4ZB7A

Phanerochaete chrysosporium ure2p6 in apo form.
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
216
structure length
171
Chain Sequence
b'GKQFTLYTHKGGPNGWKVTIVLEELGLTYESIFLRIPALIDHKNNDYTVWESNAIIQYLVDKYDKDRKVSVAPGTNEYYTQLQWLYFQASGQGYRNEIKRVLGVLESVLSKQEFLVDGKATVADFSFLPWNEGAAKFGSQFEEEFPATAKWHKKLLERPAIAKVWEERAKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PcUre2p6
publication title Evolutionary divergence of Ure2pA glutathione transferases in wood degrading fungi.
pubmed doi rcsb
source organism Phanerochaete chrysosporium
molecule tags Transferase
total genus 63
structure length 171
sequence length 216
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.130 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4zb7A00
5A1NB 4W66A 5A34A 4AKGA 5BMUB 5A34B 4ZB7A 4AI6A 4AKIA 4AKHA 5A1NA 5A5HA 5A5HB
chains in the Genus database with same CATH superfamily
2CZ3A 5ECHB 11GSA 2C80A 4EE0A 1LJRA 2WB9A 5D9VA 2WW1A 5J5NA 3O3TA 3PPUA 4KX4A 4JBBA 1ZL9A 1V40A 3LFLA 5KEJA 4G0LA 4NAXA 2IL3A 4YAPA 4MF5A 4QMKA 1IYHA 4IELA 4ECCA 4I97A 1VF3A 2LJRA 3TGZA 2H1LA 1M0UA 4AKXB 4KH7A 3VURA 5ECMB 3R3EA 5ECNB 5D73A 2OT3A 3HJMA 4KF9A 1PKZA 2JL4A 3IBHA 5A4VA 2CAQA 3GSSA 2F3MA 1BX9A 3VPTA 3KJYA 2WJUA 1TW9A 3HKRA 3SWLA 5AGYA 3LSZA 1LBKA 2AAWA 4TOPA 2CA8A 2VD1A 2ON5A 3L0HA 2YCDA 2X64A 4PNGA 5ECLB 5G5EA 1GSEA 4NHZA 5EVOA 1JLWA 1PD21 3P8WA 3G7JA 2CAIA 2GSSA 4G0KA 5AIXA 2C3QA 4BVYA 1GNEA 1GSUA 1XWGA 3N5OA 3ISOA 3M0FA 4IKHA 4KAEA 4WR4A 1C72A 1GTIA 2HRKA 1M9BA 1GSQA 2R5GA 1USBA 4PI0C 3LG6A 3ERGA 5EY6A 3LYPA 2OADA 4PHZC 4L5LA 5F0GA 2GSQA 8GSSA 4L8EA 4RI6A 1GLPA 3AY8A 5DQSA 6GSTA 1EV9A 6GSVA 1PA3A 4ECJA 1EOGA 4Q5FA 1PGTA 4G10A 1K0MA 2UZ8A 3KMOA 4G0IA 2WVXB 6GSUA 3U6VA 1U87A 5DALA 1GUMA 3EE2A 1SVOA 4ZB9A 1YQ1A 3Q19A 4JZQA 2EFHA 7GSSA 3HJOA 2WVZA 2O3EA 4WR5A 3QR6A 20GSA 3W8SA 4MF6A 3VWXA 6GSXA 5F8BA 4OFMA 4G9HA 1B8XA 18GSA 1GULA 2VO4A 3GH6A 2HSMB 2IMIA 5JCUA 4ZBAA 1GTAA 4BL7B 3UBKA 4F0BA 3BBYA 4F0CA 4HOJA 1AQXA 1HQOA 4ID0A 1U3IA 4OFTA 1VF1A 2C3TA 4DEJA 5ECSA 2IMKA 1K0AA 1Y6EA 4IS0A 1Y1UA 1OYJA 2R4VA 1YDKA 4LMVA 2ON7A 5HFKA 2C8UA 1DUGA 3FR6A 3CRTA 3DD3A 3VI5A 3D0ZA 4USSA 2V6KA 1OE7A 4IW9A 2HNLA 3MAKA 1R5AA 3IK7A 1F2EA 4NHWA 3P90A 2AHEA 1GSSA 1OKTA 1V2AA 1PN9A 4MPFA 2HRAA 2C3NA 4RI7A 2CZ2A 5GSTA 1PL2A 2PVQA 6GSWA 2OACA 4E8EA 4YQMA 1MTCA 12GSA 1JZRA 3GTUB 3VI7A 5D9TA 4BVXA 6GSYA 1F3BA 4FXYP 5DCGA 4GSTA 4MDCA 2CVDA 4KSMA 1K0NA 1VF4A 1UA5A 1RK4A 4HJ2A 1YKCA 1XW5A 3QAGA 1G7OA 