4ZB7A

Phanerochaete chrysosporium ure2p6 in apo form.
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
216
structure length
171
Chain Sequence
GKQFTLYTHKGGPNGWKVTIVLEELGLTYESIFLRIPALIDHKNNDYTVWESNAIIQYLVDKYDKDRKVSVAPGTNEYYTQLQWLYFQASGQGYRNEIKRVLGVLESVLSKQEFLVDGKATVADFSFLPWNEGAAKFGSQFEEEFPATAKWHKKLLERPAIAKVWEERAKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PcUre2p6
publication title Evolutionary divergence of Ure2pA glutathione transferases in wood degrading fungi.
pubmed doi rcsb
source organism Phanerochaete chrysosporium
molecule tags Transferase
total genus 63
structure length 171
sequence length 216
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.130 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4zb7A00
5A5HA 4W66A 5BMUB 4AKHA 5A34B 4AKIA 5A34A 4ZB7A 4AI6A 5A1NB 4AKGA 5A1NA 5A5HB
chains in the Genus database with same CATH superfamily
2WVXB 1Y6EA 4YH2A 19GSA 2EFDA 2EFHA 1FHEA 1GUHA 1OE7A 4PNFA 4ZXGA 1V2AA 1IYIA 1JZRA 4BVYA 1GTUA 5ELGA 4EXJA 5AN1A 3Q18A 3LYPA 2FNOA 4NHZA 4KSMA 2FHEA 3FR6A 1FW1A 5ECMB 4ISDA 4MPFA 4ACSA 4JBBA 4L5OA 3PR8A 1SVMA 4G01A 4WR4A 3HMJG 1EV9A 1Q4JA 4GTUA 4PXOA 4PHZC 3SWLA 1GSYA 2C3TA 1PKWA 1N25A 1RK4A 4K0NA 6GSUA 2EFCA 5BMUB 2UZ8A 3GURA 3LG6A 1GWCA 2F8FA 4ZBBA 4BVXB 1AXDA 3I69A 1M0UA 4ZB7A 2CAQA 2YV7A 3UBKA 1I1IP 18GSA 4WR5A 2OT3A 1BAYA 1OYJA 5ECSA 5F05A 6GSWA 1HNBA 4AKXB 2ON5A 1PA3A 1BG5A 2C3NA 1YQ1A 5A5HA 1YJ6A 4BL7B 14GSA 1BYEA 1GLPA 13GSA 1K3LA 3FR9A 4MF7A 3VI5A 2AAWA 1U3IA 5FWGA 16GSA 4MF6A 3VPQA 1SVLA 1S4BP 5DDLA 1Z9HA 4PURA 2VKZG 1HNCA 3ERGA 1M99A 2WZSA 2PGTA 3CWGA 3IBHA 2WVZA 2WW3A 4IBPA 4PUAA 3LYKA 4YAVA 3F63A 3M1GA 2IL3A 4LMWA 4Q5QA 1JLVA 20GSA 3LXZA 4I97A 5F07A 1GSDA 1PMTA 2VCWA 4OMVA 3UBLA 3F6DA 3RBTA 4QQ7A 1K3OA 3MAKA 3ERFA 5ECIB 1GSUA 1LJRA 2R4VA 5DJMA 6GSYA 4KDXA 3IR4A 4KAEA 4IKHA 2VCVA 2WRTA 1SVOA 4E8EA 1GLQA 1TXUA 1GUKA 3EE2A 4GSNA 4OFMA 3D0ZA 3TOTA 1ML6A 3VPTA 3P90A 4LMVA 4Q5FA 1K3YA 2PVQA 5J40A 5J4UA 3RFRC 3L0HA 3P8WA 4G9HA 1IYHA 5F06A 4QMKA 1PKZA 5D73A 5F0GA 1G7OA 4IGJA 5DAKB 2R6KA 3DD3A 4PQIA 2HQTA 1GNWA 5F8BA 4AI6A 4IS0A 2HSNA 4ZBDA 5JCUA 2OADA 1PL2A 3QR6A 4KX4A 1GULA 4HI7A 5ECPB 5DALB 1B8XA 4TOPA 2OA7A 3KTLA 3Q74A 1TW9A 2AB6A 2GSRA 4ZB9A 4W66A 5AIVA 5J47A 4MF5A 6GSTA 2C8UA 4GDFA 4AGSA 4EDYA 2NTOA 1AW9A 4IQAA 3M3MA 5HFKA 1YDKA 2JL4A 8GSSA 1PX6A 1YEWC 3M0FA 4K0GA 3RGBC 3GTUB 3CBUA 5A4WA 1XWGA 4PNGA 5BMUA 2CA8A 4RI6A 5ECLB 4DEJA 1BX9A 3FR3A 4YAPA 2R5GA 2GDRA 4JEDA 2UV8G 