4ZB7A

Phanerochaete chrysosporium ure2p6 in apo form.
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
216
structure length
171
Chain Sequence
GKQFTLYTHKGGPNGWKVTIVLEELGLTYESIFLRIPALIDHKNNDYTVWESNAIIQYLVDKYDKDRKVSVAPGTNEYYTQLQWLYFQASGQGYRNEIKRVLGVLESVLSKQEFLVDGKATVADFSFLPWNEGAAKFGSQFEEEFPATAKWHKKLLERPAIAKVWEERAKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evolutionary divergence of Ure2pA glutathione transferases in wood degrading fungi.
pubmed doi rcsb
molecule keywords PcUre2p6
molecule tags Transferase
source organism Phanerochaete chrysosporium
total genus 63
structure length 171
sequence length 216
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.130 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4zb7A00
5BMUB 5A1NA 5A5HA 5A34A 5A1NB 5A5HB 4AKIA 4ZB7A 4W66A 5A34B 4AKHA 4AKGA 4AI6A
chains in the Genus database with same CATH superfamily
1ZGNA 3Q74A 5ECSA 1G7OA 5J40A 4PXOA 3HKRA 1K0DA 4RI7A 1GTIA 2ON7A 5GSTA 5JCWA 4KSMA 4QQ7A 4EDYA 3L0HA 2EFCA 4OFNA 5EVOA 1HNAA 4PTSA 2VD0A 4ZB8A 2EFDA 4Q5NA 1TU8A 2C3QA 5FWGA 5ECIB 2VO4A 3EE2A 3I6AA 4KE3A 1U87A 5D73A 5DJLA 5A4VA 3LFLA 3VI5A 4ECIA 5LCZA 1BG1A 3C8EA 2HSMA 5A5HB 2C8UA 4ZBBA 4K0GA 2F8FA 2C3TA 4O7HA 1AQVA 3N5OA 4AKGA 4PNGA 4PI2C 2PBJA 1NHYA 4IS0A 5F06A 1DUGA 1GSFA 3IBHA 4HOJA 2ON5A 4JEDA 6GSWA 1TW9A 1EV4A 2WJUA 1YVLA 5HFKA 1GSEA 4BVXB 4KF9A 2PMTA 5F07A 5FT3A 5G5EA 4BL7B 4YH2A 5F8BA 4L5LA 4NHZA 1PD21 1ML6A 3CBUA 4G0IA 2WW0A 3FR9A 2WZSA 5DQSA 5J4UA 2HRAA 5D9WA 4ISDA 1Y6EA 1SVMA 1OYJA 1HNBA 2VCXA 1PA3A 1PL1A 5AISA 1BX9A 3GSSA 1A0FA 2CZ3A 4PQIA 1YJ6A 11GSA 3GH6A 2VKZG 4J2FA 5ECPB 4KAEA 4MPFA 3F6FA 4Q5QA 1GSUA 3CHXC 5J4YA 2O5VA 2VCTA 4GTUA 4IVFA 4PI0C 14GSA 3ISOA 4IJIA 1BYEA 1JZRA 5ECOB 4ECCA 18GSA 1PKZA 1GUHA 1BG5A 3UARA 3W8SA 4HI7A 4GSNA 4QMKA 5F05A 2PERA 3VLNA 3PPUA 2O3EA 2H1LA 2GSSA 1PN9A 4KGIA 3M1GA 5DALA 5IQYA 3CSHA 1U88A 3RBTA 1EEMA 2YV7A 1GSSA 4MF7A 4OFMA 4PHZC 2WVYA 6GSXA 2GSQA 3F6DA 3MAKA 2FNOA 4G0LA 2CVDA 5J41A 2F3MA 3GSTA 3O3TA 5JCUA 3LQ7A 1YY7A 2GLRA 1YEWC 3CRUA 4HZ4A 4JBBA 3M0FA 5AIVA 3IR4A 1PMTA 4IELA 1AXDA 4E68A 6GSTA 1GUKA 4KH7A 4HZ2A 3O76A 1XW6A 4GCIA 4TOPA 1FW1A 1GTUA 5GSSA 6GSVA 2C4JA 3GX0A 5GZZB 3UVHA 1GSQA 1SVLA 2J9HA 3LYKA 1OE8A 1USBA 4WR4A 3UBLA 1LJRA 2WVXB 4G9HA 5DAKA 1JLWA 8GSSA 2GTUA 4AGSA 1MD4A 3KXOA 5ECHB 5J4VA 5AIXA 3R3EA 1F2EA 4Q5RA 1EOGA 1K0OA 4EE0A 4G10A 3LYPA 2GDRA 2R3XA 4EDZA 3Q19A 1AQXA 1GWCA 4K0NA 1K0BA 3HJOA 5DALB 1XWGA 4JZQA 4PNFA 2A2RA 