2X64A

Glutathione-s-transferase from xylella fastidiosa
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
206
structure length
206
Chain Sequence
HMKLYIMPGACSLADHILLRWSGSSFDLQFLDHQSMKAPEYLALNPSGAVPALQVGDWVLTQNAAILNYITDIAPAERGLSGDGSLKARAEINRWIAFSNSDVHPMYWALFGGTAYLQDPQMIARSQDNARQKLRVLYQRADAHLKHHNWLANGQRSGADAYLYVTLRWAKKVGVDLSSLDALSAFFERMEADPGVQAALQAEGLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE-S-TRANSFERASE
publication title Structural and Biophysical Characterization of the Recombinant Glutathione-S-Transferase from Xylella
rcsb
source organism Xylella fastidiosa
molecule tags Transferase
total genus 76
structure length 206
sequence length 206
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2x64A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2x64A01
2H30A 1U3AA 4K9ZA 4K1FA 5JWQB 1LBKA 1CQGA 5ABRA 1XOBA 3LEFA 2F8FA 1HD2A 2ON7A 3H79A 1WIKA 1SYXA 3LXZA 5ECHB 4MABA 4IGJA 4DSSB 1SK1A 2E2MA 4NMUA 5DAKA 3HDCA 1GUHA 2GS3A 4PURA 1AQVA 3TKSA 3ZITA 3HXSA 1K0OA 5ECKB 2DSAA 1OE8A 5GAPD 1YF1A 2I1UA 1V58A 4IBPA 3J7Yb 4IKHA 4N0ZA 3L9SA 4L8EA 3UJ1A 1Y25A 4PUAA 5GAND 4PNFA 3IPZA 4BVXA 4YQVA 2XHFA 1G7OA 1M9BA 5IM9A 3TOUA 4EDZA 19GSA 4MH3A 4PQIA 1C72A 4AJ6A 2HRKA 5J4UA 3E9JB 5JCUA 4KW6A 1XVWA 1XW6A 5IMAA 1Q4JA 3EINA 4JZQA 4HZ4A 2BTOT 3GNJA 1YJ6A 3C1RA 5F05A 5G30A 1FB6A 2XC2A 1DUGA 1T8EB 3P8WA 4MPGA 3M8NA 3LWAA 3WD6A 3QCPA 2KP2A 5KN1A 4EVMA 3P7XA 1GWCA 3VLNA 1ACVA 2FWGA 5H5RA 3APSA 1MTCA 2RIIA 2PU9C 2MBTA 4G0LA 2H1DA 4E8EA 2L6CA 4F82A 2DIYA 3QD9A 5IOWA 5L71A 1H4OA 4Q5NA 5CRHA 4NV2A 2O87A 4KA0A 1MD4A 3I6AA 4KGIA 5KEJA 3FR6A 1BX9A 3FR3A 4KF9A 2VAFA 2GQMA 3NOFA 2YWNA 4PQ1A 2PWJA 4POKA 6GSSA 4ZB6A 5AISA 1TI3A 2CQ9A 4MK3A 3EU3A 4JEDA 3I43A 1AXDA 4IELA 1A0RP 2B1KA 2VCWA 2B5EA 3D22A 4LMWA 2GZPA 2MMNA 1B4QA 1YF0A 4ZB9A 4MMMA 3GTUB 3D5JA 2YP6A 4NXIA 1EV4A 3M9KA 4MA9A 3GSSA 1TRUA 3F6DA 1NW2A 2M80A 2H8LA 2H1GA 4EE0A 5D93A 3UVTA 1VF1A 1FW1A 1EGOA 4GQFA 1TK5B 2FWFA 4I8BA 2PN8A 4XS4A 5CNWA 5DBQA 1ON4A 1ERUA 2GZYA 2C1YA 3EE2A 3VWWA 1EP8A 3GL5A 4TW5A 3RAZA 20GSA 2FA8A 1UVZA 1FHEA 2J9HA 5D8IA 4MZWA 1HQOA 3Q18A 2LSTA 1B9YC 2FHEA 2P5RA 1GSDA 3TRQA 1XIYA 2H76A 3Q19A 2VLTA 1OC9A 5AIXA 3GH6A 3TKPA 3TOTA 1ABAA 1N2AA 1E2YA 2A2SA 4ML1A 2C80A 4XS1A 1WWJA 1DBYA 2JZSA 1PKWA 2PERA 2HSHA 1XXUA 3QPMA 1Z9HA 4TR3A 1G7EA 2JSYA 1AW9A 2WCIA 2RUEA 2LTKA 1ZL9A 2K18A 4KB3A 4TXOB 4MF6A 3DMLA 2HXKA 4RI7A 3S9FA 3CSHA 5KN0A 3HYPA 2GQLA 1M7TA 5JWRB 5A5KA 3HVVA 1U88A 3A2WA 4G9HA 4F9ZA 4GSSA 6GSYA 1X5DA 2I3YA 3D6IA 3TJBA 3KMOA 2P5QA 1BEDA 1B48A 4X0XA 4J57E 4MH2A 5DALB 2AV4A 3F3RA 3WGDA 2BMXA 2HQTA 5FWGA 4XCSA 4EUYA 4KSOA 2IFQB 3OR5A 2H66A 3ZYWA 3QFBC 3CTFA 4KDUA 3GHAA 2LKUA 4WR5A 1S3AA 2QKEA 1M0UA 2GT6A 1MD3A 2IMIA 1USBA 4GXZA 4BVYA 4PXOA 3ME7A 3H1NA 4IHUA 4GWRA 2YV9A 2V6KA 8GSSA 1GTUA 1XWCA 3VFIA 3DRNA 5EY6A 3PGTA 1WP0A 3PINA 3TKRA 3ZTLA 4YQUA 3RHCA 2GSTA 5KN2A 4G0IA 1VF3A 3G7JA 1JLVA 3ERGA 4MDCA 3TCOA 1S3CA 1PRXA 3ZVJA 3H4KA 4GCIA 1O73A 3APOA 1B4PA 5B8AA 1GNEA 2L5OA 3DIEA 5H5SA 1Y6EA 4LMVA 3EWLA 2DIZA 4V2LA 4YAPA 5EPFA 4XHMA 3EC3A 5B7CA 4OFTA 3UARA 2B1LA 2I4AA 1TI1A 2XPEA 4JRRA 2DLXA 1O8XA 1X5CA 3DD3A 2IWTA 5IMCA 4DVCA 4V1Ag 2AAWA 4N30A 1V2AA 3KCMA 4JU5A 1B9XC 3KJYA 1OVNA 5LNKe 2V2GA 1TOFA 4XRAA 2JACA 2YCDA 3LORA 2L4QA 4AGSA 4KAEA 3IHQA 1TKDB 2NBSA 1B8XA 2KUCA 5IPGA 1XWKA 4WBJA 3TGZA 3IAM2 4DEJA 3CTGA 2F3MA 1K0BA 3LYKA 2K8VA 2REMA 1J08A 3VK9A 1K3YA 3QAGA 2GVPA 2NDOA 5COHA 4GTUA 2B5XA 2FLSA 2XBIA 2CVDA 2MZCA 4BPYA 1GNWA 4ILFA 5ECRB 5ECMB 1N8JA 5CYYA 4V1Ap 2HSNB 2HRKB 1WPIA 2YPMA 5DQSA 5GSTA 3A5WA 9GSSA 3KD0A 2HZEA 1A2LA 4ZB8A 3CSIA 2DBCA 5HFGA 1SKWB 3WT2A 6GSWA 5F07A 2K9FA 3G9BA 3KGKA 2RM6A 2F8AA 3DYRA 4ACSA 1TXXA 1HNCA 1EWXA 3GFKA 5DJMA 3R3EA 1R4WA 2YOIA 1GSEA 2MMOA 1PX6A 2C3TA 2YJHA 5G1KA 1O8WA 2AHEA 2QSIA 3DVXA 2IMFA 2WFCA 5ENUA 1K3LA 5GSSA 1X9SB 3ME8A 2FWEA 3FZ4A 1T4ZA 4V2NA 2X8CA 4YQMA 1X9WB 1I5GA 3JCML 4POBA 5G31A 5D9TA 6GSUA 3TKSE 1S3DA 1EOGA 1MDJA 2N5FA 3RBTA 4AF2A 2JU5A 2I9HA 3IA1A 4F03A 2R4VA 4G10A 1LU4A 2YANA 3ISOA 2H01A 5G2ZA 1QMVA 1EEJA 1SD8A 3TKSC 4BWQA 4JBBA 2LRTA 3CRTA 2V6OA 2DJKA 1TRWA 1Z7PA 3QR6A 4D73A 4PGTA 4TR4A 2VLVA 4KDYA 2H75A 5IO2A 1TK8B 4TR1B 2PMTA 1G6WA 4J56E 3LFLA 2YV7A 3O6TA 4X43A 3FEUA 2WS2A 18GSA 3GX8A 1M9AA 2LNSA 4PQHA 5A4UA 3ERWA 3F9UA 3HHVA 4CW9A 2IN3A 1EV9A 1ZYEA 4HS1A 3LQ7A 1GH2A 2OE3A 2WULA 3F63A 4MF7A 4GSNA 4I5QA 4PX1A 3KEBA 4OD7A 2IMKA 1JZOA 2WZ9A 1OC9B 4USSA 5E4WA 1DSBA 3QDNA 5J9BA 3IOSA 1DE2A 2V32A 5HR2A 4EKZA 2LV3A 4I2TA 1WJKA 1WOUA 2X99A 4KSMA 3SWLA 1FAAA 4ZBAA 1G0TA 1MEKA 3GX0A 4JR6A 4HEA2 3PPUA 2GT5A 4GSTA 2OBKA 5BMUA 2VL9A 4CDOA 1ERTA 3IAS2 1J9BA 2YNXA 3HCZA 3LJRA 1FO5A 1PSQA 3IV4A 2GZZA 3GA4A 4KCAA 4L5OA 1A0FA 3MNGA 4CHSA 3GUSA 2E0QA 3QAVA 3EURA 5D9WA 4ECBA 2RLIA 2YJ7A 2FWHA 1ZZYA 3GKKA 1PA3A 4NPBA 3C1SA 2HFDA 3EVIA 2YZUA 1T00A 4DSRA 2JZRA 2WRTA 4RQRA 4BVYB 4XTSA 2H0IA 4LL4B 1DE1A 3CXGA 3KTLA 1XZOA 3L4NA 2GTUA 2H1BA 2M46A 2IPAA 3PR8A 4HUAA 3MWHA 4BL7A 4ZL7A 1K0NA 4AJ8A 1XW5A 4HZ2A 1TP9A 2LRNA 4WBRD 3ZREA 3UIWA 3FZ9A 1AAZA 1Z6NA 1HNAA 22GSA 1FG4A 3HJMA 5F8BA 4ECIA 1YKAA 4NHWA 2AJQB 1GUKA 2I81A 2CA8A 4V2MA 1THOA 1W89A 2UZ8A 2Z9SA 2P31A 4NV5A 3FZAA 4MJCA 2HE3A 2FUG2 1XWAA 3M9JA 11GSA 1NM3A 1UN2A 1VGLA 4HJ2A 1SKRB 1KBNA 2DJ3A 1A8YA 1XBSA 5ECOB 2VCTA 4YH2A 2AYTA 3DGQA 4I2UA 2GQKA 3KH7A 5G5EA 2VL2A 1FB0A 2DJ0A 1SYRA 1TRVA 6GSVA 5AN1A 4Q5RA 4K7NA 3F4RA 2X64A 3GN3A 5CRDA 2CT6A 2MMZA 2KLXA 2H19A 1CQHA 2AB6A 4AJ7A 2GSQA 2HSMB 1OYJA 1PX7A 2X8GA 4G19A 1EP7A 3VPTA 4QL9A 1VF4A 1NSWA 1EOHA 1JLWA 3A2VA 1RW1A 2JL4A 4ML6A 5FT3A 3HJOA 1M2AA 3IXRA 1V98A 2N5AA 2YWMA 1MDIA 4HDEA 1U3IA 3M3MA 1YEXA 2MYGA 2VCQA 3O76A 1WMJA 1X9MB 5IIZA 1A24A 3M1GA 2A2RA 2DMLA 1ZOFA 2FGXA 4MZBA 5F06A 2V41A 2HSYA 5DVBA 4X1UA 3GKNA 3L9VA 2B6MA 3BJ5A 1SJIA 5A4VA 3UVHA 2HZEB 3UOMA 2L5LA 5IMVA 2CAQA 4LLRA 1EEMA 2LQQA 5DDLA 1Z6MA 5ECPB 2GSRA 2JSZA 2L4CA 4RUVA 1O81A 2H70A 5HR0A 2C3NA 4ZL9A 2HRAA 4ZBBA 5HR3A 2HZFA 4RQXA 1SK0A 3GV1A 1V57A 5A4WA 3F4TA 5HFKA 4PTSA 5ID2B 2RUFA 2D2ZA 2VM2A 2L59A 2XBQA 1U87A 3QFAC 3GTUA 10GSA 1X0RA 4FIWA 5CRGA 4IQAA 4MP4A 4F2IA 3WT1A 2VCZA 1OKTA 4LL1B 1GTBA 4WEYA 3C73A 4WR4A 3APQA 3Q74A 1SU9A 3P90A 2PVQA 1SK2A 3KZQA 4OO5A 1IYIA 1EGRA 2VCVA 6GSXA 1F9MA 1T7PB 3I69A 1PKZA 2HYXA 2VD0A 5DAKB 5EVOA 1HYUA 2KOKA 2V1MA 3BCIA 1R26A 2VLUA 3WGXA 4XS6A 1BYEA 2LQOA 1A2JA 5GZZB 5IMDA 4JR4A 1AIUA 2C4JA 1JZDA 3CSJA 3KP9A 2G2QA 5IOXA 5JWOB 1I9DA 2GGTA 3HZ4A 4E8HA 1SJZA 4K8MA 4GRFA 5ECLB 3FY7A 3ZMKA 2O7KA 2WB9A 4TXOA 2O85A 4XRDA 5HR1A 1URMA 4BVXB 5ECQB 4ZILA 2GLRA 4IN0A 2HNLA 16GSA 4IS0A 1FVJA 3M0FA 1XPVA 1XVQA 2L57A 4ECJA 3FYGA 4PNGA 4GF0A 2MBSA 5DALA 5B6MA 3MAKA 3HVXA 4F0BA 1FOVA 3HKRA 5ELAA 4L0WA 3ZFLA 2WJUA 3H93A 3LSZA 4N11A 1XCCA 2HLSA 3CBUA 3G7YA 2HRFA 4HU9A 2LNTA 1GL8A 3GH9A 2OADA 3KP8A 1SJ6A 1QFNA 5E59A 5CAXA 5DJLA 4OFNA 1PL2A 5CO3A 5D9VA 4EDYA 4FYCA 2ON5A 3MDKA 3QAWA 3L9UA 3FRCA 4OMVA 3VI5A 2VCXA 2N5BA 2OACA 3GL3A 2RM5A 1IYHA 1PMTA 1A23A 2P0GA 3RPPA 1QXHA 1ZYQB 3BOAA 3C7MA 2CZ2A 2E2GA 3DXBA 1GTAA 4FO5A 4NHZA 3L78A 4KX4A 4P3YB 3UBLA 3RDWA 1F37A 2B5YA 2CZ3A 1AQXA 3N9JA 3UEMA 1YDKA 4NAXA 3VWXA 4WETA 1SL0B 3ZIJA 3KMNA 5C04A 2H6YA 4MJBA 4BL7B 1W4VA 2FCHA 1AQWA 3EU4A 3HVSA 5HQPA 1LJRA 3ZFBA 3ERFA 3TKQA 2H74A 2NVLA 3D4MA 3V1WA 3UMAA 2DC5A 3HD5A 4KH7A 3W8JA 1R5AA 1AC1A 4OFMA 3U5RE 4XS4B 2LUSA 3U6VA 1YEPA 5AGYA 1GSFA 1GSQA 2J23A 1R5PA 2H71A 2FA4A 3US3A 4N0VA 1OAZA 5DCGA 5J3RA 3ZL5A 4EO3A 5ELGA 5D96A 4TVEA 4OO4A 3GSTA 3TJJA 3QMXA 1YZXA 5IO0A 1TDIA 5G5FA 1BG5A 2LJAA 5HFIA 3D0ZA 1VRSD 5JCGA 2VM1A 4LA1A 1GTIA 3F6FA 1BAYA 4IQ1A 2OBIA 5IMFA 4HQZA 3UBKA 4O32A 2CAIA 5INYA 1Z5YE 3KTBA 1BQ7A 4O92A 2IJYA 3HZ8A 4IJIA 1QK8A 2O89A 4TXVA 14GSA 4G2EA 4IW9A 1ILOA 2DMMA 4ECCA 1Z7RA 3DKSA 2JADA 2F51A 1GSUA 2M72A 3N5OA 1G6YA 3LG6A 4YAVA 4FH8A 1E6BA 2VOCA 2OA7A 5CREA 4TOPA 4ZXGA 3TJFA 2OJLA 3F3QA 2YWIA 3IK9A 