1HNAA 5ECHB 3IK7A 1GSFA 5DCGA 4AKGA 1YVLA 5FT3A 2HRAA 3GSTA 4J2FA 4F03A 3LXTA 2X64A 5EY6A 3O3TA 4G0KA 2ON7A 3CRUA 2IMKA 2VD1A 5FHIA 3N5OA 1TU7A 1EV4A 3HJMA 1EEMA 1MD4A 1MTCA 1G6WA 3VWXA 2CZ2A 3CSHA 3N9JA 1VF4A 1GTBA 4OFNA 3ZMKA 5GSSA 3WYWA 4F0CA 11GSA 2YCDA 4KDUA 4KH7A 1AQVA 2O36A 1GUMA 5B7CA 2PBJA 2DC5A 2VCTA 1TDIA 1V40A 4O7HA 5D9XA 2LJRA 1USBA 5A4UA 2WW1A 4GLTA 3EINA 1PX7A 2GSSA 3FYGA 5AISA 3ZFBA 4RI7A 1E6BA 4HZ2A 4ZBAA 4KGIA 2O3EA 4E68A 1JLWA 2VD0A 1MD3A 4KDYA 2O5VA 3C8EA 3QAGA 4MZWA 1XWKA 2GLRA 5J4VA 3LSZA 3O76A 2J9HA 1PN9A 3VURA 4JZQA 1G6YA 1LBKA 1GSEA 3CRTA 2CZ3A 2V6KA 5ECQB 4ECCA 4PGTA 1K0AA 1ZGNA 1GTAA 3VK9A 4YQVA 1YY7A 5J41A 4N0VA 1UA5A 4IELA 4GF0A 3GUSA 3LJRA 3TGZA 2HRKB 1BG1A 4NAXA 3GH6A 3CHXC 4FQUA 4IQ1A 1B48A 4ECBA 1TU8A 1K0BA 2F3MA 2A2SA 2GTUA 5D9WA 5ECRB 1VF2A 1N2AA 3F6FA 4EC0A 5D9TA 3M8NA 4ZB8A 2WVXA 3KM6A 5A1NB 4G0LA 4MP4A 2AHEA 3MDKA 1EOGA 4HZ4A 4ZB6A 3G7IA 2OACA 5A34B 1K0CA 2C3QA 3GTUA 5KEJA 3NIVA 3FY7A 2WDUA 4AKHA 6GSVA 3CSIA 4HOJA 3BBYA 4KE3A 3IK9A 3KXOA 3GSSA 4G10A 4MDCA 1EOHA 4HJ2A 3TU3B 4F0BA 4G0IA 3DGQA 3PPUA 4FXYP 4Q5RA 5EVOA 3UVHA 12GSA 4GCIA 4BVXA 2HSMB 5A5KA 1F3AA 3G7JA 3R3EA 1DUGA 1K0OA 5D9VA 5G5EA 3VI7A 2WW2A 1VF1A 2YV9A 5ECNB 3ISOA 1K0DA 4BVYB 5ECKB 2GSTA 2VCZA 4IVFA 4USSA 2HNLA 4BL7A 3UARA 4GSTA 1HQOA 1NHYA 3IE3A 2EFEA 7GSSA 1GSQA 2N5FA 2R3XA 1M9AA 1OE8A 2WB9A 4O92A 3PGTA 2CAIA 5GSTA 2D2ZA 1R5AA 1U88A 2WJUA 4N3ZA 2VCQA 4CHSA 1Y1UA 2WW0A 4Q5NA 3ZFLA 1B4PA 3HKRA 3QAWA 1K0NA 1U87A 4PQHA 5A4VA 5LD0A 4MPGA 5J5NA 3KMNA 3FRCA 3KMOA 1AQXA 3Q19A 5AGYA 5A5HB 1XW5A 2H1LA 4PI2C 4EE0A 2CVDA 1A0FA 1ZL9A 1F3BA 4L5LA 3GX0A 5DQSA 1GTIA 1PGTA 1GNEA 5LCZA 2WS2A 4MK3A 5G5FA 3R2QA 6GSSA 2DSAA 6GSXA 4IW9A 1K0MA 2IMIA 4PX1A 4ECIA 4L8EA 3IC8A 1OKTA 3UAPA 3WD6A 4PTSA 2C4JA 1GSSA 2WVYA 5DAKA 2HRKA 3CSJA 4YQMA 1XW6A 2GSQA 1YKCA 1PL1A 2PMTA 4PI0C 5EL8A 3LQ7A 3W8SA 4KF9A 5JCWA 5ELAA 3AY8A 2C80A 2VCXA 5DALA 5GZZB 4OFTA 4EDZA 5J4YA 10GSA 3H1NA 5A1NA 2A2RA 4ECJA 1PD21 3I6AA 3TOUA 4E8HA 3ZMLA 5AIXA 5DJLA 5A34A 3VLNA 2VO4A 9GSSA 5ECOB 1AQWA 17GSA 3HJOA 5IQYA 4ID0A 4YQUA 3LFLA 3QAVA 4GSSA 4AKIA 1C72A 1KBNA 3KJYA 4G19A 4IJIA 3U6VA 1M9BA 1BF5A 2PERA 2HSNB 1VF3A 22GSA 2HSMA 1F2EA 4NHWA
chains in the Genus database with same CATH topology
