2X64A

Glutathione-s-transferase from xylella fastidiosa
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
206
structure length
206
Chain Sequence
HMKLYIMPGACSLADHILLRWSGSSFDLQFLDHQSMKAPEYLALNPSGAVPALQVGDWVLTQNAAILNYITDIAPAERGLSGDGSLKARAEINRWIAFSNSDVHPMYWALFGGTAYLQDPQMIARSQDNARQKLRVLYQRADAHLKHHNWLANGQRSGADAYLYVTLRWAKKVGVDLSSLDALSAFFERMEADPGVQAALQAEGLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE-S-TRANSFERASE
publication title Structural and Biophysical Characterization of the Recombinant Glutathione-S-Transferase from Xylella
rcsb
source organism Xylella fastidiosa
molecule tags Transferase
total genus 76
structure length 206
sequence length 206
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2x64A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2x64A01
3GUSA 4FYBA 1SYXA 3O6TA 4KSMA 2HRAA 3SBCA 2L6DA 4YQVA 1GLQA 3C1RA 2MYGA 3UVTA 3C71A 4FYUA 3FY7A 1OC8A 3TJJA 1AC1A 4KCEA 1YY7A 1YKAA 3M9JA 2WJUA 3J7Yb 4GQCA 2V6KA 4IJIA 4PQ1A 3RPPA 2L5LA 2X8GA 2XHFA 4NXIA 2B3SA 3CSHA 4TW5A 3DGQA 3RHCA 3U6VA 2BJXA 5IMFA 3TJFA 6GSWA 2H6ZA 4QL9A 2CX4A 2VUPA 4IW9A 2YZHA 3IK9A 3TOTA 5B8BA 2HXKA 2H1BA 2KLXA 3TRXA 1NW2A 3TJKA 3HHVA 4PUAA 3CBUA 2VL2C 1VF2A 1YF1A 3N5OA 3M9KA 1GL8A 2B5EA 4V2MA 3UAPA 2IMDA 1AIUA 5HFKA 1SKWB 4JBBA 3ZVJA 2IJYA 4EDZA 4K6XA 4MLYA 3TUEA 4TRXA 5D96A 1X9MB 2DIYA 1XWCA 1F6MC 1ACVA 3UBKA 3TDGA 3GMFA 5F0GA 3DXBA 2VM2A 2VIMA 3TGZA 3KXOA 1ZL9A 19GSA 4FQUA 2GVPA 3EURA 2L6CA 2B1LA 4WF5A 4LMWA 2H01A 3GRXA 3FR9A 4ZBAA 5GSSA 1K0DA 3H1NA 4BPYA 5J5NA 2IPAA 3ZL5A 3R2QA 3VK9A 3TKRA 2NPBA 1EOGA 3EVIA 1O8XA 3RHBA 1R5PA 4IELA 2H1GA 1Y25A 3S9FA 2O89A 3UARA 5EY6A 2OE0A 2JACA 2VLVA 5G2ZA 5ECPB 1F2EA 1FW1A 1WIKA 5D9TA 3D22A 3O3TA 3TRQA 4MZCA 5EVOA 2CA8A 4DSSA 3U5RE 1VRSD 1FVKA 2E2GA 4BVXB 3TOUA 3PINA 2YWMA 2H6YA 4PTSA 5COHA 1EV9A 22GSA 4GSNA 1OKTA 4HQSA 1YDKA 2GLRA 3LGCA 1G7EA 2AB6A 1Z3EA 2RM5A 5IMZA 3FZ4A 4ILFA 4KGIA 1OKDA 3EU3A 3Q19A 1WP0A 3HXSA 5D8IA 1X9SB 3DWVA 3DVWA 4L8EA 2ES7A 3CXGA 4LA1A 4PURA 3KMNA 1Z9HA 1XZOA 5KN2A 1B4PA 4KW6A 3TCOA 1FVJA 1TRWA 4MF6A 4ECCA 7GSSA 1FB6A 4HOJA 4MCUA 5IMCA 2FA4A 4MF5A 2O7KA 4P3YB 1T3BA 1XOBA 3AY8A 2C0FA 4NHWA 3F9UA 5AGYA 2H73A 2FD3A 5J9BA 1PL2A 5G5FA 1GLPA 1K3OA 2HRFA 4MK3A 5JWRB 1B9XC 2VL3A 1FB0A 2HRKB 2RIIA 5GZZB 4DSRA 3FK8A 2RUEA 4DSQA 20GSA 5DCGA 3GX8A 3IXRA 3I9V2 4HJMA 4HUAA 3QDNA 2GSTA 1F9MA 1A2JA 4Q5FA 3PPUA 3F8UA 2CV4A 2HRKA 4K0NA 1WE0A 3D4MA 4ZBBA 1ZCPA 3FR6A 1THOA 3GKKA 4G19A 2FWGA 2YWNA 1ON4A 2N5AA 3RPNA 4IJ3A 1EEMA 3LXZA 2LTKA 1I9DA 1JZWA 2CQ9A 1QK8A 2XBQA 2YOIA 2GDRA 2L59A 2DJ0A 6GSVA 1B9YC 3TRPA 3ZLPA 1M7TA 1OC9A 3QD9A 2WZ9A 1BYEA 4TR1B 4TKYA 3QFBC 4ZXGA 2H76A 1GSFA 5IM9A 1VF4A 5CRWA 2VL9A 3QAWA 1QUWA 1NSWA 4ZB6A 2KHPA 4D73B 1UN2A 3BCIA 2WFCA 1TJDA 4L0UA 4IKHA 2LKUA 3KJYA 2FWFA 3F0IA 4HU7A 1HNAA 2YWIA 5J3RA 1ZYQB 4BL7B 2C0EA 1V98A 4MF7A 2XPEA 3GHAA 1F37A 3OR5A 2FWHA 2ZUPA 3KMOA 2ZNMA 2IL3A 2WDUA 2IIYA 4I97A 2BMXA 2HFDA 1G0TA 1YF0A 5IPHA 3EU4A 4OO4A 1K3YA 1T00A 1XW9A 1V40A 12GSA 1LU4A 3D21A 4JZQA 2CT6A 2GSSA 2CVBA 2F8AA 2C4JA 2C8UA 6GSTA 2DSAA 3F6DA 3R3EA 5AIXA 3EMPA 1FOVA 5J41A 4LMVA 2D2ZA 3ERGA 4MPFA 2GZZA 1R26A 3G7JA 1O7UA 3HVVA 5BMUA 2GZPA 2VOCA 4EUYA 1EEJA 4QQ7A 3ME8A 4MDCA 1ERWA 5DALA 2H1DA 4XHMA 1UVZA 4H86A 4KAEA 2K9FA 4I5QA 2F51A 2GGTA 2VCWA 3US3A 5B7CA 2X8CA 5DQSA 3H8QA 1YZXA 1U6TA 1VF1A 2CAQA 1RQMA 4GLTA 4E8HA 4XIHA 3D5JA 2JADA 4EKZA 2NTOA 5B6MA 3LXTA 1DE2A 1OE7A 2FLSA 2H0IA 3FYGA 2PU9C 3HDCA 4YQMA 2ON7A 1TK0B 3CMIA 1IYIA 2IFQA 3KTBA 2V32A 4EF0A 3M0FA 2PERA 1FG4A 1WPIA 1SK1A 2I4AA 5ECSA 3NOFA 4ZL8A 5FWGA 1V2AA 1XBSA 2CAIA 1S3DA 2IMKA 4ZL9A 4FO5A 4ML1A 3BD2A 1Q4JA 2RM6A 3BCKA 1TP9A 3BBYA 3I69A 1MDIA 2LJAA 4TR0A 4NAXA 2MBTA 1N2AA 2MBSA 1TK8B 1GSUA 1ERUA 2A2RA 2B7JA 5ELAA 5IMVA 1PMTA 2K8VA 3A2XA 4V2NA 4IQAA 4KF9A 2YZUA 4ZBDA 1AQXA 3G7YA 2QSIA 3ZREA 5KN0A 4JE1A 2IWTA 4PNGA 3ZIVA 2HZEA 1WMJA 2X64A 3F4TA 2KUCA 3MWHA 2LNSA 3KP8A 1THXA 3EYTA 5D9WA 2LRNA 4V2LA 1C72A 2B1KA 1XWBA 1MEKA 2ON5A 2C80A 3IK7A 2R3XA 2FUG2 3GTUB 1R7HA 4GXZA 3KGKA 4IP1A 1SJIA 1AW9A 5AISA 3IA1A 2TRXA 3I6AA 4NV5A 1MDJA 5LD0A 1A2LA 1XWGA 2XPDA 2C0GA 3TKSA 5KEJA 2VL2A 10GSA 4NPBA 3G9BA 11GSA 1A2MA 4OMVA 5DJLA 2N5FA 1ZOFA 2P0GA 1WRYA 3GH9A 3F3RA 3FHKA 5ID2B 1RW1A 5CRDA 3ERWA 4MZBA 3QR6A 5D9XA 2AJQB 4V1Ag 2XC2A 1J9BA 3DEXA 4POLA 2ZCTA 4O7HA 2I3YA 2YWOA 4IBPA 3RAZA 4AJ6A 3N9JA 3APOA 3GKMA 3ZRDA 1U88A 5CNWA 4O32A 4OCFA 3QOUA 3VWVA 6GSYA 2HNLA 1SK2A 1XVQA 5ABRA 4XS1A 3L4NA 1M9BA 4KDUA 1M9AA 3LWAA 1AXDA 2JSYA 1ZMAA 3IOSA 4K7NA 3UJ1A 2DLXA 4KX4A 3O76A 4RQRA 3UL3A 5G1KA 2EIOA 2ALBA 3IV4A 2JU5A 3ZFBA 2PUKC 4KDYA 2K6VA 2G0FA 3Q74A 1GP1A 5IOWA 3CRUA 5CRGA 3M8NA 3CRTA 4JR4A 1Z5YE 3JCML 2E2MA 4RI6A 2M46A 2PPTA 2PBJA 5IOXA 5KN1A 3TKSE 4ECIA 1TI1A 4N0VA 4IS0A 3QMXA 1T4ZA 1OYJA 3MSZA 3P2AA 1ILOA 2OE1A 2H71A 2VD1A 3GFKA 1GTUA 4F0BA 4K7IA 3GNJA 1F3AA 1OC3A 1QGVA 2LRTA 1ZZYA 3WT2A 5IO2A 2X8HA 3FR3A 4XS4B 4XRAA 5H5SA 1K0BA 4BVXA 3D0ZA 2MZCA 4F0CA 5INYA 3APQA 5G30A 1BJXA 4HI7A 3GA4A 4N30A 4PNFA 5HR3A 5H5RA 4I2UA 4G0IA 3W8JA 2YCDA 5D73A 2J9HA 4MABA 1PL1A 2V1MA 2WB9A 2QC7A 4GF0A 5LNKe 1O6JA 1DUGA 4BWQA 2HI7A 3C1SA 3P8WA 3ZYWA 1PGTA 4TN8A 2FGXA 5D93A 3CTGA 4G2EA 3HKRA 4RUVA 17GSA 2LQQA 2RUFA 16GSA 3LSZA 2K18A 3TJGA 1UA5A 2AUVA 2HSMB 1GNEA 2CVDA 4PX1A 1QFNA 1JZOA 3P90A 3IPZA 5B8AA 1TKDB 1W89A 4BWSA 4HQZA 2NDOA 4MH3A 1CQHA 4OFMA 5E59A 5IIZA 2YPMA 5G1LA 5ELGA 3IR4A 4L0WA 3KM6A 2O87A 3WD6A 5DVBA 1EGOA 1SJ6A 2B5XA 3L78A 3VPQA 1N8JA 4JR6A 4MMMA 2YN1A 1W4VA 3K8NA 1X5DA 2C0DA 2OA7A 1NM3A 4EXJA 2OJLA 3GSTA 4TR4A 4OCEA 3HVSA 3WGXA 3E0UA 1JZDA 3DRNA 4JU5A 1U3AA 3DKSA 4I2TA 5DCHA 5IQYA 5DAKB 5ENUA 1Z6NA 5GAND 1G6YA 3IDVA 2CZ2A 4G10A 4HS1A 5CO3A 4EO3A 1H4OA 2H70A 3APSA 2G2QA 2GQKA 1V9WA 2DJ3A 2DMMA 2AYTA 4PQIA 3MNGA 2PMTA 2EIRA 1DBYA 2HSYA 4K2DA 3IRAA 4TR1A 3ZMKA 3WGDA 4K0GA 4Q5NA 2O85A 4NMUA 4NV2A 2B6MA 2H8LA 1WWJA 2PWJA 3H4KA 3IC8A 4ULXA 4G0LA 3L0HA 1SJZA 2HZFA 4KSOA 5GSTA 1S3CA 1SL0B 2VCZA 2HSNB 3WT1A 5ECNB 4D73A 5FT3A 3HYPA 4IN0A 5JCUA 2KOKA 1K3LA 3KCMA 1K0OA 5ECQB 3GKXA 3ERFA 4BL7A 2HRNA 3M3MA 2JSZA 2M80A 4OO5A 1GNWA 2C1YA 4I8BA 1V58A 1J08A 3UVHA 3F6FA 4F9ZA 1U3IA 2IN3A 2VCQA 1R5AA 2WS2A 3NZNA 4X1UA 2WGRA 1VF3A 3ZVJD 1V57A 1X5CA 2XBIA 4ID0A 3UBLA 4CW9A 1M2DA 4MA9A 3IAS2 1TXXA 1GUMA 4CHSA 3KZQA 5E4WA 2OACA 1GUHA 2QGVA 4JEDA 1MTCA 4O5RA 1GULA 1H75A 3CTFA 1GTIA 2HYXA 2MMAA 1ZYEA 5HQPA 3KTLA 2J23A 4CDOA 1A0FA 4FIWA 3HZ8A 2F9SA 3FW2A 4LLRA 2GTUA 2H30A 4F82A 2VLUA 1JHBA 4FYCA 4BVYB 3GH6A 4YQUA 2IMFA 5A4WA 4AJ8A 1TW9A 1GSQA 2YANA 2JZTA 2NBSA 3QFAC 2EIQA 4TXOB 4GTUA 3A5WA 2TRCP 3FKFA 5DDLA 3A3TA 3L9VA 4YAVA 2FNOA 5CREA 1FAAA 1XFLA 5G5EA 1A0RP 5D9VA 1A8YA 4WF4A 1XWKA 3VWUA 1XCCA 1TRSA 2GQMA 3BOAA 2HT9A 4TXOA 4MJAA 4IP6A 1M99A 4EDYA 3HD5A 1BAYA 3VPTA 2DBCA 3KEBA 2L5OA 2I9HA 3VURA 2LQOA 2B5YA 3IE3A 1JZRA 4K9ZA 4X43A 1KBNA 3GL3A 4YH2A 4WKWA 4N10A 1YQ1A 3UIWA 1OE8A 3TKPA 2YV9A 1IYHA 1O8WA 3QPMA 4E8EA 5EPFA 4POBA 3A2WA 1PN9A 3ISOA 4O92A 1A23A 4TR3A 2CX3A 1SL1B 2WCIA 1EZKA 3WYWA 2MMOA 4X0XA 2A2SA 1KNGA 2GSRA 4KUNA 4EL1A 2MMNA 5ECRB 1QQ2A 1G6WA 2I81A 1XXUA 1HYUA 2P5QA 1TK5B 1FO5A 4L5LA 1XWAA 2QKEA 1BQ7A 1NHOA 1K0MA 4ZB9A 1TRVA 3F4SA 3L9SA 4J57E 3HY2A 5JCWA 2GT6A 1PD21 3C8EA 1PRXA 4LL1B 3LG6A 3UMAA 4MP4A 4DVCA 4WETA 2GSQA 4HDEA 2DJ2A 5LCZA 5ECIB 5JWQB 2X99A 3GTUA 5A4VA 1EOHA 2HE3A 2H1AA 3A2VA 3ZFLA 4Q5RA 2IMIA 2HLSA 3HJPA 1PQNA 2VD0A 2OBIA 1EV4A 5JWOB 2PGTA 4MJEA 1SL2B 3ME7A 2NVLA 1B48A 3CSJA 5IMAA 3D6IA 2DC5A 1OVNA 4F03A 2H19A 5C00A 1BEDA 2FA8A 4BA7A 3L9UA 1EP8A 1USBA 3SWLA 1SENA 4WEYA 3TKSC 3RDWA 6GSSA 2F3MA 1MD4A 3LJRA 5B6NA 5AN1A 3HCZA 2IMEA 3MDKA 4TOPA 2MMZA 3PGTA 5ID2A 3LQ7A 3ED3A 3HZ4A 3GYKA 2WULA 1PX6A 1SD9A 3DMLA 3QAVA 4EE0A 3FZ9A 3WGEA 1TU8A 2FY6A 3ZIJA 2KP1A 4QL7A 3KIJA 2LNTA 3I43A 1WJKA 3DVXA 4HZ4A 1M2AA 4KA0A 3TJBA 1T8EB 5EL8A 2UZ8A 3KH7A 5L71A 1GSEA 2KP2A 5H5QA 1Z7RA 4OFNA 1HQOA 1VGLA 3BJ5A 4KB3A 4IQ1A 1A8LA 1PSQA 1TRUA 2AV4A 1R4WA 4L5OA 4ZB8A 4DSSB 4PGTA 1A24A 3VI7A 1BX9A 6GSXA 2GS3A 2LSTA 2L4CA 6GSUA 1URMA 5JCGA 3UOMA 3QAGA 1LBKA 1YEPA 4XTSA 4ML6A 2WRTA 3ZMLA 1OAZA 3VFIA 1JLVA 4WR4A 2EC4A 1TDIA 4YAPA 2LRCA 3CYNA 1B8XA 5G31A 1ERTA 2C3QA 1SKRB 4KNDA 2V2GA 3ZZXA 4HEA2 5ECOB 4ECBA 2OADA 4ZIJA 4TXVA 5CAXA 3LFLA 2GZYA 5CYYA 3KH9A 3P7XA 5DBQA 1GH2A 5HFIA 4OFTA 2VLTA 2JZSA 1ERVA 4WBRD 14GSA 1YKCA 3LYKA 4NWYA 2HQTA 3PH9A 1UC7A 2VCTA 4F2IA 3NIVA 2PVQA 3F3QA 2FWEA 5A5KA 1GSSA 4XS4A 1Z7PA 5GAPD 1XW6A 1SK0A 2V6OA 2H0HA 1QMVA 2FCHA 4JRRA 3E9JB 2LUSA 3CSIA 3GURA 1E6BA 1EGRA 1T1VA 4MJCA 4ISDA 2YJ7A 5CP1A 1G7OA 3VWWA 3IC4A 4V1Ap 5HR1A 18GSA 3FZAA 2E7PA 1GWCA 2L4QA 5CRHA 1TI3A 4AJ7A 2BTOT 4ECJA 2DJKA 3EWLA 1PKWA 2CZ3A 4MH2A 1SYRA 4KCAA 1WOUA 2CVKA 5AIVA 2R37A 3GX0A 1KEBA 2GT5A 1FHEA 3GKNA 5F06A 4LL4B 3ZTLA 2YNXA 2VO4A 4PUFC 2E0QA 2DJ1A 4EC0A 1XVWA 4K1FA 2DMLA 3UEMA 1M2BA 2R2JA 1AQVA 2REMA 4FH8A 2HSMA 2M72A 1ML6A 3LORA 1SU9A 3Q6OA 1XPVA 3KP9A 3V1WA 1S3AA 1X0RA 4HU9A 4POKA 4WBJA 1ABAA 4EVMA 1SKSB 5DQYA 5ECLB 1TTZA 2OKAA 5J4UA 2VCVA 4XCSA 4K7OA 2LV3A 1EP7A 1MDKA 1PA3A 1OC9B 2K8SA 3TKQA 1J0FA 2R5GA 3HJOA 4GQFA 2JL4A 2HSHA 1I5GA 2I1UA 1GTAA 3W8SA 2F8FA 1ZGNA 1SD8A 4J2FA 2TIRA 2FHEA 3PR8A 1GTBA 4MZWA 2LJKA 3E3EA 2O8VB 1T7PB 5F07A 4NHZA 3W6GA 5DAKA 5KN3A 4KDXA 2LEGA 4POMA 2LS5A 1AQWA 4IGJA 3RBTA 13GSA 4HZ2A 4J56E 3FEUA 2V41A 5A4UA 1DE1A 1K0NA 5F05A 4XS6A 1M0UA 1XIYA 1DSBA 1QXHA 2LJRA 2C3TA 4IHUA 2GQLA 1GRXA 1AAZA 4GSSA 3ZITA 1ST9A 2R6KA 4K8MA 3VLNA 4USSA 3H79A 1E2YA 1NHYA 3Q18A 2DIZA 3EINA 4N11A 3J7Yk 1HNBA 1TOFA 1PKZA 2PVOC 3TB2A 1YJ6A 3IAM2 4PQHA 2AHEA 2OE3A 3MAKA 2VM1A 3M1GA 2YJHA 1GSDA 4IVFA 5ECKB 5DALB 1JLWA 4G0KA 3GV1A 3HVXA 1X5EA 4I6XA 1BG5A 1K0AA 3F4RA 1XOAA 2OBKA 4Q5QA 5C04A 4ZL7A 2L57A 2A4VA 5ECMB 4GSTA 4AGSA 3FRCA 1YEXA 4AF2A 2PN8A 4MPGA 2P5RA 3DYRA 5HFGA 3FZ5A 3EMXA 2YV7A 2H6XA 3G7IA 3IBHA 1MD3A 2C3NA 2Z9SA 1B4QA 2IFQB 3IHQA 4HJ2A 2VCXA 1KTEA 5IO0A 5F8BA 1GSYA 1EWXA 4RQXA 3DIEA 1LJRA 1CQGA 3EE2A 3GL5A 3D4TA 4G9HA 8GSSA 2H75A 3GN3A 5ECHB 1K0CA 3DD3A 4TVEA 1HD2A 3GIXA 4BVYA 4ZILA 2P31A 2N5BA 3F63A 1HNCA 5FHIA 1O85A 4GWRA 3HJMA 4KH7A 2AAWA 2H66A 5IMDA 4N0ZA 3HA9A 1U87A 4XRDA 4Z7XA 2H72A 3EC3A 1O81A 3QCPA 4OWYA 1X9WB 9GSSA 2H0GA 5HR2A 3LYPA 3VI5A 4RI7A 4WR5A 1JFUA 1O73A 3KD0A 2HZEB 5IPGA 2RLIA 1Q98A 1T4YA 4PXOA 1Z6MA 1XW5A 5HR0A 3C73A 5J9CA 2YP6A 4GRFA 4DEJA 2DJJA 3GSSA 1RK4A 2H74A 4MJBA 1GUKA 3C7MA 3H93A 1TU7A 1PX7A 4WXTA 1AUCA 2VAFA 3LEFA 1F3BA 5DJMA 2R4VA 2B7KA 4GCIA 3VWXA 4ACSA 2JZRA 4OD7A 1Y6EA 4KE3A