2HRNA 3HA9A 3FW2A 4FQUA 2VUPA 3DVWA 1A8LA 2H1AA 5B6NA 3GKMA 1K3OA 1O7UA 1GLPA 3LGCA 2IL3A 2CV4A 1UA5A 3ZZXA 4KUNA 3TB2A 1OE7A 1EZKA 2H0GA 1JZWA 1PQNA 4QL7A 3UAPA 4MCUA 1T4YA 3TJGA 2R3XA 2YWOA 2C0EA 1Q98A 2TRCP 2H0HA 2OE0A 4IVFA 3W6GA 12GSA 4WF4A 4EL1A 4TR0A 3GURA 4F0CA 2EIQA 2H6ZA 6GSTA 3F4SA 3ZRDA 3CRUA 4O5RA 2LEGA 3ZLPA 1XWBA 3CYNA 1F6MC 3GIXA 5DCHA 3Q6OA 5CP1A 2HI7A 3IDVA 3F0IA 3ZMLA 4MPFA 2LJKA 3J7Yk 3HJPA 4J2FA 3GKXA 4EF0A 4OCEA 1ZMAA 2C0GA 4MJAA 4Q5QA 2XPDA 5ECIB 3NIVA 1QUWA 4DSSA 2C8UA 3A2XA 3LYPA 5ECSA 3ZVJD 4TR1A 1TRSA 2EC4A 3IC4A 3ZIVA 1FVKA 2K6VA 1F2EA 3C8EA 5LD0A 4POMA 2ZCTA 2OKAA 2B3SA 2E7PA 2VL2C 4N10A 3KM6A 4KDXA 3GYKA 1HNBA 1YQ1A 3RHBA 4HOJA 4I6XA 3TRPA 5LCZA 5IPHA 5F0GA 1O85A 3KIJA 2YZHA 4EC0A 2LJRA 3BBYA 4WXTA 4XIHA 2CX3A 2ES7A 4JE1A 2L6DA 3EMXA 2VD1A 1XW9A 1K0DA 2QC7A 4MF5A 3CMIA 4Z7XA 1Z3EA 1AUCA 1TU7A 5AIVA 4L0UA 3VWVA 1SD9A 2FNOA 4TRXA 1YY7A 3IC8A 2R37A 3TUEA 17GSA 5IMZA 3IE3A 1JHBA 1PL1A 4FYBA 4K7IA 4ZL8A 4HQSA 1VF2A 1U6TA 3VURA 1R7HA 2WGRA 3PH9A 1NHYA 3WYWA 4GLTA 4BWSA 3W8SA 2QGVA 5J9CA 1GSYA 2NTOA 4ULXA 2FD3A 2JZTA 3F8UA 4I97A 2WDUA 4ZBDA 5H5QA 1UC7A 4K0GA 2MMAA 2YN1A 2PGTA 3D4TA 3D21A 3ED3A 1M99A 4ZIJA 5DQYA 4POLA 2R2JA 1GULA 4OCFA 4TN8A 2KP1A 1PN9A 4FYUA 1PD21 2CVBA 1KTEA 2VL3A 3P2AA 1GUMA 2C0FA 3KXOA 1OC3A 4WKWA 5IQYA 3GMFA 1V40A 4DSQA 4PUFC 3GRXA 3QOUA 1KEBA 3L0HA 4HJMA 5J5NA 2C3QA 2TRXA 3TDGA 4K6XA 2PVOC 3VI7A 3SBCA 2FY6A 1SENA 5JCWA 2C0DA 1GSSA 1PGTA 1THXA 3FZ5A 3TJKA 2H6XA 2R6KA 1RK4A 3IK7A 5ECNB 2R5GA 3HY2A 5D9XA 3BD2A 4EXJA 2EIRA 4KNDA 2HT9A 2B7JA 2IMDA 2IMEA 4K2DA 1K0AA 4G0KA 1ERWA 4IP1A 1TK0B 1GRXA 4QQ7A 1O6JA 4WF5A 1F3AA 1WE0A 2VO4A 1ERVA 2PUKC 3EYTA 4MJEA 4O7HA 4D73B 2ZUPA 3FHKA 3IR4A 3I9V2 2KHPA 3C71A 2AUVA 4KCEA 1TU8A 4BA7A 2EIOA 1T3BA 1SL2B 3WGEA 4IJ3A 1SL1B 4ISDA 1GP1A 5C00A 5J41A 5KN3A 1F3BA 2HSMA 3E3EA 3NZNA 2DJ1A 3IBHA 1SKSB 1H75A 5B8BA 3R2QA 3RPNA 1A2MA 4NWYA 5EL8A 2K8SA 1X5EA 2ALBA 5D73A 1T1VA 2A4VA 2H73A 3FK8A 1M2DA 4H86A 1TW9A 2F9SA 2PPTA 3E0UA 4K0NA 1JFUA 2IIYA 2CX4A 2B7KA 2BJXA 3A3TA 7GSSA 1TTZA 1ZGNA 4HU7A 2IFQA 4MLYA 1ZCPA 3G7IA 3DWVA 2X8HA 4RI6A 3BCKA 1J0FA 3FKFA 4K7OA 3AY8A 2ZNMA 3LXTA 1K0MA 1ST9A 5CRWA 1NHOA 3EMPA 4Q5FA 1XOAA 13GSA 4ID0A 2VIMA 1QGVA 1OC8A 2PBJA 1TJDA 4HI7A 3IRAA 3KH9A 1XWGA 1JZRA 3H8QA 1K0CA 1RQMA 2H72A 2GDRA 1WRYA 1MDKA 2LS5A 2NPBA 3VWUA 2CVKA 3VPQA 2DJ2A 1YKCA 4OWYA 1V9WA 5ID2A 4KE3A 1XFLA 2OE1A 2O8VB 3MSZA 1BJXA 3K8NA 3FR9A 3DEXA 3O3TA 3UL3A 2TIRA 4TKYA 2G0FA 4GQCA 3TRXA 4L5LA 1ML6A 2GSSA 1M2BA 4MZCA 5FHIA 4IP6A 2DJJA 1QQ2A 1KNGA 1GLQA 5G1LA 1OKDA 2LRCA
chains in the Genus database with same CATH superfamily
2H30A 1U3AA 4K9ZA 2WVXA 4K1FA 5JWQB 1LBKA 1CQGA 5ABRA 1XOBA 3LEFA 2F8FA 1HD2A 2ON7A 3H79A 1WIKA 1SYXA 3LXZA 5ECHB 4MABA 4IGJA 4DSSB 1SK1A 2E2MA 4NMUA 5DAKA 3HDCA 1GUHA 2GS3A 2WVZA 4PURA 1AQVA 3TKSA 3ZITA 4YKGA 5J40A 3HXSA 1K0OA 5ECKB 2DSAA 2A2PA 1OE8A 5GAPD 1YF1A 2I1UA 1V58A 4IBPA 3J7Yb 4IKHA 4N0ZA 3L9SA 4L8EA 3UJ1A 1Y25A 4PUAA 5GAND 4PNFA 3IPZA 4BVXA 4YQVA 2XHFA 1G7OA 1M9BA 2EFDA 5IM9A 3TOUA 4EDZA 19GSA 4MH3A 4PQIA 1M3JA 1C72A 4AJ6A 2HRKA 5J4UA 3E9JB 5JCUA 4KW6A 1XVWA 1XW6A 5IMAA 1Q4JA 3EINA 4JZQA 4HZ4A 2BTOT 3GNJA 1YJ6A 3C1RA 5F05A 5G30A 1FB6A 2XC2A 1DUGA 1T8EB 3P8WA 4MPGA 3M8NA 3LWAA 3WD6A 3QCPA 2KP2A 5KN1A 4EVMA 3FMWA 3P7XA 1GWCA 3VLNA 1ACVA 2FWGA 5H5RA 3APSA 1MTCA 2RIIA 2PU9C 2MBTA 4G0LA 2H1DA 4E8EA 2L6CA 4F82A 2DIYA 3QD9A 3CHXC 5IOWA 5L71A 1H4OA 2DKIA 4Q5NA 5CRHA 4NV2A 2O87A 4KA0A 1MD4A 3I6AA 4KGIA 5KEJA 3FR6A 1BX9A 2X49A 3FR3A 4KF9A 2VAFA 5KOWA 1SVLA 2WW3A 2GQMA 3NOFA 2YWNA 4PQ1A 2DKHA 2PWJA 4POKA 6GSSA 4ZB6A 5AISA 1TI3A 2CQ9A 4MK3A 3EU3A 4JEDA 3I43A 1AXDA 4A5PA 4IELA 1A0RP 2B1KA 2VCWA 2B5EA 3D22A 4LMWA 2GZPA 2MMNA 1B4QA 3MIXA 1YF0A 4ZB9A 4MMMA 3GTUB 3D5JA 2YP6A 4NXIA 1EV4A 3M9KA 4MA9A 3GSSA 1TRUA 3F6DA 1NW2A 2M80A 2H8LA 2H1GA 4EE0A 5D93A 3UVTA 1VF1A 1FW1A 1EGOA 4GQFA 1TK5B 2FWFA 4I8BA 2PN8A 4XS4A 5CNWA 5DBQA 3HMJG 1ON4A 1ERUA 2GZYA 2C1YA 3EE2A 3VWWA 1EP8A 3GL5A 4TW5A 3RAZA 20GSA 2FA8A 1UVZA 1FHEA 2J9HA 5D8IA 4MZWA 1HQOA 3Q18A 2LSTA 1B9YC 2FHEA 4CY6A 2P5RA 1GSDA 3TRQA 1XIYA 2H76A 3Q19A 2VLTA 1OC9A 5AIXA 1FOHA 3GH6A 3TKPA 3TOTA 2R0CA 1ABAA 1N2AA 1E2YA 2A2SA 4ML1A 2C80A 4XS1A 1WWJA 1DBYA 2JZSA 1PKWA 2PERA 2HSHA 1XXUA 3QPMA 1Z9HA 4TR3A 1G7EA 2JSYA 1AW9A 2WCIA 5A1NB 2RUEA 2LTKA 1ZL9A 2K18A 4KB3A 4TXOB 4MF6A 3DMLA 2HXKA 4RI7A 3S9FA 3CSHA 5KN0A 3HYPA 2GQLA 1M7TA 5JWRB 5A5KA 3HVVA 1U88A 3A2WA 4G9HA 4F9ZA 4GSSA 6GSYA 1X5DA 2I3YA 3D6IA 3TJBA 3KMOA 2P5QA 1BEDA 1B48A 4X0XA 4J57E 4MH2A 5DALB 2AV4A 3F3RA 3WGDA 2BMXA 2HQTA 5FWGA 4XCSA 4EUYA 4KSOA 2IFQB 3OR5A 2H66A 3ZYWA 3QFBC 3CTFA 4KDUA 3GHAA 2LKUA 4WR5A 1S3AA 2QKEA 1M0UA 2GT6A 1MD3A 2IMIA 1USBA 4GXZA 4BVYA 4PXOA 3ME7A 3H1NA 4IHUA 4GWRA 2YV9A 2V6KA 8GSSA 1GTUA 1XWCA 3VFIA 3DRNA 5BRTA 5EY6A 3PGTA 1WP0A 3PINA 3TKRA 3ZTLA 4YQUA 3RHCA 2GSTA 5KN2A 4G0IA 1VF3A 3G7JA 1JLVA 3ERGA 4MDCA 3TCOA 1S3CA 1PRXA 3ZVJA 3H4KA 4EIQA 4GCIA 1O73A 3APOA 4K5SA 1B4PA 5B8AA 1GNEA 2L5OA 3RGBC 3DIEA 5H5SA 1Y6EA 4LMVA 3EWLA 2DIZA 4V2LA 2R0GA 4YAPA 5EPFA 4XHMA 3EC3A 5B7CA 4OFTA 3UARA 2B1LA 2I4AA 1TI1A 2XPEA 4JRRA 2DLXA 1O8XA 1X5CA 3DD3A 2IWTA 5IMCA 4DVCA 2R0PA 4V1Ag 2AAWA 4N30A 1V2AA 3KCMA 4JU5A 4G01A 1B9XC 3KJYA 1OVNA 5LNKe 4EIPA 2V2GA 1TOFA 4XRAA 2JACA 2YCDA 3LORA 2L4QA 4AGSA 4KAEA 3IHQA 1TKDB 2NBSA 1B8XA 2KUCA 5IPGA 1XWKA 4WBJA 3TGZA 3IAM2 4DEJA 3CTGA 2F3MA 1K0BA 3LYKA 2K8VA 2REMA 1J08A 3VK9A 1BF5A 1K3YA 3QAGA 2GVPA 2NDOA 5COHA 4GTUA 2B5XA 2FLSA 2XBIA 2CVDA 4E68A 2MZCA 4BPYA 1GNWA 2EFCA 4ILFA 5ECRB 5ECMB 1N8JA 5CYYA 5A5HB 4V1Ap 3MYDA 2HSNB 2HRKB 1WPIA 2WZSA 2YPMA 5DQSA 5GSTA 3A5WA 9GSSA 3KD0A 2HZEA 1A2LA 4ZB8A 3CSIA 2DBCA 5HFGA 3IHGA 1SKWB 3WT2A 6GSWA 5F07A 2K9FA 3G9BA 3KGKA 2RM6A 2F8AA 3DYRA 4ACSA 1TXXA 1HNCA 1EWXA 3GFKA 5DJMA 3R3EA 1R4WA 2YOIA 1GSEA 2MMOA 1PX6A 2C3TA 2YJHA 5G1KA 1O8WA 2AHEA 2QSIA 3DVXA 2IMFA 4Z2UA 2WFCA 5ENUA 1K3LA 5GSSA 1X9SB 3ME8A 2FWEA 3FZ4A 1T4ZA 4V2NA 2X8CA 4YQMA 1X9WB 1I5GA 3JCML 4POBA 5G31A 5D9TA 6GSUA 3TKSE 1S3DA 1EOGA 1MDJA 4HSCX 1S4BP 2N5FA 3RBTA 4AF2A 2JU5A 2I9HA 3IA1A 4F03A 2R4VA 4G10A 1LU4A 5A34B 2YANA 3ISOA 2H01A 5G2ZA 1QMVA 1EEJA 1SD8A 3TKSC 4BWQA 4JBBA 2LRTA 1ZYPA 3CRTA 2V6OA 2DJKA 1TRWA 2O36A 1Z7PA 3QR6A 4D73A 4PGTA 4TR4A 2VLVA 4KDYA 2H75A 5IO2A 1SVOA 1TK8B 4TR1B 2PMTA 1G6WA 4J56E 3LFLA 2YV7A 3O6TA 4X43A 3FEUA 2WS2A 18GSA 3GX8A 1M9AA 2LNSA 4PQHA 5A4UA 3ERWA 3F9UA 3TU3B 3HHVA 4CW9A 2IN3A 1EV9A 1ZYEA 3LQ7A 2WULA 1GH2A 2OE3A 4HS1A 3HVNA 3F63A 4MF7A 4GSNA 4I5QA 4PX1A 3KEBA 4OD7A 2IMKA 1JZOA 2WZ9A 1OC9B 4W66A 4USSA 5E4WA 1DSBA 3QDNA 5J9BA 3IOSA 1DE2A 2V32A 5HR2A 4EKZA 2LV3A 4I2TA 1WJKA 1WOUA 2X99A 4KSMA 3SWLA 1FAAA 4ZBAA 1G0TA 1MEKA 3GX0A 4JR6A 4HEA2 3PPUA 2GT5A 4GSTA 2OBKA 5BMUA 2VL9A 4CDOA 2EFEA 1ERTA 3IAS2 1J9BA 2YNXA 3HCZA 3LJRA 1FO5A 1PSQA 3IV4A 2GZZA 3GA4A 4KCAA 4L5OA 1A0FA 3MNGA 4CHSA 3GUSA 2E0QA 3LW9A 3QAVA 3EURA 5D9WA 4ECBA 2RLIA 2YJ7A 4ZB7A 2FWHA 1ZZYA 3GKKA 1PA3A 1M3IA 4NPBA 3C1SA 2HFDA 3EVIA 2YZUA 2WVYA 1T00A 4DSRA 2JZRA 2WRTA 4RQRA 4BVYB 4XTSA 2H0IA 4LL4B 1DE1A 3CXGA 3KTLA 1XZOA 3L4NA 2GTUA 2H1BA 2M46A 2IPAA 3PR8A 2VKZG 4HUAA 3MWHA 4BL7A 4ZL7A 1K0NA 4AJ8A 1XW5A 2UV8G 4HZ2A 1TP9A 2LRNA 4WBRD 3ZREA 3UIWA 3FZ9A 1AAZA 1Z6NA 1HNAA 22GSA 1FG4A 3HJMA 5F8BA 4ECIA 1YKAA 4NHWA 2AJQB 1GUKA 2I81A 2CA8A 4V2MA 1THOA 1W89A 2UZ8A 2Z9SA 2P31A 4NV5A 3FZAA 4MJCA 2HE3A 2FUG2 1XWAA 11GSA 1NM3A 1UN2A 3M9JA 1VGLA 4HJ2A 1SKRB 1KBNA 2DJ3A 1A8YA 1XBSA 5ECOB 2VCTA 4AI6A 4YH2A 2AYTA 3DGQA 4I2UA 2GQKA 3KH7A 4YKFA 2QA2A 5G5EA 2VL2A 1FB0A 2DJ0A 1SYRA 1TRVA 6GSVA 5AN1A 4Q5RA 4K7NA 3F4RA 2X64A 3GN3A 5CRDA 2CT6A 2MMZA 2KLXA 2H19A 1CQHA 2AB6A 4AJ7A 2GSQA 2HSMB 1OYJA 1PX7A 2X8GA 4G19A 1EP7A 3VPTA 4QL9A 1VF4A 1NSWA 1EOHA 1JLWA 3A2VA 1RW1A 2JL4A 4ML6A 5FT3A 3HJOA 1M2AA 3IXRA 3A5IA 1V98A 2N5AA 2YWMA 1YEWC 1MDIA 4HDEA 1U3IA 3M3MA 1YEXA 2MYGA 2VCQA 3O76A 