1UA5A

Non-fusion gst from s. japonicum in complex with glutathione
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
215
structure length
215
Chain Sequence
SPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords glutathione S-transferase
publication title Non-fusion GST from S. japonicum in complex with glutathione
rcsb
source organism Schistosoma japonicum
total genus 69
structure length 215
sequence length 215
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2003-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1ua5A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1ua5A01
4TW5A 3KMOA 5J5NA 5ECOB 4ZBBA 1QMVA 2NVLA 5A4VA 4MJAA 3ZVJA 2OA7A 3A3TA 1T4ZA 2K6VA 1EEJA 2V41A 1K3OA 2H74A 2P5QA 1BEDA 2HRKB 4CW9A 2L6DA 1TK5B 1HNAA 3EMXA 3FR6A 5DDLA 3DXBA 5IOXA 4TR1B 1BAYA 3ZLPA 1S3DA 3ME8A 4GSNA 1XWCA 3LXZA 2OBIA 5B7CA 1UA5A 3QCPA 2XPDA 2IMIA 5H5SA 1TW9A 1W4VA 4NV2A 3KM6A 2KOKA 3ME7A 4YAPA 5IO2A 2H6ZA 4GLTA 1QGVA 1XFLA 1SL1B 3GUSA 4F0BA 5DJMA 3FRCA 2N5AA 1XW6A 1ZCPA 3ZL5A 3WGDA 4IJ3A 3LORA 3A5WA 2CVKA 3D5JA 3D21A 5ABRA 4K1FA 4G0LA 4N11A 2IIYA 2D2ZA 1HQOA 2HSYA 3ZRDA 3TKQA 3W6GA 3UMAA 1JZWA 4MZCA 5HFGA 2VL2C 3BCIA 3LEFA 3HXSA 1PGTA 2L4CA 3E0UA 4IVFA 3CYNA 2H66A 2L4QA 3G9BA 2A2SA 3QAGA 2H76A 2DJ2A 2FWFA 3F4RA 2KLXA 4IKHA 2WB9A 2WS2A 1C72A 2WULA 1XW9A 2E0QA 2X8GA 1EV9A 2B3SA 4ZILA 4NAXA 1AC1A 5GAND 4D73B 4EDYA 3APSA 3DEXA 3KZQA 4G10A 2KP2A 2PBJA 1EV4A 1X9MB 2EIOA 3TGZA 1OVNA 3ZFBA 2H75A 1OE7A 1MDKA 4QL7A 3C8EA 1ABAA 2VCXA 3Q74A 5LCZA 4K0GA 2XHFA 5CYYA 2I81A 4HUAA 5DALB 5ECMB 1Q98A 4RI6A 3CTGA 4HS1A 1EOHA 3MAKA 4GWRA 1PL2A 3CBUA 2HXKA 2AYTA 1ERTA 2CX4A 17GSA 2VL3A 2R6KA 1EGOA 2J9HA 3J7Yb 1J0FA 5E4WA 5B6MA 2AUVA 3IR4A 5KN2A 1FVJA 2I4AA 1ML6A 5ECHB 2B5YA 1M2DA 5A4UA 5HFIA 2PVQA 1GSDA 4MF5A 1CQHA 4XHMA 1Z9HA 3N5OA 1V40A 7GSSA 1JHBA 1U3AA 1T3BA 3HJOA 4EC0A 5LNKe 4I5QA 3NIVA 1TJDA 4HQZA 1FHEA 4MJCA 1Y25A 1Z6NA 3H79A 4BVXA 3TKRA 4IW9A 4MH3A 1F3BA 1B48A 1PL1A 2GDRA 3W8JA 3A2WA 3M0FA 5EPFA 5ECRB 3TRPA 3VWWA 1GULA 2VCVA 4PQ1A 4ZBAA 3TOTA 2R37A 5DQYA 4EE0A 1B9YC 2YNXA 4OMVA 2GZYA 2C0FA 1T8EB 4N0VA 2HRKA 4XS1A 1PA3A 2X8CA 2CT6A 1M0UA 5DAKB 1SKWB 2GSQA 2DSAA 1M9BA 3EINA 4TR1A 3VWXA 4MZBA 5IQYA 1GL8A 2CX3A 4O5RA 4LMVA 2R2JA 3DGQA 3RBTA 3M1GA 2CQ9A 2F9SA 3VPTA 3HDCA 3HVSA 2VM1A 1V58A 1ERWA 1SENA 5GAPD 3QOUA 4L5LA 4XRDA 3HJPA 5D9VA 1YZXA 3L9SA 2VCTA 4KSMA 1M2BA 1W89A 1XVQA 4E8HA 4TXOB 3R2QA 1A23A 3MSZA 4ZIJA 4POKA 3RHCA 3D0ZA 3BD2A 4V1Ap 4XTSA 5KN0A 4LLRA 5D96A 3LG6A 1RW1A 4F03A 3I9V2 5INYA 5FWGA 2OBKA 2TRXA 4MH2A 1OC3A 1WJKA 1F6MC 1SJIA 4J2FA 1GSUA 2MYGA 3KTLA 3TJJA 3S9FA 1TRUA 5D9WA 1GSYA 1JFUA 2FWEA 2PVOC 2B7KA 1F37A 3UVHA 5AIVA 4IELA 2F8FA 1TOFA 2F8AA 2FCHA 2WGRA 4WR4A 1JLWA 5GSSA 1WWJA 4MP4A 1O7UA 3PH9A 4POMA 4D73A 1A2MA 1SL0B 4ZXGA 5B8BA 1GWCA 5C04A 1V2AA 3IAS2 2GTUA 6GSWA 1IYIA 1TDIA 4MABA 4HDEA 4HZ2A 4Q5RA 2DIZA 2BTOT 3C1SA 3P2AA 1V9WA 4CHSA 1T1VA 5FHIA 1G0TA 1R26A 5DALA 2IMFA 4G2EA 4MA9A 1DBYA 3G7IA 20GSA 4WF5A 1DSBA 5FT3A 3HCZA 2PGTA 2R4VA 2LTKA 3V1WA 3QAWA 3ZFLA 5JCWA 3M3MA 3ZZXA 4NV5A 1EWXA 2HE3A 3FEUA 5E59A 4YAVA 1A2LA 3FR3A 2WFCA 2H6XA 4V2MA 3GYKA 3QFAC 2YZHA 3O3TA 5DQSA 1Y6EA 2R5GA 4ISDA 3C71A 5DCHA 1ZZYA 5IMZA 3P90A 2C8UA 1GSSA 1NHYA 4MLYA 1SU9A 1G6WA 2G2QA 2HYXA 2MBSA 3TKSE 1SKSB 4DEJA 2LS5A 2B7JA 3TCOA 14GSA 3TRQA 2WDUA 2O85A 4Z7XA 1T4YA 4K6XA 1NSWA 3FZAA 4G19A 3APOA 2OKAA 4MPFA 2RLIA 3TJFA 3EURA 2H0IA 4ECIA 1TI3A 1BJXA 2L59A 1O85A 4PXOA 3U6VA 3QD9A 2C0EA 3PR8A 2I1UA 3M9KA 5DAKA 2JSYA 4JE1A 1SK2A 3HVXA 1ZYQB 1K0NA 1FG4A 2ZUPA 3PPUA 4KAEA 3KTBA 5L71A 5ECKB 1GLQA 1K0BA 3GFKA 3C7MA 2VCZA 4KX4A 1YDKA 4YQUA 3ZTLA 2FUG2 3BBYA 2YPMA 4PURA 4RI7A 2MBTA 5BMUA 4LL4B 4OO5A 1AAZA 1BG5A 4JR6A 4KDUA 5CRWA 1FO5A 2CVBA 2IMDA 1WMJA 1JZOA 4N30A 3KD0A 1R7HA 3TUEA 1R4WA 4KDXA 4OFNA 2JACA 5AIXA 1XW5A 1EOGA 5HR0A 2FD3A 1B8XA 1G6YA 1QK8A 2ES7A 4DSSB 18GSA 1KEBA 3VURA 5B6NA 1GUKA 4GSTA 5IOWA 2CZ2A 2LNTA 2NPBA 1SJZA 2HI7A 2OE0A 2YN1A 2O87A 1OKTA 2F3MA 2HSMB 4MMMA 4PX1A 4HU9A 4L5OA 4JBBA 5GZZB 1NW2A 3ZVJD 2H0HA 2XPEA 2JU5A 5F06A 5AGYA 3CXGA 4KUNA 1G7EA 1R5PA 2B1LA 5ID2A 2YP6A 1H4OA 1B9XC 3U5RE 5KEJA 3VK9A 5D9TA 4AGSA 2H73A 3LYPA 3D6IA 2A2RA 4XS6A 3FK8A 2DMLA 5D9XA 1EEMA 1NM3A 3GX0A 4H86A 4ZBDA 4O7HA 1E2YA 3D22A 5IMDA 1PQNA 3FHKA 5ENUA 3H1NA 5IMCA 2GVPA 4HJMA 1PMTA 2ZCTA 4YQVA 3F4SA 3ISOA 4JU5A 2FLSA 1TRWA 3BJ5A 1JZRA 2LRCA 3HVVA 2K8VA 3D4TA 3E9JB 3F3QA 3QMXA 2VCQA 3LYKA 3K8NA 4KGIA 3N9JA 1IYHA 2OE1A 4MF6A 2H1DA 3BOAA 1X5EA 1PX6A 5G1LA 2VOCA 1AQXA 3GSTA 3CSJA 2YCDA 5CO3A 5CRDA 3IHQA 2GLRA 1ZYEA 1LU4A 3GL3A 2DC5A 1FB6A 3EYTA 2CZ3A 2JL4A 4IS0A 5IMVA 2VD0A 3FZ4A 2HSHA 2WJUA 4Q5QA 4N10A 2DBCA 3KMNA 1XIYA 2V6OA 1NHOA 3D4MA 4HQSA 2A4VA 5DBQA 1I5GA 1VF4A 2KUCA 1YY7A 4K7OA 5B8AA 5HR2A 4XCSA 5DJLA 1ST9A 4GQFA 1A0RP 3UEMA 5COHA 4RQRA 2YZUA 4TR3A 2LNSA 5HR3A 4FO5A 2PMTA 1SJ6A 4KSOA 1WP0A 1YF1A 1WRYA 3GA4A 4ID0A 2FHEA 4G9HA 1AIUA 1GNEA 3KH9A 2L57A 3FW2A 3NZNA 3HKRA 2B5EA 4FYBA 5GSTA 4F82A 1QUWA 2KHPA 3GIXA 4FYUA 1GSEA 1EP7A 1GRXA 1MDIA 1J9BA 1MDJA 1EGRA 2ON7A 2X64A 4FYCA 3VI5A 2DJJA 2ALBA 3HZ8A 2XBIA 4OWYA 5CP1A 2YV7A 4ZB9A 2IFQB 4DSSA 4OD7A 4ZL7A 5G2ZA 4DSQA 1WE0A 2N5BA 4MPGA 1K3LA 2HSMA 3UBKA 1USBA 3CSIA 2TRCP 3DYRA 4KB3A 3J7Yk 4AF2A 2I9HA 1GSQA 3QPMA 3UVTA 5C00A 1GP1A 4ILFA 2VUPA 10GSA 5G5FA 1SK1A 3EMPA 1OYJA 3BCKA 2HZFA 3WYWA 5J9BA 4IGJA 4OCEA 1XVWA 4I8BA 4HI7A 1K0OA 1JZDA 3A2VA 1PKZA 2FNOA 4FH8A 5LD0A 1VF2A 1QXHA 1GLPA 3DD3A 2MMOA 4O32A 1MTCA 5JWOB 4I6XA 1V57A 2JZTA 1XBSA 1Z7RA 4LL1B 1JLVA 3TKSC 2H1AA 4IN0A 2GS3A 2L5LA 1KNGA 1YQ1A 1SD8A 5ECQB 4K7NA 3DIEA 4DSRA 1S3CA 3DVXA 4ZL8A 4TXVA 2V6KA 3ERGA 4I2TA 5JCUA 4JR4A 2C80A 4L0UA 2IN3A 2YWNA 3O76A 4USSA 5CRHA 2CAQA 3IBHA 4K9ZA 2IPAA 2PWJA 4JRRA 5IPHA 4NXIA 4PNFA 2OJLA 4TR0A 2JADA 4ECCA 1OE8A 3IA1A 1K3YA 4RQXA 2IWTA 3RAZA 8GSSA 3OR5A 3GTUB 1Q4JA 5KN1A 1X9WB 2PERA 1PSQA 5ID2B 1X5CA 1FVKA 4KNDA 3GNJA 4ML6A 5IMAA 1HYUA 3WT2A 1XOBA 3F6DA 4XS4B 3UBLA 2AHEA 1OC9B 3APQA 2EIQA 3F0IA 4IHUA 1Z5YE 4IP6A 2GT5A 3RPPA 2JSZA 1I9DA 3AY8A 5IMFA 2XBQA 4J56E 4BVYB 5HR1A 4EKZA 4AJ6A 2O89A 3GH6A 1DUGA 5AISA 3A2XA 2O8VB 4ZL9A 4NHWA 1PD21 2C3QA 3DVWA 1SYXA 1AXDA 1ERUA 2JZSA 2REMA 1XPVA 4OO4A 3M9JA 1U87A 5J9CA 3TJGA 2L6CA 3GH9A 4NPBA 3DMLA 1QQ2A 2RUFA 2VAFA 3I43A 2HFDA 2ZNMA 5DVBA 4FQUA 4O92A 4L0WA 2RUEA 4BWQA 1BYEA 2FWHA 1N2AA 1Z7PA 4GRFA 5J4UA 5DCGA 1KTEA 1TXXA 2EIRA 3Q6OA 4KH7A 2VIMA 1MD3A 2LKUA 2IFQA 4ZB8A 2CVDA 4MJBA 4KCEA 2QGVA 2I3YA 2GSRA 3GMFA 1BX9A 6GSTA 2HQTA 3KEBA 3UAPA 3MNGA 22GSA 2M46A 1K0CA 4K8MA 1EP8A 4BPYA 4WR5A 1EZKA 2H19A 1TRSA 2J23A 2CA8A 1FW1A 2C4JA 4IQAA 3CRUA 4I2UA 3Q18A 2GQKA 1GTUA 2GZPA 1ZOFA 4XRAA 2H8LA 3M8NA 3IK7A 2YWOA 3I69A 1UN2A 4PQIA 1ILOA 3FKFA 3LJRA 4EF0A 1WIKA 4MK3A 1XXUA 2B1KA 2GSTA 4GF0A 2PN8A 1YJ6A 5ECPB 1UVZA 1X5DA 2LV3A 1DE1A 2PPTA 2GQMA 3LGCA 4L8EA 2RIIA 3ZIJA 5F07A 5H5QA 3IAM2 4YQMA 5HFKA 4I97A 4PQHA 5J41A 4PUFC 2H70A 1XWKA 3TOUA 2AV4A 4NHZA 1PX7A 5A4WA 2HRAA 5A5KA 3DWVA 3TKSA 2V1MA 19GSA 5H5RA 2V2GA 1AQWA 3TB2A 4X0XA 1URMA 4DVCA 2CAIA 3H8QA 3GKMA 3VPQA 1AW9A 4GCIA 1TK8B 1TK0B 4X43A 3UIWA 4PGTA 3LWAA 4F0CA 1TI1A 3HA9A 1WOUA 4G0KA 1PN9A 4GQCA 2IJYA 3P7XA 4PNGA 2OACA 4TKYA 1O8WA 4TVEA 2IMEA 1B4PA 3EU3A 3KXOA 5IPGA 3IK9A 1TP9A 4WF4A 3CRTA 3SWLA 3LXTA 5D8IA 3TJKA 1RQMA 2YWMA 4IP1A 3FZ5A 5ECSA 3ZMKA 2LUSA 2LRNA 1GUHA 3FY7A 3R3EA 3GTUA 1S3AA 3IC8A 5IO0A 4LA1A 1O8XA 1GUMA 2NTOA 2RM5A 2VL9A 3QDNA 5KN3A 2DJ0A 1GTIA 4OCFA 3F63A 4XS4A 3SBCA 1F3AA 1E6BA 2HSNB 1OC9A 2DJKA 2YJHA 4ECBA 1K0MA 1M9AA 1V98A 4IJIA 2OE3A 2TIRA 3C73A 3GKNA 2EC4A 5ELGA 2QC7A 4K7IA 2C1YA 2LEGA 5AN1A 4BVYA 2FA4A 5JCGA 4F2IA 3GURA 4ML1A 4ACSA 4KDYA 1SK0A 2HZEB 3Q19A 3DRNA 4YH2A 2VD1A 3G7JA 1ERVA 1SD9A 1VGLA 4PUAA 3KH7A 5CREA 1YF0A 2K8SA 3CTFA 3VWVA 5EL8A 3UJ1A 4K2DA 2YJ7A 3TRXA 2DLXA 2H01A 4AJ8A 2VCWA 1ZL9A 3IV4A 2M72A 12GSA 5ECIB 4WETA 3IDVA 3WD6A 3HD5A 3WGEA 4HEA2 2FA8A 1CQGA 1K0AA 4V2LA 2H30A 4X1UA 4IBPA 4OFMA 2B6MA 3GSSA 1M7TA 4NWYA 2N5FA 3CSHA 6GSUA 3LSZA 2YANA 2ON5A 1A2JA 1TU8A 1K0DA 1J08A 3EWLA 2GZZA 3KP9A 4V2NA 5G30A 4TOPA 1UC7A 4KW6A 4GXZA 4QQ7A 2GSSA 2OADA 2QKEA 5D73A 4WBJA 2E7PA 2GGTA 3I6AA 13GSA 3C1RA 2PU9C 6GSXA 3HYPA 2H71A 1THXA 2PUKC 3QFBC 1HNBA 2HRFA 2FY6A 4HU7A 1R5AA 1VF3A 2M80A 3GHAA 5EY6A 2LSTA 1OC8A 2YV9A 2HT9A 4E8EA 4CDOA 4G0IA 3F9UA 3IOSA 2YWIA 5HQPA 1XWBA 3MWHA 3IC4A 2E2MA 5G1KA 6GSYA 6GSSA 2IL3A 4P3YB 3TDGA 5CAXA 3FR9A 1B4QA 1LJRA 3GN3A 1BQ7A 3TKPA 2H72A 5IIZA 1A24A 2MMNA 3TJBA 2MMAA 3F6FA 4Q5NA 3PGTA 3GX8A 3CMIA 1XCCA 4EDZA 2C0DA 3VLNA 4K0NA 1X0RA 2XC2A 1THOA 2GT6A 2WCIA 3RPNA 3QR6A 1GSFA 1O81A 4WBRD 5F8BA 5ELAA 2RM6A 4BWSA 2VLTA 1DE2A 4JZQA 3O6TA 1T7PB 2V32A 3IE3A 3DKSA 4V1Ag 1T00A 1H75A 4TN8A 2NDOA 4POLA 3H93A 3EE2A 3LQ7A 4HJ2A 2VO4A 1AQVA 4J57E 4GTUA 3ZREA 1A8LA 5JWQB 3UOMA 2HRNA 2HLSA 5ECNB 4EXJA 2LQQA 5G5EA 1TTZA 2O7KA 2KP1A 1WPIA 5F05A 3ZIVA 4BL7B 3HZ4A 4POBA 3EVIA 2YOIA 1ZMAA 2X99A 1MEKA 3GKXA 1QFNA 3KIJA 4EVMA 4HZ4A 2HZEA 2LJRA 1KBNA 3ERFA 2VLUA 5ECLB 4MZWA 3EC3A 1ON4A 2DIYA 4JEDA 2LQOA 3ZITA 4EL1A 4BA7A 1XWGA 1PKWA 2G0FA 2LJAA 2VL2A 2L5OA 1AUCA 1MD4A 4KCAA 1XOAA 1TRVA 5IM9A 2JZRA 2K9FA 2P0GA 1LBKA 3US3A 3VFIA 4NMUA 4EUYA 4MCUA 4WXTA 2GQLA 4QL9A 11GSA 3IRAA 4KA0A 3UARA 2MZCA 1GTAA 1ZGNA 3WT1A 2DJ3A 1Z6MA 4Q5FA 3VWUA 1OAZA 3FYGA 2C0GA 3MDKA 3IXRA 3ERWA 4TRXA 1GNWA 2AB6A 5EVOA 2B5XA 1X9SB 1O73A 1F9MA 4KF9A 2C3TA 2H1BA 3KGKA 1N8JA 3ZYWA 2LJKA 1F2EA 3L78A 1FOVA 4MJEA 1U6TA 2FGXA 1A0FA 4KE3A 4F9ZA 1G7OA 2FWGA 3KP8A 1VF1A 2LRTA 4IQ1A 2IMKA 3E3EA 2P31A 3F3RA 1Z3EA 4WEYA 1GH2A 3P8WA 2DJ1A 1SYRA 3IPZA 3WGXA 2HNLA 3H4KA 3F4TA 2BMXA 1FB0A 2NBSA 1O6JA 4WKWA 5D93A 1VRSD 1YEXA 2R3XA 4HOJA 2BJXA 3W8SA 3GL5A 2E2GA 2AAWA 3GKKA 1HD2A 1PRXA 1ACVA 3L4NA 3GRXA 3QAVA 2QSIA 2UZ8A 4GSSA 2MMZA 4MF7A 3FZ9A 1XZOA 3L0HA 3EU4A 2H0GA 4ECJA 1TKDB 4ZB6A 16GSA 2VLVA 4LMWA 3F8UA 4MDCA 1M99A 4XIHA 4EO3A 2P5RA 1XWAA 2VM2A 1SKRB 3PINA 1YEPA 2K18A 5F0GA 2Z9SA 1TU7A 4OFTA 3KCMA 2CV4A 3JCML 3HJMA 4RUVA 2AJQB 2DMMA 2F51A 1U3IA 2WRTA 2WZ9A 1HNCA 4N0ZA 3RHBA 3GV1A 5JWRB 4BL7A 6GSVA 1RK4A 3ED3A 4TXOA 3G7YA 4ULXA 1U88A 3HY2A 3L9VA 3VI7A 3NOFA 2C3NA 4AJ7A 3HHVA 4PTSA 1YKAA 1FAAA 3UL3A 1YKCA 1M2AA 4FIWA 3L9UA 5G31A 2H1GA 3ZMLA 5CNWA 2X8HA 1SL2B 3LFLA 2H6YA 1GTBA 9GSSA 5CRGA 1A8YA 1OKDA 3RDWA 5J3RA 4BVXB 3KJYA 4TR4A