chains in the Genus database with same CATH superfamily
3GUSA 4FYBA 1SYXA 3O6TA 4KSMA 2HRAA 3SBCA 2L6DA 4YQVA 1GLQA 3C1RA 2MYGA 3UVTA 3C71A 4FYUA 3FY7A 1OC8A 3TJJA 1AC1A 4KCEA 1YY7A 1YKAA 3M9JA 2WJUA 3J7Yb 1BG1A 4GQCA 2V6KA 1TXUA 4IJIA 4PQ1A 3RPPA 2L5LA 2X8GA 2XHFA 2WW0A 4NXIA 2B3SA 3CSHA 4TW5A 3DGQA 3RGBC 3RHCA 3U6VA 2A2PA 2BJXA 1Y1UA 5IMFA 3TJFA 6GSWA 2H6ZA 4QL9A 2CX4A 2VUPA 4IW9A 2YZHA 3IK9A 3TOTA 2R0PA 5B8BA 2HXKA 2H1BA 2KLXA 3TRXA 1NW2A 3TJKA 3HHVA 4PUAA 3CBUA 2VL2C 1VF2A 1YF1A 3N5OA 3M9KA 1GL8A 2B5EA 4V2MA 3UAPA 2IMDA 2H1LA 1AIUA 5HFKA 1SKWB 4JBBA 3ZVJA 2IJYA 4EDZA 4K6XA 4MLYA 3TUEA 4TRXA 5D96A 1X9MB 2DIYA 1XWCA 1F6MC 2EFDA 1ACVA 3UBKA 3TDGA 3GMFA 5F0GA 3DXBA 2VM2A 2VIMA 3TGZA 3KXOA 2EFEA 1ZL9A 19GSA 4FQUA 2GVPA 3EURA 2R0GA 2L6CA 2B1LA 4WF5A 4LMWA 1FOHA 2H01A 3GRXA 3FR9A 4ZBAA 3CHXC 5GSSA 1K0DA 3H1NA 4BPYA 5J5NA 2IPAA 3ZL5A 3R2QA 3VK9A 5J4YA 3TKRA 2NPBA 1EOGA 3EVIA 1O8XA 3RHBA 1R5PA 4IELA 2H1GA 1Y25A 3S9FA 2O89A 3UARA 5EY6A 2OE0A 2JACA 2VLVA 5G2ZA 5ECPB 1F2EA 1FW1A 1WIKA 5D9TA 3D22A 3O3TA 3TRQA 4MZCA 5A34B 5EVOA 2CA8A 4DSSA 3U5RE 1VRSD 1FVKA 2E2GA 4BVXB 3TOUA 3PINA 2YWMA 2H6YA 4PTSA 4AI6A 5COHA 1EV9A 22GSA 4GSNA 1OKTA 4HQSA 1YDKA 4AKGA 2GLRA 3LGCA 1G7EA 2AB6A 1Z3EA 2RM5A 5IMZA 3FZ4A 4ILFA 4KGIA 1OKDA 3EU3A 3Q19A 1WP0A 3HXSA 5D8IA 1X9SB 3DWVA 3DVWA 4L8EA 2ES7A 3CXGA 2WW3A 4LA1A 4PURA 3KMNA 1Z9HA 2UV8G 1XZOA 5KN2A 1B4PA 4KW6A 3TCOA 1FVJA 1TRWA 4MF6A 4ECCA 7GSSA 1FB6A 4HOJA 4MCUA 5IMCA 2FA4A 4MF5A 2O7KA 2OT3A 1BF5A 4P3YB 1T3BA 1XOBA 4K5RA 3AY8A 2C0FA 4NHWA 1YVLA 3F9UA 5AGYA 2H73A 2FD3A 2X49A 5J9BA 1PL2A 5G5FA 1GLPA 1K3OA 2HRFA 4MK3A 5JWRB 1B9XC 2VL3A 1FB0A 2HRKB 2RIIA 5GZZB 4DSRA 3FK8A 2RUEA 4DSQA 20GSA 5DCGA 3GX8A 3IXRA 3I9V2 4HJMA 4HUAA 1XG8A 3QDNA 2GSTA 1F9MA 1A2JA 4Q5FA 3PPUA 3F8UA 2CV4A 2HRKA 4K0NA 1WE0A 3D4MA 4ZBBA 1ZCPA 3FR6A 1THOA 3GKKA 4G19A 2FWGA 2YWNA 4PI2C 1ON4A 2N5AA 3RPNA 4IJ3A 1EEMA 3LXZA 2LTKA 1I9DA 1JZWA 2CQ9A 1QK8A 2YOIA 2XBQA 2GDRA 2L59A 2DJ0A 6GSVA 1B9YC 3TRPA 3ZLPA 1M7TA 1OC9A 3QD9A 2WZ9A 1BYEA 4TR1B 4TKYA 3QFBC 4ZXGA 2H76A 1GSFA 5IM9A 1PFOA 4MNNA 1VF4A 5CRWA 2WW1A 2VL9A 3QAWA 1QUWA 1NSWA 4ZB6A 2QA1A 2KHPA 4D73B 1UN2A 3BCIA 2WFCA 1TJDA 4L0UA 4IKHA 2LKUA 3KJYA 2FWFA 3F0IA 4HU7A 1HNAA 2YWIA 5J3RA 1ZYQB 4BL7B 2C0EA 1V98A 4MF7A 2XPEA 3GHAA 1F37A 3OR5A 2FWHA 2ZUPA 3KMOA 2R0CA 2ZNMA 2IL3A 2WDUA 2IIYA 4I97A 2BMXA 2HFDA 1G0TA 4G01A 1YF0A 5IPHA 3EU4A 4OO4A 4HSCX 1K3YA 4K2XA 1T00A 1XW9A 1V40A 12GSA 1LU4A 3D21A 4JZQA 2CT6A 2GSSA 2CVBA 2F8AA 2C4JA 2C8UA 6GSTA 2DSAA 3F6DA 3R3EA 5AIXA 3EMPA 1FOVA 5J41A 1SVMA 2D2ZA 4LMVA 3ERGA 4MPFA 2GZZA 1R26A 3G7JA 1O7UA 3HVVA 5BMUA 2GZPA 2VOCA 4EUYA 1EEJA 4QQ7A 3ME8A 4MDCA 1ERWA 5DALA 2H1DA 4XHMA 1UVZA 4H86A 4KAEA 2K9FA 4I5QA 2F51A 2GGTA 2VCWA 3US3A 5B7CA 2X8CA 5DQSA 3H8QA 1YZXA 3TU3B 1U6TA 1VF1A 2CAQA 1RQMA 4E68A 4GLTA 4E8HA 4XIHA 5A5HB 3D5JA 2JADA 4EKZA 2NTOA 4ZB7A 5B6MA 3LXTA 1DE2A 1OE7A 2FLSA 2H0IA 3FYGA 2PU9C 3HDCA 4YQMA 2ON7A 2O3EA 1TK0B 3CMIA 1IYIA 2IFQA 3KTBA 2V32A 4EF0A 3M0FA 2PERA 1FG4A 1WPIA 1SK1A 2I4AA 5ECSA 3NOFA 4ZL8A 5FWGA 1V2AA 1XBSA 2CAIA 5J40A 1S3DA 2IMKA 4ZL9A 4FO5A 4X4JA 4ML1A 3BD2A 1Q4JA 2RM6A 3BCKA 1TP9A 3BBYA 3I69A 1MDIA 2LJAA 4TR0A 4NAXA 2MBTA 1N2AA 2MBSA 1TK8B 1GSUA 1ERUA 2A2RA 2B7JA 5ELAA 5IMVA 1PMTA 2K8VA 3A2XA 4V2NA 4IQAA 4KF9A 2YZUA 4ZBDA 1AQXA 3G7YA 2QSIA 3ZREA 5KN0A 4JE1A 2IWTA 4PNGA 3ZIVA 2HZEA 1WMJA 2X64A 3F4TA 2KUCA 3MWHA 2LNSA 3KP8A 1THXA 3EYTA 5D9WA 2LRNA 4V2LA 1C72A 2B1KA 1XWBA 1MEKA 2ON5A 2C80A 2WVXB 3IK7A 2R3XA 2FUG2 3GTUB 5A1NB 1R7HA 4BIKA 4GXZA 3KGKA 4IP1A 1SJIA 1AW9A 5AISA 3IA1A 2TRXA 3I6AA 4NV5A 1MDJA 5LD0A 1A2LA 1XWGA 2XPDA 2C0GA 3TKSA 5KEJA 2VL2A 10GSA 4NPBA 3G9BA 11GSA 1A2MA 4OMVA 5DJLA 2N5FA 1ZOFA 2P0GA 1WRYA 3GH9A 3F3RA 3FHKA 5ID2B 1RW1A 5CRDA 3ERWA 4MZBA 3QR6A 5D9XA 2AJQB 3MIXA 4V1Ag 2XC2A 1J9BA 3DEXA 4POLA 2ZCTA 4O7HA 3LW9A 2I3YA 2YWOA 4PI0C 4IBPA 3RAZA 4AJ6A 3N9JA 3APOA 3GKMA 3ZRDA 1U88A 5CNWA 4O32A 4OCFA 3QOUA 3VWVA 6GSYA 3HMJG 2HNLA 2A4HA 1SK2A 1XVQA 5ABRA 4XS1A 3L4NA 1M9BA 4KDUA 1M9AA 3LWAA 1AXDA 2JSYA 1ZMAA 3IOSA 4FXYP 4K7NA 3UJ1A 2DLXA 4KX4A 3O76A 4RQRA 3UL3A 5G1KA 2EIOA 2ALBA 3IV4A 2JU5A 3ZFBA 2PUKC 4KDYA 2K6VA 2G0FA 3Q74A 4A5PA 1GP1A 5IOWA 3CRUA 5CRGA 3M8NA 3CRTA 4JR4A 1Z5YE 3JCML 2E2MA 4RI6A 2M46A 4AKXB 2PPTA 2PBJA 1M3IA 5IOXA 5KN1A 3TKSE 4ECIA 1TI1A 4N0VA 4IS0A 3QMXA 1T4ZA 1OYJA 3MSZA 3P2AA 1ILOA 2OE1A 4K5SA 2H71A 2VD1A 3GFKA 1GTUA 4F0BA 4K7IA 3GNJA 1F3AA 1OC3A 1QGVA 2LRTA 1ZZYA 3WT2A 5IO2A 5A34A 2X8HA 3FR3A 2QA2A 4XS4B 4XRAA 5H5SA 1K0BA 4BVXA 3D0ZA 2MZCA 4F0CA 5INYA 3APQA 5G30A 1BJXA 4HI7A 3GA4A 4N30A 4PNFA 5HR3A 5H5RA 4I2UA 4G0IA 3W8JA 2YCDA 3HVNA 5D73A 2J9HA 4MABA 1PL1A 2V1MA 2WB9A 2QC7A 4GF0A 5LNKe 1O6JA 1DUGA 4BWQA 4Z2RA 2HI7A 3C1SA 3P8WA 3ZYWA 1PGTA 4TN8A 2FGXA 5D93A 3CTGA 4G2EA 3HKRA 4RUVA 17GSA 2LQQA 2RUFA 16GSA 1N25A 3LSZA 2K18A 1M3JA 3TJGA 1UA5A 2AUVA 2HSMB 1GNEA 2CVDA 2O5VA 4PX1A 1QFNA 1JZOA 3P90A 3IPZA 5B8AA 1TKDB 1W89A 4BWSA 4HQZA 2NDOA 4MH3A 1CQHA 4OFMA 1SVOA 5E59A 5IIZA 2YPMA 5G1LA 5ELGA 3IR4A 4L0WA 3KM6A 2O87A 3WD6A 5DVBA 1EGOA 1SJ6A 2B5XA 2EFHA 3L78A 3VPQA 1N8JA 4JR6A 4MMMA 2YN1A 1W4VA 3K8NA 1X5DA 2C0DA 2OA7A 1NM3A 4EXJA 1S3RA 2OJLA 3GSTA 4TR4A 4OCEA 3HVSA 3WGXA 3E0UA 1JZDA 3DRNA 4JU5A 4W66A 1U3AA 3DKSA 4I2TA 5DCHA 5IQYA 5DAKB 5ENUA 1Z6NA 5GAND 1G6YA 3IDVA 2CZ2A 4G10A 4HS1A 5CO3A 4EO3A 1H4OA 2VKZG 2H70A 3APSA 2G2QA 2GQKA 1V9WA 2DJ3A 2DMMA 2AYTA 4PQIA 3MNGA 2PMTA 2EIRA 1DBYA 2HSYA 4EIPA 4K2DA 3IRAA 4TR1A 3ZMKA 3WGDA 4K0GA 4Q5NA 2O85A 4NMUA 4NV2A 2B6MA 2H8LA 1WWJA 2PWJA 3H4KA 3IC8A 4ULXA 4G0LA 3L0HA 1SJZA 2HZFA 4KSOA 5GSTA 1S3CA 1SL0B 2VCZA 2HSNB 1PN0A 3WT1A 5ECNB 4D73A 5FT3A 3HYPA 4IN0A 5JCUA 2KOKA 1K3LA 3KCMA 1K0OA 5J4VA 5ECQB 3GKXA 3ERFA 4BL7A 2HRNA 3M3MA 2JSZA 2M80A 4OO5A 1GNWA 2C1YA 4I8BA 1V58A 1J08A 3UVHA 4N3ZA 3F6FA 4F9ZA 1U3IA 2IN3A 1S4BP 2VCQA 1R5AA 2WS2A 3NZNA 4X1UA 2WGRA 1VF3A 3ZVJD 1V57A 1X5CA 2XBIA 4ID0A 3UBLA 4CW9A 1M2DA 4MA9A 3IAS2 1TXXA 1GUMA 4CHSA 3KZQA 2DKIA 5E4WA 2OACA 2WZSA 1GUHA 2QGVA 4JEDA 1MTCA 4O5RA 1GULA 1H75A 3CTFA 1GTIA 2HYXA 2MMAA 1ZYEA 5HQPA 3KTLA 2J23A 4CDOA 1A0FA 4FIWA 3HZ8A 2F9SA 3FW2A 4LLRA 2GTUA 2H30A 4F82A 2VLUA 1JHBA 4FYCA 4BVYB 3GH6A 4YQUA 2IMFA 5A4WA 4AJ8A 1TW9A 1GSQA 2YANA 2JZTA 2NBSA 3QFAC 2EIQA 4TXOB 4GTUA 3A5WA 2TRCP 5A5HA 3FKFA 5DDLA 5KOWA 3A3TA 3L9VA 4YAVA 2FNOA 5CREA 1FAAA 1XFLA 5G5EA 1A0RP 5D9VA 1A8YA 4WF4A 1XWKA 3VWUA 1XCCA 1TRSA 2GQMA 3BOAA 2HT9A 4TXOA 4MJAA 4IP6A 1M99A 4EDYA 3HD5A 1BAYA 3VPTA 2DBCA 3KEBA 2L5OA 2I9HA 3VURA 2LQOA 2B5YA 3IE3A 1JZRA 4K9ZA 4AKIA 4X43A 1KBNA 3GL3A 4YH2A 4WKWA 4N10A 1YQ1A 3UIWA 1OE8A 3TKPA 2WVZA 3RFRC 2YV9A 1IYHA 1O8WA 3QPMA 4E8EA 5EPFA 4POBA 3A2WA 1PN9A 3ISOA 4O92A 1A23A 4TR3A 2CX3A 1SL1B 2WCIA 1EZKA 3WYWA 2MMOA 4X0XA 2A2SA 1KNGA 2GSRA 4KUNA 4EL1A 2MMNA 5ECRB 1QQ2A 1G6WA 2I81A 1XXUA 1HYUA 2P5QA 1TK5B 1FO5A 4L5LA 1XWAA 2QKEA 1BQ7A 1NHOA 1K0MA 4ZB9A 1TRVA 3F4SA 3L9SA 4PHZC 4J57E 3HY2A 5JCWA 2GT6A 2WW2A 1PD21 3C8EA 1PRXA 4LL1B 4GDFA 3LG6A 3UMAA 4MP4A 2WVXA 4DVCA 4WETA 2GSQA 4HDEA 2DJ2A 5LCZA 5ECIB 5JWQB 2X99A 3GTUA 5A4VA 1EOHA 5A1NA 2HE3A 2H1AA 3A2VA 3ZFLA 4Q5RA 2IMIA 2HLSA 3HJPA 1PQNA 2VD0A 2OBIA 1EV4A 5JWOB 2PGTA 4CY8A 4MJEA 1SL2B 3ME7A 4EIQA 2NVLA 4ICYA 1B48A 3CSJA 4YKFA 5IMAA 3D6IA 2DC5A 1OVNA 4F03A 2H19A 5C00A 5KOXA 1BEDA 2FA8A 4BA7A 3L9UA 1EP8A 1USBA 3SWLA 1SENA 4WEYA 3TKSC 3RDWA 6GSSA 2F3MA 1MD4A 3LJRA 5B6NA 5AN1A 3HCZA 2IMEA 3MDKA 4TOPA 2MMZA 3PGTA 5ID2A 3LQ7A 3ED3A 3HZ4A 3GYKA 2WULA 1PX6A 1SD9A 3DMLA 3QAVA 4EE0A 3FZ9A 3WGEA 1TU8A 2FY6A 3ZIJA 2KP1A 4QL7A 3KIJA 2LNTA 3I43A 1WJKA 3DVXA 4HZ4A 1M2AA 4KA0A 3TJBA 1T8EB 5EL8A 2UZ8A 3KH7A 5L71A 1GSEA 2KP2A 5H5QA 1Z7RA 4OFNA 1HQOA 1VGLA 3BJ5A 4KB3A 1I1IP 4IQ1A 1A8LA 1PSQA 1TRUA 2AV4A 1R4WA 4L5OA 4ZB8A 4DSSB 4PGTA 1A24A 3VI7A 1BX9A 6GSXA 2GS3A 2LSTA 2L4CA 6GSUA 1URMA 5JCGA 3UOMA 3QAGA 1LBKA 1YEPA 4XTSA 4ML6A 2WRTA 3ZMLA 1OAZA 3VFIA 1JLVA 4WR4A 1SVLA 2EC4A 1ZYPA 1TDIA 4YAPA 2LRCA 3CYNA 1B8XA 5G31A 1ERTA 2C3QA 4QMKA 2DKHA 1SKRB 4KNDA 2V2GA 3ZZXA 4HEA2 5ECOB 4ECBA 2OADA 4ZIJA 4TXVA 5CAXA 3LFLA 2GZYA 5CYYA 3KH9A 3P7XA 5DBQA 1GH2A 5HFIA 4OFTA 2VLTA 2JZSA 1ERVA 4WBRD 14GSA 1YKCA 3LYKA 4NWYA 2HQTA 3PH9A 1UC7A 2VCTA 4F2IA 3NIVA 2PVQA 3F3QA 2FWEA 5A5KA 1GSSA 3FMWA 4XS4A 1Z7PA 5GAPD 1XW6A 1SK0A 2V6OA 2H0HA 1QMVA 2FCHA 4JRRA 5BRTA 3E9JB 2LUSA 3CSIA 2WVYA 3GURA 1E6BA 1YEWC 1EGRA 1T1VA 4MJCA 4ISDA 2YJ7A 5CP1A 2O36A 1G7OA 3VWWA 3IC4A 4V1Ap 5HR1A 18GSA 3FZAA 3A5IA 2E7PA 1GWCA 2L4QA 5CRHA 1TI3A 4AJ7A 2BTOT 4ECJA 2DJKA 3EWLA 1PKWA 2CZ3A 4MH2A 1SYRA 4KCAA 1WOUA 2CVKA 5AIVA 2R37A 3GX0A 1KEBA 2GT5A 1FHEA 3GKNA 5F06A 5J47A 4LL4B 3ZTLA 2YNXA 2VO4A 4PUFC 2E0QA 2DJ1A 4EC0A 1XVWA 3IHGA 4K1FA 2DMLA 3UEMA 1M2BA 2R2JA 1AQVA 