1G7OA

Nmr solution structure of reduced e. coli glutaredoxin 2
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
215
structure length
215
Chain Sequence
MKLYIYDHCPYCLKARMIFGLKNIPVELHVLLNDDAETPTRMVGQKQVPILQKDDSRYMPESMDIVHYVDKLDGKPLLTGKRSPAIEEWLRKVNGYANKLLLPRFAKSAFDEFSTPAARKYFVDKKEASAGNFADLLAHSDGLIKNISDDLRALDKLIVKPNAVNGELSEDDIQLFPLLRNLTLVAGINWPSRVADYRDNMAKQTQINLLSSMAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords GLUTAREDOXIN 2
publication title Solution structure of Escherichia coli glutaredoxin-2 shows similarity to mammalian glutathione-S-transferases.
pubmed doi rcsb
source organism Escherichia coli
total genus 84
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2000-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04399 Glutaredoxin2_C Glutaredoxin 2, C terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1g7oA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1g7oA01
2J9HA 3Q6OA 4K7NA 4MPFA 4EXJA 2OBIA 2B7JA 6GSYA 3O76A 5ECHB 1KBNA 1N2AA 3ZMLA 2HZFA 4G9HA 2LTKA 2R4VA 2NBSA 3EYTA 4V1Ap 3IXRA 2B5XA 2VCTA 5FWGA 1ERWA 4KDUA 2JZRA 4TW5A 4K0GA 3F4SA 3WGXA 1BG5A 1ERUA 1G0TA 4ACSA 4TR3A 4MJBA 1AC1A 1AXDA 1EEJA 3RAZA 4EO3A 2GZPA 2FA8A 4PUFC 5HFIA 2VL2A 4IQ1A 1PSQA 2MMNA 3LGCA 3GKMA 5GAPD 3IV4A 4BPYA 1YZXA 5IOXA 4KNDA 1FB6A 3S9FA 1VRSD 2ZCTA 4WR5A 2MZCA 3PPUA 1VF4A 2H1GA 3UOMA 3KH7A 1MEKA 1SYXA 5J9CA 2X8CA 5JWOB 1V40A 2GQMA 1EP7A 5IIZA 3BOAA 4XS1A 1PRXA 5FT3A 3GKXA 3HZ4A 3KIJA 3IC8A 4FYUA 1XWKA 4DSSA 1URMA 4PQHA 4KGIA 4RI7A 1HYUA 3ISOA 5CRGA 5ECPB 2BJXA 4ZXGA 3BCIA 1XW6A 1GTAA 2YV9A 2YOIA 3TRPA 2I4AA 4IVFA 2ZNMA 3TKPA 2P5QA 2TRXA 3CSIA 5IMDA 2H70A 5IQYA 4ECBA 2XPDA 1I5GA 10GSA 1WMJA 2GT5A 3P8WA 1WWJA 1GSFA 3GSTA 4JR6A 3QFAC 4OO4A 1M99A 3F8UA 1M2BA 2DC5A 2JZSA 1PX6A 5D8IA 5CRWA 1SK0A 4HQZA 2VCVA 1XOBA 4L0UA 2VO4A 3GNJA 5DALB 3D0ZA 3LXTA 5D96A 2HZEB 4ZB8A 3W8SA 2VL3A 4KA0A 5G30A 2HLSA 2P5RA 4OFMA 2MBSA 1SENA 2GQLA 1TXXA 4G10A 1Z7PA 2YP6A 1SL2B 1A2LA 4MZBA 3EC3A 4HQSA 1JFUA 5COHA 2X8HA 5G1KA 3VWVA 1Q98A 3G7IA 2K18A 2YN1A 1KEBA 1GSSA 1TK8B 4KSMA 2H6ZA 2L5OA 3CYNA 2K9FA 1SKRB 4MZWA 4KW6A 2HSYA 1K0CA 2L5LA 2IMKA 4KDXA 3TJJA 4Q5QA 4FO5A 1XVQA 22GSA 4XIHA 4TXOB 1TTZA 4HS1A 2JZTA 4I6XA 1X5EA 2O8VB 3KEBA 3C1SA 5B7CA 3RPPA 2N5FA 3MWHA 3W8JA 3DD3A 1DSBA 4GF0A 2REMA 1SJIA 2YWIA 2EIOA 5IM9A 3L9VA 3Q18A 1TW9A 2OE3A 2HRAA 4HOJA 4I97A 1AQVA 2DJ1A 2B5EA 2JADA 1X9WB 3UBLA 1TDIA 5GAND 3VWXA 3BD2A 4P3YB 4IS0A 4WBJA 1LJRA 3TOTA 2J23A 2VM2A 1G7OA 3F63A 4JU5A 4WEYA 2NDOA 4H86A 3IR4A 4FYBA 1I9DA 1Y25A 3M8NA 1YF0A 19GSA 4V2LA 2O85A 3ME7A 5A4UA 4PTSA 2PGTA 4MF7A 2VUPA 1JLVA 4K9ZA 4F2IA 1SKSB 2FCHA 4BWSA 4K8MA 2YZUA 5L71A 3KP9A 1DE1A 1XXUA 5KN1A 2F3MA 4NV5A 3VI7A 2N5AA 13GSA 1YJ6A 2NVLA 2WRTA 3VI5A 4IBPA 4ECCA 3F3QA 1TJDA 1AIUA 2LSTA 5D9XA 6GSWA 2CV4A 1QGVA 5INYA 1E6BA 3JCML 2PPTA 2P0GA 1BEDA 5AGYA 3GFKA 3NIVA 5LNKe 12GSA 2C80A 4I2UA 4EUYA 2M80A 2RUEA 2FUG2 1GNWA 1J9BA 3DGQA 4FIWA 3BBYA 2JU5A 2LJAA 1R4WA 2GSSA 1EGRA 3TKRA 2H1DA 6GSVA 1FHEA 5G2ZA 6GSSA 3F6DA 4PNFA 2C1YA 1QQ2A 4MF5A 3FR9A 4POKA 3PR8A 2CT6A 4YQMA 3HYPA 2B7KA 2XPEA 1OAZA 3TOUA 2OE1A 3E3EA 4YH2A 4XCSA 2YZHA 3G7JA 1YKAA 5H5QA 2DMLA 3L0HA 3HJOA 2C0EA 2H75A 1AW9A 5DALA 3H1NA 1R5AA 2HZEA 2PN8A 1F37A 3KD0A 1ST9A 3QDNA 1NSWA 4TR0A 1K3YA 2X8GA 3ZIVA 4NHZA 1UA5A 4K7IA 3UBKA 4K0NA 2K6VA 4I8BA 1SD9A 5F05A 2LJKA 2I3YA 2V2GA 4HU9A 3ZREA 2AV4A 1G6WA 4OO5A 1GUHA 5ELAA 1AQXA 4EF0A 2CA8A 3LYKA 3LFLA 5EL8A 2VD0A 3TKSE 2QKEA 4MABA 4NMUA 2UZ8A 3EMPA 2GQKA 4RUVA 5LCZA 1V98A 1A8LA 5ECQB 1UC7A 1X0RA 1ZCPA 2C0DA 1OC9B 4DSSB 3IHQA 1OC3A 3EE2A 2HSMA 3KCMA 1OC8A 1G6YA 1A2MA 4JEDA 4TXOA 2ES7A 3VWUA 4LL4B 1Z9HA 3W6GA 2C0GA 3WT1A 1O7UA 3LEFA 2WULA 2VCXA 1H4OA 4KUNA 3WD6A 2H19A 5D9TA 1NHYA 2YWOA 2M72A 4N10A 5A5KA 4NXIA 2PERA 4TR1B 4PUAA 2PVQA 2XC2A 2CAIA 3KXOA 3GURA 2HRFA 4IN0A 2WS2A 4BVXB 3E9JB 1F2EA 4ML1A 2H76A 2VOCA 5ECIB 4O92A 4GSSA 1ON4A 2IFQB 3GUSA 1UVZA 3GL5A 3D4TA 3H79A 4I2TA 4N0ZA 4F03A 4GTUA 1O6JA 2C3NA 1PL2A 3IK7A 3M0FA 1USBA 1XPVA 3TRXA 9GSSA 2LS5A 2WFCA 1XWBA 2B5YA 2C4JA 2IJYA 3GA4A 4ZILA 3GRXA 2IPAA 3EMXA 4EDYA 4ZIJA 4IJIA 4LL1B 1M0UA 2HYXA 5AN1A 1K0MA 4BVYB 2IL3A 4J56E 3VPQA 2KP1A 4MLYA 1EWXA 4NAXA 4HDEA 2DLXA 1YQ1A 1JZDA 5HR3A 2I81A 5G5FA 5EVOA 4ECJA 1AAZA 2OJLA 2OADA 4O32A 3J7Yk 3A3TA 2DJ0A 1T4YA 5AIVA 3WYWA 3N9JA 1YEPA 3VFIA 1JLWA 5CRDA 3A2XA 1LBKA 3DRNA 1SL1B 1GSUA 2Z9SA 3IAM2 3TJBA 3DEXA 3GX0A 5IMZA 1PA3A 3N5OA 4WBRD 3KJYA 3NZNA 5KN2A 5CP1A 4Q5RA 2WZ9A 2C8UA 3F3RA 1YY7A 1GLQA 3PGTA 3CRUA 2XBIA 1ZZYA 3FW2A 3TJFA 1JZOA 3APQA 4NV2A 5IPHA 2GZYA 3MNGA 4ZB9A 1S3AA 3P2AA 4KAEA 3ERWA 4GCIA 1GP1A 2EIRA 3HJMA 3M9KA 1GSYA 4K7OA 4XHMA 3M3MA 1PX7A 2E2GA 3M1GA 3IA1A 2ALBA 3KP8A 3NOFA 3FHKA 5JWQB 4XS4B 3HVXA 1VF1A 1PMTA 4OFNA 1M9AA 4CW9A 4ILFA 5J5NA 1YF1A 1EOGA 1TRSA 1OC9A 3DMLA 2O89A 3TB2A 1SL0B 4OCFA 1ABAA 5G1LA 2QSIA 1UN2A 4DVCA 4TVEA 1R26A 2AHEA 2LQOA 3L78A 4MH3A 3LYPA 5ECMB 4ZBDA 3I43A 1O73A 3QPMA 3LXZA 3TJGA 3D4MA 3ZYWA 1TK5B 3LJRA 1DE2A 3D21A 1T3BA 4KCEA 3GKNA 3UVHA 5J41A 3C1RA 4QL9A 1J0FA 4KX4A 4TR1A 4XS6A 3APOA 5DJLA 3CRTA 4PGTA 4PX1A 2VLVA 3KTLA 3QCPA 3I69A 2GSRA 1HNCA 1BAYA 4BVXA 3ZMKA 2RIIA 2L4QA 3F0IA 1THXA 4AJ7A 4BWQA 5A4WA 2IFQA 2YCDA 2YNXA 3J7Yb 3RDWA 5F06A 3HDCA 2BMXA 1OYJA 4LA1A 5ECOB 4ZBAA 2H71A 3TDGA 4WXTA 3ZRDA 3IE3A 5IO2A 2GT6A 2LNSA 2LRCA 3UVTA 1O8XA 5AISA 1F9MA 2HQTA 4OCEA 4F9ZA 2B1LA 4G0IA 2VLTA 1EV4A 3O6TA 2CZ2A 2DJ2A 1U88A 1FG4A 4JBBA 1MDIA 1FB0A 4BVYA 3SBCA 2H66A 3UJ1A 5C00A 3ZTLA 2HSMB 4QQ7A 2OBKA 2O7KA 5DJMA 2VCZA 4D73A 5ECRB 5CNWA 1A24A 3QFBC 1ILOA 2HRNA 2GS3A 3FR6A 1OVNA 18GSA 2LV3A 3P90A 5DCGA 1ZL9A 1SYRA 4LMVA 4EL1A 2FWHA 4V2MA 1PN9A 16GSA 2H1BA 1ZYEA 4YQUA 5JCUA 1GTUA 2OE0A 1TKDB 2IMFA 3APSA 3KH9A 4XRAA 4Q5NA 1XCCA 2MYGA 3P7XA 4POBA 3Q19A 3L4NA 1TOFA 2YANA 3C73A 5IMVA 1Z5YE 2HXKA 2VAFA 5H5RA 1JZRA 3CBUA 3QAWA 2R2JA 2X99A 1V58A 2FGXA 3R2QA 1WP0A 2JACA 4JE1A 3QR6A 2FWEA 1PL1A 3FR3A 4AJ8A 3CTGA 2GDRA 3HA9A 1JZWA 3WT2A 4QL7A 1CQGA 1K0NA 2VCQA 4MP4A 2PMTA 3IC4A 4N0VA 1F3AA 1XWCA 4KF9A 5GSSA 1GSQA 4ZL7A 2E7PA 3FEUA 1ZGNA 2IMIA 4IKHA 5IPGA 1WJKA 4XS4A 3L9UA 2WGRA 3VK9A 1GUMA 2MMAA 2IMDA 4N11A 4IHUA 2CVBA 2YWNA 1CQHA 3D5JA 3C8EA 2V1MA 3I9V2 5ID2B 5ECSA 5ECNB 2NPBA 2X64A 4L0WA 3U6VA 2YJHA 2ON7A 5D9VA 3VLNA 4PXOA 4DSRA 2FD3A 2DIYA 3EWLA 5J3RA 1PKZA 3G7YA 3A2VA 4DSQA 1OE7A 3BCKA 3ZVJD 2AUVA 2WJUA 2HT9A 2LEGA 5DVBA 5J9BA 2PWJA 2RM6A 17GSA 4NWYA 2I9HA 3E0UA 1ACVA 2KHPA 2LKUA 2CX3A 3DIEA 3QAVA 1RQMA 4HJ2A 1VF3A 1JHBA 4TN8A 2DJKA 3CSHA 2FY6A 2B3SA 1B4QA 2RM5A 2HE3A 3DVXA 1IYIA 2FNOA 5JCGA 3EU3A 1MD4A 4E8EA 3WGDA 3EU4A 4EDZA 4PQ1A 3SWLA 5DAKB 3LG6A 3F4TA 2DBCA 5F07A 2L6DA 3V1WA 2H72A 1Q4JA 6GSTA 4OMVA 4L5LA 3GH9A 3FYGA 1SD8A 3EURA 4KDYA 2AYTA 1T00A 2PBJA 4O7HA 1TI1A 1XWAA 2MMZA 2EC4A 3DKSA 20GSA 4EE0A 3R3EA 2ZUPA 2C3QA 3HCZA 3ZVJA 2KUCA 3FZ4A 4MF6A 3GYKA 4IJ3A 4POMA 2OKAA 4HZ4A 4MPGA 5DCHA 3KZQA 3LWAA 3UEMA 2FWGA 1HD2A 2GLRA 4J57E 1N8JA 3GL3A 4ULXA 8GSSA 4POLA 1WPIA 2GVPA 1MTCA 5LD0A 1HQOA 3WGEA 3LQ7A 4GQCA 5JCWA 2RLIA 1ML6A 3ZFBA 5ECLB 1RW1A 1GUKA 4HI7A 4NHWA 3RHBA 1EEMA 5CRHA 1A2JA 5CREA 1B8XA 4ECIA 2VLUA 2F51A 4HJMA 3TGZA 3KMOA 1VGLA 4LLRA 11GSA 2H6YA 4TOPA 1X9SB 3MAKA 2C3TA 5KN0A 2A2RA 3TKSA 1T7PB 4GXZA 2PVOC 5AIXA 3TUEA 5FHIA 5EY6A 1K0OA 1SKWB 4MDCA 3QAGA 2KP2A 5HR1A 1ZMAA 2MBTA 2LJRA 4IELA 3Q74A 2AB6A 4K2DA 4DEJA 4IQAA 2CVDA 1K0BA 2A2SA 3GMFA 2GSTA 5D73A 4MCUA 4WF4A 4KB3A 2HSNB 3FZAA 4FH8A 4K6XA 4TR4A 1WIKA 3QD9A 4D73B 2YPMA 2IN3A 1TP9A 2A4VA 2JSZA 4GSNA 4MJCA 3UMAA 5ID2A 2F8AA 3FKFA 2TRCP 2GGTA 2HI7A 4KSOA 1A8YA 3VPTA 4ID0A 4ZL9A 1MD3A 2F8FA 5D9WA 1EZKA 4J2FA 14GSA 5KN3A 1V57A 3D22A 1YDKA 3ZITA 5IOWA 1B4PA 3ERFA 5DBQA 3ZZXA 3GH6A 1FO5A 4WR4A 4N30A 6GSUA 3CMIA 4MJEA 3HXSA 2R37A 1NHOA 2FLSA 1OKTA 1F6MC 3EVIA 2LUSA 4AGSA 3US3A 3KGKA 4X0XA 2WDUA 3FY7A 1FOVA 5A4VA 2FA4A 1GSEA 3IPZA 2VIMA 1QMVA 2HRKB 1FW1A 5DDLA 5E4WA 3A2WA 1M9BA 1X5DA 1QUWA 2YJ7A 4XTSA 4WF5A 3VWWA 3PINA 1BQ7A 4AF2A 4KH7A 5DAKA 4V2NA 2E2MA 4F0BA 1U3IA 2JL4A 2H73A 5F0GA 5ELGA 1GTBA 2H30A 2EIQA 1OKDA 4G0KA 1A23A 1PD21 4LMWA 2LRTA 1GSDA 3TJKA 3CSJA 3MDKA 1V9WA 4L8EA 1A0RP 4YAPA 2DSAA 4EKZA 2QC7A 5ENUA 3F6FA 2DMMA 6GSXA 5B6MA 4NPBA 5ECKB 5JWRB 2CVKA 4ML6A 2L4CA 1G7EA 1XVWA 1U6TA 1BYEA 4WETA 3GIXA 1V2AA 4FYCA 3TRQA 4X43A 5HFKA 1GL8A 4I5QA 2WCIA 3ZLPA 1Z3EA 2H0HA 3U5RE 3QMXA 4RQXA 4USSA 3TKSC 4TRXA 5CYYA 5KEJA 1M7TA 3ED3A 3FZ5A 3ZL5A 4CHSA 1J08A 5IMCA 5HR2A 1SK2A 4HU7A 4ZL8A 3GTUB 1KNGA 4K1FA 2CAQA 5B6NA 2H0GA 3ZIJA 3LSZA 3KTBA 4JR4A 5DQSA 2DJJA 3FRCA 4IW9A 1U3AA 3AY8A 2HFDA 2HSHA 1AQWA 4GSTA 1K0DA 3KMNA 2LNTA 2K8VA 2NTOA 4HEA2 4ZBBA 4IP1A 2B1KA 1W4VA 1B9YC 2ON5A 3IDVA 3UAPA 1O85A 4V1Ag 3UARA 5J4UA 2XBQA 1WOUA 1TI3A 3TCOA 4MA9A 1TRVA 3CTFA 2LRNA 3O3TA 3RBTA 4IP6A 3GKKA 3HJPA 2OA7A 5B8BA 1BJXA 3GHAA 3VURA 4GWRA 2N5BA 1GULA 2PUKC 4O5RA 1QFNA 4ZB6A 1Z6MA 1ERVA 4BL7B 3DVWA 1TK0B 1C72A 2WB9A 1K3OA 1EGOA 3DYRA 4GRFA 3M9JA 4MMMA 1R5PA 1GWCA 3IAS2 4MZCA 1TRWA 1EOHA 2H74A 2G0FA 2HRKA 4MJAA 2VL2C 1SU9A 1VF2A 1MDJA 1FVKA 2GTUA 3H8QA 1GH2A 4MK3A 2RUFA 1T1VA 3ZFLA 1HNBA 5F8BA 2M46A 3C71A 2XHFA 4TXVA 2HNLA 2YWMA 5HFGA 1U87A 1DUGA 4FQUA 4RI6A 4TKYA 1E2YA 5IMAA 2K8SA 2OACA 3HVVA 1HNAA 1TU8A 1DBYA 1Z7RA 1AUCA 2QGVA 2L6CA 3F4RA 1MDKA 4F82A 3DWVA 1XWGA 2L57A 4AJ6A 1YKCA 1SJZA 4G2EA 3KM6A 1S3CA 3GV1A 1WRYA 3ME8A 5H5SA 1WE0A 1B48A 2VL9A 1LU4A 3FZ9A 1YEXA 5ABRA 4IGJA 2H8LA 1SJ6A 4YQVA 2V32A 4XRDA 3GSSA 1IYHA 1FAAA 3F9UA 4YAVA 5CAXA 3L9SA 2H0IA 1BX9A 1XFLA 2V41A 3GN3A 3C7MA 1O81A 4OWYA 4WKWA 3EINA 4ISDA 2MMOA 5GZZB 4OFTA 3QOUA 1PKWA 1A0FA 4RQRA 5D93A 5HR0A 2PU9C 4GQFA 4G19A 2DIZA 1QK8A 2V6OA 1B9XC 3OR5A 3D6IA 1NW2A 4OD7A 5BMUA 4E8HA 1PQNA 3GTUA 3HD5A 1X9MB 2JSYA 3A5WA 3UL3A 3IK9A 4EC0A 1XW5A 2D2ZA 2LQQA 4L5OA 3CXGA 2AJQB 2P31A 3HY2A 5B8AA 2H01A 3HKRA 1X5CA 1KTEA 2H6XA 2R6KA 2TIRA 1K0AA 5IMFA 1O8WA 2L59A 2FWFA 1XIYA 2V6KA 3LORA 1GRXA 1K3LA 2FHEA 4KE3A 4F0CA 3IOSA 2IWTA 5C04A 2KLXA 4GLTA 1M2DA 1T4ZA 1XOAA 4PQIA 1RK4A 2B6MA 1M2AA 1QXHA 2R5GA 3PH9A 5EPFA 2VCWA 1GNEA 4Z7XA 1TU7A 2AAWA 3H4KA 5HQPA 3H93A 3FK8A 3RHCA 5GSTA 1NM3A 2VD1A 4EVMA 4HZ2A 4BL7A 4G0LA 3HZ8A 1GLPA 2DJ3A 2I1UA 1T8EB 4BA7A 5G31A 1Z6NA 4MH2A 2IMEA 3HHVA 1GTIA 3IBHA 1FVJA 1PGTA 3GX8A 1H75A 4Q5FA 3MSZA 2C0FA 3DXBA 1EV9A 1Y6EA 2IIYA 3I6AA 3ERGA 4KCAA 5CO3A 2R3XA 1ZOFA 1XZOA 5E59A 4JRRA 1S3DA 1ERTA 5G5EA 1F3BA 2GZZA 2F9SA 2O87A 1W89A 3K8NA 2G2QA 4PNGA 1TRUA 4JZQA 2E0QA 1THOA 1SK1A 2KOKA 2BTOT 1EP8A 1ZYQB 3RPNA 1R7HA 3G9BA 1OE8A 2GSQA 7GSSA 5IO0A 2VM1A 2CZ3A 2CQ9A 1XBSA 4PURA 3UIWA 3TKQA 4HUAA 3IRAA 3BJ5A 1XW9A 3HVSA 2CX4A 2YV7A 2H1AA 5DQYA 4X1UA 4CDOA
