4YQUA

Glutathione s-transferase omega 1 bound to covalent inhibitor c1-31
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
238
structure length
235
Chain Sequence
ESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase omega-1
publication title Mechanistic evaluation and transcriptional signature of a glutathione S-transferase omega 1 inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 77
structure length 235
sequence length 238
chains with identical sequence B
ec nomenclature ec 1.20.4.2: Methylarsonate reductase.
pdb deposition date 2015-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4yquA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4yquA01
4MPGA 2PUKC 4ML1A 5GSSA 1R5AA 3HA9A 4F2IA 1R7HA 2HQTA 2F8AA 4ZL7A 3CSHA 5B8BA 5DQSA 1TRWA 4GLTA 1AW9A 1Z7PA 1VRSD 3D0ZA 2LNTA 1XVQA 2VOCA 4MZWA 3J7Yk 2R5GA 4HI7A 2CVBA 4IBPA 5IOWA 3FY7A 5HQPA 2BTOT 5ABRA 1U87A 4KE3A 4O32A 5EL8A 1V98A 3D22A 2OKAA 3UMAA 3HJMA 4ZBAA 6GSWA 1BYEA 3PGTA 3TJGA 3QMXA 1O6JA 1AQVA 3VWXA 2RUEA 4KNDA 4YAPA 2EIRA 2MMNA 2B7KA 4WF4A 4FYUA 3VWWA 3IE3A 2L59A 3GTUB 4DSRA 4LMWA 1KEBA 1JZOA 1SYRA 3EC3A 5HR3A 4NPBA 3QOUA 3LYPA 4QL9A 4RQXA 3M0FA 2IWTA 1J08A 1TTZA 3LORA 2CZ2A 1BAYA 4WXTA 1AUCA 4ZL8A 4ZILA 3GX8A 2CZ3A 1IYHA 2LEGA 4K8MA 4L5LA 7GSSA 4AJ7A 1FO5A 1AXDA 1OC9A 3BOAA 2HRFA 2YV9A 1TK8B 2DC5A 2OE1A 1AQWA 3TKQA 1J0FA 4HZ2A 2KUCA 5ECMB 1PGTA 4TR1B 2CAIA 2HE3A 3MAKA 2GZZA 4KH7A 4O7HA 4USSA 3F3RA 3TKSC 4I2UA 1YKCA 4XS1A 1FW1A 1M0UA 4KA0A 2ON5A 5CO3A 2WJUA 3GHAA 4PGTA 2AUVA 3IXRA 4IELA 4K0GA 4KGIA 2MYGA 2DJKA 4IQ1A 1FHEA 2VUPA 4PURA 3TUEA 3WT1A 4BVXB 3TOUA 3O3TA 5DBQA 5HR2A 3EU3A 4OFNA 1FB0A 1ZZYA 3Q19A 3PR8A 3F9UA 4KDXA 3ME8A 2O7KA 1GSYA 3I69A 2YWMA 3UIWA 1XXUA 4PUFC 5CYYA 2BJXA 2M80A 3HZ4A 4G0LA 1GNEA 1U6TA 4LMVA 2VIMA 2J9HA 4F82A 2L5OA 2YZUA 1Z6NA 3FZ4A 5KN1A 3LXTA 1YKAA 2O87A 4KCAA 2JSYA 2I81A 1T3BA 1ABAA 2RLIA 4ZB9A 4BVYB 1F6MC 2GQLA 1IYIA 3IAM2 4ZL9A 2VL2A 3IC4A 4N30A 3I9V2 1X5CA 1W89A 2YNXA 5HFGA 2V41A 3GX0A 4JEDA 1XOAA 3ZITA 4HOJA 1OE8A 5KN0A 2X64A 1NHYA 3TOTA 14GSA 1QQ2A 3UEMA 4HUAA 3L9VA 3UOMA 1TOFA 1F3AA 1OKTA 3KIJA 1DE1A 1QK8A 5F07A 3ERWA 1UVZA 1WJKA 2PMTA 1PA3A 2F9SA 2C1YA 4WETA 2QGVA 1Z9HA 2NVLA 4NV5A 8GSSA 1O8WA 1G6YA 3KMNA 1HYUA 3PPUA 4Q5QA 1SL1B 5ECOB 2XPDA 4HQSA 4Q5NA 5ECHB 2XPEA 2IFQA 1WOUA 2HZEA 3RPPA 2H1DA 4KDUA 2IMKA 5DQYA 4HS1A 2VL3A 2R6KA 1GSDA 5GZZB 4P3YB 2C0FA 1N2AA 2GSTA 1GNWA 2EIOA 1A2MA 4F03A 3ZFLA 4KUNA 5FHIA 3GYKA 3HD5A 3CMIA 5FT3A 4QL7A 3LJRA 5IM9A 1YY7A 4OO5A 2VM1A 4I5QA 3D4TA 4IVFA 3RPNA 3LWAA 2FA8A 3W8SA 1SK1A 2DSAA 3F4TA 4O5RA 5G5FA 1M99A 1EP8A 1TI1A 3D5JA 3L9UA 2H6ZA 2GLRA 2M46A 3QAVA 1ON4A 2VCXA 1Y6EA 3HCZA 2LJRA 2K18A 1GUMA 2L6DA 2V1MA 4ECBA 1XZOA 5D8IA 4POLA 2AAWA 3APSA 1TRUA 4KAEA 3E9JB 1RQMA 3VWUA 6GSXA 1NM3A 2TRXA 1GUKA 1ZGNA 1URMA 1S3CA 4X1UA 3EINA 2H76A 3EU4A 5DALB 1ZL9A 4DSSB 1FAAA 2KOKA 3ZRDA 3MWHA 5GSTA 5FWGA 3WD6A 3SBCA 4JRRA 3D6IA 4LA1A 2IN3A 2AJQB 1SD9A 1PQNA 3PH9A 5F8BA 2V6OA 4MA9A 3WYWA 1XOBA 5INYA 5ECIB 4GRFA 2LQOA 3RBTA 2FWFA 3C73A 2GS3A 3UL3A 4E8EA 2LKUA 3H8QA 2IMDA 3ZVJD 3WGEA 3GIXA 4IGJA 4FO5A 3DIEA 2VAFA 3TJBA 1T8EB 1TP9A 5H5QA 3TKSE 2PVOC 2E0QA 4K0NA 2JZRA 5ID2B 3KEBA 2B6MA 3QR6A 1SYXA 4DVCA 2FWGA 4MK3A 4XTSA 3IA1A 2C3QA 2L6CA 3CYNA 1TK5B 4EC0A 2HRNA 4MF6A 2JL4A 1B4PA 3RHBA 5ECRB 2VCVA 3A5WA 3RAZA 2OADA 3I6AA 2JZSA 1WMJA 1SJ6A 5G31A 3L9SA 1ZOFA 2LQQA 2WULA 1G7EA 2UZ8A 2H01A 2OJLA 3NIVA 4IN0A 4POMA 4J2FA 1EOGA 3FR6A 1Z6MA 5J5NA 2GSSA 1FVJA 3EMXA 2WCIA 2VCTA 1Q4JA 1V2AA 3EYTA 2OE0A 4XRAA 3O76A 3HY2A 1XWCA 2VM2A 2H1AA 2DIZA 3P8WA 2C0GA 4WR5A 4TR3A 11GSA 1YEPA 3F4SA 2Z9SA 3FK8A 2QSIA 4GSTA 2FD3A 5HR1A 1USBA 2OA7A 4GCIA 4OCFA 3M1GA 2G2QA 1DBYA 3BCIA 1YF1A 4LLRA 1HNBA 4TOPA 3LFLA 2BMXA 2HZFA 2VD0A 2YANA 5JWRB 3WGXA 2H74A 5IMFA 5DAKA 4V1Ag 1GUHA 2AYTA 4PQ1A 4MH2A 4J56E 2GT6A 5E4WA 1G6WA 1AC1A 4WF5A 2HRAA 3ZVJA 3VLNA 2CQ9A 1MD3A 4TXOB 2QC7A 2WS2A 2MBSA 2HYXA 2A2RA 1Z3EA 3GKNA 3WT2A 3TRPA 4RUVA 1O73A 1TU8A 3UVHA 3DGQA 3R2QA 4BL7A 4HEA2 1EOHA 3GKXA 1X5DA 3ZZXA 5ECKB 5CAXA 4OFTA 3N5OA 3IK9A 2FUG2 3E3EA 5D9TA 1UN2A 4IQAA 3GV1A 1TK0B 5BMUA 1N8JA 2TIRA 4E8HA 3TJJA 3FZAA 6GSSA 4FH8A 1S3DA 5DJLA 5AGYA 1K0AA 4WBRD 4POKA 5AIVA 5ECPB 2PVQA 3DYRA 3NZNA 4EVMA 2RM5A 4AJ8A 2FA4A 3MDKA 5IMZA 1Y25A 3BBYA 1SENA 4TN8A 2VLVA 3P90A 3H79A 3UJ1A 5A4UA 2M72A 4V2MA 1GL8A 2YN1A 2H71A 2AB6A 1WE0A 5IQYA 3IAS2 4MJEA 4X43A 3FW2A 2PWJA 4ECCA 2H75A 4L0UA 2X99A 2F3MA 3RDWA 3VI5A 3FEUA 1F2EA 2REMA 4EDYA 1BX9A 2FWHA 4XS6A 3QD9A 1MD4A 2VCZA 2IPAA 1A8LA 2C3NA 1S3AA 3GURA 4MLYA 1GTAA 2VL2C 5CREA 4K9ZA 3A2XA 1THOA 3ISOA 3BJ5A 3VURA 2NBSA 4Q5FA 1YZXA 2CX4A 5IO2A 3TRXA 1M2DA 1XW9A 1GRXA 4IP1A 3PINA 3GTUA 1UC7A 3ED3A 3VI7A 2DMLA 3C71A 3GUSA 1M9BA 4N10A 2CV4A 4K7NA 1LBKA 4TW5A 1C72A 2HSMA 3KM6A 5F06A 4I8BA 6GSVA 3K8NA 3LQ7A 1O7UA 4DSQA 5D9VA 2K9FA 3US3A 2WGRA 4MZCA 2R37A 2RIIA 1AAZA 3ME7A 4JR4A 2R2JA 1QFNA 1QXHA 1F37A 4TKYA 18GSA 2FGXA 1VF3A 4IP6A 1KBNA 1PMTA 3QPMA 5CRGA 2VCQA 17GSA 2GSQA 4TR1A 3M8NA 1HQOA 1LU4A 3KP9A 1H4OA 2VL9A 1B9XC 3HKRA 1SJIA 3RHCA 1W4VA 2H19A 4JBBA 4ECIA 2IIYA 2GTUA 1V40A 1SU9A 4I6XA 5DCGA 4GSNA 4IHUA 2ZNMA 3TKPA 1AQXA 1FB6A 5JWOB 2LUSA 4BVXA 1R5PA 3KH7A 3FR9A 3FKFA 3S9FA 3P2AA 1GSEA 1OYJA 1XBSA 3IC8A 1A23A 3CSJA 2AV4A 4OO4A 2P31A 3DMLA 2E2MA 5ECLB 2NDOA 2ALBA 3DD3A 2A4VA 2KHPA 4TVEA 2VD1A 2J23A 4AF2A 3F0IA 2YWIA 3C1SA 1OC3A 2V2GA 4KSOA 4TRXA 3TKRA 5GAPD 4CHSA 2E2GA 4CDOA 4OFMA 4NHZA 5IMCA 1B8XA 1GSQA 1G0TA 3H4KA 4JE1A 2O85A 1HNAA 1AIUA 3D21A 3KMOA 2ZCTA 2KLXA 1CQGA 4BVYA 2H6XA 4DEJA 1K3LA 3H93A 3H1NA 3M9KA 4YQVA 3R3EA 3C8EA 2CVDA 4BA7A 2GZPA 4ID0A 5A4VA 3WGDA 3UBKA 5J41A 5DVBA 1EGRA 4N0VA 1B48A 2H1GA 1PKWA 1PL1A 1XPVA 2JADA 1O81A 1ERUA 4ZB8A 2H70A 2PGTA 1U3IA 2WZ9A 3C1RA 4NMUA 3EWLA 5KN3A 1EEJA 3LSZA 5COHA 3HVXA 2HNLA 3LG6A 1THXA 3KH9A 2YWNA 5CRHA 5GAND 2N5BA 1NHOA 1Z5YE 5G1KA 1V9WA 3TJFA 4ISDA 2G0FA 3VPTA 2B5EA 5C04A 3ERGA 4GTUA 1TRVA 3VPQA 2WB9A 4MCUA 2DJ1A 3OR5A 2H0IA 3DEXA 4KCEA 2LNSA 1XWGA 1GH2A 4XHMA 1QUWA 2XBIA 1X5EA 1GULA 5DJMA 5C00A 2VCWA 4XCSA 2C4JA 1SL2B 2H6YA 4PQHA 4ECJA 3UAPA 1SJZA 4TR4A 3IR4A 3DVWA 3ZIVA 3CTFA 5ECNB 3O6TA 4EL1A 2D2ZA 6GSUA 2MZCA 4CW9A 4G10A 3KTBA 2F51A 3D4MA 3F6FA 1G7OA 4I97A 2HSYA 2R4VA 5ECQB 4K1FA 3GKMA 4GQCA 4D73B 4GF0A 4EF0A 3GN3A 4MMMA 1ZYQB 2P5QA 3ZMLA 1PD21 3I43A 1EV4A 5KEJA 2RM6A 4XIHA 5D9XA 2H30A 2WRTA 2IL3A 4GSSA 2B3SA 4NHWA 2PN8A 4V2LA 2C0DA 3HYPA 2AHEA 3U6VA 5EY6A 1LJRA 4YQUA 2HXKA 2MMZA 1FG4A 2VLTA 4OMVA 4G0IA 5DALA 4DSSA 3M3MA 1XVWA 3MNGA 4TR0A 2WFCA 2NTOA 1F3BA 3DRNA 5CNWA 2X8CA 2OBIA 3G7YA 4GQFA 1T4ZA 2HRKB 1SD8A 4YQMA 20GSA 5ECSA 3A2WA 4I2TA 2YJHA 2LTKA 4ZBDA 5DAKB 1OVNA 3F63A 5H5RA 2GZYA 3HVVA 2YCDA 1V57A 1T4YA 4NV2A 2HI7A 2GGTA 1XIYA 1M9AA 4XS4B 1SKRB 3IPZA 3CSIA 2HT9A 1E6BA 2V6KA 5ID2A 1JFUA 3IHQA 1HD2A 2DJJA 4WR4A 3QFBC 1K0NA 2B5XA 2LRTA 2OACA 2PERA 3TRQA 10GSA 2X8HA 4HU7A 1RW1A 1TU7A 4MJCA 5L71A 4Z7XA 2OE3A 2LS5A 5D96A 3FR3A 1KNGA 3KJYA 4V1Ap 5E59A 2P5RA 4KW6A 1BQ7A 1E2YA 3ERFA 5J4UA 2DJ2A 4IJ3A 4FIWA 4F0CA 2DMMA 4IJIA 5CRWA 3L0HA 3F6DA 1TRSA 2O89A 3IBHA 5IMDA 1X9MB 1A0RP 5B8AA 3GA4A 5G1LA 2L4CA 3GSTA 5JCUA 2VLUA 2CT6A 2DBCA 1PN9A 3U5RE 3ZTLA 1M7TA 4KDYA 5ENUA 4NWYA 4BWQA 1MDJA 5IPGA 9GSSA 2C3TA 4HJ2A 2WDUA 2CVKA 3UARA 2LRNA 1GTUA 4WEYA 1MEKA 4EE0A 3GL5A 4K7IA 4ML6A 2ES7A 1O85A 3Q6OA 2I9HA 4RI7A 3M9JA 1ERWA 1JLVA 3DVXA 2IMFA 3ZLPA 1OC9B 2N5AA 3CRTA 2CA8A 3GKKA 1K0BA 1WP0A 2B1KA 3HXSA 3FRCA 4ULXA 1DE2A 4MF5A 2LJKA 2NPBA 2H66A 1K3YA 4TXOA 5LCZA 2K8SA 1TXXA 1KTEA 1DSBA 4OCEA 5HFIA 2L5LA 1BG5A 1TDIA 4PXOA 1ZYEA 1GSSA 4LL1B 4G0KA 6GSYA 2B1LA 5IOXA 3G7JA 5IIZA 2EC4A 3GNJA 5EVOA 1XWBA 1ST9A 1ZMAA 4F0BA 3ZFBA 1Z7RA 2HSMB 4X0XA 2FCHA 2E7PA 1WPIA 1PX7A 3KD0A 2XBQA 2YOIA 2I4AA 22GSA 1SL0B 2V32A 4JU5A 1YQ1A 2DJ3A 1PSQA 4GWRA 2HSNB 3DXBA 4HU9A 4FQUA 4K7OA 4G9HA 4KF9A 3BD2A 3TCOA 1XFLA 1TW9A 2XHFA 5J3RA 1YF0A 3W8JA 3QCPA 1JZWA 5IMVA 1EWXA 2IMIA 1VF1A 1WRYA 4TXVA 1QGVA 2ZUPA 1NSWA 2JSZA 2JU5A 5A5KA 3TJKA 5JCWA 4V2NA 4IW9A 4PNFA 1J9BA 4HZ4A 2IMEA 1I5GA 3NOFA 2H8LA 3EMPA 3HJPA 1T7PB 3DWVA 1R4WA 3GH9A 5AISA 2F8FA 4O92A 3A2VA 2O8VB 1YEXA 4N0ZA 1TI3A 2H72A 1K0CA 1V58A 2JACA 4J57E 2H73A 3Q18A 2HSHA 1TJDA 3TGZA 4PTSA 1OAZA 4XRDA 2C0EA 2X8GA 4ZXGA 1F9MA 3F8UA 2DJ0A 2PPTA 3ZREA 1M2BA 2MBTA 1XCCA 1VGLA 3APOA 4YH2A 3TB2A 1B4QA 1CQHA 5B6MA 1GTBA 3MSZA 3IDVA 2TRCP 5D93A 3HHVA 2IFQB 4MJBA 2VO4A 4YAVA 2HZEB 1K3OA 2CX3A 3UBLA 3Q74A 1T00A 4F9ZA 1ACVA 5J9BA 4RQRA 3KXOA 4MH3A 2MMOA 2P0GA 4RI6A 4PNGA 1WWJA 3L78A 4MF7A 5D73A 1NW2A 1XW6A 3TKSA 1I9DA 2DLXA 2K6VA 4WBJA 5G2ZA 2GVPA 5F05A 4JR6A 4G19A 2B7JA 5F0GA 1K0MA 2FLSA 3KCMA 1O8XA 2I1UA 3QAGA 3ZIJA 1SKSB 5JWQB 1OE7A 3F4RA 4KSMA 3VWVA 4EKZA 2L57A 1ILOA 2QKEA 3BCKA 2GQKA 1PKZA 5AN1A 4MP4A 2A2SA 2LJAA 1MTCA 4MABA 2ON7A 2KP1A 1JZRA 3LEFA 5CP1A 2C80A 3HZ8A 3P7XA 1ZCPA 5J9CA 4L5OA 3ZYWA 2LSTA 2GT5A 3QFAC 2JZTA 3FHKA 4K2DA 2GDRA 4ZB6A 1JZDA 4HQZA 5DCHA 19GSA 1PL2A 3W6GA 2CAQA 1BEDA 13GSA 5B6NA 16GSA 2I3YA 1SK0A 1K0DA 2FY6A 1X9WB 3E0UA 4BWSA 3KZQA 1JLWA 1K0OA 2N5FA 3GH6A 3KGKA 2HLSA 3EVIA 1U3AA 3IK7A 3VK9A 2L4QA 4G2EA 2H1BA 4L0WA 3LXZA 2FWEA 1OKDA 3GL3A 1EV9A 1A0FA 4PQIA 1PX6A 4OWYA 2FHEA 4EUYA 1XWAA 4EXJA 5D9WA 1T1VA 2LRCA 5DDLA 1GTIA 2RUFA 5JCGA 1HNCA 3G9BA 4QQ7A 1ML6A 4ILFA 3ZL5A 3N9JA 5H5SA 2C8UA 1MDIA 2LV3A 1OC8A 3FZ9A 3F3QA 1WIKA 2GQMA 3G7IA 1A24A 4MZBA 3TDGA 3C7MA 4NAXA 2KP2A 1VF4A 4AJ6A 4H86A 4IKHA 1A2LA 1SK2A 4MPFA 3HJOA 3CXGA 3V1WA 1EP7A 4FYCA 5G5EA 2IJYA 4HJMA 1JHBA 4HDEA 3HVSA 5CRDA 5EPFA 2R3XA 2HFDA 1U88A 1X0RA 1YDKA 4GXZA 3A3TA 3DKSA 3CRUA 1UA5A 3IV4A 1FOVA 5AIXA 1EGOA 1A2JA 3APQA 1VF2A 4MJAA 3QDNA 4PX1A 3IOSA 3CTGA 2YP6A 1PRXA 3J7Yb 1B9YC 4L8EA 3EE2A 4K6XA 5ELAA 2PU9C 2YV7A 1XW5A 1XWKA 4Q5RA 5G30A 2EIQA 4EDZA 2GSRA 3IRAA 3SWLA 1YJ6A 2B5YA 3CBUA 4WKWA 1Q98A 2H0GA 5B7CA 4EO3A 3ZMKA 2H0HA 1QMVA 4IS0A 1RK4A 4ZBBA 1GSUA 2FNOA 1M2AA 4ACSA 3GMFA 6GSTA 4D73A 3GRXA 5LD0A 5HFKA 2K8VA 2YPMA 4FYBA 4LL4B 5KN2A 3VFIA 1GLQA 5IMAA 5HR0A 4PUAA 2PBJA 3JCML 3AY8A 3FZ5A 4AGSA 2DIYA 1GWCA 1A8YA 4BL7B 4KX4A 1FVKA 4JZQA 2YWOA 4KB3A 5LNKe 3KP8A 1TKDB 3FYGA 2YJ7A 4ZIJA 5IO0A 1EEMA 1MDKA 1BJXA 4N11A 3LGCA 1GLPA 1GP1A 1R26A 4OD7A 3HDCA 1GSFA 2HRKA 4NXIA 3LYKA 4POBA 3QAWA 2YZHA 3L4NA 5IPHA 1EZKA 1X9SB 5ELGA 3GFKA 5A4WA 1ERVA 12GSA 3EURA 4MDCA 3KTLA 2OBKA 3UVTA 1ERTA 3GSSA 2MMAA 2XC2A 1SKWB 4XS4A 1H75A 4BPYA 1DUGA
