8 A;  4QL9 A;  3P7X A;  1FO5 A;  4OFT A;  4V1A p;  4J2F A;  3RDW A;  4IN0 A;  12GS A;  2VCQ A;  1U3A A;  1XOA A;  2GQK A;  3KJY A;  3VFI A;  4F82 A;  5D8I A;  4MAB A;  3TKS E;  4EXJ A;  5LCZ A;  2IWT A;  2IMD A;  2YJ7 A;  1G7E A;  4MF6 A;  4O5R A;  1GP1 A;  2EFH A;  1TJD A;  4PUR A;  3EWL A;  2H0I A;  1EGR A;  4G0I A;  3A5I A;  2HRN A;  2CAI A;  3CSJ A;  3MWH A;  2B7K A;  1K0O A;  3FEU A;  3TJJ A;  2MZC A;  1UC7 A;  1WMJ A;  3IA1 A;  1BED A;  2TRX A;  2LJA A;  3UAP A;  1SKW B;  5A4V A;  4EL1 A;  3HVV A;  5ECK B;  1OE8 A;  2GQM A;  3QFB C;  2QKE A;  4GLT A;  2F51 A;  3LEF A;  2LV3 A;  2V32 A;  3F3Q A;  4OFM A;  5AIV A;  5FWG A;  2FNO A;  3P90 A;  2PVO C;  1EV9 A;  4MNN A;  1K3Y A;  5DJL A;  4HZ2 A;  2H0H A;  4TR1 A;  2G2Q A;  3C7M A;  1QFN A;  3D22 A;  2HRK A;  3TKS A;  2HSM A;  2DBC A;  4F2I A;  4WXT A;  1XG8 A;  1YZX A;  3LFL A;  3FR3 A;  1TP9 A;  2FY6 A;  3HVX A;  4KCA A;  1USB A;  2H72 A;  2DSA A;  4GRF A;  2DIY A;  1YJ6 A;  1BQ7 A;  3H93 A;  3F4S A;  4NV5 A;  3MNG A;  3TB2 A;  5HFI A;  5GST A;  1M2A A;  1Z5Y E;  1MD3 A;  3GUS A;  2WW1 A;  3UVH A;  2C3T A;  3CSI A;  4MF5 A;  5CAX A;  3G7I A;  1ZYN A;  5ELG A;  3ZRE A;  2FA8 A;  1R4W A;  4JR6 A;  1I9D A;  4K5S A;  2VOC A;  1OAZ A;  3F6D A;  3Q6O A;  3LSZ A;  3ZIJ A;  1VF3 A;  1F6M C;  2UV8 G;  2P5Q A;  2VL3 A;  2A4H A;  2LRT A;  1XXU A;  5LD0 A;  3BCK A;  19GS A;  2KOK A;  1EOG A;  3RHC A;  2IPA A;  1ERW A;  1V57 A;  2GT6 A;  1WRY A;  4YQM A;  4GTU A;  4G0L A;  1QQ2 A;  1S3A A;  4WBR D;  1ZYQ B;  1SJI A;  2C3N A;  1B9Y C;  4AKH A;  4NPB A;  4RQR A;  2RUF A;  4BIK A;  2VL2 C;  3GKX A;  2EFD A;  2NDO A;  5BMU B;  1SJ6 A;  4WKW A;  5ID2 A;  2DJJ A;  2VAF A;  3G7J A;  1VF1 A;  2H1B A;  5ECM B;  3ZFB A;  4ISD A;  2H01 A;  3GHA A;  1Y6E A;  4ECJ A;  1YVL A;  1F9M A;  1TRU A;  3KCM A;  4MLY A;  4IGJ A;  3L4N A;  2VM1 A;  3KTB A;  2E2M A;  5IIZ A;  2UZ8 A;  4Q5N A;  1I5G A;  4I6X A;  1A0F A;  2X4A A;  4MZC A;  2PPT A;  5DAL B;  1K0D A;  1EP7 A;  2LJK A;  1V9W A;  4X43 A;  4LLR A;  4NHZ A;  1R5P A;  4MJC A;  1M0U A;  1E2Y A;  3ED3 A;  4V2L A;  2H71 A;  1TW9 A;  1ZGN A;  2OA7 A;  3TGZ A;  2PVQ A;  4TOP A;  4N0V A;  4PUA A;  1G6Y A;  3VWV A;  3VWU A;  2NPB A;  4KW6 A;  1XBS A;  1B48 A;  4Z7X A;  2L59 A;  3SWL A;  4ZL8 A;  1PFO A;  2H6X A;  5CO3 A;  2EFE A;  3J7Y b;  3IXR A;  3P8W A;  1AXD A;  4TR3 A;  2L5O A;  5G1L A;  4MF7 A;  4PX1 A;  4MJB A;  2X49 A;  4L8E A;  5JWQ B; 
