4YQUA

Glutathione s-transferase omega 1 bound to covalent inhibitor c1-31
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
238
structure length
235
Chain Sequence
ESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Glutathione S-transferase omega-1
publication title Mechanistic evaluation and transcriptional signature of a glutathione S-transferase omega 1 inhibitor.
pubmed doi rcsb
source organism Homo sapiens
total genus 77
structure length 235
sequence length 238
chains with identical sequence B
ec nomenclature ec 1.20.4.2: Methylarsonate reductase.
pdb deposition date 2015-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4yquA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4yquA01
1IYHA 1XWBA 4V2MA 4TOPA 4PX1A 4F2IA 4DSRA 1OC9A 1O73A 3QAWA 4KB3A 5CYYA 4EDYA 1U87A 5AIVA 2BJXA 5HFIA 5D9VA 1B9XC 2CZ3A 4CHSA 1I9DA 4KW6A 2I4AA 3UOMA 3HCZA 2MZCA 4MK3A 3TKRA 2IWTA 2XPDA 2HRFA 2HQTA 2P0GA 5DBQA 4I8BA 4O32A 4POLA 1H75A 4OCEA 1U88A 1A8YA 1O81A 1SK1A 2REMA 4L0UA 3DRNA 1GTAA 4XRAA 2DSAA 3TJKA 5JWRB 5EVOA 4ECCA 1YQ1A 2QGVA 5DCGA 2JZTA 1PL1A 2JSZA 4YAPA 4G2EA 4N0VA 2GQKA 2H72A 2RUEA 3IV4A 3GSTA 2OE0A 4GXZA 1X5EA 2I3YA 1XOBA 4ILFA 4OD7A 4ZL9A 5ID2B 22GSA 4GWRA 1XPVA 4MA9A 2PVOC 2VCZA 12GSA 2IMIA 3PH9A 1Y25A 4NPBA 5CRGA 5JWQB 3VI5A 2A2RA 2IIYA 3BOAA 4AJ8A 2B1KA 2GGTA 2A4VA 1A8LA 2GZYA 4AF2A 3F6DA 3TJGA 2JSYA 2GDRA 2CVDA 3CBUA 4G10A 3I69A 4L5LA 5J41A 3GMFA 2ZCTA 3GA4A 3HJOA 1K0CA 3P8WA 4MMMA 1AQWA 3I43A 4V1Ag 3DEXA 2YWNA 2LRNA 3GTUB 2A2SA 1ERVA 2HSHA 1SYRA 1OC3A 1OKTA 4G0KA 6GSVA 5IMCA 1UN2A 5CNWA 3NZNA 5AIXA 5CREA 1MDJA 1JFUA 1A23A 3DWVA 3VWUA 2YWIA 2L5LA 1TTZA 2EIQA 5JCGA 2QKEA 3O3TA 1QUWA 4BA7A 5IMVA 1TRSA 2OBIA 1FVKA 1MD3A 2H70A 4FYUA 4PUFC 1O8XA 3F4TA 5KN3A 5LCZA 4IGJA 5D96A 5G1KA 4USSA 5ENUA 1T00A 3KTBA 4HS1A 1VF1A 3F9UA 3US3A 2OE3A 5DAKA 2VLVA 2Z9SA 1AC1A 2NTOA 1GSUA 3H1NA 3L9UA 1YEXA 4TR3A 2VOCA 5EPFA 3HA9A 2RUFA 4HQZA 4I6XA 1JZOA 5G2ZA 2WULA 3L78A 2H6XA 4MZWA 2ES7A 3LXZA 4MZBA 2DJ0A 2GSQA 1A2MA 3VWXA 4RQRA 1EOGA 1BJXA 4ZBBA 4IBPA 4I97A 4J56E 4NMUA 1K3LA 2WGRA 3CSJA 3KZQA 3ZIJA 3A2XA 5ABRA 5EY6A 2IPAA 2DJJA 3A5WA 4WR5A 1ERWA 3BD2A 4LMVA 2O85A 3W8JA 3ZTLA 1ZZYA 4PNGA 2DMMA 1PD21 1KNGA 2L4CA 3WD6A 4F9ZA 2LRCA 3D4TA 3PGTA 3BJ5A 3VWWA 2LRTA 2VCQA 1VF4A 3GL5A 1KBNA 2V41A 2VD0A 2GSSA 1PQNA 5INYA 1MTCA 3RHBA 2PERA 3KCMA 1EOHA 5H5SA 1URMA 3LYPA 2F8FA 2K6VA 2K8VA 2LSTA 4ID0A 2OA7A 1HQOA 3DGQA 1N8JA 1FVJA 2YV9A 5IMZA 3RHCA 3C8EA 2FA8A 2PMTA 4K0NA 1WMJA 1TKDB 3GKXA 4KX4A 3P7XA 4KUNA 1A2LA 1XOAA 2C3QA 3WGEA 3DVXA 4JE1A 2DC5A 3DIEA 4ZL7A 5L71A 2EIOA 3GYKA 2HZEB 4EXJA 3TRQA 1TK0B 2VM1A 10GSA 3QPMA 5DDLA 3DMLA 1TDIA 3GKMA 3ZREA 2J9HA 3TOUA 4X43A 3KJYA 3HZ8A 2ZNMA 3TJBA 4KSMA 1RW1A 1O8WA 2PU9C 4F82A 1E6BA 1IYIA 4ZBDA 4POKA 2CT6A 4KDYA 1PSQA 1A0RP 3LORA 4DEJA 5ID2A 4JR6A 2D2ZA 1H4OA 1SENA 1DE2A 4MJBA 3U5RE 1GSEA 1HNCA 2P5QA 1ILOA 4OFTA 1NSWA 1YKCA 2GS3A 1XW5A 3M9KA 1GSFA 2AAWA 3LQ7A 3TOTA 2LS5A 5D9TA 4K8MA 3QD9A 1BAYA 3HY2A 1NHOA 4KE3A 1Z5YE 2IMKA 3IAM2 2TRXA 3LWAA 3HXSA 3LYKA 2TIRA 4BWQA 1NW2A 3N9JA 4KH7A 3N5OA 4KDXA 1U3IA 3GTUA 3PR8A 4J2FA 2GT6A 4IJ3A 2GZPA 4JBBA 3UL3A 1OC8A 5B8BA 4WXTA 3VPTA 13GSA 2H30A 4XS4B 1ML6A 5GZZB 2DJ2A 4QL7A 1T4ZA 3ZMLA 1M99A 4F0CA 5KN1A 3E0UA 5ECLB 2PBJA 1F3AA 2AV4A 2WCIA 1DSBA 5ELGA 2VAFA 1HYUA 1K3YA 3IHQA 1M2DA 5F05A 3I9V2 1ON4A 2V1MA 2XHFA 1A24A 5J5NA 2VL2A 1EV4A 1B48A 4MH2A 4CDOA 1XFLA 2DJ3A 2YJ7A 4WBRD 2AHEA 1GTIA 1YJ6A 2RIIA 3F4SA 1M7TA 3WGXA 3APQA 3QOUA 4OWYA 3DVWA 2VCTA 2GSRA 4ML6A 4YQUA 1ERTA 3VFIA 4QL9A 1EZKA 3TB2A 1FB6A 2RM6A 2YZUA 1K0MA 1SJZA 1V40A 2VLTA 2B5XA 2NPBA 3F3RA 1OE8A 1GUMA 1GLQA 1K0NA 2V2GA 1FHEA 2K9FA 3AY8A 2LNTA 4NHWA 5AISA 3GN3A 1K0OA 4WF4A 1W89A 1PA3A 4TW5A 2YV7A 1OVNA 3SBCA 1ZL9A 1I5GA 3DXBA 1SK0A 2O8VB 1M0UA 2C3NA 3UBKA 4K9ZA 4BWSA 3F3QA 2LUSA 3Q6OA 2FHEA 3KXOA 3LXTA 4V2LA 2HSMB 3MAKA 4EVMA 2HRNA 1F3BA 3Q74A 3KH9A 3VURA 3EYTA 3TRXA 1C72A 4HI7A 1V2AA 2E2MA 4AJ6A 4G9HA 3ERFA 1MEKA 4GSSA 2VCWA 4OFNA 1VGLA 2MMAA 1AXDA 3ZMKA 4OO4A 2C1YA 3CTFA 2H1AA 1SJIA 2YPMA 1WJKA 1O85A 3HHVA 2KHPA 3UARA 3FZ5A 4GLTA 4YQMA 4XTSA 3LFLA 5LNKe 3O6TA 2C0FA 1B8XA 3APOA 4KDUA 3IE3A 1V9WA 3CXGA 2HYXA 4X1UA 4Q5NA 3TKSC 4ULXA 1TXXA 5DQSA 5COHA 2N5FA 4CW9A 3C71A 4EO3A 2WS2A 2FWGA 4DSQA 4N11A 3ZL5A 4LL4B 3HYPA 1GNEA 4ECJA 3J7Yk 3L0HA 1T4YA 1TK8B 1EEMA 3FZAA 3EMPA 2DMLA 1R26A 2X99A 4IP1A 4NV5A 1AW9A 3R2QA 3KEBA 3ZFBA 4GQCA 2H1GA 2HZEA 2RLIA 2HZFA 2YWMA 2B5EA 1VF3A 4WEYA 2RM5A 5A4WA 3P90A 1B4PA 5IM9A 2H73A 1DUGA 1XVWA 2L59A 3M3MA 4O92A 5F07A 2C80A 4LA1A 1PN9A 1K3OA 4I5QA 1OE7A 1GUHA 3HVXA 3FHKA 3KIJA 2H74A 3TDGA 20GSA 4EUYA 3KD0A 2PGTA 1PX6A 1S3DA 1S3CA 4GRFA 2PUKC 1GSSA 5IQYA 5J3RA 1GTBA 2FD3A 3J7Yb 4TRXA 3DD3A 2L57A 3QAVA 2FWHA 4MLYA 3RPNA 3IBHA 19GSA 4PNFA 4XIHA 1G7EA 3A2VA 1F9MA 1ZYEA 4PXOA 4ML1A 4X0XA 2HI7A 2NDOA 1T8EB 3FYGA 1PMTA 2LKUA 2YANA 2B1LA 5G1LA 1R5AA 2BMXA 3WT1A 4MF6A 4TR4A 3UAPA 2IMFA 3QDNA 3IDVA 3CSIA 1W4VA 1SL1B 3KM6A 3TKPA 2R37A 5C04A 2I81A 1EP7A 1OYJA 5CRHA 3RAZA 3M1GA 3IK7A 4MP4A 3FZ9A 4KA0A 2LV3A 2YCDA 3CYNA 1PRXA 1RK4A 2AYTA 2ON7A 2KP1A 4K2DA 4I2UA 1QXHA 5ECNB 4GTUA 4KAEA 4NAXA 2K18A 4XS4A 4ZIJA 1WRYA 4V1Ap 1JLVA 3C1RA 4JR4A 1THXA 3D21A 4XCSA 5D9WA 4IKHA 1FO5A 1V98A 4MJEA 1TP9A 4IP6A 4FH8A 5GSTA 3GUSA 5ECHB 2F8AA 3GX8A 1TRVA 4HZ4A 4WETA 2R4VA 1XWKA 2EC4A 2H75A 1TRWA 2VD1A 1WWJA 1A2JA 1WE0A 2H6YA 2IFQA 5E59A 3QR6A 2FWEA 1J9BA 2HSYA 1K0AA 4RQXA 2X8CA 2IMDA 3FEUA 2YZHA 1SKRB 1OKDA 1HNAA 2PVQA 1DE1A 5IO0A 2XC2A 1SD8A 3F0IA 1YZXA 2YJHA 6GSYA 1K0DA 4PUAA 4KSOA 3GIXA 1Z6MA 4RI6A 3HVSA 3BCIA 4GSNA 1GUKA 3VI7A 3GFKA 1EP8A 3GV1A 3ME8A 4L0WA 2R6KA 3W8SA 2FA4A 1M9AA 2O89A 5G5FA 3WGDA 1GNWA 4NXIA 2V32A 3FK8A 2HXKA 4N0ZA 2CX4A 4HDEA 2HSMA 3WT2A 1FB0A 18GSA 5D73A 5F8BA 2MYGA 2UZ8A 2H0GA 1EV9A 3UVHA 4FO5A 3MNGA 2LNSA 3A3TA 3GHAA 1F2EA 4DVCA 2H6ZA 3KP8A 4TN8A 3EE2A 5A4VA 1ZMAA 3F6FA 1WP0A 1OAZA 4TR0A 4I2TA 3FKFA 2B5YA 1N2AA 6GSUA 3GRXA 1ERUA 4NV2A 2MBTA 2FUG2 4O7HA 1QFNA 5F06A 2CVKA 3QAGA 5KN0A 6GSWA 2PWJA 5H5QA 4ZILA 1XWGA 3L9SA 3UVTA 2WFCA 5JCUA 3ZIVA 1PKWA 4TR1B 2MMNA 1TK5B 4HQSA 2GQMA 5HR2A 3V1WA 3GSSA 1FW1A 4PQIA 3G9BA 2H19A 2PPTA 1A0FA 2CQ9A 4D73B 5D8IA 5B8AA 2WB9A 2LJAA 1HNBA 3E3EA 4LMWA 4OMVA 2B7KA 2P31A 2L5OA 5HR0A 2KUCA 5DQYA 2B3SA 2L6DA 4ZB8A 2O7KA 2V6KA 3QFBC 2N5BA 1UVZA 2HNLA 4MF5A 2FCHA 1X5CA 3VK9A 7GSSA 3MDKA 4V2NA 3GH6A 3CRTA 2K8SA 3RBTA 2HRAA 2FLSA 5G5EA 1SD9A 1MD4A 4HOJA 5DALB 5H5RA 2XBQA 3UIWA 1UA5A 3FW2A 17GSA 3IK9A 2QSIA 4MABA 4PURA 1TW9A 1SJ6A 1ZCPA 4HJ2A 2CAQA 3TKSA 5HR1A 1KEBA 4EF0A 5ECRB 3MWHA 4AJ7A 3SWLA 2R5GA 3GNJA 2GQLA 6GSTA 2FY6A 2R2JA 1JZDA 4L5OA 2X8GA 1DBYA 1NM3A 3HDCA 1X9MB 5HQPA 2JZRA 4K1FA 2G2QA 3VPQA 1Z3EA 2P5RA 4IJIA 1JZWA 2LJKA 2OBKA 2WRTA 1TRUA 4MDCA 4GQFA 2VCVA 4HU9A 1Q4JA 2DIZA 1AQXA 1GULA 4Q5RA 4PQ1A 4IQ1A 4FYBA 4DSSB 3LSZA 4H86A 5IMDA 4N30A 4BVXB 4GF0A 2DJ1A 3HKRA 2JL4A 2H66A 2IFQB 4IHUA 5B7CA 1ZYQB 1XW9A 5ECSA 2ALBA 2VM2A 3Q18A 4Q5QA 5BMUA 2C4JA 1U3AA 2VO4A 1GL8A 3TKSE 4EKZA 3IXRA 3IC4A 3TGZA 3ERGA 1PL2A 4WKWA 4TXOB 2G0FA 3M0FA 3EU3A 3CRUA 3C1SA 2ZUPA 11GSA 2OE1A 1YF0A 2CV4A 1B9YC 2VCXA 1TOFA 1X9WB 4MZCA 3IPZA 1LBKA 3W6GA 5A5KA 1J08A 4HUAA 3E9JB 2YN1A 3R3EA 1J0FA 1GLPA 2LJRA 3ISOA 4FQUA 1PGTA 4MH3A 1XVQA 2LQOA 4POMA 2C0DA 3UMAA 4EDZA 5GSSA 3ZFLA 1ST9A 2X8HA 3QCPA 5G31A 5CRDA 3LJRA 4NWYA 4BPYA 5IO2A 1FG4A 4HJMA 1SKWB 5IPGA 1T1VA 5FT3A 3K8NA 4K6XA 5EL8A 3DKSA 1XXUA 4G0IA 2DBCA 4WBJA 3S9FA 2HRKB 4EE0A 3FR3A 4JRRA 5HFGA 3HD5A 1VF2A 4BVYB 3TKQA 4ECBA 5DVBA 2LQQA 2OJLA 1THOA 4K7IA 1Q98A 2HSNB 2M72A 2B7JA 1XW6A 3D22A 2IMEA 5CO3A 3IC8A 3ZVJD 2C8UA 2DIYA 3IOSA 5IOWA 1GWCA 2VL9A 9GSSA 1GSDA 2MMOA 4G19A 6GSXA 3IRAA 4YH2A 2MMZA 4ACSA 1XCCA 3O76A 1XBSA 3ZRDA 5ECOB 4HU7A 4TKYA 4TR1A 2YP6A 3MSZA 4L8EA 4XHMA 4K7OA 1X0RA 1R4WA 5JWOB 3C73A 3UJ1A 2N5AA 2CVBA 3TUEA 1XIYA 4D73A 4K7NA 3G7IA 2OKAA 1SL0B 5J4UA 1QGVA 8GSSA 1RQMA 5F0GA 1Z6NA 3HVVA 2IN3A 2NVLA 3ZYWA 4BL7A 1Y6EA 1Z7RA 2VL2C 2JU5A 4PQHA 2FNOA 1X9SB 2YNXA 1GTUA 3IR4A 5IOXA 5HR3A 6GSSA 1BYEA 1TI3A 3RPPA 3G7JA 5DALA 2C0GA 2PN8A 3Q19A 1M9BA 1JHBA 2KOKA 1JLWA 3GKNA 2H1DA 1ABAA 3FR6A 2F3MA 2X64A 5CRWA 2CA8A 3UEMA 1R5PA 1QK8A 5ECQB 4IN0A 2YWOA 5G30A 3EVIA 1YDKA 5J9BA 2DJKA 4IS0A 1WPIA 3L9VA 1QQ2A 1ZOFA 4RI7A 1ZGNA 3GH9A 1EGOA 3GKKA 4MPFA 4Z7XA 2GT5A 4ZB6A 2QC7A 5HFKA 2L6CA 1NHYA 3EURA 3H93A 3GL3A 5GAND 3HZ4A 1R7HA 3HJPA 1GRXA 4JEDA 1EWXA 5D93A 2FWFA 2AJQB 1F6MC 5E4WA 3I6AA 1CQHA 4DSSA 2IL3A 1E2YA 3PINA 1PX7A 4BVXA 3H4KA 4ZB9A 3ZVJA 1HD2A 1F37A 3QMXA 3KMNA 1ACVA 2CZ2A 5J9CA 2H1BA 5FHIA 4O5RA 4ZL8A 1GP1A 1SK2A 3HJMA 3GURA 5B6NA 4Q5FA 3QFAC 5KEJA 2B6MA 2OACA 4TXOA 4GCIA 1XWAA 1MDIA 3EC3A 1TJDA 2H71A 3H79A 4KNDA 4F03A 4MCUA 4K0GA 2H8LA 2J23A 1YEPA 3WYWA 4E8EA 5IMAA 4P3YB 3KGKA 2GLRA 4J57E 3UBLA 4XS1A 2H01A 1EEJA 4OFMA 4YAVA 4F0BA 1T7PB 5ECMB 4EL1A 2HT9A 3FRCA 1LU4A 3M9JA 5ELAA 1OC9B 2NBSA 3KH7A 1USBA 3ZITA 1XZOA 3JCML 2LTKA 4ECIA 1S3AA 5C00A 3KTLA 4QQ7A 2HFDA 2C0EA 5CAXA 2WZ9A 3VWVA 5DCHA 1SKSB 4AGSA 2DLXA 3APSA 3TJJA 1SYXA 3EU4A 4OCFA 2HRKA 3ERWA 1V58A 4BVYA 5AN1A 1BQ7A 5IIZA 2HE3A 4HZ2A 1G0TA 2M46A 2ON5A 2H0HA 5D9XA 2VLUA 3EWLA 3EMXA 1AAZA 2OADA 3GX0A 2FGXA 4KGIA 3D5JA 4JZQA 4E8HA 1X5DA 2V6OA 5ECKB 3LG6A 1QMVA 4MF7A 2JZSA 5AGYA 3A2WA 1M2AA 1K0BA 1O7UA 3OR5A 3FR9A 1GH2A 3CSHA 1G7OA 1YKAA 1AUCA 4WR4A 1BG5A 3IA1A 1T3BA 4OO5A 3IAS2 4GSTA 4BL7B 3D6IA 4MPGA 3D4MA 2GSTA 2H76A 3M8NA 5IMFA 4XRDA 1PKZA 2VIMA 3F63A 2E0QA 1M2BA 2HLSA 2XPEA 4POBA 3PPUA 2LEGA 1TU7A 2CX3A 5KN2A 3TJFA 5DJLA 4IW9A 2WJUA 5FWGA 1MDKA 3KMOA 4RUVA 1XWCA 1UC7A 4PTSA 2I1UA 2AB6A 1Z7PA 3ME7A 5IPHA 1VRSD 1WIKA 3KP9A 3FY7A 3F8UA 2I9HA 4YQVA 1V57A 2XBIA 2F9SA 4NHZA 2EIRA 3FZ4A 2GVPA 4IQAA 2VL3A 2GZZA 3P2AA 4MJCA 2AUVA 5GAPD 1GSQA 2JACA 5DJMA 1TU8A 5ECPB 2KLXA 3H8QA 14GSA 16GSA 3CTGA 2F51A 4ZXGA 2JADA 1JZRA 2VUPA 2GTUA 3EINA 3NIVA 1WOUA 1EGRA 5CP1A 3LGCA 5DAKB 1KTEA 1AIUA 1TI1A 1YF1A 3CMIA 2TRCP 1O6JA 1Z9HA 2E7PA 2M80A 5B6MA 4LL1B 2C3TA 1SU9A 4XS6A 4HEA2 4G0LA 2O87A 4KCEA 3TRPA 2R3XA 1G6YA 3G7YA 4KF9A 3D0ZA 1BEDA 3ED3A 4TVEA 2H0IA 1GSYA 3VLNA 3C7MA 4JU5A 3ZLPA 2L4QA 3DYRA 1FOVA 4TXVA 4IELA 4N10A 4IVFA 2IJYA 2KP2A 3BBYA 4LLRA 4ZBAA 4FIWA 1SL2B 1BX9A 2BTOT 1FAAA 1CQGA 1AQVA 1U6TA 3BCKA 1B4QA 5ECIB 1G6WA 3ZZXA 2WDUA 2CAIA 5A4UA 3F4RA 3LEFA 5JCWA 2E2GA 4KCAA 5LD0A 4ISDA 4EC0A 2MBSA 4MJAA 3U6VA 2YOIA 1YY7A 3NOFA 1LJRA 3L4NA 3RDWA 4PGTA 4WF5A 4FYCA 3TCOA
