1UA5A

Non-fusion gst from s. japonicum in complex with glutathione
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
215
structure length
215
Chain Sequence
SPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords glutathione S-transferase
publication title Non-fusion GST from S. japonicum in complex with glutathione
rcsb
source organism Schistosoma japonicum
molecule tags Transferase
total genus 69
structure length 215
sequence length 215
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2003-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1ua5A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1ua5A01
3WT1A 3TKSA 2FWEA 1SJ6A 2LJKA 4GSSA 3TRXA 2BTOT 1XWGA 3CSJA 4IP6A 1JZRA 3ZFLA 1ACVA 3PR8A 3VK9A 3UL3A 1QK8A 1PMTA 22GSA 3QAGA 2DLXA 3GN3A 1B48A 1PD21 3HJPA 3RAZA 2YWNA 1KEBA 5ENUA 2O8VB 3EE2A 5IO0A 1O73A 4OMVA 2AYTA 1B8XA 4OO4A 4L5LA 4CHSA 3EU3A 1V98A 4FQUA 2B6MA 4PURA 3EMPA 1X9MB 1LBKA 2F8FA 1H75A 2H0IA 6GSUA 4IBPA 1Z6NA 5CAXA 4EE0A 1B9YC 4ZL8A 3UVTA 4TN8A 3H8QA 2GLRA 2R6KA 5ECSA 2B1LA 4K1FA 1OVNA 1Z3EA 4BA7A 7GSSA 4AJ7A 4DSSB 3HVVA 2XPEA 2WJUA 3O76A 4IJ3A 4Z7XA 3TJFA 4YAPA 5KN0A 3L9UA 2FUG2 1EOGA 3TJGA 1TRSA 2F51A 3IV4A 4KSMA 19GSA 4J56E 5GAND 3GMFA 2YP6A 4BWQA 5CRWA 4K7IA 3LEFA 4EVMA 5COHA 5ECMB 4HUAA 12GSA 1XFLA 2AUVA 4MJCA 5AIXA 1A2MA 2CAQA 3HKRA 1NM3A 4WR4A 2P5RA 1SD8A 4FYBA 1IYIA 2C0GA 5DJLA 3I69A 1QFNA 3DKSA 11GSA 4I8BA 1PN9A 3OR5A 3VWWA 1KBNA 2HNLA 1TRVA 3KJYA 2PMTA 2YCDA 4KDUA 4EF0A 4ZXGA 1EGRA 2VL2C 2R4VA 2IMEA 3P2AA 4PUFC 2GDRA 5AGYA 1OAZA 2HT9A 4K7OA 3Q6OA 3PPUA 1JZOA 5IOWA 4G0IA 3HYPA 4LLRA 3GHAA 1GUMA 3HVSA 3QFAC 1R7HA 4O5RA 3TJBA 1SD9A 1QMVA 2YWMA 1XWAA 1MDIA 3EWLA 3GFKA 2DJJA 2M80A 5IQYA 1QGVA 4ZILA 1Z6MA 1Q98A 3C7MA 1R5PA 4NV5A 1GSSA 1AUCA 2PVQA 2FWHA 1C72A 4OFMA 2UZ8A 3KD0A 3KTBA 4KW6A 14GSA 3M0FA 4HDEA 3ZVJD 2MZCA 3FEUA 4ACSA 1PKWA 4RQXA 1XCCA 4DVCA 3FHKA 1BYEA 1GUKA 2F8AA 2YV9A 5HR1A 2K8SA 1MDJA 4JR6A 2XPDA 3TKRA 4CDOA 2HYXA 1GLQA 1LU4A 3UMAA 2ALBA 5LNKe 17GSA 3DVXA 2YPMA 5JWQB 2L6DA 2C3TA 1ERUA 2NBSA 4EXJA 1GLPA 1PA3A 3VFIA 3CTGA 2HRKA 3IC4A 1BX9A 3ED3A 3EC3A 4E8HA 4WF5A 1ZZYA 3UJ1A 5D8IA 1GP1A 3KZQA 2PUKC 3HY2A 5KN3A 3HJOA 2IN3A 4NV2A 3FR6A 2HZEA 1XWKA 2I9HA 4QQ7A 2ON7A 5C04A 2H8LA 3H4KA 1M0UA 2L5OA 5ID2A 4IW9A 2AHEA 1Z7PA 1TKDB 4FYCA 3DIEA 5A4WA 4IHUA 3J7Yb 4HQSA 1AW9A 4ECJA 1AIUA 2IL3A 1WP0A 4MK3A 4PQHA 4RI7A 1GSFA 5AIVA 2DJ2A 5B6MA 3IE3A 1WIKA 1QXHA 1O81A 1GH2A 1N2AA 3CRTA 1SKSB 2EIOA 2GSSA 1ML6A 2QGVA 2KLXA 2JSYA 3UIWA 1OC3A 1V57A 1A2LA 2IMDA 2MBTA 1RK4A 3ERGA 4MPGA 3H1NA 3TRQA 3GL5A 5DAKB 1S3AA 2CA8A 2YANA 3ZIJA 2ZUPA 2B5EA 1UVZA 1EV4A 5G5FA 4QL7A 5G30A 4WEYA 2QSIA 1ST9A 3E9JB 3IAS2 4HOJA 4OFTA 1XOBA 3VI5A 1ILOA 3HJMA 3HHVA 4TR3A 4V2MA 3IBHA 2EIQA 4FYUA 4NHZA 4RQRA 4IGJA 2PERA 2FA4A 4EDYA 1SK0A 1F3AA 4KF9A 4PNFA 4I6XA 1FHEA 1ERWA 1TP9A 5EPFA 1ABAA 1E2YA 2O89A 2HE3A 4ILFA 3GH9A 2HLSA 3L78A 4DSSA 5INYA 2P5QA 1WE0A 2GZZA 5D96A 4JEDA 3IOSA 3LGCA 2GS3A 1ZMAA 1A0FA 3WGDA 3TGZA 1YDKA 5DALB 3Q74A 4O92A 2LJAA 4LMVA 4PX1A 4MH3A 1FB6A 4PXOA 3DRNA 4MCUA 2CAIA 4ML6A 3VPTA 1I9DA 2GT6A 5J41A 5H5SA 1TXXA 2RM5A 4ISDA 4ZL9A 3M9JA 4POLA 4ML1A 5IMAA 1GNEA 2VLVA 2VLTA 2NPBA 4XTSA 5D9VA 2RUFA 3EINA 4XHMA 1G6YA 1RW1A 1TRUA 2C8UA 2D2ZA 1TU7A 4FO5A 1JFUA 1MEKA 4JRRA 1NHYA 4TXVA 2HSYA 3E0UA 1J9BA 3O6TA 1Z7RA 4G19A 2CX3A 1AQWA 4G2EA 1G0TA 2OADA 2VCQA 2CVDA 3ERFA 3M3MA 5F0GA 3QD9A 2REMA 3UAPA 2A4VA 2GSRA 4USSA 4GWRA 3C8EA 4XS1A 3GKMA 1WPIA 2M72A 1KTEA 1T4ZA 5HQPA 4GSNA 1R4WA 2VCVA 3TJJA 1PL2A 3KTLA 2FA8A 2O85A 2OJLA 2VD1A 6GSTA 3GTUA 2YJHA 4JR4A 1UN2A 1YEXA 3FW2A 3TRPA 4J57E 3WYWA 3MSZA 1F9MA 2VUPA 4QL9A 4I2UA 3F63A 2LS5A 3D5JA 3ZZXA 2HXKA 3ZRDA 3ZFBA 2FGXA 2RIIA 4PQIA 4GLTA 2LRCA 2L5LA 3IHQA 3F6FA 3F4SA 4XCSA 1W4VA 2IFQA 2YWIA 2AV4A 1M99A 4WBJA 3UARA 3F4TA 4V1Ag 4EO3A 2GT5A 2DIYA 5JCGA 3ME7A 5FWGA 3EMXA 2DJKA 1SKWB 4WXTA 1EV9A 1M7TA 4PTSA 2HSHA 2IJYA 4LMWA 3TKPA 4PQ1A 1SYRA 3FZ4A 4CW9A 5ECLB 3VWVA 2TRXA 5CNWA 3SBCA 2H72A 2H1BA 2DSAA 3IDVA 5J4UA 16GSA 1GULA 3UBKA 2C80A 2YWOA 3L9SA 1XVQA 3LSZA 3PINA 3R2QA 2DJ3A 3O3TA 2ZNMA 4POMA 3UVHA 1DE2A 3M1GA 5KEJA 5CRDA 2DMMA 4IQAA 3A5WA 5DCHA 4BVXB 3D4MA 3KH9A 1VF3A 2LNTA 5DVBA 5IPGA 1A0RP 2HRNA 3U5RE 2TIRA 1BAYA 1DE1A 1XWCA 2V32A 2LSTA 2LQQA 2G0FA 1BEDA 3IXRA 1X9SB 3CMIA 3DYRA 3F9UA 2WDUA 2E2GA 2VCTA 3EURA 3U6VA 5B8AA 5EL8A 3KH7A 3RDWA 4FH8A 1OKDA 2H76A 1K3OA 1MD3A 1OE7A 4POKA 1WOUA 4XRDA 4AJ6A 4MMMA 5DBQA 1O8WA 1T8EB 3UEMA 1ON4A 4AJ8A 2OACA 2KP1A 2MMNA 2N5AA 1XW5A 2VCZA 1JLWA 1THOA 1VF1A 3MWHA 3I43A 3LFLA 1BJXA 3ZMLA 3HCZA 1PSQA 5DAKA 2L4QA 3GX8A 3NZNA 5GAPD 1FB0A 4ECCA 3NOFA 2H0GA 2HZFA 3LQ7A 3LORA 2H30A 3AY8A 3BCIA 3ERWA 2RUEA 5ECRB 4HS1A 4MPFA 3TOTA 2N5BA 5ABRA 1X5CA 3BOAA 2DC5A 4YH2A 1AC1A 2QC7A 4F2IA 3FR9A 1TJDA 4BL7B 2CT6A 4MABA 3ZITA 1PX6A 4TR1A 4V2NA 1Y25A 5D9WA 1R5AA 3RPPA 1SENA 1TI1A 3L4NA 5H5RA 3ZTLA 4TW5A 1N8JA 2CVKA 3MAKA 5JCWA 3EYTA 4ZB6A 4TRXA 3APOA 5D93A 1Z9HA 4EC0A 3LXTA 6GSWA 2IWTA 1T00A 1OKTA 3EVIA 4K9ZA 1OC9A 2B5YA 3DWVA 1SKRB 4MJAA 4OWYA 1KNGA 1XZOA 5DJMA 4KDXA 3RBTA 2H01A 2MMOA 3DGQA 4XRAA 4YQUA 2OKAA 1YY7A 4MP4A 2LNSA 3QCPA 2H70A 2YJ7A 2WB9A 1NHOA 1AAZA 3TKSE 4AGSA 4GRFA 1SL2B 3QOUA 2VL2A 3G7YA 4DSQA 2P31A 2JL4A 4TOPA 4RUVA 3KM6A 2CX4A 1YF1A 4YAVA 3QFBC 4GQFA 4K7NA 2FWFA 4MJBA 1GWCA 3UOMA 2C0FA 4HEA2 2O7KA 3H93A 3GIXA 4ZBDA 2KP2A 2VCWA 3QAWA 2CQ9A 2YZHA 1FVJA 2HRAA 3HZ4A 1J08A 4KCEA 2V41A 1EP8A 5G5EA 2FY6A 3HXSA 4F0BA 4N11A 2I4AA 5F06A 2IMKA 4EUYA 2H6XA 4Q5QA 3PGTA 2GSQA 4TR4A 3GKXA 3C73A 2HQTA 2PU9C 2XBQA 3LYKA 4JE1A 1U3IA 3N5OA 3ZVJA 1XWBA 2RLIA 3GX0A 4I5QA 4L8EA 4TVEA 1AQXA 2X8CA 1OE8A 2H66A 1XW9A 5ELAA 2LEGA 4MZCA 3KP9A 2XBIA 2J23A 1OYJA 1WJKA 1TRWA 1PX7A 1V58A 3SWLA 1VRSD 1O6JA 3FZAA 1JLVA 1WRYA 1K0DA 3QDNA 3FRCA 4N30A 1CQGA 3R3EA 4ZBAA 2O87A 3WGEA 3J7Yk 2VO4A 4L5OA 3IK9A 2JU5A 1K0NA 4KX4A 4KH7A 3DEXA 4MDCA 2J9HA 4G0KA 3A2XA 4YQVA 1LJRA 4WKWA 2WCIA 3GYKA 4OO5A 5G31A 1A8YA 3FKFA 2IMIA 4IVFA 2LRTA 3LWAA 3RHBA 1ZGNA 2WS2A 1TI3A 3K8NA 5B6NA 5DCGA 3KCMA 3LYPA 3CSIA 3P7XA 4IKHA 4G10A 1Z5YE 3TJKA 3GV1A 5D73A 4L0UA 1X5EA 4IJIA 2XHFA 2B5XA 3M8NA 1SK1A 2GZPA 2AAWA 1E6BA 2IPAA 4JU5A 3IA1A 1XIYA 3D21A 3BD2A 5JWRB 1TK5B 5HR2A 2GQLA 2PN8A 1FOVA 2OE3A 1A8LA 3IC8A 1X9WB 2CZ3A 1A23A 3WD6A 2FWGA 1M2BA 4TXOB 1AXDA 3BJ5A 2YN1A 1XVWA 3TCOA 5E59A 1EGOA 3HZ8A 2H1GA 4X43A 2NTOA 3QMXA 1K0OA 4KE3A 1TK0B 5HR0A 1Q4JA 5IPHA 2FLSA 2X8HA 2X99A 3TB2A 2F3MA 3MDKA 1EOHA 4BVYB 4Q5RA 3H79A 1HNBA 5ECOB 5AN1A 1TK8B 1PKZA 4NWYA 3CTFA 2PVOC 2ES7A 4K0GA 4HI7A 2EC4A 3TDGA 4KB3A 3F3QA 2DMLA 4K8MA 1R26A 5J9CA 2VOCA 4HJMA 2B3SA 1ERTA 1GSYA 2GTUA 1F3BA 5IMDA 3GKNA 3GH6A 1T4YA 3GSSA 1SK2A 4H86A 4Q5NA 1EP7A 1VF2A 1M9BA 1XXUA 3D6IA 2X64A 1PQNA 8GSSA 4BL7A 1K0AA 2I3YA 4I97A 1JZDA 5A4UA 2B1KA 4KCAA 4DEJA 1YKCA 1GSQA 1GTUA 1MTCA 1HYUA 4MF6A 3IR4A 5IM9A 4MF5A 5C00A 5IOXA 2TRCP 3A2WA 1USBA 2HZEB 3FZ9A 4RI6A 1HNCA 4V1Ap 4LA1A 5A4VA 4JBBA 2A2RA 2LQOA 1EWXA 1XW6A 4IELA 3VWUA 5ID2B 3KGKA 5DQYA 4IN0A 5F8BA 2HSMB 5ECHB 4ECBA 2CZ2A 2I81A 1FO5A 5DDLA 1T1VA 4PNGA 2Z9SA 1TOFA 4FIWA 1VGLA 1EEMA 5J9BA 6GSXA 3KMNA 4MZWA 4KGIA 5JCUA 3ME8A 2JACA 2K9FA 3TUEA 3P8WA 2H1AA 2JZRA 4HJ2A 5ECNB 18GSA 2C3NA 3PH9A 4D73B 4GCIA 1ZYQB 1DSBA 4ZB9A 4NAXA 4BPYA 4MF7A 4KNDA 5ECQB 3ZMKA 5FT3A 1FW1A 5CYYA 1K3YA 2LV3A 5GSTA 3FYGA 2MBSA 2H74A 3VLNA 3DMLA 3US3A 2OE0A 13GSA 2ZCTA 1EEJA 1K0MA 1JHBA 4EDZA 4YQMA 3FK8A 3DD3A 2L4CA 2GGTA 5IMCA 4G9HA 5E4WA 1X5DA 2JSZA 1EZKA 3D4TA 2LUSA 1XPVA 2C3QA 1BG5A 5LD0A 2V6KA 1O8XA 2H73A 4IP1A 2N5FA 2VLUA 3DVWA 2YV7A 4F0CA 3HD5A 2EIRA 3LG6A 3A2VA 1G7OA 3IAM2 1A2JA 3V1WA 2MYGA 3L9VA 5HR3A 2MMAA 3ZIVA 2P0GA 1VF4A 5DQSA 4N0VA 2GZYA 2GSTA 2M46A 3WT2A 1FG4A 3G7IA 3QR6A 5EVOA 5F05A 5KN2A 3TKQA 1TTZA 1GUHA 2HFDA 2V6OA 4KSOA 1PGTA 5ECIB 2H75A 1GNWA 2WGRA 2B7JA 2VL3A 2WULA 2GQMA 3G7JA 3C1SA 3WGXA 3APQA 3MNGA 3W6GA 1G6WA 3GL3A 3F3RA 2OA7A 2C0DA 1GL8A 1YJ6A 2XC2A 4HQZA 3D22A 2PWJA 1PL1A 1MDKA 4P3YB 3I9V2 2RM6A 2GVPA 1F37A 4JZQA 4BWSA 3QAVA 4LL4B 6GSSA 3E3EA 2R2JA 1SYXA 1V2AA 1U3AA 4MH2A 1HQOA 2L57A 2KHPA 2KUCA 1THXA 5L71A 4PUAA 1K0CA 2AJQB 4GXZA 4WETA 4NXIA 2VAFA 3Q18A 4X1UA 3I6AA 2IIYA 2CVBA 3RHCA 4X0XA 3VURA 4KAEA 2H6YA 4XS4B 1F6MC 2R5GA 2WRTA 5DALA 1BQ7A 3GTUB 1ERVA 4HU7A 4TXOA 4KDYA 5GSSA 5D9XA 4OD7A 2H6ZA 3F6DA 1NW2A 3FZ5A 1HNAA 3KMOA 5CO3A 3F4RA 5KN1A 2WZ9A 5ECKB 1HD2A 3TOUA 3HVXA 2IFQB 2JZTA 2R37A 3GRXA 1ZL9A 4MZBA 4F03A 5AISA 4BVYA 1U88A 3CSHA 2E0QA 4ZB8A 4LL1B 2K6VA 1TU8A 1YKAA 4O7HA 5FHIA 4EKZA 4G0LA 1SJZA 2OE1A 1GTBA 1YF0A 2KOKA 3P90A 1B9XC 1M2AA 4OCEA 1PRXA 4O32A 3IPZA 2OBIA 1GTAA 4V2LA 1TDIA 2FNOA 1S3CA 5G1LA 3ZL5A 3KP8A 3IRAA 1K3LA 1MD4A 2JZSA 2DJ1A 3RPNA 2VCXA 5HFKA 4E8EA 2VIMA 2VL9A 2FCHA 4K6XA 1UC7A 2H71A 2LKUA 5ELGA 5B8BA 3BBYA 2OBKA 1F2EA 5IMFA 1WWJA 4PGTA 4ULXA 2DBCA 3GSTA 2R3XA 4OCFA 5HFGA 1GRXA 1QQ2A 2PPTA 3S9FA 5LCZA 2E2MA 1JZWA 3UBLA 2PBJA 1XBSA 3C1RA 2PGTA 5JWOB 1TW9A 4XS6A 2VM2A 4I2TA 4F82A 1T3BA 2FD3A 4XIHA 2I1UA 1H4OA 2HSMA 1U87A 1YQ1A 5H5QA 3EU4A 1XOAA 5G1KA 5A5KA 4OFNA 4N10A 1GTIA 4NHWA 2H1DA 1B4QA 4ZBBA 3KIJA 4TKYA 2L59A 4MJEA 1QUWA 4ID0A 3GURA 3W8SA 3LJRA 2C1YA 4ZL7A 2E7PA 2WFCA 3F8UA 2IMFA 1IYHA 3VPQA 1NSWA 5CREA 2DJ0A 3FY7A 4D73A 1GSUA 3KXOA 2K18A 5CP1A 3F0IA 1O7UA 1U6TA 2NVLA 3M9KA 5IIZA 1I5GA 5G2ZA 4ZIJA 5F07A 1V40A 4J2FA 4IQ1A 2X8GA 4GF0A 2H0HA 1DBYA 3ISOA 2LJRA 4BVXA 6GSVA 3DXBA 2YNXA 2FHEA 5IMVA 2GQKA 1CQHA 4NMUA 9GSSA 3C71A 4MLYA 1YEPA 4WF4A 3CYNA 3APSA 3GUSA 1S3DA 4WR5A 3JCML 1M2DA 3BCKA 4NPBA 1OC8A 2F9SA 4K0NA 1O85A 3HA9A 5IO2A 3VWXA 4TR1B 5ECPB 3CXGA 1FVKA 2B7KA 4IS0A 3QPMA 5CRHA 1ZYEA 4EL1A 4GTUA 4POBA 2QKEA 2H19A 1A24A 1Y6EA 2YZUA 3W8JA 5B7CA 1OC9B 5EY6A 3D0ZA 1X0RA 1ZOFA 3GNJA 1UA5A 3IK7A 3TKSC 2HSNB 2C0EA 1GSEA 4HZ2A 3L0HA 1SJIA 1B4PA 3GKKA 4DSRA 1RQMA 2HI7A 4HZ4A 3Q19A 2BMXA 4WBRD 2NDOA 5GZZB 3LXZA 4GSTA 3GA4A 4HU9A 1SU9A 2BJXA 1DUGA 3VI7A 2K8VA 2V2GA 1SL1B 3ZLPA 4N0ZA 5J3RA 3FR3A 1K0BA 2VD0A 5BMUA 3CBUA 2HRKB 2LRNA 5J5NA 1URMA 4TR0A 3NIVA 2C4JA 4KA0A 2JADA 2L6CA 4AF2A 4K2DA 1T7PB 1G7EA 3A3TA 4MA9A 1W89A 20GSA 2YOIA 2MMZA 3G9BA 5CRGA 1ZCPA 1SL0B 2ON5A 2DIZA 4KUNA 3ZREA 5HFIA 10GSA 2G2QA 6GSYA 5D9TA 2AB6A 1V9WA 4F9ZA 1M9AA 4L0WA 4ECIA 4XS4A 5IMZA 1AQVA 2LTKA 1J0FA 3CRUA 2HRFA 4GQCA 3KEBA 3N9JA 4Q5FA 2A2SA 2CV4A 1WMJA 3ZYWA 1FAAA 2VM1A 1YZXA 1GSDA 3HDCA 2V1MA