#chains in the Genus database with same CATH homology
 4EDZ A;  2VD1 A;  2TRC P;  1XZO A;  3VPQ A;  2PU9 C;  1YKC A;  3M9K A;  2AV4 A;  1ON4 A;  2X8C A;  3EMX A;  1XWK A;  1WWJ A;  2YNX A;  1MTC A;  1RQM A;  2FWE A;  4WEY A;  4TR0 A;  4HUA A;  1R26 A;  4LA1 A;  1MDK A;  4ZBA A;  5IM9 A;  5B6N A;  5J5N A;  1O8W A;  3KH7 A;  3Q19 A;  4ZIL A;  2YP6 A;  3P2A A;  4FYC A;  1ZYE A;  2LQQ A;  3WGX A;  1J08 A;  2EIR A;  3IDV A;  1T4Y A;  3HYP A;  4XS4 B;  3ZTL A;  3APQ A;  1SYX A;  7GSS A;  4HS1 A;  3BOA A;  4RUV A;  3HY2 A;  4F0B A;  3GX0 A;  4PUF C;  1QXH A;  4CDO A;  2CAQ A;  1PRX A;  1HNA A;  3HZ8 A;  1T3B A;  1ZCP A;  1U3I A;  2CT6 A;  2YZH A;  1F3B A;  2V6K A;  2MBS A;  2I81 A;  6GST A;  1EZK A;  4EIQ A;  1SJZ A;  1J9B A;  3KD0 A;  2IL3 A;  3F4R A;  5J9C A;  2XBI A;  1V58 A;  5ABR A;  1UA5 A;  1SL0 B;  4Z2U A;  3MYD A;  3IR4 A;  4BWS A;  2C4J A;  3D4M A;  3KMN A;  4IW9 A;  2WRT A;  4XTS A;  1WPI A;  3GH6 A;  2VIM A;  1WE0 A;  2HNL A;  3VWX A;  4YQU A;  3OR5 A;  5J9B A;  4X4J A;  3DKS A;  3FKF A;  2BJX A;  1YQ1 A;  1XW9 A;  4GQF A;  22GS A;  3TJF A;  3HVS A;  2VLU A;  4FYU A;  4DEJ A;  4PXO A;  1GTI A;  1OC3 A;  1BAY A;  4ML6 A;  3N5O A;  3TKP A;  5JCW A;  3ERW A;  1CQH A;  4WBJ A;  5IPG A;  2AAW A;  4DSQ A;  4L0U A;  1TI1 A;  5BMU A;  2YZU A;  4ZB7 A;  2AUV A;  3UEM A;  2R0G A;  1TDI A;  4IQA A;  3QAW A;  2R0P A;  2YWO A;  4K8M A;  5GZZ B;  2IJY A;  3C1R A;  5F07 A;  3LJR A;  5LNK e;  1YF0 A;  2KP2 A;  2FWH A;  3HKR A;  2DJ1 A;  2YPM A;  1AW9 A;  4HEA 2;  2ON5 A;  2QSI A;  3HJP A;  1BG5 A;  2E7P A;  1GLP A;  2DJK A;  4RQX A;  2K8V A;  3UBL A;  1TRS A;  3CBU A;  6GSU A;  11GS A;  2DJ0 A;  2L6D A;  1F3A A;  1N2A A;  2V1M A;  1PL2 A;  4N0Z A;  1O8X A;  5ECH B;  2PN8 A;  2YWI A;  2C0E A;  2IIY A;  2H70 A;  3ME8 A;  3I6A A;  1R7H A;  1TTZ A;  4AKX B;  5GAN D;  4E8H A;  2MMN A;  3R3E A;  2WUL A;  5J3R A;  2NTO A;  1XW6 A;  1A2L A;  1DBY A;  5CRE A;  3DXB A;  2IMF A;  2R0C A;  