chains in the Genus database with same CATH superfamily
1IYHA 1XWBA 4V2MA 4TOPA 4PX1A 4F2IA 4DSRA 1OC9A 4PI2C 1O73A 3QAWA 4KB3A 5CYYA 4EDYA 1U87A 5AIVA 2BJXA 5HFIA 5D9VA 1B9XC 2CZ3A 4CHSA 1I9DA 4KW6A 2I4AA 3UOMA 3HCZA 2MZCA 4MK3A 3TKRA 2IWTA 2XPDA 2HRFA 2HQTA 2P0GA 5DBQA 4I8BA 4O32A 4POLA 1H75A 4OCEA 1U88A 1A8YA 1O81A 2VKZG 1SK1A 2REMA 4L0UA 5A1NA 3DRNA 1GTAA 4XRAA 2DSAA 3TJKA 5JWRB 5EVOA 4ECCA 1YQ1A 2QGVA 5DCGA 4YKGA 2JZTA 1PL1A 5BRTA 2JSZA 4YAPA 4G2EA 4N0VA 2GQKA 2H72A 2RUEA 3IV4A 3GSTA 2OE0A 4GXZA 2O36A 1X5EA 2I3YA 1XOBA 4ILFA 4OD7A 4ZL9A 5ID2B 22GSA 4GWRA 1XPVA 4MA9A 2PVOC 2VCZA 12GSA 2IMIA 3PH9A 1Y25A 4NPBA 5CRGA 5JWQB 3VI5A 2A2RA 2IIYA 3BOAA 4AJ8A 2B1KA 2GGTA 2A4VA 1A8LA 2GZYA 4AF2A 3F6DA 3TJGA 2JSYA 2GDRA 2CVDA 3CBUA 4G10A 3I69A 4L5LA 5J41A 5A5HA 3GMFA 2ZCTA 3GA4A 3HJOA 1K0CA 3P8WA 1S4BP 4MMMA 1AQWA 3I43A 4V1Ag 4EIPA 3DEXA 2YWNA 2LRNA 3GTUB 2A2SA 1ERVA 2HSHA 2EFCA 1SYRA 1OC3A 1OKTA 4G0KA 6GSVA 5IMCA 1UN2A 5CNWA 1FOHA 3NZNA 5AIXA 5CREA 1MDJA 1JFUA 1A23A 3DWVA 3VWUA 2YWIA 2L5LA 1TTZA 2EIQA 5JCGA 2QKEA 3O3TA 1QUWA 4BA7A 5IMVA 1TRSA 2OBIA 1FVKA 2UV8G 1MD3A 2H70A 4FYUA 4PUFC 1O8XA 3F4TA 5KN3A 5LCZA 4IGJA 5D96A 5G1KA 4USSA 5ENUA 1T00A 3KTBA 4HS1A 1VF1A 3F9UA 3US3A 2OE3A 5DAKA 2VLVA 2Z9SA 1AC1A 2NTOA 1GSUA 3H1NA 3L9UA 1YEXA 4TR3A 2VOCA 5EPFA 3HA9A 2RUFA 4HQZA 4I6XA 1JZOA 5G2ZA 2WULA 3L78A 2H6XA 4EIQA 4MZWA 2ES7A 3LXZA 4MZBA 2DJ0A 2GSQA 1A2MA 3VWXA 4RQRA 1EOGA 1BJXA 4ZBBA 4IBPA 4Z2TA 4I97A 4J56E 4NMUA 1K3LA 4YKFA 2WGRA 3CSJA 3KZQA 3ZIJA 1ZYNA 3A2XA 5ABRA 5EY6A 2X4AA 2IPAA 2DJJA 3A5WA 4WR5A 1ERWA 3BD2A 4LMVA 2O85A 3W8JA 3ZTLA 1ZZYA 4PNGA 2DMMA 1PD21 2DKIA 1BF5A 1KNGA 2L4CA 3WD6A 4F9ZA 2LRCA 3D4TA 4AKGA 3PGTA 3LW9A 3BJ5A 3VWWA 2LRTA 2VCQA 1VF4A 3GL5A 1KBNA 1SVLA 2V41A 2VD0A 2GSSA 1PQNA 5INYA 1MTCA 3RHBA 2PERA 3KCMA 1EOHA 5H5SA 1URMA 3LYPA 2F8FA 2K6VA 2K8VA 2LSTA 4ID0A 2OA7A 1HQOA 3DGQA 1N8JA 1FVJA 2YV9A 5IMZA 3RHCA 3C8EA 2FA8A 2PMTA 4K0NA 1WMJA 1TKDB 3GKXA 4KX4A 3P7XA 4KUNA 1A2LA 1XOAA 2C3QA 2R0GA 3WGEA 3DVXA 4JE1A 2DC5A 3DIEA 4ZL7A 5L71A 2EIOA 1SVOA 3GYKA 2HZEB 4EXJA 3TRQA 1TK0B 2VM1A 10GSA 3QPMA 5DDLA 3DMLA 1TDIA 3GKMA 3ZREA 2J9HA 3TOUA 4X43A 3KJYA 3HZ8A 2ZNMA 3TJBA 4KSMA 1RW1A 1O8WA 2PU9C 4F82A 1E6BA 1IYIA 4ZBDA 4POKA 2CT6A 4KDYA 1PSQA 1A0RP 3LORA 4DEJA 5ID2A 4JR6A 2D2ZA 1H4OA 1SENA 1DE2A 4MJBA 3U5RE 1GSEA 1HNCA 2P5QA 1ILOA 4OFTA 1NSWA 1YKCA 2GS3A 1XW5A 3M9KA 1GSFA 2AAWA 3LQ7A 3TOTA 2LS5A 5D9TA 4K8MA 3QD9A 1BAYA 3HY2A 2R0CA 1NHOA 2EFDA 4KE3A 1Z5YE 2IMKA 3IAM2 2TRXA 3LWAA 3HXSA 3LYKA 2TIRA 3CWGA 4BWQA 4HSCX 5J47A 1NW2A 3N9JA 4KH7A 3N5OA 3EPTA 4KDXA 1U3IA 3GTUA 3PR8A 4J2FA 2GT6A 4IJ3A 2GZPA 4AI6A 4JBBA 3UL3A 1OC8A 5B8BA 4WXTA 3VPTA 13GSA 2H30A 4XS4B 1ML6A 5GZZB 2DJ2A 3FMWA 4QL7A 1T4ZA 3ZMLA 1M99A 5J4YA 4F0CA 5KN1A 3E0UA 5ECLB 2PBJA 1F3AA 4CY6A 2AV4A 2WCIA 1DSBA 5ELGA 2VAFA 1HYUA 1K3YA 3IHQA 1M2DA 5F05A 3I9V2 1ON4A 2V1MA 2XHFA 1A24A 5J5NA 2VL2A 1EV4A 1B48A 4MH2A 2WVYA 4CDOA 1XFLA 2DJ3A 2YJ7A 4WBRD 2AHEA 1GTIA 1YJ6A 2RIIA 3F4SA 1M7TA 3WGXA 3APQA 3QOUA 4OWYA 3DVWA 2VCTA 2GSRA 4ML6A 4YQUA 1ERTA 3VFIA 4QL9A 1EZKA 3TB2A 1FB6A 2RM6A 2YZUA 1K0MA 1SJZA 1V40A 2VLTA 2B5XA 2NPBA 3F3RA 1OE8A 1GUMA 1GLQA 1K0NA 2V2GA 1FHEA 2K9FA 3AY8A 2LNTA 4NHWA 5AISA 3GN3A 1K0OA 4WF4A 1W89A 1PA3A 4TW5A 2YV7A 1OVNA 3SBCA 1ZL9A 1I5GA 3DXBA 1SK0A 2O8VB 1M0UA 2C3NA 2QA1A 3UBKA 4K9ZA 4BWSA 3F3QA 2LUSA 3Q6OA 2FHEA 2WW3A 3KXOA 3LXTA 4V2LA 2HSMB 3MAKA 4EVMA 2HRNA 1F3BA 3Q74A 3KH9A 4N3ZA 3VURA 3EYTA 3TRXA 1C72A 4HI7A 1V2AA 2E2MA 4AJ6A 4G9HA 3ERFA 1MEKA 4GSSA 2VCWA 4OFNA 1VGLA 2MMAA 1AXDA 3ZMKA 4OO4A 2C1YA 3CTFA 2H1AA 1SJIA 2YPMA 1WJKA 1O85A 3HHVA 2KHPA 3UARA 3FZ5A 4GLTA 4YQMA 4XTSA 3LFLA 5LNKe 3O6TA 2C0FA 2DKHA 1B8XA 3APOA 4KDUA 3IE3A 1V9WA 3CXGA 2HYXA 4X1UA 2WVXB 4Q5NA 3TKSC 4ULXA 1TXXA 5DQSA 5J40A 5COHA 2N5FA 4CW9A 3C71A 4EO3A 2QA2A 2WS2A 2FWGA 4DSQA 4N11A 3ZL5A 4LL4B 3HYPA 2EFHA 1GNEA 4ECJA 3J7Yk 3L0HA 1T4YA 1TK8B 1EEMA 3FZAA 3EMPA 2DMLA 1R26A 2X99A 4IP1A 4NV5A 1AW9A 3R2QA 3KEBA 3ZFBA 4GQCA 2H1GA 2HZEA 2RLIA 2HZFA 2YWMA 2B5EA 1VF3A 4WEYA 2RM5A 5A4WA 3P90A 1B4PA 5IM9A 2H73A 1DUGA 1XVWA 2L59A 3M3MA 4O92A 5F07A 3IHGA 2C80A 4LA1A 1PN9A 1K3OA 1YEWC 4I5QA 1OE7A 1GUHA 3HVXA 3FHKA 3KIJA 2H74A 3TDGA 20GSA 4EUYA 3KD0A 2PGTA 1PX6A 1S3DA 1S3CA 4GRFA 2PUKC 1GSSA 5IQYA 5J3RA 1GTBA 2FD3A 3J7Yb 4TRXA 3DD3A 2L57A 3QAVA 2FWHA 4MLYA 3RPNA 3IBHA 19GSA 4PNFA 4XIHA 1G7EA 4QMKA 3A2VA 1F9MA 1ZYEA 4PXOA 4ML1A 4X0XA 2HI7A 2NDOA 1T8EB 3FYGA 1PMTA 2LKUA 2YANA 2B1LA 5G1LA 1R5AA 2BMXA 3WT1A 4MF6A 4TR4A 3UAPA 2IMFA 3QDNA 3IDVA 3CSIA 1W4VA 1SL1B 3KM6A 4W66A 3TKPA 2R37A 5C04A 2I81A 4ICYA 1EP7A 1OYJA 5CRHA 3RAZA 3M1GA 3IK7A 4MP4A 3FZ9A 4KA0A 2LV3A 2YCDA 3CYNA 1PRXA 1RK4A 2AYTA 2ON7A 2KP1A 4K2DA 4I2UA 2OT3A 1QXHA 5ECNB 4GTUA 3HMJG 4KAEA 1TXUA 4NAXA 2K18A 4XS4A 4ZIJA 1WRYA 4V1Ap 1JLVA 3C1RA 4JR4A 1THXA 3D21A 4XCSA 4PI0C 5D9WA 4IKHA 1FO5A 1V98A 4MJEA 1TP9A 4IP6A 4FH8A 1XG8A 5GSTA 3GUSA 5ECHB 2F8AA 3GX8A 1TRVA 4HZ4A 2EFEA 4WETA 5BMUB 2R4VA 1XWKA 2EC4A 2H75A 1TRWA 2VD1A 1WWJA 1A2JA 1WE0A 2H6YA 2IFQA 5E59A 3QR6A 2FWEA 1J9BA 2HSYA 1K0AA 4RQXA 2X8CA 2IMDA 3FEUA 3HVNA 2YZHA 2WW2A 1SKRB 1OKDA 1HNAA 2PVQA 1DE1A 5IO0A 2XC2A 1SD8A 3F0IA 1YZXA 2YJHA 6GSYA 1K0DA 4PUAA 4KSOA 3GIXA 1YVLA 1Z6MA 4RI6A 3HVSA 3BCIA 4GSNA 1GUKA 3VI7A 3GFKA 1EP8A 3GV1A 3ME8A 4L0WA 2R6KA 3W8SA 2FA4A 1M9AA 2O89A 5G5FA 3WGDA 1GNWA 4NXIA 2V32A 3FK8A 2HXKA 4N0ZA 2CX4A 4HDEA 2HSMA 3WT2A 1FB0A 18GSA 5D73A 5F8BA 2MYGA 2UZ8A 2H0GA 1EV9A 3UVHA 4FO5A 3MNGA 2LNSA 3A3TA 3GHAA 1F2EA 4DVCA 2H6ZA 3KP8A 4TN8A 3EE2A 5A4VA 1ZMAA 3F6FA 1WP0A 1OAZA 4TR0A 4I2TA 5A34B 3FKFA 2B5YA 1N2AA 6GSUA 3GRXA 1ERUA 1I1IP 4NV2A 2MBTA 2FUG2 4O7HA 1QFNA 5F06A 2CVKA 3QAGA 5KN0A 6GSWA 2PWJA 5H5QA 2WVXA 4ZILA 1XWGA 3L9SA 3UVTA 2WFCA 5JCUA 3ZIVA 1PKWA 4TR1B 2MMNA 1TK5B 4HQSA 2GQMA 5HR2A 3V1WA 3GSSA 1FW1A 4PQIA 3G9BA 2H19A 2PPTA 1A0FA 2CQ9A 4D73B 5D8IA 5B8AA 2WB9A 2LJAA 1HNBA 3E3EA 4LMWA 4OMVA 2B7KA 2P31A 2L5OA 5HR0A 2KUCA 5DQYA 2B3SA 3TU3B 2L6DA 4ZB8A 2O7KA 2V6KA 3QFBC 2N5BA 1UVZA 2HNLA 4MF5A 2FCHA 1X5CA 3VK9A 7GSSA 3MDKA 4V2NA 3GH6A 3CRTA 2K8SA 3RBTA 2HRAA 2FLSA 5G5EA 1SD9A 4Z2UA 1MD4A 4HOJA 5DALB 5H5RA 2XBQA 3UIWA 1UA5A 3FW2A 17GSA 4A5PA 3IK9A 2QSIA 4MABA 4PURA 1TW9A 1SJ6A 1ZCPA 4HJ2A 2CAQA 3TKSA 5HR1A 1KEBA 4EF0A 4G01A 5ECRB 3MWHA 4AJ7A 3SWLA 2R5GA 3GNJA 2GQLA 6GSTA 2FY6A 2R2JA 1JZDA 4L5OA 2X8GA 1DBYA 1NM3A 3HDCA 1X9MB 5HQPA 2JZRA 4K1FA 2G2QA 3VPQA 1Z3EA 2P5RA 4IJIA 1JZWA 2LJKA 2OBKA 2WRTA 1TRUA 4MDCA 2O3EA 4GQFA 2VCVA 4HU9A 1Q4JA 2DIZA 1AQXA 1GULA 4Q5RA 4PQ1A 4IQ1A 4FYBA 4DSSB 3LSZA 4H86A 5IMDA 4N30A 4BVXB 4E68A 4GF0A 2DJ1A 3HKRA 2JL4A 2H66A 2IFQB 4IHUA 5B7CA 1ZYQB 1XW9A 5ECSA 2ALBA 2VM2A 3Q18A 4Q5QA 5BMUA 2C4JA 1U3AA 2VO4A 1GL8A 3TKSE 4EKZA 3IXRA 3IC4A 3TGZA 3ERGA 1PL2A 4WKWA 4TXOB 3RGBC 2G0FA 3M0FA 3EU3A 3CRUA 3C1SA 2ZUPA 11GSA 2OE1A 1YF0A 2CV4A 2H1LA 1B9YC 2VCXA 1TOFA 1X9WB 4MZCA 3IPZA 1LBKA 3W6GA 5A5KA 1J08A 4HUAA 3E9JB 2YN1A 3R3EA 1J0FA 1GLPA 2LJRA 3ISOA 4FQUA 1PGTA 4MH3A 1XVQA 2LQOA 4POMA 2C0DA 3UMAA 4EDZA 5GSSA 3ZFLA 1ST9A 2X8HA 3QCPA 5G31A 4MNNA 5CRDA 3LJRA 4NWYA 4BPYA 5IO2A 1FG4A 4HJMA 1SKWB 5IPGA 1T1VA 4K5SA 5FT3A 3K8NA 1ZYPA 4K6XA 5EL8A 3DKSA 1XXUA 4G0IA 2DBCA 4WBJA 3S9FA 2HRKB 4EE0A 3FR3A 4JRRA 5HFGA 3HD5A 1SVMA 1VF2A 4BVYB 3TKQA 4ECBA 5DVBA 2LQQA 2OJLA 1THOA 4K7IA 1Q98A 2A2PA 2HSNB 2M72A 2B7JA 4ZB7A 1XW6A 3D22A 2IMEA 5CO3A 3IC8A 3ZVJD 2C8UA 2DIYA 3IOSA 5IOWA 5A34A 1GWCA 2VL9A 9GSSA 1GSDA 3CHXC 2MMOA 4G19A 6GSXA 3IRAA 4YH2A 2MMZA 4ACSA 1XCCA 3O76A 1XBSA 3ZRDA 5ECOB 4HU7A 4TKYA 4TR1A 2YP6A 3MSZA 4L8EA 4XHMA 4K7OA 1X0RA 1R4WA 5JWOB 2WZSA 3C73A 3UJ1A 2N5AA 2CVBA 4FXYP 3TUEA 1XIYA 4D73A 4K7NA 3G7IA 2OKAA 1SL0B 5J4UA 3A5IA 1QGVA 4O5QA 4AKXB 8GSSA 4PHZC 1RQMA 2A4HA 5F0GA 1Z6NA 3HVVA 2IN3A 2X49A 2NVLA 3ZYWA 4BL7A 1Y6EA 1Z7RA 2VL2C 2JU5A 4PQHA 2FNOA 1X9SB 2YNXA 1GTUA 3IR4A 5IOXA 5HR3A 6GSSA 1BYEA 1TI3A 3RPPA 3G7JA 5DALA 2C0GA 2PN8A 3Q19A 1M9BA 1JHBA 2KOKA 1JLWA 3GKNA 2H1DA 1ABAA 3FR6A 2F3MA 2X64A 5CRWA 2CA8A 3UEMA 1R5PA 1QK8A 5ECQB 4IN0A 2YWOA 5G30A 3EVIA 1YDKA 5J9BA 4GDFA 2DJKA 4IS0A 1WPIA 3L9VA 1QQ2A 1ZOFA 4RI7A 1ZGNA 5KOXA 3CQFA 3GH9A 1EGOA 3GKKA 4MPFA 4Z7XA 2GT5A 4ZB6A 2QC7A 3MYDA 5HFKA 4K5RA 4O5UA 2L6CA 1NHYA 3EURA 4AKHA 3H93A 3GL3A 3MIXA 5GAND 3HZ4A 1R7HA 3HJPA 1GRXA 4JEDA 1EWXA 5D93A 2FWFA 2AJQB 2O5VA 1F6MC 5E4WA 3I6AA 1CQHA 4DSSA 2IL3A 1E2YA 3PINA 1PX7A 4BVXA 3H4KA 4ZB9A 3ZVJA 1HD2A 1F37A 3QMXA 3KMNA 2WW1A 1ACVA 2CZ2A 4AKIA 5J9CA 2H1BA 5FHIA 4O5RA 4ZL8A 1GP1A 1SK2A 3HJMA 4X4JA 3GURA 5B6NA 4Q5FA 3QFAC 3RFRC 5KEJA 2B6MA 2OACA 4TXOA 4GCIA 1XWAA 1MDIA 3EC3A 1TJDA 2H71A 3H79A 4KNDA 4F03A 4MCUA 4K0GA 2H8LA 2J23A 1M3IA 3WYWA 1YEPA 4E8EA 5J4VA 5IMAA 4P3YB 3KGKA 2GLRA 4J57E 3UBLA 4XS1A 2H01A 1EEJA 4OFMA 4YAVA 4F0BA 1T7PB 5ECMB 4EL1A 