1Q4JA 3EINA 3KMNA 1GNWA 1N25A 3GURA 3HMJG 5A4WA 19GSA 1IYIA 4HZ4A 1G6WA 4Q5RA 2GTUA 5J4UA 5FHIA 1GLQA 1M99A 1BYEA 4JEDA 3LXZA 2N5FA 3M3MA 4K0NA 5ECOB 5ECPB 1EV4A 1GWCA 4GLTA 4IVFA 2WVXA 3PGTA 3TU3B 2HSNA 3F63A 1U88A 3ERFA 2FNOA 5A5HA 1TDIA 3M8NA 2WW2A 5BMUA 4YQUA 1N2AA 3WD6A 2VKZG 3ZMKA 3I6AA 2VCQA 1K3LA 4ACSA 3GUSA 3H1NA 3CSJA 4PGTA 2HSMA 2F8FA 2GDRA 5F06A 4AKHA 5J4YA 5ELAA 4BL7A 2O36A 1AQVA 1JLVA 2GSTA 3VK9A 2YV9A 4GTUA 4J2FA 4IQ1A 4YH2A 5DAKB 5ELGA 4IJIA 1YEWC 4ZB6A 4ZBBA 1F3AA 4MZWA 3LJRA 2PERA 2GSRA 4ISDA 4PQHA 1BG5A 1BF5A 5F05A 3IR4A 1GTBA 3GSTA 3KTLA 4N0VA 4EC0A 3FR9A 3KXOA 3IC8A 4FQUA 4W66A 4ECBA 3KM6A 2WVYA 1GSYA 9GSSA 4K0GA 4CHSA 3GX0A 2GLRA 3LQ7A 5GZZB 13GSA 1B4PA 2HRKB 5EL8A 5DJLA 4KGIA 1Z9HA 4HI7A 4O7HA 5ECIB 2WS2A 1PKWA 3PR8A 5LD0A 1NHYA 2WRTA 4N3ZA 3GTUA 4IQAA 1EOHA 5DDLA 2PGTA 3G7IA 2VCWA 1K3OA 3CSHA 3RBTA 4GDFA 1I1IP 5A4UA 1ZGNA 1M9AA 3IK9A 5DJMA 2VCTA 5A34B 2VD0A 4PXOA 4PTSA 3ZFLA 2WZSA 5F07A 2R6KA 5AISA 4PUAA 17GSA 1GTUA 2VCXA 4GF0A 3UARA 5A1NB 3FYGA 3QAVA 3UAPA 3LYKA 1HNCA 2VCZA 4ZB7A 3TOTA 2EFCA 3N9JA 3UBLA 4OFNA 1AW9A 5G5FA 4AKGA 1KBNA 6GSSA 2DSAA 1K0DA 1EEMA 2EFDA 2HQTA 4PX1A 1BG1A 4PURA 5J40A 3F6FA 1FW1A 1PMTA 4YQVA 3FRCA 3Q74A 2PBJA 1XW6A 4KDYA 4GSNA 3Q18A 1E6BA 1A0FA 1FHEA 3CSIA 3I69A 4EDYA 3R2QA 1TU7A 4OMVA 3RGBC 5JCWA 5AN1A 1YY7A 4Q5NA 5ECQB 5D9XA 4LMWA 5FT3A 4ECIA 3QAWA 3VPQA 2DC5A 4MP4A 1TU8A 5DAKA 1VF2A 4IBPA 3DGQA 4PQIA 2C4JA 3CWGA 2WDUA 1K3YA 2YV7A 4AI6A 4KDUA 1GUHA 1HNAA 3WYWA 4E68A 4MPGA 5ECKB 4EXJA 1K0CA 2EFEA 4PNFA 1BAYA 1MD4A 3NIVA 1AXDA 4EDZA 1K0BA 3VLNA 2UV8G 1XWKA 3FR3A 3UVHA 2O5VA 4BVXB 3LXTA 4E8HA 4GSSA 3CBUA 1AQWA 4PI2C 3ZFBA 3FY7A 2FHEA 4MK3A 4YAVA 2A2RA 5J41A 4G01A 5LCZA 1K0OA 5J47A 3ZMLA 2D2ZA 1OE8A 4G19A 3C8EA 16GSA 4AGSA 4MF7A 3CRUA 5AIVA 1PX7A 1G6YA 1YVLA 2AB6A 4BVYB 2PMTA 5B7CA 1PX6A 4GCIA 3MDKA 14GSA 2HSNB 5A34A 3RFRC 1PL1A 2R3XA 4IGJA 4AKIA 22GSA 5A5HB 4L5OA 1TXUA 4Q5QA 4QQ7A 4ZBDA 5BMUB 2A2SA 1SVMA 5A1NA 1SVLA 5GSSA 4ZB8A 3M1GA 1S4BP 5ECRB 5IQYA 1GUKA 2WW3A 3IE3A 2WW0A 4F03A 2J9HA 1GSDA 3TOUA 1B48A 4KDXA 5D9WA 5J4VA 2VCVA 5FWGA 1HNBA 3CHXC 3O76A 4O92A 1YJ6A 1ML6A 5A5KA 4HZ2A 4ZXGA 1GSFA 4KE3A 2OA7A 10GSA 3F6DA 5DALB 2NTOA 1MD3A
chains in the Genus database with same CATH topology