chains in the Genus database with same CATH superfamily
3WT1A 3TKSA 2FWEA 3EPTA 1SJ6A 2LJKA 4GSSA 3TRXA 2WW0A 2BTOT 1XWGA 3CSJA 4IP6A 1JZRA 3ZFLA 2WVYA 1ACVA 3PR8A 3VK9A 3UL3A 1QK8A 1PMTA 22GSA 3QAGA 2DLXA 3GN3A 1B48A 3CHXC 1PD21 3HJPA 3RAZA 2YWNA 1KEBA 5ENUA 5J4YA 2O8VB 3EE2A 5IO0A 1O73A 4OMVA 2AYTA 1B8XA 4OO4A 4L5LA 4CHSA 3EU3A 1V98A 4FQUA 2B6MA 4PURA 3EMPA 1X9MB 1LBKA 2F8FA 1H75A 2H0IA 6GSUA 4IBPA 1Z6NA 5CAXA 4EE0A 1B9YC 4ZL8A 3UVTA 4TN8A 3H8QA 2GLRA 2R6KA 5ECSA 2B1LA 4K1FA 1OVNA 1Z3EA 4BA7A 7GSSA 4AJ7A 4DSSB 3HVVA 2XPEA 2WJUA 3O76A 4IJ3A 4Z7XA 3TJFA 4YAPA 5KN0A 3L9UA 2FUG2 1EOGA 3TJGA 1TRSA 5J40A 2F51A 3IV4A 4KSMA 19GSA 4J56E 5GAND 3GMFA 2YP6A 2EFCA 4BWQA 5CRWA 4K7IA 3LEFA 4EVMA 5COHA 5ECMB 4HUAA 12GSA 1XFLA 2AUVA 4MJCA 5AIXA 1A2MA 2CAQA 3HKRA 1NM3A 4WR4A 2P5RA 1SD8A 4FYBA 1IYIA 2C0GA 5DJLA 3I69A 1QFNA 3DKSA 11GSA 4I8BA 1PN9A 3OR5A 3VWWA 1KBNA 4E68A 2HNLA 1TRVA 3KJYA 2PMTA 2YCDA 4KDUA 4EF0A 4ZXGA 1EGRA 2VL2C 2R4VA 2IMEA 3P2AA 4PUFC 2GDRA 5AGYA 1PFOA 1OAZA 2HT9A 3IHGA 3Q6OA 4K7OA 3PPUA 4Z2UA 1JZOA 5IOWA 4G0IA 3HYPA 4LLRA 3GHAA 1GUMA 3HVSA 3QFAC 1R7HA 4O5RA 3TJBA 1SD9A 2OT3A 1QMVA 2YWMA 1XWAA 1MDIA 3EWLA 1SVMA 3GFKA 2DJJA 2M80A 5IQYA 1QGVA 4ZILA 1Z6MA 1Q98A 3C7MA 1R5PA 4NV5A 1GSSA 1AUCA 2PVQA 2FWHA 1C72A 3RGBC 4OFMA 2UZ8A 3KD0A 3KTBA 4KW6A 14GSA 3MIXA 3M0FA 4HDEA 3ZVJD 2MZCA 3FEUA 4ACSA 1PKWA 4RQXA 1XCCA 4DVCA 3FHKA 2HSNA 1BYEA 1GUKA 2F8AA 2WVZA 2YV9A 5HR1A 2K8SA 1MDJA 4JR6A 2XPDA 3TKRA 4CDOA 2HYXA 1GLQA 1LU4A 3UMAA 2ALBA 5LNKe 17GSA 3DVXA 2YPMA 5JWQB 2L6DA 2C3TA 1S3RA 1ERUA 2NBSA 4EXJA 1GLPA 1PA3A 5J4VA 3VFIA 3CTGA 2HRKA 3IC4A 1BX9A 3ED3A 3EC3A 4E8HA 4WF5A 1ZZYA 3UJ1A 5D8IA 1GP1A 3KZQA 2PUKC 3HY2A 5KN3A 3HJOA 2WVXB 2IN3A 4NV2A 3FR6A 2HZEA 1XWKA 3HVNA 2I9HA 4QQ7A 4A5PA 2ON7A 5C04A 2H8LA 2R0GA 4CY8A 3H4KA 1M0UA 2L5OA 5ID2A 4IW9A 2AHEA 1Z7PA 1TKDB 4FYCA 3DIEA 1SVLA 5A4WA 4IHUA 3J7Yb 4HQSA 1AW9A 4ECJA 1AIUA 2IL3A 1WP0A 4MK3A 4PQHA 3CWGA 1GSFA 4RI7A 5AIVA 2DJ2A 5B6MA 3IE3A 1WIKA 1QXHA 1O81A 1GH2A 4YKGA 1N2AA 3CRTA 1SKSB 2EIOA 2GSSA 1ML6A 2QGVA 2KLXA 4G01A 2JSYA 3UIWA 1OC3A 3CQFA 1V57A 1A2LA 2IMDA 2MBTA 1RK4A 3ERGA 4MPGA 2O3EA 4W66A 3H1NA 3TRQA 3GL5A 1S4BP 5DAKB 1S3AA 2CA8A 2YANA 3ZIJA 2ZUPA 2B5EA 1UVZA 1EV4A 5G5FA 4QL7A 5G30A 4WEYA 2QSIA 1ST9A 3E9JB 3IAS2 4HOJA 4OFTA 1XOBA 3VI5A 1ILOA 2A2PA 3HJMA 3HHVA 4TR3A 4V2MA 3IBHA 2EIQA 4FYUA 4NHZA 4RQRA 4ZB7A 4IGJA 2PERA 2FA4A 4EDYA 1SK0A 1F3AA 4KF9A 4PNFA 4I6XA 1FHEA 1ERWA 1TP9A 5EPFA 1ABAA 1E2YA 2O89A 2HE3A 4ILFA 3GH9A 2HLSA 3L78A 4DSSA 5INYA 2P5QA 1WE0A 2GZZA 5D96A 4JEDA 3IOSA 3LGCA 2GS3A 1ZMAA 4MNNA 1A0FA 3WGDA 3TGZA 1YDKA 5DALB 3Q74A 4O92A 2LJAA 4LMVA 4PX1A 4MH3A 1FB6A 4PXOA 3DRNA 4MCUA 2CAIA 2VKZG 5A34B 4ML6A 3VPTA 1I9DA 2GT6A 4K5SA 5J41A 5H5SA 1TXXA 2RM5A 4ISDA 4ZL9A 3M9JA 4POLA 4ML1A 5IMAA 1GNEA 2VLVA 2VLTA 2EFHA 2NPBA 4XTSA 5D9VA 2RUFA 3EINA 4XHMA 1G6YA 1RW1A 1TRUA 2C8UA 3MYDA 2D2ZA 1TU7A 4FO5A 1JFUA 1MEKA 4JRRA 1NHYA 4TXVA 2HSYA 2QA2A 4O5QA 3E0UA 1J9BA 3O6TA 1Z7RA 4G19A 2CX3A 1AQWA 4G2EA 1G0TA 2OADA 4Z2TA 2VCQA 2CVDA 3ERFA 3M3MA 5F0GA 3QD9A 2REMA 3UAPA 2A4VA 2GSRA 4USSA 4GWRA 3C8EA 4XS1A 3GKMA 1WPIA 2M72A 1KTEA 1T4ZA 5HQPA 4GSNA 1R4WA 2VCVA 3TJJA 1PL2A 3KTLA 2FA8A 2O85A 2OJLA 2VD1A 6GSTA 3GTUA 2YJHA 4JR4A 1UN2A 1YEXA 3FW2A 3TRPA 4J57E 3WYWA 4GDFA 3MSZA 1F9MA 2VUPA 4QL9A 4I2UA 3F63A 2LS5A 3D5JA 3ZZXA 2HXKA 3ZRDA 3ZFBA 2FGXA 2RIIA 4PQIA 4GLTA 2LRCA 2L5LA 3IHQA 3F6FA 3F4SA 4XCSA 1W4VA 2IFQA 2YWIA 2AV4A 1M99A 4WBJA 3UARA 3F4TA 4V1Ag 4EO3A 2GT5A 2DIYA 1TXUA 3ME7A 5JCGA 5FWGA 3EMXA 2DJKA 4PI0C 1SKWB 4WXTA 1EV9A 1M7TA 4PTSA 2HSHA 2IJYA 4LMWA 3TKPA 4PQ1A 1SYRA 3FZ4A 4CW9A 5ECLB 3VWVA 2TRXA 5CNWA 3SBCA 2H72A 2H1BA 2DSAA 3IDVA 5J4UA 16GSA 1GULA 3UBKA 2C80A 2YWOA 3L9SA 1XVQA 3LSZA 3PINA 3R2QA 2DJ3A 3O3TA 2ZNMA 4POMA 3UVHA 1DE2A 3M1GA 5KEJA 5CRDA 2DMMA 4IQAA 5A5HB 3A5WA 5DCHA 4BVXB 3D4MA 3KH9A 5A1NB 1XG8A 1VF3A 2LNTA 4BIKA 5DVBA 5IPGA 1A0RP 2HRNA 3U5RE 2TIRA 1BAYA 1DE1A 1XWCA 2V32A 1N25A 2LSTA 2LQQA 2G0FA 1BEDA 3IXRA 1X9SB 3CMIA 3DYRA 3F9UA 2WDUA 2E2GA 2VCTA 3EURA 3U6VA 5B8AA 5EL8A 3KH7A 3RDWA 4FH8A 1OKDA 2H76A 1BG1A 1K3OA 1MD3A 1OE7A 4POKA 1WOUA 1I1IP 4XRDA 1ZYNA 4AJ6A 4MMMA 5DBQA 1O8WA 1T8EB 3UEMA 2WZSA 1ON4A 4AJ8A 2OACA 2KP1A 2MMNA 2N5AA 1XW5A 2VCZA 1JLWA 1THOA 1VF1A 3MWHA 3I43A 3LFLA 1BJXA 3ZMLA 3HCZA 1PSQA 5DAKA 2L4QA 3GX8A 3NZNA 5GAPD 1FB0A 4ECCA 3NOFA 2H0GA 2HZFA 3LQ7A 3LORA 4ICYA 2H30A 1M3IA 3AY8A 3BCIA 3ERWA 2RUEA 5ECRB 4HS1A 4CY6A 4MPFA 3TOTA 2N5BA 3TU3B 5ABRA 1X5CA 3HMJG 3BOAA 2DC5A 4YH2A 1AC1A 2QC7A 4F2IA 3FR9A 1TJDA 4BL7B 2CT6A 4MABA 3ZITA 1PX6A 4TR1A 4V2NA 1Y25A 5D9WA 1R5AA 3RPPA 1SENA 1TI1A 3L4NA 5H5RA 3ZTLA 4TW5A 1N8JA 2CVKA 3MAKA 5JCWA 3EYTA 4ZB6A 4TRXA 4X4JA 3APOA 5D93A 1Z9HA 4EC0A 3LXTA 6GSWA 1YVLA 2IWTA 1T00A 4O5UA 1OKTA 3EVIA 4K9ZA 1OC9A 2B5YA 3DWVA 1SKRB 4MJAA 4OWYA 1KNGA 1XZOA 5DJMA 5A34A 4KDXA 3RBTA 2H01A 2MMOA 3DGQA 4XRAA 4YQUA 2OKAA 1YY7A 4MP4A 2LNSA 3QCPA 2H70A 2YJ7A 2WB9A 1NHOA 1AAZA 3TKSE 4AGSA 4GRFA 1SL2B 3QOUA 2VL2A 3G7YA 4DSQA 1YEWC 2P31A 2JL4A 4TOPA 4RUVA 3KM6A 4HSCX 2CX4A 1YF1A 4YAVA 3QFBC 4GQFA 4K7NA 2FWFA 4MJBA 1GWCA 3UOMA 2C0FA 4HEA2 2O7KA 3H93A 3GIXA 4ZBDA 2KP2A 2VCWA 4K2XA 3QAWA 2CQ9A 2YZHA 1FVJA 2HRAA 3HZ4A 1J08A 4KCEA 2WW2A 2V41A 1EP8A 5G5EA 2FY6A 3HXSA 4F0BA 4N11A 2I4AA 5F06A 2IMKA 4EUYA 2H6XA 4Q5QA 3PGTA 2GSQA 4TR4A 3GKXA 3C73A 2HQTA 2PU9C 2XBQA 3LYKA 4JE1A 1U3IA 3N5OA 2UV8G 3ZVJA 1XWBA 2RLIA 3GX0A 4I5QA 4L8EA 4TVEA 1AQXA 4N3ZA 2X8CA 1OE8A 2H66A 1XW9A 5ELAA 2LEGA 4MZCA 3KP9A 2XBIA 2J23A 1OYJA 1WJKA 1TRWA 1PX7A 1V58A 3SWLA 1VRSD 3FMWA 1O6JA 4Z2RA 3FZAA 1JLVA 1WRYA 1K0DA 3QDNA 3FRCA 4N30A 1CQGA 3R3EA 4ZBAA 2O87A 3WGEA 3J7Yk 2VO4A 4L5OA 3IK9A 2JU5A 1K0NA 4KX4A 4KH7A 3DEXA 4MDCA 2J9HA 4G0KA 3A2XA 4YQVA 1LJRA 4WKWA 2WCIA 3GYKA 4OO5A 5BRTA 5G31A 1A8YA 3FKFA 2IMIA 4IVFA 2LRTA 3LWAA 3RHBA 1ZGNA 2WS2A 4AKIA 1TI3A 3K8NA 5B6NA 5DCGA 3KCMA 3LYPA 3CSIA 3P7XA 4IKHA 4G10A 1Z5YE 2A4HA 3TJKA 3GV1A 5D73A 4L0UA 1X5EA 4IJIA 2XHFA 5A1NA 2B5XA 3M8NA 1SK1A 2GZPA 2AAWA 1E6BA 2R0CA 2IPAA 4JU5A 3IA1A 1XIYA 3D21A 3BD2A 5JWRB 1TK5B 5HR2A 2GQLA 2PN8A 1FOVA 2OE3A 1A8LA 3IC8A 1X9WB 2CZ3A 1A23A 3WD6A 2FWGA 3LW9A 1M2BA 4TXOB 1AXDA 3BJ5A 2EFDA 2YN1A 1XVWA 3TCOA 5E59A 1EGOA 4PI2C 3HZ8A 4PHZC 2H1GA 4X43A 2NTOA 3QMXA 1K0OA 4KE3A 1TK0B 5HR0A 1Q4JA 5IPHA 2EFEA 2FLSA 2X8HA 2X99A 3TB2A 2F3MA 3MDKA 1EOHA 4BVYB 4Q5RA 3H79A 1HNBA 5ECOB 5AN1A 1TK8B 1PKZA 4NWYA 3CTFA 2PVOC 2ES7A 4K0GA 4HI7A 2EC4A 3TDGA 4KB3A 3F3QA 2DMLA 4K8MA 1R26A 5J9CA 2VOCA 4HJMA 2B3SA 1ERTA 1GSYA 2GTUA 1F3BA 5IMDA 3GKNA 3GH6A 1T4YA 3GSSA 1SK2A 4H86A 4Q5NA 1EP7A 1VF2A 1M9BA 1XXUA 3D6IA 2X64A 1PQNA 8GSSA 4BL7A 1K0AA 4QMKA 2I3YA 4I97A 1JZDA 5A4UA 2B1KA 4KCAA 4DEJA 1YKCA 1GSQA 1GTUA 1MTCA 1HYUA 4MF6A 3IR4A 5IM9A 4MF5A 5C00A 5IOXA 2TRCP 3A2WA 1USBA 2HZEB 3FZ9A 4RI6A 1ZYPA 1HNCA 4V1Ap 4LA1A 5A4VA 4JBBA 2A2RA 2LQOA 1EWXA 1XW6A 4IELA 3VWUA 5ID2B 3KGKA 5DQYA 4IN0A 5F8BA 2HSMB 5ECHB 4ECBA 2CZ2A 2I81A 1FO5A 5DDLA 1T1VA 5KOXA 4PNGA 2Z9SA 1TOFA 4FIWA 1VGLA 1EEMA 5J9BA 6GSXA 3KMNA 4MZWA 4KGIA 5JCUA 3ME8A 2JACA 2K9FA 3TUEA 3P8WA 2H1AA 2JZRA 4HJ2A 5ECNB 18GSA 2C3NA 3PH9A 4D73B 4GCIA 1ZYQB 1DSBA 4ZB9A 4AI6A 4NAXA 4K5RA 4BPYA 4MF7A 4KNDA 5ECQB 3ZMKA 5FT3A 1FW1A 5CYYA 1K3YA 2LV3A 5GSTA 3FYGA 2MBSA 2H74A 3VLNA 3DMLA 5KOWA 3US3A 4FXYP 2OE0A 13GSA 2ZCTA 1EEJA 1K0MA 1JHBA 2H1LA 2WVXA 4EDZA 4YQMA 3FK8A 3DD3A 2L4CA 2GGTA 5IMCA 4G9HA 5E4WA 1X5DA 4EIQA 2JSZA 1EZKA 3D4TA 2LUSA 1XPVA 2C3QA 4AKGA 1BG5A 5LD0A 2V6KA 1O8XA 2H73A 4IP1A 2N5FA 2VLUA 3DVWA 2YV7A 4F0CA 3HD5A 2EIRA 3LG6A 3A2VA 1G7OA 3IAM2 1A2JA 3V1WA 2MYGA 3L9VA 5HR3A 2MMAA 3ZIVA 2P0GA 2R0PA 1VF4A 5DQSA 4N0VA 2GZYA 2GSTA 2M46A 3WT2A 1FG4A 3G7IA 3QR6A 5EVOA 5F05A 5KN2A 3TKQA 1TTZA 1GUHA 2HFDA 2V6OA 4KSOA 1PGTA 5ECIB 2H75A 1GNWA 2WGRA 2B7JA 2VL3A 2WULA 2GQMA 3G7JA 3C1SA 3WGXA 3APQA 3MNGA 4YKFA 3W6GA 1G6WA 3GL3A 3F3RA 2OA7A 2C0DA 1GL8A 1YJ6A 2XC2A 4HQZA 3D22A 2PWJA 1PL1A 1MDKA 4P3YB 3I9V2 2RM6A 2GVPA 1F37A 5BMUB 4JZQA 4BWSA 3QAVA 4LL4B 6GSSA 2WW1A 3E3EA 2R2JA 1BF5A 1SYXA 1V2AA 1U3AA 4MH2A 1HQOA 2O36A 2L57A 3A5IA 2KHPA 2KUCA 1THXA 5L71A 4AKXB 4PUAA 1K0CA 2QA1A 2AJQB 4GXZA 4WETA 4NXIA 2VAFA 3Q18A 4X1UA 3I6AA 2X49A 2IIYA 2CVBA 3RHCA 4X0XA 3VURA 4KAEA 5J47A 2H6YA 4XS4B 1F6MC 2R5GA 2WRTA 5DALA 1BQ7A 3GTUB 1ERVA 4HU7A 4TXOA 4KDYA 5GSSA 5D9XA 4OD7A 2H6ZA 3F6DA 1NW2A 3FZ5A 1HNAA 3KMOA 5CO3A 3F4RA 5KN1A 2WZ9A 5ECKB 1HD2A 3TOUA 3HVXA 2IFQB 2JZTA 2R37A 3GRXA 1ZL9A 4MZBA 4F03A 5AISA 4BVYA 1U88A 3CSHA 2E0QA 4ZB8A 4LL1B 2K6VA 1TU8A 1YKAA 4O7HA 5FHIA 4EKZA 4G0LA 1SJZA 2OE1A 2X4AA 1GTBA 1YF0A 2KOKA 3P90A 1B9XC 1M2AA 4OCEA 1PRXA 4O32A 3IPZA 2OBIA 1GTAA 2O5VA 4V2LA 1TDIA 2FNOA 1S3CA 5G1LA 3ZL5A 1Y1UA 3KP8A 3IRAA 1K3LA 1MD4A 2JZSA 2DJ1A 3RPNA 2VCXA 5HFKA 4E8EA 2VIMA 2VL9A 2FCHA 4K6XA 1UC7A 2H71A 2LKUA 5ELGA 5B8BA 3BBYA 2OBKA 1F2EA 5IMFA 1WWJA 