chains in the Genus database with same CATH superfamily
4TW5A 3KMOA 5J5NA 5ECOB 4ZBBA 1QMVA 2NVLA 5A4VA 4MJAA 3ZVJA 2OA7A 3A3TA 1T4ZA 2K6VA 1EEJA 2V41A 1K3OA 2H74A 2P5QA 5KOWA 1BEDA 4N3ZA 2HRKB 4CW9A 2L6DA 1TK5B 1HNAA 3EMXA 3FR6A 5DDLA 3DXBA 5IOXA 4TR1B 4W66A 1BAYA 3ZLPA 1S3DA 3ME8A 4GSNA 1XWCA 3LXZA 2OBIA 5B7CA 1UA5A 3QCPA 2XPDA 2IMIA 5H5SA 1TW9A 1W4VA 4NV2A 3KM6A 2KOKA 3ME7A 4YAPA 5IO2A 2H6ZA 4YKFA 4GLTA 1QGVA 1XFLA 1SL1B 3GUSA 4F0BA 5DJMA 3FRCA 2N5AA 1M3IA 1XW6A 1ZCPA 3ZL5A 3WGDA 4IJ3A 3LORA 3A5WA 5A1NB 2CVKA 3D5JA 3D21A 5ABRA 4K1FA 4G0LA 4N11A 2IIYA 2D2ZA 1HQOA 2HSYA 3ZRDA 3TKQA 3W6GA 3UMAA 1JZWA 4MZCA 1YVLA 5HFGA 2VL2C 1S4BP 3BCIA 3LEFA 3HXSA 1PGTA 2L4CA 3E0UA 4IVFA 3CYNA 2H66A 2L4QA 3G9BA 2A2SA 3QAGA 2H76A 2DJ2A 2FWFA 3F4RA 2X49A 2KLXA 4IKHA 2WB9A 2WS2A 1C72A 3MIXA 2WULA 1XW9A 2E0QA 2X8GA 1EV9A 2B3SA 4ZILA 4NAXA 1AC1A 5GAND 4D73B 4EDYA 3RGBC 3APSA 3DEXA 3KZQA 4G10A 2KP2A 2PBJA 1EV4A 1X9MB 2EIOA 3TGZA 1OVNA 3ZFBA 2H75A 1OE7A 1MDKA 4QL7A 3C8EA 1ABAA 2VCXA 3Q74A 5LCZA 4K0GA 2XHFA 5CYYA 2I81A 1YEWC 4HUAA 5DALB 5ECMB 1Q98A 4RI6A 3CTGA 4HS1A 1EOHA 3MAKA 4GWRA 1PL2A 3CBUA 2HXKA 2AYTA 1ERTA 2CX4A 17GSA 2VL3A 2R6KA 1EGOA 2J9HA 3J7Yb 1J0FA 5E4WA 2WW1A 5B6MA 2AUVA 3IR4A 5KN2A 1FVJA 2I4AA 1ML6A 5ECHB 2B5YA 4CY8A 1Y1UA 1M2DA 5A4UA 5HFIA 2PVQA 1GSDA 4MF5A 1CQHA 4XHMA 1Z9HA 3N5OA 1V40A 7GSSA 1JHBA 1U3AA 1T3BA 3HJOA 4EC0A 5LNKe 4I5QA 3NIVA 1TJDA 4HQZA 1FHEA 4MJCA 1Y25A 1Z6NA 3H79A 4BVXA 3TKRA 4IW9A 4MH3A 1F3BA 1B48A 1PL1A 2GDRA 3W8JA 3A2WA 3M0FA 5EPFA 5ECRB 3TRPA 3VWWA 1GULA 2VCVA 4PQ1A 4ZBAA 3TOTA 2R37A 5DQYA 4EE0A 1B9YC 2YNXA 4OMVA 2GZYA 2C0FA 1T8EB 4N0VA 2HRKA 4XS1A 1PA3A 2X8CA 2CT6A 1M0UA 5DAKB 1SKWB 2GSQA 2DSAA 1M9BA 3EINA 4TR1A 3VWXA 4MZBA 5IQYA 1GL8A 2CX3A 4O5RA 4LMVA 2R2JA 3DGQA 3RBTA 3M1GA 2CQ9A 2F9SA 3VPTA 3HDCA 3HVSA 2VM1A 1V58A 1ERWA 1SENA 5A5HB 5GAPD 3QOUA 4L5LA 4XRDA 3HJPA 5D9VA 1YZXA 3L9SA 2VCTA 4KSMA 1M2BA 1W89A 1XVQA 4E8HA 4TXOB 3R2QA 1A23A 3MSZA 4ZIJA 5BMUB 4POKA 3RHCA 3D0ZA 3BD2A 4V1Ap 4XTSA 5KN0A 4LLRA 5D96A 5A1NA 3LG6A 1RW1A 4F03A 3I9V2 5INYA 5FWGA 4AKIA 4O5QA 2OBKA 2TRXA 4MH2A 1OC3A 1WJKA 1F6MC 1SJIA 4J2FA 1GSUA 2MYGA 3KTLA 3TJJA 3S9FA 1SVMA 3A5IA 1BG1A 1TRUA 5D9WA 1GSYA 1JFUA 2FWEA 2PVOC 2B7KA 1F37A 3UVHA 5AIVA 4IELA 2F8FA 1TOFA 2F8AA 2FCHA 2WGRA 4WR4A 1JLWA 5GSSA 1WWJA 4MP4A 1O7UA 2WVZA 3PH9A 4POMA 4D73A 1A2MA 1SL0B 4ZXGA 5B8BA 1GWCA 5C04A 1V2AA 3IAS2 2GTUA 2X4AA 6GSWA 1IYIA 1TDIA 4MABA 4HDEA 4HZ2A 4Q5RA 2DIZA 2BTOT 3C1SA 3P2AA 1V9WA 4CHSA 1T1VA 5FHIA 1G0TA 1R26A 5DALA 2R0GA 2IMFA 4G2EA 4MA9A 1DBYA 3G7IA 20GSA 2EFHA 4WF5A 1DSBA 5FT3A 3HCZA 2PGTA 2R4VA 2LTKA 3V1WA 3QAWA 3ZFLA 5JCWA 3M3MA 3ZZXA 4NV5A 1EWXA 2HE3A 3FEUA 5E59A 4YAVA 1A2LA 3FR3A 2WFCA 2H6XA 4V2MA 3GYKA 3QFAC 2YZHA 3O3TA 5DQSA 1Y6EA 2R5GA 4ISDA 3C71A 5DCHA 1ZZYA 5IMZA 3P90A 2C8UA 1GSSA 1NHYA 4MLYA 1SU9A 1G6WA 2G2QA 2HYXA 2MBSA 3TKSE 1SKSB 4DEJA 2LS5A 2B7JA 3TCOA 14GSA 3TRQA 2WDUA 2O85A 4Z7XA 1T4YA 4K6XA 1NSWA 3FZAA 4G19A 3APOA 2OKAA 4MPFA 2RLIA 3TJFA 3EURA 2H0IA 4ECIA 1TI3A 1BJXA 2L59A 1O85A 5BRTA 4PXOA 3U6VA 3QD9A 2C0EA 3PR8A 2I1UA 3M9KA 5DAKA 2JSYA 4JE1A 1SK2A 3HVXA 1ZYQB 1K0NA 1FG4A 2ZUPA 3PPUA 4KAEA 3KTBA 5L71A 5ECKB 1GLQA 1K0BA 3GFKA 3C7MA 2VCZA 4PHZC 4KX4A 1YDKA 3CQFA 4YQUA 5A5HA 3ZTLA 2FUG2 3BBYA 1M3JA 2YPMA 4PURA 4RI7A 2MBTA 5BMUA 4LL4B 4OO5A 1AAZA 1BG5A 4JR6A 4KDUA 5CRWA 1FO5A 2QA1A 2CVBA 2IMDA 1WMJA 1JZOA 4N30A 3KD0A 1R7HA 3TUEA 1R4WA 4KDXA 4OFNA 2JACA 5AIXA 1XW5A 1EOGA 2VKZG 2FD3A 5HR0A 1B8XA 1G6YA 1QK8A 2ES7A 4G01A 4DSSB 18GSA 3LW9A 1KEBA 3VURA 5B6NA 1GUKA 4GSTA 5IOWA 2CZ2A 2LNTA 2NPBA 2WW0A 1SJZA 2HI7A 2OE0A 2YN1A 2O87A 1OKTA 2F3MA 2HSMB 4MMMA 4PX1A 4HU9A 4L5OA 4JBBA 5GZZB 1NW2A 4PI0C 3ZVJD 2H0HA 2XPEA 2JU5A 5F06A 5AGYA 3CXGA 4KUNA 1G7EA 1R5PA 3CHXC 2B1LA 5ID2A 4AKXB 2YP6A 1H4OA 1B9XC 3U5RE 5KEJA 3VK9A 5D9TA 4AGSA 2H73A 3LYPA 3D6IA 2A2RA 4XS6A 3FK8A 2DMLA 5D9XA 1EEMA 1NM3A 3GX0A 4H86A 4ZBDA 4O7HA 1E2YA 3D22A 5IMDA 1PQNA 3FHKA 5ENUA 3H1NA 5IMCA 2GVPA 4HJMA 1PMTA 2ZCTA 4YQVA 3F4SA 2UV8G 3ISOA 4JU5A 2FLSA 1TRWA 3BJ5A 1JZRA 2LRCA 3HVVA 2K8VA 3D4TA 3E9JB 3F3QA 3QMXA 2VCQA 3LYKA 3K8NA 4KGIA 3N9JA 1IYHA 2OE1A 4MF6A 4BIKA 2H1DA 3BOAA 1X5EA 1PX6A 5G1LA 2VOCA 1AQXA 4CY6A 3GSTA 3CSJA 2YCDA 5CO3A 5CRDA 3IHQA 2GLRA 1ZYEA 1LU4A 3GL3A 2DC5A 1FB6A 3EYTA 2CZ3A 2JL4A 4IS0A 5IMVA 2QA2A 2VD0A 3FZ4A 2HSHA 2WJUA 4Q5QA 4N10A 2DBCA 3KMNA 1XIYA 2V6OA 1NHOA 3D4MA 4HQSA 2A4VA 5DBQA 1I5GA 1SVLA 1VF4A 2KUCA 1YY7A 4K7OA 5B8AA 5HR2A 4XCSA 5DJLA 1ST9A 4GQFA 1A0RP 3UEMA 5COHA 4RQRA 2YZUA 4TR3A 2LNSA 5HR3A 4FO5A 2PMTA 1SJ6A 4KSOA 1WP0A 1YF1A 1WRYA 3GA4A 4ID0A 2FHEA 4G9HA 1AIUA 1GNEA 3KH9A 2L57A 3FW2A 2OT3A 4X4JA 3NZNA 3HKRA 2B5EA 4FYBA 5GSTA 4F82A 1QUWA 2A4HA 2KHPA 3GIXA 4FYUA 1GSEA 1EP7A 1GRXA 2O5VA 1MDIA 4GDFA 1J9BA 1MDJA 1EGRA 2ON7A 2X64A 2O36A 4FYCA 4A5PA 3VI5A 2DJJA 2ALBA 3HZ8A 2XBIA 4OWYA 5CP1A 2YV7A 4ZB9A 2IFQB 4DSSA 4OD7A 4ZL7A 5G2ZA 4DSQA 1WE0A 2N5BA 5A34B 4MPGA 3EPTA 1K3LA 2EFDA 2HSMA 3UBKA 1USBA 3CSIA 2TRCP 3DYRA 4KB3A 3J7Yk 4AF2A 2I9HA 1GSQA 3QPMA 3UVTA 5C00A 1GP1A 4ILFA 2VUPA 10GSA 5G5FA 1SK1A 3EMPA 1OYJA 3BCKA 2WVXB 2HZFA 3WYWA 5J9BA 4IGJA 4OCEA 2HSNA 1XVWA 4I8BA 4HI7A 1K0OA 1JZDA 3A2VA 1PKZA 2FNOA 4FH8A 5LD0A 1VF2A 1QXHA 1GLPA 3DD3A 2MMOA 4O32A 1MTCA 5JWOB 4I6XA 1V57A 2JZTA 2R0CA 1XBSA 1Z7RA 4LL1B 1JLVA 1BF5A 5J4VA 2H1AA 3TKSC 4IN0A 2GS3A 2L5LA 1KNGA 1YQ1A 1SD8A 5ECQB 2EFEA 4K7NA 3DIEA 4DSRA 1I1IP 1S3CA 3DVXA 4ZL8A 4TXVA 2V6KA 3ERGA 4I2TA 5JCUA 4JR4A 2C80A 4L0UA 2IN3A 2YWNA 3O76A 4USSA 5CRHA 2CAQA 3IBHA 4K9ZA 2IPAA 2PWJA 4JRRA 5IPHA 4NXIA 4PNFA 2OJLA 3HVNA 4TR0A 4PI2C 2JADA 4ECCA 1OE8A 3IA1A 1K3YA 4RQXA 2IWTA 3RAZA 4HSCX 8GSSA 3OR5A 3GTUB 1Q4JA 5KN1A 1X9WB 2PERA 1PSQA 5ID2B 1X5CA 1FVKA 4KNDA 3GNJA 5KOXA 4ML6A 5IMAA 1HYUA 3WT2A 1XOBA 3F6DA 4XS4B 3UBLA 2AHEA 1OC9B 3APQA 2EIQA 3F0IA 2WZSA 4IHUA 1Z5YE 4IP6A 2GT5A 3RPPA 2JSZA 1I9DA 3AY8A 5IMFA 2XBQA 4J56E 4BVYB 5HR1A 4EKZA 4AJ6A 2O89A 3GH6A 1DUGA 5AISA 3A2XA 2O8VB 4ZL9A 4NHWA 1PD21 2C3QA 3DVWA 1SYXA 1AXDA 1ERUA 2JZSA 2REMA 1XPVA 4OO4A 3M9JA 1U87A 5J9CA 3TJGA 2L6CA 3GH9A 4NPBA 3DMLA 1QQ2A 2RUFA 2VAFA 3I43A 2HFDA 2ZNMA 5DVBA 4FQUA 4O92A 4L0WA 2RUEA 4BWQA 1BYEA 2FWHA 1N2AA 1Z7PA 4GRFA 5J4UA 5DCGA 1KTEA 1TXXA 2EIRA 3Q6OA 4KH7A 2VIMA 1MD3A 2LKUA 2IFQA 4ZB8A 2CVDA 4MJBA 4KCEA 5A34A 2I3YA 2QGVA 2GSRA 3GMFA 1BX9A 6GSTA 2HQTA 3KEBA 3UAPA 3MNGA 4QMKA 1FOHA 22GSA 2M46A 1K0CA 4K8MA 1EP8A 3IHGA 4BPYA 4WR5A 5J4YA 1EZKA 2H19A 1TRSA 2J23A 2CA8A 1FW1A 2C4JA 4IQAA 3CRUA 4I2UA 3Q18A 2GQKA 1GTUA 2GZPA 1ZOFA 4XRAA 2WVXA 2H8LA 3M8NA 3IK7A 2YWOA 1SVOA 3I69A 1UN2A 4PQIA 1ILOA 3FKFA 3LJRA 4EF0A 1WIKA 4MK3A 1XXUA 2B1KA 2GSTA 4GF0A 2PN8A 1YJ6A 5ECPB 1UVZA 1X5DA 2LV3A 1DE1A 2PPTA 2GQMA 3LGCA 4L8EA 2RIIA 3ZIJA 5F07A 5H5QA 3IAM2 4YQMA 5HFKA 4I97A 4PQHA 5J41A 4PUFC 2H70A 1XWKA 3TOUA 2AV4A 4NHZA 1PX7A 5A4WA 2HRAA 5A5KA 3DWVA 3TKSA 2V1MA 19GSA 5H5RA 2V2GA 1AQWA 3TB2A 4X0XA 1URMA 4DVCA 2CAIA 3H8QA 3GKMA 3VPQA 1AW9A 4GCIA 1TK8B 1TK0B 4X43A 3UIWA 4PGTA 2DKIA 3LWAA 3TU3B 4F0CA 1TI1A 3HA9A 1WOUA 4G0KA 1PN9A 4GQCA 2IJYA 3P7XA 4PNGA 2OACA 4TKYA 1O8WA 4TVEA 2IMEA 1B4PA 3EU3A 3KXOA 5IPGA 3IK9A 1TP9A 4WF4A 3CWGA 3CRTA 3SWLA 3LXTA 4E68A 5D8IA 3TJKA 1RQMA 2YWMA 4IP1A 3FZ5A 5ECSA 3ZMKA 4O5UA 2LUSA 2LRNA 1GUHA 3FY7A 3R3EA 3GTUA 1S3AA 3IC8A 5IO0A 4LA1A 1O8XA 1GUMA 2NTOA 2RM5A 2VL9A 3QDNA 5KN3A 2DJ0A 1GTIA 4OCFA 3F63A 4XS4A 3SBCA 1F3AA 1E6BA 2HSNB 1OC9A 2DJKA 2YJHA 4ECBA 1K0MA 1M9AA 1V98A 4IJIA 2OE3A 2TIRA 3C73A 3GKNA 2EC4A 4ICYA 5ELGA 2O3EA 2QC7A 4K7IA 4Z2UA 2C1YA 2LEGA 5AN1A 4BVYA 2FA4A 5JCGA 4F2IA 3GURA 4ML1A 4ACSA 4KDYA 1SK0A 2HZEB 3Q19A 3DRNA 4YH2A 2VD1A 3G7JA 1ERVA 1SD9A 1VGLA 4PUAA 3KH7A 5CREA 1YF0A 4AKHA 2K8SA 3CTFA 3VWVA 5EL8A 3UJ1A 4K2DA 2YJ7A 3TRXA 2DLXA 2H01A 4AJ8A 2VCWA 1ZL9A 3IV4A 2M72A 12GSA 5ECIB 4WETA 3IDVA 3WD6A 3HD5A 3WGEA 2A2PA 4HEA2 2FA8A 1CQGA 1TXUA 1K0AA 5J40A 4V2LA 2EFCA 2H30A 4X1UA 4IBPA 4OFMA 2B6MA 3GSSA 1M7TA 4NWYA 2N5FA 3CSHA 6GSUA 3LSZA 2YANA 2ON5A 1A2JA 1TU8A 1K0DA 1J08A 3EWLA 2GZZA 3KP9A 4V2NA 5G30A 4TOPA 1UC7A 4KW6A 4GXZA 4QQ7A 2GSSA 2OADA 2QKEA 5D73A 4WBJA 2E7PA 2GGTA 3I6AA 13GSA 3C1RA 2PU9C 6GSXA 3HYPA 2H71A 1THXA 2PUKC 3QFBC 1HNBA 2HRFA 2FY6A 4HU7A 1R5AA 1VF3A 2M80A 3GHAA 5EY6A 2LSTA 1OC8A 2YV9A 2HT9A 4E8EA 4CDOA 4G0IA 3F9UA 3IOSA 2YWIA 5HQPA 1XWBA 3MWHA 3IC4A 2E2MA 5G1KA 6GSYA 6GSSA 2IL3A 4P3YB 3TDGA 5CAXA 3FR9A 1B4QA 1LJRA 3GN3A 1BQ7A 3TKPA 2H72A 5IIZA 1A24A 2MMNA 3TJBA 2MMAA 3F6FA 2WW3A 4Q5NA 3MYDA 3PGTA 3GX8A 3CMIA 1XCCA 4EDZA 2C0DA 3VLNA 4K0NA 1X0RA 2XC2A 1THOA 2GT6A 2WCIA 3RPNA 3QR6A 1GSFA 1O81A 4WBRD 5F8BA 5ELAA 2RM6A 4BWSA 2VLTA 1DE2A 4JZQA 3O6TA 1T7PB 2V32A 3IE3A 3DKSA 4V1Ag 1T00A 1H75A 4TN8A 2NDOA 4POLA 3H93A 3EE2A 3LQ7A 4HJ2A 2VO4A 1AQVA 4J57E 4GTUA 3ZREA 1A8LA 5JWQB 3UOMA 2HRNA 2HLSA 5ECNB 4EXJA 2LQQA 5G5EA 4AI6A 1TTZA 2O7KA 2KP1A 1WPIA 5F05A 3ZIVA 4BL7B 3HZ4A 