3DGQA 1YQ1A 5ECNB 5EL8A 4BVYA 5D9XA 1PX6A 1AW9A 2HNLA 2GSRA 5ECKB 3LXTA 2NTOA 3QR6A 1U3IA 4PQHA 4MF5A 3CSJA 2EFEA 2WW1A 1V2AA 4PX1A 2HRKA 2O36A 4ZB7A 4GF0A 4HJ2A 1M9AA 1SVOA 1Q4JA 5A1NA 1M99A 4KX4A 5G5FA 1PGTA 1HNCA 5BMUA 6GSYA 5ECRB 1BF5A 2OT3A 1YKCA 2CZ2A 1K3LA 5LD0A 4YAVA 3PR8A 2N5FA 5A34A 5FHIA 1GNWA 4LMVA 3WD6A 4F0BA 4WR5A 4AKHA 4NHWA 6GSUA 19GSA 3AY8A 4N3ZA 1IYHA 1G6WA 1ZL9A 3DD3A 3ZMLA 4GLTA 1PL2A 3H1NA 5B7CA 3UAPA 2YCDA 4W66A 4EC0A 1OKTA 2HSMB 4MDCA 3VPTA 4IBPA 4YQUA 1GNEA 3GTUA 1K0MA 4MPGA 5ECQB 4YAPA 2WRTA 4KDXA 3CRTA 1IYIA 1M0UA 4G01A 1Z9HA 2OACA 1PKWA 3FR3A 3BBYA 12GSA 3TGZA 6GSSA 5D9TA 4EXJA 1FHEA 2YV9A 4GSSA 4YQMA 1V40A 2EFHA 2PVQA 4AKXB 4NAXA 1GTBA 4MK3A 1TXUA 1YDKA 1KBNA 3RGBC 1LBKA 1B8XA 1Y1UA 5DJMA 1B48A 3M8NA 3VI7A 2C80A 2CA8A 2V6KA 1VF2A 1PX7A 1GUMA 3IK9A 5A1NB 5DCGA 3GURA 2WS2A 3KJYA 4FQUA 3VURA 5AN1A 3WYWA 5BMUB 4KDYA 2IMKA 1GSDA 1GLQA 4BVXA 2GSTA 2UV8G 3LSZA 5ELGA 2HSNA 4BL7A 1AQWA 3ERGA 2AB6A 1XW5A 3F63A 3KM6A 2WB9A 1K0AA 1GSYA 2JL4A 4ZBAA 4ZB6A 3IK7A 3LXZA 4IQ1A 3HMJG 4ECBA 1TDIA 5J5NA 4GDFA 1R5AA 5ECLB 3U6VA 3KMNA 3FY7A 4PURA 4Q5FA 3D0ZA 1BAYA 22GSA 3SWLA 2VCWA 1B4PA 3GTUB 2IL3A 1RK4A 1N2AA 1K0CA 3FYGA 17GSA 3CSIA 3LG6A 1N25A 3VPQA 1E6BA 3M3MA 9GSSA 2IMIA 4OFTA 10GSA 3P8WA 2OA7A 3TU3B 3MDKA 3QAWA 2R5GA 1M9BA 3QAVA 3R2QA 4IW9A 20GSA 5ECMB 3G7JA 4ACSA 4E8EA 4AKIA 3KMOA 1VF3A 5DDLA 1VF4A 4GSTA 2WW3A 2HQTA 2DSAA 2VCZA 4F0CA 5A5KA 2X64A 4YQVA 1HQOA 1S4BP 4IQAA 3PGTA 3NIVA 1TU7A 2LJRA 4AI6A 3QAGA 4F03A 2HSNB 3ERFA 5F0GA 3TOTA 4DEJA 4ZXGA 3I69A 3N9JA 13GSA 4IKHA 3EINA 3RFRC 3G7IA 3ZFBA 5AGYA 4L8EA 3FRCA 3KTLA 4CHSA 5KEJA 4MF6A 4PGTA 5EY6A 3GUSA 2C3NA 1I1IP 4IGJA 3ZMKA 5DAKB 4ECJA 1F3BA 3P90A 4E8HA 3VK9A 2A2SA 3HJMA 4MP4A 1VF1A 2WW2A 1K3YA 5ELAA 4KDUA 1GLPA 1MTCA 3Q18A 1EOHA 16GSA 1G6YA 3TOUA 2CAQA 4ZBDA 3CWGA 4N0VA 2WVXA 2CAIA 4G0KA 2VCVA 2R4VA 5A5HA 4BVYB 5J47A 3LJRA 4L5OA 3IE3A 2PGTA 5A4UA 1C72A 1F3AA 1UA5A 4USSA 4ID0A 4G19A 2HRKB 1XWKA 3VWXA 4OMVA 1MD3A 5A4WA 7GSSA 1GTAA 1GULA 2VD1A 2WDUA 2WVZA 4MZWA 2FHEA 4ZB9A 4O92A 1OE7A 2DC5A 2VCQA 2R6KA 4LMWA 2OADA 4RI6A 3FR6A 2UZ8A 4PUAA 5D9VA 5A34B 4FXYP 3IC8A 3ZFLA 1K3OA 2D2ZA 3UBKA 1JLVA 1K0NA 2AAWA 4I97A 1EV9A 2AHEA
chains in the Genus database with same CATH topology