chains in the Genus database with same CATH superfamily
5J40A 4MPGA 4A5PA 2PUKC 4ML1A 5GSSA 1R5AA 3HA9A 4F2IA 1YVLA 1R7HA 2HQTA 2F8AA 4ZL7A 3CSHA 5B8BA 5DQSA 1TRWA 4GLTA 1AW9A 1Z7PA 1VRSD 3D0ZA 2LNTA 1XVQA 2VOCA 4MZWA 3J7Yk 2R5GA 4HI7A 2CVBA 1YEWC 4IBPA 5IOWA 3FY7A 5HQPA 2BTOT 5ABRA 1U87A 4KE3A 4O32A 2WW3A 5EL8A 1V98A 3D22A 2OKAA 3UMAA 3HJMA 4ZBAA 6GSWA 1BYEA 3PGTA 3TJGA 3QMXA 1O6JA 1AQVA 3VWXA 2RUEA 4KNDA 4YAPA 2EIRA 2MMNA 2B7KA 4WF4A 4FYUA 3VWWA 3IE3A 2L59A 3GTUB 4DSRA 4LMWA 1KEBA 1JZOA 1SYRA 3EC3A 5HR3A 4NPBA 3QOUA 3LYPA 4QL9A 4RQXA 3M0FA 2IWTA 1J08A 1TTZA 3LORA 1SVMA 2CZ2A 1BAYA 4WXTA 1AUCA 4ZL8A 4ZILA 3GX8A 2CZ3A 1IYHA 2LEGA 4K8MA 4L5LA 7GSSA 5BRTA 4AJ7A 1FO5A 1AXDA 1OC9A 3BOAA 2HRFA 2YV9A 1TK8B 2DC5A 2OE1A 1AQWA 3TKQA 1J0FA 4HZ2A 2KUCA 5ECMB 1ZYNA 1PGTA 4TR1B 2CAIA 2HE3A 3MAKA 2GZZA 4KH7A 4O7HA 4USSA 3F3RA 3TKSC 4I2UA 1YKCA 4XS1A 1FW1A 1M0UA 1BF5A 4KA0A 2ON5A 5CO3A 2WJUA 3GHAA 4PGTA 2AUVA 3IXRA 4IELA 4K0GA 4KGIA 2MYGA 2DJKA 4IQ1A 1FHEA 2VUPA 4PURA 3TUEA 3WT1A 4BVXB 3TOUA 3O3TA 5DBQA 5HR2A 3EU3A 4OFNA 1FB0A 1ZZYA 3Q19A 3PR8A 3CQFA 3F9UA 4KDXA 2R0GA 3ME8A 2A2PA 2O7KA 1GSYA 3I69A 2YWMA 3UIWA 4EIQA 1XXUA 4PUFC 5CYYA 3HMJG 2BJXA 4AKGA 2M80A 3HZ4A 4G0LA 1GNEA 1U6TA 4LMVA 2VIMA 2J9HA 4F82A 2L5OA 2YZUA 1Z6NA 3FZ4A 5KN1A 3LXTA 1YKAA 2O87A 4KCAA 2JSYA 2I81A 1T3BA 1ABAA 2RLIA 4ZB9A 4BVYB 1F6MC 2GQLA 1IYIA 3IAM2 4ZL9A 2VL2A 3IC4A 2H1LA 4N30A 3I9V2 1X5CA 4PI0C 1W89A 2YNXA 5HFGA 2V41A 3GX0A 4JEDA 1XOAA 3ZITA 4HOJA 1OE8A 5KN0A 2X64A 1NHYA 3TOTA 14GSA 1QQ2A 3UEMA 3RFRC 4HUAA 3L9VA 3UOMA 1TOFA 1F3AA 1OKTA 3KIJA 1DE1A 5KOXA 1QK8A 5F07A 3ERWA 1UVZA 1WJKA 2PMTA 1PA3A 2F9SA 2C1YA 4WETA 2QGVA 1Z9HA 2NVLA 4NV5A 8GSSA 1O8WA 1G6YA 3KMNA 1HYUA 3PPUA 4Q5QA 1SL1B 5ECOB 2XPDA 4HQSA 4Q5NA 5ECHB 2XPEA 2IFQA 1WOUA 2HZEA 3RPPA 2H1DA 4KDUA 2IMKA 5DQYA 4HS1A 2VL3A 2R6KA 1GSDA 5GZZB 4P3YB 2C0FA 1N2AA 2GSTA 1GNWA 2EIOA 1A2MA 4F03A 3ZFLA 4Z2TA 4KUNA 5FHIA 3GYKA 3HD5A 3CMIA 5FT3A 4QL7A 3LJRA 5IM9A 1YY7A 4OO5A 2VM1A 4I5QA 3D4TA 4IVFA 3RPNA 3LWAA 2FA8A 3W8SA 1SK1A 2DSAA 3F4TA 4O5RA 1TXUA 5G5FA 1M99A 1EP8A 1TI1A 3D5JA 3L9UA 2H6ZA 2GLRA 2M46A 3QAVA 1ON4A 2VCXA 1Y6EA 3HCZA 2LJRA 2K18A 1GUMA 3FMWA 2L6DA 2V1MA 4ECBA 1XZOA 5D8IA 4POLA 2AAWA 3APSA 1TRUA 4KAEA 3E9JB 1RQMA 3VWUA 6GSXA 1NM3A 2TRXA 1GUKA 1ZGNA 1URMA 1S3CA 4X1UA 3EINA 2H76A 3EU4A 5DALB 1ZL9A 4DSSB 1FAAA 2KOKA 3ZRDA 3MWHA 5GSTA 4ZB7A 5FWGA 3WD6A 3SBCA 4JRRA 5A1NA 3D6IA 4LA1A 2IN3A 1PFOA 2AJQB 1SD9A 1PQNA 2EFDA 3PH9A 5F8BA 2V6OA 5A5HB 4MA9A 3WYWA 1XOBA 5INYA 5ECIB 4GRFA 2LQOA 3RBTA 2FWFA 3C73A 2GS3A 3UL3A 4E8EA 2LKUA 3H8QA 2IMDA 3ZVJD 3WGEA 3GIXA 4IGJA 4FO5A 3DIEA 2VAFA 4FXYP 3TJBA 1T8EB 5A34A 1TP9A 5H5QA 3TKSE 2PVOC 2E0QA 4K0NA 2JZRA 5ID2B 3KEBA 2B6MA 3QR6A 1SYXA 2X49A 4DVCA 2FWGA 4MK3A 4XTSA 3IA1A 2C3QA 2L6CA 3CYNA 1TK5B 4EC0A 2HRNA 4MF6A 2JL4A 1B4PA 4BIKA 3RHBA 5ECRB 2VCVA 3A5WA 3RAZA 2OADA 3I6AA 2JZSA 1WMJA 1SJ6A 5G31A 3L9SA 4K2XA 1ZOFA 2LQQA 1FOHA 2WULA 1G7EA 2UZ8A 2H01A 2OJLA 3NIVA 4IN0A 4POMA 4J2FA 1EOGA 3FR6A 1SVOA 1PN0A 1Z6MA 5J5NA 2GSSA 1FVJA 3EMXA 2WCIA 2VCTA 1Q4JA 1V2AA 3EYTA 2OE0A 4XRAA 3O76A 3HY2A 1XWCA 2VM2A 2H1AA 2DIZA 3P8WA 2C0GA 4WR5A 4TR3A 11GSA 1YEPA 3F4SA 1I1IP 2Z9SA 3FK8A 2QSIA 4GSTA 2FD3A 5HR1A 1USBA 2OA7A 4GCIA 4OCFA 3M1GA 2G2QA 1DBYA 3BCIA 4AI6A 1YF1A 4LLRA 1HNBA 4TOPA 3LFLA 2BMXA 2HZFA 2VD0A 2YANA 5JWRB 3WGXA 2H74A 5IMFA 5DAKA 4V1Ag 3RGBC 1GUHA 2AYTA 4PQ1A 4MH2A 4J56E 2GT6A 5E4WA 1G6WA 1AC1A 4WF5A 2HRAA 3ZVJA 3VLNA 2CQ9A 1MD3A 4TXOB 1M3IA 2QC7A 2WS2A 2MBSA 2HYXA 2A2RA 1Z3EA 3GKNA 3WT2A 3TRPA 4RUVA 1O73A 1TU8A 3UVHA 3DGQA 3R2QA 4BL7A 4HEA2 1EOHA 3GKXA 1X5DA 3ZZXA 5ECKB 5CAXA 4OFTA 3N5OA 3IK9A 2FUG2 3E3EA 5D9TA 1UN2A 4IQAA 3GV1A 1TK0B 5BMUA 1N8JA 2UV8G 4QMKA 2TIRA 4E8HA 3TJJA 4GDFA 3FZAA 6GSSA 4FH8A 1S3DA 5DJLA 5AGYA 1K0AA 4WBRD 4POKA 5AIVA 5ECPB 4K5RA 2PVQA 3DYRA 3NZNA 4EVMA 2RM5A 4AJ8A 2FA4A 3MDKA 5IMZA 4MNNA 1Y25A 3BBYA 1SENA 4TN8A 2VLVA 4O5QA 3P90A 3H79A 3UJ1A 5A4UA 2M72A 4V2MA 1GL8A 2YN1A 2H71A 2AB6A 1WE0A 5IQYA 3IAS2 4X4JA 4MJEA 4X43A 3FW2A 2PWJA 4ECCA 2H75A 4L0UA 2X99A 2F3MA 3RDWA 2O5VA 3VI5A 3FEUA 1F2EA 2REMA 4EDYA 1BX9A 2FWHA 4XS6A 3QD9A 1MD4A 2VCZA 2IPAA 2WVXA 1A8LA 2C3NA 1S3AA 3GURA 4MLYA 1GTAA 2VL2C 5CREA 4K9ZA 4E68A 3A2XA 1THOA 3ISOA 3BJ5A 3VURA 2NBSA 4Q5FA 1YZXA 2CX4A 5IO2A 3TRXA 1M2DA 1XW9A 1GRXA 4IP1A 3PINA 3GTUA 1UC7A 3ED3A 3VI7A 2DMLA 1SVLA 3C71A 2WZSA 3GUSA 1M9BA 4N10A 2CV4A 4K7NA 1LBKA 4TW5A 1C72A 2HSMA 3KM6A 5F06A 4I8BA 6GSVA 3K8NA 3LQ7A 1O7UA 3TU3B 4DSQA 5D9VA 2K9FA 3US3A 2WGRA 2HSNA 4MZCA 4AKHA 2R37A 2RIIA 1AAZA 3ME7A 4JR4A 2R2JA 1QFNA 1QXHA 1F37A 4TKYA 18GSA 2FGXA 1VF3A 4IP6A 1KBNA 1PMTA 3QPMA 5CRGA 2VCQA 17GSA 2GSQA 4TR1A 3M8NA 1HQOA 1LU4A 3KP9A 1H4OA 2VL9A 1B9XC 3HKRA 1SJIA 3RHCA 1W4VA 2H19A 4JBBA 4ECIA 2IIYA 2GTUA 1V40A 1SU9A 1Y1UA 4I6XA 5DCGA 4GSNA 4IHUA 2ZNMA 3TKPA 1AQXA 1FB6A 5JWOB 2WVZA 2LUSA 4BVXA 1R5PA 3KH7A 3FR9A 3FKFA 3S9FA 3P2AA 1GSEA 1OYJA 1XBSA 3IC8A 1A23A 3CSJA 2AV4A 4OO4A 2P31A 3DMLA 1M3JA 2E2MA 5ECLB 2NDOA 2ALBA 3DD3A 2A4VA 2KHPA 4TVEA 2VD1A 2J23A 4AF2A 3F0IA 2YWIA 3C1SA 1OC3A 1ZYPA 2V2GA 4KSOA 4TRXA 3TKRA 5GAPD 4CHSA 2E2GA 4CDOA 4OFMA 4NHZA 5IMCA 1B8XA 1GSQA 1G0TA 2O36A 3H4KA 4JE1A 2O85A 1HNAA 1AIUA 3A5IA 5KOWA 3D21A 3KMOA 2ZCTA 2KLXA 1CQGA 4BVYA 4ICYA 2H6XA 4DEJA 1K3LA 3H93A 3H1NA 3M9KA 4YQVA 3R3EA 3C8EA 2CVDA 4BA7A 2GZPA 4ID0A 5A4VA 3WGDA 3UBKA 5J41A 5DVBA 1EGRA 4N0VA 1B48A 2H1GA 2QA2A 1PKWA 1PL1A 1XPVA 2JADA 1O81A 4N3ZA 1ERUA 4ZB8A 5A1NB 2H70A 2PGTA 1U3IA 2WZ9A 3C1RA 4NMUA 3EWLA 5KN3A 1EEJA 3LSZA 5COHA 3HVXA 2HNLA 3LG6A 1THXA 3KH9A 2YWNA 5CRHA 5GAND 2N5BA 1NHOA 1Z5YE 5G1KA 1V9WA 3TJFA 4ISDA 2QA1A 2G0FA 3VPTA 2B5EA 5C04A 3ERGA 4GTUA 1TRVA 3VPQA 2WB9A 4MCUA 2DJ1A 3OR5A 2H0IA 3DEXA 4KCEA 2LNSA 1XWGA 1GH2A 4XHMA 1QUWA 2XBIA 1X5EA 4EIPA 1GULA 5DJMA 5C00A 2VCWA 4XCSA 2C4JA 2EFHA 1SL2B 2H6YA 4PQHA 4ECJA 3UAPA 1SJZA 4TR4A 3IR4A 3DVWA 3ZIVA 3CTFA 5ECNB 3O6TA 4EL1A 2D2ZA 6GSUA 2MZCA 4CW9A 4G10A 2R0CA 3KTBA 2F51A 3D4MA 3F6FA 1G7OA 4I97A 2HSYA 2R4VA 5ECQB 4K1FA 3GKMA 4GQCA 4D73B 4GF0A 4EF0A 3GN3A 4MMMA 1ZYQB 2P5QA 3ZMLA 1PD21 3I43A 1EV4A 5KEJA 2RM6A 4XIHA 5D9XA 2H30A 2WRTA 2IL3A 4GSSA 2B3SA 4NHWA 2PN8A 4V2LA 2C0DA 3HYPA 2AHEA 3U6VA 5EY6A 1LJRA 2EFCA 4YQUA 2HXKA 2MMZA 1FG4A 2VLTA 4OMVA 4G0IA 5DALA 4DSSA 3M3MA 1XVWA 3MNGA 4TR0A 2WFCA 2NTOA 1F3BA 3DRNA 5CNWA 2X8CA 2OBIA 3G7YA 4GQFA 1T4ZA 2HRKB 1SD8A 4YQMA 20GSA 4W66A 5ECSA 3A2WA 4I2TA 2YJHA 2LTKA 4ZBDA 5DAKB 1OVNA 3F63A 5H5RA 2GZYA 3CWGA 3HVVA 2YCDA 1V57A 1T4YA 4NV2A 2HI7A 2GGTA 1XIYA 1M9AA 4XS4B 1SKRB 3IPZA 3CSIA 2HT9A 1E6BA 2V6KA 5ID2A 1JFUA 3IHQA 1HD2A 2DJJA 4WR4A 3QFBC 1K0NA 2B5XA 2LRTA 2OACA 2PERA 3TRQA 10GSA 2X8HA 4HU7A 1RW1A 1TU7A 4MJCA 5L71A 4Z7XA 2OE3A 2LS5A 5D96A 2WW0A 3FR3A 2WVYA 1KNGA 3KJYA 4V1Ap 5E59A 2P5RA 4KW6A 1BQ7A 1E2YA 3ERFA 5J4UA 2DJ2A 4IJ3A 4FIWA 4F0CA 2DMMA 4IJIA 5CRWA 3L0HA 3F6DA 1TRSA 2O89A 3IBHA 5IMDA 1X9MB 1A0RP 5B8AA 3GA4A 5G1LA 2L4CA 3GSTA 5JCUA 2VLUA 2CT6A 2DBCA 1PN9A 3U5RE 3ZTLA 1M7TA 4KDYA 5ENUA 4NWYA 4BWQA 1MDJA 5IPGA 9GSSA 2C3TA 4HJ2A 2WDUA 2CVKA 3UARA 2LRNA 1GTUA 4WEYA 1MEKA 4EE0A 3GL5A 4K7IA 4ML6A 2ES7A 1O85A 3Q6OA 2I9HA 4RI7A 3M9JA 1ERWA 1JLVA 3DVXA 2IMFA 3ZLPA 1OC9B 3CHXC 2N5AA 3CRTA 2CA8A 3GKKA 1K0BA 2WVXB 1WP0A 2B1KA 3HXSA 3FRCA 4ULXA 1DE2A 4MF5A 5J47A 2LJKA 2NPBA 2H66A 1K3YA 4TXOA 5LCZA 2K8SA 1TXXA 1KTEA 1DSBA 4OCEA 5HFIA 2L5LA 1BG5A 1TDIA 4PXOA 1ZYEA 1GSSA 4LL1B 4G0KA 6GSYA 2B1LA 5IOXA 3G7JA 5IIZA 2EC4A 3GNJA 5EVOA 1XWBA 1ST9A 1ZMAA 1N25A 4F0BA 3ZFBA 1Z7RA 2HSMB 4X0XA 2FCHA 2E7PA 1WPIA 1PX7A 3KD0A 1S4BP 2XBQA 2YOIA 2I4AA 22GSA 1SL0B 2V32A 4JU5A 1YQ1A 2DJ3A 1PSQA 4PHZC 4GWRA 2HSNB 3DXBA 4HU9A 4FQUA 4K7OA 4G9HA 4KF9A 3BD2A 4K5SA 3TCOA 1XFLA 1TW9A 2XHFA 5J3RA 1YF0A 3W8JA 3QCPA 1JZWA 5IMVA 1EWXA 2IMIA 1VF1A 1WRYA 4TXVA 1QGVA 2ZUPA 3EPTA 1NSWA 2JSZA 2JU5A 5A5KA 3TJKA 5JCWA 4V2NA 4IW9A 4PNFA 1J9BA 4HZ4A 2IMEA 1I5GA 3NOFA 2H8LA 3EMPA 3HJPA 1T7PB 3DWVA 1R4WA 3GH9A 5AISA 2F8FA 4O92A 3A2VA 2O8VB 1YEXA 4N0ZA 1TI3A 2H72A 1K0CA 1V58A 2JACA 4J57E 2H73A 3Q18A 2HSHA 1TJDA 3TGZA 4PTSA 1OAZA 4XRDA 2C0EA 2X8GA 4ZXGA 2X4AA 1F9MA 3F8UA 2DJ0A 2PPTA 3ZREA 1M2BA 2MBTA 1XCCA 4Z2RA 1VGLA 3APOA 4YH2A 3TB2A 1B4QA 1CQHA 5B6MA 1GTBA 3MSZA 3IDVA 2TRCP 5D93A 3HHVA 2IFQB 4MJBA 2VO4A 4YAVA 2HZEB 1K3OA 2CX3A 3UBLA 3Q74A 1T00A 4F9ZA 1ACVA 5J9BA 4RQRA 3KXOA 4MH3A 2MMOA 2P0GA 4RI6A 4PNGA 1WWJA 3L78A 4MF7A 5D73A 1NW2A 3MIXA 1XW6A 3TKSA 1I9DA 2DLXA 2K6VA 4WBJA 5G2ZA 2GVPA 5F05A 4JR6A 4G19A 2B7JA 5F0GA 1K0MA 2FLSA 3KCMA 4PI2C 2WW2A 1O8XA 2I1UA 3QAGA 3ZIJA 2OT3A 1SKSB 5JWQB 1OE7A 3F4RA 1BG1A 4KSMA 3VWVA 4EKZA 2L57A 1ILOA 2QKEA 1XG8A 2GQKA 3BCKA 1PKZA 5AN1A 4MP4A 2A2SA 2LJAA 1MTCA 4MABA 4CY8A 2O3EA 2ON7A 2KP1A 1JZRA 3LEFA 5CP1A 4YKFA 2C80A 3HZ8A 3P7XA 1ZCPA 5J9CA 4L5OA 3ZYWA 2LSTA 2GT5A 3QFAC 2R0PA 