2X64A

Glutathione-s-transferase from xylella fastidiosa
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
206
structure length
206
Chain Sequence
HMKLYIMPGACSLADHILLRWSGSSFDLQFLDHQSMKAPEYLALNPSGAVPALQVGDWVLTQNAAILNYITDIAPAERGLSGDGSLKARAEINRWIAFSNSDVHPMYWALFGGTAYLQDPQMIARSQDNARQKLRVLYQRADAHLKHHNWLANGQRSGADAYLYVTLRWAKKVGVDLSSLDALSAFFERMEADPGVQAALQAEGLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLUTATHIONE-S-TRANSFERASE
publication title Structural and Biophysical Characterization of the Recombinant Glutathione-S-Transferase from Xylella
rcsb
source organism Xylella fastidiosa
total genus 76
structure length 206
sequence length 206
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2x64A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2x64A01
4PQ1A 5DAKA 3F8UA 3F4SA 3QOUA 1WIKA 1DUGA 2HQTA 3ERGA 3US3A 1EP8A 4HZ2A 2ZUPA 3D5JA 5G2ZA 2CX4A 2OACA 5CRGA 1W4VA 4POLA 2HRFA 5F8BA 1BAYA 2IFQB 2VLUA 3A3TA 3GYKA 3KH7A 3ZMKA 1JZOA 5CAXA 2Z9SA 4G0IA 5G5FA 4KX4A 1WJKA 3IAS2 2OBIA 2G2QA 3GMFA 4TOPA 4OO5A 3EYTA 3DWVA 4KSOA 5ECLB 2B3SA 4TR1B 3BOAA 4HUAA 3ZZXA 2LNSA 4MPFA 5ECKB 4XTSA 5ECIB 1S3DA 1PX6A 1EOGA 4Q5RA 1YF1A 5IO2A 1EGOA 4PTSA 2C1YA 3TJKA 4HU7A 1DSBA 4L5OA 1F9MA 4OCFA 2GQKA 2VL9A 1FOVA 2B1LA 3GH6A 4LL1B 1F3AA 1W89A 3LJRA 3L9VA 2C0FA 2CZ2A 5F07A 1XWKA 3TJJA 2VCZA 2NBSA 5ID2A 2I1UA 4EE0A 4KF9A 3M0FA 1TW9A 3GKKA 5CP1A 3QD9A 1EV9A 1GSUA 4K6XA 4IBPA 1TK8B 3F4RA 4G19A 3MDKA 3LG6A 2V2GA 1GTBA 2O89A 1Z9HA 3D4TA 2H1AA 4CHSA 1EP7A 1AXDA 2V6OA 1SYRA 2IL3A 5HFGA 2MBSA 7GSSA 4IHUA 5F06A 3HXSA 5DALB 3R2QA 2FWFA 3G9BA 2PPTA 4DEJA 3HVVA 3GSTA 1ZOFA 1TRWA 2R6KA 4LLRA 2FGXA 3TDGA 1U88A 3LGCA 1QQ2A 2QSIA 3LSZA 5KN0A 2F8AA 1NM3A 3MNGA 3FZ5A 1GTAA 2F3MA 1KTEA 2DC5A 4MCUA 4F9ZA 4ULXA 2QGVA 2DJJA 2JZTA 3H1NA 4OO4A 4GSNA 2YWIA 5AISA 1ZYEA 3HY2A 3ZIJA 5FT3A 3E0UA 2VCWA 2OBKA 2R5GA 1A24A 1AAZA 1R5PA 4QL7A 4NWYA 1H4OA 4ZB8A 2ES7A 2N5AA 2WGRA 4HOJA 1FHEA 3NZNA 3CRUA 3ZRDA 1AQVA 2N5FA 3ME8A 2X8CA 3APSA 2YJHA 2MMOA 1VRSD 3F6DA 2REMA 1GWCA 5A4VA 2K9FA 2X8HA 1SL0B 2LJRA 5L71A 5LNKe 2H01A 1J9BA 3WGXA 2P0GA 4L0WA 3ME7A 3D21A 4MLYA 4ZILA 3ZREA 5COHA 1SU9A 4IS0A 2FA8A 4MJAA 3EMXA 5CRHA 5INYA 1JZWA 2FLSA 3HZ8A 1TJDA 1WP0A 3TKSE 4ECJA 1TOFA 2PN8A 5JCGA 5B6MA 4ZL7A 1GLQA 1T4YA 2KP1A 5CRWA 4HEA2 2CAQA 2XPEA 2MMNA 4EL1A 2LJKA 3E9JB 2DSAA 1Z5YE 4K7IA 1B4PA 4Q5FA 1PA3A 2HZEA 2LQQA 1QK8A 4JR4A 1GNWA 2H70A 2DLXA 2XPDA 5D8IA 2GZPA 1B4QA 2VM1A 18GSA 1V98A 3TB2A 2CAIA 5IMVA 2MYGA 1YJ6A 4PGTA 4BWSA 1YEPA 3HKRA 2KUCA 2XC2A 1GSSA 1ERTA 2B7JA 2HRKA 3IPZA 3Q6OA 2FWEA 1VF1A 2WDUA 1TKDB 3I43A 3ZLPA 1SKRB 4NV2A 2IMDA 2HZFA 4PUFC 3MSZA 4HJMA 4EDYA 3QR6A 4N30A 4POBA 1YQ1A 4XCSA 2IMKA 5G5EA 2YV9A 2H6ZA 1GTUA 3EINA 1O6JA 1EZKA 4MK3A 1TK5B 2H19A 1T8EB 3ZFLA 3UEMA 1JFUA 2HSYA 4L8EA 4D73B 1U6TA 3DVXA 2PGTA 2TRXA 2OE1A 3J7Yb 2L4CA 2LTKA 1GH2A 1JHBA 4ZXGA 1PL2A 4F82A 3M1GA 3S9FA 3GTUB 3KCMA 3C7MA 1G0TA 5IMFA 1C72A 3ED3A 3UL3A 4MZCA 4EDZA 4JE1A 3R3EA 4GSTA 4BWQA 3VWWA 1T1VA 2DMLA 1ST9A 2JSYA 1BYEA 4JU5A 4O92A 2K8VA 2ON5A 1E6BA 1GP1A 1PN9A 2GSQA 4TKYA 2VM2A 3QAVA 1M2AA 1XWAA 5IMZA 1WPIA 5JWRB 4IJ3A 1OYJA 3CXGA 2XBIA 4PQIA 2OE0A 1NHOA 4XRDA 2GVPA 3BJ5A 1TI1A 1TU7A 4K7OA 1MTCA 5ELAA 2M80A 5JWQB 2VAFA 3KP9A 1GLPA 1M2DA 1S3AA 2YNXA 4F2IA 5J9BA 2IJYA 4I8BA 3UARA 3UBKA 3M8NA 3LQ7A 3GX8A 4WKWA 4BPYA 4BVYA 1LJRA 2X8GA 1EEMA 4ZIJA 1M7TA 4FYBA 4MJEA 1Q98A 4H86A 1ERVA 4HU9A 3EC3A 1XIYA 4X1UA 3RHCA 5CREA 4IQ1A 4ACSA 4G0LA 1XZOA 2LUSA 4KSMA 3HA9A 2HSMB 4FYCA 2GLRA 3DRNA 3TRPA 1GUHA 4MDCA 1TU8A 4ISDA 2JSZA 1T4ZA 3ERFA 4KW6A 1PMTA 1OC9A 1G7EA 2HI7A 2K6VA 1EGRA 4YQMA 4HZ4A 2VLTA 3M3MA 3DEXA 2RM6A 5HR3A 12GSA 2H0HA 2O8VB 3WYWA 3IAM2 4AJ7A 2H1GA 2DJ1A 2LS5A 2E0QA 2CV4A 5CO3A 4MF5A 6GSSA 3VPQA 1O8XA 4N0ZA 4HQSA 4KH7A 2H0IA 1DE1A 1PQNA 4GSSA 5A4UA 1Z7RA 2VL2A 1K3LA 3KXOA 1XXUA 1TTZA 5D73A 3UVTA 4FH8A 1V9WA 4QL9A 2JACA 3U5RE 2KLXA 2PMTA 5KN1A 3MAKA 2DJ3A 2A2RA 2P31A 4WR4A 1KEBA 4AGSA 1K0MA 4DSSA 2PWJA 1KNGA 1X5CA 5AIVA 1G6WA 2GQLA 2XBQA 4I97A 4IGJA 4ZBBA 3IXRA 1V58A 4TR3A 1EOHA 1UA5A 1XW9A 2VL2C 1T00A 3F63A 3U6VA 3N5OA 5J5NA 2V41A 2A2SA 4GF0A 2C3NA 3GH9A 2H76A 5E4WA 3UAPA 5D9VA 3TOUA 3FRCA 5DJMA 4MF6A 1SJ6A 3LXZA 4HJ2A 3ZYWA 1AUCA 4GCIA 1QXHA 3APOA 4LA1A 2NPBA 1MDKA 1V2AA 1AIUA 1A2LA 1VF2A 1FG4A 4MMMA 3GL5A 3GX0A 3IA1A 1ACVA 1OKTA 2AB6A 4N0VA 3W8SA 4NMUA 4AF2A 3MWHA 1BG5A 4NHZA 1GRXA 4J56E 3CSHA 3HJMA 3IDVA 2JL4A 1XWBA 3AY8A 1GSFA 2C0GA 3OR5A 6GSYA 1MDJA 1RK4A 4BL7B 3HZ4A 3D0ZA 1S3CA 1I5GA 2HYXA 1PD21 4MJCA 3IHQA 19GSA 3I9V2 5JWOB 3L4NA 3NOFA 2E2GA 2X99A 4MH2A 2OA7A 1LU4A 3H8QA 2YZUA 4MP4A 3RBTA 1X9WB 5HR0A 3ZITA 2LJAA 4IP6A 4K2DA 1SENA 2QKEA 2YOIA 3KTLA 5G1LA 1NHYA 1WWJA 3C8EA 3HYPA 2ON7A 2LRNA 4PURA 1WE0A 2PERA 2OADA 4K8MA 1QUWA 2GZYA 4ZL8A 2VUPA 4GWRA 3SBCA 1FAAA 5IO0A 5DCHA 3ZIVA 4O7HA 2H1BA 4KUNA 3GUSA 5LCZA 4BVXA 3DIEA 4XRAA 4V1Ap 1R26A 1RW1A 5JCWA 4ZB9A 3QAGA 2YJ7A 4V2LA 3IV4A 3PH9A 1VF4A 2B7KA 2GT6A 2BJXA 3VURA 4K7NA 4MA9A 1FB6A 3EVIA 1O7UA 4GQCA 1VF3A 1TXXA 4FO5A 3H4KA 3M9JA 2I9HA 4GRFA 4POKA 2VCTA 2WJUA 2E7PA 3DMLA 5EPFA 4EUYA 2H73A 4JR6A 1A2MA 4LL4B 3FYGA 5G1KA 4EF0A 4TR4A 2H6XA 3O76A 5ECSA 1SKWB 4F0BA 2PUKC 4FQUA 1WMJA 3BCKA 4WBJA 3I69A 1PL1A 4TXOB 4I5QA 1JLVA 1J08A 1FVKA 2LRCA 2YCDA 4MPGA 2L5OA 1PRXA 3E3EA 1M99A 2C8UA 4I6XA 1SD9A 5DBQA 3HHVA 2IPAA 4J57E 4MF7A 3ZTLA 5ABRA 5B6NA 5DAKB 4MZBA 3TKQA 3QDNA 1G6YA 2B1KA 3G7IA 5DCGA 3PINA 5IMDA 4KNDA 5IM9A 4RI7A 5D93A 11GSA 3BBYA 1TRUA 4RQRA 3RPPA 2YANA 3UOMA 3L9UA 4POMA 4MABA 1AW9A 5ELGA 2I4AA 4XHMA 2RLIA 5IPHA 3FY7A 2MMAA 2AV4A 2GQMA 2VIMA 5LD0A 2CVDA 2RUFA 4X0XA 3TGZA 3DGQA 1FO5A 1K0AA 4IP1A 1R4WA 5J3RA 4LMVA 5ECHB 3C1RA 4EO3A 1X0RA 3V1WA 1ERUA 3IRAA 2BTOT 4HI7A 2LKUA 4O32A 4Z7XA 3VLNA 2PVQA 2QC7A 3A2VA 1UC7A 1A8LA 2R37A 1EWXA 2YWNA 2RM5A 4MZWA 2FHEA 4IELA 2DMMA 3CTFA 4E8EA 3BD2A 3W8JA 3KD0A 1A8YA 2C80A 5CRDA 3K8NA 3CMIA 2IFQA 1PSQA 5A4WA 2YP6A 5ENUA 4TXVA 4OWYA 5ID2B 1O85A 4I2TA 2VD1A 3Q19A 6GSXA 4WF5A 2UZ8A 2N5BA 3VWXA 1Y6EA 9GSSA 1CQHA 1IYHA 4HQZA 4OFMA 1HQOA 1YZXA 2WZ9A 4WXTA 1J0FA 2DIZA 4TR1A 4G2EA 1ZMAA 1E2YA 2JZRA 3KTBA 2B5XA 1V40A 2O87A 2OE3A 4NXIA 3KJYA 2C0DA 3M9KA 4ZBDA 2AUVA 1ABAA 1O73A 2EIQA 2HNLA 2L59A 3PPUA 3HCZA 4MJBA 1M9BA 4K0NA 1PKZA 1GL8A 1YF0A 1OKDA 3ZVJA 3TJBA 1TDIA 3LXTA 1TRSA 1AQWA 2WCIA 2E2MA 3F4TA 1QFNA 2EIOA 2KP2A 3FHKA 2GS3A 5F0GA 5IMAA 5KEJA 2VO4A 4WETA 2ALBA 4PNFA 2H8LA 3HJOA 4EKZA 2HE3A 1HNCA 4KDYA 1Z6MA 4ZB6A 5ECQB 2DIYA 5C04A 4PQHA 3CSIA 3O6TA 3A5WA 2YN1A 5DALA 2TRCP 5AGYA 5H5SA 1YDKA 1RQMA 2FUG2 2LV3A 1AQXA 1GUMA 2H0GA 1G7OA 4ML1A 3LORA 2H1DA 2GSSA 5ECOB 5DVBA 1O81A 2IWTA 2HSNB 3TRQA 2AJQB 2L6CA 3KIJA 1H75A 3VI7A 1BJXA 4XS4B 2FWHA 1Z7PA 2P5RA 1MD4A 2L4QA 5C00A 1K0BA 2F8FA 3L78A 1Y25A 4EXJA 1K0CA 4O5RA 5GAPD 2P5QA 1AC1A 5IOWA 2L57A 4YAPA 2FD3A 1X5DA 1YKAA 2FA4A 3GL3A 1GNEA 1YY7A 3P8WA 1OC8A 2CVKA 2PU9C 2HZEB 3GA4A 5GSTA 1BEDA 1IYIA 4HDEA 3WGDA 3LWAA 2C0EA 5ECNB 2B6MA 5IMCA 4KGIA 4V2NA 1K3OA 4KDXA 4YQUA 1N2AA 3DD3A 3IBHA 1X5EA 3CYNA 3IR4A 4GTUA 5EY6A 1ZL9A 1JZDA 4PXOA 4NHWA 3UJ1A 1FW1A 2HLSA 2AAWA 2DJKA 1EEJA 10GSA 3C1SA 2NTOA 2AYTA 1JZRA 2GDRA 3FR3A 2FWGA 3WGEA 2HRKB 2L6DA 1ZYQB 3TOTA 2WULA 3UBLA 5GZZB 3EURA 2O7KA 5J9CA 5E59A 2IMEA 4IW9A 1R7HA 2M46A 4TW5A 4L0UA 3VFIA 3VWUA 4F03A 3F9UA 3FW2A 1F37A 4DSRA 3GSSA 4ECBA 1N8JA 4TN8A 3KP8A 1GSDA 1K0NA 2LEGA 1DE2A 2VLVA 2H71A 1F2EA 5ECPB 1QMVA 2VCXA 4IN0A 3RPNA 3N9JA 1U3IA 5DDLA 4V1Ag 1XW5A 2G0FA 3J7Yk 1ZCPA 1XOAA 5FWGA 3H79A 1CQGA 1SJZA 5CNWA 3F6FA 4K1FA 2V1MA 2M72A 3JCML 3FZAA 3CRTA 2I81A 4WEYA 3QPMA 1GSQA 4N10A 1ON4A 5DQSA 5BMUA 3QMXA 4OD7A 2R2JA 3Q74A 1GULA 3KH9A 4ZBAA 5FHIA 3PR8A 1THOA 1GTIA 1I9DA 2ZCTA 1MDIA 3F3RA 1K0DA 3CBUA 3CTGA 5KN2A 3WD6A 2A4VA 2AHEA 1PGTA 5HR1A 4DSQA 5IOXA 2GGTA 1HNAA 2XHFA 1F3BA 3GNJA 1XCCA 2R3XA 2HSHA 1WOUA 4D73A 2DJ2A 1B48A 4PX1A 4XS6A 2H75A 4V2MA 3EU3A 1XWGA 1YEXA 2B5EA 22GSA 1XPVA 3GTUA 1XFLA 3TKPA 2H74A 4G0KA 1K3YA 4KAEA 2C4JA 1XBSA 1B9YC 4BVYB 3GFKA 5ECMB 3NIVA 4IVFA 2MZCA 4EVMA 2H72A 4Q5QA 3IK9A 5JCUA 1XWCA 4N11A 1SJIA 3PGTA 3IC4A 5H5RA 2BMXA 8GSSA 1SK2A 1UVZA 3Q18A 2KHPA 4FYUA 4EC0A 4P3YB 1K0OA 5GAND 3FEUA 1LBKA 4GLTA 2CT6A 5B7CA 1SD8A 5G31A 2F51A 3FR9A 3KMOA 4J2FA 2H6YA 3IOSA 2LSTA 3IK7A 3H93A 2PVOC 3HVXA 2F9SA 1OC9B 2GT5A 2WB9A 4I2UA 2LQOA 1USBA 5HQPA 4WR5A 5H5QA 4TVEA 5F05A 2OKAA 3A2XA 4YH2A 14GSA 1OC3A 3APQA 3TUEA 1THXA 4XS1A 2FY6A 3D6IA 3EU4A 2NDOA 4KDUA 3VPTA 2JZSA 5HFKA 1XOBA 1OAZA 20GSA 3QAWA 1MD3A 4KCEA 4L5LA 1BQ7A 2HRNA 1TK0B 3F3QA 1V57A 1OE8A 1SYXA 1R5AA 2HSMA 5EVOA 3L9SA 6GSVA 3HD5A 3DKSA 3QFAC 3EWLA 5D9XA 1JLWA 3LYPA 5B8BA 2R4VA 4KE3A 1OVNA 5HFIA 4XS4A 2K18A 3LEFA 3WT2A 1DBYA 1B9XC 1XVWA 2CQ9A 4DSSB 5J4UA 3KEBA 2FCHA 5CYYA 3GIXA 1SK1A 1QGVA 4USSA 5D9WA 1HYUA 5GSSA 4LMWA 3G7JA 4QQ7A 4ECIA 4IKHA 6GSUA 3P7XA 3KMNA 4ECCA 4NAXA 1O8WA 2H66A 2C3QA 3FR6A 3GKXA 4TRXA 3HDCA 3GHAA 1M9AA 3ZL5A 4OFTA 1EV4A 3ZMLA 4KA0A 1A0RP 1B8XA 4G9HA 3ZFBA 1PKWA 2VCQA 1Z3EA 3C73A 4AJ8A 2D2ZA 3RHBA 4DVCA 3P2AA 2CX3A 4IQAA 4KCAA 1A0FA 1TP9A 2CVBA 4ID0A 2IN3A 2YV7A 1SL2B 17GSA 4RUVA 5IIZA 3RDWA 2NVLA 2B5YA 2CA8A 3VI5A 3GURA 4NV5A 5DJLA 4G10A 3LYKA 3D4MA 3DVWA 3BCIA 4JZQA 5D9TA 2L5LA 2PBJA 2WRTA 4RI6A 3UIWA 4E8HA 4YAVA 3A2WA 4WBRD 4YQVA 3KGKA 2DBCA 3TJGA 4WF4A 2C3TA 1KBNA 2YPMA 3IE3A 4JEDA 5IQYA 2YWOA 3QFBC 5J41A 1VGLA 2I3YA 3GN3A 1WRYA 3GRXA 6GSWA 3DYRA 2VCVA 2J23A 2MBTA 2VD0A 1TRVA 3P90A 1GSYA 2DJ0A 3TJFA 3L0HA 1GSEA 4BA7A 4Q5NA 1F6MC 1Z6NA 4HS1A 1ILOA 1TI3A 1PX7A 3UMAA 4AJ6A 2X64A 3QCPA 3VWVA 1BX9A 4JBBA 2HT9A 2LRTA 1MEKA 1NSWA 4XIHA 2ZNMA 4BL7A 1Q4JA 3FK8A 2V6KA 5IPGA 3UVHA 1T7PB 2IMIA 2VOCA 3TKSA 1UN2A 3D22A 4BVXB 4ZL9A 1ML6A 5D96A 1SKSB 5AN1A 1U3AA 4OMVA 1X9MB 4F0CA 5AIXA 3WT1A 1SL1B 3GKNA 4RQXA 2TIRA 2MMZA 1U87A 3FKFA 3O3TA 1ERWA 3EE2A 4FIWA 1FVJA 3LFLA 1M2BA 2GTUA 3CSJA 3TCOA 3GKMA 4JRRA 4TR0A 3FZ9A 3EMPA 3TKSC 1ZZYA 3C71A 16GSA 3I6AA 2OJLA 4NPBA 4IJIA 4ILFA 3VK9A 1X9SB 2HXKA 2RIIA 2JU5A 2RUEA 2EC4A 4PNGA 3KM6A 4GQFA 1YKCA 4X43A 4K0GA 5DQYA 13GSA 2WS2A 4MH3A 1NW2A 5KN3A 2K8SA 1ZGNA 3W6GA 5ECRB 3HJPA 2CZ3A 2GSTA 1A23A 2IMFA 3SWLA 3FZ4A 4K9ZA 2EIRA 1HNBA 4CDOA 4ML6A 4CW9A 5A5KA 6GSTA 2O85A 3GV1A 2KOKA 1URMA 2LNTA 2V32A 3TKRA 2IIYA 5G30A 1FB0A 1SK0A 5B8AA 2H30A 1M0UA 2VL3A 3G7YA 2J9HA 2HRAA 2WFCA 2FNOA 2GSRA 3IC8A 1XVQA 4OFNA 2GZZA 3HVSA 3DXBA 1HD2A 4TXOA 3TRXA 1OE7A 5HR2A 1XW6A 3KZQA 4OCEA 3RAZA 2YZHA 2HFDA 3ISOA 5EL8A 3ERWA 2YWMA 1GUKA 4PUAA 1T3BA 3ZVJD 2JADA 1A2JA 4KB3A 4GXZA 3F0IA