2REMA 4FH8A 2HSMA 2M72A 1ML6A 3LORA 1SU9A 3Q6OA 1XPVA 1ZYNA 3CWGA 3KP9A 3V1WA 1S3AA 1X0RA 4HU9A 4POKA 4WBJA 1ABAA 4EVMA 1SKSB 5DQYA 5ECLB 1TTZA 2OKAA 5J4UA 2VCVA 4YKGA 4XCSA 4K7OA 2LV3A 1EP7A 1MDKA 1PA3A 1OC9B 2K8SA 3TKQA 1J0FA 2R5GA 3HJOA 4GQFA 2X4AA 2JL4A 2HSHA 1I5GA 2I1UA 4O5UA 1GTAA 3W8SA 2F8FA 1ZGNA 1SD8A 4J2FA 2TIRA 2FHEA 3PR8A 1GTBA 4MZWA 2LJKA 3E3EA 2O8VB 1T7PB 5F07A 4NHZA 3W6GA 5DAKA 5KN3A 4KDXA 2LEGA 4POMA 2LS5A 1AQWA 4IGJA 3RBTA 13GSA 4HZ2A 2EFCA 4J56E 3FEUA 2V41A 5A4UA 1DE1A 1K0NA 5F05A 4XS6A 1M0UA 1XIYA 1DSBA 1QXHA 2LJRA 2C3TA 4IHUA 2GQLA 1GRXA 1AAZA 4GSSA 3ZITA 1ST9A 2R6KA 4K8MA 3VLNA 4USSA 3H79A 1E2YA 1NHYA 3Q18A 2DIZA 3EINA 4N11A 3J7Yk 1HNBA 1TOFA 1PKZA 2PVOC 3TB2A 1YJ6A 2HSNA 3IAM2 4PQHA 2AHEA 5BMUB 2OE3A 3MAKA 2VM1A 3M1GA 2YJHA 1GSDA 4IVFA 5ECKB 5DALB 1JLWA 4G0KA 4Z2UA 3GV1A 3HVXA 1X5EA 4I6XA 1BG5A 1K0AA 3F4RA 1XOAA 4CY6A 2OBKA 4Q5QA 5C04A 4O5QA 4ZL7A 2L57A 2A4VA 5ECMB 4GSTA 4AGSA 3FRCA 1YEXA 4AF2A 2PN8A 4MPGA 2P5RA 3DYRA 5HFGA 3FZ5A 3EMXA 2YV7A 2H6XA 3G7IA 3IBHA 1MD3A 2C3NA 2Z9SA 1B4QA 2IFQB 3IHQA 4HJ2A 4AKHA 2VCXA 1KTEA 5IO0A 5F8BA 1GSYA 1EWXA 4RQXA 3DIEA 1LJRA 1CQGA 3EE2A 3GL5A 3D4TA 4G9HA 8GSSA 2H75A 3GN3A 5ECHB 1K0CA 3DD3A 4TVEA 1HD2A 3GIXA 4BVYA 4ZILA 2P31A 2N5BA 3F63A 1HNCA 5FHIA 1O85A 4GWRA 3HJMA 4KH7A 2AAWA 2H66A 5IMDA 4N0ZA 3HA9A 1U87A 4XRDA 4Z7XA 2H72A 3EC3A 1O81A 3QCPA 3CQFA 4OWYA 1X9WB 9GSSA 2H0GA 5HR2A 3LYPA 3VI5A 4RI7A 4WR5A 1JFUA 1O73A 3KD0A 2HZEB 5IPGA 2RLIA 1Q98A 1T4YA 4PXOA 1Z6MA 1XW5A 5HR0A 3C73A 5J9CA 2YP6A 3EPTA 4GRFA 4DEJA 2DJJA 3GSSA 1RK4A 2H74A 4MJBA 1GUKA 3C7MA 3H93A 1TU7A 3MYDA 1PX7A 4WXTA 1AUCA 2VAFA 3LEFA 1F3BA 5DJMA 2R4VA 2B7KA 4GCIA 3VWXA 4Z2TA 4ACSA 2JZRA 4OD7A 1Y6EA 4KE3A
chains in the Genus database with same CATH topology
3GUSA 4FYBA 1SYXA 3O6TA 4KSMA 2HRAA 3SBCA 2L6DA 4YQVA 1GLQA 3C1RA 2MYGA 3UVTA 3C71A 4FYUA 3FY7A 1OC8A 3TJJA 1AC1A 4KCEA 1YY7A 1YKAA 3M9JA 2WJUA 3J7Yb 1BG1A 4GQCA 2V6KA 1TXUA 4IJIA 4PQ1A 3RPPA 2L5LA 2X8GA 2XHFA 4NXIA 2B3SA 3CSHA 4TW5A 3DGQA 3RHCA 3U6VA 2A2PA 2BJXA 1Y1UA 5IMFA 3TJFA 6GSWA 2H6ZA 4QL9A 2CX4A 2VUPA 4IW9A 2YZHA 3IK9A 3TOTA 2R0PA 5B8BA 2HXKA 2H1BA 2KLXA 3TRXA 1NW2A 3TJKA 3HHVA 4PUAA 3CBUA 2VL2C 1VF2A 1YF1A 3N5OA 3M9KA 1GL8A 2B5EA 4V2MA 3UAPA 2IMDA 2H1LA 1AIUA 5HFKA 1SKWB 4JBBA 3ZVJA 2IJYA 4EDZA 4K6XA 4MLYA 3TUEA 4TRXA 5D96A 1X9MB 2DIYA 1XWCA 1F6MC 2EFDA 1ACVA 3UBKA 3TDGA 3GMFA 5F0GA 3DXBA 2VM2A 2VIMA 3TGZA 3KXOA 2EFEA 1ZL9A 19GSA 4FQUA 2GVPA 3EURA 2R0GA 2L6CA 2B1LA 4WF5A 4LMWA 1FOHA 2H01A 3GRXA 3FR9A 4ZBAA 5GSSA 1K0DA 3H1NA 4BPYA 5J5NA 2IPAA 3ZL5A 3R2QA 3VK9A 5J4YA 3TKRA 2NPBA 1EOGA 3EVIA 1O8XA 3RHBA 1R5PA 4IELA 2H1GA 1Y25A 3S9FA 2O89A 3UARA 5EY6A 2OE0A 2JACA 2VLVA 5G2ZA 5ECPB 1F2EA 1FW1A 1WIKA 5D9TA 3D22A 3O3TA 3TRQA 4MZCA 5A34B 5EVOA 2CA8A 4DSSA 3U5RE 1VRSD 1FVKA 2E2GA 4BVXB 3TOUA 3PINA 2YWMA 2H6YA 4PTSA 4AI6A 5COHA 1EV9A 22GSA 4GSNA 1OKTA 4HQSA 1YDKA 4AKGA 2GLRA 3LGCA 1G7EA 2AB6A 1Z3EA 2RM5A 5IMZA 3FZ4A 4ILFA 4KGIA 1OKDA 3EU3A 3Q19A 1WP0A 3HXSA 5D8IA 1X9SB 3DWVA 3DVWA 4L8EA 2ES7A 3CXGA 4LA1A 4PURA 3KMNA 1Z9HA 2UV8G 1XZOA 5KN2A 1B4PA 4KW6A 3TCOA 1FVJA 1TRWA 4MF6A 4ECCA 7GSSA 1FB6A 4HOJA 4MCUA 5IMCA 2FA4A 4MF5A 2O7KA 2OT3A 1BF5A 4P3YB 1T3BA 1XOBA 4K5RA 3AY8A 2C0FA 4NHWA 1YVLA 3F9UA 5AGYA 2H73A 2FD3A 2X49A 5J9BA 1PL2A 5G5FA 1GLPA 1K3OA 2HRFA 4MK3A 5JWRB 1B9XC 2VL3A 1FB0A 2HRKB 2RIIA 5GZZB 4DSRA 3FK8A 2RUEA 4DSQA 20GSA 5DCGA 3GX8A 3IXRA 3I9V2 4HJMA 4HUAA 3QDNA 2GSTA 1F9MA 1A2JA 4Q5FA 3PPUA 3F8UA 2CV4A 2HRKA 4K0NA 1WE0A 3D4MA 4ZBBA 1ZCPA 3FR6A 1THOA 3GKKA 4G19A 2FWGA 2YWNA 1ON4A 2N5AA 3RPNA 4IJ3A 1EEMA 3LXZA 2LTKA 1I9DA 1JZWA 2CQ9A 1QK8A 2YOIA 2XBQA 2GDRA 2L59A 2DJ0A 6GSVA 1B9YC 3TRPA 3ZLPA 1M7TA 1OC9A 3QD9A 2WZ9A 1BYEA 4TR1B 4TKYA 3QFBC 4ZXGA 2H76A 1GSFA 5IM9A 4MNNA 1VF4A 5CRWA 2VL9A 3QAWA 1QUWA 1NSWA 4ZB6A 2QA1A 2KHPA 4D73B 1UN2A 3BCIA 2WFCA 1TJDA 4L0UA 4IKHA 2LKUA 3KJYA 2FWFA 3F0IA 4HU7A 1HNAA 2YWIA 5J3RA 1ZYQB 4BL7B 2C0EA 1V98A 4MF7A 2XPEA 3GHAA 1F37A 3OR5A 2FWHA 2ZUPA 3KMOA 2R0CA 2ZNMA 2IL3A 2WDUA 2IIYA 4I97A 2BMXA 2HFDA 1G0TA 4G01A 1YF0A 5IPHA 3EU4A 4OO4A 1K3YA 4K2XA 1T00A 1XW9A 1V40A 12GSA 1LU4A 3D21A 4JZQA 2CT6A 2GSSA 2CVBA 2F8AA 2C4JA 2C8UA 6GSTA 2DSAA 3F6DA 3R3EA 5AIXA 3EMPA 1FOVA 5J41A 1SVMA 2D2ZA 4LMVA 3ERGA 4MPFA 2GZZA 1R26A 3G7JA 1O7UA 3HVVA 5BMUA 2GZPA 2VOCA 4EUYA 1EEJA 4QQ7A 3ME8A 4MDCA 1ERWA 5DALA 2H1DA 4XHMA 1UVZA 4H86A 4KAEA 2K9FA 4I5QA 2F51A 2GGTA 2VCWA 3US3A 5B7CA 2X8CA 5DQSA 3H8QA 1YZXA 3TU3B 1U6TA 1VF1A 2CAQA 1RQMA 4E68A 4GLTA 4E8HA 4XIHA 5A5HB 3D5JA 2JADA 4EKZA 2NTOA 4ZB7A 5B6MA 3LXTA 1DE2A 1OE7A 2FLSA 2H0IA 3FYGA 2PU9C 3HDCA 4YQMA 2ON7A 1TK0B 3CMIA 1IYIA 2IFQA 3KTBA 2V32A 4EF0A 3M0FA 2PERA 1FG4A 1WPIA 1SK1A 2I4AA 5ECSA 3NOFA 4ZL8A 5FWGA 1V2AA 1XBSA 2CAIA 5J40A 1S3DA 2IMKA 4ZL9A 4FO5A 4X4JA 4ML1A 3BD2A 1Q4JA 2RM6A 3BCKA 1TP9A 3BBYA 3I69A 1MDIA 2LJAA 4TR0A 4NAXA 2MBTA 1N2AA 2MBSA 1TK8B 1GSUA 1ERUA 2A2RA 2B7JA 5ELAA 5IMVA 1PMTA 2K8VA 3A2XA 4V2NA 4IQAA 4KF9A 2YZUA 4ZBDA 1AQXA 3G7YA 2QSIA 3ZREA 5KN0A 4JE1A 2IWTA 4PNGA 3ZIVA 2HZEA 1WMJA 2X64A 3F4TA 2KUCA 3MWHA 2LNSA 3KP8A 1THXA 3EYTA 5D9WA 2LRNA 4V2LA 1C72A 2B1KA 1XWBA 1MEKA 2ON5A 2C80A 3IK7A 2R3XA 2FUG2 3GTUB 5A1NB 1R7HA 4GXZA 3KGKA 4IP1A 1SJIA 1AW9A 5AISA 3IA1A 2TRXA 3I6AA 4NV5A 1MDJA 5LD0A 1A2LA 1XWGA 2XPDA 2C0GA 3TKSA 5KEJA 2VL2A 10GSA 4NPBA 3G9BA 11GSA 1A2MA 4OMVA 5DJLA 2N5FA 1ZOFA 2P0GA 1WRYA 3GH9A 3F3RA 3FHKA 5ID2B 1RW1A 5CRDA 3ERWA 4MZBA 3QR6A 5D9XA 2AJQB 3MIXA 4V1Ag 2XC2A 1J9BA 3DEXA 4POLA 2ZCTA 4O7HA 3LW9A 2I3YA 2YWOA 4IBPA 3RAZA 4AJ6A 3N9JA 3APOA 3GKMA 3ZRDA 1U88A 5CNWA 4O32A 4OCFA 3QOUA 3VWVA 6GSYA 3HMJG 2HNLA 2A4HA 1SK2A 1XVQA 5ABRA 4XS1A 3L4NA 1M9BA 4KDUA 1M9AA 3LWAA 1AXDA 2JSYA 1ZMAA 3IOSA 4K7NA 3UJ1A 2DLXA 4KX4A 3O76A 4RQRA 3UL3A 5G1KA 2EIOA 2ALBA 3IV4A 2JU5A 3ZFBA 2PUKC 4KDYA 2K6VA 2G0FA 3Q74A 4A5PA 1GP1A 5IOWA 3CRUA 5CRGA 3M8NA 3CRTA 4JR4A 1Z5YE 3JCML 2E2MA 4RI6A 2M46A 4AKXB 2PPTA 2PBJA 5IOXA 5KN1A 3TKSE 4ECIA 1TI1A 4N0VA 4IS0A 3QMXA 1T4ZA 1OYJA 3MSZA 3P2AA 1ILOA 2OE1A 4K5SA 2H71A 2VD1A 3GFKA 1GTUA 4F0BA 4K7IA 3GNJA 1F3AA 1OC3A 1QGVA 2LRTA 1ZZYA 3WT2A 5IO2A 5A34A 2X8HA 3FR3A 2QA2A 4XS4B 4XRAA 5H5SA 1K0BA 4BVXA 3D0ZA 2MZCA 4F0CA 5INYA 3APQA 5G30A 1BJXA 4HI7A 3GA4A 4N30A 4PNFA 5HR3A 5H5RA 4I2UA 4G0IA 3W8JA 2YCDA 5D73A 2J9HA 4MABA 1PL1A 2V1MA 2WB9A 2QC7A 4GF0A 5LNKe 1O6JA 1DUGA 4BWQA 4Z2RA 2HI7A 3C1SA 3P8WA 3ZYWA 1PGTA 4TN8A 2FGXA 5D93A 3CTGA 4G2EA 3HKRA 4RUVA 17GSA 2LQQA 2RUFA 16GSA 1N25A 3LSZA 2K18A 3TJGA 1UA5A 2AUVA 2HSMB 1GNEA 2CVDA 2O5VA 4PX1A 1QFNA 1JZOA 3P90A 3IPZA 5B8AA 1TKDB 1W89A 4BWSA 4HQZA 2NDOA 4MH3A 1CQHA 4OFMA 1SVOA 5E59A 5IIZA 2YPMA 5G1LA 5ELGA 3IR4A 4L0WA 3KM6A 2O87A 3WD6A 5DVBA 1EGOA 1SJ6A 2B5XA 2EFHA 3L78A 3VPQA 1N8JA 4JR6A 4MMMA 2YN1A 1W4VA 3K8NA 1X5DA 2C0DA 2OA7A 1NM3A 4EXJA 2OJLA 3GSTA 4TR4A 4OCEA 3HVSA 3WGXA 3E0UA 1JZDA 3DRNA 4JU5A 4W66A 1U3AA 3DKSA 4I2TA 5DCHA 5IQYA 5DAKB 5ENUA 1Z6NA 5GAND 1G6YA 3IDVA 2CZ2A 4G10A 4HS1A 5CO3A 4EO3A 1H4OA 2VKZG 2H70A 3APSA 2G2QA 2GQKA 1V9WA 2DJ3A 2DMMA 2AYTA 4PQIA 3MNGA 2PMTA 2EIRA 1DBYA 2HSYA 4EIPA 4K2DA 3IRAA 4TR1A 3ZMKA 3WGDA 4K0GA 4Q5NA 2O85A 4NMUA 4NV2A 2B6MA 2H8LA 1WWJA 2PWJA 3H4KA 3IC8A 4ULXA 4G0LA 3L0HA 1SJZA 2HZFA 4KSOA 5GSTA 1S3CA 1SL0B 2VCZA 2HSNB 1PN0A 3WT1A 5ECNB 4D73A 5FT3A 3HYPA 4IN0A 5JCUA 2KOKA 1K3LA 3KCMA 1K0OA 5J4VA 5ECQB 3GKXA 3ERFA 4BL7A 2HRNA 3M3MA 2JSZA 2M80A 4OO5A 1GNWA 2C1YA 4I8BA 1V58A 1J08A 3UVHA 4N3ZA 3F6FA 4F9ZA 1U3IA 2IN3A 2VCQA 1R5AA 2WS2A 3NZNA 4X1UA 2WGRA 1VF3A 3ZVJD 1V57A 1X5CA 2XBIA 4ID0A 3UBLA 4CW9A 1M2DA 4MA9A 3IAS2 1TXXA 1GUMA 4CHSA 3KZQA 2DKIA 5E4WA 2OACA 1GUHA 2QGVA 4JEDA 1MTCA 4O5RA 1GULA 1H75A 3CTFA 1GTIA 2HYXA 2MMAA 1ZYEA 5HQPA 3KTLA 2J23A 4CDOA 1A0FA 4FIWA 3HZ8A 2F9SA 3FW2A 4LLRA 2GTUA 2H30A 4F82A 2VLUA 1JHBA 4FYCA 4BVYB 3GH6A 4YQUA 2IMFA 5A4WA 4AJ8A 1TW9A 1GSQA 2YANA 2JZTA 2NBSA 3QFAC 2EIQA 4TXOB 4GTUA 3A5WA 2TRCP 5A5HA 3FKFA 5DDLA 5KOWA 3A3TA 3L9VA 4YAVA 2FNOA 5CREA 1FAAA 1XFLA 5G5EA 1A0RP 5D9VA 1A8YA 4WF4A 1XWKA 3VWUA 1XCCA 1TRSA 2GQMA 3BOAA 2HT9A 4TXOA 4MJAA 4IP6A 1M99A 4EDYA 3HD5A 1BAYA 3VPTA 2DBCA 3KEBA 2L5OA 2I9HA 3VURA 2LQOA 2B5YA 3IE3A 1JZRA 4K9ZA 4AKIA 4X43A 1KBNA 3GL3A 4YH2A 4WKWA 4N10A 1YQ1A 3UIWA 1OE8A 3TKPA 2YV9A 1IYHA 1O8WA 3QPMA 4E8EA 5EPFA 4POBA 3A2WA 1PN9A 3ISOA 4O92A 1A23A 4TR3A 2CX3A 1SL1B 2WCIA 1EZKA 3WYWA 2MMOA 4X0XA 2A2SA 1KNGA 2GSRA 4KUNA 4EL1A 2MMNA 5ECRB 1QQ2A 1G6WA 2I81A 1XXUA 1HYUA 2P5QA 1TK5B 1FO5A 4L5LA 1XWAA 2QKEA 1BQ7A 1NHOA 1K0MA 4ZB9A 1TRVA 3F4SA 3L9SA 4J57E 3HY2A 5JCWA 2GT6A 1PD21 3C8EA 1PRXA 4LL1B 4GDFA 3LG6A 3UMAA 4MP4A 4DVCA 4WETA 2GSQA 4HDEA 2DJ2A 5LCZA 5ECIB 5JWQB 2X99A 3GTUA 5A4VA 1EOHA 5A1NA 2HE3A 2H1AA 3A2VA 3ZFLA 4Q5RA 2IMIA 2HLSA 3HJPA 1PQNA 2VD0A 2OBIA 1EV4A 5JWOB 2PGTA 4CY8A 4MJEA 1SL2B 3ME7A 4EIQA 2NVLA 4ICYA 1B48A 3CSJA 4YKFA 5IMAA 3D6IA 2DC5A 1OVNA 4F03A 2H19A 5C00A 5KOXA 1BEDA 2FA8A 4BA7A 3L9UA 1EP8A 1USBA 3SWLA 1SENA 4WEYA 3TKSC 3RDWA 6GSSA 2F3MA 1MD4A 3LJRA 5B6NA 5AN1A 3HCZA 2IMEA 3MDKA 4TOPA 2MMZA 3PGTA 5ID2A 3LQ7A 3ED3A 3HZ4A 3GYKA 2WULA 1PX6A 1SD9A 3DMLA 3QAVA 4EE0A 3FZ9A 3WGEA 1TU8A 2FY6A 3ZIJA 2KP1A 4QL7A 3KIJA 2LNTA 3I43A 1WJKA 3DVXA 4HZ4A 1M2AA 4KA0A 3TJBA 1T8EB 5EL8A 2UZ8A 3KH7A 5L71A 1GSEA 2KP2A 5H5QA 1Z7RA 4OFNA 1HQOA 1VGLA 3BJ5A 4KB3A 4IQ1A 1A8LA 1PSQA 1TRUA 2AV4A 1R4WA 4L5OA 4ZB8A 4DSSB 4PGTA 1A24A 3VI7A 1BX9A 6GSXA 2GS3A 2LSTA 2L4CA 6GSUA 1URMA 5JCGA 3UOMA 3QAGA 1LBKA 1YEPA 4XTSA 4ML6A 2WRTA 3ZMLA 1OAZA 3VFIA 1JLVA 4WR4A 1SVLA 2EC4A 1ZYPA 1TDIA 4YAPA 2LRCA 3CYNA 1B8XA 5G31A 1ERTA 2C3QA 4QMKA 2DKHA 1SKRB 4KNDA 2V2GA 3ZZXA 4HEA2 5ECOB 