3G7Y A;  3GIX A;  13GS A;  4K0N A;  4NWY A;  2WDU A;  1THX A;  2R6K A;  4K7N A;  3ZVJ A;  4AJ8 A;  1TXU A;  4OCF A;  5ECL B;  2IFQ B;  1TRW A;  2O85 A;  3QD9 A;  2G0F A;  3AY8 A;  3WD6 A;  2B1K A;  1GSY A;  3KM6 A;  5C00 A;  3W6G A;  3DEX A;  2DIZ A;  1IYI A;  3FHK A;  4J56 E;  1SU9 A;  4FYB A;  1EEM A;  3MIX A;  3TDG A;  2OAD A;  3MAK A;  4ZIJ A;  4YAV A;  5JCU A;  3DGQ A;  4TXO A;  3KEB A;  3GRX A;  3S9F A;  2PGT A;  1K0M A;  2GLR A;  2R3X A;  5A5H B;  4XRA A;  4PQH A;  3LXT A;  1GUH A;  3LGC A;  4XS4 A;  4TXV A;  4KGI A;  4BA7 A;  3CSH A;  5DAK A;  2DKH A;  2VCT A;  4GCI A;  2A2S A;  4OWY A;  2QA1 A;  2DJ3 A;  2LKU A;  3FZ9 A;  1ACV A;  3QPM A;  5J41 A;  4H86 A;  5F0G A;  4KE3 A;  2O8V B;  4MH2 A;  2FGX A;  2TIR A;  3ZZX A;  3SBC A;  5BRT A;  3A5W A;  2RLI A;  2I9H A;  3C73 A;  4YKG A;  4NMU A;  1GRX A;  2IN3 A;  1SL1 B;  4KAE A;  4MP4 A;  2H1A A;  3W8S A;  1XWB A;  4JED A;  4EVM A;  3KGK A;  3TKS C;  3EUR A;  1PX7 A;  3CYN A;  2PER A;  3GV1 A;  3QCP A;  4E68 A;  4PQI A;  4KF9 A;  5A34 A;  5G30 A;  3EU3 A;  1XCC A;  4N11 A;  4YH2 A;  2HSN A;  4JR4 A;  3KXO A;  6GSX A;  3NZN A;  1LJR A;  5HFK A;  3UBK A;  4EC0 A;  4NV2 A;  2F8A A;  3GX8 A;  3ZFL A;  4Q5F A;  2R2J A;  3KP9 A;  2HSH A;  2YWN A;  2VKZ G;  1O81 A;  1HNB A;  1PMT A;  4BL7 B;  2JL4 A;  1EGO A;  1GLQ A;  3KZQ A;  5IMV A;  1SK2 A;  9GSS A;  3D0Z A;  2R4V A;  2WJU A;  2OE0 A;  2FHE A;  1PL1 A;  4PNF A;  5KN1 A;  1KBN A;  1M9B A;  2BTO T;  3VI5 A;  1AAZ A;  3TKR A;  5G2Z A;  3LW9 A;  1R5A A;  3EC3 A;  3EU4 A;  3FZ4 A;  4QQ7 A;  2H19 A;  4WF5 A;  4XS6 A;  5HR0 A;  2KLX A;  1SD9 A;  4K7O A;  4HOJ A;  4KDY A;  3R2Q A;  4GSN A;  1FW1 A;  1K3O A;  4ILF A;  3GN3 A;  3MSZ A;  2HFD A;  5ENU A;  3L78 A;  3G9B A;  3MDK A;  2GSS A;  4KSM A;  1OE7 A;  5B7C A;  5ECQ B;  2O7K A;  4K7I A;  2RM5 A;  3TOU A;  2LUS A;  4Q5R A;  2CVK A;  3LQ7 A;  3RPP A;  1FB6 A;  2A2R A;  4HZ4 A;  2E2G A;  2B5E A;  1PGT A;  3UMA A;  2N5A A;  2M80 A;  1M7T A;  2M46 A;  5J4Y A;  1LU4 A;  4O5U A;  2DKI A;  2A4V A;  4KND A;  5IO2 A;  1EV4 A;  2WS2 A;  5B8A A;  1X5E A;  1A8Y A;  2WGR A;  4POL A;  2OKA A;  3H4K A;  4CY8 A;  2WCI A;  3GKM A;  2AB6 A;  4GSS A;  4IVF A;  4WF4 