2JZTA 3FHKA 4K2DA 2GDRA 4ZB6A 1JZDA 4HQZA 5DCHA 19GSA 1PL2A 3W6GA 2CAQA 1BEDA 13GSA 5B6NA 16GSA 2I3YA 1SK0A 1K0DA 2FY6A 1X9WB 3E0UA 4BWSA 3KZQA 1JLWA 1K0OA 2N5FA 3GH6A 3KGKA 2HLSA 3EVIA 1U3AA 3IK7A 3VK9A 2L4QA 4G2EA 2H1BA 4L0WA 3MYDA 3LXZA 2FWEA 1OKDA 3GL3A 1EV9A 1A0FA 4PQIA 1PX6A 4OWYA 2FHEA 4EUYA 1XWAA 4EXJA 5D9WA 2WW1A 1T1VA 2LRCA 5DDLA 1GTIA 2RUFA 5JCGA 1HNCA 3G9BA 4QQ7A 5A34B 1ML6A 4ILFA 3ZL5A 3N9JA 5H5SA 2C8UA 1MDIA 2LV3A 1OC8A 3FZ9A 3F3QA 1WIKA 4HSCX 2GQMA 3G7IA 1A24A 3LW9A 4MZBA 3TDGA 3C7MA 4NAXA 2KP2A 1VF4A 4AJ6A 2DKHA 4H86A 4IKHA 1A2LA 1SK2A 4MPFA 3HJOA 4AKXB 3CXGA 3V1WA 1EP7A 4FYCA 5G5EA 2IJYA 4HJMA 1JHBA 4HDEA 3HVSA 5CRDA 5EPFA 3HVNA 2R3XA 2HFDA 1U88A 1X0RA 1YDKA 4GXZA 3A3TA 3DKSA 3CRUA 4Z2UA 1UA5A 3IV4A 1FOVA 5AIXA 1EGOA 1A2JA 3APQA 1VF2A 5J4YA 4MJAA 3QDNA 4PX1A 3IOSA 3CTGA 1S3RA 2YP6A 1PRXA 3J7Yb 1B9YC 4L8EA 3EE2A 4K6XA 5ELAA 2PU9C 2YV7A 1XW5A 1XWKA 4Q5RA 5G30A 2EIQA 4CY6A 4EDZA 5A5HA 2GSRA 3IRAA 3SWLA 1YJ6A 2B5YA 3CBUA 4WKWA 1Q98A 2H0GA 5B7CA 4EO3A 3ZMKA 2H0HA 1QMVA 4IS0A 1RK4A 4ZBBA 1GSUA 2FNOA 1M2AA 4G01A 4ACSA 3GMFA 6GSTA 4D73A 3GRXA 5LD0A 5HFKA 2K8VA 2YPMA 4FYBA 4LL4B 5KN2A 3VFIA 1GLQA 5IMAA 5HR0A 4PUAA 2PBJA 3JCML 3AY8A 3FZ5A 4AGSA 2DIYA 1GWCA 1A8YA 4BL7B 4KX4A 4YKGA 1FVKA 4JZQA 2A4HA 2YWOA 4KB3A 5LNKe 3IHGA 2VKZG 3KP8A 1TKDB 3FYGA 2YJ7A 4ZIJA 5IO0A 1EEMA 1MDKA 1BJXA 4N11A 3LGCA 1GLPA 1GP1A 1R26A 2EFEA 4OD7A 3HDCA 5BMUB 1GSFA 2HRKA 4NXIA 3LYKA 4POBA 3QAWA 2YZHA 3L4NA 5IPHA 5J4VA 1EZKA 1X9SB 5ELGA 3GFKA 5A4WA 1ERVA 12GSA 4AKIA 3EURA 4MDCA 3KTLA 2OBKA 3UVTA 1ERTA 3GSSA 2MMAA 2XC2A 1SKWB 4XS4A 1H75A 4O5UA 4BPYA 2DKIA 1DUGA
chains in the Genus database with same CATH topology
5J40A 4MPGA 4A5PA 2PUKC 4ML1A 5GSSA 1R5AA 3HA9A 4F2IA 1YVLA 1R7HA 2HQTA 2F8AA 4ZL7A 3CSHA 5B8BA 5DQSA 1TRWA 4GLTA 1AW9A 1Z7PA 1VRSD 3D0ZA 2LNTA 1XVQA 2VOCA 4MZWA 3J7Yk 2R5GA 4HI7A 2CVBA 4IBPA 5IOWA 3FY7A 5HQPA 2BTOT 5ABRA 1U87A 4KE3A 4O32A 5EL8A 1V98A 3D22A 2OKAA 3UMAA 3HJMA 4ZBAA 6GSWA 1BYEA 3PGTA 3TJGA 3QMXA 1O6JA 1AQVA 3VWXA 2RUEA 4KNDA 4YAPA 2EIRA 2MMNA 2B7KA 4WF4A 4FYUA 3VWWA 3IE3A 2L59A 3GTUB 4DSRA 4LMWA 1KEBA 1JZOA 1SYRA 3EC3A 5HR3A 4NPBA 3QOUA 3LYPA 4QL9A 4RQXA 3M0FA 2IWTA 1J08A 1TTZA 3LORA 1SVMA 2CZ2A 1BAYA 4WXTA 1AUCA 4ZL8A 4ZILA 3GX8A 2CZ3A 1IYHA 2LEGA 4K8MA 4L5LA 7GSSA 5BRTA 4AJ7A 1FO5A 1AXDA 1OC9A 3BOAA 2HRFA 2YV9A 1TK8B 2DC5A 2OE1A 1AQWA 3TKQA 1J0FA 4HZ2A 2KUCA 5ECMB 1ZYNA 1PGTA 4TR1B 2CAIA 2HE3A 3MAKA 2GZZA 4KH7A 4O7HA 4USSA 3F3RA 3TKSC 4I2UA 1YKCA 4XS1A 1FW1A 1M0UA 1BF5A 4KA0A 2ON5A 5CO3A 2WJUA 3GHAA 4PGTA 2AUVA 3IXRA 4IELA 4K0GA 4KGIA 2MYGA 2DJKA 4IQ1A 1FHEA 2VUPA 4PURA 3TUEA 3WT1A 4BVXB 3TOUA 3O3TA 5DBQA 5HR2A 3EU3A 4OFNA 1FB0A 1ZZYA 3Q19A 3PR8A 3F9UA 4KDXA 2R0GA 3ME8A 2A2PA 2O7KA 1GSYA 3I69A 2YWMA 3UIWA 4EIQA 1XXUA 4PUFC 5CYYA 3HMJG 2BJXA 4AKGA 2M80A 3HZ4A 4G0LA 1GNEA 1U6TA 4LMVA 2VIMA 2J9HA 4F82A 2L5OA 2YZUA 1Z6NA 3FZ4A 5KN1A 3LXTA 1YKAA 2O87A 4KCAA 2JSYA 2I81A 1T3BA 1ABAA 2RLIA 4ZB9A 4BVYB 1F6MC 2GQLA 1IYIA 3IAM2 4ZL9A 2VL2A 3IC4A 2H1LA 4N30A 3I9V2 1X5CA 1W89A 2YNXA 5HFGA 2V41A 3GX0A 4JEDA 1XOAA 3ZITA 4HOJA 1OE8A 5KN0A 2X64A 1NHYA 3TOTA 14GSA 1QQ2A 3UEMA 4HUAA 3L9VA 3UOMA 1TOFA 1F3AA 1OKTA 3KIJA 1DE1A 5KOXA 1QK8A 5F07A 3ERWA 1UVZA 1WJKA 2PMTA 1PA3A 2F9SA 2C1YA 4WETA 2QGVA 1Z9HA 2NVLA 4NV5A 8GSSA 1O8WA 1G6YA 3KMNA 1HYUA 3PPUA 4Q5QA 1SL1B 5ECOB 2XPDA 4HQSA 4Q5NA 5ECHB 2XPEA 2IFQA 1WOUA 2HZEA 3RPPA 2H1DA 4KDUA 2IMKA 5DQYA 4HS1A 2VL3A 2R6KA 1GSDA 5GZZB 4P3YB 2C0FA 1N2AA 2GSTA 1GNWA 2EIOA 1A2MA 4F03A 3ZFLA 4Z2TA 4KUNA 5FHIA 3GYKA 3HD5A 3CMIA 5FT3A 4QL7A 3LJRA 5IM9A 1YY7A 4OO5A 2VM1A 4I5QA 3D4TA 4IVFA 3RPNA 3LWAA 2FA8A 3W8SA 1SK1A 2DSAA 3F4TA 4O5RA 1TXUA 5G5FA 1M99A 1EP8A 1TI1A 3D5JA 3L9UA 2H6ZA 2GLRA 2M46A 3QAVA 1ON4A 2VCXA 1Y6EA 3HCZA 2LJRA 2K18A 1GUMA 3FMWA 2L6DA 2V1MA 4ECBA 1XZOA 5D8IA 4POLA 2AAWA 3APSA 1TRUA 4KAEA 3E9JB 1RQMA 3VWUA 6GSXA 1NM3A 2TRXA 1GUKA 1ZGNA 1URMA 1S3CA 4X1UA 3EINA 2H76A 3EU4A 5DALB 1ZL9A 4DSSB 1FAAA 2KOKA 3ZRDA 3MWHA 5GSTA 4ZB7A 5FWGA 3WD6A 3SBCA 4JRRA 5A1NA 3D6IA 4LA1A 2IN3A 2AJQB 1SD9A 1PQNA 2EFDA 3PH9A 5F8BA 2V6OA 5A5HB 4MA9A 3WYWA 1XOBA 5INYA 5ECIB 4GRFA 2LQOA 3RBTA 2FWFA 3C73A 2GS3A 3UL3A 4E8EA 2LKUA 3H8QA 2IMDA 3ZVJD 3WGEA 3GIXA 4IGJA 4FO5A 3DIEA 2VAFA 3TJBA 1T8EB 5A34A 1TP9A 5H5QA 3TKSE 2PVOC 2E0QA 4K0NA 2JZRA 5ID2B 3KEBA 2B6MA 3QR6A 1SYXA 2X49A 4DVCA 2FWGA 4MK3A 4XTSA 3IA1A 2C3QA 2L6CA 3CYNA 1TK5B 4EC0A 2HRNA 4MF6A 2JL4A 1B4PA 3RHBA 5ECRB 2VCVA 3A5WA 3RAZA 2OADA 3I6AA 2JZSA 1WMJA 1SJ6A 5G31A 3L9SA 4K2XA 1ZOFA 2LQQA 1FOHA 2WULA 1G7EA 2UZ8A 2H01A 2OJLA 3NIVA 4IN0A 4POMA 4J2FA 1EOGA 3FR6A 1SVOA 1PN0A 1Z6MA 5J5NA 2GSSA 1FVJA 3EMXA 2WCIA 2VCTA 1Q4JA 1V2AA 3EYTA 2OE0A 4XRAA 3O76A 3HY2A 1XWCA 2VM2A 2H1AA 2DIZA 3P8WA 2C0GA 4WR5A 4TR3A 11GSA 1YEPA 3F4SA 2Z9SA 3FK8A 2QSIA 4GSTA 2FD3A 5HR1A 1USBA 2OA7A 4GCIA 4OCFA 3M1GA 2G2QA 1DBYA 3BCIA 4AI6A 1YF1A 4LLRA 1HNBA 4TOPA 3LFLA 2BMXA 2HZFA 2VD0A 2YANA 5JWRB 3WGXA 2H74A 5IMFA 5DAKA 4V1Ag 1GUHA 2AYTA 4PQ1A 4MH2A 4J56E 2GT6A 5E4WA 1G6WA 1AC1A 4WF5A 2HRAA 3ZVJA 3VLNA 2CQ9A 1MD3A 4TXOB 2QC7A 2WS2A 2MBSA 2HYXA 2A2RA 1Z3EA 3GKNA 3WT2A 3TRPA 4RUVA 1O73A 1TU8A 3UVHA 3DGQA 3R2QA 4BL7A 4HEA2 1EOHA 3GKXA 1X5DA 3ZZXA 5ECKB 5CAXA 4OFTA 3N5OA 3IK9A 2FUG2 3E3EA 5D9TA 1UN2A 4IQAA 3GV1A 1TK0B 5BMUA 1N8JA 2UV8G 4QMKA 2TIRA 4E8HA 3TJJA 4GDFA 3FZAA 6GSSA 4FH8A 1S3DA 5DJLA 5AGYA 1K0AA 4WBRD 4POKA 5AIVA 5ECPB 4K5RA 2PVQA 3DYRA 3NZNA 4EVMA 2RM5A 4AJ8A 2FA4A 3MDKA 5IMZA 4MNNA 1Y25A 3BBYA 1SENA 4TN8A 2VLVA 4O5QA 3P90A 3H79A 3UJ1A 5A4UA 2M72A 4V2MA 1GL8A 2YN1A 2H71A 2AB6A 1WE0A 5IQYA 3IAS2 4X4JA 4MJEA 4X43A 3FW2A 2PWJA 4ECCA 2H75A 4L0UA 2X99A 2F3MA 3RDWA 2O5VA 3VI5A 3FEUA 1F2EA 2REMA 4EDYA 1BX9A 2FWHA 4XS6A 3QD9A 1MD4A 2VCZA 2IPAA 1A8LA 2C3NA 1S3AA 3GURA 4MLYA 1GTAA 2VL2C 5CREA 4K9ZA 4E68A 3A2XA 1THOA 3ISOA 3BJ5A 3VURA 2NBSA 4Q5FA 1YZXA 2CX4A 5IO2A 3TRXA 1M2DA 1XW9A 1GRXA 4IP1A 3PINA 3GTUA 1UC7A 3ED3A 3VI7A 2DMLA 1SVLA 3C71A 3GUSA 1M9BA 4N10A 2CV4A 4K7NA 1LBKA 4TW5A 1C72A 2HSMA 3KM6A 5F06A 4I8BA 6GSVA 3K8NA 3LQ7A 1O7UA 3TU3B 4DSQA 5D9VA 2K9FA 3US3A 2WGRA 2HSNA 4MZCA 4AKHA 2R37A 2RIIA 1AAZA 3ME7A 4JR4A 2R2JA 1QFNA 1QXHA 1F37A 4TKYA 18GSA 2FGXA 1VF3A 4IP6A 1KBNA 1PMTA 3QPMA 5CRGA 2VCQA 17GSA 2GSQA 4TR1A 3M8NA 1HQOA 1LU4A 3KP9A 1H4OA 2VL9A 1B9XC 3HKRA 1SJIA 3RHCA 1W4VA 2H19A 4JBBA 4ECIA 2IIYA 2GTUA 1V40A 1SU9A 1Y1UA 4I6XA 5DCGA 4GSNA 4IHUA 2ZNMA 3TKPA 1AQXA 1FB6A 5JWOB 2LUSA 4BVXA 1R5PA 3KH7A 3FR9A 3FKFA 3S9FA 3P2AA 1GSEA 1OYJA 1XBSA 3IC8A 1A23A 3CSJA 2AV4A 4OO4A 2P31A 3DMLA 2E2MA 5ECLB 2NDOA 2ALBA 3DD3A 2A4VA 2KHPA 4TVEA 2VD1A 2J23A 4AF2A 3F0IA 3C1SA 2YWIA 1OC3A 1ZYPA 2V2GA 4KSOA 4TRXA 3TKRA 5GAPD 4CHSA 2E2GA 4CDOA 4OFMA 4NHZA 5IMCA 1B8XA 1GSQA 1G0TA 3H4KA 4JE1A 2O85A 1HNAA 1AIUA 3A5IA 5KOWA 3D21A 3KMOA 2ZCTA 2KLXA 1CQGA 4BVYA 4ICYA 2H6XA 4DEJA 1K3LA 3H93A 3H1NA 3M9KA 4YQVA 3R3EA 3C8EA 2CVDA 4BA7A 2GZPA 4ID0A 5A4VA 3WGDA 3UBKA 5J41A 5DVBA 1EGRA 4N0VA 1B48A 2H1GA 2QA2A 1PKWA 1PL1A 1XPVA 2JADA 1O81A 4N3ZA 1ERUA 4ZB8A 5A1NB 2H70A 2PGTA 1U3IA 2WZ9A 3C1RA 4NMUA 3EWLA 5KN3A 1EEJA 3LSZA 5COHA 3HVXA 2HNLA 3LG6A 1THXA 3KH9A 2YWNA 5CRHA 5GAND 2N5BA 1NHOA 1Z5YE 5G1KA 1V9WA 3TJFA 4ISDA 2G0FA 2QA1A 3VPTA 2B5EA 5C04A 3ERGA 4GTUA 1TRVA 3VPQA 2WB9A 4MCUA 2DJ1A 3OR5A 2H0IA 3DEXA 4KCEA 2LNSA 1XWGA 1GH2A 4XHMA 1QUWA 2XBIA 1X5EA 4EIPA 1GULA 5DJMA 5C00A 2VCWA 4XCSA 2C4JA 2EFHA 1SL2B 2H6YA 4PQHA 4ECJA 3UAPA 1SJZA 4TR4A 3IR4A 3DVWA 3ZIVA 3CTFA 5ECNB 3O6TA 4EL1A 2D2ZA 6GSUA 2MZCA 4CW9A 4G10A 2R0CA 3KTBA 2F51A 3D4MA 3F6FA 1G7OA 4I97A 2HSYA 2R4VA 5ECQB 4K1FA 3GKMA 4GQCA 4D73B 4GF0A 4EF0A 3GN3A 4MMMA 1ZYQB 2P5QA 3ZMLA 1PD21 3I43A 1EV4A 5KEJA 2RM6A 4XIHA 5D9XA 2H30A 2WRTA 2IL3A 4GSSA 2B3SA 4NHWA 2PN8A 4V2LA 2C0DA 3HYPA 2AHEA 3U6VA 5EY6A 1LJRA 2EFCA 4YQUA 2HXKA 2MMZA 1FG4A 2VLTA 4OMVA 4G0IA 5DALA 4DSSA 3M3MA 1XVWA 3MNGA 4TR0A 2WFCA 2NTOA 1F3BA 3DRNA 5CNWA 2X8CA 2OBIA 3G7YA 4GQFA 1T4ZA 2HRKB 1SD8A 4YQMA 20GSA 4W66A 5ECSA 3A2WA 4I2TA 2YJHA 2LTKA 4ZBDA 5DAKB 1OVNA 3F63A 5H5RA 2GZYA 3CWGA 3HVVA 2YCDA 1V57A 1T4YA 4NV2A 2HI7A 2GGTA 1XIYA 1M9AA 4XS4B 1SKRB 3IPZA 3CSIA 2HT9A 1E6BA 2V6KA 5ID2A 1JFUA 3IHQA 1HD2A 2DJJA 4WR4A 3QFBC 1K0NA 2B5XA 2LRTA 2OACA 2PERA 3TRQA 10GSA 2X8HA 4HU7A 1RW1A 1TU7A 4MJCA 5L71A 4Z7XA 2OE3A 2LS5A 5D96A 3FR3A 1KNGA 3KJYA 4V1Ap 5E59A 2P5RA 4KW6A 1BQ7A 1E2YA 3ERFA 5J4UA 2DJ2A 4IJ3A 4FIWA 4F0CA 2DMMA 4IJIA 5CRWA 3L0HA 3F6DA 1TRSA 2O89A 3IBHA 5IMDA 1X9MB 1A0RP 5B8AA 3GA4A 5G1LA 2L4CA 3GSTA 5JCUA 2VLUA 2CT6A 2DBCA 1PN9A 3U5RE 3ZTLA 1M7TA 4KDYA 5ENUA 4NWYA 4BWQA 1MDJA 5IPGA 9GSSA 2C3TA 4HJ2A 2WDUA 2CVKA 3UARA 2LRNA 1GTUA 4WEYA 1MEKA 4EE0A 3GL5A 4K7IA 4ML6A 2ES7A 1O85A 3Q6OA 2I9HA 4RI7A 3M9JA 1ERWA 1JLVA 3DVXA 2IMFA 3ZLPA 1OC9B 2N5AA 3CRTA 2CA8A 3GKKA 1K0BA 1WP0A 2B1KA 3HXSA 3FRCA 4ULXA 1DE2A 4MF5A 5J47A 2LJKA 2NPBA 2H66A 1K3YA 4TXOA 5LCZA 2K8SA 1TXXA 1KTEA 1DSBA 4OCEA 5HFIA 2L5LA 1BG5A 1TDIA 4PXOA 1ZYEA 1GSSA 4LL1B 4G0KA 6GSYA 2B1LA 5IOXA 3G7JA 5IIZA 2EC4A 3GNJA 5EVOA 1XWBA 1ST9A 1ZMAA 1N25A 4F0BA 3ZFBA 1Z7RA 2HSMB 4X0XA 2FCHA 2E7PA 1WPIA 1PX7A 3KD0A 2XBQA 2YOIA 2I4AA 22GSA 1SL0B 2V32A 4JU5A 1YQ1A 2DJ3A 1PSQA 4GWRA 2HSNB 3DXBA 4HU9A 4FQUA 4K7OA 4G9HA 4KF9A 3BD2A 4K5SA 3TCOA 1XFLA 1TW9A 2XHFA 5J3RA 1YF0A 3W8JA 3QCPA 1JZWA 5IMVA 1EWXA 2IMIA 1VF1A 1WRYA 4TXVA 1QGVA 2ZUPA 3EPTA 1NSWA 2JSZA 2JU5A 5A5KA 3TJKA 5JCWA 4V2NA 4IW9A 4PNFA 1J9BA 4HZ4A 2IMEA 1I5GA 3NOFA 2H8LA 3EMPA 3HJPA 1T7PB 3DWVA 1R4WA 3GH9A 5AISA 2F8FA 4O92A 3A2VA 2O8VB 1YEXA 4N0ZA 1TI3A 2H72A 1K0CA 1V58A 2JACA 4J57E 2H73A 3Q18A 2HSHA 1TJDA 3TGZA 4PTSA 1OAZA 