1ZGNA 3Q74A 5ECSA 1G7OA 5J40A 4PXOA 3HKRA 1K0DA 4RI7A 1GTIA 2ON7A 5GSTA 5JCWA 4KSMA 4QQ7A 4EDYA 3L0HA 2EFCA 4OFNA 5EVOA 1HNAA 4PTSA 2VD0A 4ZB8A 2EFDA 4Q5NA 1TU8A 2C3QA 5FWGA 5ECIB 2VO4A 3EE2A 3I6AA 4KE3A 1U87A 5D73A 5DJLA 5A4VA 3LFLA 3VI5A 4ECIA 5LCZA 1BG1A 3C8EA 2HSMA 5A5HB 2C8UA 4ZBBA 4K0GA 2F8FA 2C3TA 4O7HA 1AQVA 3N5OA 4AKGA 4PNGA 2PBJA 1NHYA 4IS0A 5F06A 1DUGA 1GSFA 3IBHA 4HOJA 2ON5A 4JEDA 6GSWA 1TW9A 1EV4A 2WJUA 1YVLA 5HFKA 1GSEA 4BVXB 4KF9A 2PMTA 5F07A 5FT3A 5G5EA 4BL7B 4YH2A 5F8BA 4L5LA 4NHZA 1PD21 1ML6A 3CBUA 4G0IA 3FR9A 5DQSA 5J4UA 2HRAA 5D9WA 4ISDA 1Y6EA 1SVMA 1OYJA 1HNBA 2VCXA 1PA3A 1PL1A 5AISA 1BX9A 3GSSA 1A0FA 2CZ3A 4PQIA 1YJ6A 11GSA 3GH6A 2VKZG 4J2FA 5ECPB 4KAEA 4MPFA 3F6FA 4Q5QA 1GSUA 5J4YA 2O5VA 2VCTA 4GTUA 4IVFA 14GSA 3ISOA 4IJIA 1BYEA 1JZRA 5ECOB 4ECCA 18GSA 1PKZA 1GUHA 1BG5A 3UARA 3W8SA 4HI7A 4GSNA 4QMKA 5F05A 2PERA 3VLNA 3PPUA 2H1LA 2GSSA 1PN9A 4KGIA 3M1GA 5DALA 5IQYA 3CSHA 1U88A 3RBTA 1EEMA 2YV7A 1GSSA 4MF7A 4OFMA 6GSXA 2GSQA 3F6DA 3MAKA 2FNOA 4G0LA 2CVDA 5J41A 2F3MA 3GSTA 3O3TA 5JCUA 3LQ7A 1YY7A 2GLRA 3CRUA 4HZ4A 4JBBA 3M0FA 5AIVA 3IR4A 1PMTA 4IELA 1AXDA 4E68A 6GSTA 1GUKA 4KH7A 4HZ2A 3O76A 1XW6A 4GCIA 4TOPA 1FW1A 1GTUA 5GSSA 6GSVA 2C4JA 3GX0A 5GZZB 3UVHA 3LYKA 1GSQA 1SVLA 2J9HA 1OE8A 1USBA 4WR4A 3UBLA 1LJRA 4G9HA 5DAKA 1JLWA 8GSSA 2GTUA 4AGSA 1MD4A 3KXOA 5ECHB 5J4VA 5AIXA 3R3EA 1F2EA 4Q5RA 1EOGA 1K0OA 4EE0A 4G10A 3LYPA 2GDRA 2R3XA 4EDZA 3Q19A 1AQXA 1GWCA 4K0NA 1K0BA 3HJOA 5DALB 1XWGA 4JZQA 4PNFA 2A2RA 3DGQA 1YQ1A 5ECNB 5EL8A 4BVYA 5D9XA 1PX6A 1AW9A 2HNLA 2GSRA 5ECKB 3LXTA 2NTOA 3QR6A 1U3IA 4PQHA 4MF5A 3CSJA 2EFEA 1V2AA 4PX1A 2HRKA 4ZB7A 4GF0A 4HJ2A 1M9AA 1SVOA 1Q4JA 5A1NA 1M99A 4KX4A 5G5FA 1PGTA 1HNCA 5BMUA 6GSYA 5ECRB 1BF5A 2OT3A 1YKCA 2CZ2A 1K3LA 5LD0A 4YAVA 3PR8A 2N5FA 5A34A 5FHIA 1GNWA 4LMVA 3WD6A 4F0BA 4WR5A 4AKHA 4NHWA 6GSUA 19GSA 3AY8A 4N3ZA 1IYHA 1G6WA 1ZL9A 3DD3A 3ZMLA 4GLTA 1PL2A 3H1NA 5B7CA 3UAPA 2YCDA 4W66A 4EC0A 1OKTA 2HSMB 4MDCA 3VPTA 4IBPA 4YQUA 1GNEA 3GTUA 1K0MA 4MPGA 5ECQB 4YAPA 2WRTA 4KDXA 3CRTA 1IYIA 1M0UA 4G01A 1Z9HA 2OACA 1PKWA 3FR3A 3BBYA 12GSA 3TGZA 6GSSA 5D9TA 4EXJA 1FHEA 2YV9A 4GSSA 4YQMA 1V40A 2EFHA 2PVQA 4AKXB 4NAXA 1GTBA 4MK3A 1TXUA 1YDKA 1KBNA 1LBKA 1B8XA 1Y1UA 5DJMA 1B48A 3M8NA 3VI7A 2C80A 2CA8A 2V6KA 1VF2A 1PX7A 1GUMA 3IK9A 5A1NB 5DCGA 3GURA 2WS2A 3KJYA 4FQUA 3VURA 5AN1A 3WYWA 5BMUB 4KDYA 2IMKA 1GSDA 1GLQA 4BVXA 2GSTA 2UV8G 3LSZA 5ELGA 2HSNA 4BL7A 1AQWA 3ERGA 2AB6A 1XW5A 3F63A 3KM6A 2WB9A 1K0AA 1GSYA 2JL4A 4ZBAA 4ZB6A 3IK7A 3LXZA 4IQ1A 3HMJG 4ECBA 1TDIA 5J5NA 4GDFA 1R5AA 5ECLB 3U6VA 3KMNA 3FY7A 4PURA 4Q5FA 3D0ZA 1BAYA 22GSA 3SWLA 2VCWA 1B4PA 3GTUB 2IL3A 1RK4A 1N2AA 1K0CA 3FYGA 17GSA 3CSIA 3LG6A 