1G7OA

Nmr solution structure of reduced e. coli glutaredoxin 2
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
215
structure length
215
Chain Sequence
MKLYIYDHCPYCLKARMIFGLKNIPVELHVLLNDDAETPTRMVGQKQVPILQKDDSRYMPESMDIVHYVDKLDGKPLLTGKRSPAIEEWLRKVNGYANKLLLPRFAKSAFDEFSTPAARKYFVDKKEASAGNFADLLAHSDGLIKNISDDLRALDKLIVKPNAVNGELSEDDIQLFPLLRNLTLVAGINWPSRVADYRDNMAKQTQINLLSSMAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTAREDOXIN 2
publication title Solution structure of Escherichia coli glutaredoxin-2 shows similarity to mammalian glutathione-S-transferases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 84
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2000-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04399 Glutaredoxin2_C Glutaredoxin 2, C terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1g7oA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1g7oA01
1A2LA 4X0XA 1WE0A 1Y6EA 3H8QA 2P5QA 2RM5A 2I4AA 1R7HA 5IM9A 4FO5A 1GSSA 4QQ7A 2IMDA 3RHBA 5H5RA 3P90A 4POMA 2K8SA 1M9AA 3MNGA 5ECSA 3LYKA 1LBKA 3US3A 2HE3A 2LNTA 3IC8A 5KEJA 2ON7A 5INYA 2C3QA 2DMMA 4V2NA 2IIYA 3HJOA 1FAAA 3F3RA 1ZYQB 2BMXA 2B1KA 1BYEA 4WR4A 3KTBA 4HQZA 2GSTA 4KF9A 3DIEA 4FYBA 1GH2A 1K0NA 3Q74A 3WGDA 3FRCA 3F0IA 4JZQA 2M72A 4ZL9A 4PUAA 3TOUA 1T00A 1YEPA 3ZRDA 1TK5B 3TKRA 5G5EA 2TIRA 3LXZA 1TU7A 4IP1A 2M80A 3F6DA 4EC0A 1VF1A 3GTUB 1EOGA 3QAGA 2KHPA 1TU8A 2FCHA 4EO3A 4MABA 5D9XA 3EU3A 2H01A 1SD9A 3APOA 5CP1A 2PVQA 4F2IA 1LJRA 3CTGA 1XVWA 2BJXA 4K0GA 1TDIA 1EWXA 3FYGA 4K1FA 5AISA 3IC4A 2GQKA 1XWBA 3ZZXA 5CRDA 1JZDA 1JLWA 5HFIA 4OCEA 1M99A 3PPUA 2RM6A 4Q5RA 1OC8A 5DAKB 3TB2A 1S3DA 1SYRA 6GSSA 3QFAC 2VLTA 4WF4A 5CRWA 2GSRA 1ZGNA 3D4MA 4PNFA 1HYUA 3ZYWA 3TKSC 2HSHA 1OVNA 1THOA 3DVXA 1GTIA 4E8EA 5E59A 4BA7A 3A3TA 1FO5A 3P8WA 5KN3A 3VK9A 5JWRB 4XRDA 1M9BA 1Z3EA 2LQOA 3GFKA 2E7PA 3GMFA 3UEMA 1GULA 4CHSA 3WT1A 1GTUA 3VPTA 2HRAA 1B9YC 5DDLA 2IMIA 4DSRA 3ZL5A 3CMIA 1G6YA 1XOAA 4IP6A 4I5QA 1QXHA 3L9SA 1ILOA 4O92A 5ECMB 2L6DA 2RUFA 2CVBA 3UARA 1HQOA 3O3TA 4ISDA 5D8IA 2E2GA 1GSUA 3GKMA 3FKFA 4NHWA 2GT6A 1GSQA 4OO4A 1MTCA 1FVKA 1WP0A 3F4RA 2H72A 2JL4A 4NMUA 4GCIA 4IQAA 4DEJA 5J5NA 1GUMA 4GRFA 2VLVA 4LL1B 1GSDA 5C04A 2FWGA 1AAZA 1XW9A 1FB6A 2V32A 1W4VA 3IV4A 4X1UA 2WFCA 5J41A 3LORA 5ID2A 5ELAA 2YWIA 3EINA 2HT9A 1XXUA 2R4VA 3DYRA 3EMXA 2HLSA 2WCIA 4MA9A 11GSA 1R5AA 4MCUA 1URMA 2C1YA 4POKA 1PX7A 4JRRA 4HJMA 4POBA 3GH6A 3L9VA 4MF6A 3TJFA 4IJ3A 4PNGA 1QMVA 1T8EB 1GRXA 3GL5A 5C00A 1YZXA 4OMVA 2J9HA 4TW5A 3QD9A 2KP2A 4X43A 4ZB9A 4ZB8A 4FYCA 4ID0A 5B7CA 2DJJA 4V1Ag 1F3AA 1WPIA 5G2ZA 4KH7A 3TRPA 3GKKA 3A2WA 5GSSA 1O8XA 4HEA2 1I9DA 1PKZA 2A2RA 4CW9A 4XRAA 3UVHA 2GVPA 3GA4A 3CSHA 2CVKA 1SK1A 2R2JA 2CVDA 2XPEA 2C0EA 2CQ9A 2YWNA 3L9UA 3ZIVA 4BVXA 2OBIA 2H19A 5DBQA 4YAPA 2ZUPA 4JR4A 3RBTA 3TDGA 1V40A 2CT6A 4GTUA 2YN1A 2N5FA 1NM3A 2X99A 2VL2A 2NDOA 1TI3A 2B1LA 2GZPA 4NV2A 4IQ1A 3TKQA 2DJ0A 4L0UA 5IMCA 4H86A 4D73A 5B6NA 3DGQA 2B6MA 1XWGA 3CTFA 5IOXA 3EURA 4LMVA 1GTAA 3WYWA 4F0CA 2IL3A 3TOTA 1RK4A 3IHQA 2HFDA 1FHEA 1J0FA 7GSSA 3ZMKA 3A2XA 2GTUA 1O8WA 2GT5A 4IS0A 1MDKA 3HDCA 3E0UA 1K3YA 2HXKA 3HHVA 4ECCA 3FEUA 5AGYA 1UA5A 2RIIA 4KCEA 2GGTA 3HJPA 1A24A 1G7OA 4PQIA 4ECJA 2QSIA 4YQMA 1TW9A 1SU9A 4IHUA 1GNEA 2CAIA 4GLTA 3ERFA 4KUNA 4V2LA 3RPPA 3HVSA 2WS2A 1A23A 3KJYA 2I1UA 4TR3A 2WULA 17GSA 4ZB6A 3O76A 2WRTA 3PH9A 1MDJA 5D9WA 1YF0A 2I3YA 2XBIA 4JE1A 3GURA 2MBTA 1GUHA 3HA9A 2MYGA 3BCKA 5ECPB 2H0IA 2FHEA 3IK7A 2EIRA 3ME8A 5A4WA 3EU4A 5COHA 3GN3A 4NAXA 2PERA 4RQRA 5F06A 1A0RP 3GUSA 1TI1A 3KD0A 2C0DA 5ID2B 1K0DA 3JCML 3IOSA 5D96A 1AQVA 1PX6A 3FZAA 3KP9A 4NWYA 1PL1A 1SK2A 1G0TA 1M2BA 2NPBA 3F6FA 2YV9A 1ON4A 4K0NA 2L5LA 1SJ6A 4TVEA 1GNWA 2H73A 3TJJA 3GYKA 4HU7A 2R3XA 5GSTA 2E0QA 4GSNA 1A2MA 3MDKA 4IN0A 5CNWA 2LNSA 2YV7A 1CQHA 2LS5A 2X8CA 1MEKA 4EDZA 2HRNA 3LGCA 3ZFLA 3UL3A 3ZREA 4JR6A 2JADA 1YJ6A 1B4PA 2OADA 1AIUA 2IMEA 1IYHA 4ULXA 4I2TA 3CRTA 3UBKA 2PBJA 14GSA 2DJ1A 2JACA 1TRVA 4POLA 3F8UA 3ZLPA 1TJDA 4IW9A 2LJRA 5ECHB 20GSA 3DMLA 5IMZA 2KP1A 5F05A 5ENUA 2OA7A 2LEGA 1JZWA 3BBYA 1GTBA 2H6ZA 4ACSA 2G2QA 19GSA 2P0GA 1U3AA 4BVXB 1BAYA 3KMOA 1TK0B 3ZIJA 2TRXA 2LSTA 1EEMA 1Z9HA 2K9FA 3VWUA 1F6MC 9GSSA 2V2GA 3GX0A 12GSA 1PRXA 2AJQB 4KW6A 4EUYA 1HNBA 4USSA 5DVBA 5LNKe 2J23A 1TOFA 4G19A 3ZVJD 2V1MA 3IE3A 2B5EA 5LCZA 5HFKA 1JFUA 2H0HA 4K2DA 5F0GA 4ML6A 3LEFA 4K7OA 2C3NA 4D73B 3VWXA 3BCIA 2LJKA 1A0FA 4FH8A 4ZIJA 4G2EA 3QCPA 4OO5A 2NVLA 1F9MA 1TK8B 3IXRA 3LWAA 1PA3A 3APQA 2MBSA 4IGJA 4BWQA 3DWVA 2I9HA 1ZOFA 2D2ZA 3O6TA 3D0ZA 3DRNA 4WXTA 4TN8A 3D5JA 3UOMA 4F9ZA 5IPGA 1ST9A 4RI6A 4MPGA 3VWWA 3GSSA 3I69A 2H6XA 2IFQA 1S3CA 1WOUA 2XC2A 5F07A 3FHKA 3H93A 1EGOA 5DJLA 3KTLA 4EL1A 1FW1A 4FYUA 5IOWA 1X5DA 1LU4A 4I6XA 1QFNA 2H71A 4WBJA 3ZMLA 3L4NA 3CYNA 1EEJA 3DEXA 3G7YA 4KNDA 4TR0A 3L78A 1GSYA 1F2EA 3TKPA 5A4VA 2HZFA 2Z9SA 3K8NA 1WJKA 4BL7A 4JEDA 4YAVA 1OAZA 5J9CA 4HJ2A 3N5OA 2GSSA 1NW2A 2XBQA 6GSTA 1K0CA 1DSBA 3UIWA 3W6GA 2L5OA 5B8AA 2G0FA 3C1SA 3BOAA 1DE1A 1EV4A 3QAVA 2JU5A 4MJBA 3D22A 5EVOA 4GF0A 1AW9A 5EL8A 3HVVA 1EV9A 4K7IA 3EWLA 3KMNA 1B8XA 2N5AA 3F4TA 1SYXA 2DC5A 16GSA 5JCGA 2C4JA 2RLIA 3C1RA 2OKAA 5FWGA 2ZCTA 2K18A 3ZFBA 2C3TA 1Q4JA 2WJUA 1JZOA 3PR8A 3RHCA 2LUSA 4P3YB 4EDYA 4MZBA 2WZ9A 3WT2A 2QC7A 3C8EA 2LQQA 1SKWB 4XS4A 2KLXA 4AJ8A 2EIQA 2MMZA 2C80A 2DIZA 3F3QA 4PUFC 2F8FA 5ECIB 4TOPA 4OFNA 1KNGA 1OE8A 1A8YA 2HZEA 1AXDA 1OC3A 3VFIA 1ZL9A 3MSZA 1GWCA 4KCAA 1HNCA 2VL3A 2C0GA 5ELGA 1FB0A 3F4SA 4I97A 5H5QA 3H79A 3C71A 4DSQA 3I9V2 4O7HA 2FWHA 3VLNA 3KEBA 4IJIA 3VURA 6GSVA 3IPZA 4G0LA 1GLQA 2JZSA 4N30A 3WD6A 2P5RA 5D73A 2DBCA 2VCVA 4ML1A 2H1BA 1GL8A 3HD5A 5CREA 4NPBA 4V2MA 4F82A 3TRXA 3S9FA 4OFMA 1J9BA 1DUGA 1QUWA 2IFQB 3ERWA 5IPHA 4CDOA 1KBNA 1X9MB 3M3MA 4TXOA 4OD7A 2LRCA 2CZ3A 4RQXA 1M2AA 4J2FA 2PGTA 2PVOC 1NHYA 1OKTA 1ERVA 2A4VA 2LTKA 2K8VA 2H0GA 4YH2A 5HR1A 2HRKA 2HSYA 1AUCA 5CYYA 5ECLB 1W89A 4GWRA 3E9JB 3FW2A 3QMXA 2YZHA 1XW5A 2L4QA 2JZTA 3QFBC 2O89A 3PINA 1DBYA 3KIJA 2HQTA 5JWQB 1X9WB 4BL7B 4KX4A 1USBA 1G7EA 4Q5QA 1E2YA 3I43A 3N9JA 1MD3A 3G9BA 2V41A 4WEYA 5CAXA 1ML6A 2C0FA 2MMNA 1YKCA 3Q18A 5HR3A 4KGIA 1SL2B 1R4WA 1WWJA 1XW6A 2PWJA 2IJYA 2WB9A 4PX1A 1ERTA 1M7TA 4TR1A 3ED3A 2VM1A 1ERUA 2H66A 4FIWA 3HZ4A 3TGZA 1ABAA 4G10A 4AF2A 3TJKA 1SKSB 2GQMA 4MF5A 2K6VA 3VPQA 2P31A 1ZMAA 3Q19A 2ES7A 4IELA 2YWMA 4O32A 5ECOB 2AUVA 3MAKA 5AIVA 4MJEA 3LFLA 1SL0B 4HUAA 4IVFA 1K0MA 4MPFA 2YZUA 3HZ8A 5B8BA 4O5RA 1K3LA 2CX4A 5DALA 3H4KA 1G6WA 3TJBA 1BG5A 4JU5A 1PKWA 3HJMA 1GSFA 4QL7A 2VO4A 2VCZA 2AB6A 2WGRA 4G0IA 2F8AA 3NOFA 5A5KA 2EIOA 5JCWA 5ECKB 4AJ7A 4XS4B 1Z5YE 4F03A 5J3RA 4ZL8A 1EP7A 4KAEA 2C8UA 4ZXGA 3QR6A 4K9ZA 2PMTA 2PPTA 4MJCA 2FA4A 4EKZA 4NXIA 4N0ZA 1QQ2A 3GRXA 3KP8A 2FNOA 2HZEB 1O85A 2OJLA 4TXVA 1RQMA 1FOVA 1VGLA 1ZYEA 3GV1A 1ACVA 3CSJA 1BJXA 2GZYA 5DCHA 4XS1A 1M0UA 4KDUA 3M8NA 4LMWA 3UBLA 1V9WA 4XIHA 4KE3A 3SWLA 2FA8A 2R5GA 1YY7A 1X5EA 3NZNA 4EVMA 4I2UA 3LXTA 2OE0A 3QPMA 4HQSA 1EGRA 1XWAA 3W8SA 1PMTA 1AC1A 2YWOA 2PN8A 2B5YA 3GIXA 4KDYA 1XIYA 1NHOA 1Z7PA 1Q98A 3FZ5A 4L5LA 1SD8A 1TP9A 3QDNA 4HZ2A 2GDRA 5FT3A 1TTZA 1PQNA 3M1GA 1XWCA 5DCGA 5J9BA 2DMLA 6GSYA 4TXOB 3IK9A 1DE2A 2M46A 2PU9C 2LJAA 3KZQA 3TRQA 3CRUA 2DIYA 1SJIA 1WIKA 2L6CA 1JZRA 4WKWA 2OE1A 2VOCA 2A2SA 3KM6A 4ZL7A 2HNLA 2HRKB 3AY8A 3G7IA 4TRXA 2B5XA 4HI7A 2O8VB 3TJGA 3C7MA 3A5WA 4EF0A 1FVJA 3DD3A 4XTSA 5HR0A 1K0OA 1V98A 3GH9A 3WGXA 1XVQA 2FUG2 2R6KA 1HNAA 2L59A 3D6IA 3FK8A 3ISOA 3IAS2 1PGTA 3V1WA 4KA0A 2WDUA 4TR1B 1JHBA 1O6JA 3HY2A 4GQFA 2O85A 3MWHA 1T1VA 4HS1A 2CA8A 2H75A 2YJ7A 2FWFA 4ECIA 5ECNB 3GKNA 1BQ7A 1MD4A 1XWKA 2GLRA 2DSAA 4WETA 5D9TA 2H6YA 1U6TA 1RW1A 6GSUA 1U88A 2EC4A 4TKYA 4DVCA 5HQPA 4EXJA 3BD2A 1H4OA 2F3MA 4MJAA 3VI7A 1GP1A 4XHMA 2VD0A 4MLYA 1Z6NA 1I5GA 2KUCA 5B6MA 3KCMA 1A8LA 1O73A 1Z6MA 5DALB 1KEBA 4N10A 3HXSA 2FWEA 3R3EA 3CBUA 2DLXA 3Q6OA 5KN0A 3TUEA 1EP8A 1O81A 1UVZA 2H8LA 4Z7XA 4DSSA 1E6BA 2YJHA 4PQ1A 2H30A 3J7Yk 2DJ3A 1K3OA 4L8EA 4WF5A 2VCTA 4OFTA 3M9KA 3HKRA 2VL9A 2OE3A 3F9UA 1TRWA 3UMAA 5KN2A 1M2DA 5G1LA 3IR4A 5DJMA 3ERGA 3G7JA 4YQUA 3FY7A 2DJ2A 5IO2A 1K0BA 4ZBBA 3EVIA 5IIZA 5ECQB 3FR6A 5JCUA 3M0FA 2QKEA 5G30A 2F9SA 4AGSA 4J56E 2UZ8A 4NV5A 4HOJA 2OBKA 1XCCA 1F37A 5AN1A 2GZZA 1F3BA 2YCDA 4L5OA 2IN3A 4E8HA 2AV4A 2ALBA 1B48A 5H5SA 5A4UA 5AIXA 1SJZA 5CRHA 4HZ4A 3UJ1A 4BVYA 1N2AA 2CZ2A 2LV3A 4WR5A 3GL3A 2VD1A 1SK0A 3F63A 2CX3A 4ZBDA 2GQLA 1QK8A 5GAND 3APSA 2HSMA 1XPVA 3R2QA 3ZITA 3FR9A 3GX8A 5ABRA 4ZBAA 2IPAA 4KB3A 1OC9A 3KH9A 3RPNA 3TKSE 13GSA 4MH3A 2VLUA 4K8MA 1AQXA 4RUVA 3IRAA 1THXA 1QGVA 5G1KA 3EYTA 2VL2C 3GNJA 2H1GA 2ON5A 6GSXA 1TRUA 2F51A 1YQ1A 1GUKA 5BMUA 3LYPA 4GQCA 2AAWA 3HVXA 1X0RA 2N5BA 5HR2A 4WBRD 3TKSA 2H1DA 4G9HA 5FHIA 3FZ9A 1B9XC 1OE7A 1YEXA 3IDVA 4PURA 2L57A 3HYPA 2YPMA 3KXOA 5EPFA 2XHFA 4FQUA 1TXXA 2ZNMA 5HFGA 3IAM2 3UAPA 3GKXA 1KTEA 1VF4A 6GSWA 4YQVA 4GSTA 2MMAA 2RUEA 3P7XA 2IMFA 2MZCA 2GS3A 4GXZA 1NSWA 4HU9A 3PGTA 2YP6A 1WRYA 5IO0A 5IMVA 2FGXA 4EE0A 2LRTA 3GHAA 2H74A 1A2JA 1H75A 1U3IA 18GSA 2JZRA 4OCFA 2YNXA 5D9VA 3NIVA 3D21A 4ZILA 4J57E 5IMDA 2NTOA 4G0KA 3EC3A 3VWVA 1X9SB 3CXGA 1PSQA 4AJ6A 4BWSA 2FLSA 2H1AA 3H1NA 2PUKC 1Y25A 1SENA 3DKSA 1ERWA 1OYJA 5ECRB 1C72A 5D93A 2VUPA 5DQYA 2VCQA 1WMJA 3QOUA 4MP4A 5DQSA 1T4ZA 3RDWA 4PQHA 2VCXA 2O87A 2H70A 4MDCA 2REMA 2GSQA 3TCOA 22GSA 4JBBA 2LRNA 2KOKA 3VI5A 1GSEA 3FR3A 2IMKA 2MMOA 2E2MA 4DSSB 1ZCPA 2XPDA 2R37A 3C73A 4TR4A 3SBCA 3WGEA 1T3BA 1YKAA 1JLVA 3ZTLA 3L0HA 5GZZB 2TRCP 4KDXA 3IA1A 4K7NA 2B3SA 2BTOT 2HSNB 5L71A 1CQGA 2OACA 4K6XA 5CO3A 1UC7A 1PL2A 1Z7RA 4PTSA 4F0BA 1SL1B 4HDEA 2JSZA 4MH2A 5IMFA 1V58A 3P2AA 3J7Yb 4LLRA 2IWTA 4NHZA 1VF3A 1PN9A 2CAQA 3BJ5A 1EOHA 1YF1A 3LG6A 2QGVA 3GTUA 2I81A 1XOBA 3KGKA 1PD21 1B4QA 1OKDA 1BX9A 1HD2A 1V57A 4BVYB 2L4CA 1O7UA 3E3EA 3CSIA 4N0VA 2YANA 5CRGA 2O7KA 3IBHA 4IBPA 5JWOB 1XZOA 2HI7A 1U87A 5GAPD 2HSMB 1IYIA 3ZVJA 5G5FA 1BEDA 2V6OA 4QL9A 5IMAA 3UVTA 5IQYA 1OC9B 4MK3A 3GSTA 1SKRB 2FY6A 2VIMA 3EMPA 4MZCA 3DXBA 4V1Ap 1N8JA 3ME7A 5DAKA 5E4WA 4GSSA 1UN2A 5KN1A 4ECBA 3HCZA 5LD0A 2V6KA 4MZWA 1GLPA 2H76A 4PGTA 4XS6A 2CV4A 3DVWA 1K0AA 2X8GA 3U5RE 1T4YA 4KSOA 2X8HA 4IKHA 4BPYA 2DJKA 2FD3A 4I8BA 3LQ7A 3D4TA 3A2VA 3EE2A 2VM2A 8GSSA 3FZ4A 4N11A 4XCSA 2HYXA 1MDIA 3LJRA 4ILFA 3QAWA 2B7KA 5J4UA 1TKDB 3U6VA 3RAZA 4LL4B 1XFLA 4Q5NA 3KH7A 1ZZYA 1FG4A 5F8BA 1R26A 2YOIA 2VAFA 2NBSA 1X5CA 1VF2A 4L0WA 3W8JA 2VCWA 1AQWA 4PXOA 1S3AA 1R5PA 3OR5A 1T7PB 4OWYA 1V2AA 5G31A 3M9JA 2AYTA 1J08A 1YDKA 4KSMA 1TRSA 1XBSA 5EY6A 4LA1A 4MF7A 2AHEA 1EZKA 3I6AA 4Q5FA 2HRFA 4RI7A 4MMMA 10GSA 2B7JA 1VRSD 3LSZA 2JSYA 2X64A 2LKUA