2HT9A 3FRCA 1LU4A 3M9JA 5ELAA 1OC9B 2NBSA 3KH7A 1USBA 3ZITA 2WW0A 1XZOA 3JCML 2LTKA 4ECIA 1S3AA 5C00A 3KTLA 4QQ7A 2HFDA 2C0EA 5CAXA 2WZ9A 3VWVA 4Z2RA 5DCHA 1SKSB 4AGSA 2DLXA 3APSA 3TJJA 1SYXA 4BIKA 3EU4A 4OCFA 2HRKA 3ERWA 1V58A 4BVYA 5AN1A 1BQ7A 5IIZA 1N25A 2HE3A 4HZ2A 2HSNA 1G0TA 5A1NB 2M46A 2ON5A 2H0HA 5D9XA 2VLUA 3EWLA 3EMXA 1AAZA 2OADA 3GX0A 2FGXA 4KGIA 3D5JA 4JZQA 4E8HA 1X5DA 2V6OA 5ECKB 3LG6A 1QMVA 4MF7A 2JZSA 5AGYA 3A2WA 1M2AA 1K0BA 1O7UA 3OR5A 3FR9A 1GH2A 3CSHA 1G7OA 1YKAA 4K2XA 1AUCA 4WR4A 1BG5A 3IA1A 1S3RA 1T3BA 4OO5A 3IAS2 4GSTA 4BL7B 3D6IA 4MPGA 3D4MA 2GSTA 2H76A 3M8NA 5IMFA 4XRDA 1PKZA 2WVZA 2VIMA 3F63A 2E0QA 1M2BA 2HLSA 2XPEA 4POBA 3PPUA 2LEGA 1Y1UA 5KOWA 1TU7A 2CX3A 5A5HB 5KN2A 3TJFA 5DJLA 4IW9A 2WJUA 5FWGA 1PN0A 1MDKA 3KMOA 4RUVA 1XWCA 1UC7A 4PTSA 2I1UA 2AB6A 1Z7PA 3ME7A 5IPHA 1VRSD 1M3JA 1WIKA 3KP9A 3FY7A 3F8UA 2I9HA 4YQVA 1V57A 2XBIA 2F9SA 4NHZA 2EIRA 3FZ4A 2GVPA 4IQAA 2VL3A 2GZZA 3P2AA 4MJCA 2AUVA 5GAPD 1GSQA 2JACA 5DJMA 1PFOA 1TU8A 5ECPB 2KLXA 3H8QA 4CY8A 14GSA 16GSA 3CTGA 2F51A 4ZXGA 2JADA 1JZRA 2VUPA 2GTUA 3EINA 3NIVA 1WOUA 1EGRA 5CP1A 5DAKB 3CMIA 1KTEA 1AIUA 1TI1A 1YF1A 3LGCA 2TRCP 1O6JA 1Z9HA 2E7PA 2M80A 5B6MA 4LL1B 2C3TA 1SU9A 4XS6A 4HEA2 4G0LA 2O87A 4KCEA 3TRPA 2R3XA 1G6YA 2R0PA 3G7YA 4KF9A 3D0ZA 1BEDA 3ED3A 4TVEA 2H0IA 1GSYA 3VLNA 3C7MA 4JU5A 3ZLPA 2L4QA 3DYRA 1FOVA 4TXVA 4IELA 4N10A 4IVFA 2IJYA 2KP2A 3BBYA 4LLRA 4ZBAA 4FIWA 1SL2B 1BX9A 2BTOT 1FAAA 1CQGA 1AQVA 1U6TA 3BCKA 1B4QA 5ECIB 1G6WA 3ZZXA 2WDUA 2CAIA 5A4UA 3F4RA 1BG1A 3LEFA 5JCWA 2E2GA 4KCAA 5LD0A 4ISDA 4EC0A 2MBSA 4MJAA 3U6VA 2YOIA 1YY7A 3NOFA 1LJRA 3L4NA 3RDWA 4PGTA 4WF5A 4FYCA 3TCOA
chains in the Genus database with same CATH topology
1IYHA 1XWBA 4V2MA 4TOPA 4PX1A 4F2IA 4DSRA 1OC9A 1O73A 3QAWA 4KB3A 5CYYA 4EDYA 1U87A 5AIVA 2BJXA 5HFIA 5D9VA 1B9XC 2CZ3A 4CHSA 1I9DA 4KW6A 2I4AA 3UOMA 3HCZA 2MZCA 4MK3A 3TKRA 2IWTA 2XPDA 2HRFA 2HQTA 2P0GA 5DBQA 4I8BA 4O32A 4POLA 1H75A 4OCEA 1U88A 1A8YA 1O81A 2VKZG 1SK1A 2REMA 4L0UA 5A1NA 3DRNA 1GTAA 4XRAA 2DSAA 3TJKA 5JWRB 5EVOA 4ECCA 1YQ1A 2QGVA 5DCGA 4YKGA 2JZTA 1PL1A 5BRTA 2JSZA 4YAPA 4G2EA 4N0VA 2GQKA 2H72A 2RUEA 3IV4A 3GSTA 2OE0A 4GXZA 1X5EA 2I3YA 1XOBA 4ILFA 4OD7A 4ZL9A 5ID2B 22GSA 4GWRA 1XPVA 4MA9A 2PVOC 2VCZA 12GSA 2IMIA 3PH9A 1Y25A 4NPBA 5CRGA 5JWQB 3VI5A 2A2RA 2IIYA 3BOAA 4AJ8A 2B1KA 2GGTA 2A4VA 1A8LA 2GZYA 4AF2A 3F6DA 3TJGA 2JSYA 2GDRA 2CVDA 3CBUA 4G10A 3I69A 4L5LA 5J41A 5A5HA 3GMFA 2ZCTA 3GA4A 3HJOA 1K0CA 3P8WA 4MMMA 1AQWA 3I43A 4V1Ag 4EIPA 3DEXA 2YWNA 2LRNA 3GTUB 2A2SA 1ERVA 2HSHA 2EFCA 1SYRA 1OC3A 1OKTA 4G0KA 6GSVA 5IMCA 1UN2A 5CNWA 1FOHA 3NZNA 5AIXA 5CREA 1MDJA 1JFUA 1A23A 3DWVA 3VWUA 2YWIA 2L5LA 1TTZA 2EIQA 5JCGA 2QKEA 3O3TA 1QUWA 4BA7A 5IMVA 1TRSA 2OBIA 1FVKA 2UV8G 1MD3A 2H70A 4FYUA 4PUFC 1O8XA 3F4TA 5KN3A 5LCZA 4IGJA 5D96A 5G1KA 4USSA 5ENUA 1T00A 3KTBA 4HS1A 1VF1A 3F9UA 3US3A 2OE3A 5DAKA 2VLVA 2Z9SA 1AC1A 2NTOA 1GSUA 3H1NA 3L9UA 1YEXA 4TR3A 2VOCA 5EPFA 3HA9A 2RUFA 4HQZA 4I6XA 1JZOA 5G2ZA 2WULA 3L78A 2H6XA 4EIQA 4MZWA 2ES7A 3LXZA 4MZBA 2DJ0A 2GSQA 1A2MA 3VWXA 4RQRA 1EOGA 1BJXA 4ZBBA 4IBPA 4Z2TA 4I97A 4J56E 4NMUA 1K3LA 4YKFA 2WGRA 3CSJA 3KZQA 3ZIJA 1ZYNA 3A2XA 5ABRA 5EY6A 2X4AA 2IPAA 2DJJA 3A5WA 4WR5A 1ERWA 3BD2A 4LMVA 2O85A 3W8JA 3ZTLA 1ZZYA 4PNGA 2DMMA 1PD21 2DKIA 1BF5A 1KNGA 2L4CA 3WD6A 4F9ZA 2LRCA 3D4TA 4AKGA 3PGTA 3LW9A 3BJ5A 3VWWA 2LRTA 2VCQA 1VF4A 3GL5A 1KBNA 1SVLA 2V41A 2VD0A 2GSSA 1PQNA 5INYA 1MTCA 3RHBA 2PERA 3KCMA 1EOHA 5H5SA 1URMA 3LYPA 2F8FA 2K6VA 2K8VA 2LSTA 4ID0A 2OA7A 1HQOA 3DGQA 1N8JA 1FVJA 2YV9A 5IMZA 3RHCA 3C8EA 2FA8A 2PMTA 4K0NA 1WMJA 1TKDB 3GKXA 4KX4A 3P7XA 4KUNA 1A2LA 1XOAA 2C3QA 2R0GA 3WGEA 3DVXA 4JE1A 2DC5A 3DIEA 4ZL7A 5L71A 2EIOA 1SVOA 3GYKA 2HZEB 4EXJA 3TRQA 1TK0B 2VM1A 10GSA 3QPMA 5DDLA 3DMLA 1TDIA 3GKMA 3ZREA 2J9HA 3TOUA 4X43A 3KJYA 3HZ8A 2ZNMA 3TJBA 4KSMA 1RW1A 1O8WA 2PU9C 4F82A 1E6BA 1IYIA 4ZBDA 4POKA 2CT6A 4KDYA 1PSQA 1A0RP 3LORA 4DEJA 5ID2A 4JR6A 2D2ZA 1H4OA 1SENA 1DE2A 4MJBA 3U5RE 1GSEA 1HNCA 2P5QA 1ILOA 4OFTA 1NSWA 1YKCA 2GS3A 1XW5A 3M9KA 1GSFA 2AAWA 3LQ7A 3TOTA 2LS5A 5D9TA 4K8MA 3QD9A 1BAYA 3HY2A 2R0CA 1NHOA 2EFDA 4KE3A 1Z5YE 2IMKA 3IAM2 2TRXA 3LWAA 3HXSA 3LYKA 2TIRA 3CWGA 4BWQA 5J47A 1NW2A 3N9JA 4KH7A 3N5OA 3EPTA 4KDXA 1U3IA 3GTUA 3PR8A 4J2FA 2GT6A 4IJ3A 2GZPA 4AI6A 4JBBA 3UL3A 1OC8A 5B8BA 4WXTA 3VPTA 13GSA 2H30A 4XS4B 1ML6A 5GZZB 2DJ2A 3FMWA 4QL7A 1T4ZA 3ZMLA 1M99A 5J4YA 4F0CA 5KN1A 3E0UA 5ECLB 2PBJA 1F3AA 4CY6A 2AV4A 2WCIA 1DSBA 5ELGA 2VAFA 1HYUA 1K3YA 3IHQA 1M2DA 5F05A 3I9V2 1ON4A 2V1MA 2XHFA 1A24A 5J5NA 2VL2A 1EV4A 1B48A 4MH2A 4CDOA 1XFLA 2DJ3A 2YJ7A 4WBRD 2AHEA 1GTIA 1YJ6A 2RIIA 3F4SA 1M7TA 3WGXA 3APQA 3QOUA 4OWYA 3DVWA 2VCTA 2GSRA 4ML6A 4YQUA 1ERTA 3VFIA 4QL9A 1EZKA 3TB2A 1FB6A 2RM6A 2YZUA 1K0MA 1SJZA 1V40A 2VLTA 2B5XA 2NPBA 3F3RA 1OE8A 1GUMA 1GLQA 1K0NA 2V2GA 1FHEA 2K9FA 3AY8A 2LNTA 4NHWA 5AISA 3GN3A 1K0OA 4WF4A 1W89A 1PA3A 4TW5A 2YV7A 1OVNA 3SBCA 1ZL9A 1I5GA 3DXBA 1SK0A 2O8VB 1M0UA 2C3NA 2QA1A 3UBKA 4K9ZA 4BWSA 3F3QA 2LUSA 3Q6OA 2FHEA 3KXOA 3LXTA 4V2LA 2HSMB 3MAKA 4EVMA 2HRNA 1F3BA 3Q74A 3KH9A 4N3ZA 3VURA 3EYTA 3TRXA 1C72A 4HI7A 1V2AA 2E2MA 4AJ6A 4G9HA 3ERFA 1MEKA 4GSSA 2VCWA 4OFNA 1VGLA 2MMAA 1AXDA 3ZMKA 4OO4A 2C1YA 3CTFA 2H1AA 1SJIA 2YPMA 1WJKA 1O85A 3HHVA 2KHPA 3UARA 3FZ5A 4GLTA 4YQMA 4XTSA 3LFLA 5LNKe 3O6TA 2C0FA 2DKHA 1B8XA 3APOA 4KDUA 3IE3A 1V9WA 3CXGA 2HYXA 4X1UA 4Q5NA 3TKSC 4ULXA 1TXXA 5DQSA 5J40A 5COHA 2N5FA 4CW9A 3C71A 4EO3A 2QA2A 2WS2A 2FWGA 4DSQA 4N11A 3ZL5A 4LL4B 3HYPA 2EFHA 1GNEA 4ECJA 3J7Yk 3L0HA 1T4YA 1TK8B 1EEMA 3FZAA 3EMPA 2DMLA 1R26A 2X99A 4IP1A 4NV5A 1AW9A 3R2QA 3KEBA 3ZFBA 4GQCA 2H1GA 2HZEA 2RLIA 2HZFA 2YWMA 2B5EA 1VF3A 4WEYA 2RM5A 5A4WA 3P90A 1B4PA 5IM9A 2H73A 1DUGA 1XVWA 2L59A 3M3MA 4O92A 5F07A 3IHGA 2C80A 4LA1A 1PN9A 1K3OA 4I5QA 1OE7A 1GUHA 3HVXA 3FHKA 3KIJA 2H74A 3TDGA 20GSA 4EUYA 3KD0A 2PGTA 1PX6A 1S3DA 1S3CA 4GRFA 2PUKC 1GSSA 5IQYA 5J3RA 1GTBA 2FD3A 3J7Yb 4TRXA 3DD3A 2L57A 3QAVA 2FWHA 4MLYA 3RPNA 3IBHA 19GSA 4PNFA 4XIHA 1G7EA 4QMKA 3A2VA 1F9MA 1ZYEA 4PXOA 4ML1A 4X0XA 2HI7A 2NDOA 1T8EB 3FYGA 1PMTA 2LKUA 2YANA 2B1LA 5G1LA 1R5AA 2BMXA 3WT1A 4MF6A 4TR4A 3UAPA 2IMFA 3QDNA 3IDVA 3CSIA 1W4VA 1SL1B 3KM6A 4W66A 3TKPA 2R37A 5C04A 2I81A 4ICYA 1EP7A 1OYJA 5CRHA 3RAZA 3M1GA 3IK7A 4MP4A 3FZ9A 4KA0A 2LV3A 2YCDA 3CYNA 1PRXA 1RK4A 2AYTA 2ON7A 2KP1A 4K2DA 4I2UA 2OT3A 1QXHA 5ECNB 4GTUA 3HMJG 4KAEA 1TXUA 4NAXA 2K18A 4XS4A 4ZIJA 1WRYA 4V1Ap 1JLVA 3C1RA 4JR4A 1THXA 3D21A 4XCSA 5D9WA 4IKHA 1FO5A 1V98A 4MJEA 1TP9A 4IP6A 4FH8A 5GSTA 3GUSA 5ECHB 2F8AA 3GX8A 1TRVA 4HZ4A 2EFEA 4WETA 5BMUB 2R4VA 1XWKA 2EC4A 2H75A 1TRWA 2VD1A 1WWJA 1A2JA 1WE0A 2H6YA 2IFQA 5E59A 3QR6A 2FWEA 1J9BA 2HSYA 1K0AA 4RQXA 2X8CA 2IMDA 3FEUA 2YZHA 1SKRB 1OKDA 1HNAA 2PVQA 1DE1A 5IO0A 2XC2A 1SD8A 3F0IA 1YZXA 2YJHA 6GSYA 1K0DA 4PUAA 4KSOA 3GIXA 1YVLA 1Z6MA 4RI6A 3HVSA 3BCIA 4GSNA 1GUKA 3VI7A 3GFKA 1EP8A 3GV1A 3ME8A 4L0WA 2R6KA 3W8SA 2FA4A 1M9AA 2O89A 5G5FA 3WGDA 1GNWA 4NXIA 2V32A 3FK8A 2HXKA 4N0ZA 2CX4A 4HDEA 2HSMA 3WT2A 1FB0A 18GSA 5D73A 5F8BA 2MYGA 2UZ8A 2H0GA 1EV9A 3UVHA 4FO5A 3MNGA 2LNSA 3A3TA 3GHAA 1F2EA 4DVCA 2H6ZA 3KP8A 4TN8A 3EE2A 5A4VA 1ZMAA 3F6FA 1WP0A 1OAZA 4TR0A 4I2TA 5A34B 3FKFA 2B5YA 1N2AA 6GSUA 3GRXA 1ERUA 4NV2A 2MBTA 2FUG2 4O7HA 1QFNA 5F06A 2CVKA 3QAGA 5KN0A 6GSWA 2PWJA 5H5QA 4ZILA 1XWGA 3L9SA 3UVTA 2WFCA 5JCUA 3ZIVA 1PKWA 4TR1B 2MMNA 1TK5B 4HQSA 2GQMA 5HR2A 3V1WA 3GSSA 1FW1A 4PQIA 3G9BA 2H19A 2PPTA 1A0FA 2CQ9A 4D73B 5D8IA 5B8AA 2WB9A 2LJAA 1HNBA 3E3EA 4LMWA 4OMVA 2B7KA 2P31A 2L5OA 5HR0A 2KUCA 5DQYA 2B3SA 3TU3B 2L6DA 4ZB8A 2O7KA 2V6KA 3QFBC 2N5BA 1UVZA 2HNLA 4MF5A 2FCHA 1X5CA 3VK9A 7GSSA 3MDKA 4V2NA 3GH6A 3CRTA 2K8SA 3RBTA 2HRAA 2FLSA 5G5EA 1SD9A 4Z2UA 1MD4A 4HOJA 5DALB 5H5RA 2XBQA 3UIWA 1UA5A 3FW2A 17GSA 4A5PA 3IK9A 2QSIA 4MABA 4PURA 1TW9A 1SJ6A 1ZCPA 4HJ2A 2CAQA 3TKSA 5HR1A 1KEBA 4EF0A 4G01A 5ECRB 3MWHA 4AJ7A 3SWLA 2R5GA 3GNJA 2GQLA 6GSTA 2FY6A 2R2JA 1JZDA 4L5OA 2X8GA 1DBYA 1NM3A 3HDCA 1X9MB 5HQPA 2JZRA 4K1FA 2G2QA 3VPQA 1Z3EA 2P5RA 4IJIA 1JZWA 2LJKA 2OBKA 2WRTA 1TRUA 4MDCA 4GQFA 2VCVA 4HU9A 1Q4JA 2DIZA 1AQXA 1GULA 4Q5RA 4PQ1A 4IQ1A 4FYBA 4DSSB 3LSZA 4H86A 5IMDA 4N30A 4BVXB 4E68A 4GF0A 2DJ1A 3HKRA 2JL4A 2H66A 2IFQB 4IHUA 5B7CA 1ZYQB 1XW9A 5ECSA 2ALBA 2VM2A 3Q18A 4Q5QA 5BMUA 2C4JA 1U3AA 2VO4A 1GL8A 3TKSE 4EKZA 3IXRA 3IC4A 3TGZA 3ERGA 1PL2A 4WKWA 4TXOB 2G0FA 3M0FA 3EU3A 3CRUA 3C1SA 2ZUPA 11GSA 2OE1A 1YF0A 2CV4A 2H1LA 1B9YC 2VCXA 1TOFA 1X9WB 4MZCA 3IPZA 1LBKA 3W6GA 5A5KA 1J08A 4HUAA 3E9JB 2YN1A 3R3EA 1J0FA 1GLPA 2LJRA 3ISOA 4FQUA 1PGTA 4MH3A 1XVQA 2LQOA 4POMA 2C0DA 3UMAA 4EDZA 5GSSA 3ZFLA 1ST9A 2X8HA 3QCPA 5G31A 4MNNA 5CRDA 3LJRA 4NWYA 4BPYA 5IO2A 1FG4A 4HJMA 1SKWB 5IPGA 1T1VA 4K5SA 5FT3A 3K8NA 1ZYPA 4K6XA 5EL8A 3DKSA 1XXUA 4G0IA 2DBCA 4WBJA 3S9FA 2HRKB 4EE0A 3FR3A 4JRRA 5HFGA 3HD5A 1SVMA 1VF2A 4BVYB 3TKQA 4ECBA 5DVBA 2LQQA 2OJLA 1THOA 4K7IA 1Q98A 2A2PA 2HSNB 2M72A 2B7JA 4ZB7A 1XW6A 3D22A 2IMEA 5CO3A 3IC8A 3ZVJD 2C8UA 2DIYA 3IOSA 5IOWA 5A34A 1GWCA 2VL9A 9GSSA 1GSDA 2MMOA 4G19A 6GSXA 3IRAA 4YH2A 2MMZA 4ACSA 1XCCA 3O76A 1XBSA 3ZRDA 5ECOB 4HU7A 4TKYA 4TR1A 2YP6A 3MSZA 4L8EA 4XHMA 4K7OA 1X0RA 1R4WA 5JWOB 3C73A 3UJ1A 2N5AA 2CVBA 3TUEA 1XIYA 4D73A 4K7NA 3G7IA 2OKAA 1SL0B 5J4UA 3A5IA 1QGVA 4O5QA 4AKXB 8GSSA 1RQMA 2A4HA 5F0GA 1Z6NA 3HVVA 2IN3A 2X49A 2NVLA 3ZYWA 4BL7A 1Y6EA 1Z7RA 2VL2C 2JU5A 4PQHA 2FNOA 1X9SB 2YNXA 1GTUA 3IR4A 5IOXA 5HR3A 6GSSA 1BYEA 1TI3A 3RPPA 3G7JA 5DALA 2C0GA 2PN8A 3Q19A 1M9BA 1JHBA 2KOKA 1JLWA 3GKNA 2H1DA 1ABAA 3FR6A 2F3MA 2X64A 5CRWA 2CA8A 3UEMA 1R5PA 1QK8A 5ECQB 4IN0A 2YWOA 5G30A 