2CZ3A 5ECHB 11GSA 2C80A 4EE0A 1LJRA 2WB9A 5D9VA 5J5NA 3O3TA 3PPUA 4KX4A 4JBBA 1ZL9A 1V40A 3LFLA 5KEJA 4G0LA 4NAXA 2IL3A 4YAPA 4MF5A 4QMKA 1IYHA 4IELA 4ECCA 4I97A 1VF3A 2LJRA 3TGZA 2H1LA 1M0UA 4AKXB 4KH7A 3VURA 5ECMB 3R3EA 5ECNB 5D73A 2OT3A 3HJMA 4KF9A 1PKZA 2JL4A 3IBHA 5A4VA 2CAQA 3GSSA 2F3MA 1BX9A 3VPTA 3KJYA 2WJUA 1TW9A 3HKRA 3SWLA 5AGYA 3LSZA 1LBKA 2AAWA 4TOPA 2CA8A 2VD1A 2ON5A 3L0HA 2YCDA 2X64A 4PNGA 5ECLB 5G5EA 1GSEA 4NHZA 5EVOA 1JLWA 1PD21 3P8WA 3G7JA 2CAIA 2GSSA 4G0KA 5AIXA 2C3QA 4BVYA 1GNEA 1GSUA 1XWGA 3N5OA 3ISOA 3M0FA 4IKHA 4KAEA 4WR4A 1C72A 1GTIA 2HRKA 1M9BA 1GSQA 2R5GA 1USBA 3LG6A 3ERGA 5EY6A 3LYPA 2OADA 4L5LA 5F0GA 2GSQA 8GSSA 4L8EA 4RI6A 1GLPA 3AY8A 5DQSA 6GSTA 1EV9A 6GSVA 1PA3A 4ECJA 1EOGA 4Q5FA 1PGTA 4G10A 1K0MA 2UZ8A 3KMOA 4G0IA 6GSUA 3U6VA 1U87A 5DALA 1GUMA 3EE2A 1SVOA 4ZB9A 1YQ1A 3Q19A 4JZQA 2EFHA 7GSSA 3HJOA 4WR5A 3QR6A 20GSA 3W8SA 4MF6A 3VWXA 6GSXA 5F8BA 4OFMA 4G9HA 1B8XA 18GSA 1GULA 2VO4A 3GH6A 2HSMB 2IMIA 5JCUA 4ZBAA 1GTAA 4BL7B 3UBKA 4F0BA 3BBYA 4F0CA 4HOJA 1AQXA 1HQOA 4ID0A 1U3IA 4OFTA 1VF1A 2C3TA 4DEJA 5ECSA 2IMKA 1K0AA 1Y6EA 4IS0A 1Y1UA 1OYJA 2R4VA 1YDKA 4LMVA 2ON7A 5HFKA 2C8UA 1DUGA 3FR6A 3CRTA 3DD3A 3VI5A 3D0ZA 4USSA 2V6KA 1OE7A 4IW9A 2HNLA 3MAKA 1R5AA 3IK7A 1F2EA 4NHWA 3P90A 2AHEA 1GSSA 1OKTA 1V2AA 1PN9A 4MPFA 2HRAA 2C3NA 4RI7A 2CZ2A 5GSTA 1PL2A 2PVQA 6GSWA 2OACA 4E8EA 4YQMA 1MTCA 12GSA 1JZRA 3GTUB 3VI7A 5D9TA 4BVXA 6GSYA 1F3BA 5DCGA 4GSTA 4MDCA 2CVDA 4KSMA 1K0NA 1VF4A 1UA5A 1RK4A 4HJ2A 1YKCA 1XW5A 3QAGA 1G7OA 1Q4JA 3EINA 3KMNA 1GNWA 1N25A 3GURA 3HMJG 5A4WA 19GSA 1IYIA 4HZ4A 1G6WA 4Q5RA 2GTUA 5J4UA 5FHIA 1GLQA 1M99A 1BYEA 4JEDA 3LXZA 2N5FA 3M3MA 4K0NA 5ECOB 5ECPB 1EV4A 1GWCA 4GLTA 4IVFA 3PGTA 3TU3B 2HSNA 3F63A 1U88A 3ERFA 2FNOA 5A5HA 1TDIA 3M8NA 5BMUA 4YQUA 1N2AA 3WD6A 2VKZG 3ZMKA 3I6AA 2VCQA 1K3LA 4ACSA 3GUSA 3H1NA 3CSJA 4PGTA 2HSMA 2F8FA 2GDRA 5F06A 4AKHA 5J4YA 5ELAA 4BL7A 1AQVA 1JLVA 2GSTA 3VK9A 2YV9A 4GTUA 4J2FA 4IQ1A 4YH2A 5DAKB 5ELGA 4IJIA 4ZB6A 4ZBBA 1F3AA 4MZWA 3LJRA 2PERA 2GSRA 4ISDA 4PQHA 1BG5A 1BF5A 5F05A 3IR4A 1GTBA 3GSTA 3KTLA 4N0VA 4EC0A 3FR9A 3KXOA 3IC8A 4FQUA 4W66A 4ECBA 3KM6A 1GSYA 9GSSA 4K0GA 4CHSA 3GX0A 2GLRA 3LQ7A 5GZZB 13GSA 1B4PA 2HRKB 5EL8A 5DJLA 4KGIA 1Z9HA 4HI7A 4O7HA 5ECIB 2WS2A 1PKWA 3PR8A 5LD0A 1NHYA 2WRTA 4N3ZA 3GTUA 4IQAA 1EOHA 5DDLA 2PGTA 3G7IA 2VCWA 1K3OA 3CSHA 3RBTA 4GDFA 5A4UA 1ZGNA 1M9AA 3IK9A 5DJMA 2VCTA 5A34B 2VD0A 4PXOA 4PTSA 3ZFLA 5F07A 2R6KA 5AISA 4PUAA 17GSA 1GTUA 2VCXA 4GF0A 3UARA 5A1NB 3FYGA 3QAVA 3UAPA 3LYKA 1HNCA 2VCZA 4ZB7A 3TOTA 2EFCA 3N9JA 3UBLA 4OFNA 1AW9A 5G5FA 4AKGA 1KBNA 6GSSA 2DSAA 1K0DA 1EEMA 2EFDA 2HQTA 4PX1A 1BG1A 4PURA 5J40A 3F6FA 1FW1A 1PMTA 4YQVA 3FRCA 3Q74A 