chains in the Genus database with same CATH superfamily
2J9HA 3Q6OA 4K7NA 4MPFA 4EXJA 2OBIA 2B7JA 6GSYA 2EFCA 3O76A 5ECHB 1KBNA 1N2AA 3ZMLA 1BG1A 4G01A 2HZFA 4G9HA 2LTKA 2R4VA 2NBSA 3EYTA 4V1Ap 3IXRA 2B5XA 2VCTA 5FWGA 1ERWA 4KDUA 2JZRA 4TW5A 4K0GA 3F4SA 4K2XA 3WGXA 1BG5A 1ERUA 1G0TA 4ACSA 4CY6A 4TR3A 4MJBA 1AC1A 1AXDA 1EEJA 3RAZA 4EO3A 2GZPA 2FA8A 4PUFC 5HFIA 2VL2A 4IQ1A 1Y1UA 4O5UA 1PSQA 2MMNA 3LGCA 3GKMA 5GAPD 3IV4A 4BPYA 1YZXA 5IOXA 3FMWA 4KNDA 1FB6A 3S9FA 1VRSD 2ZCTA 4AKIA 4WR5A 2MZCA 3PPUA 5A34B 1VF4A 2H1GA 3UOMA 3KH7A 1MEKA 1SYXA 5J9CA 2X8CA 1PN0A 5JWOB 1V40A 2GQMA 1EP7A 5IIZA 3BOAA 4XS1A 1PRXA 5FT3A 3GKXA 3HZ4A 3KIJA 3IC8A 4FYUA 1XWKA 4DSSA 1URMA 4PQHA 4KGIA 4RI7A 1HYUA 3ISOA 5CRGA 5ECPB 2BJXA 4ZXGA 3BCIA 1XW6A 1GTAA 2YV9A 3MYDA 2YOIA 3TRPA 2I4AA 4IVFA 2ZNMA 3TKPA 2P5QA 2TRXA 3CSIA 5IMDA 2H70A 5IQYA 4ECBA 2XPDA 1I5GA 2WW1A 10GSA 1WMJA 2GT5A 3P8WA 1WWJA 1GSFA 3GSTA 4JR6A 3QFAC 4OO4A 1M99A 3F8UA 1M2BA 2DC5A 2JZSA 1PX6A 1ZYNA 5D8IA 5CRWA 1SK0A 4HQZA 2VCVA 1XOBA 4L0UA 2VO4A 3GNJA 5DALB 3D0ZA 3LXTA 5D96A 2HZEB 4ZB8A 3W8SA 3CHXC 2VL3A 4KA0A 5G30A 2HLSA 2P5RA 4OFMA 2MBSA 1SENA 2GQLA 1TXXA 4G10A 1Z7PA 2YP6A 1SL2B 1A2LA 4MZBA 3EC3A 4HQSA 1JFUA 5COHA 2X8HA 5G1KA 3VWVA 1Q98A 3G7IA 2K18A 2YN1A 1KEBA 4BIKA 1GSSA 1TK8B 4KSMA 2H6ZA 2L5OA 3CYNA 2K9FA 1SKRB 4MZWA 4KW6A 2HSYA 1K0CA 2L5LA 2IMKA 4KDXA 3TJJA 4Q5QA 4FO5A 1XVQA 22GSA 4XIHA 4EIPA 4W66A 4TXOB 1TTZA 4HS1A 3A5IA 2JZTA 4I6XA 1X5EA 2O8VB 3KEBA 3C1SA 5B7CA 3RPPA 2N5FA 3MWHA 3W8JA 3DD3A 1DSBA 4GF0A 2REMA 1SJIA 2YWIA 2EIOA 5IM9A 3L9VA 3Q18A 1TW9A 2OE3A 2HRAA 4HOJA 4I97A 1AQVA 2DJ1A 3EPTA 2B5EA 2JADA 1X9WB 3UBLA 1TDIA 5GAND 3VWXA 3BD2A 4P3YB 4IS0A 4WBJA 5J4YA 1LJRA 3TOTA 2J23A 2VM2A 1G7OA 3F63A 4JU5A 4WEYA 2NDOA 4H86A 3IR4A 4FYBA 1I9DA 5KOWA 1Y25A 3M8NA 1YF0A 19GSA 4V2LA 2O85A 3ME7A 5A4UA 4PTSA 2PGTA 4MF7A 2VUPA 1JLVA 4K9ZA 4F2IA 1SKSB 2FCHA 4BWSA 4K8MA 2YZUA 5L71A 3KP9A 1DE1A 1XXUA 5KN1A 2F3MA 4NV5A 3VI7A 2N5AA 13GSA 4AKHA 1YJ6A 2NVLA 2WRTA 3VI5A 5A34A 4ICYA 4IBPA 4ECCA 3F3QA 1TJDA 1AIUA 2LSTA 5D9XA 6GSWA 2CV4A 1QGVA 5INYA 1E6BA 3JCML 2PPTA 2P0GA 1BEDA 5BRTA 5AGYA 3GFKA 3NIVA 5LNKe 12GSA 2C80A 4FXYP 4I2UA 4EUYA 2M80A 2RUEA 2FUG2 1GNWA 1J9BA 3DGQA 4FIWA 3BBYA 2JU5A 2LJAA 1R4WA 2GSSA 1EGRA 3TKRA 2H1DA 6GSVA 1FHEA 5G2ZA 6GSSA 3F6DA 4PNFA 2C1YA 4QMKA 1QQ2A 4MF5A 3FR9A 4POKA 3PR8A 2CT6A 4YQMA 3HYPA 4AKXB 2B7KA 2XPEA 1OAZA 3TOUA 1M3IA 2OE1A 3E3EA 4YH2A 4XCSA 2YZHA 3G7JA 1YKAA 5H5QA 2DMLA 3L0HA 3HJOA 2C0EA 2H75A 1AW9A 5DALA 3H1NA 1R5AA 2HZEA 2PN8A 1F37A 3KD0A 1ST9A 3QDNA 1NSWA 4TR0A 1K3YA 2X8GA 3ZIVA 4NHZA 1UA5A 4K7IA 3UBKA 4K0NA 2K6VA 4I8BA 1SD9A 5F05A 2LJKA 2I3YA 2V2GA 4HU9A 3ZREA 2AV4A 1G6WA 4OO5A 1GUHA 5ELAA 2WW3A 1AQXA 4EF0A 2CA8A 3LYKA 3LFLA 5EL8A 2VD0A 3TKSE 2QKEA 4MABA 4NMUA 2UZ8A 3EMPA 2GQKA 4RUVA 5LCZA 1V98A 1A8LA 5ECQB 1UC7A 2WVYA 1X0RA 1ZCPA 2C0DA 1OC9B 4DSSB 3IHQA 1OC3A 3EE2A 2HSMA 3KCMA 1OC8A 1G6YA 1A2MA 4JEDA 4TXOA 2ES7A 3VWUA 4LL4B 1Z9HA 4AI6A 3W6GA 2C0GA 3WT1A 1O7UA 3LEFA 2R0GA 2WULA 2VCXA 1H4OA 4KUNA 3WD6A 2H19A 5D9TA 4Z2RA 1NHYA 2YWOA 2M72A 4N10A 5A5KA 4NXIA 2PERA 3MIXA 4TR1B 4PUAA 2PVQA 2XC2A 2CAIA 5A5HB 3KXOA 2O5VA 3GURA 2HRFA 4IN0A 2WS2A 3HMJG 4BVXB 3E9JB 1F2EA 2EFHA 4ML1A 2QA2A 2H76A 2VOCA 5ECIB 4O92A 4GSSA 1ON4A 2IFQB 1SVMA 3GUSA 1UVZA 3GL5A 3D4TA 3H79A 4I2TA 4N0ZA 4F03A 4GTUA 1O6JA 2C3NA 1PL2A 3IK7A 3M0FA 1USBA 1XPVA 3TRXA 9GSSA 2LS5A 2WFCA 1XWBA 2B5YA 2C4JA 2IJYA 3GA4A 4ZILA 3GRXA 2IPAA 3EMXA 4EDYA 4ZIJA 4IJIA 4LL1B 1M0UA 2HYXA 5AN1A 1K0MA 2DKIA 4BVYB 2IL3A 4J56E 3VPQA 2KP1A 4MLYA 1EWXA 4NAXA 4HDEA 2DLXA 1YQ1A 2A2PA 1JZDA 5A1NB 5HR3A 2I81A 5G5FA 5EVOA 4ECJA 1AAZA 2OJLA 2OADA 4O32A 3J7Yk 3A3TA 2DJ0A 1T4YA 5AIVA 3WYWA 3N9JA 1YEPA 3VFIA 1JLWA 5CRDA 3A2XA 1LBKA 3DRNA 1SL1B 4K5RA 1GSUA 2Z9SA 3IAM2 3TJBA 3DEXA 1YVLA 3GX0A 5IMZA 1PA3A 3N5OA 4WBRD 3KJYA 3NZNA 5KN2A 5CP1A 4Q5RA 2WZ9A 2C8UA 3F3RA 1YY7A 1GLQA 3PGTA 3CRUA 2XBIA 1ZZYA 3FW2A 3TJFA 1JZOA 3APQA 4NV2A 5IPHA 2GZYA 3MNGA 4ZB9A 1S3AA 3P2AA 4KAEA 3ERWA 4GCIA 1GP1A 2EIRA 3HJMA 3M9KA 1GSYA 4K7OA 4XHMA 3M3MA 1PX7A 2E2GA 3M1GA 3IA1A 2ALBA 3KP8A 3NOFA 4YKGA 2DKHA 3FHKA 5JWQB 4XS4B 3HVXA 1VF1A 1PMTA 4OFNA 1M9AA 4CW9A 4ILFA 3RGBC 5J5NA 1YF1A 1EOGA 1TRSA 1OC9A 3DMLA 2O89A 3TB2A 2X4AA 1SL0B 4OCFA 1ABAA 5G1LA 2QSIA 1UN2A 4DVCA 4TVEA 1R26A 1SVLA 2AHEA 2LQOA 3L78A 4MH3A 3LYPA 5ECMB 4ZBDA 3I43A 1O73A 3LXZA 3QPMA 3TJGA 3D4MA 3ZYWA 1TK5B 3LJRA 1DE2A 3D21A 1T3BA 4KCEA 3GKNA 3UVHA 5J41A 3C1RA 4QL9A 1J0FA 4KX4A 4TR1A 4XS6A 3APOA 2WW0A 5DJLA 3CRTA 5A5HA 4PGTA 4PX1A 2VLVA 3KTLA 3QCPA 3I69A 2GSRA 1HNCA 1BAYA 4YKFA 4BVXA 3ZMKA 2RIIA 3RFRC 2L4QA 4Z2TA 3F0IA 1THXA 4AJ7A 4BWQA 5A4WA 2IFQA 2YCDA 2YNXA 3J7Yb 3RDWA 5F06A 3HDCA 2BMXA 1OYJA 4LA1A 5ECOB 4ZBAA 2H71A 3TDGA 4WXTA 3ZRDA 3IE3A 5IO2A 2GT6A 2LNSA 2LRCA 3UVTA 1O8XA 5AISA 1F9MA 2HQTA 4OCEA 4F9ZA 2B1LA 4G0IA 2VLTA 1EV4A 3O6TA 2CZ2A 2DJ2A 1U88A 1FG4A 4JBBA 1MDIA 1FB0A 4BVYA 3SBCA 2H66A 3UJ1A 5C00A 3ZTLA 2HSMB 4QQ7A 2OBKA 2O7KA 5DJMA 2VCZA 4D73A 5ECRB 5CNWA 1A24A 3QFBC 1ILOA 1I1IP 2HRNA 5A1NA 2GS3A 3FR6A 1OVNA 18GSA 2LV3A 3P90A 5DCGA 1ZL9A 1SYRA 4LMVA 4EL1A 2FWHA 4V2MA 1PN9A 16GSA 2H1BA 1ZYEA 4YQUA 5JCUA 1GTUA 2OE0A 1TKDB 2IMFA 3APSA 3KH9A 4XRAA 4Q5NA 1XCCA 2MYGA 3P7XA 4POBA 3Q19A 3L4NA 1TOFA 2YANA 3C73A 5IMVA 1Z5YE 2HXKA 2VAFA 5H5RA 1JZRA 3CBUA 3QAWA 4Z2UA 2R2JA 2X99A 1V58A 2FGXA 3R2QA 1WP0A 2JACA 4JE1A 3QR6A 2FWEA 1PL1A 3FR3A 4AJ8A 3CTGA 2GDRA 3HA9A 1JZWA 3WT2A 4QL7A 2O3EA 1CQGA 1K0NA 2VCQA 4MP4A 2PMTA 3IC4A 4N0VA 1F3AA 1XWCA 4KF9A 5GSSA 1GSQA 4ZL7A 2E7PA 3FEUA 1ZGNA 1S4BP 1S3RA 2IMIA 4IKHA 5IPGA 1WJKA 4XS4A 3L9UA 2WGRA 3VK9A 1GUMA 2MMAA 2IMDA 4N11A 4IHUA 2CVBA 2YWNA 1CQHA 3D5JA 3C8EA 2V1MA 3I9V2 5ID2B 5ECSA 5ECNB 2NPBA 2X64A 4L0WA 3U6VA 2YJHA 2ON7A 5D9VA 3VLNA 4PXOA 4DSRA 2FD3A 2DIYA 3EWLA 5J3RA 1PKZA 3G7YA 3A2VA 4DSQA 1OE7A 3BCKA 3ZVJD 2AUVA 2WJUA 3TU3B 2HT9A 2LEGA 2R0PA 5DVBA 5J9BA 2PWJA 2RM6A 17GSA 4NWYA 2I9HA 3E0UA 1ACVA 2KHPA 2LKUA 2CX3A 3DIEA 3QAVA 1RQMA 4HJ2A 1VF3A 1JHBA 4TN8A 2DJKA 3CSHA 2FY6A 2B3SA 2OT3A 1B4QA 2RM5A 2HE3A 3DVXA 1IYIA 2FNOA 5JCGA 3EU3A 2R0CA 1MD4A 4E8EA 3WGDA 3EU4A 4EDZA 4PQ1A 3SWLA 5DAKB 3LG6A 3F4TA 2DBCA 5F07A 2L6DA 3V1WA 2H72A 1Q4JA 6GSTA 4OMVA 4L5LA 3GH9A 3FYGA 1SD8A 3EURA 4KDYA 2AYTA 1T00A 2PBJA 2QA1A 4O7HA 1TI1A 1XWAA 2MMZA 2EC4A 3DKSA 20GSA 5J47A 4EE0A 3R3EA 2ZUPA 2C3QA 3HCZA 2O36A 3ZVJA 2KUCA 3FZ4A 4MF6A 3GYKA 4IJ3A 2WVXB 4POMA 2OKAA 4HZ4A 4MPGA 5DCHA 3KZQA 3LWAA 3UEMA 2FWGA 1HD2A 2GLRA 4J57E 1N8JA 3GL3A 4ULXA 8GSSA 4POLA 1WPIA 5J4VA 2GVPA 1MTCA 5LD0A 1HQOA 3WGEA 3LQ7A 4GQCA 5JCWA 2RLIA 1ML6A 3ZFBA 5ECLB 1RW1A 2UV8G 1GUKA 4HI7A 4NHWA 3RHBA 4AKGA 1EEMA 5CRHA 1A2JA 5CREA 1B8XA 4ECIA 2VLUA 2F51A 4HJMA 3TGZA 4K5SA 3KMOA 1VGLA 4LLRA 11GSA 2H6YA 4TOPA 1X9SB 3MAKA 2C3TA 5KN0A 2A2RA 3TKSA 1T7PB 4GXZA 2PVOC 5AIXA 3TUEA 5FHIA 5EY6A 1K0OA 1SKWB 4MDCA 3QAGA 2KP2A 5HR1A 1ZMAA 2MBTA 2LJRA 4IELA 3Q74A 2EFDA 2AB6A 4K2DA 4DEJA 4IQAA 2CVDA 1K0BA 2A2SA 2WZSA 3GMFA 2GSTA 5D73A 4MCUA 4WF4A 4KB3A 2HSNB 3FZAA 4FH8A 4K6XA 4TR4A 1WIKA 3QD9A 4D73B 2YPMA 2EFEA 2IN3A 1TP9A 2A4VA 2JSZA 4GSNA 4MJCA 3UMAA 5ID2A 4HSCX 2F8AA 3FKFA 2TRCP 2GGTA 2HI7A 4KSOA 1A8YA 3VPTA 4ID0A 4ZL9A 1MD3A 2F8FA 5D9WA 1EZKA 4J2FA 4A5PA 14GSA 5KN3A 1V57A 3D22A 1YDKA 3ZITA 5IOWA 1B4PA 3ERFA 5DBQA 3CQFA 2A4HA 3ZZXA 3GH6A 1FO5A 4WR4A 4N30A 6GSUA 3CMIA 4MJEA 3HXSA 2R37A 1NHOA 2FLSA 1OKTA 1F6MC 3EVIA 2LUSA 4AGSA 3US3A 3KGKA 4X0XA 2WDUA 3FY7A 1FOVA 5A4VA 2FA4A 1GSEA 4E68A 3IPZA 2VIMA 3IHGA 1QMVA 2HRKB 1FW1A 5DDLA 5E4WA 3A2WA 4MNNA 1M9BA 1X5DA 1PFOA 1QUWA 2YJ7A 4XTSA 2X49A 4WF5A 3VWWA 3PINA 1BQ7A 4AF2A 4KH7A 5DAKA 4V2NA 2E2MA 4F0BA 1U3IA 2JL4A 2H73A 5F0GA 4PI0C 5ELGA 1GTBA 2H30A 2EIQA 1OKDA 4G0KA 1A23A 1PD21 4LMWA 2LRTA 1GSDA 3TJKA 3CSJA 3MDKA 1V9WA 4L8EA 1A0RP 4YAPA 2DSAA 2WVXA 4EKZA 2QC7A 5ENUA 3F6FA 2DMMA 6GSXA 5B6MA 4NPBA 5ECKB 5JWRB 2CVKA 4ML6A 2L4CA 1G7EA 1XVWA 1U6TA 1BYEA 4WETA 3GIXA 1V2AA 4FYCA 3TRQA 4X43A 5HFKA 1GL8A 4I5QA 2WCIA 3ZLPA 1Z3EA 2H0HA 3U5RE 4EIQA 3QMXA 4RQXA 1FOHA 4USSA 3TKSC 4TRXA 5CYYA 5KEJA 1M7TA 3ED3A 3FZ5A 3ZL5A 4CHSA 1J08A 5IMCA 1M3JA 5HR2A 5BMUB 1SK2A 3CWGA 4HU7A 4ZL8A 3GTUB 1KNGA 4K1FA 2CAQA 5B6NA 2H0GA 3ZIJA 3LSZA 3KTBA 4JR4A 5DQSA 2DJJA 3FRCA 4IW9A 1U3AA 3AY8A 2HFDA 2HSHA 1AQWA 4GSTA 1K0DA 3KMNA 2LNTA 2K8VA 2NTOA 4HEA2 4ZBBA 4CY8A 2HSNA 4IP1A 2B1KA 1W4VA 1B9YC 2ON5A 3IDVA 3UAPA 1O85A 4V1Ag 3UARA 3HVNA 5J4UA 2XBQA 1WOUA 1TI3A 3TCOA 4MA9A 1TRVA 4GDFA 3CTFA 1TXUA 1SVOA 2LRNA 3O3TA 3RBTA 4IP6A 3GKKA 3HJPA 2OA7A 2VKZG 5B8BA 1BJXA 3GHAA 3VURA 4GWRA 2N5BA 1GULA 2PUKC 4O5RA 1QFNA 4ZB6A 1Z6MA 1ERVA 4BL7B 3DVWA 4PI2C 