3EVIA 1YDKA 5J9BA 4GDFA 2DJKA 4IS0A 1WPIA 3L9VA 1QQ2A 1ZOFA 4RI7A 1ZGNA 5KOXA 3GH9A 1EGOA 3GKKA 4MPFA 4Z7XA 2GT5A 4ZB6A 2QC7A 3MYDA 5HFKA 4K5RA 4O5UA 2L6CA 1NHYA 3EURA 4AKHA 3H93A 3GL3A 3MIXA 5GAND 3HZ4A 1R7HA 3HJPA 1GRXA 4JEDA 1EWXA 5D93A 2FWFA 2AJQB 2O5VA 1F6MC 5E4WA 3I6AA 1CQHA 4DSSA 2IL3A 1E2YA 3PINA 1PX7A 4BVXA 3H4KA 4ZB9A 3ZVJA 1HD2A 1F37A 3QMXA 3KMNA 1ACVA 2CZ2A 4AKIA 5J9CA 2H1BA 5FHIA 4O5RA 4ZL8A 1GP1A 1SK2A 3HJMA 4X4JA 3GURA 5B6NA 4Q5FA 3QFAC 5KEJA 2B6MA 2OACA 4TXOA 4GCIA 1XWAA 1MDIA 3EC3A 1TJDA 2H71A 3H79A 4KNDA 4F03A 4MCUA 4K0GA 2H8LA 2J23A 1YEPA 3WYWA 4E8EA 5J4VA 5IMAA 4P3YB 3KGKA 2GLRA 4J57E 3UBLA 4XS1A 2H01A 1EEJA 4OFMA 4YAVA 4F0BA 1T7PB 5ECMB 4EL1A 2HT9A 3FRCA 1LU4A 3M9JA 5ELAA 1OC9B 2NBSA 3KH7A 1USBA 3ZITA 1XZOA 3JCML 2LTKA 4ECIA 1S3AA 5C00A 3KTLA 4QQ7A 2HFDA 2C0EA 5CAXA 2WZ9A 3VWVA 4Z2RA 5DCHA 1SKSB 4AGSA 2DLXA 3APSA 3TJJA 1SYXA 3EU4A 4OCFA 2HRKA 3ERWA 1V58A 4BVYA 5AN1A 1BQ7A 5IIZA 1N25A 2HE3A 4HZ2A 2HSNA 1G0TA 5A1NB 2M46A 2ON5A 2H0HA 5D9XA 2VLUA 3EWLA 3EMXA 1AAZA 2OADA 3GX0A 2FGXA 4KGIA 3D5JA 4JZQA 4E8HA 1X5DA 2V6OA 5ECKB 3LG6A 1QMVA 4MF7A 2JZSA 5AGYA 3A2WA 1M2AA 1K0BA 1O7UA 3OR5A 3FR9A 1GH2A 3CSHA 1G7OA 1YKAA 4K2XA 1AUCA 4WR4A 1BG5A 3IA1A 1T3BA 4OO5A 3IAS2 4GSTA 4BL7B 3D6IA 4MPGA 3D4MA 2GSTA 2H76A 3M8NA 5IMFA 4XRDA 1PKZA 2VIMA 3F63A 2E0QA 1M2BA 2HLSA 2XPEA 4POBA 3PPUA 2LEGA 1Y1UA 5KOWA 1TU7A 2CX3A 5A5HB 5KN2A 3TJFA 5DJLA 4IW9A 2WJUA 5FWGA 1PN0A 1MDKA 3KMOA 4RUVA 1XWCA 1UC7A 4PTSA 2I1UA 2AB6A 1Z7PA 3ME7A 5IPHA 1VRSD 1WIKA 3KP9A 3FY7A 3F8UA 2I9HA 4YQVA 1V57A 2XBIA 2F9SA 4NHZA 2EIRA 3FZ4A 2GVPA 4IQAA 2VL3A 2GZZA 3P2AA 4MJCA 2AUVA 5GAPD 1GSQA 2JACA 5DJMA 1TU8A 5ECPB 2KLXA 3H8QA 4CY8A 14GSA 16GSA 3CTGA 2F51A 4ZXGA 2JADA 1JZRA 2VUPA 2GTUA 3EINA 3NIVA 1WOUA 1EGRA 5CP1A 3LGCA 3CMIA 5DAKB 1KTEA 1AIUA 1TI1A 1YF1A 2TRCP 1O6JA 1Z9HA 2E7PA 2M80A 5B6MA 4LL1B 2C3TA 1SU9A 4XS6A 4HEA2 4G0LA 2O87A 4KCEA 3TRPA 2R3XA 1G6YA 2R0PA 3G7YA 4KF9A 3D0ZA 1BEDA 3ED3A 4TVEA 2H0IA 1GSYA 3VLNA 3C7MA 4JU5A 3ZLPA 2L4QA 3DYRA 1FOVA 4TXVA 4IELA 4N10A 4IVFA 2IJYA 2KP2A 3BBYA 4LLRA 4ZBAA 4FIWA 1SL2B 1BX9A 2BTOT 1FAAA 1CQGA 1AQVA 1U6TA 3BCKA 1B4QA 5ECIB 1G6WA 3ZZXA 2WDUA 2CAIA 5A4UA 3F4RA 1BG1A 3LEFA 5JCWA 2E2GA 4KCAA 5LD0A 4ISDA 4EC0A 2MBSA 4MJAA 3U6VA 2YOIA 1YY7A 3NOFA 1LJRA 3L4NA 3RDWA 4PGTA 4WF5A 4FYCA 3TCOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IYH A;  1XWB A;  4V2M A;  4TOP A;  4PX1 A;  4F2I A;  4DSR A;  1OC9 A;  1O73 A;  3QAW A;  4KB3 A;  5CYY A;  4EDY A;  1U87 A;  5AIV A;  2BJX A;  5HFI A;  5D9V A;  1B9X C;  2CZ3 A;  4CHS A;  1I9D A;  4KW6 A;  2I4A A;  3UOM A;  3HCZ A;  2MZC A;  4MK3 A;  3TKR A;  2IWT A;  2XPD A;  2HRF A;  2HQT A;  2P0G A;  5DBQ A;  4I8B A;  4O32 A;  4POL A;  1H75 A;  4OCE A;  1U88 A;  1A8Y A;  1O81 A;  1SK1 A;  2REM A;  4L0U A;  3DRN A;  1GTA A;  4XRA A;  2DSA A;  3TJK A;  5JWR B;  5EVO A;  4ECC A;  1YQ1 A;  2QGV A;  5DCG A;  2JZT A;  1PL1 A;  2JSZ A;  4YAP A;  4G2E A;  4N0V A;  2GQK A;  2H72 A;  2RUE A;  3IV4 A;  3GST A;  2OE0 A;  4GXZ A;  1X5E A;  2I3Y A;  1XOB A;  4ILF A;  4OD7 A;  4ZL9 A;  5ID2 B;  22GS A;  4GWR A;  1XPV A;  4MA9 A;  2PVO C;  2VCZ A;  12GS A;  2IMI A;  3PH9 A;  1Y25 A;  4NPB A;  5CRG A;  5JWQ B;  3VI5 A;  2A2R A;  2IIY A;  3BOA A;  4AJ8 A;  2B1K A;  2GGT A;  2A4V A;  1A8L A;  2GZY A;  4AF2 A;  3F6D A;  3TJG A;  2JSY A;  2GDR A;  2CVD A;  3CBU A;  4G10 A;  3I69 A;  4L5L A;  5J41 A;  3GMF A;  2ZCT A;  3GA4 A;  3HJO A;  1K0C A;  3P8W A;  4MMM A;  1AQW A;  3I43 A;  4V1A g;  3DEX A;  2YWN A;  2LRN A;  3GTU B;  2A2S A;  1ERV A;  2HSH A;  1SYR A;  1OC3 A;  1OKT A;  4G0K A;  6GSV A;  5IMC A;  1UN2 A;  5CNW A;  3NZN A;  5AIX A;  5CRE A;  1MDJ A;  1JFU A;  1A23 A;  3DWV A;  3VWU A;  2YWI A;  2L5L A;  1TTZ A;  2EIQ A;  5JCG A;  2QKE A;  3O3T A;  1QUW A;  4BA7 A;  5IMV A;  1TRS A;  2OBI A;  1FVK A;  1MD3 A;  2H70 A;  4FYU A;  4PUF C;  1O8X A;  3F4T A;  5KN3 A;  5LCZ A;  4IGJ A;  5D96 A;  5G1K A;  4USS A;  5ENU A;  1T00 A;  3KTB A;  4HS1 A;  1VF1 A;  3F9U A;  3US3 A;  2OE3 A;  5DAK A;  2VLV A;  2Z9S A;  1AC1 A;  2NTO A;  1GSU A;  3H1N A;  3L9U A;  1YEX A;  4TR3 A;  2VOC A;  5EPF A;  3HA9 A;  2RUF A;  4HQZ A;  4I6X A;  1JZO A;  5G2Z A;  2WUL A;  3L78 A;  2H6X A;  4MZW A;  2ES7 A;  3LXZ A;  4MZB A;  2DJ0 A;  2GSQ A;  1A2M A;  3VWX A;  4RQR A;  1EOG A;  1BJX A;  4ZBB A;  4IBP A;  4I97 A;  4J56 E;  4NMU A;  1K3L A;  2WGR A;  3CSJ A;  3KZQ A;  3ZIJ A;  3A2X A;  5ABR A;  5EY6 A;  2IPA A;  2DJJ A;  3A5W A;  4WR5 A;  1ERW A;  3BD2 A;  4LMV A;  2O85 A;  3W8J A;  3ZTL A;  1ZZY A;  4PNG A;  2DMM A;  1PD2 1;  1KNG A;  2L4C A;  3WD6 A;  4F9Z A;  2LRC A;  3D4T A;  3PGT A;  3BJ5 A;  3VWW A;  2LRT A;  2VCQ A;  1VF4 A;  3GL5 A;  1KBN A;  2V41 A;  2VD0 A;  2GSS A;  1PQN A;  5INY A;  1MTC A;  3RHB A;  2PER A;  3KCM A;  1EOH A;  5H5S A;  1URM A;  3LYP A;  2F8F A;  2K6V A;  2K8V A;  2LST A;  4ID0 A;  2OA7 A;  1HQO A;  3DGQ A;  1N8J A;  1FVJ A;  2YV9 A;  5IMZ A;  3RHC A;  3C8E A;  2FA8 A;  2PMT A;  4K0N A;  1WMJ A;  1TKD B;  3GKX A;  4KX4 A;  3P7X A;  4KUN A;  1A2L A;  1XOA A;  2C3Q A;  3WGE A;  3DVX A;  4JE1 A;  2DC5 A;  3DIE A;  4ZL7 A;  5L71 A;  2EIO A;  3GYK A;  2HZE B;  4EXJ A;  3TRQ A;  1TK0 B;  2VM1 A;  10GS A;  3QPM A;  5DDL A;  3DML A;  1TDI A;  3GKM A;  3ZRE A;  2J9H A;  3TOU A;  4X43 A;  3KJY A;  3HZ8 A;  2ZNM A;  3TJB A;  4KSM A;  1RW1 A;  1O8W A;  2PU9 C;  4F82 A;  1E6B A;  1IYI A;  4ZBD A;  4POK A;  2CT6 A;  4KDY A;  1PSQ A;  1A0R P;  3LOR A;  4DEJ A;  5ID2 A;  4JR6 A;  2D2Z A;  1H4O A;  1SEN A;  1DE2 A;  4MJB A;  3U5R E;  1GSE A;  1HNC A;  2P5Q A;  1ILO A;  4OFT A;  1NSW A;  1YKC A;  2GS3 A;  1XW5 A;  3M9K A;  1GSF A;  2AAW A;  3LQ7 A;  3TOT A;  2LS5 A;  5D9T A;  4K8M A;  3QD9 A;  1BAY A;  3HY2 A;  1NHO A;  4KE3 A;  1Z5Y E;  2IMK A;  3IAM 2;  2TRX A;  3LWA A;  3HXS A;  3LYK A;  2TIR A;  4BWQ A;  1NW2 A;  3N9J A;  4KH7 A;  3N5O A;  4KDX A;  1U3I A;  3GTU A;  3PR8 A;  4J2F A;  2GT6 A;  4IJ3 A;  2GZP A;  4JBB A;  3UL3 A;  1OC8 A;  5B8B A;  4WXT A;  3VPT A;  13GS A;  2H30 A;  4XS4 B;  1ML6 A;  5GZZ B;  2DJ2 A;  4QL7 A;  1T4Z A;  3ZML A;  1M99 A;  4F0C A;  5KN1 A;  3E0U A;  5ECL B;  2PBJ A;  1F3A A;  2AV4 A;  2WCI A;  1DSB A;  5ELG A;  2VAF A;  1HYU A;  1K3Y A;  3IHQ A;  1M2D A;  5F05 A;  3I9V 2;  1ON4 A;  2V1M A;  2XHF A;  1A24 A;  5J5N A;  2VL2 A;  1EV4 A;  1B48 A;  4MH2 A;  4CDO A;  1XFL A;  2DJ3 A;  2YJ7 A;  4WBR D;  2AHE A;  1GTI A;  1YJ6 A;  2RII A;  3F4S A;  1M7T A;  3WGX A;  3APQ A;  3QOU A;  4OWY A;  3DVW A;  2VCT A;  2GSR A;  4ML6 A;  4YQU A;  1ERT A;  3VFI A;  4QL9 A;  1EZK A;  3TB2 A;  1FB6 A;  2RM6 A;  2YZU A;  1K0M A;  1SJZ A;  1V40 A;  2VLT A;  2B5X A;  2NPB A;  3F3R A;  1OE8 A;  1GUM A;  1GLQ A;  1K0N A;  2V2G A;  1FHE A;  2K9F A;  3AY8 A;  2LNT A;  4NHW A;  5AIS A;  3GN3 A;  1K0O A;  4WF4 A;  1W89 A;  1PA3 A;  4TW5 A;  2YV7 A;  1OVN A;  3SBC A;  1ZL9 A;  1I5G A;  3DXB A;  1SK0 A;  2O8V B;  1M0U A;  2C3N A;  3UBK A;  4K9Z A;  4BWS A;  3F3Q A;  2LUS A;  3Q6O A;  2FHE A;  3KXO A;  3LXT A;  4V2L A;  2HSM B;  3MAK A;  4EVM A;  2HRN A;  1F3B A;  3Q74 A;  3KH9 A;  3VUR A;  3EYT A;  3TRX A;  1C72 A;  4HI7 A;  1V2A A;  2E2M A;  4AJ6 A;  4G9H A;  3ERF A;  1MEK A;  4GSS A;  2VCW A;  4OFN A;  1VGL A;  2MMA A;  1AXD A;  3ZMK A;  4OO4 A;  2C1Y A;  3CTF A;  2H1A A;  1SJI A;  2YPM A;  1WJK A;  1O85 A;  3HHV A;  2KHP A;  3UAR A;  3FZ5 A;  4GLT A;  4YQM A;  4XTS A;  3LFL A;  5LNK e;  3O6T A;  2C0F A;  1B8X A;  3APO A;  4KDU A;  3IE3 A;  1V9W A;  3CXG A;  2HYX A;  4X1U A;  4Q5N A;  3TKS C;  4ULX A;  1TXX A;  5DQS A;  5COH A;  2N5F A;  4CW9 A;  3C71 A;  4EO3 A;  2WS2 A;  2FWG A;  4DSQ A;  4N11 A;  3ZL5 A;  4LL4 B;  3HYP A;  1GNE A;  4ECJ A;  3J7Y k;  3L0H A;  1T4Y A;  1TK8 B;  1EEM A;  3FZA A;  3EMP A;  2DML A;  1R26 A;  2X99 A;  4IP1 A;  4NV5 A;  1AW9 A;  3R2Q A;  3KEB A;  3ZFB A;  4GQC A;  2H1G A;  2HZE A;  2RLI A;  2HZF A;  2YWM A;  2B5E A;  1VF3 A;  4WEY A;  2RM5 A;  5A4W A;  3P90 A;  1B4P A;  5IM9 A;  2H73 A;  1DUG A;  1XVW A;  2L59 A;  3M3M A;  4O92 A;  5F07 A;  2C80 A;  4LA1 A;  1PN9 A;  1K3O A;  4I5Q A;  1OE7 A;  1GUH A;  3HVX A;  3FHK A;  3KIJ A;  2H74 A;  3TDG A;  20GS A;  4EUY A;  3KD0 A;  2PGT A;  1PX6 A;  1S3D A;  1S3C A;  4GRF A;  2PUK C;  1GSS A;  5IQY A;  5J3R A;  1GTB A;  2FD3 A;  3J7Y b;  4TRX A;  3DD3 A;  2L57 A;  3QAV A;  2FWH A;  4MLY A;  3RPN A;  3IBH A;  19GS A;  4PNF A;  4XIH A;  1G7E A;  3A2V A;  1F9M A;  1ZYE A;  4PXO A;  4ML1 A;  4X0X A;  2HI7 A;  2NDO A;  1T8E B;  3FYG A;  1PMT A;  2LKU A;  2YAN A;  2B1L A;  5G1L A;  1R5A A;  2BMX A;  3WT1 A;  4MF6 A;  4TR4 A;  3UAP A;  2IMF A;  3QDN A;  3IDV A;  3CSI A;  1W4V A;  1SL1 B;  3KM6 A;  3TKP A;  2R37 A;  5C04 A;  2I81 A;  1EP7 A;  1OYJ A;  5CRH A;  3RAZ A;  3M1G A;  3IK7 A;  4MP4 A;  3FZ9 A;  4KA0 A;  2LV3 A;  2YCD A;  3CYN A;  1PRX A;  1RK4 A;  2AYT A;  2ON7 A;  2KP1 A;  4K2D A;  4I2U A;  1QXH A;  5ECN B;  4GTU A;  4KAE A;  4NAX A;  2K18 A;  4XS4 A;  4ZIJ A;  1WRY A;  4V1A p;  1JLV A;  3C1R A;  4JR4 A;  1THX A;  3D21 A;  4XCS A;  5D9W A;  4IKH A;  1FO5 A;  1V98 A;  4MJE A;  1TP9 A;  4IP6 A;  4FH8 A;  5GST A;  3GUS A;  5ECH B;  2F8A A;  3GX8 A;  1TRV A;  4HZ4 A;  4WET A;  2R4V A;  1XWK A;  2EC4 A;  2H75 A;  1TRW A;  2VD1 A;  1WWJ A;  1A2J A;  1WE0 A;  2H6Y A;  2IFQ A;  5E59 A;  3QR6 A;  2FWE A;  1J9B A;  2HSY A;  1K0A A;  4RQX A;  2X8C A;  2IMD A;  3FEU A;  2YZH A;  1SKR B;  1OKD A;  1HNA A;  2PVQ A;  1DE1 A;  5IO0 A;  2XC2 A;  1SD8 A;  3F0I A;  1YZX A;  2YJH A;  