14GSA

Glutathione s-transferase p1-1 apo form 1
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
208
structure length
194
Chain Sequence
PYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVYQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLUTATHIONE S-TRANSFERASE
publication title Evidence for an induced-fit mechanism operating in pi class glutathione transferases.
pubmed doi rcsb
source organism Homo sapiens
total genus 77
structure length 194
sequence length 208
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1997-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 14gsA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 14gsA01
1QXHA 2DMLA 4KE3A 4MJEA 1SKWB 3HVXA 4AJ7A 1A0RP 3TUEA 3LSZA 1KBNA 2X64A 12GSA 2C3TA 1TI3A 1ZYEA 2IFQB 5H5SA 5DCHA 4V2LA 5HQPA 4MMMA 4NHZA 5JCWA 4OFNA 2DBCA 1UN2A 4TRXA 2OJLA 3GX0A 2P5RA 3L4NA 2P5QA 4XRAA 4YH2A 1DE2A 3FR9A 4GSTA 5ECHB 3US3A 2K8VA 4J2FA 4F2IA 1XWGA 1OC9A 1MDIA 4POLA 4BA7A 4FYCA 5ELGA 2E2GA 4OO5A 2R5GA 2O8VB 2CT6A 3ERGA 4TR0A 3FYGA 4HZ2A 1DSBA 4X0XA 1S3AA 3FK8A 4GQCA 1JZWA 1PA3A 5DJMA 13GSA 3IHQA 2EIOA 5D9WA 1SKRB 5ECSA 3M9JA 3APQA 2DJ2A 3KTLA 1BAYA 5HFKA 3P2AA 9GSSA 3RBTA 4JE1A 5KN2A 4LMVA 1XZOA 4YQVA 4Z7XA 1TRUA 2GVPA 2ALBA 3HDCA 4OWYA 1U88A 4K7NA 3GIXA 3GMFA 2FWEA 3F4TA 4PXOA 1MDKA 2V32A 3IK9A 1SYXA 2GSRA 4N0VA 1LU4A 4QL9A 1T8EB 2KOKA 4EVMA 4YQUA 2Z9SA 1IYIA 4MF7A 2WB9A 3CRUA 2GZYA 1SL0B 3A2XA 2C80A 2VIMA 2VL2A 5G5FA 3N5OA 4MPFA 3F8UA 3KH9A 3LXZA 3DVWA 1TK8B 1Z5YE 2AUVA 3I43A 2CAQA 3VLNA 1PN9A 2ON7A 5GAND 3ZVJD 2HRAA 1USBA 5DAKA 3ERWA 2CAIA 2I81A 2OA7A 1W4VA 2H30A 1A0FA 3EMPA 5G30A 2DJ0A 3R3EA 1M2BA 3GSSA 3GNJA 4MLYA 4WETA 3KM6A 4GQFA 2YWOA 1UC7A 3A3TA 3P8WA 2PGTA 2TRCP 5ECMB 3GH9A 1R5AA 6GSUA 1TKDB 1JLWA 2OKAA 4E8HA 1V98A 2OE1A 2C0DA 1X0RA 4PUFC 3FZ5A 1SENA 1JFUA 5B6MA 2YJHA 1EV9A 4GF0A 3M1GA 3FW2A 2WS2A 3HJOA 1XW5A 2AB6A 4F0BA 5A5KA 2C8UA 3IV4A 4HOJA 4MF6A 1A2JA 1WP0A 1XCCA 3I69A 1QMVA 2GSQA 4PX1A 5F05A 2KLXA 3GHAA 1OAZA 3TJGA 3ZTLA 1TRSA 1FVJA 5A4VA 2ZUPA 2PERA 2LRTA 1MD4A 3A2WA 1F9MA 5AGYA 4HJ2A 2HNLA 4ZBAA 2GQKA 2G2QA 2MZCA 5CAXA 3FEUA 5CRDA 4K9ZA 1URMA 1TU7A 2JZRA 2H1DA 2FA8A 3GTUA 4BVXA 1TK0B 5B8BA 2WGRA 2QC7A 1VGLA 2H74A 2DJKA 1FO5A 4HS1A 2X8GA 2GS3A 4ZIJA 4CHSA 3VPQA 2IN3A 5DJLA 3ZIJA 3HZ4A 2VD0A 2WRTA 5H5RA 3LFLA 3GX8A 2RLIA 4HU7A 5KN1A 5IMVA 3UVTA 1O8WA 3P90A 2WDUA 2MMOA 1FW1A 3E0UA 3A2VA 3QMXA 1M2AA 4NAXA 2H1AA 2L6DA 2BMXA 1H4OA 6GSTA 4OFMA 1K3OA 3O3TA 1TXXA 5CP1A 1WRYA 3AY8A 1FB6A 4IJIA 3F63A 3ZMLA 4QQ7A 1RW1A 3M0FA 3PGTA 2B1LA 5ABRA 5AN1A 2I3YA 1T4ZA 3TKRA 1TTZA 2NVLA 2HZEB 3QAGA 3PR8A 4K6XA 5H5QA 1S3DA 5DQSA 2D2ZA 3KMNA 1Z7RA 2HZFA 2FNOA 5ECOB 5ID2B 3GL3A 4G0LA 1WOUA 3LJRA 1K0MA 3VFIA 4DEJA 1V40A 1PKZA 1OC8A 3WD6A 2HE3A 1O8XA 2F3MA 2IMEA 3UL3A 3CYNA 2FUG2 2QSIA 5L71A 2O85A 1TW9A 4ZBBA 2LJKA 1EGOA 1PX6A 1OYJA 2HRNA 2CZ3A 3UVHA 8GSSA 4GSNA 4I2TA 1XFLA 2E7PA 4KNDA 5G1LA 3GRXA 2R4VA 3KTBA 2LQQA 4IS0A 2XBIA 4NMUA 4N0ZA 3F6DA 2XPEA 5IMFA 2ZCTA 4POBA 1WJKA 4CDOA 1AIUA 4HJMA 3VWUA 3ZRDA 2HRFA 2X8CA 3UMAA 3LYKA 7GSSA 1SL1B 3Q18A 4G10A 2G0FA 4HI7A 4TVEA 2X99A 1WE0A 1TI1A 1BQ7A 1Z3EA 5KN3A 2KUCA 1QFNA 2J9HA 3CTGA 2A2SA 3R2QA 3WGXA 5G5EA 2EIRA 1F3BA 1QK8A 2V2GA 3BCKA 4O32A 6GSYA 3M3MA 3MSZA 20GSA 4OFTA 3E3EA 4FQUA 4HDEA 1THOA 3TJJA 2F8AA 3GKKA 2A4VA 1V9WA 1GSUA 4ACSA 1OC9B 2FHEA 3VI5A 1UVZA 2RUFA 2FA4A 3Q6OA 3UARA 4L0WA 2GT5A 1KNGA 1SJIA 1OKTA 1JZRA 3UIWA 4PQIA 2HSNB 4ZB8A 2JADA 1X9WB 2L5LA 10GSA 4TR4A 3ME7A 3KH7A 4MZCA 4N30A 1ZYQB 5ECPB 5DDLA 4ZILA 3C71A 4I2UA 4IKHA 1Q4JA 4BWQA 4NHWA 5C04A 3UAPA 1WWJA 3IBHA 4LL4B 1GLPA 2FWGA 4PQHA 2HSHA 4KDYA 5HR0A 2KHPA 1TDIA 4AGSA 1EP8A 1M9BA 5LNKe 5CREA 5JWOB 1GSQA 2V6OA 2OE3A 2VD1A 3RPNA 1R4WA 2DIYA 4MH3A 3TDGA 1HNAA 5KN0A 2NTOA 2LS5A 5JCUA 3H93A 2AV4A 1F3AA 2CVKA 3H8QA 4MABA 2V6KA 2H76A 4IQ1A 1M7TA 4I8BA 2DLXA 4BVYB 1G6WA 3UJ1A 3TJKA 4X1UA 5A4UA 2YWNA 2IPAA 4K7IA 2MBTA 4MA9A 2IWTA 1YF1A 1SL2B 4V2NA 2H1GA 3RPPA 3VWWA 4F03A 4IVFA 3W8SA 1YKAA 3CSJA 5HR1A 2K8SA 4G2EA 1RK4A 4L8EA 4TXOA 2CX4A 1XXUA 4ZL9A 4PGTA 3PINA 4HEA2 3LQ7A 2VL9A 2VCVA 6GSXA 4OCEA 1V2AA 1F37A 3QOUA 3IAS2 1EP7A 3ZZXA 1TRVA 3O76A 3C1RA 2NBSA 3J7Yb 2H75A 3TKSE 3TKSA 1ILOA 3GUSA 2HT9A 1SK2A 3CTFA 5IM9A 1PL1A 1GSYA 4ZBDA 2LV3A 2L4QA 2C0GA 5E4WA 3W8JA 2ON5A 2OE0A 3ZMKA 3D6IA 2YWMA 1X9SB 2JL4A 1PX7A 1NM3A 1Y25A 2FGXA 2NDOA 2YZUA 3ZREA 3EMXA 2FWFA 3KCMA 3HA9A 4G9HA 4FO5A 4K1FA 4TR1B 2WZ9A 1YQ1A 1PRXA 3L9VA 2YWIA 1V57A 1JHBA 4GRFA 1J9BA 1QQ2A 4L0UA 2LTKA 5FHIA 4IP6A 4EE0A 2E0QA 2JACA 3G7IA 2GT6A 2K18A 3I6AA 2GTUA 5ELAA 5GSTA 3MNGA 17GSA 3APSA 3VURA 1BG5A 1HD2A 2X8HA 2HSYA 3DXBA 4RI6A 2CV4A 2VOCA 2LJAA 1X5CA 1C72A 1GUKA 4O5RA 2CVBA 1TU8A 1B4QA 2F8FA 1AQVA 2B1KA 4N10A 4Q5RA 3I9V2 4RQRA 2R6KA 2XBQA 5INYA 5CRGA 2IIYA 3LEFA 2N5BA 3KXOA 3WYWA 11GSA 4WR5A 5EL8A 3LG6A 22GSA 1O7UA 1ZL9A 4YQMA 1G7OA 4XRDA 2EIQA 1X9MB 1VF4A 4RI7A 4YAVA 3DEXA 1U3IA 4P3YB 3ZL5A 5HR3A 3LWAA 3IDVA 5E59A 3EC3A 1VF1A 5J3RA 3DMLA 4PNFA 4KA0A 4JZQA 4BPYA 2JSZA 2H01A 3EURA 3UEMA 1GUMA 3TRPA 5J9CA 5IIZA 1ERUA 3K8NA 1G7EA 3HVSA 3KP9A 1AAZA 4ZB6A 2M46A 2FWHA 4HZ4A 1PMTA 1VF2A 5DBQA 2BTOT 3APOA 5IMDA 4LL1B 1ML6A 1ST9A 5AIXA 3O6TA 2DJJA 3QDNA 3W6GA 1XBSA 3CRTA 5ECQB 5AISA 1I5GA 3FHKA 1S3CA 2H6ZA 2LJRA 4PNGA 3BCIA 1GSSA 1XVWA 2K6VA 1B4PA 4MJCA 1HNBA 1GLQA 2AYTA 4WBJA 5D8IA 4PURA 1O6JA 1Y6EA 2YANA 3HD5A 4GWRA 3OR5A 2I9HA 1GH2A 4DSSA 4F82A 4FYBA 2HRKA 18GSA 1E6BA 1VRSD 4HQSA 4WKWA 1K0CA 1M99A 4I6XA 3DGQA 1YJ6A 4OO4A 14GSA 1KEBA 3KJYA 2YV7A 2VLUA 1OC3A 3DKSA 16GSA 3CSIA 1T00A 4BWSA 1O73A 1GWCA 2CVDA 2H1BA 1SJZA 4JEDA 3U5RE 1OE8A 3UOMA 1DBYA 4TR3A 1XIYA 4IN0A 1TP9A 3WT1A 5LD0A 1E2YA 3M9KA 1ZOFA 5DVBA 2RM6A 1SYRA 4Q5NA 1RQMA 2L6CA 4ID0A 3M8NA 1DE1A 1K3LA 4HQZA 4WR4A 2PPTA 1XOAA 2DSAA 2HFDA 3A5WA 1XOBA 3FY7A 2ZNMA 4KX4A 4HU9A 3D21A 2DIZA 4POMA 2R3XA 5GAPD 3QPMA 3MDKA 4G19A 4MP4A 2PWJA 4XS6A 2NPBA 3ME8A 4KUNA 1GL8A 3NIVA 2KP1A 1Z6NA 3IPZA 1ON4A 2VCZA 4WF4A 3GH6A 3FZAA 3DIEA 3FKFA 1OKDA 4PUAA 3ZLPA 1FVKA 1XPVA 3D22A 4FH8A 3HKRA 4KGIA 3EINA 3TB2A 1AW9A 2OADA 1A24A 3KIJA 2HI7A 3L9SA 3TJBA 2VUPA 5EVOA 1YF0A 1G0TA 2CA8A 3RHCA 3WT2A 1B9XC 2IMFA 5DALB 2V41A 2YNXA 1EOGA 3DRNA 1R5PA 4ML6A 5C00A 1BJXA 2GQLA 4GSSA 4K7OA 4EUYA 1JZOA 3ZVJA 2H72A 1XWAA 5F06A 3DD3A 1BX9A 4NV5A 1FG4A 2VL3A 1A8LA 2LRNA 4TXOB 4GLTA 4DVCA 1J0FA 5D93A 5COHA 1SK1A 3WGEA 5LCZA 5CRWA 2B5YA 2XPDA 5B7CA 3IOSA 1YEPA 3CMIA 2GSSA 2HSMA 2LRCA 4I97A 4WXTA 4X43A 5G2ZA 3E9JB 2H71A 3GYKA 1H75A 2QGVA 4O92A 3EU4A 5CNWA 3KMOA 4KW6A 4QL7A 4JR6A 3GV1A 2DC5A 1PSQA 4FIWA 5IO0A 4CW9A 3HHVA 5BMUA 1WIKA 4KAEA 1EWXA 5IQYA 1SU9A 3TRXA 2GQMA 5ID2A 5HFIA 1M9AA 3EYTA 1SD8A 3VPTA 1QGVA 2K9FA 3GA4A 1NW2A 4KH7A 3VI7A 2HXKA 3HYPA 4BL7A 4TKYA 1XWBA 2B7JA 2P0GA 1WMJA 1GSDA 2XHFA 5B8AA 4MZWA 1XWCA 2F51A 4YAPA 2YJ7A 3TGZA 2MMAA 1SK0A 2PN8A 3HXSA 1G6YA 4XTSA 1K0AA 3G9BA 4L5LA 3G7YA 3KGKA 1GSEA 4EC0A 5GZZB 1MDJA 1BYEA 4EDZA 2BJXA 1SJ6A 4JRRA 3GSTA 4TXVA 2L5OA 4K8MA 1YZXA 2H6XA 5DAKB 3EE2A 3TRQA 1FOVA 3Q74A 2AJQB 2J23A 2PBJA 5IO2A 3G7JA 2DJ3A 4OMVA 4WF5A 1PD21 2L59A 2WULA 2YN1A 3Q19A 4IBPA 1TJDA 3C1SA 3BBYA 3RDWA 3CSHA 4ISDA 5IMCA 2M72A 4O7HA 2PMTA 4ZL8A 3L0HA 3ED3A 4KSOA 2JZTA 4IHUA 1K3YA 2GZPA 4D73A 4IELA 2RUEA 3HJMA 3TJFA 1GTAA 5IPHA 2RIIA 3F3QA 4PQ1A 1CQGA 4ZXGA 4EXJA 2MMZA 3IAM2 2OACA 1GTBA 2MBSA 2FY6A 5ECRB 2QKEA 5FT3A 2AAWA 4AJ8A 4LMWA 2GGTA 3F6FA 3IRAA 1XW6A 3MAKA 2TRXA 1EZKA 4K0NA 1M2DA 3CXGA 4XS4A 2LQOA 3HY2A 2VO4A 4TOPA 3GTUB 4BVXB 1ZGNA 3D4TA 1TK5B 4L5OA 1X5EA 3PH9A 2H8LA 3ZIVA 4DSSB 1B9YC 2HRKB 5CO3A 2VAFA 2TIRA 3EWLA 4V1Ap 3ZFBA 3IC4A 4OCFA 1PKWA 2VLTA 3LORA 4TW5A 4JR4A 1T1VA 3LGCA 1K0DA 4AJ6A 2CZ2A 3QAWA 4HUAA 2H6YA 2LKUA 3GURA 1GSFA 1MTCA 4GXZA 3KZQA 3KD0A 1SKSB 3IK7A 2H0GA 2AHEA 5ECIB 3WGDA 3LYPA 1AQXA 1ERWA 3D5JA 2KP2A 3IC8A 1ZZYA 4BVYA 3GKMA 2FCHA 1ABAA 4K0GA 1O81A 4ILFA 2JU5A 5F07A 1OE7A 3L78A 1M0UA 3GKNA 2LNSA 1VF3A 1F6MC 1KTEA 2IJYA 5GSSA 2I4AA 2O89A 4MCUA 1U3AA 2DJ1A 2O87A 1T3BA 3HCZA 2B6MA 6GSWA 2IFQA 2R2JA 2L57A 4XIHA 1EV4A 4ECJA 4FYUA 3RAZA 5G31A 3VK9A 2VCTA 2EC4A 3ISOA 2VCQA 3GN3A 2REMA 5HFGA 1K0NA 4ML1A 1LBKA 1TOFA 3EU3A 4ULXA 1JZDA 3ZYWA 1V58A 5IMZA 3F4SA 5J4UA 3H1NA 2VM1A 1PQNA 5ENUA 3RHBA 4USSA 5CRHA 1X5DA 4EL1A 1I9DA 3HVVA 2UZ8A 4KCEA 3TKPA 1GRXA 5F8BA 2PU9C 3KEBA 1THXA 1YDKA 4RQXA 2YOIA 3F9UA 2CQ9A 4K2DA 2P31A 3P7XA 1DUGA 3C7MA 5DQYA 5A4WA 1ERTA 3UBKA 3TOUA 5G1KA 5J41A 4EO3A 5B6NA 3BOAA 1CQHA 4TR1A 2H0HA 5IMAA 5J5NA 2OBIA 4Q5FA 2C4JA 2OBKA 3IA1A 2C0EA 4NV2A 4KDUA 2H19A 4ECCA 5EPFA 4XCSA 3FR6A 2PUKC 2L4CA 2V1MA 4POKA 2LSTA 4MH2A 1HQOA 1YY7A 4G0KA 3SBCA 2GDRA 3LXTA 19GSA 5IOXA 4WBRD 1MEKA 1EEJA 1A8YA 3TKQA 1GUHA 1EGRA 5D9XA 1GP1A 3GKXA 1PGTA 3VWXA 3TCOA 4IP1A 2XC2A 4PTSA 4XHMA 2C0FA 2GSTA 3IR4A 5ECLB 4MJBA 4KB3A 4F9ZA 4N11A 3PPUA 3H79A 1K0BA 2HSMB 3HJPA 2N5AA 1GTIA 2HYXA 1GTUA 2FLSA 1EOHA 1YEXA 3FRCA 6GSSA 4IGJA 3U6VA 1FB0A 2B5EA 1XVQA 2B5XA 4DSRA 1ZCPA 2O7KA 2JZSA 4OD7A 1FHEA 2YCDA 3IXRA 1GULA 1XWKA 2LEGA 4G0IA 2F9SA 3CBUA 3ZFLA 4IJ3A 4EDYA 1AXDA 5EY6A 3DVXA 5D9VA 2M80A 2WCIA 1J08A 1Z6MA 2B7KA 3F0IA 3ERFA 2PVOC 2YP6A 1A2MA 3C8EA 5IOWA 4MK3A 5ECNB 2ES7A 2LNTA 3UBLA 4KCAA 2H0IA 1GNWA 3IE3A 3FZ4A 4BL7B 4NPBA 3V1WA 4E8EA 3F4RA 2GLRA 5JCGA 4MZBA 4NWYA 1U87A 3MWHA 4JU5A 5FWGA 5J9BA 3D4MA 1BEDA 4TN8A 5D96A 1IYHA 2IMIA 2HLSA 2C3NA 4ECBA 1JLVA 6GSVA 3TOTA 1TRWA 3D0ZA 1FAAA 2RM5A 1SD9A 2IL3A 4WEYA 1T7PB 1LJRA 1Z9HA 2IMDA 2YPMA 1ERVA 3QR6A 4J57E 4KF9A 2C1YA 2R37A 1XW9A 4J56E 3EVIA 1A2LA 3NOFA 1N2AA 4MJAA 4MF5A 3FZ9A 1R26A 5KEJA 4GTUA 3J7Yk 3KP8A 2WJUA 4JBBA 1HYUA 4D73B 3NZNA 5D9TA 1K0OA 5AIVA 3HZ8A 1YKCA 1Z7PA 2MMNA 2JSYA 3C73A 1AQWA 3QFBC 2CX3A 4ZB9A 2E2MA 2FD3A 2H70A 3L9UA 3QAVA 2GZZA 3F3RA 2A2RA 4KDXA 2YV9A 3QD9A 3TKSC 1QUWA 4GCIA 1T4YA 1EEMA 1ZMAA 1NHOA 5IPGA 2HZEA 4V1Ag 2H73A 1B48A 3SWLA 4IW9A 1GNEA 3GFKA 1WPIA 4EF0A 1HNCA 1NHYA 2WFCA 1W89A 1A23A 2YZHA 4XS4B 5CYYA 4ECIA 2H66A 1O85A 1F2EA 1OVNA 1UA5A 1R7HA 4Q5QA 1U6TA 4LLRA 2N5FA 4RUVA 4V2MA 2I1UA 2IMKA 1AUCA 1N8JA 2VM2A 2PVQA 4ZL7A 3N9JA 4F0CA 3VWVA 3DYRA 5HR2A 5JWRB 1PL2A 1MD3A 4DSQA 2B3SA 2VCXA 3BD2A 3BJ5A 3GL5A 1B8XA 3DWVA 3FR3A 3JCML 2C3QA 2MYGA 3S9FA 4KSMA 4EKZA 4I5QA 5D73A 2LUSA 5JWQB 2VL2C 5F0GA 5ECKB 2HQTA 2VLVA 1NSWA 4MDCA 1AC1A 3ZITA 5DALA 3QFAC 3H4KA 4NXIA 4IQAA 1ACVA 2DMMA 4XS1A 4AF2A 1Q98A 4MPGA 2VCWA 4H86A 5DCGA 3QCPA 4LA1A