chains in the Genus database with same CATH superfamily
4PQ1A 5DAKA 3F8UA 3F4SA 3QOUA 1WIKA 1DUGA 2HQTA 3ERGA 3US3A 4PHZC 1EP8A 4G01A 4HZ2A 2ZUPA 3D5JA 5G2ZA 2CX4A 2OACA 5CRGA 1W4VA 4POLA 2HRFA 5F8BA 1BAYA 2IFQB 2VLUA 3A3TA 3GYKA 3KH7A 3ZMKA 1JZOA 5CAXA 2Z9SA 4G0IA 5G5FA 4KX4A 1WJKA 3IAS2 2OBIA 2G2QA 3GMFA 4TOPA 4OO5A 3EYTA 4A5PA 3DWVA 4KSOA 5ECLB 2B3SA 4TR1B 3BOAA 4HUAA 3ZZXA 2LNSA 4MPFA 5ECKB 4XTSA 5ECIB 1S3DA 1PX6A 1EOGA 4Q5RA 4CY8A 1YF1A 5IO2A 1EGOA 2QA1A 4PTSA 2C1YA 3TJKA 4HU7A 1DSBA 4L5OA 1F9MA 4OCFA 2GQKA 2VL9A 1FOVA 4EIQA 2B1LA 3GH6A 4LL1B 1F3AA 1W89A 3LJRA 3L9VA 2C0FA 2CZ2A 5F07A 1XWKA 3TJJA 2VCZA 2NBSA 5ID2A 2I1UA 4EE0A 4KF9A 3M0FA 1TW9A 3GKKA 5CP1A 3QD9A 1EV9A 1GSUA 4K6XA 4IBPA 1TK8B 3F4RA 4G19A 3MDKA 5J47A 3LG6A 2V2GA 1GTBA 2O89A 1Z9HA 3D4TA 2H1AA 4CHSA 1EP7A 1AXDA 2WVXA 2V6OA 1SYRA 2IL3A 5HFGA 2MBSA 7GSSA 4IHUA 5F06A 3HXSA 5DALB 3R2QA 2FWFA 3G9BA 2PPTA 4DEJA 3HVVA 3GSTA 1ZOFA 1TRWA 2R6KA 4LLRA 2FGXA 3TDGA 1U88A 3LGCA 1QQ2A 2QSIA 3LSZA 5KN0A 2F8AA 1NM3A 3MNGA 3FZ5A 1GTAA 2F3MA 1KTEA 2DC5A 4MCUA 3MIXA 4F9ZA 4ULXA 2QGVA 2DJJA 2JZTA 3H1NA 4OO4A 4GSNA 2YWIA 5AISA 1ZYEA 3HY2A 3ZIJA 5FT3A 3E0UA 2VCWA 2OBKA 2R5GA 1A24A 4X4JA 1AAZA 1R5PA 4QL7A 4NWYA 1H4OA 4ZB8A 2ES7A 2N5AA 2WGRA 4HOJA 2R0GA 1FHEA 3NZNA 3CRUA 3ZRDA 1AQVA 2N5FA 4K5RA 3ME8A 2X8CA 3APSA 4ICYA 2YJHA 2MMOA 1VRSD 3F6DA 2REMA 1GWCA 5A4VA 2K9FA 2X8HA 1SL0B 2LJRA 5L71A 5LNKe 2H01A 1J9BA 3WGXA 2P0GA 4L0WA 3ME7A 3D21A 4MLYA 4ZILA 3ZREA 5KOWA 5COHA 1SU9A 4IS0A 2HSNA 2FA8A 4MJAA 3EMXA 5CRHA 5INYA 1JZWA 2FLSA 3HZ8A 1TJDA 1WP0A 3TKSE 4ECJA 1TOFA 2PN8A 5JCGA 5B6MA 2DKHA 3CQFA 4ZL7A 1GLQA 1T4YA 2KP1A 5CRWA 4HEA2 2CAQA 2XPEA 2MMNA 4EL1A 2LJKA 3E9JB 2DSAA 1Z5YE 4K7IA 1SVMA 1B4PA 4Q5FA 3LW9A 1PA3A 2WW3A 2HZEA 2WW0A 1QK8A 2LQQA 4JR4A 1GNWA 2H70A 2DLXA 2XPDA 5D8IA 2GZPA 1B4QA 2VM1A 18GSA 1V98A 3TB2A 1YEWC 4N3ZA 2CAIA 5IMVA 2MYGA 1YJ6A 4PGTA 4BWSA 1YEPA 3HKRA 3A5IA 2KUCA 2XC2A 1GSSA 1ERTA 2B7JA 2HRKA 3IPZA 3Q6OA 2FWEA 1VF1A 2WDUA 2O5VA 1TKDB 3I43A 3ZLPA 1SKRB 4NV2A 5BMUB 2IMDA 2HZFA 4PUFC 3MSZA 4HJMA 4EDYA 3QR6A 4N30A 4POBA 1YQ1A 4XCSA 2IMKA 5G5EA 2YV9A 2H6ZA 1GTUA 3EINA 1O6JA 1EZKA 4MK3A 1TK5B 2H19A 1T8EB 3ZFLA 3UEMA 1JFUA 2HSYA 4L8EA 4D73B 1U6TA 3DVXA 2PGTA 2TRXA 2OE1A 3J7Yb 2L4CA 2LTKA 1GH2A 1JHBA 4ZXGA 1PL2A 4F82A 3M1GA 3S9FA 3GTUB 3KCMA 3C7MA 1G0TA 5IMFA 1C72A 3ED3A 3UL3A 4MZCA 4EDZA 4JE1A 3R3EA 4GSTA 4BWQA 3VWWA 4E68A 1T1VA 2DMLA 1ST9A 2JSYA 1BYEA 4JU5A 4O92A 2K8VA 2ON5A 1E6BA 1GP1A 1PN9A 2GSQA 2WZSA 4TKYA 2VM2A 3QAVA 1M2AA 1XWAA 5IMZA 1WPIA 5JWRB 4IJ3A 1OYJA 3CXGA 2XBIA 4PQIA 2OE0A 1NHOA 4XRDA 2GVPA 3BJ5A 1TI1A 1TU7A 4K7OA 1MTCA 5ELAA 2M80A 5JWQB 2VAFA 3KP9A 1GLPA 1M2DA 1S3AA 2YNXA 4F2IA 5J9BA 2IJYA 4I8BA 3UARA 3UBKA 3M8NA 3LQ7A 3GX8A 4WKWA 4BPYA 4BVYA 1LJRA 2X8GA 1EEMA 4ZIJA 1M7TA 4FYBA 4MJEA 1Q98A 4H86A 1ERVA 4HU9A 2WW2A 3EC3A 1XIYA 4X1UA 2X4AA 3RHCA 5CREA 4IQ1A 4ACSA 4G0LA 1XZOA 2LUSA 4KSMA 3HA9A 2HSMB 4FYCA 2GLRA 3DRNA 3TRPA 1GUHA 4MDCA 1TU8A 4ISDA 2JSZA 1T4ZA 3ERFA 4KW6A 5A5HB 1PMTA 1OC9A 1G7EA 2HI7A 2K6VA 1EGRA 4YQMA 4HZ4A 2VLTA 2EFDA 3M3MA 3DEXA 2RM6A 5HR3A 12GSA 2H0HA 2O8VB 3WYWA 3IAM2 4AJ7A 2H1GA 2DJ1A 2LS5A 2E0QA 2CV4A 5CO3A 4MF5A 6GSSA 3VPQA 1O8XA 4N0ZA 4HQSA 4KH7A 2H0IA 1DE1A 1PQNA 4GSSA 5A4UA 1Z7RA 2VL2A 1K3LA 3KXOA 1XXUA 1TTZA 5D73A 3UVTA 4FH8A 1V9WA 4QL9A 2JACA 3U5RE 2KLXA 2PMTA 5KN1A 3MAKA 2DJ3A 2A2RA 2P31A 4WR4A 1KEBA 1PN0A 4AGSA 1K0MA 3HMJG 2A4HA 4DSSA 2PWJA 1KNGA 1X5CA 5AIVA 1G6WA 2GQLA 2XBQA 3EPTA 4I97A 4IGJA 4ZBBA 3IXRA 1V58A 4TR3A 1EOHA 1UA5A 1XW9A 2VL2C 1T00A 3F63A 3U6VA 3N5OA 1S4BP 5J5NA 2V41A 2A2SA 4GF0A 2C3NA 3GH9A 2H76A 5E4WA 3UAPA 5D9VA 3TOUA 3FRCA 5DJMA 4MF6A 1SJ6A 3LXZA 4HJ2A 3ZYWA 1AUCA 4GCIA 1QXHA 3APOA 4LA1A 2NPBA 1MDKA 1V2AA 1AIUA 1A2LA 1VF2A 1FG4A 4MMMA 4MNNA 3GL5A 3GX0A 3IA1A 1ACVA 1OKTA 2AB6A 4PI0C 4N0VA 3W8SA 4EIPA 4NMUA 4AF2A 3MWHA 1BG5A 4NHZA 1GRXA 4J56E 2O3EA 3CSHA 3HJMA 3IDVA 2JL4A 1XWBA 3AY8A 1GSFA 2C0GA 3OR5A 6GSYA 1MDJA 1RK4A 4BL7B 3HZ4A 3D0ZA 1S3CA 1I5GA 2HYXA 1PD21 1S3RA 4MJCA 3IHQA 4CY6A 19GSA 3I9V2 5JWOB 3L4NA 3NOFA 2E2GA 2X99A 4MH2A 2OA7A 1LU4A 3H8QA 2YZUA 4MP4A 3RBTA 1X9WB 5HR0A 3ZITA 2LJAA 4IP6A 4K2DA 1SENA 2QKEA 2YOIA 3KTLA 5G1LA 1NHYA 1WWJA 3C8EA 3HYPA 5J4YA 2ON7A 2LRNA 4PURA 1WE0A 2PERA 2OADA 4K8MA 1QUWA 2GZYA 4ZL8A 2VUPA 4GWRA 3SBCA 1FAAA 5IO0A 5DCHA 3ZIVA 4Z2TA 4O7HA 2H1BA 4KUNA 1PFOA 1XG8A 3GUSA 5LCZA 4BVXA 3DIEA 4XRAA 4V1Ap 1R26A 1RW1A 5JCWA 4ZB9A 3QAGA 2YJ7A 4V2LA 3IV4A 3PH9A 1VF4A 2B7KA 2GT6A 4YKGA 2BJXA 3VURA 1M3IA 4K7NA 4MA9A 1FB6A 3EVIA 1O7UA 4GQCA 1VF3A 4K5SA 1TXXA 4FO5A 3H4KA 3M9JA 2I9HA 4GRFA 4POKA 5A34A 2VCTA 2WJUA 2E7PA 3DMLA 5EPFA 5A1NA 2WVYA 4EUYA 2H73A 4JR6A 1A2MA 4LL4B 3FYGA 4AKHA 5G1KA 4EF0A 4TR4A 2H6XA 3RFRC 3O76A 5KOXA 5ECSA 1SKWB 4F0BA 2PUKC 4FQUA 1WMJA 3BCKA 4WBJA 3I69A 1PL1A 4TXOB 4I5QA 1JLVA 1J08A 1FVKA 2LRCA 2YCDA 4MPGA 2L5OA 1PRXA 3E3EA 1M99A 2C8UA 4I6XA 1SD9A 5DBQA 3HHVA 2IPAA 4J57E 4MF7A 3ZTLA 5ABRA 5B6NA 5DAKB 4MZBA 3TKQA 3QDNA 1G6YA 2B1KA 3G7IA 5DCGA 3PINA 5IMDA 4KNDA 5IM9A 4RI7A 5D93A 11GSA 3BBYA 1TRUA 4RQRA 3RPPA 2YANA 3UOMA 3L9UA 4POMA 4MABA 1AW9A 4O5UA 5ELGA 2I4AA 4XHMA 2RLIA 5IPHA 3FY7A 2MMAA 2AV4A 2GQMA 2VIMA 5LD0A 2CVDA 2RUFA 4X0XA 3TGZA 3DGQA 1FO5A 1K0AA 4IP1A 1R4WA 5J3RA 4LMVA 5ECHB 3C1RA 4EO3A 1X0RA 3V1WA 1ERUA 1FOHA 3IRAA 2BTOT 4HI7A 2LKUA 4O32A 4Z7XA 3VLNA 2PVQA 2QC7A 3A2VA 1UC7A 1A8LA 2R37A 5J40A 1EWXA 4AI6A 2YWNA 2RM5A 4MZWA 2FHEA 4IELA 2DMMA 3CTFA 4E8EA 2O36A 5J4VA 3BD2A 3W8JA 3KD0A 2WW1A 1A8YA 2C80A 5CRDA 3K8NA 3CMIA 2IFQA 1PSQA 5A4WA 2YP6A 5ENUA 4TXVA 4OWYA 5ID2B 1O85A 4I2TA 2VD1A 3Q19A 6GSXA 4WF5A 2UZ8A 4BIKA 2N5BA 3VWXA 1Y6EA 9GSSA 1CQHA 1IYHA 4HQZA 4OFMA 1HQOA 1YZXA 2WZ9A 4WXTA 1J0FA 3TU3B 4FXYP 2DIZA 4TR1A 4G2EA 1ZMAA 1E2YA 2JZRA 3KTBA 2B5XA 1V40A 2O87A 2OE3A 2WVXB 3RGBC 4PI2C 4NXIA 3KJYA 2C0DA 3M9KA 4ZBDA 2AUVA 1ABAA 1O73A 2EIQA 2HNLA 2A2PA 2L59A 3PPUA 3HCZA 4MJBA 1M9BA 4K0NA 1PKZA 1GL8A 1YF0A 1OKDA 3ZVJA 3TJBA 1TDIA 3LXTA 1TRSA 1AQWA 2WCIA 2E2MA 3F4TA 1QFNA 2EIOA 2KP2A 3FHKA 2EFHA 2GS3A 5F0GA 1YVLA 5IMAA 5KEJA 2VO4A 4WETA 2ALBA 4PNFA 2H8LA 3HJOA 4EKZA 2HE3A 1HNCA 4KDYA 1Z6MA 4ZB6A 5ECQB 2DIYA 5C04A 4O5QA 1BF5A 4PQHA 3CSIA 3O6TA 3A5WA 2YN1A 5DALA 2TRCP 4AKXB 5AGYA 5H5SA 1YDKA 1RQMA 2FUG2 2LV3A 1AQXA 1GUMA 2H0GA 1G7OA 4ML1A 3LORA 2H1DA 2UV8G 2QA2A 2GSSA 5ECOB 5DVBA 1O81A 2X49A 2IWTA 2HSNB 3TRQA 1BG1A 2AJQB 2L6CA 3KIJA 1H75A 3VI7A 1BJXA 4XS4B 2FWHA 1Z7PA 2P5RA 1MD4A 2L4QA 5C00A 1K0BA 2F8FA 3L78A 1Y25A 4EXJA 1K0CA 4O5RA 5GAPD 2P5QA 1AC1A 4AKGA 5IOWA 2L57A 4YAPA 2FD3A 1X5DA 1YKAA 2FA4A 1M3JA 4GDFA 3CHXC 3GL3A 1GNEA 1YY7A 3P8WA 1OC8A 2CVKA 2PU9C 2HZEB 3GA4A 5GSTA 1BEDA 1IYIA 4HDEA 3WGDA 2C0EA 3LWAA 5ECNB 2B6MA 5IMCA 4KGIA 4V2NA 1K3OA 4KDXA 4YQUA 1N2AA 3DD3A 3IBHA 1X5EA 3CYNA 3IR4A 4GTUA 5EY6A 1ZL9A 1JZDA 4PXOA 4NHWA 3UJ1A 1FW1A 2HLSA 2AAWA 2DJKA 4K2XA 1EEJA 10GSA 3C1SA 1ZYPA 2NTOA 2AYTA 1JZRA 2GDRA 3FR3A 2FWGA 3WGEA 2HRKB 2L6DA 1ZYQB 3TOTA 2WULA 3UBLA 5GZZB 3EURA 2O7KA 5J9CA 5E59A 2IMEA 4IW9A 1R7HA 2M46A 4TW5A 4L0UA 3VFIA 3VWUA 4F03A 3F9UA 3FW2A 1F37A 4DSRA 3GSSA 4ECBA 1N8JA 4TN8A 3KP8A 1GSDA 1K0NA 2LEGA 1DE2A 2VLVA 2H71A 1F2EA 5ECPB 1QMVA 2VCXA 4IN0A 3RPNA 3N9JA 1U3IA 5DDLA 4V1Ag 1XW5A 2G0FA 3J7Yk 1ZCPA 1XOAA 5FWGA 3H79A 1CQGA 1SJZA 5CNWA 3F6FA 4K1FA 2V1MA 2M72A 3JCML 3FZAA 2VKZG 3CRTA 2I81A 4WEYA 3QPMA 1GSQA 4N10A 1ON4A 5DQSA 5BMUA 3QMXA 4OD7A 2R2JA 3Q74A 1GULA 3KH9A 4ZBAA 5FHIA 3PR8A 1THOA 1GTIA 1I9DA 2ZCTA 1MDIA 3F3RA 1K0DA 3CBUA 3CTGA 5KN2A 3WD6A 2A4VA 2AHEA 1PGTA 5HR1A 4Z2UA 4DSQA 5IOXA 2GGTA 1HNAA 2XHFA 1F3BA 3GNJA 2WVZA 1XCCA 2R3XA 2HSHA 1WOUA 4D73A 2DJ2A 1B48A 4PX1A 4XS6A 2H75A 4V2MA 3EU3A 1XWGA 1YEXA 2B5EA 22GSA 4W66A 3GTUA 1XFLA 1XPVA 3TKPA 2H74A 4G0KA 1K3YA 4KAEA 2C4JA 1XBSA 1B9YC 4BVYB 3GFKA 5ECMB 3NIVA 3FMWA 4IVFA 2MZCA 4EVMA 2H72A 4Q5QA 3IK9A 5JCUA 1XWCA 4N11A 1SJIA 3PGTA 3IC4A 5H5RA 2BMXA 8GSSA 1SK2A 1UVZA 1I1IP 3Q18A 2KHPA 4FYUA 4EC0A 4P3YB 1K0OA 5GAND 3FEUA 1LBKA 4GLTA 2CT6A 2OT3A 5B7CA 1SD8A 5G31A 2F51A 3FR9A 3KMOA 4J2FA 2H6YA 3IOSA 2LSTA 3IK7A 2EFEA 3H93A 2PVOC 3HVXA 2F9SA 1OC9B 2GT5A 2WB9A 4I2UA 2LQOA 1USBA 4ZB7A 5HQPA 4WR5A 5H5QA 4TVEA 5F05A 2OKAA 3A2XA 4YH2A 14GSA 1OC3A 3APQA 3TUEA 1THXA 4XS1A 2FY6A 3D6IA 3EU4A 2R0CA 2NDOA 4KDUA 3VPTA 2JZSA 5HFKA 1XOBA 1OAZA 1SVLA 1N25A 20GSA 3QAWA 1MD3A 4KCEA 4L5LA 1BQ7A 2HRNA 1TK0B 3F3QA 1V57A 1OE8A 1SYXA 1R5AA 2HSMA 5EVOA 3L9SA 6GSVA 3HD5A 3DKSA 3QFAC 3EWLA 5D9XA 1JLWA 3LYPA 5B8BA 2R4VA 4KE3A 5A5HA 1OVNA 5HFIA 4XS4A 2K18A 3LEFA 3WT2A 1DBYA 1B9XC 1XVWA 2CQ9A 4DSSB 5J4UA 3KEBA 2FCHA 5CYYA 3GIXA 1SK1A 1QGVA 4USSA 5D9WA 1HYUA 1Y1UA 5GSSA 4LMWA 3G7JA 4QQ7A 4ECIA 4IKHA 6GSUA 3P7XA 3KMNA 4ECCA 4NAXA 1O8WA 2H66A 2C3QA 3FR6A 3GKXA 4TRXA 3HDCA 