1TK0B 1C72A 2WB9A 1K3OA 1EGOA 3DYRA 4GRFA 3M9JA 4MMMA 1R5PA 1GWCA 3IAS2 4MZCA 1TRWA 2WVZA 4N3ZA 1EOHA 2H74A 2G0FA 2HRKA 4MJAA 2VL2C 1SU9A 1VF2A 1MDJA 1FVKA 2GTUA 3H8QA 1GH2A 4MK3A 2RUFA 1T1VA 3ZFLA 1HNBA 5F8BA 2M46A 3C71A 2WW2A 2XHFA 4TXVA 2HNLA 1N25A 2YWMA 5HFGA 1U87A 1DUGA 4FQUA 4RI6A 4TKYA 1E2YA 5IMAA 2K8SA 2OACA 3HVVA 1BF5A 1HNAA 1TU8A 1DBYA 1Z7RA 1AUCA 2QGVA 2L6CA 3F4RA 1MDKA 4F82A 3DWVA 1XWGA 2L57A 4AJ6A 1YKCA 1SJZA 4G2EA 5J40A 3KM6A 1S3CA 3GV1A 1WRYA 2H1LA 3ME8A 1WE0A 1B48A 5H5SA 2VL9A 1LU4A 3FZ9A 1YEXA 5ABRA 4IGJA 2H8LA 1SJ6A 4YQVA 2V32A 4XRDA 3GSSA 1IYHA 1FAAA 3F9UA 4YAVA 5CAXA 3L9SA 4O5QA 2H0IA 1BX9A 1XFLA 2V41A 3GN3A 3C7MA 1O81A 4OWYA 4WKWA 3EINA 4ISDA 2MMOA 5GZZB 4OFTA 3LW9A 3QOUA 1PKWA 1A0FA 4RQRA 5D93A 5HR0A 2PU9C 4GQFA 4G19A 2DIZA 1QK8A 2V6OA 1B9XC 3OR5A 3D6IA 1NW2A 4OD7A 5BMUA 4E8HA 1PQNA 3GTUA 3HD5A 1X9MB 1YEWC 4PHZC 2JSYA 3A5WA 3UL3A 3IK9A 4EC0A 1XW5A 2D2ZA 2LQQA 4L5OA 3CXGA 2AJQB 2P31A 3HY2A 5B8AA 2H01A 3HKRA 1X5CA 1KTEA 2H6XA 2R6KA 2TIRA 1K0AA 5IMFA 1O8WA 2L59A 2FWFA 1XIYA 2V6KA 3LORA 1GRXA 1K3LA 2FHEA 4KE3A 4F0CA 3IOSA 2IWTA 5C04A 2KLXA 4GLTA 1M2DA 1T4ZA 1XG8A 1XOAA 4PQIA 1RK4A 2B6MA 1M2AA 1QXHA 2R5GA 3PH9A 5EPFA 2VCWA 1GNEA 4Z7XA 1TU7A 2AAWA 3H4KA 5HQPA 3H93A 3FK8A 3RHCA 5GSTA 1NM3A 2VD1A 4EVMA 4HZ2A 4BL7A 4G0LA 3HZ8A 1GLPA 2DJ3A 2I1UA 1T8EB 4BA7A 5G31A 1Z6NA 4MH2A 2IMEA 3HHVA 1GTIA 3IBHA 1FVJA 1PGTA 3GX8A 1H75A 4Q5FA 1ZYPA 3MSZA 2C0FA 3DXBA 1EV9A 1Y6EA 2IIYA 3I6AA 3ERGA 4KCAA 5CO3A 2R3XA 1ZOFA 4X4JA 1XZOA 5E59A 4JRRA 1S3DA 1ERTA 5G5EA 1F3BA 2GZZA 2F9SA 5KOXA 2O87A 1W89A 3K8NA 2G2QA 4PNGA 1TRUA 4ZB7A 4JZQA 2E0QA 1THOA 1SK1A 2KOKA 2BTOT 1EP8A 1ZYQB 3RPNA 1R7HA 3G9BA 1OE8A 2GSQA 7GSSA 5IO0A 2VM1A 2CZ3A 2CQ9A 1XBSA 4PURA 3UIWA 3TKQA 4HUAA 3IRAA 3BJ5A 1XW9A 3HVSA 2CX4A 2YV7A 2H1AA 5DQYA 4X1UA 4CDOA
chains in the Genus database with same CATH topology
2J9HA 3Q6OA 4K7NA 4MPFA 4EXJA 2OBIA 2B7JA 6GSYA 2EFCA 3O76A 5ECHB 1KBNA 1N2AA 3ZMLA 1BG1A 4G01A 2HZFA 4G9HA 2LTKA 2R4VA 2NBSA 3EYTA 4V1Ap 3IXRA 2B5XA 2VCTA 5FWGA 1ERWA 4KDUA 2JZRA 4TW5A 4K0GA 3F4SA 4K2XA 3WGXA 1BG5A 1ERUA 1G0TA 4ACSA 4CY6A 4TR3A 4MJBA 1AC1A 1AXDA 1EEJA 3RAZA 4EO3A 2GZPA 2FA8A 4PUFC 5HFIA 2VL2A 4IQ1A 1Y1UA 4O5UA 1PSQA 2MMNA 3LGCA 3GKMA 5GAPD 3IV4A 4BPYA 1YZXA 5IOXA 3FMWA 4KNDA 1FB6A 3S9FA 1VRSD 2ZCTA 4AKIA 4WR5A 2MZCA 3PPUA 5A34B 1VF4A 2H1GA 3UOMA 3KH7A 1MEKA 1SYXA 5J9CA 2X8CA 1PN0A 5JWOB 1V40A 2GQMA 1EP7A 5IIZA 3BOAA 4XS1A 1PRXA 5FT3A 3GKXA 3HZ4A 3KIJA 3IC8A 4FYUA 1XWKA 4DSSA 1URMA 4PQHA 4KGIA 4RI7A 1HYUA 3ISOA 5CRGA 5ECPB 2BJXA 4ZXGA 3BCIA 1XW6A 1GTAA 2YV9A 3MYDA 2YOIA 3TRPA 2I4AA 4IVFA 2ZNMA 3TKPA 2P5QA 2TRXA 3CSIA 5IMDA 2H70A 5IQYA 4ECBA 2XPDA 1I5GA 10GSA 1WMJA 2GT5A 3P8WA 1WWJA 1GSFA 3GSTA 4JR6A 3QFAC 4OO4A 1M99A 3F8UA 1M2BA 2DC5A 2JZSA 1PX6A 1ZYNA 5D8IA 5CRWA 1SK0A 4HQZA 2VCVA 1XOBA 4L0UA 2VO4A 3GNJA 5DALB 3D0ZA 3LXTA 5D96A 2HZEB 4ZB8A 3W8SA 2VL3A 4KA0A 5G30A 2HLSA 2P5RA 4OFMA 2MBSA 1SENA 2GQLA 1TXXA 4G10A 1Z7PA 2YP6A 1SL2B 1A2LA 4MZBA 3EC3A 4HQSA 1JFUA 5COHA 2X8HA 5G1KA 3VWVA 1Q98A 3G7IA 2K18A 2YN1A 1KEBA 1GSSA 1TK8B 4KSMA 2H6ZA 2L5OA 3CYNA 2K9FA 1SKRB 4MZWA 4KW6A 2HSYA 1K0CA 2L5LA 2IMKA 4KDXA 3TJJA 4Q5QA 4FO5A 1XVQA 22GSA 4XIHA 4EIPA 4W66A 4TXOB 1TTZA 4HS1A 3A5IA 2JZTA 4I6XA 1X5EA 2O8VB 3KEBA 3C1SA 5B7CA 3RPPA 2N5FA 3MWHA 3W8JA 3DD3A 1DSBA 4GF0A 2REMA 1SJIA 2YWIA 2EIOA 5IM9A 3L9VA 3Q18A 1TW9A 2OE3A 2HRAA 4HOJA 4I97A 1AQVA 2DJ1A 3EPTA 2B5EA 2JADA 1X9WB 3UBLA 1TDIA 5GAND 3VWXA 3BD2A 4P3YB 4IS0A 4WBJA 5J4YA 1LJRA 3TOTA 2J23A 2VM2A 1G7OA 3F63A 4JU5A 4WEYA 2NDOA 4H86A 3IR4A 4FYBA 1I9DA 5KOWA 1Y25A 3M8NA 1YF0A 19GSA 4V2LA 2O85A 3ME7A 5A4UA 4PTSA 2PGTA 4MF7A 2VUPA 1JLVA 4K9ZA 4F2IA 1SKSB 2FCHA 4BWSA 4K8MA 2YZUA 5L71A 3KP9A 1DE1A 1XXUA 5KN1A 2F3MA 4NV5A 3VI7A 2N5AA 13GSA 4AKHA 1YJ6A 2NVLA 2WRTA 3VI5A 5A34A 4ICYA 4IBPA 4ECCA 3F3QA 1TJDA 1AIUA 2LSTA 5D9XA 6GSWA 2CV4A 1QGVA 5INYA 1E6BA 3JCML 2PPTA 2P0GA 1BEDA 5BRTA 5AGYA 3GFKA 3NIVA 5LNKe 12GSA 2C80A 4I2UA 4EUYA 2M80A 2RUEA 2FUG2 1GNWA 1J9BA 3DGQA 4FIWA 3BBYA 2JU5A 2LJAA 1R4WA 2GSSA 1EGRA 3TKRA 2H1DA 6GSVA 1FHEA 5G2ZA 6GSSA 3F6DA 4PNFA 2C1YA 4QMKA 1QQ2A 4MF5A 3FR9A 4POKA 3PR8A 2CT6A 4YQMA 3HYPA 4AKXB 2B7KA 2XPEA 1OAZA 3TOUA 2OE1A 3E3EA 4YH2A 4XCSA 2YZHA 3G7JA 1YKAA 5H5QA 2DMLA 3L0HA 3HJOA 2C0EA 2H75A 1AW9A 5DALA 3H1NA 1R5AA 2HZEA 2PN8A 1F37A 3KD0A 1ST9A 3QDNA 1NSWA 4TR0A 1K3YA 2X8GA 3ZIVA 4NHZA 1UA5A 4K7IA 3UBKA 4K0NA 2K6VA 4I8BA 1SD9A 5F05A 2LJKA 2I3YA 2V2GA 4HU9A 3ZREA 2AV4A 1G6WA 4OO5A 1GUHA 5ELAA 1AQXA 4EF0A 2CA8A 3LYKA 3LFLA 5EL8A 2VD0A 3TKSE 2QKEA 4MABA 4NMUA 2UZ8A 3EMPA 2GQKA 4RUVA 5LCZA 1V98A 1A8LA 5ECQB 1UC7A 1X0RA 1ZCPA 2C0DA 1OC9B 4DSSB 3IHQA 1OC3A 3EE2A 2HSMA 3KCMA 1OC8A 1G6YA 1A2MA 4JEDA 4TXOA 2ES7A 3VWUA 4LL4B 1Z9HA 4AI6A 3W6GA 2C0GA 3WT1A 1O7UA 3LEFA 2R0GA 2WULA 2VCXA 1H4OA 4KUNA 3WD6A 2H19A 5D9TA 4Z2RA 1NHYA 2YWOA 2M72A 4N10A 5A5KA 4NXIA 2PERA 3MIXA 4TR1B 4PUAA 2PVQA 2XC2A 2CAIA 5A5HB 3KXOA 2O5VA 3GURA 2HRFA 4IN0A 2WS2A 3HMJG 4BVXB 3E9JB 1F2EA 2EFHA 4ML1A 2QA2A 2H76A 2VOCA 5ECIB 4O92A 4GSSA 1ON4A 2IFQB 1SVMA 3GUSA 1UVZA 3GL5A 3D4TA 3H79A 4I2TA 4N0ZA 4F03A 4GTUA 1O6JA 2C3NA 1PL2A 3IK7A 3M0FA 1USBA 1XPVA 3TRXA 9GSSA 2LS5A 2WFCA 1XWBA 2B5YA 2C4JA 2IJYA 3GA4A 4ZILA 3GRXA 2IPAA 3EMXA 4EDYA 4ZIJA 4IJIA 4LL1B 1M0UA 2HYXA 5AN1A 1K0MA 2DKIA 4BVYB 2IL3A 4J56E 3VPQA 2KP1A 4MLYA 1EWXA 4NAXA 4HDEA 2DLXA 1YQ1A 2A2PA 1JZDA 5A1NB 5HR3A 2I81A 5G5FA 5EVOA 4ECJA 1AAZA 2OJLA 2OADA 4O32A 3J7Yk 3A3TA 2DJ0A 1T4YA 5AIVA 3WYWA 3N9JA 1YEPA 3VFIA 1JLWA 5CRDA 3A2XA 1LBKA 3DRNA 1SL1B 4K5RA 1GSUA 2Z9SA 3IAM2 3TJBA 3DEXA 1YVLA 3GX0A 5IMZA 1PA3A 3N5OA 4WBRD 3KJYA 3NZNA 5KN2A 5CP1A 4Q5RA 2WZ9A 2C8UA 3F3RA 1YY7A 1GLQA 3PGTA 3CRUA 2XBIA 1ZZYA 3FW2A 3TJFA 1JZOA 3APQA 4NV2A 5IPHA 2GZYA 3MNGA 4ZB9A 1S3AA 3P2AA 4KAEA 3ERWA 4GCIA 1GP1A 2EIRA 3HJMA 3M9KA 1GSYA 4K7OA 4XHMA 3M3MA 1PX7A 2E2GA 3M1GA 3IA1A 2ALBA 3KP8A 3NOFA 4YKGA 2DKHA 3FHKA 5JWQB 4XS4B 3HVXA 1VF1A 1PMTA 4OFNA 1M9AA 4CW9A 4ILFA 5J5NA 1YF1A 1EOGA 1TRSA 1OC9A 3DMLA 2O89A 3TB2A 2X4AA 1SL0B 4OCFA 1ABAA 5G1LA 2QSIA 1UN2A 4DVCA 4TVEA 1R26A 1SVLA 2AHEA 2LQOA 3L78A 4MH3A 3LYPA 5ECMB 4ZBDA 3I43A 1O73A 3LXZA 3QPMA 3TJGA 3D4MA 3ZYWA 1TK5B 3LJRA 1DE2A 3D21A 1T3BA 4KCEA 3GKNA 3UVHA 5J41A 3C1RA 4QL9A 1J0FA 4KX4A 4TR1A 4XS6A 3APOA 5DJLA 3CRTA 5A5HA 4PGTA 4PX1A 2VLVA 3KTLA 3QCPA 3I69A 2GSRA 1HNCA 1BAYA 4YKFA 4BVXA 3ZMKA 2RIIA 2L4QA 4Z2TA 3F0IA 1THXA 4AJ7A 4BWQA 5A4WA 2IFQA 2YCDA 2YNXA 3J7Yb 3RDWA 5F06A 3HDCA 2BMXA 1OYJA 4LA1A 5ECOB 4ZBAA 2H71A 3TDGA 4WXTA 3ZRDA 3IE3A 5IO2A 2GT6A 2LNSA 2LRCA 3UVTA 1O8XA 5AISA 1F9MA 2HQTA 4OCEA 4F9ZA 2B1LA 4G0IA 2VLTA 1EV4A 3O6TA 2CZ2A 2DJ2A 1U88A 1FG4A 4JBBA 1MDIA 1FB0A 4BVYA 3SBCA 2H66A 3UJ1A 5C00A 3ZTLA 2HSMB 4QQ7A 2OBKA 2O7KA 5DJMA 2VCZA 4D73A 5ECRB 5CNWA 1A24A 3QFBC 1ILOA 2HRNA 5A1NA 2GS3A 3FR6A 1OVNA 18GSA 2LV3A 3P90A 5DCGA 1ZL9A 1SYRA 4LMVA 4EL1A 2FWHA 4V2MA 1PN9A 16GSA 2H1BA 1ZYEA 4YQUA 5JCUA 1GTUA 2OE0A 1TKDB 2IMFA 3APSA 3KH9A 4XRAA 4Q5NA 1XCCA 2MYGA 3P7XA 4POBA 3Q19A 3L4NA 1TOFA 2YANA 3C73A 5IMVA 1Z5YE 2HXKA 2VAFA 5H5RA 1JZRA 3CBUA 3QAWA 4Z2UA 2R2JA 2X99A 1V58A 2FGXA 3R2QA 1WP0A 2JACA 4JE1A 3QR6A 2FWEA 1PL1A 3FR3A 4AJ8A 3CTGA 2GDRA 3HA9A 1JZWA 3WT2A 4QL7A 1CQGA 1K0NA 2VCQA 4MP4A 2PMTA 3IC4A 4N0VA 1F3AA 1XWCA 4KF9A 5GSSA 1GSQA 4ZL7A 2E7PA 3FEUA 1ZGNA 2IMIA 4IKHA 5IPGA 1WJKA 4XS4A 3L9UA 2WGRA 3VK9A 1GUMA 2MMAA 2IMDA 4N11A 4IHUA 2CVBA 2YWNA 1CQHA 3D5JA 3C8EA 2V1MA 3I9V2 5ID2B 5ECSA 5ECNB 2NPBA 2X64A 4L0WA 3U6VA 2YJHA 2ON7A 5D9VA 3VLNA 4PXOA 4DSRA 2FD3A 2DIYA 3EWLA 5J3RA 1PKZA 3G7YA 3A2VA 4DSQA 1OE7A 3BCKA 3ZVJD 2AUVA 2WJUA 3TU3B 2HT9A 2LEGA 2R0PA 5DVBA 5J9BA 2PWJA 2RM6A 17GSA 4NWYA 2I9HA 3E0UA 1ACVA 2KHPA 2LKUA 2CX3A 3DIEA 3QAVA 1RQMA 4HJ2A 1VF3A 1JHBA 4TN8A 2DJKA 3CSHA 2FY6A 2B3SA 2OT3A 1B4QA 2RM5A 2HE3A 3DVXA 1IYIA 2FNOA 5JCGA 3EU3A 2R0CA 1MD4A 4E8EA 3WGDA 3EU4A 4EDZA 4PQ1A 3SWLA 5DAKB 3LG6A 3F4TA 2DBCA 5F07A 2L6DA 3V1WA 2H72A 1Q4JA 6GSTA 4OMVA 4L5LA 3GH9A 3FYGA 1SD8A 3EURA 4KDYA 2AYTA 1T00A 2PBJA 2QA1A 4O7HA 1TI1A 1XWAA 2MMZA 2EC4A 3DKSA 20GSA 5J47A 4EE0A 3R3EA 2ZUPA 2C3QA 3HCZA 3ZVJA 2KUCA 3FZ4A 4MF6A 3GYKA 4IJ3A 4POMA 2OKAA 4HZ4A 4MPGA 5DCHA 3KZQA 3LWAA 3UEMA 2FWGA 1HD2A 2GLRA 4J57E 1N8JA 3GL3A 4ULXA 8GSSA 4POLA 1WPIA 5J4VA 2GVPA 1MTCA 5LD0A 1HQOA 3WGEA 3LQ7A 4GQCA 5JCWA 2RLIA 1ML6A 3ZFBA 5ECLB 1RW1A 2UV8G 1GUKA 4HI7A 4NHWA 3RHBA 4AKGA 1EEMA 5CRHA 1A2JA 5CREA 1B8XA 4ECIA 2VLUA 2F51A 4HJMA 3TGZA 4K5SA 3KMOA 1VGLA 4LLRA 11GSA 2H6YA 4TOPA 1X9SB 3MAKA 2C3TA 5KN0A 2A2RA 3TKSA 1T7PB 4GXZA 2PVOC 5AIXA 3TUEA 5FHIA 5EY6A 1K0OA 1SKWB 4MDCA 3QAGA 2KP2A 5HR1A 1ZMAA 2MBTA 2LJRA 4IELA 3Q74A 2EFDA 2AB6A 4K2DA 4DEJA 4IQAA 2CVDA 1K0BA 2A2SA 3GMFA 2GSTA 5D73A 4MCUA 4WF4A 4KB3A 2HSNB 3FZAA 4FH8A 4K6XA 4TR4A 1WIKA 3QD9A 4D73B 2YPMA 2EFEA 2IN3A 1TP9A 2A4VA 2JSZA 4GSNA 4MJCA 3UMAA 5ID2A 2F8AA 3FKFA 2TRCP 2GGTA 2HI7A 4KSOA 1A8YA 3VPTA 4ID0A 4ZL9A 1MD3A 2F8FA 5D9WA 1EZKA 4J2FA 4A5PA 14GSA 5KN3A 1V57A 3D22A 1YDKA 3ZITA 5IOWA 1B4PA 3ERFA 5DBQA 2A4HA 3ZZXA 3GH6A 1FO5A 4WR4A 4N30A 6GSUA 3CMIA 4MJEA 3HXSA 2R37A 1NHOA 2FLSA 1OKTA 1F6MC 3EVIA 2LUSA 4AGSA 3US3A 3KGKA 4X0XA 2WDUA 3FY7A 1FOVA 5A4VA 2FA4A 1GSEA 4E68A 3IPZA 2VIMA 3IHGA 1QMVA 2HRKB 1FW1A 5DDLA 5E4WA 3A2WA 4MNNA 1M9BA 1X5DA 1QUWA 2YJ7A 4XTSA 2X49A 4WF5A 3VWWA 3PINA 1BQ7A 4AF2A 4KH7A 5DAKA 4V2NA 2E2MA 4F0BA 1U3IA 2JL4A 2H73A 5F0GA 5ELGA 1GTBA 2H30A 2EIQA 1OKDA 4G0KA 1A23A 1PD21 4LMWA 2LRTA 1GSDA 3TJKA 3CSJA 3MDKA 1V9WA 4L8EA 1A0RP 4YAPA 2DSAA 4EKZA 2QC7A 5ENUA 3F6FA 2DMMA 6GSXA 5B6MA 4NPBA 5ECKB 5JWRB 2CVKA 4ML6A 2L4CA 1G7EA 1XVWA 1U6TA 1BYEA 4WETA 3GIXA 