chains in the Genus database with same CATH superfamily
3CWGA 1A2LA 4X0XA 4HSCX 1WE0A 1Y6EA 3H8QA 2P5QA 2RM5A 2I4AA 1R7HA 5IM9A 4FO5A 2O36A 1GSSA 4QQ7A 2IMDA 3RHBA 5H5RA 3P90A 4POMA 2K8SA 1M9AA 3MNGA 5ECSA 3LYKA 1LBKA 3US3A 2HE3A 2LNTA 3IC8A 5KEJA 2ON7A 5INYA 2C3QA 2DMMA 4V2NA 2IIYA 3HJOA 1FAAA 3F3RA 1ZYQB 2BMXA 2B1KA 1BYEA 4WR4A 3KTBA 4HQZA 2GSTA 4KF9A 3DIEA 4FYBA 1GH2A 4E68A 1K0NA 3Q74A 3WGDA 3FRCA 3F0IA 4JZQA 2M72A 4CY8A 4ZL9A 4PUAA 3TOUA 1T00A 1PFOA 1YEPA 3ZRDA 1TK5B 4AI6A 3TKRA 1YVLA 5G5EA 2TIRA 3LXZA 1TU7A 4IP1A 2M80A 3F6DA 4EC0A 1VF1A 3GTUB 1EOGA 3QAGA 2KHPA 1TU8A 2FCHA 4EO3A 4MABA 5D9XA 4ZB7A 3EU3A 2H01A 1SD9A 3APOA 5CP1A 2PVQA 4F2IA 1LJRA 3CTGA 1XVWA 2BJXA 4K0GA 1TDIA 1EWXA 3FYGA 4K1FA 5AISA 3IC4A 1SVMA 2GQKA 1XWBA 3ZZXA 5CRDA 1JZDA 1JLWA 5HFIA 5BRTA 4OCEA 1M99A 3PPUA 2RM6A 4Q5RA 1OC8A 5DAKB 3TB2A 1S3DA 1SYRA 6GSSA 3QFAC 2VLTA 4WF4A 5CRWA 2GSRA 1ZGNA 3D4MA 4PNFA 1HYUA 3ZYWA 3TKSC 2HSHA 1OVNA 1THOA 3DVXA 1GTIA 4E8EA 5E59A 4BA7A 3A3TA 1FO5A 3P8WA 5KN3A 3VK9A 5JWRB 4XRDA 1M9BA 1Z3EA 2LQOA 3GFKA 2E7PA 3GMFA 3UEMA 1GULA 4CHSA 3WT1A 1GTUA 3VPTA 2HRAA 1B9YC 5DDLA 2IMIA 4DSRA 3ZL5A 3CMIA 1G6YA 1XOAA 4IP6A 4I5QA 1QXHA 3L9SA 1ILOA 4O92A 5ECMB 2L6DA 2RUFA 2CVBA 3UARA 1HQOA 3O3TA 4ISDA 5D8IA 2E2GA 1GSUA 3GKMA 3FKFA 4NHWA 2GT6A 1GSQA 4OO4A 1MTCA 1FVKA 1WP0A 3F4RA 2H72A 2JL4A 4NMUA 4GCIA 4IQAA 4DEJA 5J5NA 1GUMA 4GRFA 2VLVA 4LL1B 1GSDA 5C04A 2FWGA 1AAZA 1XW9A 1FB6A 2V32A 1W4VA 3IV4A 4X1UA 2WFCA 1Y1UA 5J41A 3LORA 3IHGA 2O5VA 4W66A 5ID2A 5ELAA 2YWIA 3EINA 2HT9A 3DYRA 1XXUA 2R4VA 3EMXA 2HLSA 2WCIA 4MA9A 4CY6A 11GSA 1R5AA 4MCUA 1URMA 2C1YA 4POKA 1PX7A 4JRRA 5KOWA 4HJMA 4POBA 3GH6A 3L9VA 4MF6A 3TJFA 4IJ3A 4PNGA 1QMVA 1T8EB 1GRXA 3GL5A 4A5PA 5C00A 1YZXA 4OMVA 2J9HA 4TW5A 3QD9A 2KP2A 4X43A 4ZB9A 4ZB8A 4FYCA 4ID0A 5B7CA 2DJJA 4V1Ag 1F3AA 1WPIA 1FOHA 5G2ZA 4KH7A 2A2PA 3TRPA 3GKKA 3A2WA 5GSSA 1O8XA 4HEA2 1I9DA 1PKZA 2X4AA 2A2RA 4CW9A 4XRAA 3UVHA 2GVPA 3GA4A 3CSHA 2CVKA 1SK1A 2R2JA 2CVDA 2XPEA 2C0EA 2CQ9A 2YWNA 3L9UA 3ZIVA 4BVXA 2OBIA 2H19A 5DBQA 4YAPA 2ZUPA 4JR4A 3RBTA 3TDGA 4Z2UA 1V40A 2CT6A 4GTUA 2YN1A 4YKGA 2N5FA 1NM3A 2X99A 2VL2A 2NDOA 1TI3A 2B1LA 2GZPA 4NV2A 4IQ1A 4X4JA 3TKQA 2DJ0A 4L0UA 5IMCA 4H86A 4D73A 1M3IA 3LW9A 5B6NA 3DGQA 2B6MA 1XWGA 3CTFA 5IOXA 3EURA 4LMVA 1GTAA 3WYWA 4F0CA 2IL3A 3TOTA 1RK4A 3IHQA 2HFDA 1FHEA 1J0FA 7GSSA 3ZMKA 3A2XA 2GTUA 1O8WA 2GT5A 4IS0A 1MDKA 2O3EA 3HDCA 3E0UA 1K3YA 2HXKA 3HHVA 4ECCA 3FEUA 5AGYA 1UA5A 2VKZG 2RIIA 4KCEA 2GGTA 3HJPA 1A24A 1G7OA 4PQIA 4ECJA 2QSIA 4YQMA 1TW9A 1SU9A 4IHUA 2WVXA 1GNEA 2CAIA 4GLTA 1PN0A 3ERFA 4KUNA 4V2LA 3RPPA 3HVSA 2WS2A 1A23A 3KJYA 2I1UA 4TR3A 2WULA 17GSA 4ZB6A 3O76A 2WRTA 3PH9A 1MDJA 5D9WA 1YF0A 2I3YA 2XBIA 3CQFA 4JE1A 3GURA 2MBTA 1GUHA 3HA9A 2MYGA 3BCKA 5ECPB 2H0IA 2FHEA 3IK7A 2EIRA 3ME8A 5A4WA 3EU4A 5COHA 3GN3A 1S4BP 4NAXA 2PERA 4RQRA 5F06A 1A0RP 3GUSA 1TI1A 2X49A 3KD0A 2C0DA 5ID2B 1K0DA 3JCML 3IOSA 5D96A 1AQVA 1PX6A 3FZAA 3KP9A 4NWYA 1PL1A 4PHZC 1SK2A 1G0TA 1M2BA 2NPBA 3F6FA 2YV9A 1ON4A 4K0NA 2L5LA 1SJ6A 4TVEA 1GNWA 2H73A 3TJJA 3GYKA 4HU7A 2WW3A 2R3XA 5GSTA 2E0QA 4GSNA 1A2MA 3MDKA 4IN0A 5CNWA 2LNSA 2YV7A 1CQHA 2LS5A 2X8CA 1MEKA 4EDZA 2HRNA 3LGCA 3ZFLA 3UL3A 3ZREA 4JR6A 2JADA 1YJ6A 1B4PA 2OADA 1AIUA 5A1NA 2IMEA 1IYHA 4ULXA 4I2TA 3CRTA 3UBKA 2PBJA 14GSA 2DJ1A 2JACA 1TRVA 4POLA 3F8UA 3ZLPA 4ICYA 1TJDA 4IW9A 3CHXC 2LJRA 5ECHB 20GSA 3DMLA 5IMZA 2KP1A 5F05A 5ENUA 2OA7A 2LEGA 1JZWA 3BBYA 1GTBA 2H6ZA 4ACSA 2G2QA 19GSA 2P0GA 1U3AA 4BVXB 1BAYA 3KMOA 1TK0B 3ZIJA 2TRXA 2LSTA 1EEMA 1Z9HA 2K9FA 3VWUA 1F6MC 9GSSA 2V2GA 4BIKA 3GX0A 12GSA 1PRXA 2AJQB 4KW6A 4EUYA 1HNBA 4USSA 3EPTA 5DVBA 5LNKe 2J23A 1TOFA 4G19A 3ZVJD 2V1MA 3IE3A 2B5EA 5LCZA 5HFKA 1JFUA 2H0HA 4K2DA 5F0GA 2QA1A 4ML6A 3LEFA 4K7OA 2C3NA 2R0CA 4D73B 3VWXA 3BCIA 2LJKA 1A0FA 4FH8A 1N25A 4ZIJA 4G2EA 3QCPA 4OO5A 2NVLA 2QA2A 1F9MA 1TK8B 3IXRA 3LWAA 1PA3A 3APQA 5A5HA 2MBSA 4IGJA 4BWQA 3DWVA 2I9HA 1ZOFA 2D2ZA 3O6TA 3D0ZA 3DRNA 4WXTA 4TN8A 3D5JA 3UOMA 2WVXB 4F9ZA 5IPGA 1ST9A 4RI6A 4MPGA 3VWWA 3GSSA 3I69A 2H6XA 2IFQA 1S3CA 1WOUA 2XC2A 5F07A 2EFDA 3FHKA 3H93A 1EGOA 5DJLA 3KTLA 4EL1A 1FW1A 4YKFA 4FYUA 5IOWA 3MIXA 1X5DA 1LU4A 4I6XA 1QFNA 2H71A 4WBJA 3ZMLA 3L4NA 3CYNA 1EEJA 3DEXA 3G7YA 4KNDA 4TR0A 3L78A 1GSYA 1F2EA 3TKPA 5A4VA 2HZFA 2Z9SA 3K8NA 1WJKA 4BL7A 4JEDA 4YAVA 1OAZA 5J9CA 4HJ2A 3N5OA 2GSSA 1NW2A 2XBQA 6GSTA 1K0CA 1DSBA 3UIWA 3W6GA 2L5OA 5B8AA 2G0FA 3C1SA 3BOAA 1DE1A 1EV4A 3QAVA 2JU5A 4MJBA 3D22A 5EVOA 4GF0A 1SVLA 1AW9A 5EL8A 3HVVA 1EV9A 4K7IA 3EWLA 3KMNA 1B8XA 2N5AA 3F4TA 1SYXA 2DC5A 16GSA 5JCGA 2C4JA 2RLIA 3C1RA 2OKAA 5A1NB 5FWGA 2ZCTA 2K18A 3ZFBA 2C3TA 1Q4JA 2WJUA 4EIQA 5J40A 4AKHA 1JZOA 3PR8A 3RHCA 2LUSA 4P3YB 3RGBC 3A5IA 4EDYA 4MZBA 2WZ9A 3WT2A 2QC7A 3C8EA 2WW2A 2LQQA 1SKWB 4XS4A 2KLXA 4AJ8A 2EIQA 2MMZA 2C80A 2DIZA 3F3QA 4PUFC 2F8FA 5ECIB 5A34B 4TOPA 4OFNA 1KNGA 1OE8A 1A8YA 2HZEA 1AXDA 1OC3A 3VFIA 1ZL9A 3MSZA 1GWCA 4KCAA 1HNCA 2VL3A 1I1IP 2C0GA 5ELGA 1FB0A 3F4SA 4I97A 5H5QA 3H79A 3C71A 2H1LA 5J4VA 4DSQA 3I9V2 4O7HA 2FWHA 3VLNA 3KEBA 4IJIA 3VURA 6GSVA 3IPZA 4G0LA 1GLQA 2JZSA 4N30A 2OT3A 3WD6A 2P5RA 5A5HB 4O5UA 5D73A 2DBCA 2VCVA 4ML1A 2H1BA 1GL8A 3HD5A 5CREA 4NPBA 2WVYA 4V2MA 4F82A 3TRXA 3S9FA 4AKIA 4OFMA 1J9BA 1DUGA 1QUWA 2IFQB 3ERWA 5IPHA 2UV8G 3MYDA 4CDOA 1KBNA 1X9MB 3M3MA 4TXOA 4OD7A 2LRCA 2CZ3A 4RQXA 1M2AA 4J2FA 2PGTA 2PVOC 1NHYA 1OKTA 1ERVA 2A4VA 2LTKA 2K8VA 2H0GA 4YH2A 5HR1A 3HMJG 2HRKA 2HSYA 1AUCA 5CYYA 5ECLB 4EIPA 1W89A 4GWRA 3E9JB 3FW2A 3QMXA 2YZHA 1XW5A 2L4QA 2JZTA 3QFBC 2O89A 3PINA 1DBYA 3KIJA 2HQTA 5JWQB 1X9WB 4BL7B 4KX4A 1USBA 1G7EA 4Q5QA 1E2YA 3I43A 3N9JA 2DKHA 1MD3A 3G9BA 2V41A 4WEYA 5CAXA 1ML6A 2C0FA 2MMNA 1YKCA 3Q18A 5HR3A 4KGIA 1SL2B 1R4WA 1WWJA 1XW6A 2PWJA 2IJYA 2WB9A 4PX1A 1ERTA 1M7TA 3HVNA 4TR1A 3ED3A 4GDFA 2VM1A 1ERUA 2H66A 4FIWA 5KOXA 3HZ4A 3TGZA 1ABAA 4G10A 4AF2A 3TJKA 1SKSB 2GQMA 4MF5A 2K6VA 3VPQA 2P31A 1ZMAA 3Q19A 2ES7A 4IELA 2YWMA 4O32A 5ECOB 2AUVA 3MAKA 5AIVA 4MJEA 3LFLA 5J47A 1SL0B 4HUAA 4IVFA 1K0MA 4MPFA 2YZUA 3HZ8A 5B8BA 4O5RA 1K3LA 2CX4A 5DALA 3H4KA 1G6WA 3TJBA 1BG5A 4JU5A 1PKWA 3HJMA 1GSFA 4QL7A 2VO4A 2VCZA 2AB6A 1BG1A 4G0IA 2F8AA 2WGRA 3NOFA 5A5KA 2WVZA 2EIOA 5JCWA 5ECKB 4AJ7A 4XS4B 1Z5YE 4F03A 5J3RA 4ZL8A 1EP7A 4KAEA 2C8UA 4ZXGA 3QR6A 4K9ZA 2PMTA 2PPTA 4AKXB 4MJCA 2FA4A 4EKZA 4NXIA 4N0ZA 1QQ2A 3GRXA 3KP8A 2FNOA 2HZEB 1O85A 2OJLA 4TXVA 1RQMA 1FOVA 1VGLA 1ZYEA 3GV1A 1ACVA 3CSJA 1BJXA 2GZYA 5DCHA 4XS1A 1M0UA 4KDUA 3M8NA 2EFCA 4LMWA 4K5RA 3UBLA 1V9WA 4XIHA 4KE3A 3SWLA 2FA8A 2R5GA 1YY7A 1X5EA 3NZNA 4EVMA 3QPMA 3LXTA 2OE0A 4HQSA 4I2UA 1EGRA 1XWAA 3W8SA 1PMTA 1AC1A 2YWOA 2PN8A 2B5YA 3GIXA 4KDYA 1XIYA 1NHOA 1Z7PA 1Q98A 3FZ5A 4L5LA 1SD8A 1TP9A 3QDNA 4HZ2A 2GDRA 5FT3A 1TTZA 1PQNA 3M1GA 1XWCA 5DCGA 5J9BA 2DMLA 6GSYA 4TXOB 3IK9A 1DE2A 2M46A 2PU9C 2LJAA 3KZQA 3TRQA 3CRUA 3FMWA 2DIYA 1SJIA 1WIKA 1M3JA 2L6CA 1JZRA 4WKWA 2OE1A 2VOCA 2A2SA 3KM6A 4ZL7A 2HNLA 2HRKB 3AY8A 3G7IA 1XG8A 4TRXA 2B5XA 4HI7A 2O8VB 3TJGA 3C7MA 3A5WA 4EF0A 1FVJA 3DD3A 4XTSA 2DKIA 5HR0A 1K0OA 1V98A 3GH9A 3WGXA 1XVQA 2FUG2 2R6KA 1HNAA 2L59A 3D6IA 3FK8A 3ISOA 3IAS2 1PGTA 3V1WA 4KA0A 2WDUA 4TR1B 1JHBA 1O6JA 3HY2A 4GQFA 2O85A 3MWHA 1T1VA 4HS1A 2CA8A 2H75A 2YJ7A 2FWFA 4ECIA 5ECNB 3GKNA 1BQ7A 1MD4A 1XWKA 2GLRA 4Z2TA 4FXYP 2DSAA 4WETA 5D9TA 2H6YA 2A4HA 4O5QA 1U6TA 1RW1A 6GSUA 1U88A 2EC4A 4TKYA 4DVCA 5HQPA 4EXJA 3BD2A 1H4OA 2F3MA 4MJAA 3VI7A 1GP1A 4XHMA 2VD0A 4MLYA 1Z6NA 1I5GA 2KUCA 5B6MA 3KCMA 1A8LA 1O73A 1Z6MA 5DALB 1KEBA 4N10A 3HXSA 2FWEA 3R3EA 3CBUA 2DLXA 3Q6OA 5KN0A 3TUEA 1EP8A 1O81A 1UVZA 2H8LA 4Z7XA 4DSSA 1E6BA 2YJHA 4PQ1A 2H30A 3J7Yk 2DJ3A 1K3OA 4L8EA 4WF5A 2VCTA 4OFTA 3M9KA 3HKRA 2VL9A 2OE3A 3F9UA 1TRWA 3UMAA 5KN2A 1M2DA 5G1LA 3IR4A 5DJMA 3ERGA 3G7JA 4YQUA 3FY7A 2HSNA 2DJ2A 5IO2A 1K0BA 4ZBBA 3EVIA 5IIZA 5ECQB 3FR6A 5JCUA 3M0FA 2QKEA 5G30A 2F9SA 4AGSA 2EFHA 4J56E 2UZ8A 4NV5A 4HOJA 2OBKA 1XCCA 1F37A 5AN1A 2GZZA 1F3BA 2YCDA 4L5OA 2IN3A 4E8HA 2AV4A 2ALBA 1B48A 5H5SA 5A4UA 5AIXA 1SJZA 5CRHA 4HZ4A 3UJ1A 4BVYA 1N2AA 2CZ2A 2LV3A 4WR5A 3GL3A 2VD1A 1SK0A 3F63A 2CX3A 4ZBDA 2GQLA 1QK8A 5GAND 3APSA 2HSMA 1XPVA 3R2QA 3ZITA 4QMKA 3FR9A 3GX8A 5ABRA 4ZBAA 2IPAA 4KB3A 1OC9A 3KH9A 4PI2C 3RPNA 3TKSE 13GSA 4N3ZA 4MH3A 2VLUA 4K8MA 3TU3B 1AQXA 4RUVA 3IRAA 1THXA 1QGVA 5G1KA 3EYTA 2VL2C 3GNJA 2H1GA 2ON5A 6GSXA 1TRUA 2F51A 1YQ1A 1GUKA 5BMUA 3LYPA 4GQCA 2AAWA 3HVXA 1X0RA 2N5BA 5HR2A 4WBRD 3TKSA 2H1DA 4G9HA 5FHIA 3FZ9A 1B9XC 1OE7A 1YEXA 3IDVA 4PURA 2L57A 3HYPA 2YPMA 3KXOA 5EPFA 2XHFA 4FQUA 1TXXA 4Z2RA 2ZNMA 5HFGA 3IAM2 3UAPA 3GKXA 1KTEA 1VF4A 6GSWA 4YQVA 4GSTA 2MMAA 2RUEA 3P7XA 2IMFA 4K2XA 2MZCA 2WW1A 2GS3A 