4XRDA 2C0EA 2X8GA 4ZXGA 2X4AA 1F9MA 3F8UA 2DJ0A 2PPTA 3ZREA 1M2BA 2MBTA 1XCCA 4Z2RA 1VGLA 3APOA 4YH2A 3TB2A 1B4QA 1CQHA 5B6MA 1GTBA 3MSZA 3IDVA 2TRCP 5D93A 3HHVA 2IFQB 4MJBA 2VO4A 4YAVA 2HZEB 1K3OA 2CX3A 3UBLA 3Q74A 1T00A 4F9ZA 1ACVA 5J9BA 4RQRA 3KXOA 4MH3A 2MMOA 2P0GA 4RI6A 4PNGA 1WWJA 3L78A 4MF7A 5D73A 1NW2A 3MIXA 1XW6A 3TKSA 1I9DA 2DLXA 2K6VA 4WBJA 5G2ZA 2GVPA 5F05A 4JR6A 4G19A 2B7JA 5F0GA 1K0MA 2FLSA 3KCMA 1O8XA 2I1UA 3QAGA 3ZIJA 2OT3A 1SKSB 5JWQB 1OE7A 3F4RA 1BG1A 4KSMA 3VWVA 4EKZA 2L57A 1ILOA 2QKEA 3BCKA 2GQKA 1PKZA 5AN1A 4MP4A 2A2SA 2LJAA 1MTCA 4MABA 4CY8A 2ON7A 2KP1A 1JZRA 3LEFA 5CP1A 4YKFA 2C80A 3HZ8A 3P7XA 1ZCPA 5J9CA 4L5OA 3ZYWA 2LSTA 2GT5A 3QFAC 2R0PA 2JZTA 3FHKA 4K2DA 2GDRA 4ZB6A 1JZDA 4HQZA 5DCHA 19GSA 1PL2A 3W6GA 2CAQA 1BEDA 13GSA 5B6NA 16GSA 2I3YA 1SK0A 1K0DA 2FY6A 1X9WB 3E0UA 4BWSA 3KZQA 1JLWA 1K0OA 2N5FA 3GH6A 3KGKA 2HLSA 3EVIA 1U3AA 3IK7A 3VK9A 2L4QA 4G2EA 2H1BA 4L0WA 3MYDA 3LXZA 2FWEA 1OKDA 3GL3A 1EV9A 1A0FA 4PQIA 1PX6A 4OWYA 2FHEA 4EUYA 1XWAA 4EXJA 5D9WA 1T1VA 2LRCA 5DDLA 1GTIA 2RUFA 5JCGA 1HNCA 3G9BA 4QQ7A 5A34B 1ML6A 4ILFA 3ZL5A 3N9JA 5H5SA 2C8UA 1MDIA 2LV3A 1OC8A 3FZ9A 3F3QA 1WIKA 2GQMA 3G7IA 1A24A 3LW9A 4MZBA 3TDGA 3C7MA 4NAXA 2KP2A 1VF4A 4AJ6A 2DKHA 4H86A 4IKHA 1A2LA 1SK2A 4MPFA 3HJOA 4AKXB 3CXGA 3V1WA 1EP7A 4FYCA 5G5EA 2IJYA 4HJMA 1JHBA 4HDEA 3HVSA 5CRDA 5EPFA 2R3XA 2HFDA 1U88A 1X0RA 1YDKA 4GXZA 3A3TA 3DKSA 3CRUA 4Z2UA 1UA5A 3IV4A 1FOVA 5AIXA 1EGOA 1A2JA 3APQA 1VF2A 5J4YA 4MJAA 3QDNA 4PX1A 3IOSA 3CTGA 2YP6A 1PRXA 3J7Yb 1B9YC 4L8EA 3EE2A 4K6XA 5ELAA 2PU9C 2YV7A 1XW5A 1XWKA 4Q5RA 5G30A 2EIQA 4CY6A 4EDZA 5A5HA 2GSRA 3IRAA 3SWLA 1YJ6A 2B5YA 3CBUA 4WKWA 1Q98A 2H0GA 5B7CA 4EO3A 3ZMKA 2H0HA 1QMVA 4IS0A 1RK4A 4ZBBA 1GSUA 2FNOA 1M2AA 4G01A 4ACSA 3GMFA 6GSTA 4D73A 3GRXA 5LD0A 5HFKA 2K8VA 2YPMA 4FYBA 4LL4B 5KN2A 3VFIA 1GLQA 5IMAA 5HR0A 4PUAA 2PBJA 3JCML 3AY8A 3FZ5A 4AGSA 2DIYA 1GWCA 1A8YA 4BL7B 4KX4A 4YKGA 1FVKA 4JZQA 2A4HA 2YWOA 4KB3A 5LNKe 3IHGA 2VKZG 3KP8A 1TKDB 3FYGA 2YJ7A 4ZIJA 5IO0A 1EEMA 1MDKA 1BJXA 4N11A 3LGCA 1GLPA 1GP1A 1R26A 2EFEA 4OD7A 3HDCA 5BMUB 1GSFA 2HRKA 4NXIA 3LYKA 4POBA 3QAWA 2YZHA 3L4NA 5IPHA 5J4VA 1EZKA 1X9SB 5ELGA 3GFKA 5A4WA 1ERVA 12GSA 4AKIA 3EURA 4MDCA 3KTLA 2OBKA 3UVTA 1ERTA 3GSSA 2MMAA 2XC2A 1SKWB 4XS4A 1H75A 4O5UA 4BPYA 2DKIA 1DUGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MPG A;  2PUK C;  4ML1 A;  5GSS A;  1R5A A;  3HA9 A;  4F2I A;  1R7H A;  2HQT A;  2F8A A;  4ZL7 A;  3CSH A;  5B8B A;  5DQS A;  1TRW A;  4GLT A;  1AW9 A;  1Z7P A;  1VRS D;  3D0Z A;  2LNT A;  1XVQ A;  2VOC A;  4MZW A;  3J7Y k;  2R5G A;  4HI7 A;  2CVB A;  4IBP A;  5IOW A;  3FY7 A;  5HQP A;  2BTO T;  5ABR A;  1U87 A;  4KE3 A;  4O32 A;  5EL8 A;  1V98 A;  3D22 A;  2OKA A;  3UMA A;  3HJM A;  4ZBA A;  6GSW A;  1BYE A;  3PGT A;  3TJG A;  3QMX A;  1O6J A;  1AQV A;  3VWX A;  2RUE A;  4KND A;  4YAP A;  2EIR A;  2MMN A;  2B7K A;  4WF4 A;  4FYU A;  3VWW A;  3IE3 A;  2L59 A;  3GTU B;  4DSR A;  4LMW A;  1KEB A;  1JZO A;  1SYR A;  3EC3 A;  5HR3 A;  4NPB A;  3QOU A;  3LYP A;  4QL9 A;  4RQX A;  3M0F A;  2IWT A;  1J08 A;  1TTZ A;  3LOR A;  2CZ2 A;  1BAY A;  4WXT A;  1AUC A;  4ZL8 A;  4ZIL A;  3GX8 A;  2CZ3 A;  1IYH A;  2LEG A;  4K8M A;  4L5L A;  7GSS A;  4AJ7 A;  1FO5 A;  1AXD A;  1OC9 A;  3BOA A;  2HRF A;  2YV9 A;  1TK8 B;  2DC5 A;  2OE1 A;  1AQW A;  3TKQ A;  1J0F A;  4HZ2 A;  2KUC A;  5ECM B;  1PGT A;  4TR1 B;  2CAI A;  2HE3 A;  3MAK A;  2GZZ A;  4KH7 A;  4O7H A;  4USS A;  3F3R A;  3TKS C;  4I2U A;  1YKC A;  4XS1 A;  1FW1 A;  1M0U A;  4KA0 A;  2ON5 A;  5CO3 A;  2WJU A;  3GHA A;  4PGT A;  2AUV A;  3IXR A;  4IEL A;  4K0G A;  4KGI A;  2MYG A;  2DJK A;  4IQ1 A;  1FHE A;  2VUP A;  4PUR A;  3TUE A;  3WT1 A;  4BVX B;  3TOU A;  3O3T A;  5DBQ A;  5HR2 A;  3EU3 A;  4OFN A;  1FB0 A;  1ZZY A;  3Q19 A;  3PR8 A;  3F9U A;  4KDX A;  3ME8 A;  2O7K A;  1GSY A;  3I69 A;  2YWM A;  3UIW A;  1XXU A;  4PUF C;  5CYY A;  2BJX A;  2M80 A;  3HZ4 A;  4G0L A;  1GNE A;  1U6T A;  4LMV A;  2VIM A;  2J9H A;  4F82 A;  2L5O A;  2YZU A;  1Z6N A;  3FZ4 A;  5KN1 A;  3LXT A;  1YKA A;  2O87 A;  4KCA A;  2JSY A;  2I81 A;  1T3B A;  1ABA A;  2RLI A;  4ZB9 A;  4BVY B;  1F6M C;  2GQL A;  1IYI A;  3IAM 2;  4ZL9 A;  2VL2 A;  3IC4 A;  4N30 A;  3I9V 2;  1X5C A;  1W89 A;  2YNX A;  5HFG A;  2V41 A;  3GX0 A;  4JED A;  1XOA A;  3ZIT A;  4HOJ A;  1OE8 A;  5KN0 A;  2X64 A;  1NHY A;  3TOT A;  14GS A;  1QQ2 A;  3UEM A;  4HUA A;  3L9V A;  3UOM A;  1TOF A;  1F3A A;  1OKT A;  3KIJ A;  1DE1 A;  1QK8 A;  5F07 A;  3ERW A;  1UVZ A;  1WJK A;  2PMT A;  1PA3 A;  2F9S A;  2C1Y A;  4WET A;  2QGV A;  1Z9H A;  2NVL A;  4NV5 A;  8GSS A;  1O8W A;  1G6Y A;  3KMN A;  1HYU A;  3PPU A;  4Q5Q A;  1SL1 B;  5ECO B;  2XPD A;  4HQS A;  4Q5N A;  5ECH B;  2XPE A;  2IFQ A;  1WOU A;  2HZE A;  3RPP A;  2H1D A;  4KDU A;  2IMK A;  5DQY A;  4HS1 A;  2VL3 A;  2R6K A;  1GSD A;  5GZZ B;  4P3Y B;  2C0F A;  1N2A A;  2GST A;  1GNW A;  2EIO A;  1A2M A;  4F03 A;  3ZFL A;  4KUN A;  5FHI A;  3GYK A;  3HD5 A;  3CMI A;  5FT3 A;  4QL7 A;  3LJR A;  5IM9 A;  1YY7 A;  4OO5 A;  2VM1 A;  4I5Q A;  3D4T A;  4IVF A;  3RPN A;  3LWA A;  2FA8 A;  3W8S A;  1SK1 A;  2DSA A;  3F4T A;  4O5R A;  5G5F A;  1M99 A;  1EP8 A;  1TI1 A;  3D5J A;  3L9U A;  2H6Z A;  2GLR A;  2M46 A;  3QAV A;  1ON4 A;  2VCX A;  1Y6E A;  3HCZ A;  2LJR A;  2K18 A;  1GUM A;  2L6D A;  2V1M A;  4ECB A;  1XZO A;  5D8I A;  4POL A;  2AAW A;  3APS A;  1TRU A;  4KAE A;  3E9J B;  1RQM A;  3VWU A;  6GSX A;  1NM3 A;  2TRX A;  1GUK A;  1ZGN A;  1URM A;  1S3C A;  4X1U A;  3EIN A;  2H76 A;  3EU4 A;  5DAL B;  1ZL9 A;  4DSS B;  1FAA A;  2KOK A;  3ZRD A;  3MWH A;  5GST A;  5FWG A;  3WD6 A;  3SBC A;  4JRR A;  3D6I A;  4LA1 A;  2IN3 A;  2AJQ B;  1SD9 A;  1PQN A;  3PH9 A;  5F8B A;  2V6O A;  4MA9 A;  3WYW A;  1XOB A;  5INY A;  5ECI B;  4GRF A;  2LQO A;  3RBT A;  2FWF A;  3C73 A;  2GS3 A;  3UL3 A;  4E8E A;  2LKU A;  3H8Q A;  2IMD A;  3ZVJ D;  3WGE A;  3GIX A;  4IGJ A;  4FO5 A;  3DIE A;  2VAF A;  3TJB A;  1T8E B;  1TP9 A;  5H5Q A;  3TKS E;  2PVO C;  2E0Q A;  4K0N A;  2JZR A;  5ID2 B;  3KEB A;  2B6M A;  3QR6 A;  1SYX A;  4DVC A;  2FWG A;  4MK3 A;  4XTS A;  3IA1 A;  2C3Q A;  2L6C A;  3CYN A;  1TK5 B;  4EC0 A;  2HRN A;  4MF6 A;  2JL4 A;  1B4P A;  3RHB A;  5ECR B;  2VCV A;  3A5W A;  3RAZ A;  2OAD A;  3I6A A;  2JZS A;  1WMJ A;  1SJ6 A;  5G31 A;  3L9S A;  1ZOF A;  2LQQ A;  2WUL A;  1G7E A;  2UZ8 A;  2H01 A;  2OJL A;  3NIV A;  4IN0 A;  4POM A;  4J2F A;  1EOG A;  3FR6 A;  1Z6M A;  5J5N A;  2GSS A;  1FVJ A;  3EMX A;  2WCI A;  2VCT A;  1Q4J A;  1V2A A;  3EYT A;  2OE0 A;  4XRA A;  3O76 A;  3HY2 A;  1XWC A;  2VM2 A;  2H1A A;  2DIZ A;  3P8W A;  2C0G A;  4WR5 A;  4TR3 A;  11GS A;  1YEP A;  3F4S A;  2Z9S A;  3FK8 A;  2QSI A;  4GST A;  2FD3 A;  5HR1 A;  1USB A;  2OA7 A;  4GCI A;  4OCF A;  3M1G A;  2G2Q A;  1DBY A;  3BCI A;  1YF1 A;  4LLR A;  1HNB A;  4TOP A;  3LFL A;  2BMX A;  2HZF A;  2VD0 A;  2YAN A;  5JWR B;  3WGX A;  2H74 A;  5IMF A;  5DAK A;  4V1A g;  1GUH A;  2AYT A;  4PQ1 A;  4MH2 A;  4J56 E;  2GT6 A;  5E4W A;  1G6W A;  1AC1 A;  4WF5 A;  2HRA A;  3ZVJ A;  3VLN A;  2CQ9 A;  1MD3 A;  4TXO B;  2QC7 A;  2WS2 A;  2MBS A;  2HYX A;  2A2R A;  1Z3E A;  3GKN A;  3WT2 A;  3TRP A;  4RUV A;  1O73 A;  1TU8 A;  3UVH A;  3DGQ A;  3R2Q A;  4BL7 A;  4HEA 2;  1EOH A;  3GKX A;  1X5D A;  3ZZX A;  5ECK B;  5CAX A;  4OFT A;  3N5O A;  3IK9 A;  2FUG 2;  3E3E A;  5D9T A;  1UN2 A;  4IQA A;  3GV1 A;  1TK0 B;  5BMU A;  1N8J A;  2TIR A;  4E8H A;  3TJJ A;  3FZA A;  6GSS A;  4FH8 A;  1S3D A;  5DJL A;  5AGY A;  1K0A A;  4WBR D;  4POK A;  5AIV A;  5ECP B;  2PVQ A;  3DYR A;  3NZN A;  4EVM A;  2RM5 A;  4AJ8 A;  2FA4 A;  3MDK A;  5IMZ A;  1Y25 A;  3BBY A;  1SEN A;  4TN8 A;  2VLV A;  3P90 A;  3H79 A;  3UJ1 A;  5A4U A;  2M72 A;  4V2M A;  1GL8 A;  2YN1 A;  2H71 A;  2AB6 A;  1WE0 A;  5IQY A;  3IAS 2;  4MJE A;  4X43 A;  3FW2 A;  2PWJ A;  4ECC A;  2H75 A;  4L0U A;  2X99 A;  2F3M A;  3RDW A;  3VI5 A;  3FEU A;  1F2E A;  2REM A;  4EDY A;  1BX9 A;  2FWH A;  4XS6 A;  3QD9 A;  1MD4 A;  2VCZ A;  2IPA A;  1A8L A;  2C3N A;  1S3A A;  3GUR A;  4MLY A;  1GTA A;  2VL2 C;  5CRE A;  4K9Z A;  3A2X A;  1THO A;  3ISO A;  3BJ5 A;  3VUR A;  2NBS A;  4Q5F A;  1YZX A;  2CX4 A;  5IO2 A;  3TRX A;  1M2D A;  1XW9 A;  1GRX A;  4IP1 A;  3PIN A;  3GTU A;  1UC7 A;  3ED3 A;  3VI7 A;  2DML A;  3C71 A;  3GUS A;  1M9B A;  4N10 A;  2CV4 A;  4K7N A;  1LBK A;  4TW5 A;  1C72 A;  2HSM A;  3KM6 A;  5F06 A;  4I8B A;  6GSV A;  3K8N A;  3LQ7 A;  1O7U A;  4DSQ A;  5D9V A;  2K9F A;  3US3 A;  2WGR A;  4MZC A;  2R37 A;  2RII A;  1AAZ A;  3ME7 A;  4JR4 A;  2R2J A;  1QFN A;  1QXH A;  1F37 A;  4TKY A;  18GS A;  2FGX A;  1VF3 A;  4IP6 A;  1KBN A;  1PMT A;  3QPM A;  5CRG A;  2VCQ A;  17GS A;  2GSQ A;  4TR1 A;  3M8N A;  1HQO A;  1LU4 A;  3KP9 A;  1H4O A;  2VL9 A;  1B9X C;  3HKR A;  1SJI A;  3RHC A;  1W4V A;  2H19 A;  4JBB A;  4ECI A;  2IIY A;  2GTU A;  1V40 A;  1SU9 A;  4I6X A;  5DCG A;  4GSN A;  4IHU A;  2ZNM A;  3TKP A;  1AQX A;  1FB6 A;  5JWO B;  2LUS A;  4BVX A;  1R5P A;  3KH7 A;  3FR9 A;  3FKF A;  3S9F A;  3P2A A;  1GSE A;  1OYJ A;  1XBS A;  3IC8 A;  1A23 A;  3CSJ A;  2AV4 A;  4OO4 A;  2P31 A;  3DML A;  2E2M A;  5ECL B;  2NDO A;  2ALB A;  3DD3 A;  2A4V A;  2KHP A;  4TVE A;  2VD1 A;  2J23 A;  4AF2 A;  3F0I A;  2YWI A;  3C1S A;  1OC3 A;  2V2G A;  4KSO A;  4TRX A;  3TKR A;  5GAP D;  4CHS A;  2E2G A;  4CDO A;  4OFM A;  4NHZ A;  5IMC A;  1B8X A;  1GSQ A;  1G0T A;  3H4K A;  4JE1 A;  2O85 A;  1HNA A;  1AIU A;  3D21 