1V2AA 4FYCA 3TRQA 4X43A 5HFKA 1GL8A 4I5QA 2WCIA 3ZLPA 1Z3EA 2H0HA 3U5RE 4EIQA 3QMXA 4RQXA 1FOHA 4USSA 3TKSC 4TRXA 5CYYA 5KEJA 1M7TA 3ED3A 3FZ5A 3ZL5A 4CHSA 1J08A 5IMCA 5HR2A 5BMUB 1SK2A 3CWGA 4HU7A 4ZL8A 3GTUB 1KNGA 4K1FA 2CAQA 5B6NA 2H0GA 3ZIJA 3LSZA 3KTBA 4JR4A 5DQSA 2DJJA 3FRCA 4IW9A 1U3AA 3AY8A 2HFDA 2HSHA 1AQWA 4GSTA 1K0DA 3KMNA 2LNTA 2K8VA 2NTOA 4HEA2 4ZBBA 4CY8A 2HSNA 4IP1A 2B1KA 1W4VA 1B9YC 2ON5A 3IDVA 3UAPA 1O85A 4V1Ag 3UARA 5J4UA 2XBQA 1WOUA 1TI3A 3TCOA 4MA9A 1TRVA 4GDFA 3CTFA 1TXUA 1SVOA 2LRNA 3O3TA 3RBTA 4IP6A 3GKKA 3HJPA 2OA7A 2VKZG 5B8BA 1BJXA 3GHAA 3VURA 4GWRA 2N5BA 1GULA 2PUKC 4O5RA 1QFNA 4ZB6A 1Z6MA 1ERVA 4BL7B 3DVWA 1TK0B 1C72A 2WB9A 1K3OA 1EGOA 3DYRA 4GRFA 3M9JA 4MMMA 1R5PA 1GWCA 3IAS2 4MZCA 1TRWA 4N3ZA 1EOHA 2H74A 2G0FA 2HRKA 4MJAA 2VL2C 1SU9A 1VF2A 1MDJA 1FVKA 2GTUA 3H8QA 1GH2A 4MK3A 2RUFA 1T1VA 3ZFLA 1HNBA 5F8BA 2M46A 3C71A 2XHFA 4TXVA 2HNLA 1N25A 2YWMA 5HFGA 1U87A 1DUGA 4FQUA 4RI6A 4TKYA 1E2YA 5IMAA 2K8SA 2OACA 3HVVA 1BF5A 1HNAA 1TU8A 1DBYA 1Z7RA 1AUCA 2QGVA 2L6CA 3F4RA 1MDKA 4F82A 3DWVA 1XWGA 2L57A 4AJ6A 1YKCA 1SJZA 4G2EA 5J40A 3KM6A 1S3CA 3GV1A 1WRYA 2H1LA 3ME8A 1WE0A 1B48A 5H5SA 2VL9A 1LU4A 3FZ9A 1YEXA 5ABRA 4IGJA 2H8LA 1SJ6A 4YQVA 2V32A 4XRDA 3GSSA 1IYHA 1FAAA 3F9UA 4YAVA 5CAXA 3L9SA 4O5QA 2H0IA 1BX9A 1XFLA 2V41A 3GN3A 3C7MA 1O81A 4OWYA 4WKWA 3EINA 4ISDA 2MMOA 5GZZB 4OFTA 3LW9A 3QOUA 1PKWA 1A0FA 4RQRA 5D93A 5HR0A 2PU9C 4GQFA 4G19A 2DIZA 1QK8A 2V6OA 1B9XC 3OR5A 3D6IA 1NW2A 4OD7A 5BMUA 4E8HA 1PQNA 3GTUA 3HD5A 1X9MB 2JSYA 3A5WA 3UL3A 3IK9A 4EC0A 1XW5A 2D2ZA 2LQQA 4L5OA 3CXGA 2AJQB 2P31A 3HY2A 5B8AA 2H01A 3HKRA 1X5CA 1KTEA 2H6XA 2R6KA 2TIRA 1K0AA 5IMFA 1O8WA 2L59A 2FWFA 1XIYA 2V6KA 3LORA 1GRXA 1K3LA 2FHEA 4KE3A 4F0CA 3IOSA 2IWTA 5C04A 2KLXA 4GLTA 1M2DA 1T4ZA 1XOAA 4PQIA 1RK4A 2B6MA 1M2AA 1QXHA 2R5GA 3PH9A 5EPFA 2VCWA 1GNEA 4Z7XA 1TU7A 2AAWA 3H4KA 5HQPA 3H93A 3FK8A 3RHCA 5GSTA 1NM3A 2VD1A 4EVMA 4HZ2A 4BL7A 4G0LA 3HZ8A 1GLPA 2DJ3A 2I1UA 1T8EB 4BA7A 5G31A 1Z6NA 4MH2A 2IMEA 3HHVA 1GTIA 3IBHA 1FVJA 1PGTA 3GX8A 1H75A 4Q5FA 1ZYPA 3MSZA 2C0FA 3DXBA 1EV9A 1Y6EA 2IIYA 3I6AA 3ERGA 4KCAA 5CO3A 2R3XA 1ZOFA 4X4JA 1XZOA 5E59A 4JRRA 1S3DA 1ERTA 5G5EA 1F3BA 2GZZA 2F9SA 5KOXA 2O87A 1W89A 3K8NA 2G2QA 4PNGA 1TRUA 4ZB7A 4JZQA 2E0QA 1THOA 1SK1A 2KOKA 2BTOT 1EP8A 1ZYQB 3RPNA 1R7HA 3G9BA 1OE8A 2GSQA 7GSSA 5IO0A 2VM1A 2CZ3A 2CQ9A 1XBSA 4PURA 3UIWA 3TKQA 4HUAA 3IRAA 3BJ5A 1XW9A 3HVSA 2CX4A 2YV7A 2H1AA 5DQYA 4X1UA 4CDOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J9H A;  3Q6O A;  4K7N A;  4MPF A;  4EXJ A;  2OBI A;  2B7J A;  6GSY A;  3O76 A;  5ECH B;  1KBN A;  1N2A A;  3ZML A;  2HZF A;  4G9H A;  2LTK A;  2R4V A;  2NBS A;  3EYT A;  4V1A p;  3IXR A;  2B5X A;  2VCT A;  5FWG A;  1ERW A;  4KDU A;  2JZR A;  4TW5 A;  4K0G A;  3F4S A;  3WGX A;  1BG5 A;  1ERU A;  1G0T A;  4ACS A;  4TR3 A;  4MJB A;  1AC1 A;  1AXD A;  1EEJ A;  3RAZ A;  4EO3 A;  2GZP A;  2FA8 A;  4PUF C;  5HFI A;  2VL2 A;  4IQ1 A;  1PSQ A;  2MMN A;  3LGC A;  3GKM A;  5GAP D;  3IV4 A;  4BPY A;  1YZX A;  5IOX A;  4KND A;  1FB6 A;  3S9F A;  1VRS D;  2ZCT A;  4WR5 A;  2MZC A;  3PPU A;  1VF4 A;  2H1G A;  3UOM A;  3KH7 A;  1MEK A;  1SYX A;  5J9C A;  2X8C A;  5JWO B;  1V40 A;  2GQM A;  1EP7 A;  5IIZ A;  3BOA A;  4XS1 A;  1PRX A;  5FT3 A;  3GKX A;  3HZ4 A;  3KIJ A;  3IC8 A;  4FYU A;  1XWK A;  4DSS A;  1URM A;  4PQH A;  4KGI A;  4RI7 A;  1HYU A;  3ISO A;  5CRG A;  5ECP B;  2BJX A;  4ZXG A;  3BCI A;  1XW6 A;  1GTA A;  2YV9 A;  2YOI A;  3TRP A;  2I4A A;  4IVF A;  2ZNM A;  3TKP A;  2P5Q A;  2TRX A;  3CSI A;  5IMD A;  2H70 A;  5IQY A;  4ECB A;  2XPD A;  1I5G A;  10GS A;  1WMJ A;  2GT5 A;  3P8W A;  1WWJ A;  1GSF A;  3GST A;  4JR6 A;  3QFA C;  4OO4 A;  1M99 A;  3F8U A;  1M2B A;  2DC5 A;  2JZS A;  1PX6 A;  5D8I A;  5CRW A;  1SK0 A;  4HQZ A;  2VCV A;  1XOB A;  4L0U A;  2VO4 A;  3GNJ A;  5DAL B;  3D0Z A;  3LXT A;  5D96 A;  2HZE B;  4ZB8 A;  3W8S A;  2VL3 A;  4KA0 A;  5G30 A;  2HLS A;  2P5R A;  4OFM A;  2MBS A;  1SEN A;  2GQL A;  1TXX A;  4G10 A;  1Z7P A;  2YP6 A;  1SL2 B;  1A2L A;  4MZB A;  3EC3 A;  4HQS A;  1JFU A;  5COH A;  2X8H A;  5G1K A;  3VWV A;  1Q98 A;  3G7I A;  2K18 A;  2YN1 A;  1KEB A;  1GSS A;  1TK8 B;  4KSM A;  2H6Z A;  2L5O A;  3CYN A;  2K9F A;  1SKR B;  4MZW A;  4KW6 A;  2HSY A;  1K0C A;  2L5L A;  2IMK A;  4KDX A;  3TJJ A;  4Q5Q A;  4FO5 A;  1XVQ A;  22GS A;  4XIH A;  4TXO B;  1TTZ A;  4HS1 A;  2JZT A;  4I6X A;  1X5E A;  2O8V B;  3KEB A;  3C1S A;  5B7C A;  3RPP A;  2N5F A;  3MWH A;  3W8J A;  3DD3 A;  1DSB A;  4GF0 A;  2REM A;  1SJI A;  2YWI A;  2EIO A;  5IM9 A;  3L9V A;  3Q18 A;  1TW9 A;  2OE3 A;  2HRA A;  4HOJ A;  4I97 A;  1AQV A;  2DJ1 A;  2B5E A;  2JAD A;  1X9W B;  3UBL A;  1TDI A;  5GAN D;  3VWX A;  3BD2 A;  4P3Y B;  4IS0 A;  4WBJ A;  1LJR A;  3TOT A;  2J23 A;  2VM2 A;  1G7O A;  3F63 A;  4JU5 A;  4WEY A;  2NDO A;  4H86 A;  3IR4 A;  4FYB A;  1I9D A;  1Y25 A;  3M8N A;  1YF0 A;  19GS A;  4V2L A;  2O85 A;  3ME7 A;  5A4U A;  4PTS A;  2PGT A;  4MF7 A;  2VUP A;  1JLV A;  4K9Z A;  4F2I A;  1SKS B;  2FCH A;  4BWS A;  4K8M A;  2YZU A;  5L71 A;  3KP9 A;  1DE1 A;  1XXU A;  5KN1 A;  2F3M A;  4NV5 A;  3VI7 A;  2N5A A;  13GS A;  1YJ6 A;  2NVL A;  2WRT A;  3VI5 A;  4IBP A;  4ECC A;  3F3Q A;  1TJD A;  1AIU A;  2LST A;  5D9X A;  6GSW A;  2CV4 A;  1QGV A;  5INY A;  1E6B A;  3JCM L;  2PPT A;  2P0G A;  1BED A;  5AGY A;  3GFK A;  3NIV A;  5LNK e;  12GS A;  2C80 A;  4I2U A;  4EUY A;  2M80 A;  2RUE A;  2FUG 2;  1GNW A;  1J9B A;  3DGQ A;  4FIW A;  3BBY A;  2JU5 A;  2LJA A;  1R4W A;  2GSS A;  1EGR A;  3TKR A;  2H1D A;  6GSV A;  1FHE A;  5G2Z A;  6GSS A;  3F6D A;  4PNF A;  2C1Y A;  1QQ2 A;  4MF5 A;  3FR9 A;  4POK A;  3PR8 A;  2CT6 A;  4YQM A;  3HYP A;  2B7K A;  2XPE A;  1OAZ A;  3TOU A;  2OE1 A;  3E3E A;  4YH2 A;  4XCS A;  2YZH A;  3G7J A;  1YKA A;  5H5Q A;  2DML A;  3L0H A;  3HJO A;  2C0E A;  2H75 A;  1AW9 A;  5DAL A;  3H1N A;  1R5A A;  2HZE A;  2PN8 A;  1F37 A;  3KD0 A;  1ST9 A;  3QDN A;  1NSW A;  4TR0 A;  1K3Y A;  2X8G A;  3ZIV A;  4NHZ A;  1UA5 A;  4K7I A;  3UBK A;  4K0N A;  2K6V A;  4I8B A;  1SD9 A;  5F05 A;  2LJK A;  2I3Y A;  2V2G A;  4HU9 A;  3ZRE A;  2AV4 A;  1G6W A;  4OO5 A;  1GUH A;  5ELA A;  1AQX A;  4EF0 A;  2CA8 A;  3LYK A;  3LFL A;  5EL8 A;  2VD0 A;  3TKS E;  2QKE A;  4MAB A;  4NMU A;  2UZ8 A;  3EMP A;  2GQK A;  4RUV A;  5LCZ A;  1V98 A;  1A8L A;  5ECQ B;  1UC7 A;  1X0R A;  1ZCP A;  2C0D A;  1OC9 B;  4DSS B;  3IHQ A;  1OC3 A;  3EE2 A;  2HSM A;  3KCM A;  1OC8 A;  1G6Y A;  1A2M A;  4JED A;  4TXO A;  2ES7 A;  3VWU A;  4LL4 B;  1Z9H A;  3W6G A;  2C0G A;  3WT1 A;  1O7U A;  3LEF A;  2WUL A;  2VCX A;  1H4O A;  4KUN A;  3WD6 A;  2H19 A;  5D9T A;  1NHY A;  2YWO A;  2M72 A;  4N10 A;  5A5K A;  4NXI A;  2PER A;  4TR1 B;  4PUA A;  2PVQ A;  2XC2 A;  2CAI A;  3KXO A;  3GUR A;  2HRF A;  4IN0 A;  2WS2 A;  4BVX B;  3E9J B;  1F2E A;  4ML1 A;  2H76 A;  2VOC A;  5ECI B;  4O92 A;  4GSS A;  1ON4 A;  2IFQ B;  3GUS A;  1UVZ A;  3GL5 A;  3D4T A;  3H79 A;  4I2T A;  4N0Z A;  4F03 A;  4GTU A;  1O6J A;  2C3N A;  1PL2 A;  3IK7 A;  3M0F A;  1USB A;  1XPV A;  3TRX A;  9GSS A;  2LS5 A;  2WFC A;  1XWB A;  2B5Y A;  2C4J A;  2IJY A;  3GA4 A;  4ZIL A;  3GRX A;  2IPA A;  3EMX A;  4EDY A;  4ZIJ A;  4IJI A;  4LL1 B;  1M0U A;  2HYX A;  5AN1 A;  1K0M A;  4BVY B;  2IL3 A;  4J56 E;  3VPQ A;  2KP1 A;  4MLY A;  1EWX A;  4NAX A;  4HDE A;  2DLX A;  1YQ1 A;  1JZD A;  5HR3 A;  2I81 A;  5G5F A;  5EVO A;  4ECJ A;  1AAZ A;  2OJL A;  2OAD A;  4O32 A;  3J7Y k;  3A3T A;  2DJ0 A;  1T4Y A;  5AIV A;  3WYW A;  3N9J A;  1YEP A;  3VFI A;  1JLW A;  5CRD A;  3A2X A;  1LBK A;  3DRN A;  1SL1 B;  1GSU A;  2Z9S A;  3IAM 2;  3TJB A;  3DEX A;  3GX0 A;  5IMZ A;  1PA3 A;  3N5O A;  4WBR D;  3KJY A;  3NZN A;  5KN2 A;  5CP1 A;  4Q5R A;  2WZ9 A;  2C8U A;  3F3R A;  1YY7 A;  1GLQ A;  3PGT A;  3CRU A;  2XBI A;  1ZZY A;  3FW2 A;  3TJF A;  1JZO A;  3APQ A;  4NV2 A;  5IPH A;  2GZY A;  3MNG A;  4ZB9 A;  1S3A A;  3P2A A;  4KAE A;  3ERW A;  4GCI A;  1GP1 A;  2EIR A;  3HJM A;  3M9K A;  1GSY A;  4K7O A;  4XHM A;  3M3M A;  1PX7 A;  2E2G A;  3M1G A;  3IA1 A;  2ALB A;  3KP8 A;  3NOF A;  3FHK A;  5JWQ B;  4XS4 B;  3HVX A;  1VF1 A;  1PMT A;  4OFN A;  1M9A A;  4CW9 A;  4ILF A;  5J5N A;  1YF1 A;  1EOG A;  1TRS A;  1OC9 A;  3DML A;  2O89 A;  3TB2 A;  1SL0 B;  4OCF A;  1ABA A;  5G1L A;  2QSI A;  1UN2 A;  4DVC A;  4TVE A;  1R26 A;  2AHE A;  2LQO A;  3L78 A;  4MH3 A;  3LYP A;  5ECM B;  4ZBD A;  3I43 A;  1O73 A;  3QPM A;  3LXZ A;  3TJG A;  3D4M A;  3ZYW A;  1TK5 B;  3LJR A;  1DE2 A;  3D21 A;  1T3B A;  4KCE A;  3GKN A;  3UVH A;  5J41 A;  3C1R A;  4QL9 A;  1J0F A;  4KX4 A;  4TR1 A;  4XS6 A;  3APO A;  5DJL A;  3CRT A;  4PGT A;  4PX1 A;  2VLV A;  3KTL A;  3QCP A;  3I69 A;  2GSR A;  1HNC A;  1BAY A;  4BVX A;  3ZMK A;  2RII A;  2L4Q A;  3F0I A;  1THX A;  4AJ7 A;  4BWQ A;  5A4W A;  2IFQ A;  2YCD A;  2YNX A;  3J7Y b;  3RDW A;  5F06 A;  3HDC A;  2BMX A;  1OYJ A;  4LA1 A;  5ECO B;  4ZBA A;  2H71 A;  3TDG A;  4WXT A;  3ZRD A;  3IE3 A;  5IO2 A;  2GT6 A;  2LNS A;  2LRC A;  3UVT A;  1O8X A;  5AIS A;  1F9M A;  2HQT A;  4OCE A;  4F9Z A;  2B1L A;  4G0I A;  2VLT A;  1EV4 A;  3O6T A;  2CZ2 A;  2DJ2 A;  1U88 A;  1FG4 A;  4JBB A;  1MDI A;  1FB0 A;  4BVY A;  3SBC A;  2H66 A;  3UJ1 A;  5C00 A;  3ZTL A;  2HSM B;  4QQ7 A;  2OBK A;  2O7K A;  5DJM A;  2VCZ A;  4D73 A;  5ECR B;  5CNW A;  1A24 A;  3QFB C;  1ILO A;  2HRN A;  2GS3 A;  3FR6 A;  1OVN A;  18GS A;  2LV3 A;  3P90 A;  5DCG A;  1ZL9 A;  1SYR A;  4LMV A;  4EL1 A;  2FWH A;  4V2M A;  1PN9 A;  16GS