4GXZA 1NSWA 4HU9A 3PGTA 1TXUA 1WRYA 2YP6A 5IO0A 5IMVA 2FGXA 4EE0A 2LRTA 3GHAA 2H74A 1A2JA 4G01A 1H75A 1U3IA 18GSA 2JZRA 4OCFA 2YNXA 5D9VA 2WW0A 3NIVA 3D21A 4ZILA 4J57E 5IMDA 2NTOA 3EC3A 4G0KA 3VWVA 1X9SB 3CXGA 1PSQA 4AJ6A 4BWSA 2FLSA 2H1AA 3H1NA 4AKGA 2PUKC 1Y25A 1SENA 3RFRC 3DKSA 1ERWA 1OYJA 5ECRB 1C72A 5D93A 2VUPA 5DQYA 2VCQA 1WMJA 3QOUA 4MP4A 5DQSA 1T4ZA 3RDWA 4PQHA 2VCXA 2O87A 2H70A 4MDCA 2REMA 2GSQA 3TCOA 22GSA 4JBBA 2LRNA 2KOKA 3VI5A 1GSEA 2R0GA 1BF5A 3FR3A 1YEWC 2IMKA 2MMOA 2E2MA 4DSSB 1ZCPA 2XPDA 2R37A 3C73A 4TR4A 3SBCA 3WGEA 1ZYNA 1T3BA 1YKAA 1JLVA 3ZTLA 3L0HA 2R0PA 5GZZB 2TRCP 4KDXA 3IA1A 4K7NA 2B3SA 2BTOT 2HSNB 5L71A 1CQGA 2OACA 4K6XA 5CO3A 1UC7A 1PL2A 1Z7RA 4PTSA 4F0BA 1SL1B 4HDEA 2JSZA 4MH2A 5IMFA 1V58A 3P2AA 3J7Yb 4LLRA 2IWTA 4NHZA 1VF3A 1PN9A 2CAQA 3BJ5A 1EOHA 1YF1A 3LG6A 2QGVA 3GTUA 2I81A 1XOBA 3KGKA 1PD21 1B4QA 1OKDA 1S3RA 1ZYPA 1BX9A 1HD2A 1V57A 4BVYB 2L4CA 1O7UA 3E3EA 3CSIA 4N0VA 2YANA 5CRGA 5J4YA 2O7KA 3IBHA 4IBPA 5JWOB 1XZOA 2HI7A 1U87A 5GAPD 2HSMB 1IYIA 3ZVJA 5G5FA 1BEDA 2V6OA 4QL9A 5IMAA 3UVTA 5IQYA 1OC9B 4MK3A 3GSTA 1SKRB 2FY6A 2VIMA 3EMPA 4MZCA 3DXBA 4V1Ap 1N8JA 3ME7A 5DAKA 5E4WA 1SVOA 4GSSA 5BMUB 1UN2A 5KN1A 4ECBA 3HCZA 5LD0A 2V6KA 4MZWA 1GLPA 2H76A 4PGTA 4XS6A 2CV4A 3DVWA 1K0AA 2X8GA 3U5RE 1T4YA 4KSOA 2X8HA 4IKHA 4BPYA 2DJKA 2FD3A 4I8BA 3LQ7A 2WZSA 3D4TA 3A2VA 3EE2A 2VM2A 8GSSA 3FZ4A 4PI0C 4N11A 4XCSA 2HYXA 1MDIA 3LJRA 4ILFA 3QAWA 2B7KA 5J4UA 2EFEA 1TKDB 3U6VA 3RAZA 4LL4B 1XFLA 4Q5NA 3KH7A 1ZZYA 1FG4A 5F8BA 1R26A 2YOIA 2VAFA 2NBSA 1X5CA 1VF2A 4L0WA 3W8JA 2VCWA 1AQWA 4K5SA 4PXOA 1S3AA 1R5PA 3OR5A 4MNNA 1T7PB 4OWYA 1V2AA 5G31A 3M9JA 2AYTA 1J08A 1YDKA 4KSMA 1TRSA 1XBSA 5EY6A 4LA1A 4MF7A 2AHEA 1EZKA 3I6AA 4Q5FA 2HRFA 4RI7A 4MMMA 10GSA 2B7JA 1VRSD 3LSZA 2JSYA 5A34A 2X64A 2LKUA
chains in the Genus database with same CATH topology
3CWGA 1A2LA 4X0XA 1WE0A 1Y6EA 3H8QA 2P5QA 2RM5A 2I4AA 1R7HA 5IM9A 4FO5A 1GSSA 4QQ7A 2IMDA 3RHBA 5H5RA 3P90A 4POMA 2K8SA 1M9AA 3MNGA 5ECSA 3LYKA 1LBKA 3US3A 2HE3A 2LNTA 3IC8A 5KEJA 2ON7A 5INYA 2C3QA 2DMMA 4V2NA 2IIYA 3HJOA 1FAAA 3F3RA 1ZYQB 2BMXA 2B1KA 1BYEA 4WR4A 3KTBA 4HQZA 2GSTA 4KF9A 3DIEA 4FYBA 1GH2A 4E68A 1K0NA 3Q74A 3WGDA 3FRCA 3F0IA 4JZQA 2M72A 4CY8A 4ZL9A 4PUAA 3TOUA 1T00A 1YEPA 3ZRDA 1TK5B 4AI6A 3TKRA 1YVLA 5G5EA 2TIRA 3LXZA 1TU7A 4IP1A 2M80A 3F6DA 4EC0A 1VF1A 3GTUB 1EOGA 3QAGA 2KHPA 1TU8A 2FCHA 4EO3A 4MABA 5D9XA 4ZB7A 3EU3A 2H01A 1SD9A 3APOA 5CP1A 2PVQA 4F2IA 1LJRA 3CTGA 1XVWA 2BJXA 4K0GA 1TDIA 1EWXA 3FYGA 4K1FA 5AISA 3IC4A 1SVMA 2GQKA 1XWBA 3ZZXA 5CRDA 1JZDA 1JLWA 5HFIA 5BRTA 4OCEA 1M99A 3PPUA 2RM6A 4Q5RA 1OC8A 5DAKB 3TB2A 1S3DA 1SYRA 6GSSA 3QFAC 2VLTA 4WF4A 5CRWA 2GSRA 1ZGNA 3D4MA 4PNFA 1HYUA 3ZYWA 3TKSC 2HSHA 1OVNA 1THOA 3DVXA 1GTIA 4E8EA 5E59A 4BA7A 3A3TA 1FO5A 3P8WA 5KN3A 3VK9A 5JWRB 4XRDA 1M9BA 1Z3EA 2LQOA 3GFKA 2E7PA 3GMFA 3UEMA 1GULA 4CHSA 3WT1A 1GTUA 3VPTA 2HRAA 1B9YC 5DDLA 2IMIA 4DSRA 3ZL5A 3CMIA 1G6YA 1XOAA 4IP6A 4I5QA 1QXHA 3L9SA 1ILOA 4O92A 5ECMB 2L6DA 2RUFA 2CVBA 3UARA 1HQOA 3O3TA 4ISDA 5D8IA 2E2GA 1GSUA 3GKMA 3FKFA 4NHWA 2GT6A 1GSQA 4OO4A 1MTCA 1FVKA 1WP0A 3F4RA 2H72A 2JL4A 4NMUA 4GCIA 4IQAA 4DEJA 5J5NA 1GUMA 4GRFA 2VLVA 4LL1B 1GSDA 5C04A 2FWGA 1AAZA 1XW9A 1FB6A 2V32A 1W4VA 3IV4A 4X1UA 2WFCA 1Y1UA 5J41A 3LORA 3IHGA 2O5VA 4W66A 5ID2A 5ELAA 2YWIA 3EINA 2HT9A 3DYRA 1XXUA 2R4VA 3EMXA 2HLSA 2WCIA 4MA9A 4CY6A 11GSA 1R5AA 4MCUA 1URMA 2C1YA 4POKA 1PX7A 4JRRA 5KOWA 4HJMA 4POBA 3GH6A 3L9VA 4MF6A 3TJFA 4IJ3A 4PNGA 1QMVA 1T8EB 1GRXA 3GL5A 4A5PA 5C00A 1YZXA 4OMVA 2J9HA 4TW5A 3QD9A 2KP2A 4X43A 4ZB9A 4ZB8A 4FYCA 4ID0A 5B7CA 2DJJA 4V1Ag 1F3AA 1WPIA 1FOHA 5G2ZA 4KH7A 2A2PA 3TRPA 3GKKA 3A2WA 5GSSA 1O8XA 4HEA2 1I9DA 1PKZA 2X4AA 2A2RA 4CW9A 4XRAA 3UVHA 2GVPA 3GA4A 3CSHA 2CVKA 1SK1A 2R2JA 2CVDA 2XPEA 2C0EA 2CQ9A 2YWNA 3L9UA 3ZIVA 4BVXA 2OBIA 2H19A 5DBQA 4YAPA 2ZUPA 4JR4A 3RBTA 3TDGA 4Z2UA 1V40A 2CT6A 4GTUA 2YN1A 4YKGA 2N5FA 1NM3A 2X99A 2VL2A 2NDOA 1TI3A 2B1LA 2GZPA 4NV2A 4IQ1A 4X4JA 3TKQA 2DJ0A 4L0UA 5IMCA 4H86A 4D73A 3LW9A 5B6NA 3DGQA 2B6MA 1XWGA 3CTFA 5IOXA 3EURA 4LMVA 1GTAA 3WYWA 4F0CA 2IL3A 3TOTA 1RK4A 3IHQA 2HFDA 1FHEA 1J0FA 7GSSA 3ZMKA 3A2XA 2GTUA 1O8WA 2GT5A 4IS0A 1MDKA 3HDCA 3E0UA 1K3YA 2HXKA 3HHVA 4ECCA 3FEUA 5AGYA 1UA5A 2VKZG 2RIIA 4KCEA 2GGTA 3HJPA 1A24A 1G7OA 4PQIA 4ECJA 2QSIA 4YQMA 1TW9A 1SU9A 4IHUA 1GNEA 2CAIA 4GLTA 1PN0A 3ERFA 4KUNA 4V2LA 3RPPA 3HVSA 2WS2A 1A23A 3KJYA 2I1UA 4TR3A 2WULA 17GSA 4ZB6A 3O76A 2WRTA 3PH9A 1MDJA 5D9WA 1YF0A 2I3YA 2XBIA 4JE1A 3GURA 2MBTA 1GUHA 3HA9A 2MYGA 3BCKA 5ECPB 2H0IA 2FHEA 3IK7A 2EIRA 3ME8A 5A4WA 3EU4A 5COHA 3GN3A 4NAXA 2PERA 4RQRA 5F06A 1A0RP 3GUSA 1TI1A 2X49A 3KD0A 2C0DA 5ID2B 1K0DA 3JCML 3IOSA 5D96A 1AQVA 1PX6A 3FZAA 3KP9A 4NWYA 1PL1A 1SK2A 1G0TA 1M2BA 2NPBA 3F6FA 2YV9A 1ON4A 4K0NA 2L5LA 1SJ6A 4TVEA 1GNWA 2H73A 3TJJA 3GYKA 4HU7A 2R3XA 5GSTA 2E0QA 4GSNA 1A2MA 3MDKA 4IN0A 5CNWA 2LNSA 2YV7A 1CQHA 2LS5A 2X8CA 1MEKA 4EDZA 2HRNA 3LGCA 3ZFLA 3UL3A 3ZREA 4JR6A 2JADA 1YJ6A 1B4PA 2OADA 1AIUA 5A1NA 2IMEA 1IYHA 4ULXA 4I2TA 3CRTA 3UBKA 2PBJA 14GSA 2DJ1A 2JACA 1TRVA 4POLA 3F8UA 3ZLPA 4ICYA 1TJDA 4IW9A 2LJRA 5ECHB 20GSA 3DMLA 5IMZA 2KP1A 5F05A 5ENUA 2OA7A 2LEGA 1JZWA 3BBYA 1GTBA 2H6ZA 4ACSA 2G2QA 19GSA 2P0GA 1U3AA 4BVXB 1BAYA 3KMOA 1TK0B 3ZIJA 2TRXA 2LSTA 1EEMA 1Z9HA 2K9FA 3VWUA 1F6MC 9GSSA 2V2GA 3GX0A 12GSA 1PRXA 2AJQB 4KW6A 4EUYA 1HNBA 4USSA 3EPTA 5DVBA 5LNKe 2J23A 1TOFA 4G19A 3ZVJD 2V1MA 3IE3A 2B5EA 5LCZA 5HFKA 1JFUA 2H0HA 4K2DA 5F0GA 2QA1A 4ML6A 3LEFA 4K7OA 2C3NA 2R0CA 4D73B 3VWXA 3BCIA 2LJKA 1A0FA 4FH8A 1N25A 4ZIJA 4G2EA 3QCPA 4OO5A 2NVLA 2QA2A 1F9MA 1TK8B 3IXRA 3LWAA 1PA3A 3APQA 5A5HA 2MBSA 4IGJA 4BWQA 3DWVA 2I9HA 1ZOFA 2D2ZA 3O6TA 3D0ZA 3DRNA 4WXTA 4TN8A 3D5JA 3UOMA 4F9ZA 5IPGA 1ST9A 4RI6A 4MPGA 3VWWA 3GSSA 3I69A 2H6XA 2IFQA 1S3CA 1WOUA 2XC2A 5F07A 2EFDA 3FHKA 3H93A 1EGOA 5DJLA 3KTLA 4EL1A 1FW1A 4YKFA 4FYUA 5IOWA 3MIXA 1X5DA 1LU4A 4I6XA 1QFNA 2H71A 4WBJA 3ZMLA 3L4NA 3CYNA 1EEJA 3DEXA 3G7YA 4KNDA 4TR0A 3L78A 1GSYA 1F2EA 3TKPA 5A4VA 2HZFA 2Z9SA 3K8NA 1WJKA 4BL7A 4JEDA 4YAVA 1OAZA 5J9CA 4HJ2A 3N5OA 2GSSA 1NW2A 2XBQA 6GSTA 1K0CA 1DSBA 3UIWA 3W6GA 2L5OA 5B8AA 2G0FA 3C1SA 3BOAA 1DE1A 1EV4A 3QAVA 2JU5A 4MJBA 3D22A 5EVOA 4GF0A 1SVLA 1AW9A 5EL8A 3HVVA 1EV9A 4K7IA 3EWLA 3KMNA 1B8XA 2N5AA 3F4TA 1SYXA 2DC5A 16GSA 5JCGA 2C4JA 2RLIA 3C1RA 2OKAA 5A1NB 5FWGA 2ZCTA 2K18A 3ZFBA 2C3TA 1Q4JA 2WJUA 4EIQA 5J40A 4AKHA 1JZOA 3PR8A 3RHCA 2LUSA 4P3YB 3A5IA 4EDYA 4MZBA 2WZ9A 3WT2A 2QC7A 3C8EA 2LQQA 1SKWB 4XS4A 2KLXA 4AJ8A 2EIQA 2MMZA 2C80A 2DIZA 3F3QA 4PUFC 2F8FA 5ECIB 5A34B 4TOPA 4OFNA 1KNGA 1OE8A 1A8YA 2HZEA 1AXDA 1OC3A 3VFIA 1ZL9A 3MSZA 1GWCA 4KCAA 1HNCA 2VL3A 2C0GA 5ELGA 1FB0A 3F4SA 4I97A 5H5QA 3H79A 3C71A 2H1LA 5J4VA 4DSQA 3I9V2 4O7HA 2FWHA 3VLNA 3KEBA 4IJIA 3VURA 6GSVA 3IPZA 4G0LA 1GLQA 2JZSA 4N30A 2OT3A 3WD6A 2P5RA 5A5HB 4O5UA 5D73A 2DBCA 2VCVA 4ML1A 2H1BA 1GL8A 3HD5A 5CREA 4NPBA 4V2MA 4F82A 3TRXA 3S9FA 4AKIA 4OFMA 1J9BA 1DUGA 1QUWA 2IFQB 3ERWA 5IPHA 2UV8G 3MYDA 4CDOA 1KBNA 1X9MB 3M3MA 4TXOA 4OD7A 2LRCA 2CZ3A 4RQXA 1M2AA 4J2FA 2PGTA 2PVOC 1NHYA 1OKTA 1ERVA 2A4VA 2LTKA 2K8VA 2H0GA 4YH2A 5HR1A 3HMJG 2HRKA 2HSYA 1AUCA 5CYYA 5ECLB 4EIPA 1W89A 4GWRA 3E9JB 3FW2A 3QMXA 2YZHA 1XW5A 2L4QA 2JZTA 3QFBC 2O89A 3PINA 1DBYA 3KIJA 2HQTA 5JWQB 1X9WB 4BL7B 4KX4A 1USBA 1G7EA 4Q5QA 1E2YA 3I43A 3N9JA 2DKHA 1MD3A 3G9BA 2V41A 4WEYA 5CAXA 1ML6A 2C0FA 2MMNA 1YKCA 3Q18A 5HR3A 4KGIA 1SL2B 1R4WA 1WWJA 1XW6A 2PWJA 2IJYA 2WB9A 4PX1A 1ERTA 1M7TA 4TR1A 3ED3A 4GDFA 2VM1A 1ERUA 2H66A 4FIWA 5KOXA 3HZ4A 3TGZA 1ABAA 4G10A 4AF2A 3TJKA 1SKSB 2GQMA 4MF5A 2K6VA 3VPQA 2P31A 1ZMAA 3Q19A 2ES7A 4IELA 2YWMA 4O32A 5ECOB 2AUVA 3MAKA 5AIVA 4MJEA 3LFLA 5J47A 1SL0B 4HUAA 4IVFA 1K0MA 4MPFA 2YZUA 3HZ8A 5B8BA 4O5RA 1K3LA 2CX4A 5DALA 3H4KA 1G6WA 3TJBA 1BG5A 4JU5A 1PKWA 3HJMA 1GSFA 4QL7A 2VO4A 2VCZA 2AB6A 1BG1A 4G0IA 2F8AA 2WGRA 3NOFA 5A5KA 2EIOA 5JCWA 5ECKB 4AJ7A 4XS4B 1Z5YE 4F03A 5J3RA 4ZL8A 1EP7A 4KAEA 2C8UA 4ZXGA 3QR6A 4K9ZA 2PMTA 2PPTA 4AKXB 4MJCA 2FA4A 4EKZA 4NXIA 4N0ZA 1QQ2A 3GRXA 3KP8A 2FNOA 2HZEB 1O85A 2OJLA 4TXVA 1RQMA 1FOVA 1VGLA 1ZYEA 3GV1A 1ACVA 3CSJA 1BJXA 2GZYA 5DCHA 4XS1A 1M0UA 4KDUA 3M8NA 2EFCA 4LMWA 4K5RA 3UBLA 1V9WA 4XIHA 4KE3A 3SWLA 2FA8A 2R5GA 1YY7A 1X5EA 3NZNA 4EVMA 3QPMA 3LXTA 2OE0A 4HQSA 4I2UA 1EGRA 1XWAA 3W8SA 1PMTA 1AC1A 2YWOA 2PN8A 2B5YA 3GIXA 4KDYA 1XIYA 1NHOA 1Z7PA 1Q98A 3FZ5A 4L5LA 1SD8A 1TP9A 3QDNA 4HZ2A 2GDRA 5FT3A 1TTZA 1PQNA 3M1GA 1XWCA 5DCGA 5J9BA 2DMLA 6GSYA 4TXOB 3IK9A 1DE2A 2M46A 2PU9C 2LJAA 3KZQA 3TRQA 3CRUA 3FMWA 2DIYA 1SJIA 1WIKA 2L6CA 1JZRA 4WKWA 2OE1A 2VOCA 2A2SA 3KM6A 4ZL7A 2HNLA 2HRKB 3AY8A 3G7IA 4TRXA 2B5XA 4HI7A 2O8VB 3TJGA 3C7MA 3A5WA 4EF0A 1FVJA 3DD3A 4XTSA 2DKIA 5HR0A 1K0OA 1V98A 3GH9A 3WGXA 1XVQA 2FUG2 2R6KA 1HNAA 2L59A 3D6IA 3FK8A 3ISOA 3IAS2 1PGTA 3V1WA 4KA0A 2WDUA 4TR1B 1JHBA 1O6JA 3HY2A 4GQFA 2O85A 3MWHA 1T1VA 4HS1A 2CA8A 2H75A 2YJ7A 2FWFA 4ECIA 5ECNB 3GKNA 1BQ7A 1MD4A 1XWKA 2GLRA 4Z2TA 2DSAA 4WETA 5D9TA 2H6YA 2A4HA 4O5QA 1U6TA 1RW1A 6GSUA 1U88A 2EC4A 4TKYA 4DVCA 5HQPA 4EXJA 3BD2A 1H4OA 2F3MA 4MJAA 3VI7A 1GP1A 4XHMA 2VD0A 4MLYA 1Z6NA 1I5GA 2KUCA 5B6MA 3KCMA 1A8LA 1O73A 1Z6MA 5DALB 1KEBA 4N10A 3HXSA 2FWEA 3R3EA 3CBUA 2DLXA 3Q6OA 5KN0A 3TUEA 1EP8A 1O81A 1UVZA 2H8LA 4Z7XA 4DSSA 1E6BA 2YJHA 4PQ1A 2H30A 3J7Yk 2DJ3A 1K3OA 4L8EA 4WF5A 2VCTA 4OFTA 3M9KA 3HKRA 2VL9A 2OE3A 3F9UA 1TRWA 3UMAA 5KN2A 1M2DA 5G1LA 3IR4A 5DJMA 3ERGA 3G7JA 4YQUA 3FY7A 2HSNA 2DJ2A 5IO2A 1K0BA 4ZBBA 3EVIA 5IIZA 5ECQB 3FR6A 5JCUA 3M0FA 2QKEA 5G30A 2F9SA 4AGSA 2EFHA 4J56E 2UZ8A 4NV5A 4HOJA 2OBKA 1XCCA 1F37A 5AN1A 2GZZA 1F3BA 2YCDA 4L5OA 