chains in the Genus database with same CATH superfamily
1QXHA 2DMLA 4KE3A 4MJEA 1TXUA 1SKWB 3HVXA 4AJ7A 1A0RP 3TUEA 3LSZA 1KBNA 2X64A 2A2PA 12GSA 2C3TA 1TI3A 1ZYEA 2IFQB 5H5SA 5DCHA 4V2LA 5HQPA 4MMMA 4NHZA 5JCWA 4OFNA 2DBCA 1UN2A 4TRXA 2OJLA 3GX0A 2P5RA 3L4NA 2P5QA 4XRAA 4YH2A 1DE2A 3FR9A 4GSTA 5ECHB 3US3A 2K8VA 4J2FA 4F2IA 1XWGA 1OC9A 1MDIA 4POLA 4BA7A 4FYCA 5ELGA 2E2GA 4OO5A 2R5GA 2O8VB 2CT6A 3ERGA 4TR0A 3FYGA 4HZ2A 1DSBA 4X0XA 1S3AA 3FK8A 4GQCA 1JZWA 1PA3A 5DJMA 2HSNA 13GSA 3IHQA 2EIOA 5D9WA 1SKRB 2EFEA 5ECSA 3APQA 3M9JA 2DJ2A 3KTLA 1BAYA 5HFKA 3P2AA 4Z2RA 9GSSA 3RBTA 4JE1A 5KN2A 4LMVA 1XZOA 4YQVA 4Z7XA 1TRUA 2GVPA 2ALBA 3HDCA 4OWYA 1U88A 4K7NA 3GIXA 3GMFA 2FWEA 3F4TA 4PXOA 1MDKA 1YEWC 2V32A 3IK9A 1SYXA 2GSRA 4N0VA 1LU4A 4QL9A 1T8EB 2KOKA 4EVMA 4YQUA 2Z9SA 1IYIA 4MF7A 2WB9A 3CRUA 2GZYA 1SL0B 3A2XA 2C80A 2VIMA 2VL2A 5G5FA 3N5OA 4MPFA 3F8UA 3KH9A 3LXZA 1SVMA 3DVWA 1TK8B 1Z5YE 2AUVA 3I43A 2CAQA 3VLNA 1PN9A 2ON7A 5GAND 3ZVJD 5KOWA 1SVLA 2HRAA 1USBA 4MNNA 2X49A 5DAKA 3ERWA 2CAIA 2I81A 2OA7A 1W4VA 2H30A 1A0FA 3EMPA 5G30A 2DJ0A 4Z2UA 4PI0C 3R3EA 1M2BA 3GSSA 3GNJA 4MLYA 4WETA 3KM6A 2YWOA 4GQFA 1UC7A 3A3TA 3P8WA 2PGTA 2TRCP 5ECMB 3GH9A 1R5AA 6GSUA 1TKDB 4PHZC 1JLWA 2OKAA 2WW0A 4E8HA 1V98A 2OE1A 2C0DA 1X0RA 4PUFC 3FZ5A 1SENA 1JFUA 5B6MA 2YJHA 1EV9A 4GF0A 3M1GA 3FW2A 2WS2A 3HJOA 1XW5A 2AB6A 4F0BA 5A5KA 2C8UA 3IV4A 4HOJA 4MF6A 1A2JA 1WP0A 1XCCA 3I69A 1QMVA 2GSQA 4PX1A 5F05A 2KLXA 3GHAA 1OAZA 3TJGA 3ZTLA 1TRSA 1FVJA 5A4VA 2ZUPA 2PERA 2LRTA 1MD4A 3A2WA 1F9MA 5AGYA 4HJ2A 2HNLA 4ZBAA 2GQKA 2G2QA 2MZCA 5CAXA 3FEUA 5CRDA 4K9ZA 1URMA 1TU7A 2JZRA 2H1DA 2FA8A 3GTUA 4BVXA 1TK0B 5B8BA 2WGRA 2QC7A 1VGLA 2H74A 2DJKA 1FO5A 4HS1A 2X8GA 2GS3A 4ZIJA 4CHSA 3VPQA 2IN3A 5DJLA 4AKXB 3ZIJA 3HZ4A 2VD0A 2WRTA 5H5RA 3LFLA 3GX8A 2RLIA 4HU7A 5KN1A 5IMVA 3UVTA 1O8WA 4GDFA 3P90A 2WDUA 2MMOA 1FW1A 3E0UA 3A2VA 3QMXA 1M2AA 4NAXA 2H1AA 2L6DA 2BMXA 1H4OA 6GSTA 4OFMA 1K3OA 3O3TA 1TXXA 5CP1A 1WRYA 3AY8A 1FB6A 4IJIA 3F63A 3ZMLA 4QQ7A 1RW1A 4X4JA 3M0FA 3PGTA 2B1LA 5ABRA 5AN1A 2I3YA 1T4ZA 3TKRA 1TTZA 5BMUB 2NVLA 2HZEB 3QAGA 3PR8A 4K6XA 5H5QA 1S3DA 5DQSA 2D2ZA 3KMNA 1Z7RA 2HZFA 2FNOA 5ECOB 5ID2B 3GL3A 4G0LA 1WOUA 4QMKA 3LJRA 1K0MA 3VFIA 4DEJA 1V40A 1PKZA 1OC8A 3WD6A 2HE3A 1O8XA 2F3MA 2IMEA 3UL3A 3CWGA 3CYNA 2FUG2 2WZSA 2QSIA 5L71A 2O85A 1TW9A 4ZBBA 2LJKA 1EGOA 1PX6A 1OYJA 2HRNA 2CZ3A 3UVHA 8GSSA 4GSNA 4I2TA 1XFLA 2E7PA 4KNDA 5G1LA 4YKFA 3GRXA 2R4VA 1M3IA 3KTBA 2LQQA 4IS0A 2XBIA 4NMUA 4N0ZA 3F6DA 2XPEA 5IMFA 2ZCTA 4POBA 1WJKA 4CDOA 1AIUA 4HJMA 3VWUA 3ZRDA 2O3EA 2HRFA 2X8CA 3UMAA 3LYKA 7GSSA 1SL1B 3Q18A 4G10A 2G0FA 4BIKA 4HI7A 4TVEA 2X99A 1WE0A 1TI1A 1BQ7A 1Z3EA 5KN3A 2KUCA 1QFNA 2J9HA 3CTGA 2A2SA 3R2QA 3WGXA 5G5EA 2EIRA 1F3BA 1QK8A 2V2GA 3BCKA 4O32A 6GSYA 3M3MA 3MSZA 20GSA 4OFTA 1Y1UA 3E3EA 4FQUA 4HDEA 1THOA 3TJJA 2F8AA 3GKKA 2A4VA 1V9WA 1GSUA 4ACSA 1OC9B 2FHEA 3VI5A 1UVZA 2RUFA 2FA4A 3Q6OA 3UARA 4L0WA 2GT5A 1KNGA 1SJIA 1OKTA 2QA1A 1JZRA 3UIWA 4PQIA 2HSNB 4ZB8A 1ZYPA 2JADA 1X9WB 2L5LA 10GSA 2UV8G 4TR4A 3ME7A 5A34A 3KH7A 4MZCA 4N30A 1ZYQB 5ECPB 4YKGA 5DDLA 4ZILA 3C71A 4I2UA 4IKHA 1Q4JA 4BWQA 4NHWA 5C04A 3UAPA 1WWJA 3IBHA 4LL4B 1GLPA 2FWGA 4PQHA 2HSHA 4KDYA 5HR0A 2KHPA 1TDIA 4AGSA 1EP8A 1M9BA 5LNKe 5CREA 5JWOB 1GSQA 2V6OA 2OE3A 2VD1A 3RPNA 1R4WA 3RGBC 2DIYA 4MH3A 3TDGA 1HNAA 5KN0A 2NTOA 2LS5A 5JCUA 3H93A 2AV4A 3MIXA 1F3AA 2CVKA 3H8QA 4MABA 2V6KA 2H76A 4IQ1A 1M7TA 4I8BA 2DLXA 4BVYB 1G6WA 3UJ1A 3TJKA 4X1UA 5A4UA 2YWNA 2IPAA 4K7IA 2MBTA 4MA9A 2EFCA 2IWTA 1YF1A 1SL2B 4V2NA 2H1GA 3RPPA 3VWWA 4F03A 4IVFA 3W8SA 1YKAA 3CSJA 5HR1A 2K8SA 4G2EA 1RK4A 4L8EA 4TXOA 2CX4A 1XXUA 4EIPA 4ZL9A 4PGTA 3PINA 4HEA2 3LQ7A 2VL9A 2VCVA 6GSXA 4OCEA 1V2AA 1F37A 3QOUA 2VKZG 3IAS2 1EP7A 3ZZXA 1TRVA 3O76A 1YVLA 3C1RA 2NBSA 3J7Yb 2H75A 3TKSE 5A5HB 3TKSA 1ILOA 3GUSA 2HT9A 1SK2A 3CTFA 5IM9A 1PL1A 1GSYA 4ZBDA 2LV3A 2L4QA 2C0GA 5E4WA 3W8JA 2ON5A 2OE0A 3ZMKA 3D6IA 2YWMA 1X9SB 2JL4A 1PX7A 1NM3A 1Y25A 2FGXA 2NDOA 2YZUA 3ZREA 3EMXA 2FWFA 3KCMA 3HA9A 4G9HA 1ZYNA 4FO5A 4K1FA 4TR1B 2WZ9A 1YQ1A 1PRXA 3L9VA 5J47A 2YWIA 1V57A 1JHBA 4GRFA 1J9BA 1QQ2A 4L0UA 2LTKA 5FHIA 4IP6A 4EE0A 2E0QA 2JACA 3G7IA 2GT6A 2K18A 4K2XA 3I6AA 2GTUA 5ELAA 5GSTA 3RFRC 3MNGA 17GSA 3APSA 3VURA 1BG5A 1HD2A 2X8HA 2HSYA 3DXBA 4RI6A 2CV4A 2VOCA 2LJAA 1X5CA 1C72A 1GUKA 2R0GA 4O5RA 1PN0A 2CVBA 1TU8A 1B4QA 2WVXB 2F8FA 1AQVA 2B1KA 4N10A 4Q5RA 5A1NB 3I9V2 4RQRA 2R6KA 2XBQA 5INYA 5CRGA 2IIYA 1S3RA 3LEFA 2N5BA 3KXOA 3WYWA 11GSA 4WR5A 5EL8A 3LG6A 22GSA 1O7UA 1ZL9A 4YQMA 1G7OA 4XRDA 2EIQA 1X9MB 1VF4A 4RI7A 4YAVA 3DEXA 1U3IA 4P3YB 3ZL5A 5HR3A 3LWAA 3IDVA 5E59A 2O36A 3EC3A 1VF1A 5J4YA 5J3RA 3DMLA 4PNFA 4KA0A 4JZQA 4BPYA 2JSZA 2H01A 3EURA 3UEMA 1GUMA 3TRPA 5J9CA 5IIZA 1ERUA 3K8NA 1BG1A 1G7EA 3HVSA 3KP9A 1AAZA 4ZB6A 2M46A 2FWHA 2EFHA 4HZ4A 3MYDA 1PMTA 1VF2A 5DBQA 2BTOT 3APOA 5IMDA 4LL1B 1ML6A 1ST9A 5AIXA 3O6TA 2DJJA 3QDNA 3W6GA 1XBSA 3CRTA 5ECQB 5AISA 1I5GA 3FHKA 1S3CA 2H6ZA 2LJRA 4PNGA 3BCIA 1GSSA 1XVWA 4Z2TA 2K6VA 1B4PA 4MJCA 1HNBA 1GLQA 2AYTA 4WBJA 5D8IA 4PURA 1O6JA 1Y6EA 2YANA 3HD5A 1I1IP 4GWRA 3OR5A 2I9HA 1GH2A 4DSSA 4F82A 4FYBA 2HRKA 18GSA 1E6BA 1VRSD 4HQSA 4WKWA 1K0CA 1M99A 4I6XA 3DGQA 1YJ6A 4OO4A 14GSA 1KEBA 3KJYA 2YV7A 2DKHA 4AKHA 2VLUA 1OC3A 3DKSA 16GSA 3CSIA 1T00A 4BWSA 1O73A 1GWCA 2CVDA 2H1BA 1SJZA 4JEDA 3U5RE 1OE8A 3UOMA 1DBYA 4TR3A 1XIYA 4IN0A 1TP9A 3WT1A 5LD0A 1E2YA 3M9KA 3EPTA 1ZOFA 5DVBA 2RM6A 1SYRA 4Q5NA 1RQMA 2L6CA 4ID0A 3M8NA 3HVNA 1DE1A 4ICYA 1K3LA 4HQZA 4WR4A 2PPTA 1XOAA 2DSAA 2HFDA 3A5WA 1XOBA 3FY7A 2ZNMA 4KX4A 4HU9A 3D21A 4AI6A 2DIZA 4POMA 2R3XA 5GAPD 4A5PA 3QPMA 2O5VA 4N3ZA 5A34B 3CHXC 3MDKA 4G19A 4MP4A 2PWJA 4XS6A 2NPBA 3ME8A 4KUNA 1GL8A 3NIVA 3FMWA 2KP1A 1Z6NA 3IPZA 1ON4A 2VCZA 4WF4A 3GH6A 3FZAA 3DIEA 3FKFA 1OKDA 4PUAA 4EIQA 3ZLPA 1FVKA 1XPVA 3D22A 4FH8A 3HKRA 4KGIA 3EINA 3TB2A 1AW9A 2OADA 1A24A 3KIJA 2HI7A 3L9SA 3TJBA 2VUPA 5EVOA 1YF0A 1G0TA 2CA8A 3RHCA 3WT2A 1B9XC 2IMFA 5DALB 2V41A 2YNXA 1EOGA 3DRNA 1R5PA 2A4HA 4ML6A 5C00A 1BJXA 2GQLA 4GSSA 2EFDA 4K7OA 4EUYA 1JZOA 3ZVJA 2H72A 1XWAA 5F06A 3DD3A 1BX9A 4NV5A 1FG4A 2VL3A 1A8LA 1SVOA 2WW1A 2LRNA 4TXOB 4GLTA 4DVCA 1J0FA 5D93A 5COHA 1SK1A 3WGEA 5LCZA 5CRWA 2B5YA 2XPDA 5B7CA 3IOSA 1YEPA 3CMIA 2GSSA 2HSMA 2LRCA 4I97A 4WXTA 4X43A 5G2ZA 3E9JB 2H71A 3GYKA 1H75A 2QGVA 4O92A 3EU4A 5CNWA 3KMOA 4O5UA 4KW6A 4QL7A 4JR6A 3GV1A 2DC5A 1PSQA 4FIWA 5IO0A 4CW9A 3HHVA 5BMUA 1WIKA 4KAEA 1EWXA 4CY8A 5IQYA 1SU9A 3TRXA 2GQMA 5ID2A 5HFIA 1M9AA 4W66A 3EYTA 1SD8A 3VPTA 1QGVA 2K9FA 3GA4A 1NW2A 4KH7A 3VI7A 2HXKA 3HYPA 4BL7A 4TKYA 1XWBA 2B7JA 2P0GA 1WMJA 1GSDA 2XHFA 5B8AA 4MZWA 1XWCA 2F51A 4YAPA 2YJ7A 3TGZA 2MMAA 1SK0A 2PN8A 3HXSA 1G6YA 4XTSA 1K0AA 3G9BA 4L5LA 3G7YA 5KOXA 3KGKA 1GSEA 4EC0A 5GZZB 1MDJA 1BYEA 4EDZA 5J40A 2BJXA 1SJ6A 4JRRA 3GSTA 4TXVA 2L5OA 4K8MA 1YZXA 2H6XA 5BRTA 5DAKB 3EE2A 3TRQA 1FOVA 4E68A 3Q74A 2AJQB 2J23A 2PBJA 5IO2A 3G7JA 2DJ3A 4OMVA 4WF5A 1PD21 2L59A 2WULA 2YN1A 3Q19A 4IBPA 1TJDA 3C1SA 3BBYA 3RDWA 3CSHA 4ISDA 5IMCA 2M72A 4O7HA 2PMTA 4ZL8A 3L0HA 3ED3A 4KSOA 2JZTA 4IHUA 1K3YA 2GZPA 4D73A 4IELA 2RUEA 3HJMA 3TJFA 1GTAA 5IPHA 2DKIA 2RIIA 3F3QA 4PQ1A 1CQGA 4ZXGA 4EXJA 2MMZA 3IAM2 2OACA 1GTBA 2MBSA 2H1LA 2FY6A 5ECRB 2QKEA 5FT3A 2AAWA 4AJ8A 4LMWA 1XG8A 2GGTA 3F6FA 3IRAA 1XW6A 3MAKA 2TRXA 1EZKA 4K0NA 1M2DA 3CXGA 4XS4A 2LQOA 3HY2A 2VO4A 4TOPA 3GTUB 3TU3B 4BVXB 1ZGNA 3CQFA 3D4TA 1TK5B 4K5SA 4L5OA 1X5EA 3PH9A 2H8LA 3ZIVA 4DSSB 1B9YC 2HRKB 5CO3A 2VAFA 2TIRA 3EWLA 4V1Ap 3ZFBA 3IC4A 4OCFA 1PKWA 2VLTA 3LORA 4TW5A 4JR4A 2WW3A 1T1VA 3LGCA 1K0DA 4AJ6A 2CZ2A 3QAWA 4HUAA 2H6YA 2LKUA 3GURA 1GSFA 1MTCA 4FXYP 4GXZA 3KZQA 3KD0A 1SKSB 3IK7A 2H0GA 2QA2A 2AHEA 5ECIB 3WGDA 3LYPA 1AQXA 1ERWA 3D5JA 2KP2A 3IC8A 1ZZYA 4BVYA 3GKMA 2FCHA 1ABAA 4K0GA 4ZB7A 1O81A 4ILFA 2JU5A 5F07A 1OE7A 3L78A 1M0UA 3GKNA 2LNSA 1VF3A 1F6MC 1KTEA 2IJYA 5GSSA 2I4AA 2O89A 4MCUA 1U3AA 2DJ1A 2O87A 1T3BA 3HCZA 2B6MA 4O5QA 6GSWA 2IFQA 2R2JA 2L57A 4XIHA 1EV4A 4ECJA 4FYUA 3RAZA 5G31A 3VK9A 4K5RA 2VCTA 2EC4A 3ISOA 2VCQA 3GN3A 2REMA 5HFGA 1K0NA 4ML1A 1LBKA 1TOFA 3EU3A 4ULXA 1JZDA 3ZYWA 1V58A 5IMZA 3LW9A 3F4SA 5J4UA 5A5HA 3H1NA 2VM1A 1PQNA 5ENUA 3RHBA 4USSA 5CRHA 1X5DA 4EL1A 1I9DA 3HVVA 2UZ8A 4KCEA 3TKPA 1GRXA 1PFOA 5F8BA 2PU9C 3KEBA 1THXA 1BF5A 1YDKA 4RQXA 2YOIA 3F9UA 2WW2A 2CQ9A 4K2DA 2P31A 3P7XA 1DUGA 3C7MA 5DQYA 5A4WA 1ERTA 3UBKA 3TOUA 5G1KA 5J41A 4EO3A 5B6NA 3BOAA 1CQHA 4TR1A 2H0HA 5IMAA 5J5NA 2OBIA 4Q5FA 2WVZA 2C4JA 2OBKA 3IA1A 2C0EA 2X4AA 4NV2A 4KDUA 2H19A 4ECCA 5EPFA 4XCSA 3FR6A 2PUKC 2L4CA 2R0CA 2V1MA 4POKA 2LSTA 4MH2A 1HQOA 1YY7A 4G0KA 3SBCA 2GDRA 3LXTA 19GSA 5IOXA 4WBRD 1MEKA 1EEJA 1A8YA 3TKQA 1GUHA 1EGRA 5D9XA 1GP1A 3GKXA 1PGTA 3VWXA 3TCOA 4IP1A 2XC2A 4PTSA 4XHMA 3A5IA 2C0FA 2GSTA 3IR4A 5ECLB 4MJBA 4KB3A 2WVXA 4F9ZA 4N11A 3PPUA 3H79A 1K0BA 5A1NA 2HSMB 3HJPA 