1WMJA 1X9MB 5IIZA 1A24A 3M1GA 2A2RA 2DMLA 1ZOFA 2FGXA 4MZBA 5F06A 2V41A 2HSYA 5DVBA 4X1UA 3GKNA 3L9VA 2B6MA 3BJ5A 1SJIA 5A4VA 3UVHA 2HZEB 3UOMA 2L5LA 5IMVA 2CAQA 4LLRA 1EEMA 2LQQA 5DDLA 1Z6MA 5ECPB 2GSRA 2JSZA 2L4CA 4RUVA 1O81A 2H70A 5HR0A 2C3NA 4ZL9A 2HRAA 4K5RA 4ZBBA 5HR3A 2HZFA 4RQXA 1SK0A 3GV1A 1V57A 5A4WA 3F4TA 5HFKA 4QMKA 4PTSA 5ID2B 2RUFA 2D2ZA 2VM2A 2L59A 2XBQA 1U87A 3QFAC 2X4AA 3GTUA 10GSA 1X0RA 4FIWA 5CRGA 4IQAA 4MP4A 4F2IA 3WT1A 2VCZA 1OKTA 4LL1B 1GTBA 4WEYA 3C73A 4WR4A 3APQA 3Q74A 1SU9A 2WVXB 3P90A 2PVQA 1SK2A 3KZQA 4OO5A 1IYIA 1EGRA 2VCVA 6GSXA 1F9MA 1T7PB 3I69A 1PKZA 2HYXA 2VD0A 5DAKB 5EVOA 1HYUA 4ICYA 2KOKA 2V1MA 3BCIA 1R26A 2VLUA 3WGXA 4XS6A 1BYEA 2LQOA 1A2JA 5GZZB 5IMDA 4JR4A 1AIUA 2C4JA 1JZDA 3CSJA 3KP9A 2G2QA 5IOXA 4X4JA 5JWOB 1I9DA 2GGTA 3HZ4A 4E8HA 1SJZA 4K8MA 5J4VA 4GRFA 5ECLB 3FY7A 3ZMKA 2O7KA 2WB9A 4TXOA 2O85A 4XRDA 5HR1A 1URMA 4BVXB 5ECQB 4ZILA 2GLRA 4IN0A 2HNLA 16GSA 4IS0A 4AKXB 1FVJA 3M0FA 1XPVA 1XVQA 2L57A 4ECJA 3FYGA 4PNGA 4GF0A 2MBSA 5DALA 5B6MA 3MAKA 4N3ZA 3HVXA 4F0BA 1FOVA 3HKRA 5ELAA 4L0WA 1BG1A 3ZFLA 2WJUA 3H93A 3LSZA 5BMUB 4N11A 1XCCA 2HLSA 3CBUA 3G7YA 2HRFA 4HU9A 2LNTA 1GL8A 3GH9A 2OADA 3KP8A 1SJ6A 1QFNA 5E59A 5CAXA 5DJLA 4OFNA 1PL2A 5CO3A 5D9VA 4EDYA 4FYCA 2ON5A 3MDKA 3QAWA 3L9UA 3FRCA 4OMVA 3VI5A 2VCXA 2N5BA 2OACA 3GL3A 2RM5A 1IYHA 4K2XA 1PMTA 1A23A 2P0GA 3RPPA 1QXHA 1ZYQB 3BOAA 4PI0C 3C7MA 4AKHA 2CZ2A 2E2GA 3DXBA 1GTAA 4FO5A 4NHZA 3L78A 4KX4A 4P3YB 3UBLA 3RDWA 4AKGA 1F37A 2B5YA 2CZ3A 1AQXA 3N9JA 3UEMA 1YDKA 4NAXA 3VWXA 4WETA 1SL0B 3ZIJA 3KMNA 5C04A 2H6YA 4MJBA 4BL7B 1W4VA 2FCHA 1AQWA 3EU4A 3HVSA 5HQPA 1LJRA 3ZFBA 3ERFA 3TKQA 2H74A 2NVLA 3D4MA 3V1WA 3UMAA 2DC5A 3HD5A 4KH7A 2QA1A 3W8JA 1R5AA 1AC1A 4OFMA 3U5RE 4XS4B 2LUSA 3U6VA 1YEPA 5AGYA 1GSFA 1GSQA 2J23A 2OT3A 1R5PA 2H71A 2FA4A 3US3A 4N0VA 1OAZA 5DCGA 5J3RA 3ZL5A 4EO3A 5ELGA 5D96A 4TVEA 4OO4A 1YVLA 3GSTA 3TJJA 3QMXA 1YZXA 5IO0A 1TDIA 5G5FA 1BG5A 2LJAA 5HFIA 3D0ZA 1VRSD 5JCGA 2VM1A 4LA1A 1GTIA 3F6FA 1BAYA 4IQ1A 2OBIA 5KOXA 5IMFA 4HQZA 3UBKA 4O32A 2CAIA 5INYA 1Z5YE 3KTBA 1BQ7A 5A5HA 4O92A 2IJYA 2HSNA 3HZ8A 4IJIA 1QK8A 1XG8A 2O89A 4TXVA 14GSA 4G2EA 4IW9A 1ILOA 4Z2RA 2DMMA 4ECCA 1Z7RA 3DKSA 2JADA 2F51A 1GSUA 2M72A 3N5OA 1G6YA 3LG6A 4YAVA 4FH8A 1E6BA 2VOCA 2OA7A 5CREA 4TOPA 4ZXGA 3TJFA 2OJLA 3F3QA 2YWIA 3IK9A 2HRNA 3HA9A 3FW2A 4FQUA 2VUPA 3DVWA 1A8LA 2H1AA 1SVMA 5B6NA 3GKMA 1K3OA 1O7UA 1GLPA 3LGCA 4BIKA 2IL3A 2CV4A 1UA5A 3ZZXA 4KUNA 3TB2A 1OE7A 1EZKA 2H0GA 1JZWA 1PQNA 4QL7A 3UAPA 4MCUA 1T4YA 3TJGA 2R3XA 4FXYP 3EPTA 2YWOA 2C0EA 1Q98A 2TRCP 2H0HA 2OE0A 4IVFA 3W6GA 12GSA 5J47A 2O5VA 4WF4A 4EL1A 4TR0A 3GURA 4F0CA 2EIQA 2H6ZA 6GSTA 3F4SA 3ZRDA 3CRUA 4O5RA 2LEGA 3ZLPA 1XWBA 3CYNA 1F6MC 3GIXA 5DCHA 3Q6OA 5CP1A 2HI7A 3IDVA 5A34A 3F0IA 3ZMLA 4MPFA 2LJKA 3J7Yk 3HJPA 4J2FA 3GKXA 4EF0A 4OCEA 1ZMAA 2C0GA 4MJAA 4Q5QA 2XPDA 5ECIB 3NIVA 1QUWA 4DSSA 2C8UA 3A2XA 3LYPA 5ECSA 3ZVJD 4TR1A 1TRSA 2EC4A 3IC4A 3ZIVA 1FVKA 2K6VA 1F2EA 3C8EA 5LD0A 4POMA 2ZCTA 1S3RA 2OKAA 2B3SA 2E7PA 2VL2C 4N10A 3KM6A 4KDXA 3GYKA 1HNBA 1YQ1A 3RHBA 4HOJA 4I6XA 3TRPA 5LCZA 5IPHA 5F0GA 1O85A 3KIJA 2YZHA 4EC0A 2LJRA 3BBYA 4WXTA 4XIHA 2CX3A 2ES7A 4JE1A 4PHZC 2L6DA 1N25A 3EMXA 2VD1A 1XW9A 1K0DA 2QC7A 4MF5A 3CMIA 4Z7XA 1Z3EA 1AUCA 1TU7A 5AIVA 4L0UA 3VWVA 1SD9A 2FNOA 4TRXA 1YY7A 2O3EA 3IC8A 2R37A 3TUEA 17GSA 5IMZA 3RFRC 3IE3A 1JHBA 1PL1A 4FYBA 4K7IA 4ZL8A 1PN0A 4HQSA 1VF2A 1U6TA 3VURA 1R7HA 2WGRA 2EFHA 3PH9A 1NHYA 3WYWA 4GLTA 4BWSA 3W8SA 1ZYNA 2QGVA 5J9CA 1GSYA 2NTOA 4ULXA 2FD3A 2JZTA 4AKIA 3F8UA 4I97A 2WDUA 4ZBDA 5H5QA 1UC7A 4K0GA 2MMAA 2YN1A 2PGTA 3D4TA 3D21A 3ED3A 1M99A 4ZIJA 4O5QA 5DQYA 4POLA 2R2JA 1GULA 4CY8A 4OCFA 4TN8A 2KP1A 1PN9A 4FYUA 1PD21 2CVBA 1KTEA 2VL3A 3P2AA 1GUMA 2C0FA 3KXOA 1OC3A 4WKWA 5IQYA 3GMFA 1V40A 4DSQA 4PUFC 3GRXA 1I1IP 3QOUA 1KEBA 2A4HA 3L0HA 4HJMA 5J5NA 2C3QA 2TRXA 3TDGA 4K6XA 2PVOC 3VI7A 3SBCA 2FY6A 1SENA 5JCWA 2C0DA 1GSSA 1PGTA 1THXA 3FZ5A 3TJKA 2H6XA 2R6KA 1RK4A 3IK7A 5ECNB 2R5GA 3HY2A 5D9XA 3BD2A 4MNNA 4EXJA 2EIRA 4KNDA 5J4YA 2HT9A 2B7JA 2IMDA 2IMEA 4K2DA 3CQFA 1K0AA 4G0KA 1ERWA 4IP1A 1TK0B 1GRXA 4QQ7A 1O6JA 4WF5A 1F3AA 1WE0A 2VO4A 4PI2C 1ERVA 2PUKC 3EYTA 4MJEA 4O7HA 4D73B 2ZUPA 3FHKA 3IR4A 3I9V2 2KHPA 3C71A 2AUVA 4KCEA 1TU8A 4BA7A 2EIOA 1T3BA 3CWGA 5A1NA 3WGEA 1SL2B 4IJ3A 1SL1B 4GDFA 4ISDA 1GP1A 5C00A 5J41A 1Y1UA 5KN3A 1F3BA 2HSMA 3E3EA 3NZNA 2DJ1A 3IBHA 1SKSB 1H75A 5B8BA 3R2QA 3RPNA 1A2MA 4NWYA 5EL8A 2K8SA 1X5EA 2ALBA 5D73A 1T1VA 1TXUA 2A4VA 2H73A 3FK8A 1M2DA 4H86A 1TW9A 2F9SA 2PPTA 3E0UA 4K0NA 1JFUA 2IIYA 2CX4A 2WW2A 2B7KA 2WW0A 2BJXA 3A3TA 7GSSA 1TTZA 1ZGNA 4HU7A 2IFQA 4MLYA 4O5UA 1ZCPA 3G7IA 3DWVA 2X8HA 4RI6A 3BCKA 1J0FA 3FKFA 4K7OA 3AY8A 2ZNMA 3LXTA 1K0MA 1PFOA 1ST9A 5CRWA 1NHOA 4Z2TA 3EMPA 4Q5FA 1XOAA 13GSA 4ID0A 2VIMA 1QGVA 1OC8A 2PBJA 1TJDA 4HI7A 3IRAA 3KH9A 1XWGA 1JZRA 3H8QA 1K0CA 1RQMA 2H72A 2GDRA 1WRYA 2WW1A 1MDKA 2LS5A 2NPBA 3VWUA 2CVKA 3VPQA 2DJ2A 1YKCA 4OWYA 1V9WA 5ID2A 2H1LA 4KE3A 1XFLA 2OE1A 2O8VB 3MSZA 1BJXA 3K8NA 3FR9A 3DEXA 3O3TA 3UL3A 2TIRA 4TKYA 2G0FA 4GQCA 3TRXA 4L5LA 1ML6A 2GSSA 1M2BA 4MZCA 5FHIA 4IP6A 2DJJA 1QQ2A 1KNGA 1GLQA 5G1LA 1OKDA 2LRCA
chains in the Genus database with same CATH topology
2H30A 1U3AA 4K9ZA 4K1FA 5JWQB 1LBKA 1CQGA 5ABRA 1XOBA 3LEFA 2F8FA 1HD2A 2ON7A 3H79A 1WIKA 1SYXA 3LXZA 5ECHB 4MABA 4IGJA 4DSSB 1SK1A 2E2MA 4NMUA 5DAKA 3HDCA 1GUHA 2GS3A 4PURA 1AQVA 3TKSA 3ZITA 4YKGA 5J40A 3HXSA 1K0OA 5ECKB 2DSAA 2A2PA 1OE8A 5GAPD 1YF1A 2I1UA 1V58A 4IBPA 3J7Yb 4IKHA 4N0ZA 3L9SA 4L8EA 3UJ1A 1Y25A 4PUAA 5GAND 4PNFA 3IPZA 4BVXA 4YQVA 2XHFA 1G7OA 1M9BA 2EFDA 5IM9A 3TOUA 4EDZA 19GSA 4MH3A 4PQIA 1C72A 4AJ6A 2HRKA 5J4UA 3E9JB 5JCUA 4KW6A 1XVWA 1XW6A 5IMAA 1Q4JA 3EINA 4JZQA 4HZ4A 2BTOT 3GNJA 1YJ6A 3C1RA 5F05A 5G30A 1FB6A 2XC2A 1DUGA 1T8EB 3P8WA 4MPGA 3M8NA 3LWAA 3WD6A 3QCPA 2KP2A 5KN1A 4EVMA 3FMWA 3P7XA 1GWCA 3VLNA 1ACVA 2FWGA 5H5RA 3APSA 1MTCA 2RIIA 2PU9C 2MBTA 4G0LA 2H1DA 4E8EA 2L6CA 4F82A 2DIYA 3QD9A 5IOWA 5L71A 1H4OA 2DKIA 4Q5NA 5CRHA 4NV2A 2O87A 4KA0A 1MD4A 3I6AA 4KGIA 5KEJA 3FR6A 1BX9A 2X49A 3FR3A 4KF9A 2VAFA 5KOWA 1SVLA 2GQMA 3NOFA 2YWNA 4PQ1A 2DKHA 2PWJA 4POKA 6GSSA 4ZB6A 5AISA 1TI3A 2CQ9A 4MK3A 3EU3A 4JEDA 3I43A 1AXDA 4A5PA 4IELA 1A0RP 2B1KA 2VCWA 2B5EA 3D22A 4LMWA 2GZPA 2MMNA 1B4QA 3MIXA 1YF0A 4ZB9A 4MMMA 3GTUB 3D5JA 2YP6A 4NXIA 1EV4A 3M9KA 4MA9A 3GSSA 1TRUA 3F6DA 1NW2A 2M80A 2H8LA 2H1GA 4EE0A 5D93A 3UVTA 1VF1A 1FW1A 1EGOA 4GQFA 1TK5B 2FWFA 4I8BA 2PN8A 4XS4A 5CNWA 5DBQA 3HMJG 1ON4A 1ERUA 2GZYA 2C1YA 3EE2A 3VWWA 1EP8A 3GL5A 4TW5A 3RAZA 20GSA 2FA8A 1UVZA 1FHEA 2J9HA 5D8IA 4MZWA 1HQOA 3Q18A 2LSTA 1B9YC 2FHEA 4CY6A 2P5RA 1GSDA 3TRQA 1XIYA 2H76A 3Q19A 2VLTA 1OC9A 5AIXA 1FOHA 3GH6A 3TKPA 3TOTA 2R0CA 1ABAA 1N2AA 1E2YA 2A2SA 4ML1A 2C80A 4XS1A 1WWJA 1DBYA 2JZSA 1PKWA 2PERA 2HSHA 1XXUA 3QPMA 1Z9HA 4TR3A 1G7EA 2JSYA 1AW9A 2WCIA 5A1NB 2RUEA 2LTKA 1ZL9A 2K18A 4KB3A 4TXOB 4MF6A 3DMLA 2HXKA 4RI7A 3S9FA 3CSHA 5KN0A 3HYPA 2GQLA 1M7TA 5JWRB 5A5KA 3HVVA 1U88A 3A2WA 4G9HA 4F9ZA 4GSSA 6GSYA 1X5DA 2I3YA 3D6IA 3TJBA 3KMOA 2P5QA 1BEDA 1B48A 4X0XA 4J57E 4MH2A 5DALB 2AV4A 3F3RA 3WGDA 2BMXA 2HQTA 5FWGA 4XCSA 4EUYA 4KSOA 2IFQB 3OR5A 2H66A 3ZYWA 3QFBC 3CTFA 4KDUA 3GHAA 2LKUA 4WR5A 1S3AA 2QKEA 1M0UA 2GT6A 1MD3A 2IMIA 1USBA 4GXZA 4BVYA 4PXOA 3ME7A 3H1NA 4IHUA 4GWRA 2YV9A 2V6KA 8GSSA 1GTUA 1XWCA 3VFIA 3DRNA 5BRTA 5EY6A 3PGTA 1WP0A 3PINA 3TKRA 3ZTLA 4YQUA 3RHCA 2GSTA 5KN2A 4G0IA 1VF3A 3G7JA 1JLVA 3ERGA 4MDCA 3TCOA 1S3CA 1PRXA 3ZVJA 3H4KA 4EIQA 4GCIA 1O73A 3APOA 4K5SA 1B4PA 5B8AA 1GNEA 2L5OA 3DIEA 5H5SA 1Y6EA 4LMVA 3EWLA 2DIZA 4V2LA 2R0GA 4YAPA 5EPFA 4XHMA 3EC3A 5B7CA 4OFTA 3UARA 2B1LA 2I4AA 1TI1A 2XPEA 4JRRA 2DLXA 1O8XA 1X5CA 3DD3A 2IWTA 5IMCA 4DVCA 2R0PA 4V1Ag 2AAWA 4N30A 1V2AA 3KCMA 4JU5A 4G01A 1B9XC 3KJYA 1OVNA 5LNKe 4EIPA 2V2GA 1TOFA 4XRAA 2JACA 2YCDA 3LORA 2L4QA 4AGSA 4KAEA 3IHQA 1TKDB 2NBSA 