4POBA 3EVIA 2YOIA 2DKHA 1ZMAA 4K5RA 2X99A 1MEKA 3GKXA 1QFNA 1XG8A 3KIJA 4FXYP 4EVMA 4HZ4A 2HZEA 2LJRA 1KBNA 3ERFA 2VLUA 5ECLB 4MZWA 4K2XA 3EC3A 1ON4A 2DIYA 4JEDA 2LQOA 3ZITA 4EL1A 4BA7A 1XWGA 1PKWA 2G0FA 2LJAA 2VL2A 2L5OA 1AUCA 1MD4A 4KCAA 1XOAA 1TRVA 5IM9A 2JZRA 4Z2TA 2K9FA 2P0GA 1LBKA 3US3A 3VFIA 4NMUA 4EUYA 4MCUA 4WXTA 2GQLA 4QL9A 11GSA 3IRAA 4KA0A 3UARA 2MZCA 1GTAA 1ZGNA 3WT1A 2DJ3A 1Z6MA 4Q5FA 3VWUA 1OAZA 3FYGA 2C0GA 1S3RA 3MDKA 3IXRA 3ERWA 4TRXA 1GNWA 2AB6A 5EVOA 2B5XA 1PFOA 1X9SB 1O73A 1F9MA 4KF9A 2C3TA 4AKGA 2H1BA 1ZYNA 3KGKA 1N8JA 3ZYWA 2LJKA 1F2EA 3L78A 1FOVA 4MJEA 4EIPA 1U6TA 3FMWA 2FGXA 1A0FA 4KE3A 4F9ZA 1G7OA 2FWGA 3KP8A 3HMJG 1VF1A 1PN0A 2LRTA 4IQ1A 2IMKA 3E3EA 2P31A 3F3RA 1Z3EA 4WEYA 1GH2A 1ZYPA 3P8WA 2DJ1A 1SYRA 3IPZA 3WGXA 2HNLA 3H4KA 3F4TA 2BMXA 1FB0A 2NBSA 1O6JA 4WKWA 5D93A 1VRSD 1YEXA 2R3XA 4HOJA 2BJXA 2WVYA 3W8SA 3GL5A 2E2GA 2AAWA 3GKKA 1HD2A 1PRXA 1ACVA 3L4NA 3GRXA 3QAVA 2QSIA 2UZ8A 4YKGA 4GSSA 2MMZA 4MF7A 3FZ9A 1XZOA 3L0HA 3EU4A 2H0GA 4EIQA 4Z2RA 4ECJA 1TKDB 4ZB6A 16GSA 2VLVA 4LMWA 3F8UA 4MDCA 1M99A 4XIHA 2WW2A 2H1LA 4EO3A 2P5RA 1XWAA 2VM2A 1SKRB 3PINA 1YEPA 2K18A 5F0GA 2Z9SA 1TU7A 4OFTA 3KCMA 2CV4A 3JCML 3HJMA 1N25A 4RUVA 2AJQB 2DMMA 2F51A 1U3IA 2WRTA 2WZ9A 1HNCA 4N0ZA 3RHBA 3GV1A 4MNNA 5JWRB 4BL7A 6GSVA 1RK4A 3ED3A 4TXOA 3G7YA 4ULXA 1U88A 4ZB7A 3HY2A 3L9VA 3VI7A 3NOFA 2C3NA 3RFRC 4AJ7A 3HHVA 4PTSA 1YKAA 1FAAA 3UL3A 1YKCA 5J47A 1M2AA 4FIWA 3L9UA 4K5SA 5G31A 2H1GA 3ZMLA 5CNWA 2X8HA 1SL2B 3LFLA 2H6YA 1GTBA 9GSSA 5CRGA 1A8YA 2R0PA 1OKDA 3RDWA 5J3RA 4BVXB 3KJYA 4TR4A
chains in the Genus database with same CATH topology
4TW5A 3KMOA 5J5NA 5ECOB 4ZBBA 1QMVA 2NVLA 5A4VA 4MJAA 3ZVJA 2OA7A 3A3TA 1T4ZA 2K6VA 1EEJA 2V41A 1K3OA 2H74A 2P5QA 5KOWA 1BEDA 4N3ZA 2HRKB 4CW9A 2L6DA 1TK5B 1HNAA 3EMXA 3FR6A 5DDLA 3DXBA 5IOXA 4TR1B 4W66A 1BAYA 3ZLPA 1S3DA 3ME8A 4GSNA 1XWCA 3LXZA 2OBIA 5B7CA 1UA5A 3QCPA 2XPDA 2IMIA 5H5SA 1TW9A 1W4VA 4NV2A 3KM6A 2KOKA 3ME7A 4YAPA 5IO2A 2H6ZA 4YKFA 4GLTA 1QGVA 1XFLA 1SL1B 3GUSA 4F0BA 5DJMA 3FRCA 2N5AA 1XW6A 1ZCPA 3ZL5A 3WGDA 4IJ3A 3LORA 3A5WA 5A1NB 2CVKA 3D5JA 3D21A 5ABRA 4K1FA 4G0LA 4N11A 2IIYA 2D2ZA 1HQOA 2HSYA 3ZRDA 3TKQA 3W6GA 3UMAA 1JZWA 4MZCA 1YVLA 5HFGA 2VL2C 3BCIA 3LEFA 3HXSA 1PGTA 2L4CA 3E0UA 4IVFA 3CYNA 2H66A 2L4QA 3G9BA 2A2SA 3QAGA 2H76A 2DJ2A 2FWFA 3F4RA 2X49A 2KLXA 4IKHA 2WB9A 2WS2A 1C72A 3MIXA 2WULA 1XW9A 2E0QA 2X8GA 1EV9A 2B3SA 4ZILA 4NAXA 1AC1A 5GAND 4D73B 4EDYA 3APSA 3DEXA 3KZQA 4G10A 2KP2A 2PBJA 1EV4A 1X9MB 2EIOA 3TGZA 1OVNA 3ZFBA 2H75A 1OE7A 1MDKA 4QL7A 3C8EA 1ABAA 2VCXA 3Q74A 5LCZA 4K0GA 2XHFA 5CYYA 2I81A 4HUAA 5DALB 5ECMB 1Q98A 4RI6A 3CTGA 4HS1A 1EOHA 3MAKA 4GWRA 1PL2A 3CBUA 2HXKA 2AYTA 1ERTA 2CX4A 17GSA 2VL3A 2R6KA 1EGOA 2J9HA 3J7Yb 1J0FA 5E4WA 5B6MA 2AUVA 3IR4A 5KN2A 1FVJA 2I4AA 1ML6A 5ECHB 2B5YA 4CY8A 1Y1UA 1M2DA 5A4UA 5HFIA 2PVQA 1GSDA 4MF5A 1CQHA 4XHMA 1Z9HA 3N5OA 1V40A 7GSSA 1JHBA 1U3AA 1T3BA 3HJOA 4EC0A 5LNKe 4I5QA 3NIVA 1TJDA 4HQZA 1FHEA 4MJCA 1Y25A 1Z6NA 3H79A 4BVXA 3TKRA 4IW9A 4MH3A 1F3BA 1B48A 1PL1A 2GDRA 3W8JA 3A2WA 3M0FA 5EPFA 5ECRB 3TRPA 3VWWA 1GULA 2VCVA 4PQ1A 4ZBAA 3TOTA 2R37A 5DQYA 4EE0A 1B9YC 2YNXA 4OMVA 2GZYA 2C0FA 1T8EB 4N0VA 2HRKA 4XS1A 1PA3A 2X8CA 2CT6A 1M0UA 5DAKB 1SKWB 2GSQA 2DSAA 1M9BA 3EINA 4TR1A 3VWXA 4MZBA 5IQYA 1GL8A 2CX3A 4O5RA 4LMVA 2R2JA 3DGQA 3RBTA 3M1GA 2CQ9A 2F9SA 3VPTA 3HDCA 3HVSA 2VM1A 1V58A 1ERWA 1SENA 5A5HB 5GAPD 3QOUA 4L5LA 4XRDA 3HJPA 5D9VA 1YZXA 3L9SA 2VCTA 4KSMA 1M2BA 1W89A 1XVQA 4E8HA 4TXOB 3R2QA 1A23A 3MSZA 4ZIJA 5BMUB 4POKA 3RHCA 3D0ZA 3BD2A 4V1Ap 4XTSA 5KN0A 4LLRA 5D96A 5A1NA 3LG6A 1RW1A 4F03A 3I9V2 5INYA 5FWGA 4AKIA 4O5QA 2OBKA 2TRXA 4MH2A 1OC3A 1WJKA 1F6MC 1SJIA 4J2FA 1GSUA 2MYGA 3KTLA 3TJJA 3S9FA 1SVMA 3A5IA 1BG1A 1TRUA 5D9WA 1GSYA 1JFUA 2FWEA 2PVOC 2B7KA 1F37A 3UVHA 5AIVA 4IELA 2F8FA 1TOFA 2F8AA 2FCHA 2WGRA 4WR4A 1JLWA 5GSSA 1WWJA 4MP4A 1O7UA 3PH9A 4POMA 4D73A 1A2MA 1SL0B 4ZXGA 5B8BA 1GWCA 5C04A 1V2AA 3IAS2 2GTUA 2X4AA 6GSWA 1IYIA 1TDIA 4MABA 4HDEA 4HZ2A 4Q5RA 2DIZA 2BTOT 3C1SA 3P2AA 1V9WA 4CHSA 1T1VA 5FHIA 1G0TA 1R26A 5DALA 2R0GA 2IMFA 4G2EA 4MA9A 1DBYA 3G7IA 20GSA 2EFHA 4WF5A 1DSBA 5FT3A 3HCZA 2PGTA 2R4VA 2LTKA 3V1WA 3QAWA 3ZFLA 5JCWA 3M3MA 3ZZXA 4NV5A 1EWXA 2HE3A 3FEUA 5E59A 4YAVA 1A2LA 3FR3A 2WFCA 2H6XA 4V2MA 3GYKA 3QFAC 2YZHA 3O3TA 5DQSA 1Y6EA 2R5GA 4ISDA 3C71A 5DCHA 1ZZYA 5IMZA 3P90A 2C8UA 1GSSA 1NHYA 4MLYA 1SU9A 1G6WA 2G2QA 2HYXA 2MBSA 3TKSE 1SKSB 4DEJA 2LS5A 2B7JA 3TCOA 14GSA 3TRQA 2WDUA 2O85A 4Z7XA 1T4YA 4K6XA 1NSWA 3FZAA 4G19A 3APOA 2OKAA 4MPFA 2RLIA 3TJFA 3EURA 2H0IA 4ECIA 1TI3A 1BJXA 2L59A 1O85A 5BRTA 4PXOA 3U6VA 3QD9A 2C0EA 3PR8A 2I1UA 3M9KA 5DAKA 2JSYA 4JE1A 1SK2A 3HVXA 1ZYQB 1K0NA 1FG4A 2ZUPA 3PPUA 4KAEA 3KTBA 5L71A 5ECKB 1GLQA 1K0BA 3GFKA 3C7MA 2VCZA 4KX4A 1YDKA 4YQUA 5A5HA 3ZTLA 2FUG2 3BBYA 2YPMA 4PURA 4RI7A 2MBTA 5BMUA 4LL4B 4OO5A 1AAZA 1BG5A 4JR6A 4KDUA 5CRWA 1FO5A 2QA1A 2CVBA 2IMDA 1WMJA 1JZOA 4N30A 3KD0A 1R7HA 3TUEA 1R4WA 4KDXA 4OFNA 2JACA 5AIXA 1XW5A 1EOGA 2VKZG 2FD3A 5HR0A 1B8XA 1G6YA 1QK8A 2ES7A 4G01A 4DSSB 18GSA 3LW9A 1KEBA 3VURA 5B6NA 1GUKA 4GSTA 5IOWA 2CZ2A 2LNTA 2NPBA 1SJZA 2HI7A 2OE0A 2YN1A 2O87A 1OKTA 2F3MA 2HSMB 4MMMA 4PX1A 4HU9A 4L5OA 4JBBA 5GZZB 1NW2A 3ZVJD 2H0HA 2XPEA 2JU5A 5F06A 5AGYA 3CXGA 4KUNA 1G7EA 1R5PA 2B1LA 5ID2A 4AKXB 2YP6A 1H4OA 1B9XC 3U5RE 5KEJA 3VK9A 5D9TA 4AGSA 2H73A 3LYPA 3D6IA 2A2RA 4XS6A 3FK8A 2DMLA 5D9XA 1EEMA 1NM3A 3GX0A 4H86A 4ZBDA 4O7HA 1E2YA 3D22A 5IMDA 1PQNA 3FHKA 5ENUA 3H1NA 5IMCA 2GVPA 4HJMA 1PMTA 2ZCTA 4YQVA 3F4SA 2UV8G 3ISOA 4JU5A 2FLSA 1TRWA 3BJ5A 1JZRA 2LRCA 3HVVA 2K8VA 3D4TA 3E9JB 3F3QA 3QMXA 2VCQA 3LYKA 3K8NA 4KGIA 3N9JA 1IYHA 2OE1A 4MF6A 2H1DA 3BOAA 1X5EA 1PX6A 5G1LA 2VOCA 1AQXA 4CY6A 3GSTA 3CSJA 2YCDA 5CO3A 5CRDA 3IHQA 2GLRA 1ZYEA 1LU4A 3GL3A 2DC5A 1FB6A 3EYTA 2CZ3A 2JL4A 4IS0A 5IMVA 2QA2A 2VD0A 3FZ4A 2HSHA 2WJUA 4Q5QA 4N10A 2DBCA 3KMNA 1XIYA 2V6OA 1NHOA 3D4MA 4HQSA 2A4VA 5DBQA 1I5GA 1SVLA 1VF4A 2KUCA 1YY7A 4K7OA 5B8AA 5HR2A 4XCSA 5DJLA 1ST9A 4GQFA 1A0RP 3UEMA 5COHA 4RQRA 2YZUA 4TR3A 2LNSA 5HR3A 4FO5A 2PMTA 1SJ6A 4KSOA 1WP0A 1YF1A 1WRYA 3GA4A 4ID0A 2FHEA 4G9HA 1AIUA 1GNEA 3KH9A 2L57A 3FW2A 2OT3A 4X4JA 3NZNA 3HKRA 2B5EA 4FYBA 5GSTA 4F82A 1QUWA 2A4HA 2KHPA 3GIXA 4FYUA 1GSEA 1EP7A 1GRXA 2O5VA 1MDIA 4GDFA 1J9BA 1MDJA 1EGRA 2ON7A 2X64A 4FYCA 4A5PA 3VI5A 2DJJA 2ALBA 3HZ8A 2XBIA 4OWYA 5CP1A 2YV7A 4ZB9A 2IFQB 4DSSA 4OD7A 4ZL7A 5G2ZA 4DSQA 1WE0A 2N5BA 5A34B 4MPGA 3EPTA 1K3LA 2EFDA 2HSMA 3UBKA 1USBA 3CSIA 2TRCP 3DYRA 4KB3A 3J7Yk 4AF2A 2I9HA 1GSQA 3QPMA 3UVTA 5C00A 1GP1A 4ILFA 2VUPA 10GSA 5G5FA 1SK1A 3EMPA 1OYJA 3BCKA 2HZFA 3WYWA 5J9BA 4IGJA 4OCEA 2HSNA 1XVWA 4I8BA 4HI7A 1K0OA 1JZDA 3A2VA 1PKZA 2FNOA 4FH8A 5LD0A 1VF2A 1QXHA 1GLPA 3DD3A 2MMOA 4O32A 1MTCA 5JWOB 4I6XA 1V57A 2JZTA 2R0CA 1XBSA 1Z7RA 4LL1B 1JLVA 1BF5A 5J4VA 2H1AA 3TKSC 4IN0A 2GS3A 2L5LA 1KNGA 1YQ1A 1SD8A 5ECQB 2EFEA 4K7NA 3DIEA 4DSRA 1S3CA 3DVXA 4ZL8A 4TXVA 2V6KA 3ERGA 4I2TA 5JCUA 4JR4A 2C80A 4L0UA 2IN3A 2YWNA 3O76A 4USSA 5CRHA 2CAQA 3IBHA 4K9ZA 2IPAA 2PWJA 4JRRA 5IPHA 4NXIA 4PNFA 2OJLA 4TR0A 2JADA 4ECCA 1OE8A 3IA1A 1K3YA 4RQXA 2IWTA 3RAZA 8GSSA 3OR5A 3GTUB 1Q4JA 5KN1A 1X9WB 2PERA 1PSQA 5ID2B 1X5CA 1FVKA 4KNDA 3GNJA 5KOXA 4ML6A 5IMAA 1HYUA 3WT2A 1XOBA 3F6DA 4XS4B 3UBLA 2AHEA 1OC9B 3APQA 2EIQA 3F0IA 4IHUA 1Z5YE 4IP6A 2GT5A 3RPPA 2JSZA 1I9DA 3AY8A 5IMFA 2XBQA 4J56E 4BVYB 5HR1A 4EKZA 4AJ6A 2O89A 3GH6A 1DUGA 5AISA 3A2XA 2O8VB 4ZL9A 4NHWA 1PD21 2C3QA 3DVWA 1SYXA 1AXDA 1ERUA 2JZSA 2REMA 1XPVA 4OO4A 3M9JA 1U87A 5J9CA 3TJGA 2L6CA 3GH9A 4NPBA 3DMLA 1QQ2A 2RUFA 2VAFA 3I43A 2HFDA 2ZNMA 5DVBA 4FQUA 4O92A 4L0WA 2RUEA 4BWQA 1BYEA 2FWHA 1N2AA 1Z7PA 4GRFA 5J4UA 5DCGA 1KTEA 1TXXA 2EIRA 3Q6OA 4KH7A 2VIMA 1MD3A 2LKUA 2IFQA 4ZB8A 2CVDA 4MJBA 4KCEA 5A34A 2I3YA 2QGVA 2GSRA 3GMFA 1BX9A 6GSTA 2HQTA 3KEBA 3UAPA 3MNGA 4QMKA 1FOHA 22GSA 2M46A 1K0CA 4K8MA 1EP8A 3IHGA 4BPYA 4WR5A 5J4YA 1EZKA 2H19A 1TRSA 2J23A 2CA8A 1FW1A 2C4JA 4IQAA 3CRUA 4I2UA 3Q18A 2GQKA 1GTUA 2GZPA 1ZOFA 4XRAA 2H8LA 3M8NA 3IK7A 2YWOA 1SVOA 3I69A 1UN2A 4PQIA 1ILOA 3FKFA 3LJRA 4EF0A 1WIKA 4MK3A 1XXUA 2B1KA 2GSTA 4GF0A 2PN8A 1YJ6A 5ECPB 1UVZA 1X5DA 2LV3A 1DE1A 2PPTA 2GQMA 3LGCA 4L8EA 2RIIA 3ZIJA 5F07A 5H5QA 3IAM2 4YQMA 5HFKA 4I97A 4PQHA 5J41A 4PUFC 2H70A 1XWKA 3TOUA 2AV4A 4NHZA 1PX7A 5A4WA 2HRAA 5A5KA 3DWVA 3TKSA 2V1MA 19GSA 5H5RA 2V2GA 1AQWA 3TB2A 4X0XA 1URMA 4DVCA 2CAIA 3H8QA 3GKMA 3VPQA 1AW9A 4GCIA 1TK8B 1TK0B 4X43A 3UIWA 4PGTA 2DKIA 3LWAA 3TU3B 4F0CA 1TI1A 3HA9A 1WOUA 4G0KA 1PN9A 4GQCA 2IJYA 3P7XA 4PNGA 2OACA 4TKYA 1O8WA 4TVEA 2IMEA 1B4PA 3EU3A 3KXOA 5IPGA 3IK9A 1TP9A 4WF4A 3CWGA 3CRTA 3SWLA 3LXTA 4E68A 5D8IA 3TJKA 1RQMA 2YWMA 4IP1A 3FZ5A 5ECSA 3ZMKA 4O5UA 2LUSA 2LRNA 1GUHA 3FY7A 3R3EA 3GTUA 1S3AA 3IC8A 5IO0A 4LA1A 1O8XA 1GUMA 2NTOA 2RM5A 2VL9A 3QDNA 5KN3A 2DJ0A 1GTIA 4OCFA 3F63A 4XS4A 3SBCA 1F3AA 1E6BA 2HSNB 1OC9A 2DJKA 2YJHA 4ECBA 1K0MA 1M9AA 1V98A 4IJIA 2OE3A 2TIRA 3C73A 3GKNA 2EC4A 4ICYA 5ELGA 2QC7A 4K7IA 4Z2UA 2C1YA 2LEGA 5AN1A 4BVYA 2FA4A 5JCGA 4F2IA 3GURA 4ML1A 4ACSA 4KDYA 1SK0A 2HZEB 3Q19A 3DRNA 4YH2A 2VD1A 3G7JA 1ERVA 1SD9A 1VGLA 4PUAA 3KH7A 5CREA 1YF0A 4AKHA 2K8SA 3CTFA 3VWVA 5EL8A 3UJ1A 4K2DA 2YJ7A 3TRXA 2DLXA 2H01A 4AJ8A 2VCWA 1ZL9A 3IV4A 2M72A 12GSA 5ECIB 4WETA 3IDVA 3WD6A 3HD5A 3WGEA 2A2PA 4HEA2 2FA8A 1CQGA 1TXUA 1K0AA 5J40A 4V2LA 2EFCA 2H30A 4X1UA 4IBPA 4OFMA 2B6MA 3GSSA 1M7TA 4NWYA 2N5FA 3CSHA 6GSUA 3LSZA 2YANA 2ON5A 1A2JA 1TU8A 1K0DA 1J08A 3EWLA 2GZZA 3KP9A 4V2NA 5G30A 4TOPA 1UC7A 4KW6A 4GXZA 4QQ7A 2GSSA 2OADA 2QKEA 5D73A 4WBJA 2E7PA 2GGTA 3I6AA 13GSA 3C1RA 