4PGTA 4ULXA 2DBCA 3GSTA 2R3XA 4OCFA 5HFGA 1GRXA 1QQ2A 2PPTA 3S9FA 5LCZA 2E2MA 1JZWA 3UBLA 2PBJA 1XBSA 3C1RA 2PGTA 5JWOB 1TW9A 4XS6A 2VM2A 4I2TA 4F82A 1T3BA 2FD3A 4XIHA 2I1UA 1H4OA 2HSMA 1U87A 1YQ1A 5H5QA 3EU4A 1XOAA 5G1KA 5A5KA 4OFNA 4N10A 1GTIA 4NHWA 2H1DA 1B4QA 4ZBBA 3KIJA 4TKYA 2L59A 4MJEA 1QUWA 4ID0A 3GURA 3W8SA 3LJRA 2C1YA 4ZL7A 2E7PA 2WFCA 3F8UA 2IMFA 1IYHA 3VPQA 1NSWA 5CREA 2DJ0A 2DKIA 3FY7A 4D73A 1GSUA 3KXOA 2K18A 5CP1A 3RFRC 3F0IA 1O7UA 1U6TA 2NVLA 3M9KA 5IIZA 1I5GA 5G2ZA 4ZIJA 5F07A 1V40A 4J2FA 4IQ1A 2X8GA 4GF0A 2H0HA 1DBYA 3ISOA 5A5HA 2LJRA 4BVXA 6GSVA 3DXBA 2YNXA 2FHEA 5IMVA 2GQKA 1FOHA 1CQHA 4NMUA 9GSSA 3C71A 4MLYA 4EIPA 1YEPA 4WF4A 3CYNA 3APSA 3GUSA 1S3DA 4WR5A 3JCML 1M2DA 3BCKA 4NPBA 1OC8A 2F9SA 2WW3A 4K0NA 1O85A 3HA9A 5IO2A 3VWXA 4TR1B 5ECPB 3CXGA 1FVKA 2B7KA 4IS0A 1M3JA 3QPMA 1PN0A 5CRHA 1ZYEA 4EL1A 4GTUA 4POBA 2QKEA 2H19A 2DKHA 1A24A 1Y6EA 2YZUA 3W8JA 5B7CA 1OC9B 5EY6A 3D0ZA 1X0RA 1ZOFA 3GNJA 1UA5A 3IK7A 3TKSC 2HSNB 2C0EA 1GSEA 4HZ2A 3L0HA 1SJIA 1B4PA 3GKKA 4DSRA 1RQMA 2HI7A 4HZ4A 3Q19A 4AKHA 2BMXA 4WBRD 2NDOA 5GZZB 3LXZA 4GSTA 3GA4A 4HU9A 1SU9A 2BJXA 1DUGA 3VI7A 2K8VA 2V2GA 1SL1B 3ZLPA 4N0ZA 5J3RA 3FR3A 1K0BA 2VD0A 5BMUA 3CBUA 2HRKB 2LRNA 5J5NA 1URMA 4TR0A 3NIVA 2C4JA 4KA0A 2JADA 2L6CA 4AF2A 4K2DA 1T7PB 1G7EA 3A3TA 4MA9A 1W89A 20GSA 2YOIA 2MMZA 3G9BA 5CRGA 1ZCPA 1SL0B 2ON5A 2DIZA 4KUNA 3ZREA 5HFIA 10GSA 2G2QA 6GSYA 5D9TA 2AB6A 1V9WA 4F9ZA 1M9AA 4L0WA 4ECIA 4XS4A 5IMZA 1SVOA 1AQVA 2LTKA 1J0FA 3CRUA 2HRFA 4GQCA 3KEBA 3N9JA 4Q5FA 2A2SA 2CV4A 1WMJA 3ZYWA 1FAAA 2VM1A 1YZXA 1GSDA 3HDCA 2V1MA
chains in the Genus database with same CATH topology
3WT1A 3TKSA 2FWEA 3EPTA 1SJ6A 2LJKA 4GSSA 3TRXA 2BTOT 1XWGA 3CSJA 4IP6A 1JZRA 3ZFLA 1ACVA 3PR8A 3VK9A 3UL3A 1QK8A 1PMTA 22GSA 3QAGA 2DLXA 3GN3A 1B48A 1PD21 3HJPA 3RAZA 2YWNA 1KEBA 5ENUA 5J4YA 2O8VB 3EE2A 5IO0A 1O73A 4OMVA 2AYTA 1B8XA 4OO4A 4L5LA 4CHSA 3EU3A 1V98A 4FQUA 2B6MA 4PURA 3EMPA 1X9MB 1LBKA 2F8FA 1H75A 2H0IA 6GSUA 4IBPA 1Z6NA 5CAXA 4EE0A 1B9YC 4ZL8A 3UVTA 4TN8A 3H8QA 2GLRA 2R6KA 5ECSA 2B1LA 4K1FA 1OVNA 1Z3EA 4BA7A 7GSSA 4AJ7A 4DSSB 3HVVA 2XPEA 2WJUA 3O76A 4IJ3A 4Z7XA 3TJFA 4YAPA 5KN0A 3L9UA 2FUG2 1EOGA 3TJGA 1TRSA 5J40A 2F51A 3IV4A 4KSMA 19GSA 4J56E 5GAND 3GMFA 2YP6A 2EFCA 4BWQA 5CRWA 4K7IA 3LEFA 4EVMA 5COHA 5ECMB 4HUAA 12GSA 1XFLA 2AUVA 4MJCA 5AIXA 1A2MA 2CAQA 3HKRA 1NM3A 4WR4A 2P5RA 1SD8A 4FYBA 1IYIA 2C0GA 5DJLA 3I69A 1QFNA 3DKSA 11GSA 4I8BA 1PN9A 3OR5A 3VWWA 1KBNA 4E68A 2HNLA 1TRVA 3KJYA 2PMTA 2YCDA 4KDUA 4EF0A 4ZXGA 1EGRA 2VL2C 2R4VA 2IMEA 3P2AA 4PUFC 2GDRA 5AGYA 1OAZA 2HT9A 3IHGA 3Q6OA 4K7OA 3PPUA 4Z2UA 1JZOA 5IOWA 4G0IA 3HYPA 4LLRA 3GHAA 1GUMA 3HVSA 3QFAC 1R7HA 4O5RA 3TJBA 1SD9A 2OT3A 1QMVA 2YWMA 1XWAA 1MDIA 3EWLA 1SVMA 3GFKA 2DJJA 2M80A 5IQYA 1QGVA 4ZILA 1Z6MA 1Q98A 3C7MA 1R5PA 4NV5A 1GSSA 1AUCA 2PVQA 2FWHA 1C72A 4OFMA 2UZ8A 3KD0A 3KTBA 4KW6A 14GSA 3MIXA 3M0FA 4HDEA 3ZVJD 2MZCA 3FEUA 4ACSA 1PKWA 4RQXA 1XCCA 4DVCA 3FHKA 2HSNA 1BYEA 1GUKA 2F8AA 2YV9A 5HR1A 2K8SA 1MDJA 4JR6A 2XPDA 3TKRA 4CDOA 2HYXA 1GLQA 1LU4A 3UMAA 2ALBA 5LNKe 17GSA 3DVXA 2YPMA 5JWQB 2L6DA 2C3TA 1ERUA 2NBSA 4EXJA 1GLPA 1PA3A 5J4VA 3VFIA 3CTGA 2HRKA 3IC4A 1BX9A 3ED3A 3EC3A 4E8HA 4WF5A 1ZZYA 3UJ1A 5D8IA 1GP1A 3KZQA 2PUKC 3HY2A 5KN3A 3HJOA 2IN3A 4NV2A 3FR6A 2HZEA 1XWKA 2I9HA 4QQ7A 4A5PA 2ON7A 5C04A 2H8LA 2R0GA 4CY8A 3H4KA 1M0UA 2L5OA 5ID2A 4IW9A 2AHEA 1Z7PA 1TKDB 4FYCA 3DIEA 1SVLA 5A4WA 4IHUA 3J7Yb 4HQSA 1AW9A 4ECJA 1AIUA 2IL3A 1WP0A 4MK3A 4PQHA 3CWGA 1GSFA 4RI7A 5AIVA 2DJ2A 5B6MA 3IE3A 1WIKA 1QXHA 1O81A 1GH2A 4YKGA 1N2AA 3CRTA 1SKSB 2EIOA 2GSSA 1ML6A 2QGVA 2KLXA 4G01A 2JSYA 3UIWA 1OC3A 1V57A 1A2LA 2IMDA 2MBTA 1RK4A 3ERGA 4MPGA 4W66A 3H1NA 3TRQA 3GL5A 5DAKB 1S3AA 2CA8A 2YANA 3ZIJA 2ZUPA 2B5EA 1UVZA 1EV4A 5G5FA 4QL7A 5G30A 4WEYA 2QSIA 1ST9A 3E9JB 3IAS2 4HOJA 4OFTA 1XOBA 3VI5A 1ILOA 2A2PA 3HJMA 3HHVA 4TR3A 4V2MA 3IBHA 2EIQA 4FYUA 4NHZA 4RQRA 4ZB7A 4IGJA 2PERA 2FA4A 4EDYA 1SK0A 1F3AA 4KF9A 4PNFA 4I6XA 1FHEA 1ERWA 1TP9A 5EPFA 1ABAA 1E2YA 2O89A 2HE3A 4ILFA 3GH9A 2HLSA 3L78A 4DSSA 5INYA 2P5QA 1WE0A 2GZZA 5D96A 4JEDA 3IOSA 3LGCA 2GS3A 1ZMAA 4MNNA 1A0FA 3WGDA 3TGZA 1YDKA 5DALB 3Q74A 4O92A 2LJAA 4LMVA 4PX1A 4MH3A 1FB6A 4PXOA 3DRNA 4MCUA 2CAIA 2VKZG 5A34B 4ML6A 3VPTA 1I9DA 2GT6A 4K5SA 5J41A 5H5SA 1TXXA 2RM5A 4ISDA 4ZL9A 3M9JA 4POLA 4ML1A 5IMAA 1GNEA 2VLVA 2VLTA 2EFHA 2NPBA 4XTSA 5D9VA 2RUFA 3EINA 4XHMA 1G6YA 1RW1A 1TRUA 2C8UA 3MYDA 2D2ZA 1TU7A 4FO5A 1JFUA 1MEKA 4JRRA 1NHYA 4TXVA 2HSYA 2QA2A 4O5QA 3E0UA 1J9BA 3O6TA 1Z7RA 4G19A 2CX3A 1AQWA 4G2EA 1G0TA 2OADA 4Z2TA 2VCQA 2CVDA 3ERFA 3M3MA 5F0GA 3QD9A 2REMA 3UAPA 2A4VA 2GSRA 4USSA 4GWRA 3C8EA 4XS1A 3GKMA 1WPIA 2M72A 1KTEA 1T4ZA 5HQPA 4GSNA 1R4WA 2VCVA 3TJJA 1PL2A 3KTLA 2FA8A 2O85A 2OJLA 2VD1A 6GSTA 3GTUA 2YJHA 4JR4A 1UN2A 1YEXA 3FW2A 3TRPA 4J57E 3WYWA 4GDFA 3MSZA 1F9MA 2VUPA 4QL9A 4I2UA 3F63A 2LS5A 3D5JA 3ZZXA 2HXKA 3ZRDA 3ZFBA 2FGXA 2RIIA 4PQIA 4GLTA 2LRCA 2L5LA 3IHQA 3F6FA 3F4SA 4XCSA 1W4VA 2IFQA 2YWIA 2AV4A 1M99A 4WBJA 3UARA 3F4TA 4V1Ag 4EO3A 2GT5A 2DIYA 1TXUA 3ME7A 5JCGA 5FWGA 3EMXA 2DJKA 1SKWB 4WXTA 1EV9A 1M7TA 4PTSA 2HSHA 2IJYA 4LMWA 3TKPA 4PQ1A 1SYRA 3FZ4A 4CW9A 5ECLB 3VWVA 2TRXA 5CNWA 3SBCA 2H72A 2H1BA 2DSAA 3IDVA 5J4UA 16GSA 1GULA 3UBKA 2C80A 2YWOA 3L9SA 1XVQA 3LSZA 3PINA 3R2QA 2DJ3A 3O3TA 2ZNMA 4POMA 3UVHA 1DE2A 3M1GA 5KEJA 5CRDA 2DMMA 4IQAA 5A5HB 3A5WA 5DCHA 4BVXB 3D4MA 3KH9A 5A1NB 1VF3A 2LNTA 5DVBA 5IPGA 1A0RP 2HRNA 3U5RE 2TIRA 1BAYA 1DE1A 1XWCA 2V32A 1N25A 2LSTA 2LQQA 2G0FA 1BEDA 3IXRA 1X9SB 3CMIA 3DYRA 3F9UA 2WDUA 2E2GA 2VCTA 3EURA 3U6VA 5B8AA 5EL8A 3KH7A 3RDWA 4FH8A 1OKDA 2H76A 1BG1A 1K3OA 1MD3A 1OE7A 4POKA 1WOUA 4XRDA 1ZYNA 4AJ6A 4MMMA 5DBQA 1O8WA 1T8EB 3UEMA 1ON4A 4AJ8A 2OACA 2KP1A 2MMNA 2N5AA 1XW5A 2VCZA 1JLWA 1THOA 1VF1A 3MWHA 3I43A 3LFLA 1BJXA 3ZMLA 3HCZA 1PSQA 5DAKA 2L4QA 3GX8A 3NZNA 5GAPD 1FB0A 4ECCA 3NOFA 2H0GA 2HZFA 3LQ7A 3LORA 4ICYA 2H30A 3AY8A 3BCIA 3ERWA 2RUEA 5ECRB 4HS1A 4CY6A 4MPFA 3TOTA 2N5BA 3TU3B 5ABRA 1X5CA 3HMJG 3BOAA 2DC5A 4YH2A 1AC1A 2QC7A 4F2IA 3FR9A 1TJDA 4BL7B 2CT6A 4MABA 3ZITA 1PX6A 4TR1A 4V2NA 1Y25A 5D9WA 1R5AA 3RPPA 1SENA 1TI1A 3L4NA 5H5RA 3ZTLA 4TW5A 1N8JA 2CVKA 3MAKA 5JCWA 3EYTA 4ZB6A 4TRXA 4X4JA 3APOA 5D93A 1Z9HA 4EC0A 3LXTA 6GSWA 1YVLA 2IWTA 1T00A 4O5UA 1OKTA 3EVIA 4K9ZA 1OC9A 2B5YA 3DWVA 1SKRB 4MJAA 4OWYA 1KNGA 1XZOA 5DJMA 5A34A 4KDXA 3RBTA 2H01A 2MMOA 3DGQA 4XRAA 4YQUA 2OKAA 1YY7A 4MP4A 2LNSA 3QCPA 2H70A 2YJ7A 2WB9A 1NHOA 1AAZA 3TKSE 4AGSA 4GRFA 1SL2B 3QOUA 2VL2A 3G7YA 4DSQA 2P31A 2JL4A 4TOPA 4RUVA 3KM6A 2CX4A 1YF1A 4YAVA 3QFBC 4GQFA 4K7NA 2FWFA 4MJBA 1GWCA 3UOMA 2C0FA 4HEA2 2O7KA 3H93A 3GIXA 4ZBDA 2KP2A 2VCWA 4K2XA 3QAWA 2CQ9A 2YZHA 1FVJA 2HRAA 3HZ4A 1J08A 4KCEA 2V41A 1EP8A 5G5EA 2FY6A 3HXSA 4F0BA 4N11A 2I4AA 5F06A 2IMKA 4EUYA 2H6XA 4Q5QA 3PGTA 2GSQA 4TR4A 3GKXA 3C73A 2HQTA 2PU9C 2XBQA 3LYKA 4JE1A 1U3IA 3N5OA 2UV8G 3ZVJA 1XWBA 2RLIA 3GX0A 4I5QA 4L8EA 4TVEA 1AQXA 4N3ZA 2X8CA 1OE8A 2H66A 1XW9A 5ELAA 2LEGA 4MZCA 3KP9A 2XBIA 2J23A 1OYJA 1WJKA 1TRWA 1PX7A 1V58A 3SWLA 1VRSD 3FMWA 1O6JA 4Z2RA 3FZAA 1JLVA 1WRYA 1K0DA 3QDNA 3FRCA 4N30A 1CQGA 3R3EA 4ZBAA 2O87A 3WGEA 3J7Yk 2VO4A 4L5OA 3IK9A 2JU5A 1K0NA 4KX4A 4KH7A 3DEXA 4MDCA 2J9HA 4G0KA 3A2XA 4YQVA 1LJRA 4WKWA 2WCIA 3GYKA 4OO5A 5BRTA 5G31A 1A8YA 3FKFA 2IMIA 4IVFA 2LRTA 3LWAA 3RHBA 1ZGNA 2WS2A 4AKIA 1TI3A 3K8NA 5B6NA 5DCGA 3KCMA 3LYPA 3CSIA 3P7XA 4IKHA 4G10A 1Z5YE 2A4HA 3TJKA 3GV1A 5D73A 4L0UA 1X5EA 4IJIA 2XHFA 5A1NA 2B5XA 3M8NA 1SK1A 2GZPA 2AAWA 1E6BA 2R0CA 2IPAA 4JU5A 3IA1A 1XIYA 3D21A 3BD2A 5JWRB 1TK5B 5HR2A 2GQLA 2PN8A 1FOVA 2OE3A 1A8LA 3IC8A 1X9WB 2CZ3A 1A23A 3WD6A 2FWGA 3LW9A 1M2BA 4TXOB 1AXDA 3BJ5A 2EFDA 2YN1A 1XVWA 3TCOA 5E59A 1EGOA 3HZ8A 2H1GA 4X43A 2NTOA 3QMXA 1K0OA 4KE3A 1TK0B 5HR0A 1Q4JA 5IPHA 2EFEA 2FLSA 2X8HA 2X99A 3TB2A 2F3MA 3MDKA 1EOHA 4BVYB 4Q5RA 3H79A 1HNBA 5ECOB 5AN1A 1TK8B 1PKZA 4NWYA 3CTFA 2PVOC 2ES7A 4K0GA 4HI7A 2EC4A 3TDGA 4KB3A 3F3QA 2DMLA 4K8MA 1R26A 5J9CA 2VOCA 4HJMA 2B3SA 1ERTA 1GSYA 2GTUA 1F3BA 5IMDA 3GKNA 3GH6A 1T4YA 3GSSA 1SK2A 4H86A 4Q5NA 1EP7A 1VF2A 1M9BA 1XXUA 3D6IA 2X64A 1PQNA 8GSSA 4BL7A 1K0AA 4QMKA 2I3YA 4I97A 1JZDA 5A4UA 2B1KA 4KCAA 4DEJA 1YKCA 1GSQA 1GTUA 1MTCA 1HYUA 4MF6A 3IR4A 5IM9A 4MF5A 5C00A 5IOXA 2TRCP 3A2WA 1USBA 2HZEB 3FZ9A 4RI6A 1ZYPA 1HNCA 4V1Ap 4LA1A 5A4VA 4JBBA 2A2RA 2LQOA 1EWXA 1XW6A 4IELA 3VWUA 5ID2B 3KGKA 5DQYA 4IN0A 5F8BA 2HSMB 5ECHB 4ECBA 2CZ2A 2I81A 1FO5A 5DDLA 1T1VA 5KOXA 4PNGA 2Z9SA 1TOFA 4FIWA 1VGLA 1EEMA 5J9BA 6GSXA 3KMNA 4MZWA 4KGIA 5JCUA 3ME8A 2JACA 2K9FA 3TUEA 3P8WA 2H1AA 2JZRA 4HJ2A 5ECNB 18GSA 2C3NA 3PH9A 4D73B 4GCIA 1ZYQB 1DSBA 4ZB9A 4AI6A 4NAXA 4K5RA 4BPYA 4MF7A 4KNDA 5ECQB 3ZMKA 5FT3A 1FW1A 5CYYA 1K3YA 2LV3A 5GSTA 3FYGA 2MBSA 2H74A 3VLNA 3DMLA 5KOWA 3US3A 2OE0A 13GSA 2ZCTA 1EEJA 1K0MA 1JHBA 2H1LA 4EDZA 4YQMA 3FK8A 3DD3A 2L4CA 2GGTA 5IMCA 4G9HA 5E4WA 1X5DA 4EIQA 2JSZA 1EZKA 3D4TA 2LUSA 1XPVA 2C3QA 4AKGA 1BG5A 5LD0A 2V6KA 1O8XA 2H73A 4IP1A 2N5FA 2VLUA 3DVWA 2YV7A 4F0CA 3HD5A 2EIRA 3LG6A 3A2VA 1G7OA 3IAM2 1A2JA 3V1WA 2MYGA 3L9VA 5HR3A 2MMAA 3ZIVA 2P0GA 2R0PA 1VF4A 5DQSA 4N0VA 2GZYA 2GSTA 2M46A 3WT2A 1FG4A 3G7IA 3QR6A 5EVOA 5F05A 5KN2A 3TKQA 1TTZA 1GUHA 2HFDA 2V6OA 4KSOA 1PGTA 5ECIB 2H75A 1GNWA 2WGRA 2B7JA 2VL3A 2WULA 2GQMA 3G7JA 3C1SA 3WGXA 3APQA 3MNGA 4YKFA 3W6GA 1G6WA 3GL3A 3F3RA 2OA7A 2C0DA 1GL8A 1YJ6A 2XC2A 4HQZA 3D22A 2PWJA 1PL1A 1MDKA 4P3YB 3I9V2 2RM6A 2GVPA 1F37A 5BMUB 4JZQA 4BWSA 3QAVA 4LL4B 6GSSA 3E3EA 2R2JA 1BF5A 1SYXA 1V2AA 1U3AA 4MH2A 1HQOA 2L57A 3A5IA 2KHPA 2KUCA 1THXA 5L71A 4AKXB 4PUAA 1K0CA 2QA1A 2AJQB 