1B8XA 2KUCA 5IPGA 1XWKA 4WBJA 3TGZA 3IAM2 4DEJA 3CTGA 2F3MA 1K0BA 3LYKA 2K8VA 2REMA 1J08A 3VK9A 1BF5A 1K3YA 3QAGA 2GVPA 2NDOA 5COHA 4GTUA 2B5XA 2FLSA 2XBIA 2CVDA 4E68A 2MZCA 4BPYA 1GNWA 2EFCA 4ILFA 5ECRB 5ECMB 1N8JA 5CYYA 5A5HB 4V1Ap 3MYDA 2HSNB 2HRKB 1WPIA 2YPMA 5DQSA 5GSTA 3A5WA 9GSSA 3KD0A 2HZEA 1A2LA 4ZB8A 3CSIA 2DBCA 5HFGA 3IHGA 1SKWB 3WT2A 6GSWA 5F07A 2K9FA 3G9BA 3KGKA 2RM6A 2F8AA 3DYRA 4ACSA 1TXXA 1HNCA 1EWXA 3GFKA 5DJMA 3R3EA 1R4WA 2YOIA 1GSEA 2MMOA 1PX6A 2C3TA 2YJHA 5G1KA 1O8WA 2AHEA 2QSIA 3DVXA 2IMFA 4Z2UA 2WFCA 5ENUA 1K3LA 5GSSA 1X9SB 3ME8A 2FWEA 3FZ4A 1T4ZA 4V2NA 2X8CA 4YQMA 1X9WB 1I5GA 3JCML 4POBA 5G31A 5D9TA 6GSUA 3TKSE 1S3DA 1EOGA 1MDJA 2N5FA 3RBTA 4AF2A 2JU5A 2I9HA 3IA1A 4F03A 2R4VA 4G10A 1LU4A 5A34B 2YANA 3ISOA 2H01A 5G2ZA 1QMVA 1EEJA 1SD8A 3TKSC 4BWQA 4JBBA 2LRTA 1ZYPA 3CRTA 2V6OA 2DJKA 1TRWA 1Z7PA 3QR6A 4D73A 4PGTA 4TR4A 2VLVA 4KDYA 2H75A 5IO2A 1SVOA 1TK8B 4TR1B 2PMTA 1G6WA 4J56E 3LFLA 2YV7A 3O6TA 4X43A 3FEUA 2WS2A 18GSA 3GX8A 1M9AA 2LNSA 4PQHA 5A4UA 3ERWA 3F9UA 3TU3B 3HHVA 4CW9A 2IN3A 1EV9A 1ZYEA 3LQ7A 2WULA 1GH2A 2OE3A 4HS1A 3F63A 4MF7A 4GSNA 4I5QA 4PX1A 3KEBA 4OD7A 2IMKA 1JZOA 2WZ9A 1OC9B 4W66A 4USSA 5E4WA 1DSBA 3QDNA 5J9BA 3IOSA 1DE2A 2V32A 5HR2A 4EKZA 2LV3A 4I2TA 1WJKA 1WOUA 2X99A 4KSMA 3SWLA 1FAAA 4ZBAA 1G0TA 1MEKA 3GX0A 4JR6A 4HEA2 3PPUA 2GT5A 4GSTA 2OBKA 5BMUA 2VL9A 4CDOA 2EFEA 1ERTA 3IAS2 1J9BA 2YNXA 3HCZA 3LJRA 1FO5A 1PSQA 3IV4A 2GZZA 3GA4A 4KCAA 4L5OA 1A0FA 3MNGA 4CHSA 3GUSA 2E0QA 3LW9A 3QAVA 3EURA 5D9WA 4ECBA 2RLIA 2YJ7A 4ZB7A 2FWHA 1ZZYA 3GKKA 1PA3A 4NPBA 3C1SA 2HFDA 3EVIA 2YZUA 1T00A 4DSRA 2JZRA 2WRTA 4RQRA 4BVYB 4XTSA 2H0IA 4LL4B 1DE1A 3CXGA 3KTLA 1XZOA 3L4NA 2GTUA 2H1BA 2M46A 2IPAA 3PR8A 2VKZG 4HUAA 3MWHA 4BL7A 4ZL7A 1K0NA 4AJ8A 1XW5A 2UV8G 4HZ2A 1TP9A 2LRNA 4WBRD 3ZREA 3UIWA 3FZ9A 1AAZA 1Z6NA 1HNAA 22GSA 1FG4A 3HJMA 5F8BA 4ECIA 1YKAA 4NHWA 2AJQB 1GUKA 2I81A 2CA8A 4V2MA 1THOA 1W89A 2UZ8A 2Z9SA 2P31A 4NV5A 3FZAA 4MJCA 2HE3A 2FUG2 1XWAA 3M9JA 11GSA 1NM3A 1UN2A 1VGLA 4HJ2A 1SKRB 1KBNA 2DJ3A 1A8YA 1XBSA 5ECOB 2VCTA 4AI6A 4YH2A 2AYTA 3DGQA 4I2UA 2GQKA 3KH7A 4YKFA 2QA2A 5G5EA 2VL2A 1FB0A 2DJ0A 1SYRA 1TRVA 6GSVA 5AN1A 4Q5RA 4K7NA 3F4RA 2X64A 3GN3A 5CRDA 2CT6A 2MMZA 2KLXA 2H19A 1CQHA 2AB6A 4AJ7A 2GSQA 2HSMB 1OYJA 1PX7A 2X8GA 4G19A 1EP7A 3VPTA 4QL9A 1VF4A 1NSWA 1EOHA 1JLWA 3A2VA 1RW1A 2JL4A 4ML6A 5FT3A 3HJOA 1M2AA 3IXRA 3A5IA 1V98A 2N5AA 2YWMA 1MDIA 4HDEA 1U3IA 3M3MA 1YEXA 2MYGA 2VCQA 3O76A 1WMJA 1X9MB 5IIZA 1A24A 3M1GA 2A2RA 2DMLA 1ZOFA 2FGXA 4MZBA 5F06A 2V41A 2HSYA 5DVBA 4X1UA 3GKNA 3L9VA 2B6MA 3BJ5A 1SJIA 5A4VA 3UVHA 2HZEB 3UOMA 2L5LA 5IMVA 2CAQA 4LLRA 1EEMA 2LQQA 5DDLA 1Z6MA 5ECPB 2GSRA 2JSZA 2L4CA 4RUVA 1O81A 2H70A 5HR0A 2C3NA 4ZL9A 2HRAA 4K5RA 4ZBBA 5HR3A 2HZFA 4RQXA 1SK0A 3GV1A 1V57A 5A4WA 3F4TA 5HFKA 4QMKA 4PTSA 5ID2B 2RUFA 2D2ZA 2VM2A 2L59A 2XBQA 1U87A 3QFAC 2X4AA 3GTUA 10GSA 1X0RA 4FIWA 5CRGA 4IQAA 4MP4A 4F2IA 3WT1A 2VCZA 1OKTA 4LL1B 1GTBA 4WEYA 3C73A 4WR4A 3APQA 3Q74A 1SU9A 3P90A 2PVQA 1SK2A 3KZQA 4OO5A 1IYIA 1EGRA 2VCVA 6GSXA 1F9MA 1T7PB 3I69A 1PKZA 2HYXA 2VD0A 5DAKB 5EVOA 1HYUA 4ICYA 2KOKA 2V1MA 3BCIA 1R26A 2VLUA 3WGXA 4XS6A 1BYEA 2LQOA 1A2JA 5GZZB 5IMDA 4JR4A 1AIUA 2C4JA 1JZDA 3CSJA 3KP9A 2G2QA 5IOXA 4X4JA 5JWOB 1I9DA 2GGTA 3HZ4A 4E8HA 1SJZA 4K8MA 5J4VA 4GRFA 5ECLB 3FY7A 3ZMKA 2O7KA 2WB9A 4TXOA 2O85A 4XRDA 5HR1A 1URMA 4BVXB 5ECQB 4ZILA 2GLRA 4IN0A 2HNLA 16GSA 4IS0A 4AKXB 1FVJA 3M0FA 1XPVA 1XVQA 2L57A 4ECJA 3FYGA 4PNGA 4GF0A 2MBSA 5DALA 5B6MA 3MAKA 4N3ZA 3HVXA 4F0BA 1FOVA 3HKRA 5ELAA 4L0WA 1BG1A 3ZFLA 2WJUA 3H93A 3LSZA 5BMUB 4N11A 1XCCA 2HLSA 3CBUA 3G7YA 2HRFA 4HU9A 2LNTA 1GL8A 3GH9A 2OADA 3KP8A 1SJ6A 1QFNA 5E59A 5CAXA 5DJLA 4OFNA 1PL2A 5CO3A 5D9VA 4EDYA 4FYCA 2ON5A 3MDKA 3QAWA 3L9UA 3FRCA 4OMVA 3VI5A 2VCXA 2N5BA 2OACA 3GL3A 2RM5A 1IYHA 4K2XA 1PMTA 1A23A 2P0GA 3RPPA 1QXHA 1ZYQB 3BOAA 3C7MA 4AKHA 2CZ2A 2E2GA 3DXBA 1GTAA 4FO5A 4NHZA 3L78A 4KX4A 4P3YB 3UBLA 3RDWA 4AKGA 1F37A 2B5YA 2CZ3A 1AQXA 3N9JA 3UEMA 1YDKA 4NAXA 3VWXA 4WETA 1SL0B 3ZIJA 3KMNA 5C04A 2H6YA 4MJBA 4BL7B 1W4VA 2FCHA 1AQWA 3EU4A 3HVSA 5HQPA 1LJRA 3ZFBA 3ERFA 3TKQA 2H74A 2NVLA 3D4MA 3V1WA 3UMAA 2DC5A 3HD5A 4KH7A 2QA1A 3W8JA 1R5AA 1AC1A 4OFMA 3U5RE 4XS4B 2LUSA 3U6VA 1YEPA 5AGYA 1GSFA 1GSQA 2J23A 2OT3A 1R5PA 2H71A 2FA4A 3US3A 4N0VA 1OAZA 5DCGA 5J3RA 3ZL5A 4EO3A 5ELGA 5D96A 4TVEA 4OO4A 1YVLA 3GSTA 3TJJA 3QMXA 1YZXA 5IO0A 1TDIA 5G5FA 1BG5A 2LJAA 5HFIA 3D0ZA 1VRSD 5JCGA 2VM1A 4LA1A 1GTIA 3F6FA 1BAYA 4IQ1A 2OBIA 5KOXA 5IMFA 4HQZA 3UBKA 4O32A 2CAIA 5INYA 1Z5YE 3KTBA 1BQ7A 5A5HA 4O92A 2IJYA 2HSNA 3HZ8A 4IJIA 1QK8A 2O89A 4TXVA 14GSA 4G2EA 4IW9A 1ILOA 4Z2RA 2DMMA 4ECCA 1Z7RA 3DKSA 2JADA 2F51A 1GSUA 2M72A 3N5OA 1G6YA 3LG6A 4YAVA 4FH8A 1E6BA 2VOCA 2OA7A 5CREA 4TOPA 4ZXGA 3TJFA 2OJLA 3F3QA 2YWIA 3IK9A 2HRNA 3HA9A 3FW2A 4FQUA 2VUPA 3DVWA 1A8LA 2H1AA 1SVMA 5B6NA 3GKMA 1K3OA 1O7UA 1GLPA 3LGCA 2IL3A 2CV4A 1UA5A 3ZZXA 4KUNA 3TB2A 1OE7A 1EZKA 2H0GA 1JZWA 1PQNA 4QL7A 3UAPA 4MCUA 1T4YA 3TJGA 2R3XA 3EPTA 2YWOA 2C0EA 1Q98A 2TRCP 2H0HA 2OE0A 4IVFA 3W6GA 12GSA 5J47A 2O5VA 4WF4A 4EL1A 4TR0A 3GURA 4F0CA 2EIQA 2H6ZA 6GSTA 3F4SA 3ZRDA 3CRUA 4O5RA 2LEGA 3ZLPA 1XWBA 3CYNA 1F6MC 3GIXA 5DCHA 3Q6OA 5CP1A 2HI7A 3IDVA 5A34A 3F0IA 3ZMLA 4MPFA 2LJKA 3J7Yk 3HJPA 4J2FA 3GKXA 4EF0A 4OCEA 1ZMAA 2C0GA 4MJAA 4Q5QA 2XPDA 5ECIB 3NIVA 1QUWA 4DSSA 2C8UA 3A2XA 3LYPA 5ECSA 3ZVJD 4TR1A 1TRSA 2EC4A 3IC4A 3ZIVA 1FVKA 2K6VA 1F2EA 3C8EA 5LD0A 4POMA 2ZCTA 2OKAA 2B3SA 2E7PA 2VL2C 4N10A 3KM6A 4KDXA 3GYKA 1HNBA 1YQ1A 3RHBA 4HOJA 4I6XA 3TRPA 5LCZA 5IPHA 5F0GA 1O85A 3KIJA 2YZHA 4EC0A 2LJRA 3BBYA 4WXTA 4XIHA 2CX3A 2ES7A 4JE1A 2L6DA 1N25A 3EMXA 2VD1A 1XW9A 1K0DA 2QC7A 4MF5A 3CMIA 4Z7XA 1Z3EA 1AUCA 1TU7A 5AIVA 4L0UA 3VWVA 1SD9A 2FNOA 4TRXA 1YY7A 3IC8A 2R37A 3TUEA 17GSA 5IMZA 3IE3A 1JHBA 1PL1A 4FYBA 4K7IA 4ZL8A 1PN0A 4HQSA 1VF2A 1U6TA 3VURA 1R7HA 2WGRA 2EFHA 3PH9A 1NHYA 3WYWA 4GLTA 4BWSA 3W8SA 1ZYNA 2QGVA 5J9CA 1GSYA 2NTOA 4ULXA 2FD3A 2JZTA 4AKIA 3F8UA 4I97A 2WDUA 4ZBDA 5H5QA 1UC7A 4K0GA 2MMAA 2YN1A 2PGTA 3D4TA 3D21A 3ED3A 1M99A 4ZIJA 4O5QA 5DQYA 4POLA 2R2JA 1GULA 4CY8A 4OCFA 4TN8A 2KP1A 1PN9A 4FYUA 1PD21 2CVBA 1KTEA 2VL3A 3P2AA 1GUMA 2C0FA 3KXOA 1OC3A 4WKWA 5IQYA 3GMFA 1V40A 4DSQA 4PUFC 3GRXA 3QOUA 1KEBA 2A4HA 3L0HA 4HJMA 5J5NA 2C3QA 2TRXA 3TDGA 4K6XA 2PVOC 3VI7A 3SBCA 2FY6A 1SENA 5JCWA 2C0DA 1GSSA 1PGTA 1THXA 3FZ5A 3TJKA 2H6XA 2R6KA 1RK4A 3IK7A 5ECNB 2R5GA 3HY2A 5D9XA 3BD2A 4MNNA 4EXJA 2EIRA 4KNDA 5J4YA 2HT9A 2B7JA 2IMDA 2IMEA 4K2DA 1K0AA 4G0KA 1ERWA 4IP1A 1TK0B 1GRXA 4QQ7A 1O6JA 4WF5A 1F3AA 1WE0A 2VO4A 1ERVA 2PUKC 3EYTA 4MJEA 4O7HA 4D73B 2ZUPA 3FHKA 3IR4A 3I9V2 2KHPA 3C71A 2AUVA 4KCEA 1TU8A 4BA7A 2EIOA 1T3BA 3CWGA 5A1NA 3WGEA 1SL2B 4IJ3A 1SL1B 4GDFA 4ISDA 1GP1A 5C00A 5J41A 1Y1UA 5KN3A 1F3BA 2HSMA 3E3EA 3NZNA 2DJ1A 3IBHA 1SKSB 1H75A 5B8BA 3R2QA 3RPNA 1A2MA 4NWYA 5EL8A 2K8SA 1X5EA 2ALBA 5D73A 1T1VA 1TXUA 2A4VA 2H73A 3FK8A 1M2DA 4H86A 1TW9A 2F9SA 2PPTA 3E0UA 4K0NA 1JFUA 2IIYA 2CX4A 2B7KA 2BJXA 3A3TA 7GSSA 1TTZA 1ZGNA 4HU7A 2IFQA 4MLYA 4O5UA 1ZCPA 3G7IA 3DWVA 2X8HA 4RI6A 3BCKA 1J0FA 3FKFA 4K7OA 3AY8A 2ZNMA 3LXTA 1K0MA 1ST9A 5CRWA 1NHOA 4Z2TA 3EMPA 4Q5FA 1XOAA 13GSA 4ID0A 2VIMA 1QGVA 1OC8A 2PBJA 1TJDA 4HI7A 3IRAA 3KH9A 1XWGA 1JZRA 3H8QA 1K0CA 1RQMA 2H72A 2GDRA 1WRYA 1MDKA 2LS5A 2NPBA 3VWUA 2CVKA 3VPQA 2DJ2A 1YKCA 4OWYA 1V9WA 5ID2A 2H1LA 4KE3A 1XFLA 2OE1A 2O8VB 3MSZA 1BJXA 3K8NA 3FR9A 3DEXA 3O3TA 3UL3A 2TIRA 4TKYA 2G0FA 4GQCA 3TRXA 4L5LA 1ML6A 2GSSA 1M2BA 4MZCA 5FHIA 4IP6A 2DJJA 1QQ2A 1KNGA 1GLQA 5G1LA 1OKDA 2LRCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H30 A;  1U3A A;  4K9Z A;  4K1F A;  5JWQ B;  1LBK A;  1CQG A;  5ABR A;  1XOB A;  3LEF A;  2F8F A;  1HD2 A;  2ON7 A;  3H79 A;  1WIK A;  1SYX A;  3LXZ A;  5ECH B;  4MAB A;  4IGJ A;  4DSS B;  1SK1 A;  2E2M A;  4NMU A;  5DAK A;  3HDC A;  1GUH A;  2GS3 A;  4PUR A;  