1Y6EA 4YH2A 19GSA 2EFDA 2EFHA 1FHEA 1GUHA 1OE7A 4PNFA 4ZXGA 1V2AA 1IYIA 1JZRA 4BVYA 1GTUA 5ELGA 4EXJA 5AN1A 3Q18A 3LYPA 2FNOA 4NHZA 4KSMA 2FHEA 3FR6A 1FW1A 5ECMB 4ISDA 4MPFA 4ACSA 4JBBA 4L5OA 3PR8A 1SVMA 4G01A 4WR4A 3HMJG 1EV9A 1Q4JA 4GTUA 4PXOA 3SWLA 1GSYA 2C3TA 1PKWA 1N25A 1RK4A 4K0NA 6GSUA 2EFCA 5BMUB 2UZ8A 3GURA 3LG6A 1GWCA 2F8FA 4ZBBA 4BVXB 1AXDA 3I69A 1M0UA 4ZB7A 2CAQA 2YV7A 3UBKA 18GSA 4WR5A 2OT3A 1BAYA 1OYJA 5ECSA 5F05A 6GSWA 1HNBA 4AKXB 2ON5A 1PA3A 1BG5A 2C3NA 1YQ1A 5A5HA 1YJ6A 4BL7B 14GSA 1BYEA 1GLPA 13GSA 1K3LA 3FR9A 4MF7A 3VI5A 2AAWA 1U3IA 5FWGA 16GSA 4MF6A 3VPQA 1SVLA 5DDLA 1Z9HA 4PURA 2VKZG 1HNCA 3ERGA 1M99A 2PGTA 3CWGA 3IBHA 4IBPA 4PUAA 3LYKA 4YAVA 3F63A 3M1GA 2IL3A 4LMWA 4Q5QA 1JLVA 20GSA 3LXZA 4I97A 5F07A 1GSDA 1PMTA 2VCWA 4OMVA 3UBLA 3F6DA 3RBTA 4QQ7A 1K3OA 3MAKA 3ERFA 5ECIB 1GSUA 1LJRA 2R4VA 5DJMA 6GSYA 4KDXA 3IR4A 4KAEA 4IKHA 2VCVA 2WRTA 1SVOA 4E8EA 1GLQA 1TXUA 1GUKA 3EE2A 4GSNA 4OFMA 3D0ZA 3TOTA 1ML6A 3VPTA 3P90A 4LMVA 4Q5FA 1K3YA 2PVQA 5J40A 5J4UA 3L0HA 3P8WA 4G9HA 1IYHA 5F06A 4QMKA 1PKZA 5D73A 5F0GA 1G7OA 4IGJA 5DAKB 2R6KA 3DD3A 4PQIA 2HQTA 1GNWA 5F8BA 4AI6A 4IS0A 2HSNA 4ZBDA 5JCUA 2OADA 1PL2A 3QR6A 4KX4A 1GULA 4HI7A 5ECPB 5DALB 1B8XA 4TOPA 2OA7A 3KTLA 3Q74A 1TW9A 2AB6A 2GSRA 4ZB9A 4W66A 5AIVA 5J47A 4MF5A 6GSTA 2C8UA 4GDFA 4AGSA 4EDYA 2NTOA 1AW9A 4IQAA 3M3MA 5HFKA 1YDKA 2JL4A 8GSSA 1PX6A 3M0FA 4K0GA 3GTUB 3CBUA 5A4WA 1XWGA 4PNGA 5BMUA 2CA8A 4RI6A 5ECLB 4DEJA 1BX9A 3FR3A 4YAPA 2R5GA 2GDRA 4JEDA 2UV8G 1HNAA 5ECHB 3IK7A 1GSFA 5DCGA 4AKGA 1YVLA 5FT3A 2HRAA 3GSTA 4J2FA 4F03A 3LXTA 2X64A 5EY6A 3O3TA 4G0KA 2ON7A 3CRUA 2IMKA 2VD1A 5FHIA 3N5OA 1TU7A 1EV4A 3HJMA 1EEMA 1MD4A 1MTCA 1G6WA 3VWXA 2CZ2A 3CSHA 3N9JA 1VF4A 1GTBA 4OFNA 3ZMKA 5GSSA 3WYWA 4F0CA 11GSA 2YCDA 4KDUA 4KH7A 1AQVA 1GUMA 5B7CA 2PBJA 2DC5A 2VCTA 1TDIA 1V40A 4O7HA 5D9XA 2LJRA 1USBA 5A4UA 4GLTA 3EINA 1PX7A 2GSSA 3FYGA 5AISA 3ZFBA 4RI7A 1E6BA 4HZ2A 4ZBAA 4KGIA 4E68A 1JLWA 2VD0A 1MD3A 4KDYA 2O5VA 3C8EA 3QAGA 4MZWA 1XWKA 2GLRA 5J4VA 3LSZA 3O76A 2J9HA 1PN9A 3VURA 4JZQA 1G6YA 1LBKA 1GSEA 3CRTA 2CZ3A 2V6KA 5ECQB 4ECCA 4PGTA 1K0AA 1ZGNA 1GTAA 3VK9A 4YQVA 1YY7A 5J41A 4N0VA 1UA5A 4IELA 4GF0A 3GUSA 3LJRA 3TGZA 2HRKB 1BG1A 4NAXA 3GH6A 4FQUA 4IQ1A 4ECBA 1B48A 1TU8A 1K0BA 2F3MA 2A2SA 2GTUA 5D9WA 5ECRB 1VF2A 1N2AA 3F6FA 4EC0A 5D9TA 3M8NA 4ZB8A 3KM6A 5A1NB 4G0LA 4MP4A 2AHEA 3MDKA 1EOGA 4HZ4A 4ZB6A 3G7IA 2OACA 5A34B 1K0CA 2C3QA 3GTUA 5KEJA 3NIVA 3FY7A 2WDUA 4AKHA 6GSVA 3CSIA 4HOJA 3BBYA 4KE3A 3IK9A 3KXOA 3GSSA 4G10A 4MDCA 1EOHA 4HJ2A 3TU3B 4F0BA 4G0IA 3DGQA 3PPUA 4Q5RA 5EVOA 3UVHA 12GSA 4GCIA 4BVXA 2HSMB 5A5KA 1F3AA 3G7JA 3R3EA 1DUGA 1K0OA 5D9VA 5G5EA 3VI7A 1VF1A 2YV9A 5ECNB 3ISOA 1K0DA 