1N25A 3VPQA 1E6BA 3M3MA 9GSSA 2IMIA 4OFTA 10GSA 3P8WA 2OA7A 3TU3B 3MDKA 3QAWA 2R5GA 1M9BA 3QAVA 3R2QA 4IW9A 20GSA 5ECMB 3G7JA 4ACSA 4E8EA 4AKIA 3KMOA 1VF3A 5DDLA 1VF4A 4GSTA 2HQTA 2DSAA 2VCZA 4F0CA 5A5KA 2X64A 4YQVA 1HQOA 4IQAA 3PGTA 3NIVA 1TU7A 2LJRA 4AI6A 3QAGA 4F03A 2HSNB 3ERFA 5F0GA 3TOTA 4DEJA 4ZXGA 3I69A 3N9JA 13GSA 4IKHA 3EINA 3G7IA 3ZFBA 5AGYA 4L8EA 3FRCA 3KTLA 4CHSA 5KEJA 4MF6A 4PGTA 5EY6A 3GUSA 2C3NA 4IGJA 3ZMKA 5DAKB 4ECJA 1F3BA 3P90A 4E8HA 3VK9A 2A2SA 3HJMA 4MP4A 1VF1A 1K3YA 5ELAA 4KDUA 1GLPA 1MTCA 3Q18A 1EOHA 16GSA 1G6YA 3TOUA 2CAQA 4ZBDA 3CWGA 4N0VA 2CAIA 4G0KA 2VCVA 2R4VA 5A5HA 4BVYB 5J47A 3LJRA 4L5OA 3IE3A 2PGTA 5A4UA 1C72A 1F3AA 1UA5A 4USSA 4ID0A 4G19A 2HRKB 1XWKA 3VWXA 4OMVA 1MD3A 5A4WA 7GSSA 1GTAA 1GULA 2VD1A 2WDUA 4MZWA 2FHEA 4ZB9A 4O92A 1OE7A 2DC5A 2VCQA 2R6KA 4LMWA 2OADA 4RI6A 3FR6A 2UZ8A 4PUAA 5D9VA 5A34B 3IC8A 3ZFLA 1K3OA 2D2ZA 3UBKA 1JLVA 1K0NA 2AAWA 4I97A 1EV9A 2AHEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BMU B;  5A1N A;  5A5H A;  5A34 A;  5A1N B;  5A5H B;  4AKI A;  4ZB7 A;  4W66 A;  5A34 B;  4AKH A;  4AKG A;  4AI6 A; 
#chains in the Genus database with same CATH topology
 1ZGN A;  3Q74 A;  5ECS A;  1G7O A;  5J40 A;  4PXO A;  3HKR A;  1K0D A;  4RI7 A;  1GTI A;  2ON7 A;  5GST A;  5JCW A;  4KSM A;  4QQ7 A;  4EDY A;  3L0H A;  2EFC A;  4OFN A;  5EVO A;  1HNA A;  4PTS A;  2VD0 A;  4ZB8 A;  2EFD A;  4Q5N A;  1TU8 A;  2C3Q A;  5FWG A;  5ECI B;  2VO4 A;  3EE2 A;  3I6A A;  4KE3 A;  1U87 A;  5D73 A;  5DJL A;  5A4V A;  3LFL A;  3VI5 A;  4ECI A;  5LCZ A;  1BG1 A;  3C8E A;  2HSM A;  5A5H B;  2C8U A;  4ZBB A;  4K0G A;  2F8F A;  2C3T A;  4O7H A;  1AQV A;  3N5O A;  4AKG A;  4PNG A;  4PI2 C;  2PBJ A;  1NHY A;  4IS0 A;  5F06 A;  1DUG A;  1GSF A;  3IBH A;  4HOJ A;  2ON5 A;  4JED A;  6GSW A;  1TW9 A;  1EV4 A;  2WJU A;  1YVL A;  5HFK A;  1GSE A;  4BVX B;  4KF9 A;  2PMT A;  5F07 A;  5FT3 A;  5G5E A;  4BL7 B;  4YH2 A;  5F8B A;  4L5L A;  4NHZ A;  1PD2 1;  1ML6 A;  3CBU A;  4G0I A;  2WW0 A;  3FR9 A;  2WZS A;  5DQS A;  5J4U A;  2HRA A;  5D9W A;  4ISD A;  1Y6E A;  1SVM A;  1OYJ A;  1HNB A;  2VCX A;  1PA3 A;  1PL1 A;  5AIS A;  1BX9 A;  3GSS A;  1A0F A;  2CZ3 A;  4PQI A;  1YJ6 A;  11GS A;  3GH6 A;  2VKZ G;  4J2F A;  5ECP B;  4KAE A;  4MPF A;  3F6F A;  4Q5Q A;  1GSU A;  3CHX C;  5J4Y A;  2O5V A;  2VCT A;  4GTU A;  4IVF A;  4PI0 C;  14GS A;  3ISO A;  4IJI A;  1BYE A;  1JZR A;  5ECO B;  4ECC A;  18GS A;  1PKZ A;  1GUH A;  1BG5 A;  3UAR