A;  1WP0 A;  4AKI A;  4ZBB A;  2NVL A;  3CWG A;  3RBT A;  1B4P A;  2E0Q A;  3GL3 A;  5DJM A;  3DIE A;  3FW2 A;  1VF4 A;  2P5R A;  5D9X A;  14GS A;  4QL7 A;  2HXK A;  1OC9 B;  4ZXG A;  2F8F A;  4GST A;  1OC8 A;  1O73 A;  2OE3 A;  5A5H A;  4EO3 A;  5CP1 A;  2ZUP A;  2YCD A;  2PBJ A;  3LYK A;  2ES7 A;  3H1N A;  1FOH A;  2HZF A;  3HJO A;  1T8E B;  5H5R A;  2C8U A;  2X99 A;  2L6C A;  4F9Z A;  2H1G A;  5ECN B;  4IEL A;  2LQO A;  1GUM A;  2EIO A;  2VLV A;  5IOX A;  1XIY A;  1CQG A;  2HZE B;  1Y25 A;  1ERU A;  2J23 A;  3K8N A;  5E4W A;  4L0W A;  2FLS A;  1YEP A;  2L5L A;  1QMV A;  3WGD A;  4MZW A;  3LWA A;  1X9S B;  5HR1 A;  3H8Q A;  4IJ3 A;  5L71 A;  3L0H A;  4ZB6 A;  4JU5 A;  3GL5 A;  2H8L A;  1M99 A;  1F2E A;  2LST A;  1AQV A;  3E3E A;  4BVX B;  5J4V A;  1GSE A;  1SVL A;  2JSY A;  2R37 A;  3DRN A;  3WGE A;  2XHF A;  2GVP A;  4CHS A;  3RHB A;  1PN0 A;  3O3T A;  2H1D A;  4WR4 A;  3A2X A;  2AHE A;  1H4O A;  2DJ2 A;  2K8S A;  1V40 A;  1NSW A;  5KN0 A;  3QR6 A;  4JRR A;  1JZW A;  4BL7 A;  3DD3 A;  1XW5 A;  2XPE A;  4POK A;  2I4A A;  4OMV A;  3C8E A;  1S3C A;  2C80 A;  17GS A;  1HD2 A;  2CA8 A;  2LJR A;  3F63 A;  2O87 A;  2CVB A;  3WT2 A;  3BD2 A;  2YN1 A;  2X8G A;  2YV9 A;  5FT3 A;  2EFC A;  4ZB9 A;  4G0K A;  4A5P A;  5DVB A;  2PMT A;  3QAV A;  2YWM A;  1HYU A;  4D73 B;  2RUE A;  3NIV A;  4ICY A;  2L57 A;  4N30 A;  1TK8 B;  2QA2 A;  2H6Y A;  1NHY A;  4MJE A;  4ULX A;  3UIW A;  3D21 A;  2OE1 A;  2CZ2 A;  1KEB A;  2VLT A;  4G2E A;  1UVZ A;  1YKA A;  18GS A;  5DQY A;  2MMA A;  1OKD A;  2JZR A;  6GSS A;  3GKK A;  5J4U A;  3I9V 2;  1N8J A;  1Z7R A;  4G19 A;  6GSW A;  10GS A;  3HCZ A;  4P3Y B;  1GTU A;  4MA9 A;  2GZP A;  1K3L A;  2HSY A;  3ZMK A;  2B1L A;  2R5G A;  2LEG A;  2VD0 A;  4DSS B;  1M2D A;  3LOR A;  20GS A;  4YKF A;  3GKN A;  1ZZY A;  2O89 A;  3NOF A;  3IK7 A;  3ZVJ D;  2GSR A;  1NM3 A;  1K0C A;  5GAP D;  5J47 A;  1HQO A;  1B9X C;  2J9H A;  2EC4 A;  5DCH A;  1OKT A;  2XPD A;  3Q74 A;  4ID0 A;  1PD2 1;  1OC9 A;  1GNE A;  2N5B A;  1FVJ A;  1SVO A;  4ZB8 A;  2H75 A;  3QDN A;  1T1V A;  2OT3 A;  1W89 A;  5EY6 A;  4NXI A;  3I69 A;  2QC7 A;  3W8J A;  3HHV A;  3GTU B;  1HNC A;  3JCM L;  4I97 A;  3QAG A;  