4BVYB 5ECKB 2GSTA 2VCZA 4IVFA 4USSA 2HNLA 4BL7A 3UARA 4GSTA 1HQOA 1NHYA 3IE3A 2EFEA 7GSSA 1GSQA 2N5FA 2R3XA 1M9AA 1OE8A 2WB9A 4O92A 3PGTA 2CAIA 5GSTA 2D2ZA 1R5AA 1U88A 2WJUA 4N3ZA 2VCQA 4CHSA 1Y1UA 4Q5NA 3ZFLA 1B4PA 3HKRA 3QAWA 1K0NA 1U87A 4PQHA 5A4VA 5LD0A 4MPGA 5J5NA 3KMNA 3FRCA 3KMOA 1AQXA 3Q19A 5AGYA 5A5HB 1XW5A 2H1LA 4EE0A 2CVDA 1A0FA 1ZL9A 1F3BA 4L5LA 3GX0A 5DQSA 1GTIA 1PGTA 1GNEA 5LCZA 2WS2A 4MK3A 5G5FA 3R2QA 6GSSA 2DSAA 6GSXA 4IW9A 1K0MA 2IMIA 4PX1A 4ECIA 4L8EA 3IC8A 1OKTA 3UAPA 3WD6A 4PTSA 2C4JA 1GSSA 5DAKA 2HRKA 3CSJA 4YQMA 1XW6A 2GSQA 1YKCA 1PL1A 2PMTA 5EL8A 3LQ7A 3W8SA 4KF9A 5JCWA 5ELAA 3AY8A 2C80A 2VCXA 5DALA 5GZZB 4OFTA 4EDZA 5J4YA 10GSA 3H1NA 5A1NA 2A2RA 4ECJA 1PD21 3I6AA 3TOUA 4E8HA 3ZMLA 5AIXA 5DJLA 5A34A 3VLNA 2VO4A 9GSSA 5ECOB 1AQWA 17GSA 3HJOA 5IQYA 4ID0A 4YQUA 3LFLA 3QAVA 4GSSA 4AKIA 1C72A 1KBNA 3KJYA 4G19A 4IJIA 3U6VA 1M9BA 1BF5A 2PERA 2HSNB 1VF3A 22GSA 2HSMA 1F2EA 4NHWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A5H A;  4W66 A;  5BMU B;  4AKH A;  5A34 B;  4AKI A;  5A34 A;  4ZB7 A;  4AI6 A;  5A1N B;  4AKG A;  5A1N A;  5A5H B; 
#chains in the Genus database with same CATH topology
 2WVX B;  1Y6E A;  4YH2 A;  19GS A;  2EFD A;  2EFH A;  1FHE A;  1GUH A;  1OE7 A;  4PNF A;  4ZXG A;  1V2A A;  1IYI A;  1JZR A;  4BVY A;  1GTU A;  5ELG A;  4EXJ A;  5AN1 A;  3Q18 A;  3LYP A;  2FNO A;  4NHZ A;  4KSM A;  2FHE A;  3FR6 A;  1FW1 A;  5ECM B;  4ISD A;  4MPF A;  4ACS A;  4JBB A;  4L5O A;  3PR8 A;  1SVM A;  4G01 A;  4WR4 A;  3HMJ G;  1EV9 A;  1Q4J A;  4GTU A;  4PXO A;  4PHZ C;  3SWL A;  1GSY A;  2C3T A;  1PKW A;  1N25 A;  1RK4 A;  4K0N A;  6GSU A;  2EFC A;  5BMU B;  2UZ8 A;  3GUR A;  3LG6 A;  1GWC A;  2F8F A;  4ZBB A;  4BVX B;  1AXD A;  3I69 A;  1M0U A;  4ZB7 A;  2CAQ A;  2YV7 A;  3UBK A;  1I1I P;  18GS A;  4WR5 A;  2OT3 A;  1BAY A;  1OYJ A;  5ECS A;  5F05 A;  6GSW A;  1HNB A;  4AKX B;  2ON5 A;  1PA3 A;  1BG5 A;  2C3N A;  1YQ1 A;  5A5H A;  1YJ6 A;  4BL7 B;  14GS A;  1BYE A;  1GLP A;  13GS A;  1K3L A;  3FR9 A;  4MF7 A;  3VI5 A;  2AAW A;  1U3I A;  5FWG A;  16GS A;  4MF6 A;  3VPQ A;  1SVL A;  1S4B P;  5DDL A;  1Z9H A;  4PUR A;  2VKZ G;  1HNC A;  3ERG A;  1M99 A;  2WZS A;  2PGT A;  3CWG A;  3IBH A;  2WVZ A;  2WW3 A;  4IBP A;  4PUA A;  3LYK A;  4YAV A;  3F63 A;  3M1G A;  2IL3 A;  4LMW A;  4Q5Q A;  1JLV A;  20GS A;  3LXZ A;  4I97 A;  5F07 A;  1GSD A;  1PMT A;  2VCW A;  4OMV A;  3UBL A;  3F6D A;  3RBT A;  4QQ7 A;  1K3O A;  3MAK A;  3ERF