A;  3W8S A;  4HI7 A;  4GSN A;  4QMK A;  5F05 A;  2PER A;  3VLN A;  3PPU A;  2O3E A;  2H1L A;  2GSS A;  1PN9 A;  4KGI A;  3M1G A;  5DAL A;  5IQY A;  3CSH A;  1U88 A;  3RBT A;  1EEM A;  2YV7 A;  1GSS A;  4MF7 A;  4OFM A;  4PHZ C;  2WVY A;  6GSX A;  2GSQ A;  3F6D A;  3MAK A;  2FNO A;  4G0L A;  2CVD A;  5J41 A;  2F3M A;  3GST A;  3O3T A;  5JCU A;  3LQ7 A;  1YY7 A;  2GLR A;  1YEW C;  3CRU A;  4HZ4 A;  4JBB A;  3M0F A;  5AIV A;  3IR4 A;  1PMT A;  4IEL A;  1AXD A;  4E68 A;  6GST A;  1GUK A;  4KH7 A;  4HZ2 A;  3O76 A;  1XW6 A;  4GCI A;  4TOP A;  1FW1 A;  1GTU A;  5GSS A;  6GSV A;  2C4J A;  3GX0 A;  5GZZ B;  3UVH A;  1GSQ A;  1SVL A;  2J9H A;  3LYK A;  1OE8 A;  1USB A;  4WR4 A;  3UBL A;  1LJR A;  2WVX B;  4G9H A;  5DAK A;  1JLW A;  8GSS A;  2GTU A;  4AGS A;  1MD4 A;  3KXO A;  5ECH B;  5J4V A;  5AIX A;  3R3E A;  1F2E A;  4Q5R A;  1EOG A;  1K0O A;  4EE0 A;  4G10 A;  3LYP A;  2GDR A;  2R3X A;  4EDZ A;  3Q19 A;  1AQX A;  1GWC A;  4K0N A;  1K0B A;  3HJO A;  5DAL B;  1XWG A;  4JZQ A;  4PNF A;  2A2R A;  3DGQ A;  1YQ1 A;  5ECN B;  5EL8 A;  4BVY A;  5D9X A;  1PX6 A;  1AW9 A;  2HNL A;  2GSR A;  5ECK B;  3LXT A;  2NTO A;  3QR6 A;  1U3I A;  4PQH A;  4MF5 A;  3CSJ A;  2EFE A;  2WW1 A;  1V2A A;  4PX1 A;  2HRK A;  2O36 A;  4ZB7 A;  4GF0 A;  4HJ2 A;  1M9A A;  1SVO A;  1Q4J A;  5A1N A;  1M99 A;  4KX4 A;  5G5F A;  1PGT A;  1HNC A;  5BMU A;  6GSY A;  5ECR B;  1BF5 A;  2OT3 A;  1YKC A;  2CZ2 A;  1K3L A;  5LD0 A;  4YAV A;  3PR8 A;  2N5F A;  5A34 A;  5FHI A;  1GNW A;  4LMV A;  3WD6 A;  4F0B A;  4WR5 A;  4AKH A;  4NHW A;  6GSU A;  19GS A;  3AY8 A;  4N3Z A;  1IYH A;  1G6W A;  1ZL9 A;  3DD3 A;  3ZML A;  4GLT A;  1PL2 A;  3H1N A;  5B7C A;  3UAP A;  2YCD A;  4W66 A;  4EC0 A;  1OKT A;  2HSM B;  4MDC A;  3VPT A;  4IBP A;  4YQU A;  1GNE A;  3GTU A;  1K0M A;  4MPG A;  5ECQ B;  4YAP A;  2WRT A;  4KDX A;  3CRT A;  1IYI A;  1M0U A;  4G01 A;  1Z9H A;  2OAC A;  1PKW A;  3FR3 A;  3BBY A;  12GS A;  3TGZ A;  6GSS A;  5D9T A;  4EXJ A;  1FHE A;  2YV9 A;  4GSS A;  4YQM A;  1V40 A;  2EFH A;  2PVQ A;  4AKX B;  4NAX A;  1GTB A;  4MK3 A;  1TXU A;  1YDK A;  1KBN A;  3RGB C;  1LBK A;  1B8X A;  1Y1U A;  5DJM A;  1B48 A;  3M8N A;  3VI7 A;  2C80 A;  2CA8 A;  2V6K A;  1VF2 A;  1PX7 A;  1GUM A;  3IK9 A;  5A1N B;  5DCG A;  3GUR A;  2WS2 A;  3KJY A;  4FQU A;  3VUR A;  5AN1 A;  3WYW A;  5BMU B;  4KDY A;  2IMK A;  1GSD A;  1GLQ A;  4BVX A;  2GST A;  2UV8 G;  3LSZ A;  5ELG A;  2HSN A;  4BL7 A;  1AQW A;  3ERG