6GSY A;  1K0D A;  4PUA A;  4KSO A;  3GIX A;  1Z6M A;  4RI6 A;  3HVS A;  3BCI A;  4GSN A;  1GUK A;  3VI7 A;  3GFK A;  1EP8 A;  3GV1 A;  3ME8 A;  4L0W A;  2R6K A;  3W8S A;  2FA4 A;  1M9A A;  2O89 A;  5G5F A;  3WGD A;  1GNW A;  4NXI A;  2V32 A;  3FK8 A;  2HXK A;  4N0Z A;  2CX4 A;  4HDE A;  2HSM A;  3WT2 A;  1FB0 A;  18GS A;  5D73 A;  5F8B A;  2MYG A;  2UZ8 A;  2H0G A;  1EV9 A;  3UVH A;  4FO5 A;  3MNG A;  2LNS A;  3A3T A;  3GHA A;  1F2E A;  4DVC A;  2H6Z A;  3KP8 A;  4TN8 A;  3EE2 A;  5A4V A;  1ZMA A;  3F6F A;  1WP0 A;  1OAZ A;  4TR0 A;  4I2T A;  3FKF A;  2B5Y A;  1N2A A;  6GSU A;  3GRX A;  1ERU A;  4NV2 A;  2MBT A;  2FUG 2;  4O7H A;  1QFN A;  5F06 A;  2CVK A;  3QAG A;  5KN0 A;  6GSW A;  2PWJ A;  5H5Q A;  4ZIL A;  1XWG A;  3L9S A;  3UVT A;  2WFC A;  5JCU A;  3ZIV A;  1PKW A;  4TR1 B;  2MMN A;  1TK5 B;  4HQS A;  2GQM A;  5HR2 A;  3V1W A;  3GSS A;  1FW1 A;  4PQI A;  3G9B A;  2H19 A;  2PPT A;  1A0F A;  2CQ9 A;  4D73 B;  5D8I A;  5B8A A;  2WB9 A;  2LJA A;  1HNB A;  3E3E A;  4LMW A;  4OMV A;  2B7K A;  2P31 A;  2L5O A;  5HR0 A;  2KUC A;  5DQY A;  2B3S A;  2L6D A;  4ZB8 A;  2O7K A;  2V6K A;  3QFB C;  2N5B A;  1UVZ A;  2HNL A;  4MF5 A;  2FCH A;  1X5C A;  3VK9 A;  7GSS A;  3MDK A;  4V2N A;  3GH6 A;  3CRT A;  2K8S A;  3RBT A;  2HRA A;  2FLS A;  5G5E A;  1SD9 A;  1MD4 A;  4HOJ A;  5DAL B;  5H5R A;  2XBQ A;  3UIW A;  1UA5 A;  3FW2 A;  17GS A;  3IK9 A;  2QSI A;  4MAB A;  4PUR A;  1TW9 A;  1SJ6 A;  1ZCP A;  4HJ2 A;  2CAQ A;  3TKS A;  5HR1 A;  1KEB A;  4EF0 A;  5ECR B;  3MWH A;  4AJ7 A;  3SWL A;  2R5G A;  3GNJ A;  2GQL A;  6GST A;  2FY6 A;  2R2J A;  1JZD A;  4L5O A;  2X8G A;  1DBY A;  1NM3 A;  3HDC A;  1X9M B;  5HQP A;  2JZR A;  4K1F A;  2G2Q A;  3VPQ A;  1Z3E A;  2P5R A;  4IJI A;  1JZW A;  2LJK A;  2OBK A;  2WRT A;  1TRU A;  4MDC A;  4GQF A;  2VCV A;  4HU9 A;  1Q4J A;  2DIZ A;  1AQX A;  1GUL A;  4Q5R A;  4PQ1 A;  4IQ1 A;  4FYB A;  4DSS B;  3LSZ A;  4H86 A;  5IMD A;  4N30 A;  4BVX B;  4GF0 A;  2DJ1 A;  3HKR A;  2JL4 A;  2H66 A;  2IFQ B;  4IHU A;  5B7C A;  1ZYQ B;  1XW9 A;  5ECS A;  2ALB A;  2VM2 A;  3Q18 A;  4Q5Q A;  5BMU A;  2C4J A;  1U3A A;  2VO4 A;  1GL8 A;  3TKS E;  4EKZ A;  3IXR A;  3IC4 A;  3TGZ A;  3ERG A;  1PL2 A;  4WKW A;  4TXO B;  2G0F A;  3M0F A;  3EU3 A;  3CRU A;  3C1S A;  2ZUP A;  11GS A;  2OE1 A;  1YF0 A;  2CV4 A;  1B9Y C;  2VCX A;  1TOF A;  1X9W B;  4MZC A;  3IPZ A;  1LBK A;  3W6G A;  5A5K A;  1J08 A;  4HUA A;  3E9J B;  2YN1 A;  3R3E A;  1J0F A;  1GLP A;  2LJR A;  3ISO A;  4FQU A;  1PGT A;  4MH3 A;  1XVQ A;  2LQO A;  4POM A;  2C0D A;  3UMA A;  4EDZ A;  5GSS A;  3ZFL A;  1ST9 A;  2X8H A;  3QCP A;  5G31 A;  5CRD A;  3LJR A;  4NWY A;  4BPY A;  5IO2 A;  1FG4 A;  4HJM A;  1SKW B;  5IPG A;  1T1V A;  5FT3 A;  3K8N A;  4K6X A;  5EL8 A;  3DKS A;  1XXU A;  4G0I A;  2DBC A;  4WBJ A;  3S9F A;  2HRK B;  4EE0 A;  3FR3 A;  4JRR A;  5HFG A;  3HD5 A;  1VF2 A;  4BVY B;  3TKQ A;  4ECB A;  5DVB A;  2LQQ A;  2OJL A;  1THO A;  4K7I A;  1Q98 A;  2HSN B;  2M72 A;  2B7J A;  1XW6 A;  3D22 A;  2IME A;  5CO3 A;  3IC8 A;  3ZVJ D;  2C8U A;  2DIY A;  3IOS A;  5IOW A;  1GWC A;  2VL9 A;  9GSS A;  1GSD A;  2MMO A;  4G19 A;  6GSX A;  3IRA A;  4YH2 A;  2MMZ A;  4ACS A;  1XCC A;  3O76 A;  1XBS A;  3ZRD A;  5ECO B;  4HU7 A;  4TKY A;  4TR1 A;  2YP6 A;  3MSZ A;  4L8E A;  4XHM A;  4K7O A;  1X0R A;  1R4W A;  5JWO B;  3C73 A;  3UJ1 A;  2N5A A;  2CVB A;  3TUE A;  1XIY A;  4D73 A;  4K7N A;  3G7I A;  2OKA A;  1SL0 B;  5J4U A;  1QGV A;  8GSS A;  1RQM A;  5F0G A;  1Z6N A;  3HVV A;  2IN3 A;  2NVL A;  3ZYW A;  4BL7 A;  1Y6E A;  1Z7R A;  2VL2 C;  2JU5 A;  4PQH A;  2FNO A;  1X9S B;  2YNX A;  1GTU A;  3IR4 A;  5IOX A;  5HR3 A;  6GSS A;  1BYE A;  1TI3 A;  3RPP A;  3G7J A;  5DAL A;  2C0G A;  2PN8 A;  3Q19 A;  1M9B A;  1JHB A;  2KOK A;  1JLW A;  3GKN A;  2H1D A;  1ABA A;  3FR6 A;  2F3M A;  2X64 A;  5CRW A;  2CA8 A;  3UEM A;  1R5P A;  1QK8 A;  5ECQ B;  4IN0 A;  2YWO A;  5G30 A;  3EVI A;  1YDK A;  5J9B A;  2DJK A;  4IS0 A;  1WPI A;  3L9V A;  1QQ2 A;  1ZOF A;  4RI7 A;  1ZGN A;  3GH9 A;  1EGO A;  3GKK A;  4MPF A;  4Z7X A;  2GT5 A;  4ZB6 A;  2QC7 A;  5HFK A;  2L6C A;  1NHY A;  3EUR A;  3H93 A;  3GL3 A;  5GAN D;  3HZ4 A;  1R7H A;  3HJP A;  1GRX A;  4JED A;  1EWX A;  5D93 A;  2FWF A;  2AJQ B;  1F6M C;  5E4W A;  3I6A A;  1CQH A;  4DSS A;  2IL3 A;  1E2Y A;  3PIN A;  1PX7 A;  4BVX A;  3H4K A;  4ZB9 A;  3ZVJ A;  1HD2 A;  1F37 A;  3QMX A;  3KMN A;  1ACV A;  2CZ2 A;  5J9C A;  2H1B A;  5FHI A;  4O5R A;  4ZL8 A;  1GP1 A;  1SK2 A;  3HJM A;  3GUR A;  5B6N A;  4Q5F A;  3QFA C;  5KEJ A;  2B6M A;  2OAC A;  4TXO A;  4GCI A;  1XWA A;  1MDI A;  3EC3 A;  1TJD A;  2H71 A;  3H79 A;  4KND A;  4F03 A;  4MCU A;  4K0G A;  2H8L A;  2J23 A;  1YEP A;  3WYW A;  4E8E A;  5IMA A;  4P3Y B;  3KGK A;  2GLR A;  4J57 E;  3UBL A;  4XS1 A;  2H01 A;  1EEJ A;  4OFM A;  4YAV A;  4F0B A;  1T7P B;  5ECM B;  4EL1 A;  2HT9 A;  3FRC A;  1LU4 A;  3M9J A;  5ELA A;  1OC9 B;  2NBS A;  3KH7 A;  1USB A;  3ZIT A;  1XZO A;  3JCM L;  2LTK A;  4ECI A;  1S3A A;  5C00 A;  3KTL A;  4QQ7 A;  2HFD A;  2C0E A;  5CAX A;  2WZ9 A;  3VWV A;  5DCH A;  1SKS B;  4AGS A;  2DLX A;  3APS A;  3TJJ A;  1SYX A;  3EU4 A;  4OCF A;  2HRK A;  3ERW A;  1V58 A;  4BVY A;  5AN1 A;  1BQ7 A;  5IIZ A;  2HE3 A;  4HZ2 A;  1G0T A;  2M46 A;  2ON5 A;  2H0H A;  5D9X A;  2VLU A;  3EWL A;  3EMX A;  1AAZ A;  2OAD A;  3GX0 A;  2FGX A;  4KGI A;  3D5J A;  4JZQ A;  4E8H A;  1X5D A;  2V6O A;  5ECK B;  3LG6 A;  1QMV A;  4MF7 A;  2JZS A;  5AGY A;  3A2W A;  1M2A A;  1K0B A;  1O7U A;  3OR5 A;  3FR9 A;  1GH2 A;  3CSH A;  1G7O A;  1YKA A;  1AUC A;  4WR4 A;  1BG5 A;  3IA1 A;  1T3B A;  4OO5 A;  3IAS 2;  4GST A;  4BL7 B;  3D6I A;  4MPG A;  3D4M A;  2GST A;  2H76 A;  3M8N A;  5IMF A;  4XRD A;  1PKZ A;  2VIM A;  3F63 A;  2E0Q A;  1M2B A;  2HLS A;  2XPE A;  4POB A;  3PPU A;  2LEG A;  1TU7 A;  2CX3 A;  5KN2 A;  3TJF A;  5DJL A;  4IW9 A;  2WJU A;  5FWG A;  1MDK A;  3KMO A;  4RUV A;  1XWC A;  1UC7 A;  4PTS A;  2I1U A;  2AB6 A;  1Z7P A;  3ME7 A;  5IPH A;  1VRS D;  1WIK A;  3KP9 A;  3FY7 A;  3F8U A;  2I9H A;  4YQV A;  1V57 A;  2XBI A;  2F9S A;  4NHZ A;  2EIR A;  3FZ4 A;  2GVP A;  4IQA A;  2VL3 A;  2GZZ A;  3P2A A;  4MJC A;  2AUV A;  5GAP D;  1GSQ A;  2JAC A;  5DJM A;  1TU8 A;  5ECP B;  2KLX A;  3H8Q A;  14GS A;  16GS A;  3CTG A;  2F51 A;  4ZXG A;  2JAD A;  1JZR A;  2VUP A;  2GTU A;  3EIN A;  3NIV A;  1WOU A;  1EGR A;  5CP1 A;  3LGC A;  5DAK B;  1KTE A;  1AIU A;  1TI1 A;  1YF1 A;  3CMI A;  2TRC P;  1O6J A;  1Z9H A;  2E7P A;  2M80 A;  5B6M A;  4LL1 B;  2C3T A;  1SU9 A;  4XS6 A;  4HEA 2;  4G0L A;  2O87 A;  4KCE A;  3TRP A;  2R3X A;  1G6Y A;  3G7Y A;  4KF9 A;  3D0Z A;  1BED A;  3ED3 A;  4TVE A;  2H0I A;  1GSY A;  3VLN A;  3C7M A;  4JU5 A;  3ZLP A;  2L4Q A;  3DYR A;  1FOV A;  4TXV A;  4IEL A;  4N10 A;  4IVF A;  2IJY A;  2KP2 A;  3BBY A;  4LLR A;  4ZBA A;  4FIW A;  1SL2 B;  1BX9 A;  2BTO T;  1FAA A;  1CQG A;  1AQV A;  1U6T A;  3BCK A;  1B4Q A;  5ECI B;  1G6W A;  3ZZX A;  2WDU A;  2CAI A;  5A4U A;  3F4R A;  3LEF A;  5JCW A;  2E2G A;  4KCA A;  5LD0 A;  4ISD A;  4EC0 A;  2MBS A;  4MJA A;  3U6V A;  2YOI A;  1YY7 A;  3NOF A;  1LJR A;  3L4N A;  3RDW A;  4PGT A;  4WF5 A;  4FYC A;  3TCO A; 
#chains in the Genus database with same CATH topology
 1IYH A;  1XWB A;  4V2M A;  4TOP A;  4PX1 A;  4F2I A;  4DSR A;  1OC9 A;  4PI2 C;  1O73 A;  3QAW A;  4KB3 A;  5CYY A;  4EDY A;  1U87 A;  5AIV A;  2BJX A;  5HFI A;  5D9V A;  1B9X C;  2CZ3 A;  4CHS A;  1I9D A;  4KW6 A;  2I4A A;  3UOM A;  3HCZ A;  2MZC A;  4MK3 A;  3TKR A;  2IWT A;  2XPD A;  2HRF A;  2HQT A;  2P0G A;  5DBQ A;  4I8B A;  4O32 A;  4POL A;  1H75 A;  4OCE A;  1U88 A;  1A8Y A;  1O81 A;  2VKZ G;  1SK1 A;  2REM A;  4L0U A;  5A1N A;  3DRN A;  1GTA A;  4XRA A;  2DSA A;  3TJK A;  5JWR B;  5EVO A;  4ECC A;  1YQ1 A;  2QGV A;  5DCG A;  4YKG A;  2JZT A;  1PL1 A;  5BRT A;  2JSZ A;  4YAP A;  4G2E A;  4N0V A;  2GQK A;  2H72 A;  2RUE A;  3IV4 A;  3GST A;  2OE0 A;  4GXZ A;  2O36 A;  1X5E A;  2I3Y A;  1XOB A;  4ILF A;  4OD7 A;  4ZL9 A;  5ID2 B;  22GS A;  4GWR A;  1XPV A;  4MA9 A;  2PVO C;  2VCZ A;  12GS A;  2IMI A;  3PH9 A;  1Y25 A;  4NPB A;  5CRG A;  5JWQ B;  3VI5 A;  2A2R A;  2IIY A;  3BOA A;  4AJ8 A;  2B1K A;  2GGT A;  2A4V A;  1A8L A;  2GZY A;  4AF2 A;  3F6D A;  3TJG A;  2JSY A;  2GDR A;  2CVD A;  3CBU A;  4G10 A;  3I69 A;  4L5L A;  5J41 A;  5A5H A;  3GMF A;  2ZCT A;  3GA4 A;  3HJO A;  1K0C A;  3P8W A;  1S4B P;  4MMM A;  1AQW A;  3I43 A;  4V1A g;  4EIP A;  3DEX A;  2YWN A;  2LRN A;  3GTU B;  2A2S A;  1ERV A;  2HSH A;  2EFC A;  1SYR A;  1OC3 A;  1OKT A;  4G0K A;  6GSV A;  5IMC A;  1UN2 A;  5CNW A;  1FOH A;  3NZN A;  5AIX A;  5CRE A;  1MDJ A;  1JFU A;  1A23 A;  3DWV A;  3VWU A;  2YWI A;  2L5L A;  1TTZ A;  2EIQ A;  5JCG A;  2QKE A;  3O3T A;  1QUW A;  4BA7 A;  5IMV A;  1TRS A;  2OBI A;  1FVK A;  2UV8 G;  1MD3 A;  2H70 A;  4FYU A;  4PUF C;  1O8X A;  3F4T A;  5KN3 A;  5LCZ A;  4IGJ A;  5D96 A;  5G1K A;  4USS A;  5ENU A;  1T00 A;  3KTB A;  4HS1 A;  1VF1 A;  3F9U A;  3US3 A;  2OE3 A;  5DAK A;  2VLV A;  2Z9S A;  1AC1 A;  2NTO A;  1GSU A;  3H1N A;  3L9U A;  1YEX A;  4TR3 A;  2VOC A;  5EPF A;  3HA9 A;  2RUF A;  4HQZ A;  4I6X A;  1JZO A;  5G2Z A;  2WUL A;  3L78 A;  2H6X A;  4EIQ A;  4MZW A;  2ES7 A;  3LXZ A;  4MZB A;  2DJ0 A;  2GSQ A;  1A2M A;  3VWX A;  4RQR A;  1EOG A;  1BJX A;  4ZBB A;  4IBP A;  4Z2T A;  4I97 A;  4J56 E;  4NMU A;  1K3L A;  4YKF A;  2WGR A;  3CSJ A;  3KZQ A;  3ZIJ A;  1ZYN A;  3A2X A;  5ABR A;  