1AQV A;  3TKS A;  3ZIT A;  3HXS A;  1K0O A;  5ECK B;  2DSA A;  1OE8 A;  5GAP D;  1YF1 A;  2I1U A;  1V58 A;  4IBP A;  3J7Y b;  4IKH A;  4N0Z A;  3L9S A;  4L8E A;  3UJ1 A;  1Y25 A;  4PUA A;  5GAN D;  4PNF A;  3IPZ A;  4BVX A;  4YQV A;  2XHF A;  1G7O A;  1M9B A;  5IM9 A;  3TOU A;  4EDZ A;  19GS A;  4MH3 A;  4PQI A;  1C72 A;  4AJ6 A;  2HRK A;  5J4U A;  3E9J B;  5JCU A;  4KW6 A;  1XVW A;  1XW6 A;  5IMA A;  1Q4J A;  3EIN A;  4JZQ A;  4HZ4 A;  2BTO T;  3GNJ A;  1YJ6 A;  3C1R A;  5F05 A;  5G30 A;  1FB6 A;  2XC2 A;  1DUG A;  1T8E B;  3P8W A;  4MPG A;  3M8N A;  3LWA A;  3WD6 A;  3QCP A;  2KP2 A;  5KN1 A;  4EVM A;  3P7X A;  1GWC A;  3VLN A;  1ACV A;  2FWG A;  5H5R A;  3APS A;  1MTC A;  2RII A;  2PU9 C;  2MBT A;  4G0L A;  2H1D A;  4E8E A;  2L6C A;  4F82 A;  2DIY A;  3QD9 A;  5IOW A;  5L71 A;  1H4O A;  4Q5N A;  5CRH A;  4NV2 A;  2O87 A;  4KA0 A;  1MD4 A;  3I6A A;  4KGI A;  5KEJ A;  3FR6 A;  1BX9 A;  3FR3 A;  4KF9 A;  2VAF A;  2GQM A;  3NOF A;  2YWN A;  4PQ1 A;  2PWJ A;  4POK A;  6GSS A;  4ZB6 A;  5AIS A;  1TI3 A;  2CQ9 A;  4MK3 A;  3EU3 A;  4JED A;  3I43 A;  1AXD A;  4IEL A;  1A0R P;  2B1K A;  2VCW A;  2B5E A;  3D22 A;  4LMW A;  2GZP A;  2MMN A;  1B4Q A;  1YF0 A;  4ZB9 A;  4MMM A;  3GTU B;  3D5J A;  2YP6 A;  4NXI A;  1EV4 A;  3M9K A;  4MA9 A;  3GSS A;  1TRU A;  3F6D A;  1NW2 A;  2M80 A;  2H8L A;  2H1G A;  4EE0 A;  5D93 A;  3UVT A;  1VF1 A;  1FW1 A;  1EGO A;  4GQF A;  1TK5 B;  2FWF A;  4I8B A;  2PN8 A;  4XS4 A;  5CNW A;  5DBQ A;  1ON4 A;  1ERU A;  2GZY A;  2C1Y A;  3EE2 A;  3VWW A;  1EP8 A;  3GL5 A;  4TW5 A;  3RAZ A;  20GS A;  2FA8 A;  1UVZ A;  1FHE A;  2J9H A;  5D8I A;  4MZW A;  1HQO A;  3Q18 A;  2LST A;  1B9Y C;  2FHE A;  2P5R A;  1GSD A;  3TRQ A;  1XIY A;  2H76 A;  3Q19 A;  2VLT A;  1OC9 A;  5AIX A;  3GH6 A;  3TKP A;  3TOT A;  1ABA A;  1N2A A;  1E2Y A;  2A2S A;  4ML1 A;  2C80 A;  4XS1 A;  1WWJ A;  1DBY A;  2JZS A;  1PKW A;  2PER A;  2HSH A;  1XXU A;  3QPM A;  1Z9H A;  4TR3 A;  1G7E A;  2JSY A;  1AW9 A;  2WCI A;  2RUE A;  2LTK A;  1ZL9 A;  2K18 A;  4KB3 A;  4TXO B;  4MF6 A;  3DML A;  2HXK A;  4RI7 A;  3S9F A;  3CSH A;  5KN0 A;  3HYP A;  2GQL A;  1M7T A;  5JWR B;  5A5K A;  3HVV A;  1U88 A;  3A2W A;  4G9H A;  4F9Z A;  4GSS A;  6GSY A;  1X5D A;  2I3Y A;  3D6I A;  3TJB A;  3KMO A;  2P5Q A;  1BED A;  1B48 A;  4X0X A;  4J57 E;  4MH2 A;  5DAL B;  2AV4 A;  3F3R A;  3WGD A;  2BMX A;  2HQT A;  5FWG A;  4XCS A;  4EUY A;  4KSO A;  2IFQ B;  3OR5 A;  2H66 A;  3ZYW A;  3QFB C;  3CTF A;  4KDU A;  3GHA A;  2LKU A;  4WR5 A;  1S3A A;  2QKE A;  1M0U A;  2GT6 A;  1MD3 A;  2IMI A;  1USB A;  4GXZ A;  4BVY A;  4PXO A;  3ME7 A;  3H1N A;  4IHU A;  4GWR A;  2YV9 A;  2V6K A;  8GSS A;  1GTU A;  1XWC A;  3VFI A;  3DRN A;  5EY6 A;  3PGT A;  1WP0 A;  3PIN A;  3TKR A;  3ZTL A;  4YQU A;  3RHC A;  2GST A;  5KN2 A;  4G0I A;  1VF3 A;  3G7J A;  1JLV A;  3ERG A;  4MDC A;  3TCO A;  1S3C A;  1PRX A;  3ZVJ A;  3H4K A;  4GCI A;  1O73 A;  3APO A;  1B4P A;  5B8A A;  1GNE A;  2L5O A;  3DIE A;  5H5S A;  1Y6E A;  4LMV A;  3EWL A;  2DIZ A;  4V2L A;  4YAP A;  5EPF A;  4XHM A;  3EC3 A;  5B7C A;  4OFT A;  3UAR A;  2B1L A;  2I4A A;  1TI1 A;  2XPE A;  4JRR A;  2DLX A;  1O8X A;  1X5C A;  3DD3 A;  2IWT A;  5IMC A;  4DVC A;  4V1A g;  2AAW A;  4N30 A;  1V2A A;  3KCM A;  4JU5 A;  1B9X C;  3KJY A;  1OVN A;  5LNK e;  2V2G A;  1TOF A;  4XRA A;  2JAC A;  2YCD A;  3LOR A;  2L4Q A;  4AGS A;  4KAE A;  3IHQ A;  1TKD B;  2NBS A;  1B8X A;  2KUC A;  5IPG A;  1XWK A;  4WBJ A;  3TGZ A;  3IAM 2;  4DEJ A;  3CTG A;  2F3M A;  1K0B A;  3LYK A;  2K8V A;  2REM A;  1J08 A;  3VK9 A;  1K3Y A;  3QAG A;  2GVP A;  2NDO A;  5COH A;  4GTU A;  2B5X A;  2FLS A;  2XBI A;  2CVD A;  2MZC A;  4BPY A;  1GNW A;  4ILF A;  5ECR B;  5ECM B;  1N8J A;  5CYY A;  4V1A p;  2HSN B;  2HRK B;  1WPI A;  2YPM A;  5DQS A;  5GST A;  3A5W A;  9GSS A;  3KD0 A;  2HZE A;  1A2L A;  4ZB8 A;  3CSI A;  2DBC A;  5HFG A;  1SKW B;  3WT2 A;  6GSW A;  5F07 A;  2K9F A;  3G9B A;  3KGK A;  2RM6 A;  2F8A A;  3DYR A;  4ACS A;  1TXX A;  1HNC A;  1EWX A;  3GFK A;  5DJM A;  3R3E A;  1R4W A;  2YOI A;  1GSE A;  2MMO A;  1PX6 A;  2C3T A;  2YJH A;  5G1K A;  1O8W A;  2AHE A;  2QSI A;  3DVX A;  2IMF A;  2WFC A;  5ENU A;  1K3L A;  5GSS A;  1X9S B;  3ME8 A;  2FWE A;  3FZ4 A;  1T4Z A;  4V2N A;  2X8C A;  4YQM A;  1X9W B;  1I5G A;  3JCM L;  4POB A;  5G31 A;  5D9T A;  6GSU A;  3TKS E;  1S3D A;  1EOG A;  1MDJ A;  2N5F A;  3RBT A;  4AF2 A;  2JU5 A;  2I9H A;  3IA1 A;  4F03 A;  2R4V A;  4G10 A;  1LU4 A;  2YAN A;  3ISO A;  2H01 A;  5G2Z A;  1QMV A;  1EEJ A;  1SD8 A;  3TKS C;  4BWQ A;  4JBB A;  2LRT A;  3CRT A;  2V6O A;  2DJK A;  1TRW A;  1Z7P A;  3QR6 A;  4D73 A;  4PGT A;  4TR4 A;  2VLV A;  4KDY A;  2H75 A;  5IO2 A;  1TK8 B;  4TR1 B;  2PMT A;  1G6W A;  4J56 E;  3LFL A;  2YV7 A;  3O6T A;  4X43 A;  3FEU A;  2WS2 A;  18GS A;  3GX8 A;  1M9A A;  2LNS A;  4PQH A;  5A4U A;  3ERW A;  3F9U A;  3HHV A;  4CW9 A;  2IN3 A;  1EV9 A;  1ZYE A;  4HS1 A;  3LQ7 A;  1GH2 A;  2OE3 A;  2WUL A;  3F63 A;  4MF7 A;  4GSN A;  4I5Q A;  4PX1 A;  3KEB A;  4OD7 A;  2IMK A;  1JZO A;  2WZ9 A;  1OC9 B;  4USS A;  5E4W A;  1DSB A;  3QDN A;  5J9B A;  3IOS A;  1DE2 A;  2V32 A;  5HR2 A;  4EKZ A;  2LV3 A;  4I2T A;  1WJK A;  1WOU A;  2X99 A;  4KSM A;  3SWL A;  1FAA A;  4ZBA A;  1G0T A;  1MEK A;  3GX0 A;  4JR6 A;  4HEA 2;  3PPU A;  2GT5 A;  4GST A;  2OBK A;  5BMU A;  2VL9 A;  4CDO A;  1ERT A;  3IAS 2;  1J9B A;  2YNX A;  3HCZ A;  3LJR A;  1FO5 A;  1PSQ A;  3IV4 A;  2GZZ A;  3GA4 A;  4KCA A;  4L5O A;  1A0F A;  3MNG A;  4CHS A;  3GUS A;  2E0Q A;  3QAV A;  3EUR A;  5D9W A;  4ECB A;  2RLI A;  2YJ7 A;  2FWH A;  1ZZY A;  3GKK A;  1PA3 A;  4NPB A;  3C1S A;  2HFD A;  3EVI A;  2YZU A;  1T00 A;  4DSR A;  2JZR A;  2WRT A;  4RQR A;  4BVY B;  4XTS A;  2H0I A;  4LL4 B;  1DE1 A;  3CXG A;  3KTL A;  1XZO A;  3L4N A;  2GTU A;  2H1B A;  2M46 A;  2IPA A;  3PR8 A;  4HUA A;  3MWH A;  4BL7 A;  4ZL7 A;  1K0N A;  4AJ8 A;  1XW5 A;  4HZ2 A;  1TP9 A;  2LRN A;  4WBR D;  3ZRE A;  3UIW A;  3FZ9 A;  1AAZ A;  1Z6N A;  1HNA A;  22GS A;  1FG4 A;  3HJM A;  5F8B A;  4ECI A;  1YKA A;  4NHW A;  2AJQ B;  1GUK A;  2I81 A;  2CA8 A;  4V2M A;  1THO A;  1W89 A;  2UZ8 A;  2Z9S A;  2P31 A;  4NV5 A;  3FZA A;  4MJC A;  2HE3 A;  2FUG 2;  1XWA A;  3M9J A;  11GS A;  1NM3 A;  1UN2 A;  1VGL A;  4HJ2 A;  1SKR B;  1KBN A;  2DJ3 A;  1A8Y A;  1XBS A;  5ECO B;  2VCT A;  4YH2 A;  2AYT A;  3DGQ A;  4I2U A;  2GQK A;  3KH7 A;  5G5E A;  2VL2 A;  1FB0 A;  2DJ0 A;  1SYR A;  1TRV A;  6GSV A;  5AN1 A;  4Q5R A;  4K7N A;  3F4R A;  2X64 A;  3GN3 A;  5CRD A;  2CT6 A;  2MMZ A;  2KLX A;  2H19 A;  1CQH A;  2AB6 A;  4AJ7 A;  2GSQ A;  2HSM B;  1OYJ A;  1PX7 A;  2X8G A;  4G19 A;  1EP7 A;  3VPT A;  4QL9 A;  1VF4 A;  1NSW A;  1EOH A;  1JLW A;  3A2V A;  1RW1 A;  2JL4 A;  4ML6 A;  5FT3 A;  3HJO A;  1M2A A;  3IXR A;  1V98 A;  2N5A A;  2YWM A;  1MDI A;  4HDE A;  1U3I A;  3M3M A;  1YEX A;  2MYG A;  2VCQ A;  3O76 A;  1WMJ A;  1X9M B;  5IIZ A;  1A24 A;  3M1G A;  2A2R A;  2DML A;  1ZOF A;  2FGX A;  4MZB A;  5F06 A;  2V41 A;  2HSY A;  5DVB A;  4X1U A;  3GKN A;  3L9V A;  2B6M A;  3BJ5 A;  1SJI A;  5A4V A;  3UVH A;  2HZE B;  3UOM A;  2L5L A;  5IMV A;  2CAQ A;  4LLR A;  1EEM A;  2LQQ A;  5DDL A;  1Z6M A;  5ECP B;  2GSR A;  2JSZ A;  2L4C A;  4RUV A;  1O81 A;  2H70 A;  5HR0 A;  2C3N A;  4ZL9 A;  2HRA A;  4ZBB A;  5HR3 A;  2HZF A;  4RQX A;  1SK0 A;  3GV1 A;  1V57 A;  5A4W A;  3F4T A;  5HFK A;  4PTS A;  5ID2 B;  2RUF A;  2D2Z A;  2VM2 A;  2L59 A;  2XBQ A;  1U87 A;  3QFA C;  3GTU A;  10GS A;  1X0R A;  4FIW A;  5CRG A;  4IQA A;  4MP4 A;  4F2I A;  3WT1 A;  2VCZ A;  1OKT A;  4LL1 B;  1GTB A;  4WEY A;  3C73 A;  4WR4 A;  3APQ A;  3Q74 A;  1SU9 A;  3P90 A;  2PVQ A;  1SK2 A;  3KZQ A;  4OO5 A;  1IYI A;  1EGR A;  2VCV A;  6GSX A;  1F9M A;  1T7P B;  3I69 A;  