2PBJA 1XW6A 4KDYA 4GSNA 3Q18A 1E6BA 1A0FA 1FHEA 3CSIA 3I69A 4EDYA 3R2QA 1TU7A 4OMVA 5JCWA 5AN1A 1YY7A 4Q5NA 5ECQB 5D9XA 4LMWA 5FT3A 4ECIA 3QAWA 3VPQA 2DC5A 4MP4A 1TU8A 5DAKA 1VF2A 4IBPA 3DGQA 4PQIA 2C4JA 3CWGA 2WDUA 1K3YA 2YV7A 4AI6A 4KDUA 1GUHA 1HNAA 3WYWA 4E68A 4MPGA 5ECKB 4EXJA 1K0CA 2EFEA 4PNFA 1BAYA 1MD4A 3NIVA 1AXDA 4EDZA 1K0BA 3VLNA 2UV8G 1XWKA 3FR3A 3UVHA 2O5VA 4BVXB 3LXTA 4E8HA 4GSSA 3CBUA 1AQWA 3ZFBA 3FY7A 2FHEA 4MK3A 4YAVA 2A2RA 5J41A 4G01A 5LCZA 1K0OA 5J47A 3ZMLA 2D2ZA 1OE8A 4G19A 3C8EA 16GSA 4AGSA 4MF7A 3CRUA 5AIVA 1PX7A 1G6YA 1YVLA 2AB6A 4BVYB 2PMTA 5B7CA 1PX6A 4GCIA 3MDKA 14GSA 2HSNB 5A34A 1PL1A 2R3XA 4IGJA 4AKIA 22GSA 5A5HB 4L5OA 1TXUA 4Q5QA 4QQ7A 4ZBDA 5BMUB 2A2SA 1SVMA 5A1NA 1SVLA 5GSSA 4ZB8A 3M1GA 5ECRB 5IQYA 1GUKA 3IE3A 4F03A 2J9HA 1GSDA 3TOUA 1B48A 4KDXA 5D9WA 5J4VA 2VCVA 5FWGA 1HNBA 3O76A 4O92A 1YJ6A 1ML6A 5A5KA 4HZ2A 4ZXGA 1GSFA 4KE3A 2OA7A 10GSA 3F6DA 5DALB 2NTOA 1MD3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A1N B;  4W66 A;  5A34 A;  4AKG A;  5BMU B;  5A34 B;  4ZB7 A;  4AI6 A;  4AKI A;  4AKH A;  5A1N A;  5A5H A;  5A5H B; 
#chains in the Genus database with same CATH topology
 2CZ3 A;  5ECH B;  11GS A;  2C80 A;  4EE0 A;  1LJR A;  2WB9 A;  5D9V A;  2WW1 A;  5J5N A;  3O3T A;  3PPU A;  4KX4 A;  4JBB A;  1ZL9 A;  1V40 A;  3LFL A;  5KEJ A;  4G0L A;  4NAX A;  2IL3 A;  4YAP A;  4MF5 A;  4QMK A;  1IYH A;  4IEL A;  4ECC A;  4I97 A;  1VF3 A;  2LJR A;  3TGZ A;  2H1L A;  1M0U A;  4AKX B;  4KH7 A;  3VUR A;  5ECM B;  3R3E A;  5ECN B;  5D73 A;  2OT3 A;  3HJM A;  4KF9 A;  1PKZ A;  2JL4 A;  3IBH A;  5A4V A;  2CAQ A;  3GSS A;  2F3M A;  1BX9 A;  3VPT A;  3KJY A;  2WJU A;  1TW9 A;  3HKR A;  3SWL A;  5AGY A;  3LSZ A;  1LBK A;  2AAW A;  4TOP A;  2CA8 A;  2VD1 A;  2ON5 A;  3L0H A;  2YCD A;  2X64 A;  4PNG A;  5ECL B;  5G5E A;  1GSE A;  4NHZ A;  5EVO A;  1JLW A;  1PD2 1;  3P8W A;  3G7J A;  2CAI A;  2GSS A;  4G0K A;  5AIX A;  2C3Q A;  4BVY A;  1GNE A;  1GSU A;  1XWG A;  3N5O A;  3ISO A;  3M0F A;  4IKH A;  4KAE A;  4WR4 A;  1C72 A;  1GTI A;  2HRK A;  1M9B A;  1GSQ A;  2R5G A;  1USB A;  4PI0 C;  3LG6 A;  3ERG A;  5EY6 A;  3LYP A;  2OAD A;  4PHZ C;  4L5L A;  5F0G A;  2GSQ A;  8GSS A;  4L8E A;  4RI6 A;  1GLP A;  3AY8 A;  5DQS A;  6GST A;  1EV9 A;  6GSV A;  1PA3 A;  4ECJ A;  1EOG A;  4Q5F A;  1PGT A;  4G10 A;  1K0M A;  2UZ8 A;  3KMO A;  4G0I A;  2WVX B;  6GSU A;  3U6V A;  1U87 A;  5DAL A;  1GUM A;  3EE2 A;  1SVO A;  4ZB9 A;  1YQ1 A;  3Q19 