3GHAA 1M9AA 3ZL5A 4OFTA 1EV4A 3ZMLA 4KA0A 1A0RP 1B8XA 4G9HA 3ZFBA 1PKWA 2VCQA 1Z3EA 3C73A 4AJ8A 2D2ZA 3RHBA 4AKIA 4DVCA 3P2AA 2CX3A 4IQAA 2DKIA 4KCAA 1A0FA 1TXUA 1TP9A 2CVBA 4ID0A 2IN3A 2YV7A 1SL2B 17GSA 4RUVA 5IIZA 3RDWA 2NVLA 2B5YA 4HSCX 2CA8A 3VI5A 3GURA 4NV5A 5DJLA 4G10A 3LYKA 3D4MA 3DVWA 3BCIA 4JZQA 5D9TA 2L5LA 2PBJA 2WRTA 4RI6A 3UIWA 4E8HA 4YAVA 3A2WA 4WBRD 4YQVA 3KGKA 2DBCA 3TJGA 4WF4A 2C3TA 1KBNA 2YPMA 3IE3A 4JEDA 5IQYA 2YWOA 3QFBC 5J41A 3IHGA 1VGLA 2I3YA 3GN3A 1WRYA 3GRXA 6GSWA 3DYRA 2VCVA 2J23A 2MBTA 2VD0A 1TRVA 3P90A 1GSYA 2DJ0A 3TJFA 3L0HA 1GSEA 4BA7A 4Q5NA 1F6MC 1Z6NA 4HS1A 1ILOA 1TI3A 1PX7A 3UMAA 4AJ6A 2X64A 3QCPA 3VWVA 1BX9A 4JBBA 2HT9A 2LRTA 1MEKA 1NSWA 4XIHA 2ZNMA 4BL7A 1Q4JA 3FK8A 2V6KA 5IPGA 3UVHA 1T7PB 2IMIA 2VOCA 3TKSA 1UN2A 3D22A 4YKFA 3CWGA 4BVXB 4ZL9A 1ML6A 5D96A 1SKSB 3MYDA 5AN1A 1U3AA 4OMVA 1X9MB 4F0CA 5AIXA 3WT1A 1SL1B 2R0PA 3GKNA 4Z2RA 4RQXA 2TIRA 2MMZA 1U87A 3FKFA 3O3TA 1ERWA 3EE2A 4FIWA 1FVJA 5A34B 3LFLA 1M2BA 2GTUA 3CSJA 3TCOA 5A1NB 3GKMA 4JRRA 4TR0A 3FZ9A 3EMPA 3TKSC 1ZZYA 3C71A 16GSA 3I6AA 2OJLA 4NPBA 4IJIA 4ILFA 3VK9A 1X9SB 2HXKA 2RIIA 2JU5A 2RUEA 2EC4A 4PNGA 3KM6A 4GQFA 1YKCA 4QMKA 4X43A 4K0GA 5DQYA 13GSA 2WS2A 4MH3A 1NW2A 5KN3A 2K8SA 1ZGNA 3W6GA 5ECRB 3HVNA 3HJPA 2CZ3A 2GSTA 1A23A 2IMFA 3SWLA 3FZ4A 4K9ZA 2EIRA 1HNBA 4CDOA 4ML6A 4CW9A 5A5KA 6GSTA 2O85A 3GV1A 2KOKA 1URMA 2LNTA 2V32A 3TKRA 2IIYA 5G30A 1FB0A 1SK0A 5B8AA 2H30A 1M0UA 2VL3A 3G7YA 2J9HA 2HRAA 2WFCA 2FNOA 2GSRA 3IC8A 1XVQA 4OFNA 2GZZA 3HVSA 3DXBA 1HD2A 4TXOA 3TRXA 1OE7A 5HR2A 1XW6A 3KZQA 2EFCA 2H1LA 4OCEA 3RAZA 2YZHA 2HFDA 3ISOA 5EL8A 3ERWA 2YWMA 1GUKA 4PUAA 1T3BA 3ZVJD 2JADA 1A2JA 4KB3A 4GXZA 5BRTA 1ZYNA 1SVOA 3F0IA
chains in the Genus database with same CATH topology
4PQ1A 5DAKA 3F8UA 3F4SA 3QOUA 1WIKA 1DUGA 2HQTA 3ERGA 3US3A 1EP8A 4G01A 4HZ2A 2ZUPA 3D5JA 5G2ZA 2CX4A 2OACA 5CRGA 1W4VA 4POLA 2HRFA 5F8BA 1BAYA 2IFQB 2VLUA 3A3TA 3GYKA 3KH7A 3ZMKA 1JZOA 5CAXA 2Z9SA 4G0IA 5G5FA 4KX4A 1WJKA 3IAS2 2OBIA 2G2QA 3GMFA 4TOPA 4OO5A 3EYTA 4A5PA 3DWVA 4KSOA 5ECLB 2B3SA 4TR1B 3BOAA 4HUAA 3ZZXA 2LNSA 4MPFA 5ECKB 4XTSA 5ECIB 1S3DA 1PX6A 1EOGA 4Q5RA 4CY8A 1YF1A 5IO2A 1EGOA 2QA1A 4PTSA 2C1YA 3TJKA 4HU7A 1DSBA 4L5OA 1F9MA 4OCFA 2GQKA 2VL9A 1FOVA 4EIQA 2B1LA 3GH6A 4LL1B 1F3AA 1W89A 3LJRA 3L9VA 2C0FA 2CZ2A 5F07A 1XWKA 3TJJA 2VCZA 2NBSA 5ID2A 2I1UA 4EE0A 4KF9A 3M0FA 1TW9A 3GKKA 5CP1A 3QD9A 1EV9A 1GSUA 4K6XA 4IBPA 1TK8B 3F4RA 4G19A 3MDKA 5J47A 3LG6A 2V2GA 1GTBA 2O89A 1Z9HA 3D4TA 2H1AA 4CHSA 1EP7A 1AXDA 2V6OA 1SYRA 2IL3A 5HFGA 2MBSA 7GSSA 4IHUA 5F06A 3HXSA 5DALB 3R2QA 2FWFA 3G9BA 2PPTA 4DEJA 3HVVA 3GSTA 1ZOFA 1TRWA 2R6KA 4LLRA 2FGXA 3TDGA 1U88A 3LGCA 1QQ2A 2QSIA 3LSZA 5KN0A 2F8AA 1NM3A 3MNGA 3FZ5A 1GTAA 2F3MA 1KTEA 2DC5A 4MCUA 3MIXA 4F9ZA 4ULXA 2QGVA 2DJJA 2JZTA 3H1NA 4OO4A 4GSNA 2YWIA 5AISA 1ZYEA 3HY2A 3ZIJA 5FT3A 3E0UA 2VCWA 2OBKA 2R5GA 1A24A 4X4JA 1AAZA 1R5PA 4QL7A 4NWYA 1H4OA 4ZB8A 2ES7A 2N5AA 2WGRA 4HOJA 2R0GA 1FHEA 3NZNA 3CRUA 3ZRDA 1AQVA 2N5FA 4K5RA 3ME8A 2X8CA 3APSA 4ICYA 2YJHA 2MMOA 1VRSD 3F6DA 2REMA 1GWCA 5A4VA 2K9FA 2X8HA 1SL0B 2LJRA 5L71A 5LNKe 2H01A 1J9BA 3WGXA 2P0GA 4L0WA 3ME7A 3D21A 4MLYA 4ZILA 3ZREA 5KOWA 5COHA 1SU9A 4IS0A 2HSNA 2FA8A 4MJAA 3EMXA 5CRHA 5INYA 1JZWA 2FLSA 3HZ8A 1TJDA 1WP0A 3TKSE 4ECJA 1TOFA 2PN8A 5JCGA 5B6MA 2DKHA 4ZL7A 1GLQA 1T4YA 2KP1A 5CRWA 4HEA2 2CAQA 2XPEA 2MMNA 4EL1A 2LJKA 3E9JB 2DSAA 1Z5YE 4K7IA 1SVMA 1B4PA 4Q5FA 3LW9A 1PA3A 2HZEA 2LQQA 1QK8A 4JR4A 1GNWA 2H70A 2DLXA 2XPDA 5D8IA 2GZPA 1B4QA 2VM1A 18GSA 1V98A 3TB2A 4N3ZA 2CAIA 5IMVA 2MYGA 1YJ6A 4PGTA 4BWSA 1YEPA 3HKRA 3A5IA 2KUCA 2XC2A 1GSSA 1ERTA 2B7JA 2HRKA 3IPZA 3Q6OA 2FWEA 1VF1A 2WDUA 2O5VA 1TKDB 3I43A 3ZLPA 1SKRB 4NV2A 5BMUB 2IMDA 2HZFA 4PUFC 3MSZA 4HJMA 4EDYA 3QR6A 4N30A 4POBA 1YQ1A 4XCSA 2IMKA 5G5EA 2YV9A 2H6ZA 1GTUA 3EINA 1O6JA 1EZKA 4MK3A 1TK5B 2H19A 1T8EB 3ZFLA 3UEMA 1JFUA 2HSYA 4L8EA 4D73B 1U6TA 3DVXA 2PGTA 2TRXA 2OE1A 3J7Yb 2L4CA 2LTKA 1GH2A 1JHBA 4ZXGA 1PL2A 4F82A 3M1GA 3S9FA 3GTUB 3KCMA 3C7MA 1G0TA 5IMFA 1C72A 3ED3A 3UL3A 4MZCA 4EDZA 4JE1A 3R3EA 4GSTA 4BWQA 3VWWA 4E68A 1T1VA 2DMLA 1ST9A 2JSYA 1BYEA 4JU5A 4O92A 2K8VA 2ON5A 1E6BA 1GP1A 1PN9A 2GSQA 4TKYA 2VM2A 3QAVA 1M2AA 1XWAA 5IMZA 1WPIA 5JWRB 4IJ3A 1OYJA 3CXGA 2XBIA 4PQIA 2OE0A 1NHOA 4XRDA 2GVPA 3BJ5A 1TI1A 1TU7A 4K7OA 1MTCA 5ELAA 2M80A 5JWQB 2VAFA 3KP9A 1GLPA 1M2DA 1S3AA 2YNXA 4F2IA 5J9BA 2IJYA 4I8BA 3UARA 3UBKA 3M8NA 3LQ7A 3GX8A 4WKWA 4BPYA 4BVYA 1LJRA 2X8GA 1EEMA 4ZIJA 1M7TA 4FYBA 4MJEA 1Q98A 4H86A 1ERVA 4HU9A 3EC3A 1XIYA 4X1UA 2X4AA 3RHCA 5CREA 4IQ1A 4ACSA 4G0LA 1XZOA 2LUSA 4KSMA 3HA9A 2HSMB 4FYCA 2GLRA 3DRNA 3TRPA 1GUHA 4MDCA 1TU8A 4ISDA 2JSZA 1T4ZA 3ERFA 4KW6A 5A5HB 1PMTA 1OC9A 1G7EA 2HI7A 2K6VA 1EGRA 4YQMA 4HZ4A 2VLTA 2EFDA 3M3MA 3DEXA 2RM6A 5HR3A 12GSA 2H0HA 2O8VB 3WYWA 3IAM2 4AJ7A 2H1GA 2DJ1A 2LS5A 2E0QA 2CV4A 5CO3A 4MF5A 6GSSA 3VPQA 1O8XA 4N0ZA 4HQSA 4KH7A 2H0IA 1DE1A 1PQNA 4GSSA 5A4UA 1Z7RA 2VL2A 1K3LA 3KXOA 1XXUA 1TTZA 5D73A 3UVTA 4FH8A 1V9WA 4QL9A 2JACA 3U5RE 2KLXA 2PMTA 5KN1A 3MAKA 2DJ3A 2A2RA 2P31A 4WR4A 1KEBA 1PN0A 4AGSA 1K0MA 3HMJG 2A4HA 4DSSA 2PWJA 1KNGA 1X5CA 5AIVA 1G6WA 2GQLA 2XBQA 3EPTA 4I97A 4IGJA 4ZBBA 3IXRA 1V58A 4TR3A 1EOHA 1UA5A 1XW9A 2VL2C 1T00A 3F63A 3U6VA 3N5OA 5J5NA 2V41A 2A2SA 4GF0A 2C3NA 3GH9A 2H76A 5E4WA 3UAPA 5D9VA 3TOUA 3FRCA 5DJMA 4MF6A 1SJ6A 3LXZA 4HJ2A 3ZYWA 1AUCA 4GCIA 1QXHA 3APOA 4LA1A 2NPBA 1MDKA 1V2AA 1AIUA 1A2LA 1VF2A 1FG4A 4MMMA 4MNNA 3GL5A 3GX0A 3IA1A 1ACVA 1OKTA 2AB6A 4N0VA 3W8SA 4EIPA 4NMUA 4AF2A 3MWHA 1BG5A 4NHZA 1GRXA 4J56E 3CSHA 3HJMA 3IDVA 2JL4A 1XWBA 3AY8A 1GSFA 2C0GA 3OR5A 6GSYA 1MDJA 1RK4A 4BL7B 3HZ4A 3D0ZA 1S3CA 1I5GA 2HYXA 1PD21 4MJCA 3IHQA 4CY6A 19GSA 3I9V2 5JWOB 3L4NA 3NOFA 2E2GA 2X99A 4MH2A 2OA7A 1LU4A 3H8QA 2YZUA 4MP4A 3RBTA 1X9WB 5HR0A 3ZITA 2LJAA 4IP6A 4K2DA 1SENA 2QKEA 2YOIA 3KTLA 5G1LA 1NHYA 1WWJA 3C8EA 3HYPA 5J4YA 2ON7A 2LRNA 4PURA 1WE0A 2PERA 2OADA 4K8MA 1QUWA 2GZYA 4ZL8A 2VUPA 4GWRA 3SBCA 1FAAA 5IO0A 5DCHA 3ZIVA 4Z2TA 4O7HA 2H1BA 4KUNA 3GUSA 5LCZA 4BVXA 3DIEA 4XRAA 4V1Ap 1R26A 1RW1A 5JCWA 4ZB9A 3QAGA 2YJ7A 4V2LA 3IV4A 3PH9A 1VF4A 2B7KA 2GT6A 4YKGA 2BJXA 3VURA 4K7NA 4MA9A 1FB6A 3EVIA 1O7UA 4GQCA 1VF3A 4K5SA 1TXXA 4FO5A 3H4KA 3M9JA 2I9HA 4GRFA 4POKA 5A34A 2VCTA 2WJUA 2E7PA 3DMLA 5EPFA 5A1NA 4EUYA 2H73A 4JR6A 1A2MA 4LL4B 3FYGA 4AKHA 5G1KA 4EF0A 4TR4A 2H6XA 3O76A 5KOXA 5ECSA 1SKWB 4F0BA 2PUKC 4FQUA 1WMJA 3BCKA 4WBJA 3I69A 1PL1A 4TXOB 4I5QA 1JLVA 1J08A 1FVKA 2LRCA 2YCDA 4MPGA 2L5OA 1PRXA 3E3EA 1M99A 2C8UA 4I6XA 1SD9A 5DBQA 3HHVA 2IPAA 4J57E 4MF7A 3ZTLA 5ABRA 5B6NA 5DAKB 4MZBA 3TKQA 3QDNA 1G6YA 2B1KA 3G7IA 5DCGA 3PINA 5IMDA 4KNDA 5IM9A 4RI7A 5D93A 11GSA 3BBYA 1TRUA 4RQRA 3RPPA 2YANA 3UOMA 3L9UA 4POMA 4MABA 1AW9A 4O5UA 5ELGA 2I4AA 4XHMA 2RLIA 5IPHA 3FY7A 2MMAA 2AV4A 2GQMA 2VIMA 5LD0A 2CVDA 2RUFA 4X0XA 3TGZA 3DGQA 1FO5A 1K0AA 4IP1A 1R4WA 5J3RA 4LMVA 5ECHB 3C1RA 4EO3A 1X0RA 3V1WA 1ERUA 1FOHA 3IRAA 2BTOT 4HI7A 2LKUA 4O32A 4Z7XA 3VLNA 2PVQA 2QC7A 3A2VA 1UC7A 1A8LA 2R37A 5J40A 1EWXA 4AI6A 2YWNA 2RM5A 4MZWA 2FHEA 4IELA 2DMMA 3CTFA 4E8EA 5J4VA 3BD2A 3W8JA 3KD0A 1A8YA 2C80A 5CRDA 3K8NA 3CMIA 2IFQA 1PSQA 5A4WA 2YP6A 5ENUA 4TXVA 4OWYA 5ID2B 1O85A 4I2TA 2VD1A 3Q19A 6GSXA 4WF5A 2UZ8A 2N5BA 3VWXA 1Y6EA 9GSSA 1CQHA 1IYHA 4HQZA 4OFMA 1HQOA 1YZXA 2WZ9A 4WXTA 1J0FA 3TU3B 2DIZA 4TR1A 4G2EA 1ZMAA 1E2YA 2JZRA 3KTBA 2B5XA 1V40A 2O87A 2OE3A 4NXIA 3KJYA 2C0DA 3M9KA 4ZBDA 2AUVA 1ABAA 1O73A 2EIQA 2HNLA 2A2PA 2L59A 3PPUA 3HCZA 4MJBA 1M9BA 4K0NA 1PKZA 1GL8A 1YF0A 1OKDA 3ZVJA 3TJBA 1TDIA 3LXTA 1TRSA 1AQWA 2WCIA 2E2MA 3F4TA 1QFNA 2EIOA 2KP2A 3FHKA 2EFHA 2GS3A 5F0GA 1YVLA 5IMAA 5KEJA 2VO4A 4WETA 2ALBA 4PNFA 2H8LA 3HJOA 4EKZA 2HE3A 1HNCA 4KDYA 1Z6MA 4ZB6A 5ECQB 2DIYA 5C04A 4O5QA 1BF5A 4PQHA 3CSIA 3O6TA 3A5WA 2YN1A 5DALA 2TRCP 4AKXB 5AGYA 5H5SA 1YDKA 1RQMA 2FUG2 2LV3A 1AQXA 1GUMA 2H0GA 1G7OA 4ML1A 3LORA 2H1DA 2UV8G 2QA2A 2GSSA 5ECOB 5DVBA 1O81A 2X49A 2IWTA 2HSNB 3TRQA 1BG1A 2AJQB 2L6CA 3KIJA 1H75A 3VI7A 1BJXA 4XS4B 2FWHA 1Z7PA 2P5RA 1MD4A 2L4QA 5C00A 1K0BA 2F8FA 3L78A 1Y25A 4EXJA 1K0CA 4O5RA 5GAPD 2P5QA 1AC1A 4AKGA 5IOWA 2L57A 4YAPA 2FD3A 1X5DA 1YKAA 2FA4A 4GDFA 3GL3A 1GNEA 1YY7A 3P8WA 1OC8A 2CVKA 2PU9C 2HZEB 3GA4A 5GSTA 1BEDA 1IYIA 4HDEA 3WGDA 3LWAA 2C0EA 5ECNB 2B6MA 5IMCA 4KGIA 4V2NA 1K3OA 4KDXA 4YQUA 1N2AA 3DD3A 3IBHA 1X5EA 3CYNA 3IR4A 4GTUA 5EY6A 1ZL9A 1JZDA 4PXOA 4NHWA 3UJ1A 1FW1A 2HLSA 2AAWA 2DJKA 4K2XA 1EEJA 10GSA 3C1SA 1ZYPA 2NTOA 2AYTA 1JZRA 2GDRA 3FR3A 2FWGA 3WGEA 2HRKB 2L6DA 1ZYQB 3TOTA 2WULA 3UBLA 5GZZB 3EURA 2O7KA 5J9CA 5E59A 2IMEA 4IW9A 1R7HA 2M46A 4TW5A 4L0UA 3VFIA 3VWUA 4F03A 3F9UA 3FW2A 1F37A 4DSRA 3GSSA 4ECBA 1N8JA 4TN8A 3KP8A 1GSDA 1K0NA 2LEGA 1DE2A 2VLVA 2H71A 1F2EA 5ECPB 1QMVA 2VCXA 4IN0A 3RPNA 3N9JA 1U3IA 5DDLA 4V1Ag 1XW5A 2G0FA 3J7Yk 1ZCPA 1XOAA 5FWGA 3H79A 1CQGA 1SJZA 5CNWA 3F6FA 4K1FA 2V1MA 2M72A 3JCML 3FZAA 2VKZG 3CRTA 2I81A 4WEYA 3QPMA 1GSQA 4N10A 1ON4A 5DQSA 5BMUA 3QMXA 4OD7A 2R2JA 3Q74A 1GULA 3KH9A 4ZBAA 5FHIA 3PR8A 1THOA 1GTIA 1I9DA 2ZCTA 1MDIA 3F3RA 1K0DA 3CBUA 3CTGA 5KN2A 3WD6A 2A4VA 2AHEA 1PGTA 5HR1A 4Z2UA 4DSQA 5IOXA 2GGTA 1HNAA 2XHFA 1F3BA 3GNJA 1XCCA 2R3XA 2HSHA 1WOUA 4D73A 2DJ2A 1B48A 4PX1A 4XS6A 2H75A 4V2MA 3EU3A 1XWGA 1YEXA 2B5EA 22GSA 4W66A 3GTUA 1XFLA 1XPVA 3TKPA 2H74A 4G0KA 1K3YA 4KAEA 2C4JA 1XBSA 1B9YC 4BVYB 3GFKA 5ECMB 3FMWA 3NIVA 4IVFA 2MZCA 4EVMA 2H72A 4Q5QA 3IK9A 5JCUA 1XWCA 4N11A 1SJIA 3PGTA 3IC4A 5H5RA 2BMXA 8GSSA 1SK2A 1UVZA 3Q18A 2KHPA 4FYUA 4EC0A 4P3YB 1K0OA 5GAND 3FEUA 1LBKA 4GLTA 2CT6A 2OT3A 5B7CA 1SD8A 5G31A 2F51A 3FR9A 3KMOA 4J2FA 2H6YA 3IOSA 2LSTA 3IK7A 