2PU9C 6GSXA 3HYPA 2H71A 1THXA 2PUKC 3QFBC 1HNBA 2HRFA 2FY6A 4HU7A 1R5AA 1VF3A 2M80A 3GHAA 5EY6A 2LSTA 1OC8A 2YV9A 2HT9A 4E8EA 4CDOA 4G0IA 3F9UA 3IOSA 2YWIA 5HQPA 1XWBA 3MWHA 3IC4A 2E2MA 5G1KA 6GSYA 6GSSA 2IL3A 4P3YB 3TDGA 5CAXA 3FR9A 1B4QA 1LJRA 3GN3A 1BQ7A 3TKPA 2H72A 5IIZA 1A24A 2MMNA 3TJBA 2MMAA 3F6FA 4Q5NA 3MYDA 3PGTA 3GX8A 3CMIA 1XCCA 4EDZA 2C0DA 3VLNA 4K0NA 1X0RA 2XC2A 1THOA 2GT6A 2WCIA 3RPNA 3QR6A 1GSFA 1O81A 4WBRD 5F8BA 5ELAA 2RM6A 4BWSA 2VLTA 1DE2A 4JZQA 3O6TA 1T7PB 2V32A 3IE3A 3DKSA 4V1Ag 1T00A 1H75A 4TN8A 2NDOA 4POLA 3H93A 3EE2A 3LQ7A 4HJ2A 2VO4A 1AQVA 4J57E 4GTUA 3ZREA 1A8LA 5JWQB 3UOMA 2HRNA 2HLSA 5ECNB 4EXJA 2LQQA 5G5EA 4AI6A 1TTZA 2O7KA 2KP1A 1WPIA 5F05A 3ZIVA 4BL7B 3HZ4A 4POBA 3EVIA 2YOIA 2DKHA 1ZMAA 4K5RA 2X99A 1MEKA 3GKXA 1QFNA 3KIJA 4EVMA 4HZ4A 2HZEA 2LJRA 1KBNA 3ERFA 2VLUA 5ECLB 4MZWA 4K2XA 3EC3A 1ON4A 2DIYA 4JEDA 2LQOA 3ZITA 4EL1A 4BA7A 1XWGA 1PKWA 2G0FA 2LJAA 2VL2A 2L5OA 1AUCA 1MD4A 4KCAA 1XOAA 1TRVA 5IM9A 2JZRA 4Z2TA 2K9FA 2P0GA 1LBKA 3US3A 3VFIA 4NMUA 4EUYA 4MCUA 4WXTA 2GQLA 4QL9A 11GSA 3IRAA 4KA0A 3UARA 2MZCA 1GTAA 1ZGNA 3WT1A 2DJ3A 1Z6MA 4Q5FA 3VWUA 1OAZA 3FYGA 2C0GA 3MDKA 3IXRA 3ERWA 4TRXA 1GNWA 2AB6A 5EVOA 2B5XA 1X9SB 1O73A 1F9MA 4KF9A 2C3TA 4AKGA 2H1BA 1ZYNA 3KGKA 1N8JA 3ZYWA 2LJKA 1F2EA 3L78A 1FOVA 4MJEA 4EIPA 1U6TA 3FMWA 2FGXA 1A0FA 4KE3A 4F9ZA 1G7OA 2FWGA 3KP8A 3HMJG 1VF1A 1PN0A 2LRTA 4IQ1A 2IMKA 3E3EA 2P31A 3F3RA 1Z3EA 4WEYA 1GH2A 1ZYPA 3P8WA 2DJ1A 1SYRA 3IPZA 3WGXA 2HNLA 3H4KA 3F4TA 2BMXA 1FB0A 2NBSA 1O6JA 4WKWA 5D93A 1VRSD 1YEXA 2R3XA 4HOJA 2BJXA 3W8SA 3GL5A 2E2GA 2AAWA 3GKKA 1HD2A 1PRXA 1ACVA 3L4NA 3GRXA 3QAVA 2QSIA 2UZ8A 4YKGA 4GSSA 2MMZA 4MF7A 3FZ9A 1XZOA 3L0HA 3EU4A 2H0GA 4EIQA 4Z2RA 4ECJA 1TKDB 4ZB6A 16GSA 2VLVA 4LMWA 3F8UA 4MDCA 1M99A 4XIHA 2H1LA 4EO3A 2P5RA 1XWAA 2VM2A 1SKRB 3PINA 1YEPA 2K18A 5F0GA 2Z9SA 1TU7A 4OFTA 3KCMA 2CV4A 3JCML 3HJMA 1N25A 4RUVA 2AJQB 2DMMA 2F51A 1U3IA 2WRTA 2WZ9A 1HNCA 4N0ZA 3RHBA 3GV1A 4MNNA 5JWRB 4BL7A 6GSVA 1RK4A 3ED3A 4TXOA 3G7YA 4ULXA 1U88A 4ZB7A 3HY2A 3L9VA 3VI7A 3NOFA 2C3NA 4AJ7A 3HHVA 4PTSA 1YKAA 1FAAA 3UL3A 1YKCA 5J47A 1M2AA 4FIWA 3L9UA 4K5SA 5G31A 2H1GA 3ZMLA 5CNWA 2X8HA 1SL2B 3LFLA 2H6YA 1GTBA 9GSSA 5CRGA 1A8YA 2R0PA 1OKDA 3RDWA 5J3RA 4BVXB 3KJYA 4TR4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TW5 A;  3KMO A;  5J5N A;  5ECO B;  4ZBB A;  1QMV A;  2NVL A;  5A4V A;  4MJA A;  3ZVJ A;  2OA7 A;  3A3T A;  1T4Z A;  2K6V A;  1EEJ A;  2V41 A;  1K3O A;  2H74 A;  2P5Q A;  1BED A;  2HRK B;  4CW9 A;  2L6D A;  1TK5 B;  1HNA A;  3EMX A;  3FR6 A;  5DDL A;  3DXB A;  5IOX A;  4TR1 B;  1BAY A;  3ZLP A;  1S3D A;  3ME8 A;  4GSN A;  1XWC A;  3LXZ A;  2OBI A;  5B7C A;  1UA5 A;  3QCP A;  2XPD A;  2IMI A;  5H5S A;  1TW9 A;  1W4V A;  4NV2 A;  3KM6 A;  2KOK A;  3ME7 A;  4YAP A;  5IO2 A;  2H6Z A;  4GLT A;  1QGV A;  1XFL A;  1SL1 B;  3GUS A;  4F0B A;  5DJM A;  3FRC A;  2N5A A;  1XW6 A;  1ZCP A;  3ZL5 A;  3WGD A;  4IJ3 A;  3LOR A;  3A5W A;  2CVK A;  3D5J A;  3D21 A;  5ABR A;  4K1F A;  4G0L A;  4N11 A;  2IIY A;  2D2Z A;  1HQO A;  2HSY A;  3ZRD A;  3TKQ A;  3W6G A;  3UMA A;  1JZW A;  4MZC A;  5HFG A;  2VL2 C;  3BCI A;  3LEF A;  3HXS A;  1PGT A;  2L4C A;  3E0U A;  4IVF A;  3CYN A;  2H66 A;  2L4Q A;  3G9B A;  2A2S A;  3QAG A;  2H76 A;  2DJ2 A;  2FWF A;  3F4R A;  2KLX A;  4IKH A;  2WB9 A;  2WS2 A;  1C72 A;  2WUL A;  1XW9 A;  2E0Q A;  2X8G A;  1EV9 A;  2B3S A;  4ZIL A;  4NAX A;  1AC1 A;  5GAN D;  4D73 B;  4EDY A;  3APS A;  3DEX A;  3KZQ A;  4G10 A;  2KP2 A;  2PBJ A;  1EV4 A;  1X9M B;  2EIO A;  3TGZ A;  1OVN A;  3ZFB A;  2H75 A;  1OE7 A;  1MDK A;  4QL7 A;  3C8E A;  1ABA A;  2VCX A;  3Q74 A;  5LCZ A;  4K0G A;  2XHF A;  5CYY A;  2I81 A;  4HUA A;  5DAL B;  5ECM B;  1Q98 A;  4RI6 A;  3CTG A;  4HS1 A;  1EOH A;  3MAK A;  4GWR A;  1PL2 A;  3CBU A;  2HXK A;  2AYT A;  1ERT A;  2CX4 A;  17GS A;  2VL3 A;  2R6K A;  1EGO A;  2J9H A;  3J7Y b;  1J0F A;  5E4W A;  5B6M A;  2AUV A;  3IR4 A;  5KN2 A;  1FVJ A;  2I4A A;  1ML6 A;  5ECH B;  2B5Y A;  1M2D A;  5A4U A;  5HFI A;  2PVQ A;  1GSD A;  4MF5 A;  1CQH A;  4XHM A;  1Z9H A;  3N5O A;  1V40 A;  7GSS A;  1JHB A;  1U3A A;  1T3B A;  3HJO A;  4EC0 A;  5LNK e;  4I5Q A;  3NIV A;  1TJD A;  4HQZ A;  1FHE A;  4MJC A;  1Y25 A;  1Z6N A;  3H79 A;  4BVX A;  3TKR A;  4IW9 A;  4MH3 A;  1F3B A;  1B48 A;  1PL1 A;  2GDR A;  3W8J A;  3A2W A;  3M0F A;  5EPF A;  5ECR B;  3TRP A;  3VWW A;  1GUL A;  2VCV A;  4PQ1 A;  4ZBA A;  3TOT A;  2R37 A;  5DQY A;  4EE0 A;  1B9Y C;  2YNX A;  4OMV A;  2GZY A;  2C0F A;  1T8E B;  4N0V A;  2HRK A;  4XS1 A;  1PA3 A;  2X8C A;  2CT6 A;  1M0U A;  5DAK B;  1SKW B;  2GSQ A;  2DSA A;  1M9B A;  3EIN A;  4TR1 A;  3VWX A;  4MZB A;  5IQY A;  1GL8 A;  2CX3 A;  4O5R A;  4LMV A;  2R2J A;  3DGQ A;  3RBT A;  3M1G A;  2CQ9 A;  2F9S A;  3VPT A;  3HDC A;  3HVS A;  2VM1 A;  1V58 A;  1ERW A;  1SEN A;  5GAP D;  3QOU A;  4L5L A;  4XRD A;  3HJP A;  5D9V A;  1YZX A;  3L9S A;  2VCT A;  4KSM A;  1M2B A;  1W89 A;  1XVQ A;  4E8H A;  4TXO B;  3R2Q A;  1A23 A;  3MSZ A;  4ZIJ A;  4POK A;  3RHC A;  3D0Z A;  3BD2 A;  4V1A p;  4XTS A;  5KN0 A;  4LLR A;  5D96 A;  3LG6 A;  1RW1 A;  4F03 A;  3I9V 2;  5INY A;  5FWG A;  2OBK A;  2TRX A;  4MH2 A;  1OC3 A;  1WJK A;  1F6M C;  1SJI A;  4J2F A;  1GSU A;  2MYG A;  3KTL A;  3TJJ A;  3S9F A;  1TRU A;  5D9W A;  1GSY A;  1JFU A;  2FWE A;  2PVO C;  2B7K A;  1F37 A;  3UVH A;  5AIV A;  4IEL A;  2F8F A;  1TOF A;  2F8A A;  2FCH A;  2WGR A;  4WR4 A;  1JLW A;  5GSS A;  1WWJ A;  4MP4 A;  1O7U A;  3PH9 A;  4POM A;  4D73 A;  1A2M A;  1SL0 B;  4ZXG A;  5B8B A;  1GWC A;  5C04 A;  1V2A A;  3IAS 2;  2GTU A;  6GSW A;  1IYI A;  1TDI A;  4MAB A;  4HDE A;  4HZ2 A;  4Q5R A;  2DIZ A;  2BTO T;  3C1S A;  3P2A A;  1V9W A;  4CHS A;  1T1V A;  5FHI A;  1G0T A;  1R26 A;  5DAL A;  2IMF A;  4G2E A;  4MA9 A;  1DBY A;  3G7I A;  20GS A;  4WF5 A;  1DSB A;  5FT3 A;  3HCZ A;  2PGT A;  2R4V A;  2LTK A;  3V1W A;  3QAW A;  3ZFL A;  5JCW A;  3M3M A;  3ZZX A;  4NV5 A;  1EWX A;  2HE3 A;  3FEU A;  5E59 A;  4YAV A;  1A2L A;  3FR3 A;  2WFC A;  2H6X A;  4V2M A;  3GYK A;  3QFA C;  2YZH A;  3O3T A;  5DQS A;  1Y6E A;  2R5G A;  4ISD A;  3C71 A;  5DCH A;  1ZZY A;  5IMZ A;  3P90 A;  2C8U A;  1GSS A;  1NHY A;  4MLY A;  1SU9 A;  1G6W A;  2G2Q A;  2HYX A;  2MBS A;  3TKS E;  1SKS B;  4DEJ A;  2LS5 A;  2B7J A;  3TCO A;  14GS A;  3TRQ A;  2WDU A;  2O85 A;  4Z7X A;  1T4Y A;  4K6X A;  1NSW A;  3FZA A;  4G19 A;  3APO A;  2OKA A;  4MPF A;  2RLI A;  3TJF A;  3EUR A;  2H0I A;  4ECI A;  1TI3 A;  1BJX A;  2L59 A;  1O85 A;  4PXO A;  3U6V A;  3QD9 A;  2C0E A;  3PR8 A;  2I1U A;  3M9K A;  5DAK A;  2JSY A;  4JE1 A;  1SK2 A;  3HVX A;  1ZYQ B;  1K0N A;  1FG4 A;  2ZUP A;  3PPU A;  4KAE A;  3KTB A;  5L71 A;  5ECK B;  1GLQ A;  1K0B A;  3GFK A;  3C7M A;  2VCZ A;  4KX4 A;  1YDK A;  4YQU A;  3ZTL A;  2FUG 2;  3BBY A;  2YPM A;  4PUR A;  4RI7 A;  2MBT A;  5BMU A;  4LL4 B;  4OO5 A;  1AAZ A;  1BG5 A;  4JR6 A;  4KDU A;  5CRW A;  1FO5 A;  2CVB A;  2IMD A;  1WMJ A;  1JZO A;  4N30 A;  3KD0 A;  1R7H A;  3TUE A;  1R4W A;  4KDX A;  4OFN A;  2JAC A;  5AIX A;  1XW5 A;  1EOG A;  5HR0 A;  2FD3 A;  1B8X A;  1G6Y A;  1QK8 A;  2ES7 A;  4DSS B;  18GS A;  1KEB A;  3VUR A;  5B6N A;  1GUK A;  4GST A;  5IOW A;  2CZ2 A;  2LNT A;  2NPB A;  1SJZ A;  2HI7 A;  2OE0 A;  2YN1 A;  2O87 A;  1OKT A;  2F3M A;  2HSM B;  4MMM A;  4PX1 A;  4HU9 A;  4L5O A;  4JBB A;  5GZZ B;  1NW2 A;  3ZVJ D;  2H0H A;  2XPE A;  2JU5 A;  5F06 A;  5AGY A;  3CXG A;  4KUN A;  1G7E A;  1R5P A;  2B1L A;  5ID2 A;  2YP6 A;  1H4O A;  1B9X C;  3U5R E;  5KEJ A;  3VK9 A;  5D9T A;  4AGS A;  2H73 A;  3LYP A;  3D6I A;  2A2R A;  4XS6 A;  3FK8 A;  2DML A;  5D9X A;  1EEM A;  1NM3 A;  3GX0 A;  4H86 A;  4ZBD A;  4O7H A;  1E2Y A;  3D22 A;  5IMD A;  1PQN A;  3FHK A;  5ENU A;  3H1N A;  5IMC A;  2GVP A;  4HJM A;  1PMT A;  2ZCT A;  4YQV A;  3F4S A;  3ISO A;  4JU5 A;  2FLS A;  1TRW A;  3BJ5 A;  1JZR A;  2LRC A;  3HVV A;  2K8V A;  3D4T A;  3E9J B;  3F3Q A;  3QMX A;  2VCQ A;  3LYK A;  3K8N A;  4KGI A;  3N9J A;  1IYH A;  2OE1 A;  4MF6 A;  2H1D A;  3BOA A;  1X5E A;  1PX6 A;  5G1L A;  2VOC A;  1AQX A;  3GST A;  3CSJ A;  2YCD A;  5CO3 A;  5CRD A;  3IHQ A;  2GLR A;  1ZYE A;  1LU4 A;  3GL3 A;  2DC5 A;  1FB6 A;  3EYT A;  2CZ3 A;  2JL4 A;  4IS0 A;  5IMV A;  2VD0 A;  3FZ4 A;  2HSH A;  2WJU A;  4Q5Q A;  4N10 A;  2DBC A;  3KMN A;  1XIY A;  2V6O A;  1NHO A;  3D4M A;  4HQS A;  2A4V A;  5DBQ A;  1I5G A;  1VF4 A;  2KUC A;  1YY7 A;  4K7O A;  5B8A A;  5HR2 A;  4XCS A;  5DJL A;  1ST9 A;  4GQF A;  1A0R P;  3UEM A;  5COH A;  4RQR A;  2YZU A;  4TR3 A;  2LNS A;  5HR3 A;  4FO5 A;  2PMT A;  1SJ6 A;  4KSO A;  1WP0 A;  1YF1 A;  1WRY A;  3GA4 A;  4ID0 A;  2FHE A;  4G9H A;  1AIU A;  1GNE A;  3KH9 A;  2L57 A;  3FW2 A;  3NZN A;  3HKR A;  2B5E A;  4FYB A;  5GST A;  4F82 A;  1QUW A;  2KHP A;  3GIX A;  4FYU A;  1GSE A;  1EP7 A;  1GRX A;  1MDI A;  1J9B A;  1MDJ A;  1EGR A;  2ON7 A;  2X64 A;  4FYC A;  3VI5 A;  2DJJ A;  2ALB A;  3HZ8 A;  2XBI A;  4OWY A;  5CP1 A;  2YV7 A;  4ZB9 A;  2IFQ B;  4DSS A;  4OD7 A;  4ZL7 A;  5G2Z A;  4DSQ A;  1WE0 A;  2N5B A;  4MPG A;  1K3L A;  2HSM A;  3UBK A;  1USB A;  3CSI A;  2TRC P;  3DYR A;  4KB3 A;  3J7Y k;  4AF2 A;  2I9H A;  1GSQ A;  3QPM A;  3UVT A;  5C00 A;  1GP1 A;  4ILF A;  2VUP A;  10GS A;  5G5F A;  1SK1 A;  3EMP A;  1OYJ A;  3BCK A;  2HZF A;  3WYW A;  5J9B A;  4IGJ A;  4OCE A;  1XVW A;  4I8B A;  4HI7 A;  1K0O A;  1JZD A;  3A2V A;  1PKZ A;  2FNO A;  4FH8 A;  5LD0 A;  1VF2 A;  1QXH A;  1GLP A;  3DD3 A;  