A;  2AB6 A;  1XW5 A;  3F63 A;  3KM6 A;  2WB9 A;  1K0A A;  1GSY A;  2JL4 A;  4ZBA A;  4ZB6 A;  3IK7 A;  3LXZ A;  4IQ1 A;  3HMJ G;  4ECB A;  1TDI A;  5J5N A;  4GDF A;  1R5A A;  5ECL B;  3U6V A;  3KMN A;  3FY7 A;  4PUR A;  4Q5F A;  3D0Z A;  1BAY A;  22GS A;  3SWL A;  2VCW A;  1B4P A;  3GTU B;  2IL3 A;  1RK4 A;  1N2A A;  1K0C A;  3FYG A;  17GS A;  3CSI A;  3LG6 A;  1N25 A;  3VPQ A;  1E6B A;  3M3M A;  9GSS A;  2IMI A;  4OFT A;  10GS A;  3P8W A;  2OA7 A;  3TU3 B;  3MDK A;  3QAW A;  2R5G A;  1M9B A;  3QAV A;  3R2Q A;  4IW9 A;  20GS A;  5ECM B;  3G7J A;  4ACS A;  4E8E A;  4AKI A;  3KMO A;  1VF3 A;  5DDL A;  1VF4 A;  4GST A;  2WW3 A;  2HQT A;  2DSA A;  2VCZ A;  4F0C A;  5A5K A;  2X64 A;  4YQV A;  1HQO A;  1S4B P;  4IQA A;  3PGT A;  3NIV A;  1TU7 A;  2LJR A;  4AI6 A;  3QAG A;  4F03 A;  2HSN B;  3ERF A;  5F0G A;  3TOT A;  4DEJ A;  4ZXG A;  3I69 A;  3N9J A;  13GS A;  4IKH A;  3EIN A;  3RFR C;  3G7I A;  3ZFB A;  5AGY A;  4L8E A;  3FRC A;  3KTL A;  4CHS A;  5KEJ A;  4MF6 A;  4PGT A;  5EY6 A;  3GUS A;  2C3N A;  1I1I P;  4IGJ A;  3ZMK A;  5DAK B;  4ECJ A;  1F3B A;  3P90 A;  4E8H A;  3VK9 A;  2A2S A;  3HJM A;  4MP4 A;  1VF1 A;  2WW2 A;  1K3Y A;  5ELA A;  4KDU A;  1GLP A;  1MTC A;  3Q18 A;  1EOH A;  16GS A;  1G6Y A;  3TOU A;  2CAQ A;  4ZBD A;  3CWG A;  4N0V A;  2WVX A;  2CAI A;  4G0K A;  2VCV A;  2R4V A;  5A5H A;  4BVY B;  5J47 A;  3LJR A;  4L5O A;  3IE3 A;  2PGT A;  5A4U A;  1C72 A;  1F3A A;  1UA5 A;  4USS A;  4ID0 A;  4G19 A;  2HRK B;  1XWK A;  3VWX A;  4OMV A;  1MD3 A;  5A4W A;  7GSS A;  1GTA A;  1GUL A;  2VD1 A;  2WDU A;  2WVZ A;  4MZW A;  2FHE A;  4ZB9 A;  4O92 A;  1OE7 A;  2DC5 A;  2VCQ A;  2R6K A;  4LMW A;  2OAD A;  4RI6 A;  3FR6 A;  2UZ8 A;  4PUA A;  5D9V A;  5A34 B;  4FXY P;  3IC8 A;  3ZFL A;  1K3O A;  2D2Z A;  3UBK A;  1JLV A;  1K0N A;  2AAW A;  4I97 A;  1EV9 A;  2AHE A; 
#chains in the Genus database with same CATH homology
 1ZGN A;  3Q74 A;  5ECS A;  1G7O A;  5J40 A;  4PXO A;  3HKR A;  1K0D A;  4RI7 A;  1GTI A;  2ON7 A;  5GST A;  5JCW A;  4KSM A;  4QQ7 A;  4EDY A;  3L0H A;  2EFC A;  4OFN A;  5EVO A;  1HNA A;  4PTS A;  2VD0 A;  4ZB8 A;  2EFD A;  4Q5N A;  1TU8 A;  2C3Q A;  5FWG A;  5ECI B;  2VO4 A;  3EE2 A;  3I6A A;  4KE3 A;  1U87 A;  5D73 A;  5DJL A;  5A4V A;  3LFL A;  3VI5 A;  4ECI A;  5LCZ A;  1BG1 A;  3C8E A;  2HSM A;  5A5H B;  2C8U A;  4ZBB A;  4K0G A;  2F8F A;  2C3T A;  4O7H A;  1AQV A;  3N5O A;  4AKG A;  4PNG A;  2PBJ A;  1NHY A;  4IS0 A;  