A;  3KMO A;  2ZCT A;  2KLX A;  1CQG A;  4BVY A;  2H6X A;  4DEJ A;  1K3L A;  3H93 A;  3H1N A;  3M9K A;  4YQV A;  3R3E A;  3C8E A;  2CVD A;  4BA7 A;  2GZP A;  4ID0 A;  5A4V A;  3WGD A;  3UBK A;  5J41 A;  5DVB A;  1EGR A;  4N0V A;  1B48 A;  2H1G A;  1PKW A;  1PL1 A;  1XPV A;  2JAD A;  1O81 A;  1ERU A;  4ZB8 A;  2H70 A;  2PGT A;  1U3I A;  2WZ9 A;  3C1R A;  4NMU A;  3EWL A;  5KN3 A;  1EEJ A;  3LSZ A;  5COH A;  3HVX A;  2HNL A;  3LG6 A;  1THX A;  3KH9 A;  2YWN A;  5CRH A;  5GAN D;  2N5B A;  1NHO A;  1Z5Y E;  5G1K A;  1V9W A;  3TJF A;  4ISD A;  2G0F A;  3VPT A;  2B5E A;  5C04 A;  3ERG A;  4GTU A;  1TRV A;  3VPQ A;  2WB9 A;  4MCU A;  2DJ1 A;  3OR5 A;  2H0I A;  3DEX A;  4KCE A;  2LNS A;  1XWG A;  1GH2 A;  4XHM A;  1QUW A;  2XBI A;  1X5E A;  1GUL A;  5DJM A;  5C00 A;  2VCW A;  4XCS A;  2C4J A;  1SL2 B;  2H6Y A;  4PQH A;  4ECJ A;  3UAP A;  1SJZ A;  4TR4 A;  3IR4 A;  3DVW A;  3ZIV A;  3CTF A;  5ECN B;  3O6T A;  4EL1 A;  2D2Z A;  6GSU A;  2MZC A;  4CW9 A;  4G10 A;  3KTB A;  2F51 A;  3D4M A;  3F6F A;  1G7O A;  4I97 A;  2HSY A;  2R4V A;  5ECQ B;  4K1F A;  3GKM A;  4GQC A;  4D73 B;  4GF0 A;  4EF0 A;  3GN3 A;  4MMM A;  1ZYQ B;  2P5Q A;  3ZML A;  1PD2 1;  3I43 A;  1EV4 A;  5KEJ A;  2RM6 A;  4XIH A;  5D9X A;  2H30 A;  2WRT A;  2IL3 A;  4GSS A;  2B3S A;  4NHW A;  2PN8 A;  4V2L A;  2C0D A;  3HYP A;  2AHE A;  3U6V A;  5EY6 A;  1LJR A;  4YQU A;  2HXK A;  2MMZ A;  1FG4 A;  2VLT A;  4OMV A;  4G0I A;  5DAL A;  4DSS A;  3M3M A;  1XVW A;  3MNG A;  4TR0 A;  2WFC A;  2NTO A;  1F3B A;  3DRN A;  5CNW A;  2X8C A;  2OBI A;  3G7Y A;  4GQF A;  1T4Z A;  2HRK B;  1SD8 A;  4YQM A;  20GS A;  5ECS A;  3A2W A;  4I2T A;  2YJH A;  2LTK A;  4ZBD A;  5DAK B;  1OVN A;  3F63 A;  5H5R A;  2GZY A;  3HVV A;  2YCD A;  1V57 A;  1T4Y A;  4NV2 A;  2HI7 A;  2GGT A;  1XIY A;  1M9A A;  4XS4 B;  1SKR B;  3IPZ A;  3CSI A;  2HT9 A;  1E6B A;  2V6K A;  5ID2 A;  1JFU A;  3IHQ A;  1HD2 A;  2DJJ A;  4WR4 A;  3QFB C;  1K0N A;  2B5X A;  2LRT A;  2OAC A;  2PER A;  3TRQ A;  10GS A;  2X8H A;  4HU7 A;  1RW1 A;  1TU7 A;  4MJC A;  5L71 A;  4Z7X A;  2OE3 A;  2LS5 A;  5D96 A;  3FR3 A;  1KNG A;  3KJY A;  4V1A p;  5E59 A;  2P5R A;  4KW6 A;  1BQ7 A;  1E2Y A;  3ERF A;  5J4U A;  2DJ2 A;  4IJ3 A;  4FIW A;  4F0C A;  2DMM A;  4IJI A;  5CRW A;  3L0H A;  3F6D A;  1TRS A;  2O89 A;  3IBH A;  5IMD A;  1X9M B;  1A0R P;  5B8A A;  3GA4 A;  5G1L A;  2L4C A;  3GST A;  5JCU A;  2VLU A;  2CT6 A;  2DBC A;  1PN9 A;  3U5R E;  3ZTL A;  1M7T A;  4KDY A;  5ENU A;  4NWY A;  4BWQ A;  1MDJ A;  5IPG A;  9GSS A;  2C3T A;  4HJ2 A;  2WDU A;  2CVK A;  3UAR A;  2LRN A;  1GTU A;  4WEY A;  1MEK A;  4EE0 A;  3GL5 A;  4K7I A;  4ML6 A;  2ES7 A;  1O85 A;  3Q6O A;  2I9H A;  4RI7 A;  3M9J A;  1ERW A;  1JLV A;  3DVX A;  2IMF A;  3ZLP A;  1OC9 B;  2N5A A;  3CRT A;  2CA8 A;  3GKK A;  1K0B A;  1WP0 A;  2B1K A;  3HXS A;  3FRC A;  4ULX A;  1DE2 A;  4MF5 A;  2LJK A;  2NPB A;  2H66 A;  1K3Y A;  4TXO A;  5LCZ A;  2K8S A;  1TXX A;  1KTE A;  1DSB A;  4OCE A;  5HFI A;  2L5L A;  1BG5 A;  1TDI A;  4PXO A;  1ZYE A;  1GSS A;  4LL1 B;  4G0K A;  6GSY A;  2B1L A;  5IOX A;  3G7J A;  5IIZ A;  2EC4 A;  3GNJ A;  5EVO A;  1XWB A;  1ST9 A;  1ZMA A;  4F0B A;  3ZFB A;  1Z7R A;  2HSM B;  4X0X A;  2FCH A;  2E7P A;  1WPI A;  1PX7 A;  3KD0 A;  2XBQ A;  2YOI A;  2I4A A;  22GS A;  1SL0 B;  2V32 A;  4JU5 A;  1YQ1 A;  2DJ3 A;  1PSQ A;  4GWR A;  2HSN B;  3DXB A;  4HU9 A;  4FQU A;  4K7O A;  4G9H A;  4KF9 A;  3BD2 A;  3TCO A;  1XFL A;  1TW9 A;  2XHF A;  5J3R A;  1YF0 A;  3W8J A;  3QCP A;  1JZW A;  5IMV A;  1EWX A;  2IMI A;  1VF1 A;  1WRY A;  4TXV A;  1QGV A;  2ZUP A;  1NSW A;  2JSZ A;  2JU5 A;  5A5K A;  3TJK A;  5JCW A;  4V2N A;  4IW9 A;  4PNF A;  1J9B A;  4HZ4 A;  2IME A;  1I5G A;  3NOF A;  2H8L A;  3EMP A;  3HJP A;  1T7P B;  3DWV A;  1R4W A;  3GH9 A;  5AIS A;  2F8F A;  4O92 A;  3A2V A;  2O8V B;  1YEX A;  4N0Z A;  1TI3 A;  2H72 A;  1K0C A;  1V58 A;  2JAC A;  4J57 E;  2H73 A;  3Q18 A;  2HSH A;  1TJD A;  3TGZ A;  4PTS A;  1OAZ A;  4XRD A;  2C0E A;  2X8G A;  4ZXG A;  1F9M A;  3F8U A;  2DJ0 A;  2PPT A;  3ZRE A;  1M2B A;  2MBT A;  1XCC A;  1VGL A;  3APO A;  4YH2 A;  3TB2 A;  1B4Q A;  1CQH A;  5B6M A;  1GTB A;  3MSZ A;  3IDV A;  2TRC P;  5D93 A;  3HHV A;  2IFQ B;  4MJB A;  2VO4 A;  4YAV A;  2HZE B;  1K3O A;  2CX3 A;  3UBL A;  3Q74 A;  1T00 A;  4F9Z A;  1ACV A;  5J9B A;  4RQR A;  3KXO A;  4MH3 A;  2MMO A;  2P0G A;  4RI6 A;  4PNG A;  1WWJ A;  3L78 A;  4MF7 A;  5D73 A;  1NW2 A;  1XW6 A;  3TKS A;  1I9D A;  2DLX A;  2K6V A;  4WBJ A;  5G2Z A;  2GVP A;  5F05 A;  4JR6 A;  4G19 A;  2B7J A;  5F0G A;  1K0M A;  2FLS A;  3KCM A;  1O8X A;  2I1U A;  3QAG A;  3ZIJ A;  1SKS B;  5JWQ B;  1OE7 A;  3F4R A;  4KSM A;  3VWV A;  4EKZ A;  2L57 A;  1ILO A;  2QKE A;  3BCK A;  2GQK A;  1PKZ A;  5AN1 A;  4MP4 A;  2A2S A;  2LJA A;  1MTC A;  4MAB A;  2ON7 A;  2KP1 A;  1JZR A;  3LEF A;  5CP1 A;  2C80 A;  3HZ8 A;  3P7X A;  1ZCP A;  5J9C A;  4L5O A;  3ZYW A;  2LST A;  2GT5 A;  3QFA C;  2JZT A;  3FHK A;  4K2D A;  2GDR A;  4ZB6 A;  1JZD A;  4HQZ A;  5DCH A;  19GS A;  1PL2 A;  3W6G A;  2CAQ A;  1BED A;  13GS A;  5B6N A;  16GS A;  2I3Y A;  1SK0 A;  1K0D A;  2FY6 A;  1X9W B;  3E0U A;  4BWS A;  3KZQ A;  1JLW A;  1K0O A;  2N5F A;  3GH6 A;  3KGK A;  2HLS A;  3EVI A;  1U3A A;  3IK7 A;  3VK9 A;  2L4Q A;  4G2E A;  2H1B A;  4L0W A;  3LXZ A;  2FWE A;  1OKD A;  3GL3 A;  1EV9 A;  1A0F A;  4PQI A;  1PX6 A;  4OWY A;  2FHE A;  4EUY A;  1XWA A;  4EXJ A;  5D9W A;  1T1V A;  2LRC A;  5DDL A;  1GTI A;  2RUF A;  5JCG A;  1HNC A;  3G9B A;  4QQ7 A;  1ML6 A;  4ILF A;  3ZL5 A;  3N9J A;  5H5S A;  2C8U A;  1MDI A;  2LV3 A;  1OC8 A;  3FZ9 A;  3F3Q A;  1WIK A;  2GQM A;  3G7I A;  1A24 A;  4MZB A;  3TDG A;  3C7M A;  4NAX A;  2KP2 A;  1VF4 A;  4AJ6 A;  4H86 A;  4IKH A;  1A2L A;  1SK2 A;  4MPF A;  3HJO A;  3CXG A;  3V1W A;  1EP7 A;  4FYC A;  5G5E A;  2IJY A;  4HJM A;  1JHB A;  4HDE A;  3HVS A;  5CRD A;  5EPF A;  2R3X A;  2HFD A;  1U88 A;  1X0R A;  1YDK A;  4GXZ A;  3A3T A;  3DKS A;  3CRU A;  1UA5 A;  3IV4 A;  1FOV A;  5AIX A;  1EGO A;  1A2J A;  3APQ A;  1VF2 A;  4MJA A;  3QDN A;  4PX1 A;  3IOS A;  3CTG A;  2YP6 A;  1PRX A;  3J7Y b;  1B9Y C;  4L8E A;  3EE2 A;  4K6X A;  5ELA A;  2PU9 C;  2YV7 A;  1XW5 A;  1XWK A;  4Q5R A;  5G30 A;  2EIQ A;  4EDZ A;  2GSR A;  3IRA A;  3SWL A;  1YJ6 A;  2B5Y A;  3CBU A;  4WKW A;  1Q98 A;  2H0G A;  5B7C A;  4EO3 A;  3ZMK A;  2H0H A;  1QMV A;  4IS0 A;  1RK4 A;  4ZBB A;  1GSU A;  2FNO A;  1M2A A;  4ACS A;  3GMF A;  6GST A;  4D73 A;  3GRX A;  5LD0 A;  5HFK A;  2K8V A;  2YPM A;  4FYB A;  4LL4 B;  5KN2 A;  3VFI A;  1GLQ A;  5IMA A;  5HR0 A;  4PUA A;  2PBJ A;  3JCM L;  3AY8 A;  3FZ5 A;  4AGS A;  2DIY A;  1GWC A;  1A8Y A;  4BL7 B;  4KX4 A;  1FVK A;  4JZQ A;  2YWO A;  4KB3 A;  5LNK e;  3KP8 A;  1TKD B;  3FYG A;  2YJ7 A;  4ZIJ A;  5IO0 A;  1EEM A;  1MDK A;  1BJX A;  4N11 A;  3LGC A;  1GLP A;  1GP1 A;  1R26 A;  4OD7 A;  3HDC A;  1GSF A;  2HRK A;  4NXI A;  3LYK A;  4POB A;  3QAW A;  2YZH A;  3L4N A;  5IPH A;  1EZK A;  1X9S B;  5ELG A;  3GFK A;  5A4W A;  1ERV A;  12GS A;  3EUR A;  4MDC A;  3KTL A;  2OBK A;  3UVT A;  1ERT A;  3GSS A;  2MMA A;  2XC2 A;  1SKW B;  4XS4 A;  1H75 A;  4BPY A;  1DUG A; 
#chains in the Genus database with same CATH topology
 5J40 A;  4MPG A;  4A5P A;  2PUK C;  4ML1 A;  5GSS A;  1R5A A;  3HA9 A;  4F2I A;  1YVL A;  1R7H A;  2HQT A;  2F8A A;  4ZL7 A;  3CSH A;  5B8B A;  5DQS A;  1TRW A;  4GLT A;  1AW9 A;  1Z7P A;  1VRS D;  3D0Z A;  2LNT A;  1XVQ A;  2VOC A;  4MZW A;  3J7Y k;  2R5G A;  4HI7 A;  2CVB A;  1YEW C;  4IBP A;  5IOW A;  3FY7 A;  5HQP A;  2BTO T;  5ABR A;  1U87 A;  4KE3 A;  4O32 A;  2WW3 A;  5EL8 A;  1V98 A;  3D22 A;  2OKA A;  3UMA A;  3HJM A;  4ZBA A;  6GSW A;  1BYE A;  3PGT A;  3TJG A;  3QMX A;  1O6J A;  1AQV A;  3VWX A;  2RUE A;  4KND A;  4YAP A;  2EIR A;  2MMN A;  2B7K A;  4WF4 A;  4FYU A;  3VWW A;  3IE3 A;  2L59 A;  3GTU B;  4DSR A;  4LMW A;  1KEB A;  1JZO A;  1SYR A;  3EC3 A;  5HR3 A;  4NPB A;  3QOU A;  3LYP A;  4QL9 A;  4RQX A;  3M0F A;  2IWT A;  1J08 A;  1TTZ A;  3LOR A;  1SVM A;  2CZ2 A;  1BAY A;  4WXT A;  1AUC A;  4ZL8 A;  4ZIL A;  3GX8 A;  2CZ3 A;  1IYH A;  2LEG A;  4K8M A;  4L5L A;  7GSS A;  5BRT A;  4AJ7 A;  1FO5 A;  1AXD A;  1OC9 A;  3BOA A;  2HRF A;  2YV9 A;  1TK8 B;  2DC5 A;  2OE1 A;  1AQW A;  3TKQ A;  1J0F A;  4HZ2 A;  2KUC A;  5ECM B;  1ZYN A;  1PGT A;  4TR1 B;  2CAI A;  2HE3 A;  3MAK A;  2GZZ A;  4KH7 A;  4O7H A;  4USS A;  3F3R A;  3TKS C;  4I2U A;  1YKC A;  4XS1 A;  1FW1 A;  1M0U A;  1BF5 A;  4KA0 A;  2ON5 A;  5CO3 A;  2WJU A;  3GHA A;  4PGT A;  2AUV A;  3IXR A;  4IEL A;  4K0G A;  4KGI A;  2MYG A;  2DJK A;  4IQ1 A;  1FHE A;  2VUP A;  4PUR A;  3TUE A;  3WT1 A;  4BVX B;  3TOU A;  3O3T A;  5DBQ A;  5HR2 A;  3EU3 A;  4OFN A;  1FB0 A;  1ZZY A;  3Q19 A;  3PR8 A;  3CQF A;  3F9U A;  4KDX A;  2R0G A;  3ME8 A;  2A2P A;  2O7K A;  1GSY A;  3I69 A;  2YWM A;  3UIW A;  4EIQ A;  1XXU A;  4PUF C;  5CYY A;  3HMJ G;  2BJX A;  4AKG A;  2M80 A;  3HZ4 A;  4G0L A;  1GNE A;  1U6T A;  4LMV A;  2VIM A;  2J9H A;  4F82 A;  2L5O A;  2YZU A;  1Z6N A;  3FZ4 A;  5KN1 A;  3LXT A;  1YKA A;  2O87 A;  4KCA A;  2JSY A;  2I81 A;  1T3B A;  1ABA A;  2RLI A;  4ZB9 A;  4BVY B;  1F6M C;  2GQL A;  1IYI A;  3IAM 2;  4ZL9 A;  2VL2 A;  3IC4 A;  2H1L A;  4N30 A;  3I9V 2;  1X5C A;  4PI0 C;  1W89 A;  2YNX A;  5HFG A;  2V41 A;  3GX0 A;  4JED A;  1XOA A;  3ZIT A;  4HOJ A;  1OE8 A;  5KN0 A;  2X64 A;  1NHY A;  3TOT A;  14GS A;  1QQ2 A;  3UEM A;  3RFR C;  4HUA