2IN3A 4E8HA 2AV4A 2ALBA 1B48A 5H5SA 5A4UA 5AIXA 1SJZA 5CRHA 4HZ4A 3UJ1A 4BVYA 1N2AA 2CZ2A 2LV3A 4WR5A 3GL3A 2VD1A 1SK0A 3F63A 2CX3A 4ZBDA 2GQLA 1QK8A 5GAND 3APSA 2HSMA 1XPVA 3R2QA 3ZITA 4QMKA 3FR9A 3GX8A 5ABRA 4ZBAA 2IPAA 4KB3A 1OC9A 3KH9A 3RPNA 3TKSE 13GSA 4N3ZA 4MH3A 2VLUA 4K8MA 3TU3B 1AQXA 4RUVA 3IRAA 1THXA 1QGVA 5G1KA 3EYTA 2VL2C 3GNJA 2H1GA 2ON5A 6GSXA 1TRUA 2F51A 1YQ1A 1GUKA 5BMUA 3LYPA 4GQCA 2AAWA 3HVXA 1X0RA 2N5BA 5HR2A 4WBRD 3TKSA 2H1DA 4G9HA 5FHIA 3FZ9A 1B9XC 1OE7A 1YEXA 3IDVA 4PURA 2L57A 3HYPA 2YPMA 3KXOA 5EPFA 2XHFA 4FQUA 1TXXA 4Z2RA 2ZNMA 5HFGA 3IAM2 3UAPA 3GKXA 1KTEA 1VF4A 6GSWA 4YQVA 4GSTA 2MMAA 2RUEA 3P7XA 2IMFA 4K2XA 2MZCA 2GS3A 4GXZA 1NSWA 4HU9A 3PGTA 1TXUA 1WRYA 2YP6A 5IO0A 5IMVA 2FGXA 4EE0A 2LRTA 3GHAA 2H74A 1A2JA 4G01A 1H75A 1U3IA 18GSA 2JZRA 4OCFA 2YNXA 5D9VA 3NIVA 3D21A 4ZILA 4J57E 5IMDA 2NTOA 3EC3A 4G0KA 3VWVA 1X9SB 3CXGA 1PSQA 4AJ6A 4BWSA 2FLSA 2H1AA 3H1NA 4AKGA 2PUKC 1Y25A 1SENA 3DKSA 1ERWA 1OYJA 5ECRB 1C72A 5D93A 2VUPA 5DQYA 2VCQA 1WMJA 3QOUA 4MP4A 5DQSA 1T4ZA 3RDWA 4PQHA 2VCXA 2O87A 2H70A 4MDCA 2REMA 2GSQA 3TCOA 22GSA 4JBBA 2LRNA 2KOKA 3VI5A 1GSEA 2R0GA 1BF5A 3FR3A 2IMKA 2MMOA 2E2MA 4DSSB 1ZCPA 2XPDA 2R37A 3C73A 4TR4A 3SBCA 3WGEA 1ZYNA 1T3BA 1YKAA 1JLVA 3ZTLA 3L0HA 2R0PA 5GZZB 2TRCP 4KDXA 3IA1A 4K7NA 2B3SA 2BTOT 2HSNB 5L71A 1CQGA 2OACA 4K6XA 5CO3A 1UC7A 1PL2A 1Z7RA 4PTSA 4F0BA 1SL1B 4HDEA 2JSZA 4MH2A 5IMFA 1V58A 3P2AA 3J7Yb 4LLRA 2IWTA 4NHZA 1VF3A 1PN9A 2CAQA 3BJ5A 1EOHA 1YF1A 3LG6A 2QGVA 3GTUA 2I81A 1XOBA 3KGKA 1PD21 1B4QA 1OKDA 1ZYPA 1BX9A 1HD2A 1V57A 4BVYB 2L4CA 1O7UA 3E3EA 3CSIA 4N0VA 2YANA 5CRGA 5J4YA 2O7KA 3IBHA 4IBPA 5JWOB 1XZOA 2HI7A 1U87A 5GAPD 2HSMB 1IYIA 3ZVJA 5G5FA 1BEDA 2V6OA 4QL9A 5IMAA 3UVTA 5IQYA 1OC9B 4MK3A 3GSTA 1SKRB 2FY6A 2VIMA 3EMPA 4MZCA 3DXBA 4V1Ap 1N8JA 3ME7A 5DAKA 5E4WA 1SVOA 4GSSA 5BMUB 1UN2A 5KN1A 4ECBA 3HCZA 5LD0A 2V6KA 4MZWA 1GLPA 2H76A 4PGTA 4XS6A 2CV4A 3DVWA 1K0AA 2X8GA 3U5RE 1T4YA 4KSOA 2X8HA 4IKHA 4BPYA 2DJKA 2FD3A 4I8BA 3LQ7A 3D4TA 3A2VA 3EE2A 2VM2A 8GSSA 3FZ4A 4N11A 4XCSA 2HYXA 1MDIA 3LJRA 4ILFA 3QAWA 2B7KA 5J4UA 2EFEA 1TKDB 3U6VA 3RAZA 4LL4B 1XFLA 4Q5NA 3KH7A 1ZZYA 1FG4A 5F8BA 1R26A 2YOIA 2VAFA 2NBSA 1X5CA 1VF2A 4L0WA 3W8JA 2VCWA 1AQWA 4K5SA 4PXOA 1S3AA 1R5PA 3OR5A 4MNNA 1T7PB 4OWYA 1V2AA 5G31A 3M9JA 2AYTA 1J08A 1YDKA 4KSMA 1TRSA 1XBSA 5EY6A 4LA1A 4MF7A 2AHEA 1EZKA 3I6AA 4Q5FA 2HRFA 4RI7A 4MMMA 10GSA 2B7JA 1VRSD 3LSZA 2JSYA 5A34A 2X64A 2LKUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A2L A;  4X0X A;  1WE0 A;  1Y6E A;  3H8Q A;  2P5Q A;  2RM5 A;  2I4A A;  1R7H A;  5IM9 A;  4FO5 A;  1GSS A;  4QQ7 A;  2IMD A;  3RHB A;  5H5R A;  3P90 A;  4POM A;  2K8S A;  1M9A A;  3MNG A;  5ECS A;  3LYK A;  1LBK A;  3US3 A;  2HE3 A;  2LNT A;  3IC8 A;  5KEJ A;  2ON7 A;  5INY A;  2C3Q A;  2DMM A;  4V2N A;  2IIY A;  3HJO A;  1FAA A;  3F3R A;  1ZYQ B;  2BMX A;  2B1K A;  1BYE A;  4WR4 A;  3KTB A;  4HQZ A;  2GST A;  4KF9 A;  3DIE A;  4FYB A;  1GH2 A;  1K0N A;  3Q74 A;  3WGD A;  3FRC A;  3F0I A;  4JZQ A;  2M72 A;  4ZL9 A;  4PUA A;  3TOU A;  1T00 A;  1YEP A;  3ZRD A;  1TK5 B;  3TKR A;  5G5E A;  2TIR A;  3LXZ A;  1TU7 A;  4IP1 A;  2M80 A;  3F6D A;  4EC0 A;  1VF1 A;  3GTU B;  1EOG A;  3QAG A;  2KHP A;  1TU8 A;  2FCH A;  4EO3 A;  4MAB A;  5D9X A;  3EU3 A;  2H01 A;  1SD9 A;  3APO A;  5CP1 A;  2PVQ A;  4F2I A;  1LJR A;  3CTG A;  1XVW A;  2BJX A;  4K0G A;  1TDI A;  1EWX A;  3FYG A;  4K1F A;  5AIS A;  3IC4 A;  2GQK A;  1XWB A;  3ZZX A;  5CRD A;  1JZD A;  1JLW A;  5HFI A;  4OCE A;  1M99 A;  3PPU A;  2RM6 A;  4Q5R A;  1OC8 A;  5DAK B;  3TB2 A;  1S3D A;  1SYR A;  6GSS A;  3QFA C;  2VLT A;  4WF4 A;  5CRW A;  2GSR A;  1ZGN A;  3D4M A;  4PNF A;  1HYU A;  3ZYW A;  3TKS C;  2HSH A;  1OVN A;  1THO A;  3DVX A;  1GTI A;  4E8E A;  5E59 A;  4BA7 A;  3A3T A;  1FO5 A;  3P8W A;  5KN3 A;  3VK9 A;  5JWR B;  4XRD A;  1M9B A;  1Z3E A;  2LQO A;  3GFK A;  2E7P A;  3GMF A;  3UEM A;  1GUL A;  4CHS A;  3WT1 A;  1GTU A;  3VPT A;  2HRA A;  1B9Y C;  5DDL A;  2IMI A;  4DSR A;  3ZL5 A;  3CMI A;  1G6Y A;  1XOA A;  4IP6 A;  4I5Q A;  1QXH A;  3L9S A;  1ILO A;  4O92 A;  5ECM B;  2L6D A;  2RUF A;  2CVB A;  3UAR A;  1HQO A;  3O3T A;  4ISD A;  5D8I A;  2E2G A;  1GSU A;  3GKM A;  3FKF A;  4NHW A;  2GT6 A;  1GSQ A;  4OO4 A;  1MTC A;  1FVK A;  1WP0 A;  3F4R A;  2H72 A;  2JL4 A;  4NMU A;  4GCI A;  4IQA A;  4DEJ A;  5J5N A;  1GUM A;  4GRF A;  2VLV A;  4LL1 B;  1GSD A;  5C04 A;  2FWG A;  1AAZ A;  1XW9 A;  1FB6 A;  2V32 A;  1W4V A;  3IV4 A;  4X1U A;  2WFC A;  5J41 A;  3LOR A;  5ID2 A;  5ELA A;  2YWI A;  3EIN A;  2HT9 A;  1XXU A;  2R4V A;  3DYR A;  3EMX A;  2HLS A;  2WCI A;  4MA9 A;  11GS A;  1R5A A;  4MCU A;  1URM A;  2C1Y A;  4POK A;  1PX7 A;  4JRR A;  4HJM A;  4POB A;  3GH6 A;  3L9V A;  4MF6 A;  3TJF A;  4IJ3 A;  4PNG A;  1QMV A;  1T8E B;  1GRX A;  3GL5 A;  5C00 A;  1YZX A;  4OMV A;  2J9H A;  4TW5 A;  3QD9 A;  2KP2 A;  4X43 A;  4ZB9 A;  4ZB8 A;  4FYC A;  4ID0 A;  5B7C A;  2DJJ A;  4V1A g;  1F3A A;  1WPI A;  5G2Z A;  4KH7 A;  3TRP A;  3GKK A;  3A2W A;  5GSS A;  1O8X A;  4HEA 2;  1I9D A;  1PKZ A;  2A2R A;  4CW9 A;  4XRA A;  3UVH A;  2GVP A;  3GA4 A;  3CSH A;  2CVK A;  1SK1 A;  2R2J A;  2CVD A;  2XPE A;  2C0E A;  2CQ9 A;  2YWN A;  3L9U A;  3ZIV A;  4BVX A;  2OBI A;  2H19 A;  5DBQ A;  4YAP A;  2ZUP A;  4JR4 A;  3RBT A;  3TDG A;  1V40 A;  2CT6 A;  4GTU A;  2YN1 A;  2N5F A;  1NM3 A;  2X99 A;  2VL2 A;  2NDO A;  1TI3 A;  2B1L A;  2GZP A;  4NV2 A;  4IQ1 A;  3TKQ A;  2DJ0 A;  4L0U A;  5IMC A;  4H86 A;  4D73 A;  5B6N A;  3DGQ A;  2B6M A;  1XWG A;  3CTF A;  5IOX A;  3EUR A;  4LMV A;  1GTA A;  3WYW A;  4F0C A;  2IL3 A;  3TOT A;  1RK4 A;  3IHQ A;  2HFD A;  1FHE A;  1J0F A;  7GSS A;  3ZMK A;  3A2X A;  2GTU A;  1O8W A;  2GT5 A;  4IS0 A;  1MDK A;  3HDC A;  3E0U A;  1K3Y A;  2HXK A;  3HHV A;  4ECC A;  3FEU A;  5AGY A;  1UA5 A;  2RII A;  4KCE A;  2GGT A;  3HJP A;  1A24 A;  1G7O A;  4PQI A;  4ECJ A;  2QSI A;  4YQM A;  1TW9 A;  1SU9 A;  4IHU A;  1GNE A;  2CAI A;  4GLT A;  3ERF A;  4KUN A;  4V2L A;  3RPP A;  3HVS A;  2WS2 A;  1A23 A;  3KJY A;  2I1U A;  4TR3 A;  2WUL A;  17GS A;  4ZB6 A;  3O76 A;  2WRT A;  3PH9 A;  1MDJ A;  5D9W A;  1YF0 A;  2I3Y A;  2XBI A;  4JE1 A;  3GUR A;  2MBT A;  1GUH A;  3HA9 A;  2MYG A;  3BCK A;  5ECP B;  2H0I A;  2FHE A;  3IK7 A;  2EIR A;  3ME8 A;  5A4W A;  3EU4 A;  5COH A;  3GN3 A;  4NAX A;  2PER A;  4RQR A;  5F06 A;  1A0R P;  3GUS A;  1TI1 A;  3KD0 A;  2C0D A;  5ID2 B;  1K0D A;  3JCM L;  3IOS A;  5D96 A;  1AQV A;  1PX6 A;  3FZA A;  3KP9 A;  4NWY A;  1PL1 A;  1SK2 A;  1G0T A;  1M2B A;  2NPB A;  3F6F A;  2YV9 A;  1ON4 A;  4K0N A;  2L5L A;  1SJ6 A;  4TVE A;  1GNW A;  2H73 A;  3TJJ A;  3GYK A;  4HU7 A;  2R3X A;  5GST A;  2E0Q A;  4GSN A;  1A2M A;  3MDK A;  4IN0 A;  5CNW A;  2LNS A;  2YV7 A;  1CQH A;  2LS5 A;  2X8C A;  1MEK A;  4EDZ A;  2HRN A;  3LGC A;  3ZFL A;  3UL3 A;  3ZRE A;  4JR6 A;  2JAD A;  1YJ6 A;  1B4P A;  2OAD A;  1AIU A;  2IME A;  1IYH A;  4ULX A;  4I2T A;  3CRT A;  3UBK A;  2PBJ A;  14GS A;  2DJ1 A;  2JAC A;  1TRV A;  4POL A;  3F8U A;  3ZLP A;  1TJD A;  4IW9 A;  2LJR A;  5ECH B;  20GS A;  3DML A;  5IMZ A;  2KP1 A;  5F05 A;  5ENU A;  2OA7 A;  2LEG A;  1JZW A;  3BBY A;  1GTB A;  2H6Z A;  4ACS A;  2G2Q A;  19GS A;  2P0G A;  1U3A A;  4BVX B;  1BAY A;  3KMO A;  1TK0 B;  3ZIJ A;  2TRX A;  2LST A;  1EEM A;  1Z9H A;  2K9F A;  3VWU A;  1F6M C;  9GSS A;  2V2G A;  3GX0 A;  12GS A;  1PRX A;  2AJQ B;  4KW6 A;  4EUY A;  1HNB A;  4USS A;  5DVB A;  5LNK e;  2J23 A;  1TOF A;  4G19 A;  3ZVJ D;  2V1M A;  3IE3 A;  2B5E A;  5LCZ A;  5HFK A;  1JFU A;  2H0H A;  4K2D A;  5F0G A;  4ML6 A;  3LEF A;  4K7O A;  2C3N A;  4D73 B;  3VWX A;  3BCI A;  2LJK A;  1A0F A;  4FH8 A;  4ZIJ A;  4G2E A;  3QCP A;  4OO5 A;  2NVL A;  1F9M A;  1TK8 B;  3IXR A;  3LWA A;  1PA3 A;  3APQ A;  2MBS A;  4IGJ A;  4BWQ A;  3DWV A;  2I9H A;  1ZOF A;  2D2Z A;  3O6T A;  3D0Z A;  3DRN A;  4WXT A;  4TN8 A;  3D5J A;  3UOM A;  4F9Z A;  5IPG A;  1ST9 A;  4RI6 A;  4MPG A;  3VWW A;  3GSS A;  3I69 A;  2H6X A;  2IFQ A;  1S3C A;  1WOU A;  2XC2 A;  5F07 A;  3FHK A;  3H93 A;  1EGO A;  5DJL A;  3KTL A;  4EL1 A;  1FW1 A;  4FYU A;  5IOW A;  1X5D A;  1LU4 A;  4I6X A;  1QFN A;  2H71 A;  4WBJ A;  3ZML A;  3L4N A;  3CYN A;  1EEJ A;  3DEX A;  3G7Y A;  4KND A;  4TR0 A;  3L78 A;  1GSY A;  1F2E A;  3TKP A;  5A4V A;  2HZF A;  2Z9S A;  3K8N A;  1WJK A;  4BL7 A;  4JED A;  4YAV A;  1OAZ A;  5J9C A;  4HJ2 A;  3N5O A;  2GSS A;  1NW2 A;  2XBQ A;  6GST A;  1K0C A;  1DSB A;  3UIW A;  3W6G A;  2L5O A;  5B8A A;  2G0F A;  3C1S A;  3BOA A;  1DE1 A;  1EV4 A;  3QAV A;  2JU5 A;  4MJB A;  3D22 A;  5EVO A;  4GF0 A;  1AW9 A;  5EL8 A;  3HVV A;  1EV9 A;  4K7I A;  3EWL A;  3KMN A;  1B8X A;  2N5A A;  3F4T A;  1SYX A;  2DC5 A;  16GS A;  5JCG A;  2C4J A;  2RLI A;  3C1R A;  2OKA A;  5FWG A;  2ZCT A;  2K18 A;  3ZFB A;  2C3T A;  1Q4J A;  2WJU A;  1JZO A;  3PR8 A;  3RHC A;  2LUS A;  4P3Y B;  4EDY A;  4MZB A;  2WZ9 A;  3WT2 A;  2QC7 A;  3C8E A;  2LQQ A;  1SKW B;  4XS4 A;  2KLX A;  4AJ8 A;  2EIQ A;  2MMZ A;  2C80 A;  2DIZ A;  3F3Q A;  4PUF C;  2F8F A;  5ECI B;  4TOP A;  4OFN A;  1KNG A;  1OE8 A;  1A8Y A;  2HZE A;  1AXD A;  1OC3 A;  3VFI A;  1ZL9 A;  3MSZ A;  1GWC A;  4KCA A;  1HNC A;  2VL3 A;  2C0G A;  5ELG A;  1FB0 A;  3F4S A;  4I97 A;  5H5Q A;  3H79 A;  3C71 A;  4DSQ A;  3I9V 2;  4O7H A;  2FWH A;  3VLN A;  3KEB A;  4IJI A;  3VUR A;  6GSV A;  3IPZ A;  4G0L A;  1GLQ A;  2JZS A;  4N30 A;  3WD6 A;  2P5R A;  5D73 A;  2DBC A;  2VCV A;  4ML1 A;  2H1B A;  1GL8 A;  3HD5 A;  5CRE