A;  5ECI B;  1GSU A;  1LJR A;  2R4V A;  5DJM A;  6GSY A;  4KDX A;  3IR4 A;  4KAE A;  4IKH A;  2VCV A;  2WRT A;  1SVO A;  4E8E A;  1GLQ A;  1TXU A;  1GUK A;  3EE2 A;  4GSN A;  4OFM A;  3D0Z A;  3TOT A;  1ML6 A;  3VPT A;  3P90 A;  4LMV A;  4Q5F A;  1K3Y A;  2PVQ A;  5J40 A;  5J4U A;  3RFR C;  3L0H A;  3P8W A;  4G9H A;  1IYH A;  5F06 A;  4QMK A;  1PKZ A;  5D73 A;  5F0G A;  1G7O A;  4IGJ A;  5DAK B;  2R6K A;  3DD3 A;  4PQI A;  2HQT A;  1GNW A;  5F8B A;  4AI6 A;  4IS0 A;  2HSN A;  4ZBD A;  5JCU A;  2OAD A;  1PL2 A;  3QR6 A;  4KX4 A;  1GUL A;  4HI7 A;  5ECP B;  5DAL B;  1B8X A;  4TOP A;  2OA7 A;  3KTL A;  3Q74 A;  1TW9 A;  2AB6 A;  2GSR A;  4ZB9 A;  4W66 A;  5AIV A;  5J47 A;  4MF5 A;  6GST A;  2C8U A;  4GDF A;  4AGS A;  4EDY A;  2NTO A;  1AW9 A;  4IQA A;  3M3M A;  5HFK A;  1YDK A;  2JL4 A;  8GSS A;  1PX6 A;  1YEW C;  3M0F A;  4K0G A;  3RGB C;  3GTU B;  3CBU A;  5A4W A;  1XWG A;  4PNG A;  5BMU A;  2CA8 A;  4RI6 A;  5ECL B;  4DEJ A;  1BX9 A;  3FR3 A;  4YAP A;  2R5G A;  2GDR A;  4JED A;  2UV8 G;  1HNA A;  5ECH B;  3IK7 A;  1GSF A;  5DCG A;  4AKG A;  1YVL A;  5FT3 A;  2HRA A;  3GST A;  4J2F A;  4F03 A;  3LXT A;  2X64 A;  5EY6 A;  3O3T A;  4G0K A;  2ON7 A;  3CRU A;  2IMK A;  2VD1 A;  5FHI A;  3N5O A;  1TU7 A;  1EV4 A;  3HJM A;  1EEM A;  1MD4 A;  1MTC A;  1G6W A;  3VWX A;  2CZ2 A;  3CSH A;  3N9J A;  1VF4 A;  1GTB A;  4OFN A;  3ZMK A;  5GSS A;  3WYW A;  4F0C A;  11GS A;  2YCD A;  4KDU A;  4KH7 A;  1AQV A;  2O36 A;  1GUM A;  5B7C A;  2PBJ A;  2DC5 A;  2VCT A;  1TDI A;  1V40 A;  4O7H A;  5D9X A;  2LJR A;  1USB A;  5A4U A;  2WW1 A;  4GLT A;  3EIN A;  1PX7 A;  2GSS A;  3FYG A;  5AIS A;  3ZFB A;  4RI7 A;  1E6B A;  4HZ2 A;  4ZBA A;  4KGI A;  2O3E A;  4E68 A;  1JLW A;  2VD0 A;  1MD3 A;  4KDY A;  2O5V A;  3C8E A;  3QAG A;  4MZW A;  1XWK A;  2GLR A;  5J4V A;  3LSZ A;  3O76 A;  2J9H A;  1PN9 A;  3VUR A;  4JZQ A;  1G6Y A;  1LBK A;  1GSE A;  3CRT A;  2CZ3 A;  2V6K A;  5ECQ B;  4ECC A;  4PGT A;  1K0A A;  1ZGN A;  1GTA A;  3VK9 A;  4YQV A;  1YY7 A;  5J41 A;  4N0V A;  1UA5 A;  4IEL A;  4GF0 A;  3GUS A;  3LJR A;  3TGZ A;  2HRK B;  1BG1 A;  4NAX A;  3GH6 A;  3CHX C;  4FQU A;  4IQ1 A;  1B48 A;  4ECB A;  1TU8 A;  1K0B A;  2F3M A;  2A2S A;  2GTU A;  5D9W A;  5ECR B;  1VF2 A;  1N2A A;  3F6F A;  4EC0 A;  5D9T A;  3M8N A;  4ZB8 A;  2WVX A;  3KM6 A;  5A1N B;  4G0L A;  4MP4 A;  2AHE A;  3MDK A;  1EOG A;  4HZ4 A;  4ZB6 A;  3G7I A;  2OAC A;  5A34 B;  1K0C A;  2C3Q A;  3GTU A;  5KEJ A;  3NIV A;  3FY7 A;  2WDU A;  4AKH A;  6GSV A;  3CSI A;  4HOJ A;  3BBY A;  4KE3 A;  3IK9 A;  3KXO A;  3GSS A;  4G10 A;  4MDC A;  1EOH A;  4HJ2 A;  3TU3 B;  4F0B A;  4G0I A;  3DGQ A;  3PPU A;  4FXY P;  4Q5R A;  5EVO A;  3UVH A;  12GS A;  4GCI A;  4BVX A;  2HSM B;  5A5K A;  1F3A A;  3G7J A;  3R3E A;  1DUG A;  1K0O A;  5D9V A;  5G5E A;  3VI7 A;  2WW2 A;  1VF1 A;  2YV9 A;  5ECN B;  3ISO A;  1K0D A;  4BVY B;  5ECK B;  2GST A;  2VCZ A;  4IVF A;  4USS A;  2HNL A;  4BL7 A;  3UAR A;  4GST A;  1HQO A;  1NHY A;  3IE3 A;  2EFE A;  7GSS A;  1GSQ A;  2N5F A;  2R3X A;  1M9A A;  1OE8 A;  2WB9 A;  4O92 A;  3PGT A;  2CAI A;  5GST A;  2D2Z A;  1R5A A;  1U88 A;  2WJU A;  4N3Z A;  2VCQ A;  4CHS A;  1Y1U A;  2WW0 A;  4Q5N A;  3ZFL A;  1B4P A;  3HKR A;  3QAW A;  1K0N A;  1U87 A;  4PQH A;  5A4V A;  5LD0 A;  4MPG A;  5J5N A;  3KMN A;  3FRC A;  3KMO A;  1AQX A;  3Q19 A;  5AGY A;  5A5H B;  1XW5 A;  2H1L A;  4PI2 C;  4EE0 A;  2CVD A;  1A0F A;  1ZL9 A;  1F3B A;  4L5L A;  3GX0 A;  5DQS A;  1GTI A;  1PGT A;  1GNE A;  5LCZ A;  2WS2 A;  4MK3 A;  5G5F A;  3R2Q A;  6GSS A;  2DSA A;  6GSX A;  4IW9 A;  1K0M A;  2IMI A;  4PX1 A;  4ECI A;  4L8E A;  3IC8 A;  1OKT A;  3UAP A;  3WD6 A;  4PTS A;  2C4J A;  1GSS A;  2WVY A;  5DAK A;  2HRK A;  3CSJ A;  4YQM A;  1XW6 A;  2GSQ A;  1YKC A;  1PL1 A;  2PMT A;  4PI0 C;  5EL8 A;  3LQ7 A;  3W8S A;  4KF9 A;  5JCW A;  5ELA A;  3AY8 A;  2C80 A;  2VCX A;  5DAL A;  5GZZ B;  4OFT A;  4EDZ A;  5J4Y A;  10GS A;  3H1N A;  5A1N A;  2A2R A;  4ECJ A;  1PD2 1;  3I6A A;  3TOU A;  4E8H A;  3ZML A;  5AIX A;  5DJL A;  5A34 A;  3VLN A;  2VO4 A;  9GSS A;  5ECO B;  1AQW A;  17GS A;  3HJO A;  5IQY A;  4ID0 A;  4YQU A;  3LFL A;  3QAV A;  4GSS A;  4AKI A;  1C72 A;  1KBN A;  3KJY A;  4G19 A;  4IJI A;  3U6V A;  1M9B A;  1BF5 A;  2PER A;  2HSN B;  1VF3 A;  22GS A;  2HSM A;  1F2E A;  4NHW A; 
#chains in the Genus database with same CATH homology
 1Y6E A;  4YH2 A;  19GS A;  2EFD A;  2EFH A;  1FHE A;  1GUH A;  1OE7 A;  4PNF A;  4ZXG A;  1V2A A;  1IYI A;  1JZR A;  4BVY A;  1GTU A;  5ELG A;  4EXJ A;  5AN1 A;  3Q18 A;  3LYP A;  2FNO A;  4NHZ A;  4KSM A;  2FHE A;  3FR6 A;  1FW1 A;  5ECM B;  4ISD A;  4MPF A;  4ACS A;  4JBB A;  4L5O A;  3PR8 A;  1SVM A;  4G01 A;  4WR4 A;  3HMJ G;  1EV9 A;  1Q4J A;  4GTU A;  4PXO A;  3SWL A;  1GSY A;  2C3T A;  1PKW A;  1N25 A;  1RK4 A;  4K0N A;  6GSU A;  2EFC A;  5BMU B;  2UZ8 A;  3GUR A;  3LG6 A;  1GWC A;  2F8F A;  4ZBB A;  4BVX B;  1AXD A;  