4GXZA 4WETA 4NXIA 2VAFA 3Q18A 4X1UA 3I6AA 2X49A 2IIYA 2CVBA 3RHCA 4X0XA 3VURA 4KAEA 5J47A 2H6YA 4XS4B 1F6MC 2R5GA 2WRTA 5DALA 1BQ7A 3GTUB 1ERVA 4HU7A 4TXOA 4KDYA 5GSSA 5D9XA 4OD7A 2H6ZA 3F6DA 1NW2A 3FZ5A 1HNAA 3KMOA 5CO3A 3F4RA 5KN1A 2WZ9A 5ECKB 1HD2A 3TOUA 3HVXA 2IFQB 2JZTA 2R37A 3GRXA 1ZL9A 4MZBA 4F03A 5AISA 4BVYA 1U88A 3CSHA 2E0QA 4ZB8A 4LL1B 2K6VA 1TU8A 1YKAA 4O7HA 5FHIA 4EKZA 4G0LA 1SJZA 2OE1A 2X4AA 1GTBA 1YF0A 2KOKA 3P90A 1B9XC 1M2AA 4OCEA 1PRXA 4O32A 3IPZA 2OBIA 1GTAA 2O5VA 4V2LA 1TDIA 2FNOA 1S3CA 5G1LA 3ZL5A 1Y1UA 3KP8A 3IRAA 1K3LA 1MD4A 2JZSA 2DJ1A 3RPNA 2VCXA 5HFKA 4E8EA 2VIMA 2VL9A 2FCHA 4K6XA 1UC7A 2H71A 2LKUA 5ELGA 5B8BA 3BBYA 2OBKA 1F2EA 5IMFA 1WWJA 4PGTA 4ULXA 2DBCA 3GSTA 2R3XA 4OCFA 5HFGA 1GRXA 1QQ2A 2PPTA 3S9FA 5LCZA 2E2MA 1JZWA 3UBLA 2PBJA 1XBSA 3C1RA 2PGTA 5JWOB 1TW9A 4XS6A 2VM2A 4I2TA 4F82A 1T3BA 2FD3A 4XIHA 2I1UA 1H4OA 2HSMA 1U87A 1YQ1A 5H5QA 3EU4A 1XOAA 5G1KA 5A5KA 4OFNA 4N10A 1GTIA 4NHWA 2H1DA 1B4QA 4ZBBA 3KIJA 4TKYA 2L59A 4MJEA 1QUWA 4ID0A 3GURA 3W8SA 3LJRA 2C1YA 4ZL7A 2E7PA 2WFCA 3F8UA 2IMFA 1IYHA 3VPQA 1NSWA 5CREA 2DJ0A 2DKIA 3FY7A 4D73A 1GSUA 3KXOA 2K18A 5CP1A 3F0IA 1O7UA 1U6TA 2NVLA 3M9KA 5IIZA 1I5GA 5G2ZA 4ZIJA 5F07A 1V40A 4J2FA 4IQ1A 2X8GA 4GF0A 2H0HA 1DBYA 3ISOA 5A5HA 2LJRA 4BVXA 6GSVA 3DXBA 2YNXA 2FHEA 5IMVA 2GQKA 1FOHA 1CQHA 4NMUA 9GSSA 3C71A 4MLYA 4EIPA 1YEPA 4WF4A 3CYNA 3APSA 3GUSA 1S3DA 4WR5A 3JCML 1M2DA 3BCKA 4NPBA 1OC8A 2F9SA 4K0NA 1O85A 3HA9A 5IO2A 3VWXA 4TR1B 5ECPB 3CXGA 1FVKA 2B7KA 4IS0A 3QPMA 1PN0A 5CRHA 1ZYEA 4EL1A 4GTUA 4POBA 2QKEA 2H19A 2DKHA 1A24A 1Y6EA 2YZUA 3W8JA 5B7CA 1OC9B 5EY6A 3D0ZA 1X0RA 1ZOFA 3GNJA 1UA5A 3IK7A 3TKSC 2HSNB 2C0EA 1GSEA 4HZ2A 3L0HA 1SJIA 1B4PA 3GKKA 4DSRA 1RQMA 2HI7A 4HZ4A 3Q19A 4AKHA 2BMXA 4WBRD 2NDOA 5GZZB 3LXZA 4GSTA 3GA4A 4HU9A 1SU9A 2BJXA 1DUGA 3VI7A 2K8VA 2V2GA 1SL1B 3ZLPA 4N0ZA 5J3RA 3FR3A 1K0BA 2VD0A 5BMUA 3CBUA 2HRKB 2LRNA 5J5NA 1URMA 4TR0A 3NIVA 2C4JA 4KA0A 2JADA 2L6CA 4AF2A 4K2DA 1T7PB 1G7EA 3A3TA 4MA9A 1W89A 20GSA 2YOIA 2MMZA 3G9BA 5CRGA 1ZCPA 1SL0B 2ON5A 2DIZA 4KUNA 3ZREA 5HFIA 10GSA 2G2QA 6GSYA 5D9TA 2AB6A 1V9WA 4F9ZA 1M9AA 4L0WA 4ECIA 4XS4A 5IMZA 1SVOA 1AQVA 2LTKA 1J0FA 3CRUA 2HRFA 4GQCA 3KEBA 3N9JA 4Q5FA 2A2SA 2CV4A 1WMJA 3ZYWA 1FAAA 2VM1A 1YZXA 1GSDA 3HDCA 2V1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WT1 A;  3TKS A;  2FWE A;  1SJ6 A;  2LJK A;  4GSS A;  3TRX A;  2BTO T;  1XWG A;  3CSJ A;  4IP6 A;  1JZR A;  3ZFL A;  1ACV A;  3PR8 A;  3VK9 A;  3UL3 A;  1QK8 A;  1PMT A;  22GS A;  3QAG A;  2DLX A;  3GN3 A;  1B48 A;  1PD2 1;  3HJP A;  3RAZ A;  2YWN A;  1KEB A;  5ENU A;  2O8V B;  3EE2 A;  5IO0 A;  1O73 A;  4OMV A;  2AYT A;  1B8X A;  4OO4 A;  4L5L A;  4CHS A;  3EU3 A;  1V98 A;  4FQU A;  2B6M A;  4PUR A;  3EMP A;  1X9M B;  1LBK A;  2F8F A;  1H75 A;  2H0I A;  6GSU A;  4IBP A;  1Z6N A;  5CAX A;  4EE0 A;  1B9Y C;  4ZL8 A;  3UVT A;  4TN8 A;  3H8Q A;  2GLR A;  2R6K A;  5ECS A;  2B1L A;  4K1F A;  1OVN A;  1Z3E A;  4BA7 A;  7GSS A;  4AJ7 A;  4DSS B;  3HVV A;  2XPE A;  2WJU A;  3O76 A;  4IJ3 A;  4Z7X A;  3TJF A;  4YAP A;  5KN0 A;  3L9U A;  2FUG 2;  1EOG A;  3TJG A;  1TRS A;  2F51 A;  3IV4 A;  4KSM A;  19GS A;  4J56 E;  5GAN D;  3GMF A;  2YP6 A;  4BWQ A;  5CRW A;  4K7I A;  3LEF A;  4EVM A;  5COH A;  5ECM B;  4HUA A;  12GS A;  1XFL A;  2AUV A;  4MJC A;  5AIX A;  1A2M A;  2CAQ A;  3HKR A;  1NM3 A;  4WR4 A;  2P5R A;  1SD8 A;  4FYB A;  1IYI A;  2C0G A;  5DJL A;  3I69 A;  1QFN A;  3DKS A;  11GS A;  4I8B A;  1PN9 A;  3OR5 A;  3VWW A;  1KBN A;  2HNL A;  1TRV A;  3KJY A;  2PMT A;  2YCD A;  4KDU A;  4EF0 A;  4ZXG A;  1EGR A;  2VL2 C;  2R4V A;  2IME A;  3P2A A;  4PUF C;  2GDR A;  5AGY A;  1OAZ A;  2HT9 A;  4K7O A;  3Q6O A;  3PPU A;  1JZO A;  5IOW A;  4G0I A;  3HYP A;  4LLR A;  3GHA A;  1GUM A;  3HVS A;  3QFA C;  1R7H A;  4O5R A;  3TJB A;  1SD9 A;  1QMV A;  2YWM A;  1XWA A;  1MDI A;  3EWL A;  3GFK A;  2DJJ A;  2M80 A;  5IQY A;  1QGV A;  4ZIL A;  1Z6M A;  1Q98 A;  3C7M A;  1R5P A;  4NV5 A;  1GSS A;  1AUC A;  2PVQ A;  2FWH A;  1C72 A;  4OFM A;  2UZ8 A;  3KD0 A;  3KTB A;  4KW6 A;  14GS A;  3M0F A;  4HDE A;  3ZVJ D;  2MZC A;  3FEU A;  4ACS A;  1PKW A;  4RQX A;  1XCC A;  4DVC A;  3FHK A;  1BYE A;  1GUK A;  2F8A A;  2YV9 A;  5HR1 A;  2K8S A;  1MDJ A;  4JR6 A;  2XPD A;  3TKR A;  4CDO A;  2HYX A;  1GLQ A;  1LU4 A;  3UMA A;  2ALB A;  5LNK e;  17GS A;  3DVX A;  2YPM A;  5JWQ B;  2L6D A;  2C3T A;  1ERU A;  2NBS A;  4EXJ A;  1GLP A;  1PA3 A;  3VFI A;  3CTG A;  2HRK A;  3IC4 A;  1BX9 A;  3ED3 A;  3EC3 A;  4E8H A;  4WF5 A;  1ZZY A;  3UJ1 A;  5D8I A;  1GP1 A;  3KZQ A;  2PUK C;  3HY2 A;  5KN3 A;  3HJO A;  2IN3 A;  4NV2 A;  3FR6 A;  2HZE A;  1XWK A;  2I9H A;  4QQ7 A;  2ON7 A;  5C04 A;  2H8L A;  3H4K A;  1M0U A;  2L5O A;  5ID2 A;  4IW9 A;  2AHE A;  1Z7P A;  1TKD B;  4FYC A;  3DIE A;  5A4W A;  4IHU A;  3J7Y b;  4HQS A;  1AW9 A;  4ECJ A;  1AIU A;  2IL3 A;  1WP0 A;  4MK3 A;  4PQH A;  4RI7 A;  1GSF A;  5AIV A;  2DJ2 A;  5B6M A;  3IE3 A;  1WIK A;  1QXH A;  1O81 A;  1GH2 A;  1N2A A;  3CRT A;  1SKS B;  2EIO A;  2GSS A;  1ML6 A;  2QGV A;  2KLX A;  2JSY A;  3UIW A;  1OC3 A;  1V57 A;  1A2L A;  2IMD A;  2MBT A;  1RK4 A;  3ERG A;  4MPG A;  3H1N A;  3TRQ A;  3GL5 A;  5DAK B;  1S3A A;  2CA8 A;  2YAN A;  3ZIJ A;  2ZUP A;  2B5E A;  1UVZ A;  1EV4 A;  5G5F A;  4QL7 A;  5G30 A;  4WEY A;  2QSI A;  1ST9 A;  3E9J B;  3IAS 2;  4HOJ A;  4OFT A;  1XOB A;  3VI5 A;  1ILO A;  3HJM A;  3HHV A;  4TR3 A;  4V2M A;  3IBH A;  2EIQ A;  4FYU A;  4NHZ A;  4RQR A;  4IGJ A;  2PER A;  2FA4 A;  4EDY A;  1SK0 A;  1F3A A;  4KF9 A;  4PNF A;  4I6X A;  1FHE A;  1ERW A;  1TP9 A;  5EPF A;  1ABA A;  1E2Y A;  2O89 A;  2HE3 A;  4ILF A;  3GH9 A;  2HLS A;  3L78 A;  4DSS A;  5INY A;  2P5Q A;  1WE0 A;  2GZZ A;  5D96 A;  4JED A;  3IOS A;  3LGC A;  2GS3 A;  1ZMA A;  1A0F A;  3WGD A;  3TGZ A;  1YDK A;  5DAL B;  3Q74 A;  4O92 A;  2LJA A;  4LMV A;  4PX1 A;  4MH3 A;  1FB6 A;  4PXO A;  3DRN A;  4MCU A;  2CAI A;  4ML6 A;  3VPT A;  1I9D A;  2GT6 A;  5J41 A;  5H5S A;  1TXX A;  2RM5 A;  4ISD A;  4ZL9 A;  3M9J A;  4POL A;  4ML1 A;  5IMA A;  1GNE A;  2VLV A;  2VLT A;  2NPB A;  4XTS A;  5D9V A;  2RUF A;  3EIN A;  4XHM A;  1G6Y A;  1RW1 A;  1TRU A;  2C8U A;  2D2Z A;  1TU7 A;  4FO5 A;  1JFU A;  1MEK A;  4JRR A;  1NHY A;  4TXV A;  2HSY A;  3E0U A;  1J9B A;  3O6T A;  1Z7R A;  4G19 A;  2CX3 A;  1AQW A;  4G2E A;  1G0T A;  2OAD A;  2VCQ A;  2CVD A;  3ERF A;  3M3M A;  5F0G A;  3QD9 A;  2REM A;  3UAP A;  2A4V A;  2GSR A;  4USS A;  4GWR A;  3C8E A;  4XS1 A;  3GKM A;  1WPI A;  2M72 A;  1KTE A;  1T4Z A;  5HQP A;  4GSN A;  1R4W A;  2VCV A;  3TJJ A;  1PL2 A;  3KTL A;  2FA8 A;  2O85 A;  2OJL A;  2VD1 A;  6GST A;  3GTU A;  2YJH A;  4JR4 A;  1UN2 A;  1YEX A;  3FW2 A;  3TRP A;  4J57 E;  3WYW A;  3MSZ A;  1F9M A;  2VUP A;  4QL9 A;  4I2U A;  3F63 A;  2LS5 A;  3D5J A;  3ZZX A;  2HXK A;  3ZRD A;  3ZFB A;  2FGX A;  2RII A;  4PQI A;  4GLT A;  2LRC A;  2L5L A;  3IHQ A;  3F6F A;  3F4S A;  4XCS A;  1W4V A;  2IFQ A;  2YWI A;  2AV4 A;  1M99 A;  4WBJ A;  3UAR A;  3F4T A;  4V1A g;  4EO3 A;  2GT5 A;  2DIY A;  5JCG A;  3ME7 A;  5FWG A;  3EMX A;  2DJK A;  1SKW B;  4WXT A;  1EV9 A;  1M7T A;  4PTS A;  2HSH A;  2IJY A;  4LMW A;  3TKP A;  4PQ1 A;  1SYR A;  3FZ4 A;  4CW9 A;  5ECL B;  3VWV A;  2TRX A;  5CNW A;  3SBC A;  2H72 A;  2H1B A;  2DSA A;  3IDV A;  5J4U A;  16GS A;  1GUL A;  3UBK A;  2C80 A;  2YWO A;  3L9S A;  1XVQ A;  3LSZ A;  3PIN A;  3R2Q A;  2DJ3 A;  3O3T A;  2ZNM A;  4POM A;  3UVH A;  1DE2 A;  3M1G A;  5KEJ A;  5CRD A;  2DMM A;  4IQA A;  3A5W A;  5DCH A;  4BVX B;  3D4M A;  3KH9 A;  1VF3 A;  2LNT A;  5DVB A;  5IPG A;  1A0R P;  2HRN A;  3U5R E;  2TIR A;  1BAY A;  1DE1 A;  1XWC A;  2V32 A;  2LST A;  2LQQ A;  2G0F A;  1BED A;  3IXR A;  1X9S B;  3CMI A;  3DYR A;  3F9U A;  2WDU A;  2E2G A;  2VCT A;  3EUR A;  3U6V A;  5B8A A;  5EL8 A;  3KH7 A;  3RDW A;  4FH8 A;  1OKD A;  2H76 A;  1K3O A;  1MD3 A;  1OE7 A;  4POK A;  1WOU A;  4XRD A;  4AJ6 A;  4MMM A;  5DBQ A;  1O8W A;  1T8E B;  3UEM A;  1ON4 A;  4AJ8 A;  2OAC A;  2KP1 A;  2MMN A;  2N5A A;  1XW5 A;  2VCZ A;  1JLW A;  1THO A;  1VF1 A;  3MWH A;  3I43 A;  3LFL A;  1BJX A;  3ZML A;  3HCZ A;  1PSQ A;  5DAK A;  2L4Q A;  3GX8 A;  3NZN A;  5GAP D;  1FB0 A;  4ECC A;  3NOF A;  2H0G A;  2HZF A;  3LQ7 A;  3LOR A;  2H30 A;  3AY8 A;  3BCI A;  3ERW A;  2RUE A;  5ECR B;  4HS1 A;  4MPF A;  3TOT A;  2N5B A;  5ABR A;  1X5C A;  3BOA A;  2DC5 A;  4YH2 A;  1AC1 A;  2QC7 A;  4F2I A;  3FR9 A;  1TJD A;  4BL7 B;  2CT6 A;  4MAB A;  3ZIT A;  1PX6 A;  4TR1 A;  4V2N A;  1Y25 A;  5D9W A;  1R5A A;  3RPP A;  1SEN A;  1TI1 A;  3L4N A;  5H5R A;  3ZTL A;  4TW5 A;  1N8J A;  2CVK A;  3MAK A;  5JCW A;  3EYT A;  4ZB6 A;  4TRX A;  3APO A;  5D93 A;  1Z9H A;  4EC0 A;  3LXT A;  6GSW A;  2IWT A;  1T00 A;  1OKT A;  3EVI A;  4K9Z A;  1OC9 A;  2B5Y A;  3DWV A;  1SKR B;  4MJA A;  4OWY A;  1KNG A;  1XZO A;  5DJM A;  4KDX A;  3RBT A;  2H01 A;  2MMO A;  3DGQ A;  4XRA A;  4YQU A;  2OKA A;  1YY7 A;  4MP4 A;  2LNS A;  3QCP A;  2H70 A;  2YJ7 A;  2WB9 A;  1NHO A;  1AAZ A;  3TKS E;  4AGS A;  4GRF A;  1SL2 B;  3QOU A;  2VL2 A;  3G7Y A;  4DSQ A;  2P31 A;  2JL4 A;  4TOP A;  4RUV A;  3KM6 A;  2CX4 A;  1YF1 A;  4YAV A;  3QFB C;  4GQF A;  4K7N A;  2FWF A;  4MJB A;  1GWC A;  3UOM A;  2C0F A;  4HEA 2;  2O7K A;  3H93 A;  3GIX A;  4ZBD A;  2KP2 A;  2VCW A;  3QAW A;  2CQ9 A;  2YZH A;  1FVJ A;  2HRA A;  3HZ4 A;  1J08 A;  4KCE A;  2V41 A;  1EP8 A;  5G5E A;  2FY6 A;  3HXS A;  4F0B A;  4N11 A;  2I4A A;  5F06 A;  2IMK