A;  2H1B A;  1ZYE A;  4YQU A;  5JCU A;  1GTU A;  2OE0 A;  1TKD B;  2IMF A;  3APS A;  3KH9 A;  4XRA A;  4Q5N A;  1XCC A;  2MYG A;  3P7X A;  4POB A;  3Q19 A;  3L4N A;  1TOF A;  2YAN A;  3C73 A;  5IMV A;  1Z5Y E;  2HXK A;  2VAF A;  5H5R A;  1JZR A;  3CBU A;  3QAW A;  2R2J A;  2X99 A;  1V58 A;  2FGX A;  3R2Q A;  1WP0 A;  2JAC A;  4JE1 A;  3QR6 A;  2FWE A;  1PL1 A;  3FR3 A;  4AJ8 A;  3CTG A;  2GDR A;  3HA9 A;  1JZW A;  3WT2 A;  4QL7 A;  1CQG A;  1K0N A;  2VCQ A;  4MP4 A;  2PMT A;  3IC4 A;  4N0V A;  1F3A A;  1XWC A;  4KF9 A;  5GSS A;  1GSQ A;  4ZL7 A;  2E7P A;  3FEU A;  1ZGN A;  2IMI A;  4IKH A;  5IPG A;  1WJK A;  4XS4 A;  3L9U A;  2WGR A;  3VK9 A;  1GUM A;  2MMA A;  2IMD A;  4N11 A;  4IHU A;  2CVB A;  2YWN A;  1CQH A;  3D5J A;  3C8E A;  2V1M A;  3I9V 2;  5ID2 B;  5ECS A;  5ECN B;  2NPB A;  2X64 A;  4L0W A;  3U6V A;  2YJH A;  2ON7 A;  5D9V A;  3VLN A;  4PXO A;  4DSR A;  2FD3 A;  2DIY A;  3EWL A;  5J3R A;  1PKZ A;  3G7Y A;  3A2V A;  4DSQ A;  1OE7 A;  3BCK A;  3ZVJ D;  2AUV A;  2WJU A;  2HT9 A;  2LEG A;  5DVB A;  5J9B A;  2PWJ A;  2RM6 A;  17GS A;  4NWY A;  2I9H A;  3E0U A;  1ACV A;  2KHP A;  2LKU A;  2CX3 A;  3DIE A;  3QAV A;  1RQM A;  4HJ2 A;  1VF3 A;  1JHB A;  4TN8 A;  2DJK A;  3CSH A;  2FY6 A;  2B3S A;  1B4Q A;  2RM5 A;  2HE3 A;  3DVX A;  1IYI A;  2FNO A;  5JCG A;  3EU3 A;  1MD4 A;  4E8E A;  3WGD A;  3EU4 A;  4EDZ A;  4PQ1 A;  3SWL A;  5DAK B;  3LG6 A;  3F4T A;  2DBC A;  5F07 A;  2L6D A;  3V1W A;  2H72 A;  1Q4J A;  6GST A;  4OMV A;  4L5L A;  3GH9 A;  3FYG A;  1SD8 A;  3EUR A;  4KDY A;  2AYT A;  1T00 A;  2PBJ A;  4O7H A;  1TI1 A;  1XWA A;  2MMZ A;  2EC4 A;  3DKS A;  20GS A;  4EE0 A;  3R3E A;  2ZUP A;  2C3Q A;  3HCZ A;  3ZVJ A;  2KUC A;  3FZ4 A;  4MF6 A;  3GYK A;  4IJ3 A;  4POM A;  2OKA A;  4HZ4 A;  4MPG A;  5DCH A;  3KZQ A;  3LWA A;  3UEM A;  2FWG A;  1HD2 A;  2GLR A;  4J57 E;  1N8J A;  3GL3 A;  4ULX A;  8GSS A;  4POL A;  1WPI A;  2GVP A;  1MTC A;  5LD0 A;  1HQO A;  3WGE A;  3LQ7 A;  4GQC A;  5JCW A;  2RLI A;  1ML6 A;  3ZFB A;  5ECL B;  1RW1 A;  1GUK A;  4HI7 A;  4NHW A;  3RHB A;  1EEM A;  5CRH A;  1A2J A;  5CRE A;  1B8X A;  4ECI A;  2VLU A;  2F51 A;  4HJM A;  3TGZ A;  3KMO A;  1VGL A;  4LLR A;  11GS A;  2H6Y A;  4TOP A;  1X9S B;  3MAK A;  2C3T A;  5KN0 A;  2A2R A;  3TKS A;  1T7P B;  4GXZ A;  2PVO C;  5AIX A;  3TUE A;  5FHI A;  5EY6 A;  1K0O A;  1SKW B;  4MDC A;  3QAG A;  2KP2 A;  5HR1 A;  1ZMA A;  2MBT A;  2LJR A;  4IEL A;  3Q74 A;  2AB6 A;  4K2D A;  4DEJ A;  4IQA A;  2CVD A;  1K0B A;  2A2S A;  3GMF A;  2GST A;  5D73 A;  4MCU A;  4WF4 A;  4KB3 A;  2HSN B;  3FZA A;  4FH8 A;  4K6X A;  4TR4 A;  1WIK A;  3QD9 A;  4D73 B;  2YPM A;  2IN3 A;  1TP9 A;  2A4V A;  2JSZ A;  4GSN A;  4MJC A;  3UMA A;  5ID2 A;  2F8A A;  3FKF A;  2TRC P;  2GGT A;  2HI7 A;  4KSO A;  1A8Y A;  3VPT A;  4ID0 A;  4ZL9 A;  1MD3 A;  2F8F A;  5D9W A;  1EZK A;  4J2F A;  14GS A;  5KN3 A;  1V57 A;  3D22 A;  1YDK A;  3ZIT A;  5IOW A;  1B4P A;  3ERF A;  5DBQ A;  3ZZX A;  3GH6 A;  1FO5 A;  4WR4 A;  4N30 A;  6GSU A;  3CMI A;  4MJE A;  3HXS A;  2R37 A;  1NHO A;  2FLS A;  1OKT A;  1F6M C;  3EVI A;  2LUS A;  4AGS A;  3US3 A;  3KGK A;  4X0X A;  2WDU A;  3FY7 A;  1FOV A;  5A4V A;  2FA4 A;  1GSE A;  3IPZ A;  2VIM A;  1QMV A;  2HRK B;  1FW1 A;  5DDL A;  5E4W A;  3A2W A;  1M9B A;  1X5D A;  1QUW A;  2YJ7 A;  4XTS A;  4WF5 A;  3VWW A;  3PIN A;  1BQ7 A;  4AF2 A;  4KH7 A;  5DAK A;  4V2N A;  2E2M A;  4F0B A;  1U3I A;  2JL4 A;  2H73 A;  5F0G A;  5ELG A;  1GTB A;  2H30 A;  2EIQ A;  1OKD A;  4G0K A;  1A23 A;  1PD2 1;  4LMW A;  2LRT A;  1GSD A;  3TJK A;  3CSJ A;  3MDK A;  1V9W A;  4L8E A;  1A0R P;  4YAP A;  2DSA A;  4EKZ A;  2QC7 A;  5ENU A;  3F6F A;  2DMM A;  6GSX A;  5B6M A;  4NPB A;  5ECK B;  5JWR B;  2CVK A;  4ML6 A;  2L4C A;  1G7E A;  1XVW A;  1U6T A;  1BYE A;  4WET A;  3GIX A;  1V2A A;  4FYC A;  3TRQ A;  4X43 A;  5HFK A;  1GL8 A;  4I5Q A;  2WCI A;  3ZLP A;  1Z3E A;  2H0H A;  3U5R E;  3QMX A;  4RQX A;  4USS A;  3TKS C;  4TRX A;  5CYY A;  5KEJ A;  1M7T A;  3ED3 A;  3FZ5 A;  3ZL5 A;  4CHS A;  1J08 A;  5IMC A;  5HR2 A;  1SK2 A;  4HU7 A;  4ZL8 A;  3GTU B;  1KNG A;  4K1F A;  2CAQ A;  5B6N A;  2H0G A;  3ZIJ A;  3LSZ A;  3KTB A;  4JR4 A;  5DQS A;  2DJJ A;  3FRC A;  4IW9 A;  1U3A A;  3AY8 A;  2HFD A;  2HSH A;  1AQW A;  4GST A;  1K0D A;  3KMN A;  2LNT A;  2K8V A;  2NTO A;  4HEA 2;  4ZBB A;  4IP1 A;  2B1K A;  1W4V A;  1B9Y C;  2ON5 A;  3IDV A;  3UAP A;  1O85 A;  4V1A g;  3UAR A;  5J4U A;  2XBQ A;  1WOU A;  1TI3 A;  3TCO A;  4MA9 A;  1TRV A;  3CTF A;  2LRN A;  3O3T A;  3RBT A;  4IP6 A;  3GKK A;  3HJP A;  2OA7 A;  5B8B A;  1BJX A;  3GHA A;  3VUR A;  4GWR A;  2N5B A;  1GUL A;  2PUK C;  4O5R A;  1QFN A;  4ZB6 A;  1Z6M A;  1ERV A;  4BL7 B;  3DVW A;  1TK0 B;  1C72 A;  2WB9 A;  1K3O A;  1EGO A;  3DYR A;  4GRF A;  3M9J A;  4MMM A;  1R5P A;  1GWC A;  3IAS 2;  4MZC A;  1TRW A;  1EOH A;  2H74 A;  2G0F A;  2HRK A;  4MJA A;  2VL2 C;  1SU9 A;  1VF2 A;  1MDJ A;  1FVK A;  2GTU A;  3H8Q A;  1GH2 A;  4MK3 A;  2RUF A;  1T1V A;  3ZFL A;  1HNB A;  5F8B A;  2M46 A;  3C71 A;  2XHF A;  4TXV A;  2HNL A;  2YWM A;  5HFG A;  1U87 A;  1DUG A;  4FQU A;  4RI6 A;  4TKY A;  1E2Y A;  5IMA A;  2K8S A;  2OAC A;  3HVV A;  1HNA A;  1TU8 A;  1DBY A;  1Z7R A;  1AUC A;  2QGV A;  2L6C A;  3F4R A;  1MDK A;  4F82 A;  3DWV A;  1XWG A;  2L57 A;  4AJ6 A;  1YKC A;  1SJZ A;  4G2E A;  3KM6 A;  1S3C A;  3GV1 A;  1WRY A;  3ME8 A;  5H5S A;  1WE0 A;  1B48 A;  2VL9 A;  1LU4 A;  3FZ9 A;  1YEX A;  5ABR A;  4IGJ A;  2H8L A;  1SJ6 A;  4YQV A;  2V32 A;  4XRD A;  3GSS A;  1IYH A;  1FAA A;  3F9U A;  4YAV A;  5CAX A;  3L9S A;  2H0I A;  1BX9 A;  1XFL A;  2V41 A;  3GN3 A;  3C7M A;  1O81 A;  4OWY A;  4WKW A;  3EIN A;  4ISD A;  2MMO A;  5GZZ B;  4OFT A;  3QOU A;  1PKW A;  1A0F A;  4RQR A;  5D93 A;  5HR0 A;  2PU9 C;  4GQF A;  4G19 A;  2DIZ A;  1QK8 A;  2V6O A;  1B9X C;  3OR5 A;  3D6I A;  1NW2 A;  4OD7 A;  5BMU A;  4E8H A;  1PQN A;  3GTU A;  3HD5 A;  1X9M B;  2JSY A;  3A5W A;  3UL3 A;  3IK9 A;  4EC0 A;  1XW5 A;  2D2Z A;  2LQQ A;  4L5O A;  3CXG A;  2AJQ B;  2P31 A;  3HY2 A;  5B8A A;  2H01 A;  3HKR A;  1X5C A;  1KTE A;  2H6X A;  2R6K A;  2TIR A;  1K0A A;  5IMF A;  1O8W A;  2L59 A;  2FWF A;  1XIY A;  2V6K A;  3LOR A;  1GRX A;  1K3L A;  2FHE A;  4KE3 A;  4F0C A;  3IOS A;  2IWT A;  5C04 A;  2KLX A;  4GLT A;  1M2D A;  1T4Z A;  1XOA A;  4PQI A;  1RK4 A;  2B6M A;  1M2A A;  1QXH A;  2R5G A;  3PH9 A;  5EPF A;  2VCW A;  1GNE A;  4Z7X A;  1TU7 A;  2AAW A;  3H4K A;  5HQP A;  3H93 A;  3FK8 A;  3RHC A;  5GST A;  1NM3 A;  2VD1 A;  4EVM A;  4HZ2 A;  4BL7 A;  4G0L A;  3HZ8 A;  1GLP A;  2DJ3 A;  2I1U A;  1T8E B;  4BA7 A;  5G31 A;  1Z6N A;  4MH2 A;  2IME A;  3HHV A;  1GTI A;  3IBH A;  1FVJ A;  1PGT A;  3GX8 A;  1H75 A;  4Q5F A;  3MSZ A;  2C0F A;  3DXB A;  1EV9 A;  1Y6E A;  2IIY A;  3I6A A;  3ERG A;  4KCA A;  5CO3 A;  2R3X A;  1ZOF A;  1XZO A;  5E59 A;  4JRR A;  1S3D A;  1ERT A;  5G5E A;  1F3B A;  2GZZ A;  2F9S A;  2O87 A;  1W89 A;  3K8N A;  2G2Q A;  4PNG A;  1TRU A;  4JZQ A;  2E0Q A;  1THO A;  1SK1 A;  2KOK A;  2BTO T;  1EP8 A;  1ZYQ B;  3RPN A;  1R7H A;  3G9B A;  1OE8 A;  2GSQ A;  7GSS A;  5IO0 A;  2VM1 A;  2CZ3 A;  2CQ9 A;  1XBS A;  4PUR A;  3UIW A;  3TKQ A;  4HUA A;  3IRA A;  3BJ5 A;  1XW9 A;  3HVS A;  2CX4 A;  2YV7 A;  2H1A A;  5DQY A;  4X1U A;  4CDO A; 
#chains in the Genus database with same CATH topology
 2J9H A;  3Q6O A;  4K7N A;  4MPF A;  4EXJ A;  2OBI A;  2B7J A;  6GSY A;  2EFC A;  3O76 A;  5ECH B;  1KBN A;  1N2A A;  3ZML A;  1BG1 A;  4G01 A;  2HZF A;  4G9H A;  2LTK A;  2R4V A;  2NBS A;  3EYT A;  4V1A p;  3IXR A;  2B5X A;  2VCT A;  5FWG A;  1ERW A;  4KDU A;  2JZR A;  4TW5 A;  4K0G A;  3F4S A;  4K2X A;  3WGX A;  1BG5 A;  1ERU A;  1G0T A;  4ACS A;  4CY6 A;  4TR3 A;  4MJB A;  1AC1 A;  1AXD A;  1EEJ A;  3RAZ A;  4EO3 A;  2GZP A;  2FA8 A;  4PUF C;  5HFI A;  2VL2 A;  4IQ1 A;  1Y1U A;  4O5U A;  1PSQ A;  2MMN A;  3LGC A;  3GKM A;  5GAP D;  3IV4 A;  4BPY A;  1YZX A;  5IOX A;  3FMW A;  4KND A;  1FB6 A;  3S9F A;  1VRS D;  2ZCT A;  4AKI A;  4WR5 A;  2MZC A;  3PPU A;  5A34 B;  1VF4 A;  2H1G A;  3UOM A;  3KH7 A;  1MEK A;  1SYX A;  5J9C A;  2X8C A;  1PN0 A;  5JWO B;  1V40 A;  2GQM A;  1EP7 A;  5IIZ A;  3BOA A;  4XS1 A;  1PRX A;  5FT3 A;  3GKX A;  3HZ4 A;  3KIJ A;  3IC8 A;  4FYU A;  1XWK A;  4DSS A;  1URM A;  4PQH A;  4KGI A;  4RI7 A;  1HYU A;  3ISO A;  5CRG A;  5ECP B;  2BJX A;  4ZXG A;  3BCI A;  1XW6 A;  1GTA A;  2YV9 A;  3MYD A;  2YOI A;  3TRP A;  2I4A A;  4IVF A;  2ZNM A;  3TKP A;  2P5Q A;  2TRX A;  3CSI A;  5IMD A;  2H70 A;  5IQY A;  4ECB A;  2XPD A;  1I5G A;  2WW1 A;  10GS A;  1WMJ A;  2GT5 A;  3P8W A;  1WWJ A;  1GSF A;  3GST A;  4JR6 A;  3QFA C;  4OO4 A;  1M99 A;  3F8U A;  1M2B A;  2DC5 A;  2JZS A;  1PX6 A;  1ZYN A;  5D8I A;  5CRW A;  1SK0 A;  4HQZ A;  2VCV A;  1XOB A;  4L0U A;  2VO4 A;  3GNJ A;  5DAL B;  3D0Z A;  3LXT A;  5D96 A;  2HZE B;  4ZB8 A;  3W8S A;  3CHX C;  2VL3 A;  4KA0 A;  5G30 A;  2HLS A;  2P5R A;  4OFM A;  2MBS A;  1SEN A;  2GQL A;  1TXX A;  4G10 A;  1Z7P A;  2YP6 A;  1SL2 B;  1A2L A;  4MZB A;  3EC3 A;  4HQS A;  1JFU A;  5COH A;  2X8H A;  5G1K A;  3VWV A;  1Q98 A;  3G7I A;  2K18 A;  2YN1 A;  1KEB A;  4BIK A;  1GSS A;  1TK8 B;  4KSM A;  2H6Z A;  2L5O A;  3CYN A;  2K9F A;  1SKR B;  4MZW A;  4KW6 A;  2HSY A;  1K0C A;  2L5L A;  2IMK A;  4KDX A;  3TJJ A;  4Q5Q A;  4FO5 A;  1XVQ A;  22GS A;  4XIH A;  4EIP A;  4W66 A;  4TXO B;  1TTZ A;  4HS1 A;  3A5I A;  2JZT A;  4I6X A;  1X5E A;  2O8V B;  3KEB A;  3C1S A;  5B7C A;  3RPP A;  