2MMO A;  4O32 A;  1MTC A;  5JWO B;  4I6X A;  1V57 A;  2JZT A;  1XBS A;  1Z7R A;  4LL1 B;  1JLV A;  3TKS C;  2H1A A;  4IN0 A;  2GS3 A;  2L5L A;  1KNG A;  1YQ1 A;  1SD8 A;  5ECQ B;  4K7N A;  3DIE A;  4DSR A;  1S3C A;  3DVX A;  4ZL8 A;  4TXV A;  2V6K A;  3ERG A;  4I2T A;  5JCU A;  4JR4 A;  2C80 A;  4L0U A;  2IN3 A;  2YWN A;  3O76 A;  4USS A;  5CRH A;  2CAQ A;  3IBH A;  4K9Z A;  2IPA A;  2PWJ A;  4JRR A;  5IPH A;  4NXI A;  4PNF A;  2OJL A;  4TR0 A;  2JAD A;  4ECC A;  1OE8 A;  3IA1 A;  1K3Y A;  4RQX A;  2IWT A;  3RAZ A;  8GSS A;  3OR5 A;  3GTU B;  1Q4J A;  5KN1 A;  1X9W B;  2PER A;  1PSQ A;  5ID2 B;  1X5C A;  1FVK A;  4KND A;  3GNJ A;  4ML6 A;  5IMA A;  1HYU A;  3WT2 A;  1XOB A;  3F6D A;  4XS4 B;  3UBL A;  2AHE A;  1OC9 B;  3APQ A;  2EIQ A;  3F0I A;  4IHU A;  1Z5Y E;  4IP6 A;  2GT5 A;  3RPP A;  2JSZ A;  1I9D A;  3AY8 A;  5IMF A;  2XBQ A;  4J56 E;  4BVY B;  5HR1 A;  4EKZ A;  4AJ6 A;  2O89 A;  3GH6 A;  1DUG A;  5AIS A;  3A2X A;  2O8V B;  4ZL9 A;  4NHW A;  1PD2 1;  2C3Q A;  3DVW A;  1SYX A;  1AXD A;  1ERU A;  2JZS A;  2REM A;  1XPV A;  4OO4 A;  3M9J A;  1U87 A;  5J9C A;  3TJG A;  2L6C A;  3GH9 A;  4NPB A;  3DML A;  1QQ2 A;  2RUF A;  2VAF A;  3I43 A;  2HFD A;  2ZNM A;  5DVB A;  4FQU A;  4O92 A;  4L0W A;  2RUE A;  4BWQ A;  1BYE A;  2FWH A;  1N2A A;  1Z7P A;  4GRF A;  5J4U A;  5DCG A;  1KTE A;  1TXX A;  2EIR A;  3Q6O A;  4KH7 A;  2VIM A;  1MD3 A;  2LKU A;  2IFQ A;  4ZB8 A;  2CVD A;  4MJB A;  4KCE A;  2QGV A;  2I3Y A;  2GSR A;  3GMF A;  1BX9 A;  6GST A;  2HQT A;  3KEB A;  3UAP A;  3MNG A;  22GS A;  2M46 A;  1K0C A;  4K8M A;  1EP8 A;  4BPY A;  4WR5 A;  1EZK A;  2H19 A;  1TRS A;  2J23 A;  2CA8 A;  1FW1 A;  2C4J A;  4IQA A;  3CRU A;  4I2U A;  3Q18 A;  2GQK A;  1GTU A;  2GZP A;  1ZOF A;  4XRA A;  2H8L A;  3M8N A;  3IK7 A;  2YWO A;  3I69 A;  1UN2 A;  4PQI A;  1ILO A;  3FKF A;  3LJR A;  4EF0 A;  1WIK A;  4MK3 A;  1XXU A;  2B1K A;  2GST A;  4GF0 A;  2PN8 A;  1YJ6 A;  5ECP B;  1UVZ A;  1X5D A;  2LV3 A;  1DE1 A;  2PPT A;  2GQM A;  3LGC A;  4L8E A;  2RII A;  3ZIJ A;  5F07 A;  5H5Q A;  3IAM 2;  4YQM A;  5HFK A;  4I97 A;  4PQH A;  5J41 A;  4PUF C;  2H70 A;  1XWK A;  3TOU A;  2AV4 A;  4NHZ A;  1PX7 A;  5A4W A;  2HRA A;  5A5K A;  3DWV A;  3TKS A;  2V1M A;  19GS A;  5H5R A;  2V2G A;  1AQW A;  3TB2 A;  4X0X A;  1URM A;  4DVC A;  2CAI A;  3H8Q A;  3GKM A;  3VPQ A;  1AW9 A;  4GCI A;  1TK8 B;  1TK0 B;  4X43 A;  3UIW A;  4PGT A;  3LWA A;  4F0C A;  1TI1 A;  3HA9 A;  1WOU A;  4G0K A;  1PN9 A;  4GQC A;  2IJY A;  3P7X A;  4PNG A;  2OAC A;  4TKY A;  1O8W A;  4TVE A;  2IME A;  1B4P A;  3EU3 A;  3KXO A;  5IPG A;  3IK9 A;  1TP9 A;  4WF4 A;  3CRT A;  3SWL A;  3LXT A;  5D8I A;  3TJK A;  1RQM A;  2YWM A;  4IP1 A;  3FZ5 A;  5ECS A;  3ZMK A;  2LUS A;  2LRN A;  1GUH A;  3FY7 A;  3R3E A;  3GTU A;  1S3A A;  3IC8 A;  5IO0 A;  4LA1 A;  1O8X A;  1GUM A;  2NTO A;  2RM5 A;  2VL9 A;  3QDN A;  5KN3 A;  2DJ0 A;  1GTI A;  4OCF A;  3F63 A;  4XS4 A;  3SBC A;  1F3A A;  1E6B A;  2HSN B;  1OC9 A;  2DJK A;  2YJH A;  4ECB A;  1K0M A;  1M9A A;  1V98 A;  4IJI A;  2OE3 A;  2TIR A;  3C73 A;  3GKN A;  2EC4 A;  5ELG A;  2QC7 A;  4K7I A;  2C1Y A;  2LEG A;  5AN1 A;  4BVY A;  2FA4 A;  5JCG A;  4F2I A;  3GUR A;  4ML1 A;  4ACS A;  4KDY A;  1SK0 A;  2HZE B;  3Q19 A;  3DRN A;  4YH2 A;  2VD1 A;  3G7J A;  1ERV A;  1SD9 A;  1VGL A;  4PUA A;  3KH7 A;  5CRE A;  1YF0 A;  2K8S A;  3CTF A;  3VWV A;  5EL8 A;  3UJ1 A;  4K2D A;  2YJ7 A;  3TRX A;  2DLX A;  2H01 A;  4AJ8 A;  2VCW A;  1ZL9 A;  3IV4 A;  2M72 A;  12GS A;  5ECI B;  4WET A;  3IDV A;  3WD6 A;  3HD5 A;  3WGE A;  4HEA 2;  2FA8 A;  1CQG A;  1K0A A;  4V2L A;  2H30 A;  4X1U A;  4IBP A;  4OFM A;  2B6M A;  3GSS A;  1M7T A;  4NWY A;  2N5F A;  3CSH A;  6GSU A;  3LSZ A;  2YAN A;  2ON5 A;  1A2J A;  1TU8 A;  1K0D A;  1J08 A;  3EWL A;  2GZZ A;  3KP9 A;  4V2N A;  5G30 A;  4TOP A;  1UC7 A;  4KW6 A;  4GXZ A;  4QQ7 A;  2GSS A;  2OAD A;  2QKE A;  5D73 A;  4WBJ A;  2E7P A;  2GGT A;  3I6A A;  13GS A;  3C1R A;  2PU9 C;  6GSX A;  3HYP A;  2H71 A;  1THX A;  2PUK C;  3QFB C;  1HNB A;  2HRF A;  2FY6 A;  4HU7 A;  1R5A A;  1VF3 A;  2M80 A;  3GHA A;  5EY6 A;  2LST A;  1OC8 A;  2YV9 A;  2HT9 A;  4E8E A;  4CDO A;  4G0I A;  3F9U A;  3IOS A;  2YWI A;  5HQP A;  1XWB A;  3MWH A;  3IC4 A;  2E2M A;  5G1K A;  6GSY A;  6GSS A;  2IL3 A;  4P3Y B;  3TDG A;  5CAX A;  3FR9 A;  1B4Q A;  1LJR A;  3GN3 A;  1BQ7 A;  3TKP A;  2H72 A;  5IIZ A;  1A24 A;  2MMN A;  3TJB A;  2MMA A;  3F6F A;  4Q5N A;  3PGT A;  3GX8 A;  3CMI A;  1XCC A;  4EDZ A;  2C0D A;  3VLN A;  4K0N A;  1X0R A;  2XC2 A;  1THO A;  2GT6 A;  2WCI A;  3RPN A;  3QR6 A;  1GSF A;  1O81 A;  4WBR D;  5F8B A;  5ELA A;  2RM6 A;  4BWS A;  2VLT A;  1DE2 A;  4JZQ A;  3O6T A;  1T7P B;  2V32 A;  3IE3 A;  3DKS A;  4V1A g;  1T00 A;  1H75 A;  4TN8 A;  2NDO A;  4POL A;  3H93 A;  3EE2 A;  3LQ7 A;  4HJ2 A;  2VO4 A;  1AQV A;  4J57 E;  4GTU A;  3ZRE A;  1A8L A;  5JWQ B;  3UOM A;  2HRN A;  2HLS A;  5ECN B;  4EXJ A;  2LQQ A;  5G5E A;  1TTZ A;  2O7K A;  2KP1 A;  1WPI A;  5F05 A;  3ZIV A;  4BL7 B;  3HZ4 A;  4POB A;  3EVI A;  2YOI A;  1ZMA A;  2X99 A;  1MEK A;  3GKX A;  1QFN A;  3KIJ A;  4EVM A;  4HZ4 A;  2HZE A;  2LJR A;  1KBN A;  3ERF A;  2VLU A;  5ECL B;  4MZW A;  3EC3 A;  1ON4 A;  2DIY A;  4JED A;  2LQO A;  3ZIT A;  4EL1 A;  4BA7 A;  1XWG A;  1PKW A;  2G0F A;  2LJA A;  2VL2 A;  2L5O A;  1AUC A;  1MD4 A;  4KCA A;  1XOA A;  1TRV A;  5IM9 A;  2JZR A;  2K9F A;  2P0G A;  1LBK A;  3US3 A;  3VFI A;  4NMU A;  4EUY A;  4MCU A;  4WXT A;  2GQL A;  4QL9 A;  11GS A;  3IRA A;  4KA0 A;  3UAR A;  2MZC A;  1GTA A;  1ZGN A;  3WT1 A;  2DJ3 A;  1Z6M A;  4Q5F A;  3VWU A;  1OAZ A;  3FYG A;  2C0G A;  3MDK A;  3IXR A;  3ERW A;  4TRX A;  1GNW A;  2AB6 A;  5EVO A;  2B5X A;  1X9S B;  1O73 A;  1F9M A;  4KF9 A;  2C3T A;  2H1B A;  3KGK A;  1N8J A;  3ZYW A;  2LJK A;  1F2E A;  3L78 A;  1FOV A;  4MJE A;  1U6T A;  2FGX A;  1A0F A;  4KE3 A;  4F9Z A;  1G7O A;  2FWG A;  3KP8 A;  1VF1 A;  2LRT A;  4IQ1 A;  2IMK A;  3E3E A;  2P31 A;  3F3R A;  1Z3E A;  4WEY A;  1GH2 A;  3P8W A;  2DJ1 A;  1SYR A;  3IPZ A;  3WGX A;  2HNL A;  3H4K A;  3F4T A;  2BMX A;  1FB0 A;  2NBS A;  1O6J A;  4WKW A;  5D93 A;  1VRS D;  1YEX A;  2R3X A;  4HOJ A;  2BJX A;  3W8S A;  3GL5 A;  2E2G A;  2AAW A;  3GKK A;  1HD2 A;  1PRX A;  1ACV A;  3L4N A;  3GRX A;  3QAV A;  2QSI A;  2UZ8 A;  4GSS A;  2MMZ A;  4MF7 A;  3FZ9 A;  1XZO A;  3L0H A;  3EU4 A;  2H0G A;  4ECJ A;  1TKD B;  4ZB6 A;  16GS A;  2VLV A;  4LMW A;  3F8U A;  4MDC A;  1M99 A;  4XIH A;  4EO3 A;  2P5R A;  1XWA A;  2VM2 A;  1SKR B;  3PIN A;  1YEP A;  2K18 A;  5F0G A;  2Z9S A;  1TU7 A;  4OFT A;  3KCM A;  2CV4 A;  3JCM L;  3HJM A;  4RUV A;  2AJQ B;  2DMM A;  2F51 A;  1U3I A;  2WRT A;  2WZ9 A;  1HNC A;  4N0Z A;  3RHB A;  3GV1 A;  5JWR B;  4BL7 A;  6GSV A;  1RK4 A;  3ED3 A;  4TXO A;  3G7Y A;  4ULX A;  1U88 A;  3HY2 A;  3L9V A;  3VI7 A;  3NOF A;  2C3N A;  4AJ7 A;  3HHV A;  4PTS A;  1YKA A;  1FAA A;  3UL3 A;  1YKC A;  1M2A A;  4FIW A;  3L9U A;  5G31 A;  2H1G A;  3ZML A;  5CNW A;  2X8H A;  1SL2 B;  3LFL A;  2H6Y A;  1GTB A;  9GSS A;  5CRG A;  1A8Y A;  1OKD A;  3RDW A;  5J3R A;  4BVX B;  3KJY A;  4TR4 A; 
#chains in the Genus database with same CATH topology
 4TW5 A;  3KMO A;  5J5N A;  5ECO B;  4ZBB A;  1QMV A;  2NVL A;  5A4V A;  4MJA A;  3ZVJ A;  2OA7 A;  3A3T A;  1T4Z A;  2K6V A;  1EEJ A;  2V41 A;  1K3O A;  2H74 A;  2P5Q A;  5KOW A;  1BED A;  4N3Z A;  2HRK B;  4CW9 A;  2L6D A;  1TK5 B;  1HNA A;  3EMX A;  3FR6 A;  5DDL A;  3DXB A;  5IOX A;  4TR1 B;  4W66 A;  1BAY A;  3ZLP A;  1S3D A;  3ME8 A;  4GSN A;  1XWC A;  3LXZ A;  2OBI A;  5B7C A;  1UA5 A;  3QCP A;  2XPD A;  2IMI A;  5H5S A;  1TW9 A;  1W4V A;  4NV2 A;  3KM6 A;  2KOK A;  3ME7 A;  4YAP A;  5IO2 A;  2H6Z A;  4YKF A;  4GLT A;  1QGV A;  1XFL A;  1SL1 B;  3GUS A;  4F0B A;  5DJM A;  3FRC A;  2N5A A;  1M3I A;  1XW6 A;  1ZCP A;  3ZL5 A;  3WGD A;  4IJ3 A;  3LOR A;  3A5W A;  5A1N B;  2CVK A;  3D5J A;  3D21 A;  5ABR A;  4K1F A;  4G0L A;  4N11 A;  2IIY A;  2D2Z A;  1HQO A;  2HSY A;  3ZRD A;  3TKQ A;  3W6G A;  3UMA A;  1JZW A;  4MZC A;  1YVL A;  5HFG A;  2VL2 C;  1S4B P;  3BCI A;  3LEF A;  3HXS A;  1PGT A;  2L4C A;  3E0U A;  4IVF A;  3CYN A;  2H66 A;  2L4Q A;  3G9B A;  2A2S A;  3QAG A;  2H76 A;  2DJ2 A;  2FWF A;  3F4R A;  2X49 A;  2KLX A;  4IKH A;  2WB9 A;  2WS2 A;  1C72 A;  3MIX A;  2WUL A;  1XW9 A;  2E0Q A;  2X8G A;  1EV9 A;  2B3S A;  4ZIL A;  4NAX A;  1AC1 A;  5GAN D;  4D73 B;  4EDY A;  3RGB C;  3APS A;  3DEX A;  3KZQ A;  4G10 A;  2KP2 A;  2PBJ A;  1EV4 A;  1X9M B;  2EIO A;  3TGZ A;  1OVN A;  3ZFB A;  2H75 A;  1OE7 A;  1MDK A;  4QL7 A;  3C8E A;  1ABA A;  2VCX A;  3Q74 A;  5LCZ A;  4K0G A;  2XHF A;  5CYY A;  2I81 A;  1YEW C;  4HUA A;  5DAL B;  5ECM B;  1Q98 A;  4RI6 A;  3CTG A;  4HS1 A;  1EOH A;  3MAK A;  4GWR A;  1PL2 A;  3CBU A;  2HXK A;  2AYT A;  1ERT A;  2CX4 A;  17GS A;  2VL3 A;  2R6K A;  1EGO A;  2J9H A;  3J7Y b;  1J0F A;  5E4W A;  2WW1 A;  5B6M A;  2AUV A;  3IR4 A;  5KN2 A;  1FVJ A;  2I4A A;  1ML6 A;  5ECH B;  2B5Y A;  4CY8 A;  1Y1U A;  1M2D A;  5A4U A;  5HFI A;  2PVQ A;  1GSD A;  4MF5 A;  1CQH A;  4XHM A;  1Z9H A;  3N5O A;  1V40 A;  7GSS A;  1JHB A;  1U3A A;  1T3B A;  3HJO A;  4EC0 A;  5LNK e;  4I5Q A;  3NIV A;  1TJD A;  4HQZ A;  1FHE A;  4MJC A;  1Y25 A;  1Z6N A;  3H79 A;  4BVX A;  3TKR A;  4IW9 A;  4MH3 A;  1F3B A;  1B48 A;  1PL1 A;  2GDR A;  3W8J A;  3A2W A;  3M0F A;  5EPF A;  5ECR B;  3TRP A;  3VWW A;  1GUL A;  2VCV A;  4PQ1 A;  4ZBA A;  