1PKZ A;  2HYX A;  2VD0 A;  5DAK B;  5EVO A;  1HYU A;  2KOK A;  2V1M A;  3BCI A;  1R26 A;  2VLU A;  3WGX A;  4XS6 A;  1BYE A;  2LQO A;  1A2J A;  5GZZ B;  5IMD A;  4JR4 A;  1AIU A;  2C4J A;  1JZD A;  3CSJ A;  3KP9 A;  2G2Q A;  5IOX A;  5JWO B;  1I9D A;  2GGT A;  3HZ4 A;  4E8H A;  1SJZ A;  4K8M A;  4GRF A;  5ECL B;  3FY7 A;  3ZMK A;  2O7K A;  2WB9 A;  4TXO A;  2O85 A;  4XRD A;  5HR1 A;  1URM A;  4BVX B;  5ECQ B;  4ZIL A;  2GLR A;  4IN0 A;  2HNL A;  16GS A;  4IS0 A;  1FVJ A;  3M0F A;  1XPV A;  1XVQ A;  2L57 A;  4ECJ A;  3FYG A;  4PNG A;  4GF0 A;  2MBS A;  5DAL A;  5B6M A;  3MAK A;  3HVX A;  4F0B A;  1FOV A;  3HKR A;  5ELA A;  4L0W A;  3ZFL A;  2WJU A;  3H93 A;  3LSZ A;  4N11 A;  1XCC A;  2HLS A;  3CBU A;  3G7Y A;  2HRF A;  4HU9 A;  2LNT A;  1GL8 A;  3GH9 A;  2OAD A;  3KP8 A;  1SJ6 A;  1QFN A;  5E59 A;  5CAX A;  5DJL A;  4OFN A;  1PL2 A;  5CO3 A;  5D9V A;  4EDY A;  4FYC A;  2ON5 A;  3MDK A;  3QAW A;  3L9U A;  3FRC A;  4OMV A;  3VI5 A;  2VCX A;  2N5B A;  2OAC A;  3GL3 A;  2RM5 A;  1IYH A;  1PMT A;  1A23 A;  2P0G A;  3RPP A;  1QXH A;  1ZYQ B;  3BOA A;  3C7M A;  2CZ2 A;  2E2G A;  3DXB A;  1GTA A;  4FO5 A;  4NHZ A;  3L78 A;  4KX4 A;  4P3Y B;  3UBL A;  3RDW A;  1F37 A;  2B5Y A;  2CZ3 A;  1AQX A;  3N9J A;  3UEM A;  1YDK A;  4NAX A;  3VWX A;  4WET A;  1SL0 B;  3ZIJ A;  3KMN A;  5C04 A;  2H6Y A;  4MJB A;  4BL7 B;  1W4V A;  2FCH A;  1AQW A;  3EU4 A;  3HVS A;  5HQP A;  1LJR A;  3ZFB A;  3ERF A;  3TKQ A;  2H74 A;  2NVL A;  3D4M A;  3V1W A;  3UMA A;  2DC5 A;  3HD5 A;  4KH7 A;  3W8J A;  1R5A A;  1AC1 A;  4OFM A;  3U5R E;  4XS4 B;  2LUS A;  3U6V A;  1YEP A;  5AGY A;  1GSF A;  1GSQ A;  2J23 A;  1R5P A;  2H71 A;  2FA4 A;  3US3 A;  4N0V A;  1OAZ A;  5DCG A;  5J3R A;  3ZL5 A;  4EO3 A;  5ELG A;  5D96 A;  4TVE A;  4OO4 A;  3GST A;  3TJJ A;  3QMX A;  1YZX A;  5IO0 A;  1TDI A;  5G5F A;  1BG5 A;  2LJA A;  5HFI A;  3D0Z A;  1VRS D;  5JCG A;  2VM1 A;  4LA1 A;  1GTI A;  3F6F A;  1BAY A;  4IQ1 A;  2OBI A;  5IMF A;  4HQZ A;  3UBK A;  4O32 A;  2CAI A;  5INY A;  1Z5Y E;  3KTB A;  1BQ7 A;  4O92 A;  2IJY A;  3HZ8 A;  4IJI A;  1QK8 A;  2O89 A;  4TXV A;  14GS A;  4G2E A;  4IW9 A;  1ILO A;  2DMM A;  4ECC A;  1Z7R A;  3DKS A;  2JAD A;  2F51 A;  1GSU A;  2M72 A;  3N5O A;  1G6Y A;  3LG6 A;  4YAV A;  4FH8 A;  1E6B A;  2VOC A;  2OA7 A;  5CRE A;  4TOP A;  4ZXG A;  3TJF A;  2OJL A;  3F3Q A;  2YWI A;  3IK9 A;  2HRN A;  3HA9 A;  3FW2 A;  4FQU A;  2VUP A;  3DVW A;  1A8L A;  2H1A A;  5B6N A;  3GKM A;  1K3O A;  1O7U A;  1GLP A;  3LGC A;  2IL3 A;  2CV4 A;  1UA5 A;  3ZZX A;  4KUN A;  3TB2 A;  1OE7 A;  1EZK A;  2H0G A;  1JZW A;  1PQN A;  4QL7 A;  3UAP A;  4MCU A;  1T4Y A;  3TJG A;  2R3X A;  2YWO A;  2C0E A;  1Q98 A;  2TRC P;  2H0H A;  2OE0 A;  4IVF A;  3W6G A;  12GS A;  4WF4 A;  4EL1 A;  4TR0 A;  3GUR A;  4F0C A;  2EIQ A;  2H6Z A;  6GST A;  3F4S A;  3ZRD A;  3CRU A;  4O5R A;  2LEG A;  3ZLP A;  1XWB A;  3CYN A;  1F6M C;  3GIX A;  5DCH A;  3Q6O A;  5CP1 A;  2HI7 A;  3IDV A;  3F0I A;  3ZML A;  4MPF A;  2LJK A;  3J7Y k;  3HJP A;  4J2F A;  3GKX A;  4EF0 A;  4OCE A;  1ZMA A;  2C0G A;  4MJA A;  4Q5Q A;  2XPD A;  5ECI B;  3NIV A;  1QUW A;  4DSS A;  2C8U A;  3A2X A;  3LYP A;  5ECS A;  3ZVJ D;  4TR1 A;  1TRS A;  2EC4 A;  3IC4 A;  3ZIV A;  1FVK A;  2K6V A;  1F2E A;  3C8E A;  5LD0 A;  4POM A;  2ZCT A;  2OKA A;  2B3S A;  2E7P A;  2VL2 C;  4N10 A;  3KM6 A;  4KDX A;  3GYK A;  1HNB A;  1YQ1 A;  3RHB A;  4HOJ A;  4I6X A;  3TRP A;  5LCZ A;  5IPH A;  5F0G A;  1O85 A;  3KIJ A;  2YZH A;  4EC0 A;  2LJR A;  3BBY A;  4WXT A;  4XIH A;  2CX3 A;  2ES7 A;  4JE1 A;  2L6D A;  3EMX A;  2VD1 A;  1XW9 A;  1K0D A;  2QC7 A;  4MF5 A;  3CMI A;  4Z7X A;  1Z3E A;  1AUC A;  1TU7 A;  5AIV A;  4L0U A;  3VWV A;  1SD9 A;  2FNO A;  4TRX A;  1YY7 A;  3IC8 A;  2R37 A;  3TUE A;  17GS A;  5IMZ A;  3IE3 A;  1JHB A;  1PL1 A;  4FYB A;  4K7I A;  4ZL8 A;  4HQS A;  1VF2 A;  1U6T A;  3VUR A;  1R7H A;  2WGR A;  3PH9 A;  1NHY A;  3WYW A;  4GLT A;  4BWS A;  3W8S A;  2QGV A;  5J9C A;  1GSY A;  2NTO A;  4ULX A;  2FD3 A;  2JZT A;  3F8U A;  4I97 A;  2WDU A;  4ZBD A;  5H5Q A;  1UC7 A;  4K0G A;  2MMA A;  2YN1 A;  2PGT A;  3D4T A;  3D21 A;  3ED3 A;  1M99 A;  4ZIJ A;  5DQY A;  4POL A;  2R2J A;  1GUL A;  4OCF A;  4TN8 A;  2KP1 A;  1PN9 A;  4FYU A;  1PD2 1;  2CVB A;  1KTE A;  2VL3 A;  3P2A A;  1GUM A;  2C0F A;  3KXO A;  1OC3 A;  4WKW A;  5IQY A;  3GMF A;  1V40 A;  4DSQ A;  4PUF C;  3GRX A;  3QOU A;  1KEB A;  3L0H A;  4HJM A;  5J5N A;  2C3Q A;  2TRX A;  3TDG A;  4K6X A;  2PVO C;  3VI7 A;  3SBC A;  2FY6 A;  1SEN A;  5JCW A;  2C0D A;  1GSS A;  1PGT A;  1THX A;  3FZ5 A;  3TJK A;  2H6X A;  2R6K A;  1RK4 A;  3IK7 A;  5ECN B;  2R5G A;  3HY2 A;  5D9X A;  3BD2 A;  4EXJ A;  2EIR A;  4KND A;  2HT9 A;  2B7J A;  2IMD A;  2IME A;  4K2D A;  1K0A A;  4G0K A;  1ERW A;  4IP1 A;  1TK0 B;  1GRX A;  4QQ7 A;  1O6J A;  4WF5 A;  1F3A A;  1WE0 A;  2VO4 A;  1ERV A;  2PUK C;  3EYT A;  4MJE A;  4O7H A;  4D73 B;  2ZUP A;  3FHK A;  3IR4 A;  3I9V 2;  2KHP A;  3C71 A;  2AUV A;  4KCE A;  1TU8 A;  4BA7 A;  2EIO A;  1T3B A;  1SL2 B;  3WGE A;  4IJ3 A;  1SL1 B;  4ISD A;  1GP1 A;  5C00 A;  5J41 A;  5KN3 A;  1F3B A;  2HSM A;  3E3E A;  3NZN A;  2DJ1 A;  3IBH A;  1SKS B;  1H75 A;  5B8B A;  3R2Q A;  3RPN A;  1A2M A;  4NWY A;  5EL8 A;  2K8S A;  1X5E A;  2ALB A;  5D73 A;  1T1V A;  2A4V A;  2H73 A;  3FK8 A;  1M2D A;  4H86 A;  1TW9 A;  2F9S A;  2PPT A;  3E0U A;  4K0N A;  1JFU A;  2IIY A;  2CX4 A;  2B7K A;  2BJX A;  3A3T A;  7GSS A;  1TTZ A;  1ZGN A;  4HU7 A;  2IFQ A;  4MLY A;  1ZCP A;  3G7I A;  3DWV A;  2X8H A;  4RI6 A;  3BCK A;  1J0F A;  3FKF A;  4K7O A;  3AY8 A;  2ZNM A;  3LXT A;  1K0M A;  1ST9 A;  5CRW A;  1NHO A;  3EMP A;  4Q5F A;  1XOA A;  13GS A;  4ID0 A;  2VIM A;  1QGV A;  1OC8 A;  2PBJ A;  1TJD A;  4HI7 A;  3IRA A;  3KH9 A;  1XWG A;  1JZR A;  3H8Q A;  1K0C A;  1RQM A;  2H72 A;  2GDR A;  1WRY A;  1MDK A;  2LS5 A;  2NPB A;  3VWU A;  2CVK A;  3VPQ A;  2DJ2 A;  1YKC A;  4OWY A;  1V9W A;  5ID2 A;  4KE3 A;  1XFL A;  2OE1 A;  2O8V B;  3MSZ A;  1BJX A;  3K8N A;  3FR9 A;  3DEX A;  3O3T A;  3UL3 A;  2TIR A;  4TKY A;  2G0F A;  4GQC A;  3TRX A;  4L5L A;  1ML6 A;  2GSS A;  1M2B A;  4MZC A;  5FHI A;  4IP6 A;  2DJJ A;  1QQ2 A;  1KNG A;  1GLQ A;  5G1L A;  1OKD A;  2LRC A; 
#chains in the Genus database with same CATH topology
 2H30 A;  1U3A A;  4K9Z A;  2WVX A;  4K1F A;  5JWQ B;  1LBK A;  1CQG A;  5ABR A;  1XOB A;  3LEF A;  2F8F A;  1HD2 A;  2ON7 A;  3H79 A;  1WIK A;  1SYX A;  3LXZ A;  5ECH B;  4MAB A;  4IGJ A;  4DSS B;  1SK1 A;  2E2M A;  4NMU A;  5DAK A;  3HDC A;  1GUH A;  2GS3 A;  2WVZ A;  4PUR A;  1AQV A;  3TKS A;  3ZIT A;  4YKG A;  5J40 A;  3HXS A;  1K0O A;  5ECK B;  2DSA A;  2A2P A;  1OE8 A;  5GAP D;  1YF1 A;  2I1U A;  1V58 A;  4IBP A;  3J7Y b;  4IKH A;  4N0Z A;  3L9S A;  4L8E A;  3UJ1 A;  1Y25 A;  4PUA A;  5GAN D;  4PNF A;  3IPZ A;  4BVX A;  4YQV A;  2XHF A;  1G7O A;  1M9B A;  2EFD A;  5IM9 A;  3TOU A;  4EDZ A;  19GS A;  4MH3 A;  4PQI A;  1M3J A;  1C72 A;  4AJ6 A;  2HRK A;  5J4U A;  3E9J B;  5JCU A;  4KW6 A;  1XVW A;  1XW6 A;  5IMA A;  1Q4J A;  3EIN A;  4JZQ A;  4HZ4 A;  2BTO T;  3GNJ A;  1YJ6 A;  3C1R A;  5F05 A;  5G30 A;  1FB6 A;  2XC2 A;  1DUG A;  1T8E B;  3P8W A;  4MPG A;  3M8N A;  3LWA A;  3WD6 A;  3QCP A;  2KP2 A;  5KN1 A;  4EVM A;  3FMW A;  3P7X A;  1GWC A;  3VLN A;  1ACV A;  2FWG A;  5H5R A;  3APS A;  1MTC A;  2RII A;  2PU9 C;  2MBT A;  4G0L A;  2H1D A;  4E8E A;  2L6C A;  4F82 A;  2DIY A;  3QD9 A;  3CHX C;  5IOW A;  5L71 A;  1H4O A;  2DKI A;  4Q5N A;  5CRH A;  4NV2 A;  2O87 A;  4KA0 A;  1MD4 A;  3I6A A;  4KGI A;  5KEJ A;  3FR6 A;  1BX9 A;  2X49 A;  3FR3 A;  4KF9 A;  2VAF A;  5KOW A;  1SVL A;  2WW3 A;  2GQM A;  3NOF A;  2YWN A;  4PQ1 A;  2DKH A;  2PWJ A;  4POK A;  6GSS A;  4ZB6 A;  5AIS A;  1TI3 A;  2CQ9 A;  4MK3 A;  