5EY6 A;  2X4A A;  2IPA A;  2DJJ A;  3A5W A;  4WR5 A;  1ERW A;  3BD2 A;  4LMV A;  2O85 A;  3W8J A;  3ZTL A;  1ZZY A;  4PNG A;  2DMM A;  1PD2 1;  2DKI A;  1BF5 A;  1KNG A;  2L4C A;  3WD6 A;  4F9Z A;  2LRC A;  3D4T A;  4AKG A;  3PGT A;  3LW9 A;  3BJ5 A;  3VWW A;  2LRT A;  2VCQ A;  1VF4 A;  3GL5 A;  1KBN A;  1SVL A;  2V41 A;  2VD0 A;  2GSS A;  1PQN A;  5INY A;  1MTC A;  3RHB A;  2PER A;  3KCM A;  1EOH A;  5H5S A;  1URM A;  3LYP A;  2F8F A;  2K6V A;  2K8V A;  2LST A;  4ID0 A;  2OA7 A;  1HQO A;  3DGQ A;  1N8J A;  1FVJ A;  2YV9 A;  5IMZ A;  3RHC A;  3C8E A;  2FA8 A;  2PMT A;  4K0N A;  1WMJ A;  1TKD B;  3GKX A;  4KX4 A;  3P7X A;  4KUN A;  1A2L A;  1XOA A;  2C3Q A;  2R0G A;  3WGE A;  3DVX A;  4JE1 A;  2DC5 A;  3DIE A;  4ZL7 A;  5L71 A;  2EIO A;  1SVO A;  3GYK A;  2HZE B;  4EXJ A;  3TRQ A;  1TK0 B;  2VM1 A;  10GS A;  3QPM A;  5DDL A;  3DML A;  1TDI A;  3GKM A;  3ZRE A;  2J9H A;  3TOU A;  4X43 A;  3KJY A;  3HZ8 A;  2ZNM A;  3TJB A;  4KSM A;  1RW1 A;  1O8W A;  2PU9 C;  4F82 A;  1E6B A;  1IYI A;  4ZBD A;  4POK A;  2CT6 A;  4KDY A;  1PSQ A;  1A0R P;  3LOR A;  4DEJ A;  5ID2 A;  4JR6 A;  2D2Z A;  1H4O A;  1SEN A;  1DE2 A;  4MJB A;  3U5R E;  1GSE A;  1HNC A;  2P5Q A;  1ILO A;  4OFT A;  1NSW A;  1YKC A;  2GS3 A;  1XW5 A;  3M9K A;  1GSF A;  2AAW A;  3LQ7 A;  3TOT A;  2LS5 A;  5D9T A;  4K8M A;  3QD9 A;  1BAY A;  3HY2 A;  2R0C A;  1NHO A;  2EFD A;  4KE3 A;  1Z5Y E;  2IMK A;  3IAM 2;  2TRX A;  3LWA A;  3HXS A;  3LYK A;  2TIR A;  3CWG A;  4BWQ A;  4HSC X;  5J47 A;  1NW2 A;  3N9J A;  4KH7 A;  3N5O A;  3EPT A;  4KDX A;  1U3I A;  3GTU A;  3PR8 A;  4J2F A;  2GT6 A;  4IJ3 A;  2GZP A;  4AI6 A;  4JBB A;  3UL3 A;  1OC8 A;  5B8B A;  4WXT A;  3VPT A;  13GS A;  2H30 A;  4XS4 B;  1ML6 A;  5GZZ B;  2DJ2 A;  3FMW A;  4QL7 A;  1T4Z A;  3ZML A;  1M99 A;  5J4Y A;  4F0C A;  5KN1 A;  3E0U A;  5ECL B;  2PBJ A;  1F3A A;  4CY6 A;  2AV4 A;  2WCI A;  1DSB A;  5ELG A;  2VAF A;  1HYU A;  1K3Y A;  3IHQ A;  1M2D A;  5F05 A;  3I9V 2;  1ON4 A;  2V1M A;  2XHF A;  1A24 A;  5J5N A;  2VL2 A;  1EV4 A;  1B48 A;  4MH2 A;  2WVY A;  4CDO A;  1XFL A;  2DJ3 A;  2YJ7 A;  4WBR D;  2AHE A;  1GTI A;  1YJ6 A;  2RII A;  3F4S A;  1M7T A;  3WGX A;  3APQ A;  3QOU A;  4OWY A;  3DVW A;  2VCT A;  2GSR A;  4ML6 A;  4YQU A;  1ERT A;  3VFI A;  4QL9 A;  1EZK A;  3TB2 A;  1FB6 A;  2RM6 A;  2YZU A;  1K0M A;  1SJZ A;  1V40 A;  2VLT A;  2B5X A;  2NPB A;  3F3R A;  1OE8 A;  1GUM A;  1GLQ A;  1K0N A;  2V2G A;  1FHE A;  2K9F A;  3AY8 A;  2LNT A;  4NHW A;  5AIS A;  3GN3 A;  1K0O A;  4WF4 A;  1W89 A;  1PA3 A;  4TW5 A;  2YV7 A;  1OVN A;  3SBC A;  1ZL9 A;  1I5G A;  3DXB A;  1SK0 A;  2O8V B;  1M0U A;  2C3N A;  2QA1 A;  3UBK A;  4K9Z A;  4BWS A;  3F3Q A;  2LUS A;  3Q6O A;  2FHE A;  2WW3 A;  3KXO A;  3LXT A;  4V2L A;  2HSM B;  3MAK A;  4EVM A;  2HRN A;  1F3B A;  3Q74 A;  3KH9 A;  4N3Z A;  3VUR A;  3EYT A;  3TRX A;  1C72 A;  4HI7 A;  1V2A A;  2E2M A;  4AJ6 A;  4G9H A;  3ERF A;  1MEK A;  4GSS A;  2VCW A;  4OFN A;  1VGL A;  2MMA A;  1AXD A;  3ZMK A;  4OO4 A;  2C1Y A;  3CTF A;  2H1A A;  1SJI A;  2YPM A;  1WJK A;  1O85 A;  3HHV A;  2KHP A;  3UAR A;  3FZ5 A;  4GLT A;  4YQM A;  4XTS A;  3LFL A;  5LNK e;  3O6T A;  2C0F A;  2DKH A;  1B8X A;  3APO A;  4KDU A;  3IE3 A;  1V9W A;  3CXG A;  2HYX A;  4X1U A;  2WVX B;  4Q5N A;  3TKS C;  4ULX A;  1TXX A;  5DQS A;  5J40 A;  5COH A;  2N5F A;  4CW9 A;  3C71 A;  4EO3 A;  2QA2 A;  2WS2 A;  2FWG A;  4DSQ A;  4N11 A;  3ZL5 A;  4LL4 B;  3HYP A;  2EFH A;  1GNE A;  4ECJ A;  3J7Y k;  3L0H A;  1T4Y A;  1TK8 B;  1EEM A;  3FZA A;  3EMP A;  2DML A;  1R26 A;  2X99 A;  4IP1 A;  4NV5 A;  1AW9 A;  3R2Q A;  3KEB A;  3ZFB A;  4GQC A;  2H1G A;  2HZE A;  2RLI A;  2HZF A;  2YWM A;  2B5E A;  1VF3 A;  4WEY A;  2RM5 A;  5A4W A;  3P90 A;  1B4P A;  5IM9 A;  2H73 A;  1DUG A;  1XVW A;  2L59 A;  3M3M A;  4O92 A;  5F07 A;  3IHG A;  2C80 A;  4LA1 A;  1PN9 A;  1K3O A;  1YEW C;  4I5Q A;  1OE7 A;  1GUH A;  3HVX A;  3FHK A;  3KIJ A;  2H74 A;  3TDG A;  20GS A;  4EUY A;  3KD0 A;  2PGT A;  1PX6 A;  1S3D A;  1S3C A;  4GRF A;  2PUK C;  1GSS A;  5IQY A;  5J3R A;  1GTB A;  2FD3 A;  3J7Y b;  4TRX A;  3DD3 A;  2L57 A;  3QAV A;  2FWH A;  4MLY A;  3RPN A;  3IBH A;  19GS A;  4PNF A;  4XIH A;  1G7E A;  4QMK A;  3A2V A;  1F9M A;  1ZYE A;  4PXO A;  4ML1 A;  4X0X A;  2HI7 A;  2NDO A;  1T8E B;  3FYG A;  1PMT A;  2LKU A;  2YAN A;  2B1L A;  5G1L A;  1R5A A;  2BMX A;  3WT1 A;  4MF6 A;  4TR4 A;  3UAP A;  2IMF A;  3QDN A;  3IDV A;  3CSI A;  1W4V A;  1SL1 B;  3KM6 A;  4W66 A;  3TKP A;  2R37 A;  5C04 A;  2I81 A;  4ICY A;  1EP7 A;  1OYJ A;  5CRH A;  3RAZ A;  3M1G A;  3IK7 A;  4MP4 A;  3FZ9 A;  4KA0 A;  2LV3 A;  2YCD A;  3CYN A;  1PRX A;  1RK4 A;  2AYT A;  2ON7 A;  2KP1 A;  4K2D A;  4I2U A;  2OT3 A;  1QXH A;  5ECN B;  4GTU A;  3HMJ G;  4KAE A;  1TXU A;  4NAX A;  2K18 A;  4XS4 A;  4ZIJ A;  1WRY A;  4V1A p;  1JLV A;  3C1R A;  4JR4 A;  1THX A;  3D21 A;  4XCS A;  4PI0 C;  5D9W A;  4IKH A;  1FO5 A;  1V98 A;  4MJE A;  1TP9 A;  4IP6 A;  4FH8 A;  1XG8 A;  5GST A;  3GUS A;  5ECH B;  2F8A A;  3GX8 A;  1TRV A;  4HZ4 A;  2EFE A;  4WET A;  5BMU B;  2R4V A;  1XWK A;  2EC4 A;  2H75 A;  1TRW A;  2VD1 A;  1WWJ A;  1A2J A;  1WE0 A;  2H6Y A;  2IFQ A;  5E59 A;  3QR6 A;  2FWE A;  1J9B A;  2HSY A;  1K0A A;  4RQX A;  2X8C A;  2IMD A;  3FEU A;  3HVN A;  2YZH A;  2WW2 A;  1SKR B;  1OKD A;  1HNA A;  2PVQ A;  1DE1 A;  5IO0 A;  2XC2 A;  1SD8 A;  3F0I A;  1YZX A;  2YJH A;  6GSY A;  1K0D A;  4PUA A;  4KSO A;  3GIX A;  1YVL A;  1Z6M A;  4RI6 A;  3HVS A;  3BCI A;  4GSN A;  1GUK A;  3VI7 A;  3GFK A;  1EP8 A;  3GV1 A;  3ME8 A;  4L0W A;  2R6K A;  3W8S A;  2FA4 A;  1M9A A;  2O89 A;  5G5F A;  3WGD A;  1GNW A;  4NXI A;  2V32 A;  3FK8 A;  2HXK A;  4N0Z A;  2CX4 A;  4HDE A;  2HSM A;  3WT2 A;  1FB0 A;  18GS A;  5D73 A;  5F8B A;  2MYG A;  2UZ8 A;  2H0G A;  1EV9 A;  3UVH A;  4FO5 A;  3MNG A;  2LNS A;  3A3T A;  3GHA A;  1F2E A;  4DVC A;  2H6Z A;  3KP8 A;  4TN8 A;  3EE2 A;  5A4V A;  1ZMA A;  3F6F A;  1WP0 A;  1OAZ A;  4TR0 A;  4I2T A;  5A34 B;  3FKF A;  2B5Y A;  1N2A A;  6GSU A;  3GRX A;  1ERU A;  1I1I P;  4NV2 A;  2MBT A;  2FUG 2;  4O7H A;  1QFN A;  5F06 A;  2CVK A;  3QAG A;  5KN0 A;  6GSW A;  2PWJ A;  5H5Q A;  2WVX A;  4ZIL A;  1XWG A;  3L9S A;  3UVT A;  2WFC A;  5JCU A;  3ZIV A;  1PKW A;  4TR1 B;  2MMN A;  1TK5 B;  4HQS A;  2GQM A;  5HR2 A;  3V1W A;  3GSS A;  1FW1 A;  4PQI A;  3G9B A;  2H19 A;  2PPT A;  1A0F A;  2CQ9 A;  4D73 B;  5D8I A;  5B8A A;  2WB9 A;  2LJA A;  1HNB A;  3E3E A;  4LMW A;  4OMV A;  2B7K A;  2P31 A;  2L5O A;  5HR0 A;  2KUC A;  5DQY A;  2B3S A;  3TU3 B;  2L6D A;  4ZB8 A;  2O7K A;  2V6K A;  3QFB C;  2N5B A;  1UVZ A;  2HNL A;  4MF5 A;  2FCH A;  1X5C A;  3VK9 A;  7GSS A;  3MDK A;  4V2N A;  3GH6 A;  3CRT A;  2K8S A;  3RBT A;  2HRA A;  2FLS A;  5G5E A;  1SD9 A;  4Z2U A;  1MD4 A;  4HOJ A;  5DAL B;  5H5R A;  2XBQ A;  3UIW A;  1UA5 A;  3FW2 A;  17GS A;  4A5P A;  3IK9 A;  2QSI A;  4MAB A;  4PUR A;  1TW9 A;  1SJ6 A;  1ZCP A;  4HJ2 A;  2CAQ A;  3TKS A;  5HR1 A;  1KEB A;  4EF0 A;  4G01 A;  5ECR B;  3MWH A;  4AJ7 A;  3SWL A;  2R5G A;  3GNJ A;  2GQL A;  6GST A;  2FY6 A;  2R2J A;  1JZD A;  4L5O A;  2X8G A;  1DBY A;  1NM3 A;  3HDC A;  1X9M B;  5HQP A;  2JZR A;  4K1F A;  2G2Q A;  3VPQ A;  1Z3E A;  2P5R A;  4IJI A;  1JZW A;  2LJK A;  2OBK A;  2WRT A;  1TRU A;  4MDC A;  2O3E A;  4GQF A;  2VCV A;  4HU9 A;  1Q4J A;  2DIZ A;  1AQX A;  1GUL A;  4Q5R A;  4PQ1 A;  4IQ1 A;  4FYB A;  4DSS B;  3LSZ A;  4H86 A;  5IMD A;  4N30 A;  4BVX B;  4E68 A;  4GF0 A;  2DJ1 A;  3HKR A;  2JL4 A;  2H66 A;  2IFQ B;  4IHU A;  5B7C A;  1ZYQ B;  1XW9 A;  5ECS A;  2ALB A;  2VM2 A;  3Q18 A;  4Q5Q A;  5BMU A;  2C4J A;  1U3A A;  2VO4 A;  1GL8 A;  3TKS E;  4EKZ A;  3IXR A;  3IC4 A;  3TGZ A;  3ERG A;  1PL2 A;  4WKW A;  4TXO B;  3RGB C;  2G0F A;  3M0F A;  3EU3 A;  3CRU A;  3C1S A;  2ZUP A;  11GS A;  2OE1 A;  1YF0 A;  2CV4 A;  2H1L A;  1B9Y C;  2VCX A;  1TOF A;  1X9W B;  4MZC A;  3IPZ A;  1LBK A;  3W6G A;  5A5K A;  1J08 A;  4HUA A;  3E9J B;  2YN1 A;  3R3E A;  1J0F A;  1GLP A;  2LJR A;  3ISO A;  4FQU A;  1PGT A;  4MH3 A;  1XVQ A;  2LQO A;  4POM A;  2C0D A;  3UMA A;  4EDZ A;  5GSS A;  3ZFL A;  1ST9 A;  2X8H A;  3QCP A;  5G31 A;  4MNN A;  5CRD A;  3LJR A;  4NWY A;  4BPY A;  5IO2 A;  1FG4 A;  4HJM A;  1SKW B;  5IPG A;  1T1V A;  4K5S A;  5FT3 A;  3K8N A;  1ZYP A;  4K6X A;  5EL8 A;  3DKS A;  1XXU A;  4G0I A;  2DBC A;  4WBJ A;  3S9F A;  2HRK B;  4EE0 A;  3FR3 A;  4JRR A;  5HFG A;  3HD5 A;  1SVM A;  1VF2 A;  4BVY B;  3TKQ A;  4ECB A;  5DVB A;  2LQQ A;  2OJL A;  1THO A;  4K7I A;  1Q98 A;  2A2P A;  2HSN B;  2M72 A;  2B7J A;  4ZB7 A;  1XW6 A;  3D22 A;  2IME A;  5CO3 A;  3IC8 A;  3ZVJ D;  2C8U A;  2DIY A;  3IOS A;  5IOW A;  5A34 A;  1GWC A;  2VL9 A;  9GSS A;  1GSD A;  3CHX C;  2MMO A;  4G19 A;  6GSX A;  3IRA A;  4YH2 A;  2MMZ A;  4ACS A;  1XCC A;  3O76 A;  1XBS A;  3ZRD A;  5ECO B;  4HU7 A;  4TKY A;  4TR1 A;  2YP6 A;  3MSZ A;  4L8E A;  4XHM A;  4K7O A;  1X0R A;  1R4W A;  5JWO B;  2WZS A;  3C73 A;  3UJ1 A;  2N5A A;  2CVB A;  4FXY P;  3TUE A;  1XIY A;  4D73 A;  4K7N A;  3G7I A;  2OKA A;  1SL0 B;  5J4U A;  3A5I A;  1QGV A;  4O5Q A;  4AKX B;  8GSS A;  4PHZ C;  1RQM A;  2A4H A;  5F0G A;  1Z6N A;  3HVV A;  2IN3 A;  2X49 A;  2NVL A;  3ZYW A;  4BL7 A;  1Y6E A;  1Z7R A;  2VL2 C;  2JU5 A;  4PQH A;  2FNO A;  1X9S B;  2YNX A;  1GTU A;  3IR4 A;  5IOX A;  5HR3 A;  6GSS A;  1BYE A;  1TI3 A;  3RPP A;  3G7J A;  5DAL A;  2C0G A;  2PN8 A;  3Q19 A;  1M9B A;  1JHB A;  2KOK A;  1JLW