3TOT A;  2R37 A;  5DQY A;  4EE0 A;  1B9Y C;  2YNX A;  4OMV A;  2GZY A;  2C0F A;  1T8E B;  4N0V A;  2HRK A;  4XS1 A;  1PA3 A;  2X8C A;  2CT6 A;  1M0U A;  5DAK B;  1SKW B;  2GSQ A;  2DSA A;  1M9B A;  3EIN A;  4TR1 A;  3VWX A;  4MZB A;  5IQY A;  1GL8 A;  2CX3 A;  4O5R A;  4LMV A;  2R2J A;  3DGQ A;  3RBT A;  3M1G A;  2CQ9 A;  2F9S A;  3VPT A;  3HDC A;  3HVS A;  2VM1 A;  1V58 A;  1ERW A;  1SEN A;  5A5H B;  5GAP D;  3QOU A;  4L5L A;  4XRD A;  3HJP A;  5D9V A;  1YZX A;  3L9S A;  2VCT A;  4KSM A;  1M2B A;  1W89 A;  1XVQ A;  4E8H A;  4TXO B;  3R2Q A;  1A23 A;  3MSZ A;  4ZIJ A;  5BMU B;  4POK A;  3RHC A;  3D0Z A;  3BD2 A;  4V1A p;  4XTS A;  5KN0 A;  4LLR A;  5D96 A;  5A1N A;  3LG6 A;  1RW1 A;  4F03 A;  3I9V 2;  5INY A;  5FWG A;  4AKI A;  4O5Q A;  2OBK A;  2TRX A;  4MH2 A;  1OC3 A;  1WJK A;  1F6M C;  1SJI A;  4J2F A;  1GSU A;  2MYG A;  3KTL A;  3TJJ A;  3S9F A;  1SVM A;  3A5I A;  1BG1 A;  1TRU A;  5D9W A;  1GSY A;  1JFU A;  2FWE A;  2PVO C;  2B7K A;  1F37 A;  3UVH A;  5AIV A;  4IEL A;  2F8F A;  1TOF A;  2F8A A;  2FCH A;  2WGR A;  4WR4 A;  1JLW A;  5GSS A;  1WWJ A;  4MP4 A;  1O7U A;  2WVZ A;  3PH9 A;  4POM A;  4D73 A;  1A2M A;  1SL0 B;  4ZXG A;  5B8B A;  1GWC A;  5C04 A;  1V2A A;  3IAS 2;  2GTU A;  2X4A A;  6GSW A;  1IYI A;  1TDI A;  4MAB A;  4HDE A;  4HZ2 A;  4Q5R A;  2DIZ A;  2BTO T;  3C1S A;  3P2A A;  1V9W A;  4CHS A;  1T1V A;  5FHI A;  1G0T A;  1R26 A;  5DAL A;  2R0G A;  2IMF A;  4G2E A;  4MA9 A;  1DBY A;  3G7I A;  20GS A;  2EFH A;  4WF5 A;  1DSB A;  5FT3 A;  3HCZ A;  2PGT A;  2R4V A;  2LTK A;  3V1W A;  3QAW A;  3ZFL A;  5JCW A;  3M3M A;  3ZZX A;  4NV5 A;  1EWX A;  2HE3 A;  3FEU A;  5E59 A;  4YAV A;  1A2L A;  3FR3 A;  2WFC A;  2H6X A;  4V2M A;  3GYK A;  3QFA C;  2YZH A;  3O3T A;  5DQS A;  1Y6E A;  2R5G A;  4ISD A;  3C71 A;  5DCH A;  1ZZY A;  5IMZ A;  3P90 A;  2C8U A;  1GSS A;  1NHY A;  4MLY A;  1SU9 A;  1G6W A;  2G2Q A;  2HYX A;  2MBS A;  3TKS E;  1SKS B;  4DEJ A;  2LS5 A;  2B7J A;  3TCO A;  14GS A;  3TRQ A;  2WDU A;  2O85 A;  4Z7X A;  1T4Y A;  4K6X A;  1NSW A;  3FZA A;  4G19 A;  3APO A;  2OKA A;  4MPF A;  2RLI A;  3TJF A;  3EUR A;  2H0I A;  4ECI A;  1TI3 A;  1BJX A;  2L59 A;  1O85 A;  5BRT A;  4PXO A;  3U6V A;  3QD9 A;  2C0E A;  3PR8 A;  2I1U A;  3M9K A;  5DAK A;  2JSY A;  4JE1 A;  1SK2 A;  3HVX A;  1ZYQ B;  1K0N A;  1FG4 A;  2ZUP A;  3PPU A;  4KAE A;  3KTB A;  5L71 A;  5ECK B;  1GLQ A;  1K0B A;  3GFK A;  3C7M A;  2VCZ A;  4PHZ C;  4KX4 A;  1YDK A;  3CQF A;  4YQU A;  5A5H A;  3ZTL A;  2FUG 2;  3BBY A;  1M3J A;  2YPM A;  4PUR A;  4RI7 A;  2MBT A;  5BMU A;  4LL4 B;  4OO5 A;  1AAZ A;  1BG5 A;  4JR6 A;  4KDU A;  5CRW A;  1FO5 A;  2QA1 A;  2CVB A;  2IMD A;  1WMJ A;  1JZO A;  4N30 A;  3KD0 A;  1R7H A;  3TUE A;  1R4W A;  4KDX A;  4OFN A;  2JAC A;  5AIX A;  1XW5 A;  1EOG A;  2VKZ G;  2FD3 A;  5HR0 A;  1B8X A;  1G6Y A;  1QK8 A;  2ES7 A;  4G01 A;  4DSS B;  18GS A;  3LW9 A;  1KEB A;  3VUR A;  5B6N A;  1GUK A;  4GST A;  5IOW A;  2CZ2 A;  2LNT A;  2NPB A;  2WW0 A;  1SJZ A;  2HI7 A;  2OE0 A;  2YN1 A;  2O87 A;  1OKT A;  2F3M A;  2HSM B;  4MMM A;  4PX1 A;  4HU9 A;  4L5O A;  4JBB A;  5GZZ B;  1NW2 A;  4PI0 C;  3ZVJ D;  2H0H A;  2XPE A;  2JU5 A;  5F06 A;  5AGY A;  3CXG A;  4KUN A;  1G7E A;  1R5P A;  3CHX C;  2B1L A;  5ID2 A;  4AKX B;  2YP6 A;  1H4O A;  1B9X C;  3U5R E;  5KEJ A;  3VK9 A;  5D9T A;  4AGS A;  2H73 A;  3LYP A;  3D6I A;  2A2R A;  4XS6 A;  3FK8 A;  2DML A;  5D9X A;  1EEM A;  1NM3 A;  3GX0 A;  4H86 A;  4ZBD A;  4O7H A;  1E2Y A;  3D22 A;  5IMD A;  1PQN A;  3FHK A;  5ENU A;  3H1N A;  5IMC A;  2GVP A;  4HJM A;  1PMT A;  2ZCT A;  4YQV A;  3F4S A;  2UV8 G;  3ISO A;  4JU5 A;  2FLS A;  1TRW A;  3BJ5 A;  1JZR A;  2LRC A;  3HVV A;  2K8V A;  3D4T A;  3E9J B;  3F3Q A;  3QMX A;  2VCQ A;  3LYK A;  3K8N A;  4KGI A;  3N9J A;  1IYH A;  2OE1 A;  4MF6 A;  4BIK A;  2H1D A;  3BOA A;  1X5E A;  1PX6 A;  5G1L A;  2VOC A;  1AQX A;  4CY6 A;  3GST A;  3CSJ A;  2YCD A;  5CO3 A;  5CRD A;  3IHQ A;  2GLR A;  1ZYE A;  1LU4 A;  3GL3 A;  2DC5 A;  1FB6 A;  3EYT A;  2CZ3 A;  2JL4 A;  4IS0 A;  5IMV A;  2QA2 A;  2VD0 A;  3FZ4 A;  2HSH A;  2WJU A;  4Q5Q A;  4N10 A;  2DBC A;  3KMN A;  1XIY A;  2V6O A;  1NHO A;  3D4M A;  4HQS A;  2A4V A;  5DBQ A;  1I5G A;  1SVL A;  1VF4 A;  2KUC A;  1YY7 A;  4K7O A;  5B8A A;  5HR2 A;  4XCS A;  5DJL A;  1ST9 A;  4GQF A;  1A0R P;  3UEM A;  5COH A;  4RQR A;  2YZU A;  4TR3 A;  2LNS A;  5HR3 A;  4FO5 A;  2PMT A;  1SJ6 A;  4KSO A;  1WP0 A;  1YF1 A;  1WRY A;  3GA4 A;  4ID0 A;  2FHE A;  4G9H A;  1AIU A;  1GNE A;  3KH9 A;  2L57 A;  3FW2 A;  2OT3 A;  4X4J A;  3NZN A;  3HKR A;  2B5E A;  4FYB A;  5GST A;  4F82 A;  1QUW A;  2A4H A;  2KHP A;  3GIX A;  4FYU A;  1GSE A;  1EP7 A;  1GRX A;  2O5V A;  1MDI A;  4GDF A;  1J9B A;  1MDJ A;  1EGR A;  2ON7 A;  2X64 A;  2O36 A;  4FYC A;  4A5P A;  3VI5 A;  2DJJ A;  2ALB A;  3HZ8 A;  2XBI A;  4OWY A;  5CP1 A;  2YV7 A;  4ZB9 A;  2IFQ B;  4DSS A;  4OD7 A;  4ZL7 A;  5G2Z A;  4DSQ A;  1WE0 A;  2N5B A;  5A34 B;  4MPG A;  3EPT A;  1K3L A;  2EFD A;  2HSM A;  3UBK A;  1USB A;  3CSI A;  2TRC P;  3DYR A;  4KB3 A;  3J7Y k;  4AF2 A;  2I9H A;  1GSQ A;  3QPM A;  3UVT A;  5C00 A;  1GP1 A;  4ILF A;  2VUP A;  10GS A;  5G5F A;  1SK1 A;  3EMP A;  1OYJ A;  3BCK A;  2WVX B;  2HZF A;  3WYW A;  5J9B A;  4IGJ A;  4OCE A;  2HSN A;  1XVW A;  4I8B A;  4HI7 A;  1K0O A;  1JZD A;  3A2V A;  1PKZ A;  2FNO A;  4FH8 A;  5LD0 A;  1VF2 A;  1QXH A;  1GLP A;  3DD3 A;  2MMO A;  4O32 A;  1MTC A;  5JWO B;  4I6X A;  1V57 A;  2JZT A;  2R0C A;  1XBS A;  1Z7R A;  4LL1 B;  1JLV A;  1BF5 A;  5J4V A;  2H1A A;  3TKS C;  4IN0 A;  2GS3 A;  2L5L A;  1KNG A;  1YQ1 A;  1SD8 A;  5ECQ B;  2EFE A;  4K7N A;  3DIE A;  4DSR A;  1I1I P;  1S3C A;  3DVX A;  4ZL8 A;  4TXV A;  2V6K A;  3ERG A;  4I2T A;  5JCU A;  4JR4 A;  2C80 A;  4L0U A;  2IN3 A;  2YWN A;  3O76 A;  4USS A;  5CRH A;  2CAQ A;  3IBH A;  4K9Z A;  2IPA A;  2PWJ A;  4JRR A;  5IPH A;  4NXI A;  4PNF A;  2OJL A;  3HVN A;  4TR0 A;  4PI2 C;  2JAD A;  4ECC A;  1OE8 A;  3IA1 A;  1K3Y A;  4RQX A;  2IWT A;  3RAZ A;  4HSC X;  8GSS A;  3OR5 A;  3GTU B;  1Q4J A;  5KN1 A;  1X9W B;  2PER A;  1PSQ A;  5ID2 B;  1X5C A;  1FVK A;  4KND A;  3GNJ A;  5KOX A;  4ML6 A;  5IMA A;  1HYU A;  3WT2 A;  1XOB A;  3F6D A;  4XS4 B;  3UBL A;  2AHE A;  1OC9 B;  3APQ A;  2EIQ A;  3F0I A;  2WZS A;  4IHU A;  1Z5Y E;  4IP6 A;  2GT5 A;  3RPP A;  2JSZ A;  1I9D A;  3AY8 A;  5IMF A;  2XBQ A;  4J56 E;  4BVY B;  5HR1 A;  4EKZ A;  4AJ6 A;  2O89 A;  3GH6 A;  1DUG A;  5AIS A;  3A2X A;  2O8V B;  4ZL9 A;  4NHW A;  1PD2 1;  2C3Q A;  3DVW A;  1SYX A;  1AXD A;  1ERU A;  2JZS A;  2REM A;  1XPV A;  4OO4 A;  3M9J A;  1U87 A;  5J9C A;  3TJG A;  2L6C A;  3GH9 A;  4NPB A;  3DML A;  1QQ2 A;  2RUF A;  2VAF A;  3I43 A;  2HFD A;  2ZNM A;  5DVB A;  4FQU A;  4O92 A;  4L0W A;  2RUE A;  4BWQ A;  1BYE A;  2FWH A;  1N2A A;  1Z7P A;  4GRF A;  5J4U A;  5DCG A;  1KTE A;  1TXX A;  2EIR A;  3Q6O A;  4KH7 A;  2VIM A;  1MD3 A;  2LKU A;  2IFQ A;  4ZB8 A;  2CVD A;  4MJB A;  4KCE A;  5A34 A;  2I3Y A;  2QGV A;  2GSR A;  3GMF A;  1BX9 A;  6GST A;  2HQT A;  3KEB A;  3UAP A;  3MNG A;  4QMK A;  1FOH A;  22GS A;  2M46 A;  1K0C A;  4K8M A;  1EP8 A;  3IHG A;  4BPY A;  4WR5 A;  5J4Y A;  1EZK A;  2H19 A;  1TRS A;  2J23 A;  2CA8 A;  1FW1 A;  2C4J A;  4IQA A;  3CRU A;  4I2U A;  3Q18 A;  2GQK A;  1GTU A;  2GZP A;  1ZOF A;  4XRA A;  2WVX A;  2H8L A;  3M8N A;  3IK7 A;  2YWO A;  1SVO A;  3I69 A;  1UN2 A;  4PQI A;  1ILO A;  3FKF A;  3LJR A;  4EF0 A;  1WIK A;  4MK3 A;  1XXU A;  2B1K A;  2GST A;  4GF0 A;  2PN8 A;  1YJ6 A;  5ECP B;  1UVZ A;  1X5D A;  2LV3 A;  1DE1 A;  2PPT A;  2GQM A;  3LGC A;  4L8E A;  2RII A;  3ZIJ A;  5F07 A;  5H5Q A;  3IAM 2;  4YQM A;  5HFK A;  4I97 A;  4PQH A;  5J41 A;  4PUF C;  2H70 A;  1XWK A;  3TOU A;  2AV4 A;  4NHZ A;  1PX7 A;  5A4W A;  2HRA A;  5A5K A;  3DWV A;  3TKS A;  2V1M A;  19GS A;  5H5R A;  2V2G A;  1AQW A;  3TB2 A;  4X0X A;  1URM A;  4DVC A;  2CAI A;  3H8Q A;  3GKM A;  3VPQ A;  1AW9 A;  4GCI A;  1TK8 B;  1TK0 B;  4X43 A;  3UIW A;  4PGT A;  2DKI A;  3LWA A;  3TU3 B;  4F0C A;  1TI1 A;  3HA9 A;  1WOU A;  4G0K A;  1PN9 A;  4GQC A;  2IJY A;  3P7X A;  4PNG A;  2OAC A;  4TKY A;  1O8W A;  4TVE A;  2IME A;  1B4P A;  3EU3 A;  3KXO A;  5IPG A;  3IK9 A;  1TP9 A;  4WF4 A;  3CWG A;  3CRT A;  3SWL A;  3LXT A;  4E68 A;  5D8I A;  3TJK A;  1RQM A;  2YWM A;  4IP1 A;  3FZ5 A;  5ECS A;  3ZMK A;  4O5U A;  2LUS A;  2LRN A;  1GUH A;  3FY7 A;  3R3E A;  3GTU A;  1S3A A;  3IC8 A;  5IO0 A;  4LA1 A;  1O8X A;  1GUM A;  2NTO A;  2RM5 A;  2VL9 A;  3QDN A;  5KN3 A;  2DJ0 A;  1GTI A;  4OCF A;  3F63 A;  4XS4 A;  3SBC A;  1F3A A;  1E6B A;  2HSN B;  1OC9 A;  2DJK A;  2YJH A;  4ECB A;  1K0M A;  1M9A A;  1V98 A;  4IJI A;  2OE3 A;  2TIR A;  3C73 A;  3GKN A;  2EC4 A;  4ICY A;  5ELG A;  2O3E A;  2QC7 A;  4K7I A;  4Z2U A;  2C1Y A;  2LEG A;  5AN1 A;  4BVY A;  2FA4 A;  5JCG A;  4F2I A;  3GUR A;  4ML1 A;  4ACS A;  4KDY A;  1SK0 A;  2HZE B;  3Q19 A;  3DRN A;  4YH2 A;  2VD1 A;  3G7J A;  1ERV A;  1SD9 A;  1VGL A;  4PUA A;  3KH7 A;  5CRE A;  1YF0 A;  4AKH A;  2K8S A;  3CTF A;  3VWV A;  5EL8 A;  3UJ1 A;  4K2D A;  2YJ7 A;  3TRX A;  2DLX A;  2H01 A;  4AJ8 A;  2VCW A;  1ZL9 A;  3IV4 A;  2M72 A;  12GS A;  5ECI B;  4WET A;  3IDV A;  3WD6 A;  3HD5 A;  3WGE A;  2A2P A;  4HEA 2;  2FA8 A;  1CQG A;  1TXU A;  1K0A A;  5J40 A;  4V2L A;  2EFC A;  2H30 A;  4X1U A;  4IBP A;  4OFM A;  2B6M A;  3GSS A;  1M7T A;  4NWY A;  2N5F A;  3CSH A;  6GSU A;  3LSZ A;  2YAN A;  