A;  4JZQ A;  2EFH A;  7GSS A;  3HJO A;  2WVZ A;  2O3E A;  4WR5 A;  3QR6 A;  20GS A;  3W8S A;  4MF6 A;  3VWX A;  6GSX A;  5F8B A;  4OFM A;  4G9H A;  1B8X A;  18GS A;  1GUL A;  2VO4 A;  3GH6 A;  2HSM B;  2IMI A;  5JCU A;  4ZBA A;  1GTA A;  4BL7 B;  3UBK A;  4F0B A;  3BBY A;  4F0C A;  4HOJ A;  1AQX A;  1HQO A;  4ID0 A;  1U3I A;  4OFT A;  1VF1 A;  2C3T A;  4DEJ A;  5ECS A;  2IMK A;  1K0A A;  1Y6E A;  4IS0 A;  1Y1U A;  1OYJ A;  2R4V A;  1YDK A;  4LMV A;  2ON7 A;  5HFK A;  2C8U A;  1DUG A;  3FR6 A;  3CRT A;  3DD3 A;  3VI5 A;  3D0Z A;  4USS A;  2V6K A;  1OE7 A;  4IW9 A;  2HNL A;  3MAK A;  1R5A A;  3IK7 A;  1F2E A;  4NHW A;  3P90 A;  2AHE A;  1GSS A;  1OKT A;  1V2A A;  1PN9 A;  4MPF A;  2HRA A;  2C3N A;  4RI7 A;  2CZ2 A;  5GST A;  1PL2 A;  2PVQ A;  6GSW A;  2OAC A;  4E8E A;  4YQM A;  1MTC A;  12GS A;  1JZR A;  3GTU B;  3VI7 A;  5D9T A;  4BVX A;  6GSY A;  1F3B A;  4FXY P;  5DCG A;  4GST A;  4MDC A;  2CVD A;  4KSM A;  1K0N A;  1VF4 A;  1UA5 A;  1RK4 A;  4HJ2 A;  1YKC A;  1XW5 A;  3QAG A;  1G7O A;  1Q4J A;  3EIN A;  3KMN A;  1GNW A;  1N25 A;  3GUR A;  3HMJ G;  5A4W A;  19GS A;  1IYI A;  4HZ4 A;  1G6W A;  4Q5R A;  2GTU A;  5J4U A;  5FHI A;  1GLQ A;  1M99 A;  1BYE A;  4JED A;  3LXZ A;  2N5F A;  3M3M A;  4K0N A;  5ECO B;  5ECP B;  1EV4 A;  1GWC A;  4GLT A;  4IVF A;  2WVX A;  3PGT A;  3TU3 B;  2HSN A;  3F63 A;  1U88 A;  3ERF A;  2FNO A;  5A5H A;  1TDI A;  3M8N A;  2WW2 A;  5BMU A;  4YQU A;  1N2A A;  3WD6 A;  2VKZ G;  3ZMK A;  3I6A A;  2VCQ A;  1K3L A;  4ACS A;  3GUS A;  3H1N A;  3CSJ A;  4PGT A;  2HSM A;  2F8F A;  2GDR A;  5F06 A;  4AKH A;  5J4Y A;  5ELA A;  4BL7 A;  2O36 A;  1AQV A;  1JLV A;  2GST A;  3VK9 A;  2YV9 A;  4GTU A;  4J2F A;  4IQ1 A;  4YH2 A;  5DAK B;  5ELG A;  4IJI A;  1YEW C;  4ZB6 A;  4ZBB A;  1F3A A;  4MZW A;  3LJR A;  2PER A;  2GSR A;  4ISD A;  4PQH A;  1BG5 A;  1BF5 A;  5F05 A;  3IR4 A;  1GTB A;  3GST A;  3KTL A;  4N0V A;  4EC0 A;  3FR9 A;  3KXO A;  3IC8 A;  4FQU A;  4W66 A;  4ECB A;  3KM6 A;  2WVY A;  1GSY A;  9GSS A;  4K0G A;  4CHS A;  3GX0 A;  2GLR A;  3LQ7 A;  5GZZ B;  13GS A;  1B4P A;  2HRK B;  5EL8 A;  5DJL A;  4KGI A;  1Z9H A;  4HI7 A;  4O7H A;  5ECI B;  2WS2 A;  1PKW A;  3PR8 A;  5LD0 A;  1NHY A;  2WRT A;  4N3Z A;  3GTU A;  4IQA A;  1EOH A;  5DDL A;  2PGT A;  3G7I A;  2VCW A;  1K3O A;  3CSH A;  3RBT A;  4GDF A;  1I1I P;  5A4U A;  1ZGN A;  1M9A A;  3IK9 A;  5DJM A;  2VCT A;  5A34 B;  2VD0 A;  4PXO A;  4PTS A;  3ZFL A;  2WZS A;  5F07 