4ECBA 2OADA 4ZIJA 4TXVA 5CAXA 3LFLA 2GZYA 5CYYA 3KH9A 3P7XA 5DBQA 1GH2A 5HFIA 4OFTA 2VLTA 2JZSA 1ERVA 4WBRD 14GSA 1YKCA 3LYKA 4NWYA 2HQTA 3PH9A 1UC7A 2VCTA 4F2IA 3NIVA 2PVQA 3F3QA 2FWEA 5A5KA 1GSSA 3FMWA 4XS4A 1Z7PA 5GAPD 1XW6A 1SK0A 2V6OA 2H0HA 1QMVA 2FCHA 4JRRA 5BRTA 3E9JB 2LUSA 3CSIA 3GURA 1E6BA 1EGRA 1T1VA 4MJCA 4ISDA 2YJ7A 5CP1A 1G7OA 3VWWA 3IC4A 4V1Ap 5HR1A 18GSA 3FZAA 3A5IA 2E7PA 1GWCA 2L4QA 5CRHA 1TI3A 4AJ7A 2BTOT 4ECJA 2DJKA 3EWLA 1PKWA 2CZ3A 4MH2A 1SYRA 4KCAA 1WOUA 2CVKA 5AIVA 2R37A 3GX0A 1KEBA 2GT5A 1FHEA 3GKNA 5F06A 5J47A 4LL4B 3ZTLA 2YNXA 2VO4A 4PUFC 2E0QA 2DJ1A 4EC0A 1XVWA 3IHGA 4K1FA 2DMLA 3UEMA 1M2BA 2R2JA 1AQVA 2REMA 4FH8A 2HSMA 2M72A 1ML6A 3LORA 1SU9A 3Q6OA 1XPVA 1ZYNA 3CWGA 3KP9A 3V1WA 1S3AA 1X0RA 4HU9A 4POKA 4WBJA 1ABAA 4EVMA 1SKSB 5DQYA 5ECLB 1TTZA 2OKAA 5J4UA 2VCVA 4YKGA 4XCSA 4K7OA 2LV3A 1EP7A 1MDKA 1PA3A 1OC9B 2K8SA 3TKQA 1J0FA 2R5GA 3HJOA 4GQFA 2X4AA 2JL4A 2HSHA 1I5GA 2I1UA 4O5UA 1GTAA 3W8SA 2F8FA 1ZGNA 1SD8A 4J2FA 2TIRA 2FHEA 3PR8A 1GTBA 4MZWA 2LJKA 3E3EA 2O8VB 1T7PB 5F07A 4NHZA 3W6GA 5DAKA 5KN3A 4KDXA 2LEGA 4POMA 2LS5A 1AQWA 4IGJA 3RBTA 13GSA 4HZ2A 2EFCA 4J56E 3FEUA 2V41A 5A4UA 1DE1A 1K0NA 5F05A 4XS6A 1M0UA 1XIYA 1DSBA 1QXHA 2LJRA 2C3TA 4IHUA 2GQLA 1GRXA 1AAZA 4GSSA 3ZITA 1ST9A 2R6KA 4K8MA 3VLNA 4USSA 3H79A 1E2YA 1NHYA 3Q18A 2DIZA 3EINA 4N11A 3J7Yk 1HNBA 1TOFA 1PKZA 2PVOC 3TB2A 1YJ6A 2HSNA 3IAM2 4PQHA 2AHEA 5BMUB 2OE3A 3MAKA 2VM1A 3M1GA 2YJHA 1GSDA 4IVFA 5ECKB 5DALB 1JLWA 4G0KA 4Z2UA 3GV1A 3HVXA 1X5EA 4I6XA 1BG5A 1K0AA 3F4RA 1XOAA 4CY6A 2OBKA 4Q5QA 5C04A 4O5QA 4ZL7A 2L57A 2A4VA 5ECMB 4GSTA 4AGSA 3FRCA 1YEXA 4AF2A 2PN8A 4MPGA 2P5RA 3DYRA 5HFGA 3FZ5A 3EMXA 2YV7A 2H6XA 3G7IA 3IBHA 1MD3A 2C3NA 2Z9SA 1B4QA 2IFQB 3IHQA 4HJ2A 4AKHA 2VCXA 1KTEA 5IO0A 5F8BA 1GSYA 1EWXA 4RQXA 3DIEA 1LJRA 1CQGA 3EE2A 3GL5A 3D4TA 4G9HA 8GSSA 2H75A 3GN3A 5ECHB 1K0CA 3DD3A 4TVEA 1HD2A 3GIXA 4BVYA 4ZILA 2P31A 2N5BA 3F63A 1HNCA 5FHIA 1O85A 4GWRA 3HJMA 4KH7A 2AAWA 2H66A 5IMDA 4N0ZA 3HA9A 1U87A 4XRDA 4Z7XA 2H72A 3EC3A 1O81A 3QCPA 4OWYA 1X9WB 9GSSA 2H0GA 5HR2A 3LYPA 3VI5A 4RI7A 4WR5A 1JFUA 1O73A 3KD0A 2HZEB 5IPGA 2RLIA 1Q98A 1T4YA 4PXOA 1Z6MA 1XW5A 5HR0A 3C73A 5J9CA 2YP6A 3EPTA 4GRFA 4DEJA 2DJJA 3GSSA 1RK4A 2H74A 4MJBA 1GUKA 3C7MA 3H93A 1TU7A 3MYDA 1PX7A 4WXTA 1AUCA 2VAFA 3LEFA 1F3BA 5DJMA 2R4VA 2B7KA 4GCIA 3VWXA 4Z2TA 4ACSA 2JZRA 4OD7A 1Y6EA 4KE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GUS A;  4FYB A;  1SYX A;  3O6T A;  4KSM A;  2HRA A;  3SBC A;  2L6D A;  4YQV A;  1GLQ A;  3C1R A;  2MYG A;  3UVT A;  3C71 A;  4FYU A;  3FY7 A;  1OC8 A;  3TJJ A;  1AC1 A;  4KCE A;  1YY7 A;  1YKA A;  3M9J A;  2WJU A;  3J7Y b;  4GQC A;  2V6K A;  4IJI A;  4PQ1 A;  3RPP A;  2L5L A;  2X8G A;  2XHF A;  4NXI A;  2B3S A;  3CSH A;  4TW5 A;  3DGQ A;  3RHC A;  3U6V A;  2BJX A;  5IMF A;  3TJF A;  6GSW A;  2H6Z A;  4QL9 A;  2CX4 A;  2VUP A;  4IW9 A;  2YZH A;  3IK9 A;  3TOT A;  5B8B A;  2HXK A;  2H1B A;  2KLX A;  3TRX A;  1NW2 A;  3TJK A;  3HHV A;  4PUA A;  3CBU A;  2VL2 C;  1VF2 A;  1YF1 A;  3N5O A;  3M9K A;  1GL8 A;  2B5E A;  4V2M A;  3UAP A;  2IMD A;  1AIU A;  5HFK A;  1SKW B;  4JBB A;  3ZVJ A;  2IJY A;  4EDZ A;  4K6X A;  4MLY A;  3TUE A;  4TRX A;  5D96 A;  1X9M B;  2DIY A;  1XWC A;  1F6M C;  1ACV A;  3UBK A;  3TDG A;  3GMF A;  5F0G A;  3DXB A;  2VM2 A;  2VIM A;  3TGZ A;  3KXO A;  1ZL9 A;  19GS A;  4FQU A;  2GVP A;  3EUR A;  2L6C A;  2B1L A;  4WF5 A;  4LMW A;  2H01 A;  3GRX A;  3FR9 A;  4ZBA A;  5GSS A;  1K0D A;  3H1N A;  4BPY A;  5J5N A;  2IPA A;  3ZL5 A;  3R2Q A;  3VK9 A;  3TKR A;  2NPB A;  1EOG A;  3EVI A;  1O8X A;  3RHB A;  1R5P A;  4IEL A;  2H1G A;  1Y25 A;  3S9F A;  2O89 A;  3UAR A;  5EY6 A;  2OE0 A;  2JAC A;  2VLV A;  5G2Z A;  5ECP B;  1F2E A;  1FW1 A;  1WIK A;  5D9T A;  3D22 A;  3O3T A;  3TRQ A;  4MZC A;  5EVO A;  2CA8 A;  4DSS A;  3U5R E;  1VRS D;  1FVK A;  2E2G A;  4BVX B;  3TOU A;  3PIN A;  2YWM A;  2H6Y A;  4PTS A;  5COH A;  1EV9 A;  22GS A;  4GSN A;  1OKT A;  4HQS A;  1YDK A;  2GLR A;  3LGC A;  1G7E A;  2AB6 A;  1Z3E A;  2RM5 A;  5IMZ A;  3FZ4 A;  4ILF A;  4KGI A;  1OKD A;  3EU3 A;  3Q19 A;  1WP0 A;  3HXS A;  5D8I A;  1X9S B;  3DWV A;  3DVW A;  4L8E A;  2ES7 A;  3CXG A;  4LA1 A;  4PUR A;  3KMN A;  1Z9H A;  1XZO A;  5KN2 A;  1B4P A;  4KW6 A;  3TCO A;  1FVJ A;  1TRW A;  4MF6 A;  4ECC A;  7GSS A;  1FB6 A;  4HOJ A;  4MCU A;  5IMC A;  2FA4 A;  4MF5 A;  2O7K A;  4P3Y B;  1T3B A;  1XOB A;  3AY8 A;  2C0F A;  4NHW A;  3F9U A;  5AGY A;  2H73 A;  2FD3 A;  5J9B A;  1PL2 A;  5G5F A;  1GLP A;  1K3O A;  2HRF A;  4MK3 A;  5JWR B;  1B9X C;  2VL3 A;  1FB0 A;  2HRK B;  2RII A;  5GZZ B;  4DSR A;  3FK8 A;  2RUE A;  4DSQ A;  20GS A;  5DCG A;  3GX8 A;  3IXR A;  3I9V 2;  4HJM A;  4HUA A;  3QDN A;  2GST A;  1F9M A;  1A2J A;  4Q5F A;  3PPU A;  3F8U A;  2CV4 A;  2HRK A;  4K0N A;  1WE0 A;  3D4M A;  4ZBB A;  1ZCP A;  3FR6 A;  1THO A;  3GKK A;  4G19 A;  2FWG A;  2YWN A;  1ON4 A;  2N5A A;  3RPN A;  4IJ3 A;  1EEM A;  3LXZ A;  2LTK A;  1I9D A;  1JZW A;  2CQ9 A;  1QK8 A;  2XBQ A;  2YOI A;  2GDR A;  2L59 A;  2DJ0 A;  6GSV A;  1B9Y C;  3TRP A;  3ZLP A;  1M7T A;  1OC9 A;  3QD9 A;  2WZ9 A;  1BYE A;  4TR1 B;  4TKY A;  3QFB C;  4ZXG A;  2H76 A;  1GSF A;  5IM9 A;  1VF4 A;  5CRW A;  2VL9 A;  3QAW A;  1QUW A;  1NSW A;  4ZB6 A;  2KHP A;  4D73 B;  1UN2 A;  3BCI A;  2WFC A;  1TJD A;  4L0U A;  4IKH A;  2LKU A;  3KJY A;  2FWF A;  3F0I A;  4HU7 A;  1HNA A;  2YWI A;  5J3R A;  1ZYQ B;  4BL7 B;  2C0E A;  1V98 A;  4MF7 A;  2XPE A;  3GHA A;  1F37 A;  3OR5 A;  2FWH A;  2ZUP A;  3KMO A;  2ZNM A;  2IL3 A;  2WDU A;  2IIY A;  4I97 A;  2BMX A;  2HFD A;  1G0T A;  1YF0 A;  5IPH A;  3EU4 A;  4OO4 A;  1K3Y A;  1T00 A;  1XW9 A;  1V40 A;  12GS A;  1LU4 A;  3D21 A;  4JZQ A;  2CT6 A;  2GSS A;  2CVB A;  2F8A A;  2C4J A;  2C8U A;  6GST A;  2DSA A;  3F6D A;  3R3E A;  5AIX A;  3EMP A;  1FOV A;  5J41 A;  4LMV A;  2D2Z A;  3ERG A;  4MPF A;  2GZZ A;  1R26 A;  3G7J A;  1O7U A;  3HVV A;  5BMU A;  2GZP A;  2VOC A;  4EUY A;  1EEJ A;  4QQ7 A;  3ME8 A;  4MDC A;  1ERW A;  5DAL A;  2H1D A;  4XHM A;  1UVZ A;  4H86 A;  4KAE A;  2K9F A;  4I5Q A;  2F51 A;  2GGT A;  2VCW A;  3US3 A;  5B7C A;  2X8C A;  5DQS A;  3H8Q A;  1YZX A;  1U6T A;  1VF1 A;  2CAQ A;  1RQM A;  4GLT A;  4E8H A;  4XIH A;  3D5J A;  2JAD A;  4EKZ A;  2NTO A;  5B6M A;  3LXT A;  1DE2 A;  1OE7 A;  2FLS A;  2H0I A;  3FYG A;  2PU9 C;  3HDC A;  4YQM A;  2ON7 A;  1TK0 B;  3CMI A;  1IYI A;  2IFQ A;  3KTB A;  2V32 A;  4EF0 A;  3M0F A;  2PER A;  1FG4 A;  1WPI A;  1SK1 A;  2I4A A;  5ECS A;  3NOF A;  4ZL8 A;  5FWG A;  1V2A A;  1XBS A;  2CAI A;  1S3D A;  2IMK A;  4ZL9 A;  4FO5 A;  4ML1 A;  3BD2 A;  1Q4J A;  2RM6 A;  3BCK A;  1TP9 A;  3BBY A;  3I69 A;  1MDI A;  2LJA A;  4TR0 A;  4NAX A;  2MBT A;  1N2A A;  2MBS A;  1TK8 B;  1GSU A;  1ERU A;  2A2R A;  2B7J A;  5ELA A;  5IMV A;  1PMT A;  2K8V A;  3A2X A;  4V2N A;  4IQA A;  4KF9 A;  2YZU A;  4ZBD A;  1AQX A;  3G7Y A;  2QSI A;  3ZRE A;  5KN0 A;  4JE1 A;  2IWT A;  4PNG A;  3ZIV A;  2HZE A;  1WMJ A;  2X64 A;  3F4T A;  2KUC A;  3MWH A;  2LNS A;  3KP8 A;  1THX A;  3EYT A;  5D9W A;  2LRN A;  4V2L A;  1C72 A;  2B1K A;  1XWB A;  1MEK A;  2ON5 A;  2C80 A;  3IK7 A;  2R3X A;  2FUG 2;  3GTU B;  1R7H A;  4GXZ A;  3KGK A;  4IP1 A;  1SJI A;  1AW9 A;  5AIS A;  3IA1 A;  2TRX A;  3I6A A;  4NV5 A;  1MDJ A;  5LD0 A;  1A2L A;  1XWG A;  2XPD A;  2C0G A;  3TKS A;  5KEJ A;  2VL2 A;  10GS A;  4NPB A;  3G9B A;  11GS A;  1A2M A;  4OMV A;  5DJL A;  2N5F A;  1ZOF A;  2P0G A;  1WRY A;  3GH9 A;  3F3R A;  3FHK A;  5ID2 B;  1RW1 A;  5CRD A;  3ERW A;  4MZB A;  3QR6 A;  5D9X A;  2AJQ B;  4V1A g;  2XC2 A;  1J9B A;  3DEX A;  4POL A;  2ZCT A;  4O7H A;  2I3Y A;  2YWO A;  4IBP A;  3RAZ A;  4AJ6 A;  3N9J A;  3APO A;  3GKM A;  3ZRD A;  1U88 A;  5CNW A;  4O32 A;  4OCF A;  3QOU A;  3VWV A;  6GSY A;  2HNL A;  1SK2 A;  1XVQ A;  5ABR A;  4XS1 A;  3L4N A;  1M9B A;  4KDU A;  1M9A A;  3LWA A;  1AXD A;  2JSY A;  1ZMA A;  3IOS A;  4K7N A;  3UJ1 A;  2DLX A;  4KX4 A;  3O76 A;  4RQR A;  3UL3 A;  5G1K A;  2EIO A;  2ALB A;  3IV4 A;  2JU5 A;  3ZFB A;  2PUK C;  4KDY A;  2K6V A;  2G0F A;  3Q74 A;  1GP1 A;  5IOW A;  3CRU A;  5CRG A;  3M8N A;  3CRT A;  4JR4 A;  1Z5Y E;  3JCM L;  2E2M A;  4RI6 A;  2M46 A;  2PPT A;  2PBJ A;  5IOX A;  5KN1 A;  3TKS E;  4ECI A;  1TI1 A;  4N0V A;  4IS0 A;  3QMX A;  1T4Z A;  1OYJ A;  3MSZ A;  3P2A A;  1ILO A;  2OE1 A;  2H71 A;  2VD1 A;  3GFK A;  1GTU A;  4F0B A;  4K7I A;  3GNJ A;  1F3A A;  1OC3 A;  1QGV A;  2LRT A;  1ZZY A;  3WT2 A;  5IO2 A;  2X8H A;  3FR3 A;  4XS4 B;  4XRA A;  5H5S A;  1K0B A;  4BVX A;  3D0Z A;  2MZC A;  4F0C A;  5INY A;  3APQ A;  5G30 A;  1BJX A;  4HI7 A;  3GA4 A;  4N30 A;  4PNF A;  5HR3 A;  5H5R A;  4I2U A;  4G0I A;  3W8J A;  2YCD A;  5D73 A;  2J9H A;  4MAB A;  1PL1 A;  2V1M A;  2WB9 A;  2QC7 A;  4GF0 A;  5LNK e;  1O6J A;  1DUG A;  4BWQ A;  2HI7 A;  3C1S A;  3P8W A;  3ZYW A;  1PGT A;  4TN8 A;  2FGX A;  5D93 A;  3CTG A;  4G2E A;  3HKR A;  4RUV A;  17GS A;  2LQQ A;  2RUF A;  16GS A;  3LSZ A;  2K18 A;  3TJG A;  1UA5 A;  2AUV A;  2HSM B;  1GNE A;  2CVD A;  4PX1 A;  1QFN A;  1JZO A;  3P90 A;  3IPZ A;  5B8A A;  1TKD B;  1W89 A;  4BWS A;  4HQZ A;  2NDO A;  4MH3 A;  1CQH A;  4OFM A;  5E59 A;  5IIZ A;  2YPM A;  5G1L A;  5ELG A;  3IR4 A;  4L0W A;  3KM6 A;  2O87 A;  3WD6 A;  5DVB A;  1EGO A;  1SJ6 A;  2B5X A;  3L78 A;  3VPQ A;  1N8J A;  4JR6 A;  4MMM A;  2YN1 A;  1W4V A;  3K8N A;  1X5D A;  2C0D A;  2OA7 A;  1NM3 A;  4EXJ A;  2OJL A;  3GST A;  4TR4 A;  4OCE A;  3HVS A;  3WGX A;  3E0U