5F06 A;  1DUG A;  1GSF A;  3IBH A;  4HOJ A;  2ON5 A;  4JED A;  6GSW A;  1TW9 A;  1EV4 A;  2WJU A;  1YVL A;  5HFK A;  1GSE A;  4BVX B;  4KF9 A;  2PMT A;  5F07 A;  5FT3 A;  5G5E A;  4BL7 B;  4YH2 A;  5F8B A;  4L5L A;  4NHZ A;  1PD2 1;  1ML6 A;  3CBU A;  4G0I A;  3FR9 A;  5DQS A;  5J4U A;  2HRA A;  5D9W A;  4ISD A;  1Y6E A;  1SVM A;  1OYJ A;  1HNB A;  2VCX A;  1PA3 A;  1PL1 A;  5AIS A;  1BX9 A;  3GSS A;  1A0F A;  2CZ3 A;  4PQI A;  1YJ6 A;  11GS A;  3GH6 A;  2VKZ G;  4J2F A;  5ECP B;  4KAE A;  4MPF A;  3F6F A;  4Q5Q A;  1GSU A;  5J4Y A;  2O5V A;  2VCT A;  4GTU A;  4IVF A;  14GS A;  3ISO A;  4IJI A;  1BYE A;  1JZR A;  5ECO B;  4ECC A;  18GS A;  1PKZ A;  1GUH A;  1BG5 A;  3UAR A;  3W8S A;  4HI7 A;  4GSN A;  4QMK A;  5F05 A;  2PER A;  3VLN A;  3PPU A;  2H1L A;  2GSS A;  1PN9 A;  4KGI A;  3M1G A;  5DAL A;  5IQY A;  3CSH A;  1U88 A;  3RBT A;  1EEM A;  2YV7 A;  1GSS A;  4MF7 A;  4OFM A;  6GSX A;  2GSQ A;  3F6D A;  3MAK A;  2FNO A;  4G0L A;  2CVD A;  5J41 A;  2F3M A;  3GST A;  3O3T A;  5JCU A;  3LQ7 A;  1YY7 A;  2GLR A;  3CRU A;  4HZ4 A;  4JBB A;  3M0F A;  5AIV A;  3IR4 A;  1PMT A;  4IEL A;  1AXD A;  4E68 A;  6GST A;  1GUK A;  4KH7 A;  4HZ2 A;  3O76 A;  1XW6 A;  4GCI A;  4TOP A;  1FW1 A;  1GTU A;  5GSS A;  6GSV A;  2C4J A;  3GX0 A;  5GZZ B;  3UVH A;  3LYK A;  1GSQ A;  1SVL A;  2J9H A;  1OE8 A;  1USB A;  4WR4 A;  3UBL A;  1LJR A;  4G9H A;  5DAK A;  1JLW A;  8GSS A;  2GTU A;  4AGS A;  1MD4 A;  3KXO A;  5ECH B;  5J4V A;  5AIX A;  3R3E A;  1F2E A;  4Q5R A;  1EOG A;  1K0O A;  4EE0 A;  4G10 A;  3LYP A;  2GDR A;  2R3X A;  4EDZ A;  3Q19 A;  1AQX A;  1GWC A;  4K0N A;  1K0B A;  3HJO A;  5DAL B;  1XWG A;  4JZQ A;  4PNF A;  2A2R A;  3DGQ A;  1YQ1 A;  5ECN B;  5EL8 A;  4BVY A;  5D9X A;  1PX6 A;  1AW9 A;  2HNL A;  2GSR A;  5ECK B;  3LXT A;  2NTO A;  3QR6 A;  1U3I A;  4PQH A;  4MF5 A;  3CSJ A;  2EFE A;  1V2A A;  4PX1 A;  2HRK A;  4ZB7 A;  4GF0 A;  4HJ2 A;  1M9A A;  1SVO A;  1Q4J A;  5A1N A;  1M99 A;  4KX4 A;  5G5F A;  1PGT A;  1HNC A;  5BMU A;  6GSY A;  5ECR B;  1BF5 A;  2OT3 A;  1YKC A;  2CZ2 A;  1K3L A;  5LD0 A;  4YAV A;  3PR8 A;  2N5F A;  5A34 A;  5FHI A;  1GNW A;  4LMV A;  3WD6 A;  4F0B A;  4WR5 A;  4AKH A;  4NHW A;  6GSU A;  19GS A;  3AY8 A;  4N3Z A;  1IYH A;  1G6W A;  1ZL9 A;  3DD3 A;  3ZML A;  4GLT A;  1PL2 A;  3H1N A;  5B7C A;  3UAP A;  2YCD A;  4W66 A;  4EC0 A;  1OKT A;  2HSM B;  4MDC A;  3VPT A;  4IBP A;  4YQU A;  1GNE A;  3GTU A;  1K0M A;  4MPG A;  5ECQ B;  