A;  2R6K A;  5AIS A;  4PUA A;  17GS A;  1GTU A;  2VCX A;  4GF0 A;  3UAR A;  5A1N B;  3FYG A;  3QAV A;  3UAP A;  3LYK A;  1HNC A;  2VCZ A;  4ZB7 A;  3TOT A;  2EFC A;  3N9J A;  3UBL A;  4OFN A;  1AW9 A;  5G5F A;  4AKG A;  1KBN A;  6GSS A;  2DSA A;  1K0D A;  1EEM A;  2EFD A;  2HQT A;  4PX1 A;  1BG1 A;  4PUR A;  5J40 A;  3F6F A;  1FW1 A;  1PMT A;  4YQV A;  3FRC A;  3Q74 A;  2PBJ A;  1XW6 A;  4KDY A;  4GSN A;  3Q18 A;  1E6B A;  1A0F A;  1FHE A;  3CSI A;  3I69 A;  4EDY A;  3R2Q A;  1TU7 A;  4OMV A;  3RGB C;  5JCW A;  5AN1 A;  1YY7 A;  4Q5N A;  5ECQ B;  5D9X A;  4LMW A;  5FT3 A;  4ECI A;  3QAW A;  3VPQ A;  2DC5 A;  4MP4 A;  1TU8 A;  5DAK A;  1VF2 A;  4IBP A;  3DGQ A;  4PQI A;  2C4J A;  3CWG A;  2WDU A;  1K3Y A;  2YV7 A;  4AI6 A;  4KDU A;  1GUH A;  1HNA A;  3WYW A;  4E68 A;  4MPG A;  5ECK B;  4EXJ A;  1K0C A;  2EFE A;  4PNF A;  1BAY A;  1MD4 A;  3NIV A;  1AXD A;  4EDZ A;  1K0B A;  3VLN A;  2UV8 G;  1XWK A;  3FR3 A;  3UVH A;  2O5V A;  4BVX B;  3LXT A;  4E8H A;  4GSS A;  3CBU A;  1AQW A;  4PI2 C;  3ZFB A;  3FY7 A;  2FHE A;  4MK3 A;  4YAV A;  2A2R A;  5J41 A;  4G01 A;  5LCZ A;  1K0O A;  5J47 A;  3ZML A;  2D2Z A;  1OE8 A;  4G19 A;  3C8E A;  16GS A;  4AGS A;  4MF7 A;  3CRU A;  5AIV A;  1PX7 A;  1G6Y A;  1YVL A;  2AB6 A;  4BVY B;  2PMT A;  5B7C A;  1PX6 A;  4GCI A;  3MDK A;  14GS A;  2HSN B;  5A34 A;  3RFR C;  1PL1 A;  2R3X A;  4IGJ A;  4AKI A;  22GS A;  5A5H B;  4L5O A;  1TXU A;  4Q5Q A;  4QQ7 A;  4ZBD A;  5BMU B;  2A2S A;  1SVM A;  5A1N A;  1SVL A;  5GSS A;  4ZB8 A;  3M1G A;  1S4B P;  5ECR B;  5IQY A;  1GUK A;  2WW3 A;  3IE3 A;  2WW0 A;  4F03 A;  2J9H A;  1GSD A;  3TOU A;  1B48 A;  4KDX A;  5D9W A;  5J4V A;  2VCV A;  5FWG A;  1HNB A;  3CHX C;  3O76 A;  4O92 A;  1YJ6 A;  1ML6 A;  5A5K A;  4HZ2 A;  4ZXG A;  1GSF A;  4KE3 A;  2OA7 A;  10GS A;  3F6D A;  5DAL B;  2NTO A;  1MD3 A; 
#chains in the Genus database with same CATH homology
 2CZ3 A;  5ECH B;  11GS A;  2C80 A;  4EE0 A;  1LJR A;  2WB9 A;  5D9V A;  5J5N A;  3O3T A;  3PPU A;  4KX4 A;  4JBB A;  1ZL9 A;  1V40 A;  3LFL A;  5KEJ A;  4G0L A;  4NAX A;  2IL3 A;  4YAP A;  4MF5 A;  4QMK A;  1IYH A;  4IEL A;  4ECC A;  4I97 A;  1VF3 A;  2LJR A;  3TGZ A;  2H1L A;  1M0U A;  4AKX B;  4KH7 A;  3VUR A;  5ECM B;  3R3E A;  5ECN B;  5D73 A;  2OT3 A;  3HJM A;  4KF9 A;  1PKZ A;  2JL4 A;  3IBH A;  5A4V A;  2CAQ A;  3GSS A;  2F3M A;  1BX9 A;  3VPT A;  3KJY A;  2WJU A;  1TW9 A;  3HKR A;  3SWL A;  5AGY A;  3LSZ A;  1LBK A;  