A;  3L9V A;  3UOM A;  1TOF A;  1F3A A;  1OKT A;  3KIJ A;  1DE1 A;  5KOX A;  1QK8 A;  5F07 A;  3ERW A;  1UVZ A;  1WJK A;  2PMT A;  1PA3 A;  2F9S A;  2C1Y A;  4WET A;  2QGV A;  1Z9H A;  2NVL A;  4NV5 A;  8GSS A;  1O8W A;  1G6Y A;  3KMN A;  1HYU A;  3PPU A;  4Q5Q A;  1SL1 B;  5ECO B;  2XPD A;  4HQS A;  4Q5N A;  5ECH B;  2XPE A;  2IFQ A;  1WOU A;  2HZE A;  3RPP A;  2H1D A;  4KDU A;  2IMK A;  5DQY A;  4HS1 A;  2VL3 A;  2R6K A;  1GSD A;  5GZZ B;  4P3Y B;  2C0F A;  1N2A A;  2GST A;  1GNW A;  2EIO A;  1A2M A;  4F03 A;  3ZFL A;  4Z2T A;  4KUN A;  5FHI A;  3GYK A;  3HD5 A;  3CMI A;  5FT3 A;  4QL7 A;  3LJR A;  5IM9 A;  1YY7 A;  4OO5 A;  2VM1 A;  4I5Q A;  3D4T A;  4IVF A;  3RPN A;  3LWA A;  2FA8 A;  3W8S A;  1SK1 A;  2DSA A;  3F4T A;  4O5R A;  1TXU A;  5G5F A;  1M99 A;  1EP8 A;  1TI1 A;  3D5J A;  3L9U A;  2H6Z A;  2GLR A;  2M46 A;  3QAV A;  1ON4 A;  2VCX A;  1Y6E A;  3HCZ A;  2LJR A;  2K18 A;  1GUM A;  3FMW A;  2L6D A;  2V1M A;  4ECB A;  1XZO A;  5D8I A;  4POL A;  2AAW A;  3APS A;  1TRU A;  4KAE A;  3E9J B;  1RQM A;  3VWU A;  6GSX A;  1NM3 A;  2TRX A;  1GUK A;  1ZGN A;  1URM A;  1S3C A;  4X1U A;  3EIN A;  2H76 A;  3EU4 A;  5DAL B;  1ZL9 A;  4DSS B;  1FAA A;  2KOK A;  3ZRD A;  3MWH A;  5GST A;  4ZB7 A;  5FWG A;  3WD6 A;  3SBC A;  4JRR A;  5A1N A;  3D6I A;  4LA1 A;  2IN3 A;  1PFO A;  2AJQ B;  1SD9 A;  1PQN A;  2EFD A;  3PH9 A;  5F8B A;  2V6O A;  5A5H B;  4MA9 A;  3WYW A;  1XOB A;  5INY A;  5ECI B;  4GRF A;  2LQO A;  3RBT A;  2FWF A;  3C73 A;  2GS3 A;  3UL3 A;  4E8E A;  2LKU A;  3H8Q A;  2IMD A;  3ZVJ D;  3WGE A;  3GIX A;  4IGJ A;  4FO5 A;  3DIE A;  2VAF A;  4FXY P;  3TJB A;  1T8E B;  5A34 A;  1TP9 A;  5H5Q A;  3TKS E;  2PVO C;  2E0Q A;  4K0N A;  2JZR A;  5ID2 B;  3KEB A;  2B6M A;  3QR6 A;  1SYX A;  2X49 A;  4DVC A;  2FWG A;  4MK3 A;  4XTS A;  3IA1 A;  2C3Q A;  2L6C A;  3CYN A;  1TK5 B;  4EC0 A;  2HRN A;  4MF6 A;  2JL4 A;  1B4P A;  4BIK A;  3RHB A;  5ECR B;  2VCV A;  3A5W A;  3RAZ A;  2OAD A;  3I6A A;  2JZS A;  1WMJ A;  1SJ6 A;  5G31 A;  3L9S A;  4K2X A;  1ZOF A;  2LQQ A;  1FOH A;  2WUL A;  1G7E A;  2UZ8 A;  2H01 A;  2OJL A;  3NIV A;  4IN0 A;  4POM A;  4J2F A;  1EOG A;  3FR6 A;  1SVO A;  1PN0 A;  1Z6M A;  5J5N A;  2GSS A;  1FVJ A;  3EMX A;  2WCI A;  2VCT A;  1Q4J A;  1V2A A;  3EYT A;  2OE0 A;  4XRA A;  3O76 A;  3HY2 A;  1XWC A;  2VM2 A;  2H1A A;  2DIZ A;  3P8W A;  2C0G A;  4WR5 A;  4TR3 A;  11GS A;  1YEP A;  3F4S A;  1I1I P;  2Z9S A;  3FK8 A;  2QSI A;  4GST A;  2FD3 A;  5HR1 A;  1USB A;  2OA7 A;  4GCI A;  4OCF A;  3M1G A;  2G2Q A;  1DBY A;  3BCI A;  4AI6 A;  1YF1 A;  4LLR A;  1HNB A;  4TOP A;  3LFL A;  2BMX A;  2HZF A;  2VD0 A;  2YAN A;  5JWR B;  3WGX A;  2H74 A;  5IMF A;  5DAK A;  4V1A g;  3RGB C;  1GUH A;  2AYT A;  4PQ1 A;  4MH2 A;  4J56 E;  2GT6 A;  5E4W A;  1G6W A;  1AC1 A;  4WF5 A;  2HRA A;  3ZVJ A;  3VLN A;  2CQ9 A;  1MD3 A;  4TXO B;  1M3I A;  2QC7 A;  2WS2 A;  2MBS A;  2HYX A;  2A2R A;  1Z3E A;  3GKN A;  3WT2 A;  3TRP A;  4RUV A;  1O73 A;  1TU8 A;  3UVH A;  3DGQ A;  3R2Q A;  4BL7 A;  4HEA 2;  1EOH A;  3GKX A;  1X5D A;  3ZZX A;  5ECK B;  5CAX A;  4OFT A;  3N5O A;  3IK9 A;  2FUG 2;  3E3E A;  5D9T A;  1UN2 A;  4IQA A;  3GV1 A;  1TK0 B;  5BMU A;  1N8J A;  2UV8 G;  4QMK A;  2TIR A;  4E8H A;  3TJJ A;  4GDF A;  3FZA A;  6GSS A;  4FH8 A;  1S3D A;  5DJL A;  5AGY A;  1K0A A;  4WBR D;  4POK A;  5AIV A;  5ECP B;  4K5R A;  2PVQ A;  3DYR A;  3NZN A;  4EVM A;  2RM5 A;  4AJ8 A;  2FA4 A;  3MDK A;  5IMZ A;  4MNN A;  1Y25 A;  3BBY A;  1SEN A;  4TN8 A;  2VLV A;  4O5Q A;  3P90 A;  3H79 A;  3UJ1 A;  5A4U A;  2M72 A;  4V2M A;  1GL8 A;  2YN1 A;  2H71 A;  2AB6 A;  1WE0 A;  5IQY A;  3IAS 2;  4X4J A;  4MJE A;  4X43 A;  3FW2 A;  2PWJ A;  4ECC A;  2H75 A;  4L0U A;  2X99 A;  2F3M A;  3RDW A;  2O5V A;  3VI5 A;  3FEU A;  1F2E A;  2REM A;  4EDY A;  1BX9 A;  2FWH A;  4XS6 A;  3QD9 A;  1MD4 A;  2VCZ A;  2IPA A;  2WVX A;  1A8L A;  2C3N A;  1S3A A;  3GUR A;  4MLY A;  1GTA A;  2VL2 C;  5CRE A;  4K9Z A;  4E68 A;  3A2X A;  1THO A;  3ISO A;  3BJ5 A;  3VUR A;  2NBS A;  4Q5F A;  1YZX A;  2CX4 A;  5IO2 A;  3TRX A;  1M2D A;  1XW9 A;  1GRX A;  4IP1 A;  3PIN A;  3GTU A;  1UC7 A;  3ED3 A;  3VI7 A;  2DML A;  1SVL A;  3C71 A;  2WZS A;  3GUS A;  1M9B A;  4N10 A;  2CV4 A;  4K7N A;  1LBK A;  4TW5 A;  1C72 A;  2HSM A;  3KM6 A;  5F06 A;  4I8B A;  6GSV A;  3K8N A;  3LQ7 A;  1O7U A;  3TU3 B;  4DSQ A;  5D9V A;  2K9F A;  3US3 A;  2WGR A;  2HSN A;  4MZC A;  4AKH A;  2R37 A;  2RII A;  1AAZ A;  3ME7 A;  4JR4 A;  2R2J A;  1QFN A;  1QXH A;  1F37 A;  4TKY A;  18GS A;  2FGX A;  1VF3 A;  4IP6 A;  1KBN A;  1PMT A;  3QPM A;  5CRG A;  2VCQ A;  17GS A;  2GSQ A;  4TR1 A;  3M8N A;  1HQO A;  1LU4 A;  3KP9 A;  1H4O A;  2VL9 A;  1B9X C;  3HKR A;  1SJI A;  3RHC A;  1W4V A;  2H19 A;  4JBB A;  4ECI A;  2IIY A;  2GTU A;  1V40 A;  1SU9 A;  1Y1U A;  4I6X A;  5DCG A;  4GSN A;  4IHU A;  2ZNM A;  3TKP A;  1AQX A;  1FB6 A;  5JWO B;  2WVZ A;  2LUS A;  4BVX A;  1R5P A;  3KH7 A;  3FR9 A;  3FKF A;  3S9F A;  3P2A A;  1GSE A;  1OYJ A;  1XBS A;  3IC8 A;  1A23 A;  3CSJ A;  2AV4 A;  4OO4 A;  2P31 A;  3DML A;  1M3J A;  2E2M A;  5ECL B;  2NDO A;  2ALB A;  3DD3 A;  2A4V A;  2KHP A;  4TVE A;  2VD1 A;  2J23 A;  4AF2 A;  3F0I A;  2YWI A;  3C1S A;  1OC3 A;  1ZYP A;  2V2G A;  4KSO A;  4TRX A;  3TKR A;  5GAP D;  4CHS A;  2E2G A;  4CDO A;  4OFM A;  4NHZ A;  5IMC A;  1B8X A;  1GSQ A;  1G0T A;  2O36 A;  3H4K A;  4JE1 A;  2O85 A;  1HNA A;  1AIU A;  3A5I A;  5KOW A;  3D21 A;  3KMO A;  2ZCT A;  2KLX A;  1CQG A;  4BVY A;  4ICY A;  2H6X A;  4DEJ A;  1K3L A;  3H93 A;  3H1N A;  3M9K A;  4YQV A;  3R3E A;  3C8E A;  2CVD A;  4BA7 A;  2GZP A;  4ID0 A;  5A4V A;  3WGD A;  3UBK A;  5J41 A;  5DVB A;  1EGR A;  4N0V A;  1B48 A;  2H1G A;  2QA2 A;  1PKW A;  1PL1 A;  1XPV A;  2JAD A;  1O81 A;  4N3Z A;  1ERU A;  4ZB8 A;  5A1N B;  2H70 A;  2PGT A;  1U3I A;  2WZ9 A;  3C1R A;  4NMU A;  3EWL A;  5KN3 A;  1EEJ A;  3LSZ A;  5COH A;  3HVX A;  2HNL A;  3LG6 A;  1THX A;  3KH9 A;  2YWN A;  5CRH A;  5GAN D;  2N5B A;  1NHO A;  1Z5Y E;  5G1K A;  1V9W A;  3TJF A;  4ISD A;  2QA1 A;  2G0F A;  3VPT A;  2B5E A;  5C04 A;  3ERG A;  4GTU A;  1TRV A;  3VPQ A;  2WB9 A;  4MCU A;  2DJ1 A;  3OR5 A;  2H0I A;  3DEX A;  4KCE A;  2LNS A;  1XWG A;  1GH2 A;  4XHM A;  1QUW A;  2XBI A;  1X5E A;  4EIP A;  1GUL A;  5DJM A;  5C00 A;  2VCW A;  4XCS A;  2C4J A;  2EFH A;  1SL2 B;  2H6Y A;  4PQH A;  4ECJ A;  3UAP A;  1SJZ A;  4TR4 A;  3IR4 A;  3DVW A;  3ZIV A;  3CTF A;  5ECN B;  3O6T A;  4EL1 A;  2D2Z A;  6GSU A;  2MZC A;  4CW9 A;  4G10 A;  2R0C A;  3KTB A;  2F51 A;  3D4M A;  3F6F A;  1G7O A;  4I97 A;  2HSY A;  2R4V A;  5ECQ B;  4K1F A;  3GKM A;  4GQC A;  4D73 B;  4GF0 A;  4EF0 A;  3GN3 A;  4MMM A;  1ZYQ B;  2P5Q A;  3ZML A;  1PD2 1;  3I43 A;  1EV4 A;  5KEJ A;  2RM6 A;  4XIH A;  5D9X A;  2H30 A;  2WRT A;  2IL3 A;  4GSS A;  2B3S A;  4NHW A;  2PN8 A;  4V2L A;  2C0D A;  3HYP A;  2AHE A;  3U6V A;  5EY6 A;  1LJR A;  2EFC A;  4YQU A;  2HXK A;  2MMZ A;  1FG4 A;  2VLT A;  4OMV A;  4G0I A;  5DAL A;  4DSS A;  3M3M A;  1XVW A;  3MNG A;  4TR0 A;  2WFC A;  2NTO A;  1F3B A;  3DRN A;  5CNW A;  2X8C A;  2OBI A;  3G7Y A;  4GQF A;  1T4Z A;  2HRK B;  1SD8 A;  4YQM A;  20GS A;  4W66 A;  5ECS A;  3A2W A;  4I2T A;  2YJH A;  2LTK A;  4ZBD A;  5DAK B;  1OVN A;  3F63 A;  5H5R A;  2GZY A;  3CWG A;  3HVV A;  2YCD A;  1V57 A;  1T4Y A;  4NV2 A;  2HI7 A;  2GGT A;  1XIY A;  1M9A A;  4XS4 B;  1SKR B;  3IPZ A;  3CSI A;  2HT9 A;  1E6B A;  2V6K A;  5ID2 A;  1JFU A;  3IHQ A;  1HD2 A;  2DJJ A;  4WR4 A;  3QFB C;  1K0N A;  2B5X A;  2LRT A;  2OAC A;  2PER A;  3TRQ A;  10GS A;  2X8H A;  4HU7 A;  1RW1 A;  1TU7 A;  4MJC A;  5L71 A;  4Z7X A;  2OE3 A;  2LS5 A;  5D96 A;  2WW0 A;  3FR3 A;  2WVY A;  1KNG A;  3KJY A;  4V1A p;  5E59 A;  2P5R A;  4KW6 A;  1BQ7 A;  1E2Y A;  3ERF A;  5J4U A;  2DJ2 A;  4IJ3 A;  4FIW A;  4F0C A;  2DMM A;  4IJI A;  5CRW A;  3L0H A;  3F6D A;  1TRS A;  2O89 A;  3IBH A;  5IMD A;  1X9M B;  1A0R P;  5B8A A;  3GA4 A;  5G1L A;  2L4C A;  3GST A;  5JCU A;  2VLU A;  2CT6 A;  2DBC A;  1PN9 A;  3U5R E;  3ZTL A;  1M7T A;  4KDY A;  5ENU A;  4NWY A;  4BWQ A;  1MDJ A;  5IPG A;  9GSS A;  2C3T A;  4HJ2 A;  2WDU A;  2CVK A;  3UAR A;  2LRN A;  1GTU A;  4WEY A;  1MEK A;  4EE0 A;  3GL5 A;  4K7I A;  4ML6 A;  2ES7 A;  1O85 A;  3Q6O A;  2I9H A;  4RI7 A;  3M9J A;  1ERW A;  1JLV A;  3DVX A;  2IMF A;  3ZLP A;  1OC9 B;  3CHX C;  2N5A A;  3CRT A;  2CA8 A;  3GKK A;  1K0B A;  2WVX B;  1WP0 A;  2B1K A;  3HXS A;  3FRC A;  4ULX A;  1DE2 A;  4MF5 A;  5J47 A;  2LJK A;  2NPB A;  2H66 A;  1K3Y A;  4TXO A;  5LCZ A;  2K8S A;  1TXX A;  1KTE A;  1DSB A;  4OCE A;  5HFI A;  2L5L A;  1BG5 A;  1TDI A;  4PXO A;  1ZYE A;  1GSS A;  4LL1 B;  4G0K A;  6GSY A;  2B1L A;  5IOX A;  3G7J A;  5IIZ A;  2EC4 A;  3GNJ A;  5EVO A;  1XWB A;  1ST9 A;  1ZMA A;  1N25 A;  4F0B A;  3ZFB A;  1Z7R A;  2HSM B;  4X0X A;  2FCH A;  2E7P A;  1WPI A;  1PX7 A;  3KD0 A;  1S4B P;  2XBQ A;  2YOI A;  2I4A A;  22GS A;  1SL0 B;  2V32 A;  4JU5 A;  1YQ1 A;  2DJ3 A;  1PSQ A;  4PHZ C;  4GWR A;  2HSN B;  3DXB A;  4HU9 A;  4FQU A;  4K7O A;  4G9H A;  4KF9 A;  3BD2 A;  4K5S A;  3TCO A;  1XFL A;  1TW9 A;  2XHF A;  5J3R A;  1YF0 A;  3W8J A;  3QCP A;  1JZW A;  5IMV A;  1EWX A;  2IMI A;  1VF1 A;  1WRY A;  4TXV A;  1QGV A;  2ZUP A;  3EPT A;  1NSW A;  2JSZ A;  2JU5 A;  5A5K A;  3TJK A;  5JCW A;  4V2N A;  4IW9 A;  4PNF A;  1J9B A;  4HZ4 A;  2IME A;  1I5G A;  3NOF A;  2H8L A;  3EMP A;  3HJP A;  1T7P B;  3DWV A;  1R4W A;  3GH9 A;  5AIS A;  2F8F A;  4O92 A;  3A2V A;  2O8V B;  1YEX A;  4N0Z A;  1TI3 A;  2H72 A;  1K0C A;  1V58 A;  2JAC A;  4J57 E;  2H73 A;  3Q18 A;  2HSH A;  1TJD A;  3TGZ A;  4PTS A;  1OAZ A;  4XRD A;  2C0E A;  2X8G A;  4ZXG A;  2X4A A;  1F9M A;  3F8U A;  2DJ0 A;  2PPT A;  3ZRE A;  1M2B A;  2MBT A;  1XCC A;  4Z2R A;  1VGL A;  3APO A;  4YH2 A;  3TB2 A;  1B4Q A;  1CQH A;  5B6M A;  1GTB A;  3MSZ A;  3IDV A;  2TRC P;  5D93 A;  3HHV A;  2IFQ B;  4MJB A;  2VO4 A;  4YAV A;  2HZE B;  1K3O A;  2CX3 A;  3UBL A;  3Q74 A;  1T00 A;  4F9Z A;  1ACV A;  5J9B A;  4RQR A;  3KXO A;  4MH3 A;  2MMO A;  2P0G A;  4RI6 A;  4PNG A;  1WWJ A;  3L78 A;  4MF7 A;  5D73 A;  1NW2 A;  3MIX A;  1XW6 A;  3TKS A;  1I9D A;  2DLX A;  2K6V A;  4WBJ A;  5G2Z A;  2GVP A;  5F05 A;  4JR6 A;  4G19 A;  2B7J A;  5F0G A;  1K0M A;  2FLS A;  3KCM A;  4PI2 C;  2WW2 A;  1O8X A;  2I1U A;  3QAG A;  3ZIJ A;  2OT3 A;  1SKS B;  5JWQ B;  1OE7 A;  3F4R A;  1BG1 A;  4KSM A;  3VWV A;  4EKZ A;  2L57 A;  1ILO A;  2QKE A;  1XG8 A;  2GQK A;  3BCK A;  1PKZ A;  5AN1 A;  4MP4 A;  2A2S A;  2LJA A;  1MTC A;  4MAB A;  4CY8 A;  2O3E A;  2ON7 A;  2KP1 A;  1JZR A;  3LEF A;  5CP1 A;  4YKF A;  2C80 A;  3HZ8 A;  3P7X A;  1ZCP A;  5J9C A;  4L5O A;  3ZYW A;  2LST A;  2GT5 A;  3QFA C;  2R0P A;  2JZT A;  3FHK A;  4K2D A;  2GDR A;  4ZB6 A;  1JZD A;  4HQZ A;  5DCH A;  19GS A;  1PL2 A;  3W6G A;  2CAQ A;  1BED A;  13GS A;  5B6N A;  16GS A;  2I3Y A;  1SK0 A;  1K0D A;  2FY6 A;  1X9W B;  3E0U A;  4BWS A;  3KZQ A;  1JLW A;  1K0O A;  2N5F A;  3GH6 A;  3KGK A;  2HLS A;  3EVI A;  1U3A A;  3IK7 A;  3VK9 A;  2L4Q A;  4G2E A;  2H1B A;  4L0W A;  3MYD A;  3LXZ A;  2FWE A;  1OKD A;  3GL3 A;  1EV9 A;  1A0F A;  4PQI A;  1PX6 A;  4OWY A;  2FHE A;  4EUY A;  1XWA A;  4EXJ A;  5D9W A;  2WW1 A;  1T1V A;  2LRC A;  5DDL A;  1GTI A;  2RUF A;  5JCG A;  1HNC A;  3G9B A;  4QQ7 A;  5A34 B;  1ML6 A;  4ILF A;  3ZL5 A;  3N9J A;  5H5S A;  2C8U A;  1MDI A;  2LV3 A;  1OC8 A;  3FZ9 A;  3F3Q A;  1WIK A;  4HSC X;  2GQM A;  3G7I A;  1A24 A;  3LW9 A;  4MZB A;  3TDG A;  3C7M A;  4NAX A;  2KP2 A;  1VF4 A;  4AJ6 A;  2DKH A;  4H86 A;  4IKH A;  1A2L A;  1SK2 A;  4MPF A;  3HJO A;  4AKX B;  3CXG A;  3V1W A;  1EP7 A;  4FYC A;  5G5E A;  2IJY A;  4HJM A;  1JHB A;  4HDE A;  3HVS A;  5CRD A;  5EPF A;  3HVN A;  2R3X A;  2HFD A;  1U88 A;  1X0R A;  1YDK A;  4GXZ A;  3A3T A;  3DKS A;  3CRU A;  4Z2U A;  1UA5 A;  3IV4 A;  1FOV A;  5AIX A;  1EGO A;  1A2J A;  3APQ A;  1VF2 A;  5J4Y A;  4MJA A;  3QDN A;  4PX1 A;  3IOS A;  3CTG A;  1S3R A;  2YP6 A;  1PRX A;  3J7Y b;  1B9Y C;  4L8E A;  3EE2 A;  4K6X A;  5ELA A;  2PU9 C;  2YV7 A;  1XW5 A;  1XWK A;  4Q5R A;  5G30 A;  2EIQ A;  4CY6 A;  4EDZ A;  5A5H A;  2GSR A;  3IRA A;  3SWL A;  1YJ6 A;  2B5Y A;  3CBU A;  4WKW A;  1Q98 A;  2H0G A;  5B7C A;  4EO3 A;  3ZMK A;  2H0H A;  1QMV A;  4IS0 A;  1RK4 A;  4ZBB A;  1GSU A;  2FNO A;  1M2A A;  4G01 A;  4ACS A;  3GMF A;  6GST A;  4D73 A;  3GRX A;  5LD0 A;  5HFK A;  2K8V A;  2YPM A;  4FYB A;  4LL4 B;  5KN2 A;  3VFI A;  1GLQ A;  5IMA A;  5HR0 A;  4PUA A;  2PBJ A;  3JCM L;  3AY8 A;  3FZ5 A;  4AGS A;  2DIY A;  1GWC A;  1A8Y A;  4BL7 B;  4KX4 A;  4YKG A;  1FVK A;  4JZQ A;  2A4H A;  2YWO A;  4KB3 A;  5LNK e;  3IHG A;  2VKZ G;  3KP8 A;  1TKD B;  3FYG A;  2YJ7 A;  4ZIJ A;  5IO0 A;  1EEM A;  1MDK A;  1BJX A;  4N11 A;  3LGC A;  1GLP A;  1GP1 A;  1R26 A;  2EFE A;  4OD7 A;  3HDC A;  5BMU B;  1GSF A;  2HRK A;  4NXI A;  3LYK A;  4POB A;  3QAW A;  2YZH A;  3L4N A;  5IPH A;  5J4V A;  1EZK A;  1X9S B;  5ELG A;  3GFK A;  5A4W A;  1ERV A;  12GS A;  4AKI A;  3EUR A;  4MDC A;  3KTL A;  2OBK A;  3UVT A;  1ERT A;  3GSS A;  2MMA A;  2XC2 A;  1SKW B;  4XS4 A;  1H75 A;  4O5U A;  4BPY A;  2DKI A;  1DUG A; 
#chains in the Genus database with same CATH homology
 5J40 A;  4MPG A;  4A5P A;  2PUK C;  4ML1 A;  5GSS A;  1R5A A;  3HA9 A;  4F2I A;  1YVL A;  1R7H A;  2HQT A;  2F8A A;  4ZL7 A;  3CSH A;  5B8B A;  5DQS A;  1TRW A;  4GLT A;  1AW9 A;  1Z7P A;  1VRS D;  3D0Z A;  2LNT A;  1XVQ A;  2VOC A;  4MZW A;  3J7Y k;  2R5G A;  4HI7 A;  2CVB A;  4IBP A;  5IOW A;  3FY7 A;  5HQP A;  2BTO T;  5ABR A;  1U87 A;  4KE3 A;  4O32 A;  5EL8 A;  1V98 A;  3D22 A;  2OKA A;  3UMA A;  3HJM A;  4ZBA A;  6GSW A;  1BYE A;  3PGT A;  3TJG A;  3QMX A;  1O6J A;  1AQV A;  3VWX A;  2RUE A;  4KND A;  4YAP A;  2EIR A;  2MMN A;  2B7K A;  4WF4 A;  4FYU A;  3VWW A;  3IE3 A;  2L59 A;  3GTU B;  4DSR A;  4LMW A;  1KEB A;  1JZO A;  1SYR A;  3EC3 A;  5HR3 A;  4NPB A;  3QOU A;  3LYP A;  4QL9 A;  4RQX A;  3M0F A;  2IWT A;  1J08 A;  1TTZ A;  3LOR A;  1SVM A;  2CZ2 A;  1BAY A;  4WXT A;  1AUC A;  4ZL8 A;  4ZIL A;  3GX8 A;  2CZ3 A;  1IYH A;  2LEG A;  4K8M A;  4L5L A;  7GSS A;  5BRT A;  4AJ7 A;  1FO5 A;  1AXD A;  1OC9 A;  3BOA A;  2HRF A;  2YV9 A;  1TK8 B;  2DC5 A;  2OE1 A;  1AQW A;  3TKQ A;  1J0F A;  4HZ2 A;  2KUC A;  5ECM B;  1ZYN A;  1PGT A;  4TR1 B;  2CAI A;  2HE3 A;  3MAK A;  2GZZ A;  4KH7 A;  4O7H A;  4USS A;  3F3R A;  3TKS C;  4I2U A;  1YKC A;  4XS1 A;  1FW1 A;  1M0U A;  1BF5 A;  4KA0 A;  2ON5 A;  5CO3 A;  2WJU A;  3GHA A;  4PGT A;  2AUV A;  3IXR A;  4IEL A;  4K0G A;  4KGI A;  2MYG A;  2DJK A;  4IQ1 A;  1FHE A;  2VUP A;  4PUR A;  3TUE A;  3WT1 A;  4BVX B;  3TOU A;  3O3T A;  5DBQ A;  5HR2 A;  3EU3 A;  4OFN A;  1FB0 A;  1ZZY A;  3Q19 A;  3PR8 A;  3F9U A;  4KDX A;  2R0G A;  3ME8 A;  2A2P A;  2O7K A;  1GSY A;  3I69 A;  2YWM A;  3UIW A;  4EIQ A;  1XXU A;  4PUF C;  5CYY A;  3HMJ G;  2BJX A;  4AKG A;  2M80 A;  3HZ4 A;  4G0L A;  1GNE A;  1U6T A;  4LMV A;  2VIM A;  2J9H A;  4F82 A;  2L5O A;  2YZU A;  1Z6N A;  3FZ4 A;  5KN1 A;  3LXT A;  1YKA A;  2O87 A;  4KCA A;  2JSY A;  2I81 A;  1T3B A;  1ABA A;  2RLI A;  4ZB9 A;  4BVY B;  1F6M C;  2GQL A;  1IYI A;  3IAM 2;  4ZL9 A;  2VL2 A;  3IC4 A;  2H1L A;  4N30 A;  3I9V 2;  1X5C A;  1W89 A;  2YNX A;  5HFG A;  2V41 A;  3GX0 A;  4JED A;  1XOA A;  3ZIT A;  4HOJ A;  1OE8 A;  5KN0 A;  2X64 A;  1NHY A;  3TOT A;  14GS A;  1QQ2 A;  3UEM A;  4HUA A;  3L9V A;  3UOM A;  1TOF A;  1F3A A;  1OKT A;  3KIJ A;  1DE1 A;  5KOX A;  1QK8 A;  5F07 A;  3ERW A;  1UVZ A;  1WJK A;  2PMT A;  1PA3 A;  2F9S A;  2C1Y A;  4WET A;  2QGV A;  1Z9H A;  2NVL A;  4NV5 A;  8GSS A;  1O8W A;  1G6Y A;  3KMN A;  1HYU A;  3PPU A;  4Q5Q A;  1SL1 B;  5ECO B;  2XPD A;  4HQS A;  4Q5N A;  5ECH B;  2XPE A;  2IFQ A;  1WOU A;  2HZE A;  3RPP A;  2H1D A;  4KDU A;  2IMK A;  5DQY A;  4HS1 A;  2VL3 A;  2R6K A;  1GSD A;  5GZZ B;  4P3Y B;  2C0F A;  1N2A A;  2GST A;  1GNW A;  2EIO A;  1A2M A;  4F03 A;  3ZFL A;  4Z2T A;  4KUN A;  5FHI A;  3GYK A;  3HD5 A;  3CMI A;  5FT3 A;  4QL7 A;  3LJR A;  5IM9 A;  1YY7 A;  4OO5 A;  2VM1 A;  4I5Q A;  3D4T A;  4IVF A;  3RPN A;  3LWA A;  2FA8 A;  3W8S A;  1SK1 A;  2DSA A;  3F4T A;  4O5R A;  1TXU A;  5G5F A;  1M99 A;  1EP8 A;  1TI1 A;  3D5J A;  3L9U A;  2H6Z A;  2GLR A;  2M46 A;  3QAV A;  1ON4 A;  2VCX A;  1Y6E A;  3HCZ A;  2LJR A;  2K18 A;  1GUM A;  3FMW A;  2L6D A;  2V1M A;  4ECB A;  1XZO A;  5D8I A;  4POL A;  2AAW A;  3APS A;  1TRU A;  4KAE A;  3E9J B;  1RQM A;  3VWU A;  6GSX A;  1NM3 A;  2TRX A;  1GUK A;  1ZGN A;  1URM A;  1S3C A;  4X1U A;  3EIN A;  2H76 A;  3EU4 A;  5DAL B;  1ZL9 A;  4DSS B;  1FAA A;  2KOK A;  3ZRD A;  3MWH A;  5GST A;  4ZB7 A;  5FWG A;  3WD6 A;  3SBC A;  4JRR A;  5A1N A;  3D6I A;  4LA1 A;  2IN3 A;  2AJQ B;  1SD9 A;  1PQN A;  2EFD A;  3PH9 A;  5F8B A;  2V6O A;  5A5H B;  4MA9 A;  3WYW A;  1XOB A;  5INY A;  5ECI B;  4GRF A;  2LQO A;  3RBT A;  2FWF A;  3C73 A;  2GS3 A;  3UL3 A;  4E8E A;  2LKU A;  3H8Q A;  2IMD A;  3ZVJ D;  3WGE A;  3GIX A;  4IGJ A;  4FO5 A;  3DIE A;  2VAF A;  3TJB A;  1T8E B;  5A34 A;  1TP9 A;  5H5Q A;  3TKS E;  2PVO C;  2E0Q A;  4K0N A;  2JZR A;  5ID2 B;  3KEB A;  2B6M A;  3QR6 A;  1SYX A;  2X49 A;  4DVC A;  2FWG A;  4MK3 A;  4XTS A;  3IA1 A;  2C3Q A;  2L6C A;  3CYN A;  1TK5 B;  4EC0 A;  2HRN A;  4MF6 A;  2JL4 A;  1B4P A;  3RHB A;  5ECR B;  2VCV A;  3A5W A;  3RAZ A;  2OAD A;  3I6A A;  2JZS A;  1WMJ A;  1SJ6 A;  5G31 A;  3L9S A;  4K2X A;  1ZOF A;  2LQQ A;  1FOH A;  2WUL A;  1G7E A;  2UZ8 A;  2H01 A;  2OJL A;  3NIV A;  4IN0 A;  4POM A;  4J2F A;  1EOG A;  3FR6 A;  1SVO A;  1PN0 A;  1Z6M A;  5J5N A;  2GSS A;  1FVJ A;  3EMX A;  2WCI A;  2VCT A;  1Q4J A;  1V2A A;  3EYT A;  2OE0 A;  4XRA A;  3O76 A;  3HY2 A;  1XWC A;  2VM2 A;  2H1A A;  2DIZ A;  3P8W A;  2C0G A;  4WR5 A;  4TR3 A;  11GS A;  1YEP A;  3F4S A;  2Z9S A;  3FK8 A;  2QSI A;  4GST A;  2FD3 A;  5HR1 A;  1USB A;  2OA7 A;  4GCI A;  4OCF A;  3M1G A;  2G2Q A;  1DBY A;  3BCI A;  4AI6 A;  1YF1 A;  4LLR A;  1HNB A;  4TOP A;  3LFL A;  2BMX A;  2HZF A;  2VD0 A;  2YAN A;  5JWR B;  3WGX A;  2H74 A;  5IMF A;  5DAK A;  4V1A g;  1GUH A;  2AYT A;  4PQ1 A;  4MH2 A;  4J56 E;  2GT6 A;  5E4W A;  1G6W A;  1AC1 A;  4WF5 A;  2HRA A;  3ZVJ A;  3VLN A;  2CQ9 A;  1MD3 A;  4TXO B;  2QC7 A;  2WS2 A;  2MBS A;  2HYX A;  2A2R A;  1Z3E A;  3GKN A;  3WT2 A;  3TRP A;  4RUV A;  1O73 A;  1TU8 A;  3UVH A;  3DGQ A;  3R2Q A;  4BL7 A;  4HEA 2;  1EOH A;  3GKX A;  1X5D A;  3ZZX A;  5ECK B;  5CAX A;  4OFT A;  3N5O A;  3IK9 A;  2FUG 2;  3E3E A;  5D9T A;  1UN2 A;  4IQA A;  3GV1 A;  1TK0 B;  5BMU A;  1N8J A;  2UV8 G;  4QMK A;  2TIR A;  4E8H A;  3TJJ A;  4GDF A;  3FZA A;  6GSS A;  4FH8 A;  1S3D A;  5DJL A;  5AGY A;  1K0A A;  4WBR D;  4POK A;  5AIV A;  5ECP B;  4K5R A;  2PVQ A;  3DYR A;  3NZN A;  4EVM A;  2RM5 A;  4AJ8 A;  2FA4 A;  3MDK A;  5IMZ A;  4MNN A;  1Y25 A;  3BBY A;  1SEN A;  4TN8 A;  2VLV A;  4O5Q A;  3P90 A;  3H79 A;  3UJ1 A;  5A4U A;  2M72 