A;  4NPB A;  4V2M A;  4F82 A;  3TRX A;  3S9F A;  4OFM A;  1J9B A;  1DUG A;  1QUW A;  2IFQ B;  3ERW A;  5IPH A;  4CDO A;  1KBN A;  1X9M B;  3M3M A;  4TXO A;  4OD7 A;  2LRC A;  2CZ3 A;  4RQX A;  1M2A A;  4J2F A;  2PGT A;  2PVO C;  1NHY A;  1OKT A;  1ERV A;  2A4V A;  2LTK A;  2K8V A;  2H0G A;  4YH2 A;  5HR1 A;  2HRK A;  2HSY A;  1AUC A;  5CYY A;  5ECL B;  1W89 A;  4GWR A;  3E9J B;  3FW2 A;  3QMX A;  2YZH A;  1XW5 A;  2L4Q A;  2JZT A;  3QFB C;  2O89 A;  3PIN A;  1DBY A;  3KIJ A;  2HQT A;  5JWQ B;  1X9W B;  4BL7 B;  4KX4 A;  1USB A;  1G7E A;  4Q5Q A;  1E2Y A;  3I43 A;  3N9J A;  1MD3 A;  3G9B A;  2V41 A;  4WEY A;  5CAX A;  1ML6 A;  2C0F A;  2MMN A;  1YKC A;  3Q18 A;  5HR3 A;  4KGI A;  1SL2 B;  1R4W A;  1WWJ A;  1XW6 A;  2PWJ A;  2IJY A;  2WB9 A;  4PX1 A;  1ERT A;  1M7T A;  4TR1 A;  3ED3 A;  2VM1 A;  1ERU A;  2H66 A;  4FIW A;  3HZ4 A;  3TGZ A;  1ABA A;  4G10 A;  4AF2 A;  3TJK A;  1SKS B;  2GQM A;  4MF5 A;  2K6V A;  3VPQ A;  2P31 A;  1ZMA A;  3Q19 A;  2ES7 A;  4IEL A;  2YWM A;  4O32 A;  5ECO B;  2AUV A;  3MAK A;  5AIV A;  4MJE A;  3LFL A;  1SL0 B;  4HUA A;  4IVF A;  1K0M A;  4MPF A;  2YZU A;  3HZ8 A;  5B8B A;  4O5R A;  1K3L A;  2CX4 A;  5DAL A;  3H4K A;  1G6W A;  3TJB A;  1BG5 A;  4JU5 A;  1PKW A;  3HJM A;  1GSF A;  4QL7 A;  2VO4 A;  2VCZ A;  2AB6 A;  2WGR A;  4G0I A;  2F8A A;  3NOF A;  5A5K A;  2EIO A;  5JCW A;  5ECK B;  4AJ7 A;  4XS4 B;  1Z5Y E;  4F03 A;  5J3R A;  4ZL8 A;  1EP7 A;  4KAE A;  2C8U A;  4ZXG A;  3QR6 A;  4K9Z A;  2PMT A;  2PPT A;  4MJC A;  2FA4 A;  4EKZ A;  4NXI A;  4N0Z A;  1QQ2 A;  3GRX A;  3KP8 A;  2FNO A;  2HZE B;  1O85 A;  2OJL A;  4TXV A;  1RQM A;  1FOV A;  1VGL A;  1ZYE A;  3GV1 A;  1ACV A;  3CSJ A;  1BJX A;  2GZY A;  5DCH A;  4XS1 A;  1M0U A;  4KDU A;  3M8N A;  4LMW A;  3UBL A;  1V9W A;  4XIH A;  4KE3 A;  3SWL A;  2FA8 A;  2R5G A;  1YY7 A;  1X5E A;  3NZN A;  4EVM A;  4I2U A;  3LXT A;  2OE0 A;  3QPM A;  4HQS A;  1EGR A;  1XWA A;  3W8S A;  1PMT A;  1AC1 A;  2YWO A;  2PN8 A;  2B5Y A;  3GIX A;  4KDY A;  1XIY A;  1NHO A;  1Z7P A;  1Q98 A;  3FZ5 A;  4L5L A;  1SD8 A;  1TP9 A;  3QDN A;  4HZ2 A;  2GDR A;  5FT3 A;  1TTZ A;  1PQN A;  3M1G A;  1XWC A;  5DCG A;  5J9B A;  2DML A;  6GSY A;  4TXO B;  3IK9 A;  1DE2 A;  2M46 A;  2PU9 C;  2LJA A;  3KZQ A;  3TRQ A;  3CRU A;  2DIY A;  1SJI A;  1WIK A;  2L6C A;  1JZR A;  4WKW A;  2OE1 A;  2VOC A;  2A2S A;  3KM6 A;  4ZL7 A;  2HNL A;  2HRK B;  3AY8 A;  3G7I A;  4TRX A;  2B5X A;  4HI7 A;  2O8V B;  3TJG A;  3C7M A;  3A5W A;  4EF0 A;  1FVJ A;  3DD3 A;  4XTS A;  5HR0 A;  1K0O A;  1V98 A;  3GH9 A;  3WGX A;  1XVQ A;  2FUG 2;  2R6K A;  1HNA A;  2L59 A;  3D6I A;  3FK8 A;  3ISO A;  3IAS 2;  1PGT A;  3V1W A;  4KA0 A;  2WDU A;  4TR1 B;  1JHB A;  1O6J A;  3HY2 A;  4GQF A;  2O85 A;  3MWH A;  1T1V A;  4HS1 A;  2CA8 A;  2H75 A;  2YJ7 A;  2FWF A;  4ECI A;  5ECN B;  3GKN A;  1BQ7 A;  1MD4 A;  1XWK A;  2GLR A;  2DSA A;  4WET A;  5D9T A;  2H6Y A;  1U6T A;  1RW1 A;  6GSU A;  1U88 A;  2EC4 A;  4TKY A;  4DVC A;  5HQP A;  4EXJ A;  3BD2 A;  1H4O A;  2F3M A;  4MJA A;  3VI7 A;  1GP1 A;  4XHM A;  2VD0 A;  4MLY A;  1Z6N A;  1I5G A;  2KUC A;  5B6M A;  3KCM A;  1A8L A;  1O73 A;  1Z6M A;  5DAL B;  1KEB A;  4N10 A;  3HXS A;  2FWE A;  3R3E A;  3CBU A;  2DLX A;  3Q6O A;  5KN0 A;  3TUE A;  1EP8 A;  1O81 A;  1UVZ A;  2H8L A;  4Z7X A;  4DSS A;  1E6B A;  2YJH A;  4PQ1 A;  2H30 A;  3J7Y k;  2DJ3 A;  1K3O A;  4L8E A;  4WF5 A;  2VCT A;  4OFT A;  3M9K A;  3HKR A;  2VL9 A;  2OE3 A;  3F9U A;  1TRW A;  3UMA A;  5KN2 A;  1M2D A;  5G1L A;  3IR4 A;  5DJM A;  3ERG A;  3G7J A;  4YQU A;  3FY7 A;  2DJ2 A;  5IO2 A;  1K0B A;  4ZBB A;  3EVI A;  5IIZ A;  5ECQ B;  3FR6 A;  5JCU A;  3M0F A;  2QKE A;  5G30 A;  2F9S A;  4AGS A;  4J56 E;  2UZ8 A;  4NV5 A;  4HOJ A;  2OBK A;  1XCC A;  1F37 A;  5AN1 A;  2GZZ A;  1F3B A;  2YCD A;  4L5O A;  2IN3 A;  4E8H A;  2AV4 A;  2ALB A;  1B48 A;  5H5S A;  5A4U A;  5AIX A;  1SJZ A;  5CRH A;  4HZ4 A;  3UJ1 A;  4BVY A;  1N2A A;  2CZ2 A;  2LV3 A;  4WR5 A;  3GL3 A;  2VD1 A;  1SK0 A;  3F63 A;  2CX3 A;  4ZBD A;  2GQL A;  1QK8 A;  5GAN D;  3APS A;  2HSM A;  1XPV A;  3R2Q A;  3ZIT A;  3FR9 A;  3GX8 A;  5ABR A;  4ZBA A;  2IPA A;  4KB3 A;  1OC9 A;  3KH9 A;  3RPN A;  3TKS E;  13GS A;  4MH3 A;  2VLU A;  4K8M A;  1AQX A;  4RUV A;  3IRA A;  1THX A;  1QGV A;  5G1K A;  3EYT A;  2VL2 C;  3GNJ A;  2H1G A;  2ON5 A;  6GSX A;  1TRU A;  2F51 A;  1YQ1 A;  1GUK A;  5BMU A;  3LYP A;  4GQC A;  2AAW A;  3HVX A;  1X0R A;  2N5B A;  5HR2 A;  4WBR D;  3TKS A;  2H1D A;  4G9H A;  5FHI A;  3FZ9 A;  1B9X C;  1OE7 A;  1YEX A;  3IDV A;  4PUR A;  2L57 A;  3HYP A;  2YPM A;  3KXO A;  5EPF A;  2XHF A;  4FQU A;  1TXX A;  2ZNM A;  5HFG A;  3IAM 2;  3UAP A;  3GKX A;  1KTE A;  1VF4 A;  6GSW A;  4YQV A;  4GST A;  2MMA A;  2RUE A;  3P7X A;  2IMF A;  2MZC A;  2GS3 A;  4GXZ A;  1NSW A;  4HU9 A;  3PGT A;  2YP6 A;  1WRY A;  5IO0 A;  5IMV A;  2FGX A;  4EE0 A;  2LRT A;  3GHA A;  2H74 A;  1A2J A;  1H75 A;  1U3I A;  18GS A;  2JZR A;  4OCF A;  2YNX A;  5D9V A;  3NIV A;  3D21 A;  4ZIL A;  4J57 E;  5IMD A;  2NTO A;  4G0K A;  3EC3 A;  3VWV A;  1X9S B;  3CXG A;  1PSQ A;  4AJ6 A;  4BWS A;  2FLS A;  2H1A A;  3H1N A;  2PUK C;  1Y25 A;  1SEN A;  3DKS A;  1ERW A;  1OYJ A;  5ECR B;  1C72 A;  5D93 A;  2VUP A;  5DQY A;  2VCQ A;  1WMJ A;  3QOU A;  4MP4 A;  5DQS A;  1T4Z A;  3RDW A;  4PQH A;  2VCX A;  2O87 A;  2H70 A;  4MDC A;  2REM A;  2GSQ A;  3TCO A;  22GS A;  4JBB A;  2LRN A;  2KOK A;  3VI5 A;  1GSE A;  3FR3 A;  2IMK A;  2MMO A;  2E2M A;  4DSS B;  1ZCP A;  2XPD A;  2R37 A;  3C73 A;  4TR4 A;  3SBC A;  3WGE A;  1T3B A;  1YKA A;  1JLV A;  3ZTL A;  3L0H A;  5GZZ B;  2TRC P;  4KDX A;  3IA1 A;  4K7N A;  2B3S A;  2BTO T;  2HSN B;  5L71 A;  1CQG A;  2OAC A;  4K6X A;  5CO3 A;  1UC7 A;  1PL2 A;  1Z7R A;  4PTS A;  4F0B A;  1SL1 B;  4HDE A;  2JSZ A;  4MH2 A;  5IMF A;  1V58 A;  3P2A A;  3J7Y b;  4LLR A;  2IWT A;  4NHZ A;  1VF3 A;  1PN9 A;  2CAQ A;  3BJ5 A;  1EOH A;  1YF1 A;  3LG6 A;  2QGV A;  3GTU A;  2I81 A;  1XOB A;  3KGK A;  1PD2 1;  1B4Q A;  1OKD A;  1BX9 A;  1HD2 A;  1V57 A;  4BVY B;  2L4C A;  1O7U A;  3E3E A;  3CSI A;  4N0V A;  2YAN A;  5CRG A;  2O7K A;  3IBH A;  4IBP A;  5JWO B;  1XZO A;  2HI7 A;  1U87 A;  5GAP D;  2HSM B;  1IYI A;  3ZVJ A;  5G5F A;  1BED A;  2V6O A;  4QL9 A;  5IMA A;  3UVT A;  5IQY A;  1OC9 B;  4MK3 A;  3GST A;  1SKR B;  2FY6 A;  2VIM A;  3EMP A;  4MZC A;  3DXB A;  4V1A p;  1N8J A;  3ME7 A;  5DAK A;  5E4W A;  4GSS A;  1UN2 A;  5KN1 A;  4ECB A;  3HCZ A;  5LD0 A;  2V6K A;  4MZW A;  1GLP A;  2H76 A;  4PGT A;  4XS6 A;  2CV4 A;  3DVW A;  1K0A A;  2X8G A;  3U5R E;  1T4Y A;  4KSO A;  2X8H A;  4IKH A;  4BPY A;  2DJK A;  2FD3 A;  4I8B A;  3LQ7 A;  3D4T A;  3A2V A;  3EE2 A;  2VM2 A;  8GSS A;  3FZ4 A;  4N11 A;  4XCS A;  2HYX A;  1MDI A;  3LJR A;  4ILF A;  3QAW A;  2B7K A;  5J4U A;  1TKD B;  3U6V A;  3RAZ A;  4LL4 B;  1XFL A;  4Q5N A;  3KH7 A;  1ZZY A;  1FG4 A;  5F8B A;  1R26 A;  2YOI A;  2VAF A;  2NBS A;  1X5C A;  1VF2 A;  4L0W A;  3W8J A;  2VCW A;  1AQW A;  4PXO A;  1S3A A;  1R5P A;  3OR5 A;  1T7P B;  4OWY A;  1V2A A;  5G31 A;  3M9J A;  2AYT A;  1J08 A;  1YDK A;  4KSM A;  1TRS A;  1XBS A;  5EY6 A;  4LA1 A;  4MF7 A;  2AHE A;  1EZK A;  3I6A A;  4Q5F A;  2HRF A;  4RI7 A;  4MMM A;  10GS A;  2B7J A;  1VRS D;  3LSZ A;  2JSY A;  2X64 A;  2LKU A; 
#chains in the Genus database with same CATH topology
 3CWG A;  1A2L A;  4X0X A;  4HSC X;  1WE0 A;  1Y6E A;  3H8Q A;  2P5Q A;  2RM5 A;  2I4A A;  1R7H A;  5IM9 A;  4FO5 A;  2O36 A;  1GSS A;  4QQ7 A;  2IMD A;  3RHB A;  5H5R A;  3P90 A;  4POM A;  2K8S A;  1M9A A;  3MNG A;  5ECS A;  3LYK A;  1LBK A;  3US3 A;  2HE3 A;  2LNT A;  3IC8 A;  5KEJ A;  2ON7 A;  5INY A;  2C3Q A;  2DMM A;  4V2N A;  2IIY A;  3HJO A;  1FAA A;  3F3R A;  1ZYQ B;  2BMX A;  2B1K A;  1BYE A;  4WR4 A;  3KTB A;  4HQZ A;  2GST A;  4KF9 A;  3DIE A;  4FYB A;  1GH2 A;  4E68 A;  1K0N A;  3Q74 A;  3WGD A;  3FRC A;  3F0I A;  4JZQ A;  2M72 A;  4CY8 A;  4ZL9 A;  4PUA A;  3TOU A;  1T00 A;  1PFO A;  1YEP A;  3ZRD A;  1TK5 B;  4AI6 A;  3TKR A;  1YVL A;  5G5E A;  2TIR A;  3LXZ A;  1TU7 A;  4IP1 A;  2M80 A;  3F6D A;  4EC0 A;  1VF1 A;  3GTU B;  1EOG A;  3QAG A;  2KHP A;  1TU8 A;  2FCH A;  4EO3 A;  4MAB A;  5D9X A;  4ZB7 A;  3EU3 A;  2H01 A;  1SD9 A;  3APO A;  5CP1 A;  2PVQ A;  4F2I A;  1LJR A;  3CTG A;  1XVW A;  2BJX A;  4K0G A;  1TDI A;  1EWX A;  3FYG A;  4K1F A;  5AIS A;  3IC4 A;  1SVM A;  2GQK A;  1XWB A;  3ZZX A;  5CRD A;  1JZD A;  1JLW A;  5HFI A;  5BRT A;  4OCE A;  1M99 A;  3PPU A;  2RM6 A;  4Q5R A;  1OC8 A;  5DAK B;  3TB2 A;  1S3D A;  1SYR A;  6GSS A;  3QFA C;  2VLT A;  4WF4 A;  5CRW A;  2GSR A;  1ZGN A;  3D4M A;  4PNF A;  1HYU A;  3ZYW A;  3TKS C;  2HSH A;  1OVN A;  1THO A;  3DVX A;  1GTI A;  4E8E A;  5E59 A;  4BA7 A;  3A3T A;  1FO5 A;  3P8W A;  5KN3 A;  3VK9 A;  5JWR B;  4XRD A;  1M9B A;  1Z3E A;  2LQO A;  3GFK A;  2E7P A;  3GMF A;  3UEM A;  1GUL A;  4CHS A;  3WT1 A;  1GTU A;  3VPT A;  2HRA A;  1B9Y C;  5DDL A;  2IMI A;  4DSR A;  3ZL5 A;  3CMI A;  1G6Y A;  1XOA A;  4IP6 A;  4I5Q A;  1QXH A;  3L9S A;  1ILO A;  4O92 A;  5ECM B;  2L6D A;  2RUF A;  2CVB A;  3UAR A;  1HQO A;  3O3T A;  4ISD A;  5D8I A;  2E2G A;  1GSU A;  3GKM A;  3FKF A;  4NHW A;  2GT6 A;  1GSQ A;  4OO4 A;  1MTC A;  1FVK A;  1WP0 A;  3F4R A;  2H72 A;  2JL4 A;  4NMU A;  4GCI A;  4IQA A;  4DEJ A;  5J5N A;  1GUM A;  4GRF A;  2VLV A;  4LL1 B;  1GSD A;  5C04 A;  2FWG A;  1AAZ A;  1XW9 A;  1FB6 A;  2V32 A;  1W4V A;  3IV4 A;  4X1U A;  2WFC A;  1Y1U A;  5J41 A;  3LOR A;  3IHG