2N5AA 1GTIA 2HYXA 1GTUA 2FLSA 1EOHA 1YEXA 3FRCA 6GSSA 4IGJA 3U6VA 1FB0A 2B5EA 1XVQA 2B5XA 4DSRA 1ZCPA 2O7KA 2JZSA 4OD7A 1FHEA 2YCDA 3IXRA 1GULA 1XWKA 2LEGA 4G0IA 2F9SA 3CBUA 3ZFLA 4IJ3A 4EDYA 1AXDA 5EY6A 3DVXA 1N25A 5D9VA 2M80A 2WCIA 1J08A 1Z6MA 2B7KA 3F0IA 3ERFA 2PVOC 2YP6A 1A2MA 1FOHA 3C8EA 5IOWA 4MK3A 5ECNB 2ES7A 2LNTA 3UBLA 4KCAA 2H0IA 2WVYA 1GNWA 3IE3A 3FZ4A 4BL7B 4NPBA 3V1WA 4E8EA 3F4RA 2GLRA 5JCGA 4MZBA 4NWYA 2OT3A 2R0PA 1U87A 3MWHA 4JU5A 5FWGA 5J9BA 3D4MA 4AKGA 1BEDA 4TN8A 5D96A 1IYHA 2IMIA 2HLSA 2C3NA 4ECBA 3IHGA 1JLVA 6GSVA 3TOTA 1TRWA 3D0ZA 1FAAA 2RM5A 1SD9A 2IL3A 4WEYA 1T7PB 1LJRA 1Z9HA 2IMDA 2YPMA 1ERVA 3QR6A 4J57E 4KF9A 2C1YA 2R37A 1XW9A 4J56E 3EVIA 1A2LA 3NOFA 1N2AA 4MJAA 4MF5A 3FZ9A 1R26A 5KEJA 4GTUA 3J7Yk 3KP8A 2WJUA 3HMJG 4JBBA 1HYUA 4D73B 3NZNA 5D9TA 1K0OA 5AIVA 3HZ8A 1YKCA 1Z7PA 2MMNA 2JSYA 3C73A 1AQWA 3QFBC 2CX3A 4ZB9A 2E2MA 2FD3A 2H70A 3L9UA 3QAVA 2GZZA 3F3RA 2A2RA 4KDXA 2YV9A 3QD9A 3TKSC 1QUWA 4GCIA 1T4YA 1EEMA 1ZMAA 1NHOA 5IPGA 2HZEA 4V1Ag 2H73A 1B48A 3SWLA 4IW9A 1GNEA 3GFKA 1WPIA 4EF0A 1HNCA 1NHYA 2WFCA 1S4BP 1W89A 1A23A 5J4VA 1M3JA 2YZHA 4XS4B 5CYYA 4ECIA 2H66A 1O85A 1F2EA 1OVNA 1UA5A 1R7HA 4Q5QA 1U6TA 4LLRA 2N5FA 4RUVA 4V2MA 2I1UA 2IMKA 1AUCA 4G01A 4HSCX 1N8JA 2VM2A 2PVQA 4ZL7A 3N9JA 4AKIA 4CY6A 4F0CA 3VWVA 3DYRA 5HR2A 5JWRB 1PL2A 1MD3A 4DSQA 2B3SA 2VCXA 3BD2A 3BJ5A 3GL5A 1B8XA 3DWVA 3FR3A 3JCML 2C3QA 2MYGA 3S9FA 4KSMA 4EKZA 4I5QA 5D73A 2LUSA 5JWQB 2VL2C 5F0GA 5ECKB 2HQTA 2VLVA 1NSWA 4MDCA 1AC1A 3ZITA 5DALA 3QFAC 3H4KA 4NXIA 4IQAA 1ACVA 2DMMA 4XS1A 4AF2A 1Q98A 4MPGA 2VCWA 4PI2C 5DCGA 3QCPA 4H86A 4LA1A
chains in the Genus database with same CATH topology
1QXHA 2DMLA 4KE3A 4MJEA 1TXUA 1SKWB 3HVXA 4AJ7A 1A0RP 3TUEA 3LSZA 1KBNA 2X64A 2A2PA 12GSA 2C3TA 1TI3A 1ZYEA 2IFQB 5H5SA 5DCHA 4V2LA 5HQPA 4MMMA 4NHZA 5JCWA 4OFNA 2DBCA 1UN2A 4TRXA 2OJLA 3GX0A 2P5RA 3L4NA 2P5QA 4XRAA 4YH2A 1DE2A 3FR9A 4GSTA 5ECHB 3US3A 2K8VA 4J2FA 4F2IA 1XWGA 1OC9A 1MDIA 4POLA 4BA7A 4FYCA 5ELGA 2E2GA 4OO5A 2R5GA 2O8VB 2CT6A 3ERGA 4TR0A 3FYGA 4HZ2A 1DSBA 4X0XA 1S3AA 3FK8A 4GQCA 1JZWA 1PA3A 5DJMA 2HSNA 13GSA 3IHQA 2EIOA 5D9WA 1SKRB 2EFEA 5ECSA 3APQA 3M9JA 2DJ2A 3KTLA 1BAYA 5HFKA 3P2AA 4Z2RA 9GSSA 3RBTA 4JE1A 5KN2A 4LMVA 1XZOA 4YQVA 4Z7XA 1TRUA 2GVPA 2ALBA 3HDCA 4OWYA 1U88A 4K7NA 3GIXA 3GMFA 2FWEA 3F4TA 4PXOA 1MDKA 2V32A 3IK9A 1SYXA 2GSRA 4N0VA 1LU4A 4QL9A 1T8EB 2KOKA 4EVMA 4YQUA 2Z9SA 1IYIA 4MF7A 2WB9A 3CRUA 2GZYA 1SL0B 3A2XA 2C80A 2VIMA 2VL2A 5G5FA 3N5OA 4MPFA 3F8UA 3KH9A 3LXZA 1SVMA 3DVWA 1TK8B 1Z5YE 2AUVA 3I43A 2CAQA 3VLNA 1PN9A 2ON7A 5GAND 3ZVJD 5KOWA 1SVLA 2HRAA 1USBA 4MNNA 2X49A 5DAKA 3ERWA 2CAIA 2I81A 2OA7A 1W4VA 2H30A 1A0FA 3EMPA 5G30A 2DJ0A 4Z2UA 3R3EA 1M2BA 3GSSA 3GNJA 4MLYA 4WETA 3KM6A 2YWOA 4GQFA 1UC7A 3A3TA 3P8WA 2PGTA 2TRCP 5ECMB 3GH9A 1R5AA 6GSUA 1TKDB 1JLWA 2OKAA 4E8HA 1V98A 2OE1A 2C0DA 1X0RA 4PUFC 3FZ5A 1SENA 1JFUA 5B6MA 2YJHA 1EV9A 4GF0A 3M1GA 3FW2A 2WS2A 3HJOA 1XW5A 2AB6A 4F0BA 5A5KA 2C8UA 3IV4A 4HOJA 4MF6A 1A2JA 1WP0A 1XCCA 3I69A 1QMVA 2GSQA 4PX1A 5F05A 2KLXA 3GHAA 1OAZA 3TJGA 3ZTLA 1TRSA 1FVJA 5A4VA 2ZUPA 2PERA 2LRTA 1MD4A 3A2WA 1F9MA 5AGYA 4HJ2A 2HNLA 4ZBAA 2GQKA 2G2QA 2MZCA 5CAXA 3FEUA 5CRDA 4K9ZA 1URMA 1TU7A 2JZRA 2H1DA 2FA8A 3GTUA 4BVXA 1TK0B 5B8BA 2WGRA 2QC7A 1VGLA 2H74A 2DJKA 1FO5A 4HS1A 2X8GA 2GS3A 4ZIJA 4CHSA 3VPQA 2IN3A 5DJLA 4AKXB 3ZIJA 3HZ4A 2VD0A 2WRTA 5H5RA 3LFLA 3GX8A 2RLIA 4HU7A 5KN1A 5IMVA 3UVTA 1O8WA 4GDFA 3P90A 2WDUA 2MMOA 1FW1A 3E0UA 3A2VA 3QMXA 1M2AA 4NAXA 2H1AA 2L6DA 2BMXA 1H4OA 6GSTA 4OFMA 1K3OA 3O3TA 1TXXA 5CP1A 1WRYA 3AY8A 1FB6A 4IJIA 3F63A 3ZMLA 4QQ7A 1RW1A 4X4JA 3M0FA 3PGTA 2B1LA 5ABRA 5AN1A 2I3YA 1T4ZA 3TKRA 1TTZA 5BMUB 2NVLA 2HZEB 3QAGA 3PR8A 4K6XA 5H5QA 1S3DA 5DQSA 2D2ZA 3KMNA 1Z7RA 2HZFA 2FNOA 5ECOB 5ID2B 3GL3A 4G0LA 1WOUA 4QMKA 3LJRA 1K0MA 3VFIA 4DEJA 1V40A 1PKZA 1OC8A 3WD6A 2HE3A 1O8XA 2F3MA 2IMEA 3UL3A 3CWGA 3CYNA 2FUG2 2QSIA 5L71A 2O85A 1TW9A 4ZBBA 2LJKA 1EGOA 1PX6A 1OYJA 2HRNA 2CZ3A 3UVHA 8GSSA 4GSNA 4I2TA 1XFLA 2E7PA 4KNDA 5G1LA 4YKFA 3GRXA 2R4VA 3KTBA 2LQQA 4IS0A 2XBIA 4NMUA 4N0ZA 3F6DA 2XPEA 5IMFA 2ZCTA 4POBA 1WJKA 4CDOA 1AIUA 4HJMA 3VWUA 3ZRDA 2HRFA 2X8CA 3UMAA 3LYKA 7GSSA 1SL1B 3Q18A 4G10A 2G0FA 4HI7A 4TVEA 2X99A 1WE0A 1TI1A 1BQ7A 1Z3EA 5KN3A 2KUCA 1QFNA 2J9HA 3CTGA 2A2SA 3R2QA 3WGXA 5G5EA 2EIRA 1F3BA 1QK8A 2V2GA 3BCKA 4O32A 6GSYA 3M3MA 3MSZA 20GSA 4OFTA 1Y1UA 3E3EA 4FQUA 4HDEA 1THOA 3TJJA 2F8AA 3GKKA 2A4VA 1V9WA 1GSUA 4ACSA 1OC9B 2FHEA 3VI5A 1UVZA 2RUFA 2FA4A 3Q6OA 3UARA 4L0WA 2GT5A 1KNGA 1SJIA 1OKTA 2QA1A 1JZRA 3UIWA 4PQIA 2HSNB 4ZB8A 1ZYPA 2JADA 1X9WB 2L5LA 10GSA 2UV8G 4TR4A 3ME7A 5A34A 3KH7A 4MZCA 4N30A 1ZYQB 5ECPB 4YKGA 5DDLA 4ZILA 3C71A 4I2UA 4IKHA 1Q4JA 4BWQA 4NHWA 5C04A 3UAPA 1WWJA 3IBHA 4LL4B 1GLPA 2FWGA 4PQHA 2HSHA 4KDYA 5HR0A 2KHPA 1TDIA 4AGSA 1EP8A 1M9BA 5LNKe 5CREA 5JWOB 1GSQA 2V6OA 2OE3A 2VD1A 3RPNA 1R4WA 2DIYA 4MH3A 3TDGA 1HNAA 5KN0A 2NTOA 2LS5A 5JCUA 3H93A 2AV4A 3MIXA 1F3AA 2CVKA 3H8QA 4MABA 2V6KA 2H76A 4IQ1A 1M7TA 4I8BA 2DLXA 4BVYB 1G6WA 3UJ1A 3TJKA 4X1UA 5A4UA 2YWNA 2IPAA 4K7IA 2MBTA 4MA9A 2EFCA 2IWTA 1YF1A 1SL2B 4V2NA 2H1GA 3RPPA 3VWWA 4F03A 4IVFA 3W8SA 1YKAA 3CSJA 5HR1A 2K8SA 4G2EA 1RK4A 4L8EA 4TXOA 2CX4A 1XXUA 4EIPA 4ZL9A 4PGTA 3PINA 4HEA2 3LQ7A 2VL9A 2VCVA 6GSXA 4OCEA 1V2AA 1F37A 3QOUA 2VKZG 3IAS2 1EP7A 3ZZXA 1TRVA 3O76A 1YVLA 3C1RA 2NBSA 3J7Yb 2H75A 3TKSE 5A5HB 3TKSA 1ILOA 3GUSA 2HT9A 1SK2A 3CTFA 5IM9A 1PL1A 1GSYA 4ZBDA 2LV3A 2L4QA 2C0GA 5E4WA 3W8JA 2ON5A 2OE0A 3ZMKA 3D6IA 2YWMA 1X9SB 2JL4A 1PX7A 1NM3A 1Y25A 2FGXA 2NDOA 2YZUA 3ZREA 3EMXA 2FWFA 3KCMA 3HA9A 4G9HA 1ZYNA 4FO5A 4K1FA 4TR1B 2WZ9A 1YQ1A 1PRXA 3L9VA 5J47A 2YWIA 1V57A 1JHBA 4GRFA 1J9BA 1QQ2A 4L0UA 2LTKA 5FHIA 4IP6A 4EE0A 2E0QA 2JACA 3G7IA 2GT6A 2K18A 4K2XA 3I6AA 2GTUA 5ELAA 5GSTA 3MNGA 17GSA 3APSA 3VURA 1BG5A 1HD2A 2X8HA 2HSYA 3DXBA 4RI6A 2CV4A 2VOCA 2LJAA 1X5CA 1C72A 1GUKA 2R0GA 4O5RA 1PN0A 2CVBA 1TU8A 1B4QA 2F8FA 1AQVA 2B1KA 4N10A 4Q5RA 5A1NB 3I9V2 4RQRA 2R6KA 2XBQA 5INYA 5CRGA 2IIYA 3LEFA 2N5BA 3KXOA 3WYWA 11GSA 4WR5A 5EL8A 3LG6A 22GSA 1O7UA 1ZL9A 4YQMA 1G7OA 4XRDA 2EIQA 1X9MB 1VF4A 4RI7A 4YAVA 3DEXA 1U3IA 4P3YB 3ZL5A 5HR3A 3LWAA 3IDVA 5E59A 3EC3A 1VF1A 5J4YA 5J3RA 3DMLA 4PNFA 4KA0A 4JZQA 4BPYA 2JSZA 2H01A 3EURA 3UEMA 1GUMA 3TRPA 5J9CA 5IIZA 1ERUA 3K8NA 1BG1A 1G7EA 3HVSA 3KP9A 1AAZA 4ZB6A 2M46A 2FWHA 2EFHA 4HZ4A 3MYDA 1PMTA 1VF2A 5DBQA 2BTOT 3APOA 5IMDA 4LL1B 1ML6A 1ST9A 5AIXA 3O6TA 2DJJA 3QDNA 3W6GA 1XBSA 3CRTA 5ECQB 5AISA 1I5GA 3FHKA 1S3CA 2H6ZA 2LJRA 4PNGA 3BCIA 1GSSA 1XVWA 4Z2TA 2K6VA 1B4PA 4MJCA 1HNBA 1GLQA 2AYTA 4WBJA 5D8IA 4PURA 1O6JA 1Y6EA 2YANA 3HD5A 4GWRA 3OR5A 2I9HA 1GH2A 4DSSA 4F82A 4FYBA 2HRKA 18GSA 1E6BA 1VRSD 4HQSA 4WKWA 1K0CA 1M99A 4I6XA 3DGQA 1YJ6A 4OO4A 14GSA 1KEBA 3KJYA 2YV7A 2DKHA 4AKHA 2VLUA 1OC3A 3DKSA 16GSA 3CSIA 1T00A 4BWSA 1O73A 1GWCA 2CVDA 2H1BA 1SJZA 4JEDA 3U5RE 1OE8A 3UOMA 1DBYA 4TR3A 1XIYA 4IN0A 1TP9A 3WT1A 5LD0A 1E2YA 3M9KA 3EPTA 1ZOFA 5DVBA 2RM6A 1SYRA 4Q5NA 1RQMA 2L6CA 4ID0A 3M8NA 1DE1A 4ICYA 1K3LA 4HQZA 4WR4A 2PPTA 1XOAA 2DSAA 2HFDA 3A5WA 1XOBA 3FY7A 2ZNMA 4KX4A 4HU9A 3D21A 4AI6A 2DIZA 4POMA 2R3XA 5GAPD 4A5PA 3QPMA 2O5VA 4N3ZA 5A34B 3MDKA 4G19A 4MP4A 2PWJA 4XS6A 2NPBA 3ME8A 4KUNA 1GL8A 3NIVA 3FMWA 2KP1A 1Z6NA 3IPZA 1ON4A 2VCZA 4WF4A 3GH6A 3FZAA 3DIEA 3FKFA 1OKDA 4PUAA 4EIQA 3ZLPA 1FVKA 1XPVA 3D22A 4FH8A 3HKRA 4KGIA 3EINA 3TB2A 1AW9A 2OADA 1A24A 3KIJA 2HI7A 3L9SA 3TJBA 2VUPA 5EVOA 1YF0A 1G0TA 2CA8A 3RHCA 3WT2A 1B9XC 2IMFA 5DALB 2V41A 2YNXA 1EOGA 3DRNA 1R5PA 2A4HA 4ML6A 5C00A 1BJXA 2GQLA 4GSSA 2EFDA 4K7OA 4EUYA 1JZOA 3ZVJA 2H72A 1XWAA 5F06A 3DD3A 1BX9A 4NV5A 1FG4A 2VL3A 1A8LA 1SVOA 2LRNA 4TXOB 4GLTA 4DVCA 1J0FA 5D93A 5COHA 1SK1A 3WGEA 5LCZA 5CRWA 2B5YA 2XPDA 5B7CA 3IOSA 1YEPA 3CMIA 2GSSA 2HSMA 2LRCA 4I97A 4WXTA 4X43A 5G2ZA 3E9JB 2H71A 3GYKA 1H75A 2QGVA 4O92A 3EU4A 5CNWA 3KMOA 4O5UA 4KW6A 4QL7A 4JR6A 3GV1A 2DC5A 1PSQA 4FIWA 5IO0A 4CW9A 3HHVA 5BMUA 1WIKA 4KAEA 1EWXA 4CY8A 5IQYA 1SU9A 3TRXA 2GQMA 5ID2A 5HFIA 1M9AA 4W66A 3EYTA 1SD8A 3VPTA 1QGVA 2K9FA 3GA4A 1NW2A 4KH7A 3VI7A 2HXKA 3HYPA 4BL7A 4TKYA 1XWBA 2B7JA 2P0GA 1WMJA 1GSDA 2XHFA 5B8AA 4MZWA 1XWCA 2F51A 4YAPA 2YJ7A 3TGZA 2MMAA 1SK0A 2PN8A 3HXSA 1G6YA 4XTSA 1K0AA 3G9BA 4L5LA 3G7YA 5KOXA 3KGKA 1GSEA 4EC0A 5GZZB 1MDJA 1BYEA 4EDZA 5J40A 2BJXA 1SJ6A 4JRRA 3GSTA 4TXVA 2L5OA 4K8MA 1YZXA 2H6XA 5BRTA 5DAKB 3EE2A 3TRQA 1FOVA 4E68A 3Q74A 2AJQB 2J23A 2PBJA 5IO2A 3G7JA 2DJ3A 4OMVA 4WF5A 1PD21 2L59A 2WULA 2YN1A 3Q19A 4IBPA 1TJDA 3C1SA 3BBYA 3RDWA 3CSHA 4ISDA 5IMCA 2M72A 4O7HA 2PMTA 4ZL8A 3L0HA 3ED3A 4KSOA 2JZTA 4IHUA 1K3YA 2GZPA 4D73A 4IELA 2RUEA 3HJMA 3TJFA 1GTAA 5IPHA 2DKIA 2RIIA 3F3QA 4PQ1A 1CQGA 4ZXGA 4EXJA 2MMZA 3IAM2 2OACA 1GTBA 2MBSA 2H1LA 2FY6A 5ECRB 2QKEA 5FT3A 2AAWA 4AJ8A 4LMWA 2GGTA 3F6FA 3IRAA 1XW6A 3MAKA 2TRXA 1EZKA 4K0NA 1M2DA 3CXGA 4XS4A 2LQOA 3HY2A 2VO4A 4TOPA 3GTUB 3TU3B 4BVXB 1ZGNA 3D4TA 1TK5B 4K5SA 4L5OA 1X5EA 3PH9A 2H8LA 3ZIVA 4DSSB 1B9YC 2HRKB 5CO3A 2VAFA 2TIRA 3EWLA 4V1Ap 3ZFBA 3IC4A 4OCFA 1PKWA 2VLTA 3LORA 4TW5A 4JR4A 1T1VA 3LGCA 1K0DA 4AJ6A 2CZ2A 3QAWA 4HUAA 2H6YA 2LKUA 3GURA 1GSFA 1MTCA 4GXZA 3KZQA 3KD0A 1SKSB 3IK7A 2H0GA 2QA2A 2AHEA 5ECIB 3WGDA 3LYPA 1AQXA 1ERWA 3D5JA 2KP2A 3IC8A 1ZZYA 4BVYA 3GKMA 2FCHA 1ABAA 4K0GA 4ZB7A 1O81A 4ILFA 2JU5A 5F07A 1OE7A 3L78A 1M0UA 3GKNA 2LNSA 1VF3A 1F6MC 1KTEA 2IJYA 5GSSA 2I4AA 2O89A 4MCUA 1U3AA 2DJ1A 2O87A 1T3BA 3HCZA 2B6MA 4O5QA 6GSWA 2IFQA 2R2JA 2L57A 4XIHA 1EV4A 4ECJA 4FYUA 3RAZA 5G31A 3VK9A 4K5RA 2VCTA 2EC4A 3ISOA 2VCQA 3GN3A 2REMA 5HFGA 1K0NA 4ML1A 1LBKA 1TOFA 3EU3A 4ULXA 1JZDA 