A;  1JZD A;  3DRN A;  4JU5 A;  1U3A A;  3DKS A;  4I2T A;  5DCH A;  5IQY A;  5DAK B;  5ENU A;  1Z6N A;  5GAN D;  1G6Y A;  3IDV A;  2CZ2 A;  4G10 A;  4HS1 A;  5CO3 A;  4EO3 A;  1H4O A;  2H70 A;  3APS A;  2G2Q A;  2GQK A;  1V9W A;  2DJ3 A;  2DMM A;  2AYT A;  4PQI A;  3MNG A;  2PMT A;  2EIR A;  1DBY A;  2HSY A;  4K2D A;  3IRA A;  4TR1 A;  3ZMK A;  3WGD A;  4K0G A;  4Q5N A;  2O85 A;  4NMU A;  4NV2 A;  2B6M A;  2H8L A;  1WWJ A;  2PWJ A;  3H4K A;  3IC8 A;  4ULX A;  4G0L A;  3L0H A;  1SJZ A;  2HZF A;  4KSO A;  5GST A;  1S3C A;  1SL0 B;  2VCZ A;  2HSN B;  3WT1 A;  5ECN B;  4D73 A;  5FT3 A;  3HYP A;  4IN0 A;  5JCU A;  2KOK A;  1K3L A;  3KCM A;  1K0O A;  5ECQ B;  3GKX A;  3ERF A;  4BL7 A;  2HRN A;  3M3M A;  2JSZ A;  2M80 A;  4OO5 A;  1GNW A;  2C1Y A;  4I8B A;  1V58 A;  1J08 A;  3UVH A;  3F6F A;  4F9Z A;  1U3I A;  2IN3 A;  2VCQ A;  1R5A A;  2WS2 A;  3NZN A;  4X1U A;  2WGR A;  1VF3 A;  3ZVJ D;  1V57 A;  1X5C A;  2XBI A;  4ID0 A;  3UBL A;  4CW9 A;  1M2D A;  4MA9 A;  3IAS 2;  1TXX A;  1GUM A;  4CHS A;  3KZQ A;  5E4W A;  2OAC A;  1GUH A;  2QGV A;  4JED A;  1MTC A;  4O5R A;  1GUL A;  1H75 A;  3CTF A;  1GTI A;  2HYX A;  2MMA A;  1ZYE A;  5HQP A;  3KTL A;  2J23 A;  4CDO A;  1A0F A;  4FIW A;  3HZ8 A;  2F9S A;  3FW2 A;  4LLR A;  2GTU A;  2H30 A;  4F82 A;  2VLU A;  1JHB A;  4FYC A;  4BVY B;  3GH6 A;  4YQU A;  2IMF A;  5A4W A;  4AJ8 A;  1TW9 A;  1GSQ A;  2YAN A;  2JZT A;  2NBS A;  3QFA C;  2EIQ A;  4TXO B;  4GTU A;  3A5W A;  2TRC P;  3FKF A;  5DDL A;  3A3T A;  3L9V A;  4YAV A;  2FNO A;  5CRE A;  1FAA A;  1XFL A;  5G5E A;  1A0R P;  5D9V A;  1A8Y A;  4WF4 A;  1XWK A;  3VWU A;  1XCC A;  1TRS A;  2GQM A;  3BOA A;  2HT9 A;  4TXO A;  4MJA A;  4IP6 A;  1M99 A;  4EDY A;  3HD5 A;  1BAY A;  3VPT A;  2DBC A;  3KEB A;  2L5O A;  2I9H A;  3VUR A;  2LQO A;  2B5Y A;  3IE3 A;  1JZR A;  4K9Z A;  4X43 A;  1KBN A;  3GL3 A;  4YH2 A;  4WKW A;  4N10 A;  1YQ1 A;  3UIW A;  1OE8 A;  3TKP A;  2YV9 A;  1IYH A;  1O8W A;  3QPM A;  4E8E A;  5EPF A;  4POB A;  3A2W A;  1PN9 A;  3ISO A;  4O92 A;  1A23 A;  4TR3 A;  2CX3 A;  1SL1 B;  2WCI A;  1EZK A;  3WYW A;  2MMO A;  4X0X A;  2A2S A;  1KNG A;  2GSR A;  4KUN A;  4EL1 A;  2MMN A;  5ECR B;  1QQ2 A;  1G6W A;  2I81 A;  1XXU A;  1HYU A;  2P5Q A;  1TK5 B;  1FO5 A;  4L5L A;  1XWA A;  2QKE A;  1BQ7 A;  1NHO A;  1K0M A;  4ZB9 A;  1TRV A;  3F4S A;  3L9S A;  4J57 E;  3HY2 A;  5JCW A;  2GT6 A;  1PD2 1;  3C8E A;  1PRX A;  4LL1 B;  3LG6 A;  3UMA A;  4MP4 A;  4DVC A;  4WET A;  2GSQ A;  4HDE A;  2DJ2 A;  5LCZ A;  5ECI B;  5JWQ B;  2X99 A;  3GTU A;  5A4V A;  1EOH A;  2HE3 A;  2H1A A;  3A2V A;  3ZFL A;  4Q5R A;  2IMI A;  2HLS A;  3HJP A;  1PQN A;  2VD0 A;  2OBI A;  1EV4 A;  5JWO B;  2PGT A;  4MJE A;  1SL2 B;  3ME7 A;  2NVL A;  1B48 A;  3CSJ A;  5IMA A;  3D6I A;  2DC5 A;  1OVN A;  4F03 A;  2H19 A;  5C00 A;  1BED A;  2FA8 A;  4BA7 A;  3L9U A;  1EP8 A;  1USB A;  3SWL A;  1SEN A;  4WEY A;  3TKS C;  3RDW A;  6GSS A;  2F3M A;  1MD4 A;  3LJR A;  5B6N A;  5AN1 A;  3HCZ A;  2IME A;  3MDK A;  4TOP A;  2MMZ A;  3PGT A;  5ID2 A;  3LQ7 A;  3ED3 A;  3HZ4 A;  3GYK A;  2WUL A;  1PX6 A;  1SD9 A;  3DML A;  3QAV A;  4EE0 A;  3FZ9 A;  3WGE A;  1TU8 A;  2FY6 A;  3ZIJ A;  2KP1 A;  4QL7 A;  3KIJ A;  2LNT A;  3I43 A;  1WJK A;  3DVX A;  4HZ4 A;  1M2A A;  4KA0 A;  3TJB A;  1T8E B;  5EL8 A;  2UZ8 A;  3KH7 A;  5L71 A;  1GSE A;  2KP2 A;  5H5Q A;  1Z7R A;  4OFN A;  1HQO A;  1VGL A;  3BJ5 A;  4KB3 A;  4IQ1 A;  1A8L A;  1PSQ A;  1TRU A;  2AV4 A;  1R4W A;  4L5O A;  4ZB8 A;  4DSS B;  4PGT A;  1A24 A;  3VI7 A;  1BX9 A;  6GSX A;  2GS3 A;  2LST A;  2L4C A;  6GSU A;  1URM A;  5JCG A;  3UOM A;  3QAG A;  1LBK A;  1YEP A;  4XTS A;  4ML6 A;  2WRT A;  3ZML A;  1OAZ A;  3VFI A;  1JLV A;  4WR4 A;  2EC4 A;  1TDI A;  4YAP A;  2LRC A;  3CYN A;  1B8X A;  5G31 A;  1ERT A;  2C3Q A;  1SKR B;  4KND A;  2V2G A;  3ZZX A;  4HEA 2;  5ECO B;  4ECB A;  2OAD A;  4ZIJ A;  4TXV A;  5CAX A;  3LFL A;  2GZY A;  5CYY A;  3KH9 A;  3P7X A;  5DBQ A;  1GH2 A;  5HFI A;  4OFT A;  2VLT A;  2JZS A;  1ERV A;  4WBR D;  14GS A;  1YKC A;  3LYK A;  4NWY A;  2HQT A;  3PH9 A;  1UC7 A;  2VCT A;  4F2I A;  3NIV A;  2PVQ A;  3F3Q A;  2FWE A;  5A5K A;  1GSS A;  4XS4 A;  1Z7P A;  5GAP D;  1XW6 A;  1SK0 A;  2V6O A;  2H0H A;  1QMV A;  2FCH A;  4JRR A;  3E9J B;  2LUS A;  3CSI A;  3GUR A;  1E6B A;  1EGR A;  1T1V A;  4MJC A;  4ISD A;  2YJ7 A;  5CP1 A;  1G7O A;  3VWW A;  3IC4 A;  4V1A p;  5HR1 A;  18GS A;  3FZA A;  2E7P A;  1GWC A;  2L4Q A;  5CRH A;  1TI3 A;  4AJ7 A;  2BTO T;  4ECJ A;  2DJK A;  3EWL A;  1PKW A;  2CZ3 A;  4MH2 A;  1SYR A;  4KCA A;  1WOU A;  2CVK A;  5AIV A;  2R37 A;  3GX0 A;  1KEB A;  2GT5 A;  1FHE A;  3GKN A;  5F06 A;  4LL4 B;  3ZTL A;  2YNX A;  2VO4 A;  4PUF C;  2E0Q A;  2DJ1 A;  4EC0 A;  1XVW A;  4K1F A;  2DML A;  3UEM A;  1M2B A;  2R2J A;  1AQV A;  2REM A;  4FH8 A;  2HSM A;  2M72 A;  1ML6 A;  3LOR A;  1SU9 A;  3Q6O A;  1XPV A;  3KP9 A;  3V1W A;  1S3A A;  1X0R A;  4HU9 A;  4POK A;  4WBJ A;  1ABA A;  4EVM A;  1SKS B;  5DQY A;  5ECL B;  1TTZ A;  2OKA A;  5J4U A;  2VCV A;  4XCS A;  4K7O A;  2LV3 A;  1EP7 A;  1MDK A;  1PA3 A;  1OC9 B;  2K8S A;  3TKQ A;  1J0F A;  2R5G A;  3HJO A;  4GQF A;  2JL4 A;  2HSH A;  1I5G A;  2I1U A;  1GTA A;  3W8S A;  2F8F A;  1ZGN A;  1SD8 A;  4J2F A;  2TIR A;  2FHE A;  3PR8 A;  1GTB A;  4MZW A;  2LJK A;  3E3E A;  2O8V B;  1T7P B;  5F07 A;  4NHZ A;  3W6G A;  5DAK A;  5KN3 A;  4KDX A;  2LEG A;  4POM A;  2LS5 A;  1AQW A;  4IGJ A;  3RBT A;  13GS A;  4HZ2 A;  4J56 E;  3FEU A;  2V41 A;  5A4U A;  1DE1 A;  1K0N A;  5F05 A;  4XS6 A;  1M0U A;  1XIY A;  1DSB A;  1QXH A;  2LJR A;  2C3T A;  4IHU A;  2GQL A;  1GRX A;  1AAZ A;  4GSS A;  3ZIT A;  1ST9 A;  2R6K A;  4K8M A;  3VLN A;  4USS A;  3H79 A;  1E2Y A;  1NHY A;  3Q18 A;  2DIZ A;  3EIN A;  4N11 A;  3J7Y k;  1HNB A;  1TOF A;  1PKZ A;  2PVO C;  3TB2 A;  1YJ6 A;  3IAM 2;  4PQH A;  2AHE A;  2OE3 A;  3MAK A;  2VM1 A;  3M1G A;  2YJH A;  1GSD A;  4IVF A;  5ECK B;  5DAL B;  1JLW A;  4G0K A;  3GV1 A;  3HVX A;  1X5E A;  4I6X A;  1BG5 A;  1K0A A;  3F4R A;  1XOA A;  2OBK A;  4Q5Q A;  5C04 A;  4ZL7 A;  2L57 A;  2A4V A;  5ECM B;  4GST A;  4AGS A;  3FRC A;  1YEX A;  4AF2 A;  2PN8 A;  4MPG A;  2P5R A;  3DYR A;  5HFG A;  3FZ5 A;  3EMX A;  2YV7 A;  2H6X A;  3G7I A;  3IBH A;  1MD3 A;  2C3N A;  2Z9S A;  1B4Q A;  2IFQ B;  3IHQ A;  4HJ2 A;  2VCX A;  1KTE A;  5IO0 A;  5F8B A;  1GSY A;  1EWX A;  4RQX A;  3DIE A;  1LJR A;  1CQG A;  3EE2 A;  3GL5 A;  3D4T A;  4G9H A;  8GSS A;  2H75 A;  3GN3 A;  5ECH B;  1K0C A;  3DD3 A;  4TVE A;  1HD2 A;  3GIX A;  4BVY A;  4ZIL A;  2P31 A;  2N5B A;  3F63 A;  1HNC A;  5FHI A;  1O85 A;  4GWR A;  3HJM A;  4KH7 A;  2AAW A;  2H66 A;  5IMD A;  4N0Z A;  3HA9 A;  1U87 A;  4XRD A;  4Z7X A;  2H72 A;  3EC3 A;  1O81 A;  3QCP A;  4OWY A;  1X9W B;  9GSS A;  2H0G A;  5HR2 A;  3LYP A;  3VI5 A;  4RI7 A;  4WR5 A;  1JFU A;  1O73 A;  3KD0 A;  2HZE B;  5IPG A;  2RLI A;  1Q98 A;  1T4Y A;  4PXO A;  1Z6M A;  1XW5 A;  5HR0 A;  3C73 A;  5J9C A;  2YP6 A;  4GRF A;  4DEJ A;  2DJJ A;  3GSS A;  1RK4 A;  2H74 A;  4MJB A;  1GUK A;  3C7M A;  3H93 A;  1TU7 A;  1PX7 A;  4WXT A;  1AUC A;  2VAF A;  3LEF A;  1F3B A;  5DJM A;  2R4V A;  2B7K A;  4GCI A;  3VWX A;  4ACS A;  2JZR A;  4OD7 A;  1Y6E A;  4KE3 A; 
#chains in the Genus database with same CATH topology
 3GUS A;  4FYB A;  1SYX A;  3O6T A;  4KSM A;  2HRA A;  3SBC A;  2L6D A;  4YQV A;  1GLQ A;  3C1R A;  2MYG A;  3UVT A;  3C71 A;  4FYU A;  3FY7 A;  1OC8 A;  3TJJ A;  1AC1 A;  4KCE A;  1YY7 A;  1YKA A;  3M9J A;  2WJU A;  3J7Y b;  1BG1 A;  4GQC A;  2V6K A;  1TXU A;  4IJI A;  4PQ1 A;  3RPP A;  2L5L A;  2X8G A;  2XHF A;  2WW0 A;  4NXI A;  2B3S A;  3CSH A;  4TW5 A;  3DGQ A;  3RGB C;  3RHC A;  3U6V A;  2A2P A;  2BJX A;  1Y1U A;  5IMF A;  3TJF A;  6GSW A;  2H6Z A;  4QL9 A;  2CX4 A;  2VUP A;  4IW9 A;  2YZH A;  3IK9 A;  3TOT A;  2R0P A;  5B8B A;  2HXK A;  2H1B A;  2KLX A;  3TRX A;  1NW2 A;  3TJK A;  3HHV A;  4PUA A;  3CBU A;  2VL2 C;  1VF2 A;  1YF1 A;  3N5O A;  3M9K A;  1GL8 A;  2B5E A;  4V2M A;  3UAP A;  2IMD A;  2H1L A;  1AIU A;  5HFK A;  1SKW B;  4JBB A;  3ZVJ A;  2IJY A;  4EDZ A;  4K6X A;  4MLY A;  3TUE A;  4TRX A;  5D96 A;  1X9M B;  2DIY A;  1XWC A;  1F6M C;  2EFD A;  1ACV A;  3UBK A;  3TDG A;  3GMF A;  5F0G A;  3DXB A;  2VM2 A;  2VIM A;  3TGZ A;  3KXO A;  2EFE A;  1ZL9 A;  19GS A;  4FQU A;  2GVP A;  3EUR A;  2R0G A;  2L6C A;  2B1L A;  4WF5 A;  4LMW A;  1FOH A;  2H01 A;  3GRX A;  3FR9 A;  4ZBA A;  3CHX C;  5GSS A;  1K0D A;  3H1N A;  4BPY A;  5J5N A;  2IPA A;  3ZL5 A;  3R2Q A;  3VK9 A;  5J4Y A;  3TKR A;  2NPB A;  1EOG A;  3EVI A;  1O8X A;  3RHB A;  1R5P A;  4IEL A;  2H1G A;  1Y25 A;  3S9F A;  2O89 A;  3UAR A;  5EY6 A;  2OE0 A;  2JAC A;  2VLV A;  5G2Z A;  5ECP B;  1F2E A;  1FW1 A;  1WIK A;  5D9T A;  3D22 A;  3O3T A;  3TRQ A;  4MZC A;  5A34 B;  5EVO A;  2CA8 A;  4DSS A;  3U5R E;  1VRS D;  1FVK A;  2E2G A;  4BVX B;  3TOU A;  3PIN A;  2YWM A;  2H6Y A;  4PTS A;  4AI6 A;  5COH A;  1EV9 A;  22GS A;  4GSN A;  1OKT A;  4HQS A;  1YDK A;  4AKG A;  2GLR A;  3LGC A;  1G7E A;  2AB6 A;  1Z3E A;  2RM5 A;  5IMZ A;  3FZ4 A;  4ILF A;  4KGI A;  1OKD A;  3EU3 A;  3Q19 A;  1WP0 A;  3HXS A;  5D8I A;  1X9S B;  3DWV A;  3DVW A;  4L8E A;  2ES7 A;  3CXG A;  2WW3 A;  4LA1 A;  4PUR A;  3KMN A;  1Z9H A;  2UV8 G;  1XZO A;  5KN2 A;  1B4P A;  4KW6 A;  3TCO A;  1FVJ A;  1TRW A;  4MF6 A;  4ECC A;  7GSS A;  1FB6 A;  4HOJ A;  4MCU A;  5IMC A;  2FA4 A;  4MF5 A;  2O7K A;  2OT3 A;  1BF5 A;  4P3Y B;  1T3B A;  1XOB A;  