2LS5 A;  1PKW A;  3HZ4 A;  5DAL A;  2C0G A;  3TRP A;  3HJM A;  5AIX A;  5INY A;  4TR1 B;  3UOM A;  2H74 A;  1M2B A;  4GF0 A;  4I5Q A;  1FB0 A;  2HRK B;  1GTB A;  2WB9 A;  2HSM B;  5CNW A;  4XRD A;  2VCW A;  4X1U A;  3UL3 A;  3EIN A;  4BWQ A;  4J57 E;  3VLN A;  5D93 A;  1FHE A;  4MPG A;  3QMX A;  4HJM A;  4HU7 A;  4HDE A;  5D73 A;  3IAM 2;  2ALB A;  3UJ1 A;  3DVX A;  2VM2 A;  1V98 A;  5H5Q A;  2HRF A;  3KIJ A;  4EKZ A;  1GL8 A;  4IBP A;  2VL9 A;  3GFK A;  1XPV A;  4DVC A;  1ZL9 A;  4KX4 A;  3VPT A;  1Z9H A;  5AGY A;  2GTU A;  1ERV A;  5AN1 A;  1C72 A;  2GSQ A;  2CZ3 A;  1GWC A;  1SD8 A;  4MCU A;  3FY7 A;  4BVX A;  5KOX A;  1M9A A;  3ZLP A;  4AI6 A;  4KA0 A;  4OD7 A;  4MH3 A;  1AC1 A;  1A0R P;  3PIN A;  1B8X A;  5DQS A;  2ZNM A;  3I43 A;  3CXG A;  4KDU A;  2FWG A;  1GUL A;  4G01 A;  2IMK A;  1G0T A;  1AQX A;  2HLS A;  3C1S A;  4Z2T A;  4BPY A;  1T00 A;  1EOH A;  1Z7P A;  4OFN A;  1SKR B;  3FZA A;  2RM6 A;  5IMF A;  5ID2 B;  2F9S A;  3VK9 A;  2JZT A;  4LMW A;  2HT9 A;  3KH9 A;  4NAX A;  1K0A A;  3ZYW A;  3FMW A;  3D4T A;  4PNG A;  1A8L A;  4V1A g;  4DSR A;  2YJH A;  5CRG A;  1DE2 A;  1T4Z A;  3TJB A;  2K9F A;  3GMF A;  4ZBD A;  3KTL A;  2C0F A;  4MJA A;  5D9V A;  4OO4 A;  1AUC A;  3CRT A;  5IOW A;  3CRU A;  2FCH A;  1XWA A;  1JZR A;  2NBS A;  4AJ6 A;  3VI7 A;  4TW5 A;  5H5S A;  4AKG A;  5G5E A;  2GS3 A;  1GNW A;  2LRC A;  4Q5Q A;  2MYG A;  1JLW A;  5IMD A;  3UAR A;  2MBT A;  1YDK A;  2FA4 A;  2H30 A;  4KH7 A;  1A23 A;  1S3D A;  1Z6N A;  4USS A;  2HI7 A;  4OO5 A;  4YAP A;  5CYY A;  2EIQ A;  5HR2 A;  4DSS A;  4CW9 A;  4K1F A;  4TN8 A;  2V2G A;  1SK1 A;  3RAZ A;  4I8B A;  2H0G A;  1U87 A;  1F37 A;  5B8B A;  1TRV A;  1ILO A;  1X9M B;  3A2V A;  2H73 A;  5HFG A;  2KHP A;  2HYX A;  3HD5 A;  5IMA A;  3C71 A;  3ZRD A;  1GH2 A;  4EF0 A;  1JZO A;  4MZB A;  1GSU A;  4KCE A;  1Z3E A;  4V2N A;  3ME7 A;  2CVD A;  1ERT A;  2JAC A;  1K0N A;  3TUE A;  3FK8 A;  1ZMA A;  4WR5 A;  3ISO A;  3M3M A;  3EYT A;  3L9S A;  2VCV A;  2V41 A;  4K2D A;  1FVK A;  3VUR A;  4IQ1 A;  1URM A;  3QOU A;  1ST9 A;  3GTU A;  1WJK A;  2KUC A;  1A2M A;  2CQ9 A;  1ABA A;  5B6M A;  2OAC A;  2JZS A;  1KTE A;  5ECP B;  2B5Y A;  1DE1 A;  3F4T