2N5F A;  3MWH A;  3W8J A;  3DD3 A;  1DSB A;  4GF0 A;  2REM A;  1SJI A;  2YWI A;  2EIO A;  5IM9 A;  3L9V A;  3Q18 A;  1TW9 A;  2OE3 A;  2HRA A;  4HOJ A;  4I97 A;  1AQV A;  2DJ1 A;  3EPT A;  2B5E A;  2JAD A;  1X9W B;  3UBL A;  1TDI A;  5GAN D;  3VWX A;  3BD2 A;  4P3Y B;  4IS0 A;  4WBJ A;  5J4Y A;  1LJR A;  3TOT A;  2J23 A;  2VM2 A;  1G7O A;  3F63 A;  4JU5 A;  4WEY A;  2NDO A;  4H86 A;  3IR4 A;  4FYB A;  1I9D A;  5KOW A;  1Y25 A;  3M8N A;  1YF0 A;  19GS A;  4V2L A;  2O85 A;  3ME7 A;  5A4U A;  4PTS A;  2PGT A;  4MF7 A;  2VUP A;  1JLV A;  4K9Z A;  4F2I A;  1SKS B;  2FCH A;  4BWS A;  4K8M A;  2YZU A;  5L71 A;  3KP9 A;  1DE1 A;  1XXU A;  5KN1 A;  2F3M A;  4NV5 A;  3VI7 A;  2N5A A;  13GS A;  4AKH A;  1YJ6 A;  2NVL A;  2WRT A;  3VI5 A;  5A34 A;  4ICY A;  4IBP A;  4ECC A;  3F3Q A;  1TJD A;  1AIU A;  2LST A;  5D9X A;  6GSW A;  2CV4 A;  1QGV A;  5INY A;  1E6B A;  3JCM L;  2PPT A;  2P0G A;  1BED A;  5BRT A;  5AGY A;  3GFK A;  3NIV A;  5LNK e;  12GS A;  2C80 A;  4FXY P;  4I2U A;  4EUY A;  2M80 A;  2RUE A;  2FUG 2;  1GNW A;  1J9B A;  3DGQ A;  4FIW A;  3BBY A;  2JU5 A;  2LJA A;  1R4W A;  2GSS A;  1EGR A;  3TKR A;  2H1D A;  6GSV A;  1FHE A;  5G2Z A;  6GSS A;  3F6D A;  4PNF A;  2C1Y A;  4QMK A;  1QQ2 A;  4MF5 A;  3FR9 A;  4POK A;  3PR8 A;  2CT6 A;  4YQM A;  3HYP A;  4AKX B;  2B7K A;  2XPE A;  1OAZ A;  3TOU A;  1M3I A;  2OE1 A;  3E3E A;  4YH2 A;  4XCS A;  2YZH A;  3G7J A;  1YKA A;  5H5Q A;  2DML A;  3L0H A;  3HJO A;  2C0E A;  2H75 A;  1AW9 A;  5DAL A;  3H1N A;  1R5A A;  2HZE A;  2PN8 A;  1F37 A;  3KD0 A;  1ST9 A;  3QDN A;  1NSW A;  4TR0 A;  1K3Y A;  2X8G A;  3ZIV A;  4NHZ A;  1UA5 A;  4K7I A;  3UBK A;  4K0N A;  2K6V A;  4I8B A;  1SD9 A;  5F05 A;  2LJK A;  2I3Y A;  2V2G A;  4HU9 A;  3ZRE A;  2AV4 A;  1G6W A;  4OO5 A;  1GUH A;  5ELA A;  2WW3 A;  1AQX A;  4EF0 A;  2CA8 A;  3LYK A;  3LFL A;  5EL8 A;  2VD0 A;  3TKS E;  2QKE A;  4MAB A;  4NMU A;  2UZ8 A;  3EMP A;  2GQK A;  4RUV A;  5LCZ A;  1V98 A;  1A8L A;  5ECQ B;  1UC7 A;  2WVY A;  1X0R A;  1ZCP A;  2C0D A;  1OC9 B;  4DSS B;  3IHQ A;  1OC3 A;  3EE2 A;  2HSM A;  3KCM A;  1OC8 A;  1G6Y A;  1A2M A;  4JED A;  4TXO A;  2ES7 A;  3VWU A;  4LL4 B;  1Z9H A;  4AI6 A;  3W6G A;  2C0G A;  3WT1 A;  1O7U A;  3LEF A;  2R0G A;  2WUL A;  2VCX A;  1H4O A;  4KUN A;  3WD6 A;  2H19 A;  5D9T A;  4Z2R A;  1NHY A;  2YWO A;  2M72 A;  4N10 A;  5A5K A;  4NXI A;  2PER A;  3MIX A;  4TR1 B;  4PUA A;  2PVQ A;  2XC2 A;  2CAI A;  5A5H B;  3KXO A;  2O5V A;  3GUR A;  2HRF A;  4IN0 A;  2WS2 A;  3HMJ G;  4BVX B;  3E9J B;  1F2E A;  2EFH A;  4ML1 A;  2QA2 A;  2H76 A;  2VOC A;  5ECI B;  4O92 A;  4GSS A;  1ON4 A;  2IFQ B;  1SVM A;  3GUS A;  1UVZ A;  3GL5 A;  3D4T A;  3H79 A;  4I2T A;  4N0Z A;  4F03 A;  4GTU A;  1O6J A;  2C3N A;  1PL2 A;  3IK7 A;  3M0F A;  1USB A;  1XPV A;  3TRX A;  9GSS A;  2LS5 A;  2WFC A;  1XWB A;  2B5Y A;  2C4J A;  2IJY A;  3GA4 A;  4ZIL A;  3GRX A;  2IPA A;  3EMX A;  4EDY A;  4ZIJ A;  4IJI A;  4LL1 B;  1M0U A;  2HYX A;  5AN1 A;  1K0M A;  2DKI A;  4BVY B;  2IL3 A;  4J56 E;  3VPQ A;  2KP1 A;  4MLY A;  1EWX A;  4NAX A;  4HDE A;  2DLX A;  1YQ1 A;  2A2P A;  1JZD A;  5A1N B;  5HR3 A;  2I81 A;  5G5F A;  5EVO A;  4ECJ A;  1AAZ A;  2OJL A;  2OAD A;  4O32 A;  3J7Y k;  3A3T A;  2DJ0 A;  1T4Y A;  5AIV A;  3WYW A;  3N9J A;  1YEP A;  3VFI A;  1JLW A;  5CRD A;  3A2X A;  1LBK A;  3DRN A;  1SL1 B;  4K5R A;  1GSU A;  2Z9S A;  3IAM 2;  3TJB A;  3DEX A;  1YVL A;  3GX0 A;  5IMZ A;  1PA3 A;  3N5O A;  4WBR D;  3KJY A;  3NZN A;  5KN2 A;  5CP1 A;  4Q5R A;  2WZ9 A;  2C8U A;  3F3R A;  1YY7 A;  1GLQ A;  3PGT A;  3CRU A;  2XBI A;  1ZZY A;  3FW2 A;  3TJF A;  1JZO A;  3APQ A;  4NV2 A;  5IPH A;  2GZY A;  3MNG A;  4ZB9 A;  1S3A A;  3P2A A;  4KAE A;  3ERW A;  4GCI A;  1GP1 A;  2EIR A;  3HJM A;  3M9K A;  1GSY A;  4K7O A;  4XHM A;  3M3M A;  1PX7 A;  2E2G A;  3M1G A;  3IA1 A;  2ALB A;  3KP8 A;  3NOF A;  4YKG A;  2DKH A;  3FHK A;  5JWQ B;  4XS4 B;  3HVX A;  1VF1 A;  1PMT A;  4OFN A;  1M9A A;  4CW9 A;  4ILF A;  3RGB C;  5J5N A;  1YF1 A;  1EOG A;  1TRS A;  1OC9 A;  3DML A;  2O89 A;  3TB2 A;  2X4A A;  1SL0 B;  4OCF A;  1ABA A;  5G1L A;  2QSI A;  1UN2 A;  4DVC A;  4TVE A;  1R26 A;  1SVL A;  2AHE A;  2LQO A;  3L78 A;  4MH3 A;  3LYP A;  5ECM B;  4ZBD A;  3I43 A;  1O73 A;  3LXZ A;  3QPM A;  3TJG A;  3D4M A;  3ZYW A;  1TK5 B;  3LJR A;  1DE2 A;  3D21 A;  1T3B A;  4KCE A;  3GKN A;  3UVH A;  5J41 A;  3C1R A;  4QL9 A;  1J0F A;  4KX4 A;  4TR1 A;  4XS6 A;  3APO A;  2WW0 A;  5DJL A;  3CRT A;  5A5H A;  4PGT A;  4PX1 A;  2VLV A;  3KTL A;  3QCP A;  3I69 A;  2GSR A;  1HNC A;  1BAY A;  4YKF A;  4BVX A;  3ZMK A;  2RII A;  3RFR C;  2L4Q A;  4Z2T A;  3F0I A;  1THX A;  4AJ7 A;  4BWQ A;  5A4W A;  2IFQ A;  2YCD A;  2YNX A;  3J7Y b;  3RDW A;  5F06 A;  3HDC A;  2BMX A;  1OYJ A;  4LA1 A;  5ECO B;  4ZBA A;  2H71 A;  3TDG A;  4WXT A;  3ZRD A;  3IE3 A;  5IO2 A;  2GT6 A;  2LNS A;  2LRC A;  3UVT A;  1O8X A;  5AIS A;  1F9M A;  2HQT A;  4OCE A;  4F9Z A;  2B1L A;  4G0I A;  2VLT A;  1EV4 A;  3O6T A;  2CZ2 A;  2DJ2 A;  1U88 A;  1FG4 A;  4JBB A;  1MDI A;  1FB0 A;  4BVY A;  3SBC A;  2H66 A;  3UJ1 A;  5C00 A;  3ZTL A;  2HSM B;  4QQ7 A;  2OBK A;  2O7K A;  5DJM A;  2VCZ A;  4D73 A;  5ECR B;  5CNW A;  1A24 A;  3QFB C;  1ILO A;  1I1I P;  2HRN A;  5A1N A;  2GS3 A;  3FR6 A;  1OVN A;  18GS A;  2LV3 A;  3P90 A;  5DCG A;  1ZL9 A;  1SYR A;  4LMV A;  4EL1 A;  2FWH A;  4V2M A;  1PN9 A;  16GS A;  2H1B A;  1ZYE A;  4YQU A;  5JCU A;  1GTU A;  2OE0 A;  1TKD B;  2IMF A;  3APS A;  3KH9 A;  4XRA A;  4Q5N A;  1XCC A;  2MYG A;  3P7X A;  4POB A;  3Q19 A;  3L4N A;  1TOF A;  2YAN A;  3C73 A;  5IMV A;  1Z5Y E;  2HXK A;  2VAF A;  5H5R A;  1JZR A;  3CBU A;  3QAW A;  4Z2U A;  2R2J A;  2X99 A;  1V58 A;  2FGX A;  3R2Q A;  1WP0 A;  2JAC A;  4JE1 A;  3QR6 A;  2FWE A;  1PL1 A;  3FR3 A;  4AJ8 A;  3CTG A;  2GDR A;  3HA9 A;  1JZW A;  3WT2 A;  4QL7 A;  2O3E A;  1CQG A;  1K0N A;  2VCQ A;  4MP4 A;  2PMT A;  3IC4 A;  4N0V A;  1F3A A;  1XWC A;  4KF9 A;  5GSS A;  1GSQ A;  4ZL7 A;  2E7P A;  3FEU A;  1ZGN A;  1S4B P;  1S3R A;  2IMI A;  4IKH A;  5IPG A;  1WJK A;  4XS4 A;  3L9U A;  2WGR A;  3VK9 A;  1GUM A;  2MMA A;  2IMD A;  4N11 A;  4IHU A;  2CVB A;  2YWN A;  1CQH A;  3D5J A;  3C8E A;  2V1M A;  3I9V 2;  5ID2 B;  5ECS A;  5ECN B;  2NPB A;  2X64 A;  4L0W A;  3U6V A;  2YJH A;  2ON7 A;  5D9V A;  3VLN A;  4PXO A;  4DSR A;  2FD3 A;  2DIY A;  3EWL A;  5J3R A;  1PKZ A;  3G7Y A;  3A2V A;  4DSQ A;  1OE7 A;  3BCK A;  3ZVJ D;  2AUV A;  2WJU A;  3TU3 B;  2HT9 A;  2LEG A;  2R0P A;  5DVB A;  5J9B A;  2PWJ A;  2RM6 A;  17GS A;  4NWY A;  2I9H A;  3E0U A;  1ACV A;  2KHP A;  2LKU A;  2CX3 A;  3DIE A;  3QAV A;  1RQM A;  4HJ2 A;  1VF3 A;  1JHB A;  4TN8 A;  2DJK A;  3CSH A;  2FY6 A;  2B3S A;  2OT3 A;  1B4Q A;  2RM5 A;  2HE3 A;  3DVX A;  1IYI A;  2FNO A;  5JCG A;  3EU3 A;  2R0C A;  1MD4 A;  4E8E A;  3WGD A;  3EU4 A;  4EDZ A;  4PQ1 A;  3SWL A;  5DAK B;  3LG6 A;  3F4T A;  2DBC A;  5F07 A;  2L6D A;  3V1W A;  2H72 A;  1Q4J A;  6GST A;  4OMV A;  4L5L A;  3GH9 A;  3FYG A;  1SD8 A;  3EUR A;  4KDY A;  2AYT A;  1T00 A;  2PBJ A;  2QA1 A;  4O7H A;  1TI1 A;  1XWA A;  2MMZ A;  2EC4 A;  3DKS A;  20GS A;  5J47 A;  4EE0 A;  3R3E A;  2ZUP A;  2C3Q A;  3HCZ A;  2O36 A;  3ZVJ A;  2KUC A;  3FZ4 A;  4MF6 A;  3GYK A;  4IJ3 A;  2WVX B;  4POM A;  2OKA A;  4HZ4 A;  4MPG A;  5DCH A;  3KZQ A;  3LWA A;  3UEM A;  2FWG A;  1HD2 A;  2GLR A;  4J57 E;  1N8J A;  3GL3 A;  4ULX A;  8GSS A;  4POL A;  1WPI A;  5J4V A;  2GVP A;  1MTC A;  5LD0 A;  1HQO A;  3WGE A;  3LQ7 A;  4GQC A;  5JCW A;  2RLI A;  1ML6 A;  3ZFB A;  5ECL B;  1RW1 A;  2UV8 G;  1GUK A;  4HI7 A;  4NHW A;  3RHB A;  4AKG A;  1EEM A;  5CRH A;  1A2J A;  5CRE A;  1B8X A;  4ECI A;  2VLU A;  2F51 A;  4HJM A;  3TGZ A;  4K5S A;  3KMO A;  1VGL A;  4LLR A;  11GS A;  2H6Y A;  4TOP A;  1X9S B;  3MAK A;  2C3T A;  5KN0 A;  2A2R A;  3TKS A;  1T7P B;  4GXZ A;  2PVO C;  5AIX A;  3TUE A;  5FHI A;  5EY6 A;  1K0O A;  1SKW B;  4MDC A;  3QAG A;  2KP2 A;  5HR1 A;  1ZMA A;  2MBT A;  2LJR A;  4IEL A;  3Q74 A;  2EFD A;  2AB6 A;  4K2D A;  4DEJ A;  4IQA A;  2CVD A;  1K0B A;  2A2S A;  2WZS A;  3GMF A;  2GST A;  5D73 A;  4MCU A;  4WF4 A;  4KB3 A;  2HSN B;  3FZA A;  4FH8 A;  4K6X A;  4TR4 A;  1WIK A;  3QD9 A;  4D73 B;  2YPM A;  2EFE A;  2IN3 A;  1TP9 A;  2A4V A;  2JSZ A;  4GSN A;  4MJC A;  3UMA A;  5ID2 A;  4HSC X;  2F8A A;  3FKF A;  2TRC P;  2GGT A;  2HI7 A;  4KSO A;  1A8Y A;  3VPT A;  4ID0 A;  4ZL9 A;  1MD3 A;  2F8F A;  5D9W A;  1EZK A;  4J2F A;  4A5P A;  14GS A;  5KN3 A;  1V57 A;  3D22 A;  1YDK A;  3ZIT A;  5IOW A;  1B4P A;  3ERF A;  5DBQ A;  3CQF A;  2A4H A;  3ZZX A;  3GH6 A;  1FO5 A;  4WR4 A;  4N30 A;  6GSU A;  3CMI A;  4MJE A;  3HXS A;  2R37 A;  1NHO A;  2FLS A;  1OKT A;  1F6M C;  3EVI A;  2LUS A;  4AGS A;  3US3 A;  3KGK A;  4X0X A;  2WDU A;  3FY7 A;  1FOV A;  5A4V A;  2FA4 A;  1GSE A;  4E68 A;  3IPZ A;  2VIM A;  3IHG A;  1QMV A;  2HRK B;  1FW1 A;  5DDL A;  5E4W A;  3A2W A;  4MNN A;  1M9B A;  1X5D A;  1PFO A;  1QUW A;  2YJ7 A;  4XTS A;  2X49 A;  4WF5 A;  3VWW A;  3PIN A;  1BQ7 A;  4AF2 A;  4KH7 A;  5DAK A;  4V2N A;  2E2M A;  4F0B A;  1U3I A;  2JL4 A;  2H73 A;  5F0G A;  4PI0 C;  5ELG A;  1GTB A;  2H30 A;  2EIQ A;  1OKD A;  4G0K A;  1A23 A;  1PD2 1;  4LMW A;  2LRT A;  1GSD A;  3TJK A;  3CSJ A;  3MDK A;  1V9W A;  4L8E A;  1A0R P;  4YAP A;  2DSA A;  2WVX A;  4EKZ A;  2QC7 A;  5ENU A;  3F6F A;  2DMM A;  6GSX A;  5B6M A;  4NPB A;  5ECK B;  5JWR B;  2CVK A;  4ML6 A;  2L4C A;  1G7E A;  1XVW A;  1U6T A;  1BYE A;  