A;  4EUY A;  2H6X A;  4Q5Q A;  3PGT A;  2GSQ A;  4TR4 A;  3GKX A;  3C73 A;  2HQT A;  2PU9 C;  2XBQ A;  3LYK A;  4JE1 A;  1U3I A;  3N5O A;  3ZVJ A;  1XWB A;  2RLI A;  3GX0 A;  4I5Q A;  4L8E A;  4TVE A;  1AQX A;  2X8C A;  1OE8 A;  2H66 A;  1XW9 A;  5ELA A;  2LEG A;  4MZC A;  3KP9 A;  2XBI A;  2J23 A;  1OYJ A;  1WJK A;  1TRW A;  1PX7 A;  1V58 A;  3SWL A;  1VRS D;  1O6J A;  3FZA A;  1JLV A;  1WRY A;  1K0D A;  3QDN A;  3FRC A;  4N30 A;  1CQG A;  3R3E A;  4ZBA A;  2O87 A;  3WGE A;  3J7Y k;  2VO4 A;  4L5O A;  3IK9 A;  2JU5 A;  1K0N A;  4KX4 A;  4KH7 A;  3DEX A;  4MDC A;  2J9H A;  4G0K A;  3A2X A;  4YQV A;  1LJR A;  4WKW A;  2WCI A;  3GYK A;  4OO5 A;  5G31 A;  1A8Y A;  3FKF A;  2IMI A;  4IVF A;  2LRT A;  3LWA A;  3RHB A;  1ZGN A;  2WS2 A;  1TI3 A;  3K8N A;  5B6N A;  5DCG A;  3KCM A;  3LYP A;  3CSI A;  3P7X A;  4IKH A;  4G10 A;  1Z5Y E;  3TJK A;  3GV1 A;  5D73 A;  4L0U A;  1X5E A;  4IJI A;  2XHF A;  2B5X A;  3M8N A;  1SK1 A;  2GZP A;  2AAW A;  1E6B A;  2IPA A;  4JU5 A;  3IA1 A;  1XIY A;  3D21 A;  3BD2 A;  5JWR B;  1TK5 B;  5HR2 A;  2GQL A;  2PN8 A;  1FOV A;  2OE3 A;  1A8L A;  3IC8 A;  1X9W B;  2CZ3 A;  1A23 A;  3WD6 A;  2FWG A;  1M2B A;  4TXO B;  1AXD A;  3BJ5 A;  2YN1 A;  1XVW A;  3TCO A;  5E59 A;  1EGO A;  3HZ8 A;  2H1G A;  4X43 A;  2NTO A;  3QMX A;  1K0O A;  4KE3 A;  1TK0 B;  5HR0 A;  1Q4J A;  5IPH A;  2FLS A;  2X8H A;  2X99 A;  3TB2 A;  2F3M A;  3MDK A;  1EOH A;  4BVY B;  4Q5R A;  3H79 A;  1HNB A;  5ECO B;  5AN1 A;  1TK8 B;  1PKZ A;  4NWY A;  3CTF A;  2PVO C;  2ES7 A;  4K0G A;  4HI7 A;  2EC4 A;  3TDG A;  4KB3 A;  3F3Q A;  2DML A;  4K8M A;  1R26 A;  5J9C A;  2VOC A;  4HJM A;  2B3S A;  1ERT A;  1GSY A;  2GTU A;  1F3B A;  5IMD A;  3GKN A;  3GH6 A;  1T4Y A;  3GSS A;  1SK2 A;  4H86 A;  4Q5N A;  1EP7 A;  1VF2 A;  1M9B A;  1XXU A;  3D6I A;  2X64 A;  1PQN A;  8GSS A;  4BL7 A;  1K0A A;  2I3Y A;  4I97 A;  1JZD A;  5A4U A;  2B1K A;  4KCA A;  4DEJ A;  1YKC A;  1GSQ A;  1GTU A;  1MTC A;  1HYU A;  4MF6 A;  3IR4 A;  5IM9 A;  4MF5 A;  5C00 A;  5IOX A;  2TRC P;  3A2W A;  1USB A;  2HZE B;  3FZ9 A;  4RI6 A;  1HNC A;  4V1A p;  4LA1 A;  5A4V A;  4JBB A;  2A2R A;  2LQO A;  1EWX A;  1XW6 A;  4IEL A;  3VWU A;  5ID2 B;  3KGK A;  5DQY A;  4IN0 A;  5F8B A;  2HSM B;  5ECH B;  4ECB A;  2CZ2 A;  2I81 A;  1FO5 A;  5DDL A;  1T1V A;  4PNG A;  2Z9S A;  1TOF A;  4FIW A;  1VGL A;  1EEM A;  5J9B A;  6GSX A;  3KMN A;  4MZW A;  4KGI A;  5JCU A;  3ME8 A;  2JAC A;  2K9F A;  3TUE A;  3P8W A;  2H1A A;  2JZR A;  4HJ2 A;  5ECN B;  18GS A;  2C3N A;  3PH9 A;  4D73 B;  4GCI A;  1ZYQ B;  1DSB A;  4ZB9 A;  4NAX A;  4BPY A;  4MF7 A;  4KND A;  5ECQ B;  3ZMK A;  5FT3 A;  1FW1 A;  5CYY A;  1K3Y A;  2LV3 A;  5GST A;  3FYG A;  2MBS A;  2H74 A;  3VLN A;  3DML A;  3US3 A;  2OE0 A;  13GS A;  2ZCT A;  1EEJ A;  1K0M A;  1JHB A;  4EDZ A;  4YQM A;  3FK8 A;  3DD3 A;  2L4C A;  2GGT A;  5IMC A;  4G9H A;  5E4W A;  1X5D A;  2JSZ A;  1EZK A;  3D4T A;  2LUS A;  1XPV A;  2C3Q A;  1BG5 A;  5LD0 A;  2V6K A;  1O8X A;  2H73 A;  4IP1 A;  2N5F A;  2VLU A;  3DVW A;  2YV7 A;  4F0C A;  3HD5 A;  2EIR A;  3LG6 A;  3A2V A;  1G7O A;  3IAM 2;  1A2J A;  3V1W A;  2MYG A;  3L9V A;  5HR3 A;  2MMA A;  3ZIV A;  2P0G A;  1VF4 A;  5DQS A;  4N0V A;  2GZY A;  2GST A;  2M46 A;  3WT2 A;  1FG4 A;  3G7I A;  3QR6 A;  5EVO A;  5F05 A;  5KN2 A;  3TKQ A;  1TTZ A;  1GUH A;  2HFD A;  2V6O A;  4KSO A;  1PGT A;  5ECI B;  2H75 A;  1GNW A;  2WGR A;  2B7J A;  2VL3 A;  2WUL A;  2GQM A;  3G7J A;  3C1S A;  3WGX A;  3APQ A;  3MNG A;  3W6G A;  1G6W A;  3GL3 A;  3F3R A;  2OA7 A;  2C0D A;  1GL8 A;  1YJ6 A;  2XC2 A;  4HQZ A;  3D22 A;  2PWJ A;  1PL1 A;  1MDK A;  4P3Y B;  3I9V 2;  2RM6 A;  2GVP A;  1F37 A;  4JZQ A;  4BWS A;  3QAV A;  4LL4 B;  6GSS A;  3E3E A;  2R2J A;  1SYX A;  1V2A A;  1U3A A;  4MH2 A;  1HQO A;  2L57 A;  2KHP A;  2KUC A;  1THX A;  5L71 A;  4PUA A;  1K0C A;  2AJQ B;  4GXZ A;  4WET A;  4NXI A;  2VAF A;  3Q18 A;  4X1U A;  3I6A A;  2IIY A;  2CVB A;  3RHC A;  4X0X A;  3VUR A;  4KAE A;  2H6Y A;  4XS4 B;  1F6M C;  2R5G A;  2WRT A;  5DAL A;  1BQ7 A;  3GTU B;  1ERV A;  4HU7 A;  4TXO A;  4KDY A;  5GSS A;  5D9X A;  4OD7 A;  2H6Z A;  3F6D A;  1NW2 A;  3FZ5 A;  1HNA A;  3KMO A;  5CO3 A;  3F4R A;  5KN1 A;  2WZ9 A;  5ECK B;  1HD2 A;  3TOU A;  3HVX A;  2IFQ B;  2JZT A;  2R37 A;  3GRX A;  1ZL9 A;  4MZB A;  4F03 A;  5AIS A;  4BVY A;  1U88 A;  3CSH A;  2E0Q A;  4ZB8 A;  4LL1 B;  2K6V A;  1TU8 A;  1YKA A;  4O7H A;  5FHI A;  4EKZ A;  4G0L A;  1SJZ A;  2OE1 A;  1GTB A;  1YF0 A;  2KOK A;  3P90 A;  1B9X C;  1M2A A;  4OCE A;  1PRX A;  4O32 A;  3IPZ A;  2OBI A;  1GTA A;  4V2L A;  1TDI A;  2FNO A;  1S3C A;  5G1L A;  3ZL5 A;  3KP8 A;  3IRA A;  1K3L A;  1MD4 A;  2JZS A;  2DJ1 A;  3RPN A;  2VCX A;  5HFK A;  4E8E A;  2VIM A;  2VL9 A;  2FCH A;  4K6X A;  1UC7 A;  2H71 A;  2LKU A;  5ELG A;  5B8B A;  3BBY A;  2OBK A;  1F2E A;  5IMF A;  1WWJ A;  4PGT A;  4ULX A;  2DBC A;  3GST A;  2R3X A;  4OCF A;  5HFG A;  1GRX A;  1QQ2 A;  2PPT A;  3S9F A;  5LCZ A;  2E2M A;  1JZW A;  3UBL A;  2PBJ A;  1XBS A;  3C1R A;  2PGT A;  5JWO B;  1TW9 A;  4XS6 A;  2VM2 A;  4I2T A;  4F82 A;  1T3B A;  2FD3 A;  4XIH A;  2I1U A;  1H4O A;  2HSM A;  1U87 A;  1YQ1 A;  5H5Q A;  3EU4 A;  1XOA A;  5G1K A;  5A5K A;  4OFN A;  4N10 A;  1GTI A;  4NHW A;  2H1D A;  1B4Q A;  4ZBB A;  3KIJ A;  4TKY A;  2L59 A;  4MJE A;  1QUW A;  4ID0 A;  3GUR A;  3W8S A;  3LJR A;  2C1Y A;  4ZL7 A;  2E7P A;  2WFC A;  3F8U A;  2IMF A;  1IYH A;  3VPQ A;  1NSW A;  5CRE A;  2DJ0 A;  3FY7 A;  4D73 A;  1GSU A;  3KXO A;  2K18 A;  5CP1 A;  3F0I A;  1O7U A;  1U6T A;  2NVL A;  3M9K A;  5IIZ A;  1I5G A;  5G2Z A;  4ZIJ A;  5F07 A;  1V40 A;  4J2F A;  4IQ1 A;  2X8G A;  4GF0 A;  2H0H A;  1DBY A;  3ISO A;  2LJR A;  4BVX A;  6GSV A;  3DXB A;  2YNX A;  2FHE A;  5IMV A;  2GQK A;  1CQH A;  4NMU A;  9GSS A;  3C71 A;  4MLY A;  1YEP A;  4WF4 A;  3CYN A;  3APS A;  3GUS A;  1S3D A;  4WR5 A;  3JCM L;  1M2D A;  3BCK A;  4NPB A;  1OC8 A;  2F9S A;  4K0N A;  1O85 A;  3HA9 A;  5IO2 A;  3VWX A;  4TR1 B;  5ECP B;  3CXG A;  1FVK A;  2B7K A;  4IS0 A;  3QPM A;  5CRH A;  1ZYE A;  4EL1 A;  4GTU A;  4POB A;  2QKE A;  2H19 A;  1A24 A;  1Y6E A;  2YZU A;  3W8J A;  5B7C A;  1OC9 B;  5EY6 A;  3D0Z A;  1X0R A;  1ZOF A;  3GNJ A;  1UA5 A;  3IK7 A;  3TKS C;  2HSN B;  2C0E A;  1GSE A;  4HZ2 A;  3L0H A;  1SJI A;  1B4P A;  3GKK A;  4DSR A;  1RQM A;  2HI7 A;  4HZ4 A;  3Q19 A;  2BMX A;  4WBR D;  2NDO A;  5GZZ B;  3LXZ A;  4GST A;  3GA4 A;  4HU9 A;  1SU9 A;  2BJX A;  1DUG A;  3VI7 A;  2K8V A;  2V2G A;  1SL1 B;  3ZLP A;  4N0Z A;  5J3R A;  3FR3 A;  1K0B A;  2VD0 A;  5BMU A;  3CBU A;  2HRK B;  2LRN A;  5J5N A;  1URM A;  4TR0 A;  3NIV A;  2C4J A;  4KA0 A;  2JAD A;  2L6C A;  4AF2 A;  4K2D A;  1T7P B;  1G7E A;  3A3T A;  4MA9 A;  1W89 A;  20GS A;  2YOI A;  2MMZ A;  3G9B A;  5CRG A;  1ZCP A;  1SL0 B;  2ON5 A;  2DIZ A;  4KUN A;  3ZRE A;  5HFI A;  10GS A;  2G2Q A;  6GSY A;  5D9T A;  2AB6 A;  1V9W A;  4F9Z A;  1M9A A;  4L0W A;  4ECI A;  4XS4 A;  5IMZ A;  1AQV A;  2LTK A;  1J0F A;  3CRU A;  2HRF A;  4GQC A;  3KEB A;  3N9J A;  4Q5F A;  2A2S A;  2CV4 A;  1WMJ A;  3ZYW A;  1FAA A;  2VM1 A;  1YZX A;  1GSD A;  3HDC A;  2V1M A; 
#chains in the Genus database with same CATH topology
 3WT1 A;  3TKS A;  2FWE A;  3EPT A;  1SJ6 A;  2LJK A;  4GSS A;  3TRX A;  2WW0 A;  2BTO T;  1XWG A;  3CSJ A;  4IP6 A;  1JZR A;  3ZFL A;  2WVY A;  1ACV A;  3PR8 A;  3VK9 A;  3UL3 A;  1QK8 A;  1PMT A;  22GS A;  3QAG A;  2DLX A;  3GN3 A;  1B48 A;  3CHX C;  1PD2 1;  3HJP A;  3RAZ A;  2YWN A;  1KEB A;  5ENU A;  5J4Y A;  2O8V B;  3EE2 A;  5IO0 A;  1O73 A;  4OMV A;  2AYT A;  1B8X A;  4OO4 A;  4L5L A;  4CHS A;  3EU3 A;  1V98 A;  4FQU A;  2B6M A;  4PUR A;  3EMP A;  1X9M B;  1LBK A;  2F8F A;  1H75 A;  2H0I A;  6GSU A;  4IBP A;  1Z6N A;  5CAX A;  4EE0 A;  1B9Y C;  4ZL8 A;  3UVT A;  4TN8 A;  3H8Q A;  2GLR A;  2R6K A;  5ECS A;  2B1L A;  4K1F A;  1OVN A;  1Z3E A;  4BA7 A;  7GSS A;  4AJ7 A;  4DSS B;  3HVV A;  2XPE A;  2WJU A;  3O76 A;  4IJ3 A;  4Z7X A;  3TJF A;  4YAP A;  5KN0 A;  3L9U A;  2FUG 2;  1EOG A;  3TJG A;  1TRS A;  5J40 A;  2F51 A;  3IV4 A;  4KSM A;  19GS A;  4J56 E;  5GAN D;  3GMF A;  2YP6 A;  2EFC A;  4BWQ A;  5CRW A;  4K7I A;  3LEF A;  4EVM A;  5COH A;  5ECM B;  4HUA A;  12GS A;  1XFL A;  2AUV A;  4MJC A;  5AIX A;  1A2M A;  2CAQ A;  3HKR A;  1NM3 A;  4WR4 A;  2P5R A;  1SD8 A;  4FYB A;  1IYI A;  2C0G A;  5DJL A;  3I69 A;  1QFN A;  3DKS A;  11GS A;  4I8B A;  1PN9 A;  3OR5 A;  3VWW A;  1KBN A;  4E68 A;  2HNL A;  1TRV A;  3KJY A;  2PMT A;  2YCD A;  4KDU A;  4EF0 A;  4ZXG A;  1EGR A;  2VL2 C;  2R4V A;  2IME A;  3P2A A;  4PUF C;  2GDR A;  5AGY A;  1PFO A;  1OAZ A;  2HT9 A;  3IHG A;  3Q6O A;  4K7O A;  3PPU A;  4Z2U A;  1JZO A;  5IOW A;  4G0I A;  3HYP A;  4LLR A;  3GHA A;  1GUM A;  3HVS A;  3QFA C;  1R7H A;  4O5R A;  3TJB A;  1SD9 A;  2OT3 A;  1QMV A;  2YWM A;  1XWA A;  1MDI A;  3EWL A;  1SVM A;  3GFK A;  2DJJ A;  2M80 A;  5IQY A;  1QGV A;  4ZIL A;  1Z6M A;  1Q98 A;  3C7M A;  1R5P A;  4NV5 A;  1GSS A;  1AUC A;  2PVQ A;  2FWH A;  1C72 A;  3RGB C;  4OFM A;  2UZ8 A;  3KD0 A;  3KTB A;  4KW6 A;  14GS A;  3MIX A;  3M0F A;  4HDE A;  3ZVJ D;  2MZC A;  3FEU A;  4ACS A;  1PKW A;  4RQX A;  1XCC A;  4DVC A;  3FHK A;  2HSN A;  1BYE A;  1GUK A;  2F8A A;  2WVZ A;  2YV9 A;  5HR1 A;  2K8S A;  1MDJ A;  4JR6 A;  2XPD A;  3TKR A;  4CDO A;  2HYX A;  1GLQ A;  1LU4 A;  3UMA A;  2ALB A;  5LNK e;  17GS A;  3DVX A;  2YPM A;  5JWQ B;  2L6D A;  2C3T A;  1S3R A;  1ERU