2ON5 A;  1A2J A;  1TU8 A;  1K0D A;  1J08 A;  3EWL A;  2GZZ A;  3KP9 A;  4V2N A;  5G30 A;  4TOP A;  1UC7 A;  4KW6 A;  4GXZ A;  4QQ7 A;  2GSS A;  2OAD A;  2QKE A;  5D73 A;  4WBJ A;  2E7P A;  2GGT A;  3I6A A;  13GS A;  3C1R A;  2PU9 C;  6GSX A;  3HYP A;  2H71 A;  1THX A;  2PUK C;  3QFB C;  1HNB A;  2HRF A;  2FY6 A;  4HU7 A;  1R5A A;  1VF3 A;  2M80 A;  3GHA A;  5EY6 A;  2LST A;  1OC8 A;  2YV9 A;  2HT9 A;  4E8E A;  4CDO A;  4G0I A;  3F9U A;  3IOS A;  2YWI A;  5HQP A;  1XWB A;  3MWH A;  3IC4 A;  2E2M A;  5G1K A;  6GSY A;  6GSS A;  2IL3 A;  4P3Y B;  3TDG A;  5CAX A;  3FR9 A;  1B4Q A;  1LJR A;  3GN3 A;  1BQ7 A;  3TKP A;  2H72 A;  5IIZ A;  1A24 A;  2MMN A;  3TJB A;  2MMA A;  3F6F A;  2WW3 A;  4Q5N A;  3MYD A;  3PGT A;  3GX8 A;  3CMI A;  1XCC A;  4EDZ A;  2C0D A;  3VLN A;  4K0N A;  1X0R A;  2XC2 A;  1THO A;  2GT6 A;  2WCI A;  3RPN A;  3QR6 A;  1GSF A;  1O81 A;  4WBR D;  5F8B A;  5ELA A;  2RM6 A;  4BWS A;  2VLT A;  1DE2 A;  4JZQ A;  3O6T A;  1T7P B;  2V32 A;  3IE3 A;  3DKS A;  4V1A g;  1T00 A;  1H75 A;  4TN8 A;  2NDO A;  4POL A;  3H93 A;  3EE2 A;  3LQ7 A;  4HJ2 A;  2VO4 A;  1AQV A;  4J57 E;  4GTU A;  3ZRE A;  1A8L A;  5JWQ B;  3UOM A;  2HRN A;  2HLS A;  5ECN B;  4EXJ A;  2LQQ A;  5G5E A;  4AI6 A;  1TTZ A;  2O7K A;  2KP1 A;  1WPI A;  5F05 A;  3ZIV A;  4BL7 B;  3HZ4 A;  4POB A;  3EVI A;  2YOI A;  2DKH A;  1ZMA A;  4K5R A;  2X99 A;  1MEK A;  3GKX A;  1QFN A;  1XG8 A;  3KIJ A;  4FXY P;  4EVM A;  4HZ4 A;  2HZE A;  2LJR A;  1KBN A;  3ERF A;  2VLU A;  5ECL B;  4MZW A;  4K2X A;  3EC3 A;  1ON4 A;  2DIY A;  4JED A;  2LQO A;  3ZIT A;  4EL1 A;  4BA7 A;  1XWG A;  1PKW A;  2G0F A;  2LJA A;  2VL2 A;  2L5O A;  1AUC A;  1MD4 A;  4KCA A;  1XOA A;  1TRV A;  5IM9 A;  2JZR A;  4Z2T A;  2K9F A;  2P0G A;  1LBK A;  3US3 A;  3VFI A;  4NMU A;  4EUY A;  4MCU A;  4WXT A;  2GQL A;  4QL9 A;  11GS A;  3IRA A;  4KA0 A;  3UAR A;  2MZC A;  1GTA A;  1ZGN A;  3WT1 A;  2DJ3 A;  1Z6M A;  4Q5F A;  3VWU A;  1OAZ A;  3FYG A;  2C0G A;  1S3R A;  3MDK A;  3IXR A;  3ERW A;  4TRX A;  1GNW A;  2AB6 A;  5EVO A;  2B5X A;  1PFO A;  1X9S B;  1O73 A;  1F9M A;  4KF9 A;  2C3T A;  4AKG A;  2H1B A;  1ZYN A;  3KGK A;  1N8J A;  3ZYW A;  2LJK A;  1F2E A;  3L78 A;  1FOV A;  4MJE A;  4EIP A;  1U6T A;  3FMW A;  2FGX A;  1A0F A;  4KE3 A;  4F9Z A;  1G7O A;  2FWG A;  3KP8 A;  3HMJ G;  1VF1 A;  1PN0 A;  2LRT A;  4IQ1 A;  2IMK A;  3E3E A;  2P31 A;  3F3R A;  1Z3E A;  4WEY A;  1GH2 A;  1ZYP A;  3P8W A;  2DJ1 A;  1SYR A;  3IPZ A;  3WGX A;  2HNL A;  3H4K A;  3F4T A;  2BMX A;  1FB0 A;  2NBS A;  1O6J A;  4WKW A;  5D93 A;  1VRS D;  1YEX A;  2R3X A;  4HOJ A;  2BJX A;  2WVY A;  3W8S A;  3GL5 A;  2E2G A;  2AAW A;  3GKK A;  1HD2 A;  1PRX A;  1ACV A;  3L4N A;  3GRX A;  3QAV A;  2QSI A;  2UZ8 A;  4YKG A;  4GSS A;  2MMZ A;  4MF7 A;  3FZ9 A;  1XZO A;  3L0H A;  3EU4 A;  2H0G A;  4EIQ A;  4Z2R A;  4ECJ A;  1TKD B;  4ZB6 A;  16GS A;  2VLV A;  4LMW A;  3F8U A;  4MDC A;  1M99 A;  4XIH A;  2WW2 A;  2H1L A;  4EO3 A;  2P5R A;  1XWA A;  2VM2 A;  1SKR B;  3PIN A;  1YEP A;  2K18 A;  5F0G A;  2Z9S A;  1TU7 A;  4OFT A;  3KCM A;  2CV4 A;  3JCM L;  3HJM A;  1N25 A;  4RUV A;  2AJQ B;  2DMM A;  2F51 A;  1U3I A;  2WRT A;  2WZ9 A;  1HNC A;  4N0Z A;  3RHB A;  3GV1 A;  4MNN A;  5JWR B;  4BL7 A;  6GSV A;  1RK4 A;  3ED3 A;  4TXO A;  3G7Y A;  4ULX A;  1U88 A;  4ZB7 A;  3HY2 A;  3L9V A;  3VI7 A;  3NOF A;  2C3N A;  3RFR C;  4AJ7 A;  3HHV A;  4PTS A;  1YKA A;  1FAA A;  3UL3 A;  1YKC A;  5J47 A;  1M2A A;  4FIW A;  3L9U A;  4K5S A;  5G31 A;  2H1G A;  3ZML A;  5CNW A;  2X8H A;  1SL2 B;  3LFL A;  2H6Y A;  1GTB A;  9GSS A;  5CRG A;  1A8Y A;  2R0P A;  1OKD A;  3RDW A;  5J3R A;  4BVX B;  3KJY A;  4TR4 A; 
#chains in the Genus database with same CATH homology
 4TW5 A;  3KMO A;  5J5N A;  5ECO B;  4ZBB A;  1QMV A;  2NVL A;  5A4V A;  4MJA A;  3ZVJ A;  2OA7 A;  3A3T A;  1T4Z A;  2K6V A;  1EEJ A;  2V41 A;  1K3O A;  2H74 A;  2P5Q A;  5KOW A;  1BED A;  4N3Z A;  2HRK B;  4CW9 A;  2L6D A;  1TK5 B;  1HNA A;  3EMX A;  3FR6 A;  5DDL A;  3DXB A;  5IOX A;  4TR1 B;  4W66 A;  1BAY A;  3ZLP A;  1S3D A;  3ME8 A;  4GSN A;  1XWC A;  3LXZ A;  2OBI A;  5B7C A;  1UA5 A;  3QCP A;  2XPD A;  2IMI A;  5H5S A;  1TW9 A;  1W4V A;  4NV2 A;  3KM6 A;  2KOK A;  3ME7 A;  4YAP A;  5IO2 A;  2H6Z A;  4YKF A;  4GLT A;  1QGV A;  1XFL A;  1SL1 B;  3GUS A;  4F0B A;  5DJM A;  3FRC A;  2N5A A;  1XW6 A;  1ZCP A;  3ZL5 A;  3WGD A;  4IJ3 A;  3LOR A;  3A5W A;  5A1N B;  2CVK A;  3D5J A;  3D21 A;  5ABR A;  4K1F A;  4G0L A;  4N11 A;  2IIY A;  2D2Z A;  1HQO A;  2HSY A;  3ZRD A;  3TKQ A;  3W6G A;  3UMA A;  1JZW A;  4MZC A;  1YVL A;  5HFG A;  2VL2 C;  3BCI A;  3LEF A;  3HXS A;  1PGT A;  2L4C A;  3E0U A;  4IVF A;  3CYN A;  2H66 A;  2L4Q A;  3G9B A;  2A2S A;  3QAG A;  2H76 A;  2DJ2 A;  2FWF A;  3F4R A;  2X49 A;  2KLX A;  4IKH A;  2WB9 A;  2WS2 A;  1C72 A;  3MIX A;  2WUL A;  1XW9 A;  2E0Q A;  2X8G A;  1EV9 A;  2B3S A;  4ZIL A;  4NAX A;  1AC1 A;  5GAN D;  4D73 B;  4EDY A;  3APS A;  3DEX A;  3KZQ A;  4G10 A;  2KP2 A;  2PBJ A;  1EV4 A;  1X9M B;  2EIO A;  3TGZ A;  1OVN A;  3ZFB A;  2H75 A;  1OE7 A;  1MDK A;  4QL7 A;  3C8E A;  1ABA A;  2VCX A;  3Q74 A;  5LCZ A;  4K0G A;  2XHF A;  5CYY A;  2I81 A;  4HUA A;  5DAL B;  5ECM B;  1Q98 A;  4RI6 A;  3CTG A;  4HS1 A;  1EOH A;  3MAK A;  4GWR A;  1PL2 A;  3CBU A;  2HXK A;  2AYT A;  1ERT A;  2CX4 A;  17GS A;  2VL3 A;  2R6K A;  1EGO A;  2J9H A;  3J7Y b;  1J0F A;  5E4W A;  5B6M A;  2AUV A;  3IR4 A;  5KN2 A;  1FVJ A;  2I4A A;  1ML6 A;  5ECH B;  2B5Y A;  4CY8 A;  1Y1U A;  1M2D A;  5A4U A;  5HFI A;  2PVQ A;  1GSD A;  4MF5 A;  1CQH A;  4XHM A;  1Z9H A;  3N5O A;  1V40 A;  7GSS A;  1JHB A;  1U3A A;  1T3B A;  3HJO A;  4EC0 A;  5LNK e;  4I5Q A;  3NIV A;  1TJD A;  4HQZ A;  1FHE A;  4MJC A;  1Y25 A;  1Z6N A;  3H79 A;  4BVX A;  3TKR A;  4IW9 A;  4MH3 A;  1F3B A;  1B48 A;  1PL1 A;  2GDR A;  3W8J A;  3A2W A;  3M0F A;  5EPF A;  5ECR B;  3TRP A;  3VWW A;  1GUL A;  2VCV A;  4PQ1 A;  4ZBA A;  3TOT A;  2R37 A;  5DQY A;  4EE0 A;  1B9Y C;  2YNX A;  4OMV A;  2GZY A;  2C0F A;  1T8E B;  4N0V A;  2HRK A;  4XS1 A;  1PA3 A;  2X8C A;  2CT6 A;  1M0U A;  5DAK B;  1SKW B;  2GSQ A;  2DSA A;  1M9B A;  3EIN A;  4TR1 A;  3VWX A;  4MZB A;  5IQY A;  1GL8 A;  2CX3 A;  4O5R A;  4LMV A;  2R2J A;  3DGQ A;  3RBT A;  3M1G A;  2CQ9 A;  2F9S A;  3VPT A;  3HDC A;  3HVS A;  2VM1 A;  1V58 A;  1ERW A;  1SEN A;  5A5H B;  5GAP D;  3QOU A;  4L5L A;  4XRD A;  3HJP A;  5D9V A;  1YZX A;  3L9S A;  2VCT A;  4KSM A;  1M2B A;  1W89 A;  1XVQ A;  4E8H A;  4TXO B;  3R2Q A;  1A23 A;  3MSZ A;  4ZIJ A;  5BMU B;  4POK A;  3RHC A;  3D0Z A;  3BD2 A;  4V1A p;  4XTS A;  5KN0 A;  4LLR A;  5D96 A;  5A1N A;  3LG6 A;  1RW1 A;  4F03 A;  3I9V 2;  5INY A;  5FWG A;  4AKI A;  4O5Q A;  2OBK A;  2TRX A;  4MH2 A;  1OC3 A;  1WJK A;  1F6M C;  1SJI A;  4J2F A;  1GSU A;  2MYG A;  3KTL A;  3TJJ A;  3S9F A;  1SVM A;  3A5I A;  1BG1 A;  1TRU A;  5D9W A;  1GSY A;  1JFU A;  2FWE A;  2PVO C;  2B7K A;  1F37 A;  3UVH A;  5AIV A;  4IEL A;  2F8F A;  1TOF A;  2F8A A;  2FCH A;  2WGR A;  4WR4 A;  1JLW A;  5GSS A;  1WWJ A;  4MP4 A;  1O7U A;  3PH9 A;  4POM A;  4D73 A;  1A2M A;  1SL0 B;  4ZXG A;  5B8B A;  1GWC A;  5C04 A;  1V2A A;  3IAS 2;  2GTU A;  2X4A A;  6GSW A;  1IYI A;  1TDI A;  4MAB A;  4HDE A;  4HZ2 A;  4Q5R A;  2DIZ A;  2BTO T;  3C1S A;  3P2A A;  1V9W A;  4CHS A;  1T1V A;  5FHI A;  1G0T A;  1R26 A;  5DAL A;  2R0G A;  2IMF A;  4G2E A;  4MA9 A;  1DBY A;  3G7I A;  20GS A;  2EFH A;  4WF5 A;  1DSB A;  5FT3 A;  3HCZ A;  2PGT A;  2R4V A;  2LTK A;  3V1W A;  3QAW A;  3ZFL A;  5JCW A;  3M3M A;  3ZZX A;  4NV5 A;  1EWX A;  2HE3 A;  3FEU A;  5E59 A;  4YAV A;  1A2L A;  3FR3 A;  2WFC A;  2H6X A;  4V2M A;  3GYK A;  3QFA C;  2YZH A;  3O3T A;  5DQS A;  1Y6E A;  2R5G A;  4ISD A;  3C71 A;  5DCH A;  1ZZY A;  5IMZ A;  3P90 A;  2C8U A;  1GSS A;  1NHY A;  4MLY A;  1SU9 A;  1G6W A;  2G2Q A;  2HYX A;  2MBS A;  3TKS E;  1SKS B;  4DEJ A;  2LS5 A;  2B7J A;  3TCO A;  14GS A;  3TRQ A;  2WDU A;  2O85 A;  4Z7X A;  1T4Y A;  4K6X A;  1NSW A;  3FZA A;  4G19 A;  3APO A;  2OKA A;  4MPF A;  2RLI A;  3TJF A;  3EUR A;  2H0I A;  4ECI A;  1TI3 A;  1BJX A;  2L59 A;  1O85 A;  5BRT A;  4PXO A;  3U6V A;  3QD9 A;  2C0E A;  3PR8 A;  2I1U A;  3M9K A;  5DAK A;  2JSY A;  4JE1 A;  1SK2 A;  3HVX A;  1ZYQ B;  1K0N A;  1FG4 A;  2ZUP A;  3PPU A;  4KAE A;  3KTB A;  5L71 A;  5ECK B;  1GLQ A;  1K0B A;  3GFK A;  3C7M A;  2VCZ A;  4KX4 A;  1YDK A;  4YQU A;  5A5H A;  3ZTL A;  2FUG 2;  3BBY A;  2YPM A;  4PUR A;  4RI7 A;  2MBT A;  5BMU A;  4LL4 B;  4OO5 A;  1AAZ A;  1BG5 A;  4JR6 A;  4KDU A;  5CRW A;  1FO5 A;  2QA1 A;  2CVB A;  2IMD A;  1WMJ A;  1JZO A;  4N30 A;  3KD0 A;  1R7H A;  3TUE A;  1R4W A;  4KDX A;  4OFN A;  2JAC A;  5AIX A;  1XW5 A;  1EOG A;  2VKZ G;  2FD3 A;  5HR0 A;  1B8X A;  1G6Y A;  1QK8 A;  2ES7 A;  4G01 A;  4DSS B;  18GS A;  3LW9 A;  1KEB A;  3VUR A;  5B6N A;  1GUK A;  4GST A;  5IOW A;  2CZ2 A;  2LNT A;  2NPB A;  1SJZ A;  2HI7 A;  2OE0 A;  2YN1 A;  2O87 A;  1OKT A;  2F3M A;  2HSM B;  4MMM A;  4PX1 A;  4HU9 A;  4L5O A;  4JBB A;  5GZZ B;  1NW2 A;  3ZVJ D;  2H0H A;  2XPE A;  2JU5 A;  5F06 A;  5AGY A;  3CXG A;  4KUN A;  1G7E A;  1R5P A;  2B1L A;  5ID2 A;  4AKX B;  2YP6 A;  1H4O A;  1B9X C;  3U5R E;  5KEJ A;  3VK9 A;  5D9T A;  4AGS A;  2H73 A;  3LYP A;  3D6I A;  2A2R A;  4XS6 A;  3FK8 A;  2DML A;  5D9X A;  1EEM A;  1NM3 A;  3GX0 A;  4H86 A;  4ZBD A;  4O7H A;  1E2Y A;  3D22 A;  5IMD A;  1PQN A;  3FHK A;  5ENU A;  3H1N A;  5IMC