2EFEA 3H93A 2PVOC 3HVXA 2F9SA 1OC9B 2GT5A 2WB9A 4I2UA 2LQOA 1USBA 4ZB7A 5HQPA 4WR5A 5H5QA 4TVEA 5F05A 2OKAA 3A2XA 4YH2A 14GSA 1OC3A 3APQA 3TUEA 1THXA 4XS1A 2FY6A 3D6IA 3EU4A 2R0CA 2NDOA 4KDUA 3VPTA 2JZSA 5HFKA 1XOBA 1OAZA 1SVLA 1N25A 20GSA 3QAWA 1MD3A 4KCEA 4L5LA 1BQ7A 2HRNA 1TK0B 3F3QA 1V57A 1OE8A 1SYXA 1R5AA 2HSMA 5EVOA 3L9SA 6GSVA 3HD5A 3DKSA 3QFAC 3EWLA 5D9XA 1JLWA 3LYPA 5B8BA 2R4VA 4KE3A 5A5HA 1OVNA 5HFIA 4XS4A 2K18A 3LEFA 3WT2A 1DBYA 1B9XC 1XVWA 2CQ9A 4DSSB 5J4UA 3KEBA 2FCHA 5CYYA 3GIXA 1SK1A 1QGVA 4USSA 5D9WA 1HYUA 1Y1UA 5GSSA 4LMWA 3G7JA 4QQ7A 4ECIA 4IKHA 6GSUA 3P7XA 3KMNA 4ECCA 4NAXA 1O8WA 2H66A 2C3QA 3FR6A 3GKXA 4TRXA 3HDCA 3GHAA 1M9AA 3ZL5A 4OFTA 1EV4A 3ZMLA 4KA0A 1A0RP 1B8XA 4G9HA 3ZFBA 1PKWA 2VCQA 1Z3EA 3C73A 4AJ8A 2D2ZA 3RHBA 4AKIA 4DVCA 3P2AA 2CX3A 4IQAA 2DKIA 4KCAA 1A0FA 1TXUA 1TP9A 2CVBA 4ID0A 2IN3A 2YV7A 1SL2B 17GSA 4RUVA 5IIZA 3RDWA 2NVLA 2B5YA 2CA8A 3VI5A 3GURA 4NV5A 5DJLA 4G10A 3LYKA 3D4MA 3DVWA 3BCIA 4JZQA 5D9TA 2L5LA 2PBJA 2WRTA 4RI6A 3UIWA 4E8HA 4YAVA 3A2WA 4WBRD 4YQVA 3KGKA 2DBCA 3TJGA 4WF4A 2C3TA 1KBNA 2YPMA 3IE3A 4JEDA 5IQYA 2YWOA 3QFBC 5J41A 3IHGA 1VGLA 2I3YA 3GN3A 1WRYA 3GRXA 6GSWA 3DYRA 2VCVA 2J23A 2MBTA 2VD0A 1TRVA 3P90A 1GSYA 2DJ0A 3TJFA 3L0HA 1GSEA 4BA7A 4Q5NA 1F6MC 1Z6NA 4HS1A 1ILOA 1TI3A 1PX7A 3UMAA 4AJ6A 2X64A 3QCPA 3VWVA 1BX9A 4JBBA 2HT9A 2LRTA 1MEKA 1NSWA 4XIHA 2ZNMA 4BL7A 1Q4JA 3FK8A 2V6KA 5IPGA 3UVHA 1T7PB 2IMIA 2VOCA 3TKSA 1UN2A 3D22A 4YKFA 3CWGA 4BVXB 4ZL9A 1ML6A 5D96A 1SKSB 3MYDA 5AN1A 1U3AA 4OMVA 1X9MB 4F0CA 5AIXA 3WT1A 1SL1B 2R0PA 3GKNA 4Z2RA 4RQXA 2TIRA 2MMZA 1U87A 3FKFA 3O3TA 1ERWA 3EE2A 4FIWA 1FVJA 5A34B 3LFLA 1M2BA 2GTUA 3CSJA 3TCOA 5A1NB 3GKMA 4JRRA 4TR0A 3FZ9A 3EMPA 3TKSC 1ZZYA 3C71A 16GSA 3I6AA 2OJLA 4NPBA 4IJIA 4ILFA 3VK9A 1X9SB 2HXKA 2RIIA 2JU5A 2RUEA 2EC4A 4PNGA 3KM6A 4GQFA 1YKCA 4QMKA 4X43A 4K0GA 5DQYA 13GSA 2WS2A 4MH3A 1NW2A 5KN3A 2K8SA 1ZGNA 3W6GA 5ECRB 3HJPA 2CZ3A 2GSTA 1A23A 2IMFA 3SWLA 3FZ4A 4K9ZA 2EIRA 1HNBA 4CDOA 4ML6A 4CW9A 5A5KA 6GSTA 2O85A 3GV1A 2KOKA 1URMA 2LNTA 2V32A 3TKRA 2IIYA 5G30A 1FB0A 1SK0A 5B8AA 2H30A 1M0UA 2VL3A 3G7YA 2J9HA 2HRAA 2WFCA 2FNOA 2GSRA 3IC8A 1XVQA 4OFNA 2GZZA 3HVSA 3DXBA 1HD2A 4TXOA 3TRXA 1OE7A 5HR2A 1XW6A 3KZQA 2EFCA 2H1LA 4OCEA 3RAZA 2YZHA 2HFDA 3ISOA 5EL8A 3ERWA 2YWMA 1GUKA 4PUAA 1T3BA 3ZVJD 2JADA 1A2JA 4KB3A 4GXZA 5BRTA 1ZYNA 1SVOA 3F0IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PQ1 A;  5DAK A;  3F8U A;  3F4S A;  3QOU A;  1WIK A;  1DUG A;  2HQT A;  3ERG A;  3US3 A;  1EP8 A;  4HZ2 A;  2ZUP A;  3D5J A;  5G2Z A;  2CX4 A;  2OAC A;  5CRG A;  1W4V A;  4POL A;  2HRF A;  5F8B A;  1BAY A;  2IFQ B;  2VLU A;  3A3T A;  3GYK A;  3KH7 A;  3ZMK A;  1JZO A;  5CAX A;  2Z9S A;  4G0I A;  5G5F A;  4KX4 A;  1WJK A;  3IAS 2;  2OBI A;  2G2Q A;  3GMF A;  4TOP A;  4OO5 A;  3EYT A;  3DWV A;  4KSO A;  5ECL B;  2B3S A;  4TR1 B;  3BOA A;  4HUA A;  3ZZX A;  2LNS A;  4MPF A;  5ECK B;  4XTS A;  5ECI B;  1S3D A;  1PX6 A;  1EOG A;  4Q5R A;  1YF1 A;  5IO2 A;  1EGO A;  4PTS A;  2C1Y A;  3TJK A;  4HU7 A;  1DSB A;  4L5O A;  1F9M A;  4OCF A;  2GQK A;  2VL9 A;  1FOV A;  2B1L A;  3GH6 A;  4LL1 B;  1F3A A;  1W89 A;  3LJR A;  3L9V A;  2C0F A;  2CZ2 A;  5F07 A;  1XWK A;  3TJJ A;  2VCZ A;  2NBS A;  5ID2 A;  2I1U A;  4EE0 A;  4KF9 A;  3M0F A;  1TW9 A;  3GKK A;  5CP1 A;  3QD9 A;  1EV9 A;  1GSU A;  4K6X A;  4IBP A;  1TK8 B;  3F4R A;  4G19 A;  3MDK A;  3LG6 A;  2V2G A;  1GTB A;  2O89 A;  1Z9H A;  3D4T A;  2H1A A;  4CHS A;  1EP7 A;  1AXD A;  2V6O A;  1SYR A;  2IL3 A;  5HFG A;  2MBS A;  7GSS A;  4IHU A;  5F06 A;  3HXS A;  5DAL B;  3R2Q A;  2FWF A;  3G9B A;  2PPT A;  4DEJ A;  3HVV A;  3GST A;  1ZOF A;  1TRW A;  2R6K A;  4LLR A;  2FGX A;  3TDG A;  1U88 A;  3LGC A;  1QQ2 A;  2QSI A;  3LSZ A;  5KN0 A;  2F8A A;  1NM3 A;  3MNG A;  3FZ5 A;  1GTA A;  2F3M A;  1KTE A;  2DC5 A;  4MCU A;  4F9Z A;  4ULX A;  2QGV A;  2DJJ A;  2JZT A;  3H1N A;  4OO4 A;  4GSN A;  2YWI A;  5AIS A;  1ZYE A;  3HY2 A;  3ZIJ A;  5FT3 A;  3E0U A;  2VCW A;  2OBK A;  2R5G A;  1A24 A;  1AAZ A;  1R5P A;  4QL7 A;  4NWY A;  1H4O A;  4ZB8 A;  2ES7 A;  2N5A A;  2WGR A;  4HOJ A;  1FHE A;  3NZN A;  3CRU A;  3ZRD A;  1AQV A;  2N5F A;  3ME8 A;  2X8C A;  3APS A;  2YJH A;  2MMO A;  1VRS D;  3F6D A;  2REM A;  1GWC A;  5A4V A;  2K9F A;  2X8H A;  1SL0 B;  2LJR A;  5L71 A;  5LNK e;  2H01 A;  1J9B A;  3WGX A;  2P0G A;  4L0W A;  3ME7 A;  3D21 A;  4MLY A;  4ZIL A;  3ZRE A;  5COH A;  1SU9 A;  4IS0 A;  2FA8 A;  4MJA A;  3EMX A;  5CRH A;  5INY A;  1JZW A;  2FLS A;  3HZ8 A;  1TJD A;  1WP0 A;  3TKS E;  4ECJ A;  1TOF A;  2PN8 A;  5JCG A;  5B6M A;  4ZL7 A;  1GLQ A;  1T4Y A;  2KP1 A;  5CRW A;  4HEA 2;  2CAQ A;  2XPE A;  2MMN A;  4EL1 A;  2LJK A;  3E9J B;  2DSA A;  1Z5Y E;  4K7I A;  1B4P A;  4Q5F A;  1PA3 A;  2HZE A;  2LQQ A;  1QK8 A;  4JR4 A;  1GNW A;  2H70 A;  2DLX A;  2XPD A;  5D8I A;  2GZP A;  1B4Q A;  2VM1 A;  18GS A;  1V98 A;  3TB2 A;  2CAI A;  5IMV A;  2MYG A;  1YJ6 A;  4PGT A;  4BWS A;  1YEP A;  3HKR A;  2KUC A;  2XC2 A;  1GSS A;  1ERT A;  2B7J A;  2HRK A;  3IPZ A;  3Q6O A;  2FWE A;  1VF1 A;  2WDU A;  1TKD B;  3I43 A;  3ZLP A;  1SKR B;  4NV2 A;  2IMD A;  2HZF A;  4PUF C;  3MSZ A;  4HJM A;  4EDY A;  3QR6 A;  4N30 A;  4POB A;  1YQ1 A;  4XCS A;  2IMK A;  5G5E A;  2YV9 A;  2H6Z A;  1GTU A;  3EIN A;  1O6J A;  1EZK A;  4MK3 A;  1TK5 B;  2H19 A;  1T8E B;  3ZFL A;  3UEM A;  1JFU A;  2HSY A;  4L8E A;  4D73 B;  1U6T A;  3DVX A;  2PGT A;  2TRX A;  2OE1 A;  3J7Y b;  2L4C A;  2LTK A;  1GH2 A;  1JHB A;  4ZXG A;  1PL2 A;  4F82 A;  3M1G A;  3S9F A;  3GTU B;  3KCM A;  3C7M A;  1G0T A;  5IMF A;  1C72 A;  3ED3 A;  3UL3 A;  4MZC A;  4EDZ A;  4JE1 A;  3R3E A;  4GST A;  4BWQ A;  3VWW A;  1T1V A;  2DML A;  1ST9 A;  2JSY A;  1BYE A;  4JU5 A;  4O92 A;  2K8V A;  2ON5 A;  1E6B A;  1GP1 A;  1PN9 A;  2GSQ A;  4TKY A;  2VM2 A;  3QAV A;  1M2A A;  1XWA A;  5IMZ A;  1WPI A;  5JWR B;  4IJ3 A;  1OYJ A;  3CXG A;  2XBI A;  4PQI A;  2OE0 A;  1NHO A;  4XRD A;  2GVP A;  3BJ5 A;  1TI1 A;  1TU7 A;  4K7O A;  1MTC A;  5ELA A;  2M80 A;  5JWQ B;  2VAF A;  3KP9 A;  1GLP A;  1M2D A;  1S3A A;  2YNX A;  4F2I A;  5J9B A;  2IJY A;  4I8B A;  3UAR A;  3UBK A;  3M8N A;  3LQ7 A;  3GX8 A;  4WKW A;  4BPY A;  4BVY A;  1LJR A;  2X8G A;  1EEM A;  4ZIJ A;  1M7T A;  4FYB A;  4MJE A;  1Q98 A;  4H86 A;  1ERV A;  4HU9 A;  3EC3 A;  1XIY A;  4X1U A;  3RHC A;  5CRE A;  4IQ1 A;  4ACS A;  4G0L A;  1XZO A;  2LUS A;  4KSM A;  3HA9 A;  2HSM B;  4FYC A;  2GLR A;  3DRN A;  3TRP A;  1GUH A;  4MDC A;  1TU8 A;  4ISD A;  2JSZ A;  1T4Z A;  3ERF A;  4KW6 A;  1PMT A;  1OC9 A;  1G7E A;  2HI7 A;  2K6V A;  1EGR A;  4YQM A;  4HZ4 A;  2VLT A;  3M3M A;  3DEX A;  2RM6 A;  5HR3 A;  12GS A;  2H0H A;  2O8V B;  3WYW A;  3IAM 2;  4AJ7 A;  2H1G A;  2DJ1 A;  2LS5 A;  2E0Q A;  2CV4 A;  5CO3 A;  4MF5 A;  6GSS A;  3VPQ A;  1O8X A;  4N0Z A;  4HQS A;  4KH7 A;  2H0I A;  1DE1 A;  1PQN A;  4GSS A;  5A4U A;  1Z7R A;  2VL2 A;  1K3L A;  3KXO A;  1XXU A;  1TTZ A;  5D73 A;  3UVT A;  4FH8 A;  1V9W A;  4QL9 A;  2JAC A;  3U5R E;  2KLX A;  2PMT A;  5KN1 A;  3MAK A;  2DJ3 A;  2A2R A;  2P31 A;  4WR4 A;  1KEB A;  4AGS A;  1K0M A;  4DSS A;  2PWJ A;  1KNG A;  1X5C A;  5AIV A;  1G6W A;  2GQL A;  2XBQ A;  4I97 A;  4IGJ A;  4ZBB A;  3IXR A;  1V58 A;  4TR3 A;  1EOH A;  1UA5 A;  1XW9 A;  2VL2 C;  1T00 A;  3F63 A;  3U6V A;  3N5O A;  5J5N A;  2V41 A;  2A2S A;  4GF0 A;  2C3N A;  3GH9 A;  2H76 A;  5E4W A;  3UAP A;  5D9V A;  3TOU A;  3FRC A;  5DJM A;  4MF6 A;  1SJ6 A;  3LXZ A;  4HJ2 A;  3ZYW A;  1AUC A;  4GCI A;  1QXH A;  3APO A;  4LA1 A;  2NPB A;  1MDK A;  1V2A A;  1AIU A;  1A2L A;  1VF2 A;  1FG4 A;  4MMM A;  3GL5 A;  3GX0 A;  3IA1 A;  1ACV A;  1OKT A;  2AB6 A;  4N0V A;  3W8S A;  4NMU A;  4AF2 A;  3MWH A;  1BG5 A;  4NHZ A;  1GRX A;  4J56 E;  3CSH A;  3HJM A;  3IDV A;  2JL4 A;  1XWB A;  3AY8 A;  1GSF A;  2C0G A;  3OR5 A;  6GSY A;  1MDJ A;  1RK4 A;  4BL7 B;  3HZ4 A;  3D0Z A;  1S3C A;  1I5G A;  2HYX A;  1PD2 1;  4MJC A;  3IHQ A;  19GS A;  3I9V 2;  5JWO B;  3L4N A;  3NOF A;  2E2G A;  2X99 A;  4MH2 A;  2OA7 A;  1LU4 A;  3H8Q A;  2YZU A;  4MP4 A;  3RBT A;  1X9W B;  5HR0 A;  3ZIT A;  2LJA A;  4IP6 A;  4K2D A;  1SEN A;  2QKE A;  2YOI A;  3KTL A;  5G1L A;  1NHY A;  1WWJ A;  3C8E A;  3HYP A;  2ON7 A;  2LRN A;  4PUR A;  1WE0 A;  2PER A;  2OAD A;  4K8M A;  1QUW A;  2GZY A;  4ZL8 A;  2VUP A;  4GWR A;  3SBC A;  1FAA A;  5IO0 A;  5DCH A;  3ZIV A;  4O7H A;  2H1B A;  4KUN A;  3GUS A;  5LCZ A;  4BVX A;  3DIE A;  4XRA A;  4V1A p;  1R26 A;  1RW1 A;  5JCW A;  4ZB9 A;  3QAG A;  2YJ7 A;  4V2L A;  3IV4 A;  3PH9 A;  1VF4 A;  2B7K A;  2GT6 A;  2BJX A;  3VUR A;  4K7N A;  4MA9 A;  1FB6 A;  3EVI A;  1O7U A;  4GQC A;  1VF3 A;  1TXX A;  4FO5 A;  3H4K A;  3M9J A;  2I9H A;  4GRF A;  4POK A;  2VCT A;  2WJU A;  2E7P A;  3DML A;  5EPF A;  4EUY A;  2H73 A;  4JR6 A;  1A2M A;  4LL4 B;  3FYG A;  5G1K A;  4EF0 A;  4TR4 A;  2H6X A;  3O76 A;  5ECS A;  1SKW B;  4F0B A;  2PUK C;  4FQU A;  1WMJ A;  3BCK A;  4WBJ A;  3I69 A;  1PL1 A;  4TXO B;  4I5Q A;  1JLV A;  1J08 A;  1FVK A;  2LRC A;  2YCD A;  4MPG A;  2L5O A;  1PRX A;  3E3E A;  1M99 A;  2C8U A;  4I6X A;  1SD9 A;  5DBQ A;  3HHV A;  2IPA A;  4J57 E;  4MF7 A;  3ZTL A;  5ABR A;  5B6N A;  5DAK B;  4MZB A;  3TKQ A;  3QDN A;  1G6Y A;  2B1K A;  3G7I A;  5DCG A;  3PIN A;  5IMD A;  4KND A;  5IM9 A;  4RI7 A;  5D93 A;  11GS A;  3BBY A;  1TRU A;  4RQR A;  3RPP A;  2YAN A;  3UOM A;  3L9U A;  4POM A;  4MAB A;  1AW9 A;  5ELG A;  2I4A A;  4XHM A;  2RLI A;  5IPH A;  3FY7 A;  2MMA A;  2AV4 A;  2GQM