A;  2NBS A;  4EXJ A;  1GLP A;  1PA3 A;  5J4V A;  3VFI A;  3CTG A;  2HRK A;  3IC4 A;  1BX9 A;  3ED3 A;  3EC3 A;  4E8H A;  4WF5 A;  1ZZY A;  3UJ1 A;  5D8I A;  1GP1 A;  3KZQ A;  2PUK C;  3HY2 A;  5KN3 A;  3HJO A;  2WVX B;  2IN3 A;  4NV2 A;  3FR6 A;  2HZE A;  1XWK A;  3HVN A;  2I9H A;  4QQ7 A;  4A5P A;  2ON7 A;  5C04 A;  2H8L A;  2R0G A;  4CY8 A;  3H4K A;  1M0U A;  2L5O A;  5ID2 A;  4IW9 A;  2AHE A;  1Z7P A;  1TKD B;  4FYC A;  3DIE A;  1SVL A;  5A4W A;  4IHU A;  3J7Y b;  4HQS A;  1AW9 A;  4ECJ A;  1AIU A;  2IL3 A;  1WP0 A;  4MK3 A;  4PQH A;  3CWG A;  1GSF A;  4RI7 A;  5AIV A;  2DJ2 A;  5B6M A;  3IE3 A;  1WIK A;  1QXH A;  1O81 A;  1GH2 A;  4YKG A;  1N2A A;  3CRT A;  1SKS B;  2EIO A;  2GSS A;  1ML6 A;  2QGV A;  2KLX A;  4G01 A;  2JSY A;  3UIW A;  1OC3 A;  3CQF A;  1V57 A;  1A2L A;  2IMD A;  2MBT A;  1RK4 A;  3ERG A;  4MPG A;  2O3E A;  4W66 A;  3H1N A;  3TRQ A;  3GL5 A;  1S4B P;  5DAK B;  1S3A A;  2CA8 A;  2YAN A;  3ZIJ A;  2ZUP A;  2B5E A;  1UVZ A;  1EV4 A;  5G5F A;  4QL7 A;  5G30 A;  4WEY A;  2QSI A;  1ST9 A;  3E9J B;  3IAS 2;  4HOJ A;  4OFT A;  1XOB A;  3VI5 A;  1ILO A;  2A2P A;  3HJM A;  3HHV A;  4TR3 A;  4V2M A;  3IBH A;  2EIQ A;  4FYU A;  4NHZ A;  4RQR A;  4ZB7 A;  4IGJ A;  2PER A;  2FA4 A;  4EDY A;  1SK0 A;  1F3A A;  4KF9 A;  4PNF A;  4I6X A;  1FHE A;  1ERW A;  1TP9 A;  5EPF A;  1ABA A;  1E2Y A;  2O89 A;  2HE3 A;  4ILF A;  3GH9 A;  2HLS A;  3L78 A;  4DSS A;  5INY A;  2P5Q A;  1WE0 A;  2GZZ A;  5D96 A;  4JED A;  3IOS A;  3LGC A;  2GS3 A;  1ZMA A;  4MNN A;  1A0F A;  3WGD A;  3TGZ A;  1YDK A;  5DAL B;  3Q74 A;  4O92 A;  2LJA A;  4LMV A;  4PX1 A;  4MH3 A;  1FB6 A;  4PXO A;  3DRN A;  4MCU A;  2CAI A;  2VKZ G;  5A34 B;  4ML6 A;  3VPT A;  1I9D A;  2GT6 A;  4K5S A;  5J41 A;  5H5S A;  1TXX A;  2RM5 A;  4ISD A;  4ZL9 A;  3M9J A;  4POL A;  4ML1 A;  5IMA A;  1GNE A;  2VLV A;  2VLT A;  2EFH A;  2NPB A;  4XTS A;  5D9V A;  2RUF A;  3EIN A;  4XHM A;  1G6Y A;  1RW1 A;  1TRU A;  2C8U A;  3MYD A;  2D2Z A;  1TU7 A;  4FO5 A;  1JFU A;  1MEK A;  4JRR A;  1NHY A;  4TXV A;  2HSY A;  2QA2 A;  4O5Q A;  3E0U A;  1J9B A;  3O6T A;  1Z7R A;  4G19 A;  2CX3 A;  1AQW A;  4G2E A;  1G0T A;  2OAD A;  4Z2T A;  2VCQ A;  2CVD A;  3ERF A;  3M3M A;  5F0G A;  3QD9 A;  2REM A;  3UAP A;  2A4V A;  2GSR A;  4USS A;  4GWR A;  3C8E A;  4XS1 A;  3GKM A;  1WPI A;  2M72 A;  1KTE A;  1T4Z A;  5HQP A;  4GSN A;  1R4W A;  2VCV A;  3TJJ A;  1PL2 A;  3KTL A;  2FA8 A;  2O85 A;  2OJL A;  2VD1 A;  6GST A;  3GTU A;  2YJH A;  4JR4 A;  1UN2 A;  1YEX A;  3FW2 A;  3TRP A;  4J57 E;  3WYW A;  4GDF A;  3MSZ A;  1F9M A;  2VUP A;  4QL9 A;  4I2U A;  3F63 A;  2LS5 A;  3D5J A;  3ZZX A;  2HXK A;  3ZRD A;  3ZFB A;  2FGX A;  2RII A;  4PQI A;  4GLT A;  2LRC A;  2L5L A;  3IHQ A;  3F6F A;  3F4S A;  4XCS A;  1W4V A;  2IFQ A;  2YWI A;  2AV4 A;  1M99 A;  4WBJ A;  3UAR A;  3F4T A;  4V1A g;  4EO3 A;  2GT5 A;  2DIY A;  1TXU A;  3ME7 A;  5JCG A;  5FWG A;  3EMX A;  2DJK A;  4PI0 C;  1SKW B;  4WXT A;  1EV9 A;  1M7T A;  4PTS A;  2HSH A;  2IJY A;  4LMW A;  3TKP A;  4PQ1 A;  1SYR A;  3FZ4 A;  4CW9 A;  5ECL B;  3VWV A;  2TRX A;  5CNW A;  3SBC A;  2H72 A;  2H1B A;  2DSA A;  3IDV A;  5J4U A;  16GS A;  1GUL A;  3UBK A;  2C80 A;  2YWO A;  3L9S A;  1XVQ A;  3LSZ A;  3PIN A;  3R2Q A;  2DJ3 A;  3O3T A;  2ZNM A;  4POM A;  3UVH A;  1DE2 A;  3M1G A;  5KEJ A;  5CRD A;  2DMM A;  4IQA A;  5A5H B;  3A5W A;  5DCH A;  4BVX B;  3D4M A;  3KH9 A;  5A1N B;  1XG8 A;  1VF3 A;  2LNT A;  4BIK A;  5DVB A;  5IPG A;  1A0R P;  2HRN A;  3U5R E;  2TIR A;  1BAY A;  1DE1 A;  1XWC A;  2V32 A;  1N25 A;  2LST A;  2LQQ A;  2G0F A;  1BED A;  3IXR A;  1X9S B;  3CMI A;  3DYR A;  3F9U A;  2WDU A;  2E2G A;  2VCT A;  3EUR A;  3U6V A;  5B8A A;  5EL8 A;  3KH7 A;  3RDW A;  4FH8 A;  1OKD A;  2H76 A;  1BG1 A;  1K3O A;  1MD3 A;  1OE7 A;  4POK A;  1WOU A;  1I1I P;  4XRD A;  1ZYN A;  4AJ6 A;  4MMM A;  5DBQ A;  1O8W A;  1T8E B;  3UEM A;  2WZS A;  1ON4 A;  4AJ8 A;  2OAC A;  2KP1 A;  2MMN A;  2N5A A;  1XW5 A;  2VCZ A;  1JLW A;  1THO A;  1VF1 A;  3MWH A;  3I43 A;  3LFL A;  1BJX A;  3ZML A;  3HCZ A;  1PSQ A;  5DAK A;  2L4Q A;  3GX8 A;  3NZN A;  5GAP D;  1FB0 A;  4ECC A;  3NOF A;  2H0G A;  2HZF A;  3LQ7 A;  3LOR A;  4ICY A;  2H30 A;  1M3I A;  3AY8 A;  3BCI A;  3ERW A;  2RUE A;  5ECR B;  4HS1 A;  4CY6 A;  4MPF A;  3TOT A;  2N5B A;  3TU3 B;  5ABR A;  1X5C A;  3HMJ G;  3BOA A;  2DC5 A;  4YH2 A;  1AC1 A;  2QC7 A;  4F2I A;  3FR9 A;  1TJD A;  4BL7 B;  2CT6 A;  4MAB A;  3ZIT A;  1PX6 A;  4TR1 A;  4V2N A;  1Y25 A;  5D9W A;  1R5A A;  3RPP A;  1SEN A;  1TI1 A;  3L4N A;  5H5R A;  3ZTL A;  4TW5 A;  1N8J A;  2CVK A;  3MAK A;  5JCW A;  3EYT A;  4ZB6 A;  4TRX A;  4X4J A;  3APO A;  5D93 A;  1Z9H A;  4EC0 A;  3LXT A;  6GSW A;  1YVL A;  2IWT A;  1T00 A;  4O5U A;  1OKT A;  3EVI A;  4K9Z A;  1OC9 A;  2B5Y A;  3DWV A;  1SKR B;  4MJA A;  4OWY A;  1KNG A;  1XZO A;  5DJM A;  5A34 A;  4KDX A;  3RBT A;  2H01 A;  2MMO A;  3DGQ A;  4XRA A;  4YQU A;  2OKA A;  1YY7 A;  4MP4 A;  2LNS A;  3QCP A;  2H70 A;  2YJ7 A;  2WB9 A;  1NHO A;  1AAZ A;  3TKS E;  4AGS A;  4GRF A;  1SL2 B;  3QOU A;  2VL2 A;  3G7Y A;  4DSQ A;  1YEW C;  2P31 A;  2JL4 A;  4TOP A;  4RUV A;  3KM6 A;  4HSC X;  2CX4 A;  1YF1 A;  4YAV A;  3QFB C;  4GQF A;  4K7N A;  2FWF A;  4MJB A;  1GWC A;  3UOM A;  2C0F A;  4HEA 2;  2O7K A;  3H93 A;  3GIX A;  4ZBD A;  2KP2 A;  2VCW A;  4K2X A;  3QAW A;  2CQ9 A;  2YZH A;  1FVJ A;  2HRA A;  3HZ4 A;  1J08 A;  4KCE A;  2WW2 A;  2V41 A;  1EP8 A;  5G5E A;  2FY6 A;  3HXS A;  4F0B A;  4N11 A;  2I4A A;  5F06 A;  2IMK A;  4EUY A;  2H6X A;  4Q5Q A;  3PGT A;  2GSQ A;  4TR4 A;  3GKX A;  3C73 A;  2HQT A;  2PU9 C;  2XBQ A;  3LYK A;  4JE1 A;  1U3I A;  3N5O A;  2UV8 G;  3ZVJ A;  1XWB A;  2RLI A;  3GX0 A;  4I5Q A;  4L8E A;  4TVE A;  1AQX A;  4N3Z A;  2X8C A;  1OE8 A;  2H66 A;  1XW9 A;  5ELA A;  2LEG A;  4MZC A;  3KP9 A;  2XBI A;  2J23 A;  1OYJ A;  1WJK A;  1TRW A;  1PX7 A;  1V58 A;  3SWL A;  1VRS D;  3FMW A;  1O6J A;  4Z2R A;  3FZA A;  1JLV A;  1WRY A;  1K0D A;  3QDN A;  3FRC A;  4N30 A;  1CQG A;  3R3E A;  4ZBA A;  2O87 A;  3WGE A;  3J7Y k;  2VO4 A;  4L5O A;  3IK9 A;  2JU5 A;  1K0N A;  4KX4 A;  4KH7 A;  3DEX A;  4MDC A;  2J9H A;  4G0K A;  3A2X A;  4YQV A;  1LJR A;  4WKW A;  2WCI A;  3GYK A;  4OO5 A;  5BRT A;  5G31 A;  1A8Y A;  3FKF A;  2IMI A;  4IVF A;  2LRT A;  3LWA A;  3RHB A;  1ZGN A;  2WS2 A;  4AKI A;  1TI3 A;  3K8N A;  5B6N A;  5DCG A;  3KCM A;  3LYP A;  3CSI A;  3P7X A;  4IKH A;  4G10 A;  1Z5Y E;  2A4H A;  3TJK A;  3GV1 A;  5D73 A;  4L0U A;  1X5E A;  4IJI A;  2XHF A;  5A1N A;  2B5X A;  3M8N A;  1SK1 A;  2GZP A;  2AAW A;  1E6B A;  2R0C A;  2IPA A;  4JU5 A;  3IA1 A;  1XIY A;  3D21 A;  3BD2 A;  5JWR B;  1TK5 B;  5HR2 A;  2GQL A;  2PN8 A;  1FOV A;  2OE3 A;  1A8L A;  3IC8 A;  1X9W B;  2CZ3 A;  1A23 A;  3WD6 A;  2FWG A;  3LW9 A;  1M2B A;  4TXO B;  1AXD A;  3BJ5 A;  2EFD A;  2YN1 A;  1XVW A;  3TCO A;  5E59 A;  1EGO A;  4PI2 C;  3HZ8 A;  4PHZ C;  2H1G A;  4X43 A;  2NTO A;  3QMX A;  1K0O A;  4KE3 A;  1TK0 B;  5HR0 A;  1Q4J A;  5IPH A;  2EFE A;  2FLS A;  2X8H A;  2X99 A;  3TB2 A;  2F3M A;  3MDK A;  1EOH A;  4BVY B;  4Q5R A;  3H79 A;  1HNB A;  5ECO B;  5AN1 A;  1TK8 B;  1PKZ A;  4NWY A;  3CTF A;  2PVO C;  2ES7 A;  4K0G A;  4HI7 A;  2EC4 A;  3TDG A;  4KB3 A;  3F3Q A;  2DML A;  4K8M A;  1R26 A;  5J9C A;  2VOC A;  4HJM A;  2B3S A;  1ERT A;  1GSY A;  2GTU A;  1F3B A;  5IMD A;  3GKN A;  3GH6 A;  1T4Y A;  3GSS A;  1SK2 A;  4H86 A;  4Q5N A;  1EP7 A;  1VF2 A;  1M9B A;  1XXU A;  3D6I A;  2X64 A;  1PQN A;  8GSS A;  4BL7 A;  1K0A A;  4QMK A;  2I3Y A;  4I97 A;  1JZD A;  5A4U A;  2B1K A;  4KCA A;  4DEJ A;  1YKC A;  1GSQ A;  1GTU A;  1MTC A;  1HYU A;  4MF6 A;  3IR4 A;  5IM9 A;  4MF5 A;  5C00 A;  5IOX A;  2TRC P;  3A2W A;  1USB A;  2HZE B;  3FZ9 A;  4RI6 A;  1ZYP A;  1HNC A;  4V1A p;  4LA1 A;  5A4V A;  4JBB A;  2A2R A;  2LQO A;  1EWX A;  1XW6 A;  4IEL A;  3VWU A;  5ID2 B;  3KGK A;  5DQY A;  4IN0 A;  5F8B A;  2HSM B;  5ECH B;  4ECB A;  2CZ2 A;  2I81 A;  1FO5 A;  5DDL A;  1T1V A;  5KOX A;  4PNG A;  2Z9S A;  1TOF A;  4FIW A;  1VGL A;  1EEM A;  5J9B A;  6GSX A;  3KMN A;  4MZW A;  4KGI A;  5JCU A;  3ME8 A;  2JAC A;  2K9F A;  3TUE A;  3P8W A;  2H1A A;  2JZR A;  4HJ2 A;  5ECN B;  18GS A;  2C3N A;  3PH9 A;  4D73 B;  4GCI A;  1ZYQ B;  1DSB A;  4ZB9 A;  4AI6 A;  4NAX A;  4K5R A;  4BPY A;  4MF7 A;  4KND A;  5ECQ B;  3ZMK A;  5FT3 A;  1FW1 A;  5CYY A;  1K3Y A;  2LV3 A;  5GST A;  3FYG A;  2MBS A;  2H74 A;  3VLN A;  3DML A;  5KOW A;  3US3 A;  4FXY P;  2OE0 A;  13GS A;  2ZCT A;  1EEJ A;  1K0M A;  1JHB A;  2H1L A;  2WVX A;  4EDZ A;  4YQM A;  3FK8 A;  3DD3 A;  2L4C A;  2GGT A;  5IMC A;  4G9H A;  5E4W A;  1X5D A;  4EIQ A;  2JSZ A;  1EZK A;  3D4T A;  2LUS A;  1XPV A;  2C3Q A;  4AKG A;  1BG5 A;  5LD0 A;  2V6K A;  1O8X A;  2H73 A;  4IP1 A;  2N5F A;  2VLU A;  3DVW A;  2YV7 A;  4F0C A;  3HD5 A;  2EIR A;  3LG6 A;  3A2V A;  1G7O A;  3IAM 2;  1A2J A;  3V1W A;  2MYG A;  3L9V A;  5HR3 A;  2MMA A;  3ZIV A;  2P0G A;  2R0P A;  1VF4 A;  5DQS A;  4N0V A;  2GZY A;  2GST A;  2M46 A;  3WT2 A;  1FG4 A;  3G7I A;  3QR6 A;  5EVO A;  5F05 A;  5KN2 A;  3TKQ A;  1TTZ A;  1GUH A;  2HFD A;  2V6O A;  4KSO A;  1PGT A;  5ECI B;  2H75 A;  1GNW A;  2WGR A;  2B7J A;  2VL3 A;  2WUL A;  2GQM A;  3G7J A;  3C1S A;  3WGX A;  3APQ A;  3MNG A;  4YKF A;  3W6G A;  1G6W A;  3GL3 A;  3F3R A;  2OA7 A;  2C0D A;  1GL8 A;  1YJ6 A;  2XC2 A;  4HQZ A;  3D22 A;  2PWJ A;  1PL1 A;  1MDK A;  4P3Y B;  3I9V 2;  2RM6 A;  2GVP A;  1F37 A;  5BMU B;  4JZQ A;  4BWS A;  3QAV A;  4LL4 B;  6GSS A;  2WW1 A;  3E3E A;  2R2J A;  1BF5 A;  1SYX A;  1V2A A;  1U3A A;  4MH2 A;  1HQO A;  2O36 A;  2L57 A;  3A5I A;  2KHP A;  2KUC A;  1THX A;  5L71 A;  4AKX B;  4PUA A;  1K0C A;  2QA1 A;  2AJQ B;  4GXZ A;  4WET A;  4NXI A;  2VAF A;  3Q18 A;  4X1U A;  3I6A A;  2X49 A;  2IIY A;  2CVB A;  3RHC A;  4X0X A;  3VUR A;  4KAE A;  5J47 A;  2H6Y A;  4XS4 B;  1F6M C;  2R5G A;  2WRT A;  5DAL A;  1BQ7 A;  3GTU B;  1ERV A;  4HU7 A;  4TXO A;  4KDY A;  5GSS A;  5D9X A;  4OD7 A;  2H6Z A;  3F6D A;  1NW2 A;  3FZ5 A;  1HNA A;  3KMO A;  5CO3 A;  3F4R A;  5KN1 A;  2WZ9 A;  5ECK B;  1HD2 A;  3TOU A;  3HVX A;  2IFQ B;  2JZT A;  2R37 A;  3GRX A;  1ZL9 A;  4MZB A;  4F03 A;  5AIS A;  4BVY A;  1U88 A;  3CSH A;  2E0Q A;  4ZB8 A;  4LL1 B;  2K6V A;  1TU8 A;  1YKA A;  4O7H A;  5FHI A;  4EKZ A;  4G0L A;  1SJZ A;  2OE1 A;  2X4A A;  1GTB A;  1YF0 A;  2KOK A;  3P90 A;  1B9X C;  1M2A A;  4OCE A;  1PRX A;  4O32 A;  3IPZ A;  2OBI A;  1GTA A;  2O5V A;  4V2L A;  1TDI A;  2FNO A;  1S3C A;  5G1L A;  3ZL5 A;  1Y1U A;  3KP8 A;  3IRA A;  1K3L A;  1MD4 A;  2JZS A;  2DJ1 A;  3RPN A;  2VCX A;  5HFK A;  4E8E A;  2VIM A;  2VL9 A;  2FCH A;  4K6X A;  1UC7 A;  2H71 A;  2LKU A;  5ELG A;  5B8B A;  3BBY A;  2OBK A;  1F2E A;  5IMF A;  1WWJ A;  4PGT A;  4ULX A;  2DBC A;  3GST A;  2R3X A;  4OCF A;  5HFG A;  1GRX A;  1QQ2 A;  2PPT A;  3S9F A;  5LCZ A;  2E2M A;  1JZW A;  3UBL A;  2PBJ A;  1XBS A;  3C1R A;  2PGT A;  5JWO B;  1TW9 A;  4XS6 A;  2VM2 A;  4I2T A;  4F82 A;  1T3B A;  2FD3 A;  4XIH A;  2I1U A;  1H4O A;  2HSM A;  1U87 A;  1YQ1 A;  5H5Q A;  3EU4 A;  1XOA A;  5G1K A;  5A5K A;  4OFN A;  4N10 A;  1GTI A;  4NHW A;  2H1D A;  1B4Q A;  4ZBB A;  3KIJ A;  4TKY A;  2L59 A;  4MJE A;  1QUW A;  4ID0 A;  3GUR A;  3W8S A;  3LJR A;  2C1Y A;  4ZL7 A;  2E7P A;  2WFC A;  3F8U A;  2IMF A;  1IYH A;  3VPQ A;  1NSW A;  5CRE A;  2DJ0 A;  2DKI A;  3FY7 A;  4D73 A;  1GSU A;  3KXO A;  2K18 A;  5CP1 A;  3RFR C;  3F0I A;  1O7U A;  1U6T A;  2NVL A;  3M9K A;  5IIZ A;  1I5G A;  5G2Z A;  4ZIJ A;  5F07 A;  1V40 A;  4J2F A;  4IQ1 A;  2X8G A;  4GF0 A;  2H0H A;  1DBY A;  3ISO A;  5A5H A;  2LJR A;  4BVX A;  6GSV A;  3DXB A;  2YNX A;  2FHE A;  5IMV A;  2GQK A;  1FOH A;  1CQH A;  4NMU A;  9GSS A;  3C71 A;  4MLY A;  4EIP A;  1YEP A;  4WF4 A;  3CYN A;  3APS A;  3GUS A;  1S3D A;  4WR5 A;  3JCM L;  1M2D A;  3BCK A;  4NPB A;  1OC8 A;  2F9S A;  2WW3 A;  4K0N A;  1O85 A;  3HA9 A;  5IO2 A;  3VWX A;  4TR1 B;  5ECP B;  3CXG A;  1FVK A;  2B7K A;  4IS0 A;  1M3J A;  3QPM A;  1PN0 A;  5CRH A;  1ZYE A;  4EL1 A;  4GTU A;  4POB A;  2QKE A;  2H19 A;  2DKH A;  1A24 A;  1Y6E A;  2YZU A;  3W8J A;  5B7C A;  1OC9 B;  5EY6 A;  3D0Z A;  1X0R A;  1ZOF A;  3GNJ A;  1UA5 A;  3IK7 A;  3TKS C;  2HSN B;  2C0E A;  1GSE A;  4HZ2 A;  3L0H A;  1SJI A;  1B4P A;  3GKK A;  4DSR A;  1RQM A;  2HI7 A;  4HZ4 A;  3Q19 A;  4AKH A;  2BMX A;  4WBR D;  2NDO A;  5GZZ B;  3LXZ A;  4GST A;  3GA4 A;  4HU9 A;  1SU9 A;  2BJX A;  1DUG A;  3VI7 A;  2K8V A;  2V2G A;  1SL1 B;  3ZLP A;  4N0Z A;  5J3R A;  3FR3 A;  1K0B A;  2VD0 A;  5BMU A;  3CBU A;  2HRK B;  2LRN A;  5J5N A;  1URM A;  4TR0 A;  3NIV A;  2C4J A;  4KA0 A;  2JAD A;  2L6C A;  4AF2 A;  4K2D A;  1T7P B;  1G7E A;  3A3T A;  4MA9 A;  1W89 A;  20GS A;  2YOI A;  2MMZ A;  3G9B A;  5CRG A;  1ZCP A;  1SL0 B;  2ON5 A;  2DIZ A;  4KUN A;  3ZRE A;  5HFI A;  10GS A;  2G2Q A;  6GSY A;  5D9T A;  2AB6 A;  1V9W A;  4F9Z A;  1M9A A;  4L0W A;  4ECI A;  4XS4 A;  5IMZ A;  1SVO A;  1AQV A;  2LTK A;  1J0F A;  3CRU A;  2HRF A;  4GQC A;  3KEB A;  3N9J A;  4Q5F A;  2A2S A;  2CV4 A;  1WMJ A;  3ZYW A;  1FAA A;  2VM1 A;  1YZX A;  1GSD A;  3HDC A;  2V1M A; 
#chains in the Genus database with same CATH homology
 3WT1 A;  3TKS A;  2FWE A;  3EPT A;  1SJ6 A;  2LJK A;  4GSS A;  3TRX A;  2BTO T;  1XWG A;  3CSJ A;  4IP6 A;  1JZR A;  3ZFL A;  1ACV A;  3PR8 A;  3VK9 A;  3UL3 A;  1QK8 A;  1PMT A;  22GS A;  3QAG A;  2DLX A;  3GN3 A;  1B48 A;  1PD2 1;  3HJP A;  3RAZ A;  2YWN A;  1KEB A;  5ENU A;  5J4Y A;  2O8V B;  3EE2 A;  5IO0 A;  1O73 A;  4OMV A;  2AYT A;  1B8X A;  4OO4 A;  4L5L A;  4CHS A;  3EU3 A;  1V98 A;  4FQU A;  2B6M A;  4PUR A;  3EMP A;  1X9M B;  1LBK A;  2F8F A;  1H75 A;  2H0I A;  6GSU A;  4IBP A;  1Z6N A;  5CAX A;  4EE0 A;  1B9Y C;  4ZL8 A;  3UVT A;  4TN8 A;  3H8Q A;  2GLR A;  2R6K A;  5ECS A;  2B1L A;  4K1F A;  1OVN A;  1Z3E A;  4BA7 A;  7GSS A;  4AJ7 A;  4DSS B;  3HVV A;  2XPE A;  2WJU A;  3O76 A;  4IJ3 A;  4Z7X A;  3TJF A;  4YAP A;  5KN0 A;  3L9U A;  2FUG 2;  1EOG A;  3TJG A;  1TRS A;  5J40 A;  2F51 A;  3IV4 A;  4KSM A;  19GS A;  4J56 E;  5GAN D;  3GMF A;  2YP6 A;  2EFC A;  4BWQ A;  5CRW A;  4K7I A;  3LEF A;  4EVM A;  5COH A;  5ECM B;  4HUA A;  12GS A;  1XFL A;  2AUV A;  4MJC A;  5AIX A;  1A2M A;  2CAQ A;  3HKR A;  1NM3 A;  4WR4 A;  2P5R A;  1SD8 A;  4FYB A;  1IYI A;  2C0G A;  5DJL A;  3I69 A;  1QFN A;  3DKS A;  11GS A;  4I8B A;  1PN9 A;  3OR5 A;  3VWW A;  1KBN A;  4E68 A;  2HNL A;  1TRV A;  3KJY A;  2PMT A;  2YCD A;  4KDU A;  4EF0 A;  4ZXG A;  1EGR A;  2VL2 C;  2R4V A;  2IME A;  3P2A A;  4PUF C;  2GDR A;  5AGY A;  1OAZ A;  2HT9 A;  3IHG A;  3Q6O A;  4K7O A;  3PPU A;  4Z2U A;  1JZO A;  5IOW A;  4G0I A;  3HYP A;  4LLR A;  3GHA A;  1GUM A;  3HVS A;  3QFA C;  1R7H A;  4O5R A;  3TJB A;  1SD9 A;  2OT3 A;  1QMV A;  2YWM A;  1XWA A;  1MDI A;  3EWL A;  1SVM A;  3GFK A;  2DJJ A;  2M80 A;  5IQY A;  1QGV A;  4ZIL A;  1Z6M A;  1Q98 A;  3C7M A;  1R5P A;  4NV5 A;  1GSS A;  1AUC A;  2PVQ A;  2FWH A;  1C72 A;  4OFM A;  2UZ8 A;  3KD0 A;  3KTB A;  4KW6 A;  14GS A;  3MIX A;  3M0F A;  4HDE A;  3ZVJ D;  2MZC A;  3FEU A;  4ACS A;  1PKW A;  4RQX A;  1XCC A;  4DVC A;  3FHK A;  2HSN A;  1BYE A;  1GUK A;  2F8A A;  2YV9 A;  5HR1 A;  2K8S A;  1MDJ A;  4JR6 A;  2XPD A;  3TKR A;  4CDO A;  2HYX A;  1GLQ A;  1LU4 A;  3UMA A;  2ALB A;  5LNK e;  17GS A;  3DVX A;  2YPM A;  5JWQ B;  2L6D A;  2C3T A;  1ERU A;  2NBS A;  4EXJ A;  1GLP A;  1PA3 A;  5J4V A;  3VFI A;  3CTG A;  2HRK A;  3IC4 A;  1BX9 A;  3ED3 A;  3EC3 A;  4E8H A;  4WF5 A;  1ZZY A;  3UJ1 A;  5D8I A;  1GP1 A;  3KZQ A;  2PUK C;  3HY2 A;  5KN3 A;  3HJO A;  2IN3 A;  4NV2 A;  3FR6 A;  2HZE A;  1XWK A;  2I9H A;  4QQ7 A;  4A5P A;  2ON7 A;  5C04 A;  2H8L A;  2R0G A;  4CY8 A;  3H4K A;  1M0U A;  2L5O A;  5ID2 A;  4IW9 A;  2AHE A;  1Z7P A;  1TKD B;  4FYC A;  3DIE A;  1SVL A;  5A4W A;  4IHU A;  3J7Y b;  4HQS A;  1AW9 A;  4ECJ A;  1AIU A;  2IL3 A;  1WP0 A;  4MK3 A;  4PQH A;  3CWG A;  1GSF A;  4RI7 A;  5AIV A;  2DJ2 A;  5B6M A;  3IE3 A;  1WIK A;  1QXH A;  1O81 A;  1GH2 A;  4YKG A;  1N2A A;  3CRT A;  1SKS B;  2EIO A;  2GSS A;  1ML6 A;  2QGV A;  2KLX A;  4G01 A;  2JSY A;  3UIW A;  1OC3 A;  1V57 A;  1A2L A;  2IMD A;  2MBT A;  1RK4 A;  3ERG A;  4MPG A;  4W66 A;  3H1N A;  3TRQ A;  3GL5 A;  5DAK B;  1S3A A;  2CA8 A;  2YAN A;  3ZIJ A;  2ZUP A;  2B5E A;  1UVZ A;  1EV4 A;  5G5F A;  4QL7 A;  5G30 A;  4WEY A;  2QSI A;  1ST9 A;  3E9J B;  3IAS 2;  4HOJ A;  4OFT A;  1XOB A;  3VI5 A;  1ILO A;  2A2P A;  3HJM A;  3HHV A;  4TR3 A;  4V2M A;  3IBH A;  2EIQ A;  4FYU A;  4NHZ A;  4RQR A;  4ZB7 A;  4IGJ A;  2PER A;  2FA4 A;  4EDY A;  1SK0 A;  1F3A A;  4KF9 A;  4PNF A;  4I6X A;  1FHE A;  1ERW A;  1TP9 A;  5EPF A;  1ABA A;  1E2Y A;  2O89 A;  2HE3 A;  4ILF A;  3GH9 A;  2HLS A;  3L78 A;  4DSS A;  5INY A;  2P5Q A;  1WE0 A;  2GZZ A;  5D96 A;  4JED A;  3IOS A;  3LGC A;  2GS3 A;  1ZMA A;  4MNN A;  1A0F A;  3WGD A;  3TGZ A;  1YDK A;  5DAL B;  3Q74 A;  4O92 A;  2LJA A;  4LMV A;  4PX1 A;  4MH3 A;  1FB6 A;  4PXO A;  3DRN A;  4MCU A;  2CAI A;  2VKZ G;  5A34 B;  4ML6 A;  3VPT A;  1I9D A;  2GT6 A;  4K5S A;  5J41 A;  5H5S A;  1TXX A;  2RM5 A;  4ISD A;  4ZL9 A;  3M9J A;  4POL A;  4ML1 A;  5IMA A;  1GNE A;  2VLV A;  2VLT A;  2EFH A;  2NPB A;  4XTS A;  5D9V A;  2RUF A;  3EIN A;  4XHM A;  1G6Y A;  1RW1 A;  1TRU A;  2C8U A;  3MYD A;  2D2Z A;  1TU7 A;  4FO5 A;  1JFU A;  1MEK A;  4JRR A;  1NHY A;  4TXV A;  2HSY A;  2QA2 A;  4O5Q A;  3E0U A;  1J9B A;  3O6T A;  1Z7R A;  4G19 A;  2CX3 A;  1AQW A;  4G2E A;  1G0T A;  2OAD A;  4Z2T A;  2VCQ A;  2CVD A;  3ERF A;  3M3M A;  5F0G A;  3QD9 A;  2REM A;  3UAP A;  2A4V A;  2GSR A;  4USS A;  4GWR A;  3C8E A;  4XS1 A;  3GKM A;  1WPI A;  2M72 A;  1KTE A;  1T4Z A;  5HQP A;  4GSN A;  1R4W A;  2VCV A;  3TJJ A;  1PL2 A;  3KTL A;  2FA8 A;  2O85 A;  2OJL A;  2VD1 A;  6GST A;  3GTU A;  2YJH A;  4JR4 A;  1UN2 A;  1YEX A;  3FW2 A;  3TRP A;  4J57 E;  3WYW A;  4GDF A;  3MSZ A;  1F9M A;  2VUP A;  4QL9 A;  4I2U A;  3F63 A;  2LS5 A;  3D5J A;  3ZZX A;  2HXK A;  3ZRD A;  3ZFB A;  2FGX A;  2RII A;  4PQI A;  4GLT A;  2LRC A;  2L5L A;  3IHQ A;  3F6F A;  3F4S A;  4XCS A;  1W4V A;  2IFQ A;  2YWI A;  2AV4 A;  1M99 A;  4WBJ A;  3UAR A;  3F4T A;  4V1A g;  4EO3 A;  2GT5 A;  2DIY A;  1TXU A;  3ME7 A;  5JCG A;  5FWG A;  3EMX A;  2DJK A;  1SKW B;  4WXT A;  1EV9 A;  1M7T A;  4PTS A;  2HSH A;  2IJY A;  4LMW A;  3TKP A;  4PQ1 A;  1SYR A;  3FZ4 A;  4CW9 A;  5ECL B;  3VWV A;  2TRX A;  5CNW A;  3SBC A;  2H72 A;  2H1B A;  2DSA A;  3IDV A;  5J4U A;  16GS A;  1GUL A;  3UBK A;  2C80 A;  2YWO A;  3L9S A;  1XVQ A;  3LSZ A;  3PIN A;  3R2Q A;  2DJ3 A;  3O3T A;  2ZNM A;  4POM A;  3UVH A;  1DE2 A;  3M1G A;  5KEJ A;  5CRD A;  2DMM A;  4IQA A;  5A5H B;  3A5W A;  5DCH A;  4BVX B;  3D4M A;  3KH9 A;  5A1N B;  1VF3 A;  2LNT A;  5DVB A;  5IPG A;  1A0R P;  2HRN A;  3U5R E;  2TIR A;  1BAY A;  1DE1 A;  1XWC A;  2V32 A;  1N25 A;  2LST A;  2LQQ A;  2G0F A;  