3ZYWA 1V58A 5IMZA 3LW9A 3F4SA 5J4UA 5A5HA 3H1NA 2VM1A 1PQNA 5ENUA 3RHBA 4USSA 5CRHA 1X5DA 4EL1A 1I9DA 3HVVA 2UZ8A 4KCEA 3TKPA 1GRXA 5F8BA 2PU9C 3KEBA 1THXA 1BF5A 1YDKA 4RQXA 2YOIA 3F9UA 2CQ9A 4K2DA 2P31A 3P7XA 1DUGA 3C7MA 5DQYA 5A4WA 1ERTA 3UBKA 3TOUA 5G1KA 5J41A 4EO3A 5B6NA 3BOAA 1CQHA 4TR1A 2H0HA 5IMAA 5J5NA 2OBIA 4Q5FA 2C4JA 2OBKA 3IA1A 2C0EA 2X4AA 4NV2A 4KDUA 2H19A 4ECCA 5EPFA 4XCSA 3FR6A 2PUKC 2L4CA 2R0CA 2V1MA 4POKA 2LSTA 4MH2A 1HQOA 1YY7A 4G0KA 3SBCA 2GDRA 3LXTA 19GSA 5IOXA 4WBRD 1MEKA 1EEJA 1A8YA 3TKQA 1GUHA 1EGRA 5D9XA 1GP1A 3GKXA 1PGTA 3VWXA 3TCOA 4IP1A 2XC2A 4PTSA 4XHMA 3A5IA 2C0FA 2GSTA 3IR4A 5ECLB 4MJBA 4KB3A 4F9ZA 4N11A 3PPUA 3H79A 1K0BA 5A1NA 2HSMB 3HJPA 2N5AA 1GTIA 2HYXA 1GTUA 2FLSA 1EOHA 1YEXA 3FRCA 6GSSA 4IGJA 3U6VA 1FB0A 2B5EA 1XVQA 2B5XA 4DSRA 1ZCPA 2O7KA 2JZSA 4OD7A 1FHEA 2YCDA 3IXRA 1GULA 1XWKA 2LEGA 4G0IA 2F9SA 3CBUA 3ZFLA 4IJ3A 4EDYA 1AXDA 5EY6A 3DVXA 1N25A 5D9VA 2M80A 2WCIA 1J08A 1Z6MA 2B7KA 3F0IA 3ERFA 2PVOC 2YP6A 1A2MA 1FOHA 3C8EA 5IOWA 4MK3A 5ECNB 2ES7A 2LNTA 3UBLA 4KCAA 2H0IA 1GNWA 3IE3A 3FZ4A 4BL7B 4NPBA 3V1WA 4E8EA 3F4RA 2GLRA 5JCGA 4MZBA 4NWYA 2OT3A 2R0PA 1U87A 3MWHA 4JU5A 5FWGA 5J9BA 3D4MA 4AKGA 1BEDA 4TN8A 5D96A 1IYHA 2IMIA 2HLSA 2C3NA 4ECBA 3IHGA 1JLVA 6GSVA 3TOTA 1TRWA 3D0ZA 1FAAA 2RM5A 1SD9A 2IL3A 4WEYA 1T7PB 1LJRA 1Z9HA 2IMDA 2YPMA 1ERVA 3QR6A 4J57E 4KF9A 2C1YA 2R37A 1XW9A 4J56E 3EVIA 1A2LA 3NOFA 1N2AA 4MJAA 4MF5A 3FZ9A 1R26A 5KEJA 4GTUA 3J7Yk 3KP8A 2WJUA 3HMJG 4JBBA 1HYUA 4D73B 3NZNA 5D9TA 1K0OA 5AIVA 3HZ8A 1YKCA 1Z7PA 2MMNA 2JSYA 3C73A 1AQWA 3QFBC 2CX3A 4ZB9A 2E2MA 2FD3A 2H70A 3L9UA 3QAVA 2GZZA 3F3RA 2A2RA 4KDXA 2YV9A 3QD9A 3TKSC 1QUWA 4GCIA 1T4YA 1EEMA 1ZMAA 1NHOA 5IPGA 2HZEA 4V1Ag 2H73A 1B48A 3SWLA 4IW9A 1GNEA 3GFKA 1WPIA 4EF0A 1HNCA 1NHYA 2WFCA 1W89A 1A23A 5J4VA 2YZHA 4XS4B 5CYYA 4ECIA 2H66A 1O85A 1F2EA 1OVNA 1UA5A 1R7HA 4Q5QA 1U6TA 4LLRA 2N5FA 4RUVA 4V2MA 2I1UA 2IMKA 1AUCA 4G01A 1N8JA 2VM2A 2PVQA 4ZL7A 3N9JA 4AKIA 4CY6A 4F0CA 3VWVA 3DYRA 5HR2A 5JWRB 1PL2A 1MD3A 4DSQA 2B3SA 2VCXA 3BD2A 3BJ5A 3GL5A 1B8XA 3DWVA 3FR3A 3JCML 2C3QA 2MYGA 3S9FA 4KSMA 4EKZA 4I5QA 5D73A 2LUSA 5JWQB 2VL2C 5F0GA 5ECKB 2HQTA 2VLVA 1NSWA 4MDCA 1AC1A 3ZITA 5DALA 3QFAC 3H4KA 4NXIA 4IQAA 1ACVA 2DMMA 4XS1A 4AF2A 1Q98A 4MPGA 2VCWA 4H86A 5DCGA 3QCPA 4LA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QXH A;  2DML A;  4KE3 A;  4MJE A;  1SKW B;  3HVX A;  4AJ7 A;  1A0R P;  3TUE A;  3LSZ A;  1KBN A;  2X64 A;  12GS A;  2C3T A;  1TI3 A;  1ZYE A;  2IFQ B;  5H5S A;  5DCH A;  4V2L A;  5HQP A;  4MMM A;  4NHZ A;  5JCW A;  4OFN A;  2DBC A;  1UN2 A;  4TRX A;  2OJL A;  3GX0 A;  2P5R A;  3L4N A;  2P5Q A;  4XRA A;  4YH2 A;  1DE2 A;  3FR9 A;  4GST A;  5ECH B;  3US3 A;  2K8V A;  4J2F A;  4F2I A;  1XWG A;  1OC9 A;  1MDI A;  4POL A;  4BA7 A;  4FYC A;  5ELG A;  2E2G A;  4OO5 A;  2R5G A;  2O8V B;  2CT6 A;  3ERG A;  4TR0 A;  3FYG A;  4HZ2 A;  1DSB A;  4X0X A;  1S3A A;  3FK8 A;  4GQC A;  1JZW A;  1PA3 A;  5DJM A;  13GS A;  3IHQ A;  2EIO A;  5D9W A;  1SKR B;  5ECS A;  3M9J A;  3APQ A;  2DJ2 A;  3KTL A;  1BAY A;  5HFK A;  3P2A A;  9GSS A;  3RBT A;  4JE1 A;  5KN2 A;  4LMV A;  1XZO A;  4YQV A;  4Z7X A;  1TRU A;  2GVP A;  2ALB A;  3HDC A;  4OWY A;  1U88 A;  4K7N A;  3GIX A;  3GMF A;  2FWE A;  3F4T A;  4PXO A;  1MDK A;  2V32 A;  3IK9 A;  1SYX A;  2GSR A;  4N0V A;  1LU4 A;  4QL9 A;  1T8E B;  2KOK A;  4EVM A;  4YQU A;  2Z9S A;  1IYI A;  4MF7 A;  2WB9 A;  3CRU A;  2GZY A;  1SL0 B;  3A2X A;  2C80 A;  2VIM A;  2VL2 A;  5G5F A;  3N5O A;  4MPF A;  3F8U A;  3KH9 A;  3LXZ A;  3DVW A;  1TK8 B;  1Z5Y E;  2AUV A;  3I43 A;  2CAQ A;  3VLN A;  1PN9 A;  2ON7 A;  5GAN D;  3ZVJ D;  2HRA A;  1USB A;  5DAK A;  3ERW A;  2CAI A;  2I81 A;  2OA7 A;  1W4V A;  2H30 A;  1A0F A;  3EMP A;  5G30 A;  2DJ0 A;  3R3E A;  1M2B A;  3GSS A;  3GNJ A;  4MLY A;  4WET A;  3KM6 A;  4GQF A;  2YWO A;  1UC7 A;  3A3T A;  3P8W A;  2PGT A;  2TRC P;  5ECM B;  3GH9 A;  1R5A A;  6GSU A;  1TKD B;  1JLW A;  2OKA A;  4E8H A;  1V98 A;  2OE1 A;  2C0D A;  1X0R A;  4PUF C;  3FZ5 A;  1SEN A;  1JFU A;  5B6M A;  2YJH A;  1EV9 A;  4GF0 A;  3M1G A;  3FW2 A;  2WS2 A;  3HJO A;  1XW5 A;  2AB6 A;  4F0B A;  5A5K A;  2C8U A;  3IV4 A;  4HOJ A;  4MF6 A;  1A2J A;  1WP0 A;  1XCC A;  3I69 A;  1QMV A;  2GSQ A;  4PX1 A;  5F05 A;  2KLX A;  3GHA A;  1OAZ A;  3TJG A;  3ZTL A;  1TRS A;  1FVJ A;  5A4V A;  2ZUP A;  2PER A;  2LRT A;  1MD4 A;  3A2W A;  1F9M A;  5AGY A;  4HJ2 A;  2HNL A;  4ZBA A;  2GQK A;  2G2Q A;  2MZC A;  5CAX A;  3FEU A;  5CRD A;  4K9Z A;  1URM A;  1TU7 A;  2JZR A;  2H1D A;  2FA8 A;  3GTU A;  4BVX A;  1TK0 B;  5B8B A;  2WGR A;  2QC7 A;  1VGL A;  2H74 A;  2DJK A;  1FO5 A;  4HS1 A;  2X8G A;  2GS3 A;  4ZIJ A;  4CHS A;  3VPQ A;  2IN3 A;  5DJL A;  3ZIJ A;  3HZ4 A;  2VD0 A;  2WRT A;  5H5R A;  3LFL A;  3GX8 A;  2RLI A;  4HU7 A;  5KN1 A;  5IMV A;  3UVT A;  1O8W A;  3P90 A;  2WDU A;  2MMO A;  1FW1 A;  3E0U A;  3A2V A;  3QMX A;  1M2A A;  4NAX A;  2H1A A;  2L6D A;  2BMX A;  1H4O A;  6GST A;  4OFM A;  1K3O A;  3O3T A;  1TXX A;  5CP1 A;  1WRY A;  3AY8 A;  1FB6 A;  4IJI A;  3F63 A;  3ZML A;  4QQ7 A;  1RW1 A;  3M0F A;  3PGT A;  2B1L A;  5ABR A;  5AN1 A;  2I3Y A;  1T4Z A;  3TKR A;  1TTZ A;  2NVL A;  2HZE B;  3QAG A;  3PR8 A;  4K6X A;  5H5Q A;  1S3D A;  5DQS A;  2D2Z A;  3KMN A;  1Z7R A;  2HZF A;  2FNO A;  5ECO B;  5ID2 B;  3GL3 A;  4G0L A;  1WOU A;  3LJR A;  1K0M A;  3VFI A;  4DEJ A;  1V40 A;  1PKZ A;  1OC8 A;  3WD6 A;  2HE3 A;  1O8X A;  2F3M A;  2IME A;  3UL3 A;  3CYN A;  2FUG 2;  2QSI A;  5L71 A;  2O85 A;  1TW9 A;  4ZBB A;  2LJK A;  1EGO A;  1PX6 A;  1OYJ A;  2HRN A;  2CZ3 A;  3UVH A;  8GSS A;  4GSN A;  4I2T A;  1XFL A;  2E7P A;  4KND A;  5G1L A;  3GRX A;  2R4V A;  3KTB A;  2LQQ A;  4IS0 A;  2XBI A;  4NMU A;  4N0Z A;  3F6D A;  2XPE A;  5IMF A;  2ZCT A;  4POB A;  1WJK A;  4CDO A;  1AIU A;  4HJM A;  3VWU A;  3ZRD A;  2HRF A;  2X8C A;  3UMA A;  3LYK A;  7GSS A;  1SL1 B;  3Q18 A;  4G10 A;  2G0F A;  4HI7 A;  4TVE A;  2X99 A;  1WE0 A;  1TI1 A;  1BQ7 A;  1Z3E A;  5KN3 A;  2KUC A;  1QFN A;  2J9H A;  3CTG A;  2A2S A;  3R2Q A;  3WGX A;  5G5E A;  2EIR A;  1F3B A;  1QK8 A;  2V2G A;  3BCK A;  4O32 A;  6GSY A;  3M3M A;  3MSZ A;  20GS A;  4OFT A;  3E3E A;  4FQU A;  4HDE A;  1THO A;  3TJJ A;  2F8A A;  3GKK A;  2A4V A;  1V9W A;  1GSU A;  4ACS A;  1OC9 B;  2FHE A;  3VI5 A;  1UVZ A;  2RUF A;  2FA4 A;  3Q6O A;  3UAR A;  4L0W A;  2GT5 A;  1KNG A;  1SJI A;  1OKT A;  1JZR A;  3UIW A;  4PQI A;  2HSN B;  4ZB8 A;  2JAD A;  1X9W B;  2L5L A;  10GS A;  4TR4 A;  3ME7 A;  3KH7 A;  4MZC A;  4N30 A;  1ZYQ B;  5ECP B;  5DDL A;  4ZIL A;  3C71 A;  4I2U A;  4IKH A;  1Q4J A;  4BWQ A;  4NHW A;  5C04 A;  3UAP A;  1WWJ A;  3IBH A;  4LL4 B;  1GLP A;  2FWG A;  4PQH A;  2HSH A;  4KDY A;  5HR0 A;  2KHP A;  1TDI A;  4AGS A;  1EP8 A;  1M9B A;  5LNK e;  5CRE A;  5JWO B;  1GSQ A;  2V6O A;  2OE3 A;  2VD1 A;  3RPN A;  1R4W A;  2DIY A;  4MH3 A;  3TDG A;  1HNA A;  5KN0 A;  2NTO A;  2LS5 A;  5JCU A;  3H93 A;  2AV4 A;  1F3A A;  2CVK A;  3H8Q A;  4MAB A;  2V6K A;  2H76 A;  4IQ1 A;  1M7T A;  4I8B A;  2DLX A;  4BVY B;  1G6W A;  3UJ1 A;  3TJK A;  4X1U A;  5A4U A;  2YWN A;  2IPA A;  4K7I A;  2MBT A;  4MA9 A;  2IWT A;  1YF1 A;  1SL2 B;  4V2N A;  2H1G A;  3RPP A;  3VWW A;  4F03 A;  4IVF A;  3W8S A;  1YKA A;  3CSJ A;  5HR1 A;  2K8S A;  4G2E A;  1RK4 A;  4L8E A;  4TXO A;  2CX4 A;  1XXU A;  4ZL9 A;  4PGT A;  3PIN A;  4HEA 2;  3LQ7 A;  2VL9 A;  2VCV A;  6GSX A;  4OCE A;  1V2A A;  1F37 A;  3QOU A;  3IAS 2;  1EP7 A;  3ZZX A;  1TRV A;  3O76 A;  3C1R A;  2NBS A;  3J7Y b;  2H75 A;  3TKS E;  3TKS A;  1ILO A;  3GUS A;  2HT9 A;  1SK2 A;  3CTF A;  5IM9 A;  1PL1 A;  1GSY A;  4ZBD A;  2LV3 A;  2L4Q A;  2C0G A;  5E4W A;  3W8J A;  2ON5 A;  2OE0 A;  3ZMK A;  3D6I A;  2YWM A;  1X9S B;  2JL4 A;  1PX7 A;  1NM3 A;  1Y25 A;  2FGX A;  2NDO A;  2YZU A;  3ZRE A;  3EMX A;  2FWF A;  3KCM A;  3HA9 A;  4G9H A;  4FO5 A;  4K1F A;  4TR1 B;  2WZ9 A;  1YQ1 A;  1PRX A;  3L9V A;  2YWI A;  1V57 A;  1JHB A;  4GRF A;  1J9B A;  1QQ2 A;  4L0U A;  2LTK A;  5FHI A;  4IP6 A;  4EE0 A;  2E0Q A;  2JAC A;  3G7I A;  2GT6 A;  2K18 A;  3I6A A;  2GTU A;  5ELA A;  5GST A;  3MNG A;  17GS A;  3APS A;  3VUR A;  1BG5 A;  1HD2 A;  2X8H A;  2HSY A;  3DXB A;  4RI6 A;  2CV4 A;  2VOC A;  2LJA A;  1X5C A;  1C72 A;  1GUK A;  4O5R A;  2CVB A;  1TU8 A;  1B4Q A;  2F8F A;  1AQV A;  2B1K A;  4N10 A;  4Q5R A;  3I9V 2;  4RQR A;  2R6K A;  2XBQ A;  5INY A;  5CRG A;  2IIY A;  3LEF A;  2N5B A;  3KXO A;  3WYW A;  11GS A;  4WR5 A;  5EL8 A;  3LG6 A;  22GS A;  1O7U A;  1ZL9 A;  4YQM A;  1G7O A;  4XRD A;  2EIQ A;  1X9M B;  1VF4 A;  4RI7 A;  4YAV A;  3DEX A;  1U3I A;  4P3Y B;  3ZL5 A;  5HR3 A;  3LWA A;  3IDV A;  5E59 A;  3EC3 A;  1VF1 A;  5J3R A;  3DML A;  4PNF A;  4KA0 A;  4JZQ A;  4BPY A;  2JSZ A;  2H01 A;  3EUR A;  3UEM A;  1GUM A;  3TRP A;  5J9C A;  5IIZ A;  1ERU A;  3K8N A;  1G7E A;  3HVS A;  3KP9 A;  1AAZ A;  4ZB6 A;  2M46 A;  2FWH A;  4HZ4 A;  1PMT A;  1VF2 A;  5DBQ A;  2BTO T;  3APO A;  5IMD A;  4LL1 B;  1ML6 A;  1ST9 A;  5AIX A;  3O6T A;  2DJJ A;  3QDN A;  3W6G A;  1XBS A;  3CRT A;  5ECQ B;  5AIS A;  1I5G A;  3FHK A;  1S3C A;  2H6Z A;  2LJR A;  4PNG A;  3BCI A;  1GSS A;  1XVW A;  2K6V A;  1B4P A;  4MJC A;  1HNB A;  1GLQ A;  2AYT A;  4WBJ A;  5D8I A;  4PUR A;  1O6J A;  1Y6E A;  2YAN A;  3HD5 A;  4GWR A;  3OR5 A;  2I9H A;  1GH2 A;  4DSS A;  4F82 A;  4FYB A;  2HRK A;  18GS A;  1E6B A;  1VRS D;  4HQS A;  4WKW A;  1K0C A;  1M99 A;  4I6X A;  3DGQ A;  1YJ6 A;  4OO4 A;  14GS