A;  2O5V A;  4W66 A;  5ID2 A;  5ELA A;  2YWI A;  3EIN A;  2HT9 A;  3DYR A;  1XXU A;  2R4V A;  3EMX A;  2HLS A;  2WCI A;  4MA9 A;  4CY6 A;  11GS A;  1R5A A;  4MCU A;  1URM A;  2C1Y A;  4POK A;  1PX7 A;  4JRR A;  5KOW A;  4HJM A;  4POB A;  3GH6 A;  3L9V A;  4MF6 A;  3TJF A;  4IJ3 A;  4PNG A;  1QMV A;  1T8E B;  1GRX A;  3GL5 A;  4A5P A;  5C00 A;  1YZX A;  4OMV A;  2J9H A;  4TW5 A;  3QD9 A;  2KP2 A;  4X43 A;  4ZB9 A;  4ZB8 A;  4FYC A;  4ID0 A;  5B7C A;  2DJJ A;  4V1A g;  1F3A A;  1WPI A;  1FOH A;  5G2Z A;  4KH7 A;  2A2P A;  3TRP A;  3GKK A;  3A2W A;  5GSS A;  1O8X A;  4HEA 2;  1I9D A;  1PKZ A;  2X4A A;  2A2R A;  4CW9 A;  4XRA A;  3UVH A;  2GVP A;  3GA4 A;  3CSH A;  2CVK A;  1SK1 A;  2R2J A;  2CVD A;  2XPE A;  2C0E A;  2CQ9 A;  2YWN A;  3L9U A;  3ZIV A;  4BVX A;  2OBI A;  2H19 A;  5DBQ A;  4YAP A;  2ZUP A;  4JR4 A;  3RBT A;  3TDG A;  4Z2U A;  1V40 A;  2CT6 A;  4GTU A;  2YN1 A;  4YKG A;  2N5F A;  1NM3 A;  2X99 A;  2VL2 A;  2NDO A;  1TI3 A;  2B1L A;  2GZP A;  4NV2 A;  4IQ1 A;  4X4J A;  3TKQ A;  2DJ0 A;  4L0U A;  5IMC A;  4H86 A;  4D73 A;  1M3I A;  3LW9 A;  5B6N A;  3DGQ A;  2B6M A;  1XWG A;  3CTF A;  5IOX A;  3EUR A;  4LMV A;  1GTA A;  3WYW A;  4F0C A;  2IL3 A;  3TOT A;  1RK4 A;  3IHQ A;  2HFD A;  1FHE A;  1J0F A;  7GSS A;  3ZMK A;  3A2X A;  2GTU A;  1O8W A;  2GT5 A;  4IS0 A;  1MDK A;  2O3E A;  3HDC A;  3E0U A;  1K3Y A;  2HXK A;  3HHV A;  4ECC A;  3FEU A;  5AGY A;  1UA5 A;  2VKZ G;  2RII A;  4KCE A;  2GGT A;  3HJP A;  1A24 A;  1G7O A;  4PQI A;  4ECJ A;  2QSI A;  4YQM A;  1TW9 A;  1SU9 A;  4IHU A;  2WVX A;  1GNE A;  2CAI A;  4GLT A;  1PN0 A;  3ERF A;  4KUN A;  4V2L A;  3RPP A;  3HVS A;  2WS2 A;  1A23 A;  3KJY A;  2I1U A;  4TR3 A;  2WUL A;  17GS A;  4ZB6 A;  3O76 A;  2WRT A;  3PH9 A;  1MDJ A;  5D9W A;  1YF0 A;  2I3Y A;  2XBI A;  3CQF A;  4JE1 A;  3GUR A;  2MBT A;  1GUH A;  3HA9 A;  2MYG A;  3BCK A;  5ECP B;  2H0I A;  2FHE A;  3IK7 A;  2EIR A;  3ME8 A;  5A4W A;  3EU4 A;  5COH A;  3GN3 A;  1S4B P;  4NAX A;  2PER A;  4RQR A;  5F06 A;  1A0R P;  3GUS A;  1TI1 A;  2X49 A;  3KD0 A;  2C0D A;  5ID2 B;  1K0D A;  3JCM L;  3IOS A;  5D96 A;  1AQV A;  1PX6 A;  3FZA A;  3KP9 A;  4NWY A;  1PL1 A;  4PHZ C;  1SK2 A;  1G0T A;  1M2B A;  2NPB A;  3F6F A;  2YV9 A;  1ON4 A;  4K0N A;  2L5L A;  1SJ6 A;  4TVE A;  1GNW A;  2H73 A;  3TJJ A;  3GYK A;  4HU7 A;  2WW3 A;  2R3X A;  5GST A;  2E0Q A;  4GSN A;  1A2M A;  3MDK A;  4IN0 A;  5CNW A;  2LNS A;  2YV7 A;  1CQH A;  2LS5 A;  2X8C A;  1MEK A;  4EDZ A;  2HRN A;  3LGC A;  3ZFL A;  3UL3 A;  3ZRE A;  4JR6 A;  2JAD A;  1YJ6 A;  1B4P A;  2OAD A;  1AIU A;  5A1N A;  2IME A;  1IYH A;  4ULX A;  4I2T A;  3CRT A;  3UBK A;  2PBJ A;  14GS A;  2DJ1 A;  2JAC A;  1TRV A;  4POL A;  3F8U A;  3ZLP A;  4ICY A;  1TJD A;  4IW9 A;  3CHX C;  2LJR A;  5ECH B;  20GS A;  3DML A;  5IMZ A;  2KP1 A;  5F05 A;  5ENU A;  2OA7 A;  2LEG A;  1JZW A;  3BBY A;  1GTB A;  2H6Z A;  4ACS A;  2G2Q A;  19GS A;  2P0G A;  1U3A A;  4BVX B;  1BAY A;  3KMO A;  1TK0 B;  3ZIJ A;  2TRX A;  2LST A;  1EEM A;  1Z9H A;  2K9F A;  3VWU A;  1F6M C;  9GSS A;  2V2G A;  4BIK A;  3GX0 A;  12GS A;  1PRX A;  2AJQ B;  4KW6 A;  4EUY A;  1HNB A;  4USS A;  3EPT A;  5DVB A;  5LNK e;  2J23 A;  1TOF A;  4G19 A;  3ZVJ D;  2V1M A;  3IE3 A;  2B5E A;  5LCZ A;  5HFK A;  1JFU A;  2H0H A;  4K2D A;  5F0G A;  2QA1 A;  4ML6 A;  3LEF A;  4K7O A;  2C3N A;  2R0C A;  4D73 B;  3VWX A;  3BCI A;  2LJK A;  1A0F A;  4FH8 A;  1N25 A;  4ZIJ A;  4G2E A;  3QCP A;  4OO5 A;  2NVL A;  2QA2 A;  1F9M A;  1TK8 B;  3IXR A;  3LWA A;  1PA3 A;  3APQ A;  5A5H A;  2MBS A;  4IGJ A;  4BWQ A;  3DWV A;  2I9H A;  1ZOF A;  2D2Z A;  3O6T A;  3D0Z A;  3DRN A;  4WXT A;  4TN8 A;  3D5J A;  3UOM A;  2WVX B;  4F9Z A;  5IPG A;  1ST9 A;  4RI6 A;  4MPG A;  3VWW A;  3GSS A;  3I69 A;  2H6X A;  2IFQ A;  1S3C A;  1WOU A;  2XC2 A;  5F07 A;  2EFD A;  3FHK A;  3H93 A;  1EGO A;  5DJL A;  3KTL A;  4EL1 A;  1FW1 A;  4YKF A;  4FYU A;  5IOW A;  3MIX A;  1X5D A;  1LU4 A;  4I6X A;  1QFN A;  2H71 A;  4WBJ A;  3ZML A;  3L4N A;  3CYN A;  1EEJ A;  3DEX A;  3G7Y A;  4KND A;  4TR0 A;  3L78 A;  1GSY A;  1F2E A;  3TKP A;  5A4V A;  2HZF A;  2Z9S A;  3K8N A;  1WJK A;  4BL7 A;  4JED A;  4YAV A;  1OAZ A;  5J9C A;  4HJ2 A;  3N5O A;  2GSS A;  1NW2 A;  2XBQ A;  6GST A;  1K0C A;  1DSB A;  3UIW A;  3W6G A;  2L5O A;  5B8A A;  2G0F A;  3C1S A;  3BOA A;  1DE1 A;  1EV4 A;  3QAV A;  2JU5 A;  4MJB A;  3D22 A;  5EVO A;  4GF0 A;  1SVL A;  1AW9 A;  5EL8 A;  3HVV A;  1EV9 A;  4K7I A;  3EWL A;  3KMN A;  1B8X A;  2N5A A;  3F4T A;  1SYX A;  2DC5 A;  16GS A;  5JCG A;  2C4J A;  2RLI A;  3C1R A;  2OKA A;  5A1N B;  5FWG A;  2ZCT A;  2K18 A;  3ZFB A;  2C3T A;  1Q4J A;  2WJU A;  4EIQ A;  5J40 A;  4AKH A;  1JZO A;  3PR8 A;  3RHC A;  2LUS A;  4P3Y B;  3RGB C;  3A5I A;  4EDY A;  4MZB A;  2WZ9 A;  3WT2 A;  2QC7 A;  3C8E A;  2WW2 A;  2LQQ A;  1SKW B;  4XS4 A;  2KLX A;  4AJ8 A;  2EIQ A;  2MMZ A;  2C80 A;  2DIZ A;  3F3Q A;  4PUF C;  2F8F A;  5ECI B;  5A34 B;  4TOP A;  4OFN A;  1KNG A;  1OE8 A;  1A8Y A;  2HZE A;  1AXD A;  1OC3 A;  3VFI A;  1ZL9 A;  3MSZ A;  1GWC A;  4KCA A;  1HNC A;  2VL3 A;  1I1I P;  2C0G A;  5ELG A;  1FB0 A;  3F4S A;  4I97 A;  5H5Q A;  3H79 A;  3C71 A;  2H1L A;  5J4V A;  4DSQ A;  3I9V 2;  4O7H A;  2FWH A;  3VLN A;  3KEB A;  4IJI A;  3VUR A;  6GSV A;  3IPZ A;  4G0L A;  1GLQ A;  2JZS A;  4N30 A;  2OT3 A;  3WD6 A;  2P5R A;  5A5H B;  4O5U A;  5D73 A;  2DBC A;  2VCV A;  4ML1 A;  2H1B A;  1GL8 A;  3HD5 A;  5CRE A;  4NPB A;  2WVY A;  4V2M A;  4F82 A;  3TRX A;  3S9F A;  4AKI A;  4OFM A;  1J9B A;  1DUG A;  1QUW A;  2IFQ B;  3ERW A;  5IPH A;  2UV8 G;  3MYD A;  4CDO A;  1KBN A;  1X9M B;  3M3M A;  4TXO A;  4OD7 A;  2LRC A;  2CZ3 A;  4RQX A;  1M2A A;  4J2F A;  2PGT A;  2PVO C;  1NHY A;  1OKT A;  1ERV A;  2A4V A;  2LTK A;  2K8V A;  2H0G A;  4YH2 A;  5HR1 A;  3HMJ G;  2HRK A;  2HSY A;  1AUC A;  5CYY A;  5ECL B;  4EIP A;  1W89 A;  4GWR A;  3E9J B;  3FW2 A;  3QMX A;  2YZH A;  1XW5 A;  2L4Q A;  2JZT A;  3QFB C;  2O89 A;  3PIN A;  1DBY A;  3KIJ A;  2HQT A;  5JWQ B;  1X9W B;  4BL7 B;  4KX4 A;  1USB A;  1G7E A;  4Q5Q A;  1E2Y A;  3I43 A;  3N9J A;  2DKH A;  1MD3 A;  3G9B A;  2V41 A;  4WEY A;  5CAX A;  1ML6 A;  2C0F A;  2MMN A;  1YKC A;  3Q18 A;  5HR3 A;  4KGI A;  1SL2 B;  1R4W A;  1WWJ A;  1XW6 A;  2PWJ A;  2IJY A;  2WB9 A;  4PX1 A;  1ERT A;  1M7T A;  3HVN A;  4TR1 A;  3ED3 A;  4GDF A;  2VM1 A;  1ERU A;  2H66 A;  4FIW A;  5KOX A;  3HZ4 A;  3TGZ A;  1ABA A;  4G10 A;  4AF2 A;  3TJK A;  1SKS B;  2GQM A;  4MF5 A;  2K6V A;  3VPQ A;  2P31 A;  1ZMA A;  3Q19 A;  2ES7 A;  4IEL A;  2YWM A;  4O32 A;  5ECO B;  2AUV A;  3MAK A;  5AIV A;  4MJE A;  3LFL A;  5J47 A;  1SL0 B;  4HUA A;  4IVF A;  1K0M A;  4MPF A;  2YZU A;  3HZ8 A;  5B8B A;  4O5R A;  1K3L A;  2CX4 A;  5DAL A;  3H4K A;  1G6W A;  3TJB A;  1BG5 A;  4JU5 A;  1PKW A;  3HJM A;  1GSF A;  4QL7 A;  2VO4 A;  2VCZ A;  2AB6 A;  1BG1 A;  4G0I A;  2F8A A;  2WGR A;  3NOF A;  5A5K A;  2WVZ A;  2EIO A;  5JCW A;  5ECK B;  4AJ7 A;  4XS4 B;  1Z5Y E;  4F03 A;  5J3R A;  4ZL8 A;  1EP7 A;  4KAE A;  2C8U A;  4ZXG A;  3QR6 A;  4K9Z A;  2PMT A;  2PPT A;  4AKX B;  4MJC A;  2FA4 A;  4EKZ A;  4NXI A;  4N0Z A;  1QQ2 A;  3GRX A;  3KP8 A;  2FNO A;  2HZE B;  1O85 A;  2OJL A;  4TXV A;  1RQM A;  1FOV A;  1VGL A;  1ZYE A;  3GV1 A;  1ACV A;  3CSJ A;  1BJX A;  2GZY A;  5DCH A;  4XS1 A;  1M0U A;  4KDU A;  3M8N A;  2EFC A;  4LMW A;  4K5R A;  3UBL A;  1V9W A;  4XIH A;  4KE3 A;  3SWL A;  2FA8 A;  2R5G A;  1YY7 A;  1X5E A;  3NZN A;  4EVM A;  3QPM A;  3LXT A;  2OE0 A;  4HQS A;  4I2U A;  1EGR A;  1XWA A;  3W8S A;  1PMT A;  1AC1 A;  2YWO A;  2PN8 A;  2B5Y A;  3GIX A;  4KDY A;  1XIY A;  1NHO A;  1Z7P A;  1Q98 A;  3FZ5 A;  4L5L A;  1SD8 A;  1TP9 A;  3QDN A;  4HZ2 A;  2GDR A;  5FT3 A;  1TTZ A;  1PQN A;  3M1G A;  1XWC A;  5DCG A;  5J9B A;  2DML A;  6GSY A;  4TXO B;  3IK9 A;  1DE2 A;  2M46 A;  2PU9 C;  2LJA A;  3KZQ A;  3TRQ A;  3CRU A;  3FMW A;  2DIY A;  1SJI A;  1WIK A;  1M3J A;  2L6C A;  1JZR A;  4WKW A;  2OE1 A;  2VOC A;  2A2S A;  3KM6 A;  4ZL7 A;  2HNL A;  2HRK B;  3AY8 A;  3G7I A;  1XG8 A;  4TRX A;  2B5X A;  4HI7 A;  2O8V B;  3TJG A;  3C7M A;  3A5W A;  4EF0 A;  1FVJ A;  3DD3 A;  4XTS A;  2DKI A;  5HR0 A;  1K0O A;  1V98 A;  3GH9 A;  3WGX A;  1XVQ A;  2FUG 2;  2R6K A;  1HNA A;  2L59 A;  3D6I A;  3FK8 A;  3ISO A;  3IAS 2;  1PGT A;  3V1W A;  4KA0 A;  2WDU A;  4TR1 B;  1JHB A;  1O6J A;  3HY2 A;  4GQF A;  2O85 A;  3MWH A;  1T1V A;  4HS1 A;  2CA8 A;  2H75 A;  2YJ7 A;  2FWF A;  4ECI A;  5ECN B;  3GKN A;  1BQ7 A;  1MD4 A;  1XWK A;  2GLR A;  4Z2T A;  4FXY P;  2DSA A;  4WET A;  5D9T A;  2H6Y A;  2A4H A;  4O5Q A;  1U6T A;  1RW1 A;  6GSU A;  1U88 A;  2EC4 A;  4TKY A;  4DVC A;  5HQP A;  4EXJ A;  3BD2 A;  1H4O A;  2F3M A;  4MJA A;  3VI7 A;  1GP1 A;  4XHM A;  2VD0 A;  4MLY A;  1Z6N A;  1I5G A;  2KUC A;  5B6M A;  3KCM A;  1A8L A;  1O73 A;  1Z6M A;  5DAL B;  1KEB A;  4N10 A;  3HXS A;  2FWE A;  3R3E A;  3CBU A;  2DLX A;  3Q6O A;  5KN0 A;  3TUE A;  1EP8 A;  1O81 A;  1UVZ A;  2H8L A;  4Z7X A;  4DSS A;  1E6B A;  2YJH A;  4PQ1 A;  2H30 A;  3J7Y k;  2DJ3 A;  1K3O A;  4L8E A;  4WF5 A;  2VCT A;  4OFT A;  3M9K A;  3HKR A;  2VL9 A;  2OE3 A;  3F9U A;  1TRW A;  3UMA A;  5KN2 A;  1M2D A;  5G1L A;  3IR4 A;  5DJM A;  3ERG A;  3G7J A;  4YQU A;  3FY7 A;  2HSN A;  2DJ2 A;  5IO2 A;  1K0B A;  4ZBB A;  3EVI A;  5IIZ A;  5ECQ B;  3FR6 A;  5JCU A;  3M0F A;  2QKE A;  5G30 A;  2F9S A;  4AGS A;  2EFH A;  4J56 E;  2UZ8 A;  4NV5 A;  4HOJ A;  2OBK A;  1XCC A;  1F37 A;  5AN1 A;  2GZZ A;  1F3B A;  2YCD A;  4L5O A;  2IN3 A;  4E8H A;  2AV4 A;  2ALB A;  1B48 A;  5H5S A;  5A4U A;  5AIX A;  1SJZ A;  5CRH A;  4HZ4 A;  3UJ1 A;  4BVY A;  1N2A A;  2CZ2 A;  2LV3 A;  4WR5 A;  3GL3 A;  2VD1 A;  1SK0 A;  3F63 A;  2CX3 A;  4ZBD A;  2GQL A;  1QK8 A;  5GAN D;  3APS A;  2HSM A;  1XPV A;  3R2Q A;  3ZIT A;  4QMK A;  3FR9 A;  3GX8 A;  5ABR A;  4ZBA A;  2IPA A;  4KB3 A;  1OC9 A;  3KH9 A;  4PI2 C;  3RPN A;  3TKS E;  13GS A;  4N3Z A;  4MH3 A;  2VLU A;  4K8M A;  3TU3 B;  1AQX A;  4RUV A;  3IRA A;  1THX A;  1QGV A;  5G1K A;  3EYT A;  2VL2 C;  3GNJ A;  2H1G A;  2ON5 A;  6GSX A;  1TRU A;  2F51 A;  1YQ1 A;  1GUK A;  5BMU A;  3LYP A;  4GQC A;  2AAW A;  3HVX A;  1X0R A;  2N5B A;  5HR2 A;  4WBR D;  3TKS A;  2H1D A;  4G9H A;  5FHI A;  3FZ9 A;  1B9X C;  1OE7 A;  1YEX A;  3IDV A;  4PUR A;  2L57 A;  3HYP A;  2YPM A;  3KXO A;  5EPF A;  2XHF A;  4FQU A;  1TXX A;  4Z2R A;  2ZNM A;  5HFG A;  3IAM 2;  3UAP A;  3GKX A;  1KTE A;  1VF4 A;  6GSW A;  4YQV A;  4GST A;  2MMA A;  2RUE A;  3P7X A;  2IMF A;  4K2X A;  2MZC A;  2WW1 A;  2GS3 A;  4GXZ A;  1NSW A;  4HU9 A;  3PGT A;  1TXU A;  1WRY A;  2YP6 A;  5IO0 A;  5IMV A;  2FGX A;  4EE0 A;  2LRT A;  3GHA A;  2H74 A;  1A2J A;  4G01 A;  1H75 A;  1U3I A;  18GS A;  2JZR A;  4OCF A;  2YNX A;  5D9V A;  2WW0 A;  3NIV A;  3D21 A;  4ZIL A;  4J57 E;  5IMD A;  2NTO A;  3EC3 A;  4G0K A;  3VWV A;  1X9S B;  3CXG A;  1PSQ A;  4AJ6 A;  4BWS A;  2FLS A;  2H1A A;  3H1N A;  4AKG A;  2PUK C;  1Y25 A;  1SEN A;  3RFR C;  3DKS A;  1ERW A;  1OYJ A;  5ECR B;  1C72 A;  5D93 A;  2VUP A;  5DQY A;  2VCQ A;  1WMJ A;  3QOU A;  4MP4 A;  5DQS A;  1T4Z A;  3RDW A;  4PQH A;  2VCX A;  2O87 A;  2H70 A;  4MDC A;  2REM A;  2GSQ A;  3TCO A;  22GS A;  4JBB A;  2LRN A;  2KOK A;  3VI5 A;  1GSE A;  2R0G A;  1BF5 A;  3FR3 A;  1YEW C;  2IMK A;  2MMO A;  2E2M A;  4DSS B;  1ZCP A;  2XPD A;  2R37 A;  3C73 A;  4TR4 A;  3SBC A;  3WGE A;  1ZYN A;  1T3B A;  1YKA A;  1JLV A;  3ZTL A;  3L0H A;  2R0P A;  5GZZ B;  2TRC P;  4KDX A;  3IA1 A;  4K7N A;  2B3S A;  2BTO T;  2HSN B;  5L71 A;  1CQG A;  2OAC A;  4K6X A;  5CO3 A;  1UC7 A;  1PL2 A;  1Z7R A;  4PTS A;  4F0B A;  1SL1 B;  4HDE A;  2JSZ A;  4MH2 A;  5IMF A;  1V58 A;  3P2A A;  3J7Y b;  4LLR A;  2IWT A;  4NHZ A;  1VF3 A;  1PN9 A;  2CAQ A;  3BJ5 A;  1EOH A;  1YF1 A;  3LG6 A;  2QGV A;  3GTU A;  2I81 A;  1XOB A;  3KGK A;  1PD2 1;  1B4Q A;  1OKD A;  1S3R A;  1ZYP A;  1BX9 A;  1HD2 A;  1V57 A;  4BVY B;  2L4C A;  1O7U A;  3E3E A;  3CSI A;  4N0V A;  2YAN A;  5CRG A;  5J4Y A;  2O7K A;  3IBH A;  4IBP A;  5JWO B;  1XZO A;  2HI7 A;  1U87 A;  5GAP D;  2HSM B;  1IYI A;  3ZVJ A;  5G5F A;  1BED A;  2V6O A;  4QL9 A;  5IMA A;  3UVT A;  5IQY A;  1OC9 B;  4MK3 A;  3GST A;  1SKR B;  2FY6 A;  2VIM A;  3EMP A;  4MZC A;  3DXB A;  4V1A p;  1N8J A;  3ME7 A;  5DAK A;  5E4W A;  1SVO A;  4GSS A;  5BMU B;  1UN2 A;  5KN1 A;  4ECB A;  3HCZ A;  5LD0 A;  2V6K A;  4MZW A;  1GLP A;  2H76 A;  4PGT A;  4XS6 A;  2CV4 A;  3DVW A;  1K0A A;  2X8G A;  3U5R E;  1T4Y A;  4KSO A;  2X8H A;  4IKH A;  4BPY A;  2DJK A;  2FD3 A;  4I8B A;  3LQ7 A;  2WZS A;  3D4T A;  3A2V A;  3EE2 A;  2VM2 A;  8GSS A;  3FZ4 A;  4PI0 C;  4N11 A;  4XCS A;  2HYX A;  1MDI A;  3LJR A;  4ILF A;  3QAW A;  2B7K A;  5J4U A;  2EFE A;  1TKD B;  3U6V A;  3RAZ A;  4LL4 B;  1XFL A;  4Q5N A;  3KH7 A;  1ZZY A;  1FG4 A;  5F8B A;  1R26 A;  2YOI A;  2VAF A;  2NBS A;  1X5C A;  1VF2 A;  4L0W A;  3W8J A;  2VCW A;  1AQW A;  4K5S A;  4PXO A;  1S3A A;  1R5P A;  3OR5 A;  4MNN A;  1T7P B;  4OWY A;  1V2A A;  5G31 A;  3M9J A;  2AYT A;  1J08 A;  1YDK A;  4KSM A;  1TRS A;  1XBS A;  5EY6 A;  4LA1 A;  4MF7 A;  2AHE A;  1EZK A;  3I6A A;  4Q5F A;  2HRF A;  4RI7 A;  4MMM A;  10GS A;  2B7J A;  1VRS D;  3LSZ A;  2JSY A;  5A34 A;  2X64 A;  2LKU A; 
#chains in the Genus database with same CATH homology
 3CWG A;  1A2L A;  4X0X A;  1WE0 A;  1Y6E A;  3H8Q A;  2P5Q A;  2RM5 A;  2I4A A;  1R7H A;  5IM9 A;  4FO5 A;  1GSS A;  4QQ7 A;  2IMD A;  3RHB A;  5H5R A;  3P90 A;  4POM A;  2K8S A;  1M9A A;  3MNG A;  5ECS A;  3LYK A;  1LBK A;  3US3 A;  2HE3 A;  2LNT A;  3IC8 A;  5KEJ A;  2ON7 A;  5INY A;  2C3Q A;  2DMM A;  4V2N A;  2IIY A;  3HJO A;  1FAA A;  3F3R A;  1ZYQ B;  2BMX A;  2B1K A;  1BYE A;  4WR4 A;  3KTB A;  4HQZ A;  2GST A;  4KF9 A;  3DIE A;  4FYB A;  1GH2 A;  4E68 A;  1K0N A;  3Q74 A;  3WGD A;  3FRC A;  3F0I A;  4JZQ A;  2M72 A;  4CY8 A;  4ZL9 A;  4PUA A;  3TOU A;  1T00 A;  1YEP A;  3ZRD A;  1TK5 B;  4AI6 A;  3TKR A;  1YVL A;  5G5E A;  2TIR A;  3LXZ A;  1TU7 A;  4IP1 A;  2M80 A;  3F6D A;  4EC0 A;  1VF1 A;  3GTU B;  1EOG A;  3QAG A;  2KHP A;  1TU8 A;  2FCH A;  4EO3 A;  4MAB A;  5D9X A;  4ZB7 A;  3EU3 A;  2H01 A;  1SD9 A;  3APO A;  5CP1 A;  2PVQ A;  4F2I A;  1LJR A;  3CTG A;  1XVW A;  2BJX A;  4K0G A;  1TDI A;  1EWX A;  3FYG A;  4K1F A;  5AIS A;  3IC4 A;  1SVM A;  2GQK A;  1XWB A;  3ZZX A;  5CRD A;  1JZD A;  1JLW A;  5HFI A;  5BRT A;  4OCE A;  1M99 A;  3PPU A;  2RM6 A;  4Q5R A;  1OC8 A;  5DAK B;  3TB2 A;  1S3D A;  1SYR A;  6GSS A;  3QFA C;  2VLT A;  4WF4 A;  5CRW A;  2GSR A;  1ZGN A;  3D4M A;  4PNF A;  1HYU A;  3ZYW A;  3TKS C;  2HSH A;  1OVN A;  1THO A;  3DVX A;  1GTI A;  4E8E A;  5E59 A;  4BA7 A;  3A3T A;  1FO5 A;  3P8W A;  5KN3 A;  3VK9 A;  5JWR B;  4XRD A;  1M9B A;  1Z3E A;  2LQO A;  3GFK A;  2E7P A;  3GMF A;  3UEM A;  1GUL A;  4CHS A;  3WT1 A;  1GTU A;  3VPT A;  2HRA A;  1B9Y C;  5DDL A;  2IMI A;  4DSR A;  3ZL5 A;  3CMI A;  1G6Y A;  1XOA A;  4IP6 A;  4I5Q A;  1QXH A;  3L9S A;  1ILO A;  4O92 A;  5ECM B;  2L6D A;  2RUF A;  2CVB A;  3UAR A;  1HQO A;  3O3T A;  4ISD A;  5D8I A;  2E2G A;  1GSU A;  3GKM A;  3FKF A;  4NHW A;  2GT6 A;  1GSQ A;  4OO4 A;  1MTC A;  1FVK A;  1WP0 A;  3F4R A;  2H72 A;  2JL4 A;  4NMU A;  4GCI A;  4IQA A;  4DEJ A;  5J5N A;  1GUM A;  4GRF A;  2VLV A;  4LL1 B;  1GSD A;  5C04 A;  2FWG A;  1AAZ A;  1XW9 A;  1FB6 A;  2V32 A;  1W4V A;  3IV4 A;  4X1U A;  2WFC A;  1Y1U A;  5J41 A;  3LOR A;  3IHG A;  2O5V A;  4W66 A;  5ID2 A;  5ELA A;  2YWI A;  3EIN A;  2HT9 A;  3DYR A;  1XXU A;  2R4V A;  3EMX A;  2HLS A;  2WCI A;  4MA9 A;  4CY6 A;  11GS A;  1R5A A;  4MCU A;  1URM A;  2C1Y A;  4POK A;  1PX7 A;  4JRR A;  5KOW A;  4HJM A;  4POB A;  3GH6 A;  3L9V A;  4MF6 A;  3TJF A;  4IJ3 A;  4PNG A;  1QMV A;  1T8E B;  1GRX A;  3GL5 A;  4A5P A;  5C00 A;  1YZX A;  4OMV A;  2J9H A;  4TW5 A;  3QD9 A;  2KP2 A;  4X43 A;  4ZB9 A;  4ZB8 A;  4FYC A;  4ID0 A;  5B7C A;  2DJJ A;  4V1A g;  1F3A A;  1WPI A;  1FOH A;  5G2Z A;  4KH7 A;  2A2P A;  3TRP A;  3GKK A;  3A2W A;  5GSS A;  1O8X A;  4HEA 2;  1I9D A;  1PKZ A;  2X4A A;  2A2R A;  4CW9 A;  4XRA A;  3UVH A;  2GVP A;  3GA4 A;  3CSH A;  2CVK A;  1SK1 A;  2R2J A;  2CVD A;  2XPE A;  2C0E A;  2CQ9 A;  2YWN A;  3L9U A;  3ZIV A;  4BVX A;  2OBI A;  2H19 A;  5DBQ A;  4YAP A;  2ZUP A;  4JR4 A;  3RBT A;  3TDG A;  4Z2U A;  1V40 A;  2CT6 A;  4GTU A;  2YN1 A;  4YKG A;  2N5F A;  1NM3 A;  2X99 A;  2VL2 A;  2NDO A;  1TI3 A;  2B1L A;  2GZP A;  4NV2 A;  4IQ1 A;  4X4J A;  3TKQ A;  2DJ0 A;  4L0U A;  5IMC A;  4H86 A;  4D73 A;  3LW9 A;  5B6N A;  3DGQ A;  2B6M A;  1XWG A;  3CTF A;  5IOX A;  3EUR A;  4LMV A;  1GTA A;  3WYW A;  4F0C A;  2IL3 A;  3TOT A;  1RK4 A;  3IHQ A;  2HFD A;  1FHE A;  1J0F A;  7GSS A;  3ZMK A;  3A2X A;  2GTU A;  1O8W A;  2GT5 A;  4IS0 A;  1MDK A;  3HDC A;  3E0U A;  1K3Y A;  2HXK A;  3HHV A;  4ECC A;  3FEU A;  5AGY A;  1UA5 A;  2VKZ G;  2RII A;  4KCE A;  2GGT A;  3HJP A;  1A24 A;  1G7O A;  4PQI A;  4ECJ A;  2QSI A;  4YQM A;  1TW9 A;  1SU9 A;  4IHU A;  1GNE A;  2CAI A;  4GLT A;  1PN0 A;  3ERF A;  4KUN A;  4V2L A;  3RPP A;  3HVS A;  2WS2 A;  1A23 A;  3KJY A;  2I1U A;  4TR3 A;  2WUL A;  17GS A;  4ZB6 A;  3O76 A;  2WRT A;  3PH9 A;  1MDJ A;  5D9W A;  1YF0 A;  2I3Y A;  2XBI A;  4JE1 A;  3GUR A;  2MBT A;  1GUH A;  3HA9 A;  2MYG A;  3BCK A;  5ECP B;  2H0I A;  2FHE A;  3IK7 A;  2EIR A;  3ME8 A;  5A4W A;  3EU4 A;  5COH A;  3GN3 A;  4NAX A;  2PER A;  4RQR A;  5F06 A;  1A0R P;  3GUS A;  1TI1 A;  2X49 A;  3KD0 A;  2C0D A;  5ID2 B;  1K0D A;  3JCM L;  3IOS A;  5D96 A;  1AQV A;  1PX6 A;  3FZA A;  3KP9 A;  4NWY A;  1PL1 A;  1SK2 A;  1G0T A;  1M2B A;  2NPB A;  3F6F A;  2YV9 A;  1ON4 A;  4K0N A;  2L5L A;  1SJ6 A;  4TVE A;  1GNW A;  2H73 A;  3TJJ A;  3GYK A;  4HU7 A;  2R3X A;  5GST A;  2E0Q A;  4GSN A;  1A2M A;  3MDK A;  4IN0 A;  5CNW A;  2LNS A;  2YV7 A;  1CQH A;  2LS5 A;  2X8C A;  1MEK A;  4EDZ A;  2HRN A;  3LGC A;  3ZFL A;  3UL3 A;  3ZRE A;  4JR6 A;  2JAD A;  1YJ6 A;  1B4P A;  2OAD A;  1AIU A;  5A1N A;  2IME A;  1IYH A;  4ULX A;  4I2T A;  3CRT A;  3UBK A;  2PBJ A;  14GS A;  2DJ1 A;  2JAC A;  1TRV A;  4POL A;  3F8U A;  3ZLP A;  4ICY A;  1TJD A;  4IW9 A;  2LJR A;  5ECH B;  20GS A;  3DML A;  5IMZ A;  2KP1 A;  5F05 A;  5ENU A;  2OA7 A;  2LEG A;  1JZW A;  3BBY A;  1GTB A;  2H6Z A;  4ACS A;  2G2Q A;  19GS A;  2P0G A;  1U3A A;  4BVX B;  1BAY A;  3KMO A;  1TK0 B;  3ZIJ A;  2TRX A;  2LST A;  1EEM A;  1Z9H A;  2K9F A;  3VWU A;  1F6M C;  9GSS A;  2V2G A;  3GX0 A;  12GS A;  1PRX A;  2AJQ B;  4KW6 A;  4EUY A;  1HNB A;  4USS A;  3EPT A;  5DVB A;  5LNK e;  2J23 A;  1TOF A;  4G19 A;  3ZVJ D;  2V1M A;  3IE3 A;  2B5E A;  5LCZ A;  5HFK A;  1JFU A;  2H0H A;  4K2D A;  5F0G A;  2QA1 A;  4ML6 A;  3LEF A;  4K7O A;  2C3N A;  2R0C A;  4D73 B;  3VWX A;  3BCI A;  2LJK A;  1A0F A;  4FH8 A;  1N25 A;  4ZIJ A;  4G2E A;  3QCP A;  4OO5 A;  2NVL A;  2QA2 A;  1F9M A;  1TK8 B;  3IXR A;  3LWA A;  1PA3 A;  3APQ A;  5A5H A;  2MBS A;  4IGJ A;  4BWQ A;  3DWV A;  2I9H A;  1ZOF A;  2D2Z A;  3O6T A;  3D0Z