A;  2HQT A;  1JFU A;  1AQW A;  2H6Z A;  4XCS A;  5DCG A;  1ZOF A;  1QUW A;  4EDY A;  2LNT A;  1EP8 A;  3APS A;  4ZL9 A;  2I1U A;  1RK4 A;  5IQY A;  5JWO B;  1VF2 A;  3TOT A;  3GUR A;  5FHI A;  5G5F A;  2FUG 2;  2C1Y A;  3Q18 A;  4JBB A;  4ML1 A;  3IV4 A;  5EL8 A;  5D9T A;  4TRX A;  3GSS A;  2VUP A;  5DDL A;  1YY7 A;  1TK0 B;  2X8H A;  6GSY A;  2A2P A;  1SEN A;  1Q4J A;  3GYK A;  2B7J A;  2RII A;  2PUK C;  4HQZ A;  4TVE A;  1PX6 A;  1B4Q A;  1FOV A;  4K6X A;  4KB3 A;  1FAA A;  1O7U A;  2IFQ A;  1X0R A;  2M72 A;  1V2A A;  4KSO A;  1SVM A;  1JZD A;  1JLV A;  4PQ1 A;  1DUG A;  3TRX A;  1XWG A;  4XS1 A;  1W4V A;  3IPZ A;  1MD4 A;  4BVY B;  2V6O A;  5D9W A;  1AIU A;  1WOU A;  4K2X A;  4K9Z A;  2C0D A;  3PGT A;  1SL2 B;  4MDC A;  4O7H A;  2GDR A;  3FRC A;  2JSZ A;  4V2M A;  3ERF A;  5JWR B;  1U6T A;  4F03 A;  2JAD A;  4GXZ A;  3HA9 A;  2DMM A;  1TKD B;  3PR8 A;  1BF5 A;  3DML A;  3IHG A;  2AYT A;  4KDX A;  3F9U A;  4NHW A;  1TI3 A;  3TJG A;  3A2W A;  3GNJ A;  1WIK A;  1KNG A;  2P0G A;  4JZQ A;  5A1N B;  2FD3 A;  3DWV A;  2CX4 A;  3ZIV A;  2ZCT A;  4X0X A;  3CTG A;  3ZML A;  5KN3 A;  2WFC A;  3TCO A;  2YAN A;  5GSS A;  1XVW A;  2DML A;  5A5K A;  1VRS D;  3J7Y k;  3GH9 A;  2QGV A;  4N10 A;  2XC2 A;  4L5L A;  5F06 A;  2P31 A;  5IMC A;  4OCE A;  2H1L A;  16GS A;  1ML6 A;  1A2J A;  2VO4 A;  1A24 A;  2VL2 A;  5KOW A;  2KP1 A;  4PTS A;  2D2Z A;  3EE2 A;  2FWF A;  3F8U A;  2OJL A;  5ELA A;  1E6B A;  1TK5 B;  4AGS A;  3DVW A;  1O6J A;  3KMO A;  4I2T A;  3IRA A;  3VWW A;  3FR6 A;  3E0U A;  3ZIT A;  4RI6 A;  2GT5 A;  2JU5 A;  2PWJ A;  1K0B A;  4XIH A;  1NW2 A;  2K6V A;  5KEJ A;  2BMX A;  3U5R E;  1Q98 A;  2B3S A;  1MDJ A;  4GQC A;  3A3T A;  4LL1 B;  3CTF A;  2H76 A;  4POB A;  2REM A;  1EEJ A;  4POM A;  1PA3 A;  3BCI A;  4EIP A;  3F3R A;  4FQU A;  3IK9 A;  4LMV A;  3D6I A;  1G6W A;  3M0F A;  1U88 A;  4IKH A;  4O32 A;  4TXO B;  1Z6M A;  5EPF A;  1TU8 A;  3U6V A;  4HJ2 A;  5CRW A;  5E59 A;  4N3Z A;  1XVQ A;  5ECS A;  2LRN A;  2Z9S A;  3TKQ A;  1OVN A;  3O76 A;  1O85 A;  5ECR B;  2B5X A;  1QGV A;  1DSB A;  4IHU A;  3ZL5 A;  3GST A;  5F05 A;  2L4Q A;  1UN2 A;  2XBQ A;  2LNS A;  4ECB A;  5CRH A;  2I3Y A;  4PGT A;  