A;  1KEB A;  3KJY A;  2YV7 A;  2VLU A;  1OC3 A;  3DKS A;  16GS A;  3CSI A;  1T00 A;  4BWS A;  1O73 A;  1GWC A;  2CVD A;  2H1B A;  1SJZ A;  4JED A;  3U5R E;  1OE8 A;  3UOM A;  1DBY A;  4TR3 A;  1XIY A;  4IN0 A;  1TP9 A;  3WT1 A;  5LD0 A;  1E2Y A;  3M9K A;  1ZOF A;  5DVB A;  2RM6 A;  1SYR A;  4Q5N A;  1RQM A;  2L6C A;  4ID0 A;  3M8N A;  1DE1 A;  1K3L A;  4HQZ A;  4WR4 A;  2PPT A;  1XOA A;  2DSA A;  2HFD A;  3A5W A;  1XOB A;  3FY7 A;  2ZNM A;  4KX4 A;  4HU9 A;  3D21 A;  2DIZ A;  4POM A;  2R3X A;  5GAP D;  3QPM A;  3MDK A;  4G19 A;  4MP4 A;  2PWJ A;  4XS6 A;  2NPB A;  3ME8 A;  4KUN A;  1GL8 A;  3NIV A;  2KP1 A;  1Z6N A;  3IPZ A;  1ON4 A;  2VCZ A;  4WF4 A;  3GH6 A;  3FZA A;  3DIE A;  3FKF A;  1OKD A;  4PUA A;  3ZLP A;  1FVK A;  1XPV A;  3D22 A;  4FH8 A;  3HKR A;  4KGI A;  3EIN A;  3TB2 A;  1AW9 A;  2OAD A;  1A24 A;  3KIJ A;  2HI7 A;  3L9S A;  3TJB A;  2VUP A;  5EVO A;  1YF0 A;  1G0T A;  2CA8 A;  3RHC A;  3WT2 A;  1B9X C;  2IMF A;  5DAL B;  2V41 A;  2YNX A;  1EOG A;  3DRN A;  1R5P A;  4ML6 A;  5C00 A;  1BJX A;  2GQL A;  4GSS A;  4K7O A;  4EUY A;  1JZO A;  3ZVJ A;  2H72 A;  1XWA A;  5F06 A;  3DD3 A;  1BX9 A;  4NV5 A;  1FG4 A;  2VL3 A;  1A8L A;  2LRN A;  4TXO B;  4GLT A;  4DVC A;  1J0F A;  5D93 A;  5COH A;  1SK1 A;  3WGE A;  5LCZ A;  5CRW A;  2B5Y A;  2XPD A;  5B7C A;  3IOS A;  1YEP A;  3CMI A;  2GSS A;  2HSM A;  2LRC A;  4I97 A;  4WXT A;  4X43 A;  5G2Z A;  3E9J B;  2H71 A;  3GYK A;  1H75 A;  2QGV A;  4O92 A;  3EU4 A;  5CNW A;  3KMO A;  4KW6 A;  4QL7 A;  4JR6 A;  3GV1 A;  2DC5 A;  1PSQ A;  4FIW A;  5IO0 A;  4CW9 A;  3HHV A;  5BMU A;  1WIK A;  4KAE A;  1EWX A;  5IQY A;  1SU9 A;  3TRX A;  2GQM A;  5ID2 A;  5HFI A;  1M9A A;  3EYT A;  1SD8 A;  3VPT A;  1QGV A;  2K9F A;  3GA4 A;  1NW2 A;  4KH7 A;  3VI7 A;  2HXK A;  3HYP A;  4BL7 A;  4TKY A;  1XWB A;  2B7J A;  2P0G A;  1WMJ A;  1GSD A;  2XHF A;  5B8A A;  4MZW A;  1XWC A;  2F51 A;  4YAP A;  2YJ7 A;  3TGZ A;  2MMA A;  1SK0 A;  2PN8 A;  3HXS A;  1G6Y A;  4XTS A;  1K0A A;  3G9B A;  4L5L A;  3G7Y A;  3KGK A;  1GSE A;  4EC0 A;  5GZZ B;  1MDJ A;  1BYE A;  4EDZ A;  2BJX A;  1SJ6 A;  4JRR A;  3GST A;  4TXV A;  2L5O A;  4K8M A;  1YZX A;  2H6X A;  5DAK B;  3EE2 A;  3TRQ A;  1FOV A;  3Q74 A;  2AJQ B;  2J23 A;  2PBJ A;  5IO2 A;  3G7J A;  2DJ3 A;  4OMV A;  4WF5 A;  1PD2 1;  2L59 A;  2WUL A;  2YN1 A;  3Q19 A;  4IBP A;  1TJD A;  3C1S A;  3BBY A;  3RDW A;  3CSH A;  4ISD A;  5IMC A;  2M72 A;  4O7H A;  2PMT A;  4ZL8 A;  3L0H A;  3ED3 A;  4KSO A;  2JZT A;  4IHU A;  1K3Y A;  2GZP A;  4D73 A;  4IEL A;  2RUE A;  3HJM A;  3TJF A;  1GTA A;  5IPH A;  2RII A;  3F3Q A;  4PQ1 A;  1CQG A;  4ZXG A;  4EXJ A;  2MMZ A;  3IAM 2;  2OAC A;  1GTB A;  2MBS A;  2FY6 A;  5ECR B;  2QKE A;  5FT3 A;  2AAW A;  4AJ8 A;  4LMW A;  2GGT A;  3F6F A;  3IRA A;  1XW6 A;  3MAK A;  2TRX A;  1EZK A;  4K0N A;  1M2D A;  3CXG A;  4XS4 A;  2LQO A;  3HY2 A;  2VO4 A;  4TOP A;  3GTU B;  4BVX B;  1ZGN A;  3D4T A;  1TK5 B;  4L5O A;  1X5E A;  3PH9 A;  2H8L A;  3ZIV A;  4DSS B;  1B9Y C;  2HRK B;  5CO3 A;  2VAF A;  2TIR A;  3EWL A;  4V1A p;  3ZFB A;  3IC4 A;  4OCF A;  1PKW A;  2VLT A;  3LOR A;  4TW5 A;  4JR4 A;  1T1V A;  3LGC A;  1K0D A;  4AJ6 A;  2CZ2 A;  3QAW A;  4HUA A;  2H6Y A;  2LKU A;  3GUR A;  1GSF A;  1MTC A;  4GXZ A;  3KZQ A;  3KD0 A;  1SKS B;  3IK7 A;  2H0G A;  2AHE A;  5ECI B;  3WGD A;  3LYP A;  1AQX A;  1ERW A;  3D5J A;  2KP2 A;  3IC8 A;  1ZZY A;  4BVY A;  3GKM A;  2FCH A;  1ABA A;  4K0G A;  1O81 A;  4ILF A;  2JU5 A;  5F07 A;  1OE7 A;  3L78 A;  1M0U A;  3GKN A;  2LNS A;  1VF3 A;  1F6M C;  1KTE A;  2IJY A;  5GSS A;  2I4A A;  2O89 A;  4MCU A;  1U3A A;  2DJ1 A;  2O87 A;  1T3B A;  3HCZ A;  2B6M A;  6GSW A;  2IFQ A;  2R2J A;  2L57 A;  4XIH A;  1EV4 A;  4ECJ A;  4FYU A;  3RAZ A;  5G31 A;  3VK9 A;  2VCT A;  2EC4 A;  3ISO A;  2VCQ A;  3GN3 A;  2REM A;  5HFG A;  1K0N A;  4ML1 A;  1LBK A;  1TOF A;  3EU3 A;  4ULX A;  1JZD A;  3ZYW A;  1V58 A;  5IMZ A;  3F4S A;  5J4U A;  3H1N A;  2VM1 A;  1PQN A;  5ENU A;  3RHB A;  4USS A;  5CRH A;  1X5D A;  4EL1 A;  1I9D A;  3HVV A;  2UZ8 A;  4KCE A;  3TKP A;  1GRX A;  5F8B A;  2PU9 C;  3KEB A;  1THX A;  1YDK A;  4RQX A;  2YOI A;  3F9U A;  2CQ9 A;  4K2D A;  2P31 A;  3P7X A;  1DUG A;  3C7M A;  5DQY A;  5A4W A;  1ERT A;  3UBK A;  3TOU A;  5G1K A;  5J41 A;  4EO3 A;  5B6N A;  3BOA A;  1CQH A;  4TR1 A;  2H0H A;  5IMA A;  5J5N A;  2OBI A;  4Q5F A;  2C4J A;  2OBK A;  3IA1 A;  2C0E A;  4NV2 A;  4KDU A;  2H19 A;  4ECC A;  5EPF A;  4XCS A;  3FR6 A;  2PUK C;  2L4C A;  2V1M A;  4POK A;  2LST A;  4MH2 A;  1HQO A;  1YY7 A;  4G0K A;  3SBC A;  2GDR A;  3LXT A;  19GS A;  5IOX A;  4WBR D;  1MEK A;  1EEJ A;  1A8Y A;  3TKQ A;  1GUH A;  1EGR A;  5D9X A;  1GP1 A;  3GKX A;  1PGT A;  3VWX A;  3TCO A;  4IP1 A;  2XC2 A;  4PTS A;  4XHM A;  2C0F A;  2GST A;  3IR4 A;  5ECL B;  4MJB A;  4KB3 A;  4F9Z A;  4N11 A;  3PPU A;  3H79 A;  1K0B A;  2HSM B;  3HJP A;  2N5A A;  1GTI A;  2HYX A;  1GTU A;  2FLS A;  1EOH A;  1YEX A;  3FRC A;  6GSS A;  4IGJ A;  3U6V A;  1FB0 A;  2B5E A;  1XVQ A;  2B5X A;  4DSR A;  1ZCP A;  2O7K A;  2JZS A;  4OD7 A;  1FHE A;  2YCD A;  3IXR A;  1GUL A;  1XWK A;  2LEG A;  4G0I A;  2F9S A;  3CBU A;  3ZFL A;  4IJ3 A;  4EDY A;  1AXD A;  5EY6 A;  3DVX A;  5D9V A;  2M80 A;  2WCI A;  1J08 A;  1Z6M A;  2B7K A;  3F0I A;  3ERF A;  2PVO C;  2YP6 A;  1A2M A;  3C8E A;  5IOW A;  4MK3 A;  5ECN B;  2ES7 A;  2LNT A;  3UBL A;  4KCA A;  2H0I A;  1GNW A;  3IE3 A;  3FZ4 A;  4BL7 B;  4NPB A;  3V1W A;  4E8E A;  3F4R A;  2GLR A;  5JCG A;  4MZB A;  4NWY A;  1U87 A;  3MWH A;  4JU5 A;  5FWG A;  5J9B A;  3D4M A;  1BED A;  4TN8 A;  5D96 A;  1IYH A;  2IMI A;  2HLS A;  2C3N A;  4ECB A;  1JLV A;  6GSV A;  3TOT A;  1TRW A;  3D0Z A;  1FAA A;  2RM5 A;  1SD9 A;  2IL3 A;  4WEY A;  1T7P B;  1LJR A;  1Z9H A;  2IMD A;  2YPM A;  1ERV A;  3QR6 A;  4J57 E;  4KF9 A;  2C1Y A;  2R37 A;  1XW9 A;  4J56 E;  3EVI A;  1A2L A;  3NOF A;  1N2A A;  4MJA A;  4MF5 A;  3FZ9 A;  1R26 A;  5KEJ A;  4GTU A;  3J7Y k;  3KP8 A;  2WJU A;  4JBB A;  1HYU A;  4D73 B;  3NZN A;  5D9T A;  1K0O A;  5AIV A;  3HZ8 A;  1YKC A;  1Z7P A;  2MMN A;  2JSY A;  3C73 A;  1AQW A;  3QFB C;  2CX3 A;  4ZB9 A;  2E2M A;  2FD3 A;  2H70 A;  3L9U A;  3QAV A;  2GZZ A;  3F3R A;  2A2R A;  4KDX A;  2YV9 A;  3QD9 A;  3TKS C;  1QUW A;  4GCI A;  1T4Y A;  1EEM A;  1ZMA A;  1NHO A;  5IPG A;  2HZE A;  4V1A g;  2H73 A;  1B48 A;  3SWL A;  4IW9 A;  1GNE A;  3GFK A;  1WPI A;  4EF0 A;  1HNC A;  1NHY A;  2WFC A;  1W89 A;  1A23 A;  2YZH A;  4XS4 B;  5CYY A;  4ECI A;  2H66 A;  1O85 A;  1F2E A;  1OVN A;  1UA5 A;  1R7H A;  4Q5Q A;  1U6T A;  4LLR A;  2N5F A;  4RUV A;  4V2M A;  2I1U A;  2IMK A;  1AUC A;  1N8J A;  2VM2 A;  2PVQ A;  4ZL7 A;  3N9J A;  4F0C A;  3VWV A;  3DYR A;  5HR2 A;  5JWR B;  1PL2 A;  1MD3 A;  4DSQ A;  2B3S A;  2VCX A;  3BD2 A;  3BJ5 A;  3GL5 A;  1B8X A;  3DWV A;  3FR3 A;  3JCM L;  2C3Q A;  2MYG A;  3S9F A;  4KSM A;  4EKZ A;  4I5Q A;  5D73 A;  2LUS A;  5JWQ B;  2VL2 C;  5F0G A;  5ECK B;  2HQT A;  2VLV A;  1NSW A;  4MDC A;  1AC1 A;  3ZIT A;  5DAL A;  3QFA C;  3H4K A;  4NXI A;  4IQA A;  1ACV A;  2DMM A;  4XS1 A;  4AF2 A;  1Q98 A;  4MPG A;  2VCW A;  4H86 A;  5DCG A;  3QCP A;  4LA1 A; 
#chains in the Genus database with same CATH topology
 1QXH A;  2DML A;  4KE3 A;  4MJE A;  1TXU A;  1SKW B;  3HVX A;  4AJ7 A;  1A0R P;  3TUE A;  3LSZ A;  1KBN A;  2X64 A;  2A2P A;  12GS A;  2C3T A;  1TI3 A;  1ZYE A;  2IFQ B;  5H5S A;  5DCH A;  4V2L A;  5HQP A;  4MMM A;  4NHZ A;  5JCW A;  4OFN A;  2DBC A;  1UN2 A;  4TRX A;  2OJL A;  3GX0 A;  2P5R A;  3L4N A;  2P5Q A;  4XRA A;  4YH2 A;  1DE2 A;  3FR9 A;  4GST A;  5ECH B;  3US3 A;  2K8V A;  4J2F A;  4F2I A;  1XWG A;  1OC9 A;  1MDI A;  4POL A;  4BA7 A;  4FYC A;  5ELG A;  2E2G A;  4OO5 A;  2R5G A;  2O8V B;  2CT6 A;  3ERG A;  4TR0 A;  3FYG A;  4HZ2 A;  1DSB A;  4X0X A;  1S3A A;  3FK8 A;  4GQC A;  1JZW A;  1PA3 A;  5DJM A;  2HSN A;  13GS A;  3IHQ A;  2EIO A;  5D9W A;  1SKR B;  2EFE A;  5ECS A;  3APQ A;  3M9J A;  2DJ2 A;  3KTL A;  1BAY A;  5HFK A;  3P2A A;  4Z2R A;  9GSS A;  3RBT A;  4JE1 A;  5KN2 A;  4LMV A;  1XZO A;  4YQV A;  4Z7X A;  1TRU A;  2GVP A;  2ALB A;  3HDC A;  4OWY A;  1U88 A;  4K7N A;  3GIX A;  3GMF A;  2FWE A;  3F4T A;  4PXO A;  1MDK A;  1YEW C;  2V32 A;  3IK9 A;  1SYX A;  2GSR A;  4N0V A;  1LU4 A;  4QL9 A;  1T8E B;  2KOK A;  4EVM A;  4YQU A;  2Z9S A;  1IYI A;  4MF7 A;  2WB9 A;  3CRU A;  2GZY A;  1SL0 B;  3A2X A;  2C80 A;  2VIM A;  2VL2 A;  5G5F A;  3N5O A;  4MPF A;  3F8U A;  3KH9 A;  3LXZ A;  1SVM A;  3DVW A;  1TK8 B;  1Z5Y E;  2AUV A;  3I43 A;  2CAQ A;  3VLN A;  1PN9 A;  2ON7 A;  5GAN D;  3ZVJ D;  5KOW A;  1SVL A;  2HRA A;  1USB A;  4MNN A;  2X49 A;  5DAK A;  3ERW A;  2CAI A;  2I81 A;  2OA7 A;  1W4V A;  2H30 A;  1A0F A;  3EMP A;  5G30 A;  2DJ0 A;  4Z2U A;  4PI0 C;  3R3E A;  1M2B A;  3GSS A;  3GNJ A;  4MLY A;  4WET A;  3KM6 A;  2YWO A;  4GQF A;  1UC7 A;  3A3T A;  3P8W A;  2PGT A;  2TRC P;  5ECM B;  3GH9 A;  1R5A A;  6GSU A;  1TKD B;  4PHZ C;  1JLW A;  2OKA A;  2WW0 A;  4E8H A;  1V98 A;  2OE1 A;  2C0D A;  1X0R A;  4PUF C;  3FZ5 A;  1SEN A;  1JFU A;  5B6M A;  2YJH A;  1EV9 A;  4GF0 A;  3M1G A;  3FW2 A;  2WS2 A;  3HJO A;  1XW5 A;  2AB6 A;  4F0B A;  5A5K A;  2C8U A;  3IV4 A;  4HOJ A;  4MF6 A;  1A2J A;  1WP0 A;  1XCC A;  3I69 A;  1QMV A;  2GSQ A;  4PX1 A;  5F05 A;  2KLX A;  3GHA A;  1OAZ A;  3TJG A;  3ZTL A;  1TRS A;  1FVJ A;  5A4V A;  2ZUP A;  2PER A;  2LRT A;  1MD4 A;  3A2W A;  1F9M A;  5AGY A;  4HJ2 A;  2HNL A;  4ZBA