1BED A;  3IXR A;  1X9S B;  3CMI A;  3DYR A;  3F9U A;  2WDU A;  2E2G A;  2VCT A;  3EUR A;  3U6V A;  5B8A A;  5EL8 A;  3KH7 A;  3RDW A;  4FH8 A;  1OKD A;  2H76 A;  1BG1 A;  1K3O A;  1MD3 A;  1OE7 A;  4POK A;  1WOU A;  4XRD A;  1ZYN A;  4AJ6 A;  4MMM A;  5DBQ A;  1O8W A;  1T8E B;  3UEM A;  1ON4 A;  4AJ8 A;  2OAC A;  2KP1 A;  2MMN A;  2N5A A;  1XW5 A;  2VCZ A;  1JLW A;  1THO A;  1VF1 A;  3MWH A;  3I43 A;  3LFL A;  1BJX A;  3ZML A;  3HCZ A;  1PSQ A;  5DAK A;  2L4Q A;  3GX8 A;  3NZN A;  5GAP D;  1FB0 A;  4ECC A;  3NOF A;  2H0G A;  2HZF A;  3LQ7 A;  3LOR A;  4ICY A;  2H30 A;  3AY8 A;  3BCI A;  3ERW A;  2RUE A;  5ECR B;  4HS1 A;  4CY6 A;  4MPF A;  3TOT A;  2N5B A;  3TU3 B;  5ABR A;  1X5C A;  3HMJ G;  3BOA A;  2DC5 A;  4YH2 A;  1AC1 A;  2QC7 A;  4F2I A;  3FR9 A;  1TJD A;  4BL7 B;  2CT6 A;  4MAB A;  3ZIT A;  1PX6 A;  4TR1 A;  4V2N A;  1Y25 A;  5D9W A;  1R5A A;  3RPP A;  1SEN A;  1TI1 A;  3L4N A;  5H5R A;  3ZTL A;  4TW5 A;  1N8J A;  2CVK A;  3MAK A;  5JCW A;  3EYT A;  4ZB6 A;  4TRX A;  4X4J A;  3APO A;  5D93 A;  1Z9H A;  4EC0 A;  3LXT A;  6GSW A;  1YVL A;  2IWT A;  1T00 A;  4O5U A;  1OKT A;  3EVI A;  4K9Z A;  1OC9 A;  2B5Y A;  3DWV A;  1SKR B;  4MJA A;  4OWY A;  1KNG A;  1XZO A;  5DJM A;  5A34 A;  4KDX A;  3RBT A;  2H01 A;  2MMO A;  3DGQ A;  4XRA A;  4YQU A;  2OKA A;  1YY7 A;  4MP4 A;  2LNS A;  3QCP A;  2H70 A;  2YJ7 A;  2WB9 A;  1NHO A;  1AAZ A;  3TKS E;  4AGS A;  4GRF A;  1SL2 B;  3QOU A;  2VL2 A;  3G7Y A;  4DSQ A;  2P31 A;  2JL4 A;  4TOP A;  4RUV A;  3KM6 A;  2CX4 A;  1YF1 A;  4YAV A;  3QFB C;  4GQF A;  4K7N A;  2FWF A;  4MJB A;  1GWC A;  3UOM A;  2C0F A;  4HEA 2;  2O7K A;  3H93 A;  3GIX A;  4ZBD A;  2KP2 A;  2VCW A;  4K2X A;  3QAW A;  2CQ9 A;  2YZH A;  1FVJ A;  2HRA A;  3HZ4 A;  1J08 A;  4KCE A;  2V41 A;  1EP8 A;  5G5E A;  2FY6 A;  3HXS A;  4F0B A;  4N11 A;  2I4A A;  5F06 A;  2IMK A;  4EUY A;  2H6X A;  4Q5Q A;  3PGT A;  2GSQ A;  4TR4 A;  3GKX A;  3C73 A;  2HQT A;  2PU9 C;  2XBQ A;  3LYK A;  4JE1 A;  1U3I A;  3N5O A;  2UV8 G;  3ZVJ A;  1XWB A;  2RLI A;  3GX0 A;  4I5Q A;  4L8E A;  4TVE A;  1AQX A;  4N3Z A;  2X8C A;  1OE8 A;  2H66 A;  1XW9 A;  5ELA A;  2LEG A;  4MZC A;  3KP9 A;  2XBI A;  2J23 A;  1OYJ A;  1WJK A;  1TRW A;  1PX7 A;  1V58 A;  3SWL A;  1VRS D;  3FMW A;  1O6J A;  4Z2R A;  3FZA A;  1JLV A;  1WRY A;  1K0D A;  3QDN A;  3FRC A;  4N30 A;  1CQG A;  3R3E A;  4ZBA A;  2O87 A;  3WGE A;  3J7Y k;  2VO4 A;  4L5O A;  3IK9 A;  2JU5 A;  1K0N A;  4KX4 A;  4KH7 A;  3DEX A;  4MDC A;  2J9H A;  4G0K A;  3A2X A;  4YQV A;  1LJR A;  4WKW A;  2WCI A;  3GYK A;  4OO5 A;  5BRT A;  5G31 A;  1A8Y A;  3FKF A;  2IMI A;  4IVF A;  2LRT A;  3LWA A;  3RHB A;  1ZGN A;  2WS2 A;  4AKI A;  1TI3 A;  3K8N A;  5B6N A;  5DCG A;  3KCM A;  3LYP A;  3CSI A;  3P7X A;  4IKH A;  4G10 A;  1Z5Y E;  2A4H A;  3TJK A;  3GV1 A;  5D73 A;  4L0U A;  1X5E A;  4IJI A;  2XHF A;  5A1N A;  2B5X A;  3M8N A;  1SK1 A;  2GZP A;  2AAW A;  1E6B A;  2R0C A;  2IPA A;  4JU5 A;  3IA1 A;  1XIY A;  3D21 A;  3BD2 A;  5JWR B;  1TK5 B;  5HR2 A;  2GQL A;  2PN8 A;  1FOV A;  2OE3 A;  1A8L A;  3IC8 A;  1X9W B;  2CZ3 A;  1A23 A;  3WD6 A;  2FWG A;  3LW9 A;  1M2B A;  4TXO B;  1AXD A;  3BJ5 A;  2EFD A;  2YN1 A;  1XVW A;  3TCO A;  5E59 A;  1EGO A;  3HZ8 A;  2H1G A;  4X43 A;  2NTO A;  3QMX A;  1K0O A;  4KE3 A;  1TK0 B;  5HR0 A;  1Q4J A;  5IPH A;  2EFE A;  2FLS A;  2X8H A;  2X99 A;  3TB2 A;  2F3M A;  3MDK A;  1EOH A;  4BVY B;  4Q5R A;  3H79 A;  1HNB A;  5ECO B;  5AN1 A;  1TK8 B;  1PKZ A;  4NWY A;  3CTF A;  2PVO C;  2ES7 A;  4K0G A;  4HI7 A;  2EC4 A;  3TDG A;  4KB3 A;  3F3Q A;  2DML A;  4K8M A;  1R26 A;  5J9C A;  2VOC A;  4HJM A;  2B3S A;  1ERT A;  1GSY A;  2GTU A;  1F3B A;  5IMD A;  3GKN A;  3GH6 A;  1T4Y A;  3GSS A;  1SK2 A;  4H86 A;  4Q5N A;  1EP7 A;  1VF2 A;  1M9B A;  1XXU A;  3D6I A;  2X64 A;  1PQN A;  8GSS A;  4BL7 A;  1K0A A;  4QMK A;  2I3Y A;  4I97 A;  1JZD A;  5A4U A;  2B1K A;  4KCA A;  4DEJ A;  1YKC A;  1GSQ A;  1GTU A;  1MTC A;  1HYU A;  4MF6 A;  3IR4 A;  5IM9 A;  4MF5 A;  5C00 A;  5IOX A;  2TRC P;  3A2W A;  1USB A;  2HZE B;  3FZ9 A;  4RI6 A;  1ZYP A;  1HNC A;  4V1A p;  4LA1 A;  5A4V A;  4JBB A;  2A2R A;  2LQO A;  1EWX A;  1XW6 A;  4IEL A;  3VWU A;  5ID2 B;  3KGK A;  5DQY A;  4IN0 A;  5F8B A;  2HSM B;  5ECH B;  4ECB A;  2CZ2 A;  2I81 A;  1FO5 A;  5DDL A;  1T1V A;  5KOX A;  4PNG A;  2Z9S A;  1TOF A;  4FIW A;  1VGL A;  1EEM A;  5J9B A;  6GSX A;  3KMN A;  4MZW A;  4KGI A;  5JCU A;  3ME8 A;  2JAC A;  2K9F A;  3TUE A;  3P8W A;  2H1A A;  2JZR A;  4HJ2 A;  5ECN B;  18GS A;  2C3N A;  3PH9 A;  4D73 B;  4GCI A;  1ZYQ B;  1DSB A;  4ZB9 A;  4AI6 A;  4NAX A;  4K5R A;  4BPY A;  4MF7 A;  4KND A;  5ECQ B;  3ZMK A;  5FT3 A;  1FW1 A;  5CYY A;  1K3Y A;  2LV3 A;  5GST A;  3FYG A;  2MBS A;  2H74 A;  3VLN A;  3DML A;  5KOW A;  3US3 A;  2OE0 A;  13GS A;  2ZCT A;  1EEJ A;  1K0M A;  1JHB A;  2H1L A;  4EDZ A;  4YQM A;  3FK8 A;  3DD3 A;  2L4C A;  2GGT A;  5IMC A;  4G9H A;  5E4W A;  1X5D A;  4EIQ A;  2JSZ A;  1EZK A;  3D4T A;  2LUS A;  1XPV A;  2C3Q A;  4AKG A;  1BG5 A;  5LD0 A;  2V6K A;  1O8X A;  2H73 A;  4IP1 A;  2N5F A;  2VLU A;  3DVW A;  2YV7 A;  4F0C A;  3HD5 A;  2EIR A;  3LG6 A;  3A2V A;  1G7O A;  3IAM 2;  1A2J A;  3V1W A;  2MYG A;  3L9V A;  5HR3 A;  2MMA A;  3ZIV A;  2P0G A;  2R0P A;  1VF4 A;  5DQS A;  4N0V A;  2GZY A;  2GST A;  2M46 A;  3WT2 A;  1FG4 A;  3G7I A;  3QR6 A;  5EVO A;  5F05 A;  5KN2 A;  3TKQ A;  1TTZ A;  1GUH A;  2HFD A;  2V6O A;  4KSO A;  1PGT A;  5ECI B;  2H75 A;  1GNW A;  2WGR A;  2B7J A;  2VL3 A;  2WUL A;  2GQM A;  3G7J A;  3C1S A;  3WGX A;  3APQ A;  3MNG A;  4YKF A;  3W6G A;  1G6W A;  3GL3 A;  3F3R A;  2OA7 A;  2C0D A;  1GL8 A;  1YJ6 A;  2XC2 A;  4HQZ A;  3D22 A;  2PWJ A;  1PL1 A;  1MDK A;  4P3Y B;  3I9V 2;  2RM6 A;  2GVP A;  1F37 A;  5BMU B;  4JZQ A;  4BWS A;  3QAV A;  4LL4 B;  6GSS A;  3E3E A;  2R2J A;  1BF5 A;  1SYX A;  1V2A A;  1U3A A;  4MH2 A;  1HQO A;  2L57 A;  3A5I A;  2KHP A;  2KUC A;  1THX A;  5L71 A;  4AKX B;  4PUA A;  1K0C A;  2QA1 A;  2AJQ B;  4GXZ A;  4WET A;  4NXI A;  2VAF A;  3Q18 A;  4X1U A;  3I6A A;  2X49 A;  2IIY A;  2CVB A;  3RHC A;  4X0X A;  3VUR A;  4KAE A;  5J47 A;  2H6Y A;  4XS4 B;  1F6M C;  2R5G A;  2WRT A;  5DAL A;  1BQ7 A;  3GTU B;  1ERV A;  4HU7 A;  4TXO A;  4KDY A;  5GSS A;  5D9X A;  4OD7 A;  2H6Z A;  3F6D A;  1NW2 A;  3FZ5 A;  1HNA A;  3KMO A;  5CO3 A;  3F4R A;  5KN1 A;  2WZ9 A;  5ECK B;  1HD2 A;  3TOU A;  3HVX A;  2IFQ B;  2JZT A;  2R37 A;  3GRX A;  1ZL9 A;  4MZB A;  4F03 A;  5AIS A;  4BVY A;  1U88 A;  3CSH A;  2E0Q A;  4ZB8 A;  4LL1 B;  2K6V A;  1TU8 A;  1YKA A;  4O7H A;  5FHI A;  4EKZ A;  4G0L A;  1SJZ A;  2OE1 A;  2X4A A;  1GTB A;  1YF0 A;  2KOK A;  3P90 A;  1B9X C;  1M2A A;  4OCE A;  1PRX A;  4O32 A;  3IPZ A;  2OBI A;  1GTA A;  2O5V A;  4V2L A;  1TDI A;  2FNO A;  1S3C A;  5G1L A;  3ZL5 A;  1Y1U A;  3KP8 A;  3IRA A;  1K3L A;  1MD4 A;  2JZS A;  2DJ1 A;  3RPN A;  2VCX A;  5HFK A;  4E8E A;  2VIM A;  2VL9 A;  2FCH A;  4K6X A;  1UC7 A;  2H71 A;  2LKU A;  5ELG A;  5B8B A;  3BBY A;  2OBK A;  1F2E A;  5IMF A;  1WWJ A;  4PGT A;  4ULX A;  2DBC A;  3GST A;  2R3X A;  4OCF A;  5HFG A;  1GRX A;  1QQ2 A;  2PPT A;  3S9F A;  5LCZ A;  2E2M A;  1JZW A;  3UBL A;  2PBJ A;  1XBS A;  3C1R A;  2PGT A;  5JWO B;  1TW9 A;  4XS6 A;  2VM2 A;  4I2T A;  4F82 A;  1T3B A;  2FD3 A;  4XIH A;  2I1U A;  1H4O A;  2HSM A;  1U87 A;  1YQ1 A;  5H5Q A;  3EU4 A;  1XOA A;  5G1K A;  5A5K A;  4OFN A;  4N10 A;  1GTI A;  4NHW A;  2H1D A;  1B4Q A;  4ZBB A;  3KIJ A;  4TKY A;  2L59 A;  4MJE A;  1QUW A;  4ID0 A;  3GUR A;  3W8S A;  3LJR A;  2C1Y A;  4ZL7 A;  2E7P A;  2WFC A;  3F8U A;  2IMF A;  1IYH A;  3VPQ A;  1NSW A;  5CRE A;  2DJ0 A;  2DKI A;  3FY7 A;  4D73 A;  1GSU A;  3KXO A;  2K18 A;  5CP1 A;  3F0I A;  1O7U A;  1U6T A;  2NVL A;  3M9K A;  5IIZ A;  1I5G A;  5G2Z A;  4ZIJ A;  5F07 A;  1V40 A;  4J2F A;  4IQ1 A;  2X8G A;  4GF0 A;  2H0H A;  1DBY A;  3ISO A;  5A5H A;  2LJR A;  4BVX A;  6GSV A;  3DXB A;  2YNX A;  2FHE A;  5IMV A;  2GQK A;  1FOH A;  1CQH A;  4NMU A;  9GSS A;  3C71 A;  4MLY A;  4EIP A;  1YEP A;  4WF4 A;  3CYN A;  3APS A;  3GUS A;  1S3D A;  4WR5 A;  3JCM L;  1M2D A;  3BCK A;  4NPB A;  1OC8 A;  2F9S A;  4K0N A;  1O85 A;  3HA9 A;  5IO2 A;  3VWX A;  4TR1 B;  5ECP B;  3CXG A;  1FVK A;  2B7K A;  4IS0 A;  3QPM A;  1PN0 A;  5CRH A;  1ZYE A;  4EL1 A;  4GTU A;  4POB A;  2QKE A;  2H19 A;  2DKH A;  1A24 A;  1Y6E A;  2YZU A;  3W8J A;  5B7C A;  1OC9 B;  5EY6 A;  3D0Z A;  1X0R A;  1ZOF A;  3GNJ A;  1UA5 A;  3IK7 A;  3TKS C;  2HSN B;  2C0E A;  1GSE A;  4HZ2 A;  3L0H A;  1SJI A;  1B4P A;  3GKK A;  4DSR A;  1RQM A;  2HI7 A;  4HZ4 A;  3Q19 A;  4AKH A;  2BMX A;  4WBR D;  2NDO A;  5GZZ B;  3LXZ A;  4GST A;  3GA4 A;  4HU9 A;  1SU9 A;  2BJX A;  1DUG A;  3VI7 A;  2K8V A;  2V2G A;  1SL1 B;  3ZLP A;  4N0Z A;  5J3R A;  3FR3 A;  1K0B A;  2VD0 A;  5BMU A;  3CBU A;  2HRK B;  2LRN A;  5J5N A;  1URM A;  4TR0 A;  3NIV A;  2C4J A;  4KA0 A;  2JAD A;  2L6C A;  4AF2 A;  4K2D A;  1T7P B;  1G7E A;  3A3T A;  4MA9 A;  1W89 A;  20GS A;  2YOI A;  2MMZ A;  3G9B A;  5CRG A;  1ZCP A;  1SL0 B;  2ON5 A;  2DIZ A;  4KUN A;  3ZRE A;  5HFI A;  10GS A;  2G2Q A;  6GSY A;  5D9T A;  2AB6 A;  1V9W A;  4F9Z A;  1M9A A;  4L0W A;  4ECI A;  4XS4 A;  5IMZ A;  1SVO A;  1AQV A;  2LTK A;  1J0F A;  3CRU A;  2HRF A;  4GQC A;  3KEB A;  3N9J A;  4Q5F A;  2A2S A;  2CV4 A;  1WMJ A;  3ZYW A;  1FAA A;  2VM1 A;  1YZX A;  1GSD A;  3HDC A;  2V1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...