2AAW A;  4TOP A;  2CA8 A;  2VD1 A;  2ON5 A;  3L0H A;  2YCD A;  2X64 A;  4PNG A;  5ECL B;  5G5E A;  1GSE A;  4NHZ A;  5EVO A;  1JLW A;  1PD2 1;  3P8W A;  3G7J A;  2CAI A;  2GSS A;  4G0K A;  5AIX A;  2C3Q A;  4BVY A;  1GNE A;  1GSU A;  1XWG A;  3N5O A;  3ISO A;  3M0F A;  4IKH A;  4KAE A;  4WR4 A;  1C72 A;  1GTI A;  2HRK A;  1M9B A;  1GSQ A;  2R5G A;  1USB A;  3LG6 A;  3ERG A;  5EY6 A;  3LYP A;  2OAD A;  4L5L A;  5F0G A;  2GSQ A;  8GSS A;  4L8E A;  4RI6 A;  1GLP A;  3AY8 A;  5DQS A;  6GST A;  1EV9 A;  6GSV A;  1PA3 A;  4ECJ A;  1EOG A;  4Q5F A;  1PGT A;  4G10 A;  1K0M A;  2UZ8 A;  3KMO A;  4G0I A;  6GSU A;  3U6V A;  1U87 A;  5DAL A;  1GUM A;  3EE2 A;  1SVO A;  4ZB9 A;  1YQ1 A;  3Q19 A;  4JZQ A;  2EFH A;  7GSS A;  3HJO A;  4WR5 A;  3QR6 A;  20GS A;  3W8S A;  4MF6 A;  3VWX A;  6GSX A;  5F8B A;  4OFM A;  4G9H A;  1B8X A;  18GS A;  1GUL A;  2VO4 A;  3GH6 A;  2HSM B;  2IMI A;  5JCU A;  4ZBA A;  1GTA A;  4BL7 B;  3UBK A;  4F0B A;  3BBY A;  4F0C A;  4HOJ A;  1AQX A;  1HQO A;  4ID0 A;  1U3I A;  4OFT A;  1VF1 A;  2C3T A;  4DEJ A;  5ECS A;  2IMK A;  1K0A A;  1Y6E A;  4IS0 A;  1Y1U A;  1OYJ A;  2R4V A;  1YDK A;  4LMV A;  2ON7 A;  5HFK A;  2C8U A;  1DUG A;  3FR6 A;  3CRT A;  3DD3 A;  3VI5 A;  3D0Z A;  4USS A;  2V6K A;  1OE7 A;  4IW9 A;  2HNL A;  3MAK A;  1R5A A;  3IK7 A;  1F2E A;  4NHW A;  3P90 A;  2AHE A;  1GSS A;  1OKT A;  1V2A A;  1PN9 A;  4MPF A;  2HRA A;  2C3N A;  4RI7 A;  2CZ2 A;  5GST A;  1PL2 A;  2PVQ A;  6GSW A;  2OAC A;  4E8E A;  4YQM A;  1MTC A;  12GS A;  1JZR A;  3GTU B;  3VI7 A;  5D9T A;  4BVX A;  6GSY A;  1F3B A;  5DCG A;  4GST A;  4MDC A;  2CVD A;  4KSM A;  1K0N A;  1VF4 A;  1UA5 A;  1RK4 A;  4HJ2 A;  1YKC A;  1XW5 A;  3QAG A;  1G7O A;  1Q4J A;  3EIN A;  3KMN A;  1GNW A;  1N25 A;  3GUR A;  3HMJ G;  5A4W A;  19GS A;  1IYI A;  4HZ4 A;  1G6W A;  4Q5R A;  2GTU A;  5J4U A;  5FHI A;  1GLQ A;  1M99 A;  1BYE A;  4JED A;  3LXZ A;  2N5F A;  3M3M A;  4K0N A;  5ECO B;  5ECP B;  1EV4 A;  1GWC A;  4GLT A;  4IVF A;  3PGT A;  3TU3 B;  2HSN A;  3F63 A;  1U88 A;  3ERF A;  2FNO A;  5A5H A;  1TDI A;  3M8N A;  5BMU A;  4YQU A;  1N2A A;  3WD6 A;  2VKZ G;  3ZMK A;  3I6A A;  2VCQ A;  1K3L A;  4ACS A;  3GUS A;  3H1N A;  3CSJ A;  4PGT A;  2HSM A;  2F8F A;  2GDR A;  5F06 A;  4AKH A;  5J4Y A;  5ELA A;  4BL7 A;  1AQV A;  1JLV A;  2GST A;  3VK9 A;  2YV9 A;  4GTU A;  4J2F A;  4IQ1 A;  4YH2 A;  5DAK B;  5ELG A;  4IJI A;  4ZB6 A;  4ZBB A;  1F3A A;  4MZW A;  3LJR A;  2PER A;  