A;  2VIM A;  5LD0 A;  2CVD A;  2RUF A;  4X0X A;  3TGZ A;  3DGQ A;  1FO5 A;  1K0A A;  4IP1 A;  1R4W A;  5J3R A;  4LMV A;  5ECH B;  3C1R A;  4EO3 A;  1X0R A;  3V1W A;  1ERU A;  3IRA A;  2BTO T;  4HI7 A;  2LKU A;  4O32 A;  4Z7X A;  3VLN A;  2PVQ A;  2QC7 A;  3A2V A;  1UC7 A;  1A8L A;  2R37 A;  1EWX A;  2YWN A;  2RM5 A;  4MZW A;  2FHE A;  4IEL A;  2DMM A;  3CTF A;  4E8E A;  3BD2 A;  3W8J A;  3KD0 A;  1A8Y A;  2C80 A;  5CRD A;  3K8N A;  3CMI A;  2IFQ A;  1PSQ A;  5A4W A;  2YP6 A;  5ENU A;  4TXV A;  4OWY A;  5ID2 B;  1O85 A;  4I2T A;  2VD1 A;  3Q19 A;  6GSX A;  4WF5 A;  2UZ8 A;  2N5B A;  3VWX A;  1Y6E A;  9GSS A;  1CQH A;  1IYH A;  4HQZ A;  4OFM A;  1HQO A;  1YZX A;  2WZ9 A;  4WXT A;  1J0F A;  2DIZ A;  4TR1 A;  4G2E A;  1ZMA A;  1E2Y A;  2JZR A;  3KTB A;  2B5X A;  1V40 A;  2O87 A;  2OE3 A;  4NXI A;  3KJY A;  2C0D A;  3M9K A;  4ZBD A;  2AUV A;  1ABA A;  1O73 A;  2EIQ A;  2HNL A;  2L59 A;  3PPU A;  3HCZ A;  4MJB A;  1M9B A;  4K0N A;  1PKZ A;  1GL8 A;  1YF0 A;  1OKD A;  3ZVJ A;  3TJB A;  1TDI A;  3LXT A;  1TRS A;  1AQW A;  2WCI A;  2E2M A;  3F4T A;  1QFN A;  2EIO A;  2KP2 A;  3FHK A;  2GS3 A;  5F0G A;  5IMA A;  5KEJ A;  2VO4 A;  4WET A;  2ALB A;  4PNF A;  2H8L A;  3HJO A;  4EKZ A;  2HE3 A;  1HNC A;  4KDY A;  1Z6M A;  4ZB6 A;  5ECQ B;  2DIY A;  5C04 A;  4PQH A;  3CSI A;  3O6T A;  3A5W A;  2YN1 A;  5DAL A;  2TRC P;  5AGY A;  5H5S A;  1YDK A;  1RQM A;  2FUG 2;  2LV3 A;  1AQX A;  1GUM A;  2H0G A;  1G7O A;  4ML1 A;  3LOR A;  2H1D A;  2GSS A;  5ECO B;  5DVB A;  1O81 A;  2IWT A;  2HSN B;  3TRQ A;  2AJQ B;  2L6C A;  3KIJ A;  1H75 A;  3VI7 A;  1BJX A;  4XS4 B;  2FWH A;  1Z7P A;  2P5R A;  1MD4 A;  2L4Q A;  5C00 A;  1K0B A;  2F8F A;  3L78 A;  1Y25 A;  4EXJ A;  1K0C A;  4O5R A;  5GAP D;  2P5Q A;  1AC1 A;  5IOW A;  2L57 A;  4YAP A;  2FD3 A;  1X5D A;  1YKA A;  2FA4 A;  3GL3 A;  1GNE A;  1YY7 A;  3P8W A;  1OC8 A;  2CVK A;  2PU9 C;  2HZE B;  3GA4 A;  5GST A;  1BED A;  1IYI A;  4HDE A;  3WGD A;  3LWA A;  2C0E A;  5ECN B;  2B6M A;  5IMC A;  4KGI A;  4V2N A;  1K3O A;  4KDX A;  4YQU A;  1N2A A;  3DD3 A;  3IBH A;  1X5E A;  3CYN A;  3IR4 A;  4GTU A;  5EY6 A;  1ZL9 A;  1JZD A;  4PXO A;  4NHW A;  3UJ1 A;  1FW1 A;  2HLS A;  2AAW A;  2DJK A;  1EEJ A;  10GS A;  3C1S A;  2NTO A;  2AYT A;  1JZR A;  2GDR A;  3FR3 A;  2FWG A;  3WGE A;  2HRK B;  2L6D A;  1ZYQ B;  3TOT A;  2WUL A;  3UBL A;  5GZZ B;  3EUR A;  2O7K A;  5J9C A;  5E59 A;  2IME A;  4IW9 A;  1R7H A;  2M46 A;  4TW5 A;  4L0U A;  3VFI A;  3VWU A;  4F03 A;  3F9U A;  3FW2 A;  1F37 A;  4DSR A;  3GSS A;  4ECB A;  1N8J A;  4TN8 A;  3KP8 A;  1GSD A;  1K0N A;  2LEG A;  1DE2 A;  2VLV A;  2H71 A;  1F2E A;  5ECP B;  1QMV A;  2VCX A;  4IN0 A;  3RPN A;  3N9J A;  1U3I A;  5DDL A;  4V1A g;  1XW5 A;  2G0F A;  3J7Y k;  1ZCP A;  1XOA A;  5FWG A;  3H79 A;  1CQG A;  1SJZ A;  5CNW A;  3F6F A;  4K1F A;  2V1M A;  2M72 A;  3JCM L;  3FZA A;  3CRT A;  2I81 A;  4WEY A;  3QPM A;  1GSQ A;  4N10 A;  1ON4 A;  5DQS A;  5BMU A;  3QMX A;  4OD7 A;  2R2J A;  3Q74 A;  1GUL A;  3KH9 A;  4ZBA A;  5FHI A;  3PR8 A;  1THO A;  1GTI A;  1I9D A;  2ZCT A;  1MDI A;  3F3R A;  1K0D A;  3CBU A;  3CTG A;  5KN2 A;  3WD6 A;  2A4V A;  2AHE A;  1PGT A;  5HR1 A;  4DSQ A;  5IOX A;  2GGT A;  1HNA A;  2XHF A;  1F3B A;  3GNJ A;  1XCC A;  2R3X A;  2HSH A;  1WOU A;  4D73 A;  2DJ2 A;  1B48 A;  4PX1 A;  4XS6 A;  2H75 A;  4V2M A;  3EU3 A;  1XWG A;  1YEX A;  2B5E A;  22GS A;  1XPV A;  3GTU A;  1XFL A;  3TKP A;  2H74 A;  4G0K A;  1K3Y A;  4KAE A;  2C4J A;  1XBS A;  1B9Y C;  4BVY B;  3GFK A;  5ECM B;  3NIV A;  4IVF A;  2MZC A;  4EVM A;  2H72 A;  4Q5Q A;  3IK9 A;  5JCU A;  1XWC A;  4N11 A;  1SJI A;  3PGT A;  3IC4 A;  5H5R A;  2BMX A;  8GSS A;  1SK2 A;  1UVZ A;  3Q18 A;  2KHP A;  4FYU A;  4EC0 A;  4P3Y B;  1K0O A;  5GAN D;  3FEU A;  1LBK A;  4GLT A;  2CT6 A;  5B7C A;  1SD8 A;  5G31 A;  2F51 A;  3FR9 A;  3KMO A;  4J2F A;  2H6Y A;  3IOS A;  2LST A;  3IK7 A;  3H93 A;  2PVO C;  3HVX A;  2F9S A;  1OC9 B;  2GT5 A;  2WB9 A;  4I2U A;  2LQO A;  1USB A;  5HQP A;  4WR5 A;  5H5Q A;  4TVE A;  5F05 A;  2OKA A;  3A2X A;  4YH2 A;  14GS A;  1OC3 A;  3APQ A;  3TUE A;  1THX A;  4XS1 A;  2FY6 A;  3D6I A;  3EU4 A;  2NDO A;  4KDU A;  3VPT A;  2JZS A;  5HFK A;  1XOB A;  1OAZ A;  20GS A;  3QAW A;  1MD3 A;  4KCE A;  4L5L A;  1BQ7 A;  2HRN A;  1TK0 B;  3F3Q A;  1V57 A;  1OE8 A;  1SYX A;  1R5A A;  2HSM A;  5EVO A;  3L9S A;  6GSV A;  3HD5 A;  3DKS A;  3QFA C;  3EWL A;  5D9X A;  1JLW A;  3LYP A;  5B8B A;  2R4V A;  4KE3 A;  1OVN A;  5HFI A;  4XS4 A;  2K18 A;  3LEF A;  3WT2 A;  1DBY A;  1B9X C;  1XVW A;  2CQ9 A;  4DSS B;  5J4U A;  3KEB A;  2FCH A;  5CYY A;  3GIX A;  1SK1 A;  1QGV A;  4USS A;  5D9W A;  1HYU A;  5GSS A;  4LMW A;  3G7J A;  4QQ7 A;  4ECI A;  4IKH A;  6GSU A;  3P7X A;  3KMN A;  4ECC A;  4NAX A;  1O8W A;  2H66 A;  2C3Q A;  3FR6 A;  3GKX A;  4TRX A;  3HDC A;  3GHA A;  1M9A A;  3ZL5 A;  4OFT A;  1EV4 A;  3ZML A;  4KA0 A;  1A0R P;  1B8X A;  4G9H A;  3ZFB A;  1PKW A;  2VCQ A;  1Z3E A;  3C73 A;  4AJ8 A;  2D2Z A;  3RHB A;  4DVC A;  3P2A A;  2CX3 A;  4IQA A;  4KCA A;  1A0F A;  1TP9 A;  2CVB A;  4ID0 A;  2IN3 A;  2YV7 A;  1SL2 B;  17GS A;  4RUV A;  5IIZ A;  3RDW A;  2NVL A;  2B5Y A;  2CA8 A;  3VI5 A;  3GUR A;  4NV5 A;  5DJL A;  4G10 A;  3LYK A;  3D4M A;  3DVW A;  3BCI A;  4JZQ A;  5D9T A;  2L5L A;  2PBJ A;  2WRT A;  4RI6 A;  3UIW A;  4E8H A;  4YAV A;  3A2W A;  4WBR D;  4YQV A;  3KGK A;  2DBC A;  3TJG A;  4WF4 A;  2C3T A;  1KBN A;  2YPM A;  3IE3 A;  4JED A;  5IQY A;  2YWO A;  3QFB C;  5J41 A;  1VGL A;  2I3Y A;  3GN3 A;  1WRY A;  3GRX A;  6GSW A;  3DYR A;  2VCV A;  2J23 A;  2MBT A;  2VD0 A;  1TRV A;  3P90 A;  1GSY A;  2DJ0 A;  3TJF A;  3L0H A;  1GSE A;  4BA7 A;  4Q5N A;  1F6M C;  1Z6N A;  4HS1 A;  1ILO A;  1TI3 A;  1PX7 A;  3UMA A;  4AJ6 A;  2X64 A;  3QCP A;  3VWV A;  1BX9 A;  4JBB A;  2HT9 A;  2LRT A;  1MEK A;  1NSW A;  4XIH A;  2ZNM A;  4BL7 A;  1Q4J A;  3FK8 A;  2V6K A;  5IPG A;  3UVH A;  1T7P B;  2IMI A;  2VOC A;  3TKS A;  1UN2 A;  3D22 A;  4BVX B;  4ZL9 A;  1ML6 A;  5D96 A;  1SKS B;  5AN1 A;  1U3A A;  4OMV A;  1X9M B;  4F0C A;  5AIX A;  3WT1 A;  1SL1 B;  3GKN A;  4RQX A;  2TIR A;  2MMZ A;  1U87 A;  3FKF A;  3O3T A;  1ERW A;  3EE2 A;  4FIW A;  1FVJ A;  3LFL A;  1M2B A;  2GTU A;  3CSJ A;  3TCO A;  3GKM A;  4JRR A;  4TR0 A;  3FZ9 A;  3EMP A;  3TKS C;  1ZZY A;  3C71 A;  16GS A;  3I6A A;  2OJL A;  4NPB A;  4IJI A;  4ILF A;  3VK9 A;  1X9S B;  2HXK A;  2RII A;  2JU5 A;  2RUE A;  2EC4 A;  4PNG A;  3KM6 A;  4GQF A;  1YKC A;  4X43 A;  4K0G A;  5DQY A;  13GS A;  2WS2 A;  4MH3 A;  1NW2 A;  5KN3 A;  2K8S A;  1ZGN A;  3W6G A;  5ECR B;  3HJP A;  2CZ3 A;  2GST A;  1A23 A;  2IMF A;  3SWL A;  3FZ4 A;  4K9Z A;  2EIR A;  1HNB A;  4CDO A;  4ML6 A;  4CW9 A;  5A5K A;  6GST A;  2O85 A;  3GV1 A;  2KOK A;  1URM A;  2LNT A;  2V32 A;  3TKR A;  2IIY A;  5G30 A;  1FB0 A;  1SK0 A;  5B8A A;  2H30 A;  1M0U A;  2VL3 A;  3G7Y A;  2J9H A;  2HRA A;  2WFC A;  2FNO A;  2GSR A;  3IC8 A;  1XVQ A;  4OFN A;  2GZZ A;  3HVS A;  3DXB A;  1HD2 A;  4TXO A;  3TRX A;  1OE7 A;  5HR2 A;  1XW6 A;  3KZQ A;  4OCE A;  3RAZ A;  2YZH A;  2HFD A;  3ISO A;  5EL8 A;  3ERW A;  2YWM A;  1GUK A;  4PUA A;  1T3B A;  3ZVJ D;  2JAD A;  1A2J A;  4KB3 A;  4GXZ A;  3F0I A; 
#chains in the Genus database with same CATH topology
 4PQ1 A;  5DAK A;  3F8U A;  3F4S A;  3QOU A;  1WIK A;  1DUG A;  2HQT A;  3ERG A;  3US3 A;  4PHZ C;  1EP8 A;  4G01 A;  4HZ2 A;  2ZUP A;  3D5J A;  5G2Z A;  2CX4 A;  2OAC A;  5CRG A;  1W4V A;  4POL A;  2HRF A;  5F8B A;  1BAY A;  2IFQ B;  2VLU A;  3A3T A;  3GYK A;  3KH7 A;  3ZMK A;  1JZO A;  5CAX A;  2Z9S A;  4G0I A;  5G5F A;  4KX4 A;  1WJK A;  3IAS 2;  2OBI A;  2G2Q A;  3GMF A;  4TOP A;  4OO5 A;  3EYT A;  4A5P A;  3DWV A;  4KSO A;  5ECL B;  2B3S A;  4TR1 B;  3BOA A;  4HUA A;  3ZZX A;  2LNS A;  4MPF A;  5ECK B;  4XTS A;  5ECI B;  1S3D A;  1PX6 A;  1EOG A;  4Q5R A;  4CY8 A;  1YF1 A;  5IO2 A;  1EGO A;  2QA1 A;  4PTS A;  2C1Y A;  3TJK A;  4HU7 A;  1DSB A;  4L5O A;  1F9M A;  4OCF A;  2GQK A;  2VL9 A;  1FOV A;  4EIQ A;  2B1L A;  3GH6 A;  4LL1 B;  1F3A A;  1W89 A;  3LJR A;  3L9V A;  2C0F A;  2CZ2 A;  5F07 A;  1XWK A;  3TJJ A;  2VCZ A;  2NBS A;  5ID2 A;  2I1U A;  4EE0 A;  4KF9 A;  3M0F A;  1TW9 A;  3GKK A;  5CP1 A;  3QD9 A;  1EV9 A;  1GSU A;  4K6X A;  4IBP A;  1TK8 B;  3F4R A;  4G19 A;  3MDK A;  5J47 A;  3LG6 A;  2V2G A;  1GTB A;  2O89 A;  1Z9H A;  3D4T A;  2H1A A;  4CHS A;  1EP7 A;  1AXD A;  2WVX A;  2V6O A;  1SYR A;  2IL3 A;  5HFG A;  2MBS A;  7GSS A;  4IHU A;  5F06 A;  3HXS A;  5DAL B;  3R2Q A;  2FWF A;  3G9B A;  2PPT A;  4DEJ A;  3HVV A;  3GST A;  1ZOF A;  1TRW A;  2R6K A;  4LLR A;  2FGX A;  3TDG A;  1U88 A;  3LGC A;  1QQ2 A;  2QSI A;  3LSZ A;  5KN0 A;  2F8A A;  1NM3 A;  3MNG A;  3FZ5 A;  1GTA A;  2F3M A;  1KTE A;  2DC5 A;  4MCU A;  3MIX A;  4F9Z A;  4ULX A;  2QGV A;  2DJJ A;  2JZT A;  3H1N A;  4OO4 A;  4GSN A;  2YWI A;  5AIS A;  1ZYE A;  3HY2 A;  3ZIJ A;  5FT3 A;  3E0U A;  2VCW A;  2OBK A;  2R5G A;  1A24 A;  4X4J A;  1AAZ A;  1R5P A;  4QL7 A;  4NWY A;  1H4O A;  4ZB8 A;  2ES7 A;  2N5A A;  2WGR A;  4HOJ A;  2R0G A;  1FHE A;  3NZN A;  3CRU A;  3ZRD A;  1AQV A;  2N5F A;  4K5R A;  3ME8 A;  2X8C A;  3APS A;  4ICY A;  2YJH A;  2MMO A;  1VRS D;  3F6D A;  2REM A;  1GWC A;  5A4V A;  2K9F A;  2X8H A;  1SL0 B;  2LJR A;  5L71 A;  5LNK e;  2H01 A;  1J9B A;  3WGX A;  2P0G A;  4L0W A;  3ME7 A;  3D21 A;  4MLY A;  4ZIL A;  3ZRE A;  5KOW A;  5COH A;  1SU9 A;  4IS0 A;  2HSN A;  2FA8 A;  4MJA A;  3EMX A;  