A;  2GQK A;  2G2Q A;  2MZC A;  5CAX A;  3FEU A;  5CRD A;  4K9Z A;  1URM A;  1TU7 A;  2JZR A;  2H1D A;  2FA8 A;  3GTU A;  4BVX A;  1TK0 B;  5B8B A;  2WGR A;  2QC7 A;  1VGL A;  2H74 A;  2DJK A;  1FO5 A;  4HS1 A;  2X8G A;  2GS3 A;  4ZIJ A;  4CHS A;  3VPQ A;  2IN3 A;  5DJL A;  4AKX B;  3ZIJ A;  3HZ4 A;  2VD0 A;  2WRT A;  5H5R A;  3LFL A;  3GX8 A;  2RLI A;  4HU7 A;  5KN1 A;  5IMV A;  3UVT A;  1O8W A;  4GDF A;  3P90 A;  2WDU A;  2MMO A;  1FW1 A;  3E0U A;  3A2V A;  3QMX A;  1M2A A;  4NAX A;  2H1A A;  2L6D A;  2BMX A;  1H4O A;  6GST A;  4OFM A;  1K3O A;  3O3T A;  1TXX A;  5CP1 A;  1WRY A;  3AY8 A;  1FB6 A;  4IJI A;  3F63 A;  3ZML A;  4QQ7 A;  1RW1 A;  4X4J A;  3M0F A;  3PGT A;  2B1L A;  5ABR A;  5AN1 A;  2I3Y A;  1T4Z A;  3TKR A;  1TTZ A;  5BMU B;  2NVL A;  2HZE B;  3QAG A;  3PR8 A;  4K6X A;  5H5Q A;  1S3D A;  5DQS A;  2D2Z A;  3KMN A;  1Z7R A;  2HZF A;  2FNO A;  5ECO B;  5ID2 B;  3GL3 A;  4G0L A;  1WOU A;  4QMK A;  3LJR A;  1K0M A;  3VFI A;  4DEJ A;  1V40 A;  1PKZ A;  1OC8 A;  3WD6 A;  2HE3 A;  1O8X A;  2F3M A;  2IME A;  3UL3 A;  3CWG A;  3CYN A;  2FUG 2;  2WZS A;  2QSI A;  5L71 A;  2O85 A;  1TW9 A;  4ZBB A;  2LJK A;  1EGO A;  1PX6 A;  1OYJ A;  2HRN A;  2CZ3 A;  3UVH A;  8GSS A;  4GSN A;  4I2T A;  1XFL A;  2E7P A;  4KND A;  5G1L A;  4YKF A;  3GRX A;  2R4V A;  1M3I A;  3KTB A;  2LQQ A;  4IS0 A;  2XBI A;  4NMU A;  4N0Z A;  3F6D A;  2XPE A;  5IMF A;  2ZCT A;  4POB A;  1WJK A;  4CDO A;  1AIU A;  4HJM A;  3VWU A;  3ZRD A;  2O3E A;  2HRF A;  2X8C A;  3UMA A;  3LYK A;  7GSS A;  1SL1 B;  3Q18 A;  4G10 A;  2G0F A;  4BIK A;  4HI7 A;  4TVE A;  2X99 A;  1WE0 A;  1TI1 A;  1BQ7 A;  1Z3E A;  5KN3 A;  2KUC A;  1QFN A;  2J9H A;  3CTG A;  2A2S A;  3R2Q A;  3WGX A;  5G5E A;  2EIR A;  1F3B A;  1QK8 A;  2V2G A;  3BCK A;  4O32 A;  6GSY A;  3M3M A;  3MSZ A;  20GS A;  4OFT A;  1Y1U A;  3E3E A;  4FQU A;  4HDE A;  1THO A;  3TJJ A;  2F8A A;  3GKK A;  2A4V A;  1V9W A;  1GSU A;  4ACS A;  1OC9 B;  2FHE A;  3VI5 A;  1UVZ A;  2RUF A;  2FA4 A;  3Q6O A;  3UAR A;  4L0W A;  2GT5 A;  1KNG A;  1SJI A;  1OKT A;  2QA1 A;  1JZR A;  3UIW A;  4PQI A;  2HSN B;  4ZB8 A;  1ZYP A;  2JAD A;  1X9W B;  2L5L A;  10GS A;  2UV8 G;  4TR4 A;  3ME7 A;  5A34 A;  3KH7 A;  4MZC A;  4N30 A;  1ZYQ B;  5ECP B;  4YKG A;  5DDL A;  4ZIL A;  3C71 A;  4I2U A;  4IKH A;  1Q4J A;  4BWQ A;  4NHW A;  5C04 A;  3UAP A;  1WWJ A;  3IBH A;  4LL4 B;  1GLP A;  2FWG A;  4PQH A;  2HSH A;  4KDY A;  5HR0 A;  2KHP A;  1TDI A;  4AGS A;  1EP8 A;  1M9B A;  5LNK e;  5CRE A;  5JWO B;  1GSQ A;  2V6O A;  2OE3 A;  2VD1 A;  3RPN A;  1R4W A;  3RGB C;  2DIY A;  4MH3 A;  3TDG A;  1HNA A;  5KN0 A;  2NTO A;  2LS5 A;  5JCU A;  3H93 A;  2AV4 A;  3MIX A;  1F3A A;  2CVK A;  3H8Q A;  4MAB A;  2V6K A;  2H76 A;  4IQ1 A;  1M7T A;  4I8B A;  2DLX A;  4BVY B;  1G6W A;  3UJ1 A;  3TJK A;  4X1U A;  5A4U A;  2YWN A;  2IPA A;  4K7I A;  2MBT A;  4MA9 A;  2EFC A;  2IWT A;  1YF1 A;  1SL2 B;  4V2N A;  2H1G A;  3RPP A;  3VWW A;  4F03 A;  4IVF A;  3W8S A;  1YKA A;  3CSJ A;  5HR1 A;  2K8S A;  4G2E A;  1RK4 A;  4L8E A;  4TXO A;  2CX4 A;  1XXU A;  4EIP A;  4ZL9 A;  4PGT A;  3PIN A;  4HEA 2;  3LQ7 A;  2VL9 A;  2VCV A;  6GSX A;  4OCE A;  1V2A A;  1F37 A;  3QOU A;  2VKZ G;  3IAS 2;  1EP7 A;  3ZZX A;  1TRV A;  3O76 A;  1YVL A;  3C1R A;  2NBS A;  3J7Y b;  2H75 A;  3TKS E;  5A5H B;  3TKS A;  1ILO A;  3GUS A;  2HT9 A;  1SK2 A;  3CTF A;  5IM9 A;  1PL1 A;  1GSY A;  4ZBD A;  2LV3 A;  2L4Q A;  2C0G A;  5E4W A;  3W8J A;  2ON5 A;  2OE0 A;  3ZMK A;  3D6I A;  2YWM A;  1X9S B;  2JL4 A;  1PX7 A;  1NM3 A;  1Y25 A;  2FGX A;  2NDO A;  2YZU A;  3ZRE A;  3EMX A;  2FWF A;  3KCM A;  3HA9 A;  4G9H A;  1ZYN A;  4FO5 A;  4K1F A;  4TR1 B;  2WZ9 A;  1YQ1 A;  1PRX A;  3L9V A;  5J47 A;  2YWI A;  1V57 A;  1JHB A;  4GRF A;  1J9B A;  1QQ2 A;  4L0U A;  2LTK A;  5FHI A;  4IP6 A;  4EE0 A;  2E0Q A;  2JAC A;  3G7I A;  2GT6 A;  2K18 A;  4K2X A;  3I6A A;  2GTU A;  5ELA A;  5GST A;  3RFR C;  3MNG A;  17GS A;  3APS A;  3VUR A;  1BG5 A;  1HD2 A;  2X8H A;  2HSY A;  3DXB A;  4RI6 A;  2CV4 A;  2VOC A;  2LJA A;  1X5C A;  1C72 A;  1GUK A;  2R0G A;  4O5R A;  1PN0 A;  2CVB A;  1TU8 A;  1B4Q A;  2WVX B;  2F8F A;  1AQV A;  2B1K A;  4N10 A;  4Q5R A;  5A1N B;  3I9V 2;  4RQR A;  2R6K A;  2XBQ A;  5INY A;  5CRG A;  2IIY A;  1S3R A;  3LEF A;  2N5B A;  3KXO A;  3WYW A;  11GS A;  4WR5 A;  5EL8 A;  3LG6 A;  22GS A;  1O7U A;  1ZL9 A;  4YQM A;  1G7O A;  4XRD A;  2EIQ A;  1X9M B;  1VF4 A;  4RI7 A;  4YAV A;  3DEX A;  1U3I A;  4P3Y B;  3ZL5 A;  5HR3 A;  3LWA A;  3IDV A;  5E59 A;  2O36 A;  3EC3 A;  1VF1 A;  5J4Y A;  5J3R A;  3DML A;  4PNF A;  4KA0 A;  4JZQ A;  4BPY A;  2JSZ A;  2H01 A;  3EUR A;  3UEM A;  1GUM A;  3TRP A;  5J9C A;  5IIZ A;  1ERU A;  3K8N A;  1BG1 A;  1G7E A;  3HVS A;  3KP9 A;  1AAZ A;  4ZB6 A;  2M46 A;  2FWH A;  2EFH A;  4HZ4 A;  3MYD A;  1PMT A;  1VF2 A;  5DBQ A;  2BTO T;  3APO A;  5IMD A;  4LL1 B;  1ML6 A;  1ST9 A;  5AIX A;  3O6T A;  2DJJ A;  3QDN A;  3W6G A;  1XBS A;  3CRT A;  5ECQ B;  5AIS A;  1I5G A;  3FHK A;  1S3C A;  2H6Z A;  2LJR A;  4PNG A;  3BCI A;  1GSS A;  1XVW A;  4Z2T A;  2K6V A;  1B4P A;  4MJC A;  1HNB A;  1GLQ A;  2AYT A;  4WBJ A;  5D8I A;  4PUR A;  1O6J A;  1Y6E A;  2YAN A;  3HD5 A;  1I1I P;  4GWR A;  3OR5 A;  2I9H A;  1GH2 A;  4DSS A;  4F82 A;  4FYB A;  2HRK A;  18GS A;  1E6B A;  1VRS D;  4HQS A;  4WKW A;  1K0C A;  1M99 A;  4I6X A;  3DGQ A;  1YJ6 A;  4OO4 A;  14GS A;  1KEB A;  3KJY A;  2YV7 A;  2DKH A;  4AKH A;  2VLU A;  1OC3 A;  3DKS A;  16GS A;  3CSI A;  1T00 A;  4BWS A;  1O73 A;  1GWC A;  2CVD A;  2H1B A;  1SJZ A;  4JED A;  3U5R E;  1OE8 A;  3UOM A;  1DBY A;  4TR3 A;  1XIY A;  4IN0 A;  1TP9 A;  3WT1 A;  5LD0 A;  1E2Y A;  3M9K A;  3EPT A;  1ZOF A;  5DVB A;  2RM6 A;  1SYR A;  4Q5N A;  1RQM A;  2L6C A;  4ID0 A;  3M8N A;  3HVN A;  1DE1 A;  4ICY A;  1K3L A;  4HQZ A;  4WR4 A;  2PPT A;  1XOA A;  2DSA A;  2HFD A;  3A5W A;  1XOB A;  3FY7 A;  2ZNM A;  4KX4 A;  4HU9 A;  3D21 A;  4AI6 A;  2DIZ A;  4POM A;  2R3X A;  5GAP D;  4A5P A;  3QPM A;  2O5V A;  4N3Z A;  5A34 B;  3CHX C;  3MDK A;  4G19 A;  4MP4 A;  2PWJ A;  4XS6 A;  2NPB A;  3ME8 A;  4KUN A;  1GL8 A;  3NIV A;  3FMW A;  2KP1 A;  1Z6N A;  3IPZ A;  1ON4 A;  2VCZ A;  4WF4 A;  3GH6 A;  3FZA A;  3DIE A;  3FKF A;  1OKD A;  4PUA A;  4EIQ A;  3ZLP A;  1FVK A;  1XPV A;  3D22 A;  4FH8 A;  3HKR A;  4KGI A;  3EIN A;  3TB2 A;  1AW9 A;  2OAD A;  1A24 A;  3KIJ A;  2HI7 A;  3L9S A;  3TJB A;  2VUP A;  5EVO A;  1YF0 A;  1G0T A;  2CA8 A;  3RHC A;  3WT2 A;  1B9X C;  2IMF A;  5DAL B;  2V41 A;  2YNX A;  1EOG A;  3DRN A;  1R5P A;  2A4H A;  4ML6 A;  5C00 A;  1BJX A;  2GQL A;  4GSS A;  2EFD A;  4K7O A;  4EUY A;  1JZO A;  3ZVJ A;  2H72 A;  1XWA A;  5F06 A;  3DD3 A;  1BX9 A;  4NV5 A;  1FG4 A;  2VL3 A;  1A8L A;  1SVO A;  2WW1 A;  2LRN A;  4TXO B;  4GLT A;  4DVC A;  1J0F A;  5D93 A;  5COH A;  1SK1 A;  3WGE A;  5LCZ A;  5CRW A;  2B5Y A;  2XPD A;  5B7C A;  3IOS A;  1YEP A;  3CMI A;  2GSS A;  2HSM A;  2LRC A;  4I97 A;  4WXT A;  4X43 A;  5G2Z A;  3E9J B;  2H71 A;  3GYK A;  1H75 A;  2QGV A;  4O92 A;  3EU4 A;  5CNW A;  3KMO A;  4O5U A;  4KW6 A;  4QL7 A;  4JR6 A;  3GV1 A;  2DC5 A;  1PSQ A;  4FIW A;  5IO0 A;  4CW9 A;  3HHV A;  5BMU A;  1WIK A;  4KAE A;  1EWX A;  4CY8 A;  5IQY A;  1SU9 A;  3TRX A;  2GQM A;  5ID2 A;  5HFI A;  1M9A A;  4W66 A;  3EYT A;  1SD8 A;  3VPT A;  1QGV A;  2K9F A;  3GA4 A;  1NW2 A;  4KH7 A;  3VI7 A;  2HXK A;  3HYP A;  4BL7 A;  4TKY A;  1XWB A;  2B7J A;  2P0G A;  1WMJ A;  1GSD A;  2XHF A;  5B8A A;  4MZW A;  1XWC A;  2F51 A;  4YAP A;  2YJ7 A;  3TGZ A;  2MMA A;  1SK0 A;  2PN8 A;  3HXS A;  1G6Y A;  4XTS A;  1K0A A;  3G9B A;  4L5L A;  3G7Y A;  5KOX A;  3KGK A;  1GSE A;  4EC0 A;  5GZZ B;  1MDJ A;  1BYE A;  4EDZ A;  5J40 A;  2BJX A;  1SJ6 A;  4JRR A;  3GST A;  4TXV A;  2L5O A;  4K8M A;  1YZX A;  2H6X A;  5BRT A;  5DAK B;  3EE2 A;  3TRQ A;  1FOV A;  4E68 A;  3Q74 A;  2AJQ B;  2J23 A;  2PBJ A;  5IO2 A;  3G7J A;  2DJ3 A;  4OMV A;  4WF5 A;  1PD2 1;  2L59 A;  2WUL A;  2YN1 A;  3Q19 A;  4IBP A;  1TJD A;  3C1S A;  3BBY A;  3RDW A;  3CSH A;  4ISD A;  5IMC A;  2M72 A;  4O7H A;  2PMT A;  4ZL8 A;  3L0H A;  3ED3 A;  4KSO A;  2JZT A;  4IHU A;  1K3Y A;  2GZP A;  4D73 A;  4IEL A;  2RUE A;  3HJM A;  3TJF A;  1GTA A;  5IPH A;  2DKI A;  2RII A;  3F3Q A;  4PQ1 A;  1CQG A;  4ZXG A;  4EXJ A;  2MMZ A;  3IAM 2;  2OAC A;  1GTB A;  2MBS A;  2H1L A;  2FY6 A;  5ECR B;  2QKE A;  5FT3 A;  2AAW A;  4AJ8 A;  4LMW A;  1XG8 A;  2GGT A;  3F6F A;  3IRA A;  1XW6 A;  3MAK A;  2TRX A;  1EZK A;  4K0N A;  1M2D A;  3CXG A;  4XS4 A;  2LQO A;  3HY2 A;  2VO4 A;  4TOP A;  3GTU B;  3TU3 B;  4BVX B;  1ZGN A;  3CQF A;  3D4T A;  1TK5 B;  4K5S A;  4L5O A;  1X5E A;  3PH9 A;  2H8L A;  3ZIV A;  4DSS B;  1B9Y C;  2HRK B;  5CO3 A;  2VAF A;  2TIR A;  3EWL A;  4V1A p;  3ZFB A;  3IC4 A;  4OCF A;  1PKW A;  2VLT A;  3LOR A;  4TW5 A;  4JR4 A;  2WW3 A;  1T1V A;  3LGC A;  1K0D A;  4AJ6 A;  2CZ2 A;  3QAW A;  4HUA A;  2H6Y A;  2LKU A;  3GUR A;  1GSF A;  1MTC A;  4FXY P;  4GXZ A;  3KZQ A;  3KD0 A;  1SKS B;  3IK7 A;  2H0G A;  2QA2 A;  2AHE A;  5ECI B;  3WGD A;  3LYP A;  1AQX A;  1ERW A;  3D5J A;  2KP2 A;  3IC8 A;  1ZZY A;  4BVY A;  3GKM A;  2FCH A;  1ABA A;  4K0G A;  4ZB7 A;  1O81 A;  4ILF A;  2JU5 A;  5F07 A;  1OE7 A;  3L78 A;  1M0U A;  3GKN A;  2LNS A;  1VF3 A;  1F6M C;  1KTE A;  2IJY A;  5GSS A;  2I4A A;  2O89 A;  4MCU A;  1U3A A;  2DJ1 A;  2O87 A;  1T3B A;  3HCZ A;  2B6M A;  4O5Q A;  6GSW A;  2IFQ A;  2R2J A;  2L57 A;  4XIH A;  1EV4 A;  