A;  4V2M A;  1GL8 A;  2YN1 A;  2H71 A;  2AB6 A;  1WE0 A;  5IQY A;  3IAS 2;  4X4J A;  4MJE A;  4X43 A;  3FW2 A;  2PWJ A;  4ECC A;  2H75 A;  4L0U A;  2X99 A;  2F3M A;  3RDW A;  2O5V A;  3VI5 A;  3FEU A;  1F2E A;  2REM A;  4EDY A;  1BX9 A;  2FWH A;  4XS6 A;  3QD9 A;  1MD4 A;  2VCZ A;  2IPA A;  1A8L A;  2C3N A;  1S3A A;  3GUR A;  4MLY A;  1GTA A;  2VL2 C;  5CRE A;  4K9Z A;  4E68 A;  3A2X A;  1THO A;  3ISO A;  3BJ5 A;  3VUR A;  2NBS A;  4Q5F A;  1YZX A;  2CX4 A;  5IO2 A;  3TRX A;  1M2D A;  1XW9 A;  1GRX A;  4IP1 A;  3PIN A;  3GTU A;  1UC7 A;  3ED3 A;  3VI7 A;  2DML A;  1SVL A;  3C71 A;  3GUS A;  1M9B A;  4N10 A;  2CV4 A;  4K7N A;  1LBK A;  4TW5 A;  1C72 A;  2HSM A;  3KM6 A;  5F06 A;  4I8B A;  6GSV A;  3K8N A;  3LQ7 A;  1O7U A;  3TU3 B;  4DSQ A;  5D9V A;  2K9F A;  3US3 A;  2WGR A;  2HSN A;  4MZC A;  4AKH A;  2R37 A;  2RII A;  1AAZ A;  3ME7 A;  4JR4 A;  2R2J A;  1QFN A;  1QXH A;  1F37 A;  4TKY A;  18GS A;  2FGX A;  1VF3 A;  4IP6 A;  1KBN A;  1PMT A;  3QPM A;  5CRG A;  2VCQ A;  17GS A;  2GSQ A;  4TR1 A;  3M8N A;  1HQO A;  1LU4 A;  3KP9 A;  1H4O A;  2VL9 A;  1B9X C;  3HKR A;  1SJI A;  3RHC A;  1W4V A;  2H19 A;  4JBB A;  4ECI A;  2IIY A;  2GTU A;  1V40 A;  1SU9 A;  1Y1U A;  4I6X A;  5DCG A;  4GSN A;  4IHU A;  2ZNM A;  3TKP A;  1AQX A;  1FB6 A;  5JWO B;  2LUS A;  4BVX A;  1R5P A;  3KH7 A;  3FR9 A;  3FKF A;  3S9F A;  3P2A A;  1GSE A;  1OYJ A;  1XBS A;  3IC8 A;  1A23 A;  3CSJ A;  2AV4 A;  4OO4 A;  2P31 A;  3DML A;  2E2M A;  5ECL B;  2NDO A;  2ALB A;  3DD3 A;  2A4V A;  2KHP A;  4TVE A;  2VD1 A;  2J23 A;  4AF2 A;  3F0I A;  3C1S A;  2YWI A;  1OC3 A;  1ZYP A;  2V2G A;  4KSO A;  4TRX A;  3TKR A;  5GAP D;  4CHS A;  2E2G A;  4CDO A;  4OFM A;  4NHZ A;  5IMC A;  1B8X A;  1GSQ A;  1G0T A;  3H4K A;  4JE1 A;  2O85 A;  1HNA A;  1AIU A;  3A5I A;  5KOW A;  3D21 A;  3KMO A;  2ZCT A;  2KLX A;  1CQG A;  4BVY A;  4ICY A;  2H6X A;  4DEJ A;  1K3L A;  3H93 A;  3H1N A;  3M9K A;  4YQV A;  3R3E A;  3C8E A;  2CVD A;  4BA7 A;  2GZP A;  4ID0 A;  5A4V A;  3WGD A;  3UBK A;  5J41 A;  5DVB A;  1EGR A;  4N0V A;  1B48 A;  2H1G A;  2QA2 A;  1PKW A;  1PL1 A;  1XPV A;  2JAD A;  1O81 A;  4N3Z A;  1ERU A;  4ZB8 A;  5A1N B;  2H70 A;  2PGT A;  1U3I A;  2WZ9 A;  3C1R A;  4NMU A;  3EWL A;  5KN3 A;  1EEJ A;  3LSZ A;  5COH A;  3HVX A;  2HNL A;  3LG6 A;  1THX A;  3KH9 A;  2YWN A;  5CRH A;  5GAN D;  2N5B A;  1NHO A;  1Z5Y E;  5G1K A;  1V9W A;  3TJF A;  4ISD A;  2G0F A;  2QA1 A;  3VPT A;  2B5E A;  5C04 A;  3ERG A;  4GTU A;  1TRV A;  3VPQ A;  2WB9 A;  4MCU A;  2DJ1 A;  3OR5 A;  2H0I A;  3DEX A;  4KCE A;  2LNS A;  1XWG A;  1GH2 A;  4XHM A;  1QUW A;  2XBI A;  1X5E A;  4EIP A;  1GUL A;  5DJM A;  5C00 A;  2VCW A;  4XCS A;  2C4J A;  2EFH A;  1SL2 B;  2H6Y A;  4PQH A;  4ECJ A;  3UAP A;  1SJZ A;  4TR4 A;  3IR4 A;  3DVW A;  3ZIV A;  3CTF A;  5ECN B;  3O6T A;  4EL1 A;  2D2Z A;  6GSU A;  2MZC A;  4CW9 A;  4G10 A;  2R0C A;  3KTB A;  2F51 A;  3D4M A;  3F6F A;  1G7O A;  4I97 A;  2HSY A;  2R4V A;  5ECQ B;  4K1F A;  3GKM A;  4GQC A;  4D73 B;  4GF0 A;  4EF0 A;  3GN3 A;  4MMM A;  1ZYQ B;  2P5Q A;  3ZML A;  1PD2 1;  3I43 A;  1EV4 A;  5KEJ A;  2RM6 A;  4XIH A;  5D9X A;  2H30 A;  2WRT A;  2IL3 A;  4GSS A;  2B3S A;  4NHW A;  2PN8 A;  4V2L A;  2C0D A;  3HYP A;  2AHE A;  3U6V A;  5EY6 A;  1LJR A;  2EFC A;  4YQU A;  2HXK A;  2MMZ A;  1FG4 A;  2VLT A;  4OMV A;  4G0I A;  5DAL A;  4DSS A;  3M3M A;  1XVW A;  3MNG A;  4TR0 A;  2WFC A;  2NTO A;  1F3B A;  3DRN A;  5CNW A;  2X8C A;  2OBI A;  3G7Y A;  4GQF A;  1T4Z A;  2HRK B;  1SD8 A;  4YQM A;  20GS A;  4W66 A;  5ECS A;  3A2W A;  4I2T A;  2YJH A;  2LTK A;  4ZBD A;  5DAK B;  1OVN A;  3F63 A;  5H5R A;  2GZY A;  3CWG A;  3HVV A;  2YCD A;  1V57 A;  1T4Y A;  4NV2 A;  2HI7 A;  2GGT A;  1XIY A;  1M9A A;  4XS4 B;  1SKR B;  3IPZ A;  3CSI A;  2HT9 A;  1E6B A;  2V6K A;  5ID2 A;  1JFU A;  3IHQ A;  1HD2 A;  2DJJ A;  4WR4 A;  3QFB C;  1K0N A;  2B5X A;  2LRT A;  2OAC A;  2PER A;  3TRQ A;  10GS A;  2X8H A;  4HU7 A;  1RW1 A;  1TU7 A;  4MJC A;  5L71 A;  4Z7X A;  2OE3 A;  2LS5 A;  5D96 A;  3FR3 A;  1KNG A;  3KJY A;  4V1A p;  5E59 A;  2P5R A;  4KW6 A;  1BQ7 A;  1E2Y A;  3ERF A;  5J4U A;  2DJ2 A;  4IJ3 A;  4FIW A;  4F0C A;  2DMM A;  4IJI A;  5CRW A;  3L0H A;  3F6D A;  1TRS A;  2O89 A;  3IBH A;  5IMD A;  1X9M B;  1A0R P;  5B8A A;  3GA4 A;  5G1L A;  2L4C A;  3GST A;  5JCU A;  2VLU A;  2CT6 A;  2DBC A;  1PN9 A;  3U5R E;  3ZTL A;  1M7T A;  4KDY A;  5ENU A;  4NWY A;  4BWQ A;  1MDJ A;  5IPG A;  9GSS A;  2C3T A;  4HJ2 A;  2WDU A;  2CVK A;  3UAR A;  2LRN A;  1GTU A;  4WEY A;  1MEK A;  4EE0 A;  3GL5 A;  4K7I A;  4ML6 A;  2ES7 A;  1O85 A;  3Q6O A;  2I9H A;  4RI7 A;  3M9J A;  1ERW A;  1JLV A;  3DVX A;  2IMF A;  3ZLP A;  1OC9 B;  2N5A A;  3CRT A;  2CA8 A;  3GKK A;  1K0B A;  1WP0 A;  2B1K A;  3HXS A;  3FRC A;  4ULX A;  1DE2 A;  4MF5 A;  5J47 A;  2LJK A;  2NPB A;  2H66 A;  1K3Y A;  4TXO A;  5LCZ A;  2K8S A;  1TXX A;  1KTE A;  1DSB A;  4OCE A;  5HFI A;  2L5L A;  1BG5 A;  1TDI A;  4PXO A;  1ZYE A;  1GSS A;  4LL1 B;  4G0K A;  6GSY A;  2B1L A;  5IOX A;  3G7J A;  5IIZ A;  2EC4 A;  3GNJ A;  5EVO A;  1XWB A;  1ST9 A;  1ZMA A;  1N25 A;  4F0B A;  3ZFB A;  1Z7R A;  2HSM B;  4X0X A;  2FCH A;  2E7P A;  1WPI A;  1PX7 A;  3KD0 A;  2XBQ A;  2YOI A;  2I4A A;  22GS A;  1SL0 B;  2V32 A;  4JU5 A;  1YQ1 A;  2DJ3 A;  1PSQ A;  4GWR A;  2HSN B;  3DXB A;  4HU9 A;  4FQU A;  4K7O A;  4G9H A;  4KF9 A;  3BD2 A;  4K5S A;  3TCO A;  1XFL A;  1TW9 A;  2XHF A;  5J3R A;  1YF0 A;  3W8J A;  3QCP A;  1JZW A;  5IMV A;  1EWX A;  2IMI A;  1VF1 A;  1WRY A;  4TXV A;  1QGV A;  2ZUP A;  3EPT A;  1NSW A;  2JSZ A;  2JU5 A;  5A5K A;  3TJK A;  5JCW A;  4V2N A;  4IW9 A;  4PNF A;  1J9B A;  4HZ4 A;  2IME A;  1I5G A;  3NOF A;  2H8L A;  3EMP A;  3HJP A;  1T7P B;  3DWV A;  1R4W A;  3GH9 A;  5AIS A;  2F8F A;  4O92 A;  3A2V A;  2O8V B;  1YEX A;  4N0Z A;  1TI3 A;  2H72 A;  1K0C A;  1V58 A;  2JAC A;  4J57 E;  2H73 A;  3Q18 A;  2HSH A;  1TJD A;  3TGZ A;  4PTS A;  1OAZ A;  4XRD A;  2C0E A;  2X8G A;  4ZXG A;  2X4A A;  1F9M A;  3F8U A;  2DJ0 A;  2PPT A;  3ZRE A;  1M2B A;  2MBT A;  1XCC A;  4Z2R A;  1VGL A;  3APO A;  4YH2 A;  3TB2 A;  1B4Q A;  1CQH A;  5B6M A;  1GTB A;  3MSZ A;  3IDV A;  2TRC P;  5D93 A;  3HHV A;  2IFQ B;  4MJB A;  2VO4 A;  4YAV A;  2HZE B;  1K3O A;  2CX3 A;  3UBL A;  3Q74 A;  1T00 A;  4F9Z A;  1ACV A;  5J9B A;  4RQR A;  3KXO A;  4MH3 A;  2MMO A;  2P0G A;  4RI6 A;  4PNG A;  1WWJ A;  3L78 A;  4MF7 A;  5D73 A;  1NW2 A;  3MIX A;  1XW6 A;  3TKS A;  1I9D A;  2DLX A;  2K6V A;  4WBJ A;  5G2Z A;  2GVP A;  5F05 A;  4JR6 A;  4G19 A;  2B7J A;  5F0G A;  1K0M A;  2FLS A;  3KCM A;  1O8X A;  2I1U A;  3QAG A;  3ZIJ A;  2OT3 A;  1SKS B;  5JWQ B;  1OE7 A;  3F4R A;  1BG1 A;  4KSM A;  3VWV A;  4EKZ A;  2L57 A;  1ILO A;  2QKE A;  3BCK A;  2GQK A;  1PKZ A;  5AN1 A;  4MP4 A;  2A2S A;  2LJA A;  1MTC A;  4MAB A;  4CY8 A;  2ON7 A;  2KP1 A;  1JZR A;  3LEF A;  5CP1 A;  4YKF A;  2C80 A;  3HZ8 A;  3P7X A;  1ZCP A;  5J9C A;  4L5O A;  3ZYW A;  2LST A;  2GT5 A;  3QFA C;  2R0P A;  2JZT A;  3FHK A;  4K2D A;  2GDR A;  4ZB6 A;  1JZD A;  4HQZ A;  5DCH A;  19GS A;  1PL2 A;  3W6G A;  2CAQ A;  1BED A;  13GS A;  5B6N A;  16GS A;  2I3Y A;  1SK0 A;  1K0D A;  2FY6 A;  1X9W B;  3E0U A;  4BWS A;  3KZQ A;  1JLW A;  1K0O A;  2N5F A;  3GH6 A;  3KGK A;  2HLS A;  3EVI A;  1U3A A;  3IK7 A;  3VK9 A;  2L4Q A;  4G2E A;  2H1B A;  4L0W A;  3MYD A;  3LXZ A;  2FWE A;  1OKD A;  3GL3 A;  1EV9 A;  1A0F A;  4PQI A;  1PX6 A;  4OWY A;  2FHE A;  4EUY A;  1XWA A;  4EXJ A;  5D9W A;  1T1V A;  2LRC A;  5DDL A;  1GTI A;  2RUF A;  5JCG A;  1HNC A;  3G9B A;  4QQ7 A;  5A34 B;  1ML6 A;  4ILF A;  3ZL5 A;  3N9J A;  5H5S A;  2C8U A;  1MDI A;  2LV3 A;  1OC8 A;  3FZ9 A;  3F3Q A;  1WIK A;  2GQM A;  3G7I A;  1A24 A;  3LW9 A;  4MZB A;  3TDG A;  3C7M A;  4NAX A;  2KP2 A;  1VF4 A;  4AJ6 A;  2DKH A;  4H86 A;  4IKH A;  1A2L A;  1SK2 A;  4MPF A;  3HJO A;  4AKX B;  3CXG A;  3V1W A;  1EP7 A;  4FYC A;  5G5E A;  2IJY A;  4HJM A;  1JHB A;  4HDE A;  3HVS A;  5CRD A;  5EPF A;  2R3X A;  2HFD A;  1U88 A;  1X0R A;  1YDK A;  4GXZ A;  3A3T A;  3DKS A;  3CRU A;  4Z2U A;  1UA5 A;  3IV4 A;  1FOV A;  5AIX A;  1EGO A;  1A2J A;  3APQ A;  1VF2 A;  5J4Y A;  4MJA A;  3QDN A;  4PX1 A;  3IOS A;  3CTG A;  2YP6 A;  1PRX A;  3J7Y b;  1B9Y C;  4L8E A;  3EE2 A;  4K6X A;  5ELA A;  2PU9 C;  2YV7 A;  1XW5 A;  1XWK A;  4Q5R A;  5G30 A;  2EIQ A;  4CY6 A;  4EDZ A;  5A5H A;  2GSR A;  3IRA A;  3SWL A;  1YJ6 A;  2B5Y A;  3CBU A;  4WKW A;  1Q98 A;  2H0G A;  5B7C A;  4EO3 A;  3ZMK A;  2H0H A;  1QMV A;  4IS0 A;  1RK4 A;  4ZBB A;  1GSU A;  2FNO A;  1M2A A;  4G01 A;  4ACS A;  3GMF A;  6GST A;  4D73 A;  3GRX A;  5LD0 A;  5HFK A;  2K8V A;  2YPM A;  4FYB A;  4LL4 B;  5KN2 A;  3VFI A;  1GLQ A;  5IMA A;  5HR0 A;  4PUA A;  2PBJ A;  3JCM L;  3AY8 A;  3FZ5 A;  4AGS A;  2DIY A;  1GWC A;  1A8Y A;  4BL7 B;  4KX4 A;  4YKG A;  1FVK A;  4JZQ A;  2A4H A;  2YWO A;  4KB3 A;  5LNK e;  3IHG A;  2VKZ G;  3KP8 A;  1TKD B;  3FYG A;  2YJ7 A;  4ZIJ A;  5IO0 A;  1EEM A;  1MDK A;  1BJX A;  4N11 A;  3LGC A;  1GLP A;  1GP1 A;  1R26 A;  2EFE A;  4OD7 A;  3HDC A;  5BMU B;  1GSF A;  2HRK A;  4NXI A;  3LYK A;  4POB A;  3QAW A;  2YZH A;  3L4N A;  5IPH A;  5J4V A;  1EZK A;  1X9S B;  5ELG A;  3GFK A;  5A4W A;  1ERV A;  12GS A;  4AKI A;  3EUR A;  4MDC A;  3KTL A;  2OBK A;  3UVT A;  1ERT A;  3GSS A;  2MMA A;  2XC2 A;  1SKW B;  4XS4 A;  1H75 A;  4O5U A;  4BPY A;  2DKI A;  1DUG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...