3EU3 A;  4JED A;  3I43 A;  1AXD A;  4A5P A;  4IEL A;  1A0R P;  2B1K A;  2VCW A;  2B5E A;  3D22 A;  4LMW A;  2GZP A;  2MMN A;  1B4Q A;  3MIX A;  1YF0 A;  4ZB9 A;  4MMM A;  3GTU B;  3D5J A;  2YP6 A;  4NXI A;  1EV4 A;  3M9K A;  4MA9 A;  3GSS A;  1TRU A;  3F6D A;  1NW2 A;  2M80 A;  2H8L A;  2H1G A;  4EE0 A;  5D93 A;  3UVT A;  1VF1 A;  1FW1 A;  1EGO A;  4GQF A;  1TK5 B;  2FWF A;  4I8B A;  2PN8 A;  4XS4 A;  5CNW A;  5DBQ A;  3HMJ G;  1ON4 A;  1ERU A;  2GZY A;  2C1Y A;  3EE2 A;  3VWW A;  1EP8 A;  3GL5 A;  4TW5 A;  3RAZ A;  20GS A;  2FA8 A;  1UVZ A;  1FHE A;  2J9H A;  5D8I A;  4MZW A;  1HQO A;  3Q18 A;  2LST A;  1B9Y C;  2FHE A;  4CY6 A;  2P5R A;  1GSD A;  3TRQ A;  1XIY A;  2H76 A;  3Q19 A;  2VLT A;  1OC9 A;  5AIX A;  1FOH A;  3GH6 A;  3TKP A;  3TOT A;  2R0C A;  1ABA A;  1N2A A;  1E2Y A;  2A2S A;  4ML1 A;  2C80 A;  4XS1 A;  1WWJ A;  1DBY A;  2JZS A;  1PKW A;  2PER A;  2HSH A;  1XXU A;  3QPM A;  1Z9H A;  4TR3 A;  1G7E A;  2JSY A;  1AW9 A;  2WCI A;  5A1N B;  2RUE A;  2LTK A;  1ZL9 A;  2K18 A;  4KB3 A;  4TXO B;  4MF6 A;  3DML A;  2HXK A;  4RI7 A;  3S9F A;  3CSH A;  5KN0 A;  3HYP A;  2GQL A;  1M7T A;  5JWR B;  5A5K A;  3HVV A;  1U88 A;  3A2W A;  4G9H A;  4F9Z A;  4GSS A;  6GSY A;  1X5D A;  2I3Y A;  3D6I A;  3TJB A;  3KMO A;  2P5Q A;  1BED A;  1B48 A;  4X0X A;  4J57 E;  4MH2 A;  5DAL B;  2AV4 A;  3F3R A;  3WGD A;  2BMX A;  2HQT A;  5FWG A;  4XCS A;  4EUY A;  4KSO A;  2IFQ B;  3OR5 A;  2H66 A;  3ZYW A;  3QFB C;  3CTF A;  4KDU A;  3GHA A;  2LKU A;  4WR5 A;  1S3A A;  2QKE A;  1M0U A;  2GT6 A;  1MD3 A;  2IMI A;  1USB A;  4GXZ A;  4BVY A;  4PXO A;  3ME7 A;  3H1N A;  4IHU A;  4GWR A;  2YV9 A;  2V6K A;  8GSS A;  1GTU A;  1XWC A;  3VFI A;  3DRN A;  5BRT A;  5EY6 A;  3PGT A;  1WP0 A;  3PIN A;  3TKR A;  3ZTL A;  4YQU A;  3RHC A;  2GST A;  5KN2 A;  4G0I A;  1VF3 A;  3G7J A;  1JLV A;  3ERG A;  4MDC A;  3TCO A;  1S3C A;  1PRX A;  3ZVJ A;  3H4K A;  4EIQ A;  4GCI A;  1O73 A;  3APO A;  4K5S A;  1B4P A;  5B8A A;  1GNE A;  2L5O A;  3RGB C;  3DIE A;  5H5S A;  1Y6E A;  4LMV A;  3EWL A;  2DIZ A;  4V2L A;  2R0G A;  4YAP A;  5EPF A;  4XHM A;  3EC3 A;  5B7C A;  4OFT A;  3UAR A;  2B1L A;  2I4A A;  1TI1 A;  2XPE A;  4JRR A;  2DLX A;  1O8X A;  1X5C A;  3DD3 A;  2IWT A;  5IMC A;  4DVC A;  2R0P A;  4V1A g;  2AAW A;  4N30 A;  1V2A A;  3KCM A;  4JU5 A;  4G01 A;  1B9X C;  3KJY A;  1OVN A;  5LNK e;  4EIP A;  2V2G A;  1TOF A;  4XRA A;  2JAC A;  2YCD A;  3LOR A;  2L4Q A;  4AGS A;  4KAE A;  3IHQ A;  1TKD B;  2NBS A;  1B8X A;  2KUC A;  5IPG A;  1XWK A;  4WBJ A;  3TGZ A;  3IAM 2;  4DEJ A;  3CTG A;  2F3M A;  1K0B A;  3LYK A;  2K8V A;  2REM A;  1J08 A;  3VK9 A;  1BF5 A;  1K3Y A;  3QAG A;  2GVP A;  2NDO A;  5COH A;  4GTU A;  2B5X A;  2FLS A;  2XBI A;  2CVD A;  4E68 A;  2MZC A;  4BPY A;  1GNW A;  2EFC A;  4ILF A;  5ECR B;  5ECM B;  1N8J A;  5CYY A;  5A5H B;  4V1A p;  3MYD A;  2HSN B;  2HRK B;  1WPI A;  2WZS A;  2YPM A;  5DQS A;  5GST A;  3A5W A;  9GSS A;  3KD0 A;  2HZE A;  1A2L A;  4ZB8 A;  3CSI A;  2DBC A;  5HFG A;  3IHG A;  1SKW B;  3WT2 A;  6GSW A;  5F07 A;  2K9F A;  3G9B A;  3KGK A;  2RM6 A;  2F8A A;  3DYR A;  4ACS A;  1TXX A;  1HNC A;  1EWX A;  3GFK A;  5DJM A;  3R3E A;  1R4W A;  2YOI A;  1GSE A;  2MMO A;  1PX6 A;  2C3T A;  2YJH A;  5G1K A;  1O8W A;  2AHE A;  2QSI A;  3DVX A;  2IMF A;  4Z2U A;  2WFC A;  5ENU A;  1K3L A;  5GSS A;  1X9S B;  3ME8 A;  2FWE A;  3FZ4 A;  1T4Z A;  4V2N A;  2X8C A;  4YQM A;  1X9W B;  1I5G A;  3JCM L;  4POB A;  5G31 A;  5D9T A;  6GSU A;  3TKS E;  1S3D A;  1EOG A;  1MDJ A;  4HSC X;  1S4B P;  2N5F A;  3RBT A;  4AF2 A;  2JU5 A;  2I9H A;  3IA1 A;  4F03 A;  2R4V A;  4G10 A;  1LU4 A;  5A34 B;  2YAN A;  3ISO A;  2H01 A;  5G2Z A;  1QMV A;  1EEJ A;  1SD8 A;  3TKS C;  4BWQ A;  4JBB A;  2LRT A;  1ZYP A;  3CRT A;  2V6O A;  2DJK A;  1TRW A;  2O36 A;  1Z7P A;  3QR6 A;  4D73 A;  4PGT A;  4TR4 A;  2VLV A;  4KDY A;  2H75 A;  5IO2 A;  1SVO A;  1TK8 B;  4TR1 B;  2PMT A;  1G6W A;  4J56 E;  3LFL A;  2YV7 A;  3O6T A;  4X43 A;  3FEU A;  2WS2 A;  18GS A;  3GX8 A;  1M9A A;  2LNS A;  4PQH A;  5A4U A;  3ERW A;  3F9U A;  3TU3 B;  3HHV A;  4CW9 A;  2IN3 A;  1EV9 A;  1ZYE A;  3LQ7 A;  2WUL A;  1GH2 A;  2OE3 A;  4HS1 A;  3HVN A;  3F63 A;  4MF7 A;  4GSN A;  4I5Q A;  4PX1 A;  3KEB A;  4OD7 A;  2IMK A;  1JZO A;  2WZ9 A;  1OC9 B;  4W66 A;  4USS A;  5E4W A;  1DSB A;  3QDN A;  5J9B A;  3IOS A;  1DE2 A;  2V32 A;  5HR2 A;  4EKZ A;  2LV3 A;  4I2T A;  1WJK A;  1WOU A;  2X99 A;  4KSM A;  3SWL A;  1FAA A;  4ZBA A;  1G0T A;  1MEK A;  3GX0 A;  4JR6 A;  4HEA 2;  3PPU A;  2GT5 A;  4GST A;  2OBK A;  5BMU A;  2VL9 A;  4CDO A;  2EFE A;  1ERT A;  3IAS 2;  1J9B A;  2YNX A;  3HCZ A;  3LJR A;  1FO5 A;  1PSQ A;  3IV4 A;  2GZZ A;  3GA4 A;  4KCA A;  4L5O A;  1A0F A;  3MNG A;  4CHS A;  3GUS A;  2E0Q A;  3LW9 A;  3QAV A;  3EUR A;  5D9W A;  4ECB A;  2RLI A;  2YJ7 A;  4ZB7 A;  2FWH A;  1ZZY A;  3GKK A;  1PA3 A;  1M3I A;  4NPB A;  3C1S A;  2HFD A;  3EVI A;  2YZU A;  2WVY A;  1T00 A;  4DSR A;  2JZR A;  2WRT A;  4RQR A;  4BVY B;  4XTS A;  2H0I A;  4LL4 B;  1DE1 A;  3CXG A;  3KTL A;  1XZO A;  3L4N A;  2GTU A;  2H1B A;  2M46 A;  2IPA A;  3PR8 A;  2VKZ G;  4HUA A;  3MWH A;  4BL7 A;  4ZL7 A;  1K0N A;  4AJ8 A;  1XW5 A;  2UV8 G;  4HZ2 A;  1TP9 A;  2LRN A;  4WBR D;  3ZRE A;  3UIW A;  3FZ9 A;  1AAZ A;  1Z6N A;  1HNA A;  22GS A;  1FG4 A;  3HJM A;  5F8B A;  4ECI A;  1YKA A;  4NHW A;  2AJQ B;  1GUK A;  2I81 A;  2CA8 A;  4V2M A;  1THO A;  1W89 A;  2UZ8 A;  2Z9S A;  2P31 A;  4NV5 A;  3FZA A;  4MJC A;  2HE3 A;  2FUG 2;  1XWA A;  11GS A;  1NM3 A;  1UN2 A;  3M9J A;  1VGL A;  4HJ2 A;  1SKR B;  1KBN A;  2DJ3 A;  1A8Y A;  1XBS A;  5ECO B;  2VCT A;  4AI6 A;  4YH2 A;  2AYT A;  3DGQ A;  4I2U A;  2GQK A;  3KH7 A;  4YKF A;  2QA2 A;  5G5E A;  2VL2 A;  1FB0 A;  2DJ0 A;  1SYR A;  1TRV A;  6GSV A;  5AN1 A;  4Q5R A;  4K7N A;  3F4R A;  2X64 A;  3GN3 A;  5CRD A;  2CT6 A;  2MMZ A;  2KLX A;  2H19 A;  1CQH A;  2AB6 A;  4AJ7 A;  2GSQ A;  2HSM B;  1OYJ A;  1PX7 A;  2X8G A;  4G19 A;  1EP7 A;  3VPT A;  4QL9 A;  1VF4 A;  1NSW A;  1EOH A;  1JLW A;  3A2V A;  1RW1 A;  2JL4 A;  4ML6 A;  5FT3 A;  3HJO A;  1M2A A;  3IXR A;  3A5I A;  1V98 A;  2N5A A;  2YWM A;  1YEW C;  1MDI A;  4HDE A;  1U3I A;  3M3M A;  1YEX A;  2MYG A;  2VCQ A;  3O76 A;  1WMJ A;  1X9M B;  5IIZ A;  1A24 A;  3M1G A;  2A2R A;  2DML A;  1ZOF A;  2FGX A;  4MZB A;  5F06 A;  2V41 A;  2HSY A;  5DVB A;  4X1U A;  3GKN A;  3L9V A;  2B6M A;  3BJ5 A;  1SJI A;  5A4V A;  3UVH A;  2HZE B;  3UOM A;  2L5L A;  5IMV A;  2CAQ A;  4LLR A;  1EEM A;  2LQQ A;  5DDL A;  1Z6M A;  5ECP B;  2GSR A;  2JSZ A;  2L4C A;  4RUV A;  1O81 A;  2H70 A;  5HR0 A;  2C3N A;  4ZL9 A;  2HRA A;  4K5R A;  4ZBB A;  5HR3 A;  2HZF A;  4RQX A;  1SK0 A;  3GV1 A;  1V57 A;  5A4W A;  3F4T A;  5HFK A;  4QMK A;  4PTS A;  5ID2 B;  2RUF A;  2D2Z A;  2VM2 A;  2L59 A;  2XBQ A;  1U87 A;  3QFA C;  2X4A A;  3GTU A;  10GS A;  1X0R A;  4FIW A;  5CRG A;  4IQA A;  4MP4 A;  4F2I A;  3WT1 A;  2VCZ A;  1OKT A;  4LL1 B;  1GTB A;  4WEY A;  3C73 A;  4WR4 A;  3APQ A;  3Q74 A;  1SU9 A;  2WVX B;  3P90 A;  2PVQ A;  1SK2 A;  3KZQ A;  4OO5 A;  1IYI A;  1EGR A;  2VCV A;  6GSX A;  1F9M A;  1T7P B;  3I69 A;  1PKZ A;  2HYX A;  2VD0 A;  5DAK B;  5EVO A;  1HYU A;  4ICY A;  2KOK A;  2V1M A;  3BCI A;  1R26 A;  2VLU A;  3WGX A;  4XS6 A;  1BYE A;  2LQO A;  1A2J A;  5GZZ B;  5IMD A;  4JR4 A;  1AIU A;  2C4J A;  1JZD A;  3CSJ A;  3KP9 A;  2G2Q A;  5IOX A;  4X4J A;  5JWO B;  1I9D A;  2GGT A;  3HZ4 A;  4E8H A;  1SJZ A;  4K8M A;  5J4V A;  4GRF A;  5ECL B;  3FY7 A;  3ZMK A;  2O7K A;  2WB9 A;  4TXO A;  2O85 A;  4XRD A;  5HR1 A;  1URM A;  4BVX B;  5ECQ B;  4ZIL A;  2GLR A;  4IN0 A;  2HNL A;  16GS A;  4IS0 A;  4AKX B;  1FVJ A;  3M0F A;  1XPV A;  1XVQ A;  2L57 A;  4ECJ A;  3FYG A;  4PNG A;  4GF0 A;  2MBS A;  5DAL