A;  3GKN A;  2H1D A;  1ABA A;  3FR6 A;  2F3M A;  2X64 A;  5CRW A;  2CA8 A;  3UEM A;  1R5P A;  1QK8 A;  5ECQ B;  4IN0 A;  2YWO A;  5G30 A;  3EVI A;  1YDK A;  5J9B A;  4GDF A;  2DJK A;  4IS0 A;  1WPI A;  3L9V A;  1QQ2 A;  1ZOF A;  4RI7 A;  1ZGN A;  5KOX A;  3CQF A;  3GH9 A;  1EGO A;  3GKK A;  4MPF A;  4Z7X A;  2GT5 A;  4ZB6 A;  2QC7 A;  3MYD A;  5HFK A;  4K5R A;  4O5U A;  2L6C A;  1NHY A;  3EUR A;  4AKH A;  3H93 A;  3GL3 A;  3MIX A;  5GAN D;  3HZ4 A;  1R7H A;  3HJP A;  1GRX A;  4JED A;  1EWX A;  5D93 A;  2FWF A;  2AJQ B;  2O5V A;  1F6M C;  5E4W A;  3I6A A;  1CQH A;  4DSS A;  2IL3 A;  1E2Y A;  3PIN A;  1PX7 A;  4BVX A;  3H4K A;  4ZB9 A;  3ZVJ A;  1HD2 A;  1F37 A;  3QMX A;  3KMN A;  2WW1 A;  1ACV A;  2CZ2 A;  4AKI A;  5J9C A;  2H1B A;  5FHI A;  4O5R A;  4ZL8 A;  1GP1 A;  1SK2 A;  3HJM A;  4X4J A;  3GUR A;  5B6N A;  4Q5F A;  3QFA C;  3RFR C;  5KEJ A;  2B6M A;  2OAC A;  4TXO A;  4GCI A;  1XWA A;  1MDI A;  3EC3 A;  1TJD A;  2H71 A;  3H79 A;  4KND A;  4F03 A;  4MCU A;  4K0G A;  2H8L A;  2J23 A;  1M3I A;  3WYW A;  1YEP A;  4E8E A;  5J4V A;  5IMA A;  4P3Y B;  3KGK A;  2GLR A;  4J57 E;  3UBL A;  4XS1 A;  2H01 A;  1EEJ A;  4OFM A;  4YAV A;  4F0B A;  1T7P B;  5ECM B;  4EL1 A;  2HT9 A;  3FRC A;  1LU4 A;  3M9J A;  5ELA A;  1OC9 B;  2NBS A;  3KH7 A;  1USB A;  3ZIT A;  2WW0 A;  1XZO A;  3JCM L;  2LTK A;  4ECI A;  1S3A A;  5C00 A;  3KTL A;  4QQ7 A;  2HFD A;  2C0E A;  5CAX A;  2WZ9 A;  3VWV A;  4Z2R A;  5DCH A;  1SKS B;  4AGS A;  2DLX A;  3APS A;  3TJJ A;  1SYX A;  4BIK A;  3EU4 A;  4OCF A;  2HRK A;  3ERW A;  1V58 A;  4BVY A;  5AN1 A;  1BQ7 A;  5IIZ A;  1N25 A;  2HE3 A;  4HZ2 A;  2HSN A;  1G0T A;  5A1N B;  2M46 A;  2ON5 A;  2H0H A;  5D9X A;  2VLU A;  3EWL A;  3EMX A;  1AAZ A;  2OAD A;  3GX0 A;  2FGX A;  4KGI A;  3D5J A;  4JZQ A;  4E8H A;  1X5D A;  2V6O A;  5ECK B;  3LG6 A;  1QMV A;  4MF7 A;  2JZS A;  5AGY A;  3A2W A;  1M2A A;  1K0B A;  1O7U A;  3OR5 A;  3FR9 A;  1GH2 A;  3CSH A;  1G7O A;  1YKA A;  4K2X A;  1AUC A;  4WR4 A;  1BG5 A;  3IA1 A;  1S3R A;  1T3B A;  4OO5 A;  3IAS 2;  4GST A;  4BL7 B;  3D6I A;  4MPG A;  3D4M A;  2GST A;  2H76 A;  3M8N A;  5IMF A;  4XRD A;  1PKZ A;  2WVZ A;  2VIM A;  3F63 A;  2E0Q A;  1M2B A;  2HLS A;  2XPE A;  4POB A;  3PPU A;  2LEG A;  1Y1U A;  5KOW A;  1TU7 A;  2CX3 A;  5A5H B;  5KN2 A;  3TJF A;  5DJL A;  4IW9 A;  2WJU A;  5FWG A;  1PN0 A;  1MDK A;  3KMO A;  4RUV A;  1XWC A;  1UC7 A;  4PTS A;  2I1U A;  2AB6 A;  1Z7P A;  3ME7 A;  5IPH A;  1VRS D;  1M3J A;  1WIK A;  3KP9 A;  3FY7 A;  3F8U A;  2I9H A;  4YQV A;  1V57 A;  2XBI A;  2F9S A;  4NHZ A;  2EIR A;  3FZ4 A;  2GVP A;  4IQA A;  2VL3 A;  2GZZ A;  3P2A A;  4MJC A;  2AUV A;  5GAP D;  1GSQ A;  2JAC A;  5DJM A;  1PFO A;  1TU8 A;  5ECP B;  2KLX A;  3H8Q A;  4CY8 A;  14GS A;  16GS A;  3CTG A;  2F51 A;  4ZXG A;  2JAD A;  1JZR A;  2VUP A;  2GTU A;  3EIN A;  3NIV A;  1WOU A;  1EGR A;  5CP1 A;  5DAK B;  3CMI A;  1KTE A;  1AIU A;  1TI1 A;  1YF1 A;  3LGC A;  2TRC P;  1O6J A;  1Z9H A;  2E7P A;  2M80 A;  5B6M A;  4LL1 B;  2C3T A;  1SU9 A;  4XS6 A;  4HEA 2;  4G0L A;  2O87 A;  4KCE A;  3TRP A;  2R3X A;  1G6Y A;  2R0P A;  3G7Y A;  4KF9 A;  3D0Z A;  1BED A;  3ED3 A;  4TVE A;  2H0I A;  1GSY A;  3VLN A;  3C7M A;  4JU5 A;  3ZLP A;  2L4Q A;  3DYR A;  1FOV A;  4TXV A;  4IEL A;  4N10 A;  4IVF A;  2IJY A;  2KP2 A;  3BBY A;  4LLR A;  4ZBA A;  4FIW A;  1SL2 B;  1BX9 A;  2BTO T;  1FAA A;  1CQG A;  1AQV A;  1U6T A;  3BCK A;  1B4Q A;  5ECI B;  1G6W A;  3ZZX A;  2WDU A;  2CAI A;  5A4U A;  3F4R A;  1BG1 A;  3LEF A;  5JCW A;  2E2G A;  4KCA A;  5LD0 A;  4ISD A;  4EC0 A;  2MBS A;  4MJA A;  3U6V A;  2YOI A;  1YY7 A;  3NOF A;  1LJR A;  3L4N A;  3RDW A;  4PGT A;  4WF5 A;  4FYC A;  3TCO A; 
#chains in the Genus database with same CATH homology
 1IYH A;  1XWB A;  4V2M A;  4TOP A;  4PX1 A;  4F2I A;  4DSR A;  1OC9 A;  1O73 A;  3QAW A;  4KB3 A;  5CYY A;  4EDY A;  1U87 A;  5AIV A;  2BJX A;  5HFI A;  5D9V A;  1B9X C;  2CZ3 A;  4CHS A;  1I9D A;  4KW6 A;  2I4A A;  3UOM A;  3HCZ A;  2MZC A;  4MK3 A;  3TKR A;  2IWT A;  2XPD A;  2HRF A;  2HQT A;  2P0G A;  5DBQ A;  4I8B A;  4O32 A;  4POL A;  1H75 A;  4OCE A;  1U88 A;  1A8Y A;  1O81 A;  2VKZ G;  1SK1 A;  2REM A;  4L0U A;  5A1N A;  3DRN A;  1GTA A;  4XRA A;  2DSA A;  3TJK A;  5JWR B;  5EVO A;  4ECC A;  1YQ1 A;  2QGV A;  5DCG A;  4YKG A;  2JZT A;  1PL1 A;  5BRT A;  2JSZ A;  4YAP A;  4G2E A;  4N0V A;  2GQK A;  2H72 A;  2RUE A;  3IV4 A;  3GST A;  2OE0 A;  4GXZ A;  1X5E A;  2I3Y A;  1XOB A;  4ILF A;  4OD7 A;  4ZL9 A;  5ID2 B;  22GS A;  4GWR A;  1XPV A;  4MA9 A;  2PVO C;  2VCZ A;  12GS A;  2IMI A;  3PH9 A;  1Y25 A;  4NPB A;  5CRG A;  5JWQ B;  3VI5 A;  2A2R A;  2IIY A;  3BOA A;  4AJ8 A;  2B1K A;  2GGT A;  2A4V A;  1A8L A;  2GZY A;  4AF2 A;  3F6D A;  3TJG A;  2JSY A;  2GDR A;  2CVD A;  3CBU A;  4G10 A;  3I69 A;  4L5L A;  5J41 A;  5A5H A;  3GMF A;  2ZCT A;  3GA4 A;  3HJO A;  1K0C A;  3P8W A;  4MMM A;  1AQW A;  3I43 A;  4V1A g;  4EIP A;  3DEX A;  2YWN A;  2LRN A;  3GTU B;  2A2S A;  1ERV A;  2HSH A;  2EFC A;  1SYR A;  1OC3 A;  1OKT A;  4G0K A;  6GSV A;  5IMC A;  1UN2 A;  5CNW A;  1FOH A;  3NZN A;  5AIX A;  5CRE A;  1MDJ A;  1JFU A;  1A23 A;  3DWV A;  3VWU A;  2YWI A;  2L5L A;  1TTZ A;  2EIQ A;  5JCG A;  2QKE A;  3O3T A;  1QUW A;  4BA7 A;  5IMV A;  1TRS A;  2OBI A;  1FVK A;  2UV8 G;  1MD3 A;  2H70 A;  4FYU A;  4PUF C;  1O8X A;  3F4T A;  5KN3 A;  5LCZ A;  4IGJ A;  5D96 A;  5G1K A;  4USS A;  5ENU A;  1T00 A;  3KTB A;  4HS1 A;  1VF1 A;  3F9U A;  3US3 A;  2OE3 A;  5DAK A;  2VLV A;  2Z9S A;  1AC1 A;  2NTO A;  1GSU A;  3H1N A;  3L9U A;  1YEX A;  4TR3 A;  2VOC A;  5EPF A;  3HA9 A;  2RUF A;  4HQZ A;  4I6X A;  1JZO A;  5G2Z A;  2WUL A;  3L78 A;  2H6X A;  4EIQ A;  4MZW A;  2ES7 A;  3LXZ A;  4MZB A;  2DJ0 A;  2GSQ A;  1A2M A;  3VWX A;  4RQR A;  1EOG A;  1BJX A;  4ZBB A;  4IBP A;  4Z2T A;  4I97 A;  4J56 E;  4NMU A;  1K3L A;  4YKF A;  2WGR A;  3CSJ A;  3KZQ A;  3ZIJ A;  1ZYN A;  3A2X A;  5ABR A;  5EY6 A;  2X4A A;  2IPA A;  2DJJ A;  3A5W A;  4WR5 A;  1ERW A;  3BD2 A;  4LMV A;  2O85 A;  3W8J A;  3ZTL A;  1ZZY A;  4PNG A;  2DMM A;  1PD2 1;  2DKI A;  1BF5 A;  1KNG A;  2L4C A;  3WD6 A;  4F9Z A;  2LRC A;  3D4T A;  4AKG A;  3PGT A;  3LW9 A;  3BJ5 A;  3VWW A;  2LRT A;  2VCQ A;  1VF4 A;  3GL5 A;  1KBN A;  1SVL A;  2V41 A;  2VD0 A;  2GSS A;  1PQN A;  5INY A;  1MTC A;  3RHB A;  2PER A;  3KCM A;  1EOH A;  5H5S A;  1URM A;  3LYP A;  2F8F A;  2K6V A;  2K8V A;  2LST A;  4ID0 A;  2OA7 A;  1HQO A;  3DGQ A;  1N8J A;  1FVJ A;  2YV9 A;  5IMZ A;  3RHC A;  3C8E A;  2FA8 A;  2PMT A;  4K0N A;  1WMJ A;  1TKD B;  3GKX A;  4KX4 A;  3P7X A;  4KUN A;  1A2L A;  1XOA A;  2C3Q A;  2R0G A;  3WGE A;  3DVX A;  4JE1 A;  2DC5 A;  3DIE A;  4ZL7 A;  5L71 A;  2EIO A;  1SVO A;  3GYK A;  2HZE B;  4EXJ A;  3TRQ A;  1TK0 B;  2VM1 A;  10GS A;  3QPM A;  5DDL A;  3DML A;  1TDI A;  3GKM A;  3ZRE A;  2J9H A;  3TOU A;  4X43 A;  3KJY A;  3HZ8 A;  2ZNM A;  3TJB A;  4KSM A;  1RW1 A;  1O8W A;  2PU9 C;  4F82 A;  1E6B A;  1IYI A;  4ZBD A;  4POK A;  2CT6 A;  4KDY A;  1PSQ A;  1A0R P;  3LOR A;  4DEJ A;  5ID2 A;  4JR6 A;  2D2Z A;  1H4O A;  1SEN A;  1DE2 A;  4MJB A;  3U5R E;  1GSE A;  1HNC A;  2P5Q A;  1ILO A;  4OFT A;  1NSW A;  1YKC A;  2GS3 A;  1XW5 A;  3M9K A;  1GSF A;  2AAW A;  3LQ7 A;  3TOT A;  2LS5 A;  5D9T A;  4K8M A;  3QD9 A;  1BAY A;  3HY2 A;  2R0C A;  1NHO A;  2EFD A;  4KE3 A;  1Z5Y E;  2IMK A;  3IAM 2;  2TRX A;  3LWA A;  3HXS A;  3LYK A;  2TIR A;  3CWG A;  4BWQ A;  5J47 A;  1NW2 A;  3N9J A;  4KH7 A;  3N5O A;  3EPT A;  4KDX A;  1U3I A;  3GTU A;  3PR8 A;  4J2F A;  2GT6 A;  4IJ3 A;  2GZP A;  4AI6 A;  4JBB A;  3UL3 A;  1OC8 A;  5B8B A;  4WXT A;  3VPT A;  13GS A;  2H30 A;  4XS4 B;  1ML6 A;  5GZZ B;  2DJ2 A;  3FMW A;  4QL7 A;  1T4Z A;  3ZML A;  1M99 A;  5J4Y A;  4F0C A;  5KN1 A;  3E0U A;  5ECL B;  2PBJ A;  1F3A A;  4CY6 A;  2AV4 A;  2WCI A;  1DSB A;  5ELG A;  2VAF A;  1HYU A;  1K3Y A;  3IHQ A;  1M2D A;  5F05 A;  3I9V 2;  1ON4 A;  2V1M A;  2XHF A;  1A24 A;  5J5N A;  2VL2 A;  1EV4 A;  1B48 A;  4MH2 A;  4CDO A;  1XFL A;  2DJ3 A;  2YJ7 A;  4WBR D;  2AHE A;  1GTI A;  1YJ6 A;  2RII A;  3F4S A;  1M7T A;  3WGX A;  3APQ A;  3QOU A;  4OWY A;  3DVW A;  2VCT A;  2GSR A;  4ML6 A;  4YQU A;  1ERT A;  3VFI A;  4QL9 A;  1EZK A;  3TB2 A;  1FB6 A;  2RM6 A;  2YZU A;  1K0M A;  1SJZ A;  1V40 A;  2VLT A;  2B5X A;  2NPB A;  3F3R A;  1OE8 A;  1GUM A;  1GLQ A;  1K0N A;  2V2G A;  1FHE A;  2K9F A;  3AY8 A;  2LNT A;  4NHW A;  5AIS A;  3GN3 A;  1K0O A;  4WF4 A;  1W89 A;  1PA3 A;  4TW5 A;  2YV7 A;  1OVN A;  3SBC A;  1ZL9 A;  1I5G A;  3DXB A;  1SK0 A;  2O8V B;  1M0U A;  2C3N A;  2QA1 A;  3UBK A;  4K9Z A;  4BWS A;  3F3Q A;  2LUS A;  3Q6O A;  2FHE A;  3KXO A;  3LXT A;  4V2L A;  2HSM B;  3MAK A;  4EVM A;  2HRN A;  1F3B A;  3Q74 A;  3KH9 A;  4N3Z A;  3VUR A;  3EYT A;  3TRX A;  1C72 A;  4HI7 A;  1V2A A;  2E2M A;  4AJ6 A;  4G9H A;  3ERF A;  1MEK A;  4GSS A;  2VCW A;  4OFN A;  1VGL A;  2MMA A;  1AXD A;  3ZMK A;  4OO4 A;  2C1Y A;  3CTF A;  2H1A A;  1SJI A;  2YPM A;  1WJK A;  1O85 A;  3HHV A;  2KHP A;  3UAR A;  3FZ5 A;  4GLT A;  4YQM A;  4XTS A;  3LFL A;  5LNK e;  3O6T A;  2C0F A;  2DKH A;  1B8X A;  3APO A;  4KDU A;  3IE3 A;  1V9W A;  3CXG A;  2HYX A;  4X1U A;  4Q5N A;  3TKS C;  4ULX A;  1TXX A;  5DQS A;  5J40 A;  5COH A;  2N5F A;  4CW9 A;  3C71 A;  4EO3 A;  2QA2 A;  2WS2 A;  2FWG A;  4DSQ A;  4N11 A;  3ZL5 A;  4LL4 B;  3HYP A;  2EFH A;  1GNE A;  4ECJ A;  3J7Y k;  3L0H A;  1T4Y A;  1TK8 B;  1EEM A;  3FZA A;  