A;  2GVP A;  4HJM A;  1PMT A;  2ZCT A;  4YQV A;  3F4S A;  2UV8 G;  3ISO A;  4JU5 A;  2FLS A;  1TRW A;  3BJ5 A;  1JZR A;  2LRC A;  3HVV A;  2K8V A;  3D4T A;  3E9J B;  3F3Q A;  3QMX A;  2VCQ A;  3LYK A;  3K8N A;  4KGI A;  3N9J A;  1IYH A;  2OE1 A;  4MF6 A;  2H1D A;  3BOA A;  1X5E A;  1PX6 A;  5G1L A;  2VOC A;  1AQX A;  4CY6 A;  3GST A;  3CSJ A;  2YCD A;  5CO3 A;  5CRD A;  3IHQ A;  2GLR A;  1ZYE A;  1LU4 A;  3GL3 A;  2DC5 A;  1FB6 A;  3EYT A;  2CZ3 A;  2JL4 A;  4IS0 A;  5IMV A;  2QA2 A;  2VD0 A;  3FZ4 A;  2HSH A;  2WJU A;  4Q5Q A;  4N10 A;  2DBC A;  3KMN A;  1XIY A;  2V6O A;  1NHO A;  3D4M A;  4HQS A;  2A4V A;  5DBQ A;  1I5G A;  1SVL A;  1VF4 A;  2KUC A;  1YY7 A;  4K7O A;  5B8A A;  5HR2 A;  4XCS A;  5DJL A;  1ST9 A;  4GQF A;  1A0R P;  3UEM A;  5COH A;  4RQR A;  2YZU A;  4TR3 A;  2LNS A;  5HR3 A;  4FO5 A;  2PMT A;  1SJ6 A;  4KSO A;  1WP0 A;  1YF1 A;  1WRY A;  3GA4 A;  4ID0 A;  2FHE A;  4G9H A;  1AIU A;  1GNE A;  3KH9 A;  2L57 A;  3FW2 A;  2OT3 A;  4X4J A;  3NZN A;  3HKR A;  2B5E A;  4FYB A;  5GST A;  4F82 A;  1QUW A;  2A4H A;  2KHP A;  3GIX A;  4FYU A;  1GSE A;  1EP7 A;  1GRX A;  2O5V A;  1MDI A;  4GDF A;  1J9B A;  1MDJ A;  1EGR A;  2ON7 A;  2X64 A;  4FYC A;  4A5P A;  3VI5 A;  2DJJ A;  2ALB A;  3HZ8 A;  2XBI A;  4OWY A;  5CP1 A;  2YV7 A;  4ZB9 A;  2IFQ B;  4DSS A;  4OD7 A;  4ZL7 A;  5G2Z A;  4DSQ A;  1WE0 A;  2N5B A;  5A34 B;  4MPG A;  3EPT A;  1K3L A;  2EFD A;  2HSM A;  3UBK A;  1USB A;  3CSI A;  2TRC P;  3DYR A;  4KB3 A;  3J7Y k;  4AF2 A;  2I9H A;  1GSQ A;  3QPM A;  3UVT A;  5C00 A;  1GP1 A;  4ILF A;  2VUP A;  10GS A;  5G5F A;  1SK1 A;  3EMP A;  1OYJ A;  3BCK A;  2HZF A;  3WYW A;  5J9B A;  4IGJ A;  4OCE A;  2HSN A;  1XVW A;  4I8B A;  4HI7 A;  1K0O A;  1JZD A;  3A2V A;  1PKZ A;  2FNO A;  4FH8 A;  5LD0 A;  1VF2 A;  1QXH A;  1GLP A;  3DD3 A;  2MMO A;  4O32 A;  1MTC A;  5JWO B;  4I6X A;  1V57 A;  2JZT A;  2R0C A;  1XBS A;  1Z7R A;  4LL1 B;  1JLV A;  1BF5 A;  5J4V A;  2H1A A;  3TKS C;  4IN0 A;  2GS3 A;  2L5L A;  1KNG A;  1YQ1 A;  1SD8 A;  5ECQ B;  2EFE A;  4K7N A;  3DIE A;  4DSR A;  1S3C A;  3DVX A;  4ZL8 A;  4TXV A;  2V6K A;  3ERG A;  4I2T A;  5JCU A;  4JR4 A;  2C80 A;  4L0U A;  2IN3 A;  2YWN A;  3O76 A;  4USS A;  5CRH A;  2CAQ A;  3IBH A;  4K9Z A;  2IPA A;  2PWJ A;  4JRR A;  5IPH A;  4NXI A;  4PNF A;  2OJL A;  4TR0 A;  2JAD A;  4ECC A;  1OE8 A;  3IA1 A;  1K3Y A;  4RQX A;  2IWT A;  3RAZ A;  8GSS A;  3OR5 A;  3GTU B;  1Q4J A;  5KN1 A;  1X9W B;  2PER A;  1PSQ A;  5ID2 B;  1X5C A;  1FVK A;  4KND A;  3GNJ A;  5KOX A;  4ML6 A;  5IMA A;  1HYU A;  3WT2 A;  1XOB A;  3F6D A;  4XS4 B;  3UBL A;  2AHE A;  1OC9 B;  3APQ A;  2EIQ A;  3F0I A;  4IHU A;  1Z5Y E;  4IP6 A;  2GT5 A;  3RPP A;  2JSZ A;  1I9D A;  3AY8 A;  5IMF A;  2XBQ A;  4J56 E;  4BVY B;  5HR1 A;  4EKZ A;  4AJ6 A;  2O89 A;  3GH6 A;  1DUG A;  5AIS A;  3A2X A;  2O8V B;  4ZL9 A;  4NHW A;  1PD2 1;  2C3Q A;  3DVW A;  1SYX A;  1AXD A;  1ERU A;  2JZS A;  2REM A;  1XPV A;  4OO4 A;  3M9J A;  1U87 A;  5J9C A;  3TJG A;  2L6C A;  3GH9 A;  4NPB A;  3DML A;  1QQ2 A;  2RUF A;  2VAF A;  3I43 A;  2HFD A;  2ZNM A;  5DVB A;  4FQU A;  4O92 A;  4L0W A;  2RUE A;  4BWQ A;  1BYE A;  2FWH A;  1N2A A;  1Z7P A;  4GRF A;  5J4U A;  5DCG A;  1KTE A;  1TXX A;  2EIR A;  3Q6O A;  4KH7 A;  2VIM A;  1MD3 A;  2LKU A;  2IFQ A;  4ZB8 A;  2CVD A;  4MJB A;  4KCE A;  5A34 A;  2I3Y A;  2QGV A;  2GSR A;  3GMF A;  1BX9 A;  6GST A;  2HQT A;  3KEB A;  3UAP A;  3MNG A;  4QMK A;  1FOH A;  22GS A;  2M46 A;  1K0C A;  4K8M A;  1EP8 A;  3IHG A;  4BPY A;  4WR5 A;  5J4Y A;  1EZK A;  2H19 A;  1TRS A;  2J23 A;  2CA8 A;  1FW1 A;  2C4J A;  4IQA A;  3CRU A;  4I2U A;  3Q18 A;  2GQK A;  1GTU A;  2GZP A;  1ZOF A;  4XRA A;  2H8L A;  3M8N A;  3IK7 A;  2YWO A;  1SVO A;  3I69 A;  1UN2 A;  4PQI A;  1ILO A;  3FKF A;  3LJR A;  4EF0 A;  1WIK A;  4MK3 A;  1XXU A;  2B1K A;  2GST A;  4GF0 A;  2PN8 A;  1YJ6 A;  5ECP B;  1UVZ A;  1X5D A;  2LV3 A;  1DE1 A;  2PPT A;  2GQM A;  3LGC A;  4L8E A;  2RII A;  3ZIJ A;  5F07 A;  5H5Q A;  3IAM 2;  4YQM A;  5HFK A;  4I97 A;  4PQH A;  5J41 A;  4PUF C;  2H70 A;  1XWK A;  3TOU A;  2AV4 A;  4NHZ A;  1PX7 A;  5A4W A;  2HRA A;  5A5K A;  3DWV A;  3TKS A;  2V1M A;  19GS A;  5H5R A;  2V2G A;  1AQW A;  3TB2 A;  4X0X A;  1URM A;  4DVC A;  2CAI A;  3H8Q A;  3GKM A;  3VPQ A;  1AW9 A;  4GCI A;  1TK8 B;  1TK0 B;  4X43 A;  3UIW A;  4PGT A;  2DKI A;  3LWA A;  3TU3 B;  4F0C A;  1TI1 A;  3HA9 A;  1WOU A;  4G0K A;  1PN9 A;  4GQC A;  2IJY A;  3P7X A;  4PNG A;  2OAC A;  4TKY A;  1O8W A;  4TVE A;  2IME A;  1B4P A;  3EU3 A;  3KXO A;  5IPG A;  3IK9 A;  1TP9 A;  4WF4 A;  3CWG A;  3CRT A;  3SWL A;  3LXT A;  4E68 A;  5D8I A;  3TJK A;  1RQM A;  2YWM A;  4IP1 A;  3FZ5 A;  5ECS A;  3ZMK A;  4O5U A;  2LUS A;  2LRN A;  1GUH A;  3FY7 A;  3R3E A;  3GTU A;  1S3A A;  3IC8 A;  5IO0 A;  4LA1 A;  1O8X A;  1GUM A;  2NTO A;  2RM5 A;  2VL9 A;  3QDN A;  5KN3 A;  2DJ0 A;  1GTI A;  4OCF A;  3F63 A;  4XS4 A;  3SBC A;  1F3A A;  1E6B A;  2HSN B;  1OC9 A;  2DJK A;  2YJH A;  4ECB A;  1K0M A;  1M9A A;  1V98 A;  4IJI A;  2OE3 A;  2TIR A;  3C73 A;  3GKN A;  2EC4 A;  4ICY A;  5ELG A;  2QC7 A;  4K7I A;  4Z2U A;  2C1Y A;  2LEG A;  5AN1 A;  4BVY A;  2FA4 A;  5JCG A;  4F2I A;  3GUR A;  4ML1 A;  4ACS A;  4KDY A;  1SK0 A;  2HZE B;  3Q19 A;  3DRN A;  4YH2 A;  2VD1 A;  3G7J A;  1ERV A;  1SD9 A;  1VGL A;  4PUA A;  3KH7 A;  5CRE A;  1YF0 A;  4AKH A;  2K8S A;  3CTF A;  3VWV A;  5EL8 A;  3UJ1 A;  4K2D A;  2YJ7 A;  3TRX A;  2DLX A;  2H01 A;  4AJ8 A;  2VCW A;  1ZL9 A;  3IV4 A;  2M72 A;  12GS A;  5ECI B;  4WET A;  3IDV A;  3WD6 A;  3HD5 A;  3WGE A;  2A2P A;  4HEA 2;  2FA8 A;  1CQG A;  1TXU A;  1K0A A;  5J40 A;  4V2L A;  2EFC A;  2H30 A;  4X1U A;  4IBP A;  4OFM A;  2B6M A;  3GSS A;  1M7T A;  4NWY A;  2N5F A;  3CSH A;  6GSU A;  3LSZ A;  2YAN A;  2ON5 A;  1A2J A;  1TU8 A;  1K0D A;  1J08 A;  3EWL A;  2GZZ A;  3KP9 A;  4V2N A;  5G30 A;  4TOP A;  1UC7 A;  4KW6 A;  4GXZ A;  4QQ7 A;  2GSS A;  2OAD A;  2QKE A;  5D73 A;  4WBJ A;  2E7P A;  2GGT A;  3I6A A;  13GS A;  3C1R A;  2PU9 C;  6GSX A;  3HYP A;  2H71 A;  1THX A;  2PUK C;  3QFB C;  1HNB A;  2HRF A;  2FY6 A;  4HU7 A;  1R5A A;  1VF3 A;  2M80 A;  3GHA A;  5EY6 A;  2LST A;  1OC8 A;  2YV9 A;  2HT9 A;  4E8E A;  4CDO A;  4G0I A;  3F9U A;  3IOS A;  2YWI A;  5HQP A;  1XWB A;  3MWH A;  3IC4 A;  2E2M A;  5G1K A;  6GSY A;  6GSS A;  2IL3 A;  4P3Y B;  3TDG A;  5CAX A;  3FR9 A;  1B4Q A;  1LJR A;  3GN3 A;  1BQ7 A;  3TKP A;  2H72 A;  5IIZ A;  1A24 A;  2MMN A;  3TJB A;  2MMA A;  3F6F A;  4Q5N A;  3MYD A;  3PGT A;  3GX8 A;  3CMI A;  1XCC A;  4EDZ A;  2C0D A;  3VLN A;  4K0N A;  1X0R A;  2XC2 A;  1THO A;  2GT6 A;  2WCI A;  3RPN A;  3QR6 A;  1GSF A;  1O81 A;  4WBR D;  5F8B A;  5ELA A;  2RM6 A;  4BWS A;  2VLT A;  1DE2 A;  4JZQ A;  3O6T A;  1T7P B;  2V32 A;  3IE3 A;  3DKS A;  4V1A g;  1T00 A;  1H75 A;  4TN8 A;  2NDO A;  4POL A;  3H93 A;  3EE2 A;  3LQ7 A;  4HJ2 A;  2VO4 A;  1AQV A;  4J57 E;  4GTU A;  3ZRE A;  1A8L A;  5JWQ B;  3UOM A;  2HRN A;  2HLS A;  5ECN B;  4EXJ A;  2LQQ A;  5G5E A;  4AI6 A;  1TTZ A;  2O7K A;  2KP1 A;  1WPI A;  5F05 A;  3ZIV A;  4BL7 B;  3HZ4 A;  4POB A;  3EVI A;  2YOI A;  2DKH A;  1ZMA A;  4K5R A;  2X99 A;  1MEK A;  3GKX A;  1QFN A;  3KIJ A;  4EVM A;  4HZ4 A;  2HZE A;  2LJR A;  1KBN A;  3ERF A;  2VLU A;  5ECL B;  4MZW A;  4K2X A;  3EC3 A;  1ON4 A;  2DIY A;  4JED A;  2LQO A;  3ZIT A;  4EL1 A;  4BA7 A;  1XWG A;  1PKW A;  2G0F A;  2LJA A;  2VL2 A;  2L5O A;  1AUC A;  1MD4 A;  4KCA A;  1XOA A;  1TRV A;  5IM9 A;  2JZR A;  4Z2T A;  2K9F A;  2P0G A;  1LBK A;  3US3 A;  3VFI A;  4NMU A;  4EUY A;  4MCU A;  4WXT A;  2GQL A;  4QL9 A;  11GS A;  3IRA A;  4KA0 A;  3UAR A;  2MZC A;  1GTA A;  1ZGN A;  3WT1 A;  2DJ3 A;  1Z6M A;  4Q5F A;  3VWU A;  1OAZ A;  3FYG A;  2C0G A;  3MDK A;  3IXR A;  3ERW A;  4TRX A;  1GNW A;  2AB6 A;  5EVO A;  2B5X A;  1X9S B;  1O73 A;  1F9M A;  4KF9 A;  2C3T A;  4AKG A;  2H1B A;  1ZYN A;  3KGK A;  1N8J A;  3ZYW A;  2LJK A;  1F2E A;  3L78 A;  1FOV A;  4MJE A;  4EIP A;  1U6T A;  3FMW A;  2FGX A;  1A0F A;  4KE3 A;  4F9Z A;  1G7O A;  2FWG A;  3KP8 A;  3HMJ G;  1VF1 A;  1PN0 A;  2LRT A;  4IQ1 A;  2IMK A;  3E3E A;  2P31 A;  3F3R A;  1Z3E A;  4WEY A;  1GH2 A;  1ZYP A;  3P8W A;  2DJ1 A;  1SYR A;  3IPZ A;  3WGX A;  2HNL A;  3H4K A;  3F4T A;  2BMX A;  1FB0 A;  2NBS A;  1O6J A;  4WKW A;  5D93 A;  1VRS D;  1YEX A;  2R3X A;  4HOJ A;  2BJX A;  3W8S A;  3GL5 A;  2E2G A;  2AAW A;  3GKK A;  1HD2 A;  1PRX A;  1ACV A;  3L4N A;  3GRX A;  3QAV A;  2QSI A;  2UZ8 A;  4YKG A;  4GSS A;  2MMZ A;  4MF7 A;  3FZ9 A;  1XZO A;  3L0H A;  3EU4 A;  2H0G A;  4EIQ A;  4Z2R A;  4ECJ A;  1TKD B;  4ZB6 A;  16GS A;  2VLV A;  4LMW A;  3F8U A;  4MDC A;  1M99 A;  4XIH A;  2H1L A;  4EO3 A;  2P5R A;  1XWA A;  2VM2 A;  1SKR B;  3PIN A;  1YEP A;  2K18 A;  5F0G A;  2Z9S A;  1TU7 A;  4OFT A;  3KCM A;  2CV4 A;  3JCM L;  3HJM A;  1N25 A;  4RUV A;  2AJQ B;  2DMM A;  2F51 A;  1U3I A;  2WRT A;  2WZ9 A;  1HNC A;  4N0Z A;  3RHB A;  3GV1 A;  4MNN A;  5JWR B;  4BL7 A;  6GSV A;  1RK4 A;  3ED3 A;  4TXO A;  3G7Y A;  4ULX A;  1U88 A;  4ZB7 A;  3HY2 A;  3L9V A;  3VI7 A;  3NOF A;  2C3N A;  4AJ7 A;  3HHV A;  4PTS A;  1YKA A;  1FAA A;  3UL3 A;  1YKC A;  5J47 A;  1M2A A;  4FIW A;  3L9U A;  4K5S A;  5G31 A;  2H1G A;  3ZML A;  5CNW A;  2X8H A;  1SL2 B;  3LFL A;  2H6Y A;  1GTB A;  9GSS A;  5CRG A;  1A8Y A;  2R0P A;  1OKD A;  3RDW A;  5J3R A;  4BVX B;  3KJY A;  4TR4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...