A;  3DRN A;  4WXT A;  4TN8 A;  3D5J A;  3UOM A;  4F9Z A;  5IPG A;  1ST9 A;  4RI6 A;  4MPG A;  3VWW A;  3GSS A;  3I69 A;  2H6X A;  2IFQ A;  1S3C A;  1WOU A;  2XC2 A;  5F07 A;  2EFD A;  3FHK A;  3H93 A;  1EGO A;  5DJL A;  3KTL A;  4EL1 A;  1FW1 A;  4YKF A;  4FYU A;  5IOW A;  3MIX A;  1X5D A;  1LU4 A;  4I6X A;  1QFN A;  2H71 A;  4WBJ A;  3ZML A;  3L4N A;  3CYN A;  1EEJ A;  3DEX A;  3G7Y A;  4KND A;  4TR0 A;  3L78 A;  1GSY A;  1F2E A;  3TKP A;  5A4V A;  2HZF A;  2Z9S A;  3K8N A;  1WJK A;  4BL7 A;  4JED A;  4YAV A;  1OAZ A;  5J9C A;  4HJ2 A;  3N5O A;  2GSS A;  1NW2 A;  2XBQ A;  6GST A;  1K0C A;  1DSB A;  3UIW A;  3W6G A;  2L5O A;  5B8A A;  2G0F A;  3C1S A;  3BOA A;  1DE1 A;  1EV4 A;  3QAV A;  2JU5 A;  4MJB A;  3D22 A;  5EVO A;  4GF0 A;  1SVL A;  1AW9 A;  5EL8 A;  3HVV A;  1EV9 A;  4K7I A;  3EWL A;  3KMN A;  1B8X A;  2N5A A;  3F4T A;  1SYX A;  2DC5 A;  16GS A;  5JCG A;  2C4J A;  2RLI A;  3C1R A;  2OKA A;  5A1N B;  5FWG A;  2ZCT A;  2K18 A;  3ZFB A;  2C3T A;  1Q4J A;  2WJU A;  4EIQ A;  5J40 A;  4AKH A;  1JZO A;  3PR8 A;  3RHC A;  2LUS A;  4P3Y B;  3A5I A;  4EDY A;  4MZB A;  2WZ9 A;  3WT2 A;  2QC7 A;  3C8E A;  2LQQ A;  1SKW B;  4XS4 A;  2KLX A;  4AJ8 A;  2EIQ A;  2MMZ A;  2C80 A;  2DIZ A;  3F3Q A;  4PUF C;  2F8F A;  5ECI B;  5A34 B;  4TOP A;  4OFN A;  1KNG A;  1OE8 A;  1A8Y A;  2HZE A;  1AXD A;  1OC3 A;  3VFI A;  1ZL9 A;  3MSZ A;  1GWC A;  4KCA A;  1HNC A;  2VL3 A;  2C0G A;  5ELG A;  1FB0 A;  3F4S A;  4I97 A;  5H5Q A;  3H79 A;  3C71 A;  2H1L A;  5J4V A;  4DSQ A;  3I9V 2;  4O7H A;  2FWH A;  3VLN A;  3KEB A;  4IJI A;  3VUR A;  6GSV A;  3IPZ A;  4G0L A;  1GLQ A;  2JZS A;  4N30 A;  2OT3 A;  3WD6 A;  2P5R A;  5A5H B;  4O5U A;  5D73 A;  2DBC A;  2VCV A;  4ML1 A;  2H1B A;  1GL8 A;  3HD5 A;  5CRE A;  4NPB A;  4V2M A;  4F82 A;  3TRX A;  3S9F A;  4AKI A;  4OFM A;  1J9B A;  1DUG A;  1QUW A;  2IFQ B;  3ERW A;  5IPH A;  2UV8 G;  3MYD A;  4CDO A;  1KBN A;  1X9M B;  3M3M A;  4TXO A;  4OD7 A;  2LRC A;  2CZ3 A;  4RQX A;  1M2A A;  4J2F A;  2PGT A;  2PVO C;  1NHY A;  1OKT A;  1ERV A;  2A4V A;  2LTK A;  2K8V A;  2H0G A;  4YH2 A;  5HR1 A;  3HMJ G;  2HRK A;  2HSY A;  1AUC A;  5CYY A;  5ECL B;  4EIP A;  1W89 A;  4GWR A;  3E9J B;  3FW2 A;  3QMX A;  2YZH A;  1XW5 A;  2L4Q A;  2JZT A;  3QFB C;  2O89 A;  3PIN A;  1DBY A;  3KIJ A;  2HQT A;  5JWQ B;  1X9W B;  4BL7 B;  4KX4 A;  1USB A;  1G7E A;  4Q5Q A;  1E2Y A;  3I43 A;  3N9J A;  2DKH A;  1MD3 A;  3G9B A;  2V41 A;  4WEY A;  5CAX A;  1ML6 A;  2C0F A;  2MMN A;  1YKC A;  3Q18 A;  5HR3 A;  4KGI A;  1SL2 B;  1R4W A;  1WWJ A;  1XW6 A;  2PWJ A;  2IJY A;  2WB9 A;  4PX1 A;  1ERT A;  1M7T A;  4TR1 A;  3ED3 A;  4GDF A;  2VM1 A;  1ERU A;  2H66 A;  4FIW A;  5KOX A;  3HZ4 A;  3TGZ A;  1ABA A;  4G10 A;  4AF2 A;  3TJK A;  1SKS B;  2GQM A;  4MF5 A;  2K6V A;  3VPQ A;  2P31 A;  1ZMA A;  3Q19 A;  2ES7 A;  4IEL A;  2YWM A;  4O32 A;  5ECO B;  2AUV A;  3MAK A;  5AIV A;  4MJE A;  3LFL A;  5J47 A;  1SL0 B;  4HUA A;  4IVF A;  1K0M A;  4MPF A;  2YZU A;  3HZ8 A;  5B8B A;  4O5R A;  1K3L A;  2CX4 A;  5DAL A;  3H4K A;  1G6W A;  3TJB A;  1BG5 A;  4JU5 A;  1PKW A;  3HJM A;  1GSF A;  4QL7 A;  2VO4 A;  2VCZ A;  2AB6 A;  1BG1 A;  4G0I A;  2F8A A;  2WGR A;  3NOF A;  5A5K A;  2EIO A;  5JCW A;  5ECK B;  4AJ7 A;  4XS4 B;  1Z5Y E;  4F03 A;  5J3R A;  4ZL8 A;  1EP7 A;  4KAE A;  2C8U A;  4ZXG A;  3QR6 A;  4K9Z A;  2PMT A;  2PPT A;  4AKX B;  4MJC A;  2FA4 A;  4EKZ A;  4NXI A;  4N0Z A;  1QQ2 A;  3GRX A;  3KP8 A;  2FNO A;  2HZE B;  1O85 A;  2OJL A;  4TXV A;  1RQM A;  1FOV A;  1VGL A;  1ZYE A;  3GV1 A;  1ACV A;  3CSJ A;  1BJX A;  2GZY A;  5DCH A;  4XS1 A;  1M0U A;  4KDU A;  3M8N A;  2EFC A;  4LMW A;  4K5R A;  3UBL A;  1V9W A;  4XIH A;  4KE3 A;  3SWL A;  2FA8 A;  2R5G A;  1YY7 A;  1X5E A;  3NZN A;  4EVM A;  3QPM A;  3LXT A;  2OE0 A;  4HQS A;  4I2U A;  1EGR A;  1XWA A;  3W8S A;  1PMT A;  1AC1 A;  2YWO A;  2PN8 A;  2B5Y A;  3GIX A;  4KDY A;  1XIY A;  1NHO A;  1Z7P A;  1Q98 A;  3FZ5 A;  4L5L A;  1SD8 A;  1TP9 A;  3QDN A;  4HZ2 A;  2GDR A;  5FT3 A;  1TTZ A;  1PQN A;  3M1G A;  1XWC A;  5DCG A;  5J9B A;  2DML A;  6GSY A;  4TXO B;  3IK9 A;  1DE2 A;  2M46 A;  2PU9 C;  2LJA A;  3KZQ A;  3TRQ A;  3CRU A;  3FMW A;  2DIY A;  1SJI A;  1WIK A;  2L6C A;  1JZR A;  4WKW A;  2OE1 A;  2VOC A;  2A2S A;  3KM6 A;  4ZL7 A;  2HNL A;  2HRK B;  3AY8 A;  3G7I A;  4TRX A;  2B5X A;  4HI7 A;  2O8V B;  3TJG A;  3C7M A;  3A5W A;  4EF0 A;  1FVJ A;  3DD3 A;  4XTS A;  2DKI A;  5HR0 A;  1K0O A;  1V98 A;  3GH9 A;  3WGX A;  1XVQ A;  2FUG 2;  2R6K A;  1HNA A;  2L59 A;  3D6I A;  3FK8 A;  3ISO A;  3IAS 2;  1PGT A;  3V1W A;  4KA0 A;  2WDU A;  4TR1 B;  1JHB A;  1O6J A;  3HY2 A;  4GQF A;  2O85 A;  3MWH A;  1T1V A;  4HS1 A;  2CA8 A;  2H75 A;  2YJ7 A;  2FWF A;  4ECI A;  5ECN B;  3GKN A;  1BQ7 A;  1MD4 A;  1XWK A;  2GLR A;  4Z2T A;  2DSA A;  4WET A;  5D9T A;  2H6Y A;  2A4H A;  4O5Q A;  1U6T A;  1RW1 A;  6GSU A;  1U88 A;  2EC4 A;  4TKY A;  4DVC A;  5HQP A;  4EXJ A;  3BD2 A;  1H4O A;  2F3M A;  4MJA A;  3VI7 A;  1GP1 A;  4XHM A;  2VD0 A;  4MLY A;  1Z6N A;  1I5G A;  2KUC A;  5B6M A;  3KCM A;  1A8L A;  1O73 A;  1Z6M A;  5DAL B;  1KEB A;  4N10 A;  3HXS A;  2FWE A;  3R3E A;  3CBU A;  2DLX A;  3Q6O A;  5KN0 A;  3TUE A;  1EP8 A;  1O81 A;  1UVZ A;  2H8L A;  4Z7X A;  4DSS A;  1E6B A;  2YJH A;  4PQ1 A;  2H30 A;  3J7Y k;  2DJ3 A;  1K3O A;  4L8E A;  4WF5 A;  2VCT A;  4OFT A;  3M9K A;  3HKR A;  2VL9 A;  2OE3 A;  3F9U A;  1TRW A;  3UMA A;  5KN2 A;  1M2D A;  5G1L A;  3IR4 A;  5DJM A;  3ERG A;  3G7J A;  4YQU A;  3FY7 A;  2HSN A;  2DJ2 A;  5IO2 A;  1K0B A;  4ZBB A;  3EVI A;  5IIZ A;  5ECQ B;  3FR6 A;  5JCU A;  3M0F A;  2QKE A;  5G30 A;  2F9S A;  4AGS A;  2EFH A;  4J56 E;  2UZ8 A;  4NV5 A;  4HOJ A;  2OBK A;  1XCC A;  1F37 A;  5AN1 A;  2GZZ A;  1F3B A;  2YCD A;  4L5O A;  2IN3 A;  4E8H A;  2AV4 A;  2ALB A;  1B48 A;  5H5S A;  5A4U A;  5AIX A;  1SJZ A;  5CRH A;  4HZ4 A;  3UJ1 A;  4BVY A;  1N2A A;  2CZ2 A;  2LV3 A;  4WR5 A;  3GL3 A;  2VD1 A;  1SK0 A;  3F63 A;  2CX3 A;  4ZBD A;  2GQL A;  1QK8 A;  5GAN D;  3APS A;  2HSM A;  1XPV A;  3R2Q A;  3ZIT A;  4QMK A;  3FR9 A;  3GX8 A;  5ABR A;  4ZBA A;  2IPA A;  4KB3 A;  1OC9 A;  3KH9 A;  3RPN A;  3TKS E;  13GS A;  4N3Z A;  4MH3 A;  2VLU A;  4K8M A;  3TU3 B;  1AQX A;  4RUV A;  3IRA A;  1THX A;  1QGV A;  5G1K A;  3EYT A;  2VL2 C;  3GNJ A;  2H1G A;  2ON5 A;  6GSX A;  1TRU A;  2F51 A;  1YQ1 A;  1GUK A;  5BMU A;  3LYP A;  4GQC A;  2AAW A;  3HVX A;  1X0R A;  2N5B A;  5HR2 A;  4WBR D;  3TKS A;  2H1D A;  4G9H A;  5FHI A;  3FZ9 A;  1B9X C;  1OE7 A;  1YEX A;  3IDV A;  4PUR A;  2L57 A;  3HYP A;  2YPM A;  3KXO A;  5EPF A;  2XHF A;  4FQU A;  1TXX A;  4Z2R A;  2ZNM A;  5HFG A;  3IAM 2;  3UAP A;  3GKX A;  1KTE A;  1VF4 A;  6GSW A;  4YQV A;  4GST A;  2MMA A;  2RUE A;  3P7X A;  2IMF A;  4K2X A;  2MZC A;  2GS3 A;  4GXZ A;  1NSW A;  4HU9 A;  3PGT A;  1TXU A;  1WRY A;  2YP6 A;  5IO0 A;  5IMV A;  2FGX A;  4EE0 A;  2LRT A;  3GHA A;  2H74 A;  1A2J A;  4G01 A;  1H75 A;  1U3I A;  18GS A;  2JZR A;  4OCF A;  2YNX A;  5D9V A;  3NIV A;  3D21 A;  4ZIL A;  4J57 E;  5IMD A;  2NTO A;  3EC3 A;  4G0K A;  3VWV A;  1X9S B;  3CXG A;  1PSQ A;  4AJ6 A;  4BWS A;  2FLS A;  2H1A A;  3H1N A;  4AKG A;  2PUK C;  1Y25 A;  1SEN A;  3DKS A;  1ERW A;  1OYJ A;  5ECR B;  1C72 A;  5D93 A;  2VUP A;  5DQY A;  2VCQ A;  1WMJ A;  3QOU A;  4MP4 A;  5DQS A;  1T4Z A;  3RDW A;  4PQH A;  2VCX A;  2O87 A;  2H70 A;  4MDC A;  2REM A;  2GSQ A;  3TCO A;  22GS A;  4JBB A;  2LRN A;  2KOK A;  3VI5 A;  1GSE A;  2R0G A;  1BF5 A;  3FR3 A;  2IMK A;  2MMO A;  2E2M A;  4DSS B;  1ZCP A;  2XPD A;  2R37 A;  3C73 A;  4TR4 A;  3SBC A;  3WGE A;  1ZYN A;  1T3B A;  1YKA A;  1JLV A;  3ZTL A;  3L0H A;  2R0P A;  5GZZ B;  2TRC P;  4KDX A;  3IA1 A;  4K7N A;  2B3S A;  2BTO T;  2HSN B;  5L71 A;  1CQG A;  2OAC A;  4K6X A;  5CO3 A;  1UC7 A;  1PL2 A;  1Z7R A;  4PTS A;  4F0B A;  1SL1 B;  4HDE A;  2JSZ A;  4MH2 A;  5IMF A;  1V58 A;  3P2A A;  3J7Y b;  4LLR A;  2IWT A;  4NHZ A;  1VF3 A;  1PN9 A;  2CAQ A;  3BJ5 A;  1EOH A;  1YF1 A;  3LG6 A;  2QGV A;  3GTU A;  2I81 A;  1XOB A;  3KGK A;  1PD2 1;  1B4Q A;  1OKD A;  1ZYP A;  1BX9 A;  1HD2 A;  1V57 A;  4BVY B;  2L4C A;  1O7U A;  3E3E A;  3CSI A;  4N0V A;  2YAN A;  5CRG A;  5J4Y A;  2O7K A;  3IBH A;  4IBP A;  5JWO B;  1XZO A;  2HI7 A;  1U87 A;  5GAP D;  2HSM B;  1IYI A;  3ZVJ A;  5G5F A;  1BED A;  2V6O A;  4QL9 A;  5IMA A;  3UVT A;  5IQY A;  1OC9 B;  4MK3 A;  3GST A;  1SKR B;  2FY6 A;  2VIM A;  3EMP A;  4MZC A;  3DXB A;  4V1A p;  1N8J A;  3ME7 A;  5DAK A;  5E4W A;  1SVO A;  4GSS A;  5BMU B;  1UN2 A;  5KN1 A;  4ECB A;  3HCZ A;  5LD0 A;  2V6K A;  4MZW A;  1GLP A;  2H76 A;  4PGT A;  4XS6 A;  2CV4 A;  3DVW A;  1K0A A;  2X8G A;  3U5R E;  1T4Y A;  4KSO A;  2X8H A;  4IKH A;  4BPY A;  2DJK A;  2FD3 A;  4I8B A;  3LQ7 A;  3D4T A;  3A2V A;  3EE2 A;  2VM2 A;  8GSS A;  3FZ4 A;  4N11 A;  4XCS A;  2HYX A;  1MDI A;  3LJR A;  4ILF A;  3QAW A;  2B7K A;  5J4U A;  2EFE A;  1TKD B;  3U6V A;  3RAZ A;  4LL4 B;  1XFL A;  4Q5N A;  3KH7 A;  1ZZY A;  1FG4 A;  5F8B A;  1R26 A;  2YOI A;  2VAF A;  2NBS A;  1X5C A;  1VF2 A;  4L0W A;  3W8J A;  2VCW A;  1AQW A;  4K5S A;  4PXO A;  1S3A A;  1R5P A;  3OR5 A;  4MNN A;  1T7P B;  4OWY A;  1V2A A;  5G31 A;  3M9J A;  2AYT A;  1J08 A;  1YDK A;  4KSM A;  1TRS A;  1XBS A;  5EY6 A;  4LA1 A;  4MF7 A;  2AHE A;  1EZK A;  3I6A A;  4Q5F A;  2HRF A;  4RI7 A;  4MMM A;  10GS A;  2B7J A;  1VRS D;  3LSZ A;  2JSY A;  5A34 A;  2X64 A;  2LKU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...