5CRH A;  5INY A;  1JZW A;  2FLS A;  3HZ8 A;  1TJD A;  1WP0 A;  3TKS E;  4ECJ A;  1TOF A;  2PN8 A;  5JCG A;  5B6M A;  2DKH A;  3CQF A;  4ZL7 A;  1GLQ A;  1T4Y A;  2KP1 A;  5CRW A;  4HEA 2;  2CAQ A;  2XPE A;  2MMN A;  4EL1 A;  2LJK A;  3E9J B;  2DSA A;  1Z5Y E;  4K7I A;  1SVM A;  1B4P A;  4Q5F A;  3LW9 A;  1PA3 A;  2WW3 A;  2HZE A;  2WW0 A;  1QK8 A;  2LQQ A;  4JR4 A;  1GNW A;  2H70 A;  2DLX A;  2XPD A;  5D8I A;  2GZP A;  1B4Q A;  2VM1 A;  18GS A;  1V98 A;  3TB2 A;  1YEW C;  4N3Z A;  2CAI A;  5IMV A;  2MYG A;  1YJ6 A;  4PGT A;  4BWS A;  1YEP A;  3HKR A;  3A5I A;  2KUC A;  2XC2 A;  1GSS A;  1ERT A;  2B7J A;  2HRK A;  3IPZ A;  3Q6O A;  2FWE A;  1VF1 A;  2WDU A;  2O5V A;  1TKD B;  3I43 A;  3ZLP A;  1SKR B;  4NV2 A;  5BMU B;  2IMD A;  2HZF A;  4PUF C;  3MSZ A;  4HJM A;  4EDY A;  3QR6 A;  4N30 A;  4POB A;  1YQ1 A;  4XCS A;  2IMK A;  5G5E A;  2YV9 A;  2H6Z A;  1GTU A;  3EIN A;  1O6J A;  1EZK A;  4MK3 A;  1TK5 B;  2H19 A;  1T8E B;  3ZFL A;  3UEM A;  1JFU A;  2HSY A;  4L8E A;  4D73 B;  1U6T A;  3DVX A;  2PGT A;  2TRX A;  2OE1 A;  3J7Y b;  2L4C A;  2LTK A;  1GH2 A;  1JHB A;  4ZXG A;  1PL2 A;  4F82 A;  3M1G A;  3S9F A;  3GTU B;  3KCM A;  3C7M A;  1G0T A;  5IMF A;  1C72 A;  3ED3 A;  3UL3 A;  4MZC A;  4EDZ A;  4JE1 A;  3R3E A;  4GST A;  4BWQ A;  3VWW A;  4E68 A;  1T1V A;  2DML A;  1ST9 A;  2JSY A;  1BYE A;  4JU5 A;  4O92 A;  2K8V A;  2ON5 A;  1E6B A;  1GP1 A;  1PN9 A;  2GSQ A;  2WZS A;  4TKY A;  2VM2 A;  3QAV A;  1M2A A;  1XWA A;  5IMZ A;  1WPI A;  5JWR B;  4IJ3 A;  1OYJ A;  3CXG A;  2XBI A;  4PQI A;  2OE0 A;  1NHO A;  4XRD A;  2GVP A;  3BJ5 A;  1TI1 A;  1TU7 A;  4K7O A;  1MTC A;  5ELA A;  2M80 A;  5JWQ B;  2VAF A;  3KP9 A;  1GLP A;  1M2D A;  1S3A A;  2YNX A;  4F2I A;  5J9B A;  2IJY A;  4I8B A;  3UAR A;  3UBK A;  3M8N A;  3LQ7 A;  3GX8 A;  4WKW A;  4BPY A;  4BVY A;  1LJR A;  2X8G A;  1EEM A;  4ZIJ A;  1M7T A;  4FYB A;  4MJE A;  1Q98 A;  4H86 A;  1ERV A;  4HU9 A;  2WW2 A;  3EC3 A;  1XIY A;  4X1U A;  2X4A A;  3RHC A;  5CRE A;  4IQ1 A;  4ACS A;  4G0L A;  1XZO A;  2LUS A;  4KSM A;  3HA9 A;  2HSM B;  4FYC A;  2GLR A;  3DRN A;  3TRP A;  1GUH A;  4MDC A;  1TU8 A;  4ISD A;  2JSZ A;  1T4Z A;  3ERF A;  4KW6 A;  5A5H B;  1PMT A;  1OC9 A;  1G7E A;  2HI7 A;  2K6V A;  1EGR A;  4YQM A;  4HZ4 A;  2VLT A;  2EFD A;  3M3M A;  3DEX A;  2RM6 A;  5HR3 A;  12GS A;  2H0H A;  2O8V B;  3WYW A;  3IAM 2;  4AJ7 A;  2H1G A;  2DJ1 A;  2LS5 A;  2E0Q A;  2CV4 A;  5CO3 A;  4MF5 A;  6GSS A;  3VPQ A;  1O8X A;  4N0Z A;  4HQS A;  4KH7 A;  2H0I A;  1DE1 A;  1PQN A;  4GSS A;  5A4U A;  1Z7R A;  2VL2 A;  1K3L A;  3KXO A;  1XXU A;  1TTZ A;  5D73 A;  3UVT A;  4FH8 A;  1V9W A;  4QL9 A;  2JAC A;  3U5R E;  2KLX A;  2PMT A;  5KN1 A;  3MAK A;  2DJ3 A;  2A2R A;  2P31 A;  4WR4 A;  1KEB A;  1PN0 A;  4AGS A;  1K0M A;  3HMJ G;  2A4H A;  4DSS A;  2PWJ A;  1KNG A;  1X5C A;  5AIV A;  1G6W A;  2GQL A;  2XBQ A;  3EPT A;  4I97 A;  4IGJ A;  4ZBB A;  3IXR A;  1V58 A;  4TR3 A;  1EOH A;  1UA5 A;  1XW9 A;  2VL2 C;  1T00 A;  3F63 A;  3U6V A;  3N5O A;  1S4B P;  5J5N A;  2V41 A;  2A2S A;  4GF0 A;  2C3N A;  3GH9 A;  2H76 A;  5E4W A;  3UAP A;  5D9V A;  3TOU A;  3FRC A;  5DJM A;  4MF6 A;  1SJ6 A;  3LXZ A;  4HJ2 A;  3ZYW A;  1AUC A;  4GCI A;  1QXH A;  3APO A;  4LA1 A;  2NPB A;  1MDK A;  1V2A A;  1AIU A;  1A2L A;  1VF2 A;  1FG4 A;  4MMM A;  4MNN A;  3GL5 A;  3GX0 A;  3IA1 A;  1ACV A;  1OKT A;  2AB6 A;  4PI0 C;  4N0V A;  3W8S A;  4EIP A;  4NMU A;  4AF2 A;  3MWH A;  1BG5 A;  4NHZ A;  1GRX A;  4J56 E;  2O3E A;  3CSH A;  3HJM A;  3IDV A;  2JL4 A;  1XWB A;  3AY8 A;  1GSF A;  2C0G A;  3OR5 A;  6GSY A;  1MDJ A;  1RK4 A;  4BL7 B;  3HZ4 A;  3D0Z A;  1S3C A;  1I5G A;  2HYX A;  1PD2 1;  1S3R A;  4MJC A;  3IHQ A;  4CY6 A;  19GS A;  3I9V 2;  5JWO B;  3L4N A;  3NOF A;  2E2G A;  2X99 A;  4MH2 A;  2OA7 A;  1LU4 A;  3H8Q A;  2YZU A;  4MP4 A;  3RBT A;  1X9W B;  5HR0 A;  3ZIT A;  2LJA A;  4IP6 A;  4K2D A;  1SEN A;  2QKE A;  2YOI A;  3KTL A;  5G1L A;  1NHY A;  1WWJ A;  3C8E A;  3HYP A;  5J4Y A;  2ON7 A;  2LRN A;  4PUR A;  1WE0 A;  2PER A;  2OAD A;  4K8M A;  1QUW A;  2GZY A;  4ZL8 A;  2VUP A;  4GWR A;  3SBC A;  1FAA A;  5IO0 A;  5DCH A;  3ZIV A;  4Z2T A;  4O7H A;  2H1B A;  4KUN A;  1PFO A;  1XG8 A;  3GUS A;  5LCZ A;  4BVX A;  3DIE A;  4XRA A;  4V1A p;  1R26 A;  1RW1 A;  5JCW A;  4ZB9 A;  3QAG A;  2YJ7 A;  4V2L A;  3IV4 A;  3PH9 A;  1VF4 A;  2B7K A;  2GT6 A;  4YKG A;  2BJX A;  3VUR A;  1M3I A;  4K7N A;  4MA9 A;  1FB6 A;  3EVI A;  1O7U A;  4GQC A;  1VF3 A;  4K5S A;  1TXX A;  4FO5 A;  3H4K A;  3M9J A;  2I9H A;  4GRF A;  4POK A;  5A34 A;  2VCT A;  2WJU A;  2E7P A;  3DML A;  5EPF A;  5A1N A;  2WVY A;  4EUY A;  2H73 A;  4JR6 A;  1A2M A;  4LL4 B;  3FYG A;  4AKH A;  5G1K A;  4EF0 A;  4TR4 A;  2H6X A;  3RFR C;  3O76 A;  5KOX A;  5ECS A;  1SKW B;  4F0B A;  2PUK C;  4FQU A;  1WMJ A;  3BCK A;  4WBJ A;  3I69 A;  1PL1 A;  4TXO B;  4I5Q A;  1JLV A;  1J08 A;  1FVK A;  2LRC A;  2YCD A;  4MPG A;  2L5O A;  1PRX A;  3E3E A;  1M99 A;  2C8U A;  4I6X A;  1SD9 A;  5DBQ A;  3HHV A;  2IPA A;  4J57 E;  4MF7 A;  3ZTL A;  5ABR A;  5B6N A;  5DAK B;  4MZB A;  3TKQ A;  3QDN A;  1G6Y A;  2B1K A;  3G7I A;  5DCG A;  3PIN A;  5IMD A;  4KND A;  5IM9 A;  4RI7 A;  5D93 A;  11GS A;  3BBY A;  1TRU A;  4RQR A;  3RPP A;  2YAN A;  3UOM A;  3L9U A;  4POM A;  4MAB A;  1AW9 A;  4O5U A;  5ELG A;  2I4A A;  4XHM A;  2RLI A;  5IPH A;  3FY7 A;  2MMA A;  2AV4 A;  2GQM A;  2VIM A;  5LD0 A;  2CVD A;  2RUF A;  4X0X A;  3TGZ A;  3DGQ A;  1FO5 A;  1K0A A;  4IP1 A;  1R4W A;  5J3R A;  4LMV A;  5ECH B;  3C1R A;  4EO3 A;  1X0R A;  3V1W A;  1ERU A;  1FOH A;  3IRA A;  2BTO T;  4HI7 A;  2LKU A;  4O32 A;  4Z7X A;  3VLN A;  2PVQ A;  2QC7 A;  3A2V A;  1UC7 A;  1A8L A;  2R37 A;  5J40 A;  1EWX A;  4AI6 A;  2YWN A;  2RM5 A;  4MZW A;  2FHE A;  4IEL A;  2DMM A;  3CTF A;  4E8E A;  2O36 A;  5J4V A;  3BD2 A;  3W8J A;  3KD0 A;  2WW1 A;  1A8Y A;  2C80 A;  5CRD A;  3K8N A;  3CMI A;  2IFQ A;  1PSQ A;  5A4W A;  2YP6 A;  5ENU A;  4TXV A;  4OWY A;  5ID2 B;  1O85 A;  4I2T A;  2VD1 A;  3Q19 A;  6GSX A;  4WF5 A;  2UZ8 A;  4BIK A;  2N5B A;  3VWX A;  1Y6E A;  9GSS A;  1CQH A;  1IYH A;  4HQZ A;  4OFM A;  1HQO A;  1YZX A;  2WZ9 A;  4WXT A;  1J0F A;  3TU3 B;  4FXY P;  2DIZ A;  4TR1 A;  4G2E A;  1ZMA A;  1E2Y A;  2JZR A;  3KTB A;  2B5X A;  1V40 A;  2O87 A;  2OE3 A;  2WVX B;  3RGB C;  4PI2 C;  4NXI A;  3KJY A;  2C0D A;  3M9K A;  4ZBD A;  2AUV A;  1ABA A;  1O73 A;  2EIQ A;  2HNL A;  2A2P A;  2L59 A;  3PPU A;  3HCZ A;  4MJB A;  1M9B A;  4K0N A;  1PKZ A;  1GL8 A;  1YF0 A;  1OKD A;  3ZVJ A;  3TJB A;  1TDI A;  3LXT A;  1TRS A;  1AQW A;  2WCI A;  2E2M A;  3F4T A;  1QFN A;  2EIO A;  2KP2 A;  3FHK A;  2EFH A;  2GS3 A;  5F0G A;  1YVL A;  5IMA A;  5KEJ A;  2VO4 A;  4WET A;  2ALB A;  4PNF A;  2H8L A;  3HJO A;  4EKZ A;  2HE3 A;  1HNC A;  4KDY A;  1Z6M A;  4ZB6 A;  5ECQ B;  2DIY A;  5C04 A;  4O5Q A;  1BF5 A;  4PQH A;  3CSI A;  3O6T A;  3A5W A;  2YN1 A;  5DAL A;  2TRC P;  4AKX B;  5AGY A;  5H5S A;  1YDK A;  1RQM A;  2FUG 2;  2LV3 A;  1AQX A;  1GUM A;  2H0G A;  1G7O A;  4ML1 A;  3LOR A;  2H1D A;  2UV8 G;  2QA2 A;  2GSS A;  5ECO B;  5DVB A;  1O81 A;  2X49 A;  2IWT A;  2HSN B;  3TRQ A;  1BG1 A;  2AJQ B;  2L6C A;  3KIJ A;  1H75 A;  3VI7 A;  1BJX A;  4XS4 B;  2FWH A;  1Z7P A;  2P5R A;  1MD4 A;  2L4Q A;  5C00 A;  1K0B A;  2F8F A;  3L78 A;  1Y25 A;  4EXJ A;  1K0C A;  4O5R A;  5GAP D;  2P5Q A;  1AC1 A;  4AKG A;  5IOW A;  2L57 A;  4YAP A;  2FD3 A;  1X5D A;  1YKA A;  2FA4 A;  1M3J A;  4GDF A;  3CHX C;  3GL3 A;  1GNE A;  1YY7 A;  3P8W A;  1OC8 A;  2CVK A;  2PU9 C;  2HZE B;  3GA4 A;  5GST A;  1BED A;  1IYI A;  4HDE A;  3WGD A;  2C0E A;  3LWA A;  5ECN B;  2B6M A;  5IMC A;  4KGI A;  4V2N A;  1K3O A;  4KDX A;  4YQU A;  1N2A A;  3DD3 A;  3IBH A;  1X5E A;  3CYN A;  3IR4 A;  4GTU A;  5EY6 A;  1ZL9 A;  1JZD A;  4PXO A;  4NHW A;  3UJ1 A;  1FW1 A;  2HLS A;  2AAW A;  2DJK A;  4K2X A;  1EEJ A;  10GS A;  3C1S A;  1ZYP A;  2NTO A;  2AYT A;  1JZR A;  2GDR A;  3FR3 A;  2FWG A;  3WGE A;  2HRK B;  2L6D A;  1ZYQ B;  3TOT A;  2WUL A;  3UBL A;  5GZZ B;  3EUR A;  2O7K A;  5J9C A;  5E59 A;  2IME A;  4IW9 A;  1R7H A;  2M46 A;  4TW5 A;  4L0U A;  3VFI A;  3VWU A;  4F03 A;  3F9U A;  3FW2 A;  1F37 A;  4DSR A;  3GSS A;  4ECB A;  1N8J A;  4TN8 A;  3KP8 A;  1GSD A;  1K0N A;  2LEG A;  1DE2 A;  2VLV A;  2H71 A;  1F2E A;  5ECP B;  1QMV A;  2VCX A;  4IN0 A;  3RPN A;  3N9J A;  1U3I A;  5DDL A;  4V1A g;  1XW5 A;  2G0F A;  3J7Y k;  1ZCP A;  1XOA A;  5FWG A;  3H79 A;  1CQG A;  1SJZ A;  5CNW A;  3F6F A;  4K1F A;  2V1M A;  2M72 A;  3JCM L;  3FZA A;  2VKZ G;  3CRT A;  2I81 A;  4WEY A;  3QPM A;  1GSQ A;  4N10 A;  1ON4 A;  5DQS A;  5BMU A;  3QMX A;  4OD7 A;  2R2J A;  3Q74 A;  1GUL A;  3KH9 A;  4ZBA A;  5FHI A;  3PR8 A;  1THO A;  1GTI A;  1I9D A;  2ZCT A;  1MDI A;  3F3R A;  1K0D A;  3CBU A;  3CTG A;  5KN2 A;  3WD6 A;  2A4V A;  2AHE A;  1PGT A;  5HR1 A;  4Z2U A;  4DSQ A;  5IOX A;  2GGT A;  1HNA A;  2XHF A;  1F3B A;  3GNJ A;  2WVZ A;  1XCC A;  2R3X A;  2HSH A;  1WOU A;  4D73 A;  2DJ2 A;  1B48 A;  4PX1 A;  4XS6 A;  2H75 A;  4V2M A;  3EU3 A;  1XWG A;  1YEX A;  2B5E A;  22GS A;  4W66 A;  3GTU A;  1XFL A;  1XPV A;  3TKP A;  2H74 A;  4G0K A;  1K3Y A;  4KAE A;  2C4J A;  1XBS A;  1B9Y C;  4BVY B;  3GFK A;  5ECM B;  3NIV A;  3FMW A;  4IVF A;  2MZC A;  4EVM A;  2H72 A;  4Q5Q A;  3IK9 A;  5JCU A;  1XWC A;  4N11 A;  1SJI A;  3PGT A;  3IC4 A;  5H5R A;  2BMX A;  8GSS A;  1SK2 A;  1UVZ A;  1I1I P;  3Q18 A;  2KHP A;  4FYU A;  4EC0 A;  