4WET A;  3GIX A;  1V2A A;  4FYC A;  3TRQ A;  4X43 A;  5HFK A;  1GL8 A;  4I5Q A;  2WCI A;  3ZLP A;  1Z3E A;  2H0H A;  3U5R E;  4EIQ A;  3QMX A;  4RQX A;  1FOH A;  4USS A;  3TKS C;  4TRX A;  5CYY A;  5KEJ A;  1M7T A;  3ED3 A;  3FZ5 A;  3ZL5 A;  4CHS A;  1J08 A;  5IMC A;  1M3J A;  5HR2 A;  5BMU B;  1SK2 A;  3CWG A;  4HU7 A;  4ZL8 A;  3GTU B;  1KNG A;  4K1F A;  2CAQ A;  5B6N A;  2H0G A;  3ZIJ A;  3LSZ A;  3KTB A;  4JR4 A;  5DQS A;  2DJJ A;  3FRC A;  4IW9 A;  1U3A A;  3AY8 A;  2HFD A;  2HSH A;  1AQW A;  4GST A;  1K0D A;  3KMN A;  2LNT A;  2K8V A;  2NTO A;  4HEA 2;  4ZBB A;  4CY8 A;  2HSN A;  4IP1 A;  2B1K A;  1W4V A;  1B9Y C;  2ON5 A;  3IDV A;  3UAP A;  1O85 A;  4V1A g;  3UAR A;  3HVN A;  5J4U A;  2XBQ A;  1WOU A;  1TI3 A;  3TCO A;  4MA9 A;  1TRV A;  4GDF A;  3CTF A;  1TXU A;  1SVO A;  2LRN A;  3O3T A;  3RBT A;  4IP6 A;  3GKK A;  3HJP A;  2OA7 A;  2VKZ G;  5B8B A;  1BJX A;  3GHA A;  3VUR A;  4GWR A;  2N5B A;  1GUL A;  2PUK C;  4O5R A;  1QFN A;  4ZB6 A;  1Z6M A;  1ERV A;  4BL7 B;  3DVW A;  4PI2 C;  1TK0 B;  1C72 A;  2WB9 A;  1K3O A;  1EGO A;  3DYR A;  4GRF A;  3M9J A;  4MMM A;  1R5P A;  1GWC A;  3IAS 2;  4MZC A;  1TRW A;  2WVZ A;  4N3Z A;  1EOH A;  2H74 A;  2G0F A;  2HRK A;  4MJA A;  2VL2 C;  1SU9 A;  1VF2 A;  1MDJ A;  1FVK A;  2GTU A;  3H8Q A;  1GH2 A;  4MK3 A;  2RUF A;  1T1V A;  3ZFL A;  1HNB A;  5F8B A;  2M46 A;  3C71 A;  2WW2 A;  2XHF A;  4TXV A;  2HNL A;  1N25 A;  2YWM A;  5HFG A;  1U87 A;  1DUG A;  4FQU A;  4RI6 A;  4TKY A;  1E2Y A;  5IMA A;  2K8S A;  2OAC A;  3HVV A;  1BF5 A;  1HNA A;  1TU8 A;  1DBY A;  1Z7R A;  1AUC A;  2QGV A;  2L6C A;  3F4R A;  1MDK A;  4F82 A;  3DWV A;  1XWG A;  2L57 A;  4AJ6 A;  1YKC A;  1SJZ A;  4G2E A;  5J40 A;  3KM6 A;  1S3C A;  3GV1 A;  1WRY A;  2H1L A;  3ME8 A;  1WE0 A;  1B48 A;  5H5S A;  2VL9 A;  1LU4 A;  3FZ9 A;  1YEX A;  5ABR A;  4IGJ A;  2H8L A;  1SJ6 A;  4YQV A;  2V32 A;  4XRD A;  3GSS A;  1IYH A;  1FAA A;  3F9U A;  4YAV A;  5CAX A;  3L9S A;  4O5Q A;  2H0I A;  1BX9 A;  1XFL A;  2V41 A;  3GN3 A;  3C7M A;  1O81 A;  4OWY A;  4WKW A;  3EIN A;  4ISD A;  2MMO A;  5GZZ B;  4OFT A;  3LW9 A;  3QOU A;  1PKW A;  1A0F A;  4RQR A;  5D93 A;  5HR0 A;  2PU9 C;  4GQF A;  4G19 A;  2DIZ A;  1QK8 A;  2V6O A;  1B9X C;  3OR5 A;  3D6I A;  1NW2 A;  4OD7 A;  5BMU A;  4E8H A;  1PQN A;  3GTU A;  3HD5 A;  1X9M B;  1YEW C;  4PHZ C;  2JSY A;  3A5W A;  3UL3 A;  3IK9 A;  4EC0 A;  1XW5 A;  2D2Z A;  2LQQ A;  4L5O A;  3CXG A;  2AJQ B;  2P31 A;  3HY2 A;  5B8A A;  2H01 A;  3HKR A;  1X5C A;  1KTE A;  2H6X A;  2R6K A;  2TIR A;  1K0A A;  5IMF A;  1O8W A;  2L59 A;  2FWF A;  1XIY A;  2V6K A;  3LOR A;  1GRX A;  1K3L A;  2FHE A;  4KE3 A;  4F0C A;  3IOS A;  2IWT A;  5C04 A;  2KLX A;  4GLT A;  1M2D A;  1T4Z A;  1XG8 A;  1XOA A;  4PQI A;  1RK4 A;  2B6M A;  1M2A A;  1QXH A;  2R5G A;  3PH9 A;  5EPF A;  2VCW A;  1GNE A;  4Z7X A;  1TU7 A;  2AAW A;  3H4K A;  5HQP A;  3H93 A;  3FK8 A;  3RHC A;  5GST A;  1NM3 A;  2VD1 A;  4EVM A;  4HZ2 A;  4BL7 A;  4G0L A;  3HZ8 A;  1GLP A;  2DJ3 A;  2I1U A;  1T8E B;  4BA7 A;  5G31 A;  1Z6N A;  4MH2 A;  2IME A;  3HHV A;  1GTI A;  3IBH A;  1FVJ A;  1PGT A;  3GX8 A;  1H75 A;  4Q5F A;  1ZYP A;  3MSZ A;  2C0F A;  3DXB A;  1EV9 A;  1Y6E A;  2IIY A;  3I6A A;  3ERG A;  4KCA A;  5CO3 A;  2R3X A;  1ZOF A;  4X4J A;  1XZO A;  5E59 A;  4JRR A;  1S3D A;  1ERT A;  5G5E A;  1F3B A;  2GZZ A;  2F9S A;  5KOX A;  2O87 A;  1W89 A;  3K8N A;  2G2Q A;  4PNG A;  1TRU A;  4ZB7 A;  4JZQ A;  2E0Q A;  1THO A;  1SK1 A;  2KOK A;  2BTO T;  1EP8 A;  1ZYQ B;  3RPN A;  1R7H A;  3G9B A;  1OE8 A;  2GSQ A;  7GSS A;  5IO0 A;  2VM1 A;  2CZ3 A;  2CQ9 A;  1XBS A;  4PUR A;  3UIW A;  3TKQ A;  4HUA A;  3IRA A;  3BJ5 A;  1XW9 A;  3HVS A;  2CX4 A;  2YV7 A;  2H1A A;  5DQY A;  4X1U A;  4CDO A; 
#chains in the Genus database with same CATH homology
 2J9H A;  3Q6O A;  4K7N A;  4MPF A;  4EXJ A;  2OBI A;  2B7J A;  6GSY A;  2EFC A;  3O76 A;  5ECH B;  1KBN A;  1N2A A;  3ZML A;  1BG1 A;  4G01 A;  2HZF A;  4G9H A;  2LTK A;  2R4V A;  2NBS A;  3EYT A;  4V1A p;  3IXR A;  2B5X A;  2VCT A;  5FWG A;  1ERW A;  4KDU A;  2JZR A;  4TW5 A;  4K0G A;  3F4S A;  4K2X A;  3WGX A;  1BG5 A;  1ERU A;  1G0T A;  4ACS A;  4CY6 A;  4TR3 A;  4MJB A;  1AC1 A;  1AXD A;  1EEJ A;  3RAZ A;  4EO3 A;  2GZP A;  2FA8 A;  4PUF C;  5HFI A;  2VL2 A;  4IQ1 A;  1Y1U A;  4O5U A;  1PSQ A;  2MMN A;  3LGC A;  3GKM A;  5GAP D;  3IV4 A;  4BPY A;  1YZX A;  5IOX A;  3FMW A;  4KND A;  1FB6 A;  3S9F A;  1VRS D;  2ZCT A;  4AKI A;  4WR5 A;  2MZC A;  3PPU A;  5A34 B;  1VF4 A;  2H1G A;  3UOM A;  3KH7 A;  1MEK A;  1SYX A;  5J9C A;  2X8C A;  1PN0 A;  5JWO B;  1V40 A;  2GQM A;  1EP7 A;  5IIZ A;  3BOA A;  4XS1 A;  1PRX A;  5FT3 A;  3GKX A;  3HZ4 A;  3KIJ A;  3IC8 A;  4FYU A;  1XWK A;  4DSS A;  1URM A;  4PQH A;  4KGI A;  4RI7 A;  1HYU A;  3ISO A;  5CRG A;  5ECP B;  2BJX A;  4ZXG A;  3BCI A;  1XW6 A;  1GTA A;  2YV9 A;  3MYD A;  2YOI A;  3TRP A;  2I4A A;  4IVF A;  2ZNM A;  3TKP A;  2P5Q A;  2TRX A;  3CSI A;  5IMD A;  2H70 A;  5IQY A;  4ECB A;  2XPD A;  1I5G A;  10GS A;  1WMJ A;  2GT5 A;  3P8W A;  1WWJ A;  1GSF A;  3GST A;  4JR6 A;  3QFA C;  4OO4 A;  1M99 A;  3F8U A;  1M2B A;  2DC5 A;  2JZS A;  1PX6 A;  1ZYN A;  5D8I A;  5CRW A;  1SK0 A;  4HQZ A;  2VCV A;  1XOB A;  4L0U A;  2VO4 A;  3GNJ A;  5DAL B;  3D0Z A;  3LXT A;  5D96 A;  2HZE B;  4ZB8 A;  3W8S A;  2VL3 A;  4KA0 A;  5G30 A;  2HLS A;  2P5R A;  4OFM A;  2MBS A;  1SEN A;  2GQL A;  1TXX A;  4G10 A;  1Z7P A;  2YP6 A;  1SL2 B;  1A2L A;  4MZB A;  3EC3 A;  4HQS A;  1JFU A;  5COH A;  2X8H A;  5G1K A;  3VWV A;  1Q98 A;  3G7I A;  2K18 A;  2YN1 A;  1KEB A;  1GSS A;  1TK8 B;  4KSM A;  2H6Z A;  2L5O A;  3CYN A;  2K9F A;  1SKR B;  4MZW A;  4KW6 A;  2HSY A;  1K0C A;  2L5L A;  2IMK A;  4KDX A;  3TJJ A;  4Q5Q A;  4FO5 A;  1XVQ A;  22GS A;  4XIH A;  4EIP A;  4W66 A;  4TXO B;  1TTZ A;  4HS1 A;  3A5I A;  2JZT A;  4I6X A;  1X5E A;  2O8V B;  3KEB A;  3C1S A;  5B7C A;  3RPP A;  2N5F A;  3MWH A;  3W8J A;  3DD3 A;  1DSB A;  4GF0 A;  2REM A;  1SJI A;  2YWI A;  2EIO A;  5IM9 A;  3L9V A;  3Q18 A;  1TW9 A;  2OE3 A;  2HRA A;  4HOJ A;  4I97 A;  1AQV A;  2DJ1 A;  3EPT A;  2B5E A;  2JAD A;  1X9W B;  3UBL A;  1TDI A;  5GAN D;  3VWX A;  3BD2 A;  4P3Y B;  4IS0 A;  4WBJ A;  5J4Y A;  1LJR A;  3TOT A;  2J23 A;  2VM2 A;  1G7O A;  3F63 A;  4JU5 A;  4WEY A;  2NDO A;  4H86 A;  3IR4 A;  4FYB A;  1I9D A;  5KOW A;  1Y25 A;  3M8N A;  1YF0 A;  19GS A;  4V2L A;  2O85 A;  3ME7 A;  5A4U A;  4PTS A;  2PGT A;  4MF7 A;  2VUP A;  1JLV A;  4K9Z A;  4F2I A;  1SKS B;  2FCH A;  4BWS A;  4K8M A;  2YZU A;  5L71 A;  3KP9 A;  1DE1 A;  1XXU A;  5KN1 A;  2F3M A;  4NV5 A;  3VI7 A;  2N5A A;  13GS A;  4AKH A;  1YJ6 A;  2NVL A;  2WRT A;  3VI5 A;  5A34 A;  4ICY A;  4IBP A;  4ECC A;  3F3Q A;  1TJD A;  1AIU A;  2LST A;  5D9X A;  6GSW A;  2CV4 A;  1QGV A;  5INY A;  1E6B A;  3JCM L;  2PPT A;  2P0G A;  1BED A;  5BRT A;  5AGY A;  3GFK A;  3NIV A;  5LNK e;  12GS A;  2C80 A;  4I2U A;  4EUY A;  2M80 A;  2RUE A;  2FUG 2;  1GNW A;  1J9B A;  3DGQ A;  4FIW A;  3BBY A;  2JU5 A;  2LJA A;  1R4W A;  2GSS A;  1EGR A;  3TKR A;  2H1D A;  6GSV A;  1FHE A;  5G2Z A;  6GSS A;  3F6D A;  4PNF A;  2C1Y A;  4QMK A;  1QQ2 A;  4MF5 A;  3FR9 A;  4POK A;  3PR8 A;  2CT6 A;  4YQM A;  3HYP A;  4AKX B;  2B7K A;  2XPE A;  1OAZ A;  3TOU A;  2OE1 A;  3E3E A;  4YH2 A;  4XCS A;  2YZH A;  3G7J A;  1YKA A;  5H5Q A;  2DML A;  3L0H A;  3HJO A;  2C0E A;  2H75 A;  1AW9 A;  5DAL A;  3H1N A;  1R5A A;  2HZE A;  2PN8 A;  1F37 A;  3KD0 A;  1ST9 A;  3QDN A;  1NSW A;  4TR0 A;  1K3Y A;  2X8G A;  3ZIV A;  4NHZ A;  1UA5 A;  4K7I A;  3UBK A;  4K0N A;  2K6V A;  4I8B A;  1SD9 A;  5F05 A;  2LJK A;  2I3Y A;  2V2G A;  4HU9 A;  3ZRE A;  2AV4 A;  1G6W A;  4OO5 A;  1GUH A;  5ELA A;  1AQX A;  4EF0 A;  2CA8 A;  3LYK A;  3LFL A;  5EL8 A;  2VD0 A;  3TKS E;  2QKE A;  4MAB A;  4NMU A;  2UZ8 A;  3EMP A;  2GQK A;  4RUV A;  5LCZ A;  1V98 A;  1A8L A;  5ECQ B;  1UC7 A;  1X0R A;  1ZCP A;  2C0D A;  1OC9 B;  4DSS B;  3IHQ A;  1OC3 A;  3EE2 A;  2HSM A;  3KCM A;  1OC8 A;  1G6Y A;  1A2M A;  4JED A;  4TXO A;  2ES7 A;  3VWU A;  4LL4 B;  1Z9H A;  4AI6 A;  3W6G A;  2C0G A;  3WT1 A;  1O7U A;  3LEF A;  2R0G A;  2WUL A;  2VCX A;  1H4O A;  4KUN A;  3WD6 A;  2H19 A;  5D9T A;  4Z2R A;  1NHY A;  2YWO A;  2M72 A;  4N10 A;  5A5K A;  4NXI A;  2PER A;  3MIX A;  4TR1 B;  4PUA A;  2PVQ A;  2XC2 A;  2CAI A;  5A5H B;  3KXO A;  2O5V A;  3GUR A;  2HRF A;  4IN0 A;  2WS2 A;  3HMJ G;  4BVX B;  3E9J B;  1F2E A;  2EFH A;  4ML1 A;  2QA2 A;  2H76 A;  2VOC A;  5ECI B;  4O92 A;  4GSS A;  1ON4 A;  2IFQ B;  1SVM A;  3GUS A;  1UVZ A;  3GL5 A;  3D4T A;  3H79 A;  4I2T A;  4N0Z A;  4F03 A;  4GTU A;  1O6J A;  2C3N A;  1PL2 A;  3IK7 A;  3M0F A;  1USB A;  1XPV A;  3TRX A;  9GSS A;  2LS5 A;  2WFC A;  1XWB A;  2B5Y A;  2C4J A;  2IJY A;  3GA4 A;  4ZIL A;  3GRX A;  2IPA A;  3EMX A;  4EDY A;  4ZIJ A;  4IJI A;  4LL1 B;  1M0U A;  2HYX A;  5AN1 A;  1K0M A;  2DKI A;  4BVY B;  2IL3 A;  4J56 E;  3VPQ A;  2KP1 A;  4MLY A;  1EWX A;  4NAX A;  4HDE A;  2DLX A;  1YQ1 A;  2A2P A;  1JZD A;  5A1N B;  5HR3 A;  2I81 A;  5G5F A;  5EVO A;  4ECJ A;  1AAZ A;  2OJL A;  2OAD A;  4O32 A;  3J7Y k;  3A3T A;  2DJ0 A;  1T4Y A;  5AIV A;  3WYW A;  3N9J A;  1YEP A;  3VFI A;  1JLW A;  5CRD A;  3A2X A;  1LBK A;  3DRN A;  1SL1 B;  4K5R A;  1GSU A;  2Z9S A;  3IAM 2;  3TJB A;  3DEX A;  1YVL A;  3GX0 A;  5IMZ A;  1PA3 A;  3N5O A;  4WBR D;  3KJY A;  3NZN A;  5KN2 A;  5CP1 A;  4Q5R A;  2WZ9 A;  2C8U A;  3F3R A;  1YY7 A;  1GLQ A;  3PGT A;  3CRU A;  2XBI