3I69 A;  1M0U A;  4ZB7 A;  2CAQ A;  2YV7 A;  3UBK A;  18GS A;  4WR5 A;  2OT3 A;  1BAY A;  1OYJ A;  5ECS A;  5F05 A;  6GSW A;  1HNB A;  4AKX B;  2ON5 A;  1PA3 A;  1BG5 A;  2C3N A;  1YQ1 A;  5A5H A;  1YJ6 A;  4BL7 B;  14GS A;  1BYE A;  1GLP A;  13GS A;  1K3L A;  3FR9 A;  4MF7 A;  3VI5 A;  2AAW A;  1U3I A;  5FWG A;  16GS A;  4MF6 A;  3VPQ A;  1SVL A;  5DDL A;  1Z9H A;  4PUR A;  2VKZ G;  1HNC A;  3ERG A;  1M99 A;  2PGT A;  3CWG A;  3IBH A;  4IBP A;  4PUA A;  3LYK A;  4YAV A;  3F63 A;  3M1G A;  2IL3 A;  4LMW A;  4Q5Q A;  1JLV A;  20GS A;  3LXZ A;  4I97 A;  5F07 A;  1GSD A;  1PMT A;  2VCW A;  4OMV A;  3UBL A;  3F6D A;  3RBT A;  4QQ7 A;  1K3O A;  3MAK A;  3ERF A;  5ECI B;  1GSU A;  1LJR A;  2R4V A;  5DJM A;  6GSY A;  4KDX A;  3IR4 A;  4KAE A;  4IKH A;  2VCV A;  2WRT A;  1SVO A;  4E8E A;  1GLQ A;  1TXU A;  1GUK A;  3EE2 A;  4GSN A;  4OFM A;  3D0Z A;  3TOT A;  1ML6 A;  3VPT A;  3P90 A;  4LMV A;  4Q5F A;  1K3Y A;  2PVQ A;  5J40 A;  5J4U A;  3L0H A;  3P8W A;  4G9H A;  1IYH A;  5F06 A;  4QMK A;  1PKZ A;  5D73 A;  5F0G A;  1G7O A;  4IGJ A;  5DAK B;  2R6K A;  3DD3 A;  4PQI A;  2HQT A;  1GNW A;  5F8B A;  4AI6 A;  4IS0 A;  2HSN A;  4ZBD A;  5JCU A;  2OAD A;  1PL2 A;  3QR6 A;  4KX4 A;  1GUL A;  4HI7 A;  5ECP B;  5DAL B;  1B8X A;  4TOP A;  2OA7 A;  3KTL A;  3Q74 A;  1TW9 A;  2AB6 A;  2GSR A;  4ZB9 A;  4W66 A;  5AIV A;  5J47 A;  4MF5 A;  6GST A;  2C8U A;  4GDF A;  4AGS A;  4EDY A;  2NTO A;  1AW9 A;  4IQA A;  3M3M A;  5HFK A;  1YDK A;  2JL4 A;  8GSS A;  1PX6 A;  3M0F A;  4K0G A;  3GTU B;  3CBU A;  5A4W A;  1XWG A;  4PNG A;  5BMU A;  2CA8 A;  4RI6 A;  5ECL B;  4DEJ A;  1BX9 A;  3FR3 A;  4YAP A;  2R5G A;  2GDR A;  4JED A;  2UV8 G;  1HNA A;  5ECH B;  3IK7 A;  1GSF A;  5DCG A;  4AKG A;  1YVL A;  5FT3 A;  2HRA A;  3GST A;  4J2F A;  4F03 A;  3LXT A;  2X64 A;  5EY6 A;  3O3T A;  4G0K A;  2ON7 A;  3CRU A;  2IMK A;  2VD1 A;  5FHI A;  3N5O A;  1TU7 A;  1EV4 A;  3HJM A;  1EEM A;  1MD4 A;  1MTC A;  1G6W A;  3VWX A;  2CZ2 A;  3CSH A;  3N9J A;  1VF4 A;  1GTB A;  4OFN A;  3ZMK A;  5GSS A;  3WYW A;  4F0C A;  11GS A;  2YCD A;  4KDU A;  4KH7 A;  1AQV A;  1GUM A;  5B7C A;  2PBJ A;  2DC5 A;  2VCT A;  1TDI A;  1V40 A;  4O7H A;  5D9X A;  2LJR A;  1USB A;  5A4U A;  4GLT A;  3EIN A;  1PX7 A;  2GSS A;  3FYG A;  5AIS A;  3ZFB A;  4RI7 A;  1E6B A;  4HZ2 A;  4ZBA A;  4KGI A;  4E68 A;  1JLW A;  2VD0 A;  1MD3 A;  4KDY A;  2O5V A;  3C8E A;  3QAG A;  4MZW A;  1XWK A;  2GLR A;  5J4V A;  3LSZ A;  