4P3Y B;  1K0O A;  5GAN D;  3FEU A;  1LBK A;  4GLT A;  2CT6 A;  2OT3 A;  5B7C A;  1SD8 A;  5G31 A;  2F51 A;  3FR9 A;  3KMO A;  4J2F A;  2H6Y A;  3IOS A;  2LST A;  3IK7 A;  2EFE A;  3H93 A;  2PVO C;  3HVX A;  2F9S A;  1OC9 B;  2GT5 A;  2WB9 A;  4I2U A;  2LQO A;  1USB A;  4ZB7 A;  5HQP A;  4WR5 A;  5H5Q A;  4TVE A;  5F05 A;  2OKA A;  3A2X A;  4YH2 A;  14GS A;  1OC3 A;  3APQ A;  3TUE A;  1THX A;  4XS1 A;  2FY6 A;  3D6I A;  3EU4 A;  2R0C A;  2NDO A;  4KDU A;  3VPT A;  2JZS A;  5HFK A;  1XOB A;  1OAZ A;  1SVL A;  1N25 A;  20GS A;  3QAW A;  1MD3 A;  4KCE A;  4L5L A;  1BQ7 A;  2HRN A;  1TK0 B;  3F3Q A;  1V57 A;  1OE8 A;  1SYX A;  1R5A A;  2HSM A;  5EVO A;  3L9S A;  6GSV A;  3HD5 A;  3DKS A;  3QFA C;  3EWL A;  5D9X A;  1JLW A;  3LYP A;  5B8B A;  2R4V A;  4KE3 A;  5A5H A;  1OVN A;  5HFI A;  4XS4 A;  2K18 A;  3LEF A;  3WT2 A;  1DBY A;  1B9X C;  1XVW A;  2CQ9 A;  4DSS B;  5J4U A;  3KEB A;  2FCH A;  5CYY A;  3GIX A;  1SK1 A;  1QGV A;  4USS A;  5D9W A;  1HYU A;  1Y1U A;  5GSS A;  4LMW A;  3G7J A;  4QQ7 A;  4ECI A;  4IKH A;  6GSU A;  3P7X A;  3KMN A;  4ECC A;  4NAX A;  1O8W A;  2H66 A;  2C3Q A;  3FR6 A;  3GKX A;  4TRX A;  3HDC A;  3GHA A;  1M9A A;  3ZL5 A;  4OFT A;  1EV4 A;  3ZML A;  4KA0 A;  1A0R P;  1B8X A;  4G9H A;  3ZFB A;  1PKW A;  2VCQ A;  1Z3E A;  3C73 A;  4AJ8 A;  2D2Z A;  3RHB A;  4AKI A;  4DVC A;  3P2A A;  2CX3 A;  4IQA A;  2DKI A;  4KCA A;  1A0F A;  1TXU A;  1TP9 A;  2CVB A;  4ID0 A;  2IN3 A;  2YV7 A;  1SL2 B;  17GS A;  4RUV A;  5IIZ A;  3RDW A;  2NVL A;  2B5Y A;  4HSC X;  2CA8 A;  3VI5 A;  3GUR A;  4NV5 A;  5DJL A;  4G10 A;  3LYK A;  3D4M A;  3DVW A;  3BCI A;  4JZQ A;  5D9T A;  2L5L A;  2PBJ A;  2WRT A;  4RI6 A;  3UIW A;  4E8H A;  4YAV A;  3A2W A;  4WBR D;  4YQV A;  3KGK A;  2DBC A;  3TJG A;  4WF4 A;  2C3T A;  1KBN A;  2YPM A;  3IE3 A;  4JED A;  5IQY A;  2YWO A;  3QFB C;  5J41 A;  3IHG A;  1VGL A;  2I3Y A;  3GN3 A;  1WRY A;  3GRX A;  6GSW A;  3DYR A;  2VCV A;  2J23 A;  2MBT A;  2VD0 A;  1TRV A;  3P90 A;  1GSY A;  2DJ0 A;  3TJF A;  3L0H A;  1GSE A;  4BA7 A;  4Q5N A;  1F6M C;  1Z6N A;  4HS1 A;  1ILO A;  1TI3 A;  1PX7 A;  3UMA A;  4AJ6 A;  2X64 A;  3QCP A;  3VWV A;  1BX9 A;  4JBB A;  2HT9 A;  2LRT A;  1MEK A;  1NSW A;  4XIH A;  2ZNM A;  4BL7 A;  1Q4J A;  3FK8 A;  2V6K A;  5IPG A;  3UVH A;  1T7P B;  2IMI A;  2VOC A;  3TKS A;  1UN2 A;  3D22 A;  4YKF A;  3CWG A;  4BVX B;  4ZL9 A;  1ML6 A;  5D96 A;  1SKS B;  3MYD A;  5AN1 A;  1U3A A;  4OMV A;  1X9M B;  4F0C A;  5AIX A;  3WT1 A;  1SL1 B;  2R0P A;  3GKN A;  4Z2R A;  4RQX A;  2TIR A;  2MMZ A;  1U87 A;  3FKF A;  3O3T A;  1ERW A;  3EE2 A;  4FIW A;  1FVJ A;  5A34 B;  3LFL A;  1M2B A;  2GTU A;  3CSJ A;  3TCO A;  5A1N B;  3GKM A;  4JRR A;  4TR0 A;  3FZ9 A;  3EMP A;  3TKS C;  1ZZY A;  3C71 A;  16GS A;  3I6A A;  2OJL A;  4NPB A;  4IJI A;  4ILF A;  3VK9 A;  1X9S B;  2HXK A;  2RII A;  2JU5 A;  2RUE A;  2EC4 A;  4PNG A;  3KM6 A;  4GQF A;  1YKC A;  4QMK A;  4X43 A;  4K0G A;  5DQY A;  13GS A;  2WS2 A;  4MH3 A;  1NW2 A;  5KN3 A;  2K8S A;  1ZGN A;  3W6G A;  5ECR B;  3HVN A;  3HJP A;  2CZ3 A;  2GST A;  1A23 A;  2IMF A;  3SWL A;  3FZ4 A;  4K9Z A;  2EIR A;  1HNB A;  4CDO A;  4ML6 A;  4CW9 A;  5A5K A;  6GST A;  2O85 A;  3GV1 A;  2KOK A;  1URM A;  2LNT A;  2V32 A;  3TKR A;  2IIY A;  5G30 A;  1FB0 A;  1SK0 A;  5B8A A;  2H30 A;  1M0U A;  2VL3 A;  3G7Y A;  2J9H A;  2HRA A;  2WFC A;  2FNO A;  2GSR A;  3IC8 A;  1XVQ A;  4OFN A;  2GZZ A;  3HVS A;  3DXB A;  1HD2 A;  4TXO A;  3TRX A;  1OE7 A;  5HR2 A;  1XW6 A;  3KZQ A;  2EFC A;  2H1L A;  4OCE A;  3RAZ A;  2YZH A;  2HFD A;  3ISO A;  5EL8 A;  3ERW A;  2YWM A;  1GUK A;  4PUA A;  1T3B A;  3ZVJ D;  2JAD A;  1A2J A;  4KB3 A;  4GXZ A;  5BRT A;  1ZYN A;  1SVO A;  3F0I A; 
#chains in the Genus database with same CATH homology
 4PQ1 A;  5DAK A;  3F8U A;  3F4S A;  3QOU A;  1WIK A;  1DUG A;  2HQT A;  3ERG A;  3US3 A;  1EP8 A;  4G01 A;  4HZ2 A;  2ZUP A;  3D5J A;  5G2Z A;  2CX4 A;  2OAC A;  5CRG A;  1W4V A;  4POL A;  2HRF A;  5F8B A;  1BAY A;  2IFQ B;  2VLU A;  3A3T A;  3GYK A;  3KH7 A;  3ZMK A;  1JZO A;  5CAX A;  2Z9S A;  4G0I A;  5G5F A;  4KX4 A;  1WJK A;  3IAS 2;  2OBI A;  2G2Q A;  3GMF A;  4TOP A;  4OO5 A;  3EYT A;  4A5P A;  3DWV A;  4KSO A;  5ECL B;  2B3S A;  4TR1 B;  3BOA A;  4HUA A;  3ZZX A;  2LNS A;  4MPF A;  5ECK B;  4XTS A;  5ECI B;  1S3D A;  1PX6 A;  1EOG A;  4Q5R A;  4CY8 A;  1YF1 A;  5IO2 A;  1EGO A;  2QA1 A;  4PTS A;  2C1Y A;  3TJK A;  4HU7 A;  1DSB A;  4L5O A;  1F9M A;  4OCF A;  2GQK A;  2VL9 A;  1FOV A;  4EIQ A;  2B1L A;  3GH6 A;  4LL1 B;  1F3A A;  1W89 A;  3LJR A;  3L9V A;  2C0F A;  2CZ2 A;  5F07 A;  1XWK A;  3TJJ A;  2VCZ A;  2NBS A;  5ID2 A;  2I1U A;  4EE0 A;  4KF9 A;  3M0F A;  1TW9 A;  3GKK A;  5CP1 A;  3QD9 A;  1EV9 A;  1GSU A;  4K6X A;  4IBP A;  1TK8 B;  3F4R A;  4G19 A;  3MDK A;  5J47 A;  3LG6 A;  2V2G A;  1GTB A;  2O89 A;  1Z9H A;  3D4T A;  2H1A A;  4CHS A;  1EP7 A;  1AXD A;  2V6O A;  1SYR A;  2IL3 A;  5HFG A;  2MBS A;  7GSS A;  4IHU A;  5F06 A;  3HXS A;  5DAL B;  3R2Q A;  2FWF A;  3G9B A;  2PPT A;  4DEJ A;  3HVV A;  3GST A;  1ZOF A;  1TRW A;  2R6K A;  4LLR A;  2FGX A;  3TDG A;  1U88 A;  3LGC A;  1QQ2 A;  2QSI A;  3LSZ A;  5KN0 A;  2F8A A;  1NM3 A;  3MNG A;  3FZ5 A;  1GTA A;  2F3M A;  1KTE A;  2DC5 A;  4MCU A;  3MIX A;  4F9Z A;  4ULX A;  2QGV A;  2DJJ A;  2JZT A;  3H1N A;  4OO4 A;  4GSN A;  2YWI A;  5AIS A;  1ZYE A;  3HY2 A;  3ZIJ A;  5FT3 A;  3E0U A;  2VCW A;  2OBK A;  2R5G A;  1A24 A;  4X4J A;  1AAZ A;  1R5P A;  4QL7 A;  4NWY A;  1H4O A;  4ZB8 A;  2ES7 A;  2N5A A;  2WGR A;  4HOJ A;  2R0G A;  1FHE A;  3NZN A;  3CRU A;  3ZRD A;  1AQV A;  2N5F A;  4K5R A;  3ME8 A;  2X8C A;  3APS A;  4ICY A;  2YJH A;  2MMO A;  1VRS D;  3F6D A;  2REM A;  1GWC A;  5A4V A;  2K9F A;  2X8H A;  1SL0 B;  2LJR A;  5L71 A;  5LNK e;  2H01 A;  1J9B A;  3WGX A;  2P0G A;  4L0W A;  3ME7 A;  3D21 A;  4MLY A;  4ZIL A;  3ZRE A;  5KOW A;  5COH A;  1SU9 A;  4IS0 A;  2HSN A;  2FA8 A;  4MJA A;  3EMX A;  5CRH A;  5INY A;  1JZW A;  2FLS A;  3HZ8 A;  1TJD A;  1WP0 A;  3TKS E;  4ECJ A;  1TOF A;  2PN8 A;  5JCG A;  5B6M A;  2DKH A;  4ZL7 A;  1GLQ A;  1T4Y A;  2KP1 A;  5CRW A;  4HEA 2;  2CAQ A;  2XPE A;  2MMN A;  4EL1 A;  2LJK A;  3E9J B;  2DSA A;  1Z5Y E;  4K7I A;  1SVM A;  1B4P A;  4Q5F A;  3LW9 A;  1PA3 A;  2HZE A;  2LQQ A;  1QK8 A;  4JR4 A;  1GNW A;  2H70 A;  2DLX A;  2XPD A;  5D8I A;  2GZP A;  1B4Q A;  2VM1 A;  18GS A;  1V98 A;  3TB2 A;  4N3Z A;  2CAI A;  5IMV A;  2MYG A;  1YJ6 A;  4PGT A;  4BWS A;  1YEP A;  3HKR A;  3A5I A;  2KUC A;  2XC2 A;  1GSS A;  1ERT A;  2B7J A;  2HRK A;  3IPZ A;  3Q6O A;  2FWE A;  1VF1 A;  2WDU A;  2O5V A;  1TKD B;  3I43 A;  3ZLP A;  1SKR B;  4NV2 A;  5BMU B;  2IMD A;  2HZF A;  4PUF C;  3MSZ A;  4HJM A;  4EDY A;  3QR6 A;  4N30 A;  4POB A;  1YQ1 A;  4XCS A;  2IMK A;  5G5E A;  2YV9 A;  2H6Z A;  1GTU A;  3EIN A;  1O6J A;  1EZK A;  4MK3 A;  1TK5 B;  2H19 A;  1T8E B;  3ZFL A;  3UEM A;  1JFU A;  2HSY A;  4L8E A;  4D73 B;  1U6T A;  3DVX A;  2PGT A;  2TRX A;  2OE1 A;  3J7Y b;  2L4C A;  2LTK A;  1GH2 A;  1JHB A;  4ZXG A;  1PL2 A;  4F82 A;  3M1G A;  3S9F A;  3GTU B;  3KCM A;  3C7M A;  1G0T A;  5IMF A;  1C72 A;  3ED3 A;  3UL3 A;  4MZC A;  4EDZ A;  4JE1 A;  3R3E A;  4GST A;  4BWQ A;  3VWW A;  4E68 A;  1T1V A;  2DML A;  1ST9 A;  2JSY A;  1BYE A;  4JU5 A;  4O92 A;  2K8V A;  2ON5 A;  1E6B A;  1GP1 A;  1PN9 A;  2GSQ A;  4TKY A;  2VM2 A;  3QAV A;  1M2A A;  1XWA A;  5IMZ A;  1WPI A;  5JWR B;  4IJ3 A;  1OYJ A;  3CXG A;  2XBI A;  4PQI A;  2OE0 A;  1NHO A;  4XRD A;  2GVP A;  3BJ5 A;  1TI1 A;  1TU7 A;  4K7O A;  1MTC A;  5ELA A;  2M80 A;  5JWQ B;  2VAF A;  3KP9 A;  1GLP A;  1M2D A;  1S3A A;  2YNX A;  4F2I A;  5J9B A;  2IJY A;  4I8B A;  3UAR A;  3UBK A;  3M8N A;  3LQ7 A;  3GX8 A;  4WKW A;  4BPY A;  4BVY A;  1LJR A;  2X8G A;  1EEM A;  4ZIJ A;  1M7T A;  4FYB A;  4MJE A;  1Q98 A;  4H86 A;  1ERV A;  4HU9 A;  3EC3 A;  1XIY A;  4X1U A;  2X4A A;  3RHC A;  5CRE A;  4IQ1 A;  4ACS A;  4G0L A;  1XZO A;  2LUS A;  4KSM A;  3HA9 A;  2HSM B;  4FYC A;  2GLR A;  3DRN A;  3TRP A;  1GUH A;  4MDC A;  1TU8 A;  4ISD A;  2JSZ A;  1T4Z A;  3ERF A;  4KW6 A;  5A5H B;  1PMT A;  1OC9 A;  1G7E A;  2HI7 A;  2K6V A;  1EGR A;  4YQM A;  4HZ4 A;  2VLT A;  2EFD A;  3M3M A;  3DEX A;  2RM6 A;  5HR3 A;  12GS A;  2H0H A;  2O8V B;  3WYW A;  3IAM 2;  4AJ7 A;  2H1G A;  2DJ1 A;  2LS5 A;  2E0Q A;  2CV4 A;  5CO3 A;  4MF5 A;  6GSS A;  3VPQ A;  1O8X A;  4N0Z A;  4HQS A;  4KH7 A;  2H0I A;  1DE1 A;  1PQN A;  4GSS A;  5A4U A;  1Z7R A;  2VL2 A;  1K3L A;  3KXO A;  1XXU A;  1TTZ A;  5D73 A;  3UVT A;  4FH8 A;  1V9W A;  4QL9 A;  2JAC A;  3U5R E;  2KLX A;  2PMT A;  5KN1 A;  3MAK A;  2DJ3 A;  2A2R A;  2P31 A;  4WR4 A;  1KEB A;  1PN0 A;  4AGS A;  1K0M A;  3HMJ G;  2A4H A;  4DSS A;  2PWJ A;  1KNG A;  1X5C A;  5AIV A;  1G6W A;  2GQL A;  2XBQ A;  3EPT A;  4I97 A;  4IGJ A;  4ZBB A;  3IXR A;  1V58 A;  4TR3 A;  1EOH A;  1UA5 A;  1XW9 A;  2VL2 C;  1T00 A;  3F63 A;  3U6V A;  3N5O A;  5J5N A;  2V41 A;  2A2S A;  4GF0 A;  2C3N A;  3GH9 A;  2H76 A;  5E4W A;  3UAP A;  5D9V A;  3TOU A;  3FRC A;  5DJM A;  4MF6 A;  1SJ6 A;  3LXZ A;  4HJ2 A;  3ZYW A;  1AUC A;  4GCI A;  1QXH A;  3APO A;  4LA1 A;  2NPB A;  1MDK A;  1V2A A;  1AIU A;  1A2L A;  1VF2 A;  1FG4 A;  4MMM A;  4MNN A;  3GL5 A;  3GX0 A;  3IA1 A;  1ACV A;  1OKT A;  2AB6 A;  4N0V A;  3W8S A;  4EIP A;  4NMU A;  4AF2 A;  3MWH A;  1BG5 A;  4NHZ A;  1GRX A;  4J56 E;  3CSH A;  3HJM A;  3IDV A;  2JL4 A;  1XWB A;  3AY8 A;  1GSF A;  2C0G A;  3OR5 A;  6GSY