4ECJ A;  4FYU A;  3RAZ A;  5G31 A;  3VK9 A;  4K5R A;  2VCT A;  2EC4 A;  3ISO A;  2VCQ A;  3GN3 A;  2REM A;  5HFG A;  1K0N A;  4ML1 A;  1LBK A;  1TOF A;  3EU3 A;  4ULX A;  1JZD A;  3ZYW A;  1V58 A;  5IMZ A;  3LW9 A;  3F4S A;  5J4U A;  5A5H A;  3H1N A;  2VM1 A;  1PQN A;  5ENU A;  3RHB A;  4USS A;  5CRH A;  1X5D A;  4EL1 A;  1I9D A;  3HVV A;  2UZ8 A;  4KCE A;  3TKP A;  1GRX A;  1PFO A;  5F8B A;  2PU9 C;  3KEB A;  1THX A;  1BF5 A;  1YDK A;  4RQX A;  2YOI A;  3F9U A;  2WW2 A;  2CQ9 A;  4K2D A;  2P31 A;  3P7X A;  1DUG A;  3C7M A;  5DQY A;  5A4W A;  1ERT A;  3UBK A;  3TOU A;  5G1K A;  5J41 A;  4EO3 A;  5B6N A;  3BOA A;  1CQH A;  4TR1 A;  2H0H A;  5IMA A;  5J5N A;  2OBI A;  4Q5F A;  2WVZ A;  2C4J A;  2OBK A;  3IA1 A;  2C0E A;  2X4A A;  4NV2 A;  4KDU A;  2H19 A;  4ECC A;  5EPF A;  4XCS A;  3FR6 A;  2PUK C;  2L4C A;  2R0C A;  2V1M A;  4POK A;  2LST A;  4MH2 A;  1HQO A;  1YY7 A;  4G0K A;  3SBC A;  2GDR A;  3LXT A;  19GS A;  5IOX A;  4WBR D;  1MEK A;  1EEJ A;  1A8Y A;  3TKQ A;  1GUH A;  1EGR A;  5D9X A;  1GP1 A;  3GKX A;  1PGT A;  3VWX A;  3TCO A;  4IP1 A;  2XC2 A;  4PTS A;  4XHM A;  3A5I A;  2C0F A;  2GST A;  3IR4 A;  5ECL B;  4MJB A;  4KB3 A;  2WVX A;  4F9Z A;  4N11 A;  3PPU A;  3H79 A;  1K0B A;  5A1N A;  2HSM B;  3HJP A;  2N5A A;  1GTI A;  2HYX A;  1GTU A;  2FLS A;  1EOH A;  1YEX A;  3FRC A;  6GSS A;  4IGJ A;  3U6V A;  1FB0 A;  2B5E A;  1XVQ A;  2B5X A;  4DSR A;  1ZCP A;  2O7K A;  2JZS A;  4OD7 A;  1FHE A;  2YCD A;  3IXR A;  1GUL A;  1XWK A;  2LEG A;  4G0I A;  2F9S A;  3CBU A;  3ZFL A;  4IJ3 A;  4EDY A;  1AXD A;  5EY6 A;  3DVX A;  1N25 A;  5D9V A;  2M80 A;  2WCI A;  1J08 A;  1Z6M A;  2B7K A;  3F0I A;  3ERF A;  2PVO C;  2YP6 A;  1A2M A;  1FOH A;  3C8E A;  5IOW A;  4MK3 A;  5ECN B;  2ES7 A;  2LNT A;  3UBL A;  4KCA A;  2H0I A;  2WVY A;  1GNW A;  3IE3 A;  3FZ4 A;  4BL7 B;  4NPB A;  3V1W A;  4E8E A;  3F4R A;  2GLR A;  5JCG A;  4MZB A;  4NWY A;  2OT3 A;  2R0P A;  1U87 A;  3MWH A;  4JU5 A;  5FWG A;  5J9B A;  3D4M A;  4AKG A;  1BED A;  4TN8 A;  5D96 A;  1IYH A;  2IMI A;  2HLS A;  2C3N A;  4ECB A;  3IHG A;  1JLV A;  6GSV A;  3TOT A;  1TRW A;  3D0Z A;  1FAA A;  2RM5 A;  1SD9 A;  2IL3 A;  4WEY A;  1T7P B;  1LJR A;  1Z9H A;  2IMD A;  2YPM A;  1ERV A;  3QR6 A;  4J57 E;  4KF9 A;  2C1Y A;  2R37 A;  1XW9 A;  4J56 E;  3EVI A;  1A2L A;  3NOF A;  1N2A A;  4MJA A;  4MF5 A;  3FZ9 A;  1R26 A;  5KEJ A;  4GTU A;  3J7Y k;  3KP8 A;  2WJU A;  3HMJ G;  4JBB A;  1HYU A;  4D73 B;  3NZN A;  5D9T A;  1K0O A;  5AIV A;  3HZ8 A;  1YKC A;  1Z7P A;  2MMN A;  2JSY A;  3C73 A;  1AQW A;  3QFB C;  2CX3 A;  4ZB9 A;  2E2M A;  2FD3 A;  2H70 A;  3L9U A;  3QAV A;  2GZZ A;  3F3R A;  2A2R A;  4KDX A;  2YV9 A;  3QD9 A;  3TKS C;  1QUW A;  4GCI A;  1T4Y A;  1EEM A;  1ZMA A;  1NHO A;  5IPG A;  2HZE A;  4V1A g;  2H73 A;  1B48 A;  3SWL A;  4IW9 A;  1GNE A;  3GFK A;  1WPI A;  4EF0 A;  1HNC A;  1NHY A;  2WFC A;  1S4B P;  1W89 A;  1A23 A;  5J4V A;  1M3J A;  2YZH A;  4XS4 B;  5CYY A;  4ECI A;  2H66 A;  1O85 A;  1F2E A;  1OVN A;  1UA5 A;  1R7H A;  4Q5Q A;  1U6T A;  4LLR A;  2N5F A;  4RUV A;  4V2M A;  2I1U A;  2IMK A;  1AUC A;  4G01 A;  4HSC X;  1N8J A;  2VM2 A;  2PVQ A;  4ZL7 A;  3N9J A;  4AKI A;  4CY6 A;  4F0C A;  3VWV A;  3DYR A;  5HR2 A;  5JWR B;  1PL2 A;  1MD3 A;  4DSQ A;  2B3S A;  2VCX A;  3BD2 A;  3BJ5 A;  3GL5 A;  1B8X A;  3DWV A;  3FR3 A;  3JCM L;  2C3Q A;  2MYG A;  3S9F A;  4KSM A;  4EKZ A;  4I5Q A;  5D73 A;  2LUS A;  5JWQ B;  2VL2 C;  5F0G A;  5ECK B;  2HQT A;  2VLV A;  1NSW A;  4MDC A;  1AC1 A;  3ZIT A;  5DAL A;  3QFA C;  3H4K A;  4NXI A;  4IQA A;  1ACV A;  2DMM A;  4XS1 A;  4AF2 A;  1Q98 A;  4MPG A;  2VCW A;  4PI2 C;  5DCG A;  3QCP A;  4H86 A;  4LA1 A; 
#chains in the Genus database with same CATH homology
 1QXH A;  2DML A;  4KE3 A;  4MJE A;  1TXU A;  1SKW B;  3HVX A;  4AJ7 A;  1A0R P;  3TUE A;  3LSZ A;  1KBN A;  2X64 A;  2A2P A;  12GS A;  2C3T A;  1TI3 A;  1ZYE A;  2IFQ B;  5H5S A;  5DCH A;  4V2L A;  5HQP A;  4MMM A;  4NHZ A;  5JCW A;  4OFN A;  2DBC A;  1UN2 A;  4TRX A;  2OJL A;  3GX0 A;  2P5R A;  3L4N A;  2P5Q A;  4XRA A;  4YH2 A;  1DE2 A;  3FR9 A;  4GST A;  5ECH B;  3US3 A;  2K8V A;  4J2F A;  4F2I A;  1XWG A;  1OC9 A;  1MDI A;  4POL A;  4BA7 A;  4FYC A;  5ELG A;  2E2G A;  4OO5 A;  2R5G A;  2O8V B;  2CT6 A;  3ERG A;  4TR0 A;  3FYG A;  4HZ2 A;  1DSB A;  4X0X A;  1S3A A;  3FK8 A;  4GQC A;  1JZW A;  1PA3 A;  5DJM A;  2HSN A;  13GS A;  3IHQ A;  2EIO A;  5D9W A;  1SKR B;  2EFE A;  5ECS A;  3APQ A;  3M9J A;  2DJ2 A;  3KTL A;  1BAY A;  5HFK A;  3P2A A;  4Z2R A;  9GSS A;  3RBT A;  4JE1 A;  5KN2 A;  4LMV A;  1XZO A;  4YQV A;  4Z7X A;  1TRU A;  2GVP A;  2ALB A;  3HDC A;  4OWY A;  1U88 A;  4K7N A;  3GIX A;  3GMF A;  2FWE A;  3F4T A;  4PXO A;  1MDK A;  2V32 A;  3IK9 A;  1SYX A;  2GSR A;  4N0V A;  1LU4 A;  4QL9 A;  1T8E B;  2KOK A;  4EVM A;  4YQU A;  2Z9S A;  1IYI A;  4MF7 A;  2WB9 A;  3CRU A;  2GZY A;  1SL0 B;  3A2X A;  2C80 A;  2VIM A;  2VL2 A;  5G5F A;  3N5O A;  4MPF A;  3F8U A;  3KH9 A;  3LXZ A;  1SVM A;  3DVW A;  1TK8 B;  1Z5Y E;  2AUV A;  3I43 A;  2CAQ A;  3VLN A;  1PN9 A;  2ON7 A;  5GAN D;  3ZVJ D;  5KOW A;  1SVL A;  2HRA A;  1USB A;  4MNN A;  2X49 A;  5DAK A;  3ERW A;  2CAI A;  2I81 A;  2OA7 A;  1W4V A;  2H30 A;  1A0F A;  3EMP A;  5G30 A;  2DJ0 A;  4Z2U A;  3R3E A;  1M2B A;  3GSS A;  3GNJ A;  4MLY A;  4WET A;  3KM6 A;  2YWO A;  4GQF A;  1UC7 A;  3A3T A;  3P8W A;  2PGT A;  2TRC P;  5ECM B;  3GH9 A;  1R5A A;  6GSU A;  1TKD B;  1JLW A;  2OKA A;  4E8H A;  1V98 A;  2OE1 A;  2C0D A;  1X0R A;  4PUF C;  3FZ5 A;  1SEN A;  1JFU A;  5B6M A;  2YJH A;  1EV9 A;  4GF0 A;  3M1G A;  3FW2 A;  2WS2 A;  3HJO A;  1XW5 A;  2AB6 A;  4F0B A;  5A5K A;  2C8U A;  3IV4 A;  4HOJ A;  4MF6 A;  1A2J A;  1WP0 A;  1XCC A;  3I69 A;  1QMV A;  2GSQ A;  4PX1 A;  5F05 A;  2KLX A;  3GHA A;  1OAZ A;  3TJG A;  3ZTL A;  1TRS A;  1FVJ A;  5A4V A;  2ZUP A;  2PER A;  2LRT A;  1MD4 A;  3A2W A;  1F9M A;  5AGY A;  4HJ2 A;  2HNL A;  4ZBA A;  2GQK A;  2G2Q A;  2MZC A;  5CAX A;  3FEU A;  5CRD A;  4K9Z A;  1URM A;  1TU7 A;  2JZR A;  2H1D A;  2FA8 A;  3GTU A;  4BVX A;  1TK0 B;  5B8B A;  2WGR A;  2QC7 A;  1VGL A;  2H74 A;  2DJK A;  1FO5 A;  4HS1 A;  2X8G A;  2GS3 A;  4ZIJ A;  4CHS A;  3VPQ A;  2IN3 A;  5DJL A;  4AKX B;  3ZIJ A;  3HZ4 A;  2VD0 A;  2WRT A;  5H5R A;  3LFL A;  3GX8 A;  2RLI A;  4HU7 A;  5KN1 A;  5IMV A;  3UVT A;  1O8W A;  4GDF A;  3P90 A;  2WDU A;  2MMO A;  1FW1 A;  3E0U A;  3A2V A;  3QMX A;  1M2A A;  4NAX A;  2H1A A;  2L6D A;  2BMX A;  1H4O A;  6GST A;  4OFM A;  1K3O A;  3O3T A;  1TXX A;  5CP1 A;  1WRY A;  3AY8 A;  1FB6 A;  4IJI A;  3F63 A;  3ZML A;  4QQ7 A;  1RW1 A;  4X4J A;  3M0F A;  3PGT A;  2B1L A;  5ABR A;  5AN1 A;  2I3Y A;  1T4Z A;  3TKR A;  1TTZ A;  5BMU B;  2NVL A;  2HZE B;  3QAG A;  3PR8 A;  4K6X A;  5H5Q A;  1S3D A;  5DQS A;  2D2Z A;  3KMN A;  1Z7R A;  2HZF A;  2FNO A;  5ECO B;  5ID2 B;  3GL3 A;  4G0L A;  1WOU A;  4QMK A;  3LJR A;  1K0M A;  3VFI A;  4DEJ A;  1V40 A;  1PKZ A;  1OC8 A;  3WD6 A;  2HE3 A;  1O8X A;  2F3M A;  2IME A;  3UL3 A;  3CWG A;  3CYN A;  2FUG 2;  2QSI A;  5L71 A;  2O85 A;  1TW9 A;  4ZBB A;  2LJK A;  1EGO A;  1PX6 A;  1OYJ A;  2HRN A;  2CZ3 A;  3UVH A;  8GSS A;  4GSN A;  4I2T A;  1XFL A;  2E7P A;  4KND A;  5G1L A;  4YKF A;  3GRX A;  2R4V A;  3KTB A;  2LQQ A;  4IS0 A;  2XBI A;  4NMU A;  4N0Z A;  3F6D A;  2XPE A;  5IMF A;  2ZCT A;  4POB A;  1WJK A;  4CDO A;  1AIU A;  4HJM A;  3VWU A;  3ZRD A;  2HRF A;  2X8C A;  3UMA A;  3LYK A;  7GSS A;  1SL1 B;  3Q18 A;  4G10 A;  2G0F A;  4HI7 A;  4TVE A;  2X99 A;  1WE0 A;  1TI1 A;  1BQ7 A;  1Z3E A;  5KN3 A;  2KUC A;  1QFN A;  2J9H A;  3CTG A;  2A2S A;  3R2Q A;  3WGX A;  5G5E A;  2EIR A;  1F3B A;  1QK8 A;  2V2G A;  3BCK A;  4O32 A;  6GSY A;  3M3M A;  3MSZ A;  20GS A;  4OFT A;  1Y1U A;  3E3E A;  4FQU A;  4HDE A;  1THO A;  3TJJ A;  2F8A A;  3GKK A;  2A4V A;  1V9W A;  1GSU A;  4ACS A;  1OC9 B;  2FHE A;  3VI5 A;  1UVZ A;  2RUF A;  2FA4 A;  3Q6O A;  3UAR A;  4L0W A;  2GT5 A;  1KNG A;  1SJI A;  1OKT A;  2QA1 A;  1JZR A;  3UIW A;  4PQI A;  2HSN B;  4ZB8 A;  1ZYP A;  2JAD A;  1X9W B;  2L5L A;  10GS A;  2UV8 G;  4TR4 A;  3ME7 A;  5A34 A;  3KH7 A;  4MZC A;  4N30 A;  1ZYQ B;  5ECP B;  4YKG A;  5DDL A;  4ZIL A;  3C71 A;  4I2U A;  4IKH A;  1Q4J A;  4BWQ A;  4NHW A;  5C04 A;  3UAP A;  1WWJ A;  3IBH A;  4LL4 B;  1GLP A;  2FWG A;  4PQH A;  2HSH A;  4KDY A;  5HR0 A;  2KHP A;  1TDI A;  4AGS A;  1EP8 A;  1M9B A;  5LNK e;  5CRE A;  5JWO B;  1GSQ A;  2V6O A;  2OE3 A;  2VD1 A;  3RPN A;  1R4W A;  2DIY A;  4MH3 A;  3TDG A;  1HNA A;  5KN0 A;  2NTO A;  2LS5 A;  5JCU A;  3H93 A;  2AV4 A;  3MIX A;  1F3A A;  2CVK A;  3H8Q A;  4MAB A;  2V6K A;  2H76 A;  4IQ1 A;  1M7T A;  4I8B A;  2DLX A;  4BVY B;  1G6W A;  3UJ1 A;  3TJK A;  4X1U A;  5A4U A;  2YWN A;  2IPA A;  4K7I A;  2MBT A;  4MA9 A;  2EFC A;  2IWT A;  1YF1 A;  1SL2 B;  4V2N A;  2H1G A;  3RPP A;  3VWW A;  4F03 A;  4IVF A;  3W8S A;  1YKA A;  3CSJ A;  5HR1 A;  2K8S A;  4G2E A;  1RK4 A;  4L8E A;  4TXO A;  2CX4 A;  1XXU A;  4EIP A;  4ZL9 A;  4PGT A;  3PIN A;  4HEA 2;  3LQ7 A;  2VL9 A;  2VCV A;  6GSX A;  4OCE A;  1V2A A;  1F37 A;  3QOU A;  2VKZ G;  3IAS 2;  1EP7 A;  3ZZX A;  1TRV A;  3O76 A;  1YVL A;  3C1R A;  2NBS A;  3J7Y b;  2H75 A;  3TKS E;  5A5H B;  3TKS A;  1ILO A;  3GUS A;  2HT9 A;  1SK2 A;  3CTF A;  5IM9 A;  1PL1 A;  1GSY A;  4ZBD A;  2LV3 A;  2L4Q A;  2C0G A;  5E4W A;  3W8J A;  2ON5 A;  2OE0 A;  3ZMK A;  3D6I A;  2YWM A;  1X9S B;  2JL4 A;  1PX7 A;  1NM3 