4YAP A;  2WRT A;  4KDX A;  3CRT A;  1IYI A;  1M0U A;  4G01 A;  1Z9H A;  2OAC A;  1PKW A;  3FR3 A;  3BBY A;  12GS A;  3TGZ A;  6GSS A;  5D9T A;  4EXJ A;  1FHE A;  2YV9 A;  4GSS A;  4YQM A;  1V40 A;  2EFH A;  2PVQ A;  4AKX B;  4NAX A;  1GTB A;  4MK3 A;  1TXU A;  1YDK A;  1KBN A;  1LBK A;  1B8X A;  1Y1U A;  5DJM A;  1B48 A;  3M8N A;  3VI7 A;  2C80 A;  2CA8 A;  2V6K A;  1VF2 A;  1PX7 A;  1GUM A;  3IK9 A;  5A1N B;  5DCG A;  3GUR A;  2WS2 A;  3KJY A;  4FQU A;  3VUR A;  5AN1 A;  3WYW A;  5BMU B;  4KDY A;  2IMK A;  1GSD A;  1GLQ A;  4BVX A;  2GST A;  2UV8 G;  3LSZ A;  5ELG A;  2HSN A;  4BL7 A;  1AQW A;  3ERG A;  2AB6 A;  1XW5 A;  3F63 A;  3KM6 A;  2WB9 A;  1K0A A;  1GSY A;  2JL4 A;  4ZBA A;  4ZB6 A;  3IK7 A;  3LXZ A;  4IQ1 A;  3HMJ G;  4ECB A;  1TDI A;  5J5N A;  4GDF A;  1R5A A;  5ECL B;  3U6V A;  3KMN A;  3FY7 A;  4PUR A;  4Q5F A;  3D0Z A;  1BAY A;  22GS A;  3SWL A;  2VCW A;  1B4P A;  3GTU B;  2IL3 A;  1RK4 A;  1N2A A;  1K0C A;  3FYG A;  17GS A;  3CSI A;  3LG6 A;  1N25 A;  3VPQ A;  1E6B A;  3M3M A;  9GSS A;  2IMI A;  4OFT A;  10GS A;  3P8W A;  2OA7 A;  3TU3 B;  3MDK A;  3QAW A;  2R5G A;  1M9B A;  3QAV A;  3R2Q A;  4IW9 A;  20GS A;  5ECM B;  3G7J A;  4ACS A;  4E8E A;  4AKI A;  3KMO A;  1VF3 A;  5DDL A;  1VF4 A;  4GST A;  2HQT A;  2DSA A;  2VCZ A;  4F0C A;  5A5K A;  2X64 A;  4YQV A;  1HQO A;  4IQA A;  3PGT A;  3NIV A;  1TU7 A;  2LJR A;  4AI6 A;  3QAG A;  4F03 A;  2HSN B;  3ERF A;  5F0G A;  3TOT A;  4DEJ A;  4ZXG A;  3I69 A;  3N9J A;  13GS A;  4IKH A;  3EIN A;  3G7I A;  3ZFB A;  5AGY A;  4L8E A;  3FRC A;  3KTL A;  4CHS A;  5KEJ A;  4MF6 A;  4PGT A;  5EY6 A;  3GUS A;  2C3N A;  4IGJ A;  3ZMK A;  5DAK B;  4ECJ A;  1F3B A;  3P90 A;  4E8H A;  3VK9 A;  2A2S A;  3HJM A;  4MP4 A;  1VF1 A;  1K3Y A;  5ELA A;  4KDU A;  1GLP A;  1MTC A;  3Q18 A;  1EOH A;  16GS A;  1G6Y A;  3TOU A;  2CAQ A;  4ZBD A;  3CWG A;  4N0V A;  2CAI A;  4G0K A;  2VCV A;  2R4V A;  5A5H A;  4BVY B;  5J47 A;  3LJR A;  4L5O A;  3IE3 A;  2PGT A;  5A4U A;  1C72 A;  1F3A A;  1UA5 A;  4USS A;  4ID0 A;  4G19 A;  2HRK B;  1XWK A;  3VWX A;  4OMV A;  1MD3 A;  5A4W A;  7GSS A;  1GTA A;  1GUL A;  2VD1 A;  2WDU A;  4MZW A;  2FHE A;  4ZB9 A;  4O92 A;  1OE7 A;  2DC5 A;  2VCQ A;  2R6K A;  4LMW A;  2OAD A;  4RI6 A;  3FR6 A;  2UZ8 A;  4PUA A;  5D9V A;  5A34 B;  3IC8 A;  3ZFL A;  1K3O A;  2D2Z A;  3UBK A;  1JLV A;  1K0N A;  2AAW A;  4I97 A;  1EV9 A;  2AHE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...