5DAK B;  3HDC A;  2O5V A;  2GGT A;  5KN2 A;  1JHB A;  2GZY A;  1Y1U A;  3QFA C;  3FZ5 A;  3LG6 A;  1QK8 A;  4IP6 A;  3M8N A;  2HE3 A;  3FR9 A;  3EMP A;  4IP1 A;  1THO A;  1GTA A;  5A4W A;  2YV7 A;  3UVT A;  3TU3 B;  2OBK A;  3TRQ A;  1PSQ A;  1XFL A;  3PPU A;  2IMI A;  5ECO B;  2MMO A;  1BYE A;  3V1W A;  6GSV A;  5CRD A;  4MPF A;  5EVO A;  1X9W B;  4ZL7 A;  4O5Q A;  2VCX A;  3US3 A;  3L9V A;  4BVY A;  4TKY A;  8GSS A;  3HXS A;  3IOS A;  4Z2R A;  5A34 B;  3APO A;  4HI7 A;  3CMI A;  1IYH A;  1ZYP A;  2HSN B;  3FYG A;  3IC4 A;  2DC5 A;  5J40 A;  1PKZ A;  5F8B A;  4W66 A;  4EE0 A;  4G10 A;  3IC8 A;  4IJI A;  4AF2 A;  1VGL A;  1GSQ A;  2C3Q A;  2WZ9 A;  2MMZ A;  2LTK A;  2ON7 A;  5IPH A;  2X64 A;  4K5R A;  2GZZ A;  5D96 A;  5A1N A;  3L9U A;  4TR4 A;  4I2U A;  1X5C A;  3WYW A;  2CX3 A;  4O92 A;  3IAS 2;  4JE1 A;  3M1G A;  1GSD A;  2VCZ A;  5G1K A;  2L4C A;  1PN9 A;  2HZE A;  2IME A;  4ECI A;  1G7O A;  5ECI B;  4CY6 A;  3IBH A;  4ACS A;  2K18 A;  1T7P B;  5G31 A;  3N9J A;  3BJ5 A;  3BBY A;  1XOB A;  4AJ7 A;  3H79 A;  1EWX A;  1MEK A;  4FH8 A;  3EVI A;  1YF1 A;  3GA4 A;  1MDI A;  5AIS A;  3HMJ G;  4GDF A;  2GQL A;  1TOF A;  4QMK A;  4L5O A;  1BG1 A;  5IO0 A;  4K0G A;  2HRA A;  4ECC A;  2GST A;  1GSS A;  3E9J B;  4XHM A;  4E8E A;  5HR3 A;  2N5F A;  1BX9 A;  1SK0 A;  3IE3 A;  5JCG A;  5COH A;  2B6M A;  2AJQ B;  4KUN A;  1SYR A;  1SKS B;  4FIW A;  4HQS A;  4LL4 B;  3EPT A;  4WET A;  1RW1 A;  2H66 A;  3M9J A;  3TJK A;  1PQN A;  2OBI A;  3LYP A;  1J0F A;  3WT1 A;  1TXX A;  1XWC A;  1FG4 A;  3ERG A;  1GUK A;  2YOI A;  1H75 A;  5DBQ A;  4G9H A;  1N25 A;  4FO5 A;  4HU9 A;  4RI7 A;  3O6T A;  4MMM A;  3DYR A;  3F0I A;  1TU7 A;  4F0C A;  5IMZ A;  1NHO A;  1BJX A;  4YQV A;  4D73 A;  3D5J A;  4GWR A;  1LBK A;  3RPN A;  3PH9 A;  4IS0 A;  3IHQ A;  4MK3 A;  2DLX A;  3LXZ A;  4EUY A;  5A4U A;  5C04 A;  5HQP A;  1OYJ A;  2CV4 A;  1YEX A;  3F6F A;  1GSF A;  2F3M A;  1X5D A;  3KP8 A;  4QL9 A;  3P7X A;  1FO5 A;  4OFT A;  4V1A p;  4J2F A;  3RDW A;  4IN0 A;  12GS A;  2VCQ A;  1U3A A;  1XOA A;  2GQK A;  3KJY A;  3VFI A;  4F82 A;  5D8I A;  4MAB A;  3TKS E;  4EXJ A;  5LCZ A;  2IWT A;  2IMD A;  2YJ7 A;  1G7E A;  4MF6 A;  