A;  1Y25 A;  2FGX A;  2NDO A;  2YZU A;  3ZRE A;  3EMX A;  2FWF A;  3KCM A;  3HA9 A;  4G9H A;  1ZYN A;  4FO5 A;  4K1F A;  4TR1 B;  2WZ9 A;  1YQ1 A;  1PRX A;  3L9V A;  5J47 A;  2YWI A;  1V57 A;  1JHB A;  4GRF A;  1J9B A;  1QQ2 A;  4L0U A;  2LTK A;  5FHI A;  4IP6 A;  4EE0 A;  2E0Q A;  2JAC A;  3G7I A;  2GT6 A;  2K18 A;  4K2X A;  3I6A A;  2GTU A;  5ELA A;  5GST A;  3MNG A;  17GS A;  3APS A;  3VUR A;  1BG5 A;  1HD2 A;  2X8H A;  2HSY A;  3DXB A;  4RI6 A;  2CV4 A;  2VOC A;  2LJA A;  1X5C A;  1C72 A;  1GUK A;  2R0G A;  4O5R A;  1PN0 A;  2CVB A;  1TU8 A;  1B4Q A;  2F8F A;  1AQV A;  2B1K A;  4N10 A;  4Q5R A;  5A1N B;  3I9V 2;  4RQR A;  2R6K A;  2XBQ A;  5INY A;  5CRG A;  2IIY A;  3LEF A;  2N5B A;  3KXO A;  3WYW A;  11GS A;  4WR5 A;  5EL8 A;  3LG6 A;  22GS A;  1O7U A;  1ZL9 A;  4YQM A;  1G7O A;  4XRD A;  2EIQ A;  1X9M B;  1VF4 A;  4RI7 A;  4YAV A;  3DEX A;  1U3I A;  4P3Y B;  3ZL5 A;  5HR3 A;  3LWA A;  3IDV A;  5E59 A;  3EC3 A;  1VF1 A;  5J4Y A;  5J3R A;  3DML A;  4PNF A;  4KA0 A;  4JZQ A;  4BPY A;  2JSZ A;  2H01 A;  3EUR A;  3UEM A;  1GUM A;  3TRP A;  5J9C A;  5IIZ A;  1ERU A;  3K8N A;  1BG1 A;  1G7E A;  3HVS A;  3KP9 A;  1AAZ A;  4ZB6 A;  2M46 A;  2FWH A;  2EFH A;  4HZ4 A;  3MYD A;  1PMT A;  1VF2 A;  5DBQ A;  2BTO T;  3APO A;  5IMD A;  4LL1 B;  1ML6 A;  1ST9 A;  5AIX A;  3O6T A;  2DJJ A;  3QDN A;  3W6G A;  1XBS A;  3CRT A;  5ECQ B;  5AIS A;  1I5G A;  3FHK A;  1S3C A;  2H6Z A;  2LJR A;  4PNG A;  3BCI A;  1GSS A;  1XVW A;  4Z2T A;  2K6V A;  1B4P A;  4MJC A;  1HNB A;  1GLQ A;  2AYT A;  4WBJ A;  5D8I A;  4PUR A;  1O6J A;  1Y6E A;  2YAN A;  3HD5 A;  4GWR A;  3OR5 A;  2I9H A;  1GH2 A;  4DSS A;  4F82 A;  4FYB A;  2HRK A;  18GS A;  1E6B A;  1VRS D;  4HQS A;  4WKW A;  1K0C A;  1M99 A;  4I6X A;  3DGQ A;  1YJ6 A;  4OO4 A;  14GS A;  1KEB A;  3KJY A;  2YV7 A;  2DKH A;  4AKH A;  2VLU A;  1OC3 A;  3DKS A;  16GS A;  3CSI A;  1T00 A;  4BWS A;  1O73 A;  1GWC A;  2CVD A;  2H1B A;  1SJZ A;  4JED A;  3U5R E;  1OE8 A;  3UOM A;  1DBY A;  4TR3 A;  1XIY A;  4IN0 A;  1TP9 A;  3WT1 A;  5LD0 A;  1E2Y A;  3M9K A;  3EPT A;  1ZOF A;  5DVB A;  2RM6 A;  1SYR A;  4Q5N A;  1RQM A;  2L6C A;  4ID0 A;  3M8N A;  1DE1 A;  4ICY A;  1K3L A;  4HQZ A;  4WR4 A;  2PPT A;  1XOA A;  2DSA A;  2HFD A;  3A5W A;  1XOB A;  3FY7 A;  2ZNM A;  4KX4 A;  4HU9 A;  3D21 A;  4AI6 A;  2DIZ A;  4POM A;  2R3X A;  5GAP D;  4A5P A;  3QPM A;  2O5V A;  4N3Z A;  5A34 B;  3MDK A;  4G19 A;  4MP4 A;  2PWJ A;  4XS6 A;  2NPB A;  3ME8 A;  4KUN A;  1GL8 A;  3NIV A;  3FMW A;  2KP1 A;  1Z6N A;  3IPZ A;  1ON4 A;  2VCZ A;  4WF4 A;  3GH6 A;  3FZA A;  3DIE A;  3FKF A;  1OKD A;  4PUA A;  4EIQ A;  3ZLP A;  1FVK A;  1XPV A;  3D22 A;  4FH8 A;  3HKR A;  4KGI A;  3EIN A;  3TB2 A;  1AW9 A;  2OAD A;  1A24 A;  3KIJ A;  2HI7 A;  3L9S A;  3TJB A;  2VUP A;  5EVO A;  1YF0 A;  1G0T A;  2CA8 A;  3RHC A;  3WT2 A;  1B9X C;  2IMF A;  5DAL B;  2V41 A;  2YNX A;  1EOG A;  3DRN A;  1R5P A;  2A4H A;  4ML6 A;  5C00 A;  1BJX A;  2GQL A;  4GSS A;  2EFD A;  4K7O A;  4EUY A;  1JZO A;  3ZVJ A;  2H72 A;  1XWA A;  5F06 A;  3DD3 A;  1BX9 A;  4NV5 A;  1FG4 A;  2VL3 A;  1A8L A;  1SVO A;  2LRN A;  4TXO B;  4GLT A;  4DVC A;  1J0F A;  5D93 A;  5COH A;  1SK1 A;  3WGE A;  5LCZ A;  5CRW A;  2B5Y A;  2XPD A;  5B7C A;  3IOS A;  1YEP A;  3CMI A;  2GSS A;  2HSM A;  2LRC A;  4I97 A;  4WXT A;  4X43 A;  5G2Z A;  3E9J B;  2H71 A;  3GYK A;  1H75 A;  2QGV A;  4O92 A;  3EU4 A;  5CNW A;  3KMO A;  4O5U A;  4KW6 A;  4QL7 A;  4JR6 A;  3GV1 A;  2DC5 A;  1PSQ A;  4FIW A;  5IO0 A;  4CW9 A;  3HHV A;  5BMU A;  1WIK A;  4KAE A;  1EWX A;  4CY8 A;  5IQY A;  1SU9 A;  3TRX A;  2GQM A;  5ID2 A;  5HFI A;  1M9A A;  4W66 A;  3EYT A;  1SD8 A;  3VPT A;  1QGV A;  2K9F A;  3GA4 A;  1NW2 A;  4KH7 A;  3VI7 A;  2HXK A;  3HYP A;  4BL7 A;  4TKY A;  1XWB A;  2B7J A;  2P0G A;  1WMJ A;  1GSD A;  2XHF A;  5B8A A;  4MZW A;  1XWC A;  2F51 A;  4YAP A;  2YJ7 A;  3TGZ A;  2MMA A;  1SK0 A;  2PN8 A;  3HXS A;  1G6Y A;  4XTS A;  1K0A A;  3G9B A;  4L5L A;  3G7Y A;  5KOX A;  3KGK A;  1GSE A;  4EC0 A;  5GZZ B;  1MDJ A;  1BYE A;  4EDZ A;  5J40 A;  2BJX A;  1SJ6 A;  4JRR A;  3GST A;  4TXV A;  2L5O A;  4K8M A;  1YZX A;  2H6X A;  5BRT A;  5DAK B;  3EE2 A;  3TRQ A;  1FOV A;  4E68 A;  3Q74 A;  2AJQ B;  2J23 A;  2PBJ A;  5IO2 A;  3G7J A;  2DJ3 A;  4OMV A;  4WF5 A;  1PD2 1;  2L59 A;  2WUL A;  2YN1 A;  3Q19 A;  4IBP A;  1TJD A;  3C1S A;  3BBY A;  3RDW A;  3CSH A;  4ISD A;  5IMC A;  2M72 A;  4O7H A;  2PMT A;  4ZL8 A;  3L0H A;  3ED3 A;  4KSO A;  2JZT A;  4IHU A;  1K3Y A;  2GZP A;  4D73 A;  4IEL A;  2RUE A;  3HJM A;  3TJF A;  1GTA A;  5IPH A;  2DKI A;  2RII A;  3F3Q A;  4PQ1 A;  1CQG A;  4ZXG A;  4EXJ A;  2MMZ A;  3IAM 2;  2OAC A;  1GTB A;  2MBS A;  2H1L A;  2FY6 A;  5ECR B;  2QKE A;  5FT3 A;  2AAW A;  4AJ8 A;  4LMW A;  2GGT A;  3F6F A;  3IRA A;  1XW6 A;  3MAK A;  2TRX A;  1EZK A;  4K0N A;  1M2D A;  3CXG A;  4XS4 A;  2LQO A;  3HY2 A;  2VO4 A;  4TOP A;  3GTU B;  3TU3 B;  4BVX B;  1ZGN A;  3D4T A;  1TK5 B;  4K5S A;  4L5O A;  1X5E A;  3PH9 A;  2H8L A;  3ZIV A;  4DSS B;  1B9Y C;  2HRK B;  5CO3 A;  2VAF A;  2TIR A;  3EWL A;  4V1A p;  3ZFB A;  3IC4 A;  4OCF A;  1PKW A;  2VLT A;  3LOR A;  4TW5 A;  4JR4 A;  1T1V A;  3LGC A;  1K0D A;  4AJ6 A;  2CZ2 A;  3QAW A;  4HUA A;  2H6Y A;  2LKU A;  3GUR A;  1GSF A;  1MTC A;  4GXZ A;  3KZQ A;  3KD0 A;  1SKS B;  3IK7 A;  2H0G A;  2QA2 A;  2AHE A;  5ECI B;  3WGD A;  3LYP A;  1AQX A;  1ERW A;  3D5J A;  2KP2 A;  3IC8 A;  1ZZY A;  4BVY A;  3GKM A;  2FCH A;  1ABA A;  4K0G A;  4ZB7 A;  1O81 A;  4ILF A;  2JU5 A;  5F07 A;  1OE7 A;  3L78 A;  1M0U A;  3GKN A;  2LNS A;  1VF3 A;  1F6M C;  1KTE A;  2IJY A;  5GSS A;  2I4A A;  2O89 A;  4MCU A;  1U3A A;  2DJ1 A;  2O87 A;  1T3B A;  3HCZ A;  2B6M A;  4O5Q A;  6GSW A;  2IFQ A;  2R2J A;  2L57 A;  4XIH A;  1EV4 A;  4ECJ A;  4FYU A;  3RAZ A;  5G31 A;  3VK9 A;  4K5R A;  2VCT A;  2EC4 A;  3ISO A;  2VCQ A;  3GN3 A;  2REM A;  5HFG A;  1K0N A;  4ML1 A;  1LBK A;  1TOF A;  3EU3 A;  4ULX A;  1JZD A;  3ZYW A;  1V58 A;  5IMZ A;  3LW9 A;  3F4S A;  5J4U A;  5A5H A;  3H1N A;  2VM1 A;  1PQN A;  5ENU A;  3RHB A;  4USS A;  5CRH A;  1X5D A;  4EL1 A;  1I9D A;  3HVV A;  2UZ8 A;  4KCE A;  3TKP A;  1GRX A;  5F8B A;  2PU9 C;  3KEB A;  1THX A;  1BF5 A;  1YDK A;  4RQX A;  2YOI A;  3F9U A;  2CQ9 A;  4K2D A;  2P31 A;  3P7X A;  1DUG A;  3C7M A;  5DQY A;  5A4W A;  1ERT A;  3UBK A;  3TOU A;  5G1K A;  5J41 A;  4EO3 A;  5B6N A;  3BOA A;  1CQH A;  4TR1 A;  2H0H A;  5IMA A;  5J5N A;  2OBI A;  4Q5F A;  2C4J A;  2OBK A;  3IA1 A;  2C0E A;  2X4A A;  4NV2 A;  4KDU A;  2H19 A;  4ECC A;  5EPF A;  4XCS A;  3FR6 A;  2PUK C;  2L4C A;  2R0C A;  2V1M A;  4POK A;  2LST A;  4MH2 A;  1HQO A;  1YY7 A;  4G0K A;  3SBC A;  2GDR A;  3LXT A;  19GS A;  5IOX A;  4WBR D;  1MEK A;  1EEJ A;  1A8Y A;  3TKQ A;  1GUH A;  1EGR A;  5D9X A;  1GP1 A;  3GKX A;  1PGT A;  3VWX A;  3TCO A;  4IP1 A;  2XC2 A;  4PTS A;  4XHM A;  3A5I A;  2C0F A;  2GST A;  3IR4 A;  5ECL B;  4MJB A;  4KB3 A;  4F9Z A;  4N11 A;  3PPU A;  3H79 A;  1K0B A;  5A1N A;  2HSM B;  3HJP A;  2N5A A;  1GTI A;  2HYX A;  1GTU A;  2FLS A;  1EOH A;  1YEX A;  3FRC A;  6GSS A;  4IGJ A;  3U6V A;  1FB0 A;  2B5E A;  1XVQ A;  2B5X A;  4DSR A;  1ZCP A;  2O7K A;  2JZS A;  4OD7 A;  1FHE A;  2YCD A;  3IXR A;  1GUL A;  1XWK A;  2LEG A;  4G0I A;  2F9S A;  3CBU A;  3ZFL A;  4IJ3 A;  4EDY A;  1AXD A;  5EY6 A;  3DVX A;  1N25 A;  5D9V A;  2M80 A;  2WCI A;  1J08 A;  1Z6M A;  2B7K A;  3F0I A;  3ERF A;  2PVO C;  2YP6 A;  1A2M A;  1FOH A;  3C8E A;  5IOW A;  4MK3 A;  5ECN B;  2ES7 A;  2LNT A;  3UBL A;  4KCA A;  2H0I A;  1GNW A;  3IE3 A;  3FZ4 A;  4BL7 B;  4NPB A;  3V1W A;  4E8E A;  3F4R A;  2GLR A;  5JCG A;  4MZB A;  4NWY A;  2OT3 A;  2R0P A;  1U87 A;  3MWH A;  4JU5 A;  5FWG A;  5J9B A;  3D4M A;  4AKG A;  1BED A;  4TN8 A;  5D96 A;  1IYH A;  2IMI A;  2HLS A;  2C3N A;  4ECB A;  3IHG A;  1JLV A;  6GSV A;  3TOT A;  1TRW A;  3D0Z A;  1FAA A;  2RM5 A;  1SD9 A;  2IL3 A;  4WEY A;  1T7P B;  1LJR A;  1Z9H A;  2IMD A;  2YPM A;  1ERV A;  3QR6 A;  4J57 E;  4KF9 A;  2C1Y A;  2R37 A;  1XW9 A;  4J56 E;  3EVI A;  1A2L A;  3NOF A;  1N2A A;  4MJA A;  4MF5 A;  3FZ9 A;  1R26 A;  5KEJ A;  4GTU A;  3J7Y k;  3KP8 A;  2WJU A;  3HMJ G;  4JBB A;  1HYU A;  4D73 B;  3NZN A;  5D9T A;  1K0O A;  5AIV A;  3HZ8 A;  1YKC A;  1Z7P A;  2MMN A;  2JSY A;  3C73 A;  1AQW A;  3QFB C;  2CX3 A;  4ZB9 A;  2E2M A;  2FD3 A;  2H70 A;  3L9U A;  3QAV A;  2GZZ A;  3F3R A;  2A2R A;  4KDX A;  2YV9 A;  3QD9 A;  3TKS C;  1QUW A;  4GCI A;  1T4Y A;  1EEM A;  1ZMA A;  1NHO A;  5IPG A;  2HZE A;  4V1A g;  2H73 A;  1B48 A;  3SWL A;  4IW9 A;  1GNE A;  3GFK A;  1WPI A;  4EF0 A;  1HNC A;  1NHY A;  2WFC A;  1W89 A;  1A23 A;  5J4V A;  2YZH A;  4XS4 B;  5CYY A;  4ECI A;  2H66 A;  1O85 A;  1F2E A;  1OVN A;  1UA5 A;  1R7H A;  4Q5Q A;  1U6T A;  4LLR A;  2N5F A;  4RUV A;  4V2M A;  2I1U A;  2IMK A;  1AUC A;  4G01 A;  1N8J A;  2VM2 A;  2PVQ A;  4ZL7 A;  3N9J A;  4AKI A;  4CY6 A;  4F0C A;  3VWV A;  3DYR A;  5HR2 A;  5JWR B;  1PL2 A;  1MD3 A;  4DSQ A;  2B3S A;  2VCX A;  3BD2 A;  3BJ5 A;  3GL5 A;  1B8X A;  3DWV A;  3FR3 A;  3JCM L;  2C3Q A;  2MYG A;  3S9F A;  4KSM A;  4EKZ A;  4I5Q A;  5D73 A;  2LUS A;  5JWQ B;  2VL2 C;  5F0G A;  5ECK B;  2HQT A;  2VLV A;  1NSW A;  4MDC A;  1AC1 A;  3ZIT A;  5DAL A;  3QFA C;  3H4K A;  4NXI A;  4IQA A;  1ACV A;  2DMM A;  4XS1 A;  4AF2 A;  1Q98 A;  4MPG A;  2VCW A;  4H86 A;  5DCG A;  3QCP A;  4LA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...