4K5R A;  3AY8 A;  2C0F A;  4NHW A;  1YVL A;  3F9U A;  5AGY A;  2H73 A;  2FD3 A;  2X49 A;  5J9B A;  1PL2 A;  5G5F A;  1GLP A;  1K3O A;  2HRF A;  4MK3 A;  5JWR B;  1B9X C;  2VL3 A;  1FB0 A;  2HRK B;  2RII A;  5GZZ B;  4DSR A;  3FK8 A;  2RUE A;  4DSQ A;  20GS A;  5DCG A;  3GX8 A;  3IXR A;  3I9V 2;  4HJM A;  4HUA A;  1XG8 A;  3QDN A;  2GST A;  1F9M A;  1A2J A;  4Q5F A;  3PPU A;  3F8U A;  2CV4 A;  2HRK A;  4K0N A;  1WE0 A;  3D4M A;  4ZBB A;  1ZCP A;  3FR6 A;  1THO A;  3GKK A;  4G19 A;  2FWG A;  2YWN A;  4PI2 C;  1ON4 A;  2N5A A;  3RPN A;  4IJ3 A;  1EEM A;  3LXZ A;  2LTK A;  1I9D A;  1JZW A;  2CQ9 A;  1QK8 A;  2YOI A;  2XBQ A;  2GDR A;  2L59 A;  2DJ0 A;  6GSV A;  1B9Y C;  3TRP A;  3ZLP A;  1M7T A;  1OC9 A;  3QD9 A;  2WZ9 A;  1BYE A;  4TR1 B;  4TKY A;  3QFB C;  4ZXG A;  2H76 A;  1GSF A;  5IM9 A;  1PFO A;  4MNN A;  1VF4 A;  5CRW A;  2WW1 A;  2VL9 A;  3QAW A;  1QUW A;  1NSW A;  4ZB6 A;  2QA1 A;  2KHP A;  4D73 B;  1UN2 A;  3BCI A;  2WFC A;  1TJD A;  4L0U A;  4IKH A;  2LKU A;  3KJY A;  2FWF A;  3F0I A;  4HU7 A;  1HNA A;  2YWI A;  5J3R A;  1ZYQ B;  4BL7 B;  2C0E A;  1V98 A;  4MF7 A;  2XPE A;  3GHA A;  1F37 A;  3OR5 A;  2FWH A;  2ZUP A;  3KMO A;  2R0C A;  2ZNM A;  2IL3 A;  2WDU A;  2IIY A;  4I97 A;  2BMX A;  2HFD A;  1G0T A;  4G01 A;  1YF0 A;  5IPH A;  3EU4 A;  4OO4 A;  4HSC X;  1K3Y A;  4K2X A;  1T00 A;  1XW9 A;  1V40 A;  12GS A;  1LU4 A;  3D21 A;  4JZQ A;  2CT6 A;  2GSS A;  2CVB A;  2F8A A;  2C4J A;  2C8U A;  6GST A;  2DSA A;  3F6D A;  3R3E A;  5AIX A;  3EMP A;  1FOV A;  5J41 A;  1SVM A;  2D2Z A;  4LMV A;  3ERG A;  4MPF A;  2GZZ A;  1R26 A;  3G7J A;  1O7U A;  3HVV A;  5BMU A;  2GZP A;  2VOC A;  4EUY A;  1EEJ A;  4QQ7 A;  3ME8 A;  4MDC A;  1ERW A;  5DAL A;  2H1D A;  4XHM A;  1UVZ A;  4H86 A;  4KAE A;  2K9F A;  4I5Q A;  2F51 A;  2GGT A;  2VCW A;  3US3 A;  5B7C A;  2X8C A;  5DQS A;  3H8Q A;  1YZX A;  3TU3 B;  1U6T A;  1VF1 A;  2CAQ A;  1RQM A;  4E68 A;  4GLT A;  4E8H A;  4XIH A;  5A5H B;  3D5J A;  2JAD A;  4EKZ A;  2NTO A;  4ZB7 A;  5B6M A;  3LXT A;  1DE2 A;  1OE7 A;  2FLS A;  2H0I A;  3FYG A;  2PU9 C;  3HDC A;  4YQM A;  2ON7 A;  2O3E A;  1TK0 B;  3CMI A;  1IYI A;  2IFQ A;  3KTB A;  2V32 A;  4EF0 A;  3M0F A;  2PER A;  1FG4 A;  1WPI A;  1SK1 A;  2I4A A;  5ECS A;  3NOF A;  4ZL8 A;  5FWG A;  1V2A A;  1XBS A;  2CAI A;  5J40 A;  1S3D A;  2IMK A;  4ZL9 A;  4FO5 A;  4X4J A;  4ML1 A;  3BD2 A;  1Q4J A;  2RM6 A;  3BCK A;  1TP9 A;  3BBY A;  3I69 A;  1MDI A;  2LJA A;  4TR0 A;  4NAX A;  2MBT A;  1N2A A;  2MBS A;  1TK8 B;  1GSU A;  1ERU A;  2A2R A;  2B7J A;  5ELA A;  5IMV A;  1PMT A;  2K8V A;  3A2X A;  4V2N A;  4IQA A;  4KF9 A;  2YZU A;  4ZBD A;  1AQX A;  3G7Y A;  2QSI A;  3ZRE A;  5KN0 A;  4JE1 A;  2IWT A;  4PNG A;  3ZIV A;  2HZE A;  1WMJ A;  2X64 A;  3F4T A;  2KUC A;  3MWH A;  2LNS A;  3KP8 A;  1THX A;  3EYT A;  5D9W A;  2LRN A;  4V2L A;  1C72 A;  2B1K A;  1XWB A;  1MEK A;  2ON5 A;  2C80 A;  2WVX B;  3IK7 A;  2R3X A;  2FUG 2;  3GTU B;  5A1N B;  1R7H A;  4BIK A;  4GXZ A;  3KGK A;  4IP1 A;  1SJI A;  1AW9 A;  5AIS A;  3IA1 A;  2TRX A;  3I6A A;  4NV5 A;  1MDJ A;  5LD0 A;  1A2L A;  1XWG A;  2XPD A;  2C0G A;  3TKS A;  5KEJ A;  2VL2 A;  10GS A;  4NPB A;  3G9B A;  11GS A;  1A2M A;  4OMV A;  5DJL A;  2N5F A;  1ZOF A;  2P0G A;  1WRY A;  3GH9 A;  3F3R A;  3FHK A;  5ID2 B;  1RW1 A;  5CRD A;  3ERW A;  4MZB A;  3QR6 A;  5D9X A;  2AJQ B;  3MIX A;  4V1A g;  2XC2 A;  1J9B A;  3DEX A;  4POL A;  2ZCT A;  4O7H A;  3LW9 A;  2I3Y A;  2YWO A;  4PI0 C;  4IBP A;  3RAZ A;  4AJ6 A;  3N9J A;  3APO A;  3GKM A;  3ZRD A;  1U88 A;  5CNW A;  4O32 A;  4OCF A;  3QOU A;  3VWV A;  6GSY A;  3HMJ G;  2HNL A;  2A4H A;  1SK2 A;  1XVQ A;  5ABR A;  4XS1 A;  3L4N A;  1M9B A;  4KDU A;  1M9A A;  3LWA A;  1AXD A;  2JSY A;  1ZMA A;  3IOS A;  4FXY P;  4K7N A;  3UJ1 A;  2DLX A;  4KX4 A;  3O76 A;  4RQR A;  3UL3 A;  5G1K A;  2EIO A;  2ALB A;  3IV4 A;  2JU5 A;  3ZFB A;  2PUK C;  4KDY A;  2K6V A;  2G0F A;  3Q74 A;  4A5P A;  1GP1 A;  5IOW A;  3CRU A;  5CRG A;  3M8N A;  3CRT A;  4JR4 A;  1Z5Y E;  3JCM L;  2E2M A;  4RI6 A;  2M46 A;  4AKX B;  2PPT A;  2PBJ A;  1M3I A;  5IOX A;  5KN1 A;  3TKS E;  4ECI A;  1TI1 A;  4N0V A;  4IS0 A;  3QMX A;  1T4Z A;  1OYJ A;  3MSZ A;  3P2A A;  1ILO A;  2OE1 A;  4K5S A;  2H71 A;  2VD1 A;  3GFK A;  1GTU A;  4F0B A;  4K7I A;  3GNJ A;  1F3A A;  1OC3 A;  1QGV A;  2LRT A;  1ZZY A;  3WT2 A;  5IO2 A;  5A34 A;  2X8H A;  3FR3 A;  2QA2 A;  4XS4 B;  4XRA A;  5H5S A;  1K0B A;  4BVX A;  3D0Z A;  2MZC A;  4F0C A;  5INY A;  3APQ A;  5G30 A;  1BJX A;  4HI7 A;  3GA4 A;  4N30 A;  4PNF A;  5HR3 A;  5H5R A;  4I2U A;  4G0I A;  3W8J A;  2YCD A;  3HVN A;  5D73 A;  2J9H A;  4MAB A;  1PL1 A;  2V1M A;  2WB9 A;  2QC7 A;  4GF0 A;  5LNK e;  1O6J A;  1DUG A;  4BWQ A;  4Z2R A;  2HI7 A;  3C1S A;  3P8W A;  3ZYW A;  1PGT A;  4TN8 A;  2FGX A;  5D93 A;  3CTG A;  4G2E A;  3HKR A;  4RUV A;  17GS A;  2LQQ A;  2RUF A;  16GS A;  1N25 A;  3LSZ A;  2K18 A;  1M3J A;  3TJG A;  1UA5 A;  2AUV A;  2HSM B;  1GNE A;  2CVD A;  2O5V A;  4PX1 A;  1QFN A;  1JZO A;  3P90 A;  3IPZ A;  5B8A A;  1TKD B;  1W89 A;  4BWS A;  4HQZ A;  2NDO A;  4MH3 A;  1CQH A;  4OFM A;  1SVO A;  5E59 A;  5IIZ A;  2YPM A;  5G1L A;  5ELG A;  3IR4 A;  4L0W A;  3KM6 A;  2O87 A;  3WD6 A;  5DVB A;  1EGO A;  1SJ6 A;  2B5X A;  2EFH A;  3L78 A;  3VPQ A;  1N8J A;  4JR6 A;  4MMM A;  2YN1 A;  1W4V A;  3K8N A;  1X5D A;  2C0D A;  2OA7 A;  1NM3 A;  4EXJ A;  1S3R A;  2OJL A;  3GST A;  4TR4 A;  4OCE A;  3HVS A;  3WGX A;  3E0U A;  1JZD A;  3DRN A;  4JU5 A;  4W66 A;  1U3A A;  3DKS A;  4I2T A;  5DCH A;  5IQY A;  5DAK B;  5ENU A;  1Z6N A;  5GAN D;  1G6Y A;  3IDV A;  2CZ2 A;  4G10 A;  4HS1 A;  5CO3 A;  4EO3 A;  1H4O A;  2VKZ G;  2H70 A;  3APS A;  2G2Q A;  2GQK A;  1V9W A;  2DJ3 A;  2DMM A;  2AYT A;  4PQI A;  3MNG A;  2PMT A;  2EIR A;  1DBY A;  2HSY A;  4EIP A;  4K2D A;  3IRA A;  4TR1 A;  3ZMK A;  3WGD A;  4K0G A;  4Q5N A;  2O85 A;  4NMU A;  4NV2 A;  2B6M A;  2H8L A;  1WWJ A;  2PWJ A;  3H4K A;  3IC8 A;  4ULX A;  4G0L A;  3L0H A;  1SJZ A;  2HZF A;  4KSO A;  5GST A;  1S3C A;  1SL0 B;  2VCZ A;  2HSN B;  1PN0 A;  3WT1 A;  5ECN B;  4D73 A;  5FT3 A;  3HYP A;  4IN0 A;  5JCU A;  2KOK A;  1K3L A;  3KCM A;  1K0O A;  5J4V A;  5ECQ B;  3GKX A;  3ERF A;  4BL7 A;  2HRN A;  3M3M A;  2JSZ A;  2M80 A;  4OO5 A;  1GNW A;  2C1Y A;  4I8B A;  1V58 A;  1J08 A;  3UVH A;  4N3Z A;  3F6F A;  4F9Z A;  1U3I A;  2IN3 A;  1S4B P;  2VCQ A;  1R5A A;  2WS2 A;  3NZN A;  4X1U A;  2WGR A;  1VF3 A;  3ZVJ D;  1V57 A;  1X5C A;  2XBI A;  4ID0 A;  3UBL A;  4CW9 A;  1M2D A;  4MA9 A;  3IAS 2;  1TXX A;  1GUM A;  4CHS A;  3KZQ A;  2DKI A;  5E4W A;  2OAC A;  2WZS A;  1GUH A;  2QGV A;  4JED A;  1MTC A;  4O5R A;  1GUL A;  1H75 A;  3CTF A;  1GTI A;  2HYX A;  2MMA A;  1ZYE A;  5HQP A;  3KTL A;  2J23 A;  4CDO A;  1A0F A;  4FIW A;  3HZ8 A;  2F9S A;  3FW2 A;  4LLR A;  2GTU A;  2H30 A;  4F82 A;  2VLU A;  1JHB A;  4FYC A;  4BVY B;  3GH6 A;  4YQU A;  2IMF A;  5A4W A;  4AJ8 A;  1TW9 A;  1GSQ A;  2YAN A;  2JZT A;  2NBS A;  3QFA C;  2EIQ A;  4TXO B;  4GTU A;  3A5W A;  2TRC P;  5A5H A;  3FKF A;  5DDL A;  5KOW A;  3A3T A;  3L9V A;  4YAV A;  2FNO A;  5CRE A;  1FAA A;  1XFL A;  5G5E A;  1A0R P;  5D9V A;  1A8Y A;  4WF4 A;  1XWK A;  3VWU A;  1XCC A;  1TRS A;  2GQM A;  3BOA A;  2HT9 A;  4TXO A;  4MJA A;  4IP6 A;  1M99 A;  4EDY A;  3HD5 A;  1BAY A;  3VPT A;  2DBC A;  3KEB A;  2L5O A;  2I9H A;  3VUR A;  2LQO A;  2B5Y A;  3IE3 A;  1JZR A;  4K9Z A;  4AKI A;  4X43 A;  1KBN A;  3GL3 A;  4YH2 A;  4WKW A;  4N10 A;  1YQ1 A;  3UIW A;  1OE8 A;  3TKP A;  2WVZ A;  3RFR C;  2YV9 A;  1IYH A;  1O8W A;  3QPM A;  4E8E A;  5EPF A;  4POB A;  3A2W A;  1PN9 A;  3ISO A;  4O92 A;  1A23 A;  4TR3 A;  2CX3 A;  1SL1 B;  2WCI A;  1EZK A;  3WYW A;  2MMO A;  4X0X A;  2A2S A;  1KNG A;  2GSR A;  4KUN A;  4EL1 A;  2MMN A;  5ECR B;  1QQ2 A;  1G6W A;  2I81 A;  1XXU A;  1HYU A;  2P5Q A;  1TK5 B;  1FO5 A;  4L5L A;  1XWA A;  2QKE A;  1BQ7 A;  1NHO A;  1K0M A;  4ZB9 A;  1TRV A;  3F4S A;  3L9S A;  4PHZ C;  4J57 E;  3HY2 A;  5JCW A;  2GT6 A;  2WW2 A;  1PD2 1;  3C8E A;  1PRX A;  4LL1 B;  4GDF A;  3LG6 A;  3UMA A;  4MP4 A;  2WVX A;  4DVC A;  4WET A;  2GSQ A;  4HDE A;  2DJ2 A;  5LCZ A;  5ECI B;  5JWQ B;  2X99 A;  3GTU A;  5A4V A;  1EOH A;  5A1N A;  2HE3 A;  2H1A A;  3A2V A;  3ZFL A;  4Q5R A;  2IMI A;  2HLS A;  3HJP A;  1PQN A;  2VD0 A;  2OBI A;  1EV4 A;  5JWO B;  2PGT A;  4CY8 A;  4MJE A;  1SL2 B;  3ME7 A;  4EIQ A;  2NVL A;  4ICY A;  1B48 A;  3CSJ A;  4YKF A;  5IMA A;  3D6I A;  2DC5 A;  1OVN A;  4F03 A;  2H19 A;  5C00 A;  5KOX A;  1BED A;  2FA8 A;  4BA7 A;  3L9U A;  1EP8 A;  1USB A;  3SWL A;  1SEN A;  4WEY A;  3TKS C;  3RDW A;  6GSS A;  2F3M A;  1MD4 A;  3LJR A;  5B6N A;  5AN1 A;  3HCZ A;  2IME A;  3MDK A;  4TOP A;  2MMZ A;  3PGT A;  5ID2 A;  3LQ7 A;  3ED3 A;  3HZ4 A;  3GYK A;  2WUL A;  1PX6 A;  1SD9 A;  3DML A;  3QAV A;  4EE0 A;  3FZ9 A;  3WGE A;  1TU8 A;  2FY6 A;  3ZIJ A;  2KP1 A;  4QL7 A;  3KIJ A;  2LNT A;  3I43 A;  1WJK A;  3DVX A;  4HZ4 A;  1M2A A;  4KA0 A;  3TJB A;  1T8E B;  5EL8 A;  2UZ8 A;  3KH7 A;  5L71 A;  1GSE A;  2KP2 A;  5H5Q A;  1Z7R A;  4OFN A;  1HQO A;  1VGL A;  3BJ5 A;  4KB3 A;  1I1I P;  4IQ1 A;  1A8L A;  1PSQ A;  1TRU A;  2AV4 A;  1R4W A;  4L5O A;  4ZB8 A;  4DSS B;  4PGT A;  1A24 A;  3VI7 A;  1BX9 A;  6GSX A;  2GS3 A;  2LST A;  2L4C A;  6GSU A;  1URM A;  5JCG A;  3UOM A;  3QAG A;  1LBK A;  1YEP A;  4XTS A;  4ML6 A;  2WRT A;  3ZML A;  1OAZ A;  3VFI A;  1JLV A;  4WR4 A;  1SVL A;  2EC4 A;  1ZYP A;  1TDI