4O5R A;  1GP1 A;  2EFH A;  1TJD A;  4PUR A;  3EWL A;  2H0I A;  1EGR A;  4G0I A;  3A5I A;  2HRN A;  2CAI A;  3CSJ A;  3MWH A;  2B7K A;  1K0O A;  3FEU A;  3TJJ A;  2MZC A;  1UC7 A;  1WMJ A;  3IA1 A;  1BED A;  2TRX A;  2LJA A;  3UAP A;  1SKW B;  5A4V A;  4EL1 A;  3HVV A;  5ECK B;  1OE8 A;  2GQM A;  3QFB C;  2QKE A;  4GLT A;  2F51 A;  3LEF A;  2LV3 A;  2V32 A;  3F3Q A;  4OFM A;  5AIV A;  5FWG A;  2FNO A;  3P90 A;  2PVO C;  1EV9 A;  4MNN A;  1K3Y A;  5DJL A;  4HZ2 A;  2H0H A;  4TR1 A;  2G2Q A;  3C7M A;  1QFN A;  3D22 A;  2HRK A;  3TKS A;  2HSM A;  2DBC A;  4F2I A;  4WXT A;  1YZX A;  3LFL A;  3FR3 A;  1TP9 A;  2FY6 A;  3HVX A;  4KCA A;  1USB A;  2H72 A;  2DSA A;  4GRF A;  2DIY A;  1YJ6 A;  1BQ7 A;  3H93 A;  3F4S A;  4NV5 A;  3MNG A;  3TB2 A;  5HFI A;  5GST A;  1M2A A;  1Z5Y E;  1MD3 A;  3GUS A;  3UVH A;  2C3T A;  3CSI A;  4MF5 A;  5CAX A;  3G7I A;  1ZYN A;  5ELG A;  3ZRE A;  2FA8 A;  1R4W A;  4JR6 A;  1I9D A;  4K5S A;  2VOC A;  1OAZ A;  3F6D A;  3Q6O A;  3LSZ A;  3ZIJ A;  1VF3 A;  1F6M C;  2UV8 G;  2P5Q A;  2VL3 A;  2A4H A;  2LRT A;  1XXU A;  5LD0 A;  3BCK A;  19GS A;  2KOK A;  1EOG A;  3RHC A;  2IPA A;  1ERW A;  1V57 A;  2GT6 A;  1WRY A;  4YQM A;  4GTU A;  4G0L A;  1QQ2 A;  1S3A A;  4WBR D;  1ZYQ B;  1SJI A;  2C3N A;  1B9Y C;  4AKH A;  4NPB A;  4RQR A;  2RUF A;  2VL2 C;  3GKX A;  2EFD A;  2NDO A;  5BMU B;  1SJ6 A;  4WKW A;  5ID2 A;  2DJJ A;  2VAF A;  3G7J A;  1VF1 A;  2H1B A;  5ECM B;  3ZFB A;  4ISD A;  2H01 A;  3GHA A;  1Y6E A;  4ECJ A;  1YVL A;  1F9M A;  1TRU A;  3KCM A;  4MLY A;  4IGJ A;  3L4N A;  2VM1 A;  3KTB A;  2E2M A;  5IIZ A;  2UZ8 A;  4Q5N A;  1I5G A;  4I6X A;  1A0F A;  2X4A A;  4MZC A;  2PPT A;  5DAL B;  1K0D A;  1EP7 A;  2LJK A;  1V9W A;  4X43 A;  4LLR A;  4NHZ A;  1R5P A;  4MJC A;  1M0U A;  1E2Y A;  3ED3 A;  4V2L A;  2H71 A;  1TW9 A;  1ZGN A;  2OA7 A;  3TGZ A;  2PVQ A;  4TOP A;  4N0V A;  4PUA A;  1G6Y A;  3VWV A;  3VWU A;  2NPB A;  4KW6 A;  1XBS A;  1B48 A;  4Z7X A;  2L59 A;  3SWL A;  4ZL8 A;  2H6X A;  5CO3 A;  2EFE A;  3J7Y b;  3IXR A;  3P8W A;  1AXD A;  4TR3 A;  2L5O A;  5G1L A;  4MF7 A;  4PX1 A;  4MJB A;  2X49 A;  4L8E A;  5JWQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...