3EMP A;  2DML A;  1R26 A;  2X99 A;  4IP1 A;  4NV5 A;  1AW9 A;  3R2Q A;  3KEB A;  3ZFB A;  4GQC A;  2H1G A;  2HZE A;  2RLI A;  2HZF A;  2YWM A;  2B5E A;  1VF3 A;  4WEY A;  2RM5 A;  5A4W A;  3P90 A;  1B4P A;  5IM9 A;  2H73 A;  1DUG A;  1XVW A;  2L59 A;  3M3M A;  4O92 A;  5F07 A;  3IHG A;  2C80 A;  4LA1 A;  1PN9 A;  1K3O A;  4I5Q A;  1OE7 A;  1GUH A;  3HVX A;  3FHK A;  3KIJ A;  2H74 A;  3TDG A;  20GS A;  4EUY A;  3KD0 A;  2PGT A;  1PX6 A;  1S3D A;  1S3C A;  4GRF A;  2PUK C;  1GSS A;  5IQY A;  5J3R A;  1GTB A;  2FD3 A;  3J7Y b;  4TRX A;  3DD3 A;  2L57 A;  3QAV A;  2FWH A;  4MLY A;  3RPN A;  3IBH A;  19GS A;  4PNF A;  4XIH A;  1G7E A;  4QMK A;  3A2V A;  1F9M A;  1ZYE A;  4PXO A;  4ML1 A;  4X0X A;  2HI7 A;  2NDO A;  1T8E B;  3FYG A;  1PMT A;  2LKU A;  2YAN A;  2B1L A;  5G1L A;  1R5A A;  2BMX A;  3WT1 A;  4MF6 A;  4TR4 A;  3UAP A;  2IMF A;  3QDN A;  3IDV A;  3CSI A;  1W4V A;  1SL1 B;  3KM6 A;  4W66 A;  3TKP A;  2R37 A;  5C04 A;  2I81 A;  4ICY A;  1EP7 A;  1OYJ A;  5CRH A;  3RAZ A;  3M1G A;  3IK7 A;  4MP4 A;  3FZ9 A;  4KA0 A;  2LV3 A;  2YCD A;  3CYN A;  1PRX A;  1RK4 A;  2AYT A;  2ON7 A;  2KP1 A;  4K2D A;  4I2U A;  2OT3 A;  1QXH A;  5ECN B;  4GTU A;  3HMJ G;  4KAE A;  1TXU A;  4NAX A;  2K18 A;  4XS4 A;  4ZIJ A;  1WRY A;  4V1A p;  1JLV A;  3C1R A;  4JR4 A;  1THX A;  3D21 A;  4XCS A;  5D9W A;  4IKH A;  1FO5 A;  1V98 A;  4MJE A;  1TP9 A;  4IP6 A;  4FH8 A;  5GST A;  3GUS A;  5ECH B;  2F8A A;  3GX8 A;  1TRV A;  4HZ4 A;  2EFE A;  4WET A;  5BMU B;  2R4V A;  1XWK A;  2EC4 A;  2H75 A;  1TRW A;  2VD1 A;  1WWJ A;  1A2J A;  1WE0 A;  2H6Y A;  2IFQ A;  5E59 A;  3QR6 A;  2FWE A;  1J9B A;  2HSY A;  1K0A A;  4RQX A;  2X8C A;  2IMD A;  3FEU A;  2YZH A;  1SKR B;  1OKD A;  1HNA A;  2PVQ A;  1DE1 A;  5IO0 A;  2XC2 A;  1SD8 A;  3F0I A;  1YZX A;  2YJH A;  6GSY A;  1K0D A;  4PUA A;  4KSO A;  3GIX A;  1YVL A;  1Z6M A;  4RI6 A;  3HVS A;  3BCI A;  4GSN A;  1GUK A;  3VI7 A;  3GFK A;  1EP8 A;  3GV1 A;  3ME8 A;  4L0W A;  2R6K A;  3W8S A;  2FA4 A;  1M9A A;  2O89 A;  5G5F A;  3WGD A;  1GNW A;  4NXI A;  2V32 A;  3FK8 A;  2HXK A;  4N0Z A;  2CX4 A;  4HDE A;  2HSM A;  3WT2 A;  1FB0 A;  18GS A;  5D73 A;  5F8B A;  2MYG A;  2UZ8 A;  2H0G A;  1EV9 A;  3UVH A;  4FO5 A;  3MNG A;  2LNS A;  3A3T A;  3GHA A;  1F2E A;  4DVC A;  2H6Z A;  3KP8 A;  4TN8 A;  3EE2 A;  5A4V A;  1ZMA A;  3F6F A;  1WP0 A;  1OAZ A;  4TR0 A;  4I2T A;  5A34 B;  3FKF A;  2B5Y A;  1N2A A;  6GSU A;  3GRX A;  1ERU A;  4NV2 A;  2MBT A;  2FUG 2;  4O7H A;  1QFN A;  5F06 A;  2CVK A;  3QAG A;  5KN0 A;  6GSW A;  2PWJ A;  5H5Q A;  4ZIL A;  1XWG A;  3L9S A;  3UVT A;  2WFC A;  5JCU A;  3ZIV A;  1PKW A;  4TR1 B;  2MMN A;  1TK5 B;  4HQS A;  2GQM A;  5HR2 A;  3V1W A;  3GSS A;  1FW1 A;  4PQI A;  3G9B A;  2H19 A;  2PPT A;  1A0F A;  2CQ9 A;  4D73 B;  5D8I A;  5B8A A;  2WB9 A;  2LJA A;  1HNB A;  3E3E A;  4LMW A;  4OMV A;  2B7K A;  2P31 A;  2L5O A;  5HR0 A;  2KUC A;  5DQY A;  2B3S A;  3TU3 B;  2L6D A;  4ZB8 A;  2O7K A;  2V6K A;  3QFB C;  2N5B A;  1UVZ A;  2HNL A;  4MF5 A;  2FCH A;  1X5C A;  3VK9 A;  7GSS A;  3MDK A;  4V2N A;  3GH6 A;  3CRT A;  2K8S A;  3RBT A;  2HRA A;  2FLS A;  5G5E A;  1SD9 A;  4Z2U A;  1MD4 A;  4HOJ A;  5DAL B;  5H5R A;  2XBQ A;  3UIW A;  1UA5 A;  3FW2 A;  17GS A;  4A5P A;  3IK9 A;  2QSI A;  4MAB A;  4PUR A;  1TW9 A;  1SJ6 A;  1ZCP A;  4HJ2 A;  2CAQ A;  3TKS A;  5HR1 A;  1KEB A;  4EF0 A;  4G01 A;  5ECR B;  3MWH A;  4AJ7 A;  3SWL A;  2R5G A;  3GNJ A;  2GQL A;  6GST A;  2FY6 A;  2R2J A;  1JZD A;  4L5O A;  2X8G A;  1DBY A;  1NM3 A;  3HDC A;  1X9M B;  5HQP A;  2JZR A;  4K1F A;  2G2Q A;  3VPQ A;  1Z3E A;  2P5R A;  4IJI A;  1JZW A;  2LJK A;  2OBK A;  2WRT A;  1TRU A;  4MDC A;  4GQF A;  2VCV A;  4HU9 A;  1Q4J A;  2DIZ A;  1AQX A;  1GUL A;  4Q5R A;  4PQ1 A;  4IQ1 A;  4FYB A;  4DSS B;  3LSZ A;  4H86 A;  5IMD A;  4N30 A;  4BVX B;  4E68 A;  4GF0 A;  2DJ1 A;  3HKR A;  2JL4 A;  2H66 A;  2IFQ B;  4IHU A;  5B7C A;  1ZYQ B;  1XW9 A;  5ECS A;  2ALB A;  2VM2 A;  3Q18 A;  4Q5Q A;  5BMU A;  2C4J A;  1U3A A;  2VO4 A;  1GL8 A;  3TKS E;  4EKZ A;  3IXR A;  3IC4 A;  3TGZ A;  3ERG A;  1PL2 A;  4WKW A;  4TXO B;  2G0F A;  3M0F A;  3EU3 A;  3CRU A;  3C1S A;  2ZUP A;  11GS A;  2OE1 A;  1YF0 A;  2CV4 A;  2H1L A;  1B9Y C;  2VCX A;  1TOF A;  1X9W B;  4MZC A;  3IPZ A;  1LBK A;  3W6G A;  5A5K A;  1J08 A;  4HUA A;  3E9J B;  2YN1 A;  3R3E A;  1J0F A;  1GLP A;  2LJR A;  3ISO A;  4FQU A;  1PGT A;  4MH3 A;  1XVQ A;  2LQO A;  4POM A;  2C0D A;  3UMA A;  4EDZ A;  5GSS A;  3ZFL A;  1ST9 A;  2X8H A;  3QCP A;  5G31 A;  4MNN A;  5CRD A;  3LJR A;  4NWY A;  4BPY A;  5IO2 A;  1FG4 A;  4HJM A;  1SKW B;  5IPG A;  1T1V A;  4K5S A;  5FT3 A;  3K8N A;  1ZYP A;  4K6X A;  5EL8 A;  3DKS A;  1XXU A;  4G0I A;  2DBC A;  4WBJ A;  3S9F A;  2HRK B;  4EE0 A;  3FR3 A;  4JRR A;  5HFG A;  3HD5 A;  1SVM A;  1VF2 A;  4BVY B;  3TKQ A;  4ECB A;  5DVB A;  2LQQ A;  2OJL A;  1THO A;  4K7I A;  1Q98 A;  2A2P A;  2HSN B;  2M72 A;  2B7J A;  4ZB7 A;  1XW6 A;  3D22 A;  2IME A;  5CO3 A;  3IC8 A;  3ZVJ D;  2C8U A;  2DIY A;  3IOS A;  5IOW A;  5A34 A;  1GWC A;  2VL9 A;  9GSS A;  1GSD A;  2MMO A;  4G19 A;  6GSX A;  3IRA A;  4YH2 A;  2MMZ A;  4ACS A;  1XCC A;  3O76 A;  1XBS A;  3ZRD A;  5ECO B;  4HU7 A;  4TKY A;  4TR1 A;  2YP6 A;  3MSZ A;  4L8E A;  4XHM A;  4K7O A;  1X0R A;  1R4W A;  5JWO B;  3C73 A;  3UJ1 A;  2N5A A;  2CVB A;  3TUE A;  1XIY A;  4D73 A;  4K7N A;  3G7I A;  2OKA A;  1SL0 B;  5J4U A;  3A5I A;  1QGV A;  4O5Q A;  4AKX B;  8GSS A;  1RQM A;  2A4H A;  5F0G A;  1Z6N A;  3HVV A;  2IN3 A;  2X49 A;  2NVL A;  3ZYW A;  4BL7 A;  1Y6E A;  1Z7R A;  2VL2 C;  2JU5 A;  4PQH A;  2FNO A;  1X9S B;  2YNX A;  1GTU A;  3IR4 A;  5IOX A;  5HR3 A;  6GSS A;  1BYE A;  1TI3 A;  3RPP A;  3G7J A;  5DAL A;  2C0G A;  2PN8 A;  3Q19 A;  1M9B A;  1JHB A;  2KOK A;  1JLW A;  3GKN A;  2H1D A;  1ABA A;  3FR6 A;  2F3M A;  2X64 A;  5CRW A;  2CA8 A;  3UEM A;  1R5P A;  1QK8 A;  5ECQ B;  4IN0 A;  2YWO A;  5G30 A;  3EVI A;  1YDK A;  5J9B A;  4GDF A;  2DJK A;  4IS0 A;  1WPI A;  3L9V A;  1QQ2 A;  1ZOF A;  4RI7 A;  1ZGN A;  5KOX A;  3GH9 A;  1EGO A;  3GKK A;  4MPF A;  4Z7X A;  2GT5 A;  4ZB6 A;  2QC7 A;  3MYD A;  5HFK A;  4K5R A;  4O5U A;  2L6C A;  1NHY A;  3EUR A;  4AKH A;  3H93 A;  3GL3 A;  3MIX A;  5GAN D;  3HZ4 A;  1R7H A;  3HJP A;  1GRX A;  4JED A;  1EWX A;  5D93 A;  2FWF A;  2AJQ B;  2O5V A;  1F6M C;  5E4W A;  3I6A A;  1CQH A;  4DSS A;  2IL3 A;  1E2Y A;  3PIN A;  1PX7 A;  4BVX A;  3H4K A;  4ZB9 A;  3ZVJ A;  1HD2 A;  1F37 A;  3QMX A;  3KMN A;  1ACV A;  2CZ2 A;  4AKI A;  5J9C A;  2H1B A;  5FHI A;  4O5R A;  4ZL8 A;  1GP1 A;  1SK2 A;  3HJM A;  4X4J A;  3GUR A;  5B6N A;  4Q5F A;  3QFA C;  5KEJ A;  2B6M A;  2OAC A;  4TXO A;  4GCI A;  1XWA A;  1MDI A;  3EC3 A;  1TJD A;  2H71 A;  3H79 A;  4KND A;  4F03 A;  4MCU A;  4K0G A;  2H8L A;  2J23 A;  1YEP A;  3WYW A;  4E8E A;  5J4V A;  5IMA A;  4P3Y B;  3KGK A;  2GLR A;  4J57 E;  3UBL A;  4XS1 A;  2H01 A;  1EEJ A;  4OFM A;  4YAV A;  4F0B A;  1T7P B;  5ECM B;  4EL1 A;  2HT9 A;  3FRC A;  1LU4 A;  3M9J A;  5ELA A;  1OC9 B;  2NBS A;  3KH7 A;  1USB A;  3ZIT A;  1XZO A;  3JCM L;  2LTK A;  4ECI A;  1S3A A;  5C00 A;  3KTL A;  4QQ7 A;  2HFD A;  2C0E A;  5CAX A;  2WZ9 A;  3VWV A;  4Z2R A;  5DCH A;  1SKS B;  4AGS A;  2DLX A;  3APS A;  3TJJ A;  1SYX A;  3EU4 A;  4OCF A;  2HRK A;  3ERW A;  1V58 A;  4BVY A;  5AN1 A;  1BQ7 A;  5IIZ A;  1N25 A;  2HE3 A;  4HZ2 A;  2HSN A;  1G0T A;  5A1N B;  2M46 A;  2ON5 A;  2H0H A;  5D9X A;  2VLU A;  3EWL A;  3EMX A;  1AAZ A;  2OAD A;  3GX0 A;  2FGX A;  4KGI A;  3D5J A;  4JZQ A;  4E8H A;  1X5D A;  2V6O A;  5ECK B;  3LG6 A;  1QMV A;  4MF7 A;  2JZS A;  5AGY A;  3A2W A;  1M2A A;  1K0B A;  1O7U A;  3OR5 A;  3FR9 A;  1GH2 A;  3CSH A;  1G7O A;  1YKA A;  4K2X A;  1AUC A;  4WR4 A;  1BG5 A;  3IA1 A;  1T3B A;  4OO5 A;  3IAS 2;  4GST A;  4BL7 B;  3D6I A;  4MPG A;  3D4M A;  2GST A;  2H76 A;  3M8N A;  5IMF A;  4XRD A;  1PKZ A;  2VIM A;  3F63 A;  2E0Q A;  1M2B A;  2HLS A;  2XPE A;  4POB A;  3PPU A;  2LEG A;  1Y1U A;  5KOW A;  1TU7 A;  2CX3 A;  5A5H B;  5KN2 A;  3TJF A;  5DJL A;  4IW9 A;  2WJU A;  5FWG A;  1PN0 A;  1MDK A;  3KMO A;  4RUV A;  1XWC A;  1UC7 A;  4PTS A;  2I1U A;  2AB6 A;  1Z7P A;  3ME7 A;  5IPH A;  1VRS D;  1WIK A;  3KP9 A;  3FY7 A;  3F8U A;  2I9H A;  4YQV A;  1V57 A;  2XBI A;  2F9S A;  4NHZ A;  2EIR A;  3FZ4 A;  2GVP A;  4IQA A;  2VL3 A;  2GZZ A;  3P2A A;  4MJC A;  2AUV A;  5GAP D;  1GSQ A;  2JAC A;  5DJM A;  1TU8 A;  5ECP B;  2KLX A;  3H8Q A;  4CY8 A;  14GS A;  16GS A;  3CTG A;  2F51 A;  4ZXG A;  2JAD A;  1JZR A;  2VUP A;  2GTU A;  3EIN A;  3NIV A;  1WOU A;  1EGR A;  5CP1 A;  3LGC A;  3CMI A;  5DAK B;  1KTE A;  1AIU A;  1TI1 A;  1YF1 A;  2TRC P;  1O6J A;  1Z9H A;  2E7P A;  2M80 A;  5B6M A;  4LL1 B;  2C3T A;  1SU9 A;  4XS6 A;  4HEA 2;  4G0L A;  2O87 A;  4KCE A;  3TRP A;  2R3X A;  1G6Y A;  2R0P A;  3G7Y A;  4KF9 A;  3D0Z A;  1BED A;  3ED3 A;  4TVE A;  2H0I A;  1GSY A;  3VLN A;  3C7M A;  4JU5 A;  3ZLP A;  2L4Q A;  3DYR A;  1FOV A;  4TXV A;  4IEL A;  4N10 A;  4IVF A;  2IJY A;  2KP2 A;  3BBY A;  4LLR A;  4ZBA A;  4FIW A;  1SL2 B;  1BX9 A;  2BTO T;  1FAA A;  1CQG A;  1AQV A;  1U6T A;  3BCK A;  1B4Q A;  5ECI B;  1G6W A;  3ZZX A;  2WDU A;  2CAI A;  5A4U A;  3F4R A;  1BG1 A;  3LEF A;  5JCW A;  2E2G A;  4KCA A;  5LD0 A;  4ISD A;  4EC0 A;  2MBS A;  4MJA A;  3U6V A;  2YOI A;  1YY7 A;  3NOF A;  1LJR A;  3L4N A;  3RDW A;  4PGT A;  4WF5 A;  4FYC A;  3TCO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...