A;  4YAP A;  2LRC A;  3CYN A;  1B8X A;  5G31 A;  1ERT A;  2C3Q A;  4QMK A;  2DKH A;  1SKR B;  4KND A;  2V2G A;  3ZZX A;  4HEA 2;  5ECO B;  4ECB A;  2OAD A;  4ZIJ A;  4TXV A;  5CAX A;  3LFL A;  2GZY A;  5CYY A;  3KH9 A;  3P7X A;  5DBQ A;  1GH2 A;  5HFI A;  4OFT A;  2VLT A;  2JZS A;  1ERV A;  4WBR D;  14GS A;  1YKC A;  3LYK A;  4NWY A;  2HQT A;  3PH9 A;  1UC7 A;  2VCT A;  4F2I A;  3NIV A;  2PVQ A;  3F3Q A;  2FWE A;  5A5K A;  1GSS A;  3FMW A;  4XS4 A;  1Z7P A;  5GAP D;  1XW6 A;  1SK0 A;  2V6O A;  2H0H A;  1QMV A;  2FCH A;  4JRR A;  5BRT A;  3E9J B;  2LUS A;  3CSI A;  2WVY A;  3GUR A;  1E6B A;  1YEW C;  1EGR A;  1T1V A;  4MJC A;  4ISD A;  2YJ7 A;  5CP1 A;  2O36 A;  1G7O A;  3VWW A;  3IC4 A;  4V1A p;  5HR1 A;  18GS A;  3FZA A;  3A5I A;  2E7P A;  1GWC A;  2L4Q A;  5CRH A;  1TI3 A;  4AJ7 A;  2BTO T;  4ECJ A;  2DJK A;  3EWL A;  1PKW A;  2CZ3 A;  4MH2 A;  1SYR A;  4KCA A;  1WOU A;  2CVK A;  5AIV A;  2R37 A;  3GX0 A;  1KEB A;  2GT5 A;  1FHE A;  3GKN A;  5F06 A;  5J47 A;  4LL4 B;  3ZTL A;  2YNX A;  2VO4 A;  4PUF C;  2E0Q A;  2DJ1 A;  4EC0 A;  1XVW A;  3IHG A;  4K1F A;  2DML A;  3UEM A;  1M2B A;  2R2J A;  1AQV A;  2REM A;  4FH8 A;  2HSM A;  2M72 A;  1ML6 A;  3LOR A;  1SU9 A;  3Q6O A;  1XPV A;  1ZYN A;  3CWG A;  3KP9 A;  3V1W A;  1S3A A;  1X0R A;  4HU9 A;  4POK A;  4WBJ A;  1ABA A;  4EVM A;  1SKS B;  5DQY A;  5ECL B;  1TTZ A;  2OKA A;  5J4U A;  2VCV A;  4YKG A;  4XCS A;  4K7O A;  2LV3 A;  1EP7 A;  1MDK A;  1PA3 A;  1OC9 B;  2K8S A;  3TKQ A;  1J0F A;  2R5G A;  3HJO A;  4GQF A;  2X4A A;  2JL4 A;  2HSH A;  1I5G A;  2I1U A;  4O5U A;  1GTA A;  3W8S A;  2F8F A;  1ZGN A;  1SD8 A;  4J2F A;  2TIR A;  2FHE A;  3PR8 A;  1GTB A;  4MZW A;  2LJK A;  3E3E A;  2O8V B;  1T7P B;  5F07 A;  4NHZ A;  3W6G A;  5DAK A;  5KN3 A;  4KDX A;  2LEG A;  4POM A;  2LS5 A;  1AQW A;  4IGJ A;  3RBT A;  13GS A;  4HZ2 A;  2EFC A;  4J56 E;  3FEU A;  2V41 A;  5A4U A;  1DE1 A;  1K0N A;  5F05 A;  4XS6 A;  1M0U A;  1XIY A;  1DSB A;  1QXH A;  2LJR A;  2C3T A;  4IHU A;  2GQL A;  1GRX A;  1AAZ A;  4GSS A;  3ZIT A;  1ST9 A;  2R6K A;  4K8M A;  3VLN A;  4USS A;  3H79 A;  1E2Y A;  1NHY A;  3Q18 A;  2DIZ A;  3EIN A;  4N11 A;  3J7Y k;  1HNB A;  1TOF A;  1PKZ A;  2PVO C;  3TB2 A;  1YJ6 A;  2HSN A;  3IAM 2;  4PQH A;  2AHE A;  5BMU B;  2OE3 A;  3MAK A;  2VM1 A;  3M1G A;  2YJH A;  1GSD A;  4IVF A;  5ECK B;  5DAL B;  1JLW A;  4G0K A;  4Z2U A;  3GV1 A;  3HVX A;  1X5E A;  4I6X A;  1BG5 A;  1K0A A;  3F4R A;  1XOA A;  4CY6 A;  2OBK A;  4Q5Q A;  5C04 A;  4O5Q A;  4ZL7 A;  2L57 A;  2A4V A;  5ECM B;  4GST A;  4AGS A;  3FRC A;  1YEX A;  4AF2 A;  2PN8 A;  4MPG A;  2P5R A;  3DYR A;  5HFG A;  3FZ5 A;  3EMX A;  2YV7 A;  2H6X A;  3G7I A;  3IBH A;  1MD3 A;  2C3N A;  2Z9S A;  1B4Q A;  2IFQ B;  3IHQ A;  4HJ2 A;  4AKH A;  2VCX A;  1KTE A;  5IO0 A;  5F8B A;  1GSY A;  1EWX A;  4RQX A;  3DIE A;  1LJR A;  1CQG A;  3EE2 A;  3GL5 A;  3D4T A;  4G9H A;  8GSS A;  2H75 A;  3GN3 A;  5ECH B;  1K0C A;  3DD3 A;  4TVE A;  1HD2 A;  3GIX A;  4BVY A;  4ZIL A;  2P31 A;  2N5B A;  3F63 A;  1HNC A;  5FHI A;  1O85 A;  4GWR A;  3HJM A;  4KH7 A;  2AAW A;  2H66 A;  5IMD A;  4N0Z A;  3HA9 A;  1U87 A;  4XRD A;  4Z7X A;  2H72 A;  3EC3 A;  1O81 A;  3QCP A;  3CQF A;  4OWY A;  1X9W B;  9GSS A;  2H0G A;  5HR2 A;  3LYP A;  3VI5 A;  4RI7 A;  4WR5 A;  1JFU A;  1O73 A;  3KD0 A;  2HZE B;  5IPG A;  2RLI A;  1Q98 A;  1T4Y A;  4PXO A;  1Z6M A;  1XW5 A;  5HR0 A;  3C73 A;  5J9C A;  2YP6 A;  3EPT A;  4GRF A;  4DEJ A;  2DJJ A;  3GSS A;  1RK4 A;  2H74 A;  4MJB A;  1GUK A;  3C7M A;  3H93 A;  1TU7 A;  3MYD A;  1PX7 A;  4WXT A;  1AUC A;  2VAF A;  3LEF A;  1F3B A;  5DJM A;  2R4V A;  2B7K A;  4GCI A;  3VWX A;  4Z2T A;  4ACS A;  2JZR A;  4OD7 A;  1Y6E A;  4KE3 A; 
#chains in the Genus database with same CATH homology
 3GUS A;  4FYB A;  1SYX A;  3O6T A;  4KSM A;  2HRA A;  3SBC A;  2L6D A;  4YQV A;  1GLQ A;  3C1R A;  2MYG A;  3UVT A;  3C71 A;  4FYU A;  3FY7 A;  1OC8 A;  3TJJ A;  1AC1 A;  4KCE A;  1YY7 A;  1YKA A;  3M9J A;  2WJU A;  3J7Y b;  1BG1 A;  4GQC A;  2V6K A;  1TXU A;  4IJI A;  4PQ1 A;  3RPP A;  2L5L A;  2X8G A;  2XHF A;  4NXI A;  2B3S A;  3CSH A;  4TW5 A;  3DGQ A;  3RHC A;  3U6V A;  2A2P A;  2BJX A;  1Y1U A;  5IMF A;  3TJF A;  6GSW A;  2H6Z A;  4QL9 A;  2CX4 A;  2VUP A;  4IW9 A;  2YZH A;  3IK9 A;  3TOT A;  2R0P A;  5B8B A;  2HXK A;  2H1B A;  2KLX A;  3TRX A;  1NW2 A;  3TJK A;  3HHV A;  4PUA A;  3CBU A;  2VL2 C;  1VF2 A;  1YF1 A;  3N5O A;  3M9K A;  1GL8 A;  2B5E A;  4V2M A;  3UAP A;  2IMD A;  2H1L A;  1AIU A;  5HFK A;  1SKW B;  4JBB A;  3ZVJ A;  2IJY A;  4EDZ A;  4K6X A;  4MLY A;  3TUE A;  4TRX A;  5D96 A;  1X9M B;  2DIY A;  1XWC A;  1F6M C;  2EFD A;  1ACV A;  3UBK A;  3TDG A;  3GMF A;  5F0G A;  3DXB A;  2VM2 A;  2VIM A;  3TGZ A;  3KXO A;  2EFE A;  1ZL9 A;  19GS A;  4FQU A;  2GVP A;  3EUR A;  2R0G A;  2L6C A;  2B1L A;  4WF5 A;  4LMW A;  1FOH A;  2H01 A;  3GRX A;  3FR9 A;  4ZBA A;  5GSS A;  1K0D A;  3H1N A;  4BPY A;  5J5N A;  2IPA A;  3ZL5 A;  3R2Q A;  3VK9 A;  5J4Y A;  3TKR A;  2NPB A;  1EOG A;  3EVI A;  1O8X A;  3RHB A;  1R5P A;  4IEL A;  2H1G A;  1Y25 A;  3S9F A;  2O89 A;  3UAR A;  5EY6 A;  2OE0 A;  2JAC A;  2VLV A;  5G2Z A;  5ECP B;  1F2E A;  1FW1 A;  1WIK A;  5D9T A;  3D22 A;  3O3T A;  3TRQ A;  4MZC A;  5A34 B;  5EVO A;  2CA8 A;  4DSS A;  3U5R E;  1VRS D;  1FVK A;  2E2G A;  4BVX B;  3TOU A;  3PIN A;  2YWM A;  2H6Y A;  4PTS A;  4AI6 A;  5COH A;  1EV9 A;  22GS A;  4GSN A;  1OKT A;  4HQS A;  1YDK A;  4AKG A;  2GLR A;  3LGC A;  1G7E A;  2AB6 A;  1Z3E A;  2RM5 A;  5IMZ A;  3FZ4 A;  4ILF A;  4KGI A;  1OKD A;  3EU3 A;  3Q19 A;  1WP0 A;  3HXS A;  5D8I A;  1X9S B;  3DWV A;  3DVW A;  4L8E A;  2ES7 A;  3CXG A;  4LA1 A;  4PUR A;  3KMN A;  1Z9H A;  2UV8 G;  1XZO A;  5KN2 A;  1B4P A;  4KW6 A;  3TCO A;  1FVJ A;  1TRW A;  4MF6 A;  4ECC A;  7GSS A;  1FB6 A;  4HOJ A;  4MCU A;  5IMC A;  2FA4 A;  4MF5 A;  2O7K A;  2OT3 A;  1BF5 A;  4P3Y B;  1T3B A;  1XOB A;  4K5R A;  3AY8 A;  2C0F A;  4NHW A;  1YVL A;  3F9U A;  5AGY A;  2H73 A;  2FD3 A;  2X49 A;  5J9B A;  1PL2 A;  5G5F A;  1GLP A;  1K3O A;  2HRF A;  4MK3 A;  5JWR B;  1B9X C;  2VL3 A;  1FB0 A;  2HRK B;  2RII A;  5GZZ B;  4DSR A;  3FK8 A;  2RUE A;  4DSQ A;  20GS A;  5DCG A;  3GX8 A;  3IXR A;  3I9V 2;  4HJM A;  4HUA A;  3QDN A;  2GST A;  1F9M A;  1A2J A;  4Q5F A;  3PPU A;  3F8U A;  2CV4 A;  2HRK A;  4K0N A;  1WE0 A;  3D4M A;  4ZBB A;  1ZCP A;  3FR6 A;  1THO A;  3GKK A;  4G19 A;  2FWG A;  2YWN A;  1ON4 A;  2N5A A;  3RPN A;  4IJ3 A;  1EEM A;  3LXZ A;  2LTK A;  1I9D A;  1JZW A;  2CQ9 A;  1QK8 A;  2YOI A;  2XBQ A;  2GDR A;  2L59 A;  2DJ0 A;  6GSV A;  1B9Y C;  3TRP A;  3ZLP A;  1M7T A;  1OC9 A;  3QD9 A;  2WZ9 A;  1BYE A;  4TR1 B;  4TKY A;  3QFB C;  4ZXG A;  2H76 A;  1GSF A;  5IM9 A;  4MNN A;  1VF4 A;  5CRW A;  2VL9 A;  3QAW A;  1QUW A;  1NSW A;  4ZB6 A;  2QA1 A;  2KHP A;  4D73 B;  1UN2 A;  3BCI A;  2WFC A;  1TJD A;  4L0U A;  4IKH A;  2LKU A;  3KJY A;  2FWF A;  3F0I A;  4HU7 A;  1HNA A;  2YWI A;  5J3R A;  1ZYQ B;  4BL7 B;  2C0E A;  1V98 A;  4MF7 A;  2XPE A;  3GHA A;  1F37 A;  3OR5 A;  2FWH A;  2ZUP A;  3KMO A;  2R0C A;  2ZNM A;  2IL3 A;  2WDU A;  2IIY A;  4I97 A;  2BMX A;  2HFD A;  1G0T A;  4G01 A;  1YF0 A;  5IPH A;  3EU4 A;  4OO4 A;  1K3Y A;  4K2X A;  1T00 A;  1XW9 A;  1V40 A;  12GS A;  1LU4 A;  3D21 A;  4JZQ A;  2CT6 A;  2GSS A;  2CVB A;  2F8A A;  2C4J A;  2C8U A;  6GST A;  2DSA A;  3F6D A;  3R3E A;  5AIX A;  3EMP A;  1FOV A;  5J41 A;  1SVM A;  2D2Z A;  4LMV A;  3ERG A;  4MPF A;  2GZZ A;  1R26 A;  3G7J A;  1O7U A;  3HVV A;  5BMU A;  2GZP A;  2VOC A;  4EUY A;  1EEJ A;  4QQ7 A;  3ME8 A;  4MDC A;  1ERW A;  5DAL A;  2H1D A;  4XHM A;  1UVZ A;  4H86 A;  4KAE A;  2K9F A;  4I5Q A;  2F51 A;  2GGT A;  2VCW A;  3US3 A;  5B7C A;  2X8C A;  5DQS A;  3H8Q A;  1YZX A;  3TU3 B;  1U6T A;  1VF1 A;  2CAQ A;  1RQM A;  4E68 A;  4GLT A;  4E8H A;  4XIH A;  5A5H B;  3D5J A;  2JAD A;  4EKZ A;  2NTO A;  4ZB7 A;  5B6M A;  3LXT A;  1DE2 A;  1OE7 A;  2FLS A;  2H0I A;  3FYG A;  2PU9 C;  3HDC A;  4YQM A;  2ON7 A;  1TK0 B;  3CMI A;  1IYI A;  2IFQ A;  3KTB A;  2V32 A;  4EF0 A;  3M0F A;  2PER A;  1FG4 A;  1WPI A;  1SK1 A;  2I4A A;  5ECS A;  3NOF A;  4ZL8 A;  5FWG A;  1V2A A;  1XBS A;  2CAI A;  5J40 A;  1S3D A;  2IMK A;  4ZL9 A;  4FO5 A;  4X4J A;  4ML1 A;  3BD2 A;  1Q4J A;  2RM6 A;  3BCK A;  1TP9 A;  3BBY A;  3I69 A;  1MDI A;  2LJA A;  4TR0 A;  4NAX A;  2MBT A;  1N2A A;  2MBS A;  1TK8 B;  1GSU A;  1ERU A;  2A2R A;  2B7J A;  5ELA A;  5IMV A;  1PMT A;  2K8V A;  3A2X A;  4V2N A;  4IQA A;  4KF9 A;  2YZU A;  4ZBD A;  1AQX A;  3G7Y A;  2QSI A;  3ZRE A;  5KN0 A;  4JE1 A;  2IWT A;  4PNG A;  3ZIV A;  2HZE A;  1WMJ A;  2X64 A;  3F4T A;  2KUC A;  3MWH A;  2LNS A;  3KP8 A;  1THX A;  3EYT A;  5D9W A;  2LRN A;  4V2L A;  1C72 A;  2B1K A;  1XWB A;  1MEK A;  2ON5 A;  2C80 A;  3IK7 A;  2R3X A;  2FUG 2;  3GTU B;  5A1N B;  1R7H A;  4GXZ A;  3KGK A;  4IP1 A;  1SJI A;  1AW9 A;  5AIS A;  3IA1 A;  2TRX A;  3I6A A;  4NV5 A;  1MDJ A;  5LD0 A;  1A2L A;  1XWG A;  2XPD A;  2C0G A;  3TKS A;  5KEJ A;  2VL2 A;  10GS A;  4NPB A;  3G9B A;  11GS A;  1A2M A;  4OMV A;  5DJL A;  2N5F A;  1ZOF A;  2P0G A;  1WRY A;  3GH9 A;  3F3R A;  3FHK A;  5ID2 B;  1RW1 A;  5CRD A;  3ERW A;  4MZB A;  3QR6 A;  5D9X A;  2AJQ B;  3MIX A;  4V1A g;  2XC2 A;  1J9B A;  3DEX A;  4POL A;  2ZCT A;  4O7H A;  3LW9 A;  2I3Y A;  2YWO A;  4IBP A;  3RAZ A;  4AJ6 A;  3N9J A;  3APO A;  3GKM A;  3ZRD A;  1U88 A;  5CNW A;  4O32 A;  4OCF A;  3QOU A;  3VWV A;  6GSY A;  