A;  1ZZY A;  3FW2 A;  3TJF A;  1JZO A;  3APQ A;  4NV2 A;  5IPH A;  2GZY A;  3MNG A;  4ZB9 A;  1S3A A;  3P2A A;  4KAE A;  3ERW A;  4GCI A;  1GP1 A;  2EIR A;  3HJM A;  3M9K A;  1GSY A;  4K7O A;  4XHM A;  3M3M A;  1PX7 A;  2E2G A;  3M1G A;  3IA1 A;  2ALB A;  3KP8 A;  3NOF A;  4YKG A;  2DKH A;  3FHK A;  5JWQ B;  4XS4 B;  3HVX A;  1VF1 A;  1PMT A;  4OFN A;  1M9A A;  4CW9 A;  4ILF A;  5J5N A;  1YF1 A;  1EOG A;  1TRS A;  1OC9 A;  3DML A;  2O89 A;  3TB2 A;  2X4A A;  1SL0 B;  4OCF A;  1ABA A;  5G1L A;  2QSI A;  1UN2 A;  4DVC A;  4TVE A;  1R26 A;  1SVL A;  2AHE A;  2LQO A;  3L78 A;  4MH3 A;  3LYP A;  5ECM B;  4ZBD A;  3I43 A;  1O73 A;  3LXZ A;  3QPM A;  3TJG A;  3D4M A;  3ZYW A;  1TK5 B;  3LJR A;  1DE2 A;  3D21 A;  1T3B A;  4KCE A;  3GKN A;  3UVH A;  5J41 A;  3C1R A;  4QL9 A;  1J0F A;  4KX4 A;  4TR1 A;  4XS6 A;  3APO A;  5DJL A;  3CRT A;  5A5H A;  4PGT A;  4PX1 A;  2VLV A;  3KTL A;  3QCP A;  3I69 A;  2GSR A;  1HNC A;  1BAY A;  4YKF A;  4BVX A;  3ZMK A;  2RII A;  2L4Q A;  4Z2T A;  3F0I A;  1THX A;  4AJ7 A;  4BWQ A;  5A4W A;  2IFQ A;  2YCD A;  2YNX A;  3J7Y b;  3RDW A;  5F06 A;  3HDC A;  2BMX A;  1OYJ A;  4LA1 A;  5ECO B;  4ZBA A;  2H71 A;  3TDG A;  4WXT A;  3ZRD A;  3IE3 A;  5IO2 A;  2GT6 A;  2LNS A;  2LRC A;  3UVT A;  1O8X A;  5AIS A;  1F9M A;  2HQT A;  4OCE A;  4F9Z A;  2B1L A;  4G0I A;  2VLT A;  1EV4 A;  3O6T A;  2CZ2 A;  2DJ2 A;  1U88 A;  1FG4 A;  4JBB A;  1MDI A;  1FB0 A;  4BVY A;  3SBC A;  2H66 A;  3UJ1 A;  5C00 A;  3ZTL A;  2HSM B;  4QQ7 A;  2OBK A;  2O7K A;  5DJM A;  2VCZ A;  4D73 A;  5ECR B;  5CNW A;  1A24 A;  3QFB C;  1ILO A;  2HRN A;  5A1N A;  2GS3 A;  3FR6 A;  1OVN A;  18GS A;  2LV3 A;  3P90 A;  5DCG A;  1ZL9 A;  1SYR A;  4LMV A;  4EL1 A;  2FWH A;  4V2M A;  1PN9 A;  16GS A;  2H1B A;  1ZYE A;  4YQU A;  5JCU A;  1GTU A;  2OE0 A;  1TKD B;  2IMF A;  3APS A;  3KH9 A;  4XRA A;  4Q5N A;  1XCC A;  2MYG A;  3P7X A;  4POB A;  3Q19 A;  3L4N A;  1TOF A;  2YAN A;  3C73 A;  5IMV A;  1Z5Y E;  2HXK A;  2VAF A;  5H5R A;  1JZR A;  3CBU A;  3QAW A;  4Z2U A;  2R2J A;  2X99 A;  1V58 A;  2FGX A;  3R2Q A;  1WP0 A;  2JAC A;  4JE1 A;  3QR6 A;  2FWE A;  1PL1 A;  3FR3 A;  4AJ8 A;  3CTG A;  2GDR A;  3HA9 A;  1JZW A;  3WT2 A;  4QL7 A;  1CQG A;  1K0N A;  2VCQ A;  4MP4 A;  2PMT A;  3IC4 A;  4N0V A;  1F3A A;  1XWC A;  4KF9 A;  5GSS A;  1GSQ A;  4ZL7 A;  2E7P A;  3FEU A;  1ZGN A;  2IMI A;  4IKH A;  5IPG A;  1WJK A;  4XS4 A;  3L9U A;  2WGR A;  3VK9 A;  1GUM A;  2MMA A;  2IMD A;  4N11 A;  4IHU A;  2CVB A;  2YWN A;  1CQH A;  3D5J A;  3C8E A;  2V1M A;  3I9V 2;  5ID2 B;  5ECS A;  5ECN B;  2NPB A;  2X64 A;  4L0W A;  3U6V A;  2YJH A;  2ON7 A;  5D9V A;  3VLN A;  4PXO A;  4DSR A;  2FD3 A;  2DIY A;  3EWL A;  5J3R A;  1PKZ A;  3G7Y A;  3A2V A;  4DSQ A;  1OE7 A;  3BCK A;  3ZVJ D;  2AUV A;  2WJU A;  3TU3 B;  2HT9 A;  2LEG A;  2R0P A;  5DVB A;  5J9B A;  2PWJ A;  2RM6 A;  17GS A;  4NWY A;  2I9H A;  3E0U A;  1ACV A;  2KHP A;  2LKU A;  2CX3 A;  3DIE A;  3QAV A;  1RQM A;  4HJ2 A;  1VF3 A;  1JHB A;  4TN8 A;  2DJK A;  3CSH A;  2FY6 A;  2B3S A;  2OT3 A;  1B4Q A;  2RM5 A;  2HE3 A;  3DVX A;  1IYI A;  2FNO A;  5JCG A;  3EU3 A;  2R0C A;  1MD4 A;  4E8E A;  3WGD A;  3EU4 A;  4EDZ A;  4PQ1 A;  3SWL A;  5DAK B;  3LG6 A;  3F4T A;  2DBC A;  5F07 A;  2L6D A;  3V1W A;  2H72 A;  1Q4J A;  6GST A;  4OMV A;  4L5L A;  3GH9 A;  3FYG A;  1SD8 A;  3EUR A;  4KDY A;  2AYT A;  1T00 A;  2PBJ A;  2QA1 A;  4O7H A;  1TI1 A;  1XWA A;  2MMZ A;  2EC4 A;  3DKS A;  20GS A;  5J47 A;  4EE0 A;  3R3E A;  2ZUP A;  2C3Q A;  3HCZ A;  3ZVJ A;  2KUC A;  3FZ4 A;  4MF6 A;  3GYK A;  4IJ3 A;  4POM A;  2OKA A;  4HZ4 A;  4MPG A;  5DCH A;  3KZQ A;  3LWA A;  3UEM A;  2FWG A;  1HD2 A;  2GLR A;  4J57 E;  1N8J A;  3GL3 A;  4ULX A;  8GSS A;  4POL A;  1WPI A;  5J4V A;  2GVP A;  1MTC A;  5LD0 A;  1HQO A;  3WGE A;  3LQ7 A;  4GQC A;  5JCW A;  2RLI A;  1ML6 A;  3ZFB A;  5ECL B;  1RW1 A;  2UV8 G;  1GUK A;  4HI7 A;  4NHW A;  3RHB A;  4AKG A;  1EEM A;  5CRH A;  1A2J A;  5CRE A;  1B8X A;  4ECI A;  2VLU A;  2F51 A;  4HJM A;  3TGZ A;  4K5S A;  3KMO A;  1VGL A;  4LLR A;  11GS A;  2H6Y A;  4TOP A;  1X9S B;  3MAK A;  2C3T A;  5KN0 A;  2A2R A;  3TKS A;  1T7P B;  4GXZ A;  2PVO C;  5AIX A;  3TUE A;  5FHI A;  5EY6 A;  1K0O A;  1SKW B;  4MDC A;  3QAG A;  2KP2 A;  5HR1 A;  1ZMA A;  2MBT A;  2LJR A;  4IEL A;  3Q74 A;  2EFD A;  2AB6 A;  4K2D A;  4DEJ A;  4IQA A;  2CVD A;  1K0B A;  2A2S A;  3GMF A;  2GST A;  5D73 A;  4MCU A;  4WF4 A;  4KB3 A;  2HSN B;  3FZA A;  4FH8 A;  4K6X A;  4TR4 A;  1WIK A;  3QD9 A;  4D73 B;  2YPM A;  2EFE A;  2IN3 A;  1TP9 A;  2A4V A;  2JSZ A;  4GSN A;  4MJC A;  3UMA A;  5ID2 A;  2F8A A;  3FKF A;  2TRC P;  2GGT A;  2HI7 A;  4KSO A;  1A8Y A;  3VPT A;  4ID0 A;  4ZL9 A;  1MD3 A;  2F8F A;  5D9W A;  1EZK A;  4J2F A;  4A5P A;  14GS A;  5KN3 A;  1V57 A;  3D22 A;  1YDK A;  3ZIT A;  5IOW A;  1B4P A;  3ERF A;  5DBQ A;  2A4H A;  3ZZX A;  3GH6 A;  1FO5 A;  4WR4 A;  4N30 A;  6GSU A;  3CMI A;  4MJE A;  3HXS A;  2R37 A;  1NHO A;  2FLS A;  1OKT A;  1F6M C;  3EVI A;  2LUS A;  4AGS A;  3US3 A;  3KGK A;  4X0X A;  2WDU A;  3FY7 A;  1FOV A;  5A4V A;  2FA4 A;  1GSE A;  4E68 A;  3IPZ A;  2VIM A;  3IHG A;  1QMV A;  2HRK B;  1FW1 A;  5DDL A;  5E4W A;  3A2W A;  4MNN A;  1M9B A;  1X5D A;  1QUW A;  2YJ7 A;  4XTS A;  2X49 A;  4WF5 A;  3VWW A;  3PIN A;  1BQ7 A;  4AF2 A;  4KH7 A;  5DAK A;  4V2N A;  2E2M A;  4F0B A;  1U3I A;  2JL4 A;  2H73 A;  5F0G A;  5ELG A;  1GTB A;  2H30 A;  2EIQ A;  1OKD A;  4G0K A;  1A23 A;  1PD2 1;  4LMW A;  2LRT A;  1GSD A;  3TJK A;  3CSJ A;  3MDK A;  1V9W A;  4L8E A;  1A0R P;  4YAP A;  2DSA A;  4EKZ A;  2QC7 A;  5ENU A;  3F6F A;  2DMM A;  6GSX A;  5B6M A;  4NPB A;  5ECK B;  5JWR B;  2CVK A;  4ML6 A;  2L4C A;  1G7E A;  1XVW A;  1U6T A;  1BYE A;  4WET A;  3GIX A;  1V2A A;  4FYC A;  3TRQ A;  4X43 A;  5HFK A;  1GL8 A;  4I5Q A;  2WCI A;  3ZLP A;  1Z3E A;  2H0H A;  3U5R E;  4EIQ A;  3QMX A;  4RQX A;  1FOH A;  4USS A;  3TKS C;  4TRX A;  5CYY A;  5KEJ A;  1M7T A;  3ED3 A;  3FZ5 A;  3ZL5 A;  4CHS A;  1J08 A;  5IMC A;  5HR2 A;  5BMU B;  1SK2 A;  3CWG A;  4HU7 A;  4ZL8 A;  3GTU B;  1KNG A;  4K1F A;  2CAQ A;  5B6N A;  2H0G A;  3ZIJ A;  3LSZ A;  3KTB A;  4JR4 A;  5DQS A;  2DJJ A;  3FRC A;  4IW9 A;  1U3A A;  3AY8 A;  2HFD A;  2HSH A;  1AQW A;  4GST A;  1K0D A;  3KMN A;  2LNT A;  2K8V A;  2NTO A;  4HEA 2;  4ZBB A;  4CY8 A;  2HSN A;  4IP1 A;  2B1K A;  1W4V A;  1B9Y C;  2ON5 A;  3IDV A;  3UAP A;  1O85 A;  4V1A g;  3UAR A;  5J4U A;  2XBQ A;  1WOU A;  1TI3 A;  3TCO A;  4MA9 A;  1TRV A;  4GDF A;  3CTF A;  1TXU A;  1SVO A;  2LRN A;  3O3T A;  3RBT A;  4IP6 A;  3GKK A;  3HJP A;  2OA7 A;  2VKZ G;  5B8B A;  1BJX A;  3GHA A;  3VUR A;  4GWR A;  2N5B A;  1GUL A;  2PUK C;  4O5R A;  1QFN A;  4ZB6 A;  1Z6M A;  1ERV A;  4BL7 B;  3DVW A;  1TK0 B;  1C72 A;  2WB9 A;  1K3O A;  1EGO A;  3DYR A;  4GRF A;  3M9J A;  4MMM A;  1R5P A;  1GWC A;  3IAS 2;  4MZC A;  1TRW A;  4N3Z A;  1EOH A;  2H74 A;  2G0F A;  2HRK A;  4MJA A;  2VL2 C;  1SU9 A;  1VF2 A;  1MDJ A;  1FVK A;  2GTU A;  3H8Q A;  1GH2 A;  4MK3 A;  2RUF A;  1T1V A;  3ZFL A;  1HNB A;  5F8B A;  2M46 A;  3C71 A;  2XHF A;  4TXV A;  2HNL A;  1N25 A;  2YWM A;  5HFG A;  1U87 A;  1DUG A;  4FQU A;  4RI6 A;  4TKY A;  1E2Y A;  5IMA A;  2K8S A;  2OAC A;  3HVV A;  1BF5 A;  1HNA A;  1TU8 A;  1DBY A;  1Z7R A;  1AUC A;  2QGV A;  2L6C A;  3F4R A;  1MDK A;  4F82 A;  3DWV A;  1XWG A;  2L57 A;  4AJ6 A;  1YKC A;  1SJZ A;  4G2E A;  5J40 A;  3KM6 A;  1S3C A;  3GV1 A;  1WRY A;  2H1L A;  3ME8 A;  1WE0 A;  1B48 A;  5H5S A;  2VL9 A;  1LU4 A;  3FZ9 A;  1YEX A;  5ABR A;  4IGJ A;  2H8L A;  1SJ6 A;  4YQV A;  2V32 A;  4XRD A;  3GSS A;  1IYH A;  1FAA A;  3F9U A;  4YAV A;  5CAX A;  3L9S A;  4O5Q A;  2H0I A;  1BX9 A;  1XFL A;  2V41 A;  3GN3 A;  3C7M A;  1O81 A;  4OWY A;  4WKW A;  3EIN A;  4ISD A;  2MMO A;  5GZZ B;  4OFT A;  3LW9 A;  3QOU A;  1PKW A;  1A0F A;  4RQR A;  5D93 A;  5HR0 A;  2PU9 C;  4GQF A;  4G19 A;  2DIZ A;  1QK8 A;  2V6O A;  1B9X C;  3OR5 A;  3D6I A;  1NW2 A;  4OD7 A;  5BMU A;  4E8H A;  1PQN A;  3GTU A;  3HD5 A;  1X9M B;  2JSY A;  3A5W A;  3UL3 A;  3IK9 A;  4EC0 A;  1XW5 A;  2D2Z A;  2LQQ A;  4L5O A;  3CXG A;  2AJQ B;  2P31 A;  3HY2 A;  5B8A A;  2H01 A;  3HKR A;  1X5C A;  1KTE A;  2H6X A;  2R6K A;  2TIR A;  1K0A A;  5IMF A;  1O8W A;  2L59 A;  2FWF A;  1XIY A;  2V6K A;  3LOR A;  1GRX A;  1K3L A;  2FHE A;  4KE3 A;  4F0C A;  3IOS A;  2IWT A;  5C04 A;  2KLX A;  4GLT A;  1M2D A;  1T4Z A;  1XOA A;  4PQI A;  1RK4 A;  2B6M A;  1M2A A;  1QXH A;  2R5G A;  3PH9 A;  5EPF A;  2VCW A;  1GNE A;  4Z7X A;  1TU7 A;  2AAW A;  3H4K A;  5HQP A;  3H93 A;  3FK8 A;  3RHC A;  5GST A;  1NM3 A;  2VD1 A;  4EVM A;  4HZ2 A;  4BL7 A;  4G0L A;  3HZ8 A;  1GLP A;  2DJ3 A;  2I1U A;  1T8E B;  4BA7 A;  5G31 A;  1Z6N A;  4MH2 A;  2IME A;  3HHV A;  1GTI A;  3IBH A;  1FVJ A;  1PGT A;  3GX8 A;  1H75 A;  4Q5F A;  1ZYP A;  3MSZ A;  2C0F A;  3DXB A;  1EV9 A;  1Y6E A;  2IIY A;  3I6A A;  3ERG A;  4KCA A;  5CO3 A;  2R3X A;  1ZOF A;  4X4J A;  1XZO A;  5E59 A;  4JRR A;  1S3D A;  1ERT A;  5G5E A;  1F3B A;  2GZZ A;  2F9S A;  5KOX A;  2O87 A;  1W89 A;  3K8N A;  2G2Q A;  4PNG A;  1TRU A;  4ZB7 A;  4JZQ A;  2E0Q A;  1THO A;  1SK1 A;  2KOK A;  2BTO T;  1EP8 A;  1ZYQ B;  3RPN A;  1R7H A;  3G9B A;  1OE8 A;  2GSQ A;  7GSS A;  5IO0 A;  2VM1 A;  2CZ3 A;  2CQ9 A;  1XBS A;  4PUR A;  3UIW A;  3TKQ A;  4HUA A;  3IRA A;  3BJ5 A;  1XW9 A;  3HVS A;  2CX4 A;  2YV7 A;  2H1A A;  5DQY A;  4X1U A;  4CDO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...