3O76 A;  2J9H A;  1PN9 A;  3VUR A;  4JZQ A;  1G6Y A;  1LBK A;  1GSE A;  3CRT A;  2CZ3 A;  2V6K A;  5ECQ B;  4ECC A;  4PGT A;  1K0A A;  1ZGN A;  1GTA A;  3VK9 A;  4YQV A;  1YY7 A;  5J41 A;  4N0V A;  1UA5 A;  4IEL A;  4GF0 A;  3GUS A;  3LJR A;  3TGZ A;  2HRK B;  1BG1 A;  4NAX A;  3GH6 A;  4FQU A;  4IQ1 A;  4ECB A;  1B48 A;  1TU8 A;  1K0B A;  2F3M A;  2A2S A;  2GTU A;  5D9W A;  5ECR B;  1VF2 A;  1N2A A;  3F6F A;  4EC0 A;  5D9T A;  3M8N A;  4ZB8 A;  3KM6 A;  5A1N B;  4G0L A;  4MP4 A;  2AHE A;  3MDK A;  1EOG A;  4HZ4 A;  4ZB6 A;  3G7I A;  2OAC A;  5A34 B;  1K0C A;  2C3Q A;  3GTU A;  5KEJ A;  3NIV A;  3FY7 A;  2WDU A;  4AKH A;  6GSV A;  3CSI A;  4HOJ A;  3BBY A;  4KE3 A;  3IK9 A;  3KXO A;  3GSS A;  4G10 A;  4MDC A;  1EOH A;  4HJ2 A;  3TU3 B;  4F0B A;  4G0I A;  3DGQ A;  3PPU A;  4Q5R A;  5EVO A;  3UVH A;  12GS A;  4GCI A;  4BVX A;  2HSM B;  5A5K A;  1F3A A;  3G7J A;  3R3E A;  1DUG A;  1K0O A;  5D9V A;  5G5E A;  3VI7 A;  1VF1 A;  2YV9 A;  5ECN B;  3ISO A;  1K0D A;  4BVY B;  5ECK B;  2GST A;  2VCZ A;  4IVF A;  4USS A;  2HNL A;  4BL7 A;  3UAR A;  4GST A;  1HQO A;  1NHY A;  3IE3 A;  2EFE A;  7GSS A;  1GSQ A;  2N5F A;  2R3X A;  1M9A A;  1OE8 A;  2WB9 A;  4O92 A;  3PGT A;  2CAI A;  5GST A;  2D2Z A;  1R5A A;  1U88 A;  2WJU A;  4N3Z A;  2VCQ A;  4CHS A;  1Y1U A;  4Q5N A;  3ZFL A;  1B4P A;  3HKR A;  3QAW A;  1K0N A;  1U87 A;  4PQH A;  5A4V A;  5LD0 A;  4MPG A;  5J5N A;  3KMN A;  3FRC A;  3KMO A;  1AQX A;  3Q19 A;  5AGY A;  5A5H B;  1XW5 A;  2H1L A;  4EE0 A;  2CVD A;  1A0F A;  1ZL9 A;  1F3B A;  4L5L A;  3GX0 A;  5DQS A;  1GTI A;  1PGT A;  1GNE A;  5LCZ A;  2WS2 A;  4MK3 A;  5G5F A;  3R2Q A;  6GSS A;  2DSA A;  6GSX A;  4IW9 A;  1K0M A;  2IMI A;  4PX1 A;  4ECI A;  4L8E A;  3IC8 A;  1OKT A;  3UAP A;  3WD6 A;  4PTS A;  2C4J A;  1GSS A;  5DAK A;  2HRK A;  3CSJ A;  4YQM A;  1XW6 A;  2GSQ A;  1YKC A;  1PL1 A;  2PMT A;  5EL8 A;  3LQ7 A;  3W8S A;  4KF9 A;  5JCW A;  5ELA A;  3AY8 A;  2C80 A;  2VCX A;  5DAL A;  5GZZ B;  4OFT A;  4EDZ A;  5J4Y A;  10GS A;  3H1N A;  5A1N A;  2A2R A;  4ECJ A;  1PD2 1;  3I6A A;  3TOU A;  4E8H A;  3ZML A;  5AIX A;  5DJL A;  5A34 A;  3VLN A;  2VO4 A;  9GSS A;  5ECO B;  1AQW A;  17GS A;  3HJO A;  5IQY A;  4ID0 A;  4YQU A;  3LFL A;  3QAV A;  4GSS A;  4AKI A;  1C72 A;  1KBN A;  3KJY A;  4G19 A;  4IJI A;  3U6V A;  1M9B A;  1BF5 A;  2PER A;  2HSN B;  1VF3 A;  22GS A;  2HSM A;  1F2E A;  4NHW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...