3HMJ G;  2HNL A;  2A4H A;  1SK2 A;  1XVQ A;  5ABR A;  4XS1 A;  3L4N A;  1M9B A;  4KDU A;  1M9A A;  3LWA A;  1AXD A;  2JSY A;  1ZMA A;  3IOS A;  4K7N A;  3UJ1 A;  2DLX A;  4KX4 A;  3O76 A;  4RQR A;  3UL3 A;  5G1K A;  2EIO A;  2ALB A;  3IV4 A;  2JU5 A;  3ZFB A;  2PUK C;  4KDY A;  2K6V A;  2G0F A;  3Q74 A;  4A5P A;  1GP1 A;  5IOW A;  3CRU A;  5CRG A;  3M8N A;  3CRT A;  4JR4 A;  1Z5Y E;  3JCM L;  2E2M A;  4RI6 A;  2M46 A;  4AKX B;  2PPT A;  2PBJ A;  5IOX A;  5KN1 A;  3TKS E;  4ECI A;  1TI1 A;  4N0V A;  4IS0 A;  3QMX A;  1T4Z A;  1OYJ A;  3MSZ A;  3P2A A;  1ILO A;  2OE1 A;  4K5S A;  2H71 A;  2VD1 A;  3GFK A;  1GTU A;  4F0B A;  4K7I A;  3GNJ A;  1F3A A;  1OC3 A;  1QGV A;  2LRT A;  1ZZY A;  3WT2 A;  5IO2 A;  5A34 A;  2X8H A;  3FR3 A;  2QA2 A;  4XS4 B;  4XRA A;  5H5S A;  1K0B A;  4BVX A;  3D0Z A;  2MZC A;  4F0C A;  5INY A;  3APQ A;  5G30 A;  1BJX A;  4HI7 A;  3GA4 A;  4N30 A;  4PNF A;  5HR3 A;  5H5R A;  4I2U A;  4G0I A;  3W8J A;  2YCD A;  5D73 A;  2J9H A;  4MAB A;  1PL1 A;  2V1M A;  2WB9 A;  2QC7 A;  4GF0 A;  5LNK e;  1O6J A;  1DUG A;  4BWQ A;  4Z2R A;  2HI7 A;  3C1S A;  3P8W A;  3ZYW A;  1PGT A;  4TN8 A;  2FGX A;  5D93 A;  3CTG A;  4G2E A;  3HKR A;  4RUV A;  17GS A;  2LQQ A;  2RUF A;  16GS A;  1N25 A;  3LSZ A;  2K18 A;  3TJG A;  1UA5 A;  2AUV A;  2HSM B;  1GNE A;  2CVD A;  2O5V A;  4PX1 A;  1QFN A;  1JZO A;  3P90 A;  3IPZ A;  5B8A A;  1TKD B;  1W89 A;  4BWS A;  4HQZ A;  2NDO A;  4MH3 A;  1CQH A;  4OFM A;  1SVO A;  5E59 A;  5IIZ A;  2YPM A;  5G1L A;  5ELG A;  3IR4 A;  4L0W A;  3KM6 A;  2O87 A;  3WD6 A;  5DVB A;  1EGO A;  1SJ6 A;  2B5X A;  2EFH A;  3L78 A;  3VPQ A;  1N8J A;  4JR6 A;  4MMM A;  2YN1 A;  1W4V A;  3K8N A;  1X5D A;  2C0D A;  2OA7 A;  1NM3 A;  4EXJ A;  2OJL A;  3GST A;  4TR4 A;  4OCE A;  3HVS A;  3WGX A;  3E0U A;  1JZD A;  3DRN A;  4JU5 A;  4W66 A;  1U3A A;  3DKS A;  4I2T A;  5DCH A;  5IQY A;  5DAK B;  5ENU A;  1Z6N A;  5GAN D;  1G6Y A;  3IDV A;  2CZ2 A;  4G10 A;  4HS1 A;  5CO3 A;  4EO3 A;  1H4O A;  2VKZ G;  2H70 A;  3APS A;  2G2Q A;  2GQK A;  1V9W A;  2DJ3 A;  2DMM A;  2AYT A;  4PQI A;  3MNG A;  2PMT A;  2EIR A;  1DBY A;  2HSY A;  4EIP A;  4K2D A;  3IRA A;  4TR1 A;  3ZMK A;  3WGD A;  4K0G A;  4Q5N A;  2O85 A;  4NMU A;  4NV2 A;  2B6M A;  2H8L A;  1WWJ A;  2PWJ A;  3H4K A;  3IC8 A;  4ULX A;  4G0L A;  3L0H A;  1SJZ A;  2HZF A;  4KSO A;  5GST A;  1S3C A;  1SL0 B;  2VCZ A;  2HSN B;  1PN0 A;  3WT1 A;  5ECN B;  4D73 A;  5FT3 A;  3HYP A;  4IN0 A;  5JCU A;  2KOK A;  1K3L A;  3KCM A;  1K0O A;  5J4V A;  5ECQ B;  3GKX A;  3ERF A;  4BL7 A;  2HRN A;  3M3M A;  2JSZ A;  2M80 A;  4OO5 A;  1GNW A;  2C1Y A;  4I8B A;  1V58 A;  1J08 A;  3UVH A;  4N3Z A;  3F6F A;  4F9Z A;  1U3I A;  2IN3 A;  2VCQ A;  1R5A A;  2WS2 A;  3NZN A;  4X1U A;  2WGR A;  1VF3 A;  3ZVJ D;  1V57 A;  1X5C A;  2XBI A;  4ID0 A;  3UBL A;  4CW9 A;  1M2D A;  4MA9 A;  3IAS 2;  1TXX A;  1GUM A;  4CHS A;  3KZQ A;  2DKI A;  5E4W A;  2OAC A;  1GUH A;  2QGV A;  4JED A;  1MTC A;  4O5R A;  1GUL A;  1H75 A;  3CTF A;  1GTI A;  2HYX A;  2MMA A;  1ZYE A;  5HQP A;  3KTL A;  2J23 A;  4CDO A;  1A0F A;  4FIW A;  3HZ8 A;  2F9S A;  3FW2 A;  4LLR A;  2GTU A;  2H30 A;  4F82 A;  2VLU A;  1JHB A;  4FYC A;  4BVY B;  3GH6 A;  4YQU A;  2IMF A;  5A4W A;  4AJ8 A;  1TW9 A;  1GSQ A;  2YAN A;  2JZT A;  2NBS A;  3QFA C;  2EIQ A;  4TXO B;  4GTU A;  3A5W A;  2TRC P;  5A5H A;  3FKF A;  5DDL A;  5KOW A;  3A3T A;  3L9V A;  4YAV A;  2FNO A;  5CRE A;  1FAA A;  1XFL A;  5G5E A;  1A0R P;  5D9V A;  1A8Y A;  4WF4 A;  1XWK A;  3VWU A;  1XCC A;  1TRS A;  2GQM A;  3BOA A;  2HT9 A;  4TXO A;  4MJA A;  4IP6 A;  1M99 A;  4EDY A;  3HD5 A;  1BAY A;  3VPT A;  2DBC A;  3KEB A;  2L5O A;  2I9H A;  3VUR A;  2LQO A;  2B5Y A;  3IE3 A;  1JZR A;  4K9Z A;  4AKI A;  4X43 A;  1KBN A;  3GL3 A;  4YH2 A;  4WKW A;  4N10 A;  1YQ1 A;  3UIW A;  1OE8 A;  3TKP A;  2YV9 A;  1IYH A;  1O8W A;  3QPM A;  4E8E A;  5EPF A;  4POB A;  3A2W A;  1PN9 A;  3ISO A;  4O92 A;  1A23 A;  4TR3 A;  2CX3 A;  1SL1 B;  2WCI A;  1EZK A;  3WYW A;  2MMO A;  4X0X A;  2A2S A;  1KNG A;  2GSR A;  4KUN A;  4EL1 A;  2MMN A;  5ECR B;  1QQ2 A;  1G6W A;  2I81 A;  1XXU A;  1HYU A;  2P5Q A;  1TK5 B;  1FO5 A;  4L5L A;  1XWA A;  2QKE A;  1BQ7 A;  1NHO A;  1K0M A;  4ZB9 A;  1TRV A;  3F4S A;  3L9S A;  4J57 E;  3HY2 A;  5JCW A;  2GT6 A;  1PD2 1;  3C8E A;  1PRX A;  4LL1 B;  4GDF A;  3LG6 A;  3UMA A;  4MP4 A;  4DVC A;  4WET A;  2GSQ A;  4HDE A;  2DJ2 A;  5LCZ A;  5ECI B;  5JWQ B;  2X99 A;  3GTU A;  5A4V A;  1EOH A;  5A1N A;  2HE3 A;  2H1A A;  3A2V A;  3ZFL A;  4Q5R A;  2IMI A;  2HLS A;  3HJP A;  1PQN A;  2VD0 A;  2OBI A;  1EV4 A;  5JWO B;  2PGT A;  4CY8 A;  4MJE A;  1SL2 B;  3ME7 A;  4EIQ A;  2NVL A;  4ICY A;  1B48 A;  3CSJ A;  4YKF A;  5IMA A;  3D6I A;  2DC5 A;  1OVN A;  4F03 A;  2H19 A;  5C00 A;  5KOX A;  1BED A;  2FA8 A;  4BA7 A;  3L9U A;  1EP8 A;  1USB A;  3SWL A;  1SEN A;  4WEY A;  3TKS C;  3RDW A;  6GSS A;  2F3M A;  1MD4 A;  3LJR A;  5B6N A;  5AN1 A;  3HCZ A;  2IME A;  3MDK A;  4TOP A;  2MMZ A;  3PGT A;  5ID2 A;  3LQ7 A;  3ED3 A;  3HZ4 A;  3GYK A;  2WUL A;  1PX6 A;  1SD9 A;  3DML A;  3QAV A;  4EE0 A;  3FZ9 A;  3WGE A;  1TU8 A;  2FY6 A;  3ZIJ A;  2KP1 A;  4QL7 A;  3KIJ A;  2LNT A;  3I43 A;  1WJK A;  3DVX A;  4HZ4 A;  1M2A A;  4KA0 A;  3TJB A;  1T8E B;  5EL8 A;  2UZ8 A;  3KH7 A;  5L71 A;  1GSE A;  2KP2 A;  5H5Q A;  1Z7R A;  4OFN A;  1HQO A;  1VGL A;  3BJ5 A;  4KB3 A;  4IQ1 A;  1A8L A;  1PSQ A;  1TRU A;  2AV4 A;  1R4W A;  4L5O A;  4ZB8 A;  4DSS B;  4PGT A;  1A24 A;  3VI7 A;  1BX9 A;  6GSX A;  2GS3 A;  2LST A;  2L4C A;  6GSU A;  1URM A;  5JCG A;  3UOM A;  3QAG A;  1LBK A;  1YEP A;  4XTS A;  4ML6 A;  2WRT A;  3ZML A;  1OAZ A;  3VFI A;  1JLV A;  4WR4 A;  1SVL A;  2EC4 A;  1ZYP A;  1TDI A;  4YAP A;  2LRC A;  3CYN A;  1B8X A;  5G31 A;  1ERT A;  2C3Q A;  4QMK A;  2DKH A;  1SKR B;  4KND A;  2V2G A;  3ZZX A;  4HEA 2;  5ECO B;  4ECB A;  2OAD A;  4ZIJ A;  4TXV A;  5CAX A;  3LFL A;  2GZY A;  5CYY A;  3KH9 A;  3P7X A;  5DBQ A;  1GH2 A;  5HFI A;  4OFT A;  2VLT A;  2JZS A;  1ERV A;  4WBR D;  14GS A;  1YKC A;  3LYK A;  4NWY A;  2HQT A;  3PH9 A;  1UC7 A;  2VCT A;  4F2I A;  3NIV A;  2PVQ A;  3F3Q A;  2FWE A;  5A5K A;  1GSS A;  3FMW A;  4XS4 A;  1Z7P A;  5GAP D;  1XW6 A;  1SK0 A;  2V6O A;  2H0H A;  1QMV A;  2FCH A;  4JRR A;  5BRT A;  3E9J B;  2LUS A;  3CSI A;  3GUR A;  1E6B A;  1EGR A;  1T1V A;  4MJC A;  4ISD A;  2YJ7 A;  5CP1 A;  1G7O A;  3VWW A;  3IC4 A;  4V1A p;  5HR1 A;  18GS A;  3FZA A;  3A5I A;  2E7P A;  1GWC A;  2L4Q A;  5CRH A;  1TI3 A;  4AJ7 A;  2BTO T;  4ECJ A;  2DJK A;  3EWL A;  1PKW A;  2CZ3 A;  4MH2 A;  1SYR A;  4KCA A;  1WOU A;  2CVK A;  5AIV A;  2R37 A;  3GX0 A;  1KEB A;  2GT5 A;  1FHE A;  3GKN A;  5F06 A;  5J47 A;  4LL4 B;  3ZTL A;  2YNX A;  2VO4 A;  4PUF C;  2E0Q A;  2DJ1 A;  4EC0 A;  1XVW A;  3IHG A;  4K1F A;  2DML A;  3UEM A;  1M2B A;  2R2J A;  1AQV A;  2REM A;  4FH8 A;  2HSM A;  2M72 A;  1ML6 A;  3LOR A;  1SU9 A;  3Q6O A;  1XPV A;  1ZYN A;  3CWG A;  3KP9 A;  3V1W A;  1S3A A;  1X0R A;  4HU9 A;  4POK A;  4WBJ A;  1ABA A;  4EVM A;  1SKS B;  5DQY A;  5ECL B;  1TTZ A;  2OKA A;  5J4U A;  2VCV A;  4YKG A;  4XCS A;  4K7O A;  2LV3 A;  1EP7 A;  1MDK A;  1PA3 A;  1OC9 B;  2K8S A;  3TKQ A;  1J0F A;  2R5G A;  3HJO A;  4GQF A;  2X4A A;  2JL4 A;  2HSH A;  1I5G A;  2I1U A;  4O5U A;  1GTA A;  3W8S A;  2F8F A;  1ZGN A;  1SD8 A;  4J2F A;  2TIR A;  2FHE A;  3PR8 A;  1GTB A;  4MZW A;  2LJK A;  3E3E A;  2O8V B;  1T7P B;  5F07 A;  4NHZ A;  3W6G A;  5DAK A;  5KN3 A;  4KDX A;  2LEG A;  4POM A;  2LS5 A;  1AQW A;  4IGJ A;  3RBT A;  13GS A;  4HZ2 A;  2EFC A;  4J56 E;  3FEU A;  2V41 A;  5A4U A;  1DE1 A;  1K0N A;  5F05 A;  4XS6 A;  1M0U A;  1XIY A;  1DSB A;  1QXH A;  2LJR A;  2C3T A;  4IHU A;  2GQL A;  1GRX A;  1AAZ A;  4GSS A;  3ZIT A;  1ST9 A;  2R6K A;  4K8M A;  3VLN A;  4USS A;  3H79 A;  1E2Y A;  1NHY A;  3Q18 A;  2DIZ A;  3EIN A;  4N11 A;  3J7Y k;  1HNB A;  1TOF A;  1PKZ A;  2PVO C;  3TB2 A;  1YJ6 A;  2HSN A;  3IAM 2;  4PQH A;  2AHE A;  5BMU B;  2OE3 A;  3MAK A;  2VM1 A;  3M1G A;  2YJH A;  1GSD A;  4IVF A;  5ECK B;  5DAL B;  1JLW A;  4G0K A;  4Z2U A;  3GV1 A;  3HVX A;  1X5E A;  4I6X A;  1BG5 A;  1K0A A;  3F4R A;  1XOA A;  4CY6 A;  2OBK A;  4Q5Q A;  5C04 A;  4O5Q A;  4ZL7 A;  2L57 A;  2A4V A;  5ECM B;  4GST A;  4AGS A;  3FRC A;  1YEX A;  4AF2 A;  2PN8 A;  4MPG A;  2P5R A;  3DYR A;  5HFG A;  3FZ5 A;  3EMX A;  2YV7 A;  2H6X A;  3G7I A;  3IBH A;  1MD3 A;  2C3N A;  2Z9S A;  1B4Q A;  2IFQ B;  3IHQ A;  4HJ2 A;  4AKH A;  2VCX A;  1KTE A;  5IO0 A;  5F8B A;  1GSY A;  1EWX A;  4RQX A;  3DIE A;  1LJR A;  1CQG A;  3EE2 A;  3GL5 A;  3D4T A;  4G9H A;  8GSS A;  2H75 A;  3GN3 A;  5ECH B;  1K0C A;  3DD3 A;  4TVE A;  1HD2 A;  3GIX A;  4BVY A;  4ZIL A;  2P31 A;  2N5B A;  3F63 A;  1HNC A;  5FHI A;  1O85 A;  4GWR A;  3HJM A;  4KH7 A;  2AAW A;  2H66 A;  5IMD A;  4N0Z A;  3HA9 A;  1U87 A;  4XRD A;  4Z7X A;  2H72 A;  3EC3 A;  1O81 A;  3QCP A;  4OWY A;  1X9W B;  9GSS A;  2H0G A;  5HR2 A;  3LYP A;  3VI5 A;  4RI7 A;  4WR5 A;  1JFU A;  1O73 A;  3KD0 A;  2HZE B;  5IPG A;  2RLI A;  1Q98 A;  1T4Y A;  4PXO A;  1Z6M A;  1XW5 A;  5HR0 A;  3C73 A;  5J9C A;  2YP6 A;  3EPT A;  4GRF A;  4DEJ A;  2DJJ A;  3GSS A;  1RK4 A;  2H74 A;  4MJB A;  1GUK A;  3C7M A;  3H93 A;  1TU7 A;  3MYD A;  1PX7 A;  4WXT A;  1AUC A;  2VAF A;  3LEF A;  1F3B A;  5DJM A;  2R4V A;  2B7K A;  4GCI A;  3VWX A;  4Z2T A;  4ACS A;  2JZR A;  4OD7 A;  1Y6E A;  4KE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...