2GSR A;  4ISD A;  4PQH A;  1BG5 A;  1BF5 A;  5F05 A;  3IR4 A;  1GTB A;  3GST A;  3KTL A;  4N0V A;  4EC0 A;  3FR9 A;  3KXO A;  3IC8 A;  4FQU A;  4W66 A;  4ECB A;  3KM6 A;  1GSY A;  9GSS A;  4K0G A;  4CHS A;  3GX0 A;  2GLR A;  3LQ7 A;  5GZZ B;  13GS A;  1B4P A;  2HRK B;  5EL8 A;  5DJL A;  4KGI A;  1Z9H A;  4HI7 A;  4O7H A;  5ECI B;  2WS2 A;  1PKW A;  3PR8 A;  5LD0 A;  1NHY A;  2WRT A;  4N3Z A;  3GTU A;  4IQA A;  1EOH A;  5DDL A;  2PGT A;  3G7I A;  2VCW A;  1K3O A;  3CSH A;  3RBT A;  4GDF A;  5A4U A;  1ZGN A;  1M9A A;  3IK9 A;  5DJM A;  2VCT A;  5A34 B;  2VD0 A;  4PXO A;  4PTS A;  3ZFL A;  5F07 A;  2R6K A;  5AIS A;  4PUA A;  17GS A;  1GTU A;  2VCX A;  4GF0 A;  3UAR A;  5A1N B;  3FYG A;  3QAV A;  3UAP A;  3LYK A;  1HNC A;  2VCZ A;  4ZB7 A;  3TOT A;  2EFC A;  3N9J A;  3UBL A;  4OFN A;  1AW9 A;  5G5F A;  4AKG A;  1KBN A;  6GSS A;  2DSA A;  1K0D A;  1EEM A;  2EFD A;  2HQT A;  4PX1 A;  1BG1 A;  4PUR A;  5J40 A;  3F6F A;  1FW1 A;  1PMT A;  4YQV A;  3FRC A;  3Q74 A;  2PBJ A;  1XW6 A;  4KDY A;  4GSN A;  3Q18 A;  1E6B A;  1A0F A;  1FHE A;  3CSI A;  3I69 A;  4EDY A;  3R2Q A;  1TU7 A;  4OMV A;  5JCW A;  5AN1 A;  1YY7 A;  4Q5N A;  5ECQ B;  5D9X A;  4LMW A;  5FT3 A;  4ECI A;  3QAW A;  3VPQ A;  2DC5 A;  4MP4 A;  1TU8 A;  5DAK A;  1VF2 A;  4IBP A;  3DGQ A;  4PQI A;  2C4J A;  3CWG A;  2WDU A;  1K3Y A;  2YV7 A;  4AI6 A;  4KDU A;  1GUH A;  1HNA A;  3WYW A;  4E68 A;  4MPG A;  5ECK B;  4EXJ A;  1K0C A;  2EFE A;  4PNF A;  1BAY A;  1MD4 A;  3NIV A;  1AXD A;  4EDZ A;  1K0B A;  3VLN A;  2UV8 G;  1XWK A;  3FR3 A;  3UVH A;  2O5V A;  4BVX B;  3LXT A;  4E8H A;  4GSS A;  3CBU A;  1AQW A;  3ZFB A;  3FY7 A;  2FHE A;  4MK3 A;  4YAV A;  2A2R A;  5J41 A;  4G01 A;  5LCZ A;  1K0O A;  5J47 A;  3ZML A;  2D2Z A;  1OE8 A;  4G19 A;  3C8E A;  16GS A;  4AGS A;  4MF7 A;  3CRU A;  5AIV A;  1PX7 A;  1G6Y A;  1YVL A;  2AB6 A;  4BVY B;  2PMT A;  5B7C A;  1PX6 A;  4GCI A;  3MDK A;  14GS A;  2HSN B;  5A34 A;  1PL1 A;  2R3X A;  4IGJ A;  4AKI A;  22GS A;  5A5H B;  4L5O A;  1TXU A;  4Q5Q A;  4QQ7 A;  4ZBD A;  5BMU B;  2A2S A;  1SVM A;  5A1N A;  1SVL A;  5GSS A;  4ZB8 A;  3M1G A;  5ECR B;  5IQY A;  1GUK A;  3IE3 A;  4F03 A;  2J9H A;  1GSD A;  3TOU A;  1B48 A;  4KDX A;  5D9W A;  5J4V A;  2VCV A;  5FWG A;  1HNB A;  3O76 A;  4O92 A;  1YJ6 A;  1ML6 A;  5A5K A;  4HZ2 A;  4ZXG A;  1GSF A;  4KE3 A;  2OA7 A;  10GS A;  3F6D A;  5DAL B;  2NTO A;  1MD3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...