A;  1MDJ A;  1RK4 A;  4BL7 B;  3HZ4 A;  3D0Z A;  1S3C A;  1I5G A;  2HYX A;  1PD2 1;  4MJC A;  3IHQ A;  4CY6 A;  19GS A;  3I9V 2;  5JWO B;  3L4N A;  3NOF A;  2E2G A;  2X99 A;  4MH2 A;  2OA7 A;  1LU4 A;  3H8Q A;  2YZU A;  4MP4 A;  3RBT A;  1X9W B;  5HR0 A;  3ZIT A;  2LJA A;  4IP6 A;  4K2D A;  1SEN A;  2QKE A;  2YOI A;  3KTL A;  5G1L A;  1NHY A;  1WWJ A;  3C8E A;  3HYP A;  5J4Y A;  2ON7 A;  2LRN A;  4PUR A;  1WE0 A;  2PER A;  2OAD A;  4K8M A;  1QUW A;  2GZY A;  4ZL8 A;  2VUP A;  4GWR A;  3SBC A;  1FAA A;  5IO0 A;  5DCH A;  3ZIV A;  4Z2T A;  4O7H A;  2H1B A;  4KUN A;  3GUS A;  5LCZ A;  4BVX A;  3DIE A;  4XRA A;  4V1A p;  1R26 A;  1RW1 A;  5JCW A;  4ZB9 A;  3QAG A;  2YJ7 A;  4V2L A;  3IV4 A;  3PH9 A;  1VF4 A;  2B7K A;  2GT6 A;  4YKG A;  2BJX A;  3VUR A;  4K7N A;  4MA9 A;  1FB6 A;  3EVI A;  1O7U A;  4GQC A;  1VF3 A;  4K5S A;  1TXX A;  4FO5 A;  3H4K A;  3M9J A;  2I9H A;  4GRF A;  4POK A;  5A34 A;  2VCT A;  2WJU A;  2E7P A;  3DML A;  5EPF A;  5A1N A;  4EUY A;  2H73 A;  4JR6 A;  1A2M A;  4LL4 B;  3FYG A;  4AKH A;  5G1K A;  4EF0 A;  4TR4 A;  2H6X A;  3O76 A;  5KOX A;  5ECS A;  1SKW B;  4F0B A;  2PUK C;  4FQU A;  1WMJ A;  3BCK A;  4WBJ A;  3I69 A;  1PL1 A;  4TXO B;  4I5Q A;  1JLV A;  1J08 A;  1FVK A;  2LRC A;  2YCD A;  4MPG A;  2L5O A;  1PRX A;  3E3E A;  1M99 A;  2C8U A;  4I6X A;  1SD9 A;  5DBQ A;  3HHV A;  2IPA A;  4J57 E;  4MF7 A;  3ZTL A;  5ABR A;  5B6N A;  5DAK B;  4MZB A;  3TKQ A;  3QDN A;  1G6Y A;  2B1K A;  3G7I A;  5DCG A;  3PIN A;  5IMD A;  4KND A;  5IM9 A;  4RI7 A;  5D93 A;  11GS A;  3BBY A;  1TRU A;  4RQR A;  3RPP A;  2YAN A;  3UOM A;  3L9U A;  4POM A;  4MAB A;  1AW9 A;  4O5U A;  5ELG A;  2I4A A;  4XHM A;  2RLI A;  5IPH A;  3FY7 A;  2MMA A;  2AV4 A;  2GQM A;  2VIM A;  5LD0 A;  2CVD A;  2RUF A;  4X0X A;  3TGZ A;  3DGQ A;  1FO5 A;  1K0A A;  4IP1 A;  1R4W A;  5J3R A;  4LMV A;  5ECH B;  3C1R A;  4EO3 A;  1X0R A;  3V1W A;  1ERU A;  1FOH A;  3IRA A;  2BTO T;  4HI7 A;  2LKU A;  4O32 A;  4Z7X A;  3VLN A;  2PVQ A;  2QC7 A;  3A2V A;  1UC7 A;  1A8L A;  2R37 A;  5J40 A;  1EWX A;  4AI6 A;  2YWN A;  2RM5 A;  4MZW A;  2FHE A;  4IEL A;  2DMM A;  3CTF A;  4E8E A;  5J4V A;  3BD2 A;  3W8J A;  3KD0 A;  1A8Y A;  2C80 A;  5CRD A;  3K8N A;  3CMI A;  2IFQ A;  1PSQ A;  5A4W A;  2YP6 A;  5ENU A;  4TXV A;  4OWY A;  5ID2 B;  1O85 A;  4I2T A;  2VD1 A;  3Q19 A;  6GSX A;  4WF5 A;  2UZ8 A;  2N5B A;  3VWX A;  1Y6E A;  9GSS A;  1CQH A;  1IYH A;  4HQZ A;  4OFM A;  1HQO A;  1YZX A;  2WZ9 A;  4WXT A;  1J0F A;  3TU3 B;  2DIZ A;  4TR1 A;  4G2E A;  1ZMA A;  1E2Y A;  2JZR A;  3KTB A;  2B5X A;  1V40 A;  2O87 A;  2OE3 A;  4NXI A;  3KJY A;  2C0D A;  3M9K A;  4ZBD A;  2AUV A;  1ABA A;  1O73 A;  2EIQ A;  2HNL A;  2A2P A;  2L59 A;  3PPU A;  3HCZ A;  4MJB A;  1M9B A;  4K0N A;  1PKZ A;  1GL8 A;  1YF0 A;  1OKD A;  3ZVJ A;  3TJB A;  1TDI A;  3LXT A;  1TRS A;  1AQW A;  2WCI A;  2E2M A;  3F4T A;  1QFN A;  2EIO A;  2KP2 A;  3FHK A;  2EFH A;  2GS3 A;  5F0G A;  1YVL A;  5IMA A;  5KEJ A;  2VO4 A;  4WET A;  2ALB A;  4PNF A;  2H8L A;  3HJO A;  4EKZ A;  2HE3 A;  1HNC A;  4KDY A;  1Z6M A;  4ZB6 A;  5ECQ B;  2DIY A;  5C04 A;  4O5Q A;  1BF5 A;  4PQH A;  3CSI A;  3O6T A;  3A5W A;  2YN1 A;  5DAL A;  2TRC P;  4AKX B;  5AGY A;  5H5S A;  1YDK A;  1RQM A;  2FUG 2;  2LV3 A;  1AQX A;  1GUM A;  2H0G A;  1G7O A;  4ML1 A;  3LOR A;  2H1D A;  2UV8 G;  2QA2 A;  2GSS A;  5ECO B;  5DVB A;  1O81 A;  2X49 A;  2IWT A;  2HSN B;  3TRQ A;  1BG1 A;  2AJQ B;  2L6C A;  3KIJ A;  1H75 A;  3VI7 A;  1BJX A;  4XS4 B;  2FWH A;  1Z7P A;  2P5R A;  1MD4 A;  2L4Q A;  5C00 A;  1K0B A;  2F8F A;  3L78 A;  1Y25 A;  4EXJ A;  1K0C A;  4O5R A;  5GAP D;  2P5Q A;  1AC1 A;  4AKG A;  5IOW A;  2L57 A;  4YAP A;  2FD3 A;  1X5D A;  1YKA A;  2FA4 A;  4GDF A;  3GL3 A;  1GNE A;  1YY7 A;  3P8W A;  1OC8 A;  2CVK A;  2PU9 C;  2HZE B;  3GA4 A;  5GST A;  1BED A;  1IYI A;  4HDE A;  3WGD A;  3LWA A;  2C0E A;  5ECN B;  2B6M A;  5IMC A;  4KGI A;  4V2N A;  1K3O A;  4KDX A;  4YQU A;  1N2A A;  3DD3 A;  3IBH A;  1X5E A;  3CYN A;  3IR4 A;  4GTU A;  5EY6 A;  1ZL9 A;  1JZD A;  4PXO A;  4NHW A;  3UJ1 A;  1FW1 A;  2HLS A;  2AAW A;  2DJK A;  4K2X A;  1EEJ A;  10GS A;  3C1S A;  1ZYP A;  2NTO A;  2AYT A;  1JZR A;  2GDR A;  3FR3 A;  2FWG A;  3WGE A;  2HRK B;  2L6D A;  1ZYQ B;  3TOT A;  2WUL A;  3UBL A;  5GZZ B;  3EUR A;  2O7K A;  5J9C A;  5E59 A;  2IME A;  4IW9 A;  1R7H A;  2M46 A;  4TW5 A;  4L0U A;  3VFI A;  3VWU A;  4F03 A;  3F9U A;  3FW2 A;  1F37 A;  4DSR A;  3GSS A;  4ECB A;  1N8J A;  4TN8 A;  3KP8 A;  1GSD A;  1K0N A;  2LEG A;  1DE2 A;  2VLV A;  2H71 A;  1F2E A;  5ECP B;  1QMV A;  2VCX A;  4IN0 A;  3RPN A;  3N9J A;  1U3I A;  5DDL A;  4V1A g;  1XW5 A;  2G0F A;  3J7Y k;  1ZCP A;  1XOA A;  5FWG A;  3H79 A;  1CQG A;  1SJZ A;  5CNW A;  3F6F A;  4K1F A;  2V1M A;  2M72 A;  3JCM L;  3FZA A;  2VKZ G;  3CRT A;  2I81 A;  4WEY A;  3QPM A;  1GSQ A;  4N10 A;  1ON4 A;  5DQS A;  5BMU A;  3QMX A;  4OD7 A;  2R2J A;  3Q74 A;  1GUL A;  3KH9 A;  4ZBA A;  5FHI A;  3PR8 A;  1THO A;  1GTI A;  1I9D A;  2ZCT A;  1MDI A;  3F3R A;  1K0D A;  3CBU A;  3CTG A;  5KN2 A;  3WD6 A;  2A4V A;  2AHE A;  1PGT A;  5HR1 A;  4Z2U A;  4DSQ A;  5IOX A;  2GGT A;  1HNA A;  2XHF A;  1F3B A;  3GNJ A;  1XCC A;  2R3X A;  2HSH A;  1WOU A;  4D73 A;  2DJ2 A;  1B48 A;  4PX1 A;  4XS6 A;  2H75 A;  4V2M A;  3EU3 A;  1XWG A;  1YEX A;  2B5E A;  22GS A;  4W66 A;  3GTU A;  1XFL A;  1XPV A;  3TKP A;  2H74 A;  4G0K A;  1K3Y A;  4KAE A;  2C4J A;  1XBS A;  1B9Y C;  4BVY B;  3GFK A;  5ECM B;  3FMW A;  3NIV A;  4IVF A;  2MZC A;  4EVM A;  2H72 A;  4Q5Q A;  3IK9 A;  5JCU A;  1XWC A;  4N11 A;  1SJI A;  3PGT A;  3IC4 A;  5H5R A;  2BMX A;  8GSS A;  1SK2 A;  1UVZ A;  3Q18 A;  2KHP A;  4FYU A;  4EC0 A;  4P3Y B;  1K0O A;  5GAN D;  3FEU A;  1LBK A;  4GLT A;  2CT6 A;  2OT3 A;  5B7C A;  1SD8 A;  5G31 A;  2F51 A;  3FR9 A;  3KMO A;  4J2F A;  2H6Y A;  3IOS A;  2LST A;  3IK7 A;  2EFE A;  3H93 A;  2PVO C;  3HVX A;  2F9S A;  1OC9 B;  2GT5 A;  2WB9 A;  4I2U A;  2LQO A;  1USB A;  4ZB7 A;  5HQP A;  4WR5 A;  5H5Q A;  4TVE A;  5F05 A;  2OKA A;  3A2X A;  4YH2 A;  14GS A;  1OC3 A;  3APQ A;  3TUE A;  1THX A;  4XS1 A;  2FY6 A;  3D6I A;  3EU4 A;  2R0C A;  2NDO A;  4KDU A;  3VPT A;  2JZS A;  5HFK A;  1XOB A;  1OAZ A;  1SVL A;  1N25 A;  20GS A;  3QAW A;  1MD3 A;  4KCE A;  4L5L A;  1BQ7 A;  2HRN A;  1TK0 B;  3F3Q A;  1V57 A;  1OE8 A;  1SYX A;  1R5A A;  2HSM A;  5EVO A;  3L9S A;  6GSV A;  3HD5 A;  3DKS A;  3QFA C;  3EWL A;  5D9X A;  1JLW A;  3LYP A;  5B8B A;  2R4V A;  4KE3 A;  5A5H A;  1OVN A;  5HFI A;  4XS4 A;  2K18 A;  3LEF A;  3WT2 A;  1DBY A;  1B9X C;  1XVW A;  2CQ9 A;  4DSS B;  5J4U A;  3KEB A;  2FCH A;  5CYY A;  3GIX A;  1SK1 A;  1QGV A;  4USS A;  5D9W A;  1HYU A;  1Y1U A;  5GSS A;  4LMW A;  3G7J A;  4QQ7 A;  4ECI A;  4IKH A;  6GSU A;  3P7X A;  3KMN A;  4ECC A;  4NAX A;  1O8W A;  2H66 A;  2C3Q A;  3FR6 A;  3GKX A;  4TRX A;  3HDC A;  3GHA A;  1M9A A;  3ZL5 A;  4OFT A;  1EV4 A;  3ZML A;  4KA0 A;  1A0R P;  1B8X A;  4G9H A;  3ZFB A;  1PKW A;  2VCQ A;  1Z3E A;  3C73 A;  4AJ8 A;  2D2Z A;  3RHB A;  4AKI A;  4DVC A;  3P2A A;  2CX3 A;  4IQA A;  2DKI A;  4KCA A;  1A0F A;  1TXU A;  1TP9 A;  2CVB A;  4ID0 A;  2IN3 A;  2YV7 A;  1SL2 B;  17GS A;  4RUV A;  5IIZ A;  3RDW A;  2NVL A;  2B5Y A;  2CA8 A;  3VI5 A;  3GUR A;  4NV5 A;  5DJL A;  4G10 A;  3LYK A;  3D4M A;  3DVW A;  3BCI A;  4JZQ A;  5D9T A;  2L5L A;  2PBJ A;  2WRT A;  4RI6 A;  3UIW A;  4E8H A;  4YAV A;  3A2W A;  4WBR D;  4YQV A;  3KGK A;  2DBC A;  3TJG A;  4WF4 A;  2C3T A;  1KBN A;  2YPM A;  3IE3 A;  4JED A;  5IQY A;  2YWO A;  3QFB C;  5J41 A;  3IHG A;  1VGL A;  2I3Y A;  3GN3 A;  1WRY A;  3GRX A;  6GSW A;  3DYR A;  2VCV A;  2J23 A;  2MBT A;  2VD0 A;  1TRV A;  3P90 A;  1GSY A;  2DJ0 A;  3TJF A;  3L0H A;  1GSE A;  4BA7 A;  4Q5N A;  1F6M C;  1Z6N A;  4HS1 A;  1ILO A;  1TI3 A;  1PX7 A;  3UMA A;  4AJ6 A;  2X64 A;  3QCP A;  3VWV A;  1BX9 A;  4JBB A;  2HT9 A;  2LRT A;  1MEK A;  1NSW A;  4XIH A;  2ZNM A;  4BL7 A;  1Q4J A;  3FK8 A;  2V6K A;  5IPG A;  3UVH A;  1T7P B;  2IMI A;  2VOC A;  3TKS A;  1UN2 A;  3D22 A;  4YKF A;  3CWG A;  4BVX B;  4ZL9 A;  1ML6 A;  5D96 A;  1SKS B;  3MYD A;  5AN1 A;  1U3A A;  4OMV A;  1X9M B;  4F0C A;  5AIX A;  3WT1 A;  1SL1 B;  2R0P A;  3GKN A;  4Z2R A;  4RQX A;  2TIR A;  2MMZ A;  1U87 A;  3FKF A;  3O3T A;  1ERW A;  3EE2 A;  4FIW A;  1FVJ A;  5A34 B;  3LFL A;  1M2B A;  2GTU A;  3CSJ A;  3TCO A;  5A1N B;  3GKM A;  4JRR A;  4TR0 A;  3FZ9 A;  3EMP A;  3TKS C;  1ZZY A;  3C71 A;  16GS A;  3I6A A;  2OJL A;  4NPB A;  4IJI A;  4ILF A;  3VK9 A;  1X9S B;  2HXK A;  2RII A;  2JU5 A;  2RUE A;  2EC4 A;  4PNG A;  3KM6 A;  4GQF A;  1YKC A;  4QMK A;  4X43 A;  4K0G A;  5DQY A;  13GS A;  2WS2 A;  4MH3 A;  1NW2 A;  5KN3 A;  2K8S A;  1ZGN A;  3W6G A;  5ECR B;  3HJP A;  2CZ3 A;  2GST A;  1A23 A;  2IMF A;  3SWL A;  3FZ4 A;  4K9Z A;  2EIR A;  1HNB A;  4CDO A;  4ML6 A;  4CW9 A;  5A5K A;  6GST A;  2O85 A;  3GV1 A;  2KOK A;  1URM A;  2LNT A;  2V32 A;  3TKR A;  2IIY A;  5G30 A;  1FB0 A;  1SK0 A;  5B8A A;  2H30 A;  1M0U A;  2VL3 A;  3G7Y A;  2J9H A;  2HRA A;  2WFC A;  2FNO A;  2GSR A;  3IC8 A;  1XVQ A;  4OFN A;  2GZZ A;  3HVS A;  3DXB A;  1HD2 A;  4TXO A;  3TRX A;  1OE7 A;  5HR2 A;  1XW6 A;  3KZQ A;  2EFC A;  2H1L A;  4OCE A;  3RAZ A;  2YZH A;  2HFD A;  3ISO A;  5EL8 A;  3ERW A;  2YWM A;  1GUK A;  4PUA A;  1T3B A;  3ZVJ D;  2JAD A;  1A2J A;  4KB3 A;  4GXZ A;  5BRT A;  1ZYN A;  1SVO A;  3F0I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...