A;  5B6M A;  3MAK A;  4N3Z A;  3HVX A;  4F0B A;  1FOV A;  3HKR A;  5ELA A;  4L0W A;  1BG1 A;  3ZFL A;  2WJU A;  3H93 A;  3LSZ A;  5BMU B;  4N11 A;  1XCC A;  2HLS A;  3CBU A;  3G7Y A;  2HRF A;  4HU9 A;  2LNT A;  1GL8 A;  3GH9 A;  2OAD A;  3KP8 A;  1SJ6 A;  1QFN A;  5E59 A;  5CAX A;  5DJL A;  4OFN A;  1PL2 A;  5CO3 A;  5D9V A;  4EDY A;  4FYC A;  2ON5 A;  3MDK A;  3QAW A;  3L9U A;  3FRC A;  4OMV A;  3VI5 A;  2VCX A;  2N5B A;  2OAC A;  3GL3 A;  2RM5 A;  1IYH A;  4K2X A;  1PMT A;  1A23 A;  2P0G A;  3RPP A;  1QXH A;  1ZYQ B;  3BOA A;  4PI0 C;  3C7M A;  4AKH A;  2CZ2 A;  2E2G A;  3DXB A;  1GTA A;  4FO5 A;  4NHZ A;  3L78 A;  4KX4 A;  4P3Y B;  3UBL A;  3RDW A;  4AKG A;  1F37 A;  2B5Y A;  2CZ3 A;  1AQX A;  3N9J A;  3UEM A;  1YDK A;  4NAX A;  3VWX A;  4WET A;  1SL0 B;  3ZIJ A;  3KMN A;  5C04 A;  2H6Y A;  4MJB A;  4BL7 B;  1W4V A;  2FCH A;  1AQW A;  3EU4 A;  3HVS A;  5HQP A;  1LJR A;  3ZFB A;  3ERF A;  3TKQ A;  2H74 A;  2NVL A;  3D4M A;  3V1W A;  3UMA A;  2DC5 A;  3HD5 A;  4KH7 A;  2QA1 A;  3W8J A;  1R5A A;  1AC1 A;  4OFM A;  3U5R E;  4XS4 B;  2LUS A;  3U6V A;  1YEP A;  5AGY A;  1GSF A;  1GSQ A;  2J23 A;  2OT3 A;  1R5P A;  2H71 A;  2FA4 A;  3US3 A;  4N0V A;  1OAZ A;  5DCG A;  5J3R A;  3ZL5 A;  4EO3 A;  5ELG A;  5D96 A;  4TVE A;  4OO4 A;  1YVL A;  3GST A;  3TJJ A;  3QMX A;  1YZX A;  5IO0 A;  1TDI A;  5G5F A;  1BG5 A;  2LJA A;  5HFI A;  3D0Z A;  1VRS D;  5JCG A;  2VM1 A;  4LA1 A;  1GTI A;  3F6F A;  1BAY A;  4IQ1 A;  2OBI A;  5KOX A;  5IMF A;  4HQZ A;  3UBK A;  4O32 A;  2CAI A;  5INY A;  1Z5Y E;  3KTB A;  1BQ7 A;  5A5H A;  4O92 A;  2IJY A;  2HSN A;  3HZ8 A;  4IJI A;  1QK8 A;  1XG8 A;  2O89 A;  4TXV A;  14GS A;  4G2E A;  4IW9 A;  1ILO A;  4Z2R A;  2DMM A;  4ECC A;  1Z7R A;  3DKS A;  2JAD A;  2F51 A;  1GSU A;  2M72 A;  3N5O A;  1G6Y A;  3LG6 A;  4YAV A;  4FH8 A;  1E6B A;  2VOC A;  2OA7 A;  5CRE A;  4TOP A;  4ZXG A;  3TJF A;  2OJL A;  3F3Q A;  2YWI A;  3IK9 A;  2HRN A;  3HA9 A;  3FW2 A;  4FQU A;  2VUP A;  3DVW A;  1A8L A;  2H1A A;  1SVM A;  5B6N A;  3GKM A;  1K3O A;  1O7U A;  1GLP A;  3LGC A;  4BIK A;  2IL3 A;  2CV4 A;  1UA5 A;  3ZZX A;  4KUN A;  3TB2 A;  1OE7 A;  1EZK A;  2H0G A;  1JZW A;  1PQN A;  4QL7 A;  3UAP A;  4MCU A;  1T4Y A;  3TJG A;  2R3X A;  4FXY P;  3EPT A;  2YWO A;  2C0E A;  1Q98 A;  2TRC P;  2H0H A;  2OE0 A;  4IVF A;  3W6G A;  12GS A;  5J47 A;  2O5V A;  4WF4 A;  4EL1 A;  4TR0 A;  3GUR A;  4F0C A;  2EIQ A;  2H6Z A;  6GST A;  3F4S A;  3ZRD A;  3CRU A;  4O5R A;  2LEG A;  3ZLP A;  1XWB A;  3CYN A;  1F6M C;  3GIX A;  5DCH A;  3Q6O A;  5CP1 A;  2HI7 A;  3IDV A;  5A34 A;  3F0I A;  3ZML A;  4MPF A;  2LJK A;  3J7Y k;  3HJP A;  4J2F A;  3GKX A;  4EF0 A;  4OCE A;  1ZMA A;  2C0G A;  4MJA A;  4Q5Q A;  2XPD A;  5ECI B;  3NIV A;  1QUW A;  4DSS A;  2C8U A;  3A2X A;  3LYP A;  5ECS A;  3ZVJ D;  4TR1 A;  1TRS A;  2EC4 A;  3IC4 A;  3ZIV A;  1FVK A;  2K6V A;  1F2E A;  3C8E A;  5LD0 A;  4POM A;  2ZCT A;  1S3R A;  2OKA A;  2B3S A;  2E7P A;  2VL2 C;  4N10 A;  3KM6 A;  4KDX A;  3GYK A;  1HNB A;  1YQ1 A;  3RHB A;  4HOJ A;  4I6X A;  3TRP A;  5LCZ A;  5IPH A;  5F0G A;  1O85 A;  3KIJ A;  2YZH A;  4EC0 A;  2LJR A;  3BBY A;  4WXT A;  4XIH A;  2CX3 A;  2ES7 A;  4JE1 A;  4PHZ C;  2L6D A;  1N25 A;  3EMX A;  2VD1 A;  1XW9 A;  1K0D A;  2QC7 A;  4MF5 A;  3CMI A;  4Z7X A;  1Z3E A;  1AUC A;  1TU7 A;  5AIV A;  4L0U A;  3VWV A;  1SD9 A;  2FNO A;  4TRX A;  1YY7 A;  2O3E A;  3IC8 A;  2R37 A;  3TUE A;  17GS A;  5IMZ A;  3RFR C;  3IE3 A;  1JHB A;  1PL1 A;  4FYB A;  4K7I A;  4ZL8 A;  1PN0 A;  4HQS A;  1VF2 A;  1U6T A;  3VUR A;  1R7H A;  2WGR A;  2EFH A;  3PH9 A;  1NHY A;  3WYW A;  4GLT A;  4BWS A;  3W8S A;  1ZYN A;  2QGV A;  5J9C A;  1GSY A;  2NTO A;  4ULX A;  2FD3 A;  2JZT A;  4AKI A;  3F8U A;  4I97 A;  2WDU A;  4ZBD A;  5H5Q A;  1UC7 A;  4K0G A;  2MMA A;  2YN1 A;  2PGT A;  3D4T A;  3D21 A;  3ED3 A;  1M99 A;  4ZIJ A;  4O5Q A;  5DQY A;  4POL A;  2R2J A;  1GUL A;  4CY8 A;  4OCF A;  4TN8 A;  2KP1 A;  1PN9 A;  4FYU A;  1PD2 1;  2CVB A;  1KTE A;  2VL3 A;  3P2A A;  1GUM A;  2C0F A;  3KXO A;  1OC3 A;  4WKW A;  5IQY A;  3GMF A;  1V40 A;  4DSQ A;  4PUF C;  3GRX A;  1I1I P;  3QOU A;  1KEB A;  2A4H A;  3L0H A;  4HJM A;  5J5N A;  2C3Q A;  2TRX A;  3TDG A;  4K6X A;  2PVO C;  3VI7 A;  3SBC A;  2FY6 A;  1SEN A;  5JCW A;  2C0D A;  1GSS A;  1PGT A;  1THX A;  3FZ5 A;  3TJK A;  2H6X A;  2R6K A;  1RK4 A;  3IK7 A;  5ECN B;  2R5G A;  3HY2 A;  5D9X A;  3BD2 A;  4MNN A;  4EXJ A;  2EIR A;  4KND A;  5J4Y A;  2HT9 A;  2B7J A;  2IMD A;  2IME A;  4K2D A;  3CQF A;  1K0A A;  4G0K A;  1ERW A;  4IP1 A;  1TK0 B;  1GRX A;  4QQ7 A;  1O6J A;  4WF5 A;  1F3A A;  1WE0 A;  2VO4 A;  4PI2 C;  1ERV A;  2PUK C;  3EYT A;  4MJE A;  4O7H A;  4D73 B;  2ZUP A;  3FHK A;  3IR4 A;  3I9V 2;  2KHP A;  3C71 A;  2AUV A;  4KCE A;  1TU8 A;  4BA7 A;  2EIO A;  1T3B A;  3CWG A;  5A1N A;  3WGE A;  1SL2 B;  4IJ3 A;  1SL1 B;  4GDF A;  4ISD A;  1GP1 A;  5C00 A;  5J41 A;  1Y1U A;  5KN3 A;  1F3B A;  2HSM A;  3E3E A;  3NZN A;  2DJ1 A;  3IBH A;  1SKS B;  1H75 A;  5B8B A;  3R2Q A;  3RPN A;  1A2M A;  4NWY A;  5EL8 A;  2K8S A;  1X5E A;  2ALB A;  5D73 A;  1T1V A;  1TXU A;  2A4V A;  2H73 A;  3FK8 A;  1M2D A;  4H86 A;  1TW9 A;  2F9S A;  2PPT A;  3E0U A;  4K0N A;  1JFU A;  2IIY A;  2CX4 A;  2WW2 A;  2B7K A;  2WW0 A;  2BJX A;  3A3T A;  7GSS A;  1TTZ A;  1ZGN A;  4HU7 A;  2IFQ A;  4MLY A;  4O5U A;  1ZCP A;  3G7I A;  3DWV A;  2X8H A;  4RI6 A;  3BCK A;  1J0F A;  3FKF A;  4K7O A;  3AY8 A;  2ZNM A;  3LXT A;  1K0M A;  1PFO A;  1ST9 A;  5CRW A;  1NHO A;  4Z2T A;  3EMP A;  4Q5F A;  1XOA A;  13GS A;  4ID0 A;  2VIM A;  1QGV A;  1OC8 A;  2PBJ A;  1TJD A;  4HI7 A;  3IRA A;  3KH9 A;  1XWG A;  1JZR A;  3H8Q A;  1K0C A;  1RQM A;  2H72 A;  2GDR A;  1WRY A;  2WW1 A;  1MDK A;  2LS5 A;  2NPB A;  3VWU A;  2CVK A;  3VPQ A;  2DJ2 A;  1YKC A;  4OWY A;  1V9W A;  5ID2 A;  2H1L A;  4KE3 A;  1XFL A;  2OE1 A;  2O8V B;  3MSZ A;  1BJX A;  3K8N A;  3FR9 A;  3DEX A;  3O3T A;  3UL3 A;  2TIR A;  4TKY A;  2G0F A;  4GQC A;  3TRX A;  4L5L A;  1ML6 A;  2GSS A;  1M2B A;  4MZC A;  5FHI A;  4IP6 A;  2DJJ A;  1QQ2 A;  1KNG A;  1GLQ A;  5G1L A;  1OKD A;  2LRC A; 
#chains in the Genus database with same CATH homology
 2H30 A;  1U3A A;  4K9Z A;  4K1F A;  5JWQ B;  1LBK A;  1CQG A;  5ABR A;  1XOB A;  3LEF A;  2F8F A;  1HD2 A;  2ON7 A;  3H79 A;  1WIK A;  1SYX A;  3LXZ A;  5ECH B;  4MAB A;  4IGJ A;  4DSS B;  1SK1 A;  2E2M A;  4NMU A;  5DAK A;  3HDC A;  1GUH A;  2GS3 A;  4PUR A;  1AQV A;  3TKS A;  3ZIT A;  4YKG A;  5J40 A;  3HXS A;  1K0O A;  5ECK B;  2DSA A;  2A2P A;  1OE8 A;  5GAP D;  1YF1 A;  2I1U A;  1V58 A;  4IBP A;  3J7Y b;  4IKH A;  4N0Z A;  3L9S A;  4L8E A;  3UJ1 A;  1Y25 A;  4PUA A;  5GAN D;  4PNF A;  3IPZ A;  4BVX A;  4YQV A;  2XHF A;  1G7O A;  1M9B A;  2EFD A;  5IM9 A;  3TOU A;  4EDZ A;  19GS A;  4MH3 A;  4PQI A;  1C72 A;  4AJ6 A;  2HRK A;  5J4U A;  3E9J B;  5JCU A;  4KW6 A;  1XVW A;  1XW6 A;  5IMA A;  1Q4J A;  3EIN A;  4JZQ A;  4HZ4 A;  2BTO T;  3GNJ A;  1YJ6 A;  3C1R A;  5F05 A;  5G30 A;  1FB6 A;  2XC2 A;  1DUG A;  1T8E B;  3P8W A;  4MPG A;  3M8N A;  3LWA A;  3WD6 A;  3QCP A;  2KP2 A;  5KN1 A;  4EVM A;  3FMW A;  3P7X A;  1GWC A;  3VLN A;  1ACV A;  2FWG A;  5H5R A;  3APS A;  1MTC A;  2RII A;  2PU9 C;  2MBT A;  4G0L A;  2H1D A;  4E8E A;  2L6C A;  4F82 A;  2DIY A;  3QD9 A;  5IOW A;  5L71 A;  1H4O A;  2DKI A;  4Q5N A;  5CRH A;  4NV2 A;  2O87 A;  4KA0 A;  1MD4 A;  3I6A A;  4KGI A;  5KEJ A;  3FR6 A;  1BX9 A;  2X49 A;  3FR3 A;  4KF9 A;  2VAF A;  5KOW A;  1SVL A;  2GQM A;  3NOF A;  2YWN A;  4PQ1 A;  2DKH A;  2PWJ A;  4POK A;  6GSS A;  4ZB6 A;  5AIS A;  1TI3 A;  2CQ9 A;  4MK3 A;  3EU3 A;  4JED A;  3I43 A;  1AXD A;  4A5P A;  4IEL A;  1A0R P;  2B1K A;  2VCW A;  2B5E A;  3D22 A;  4LMW A;  2GZP A;  2MMN A;  1B4Q A;  3MIX A;  1YF0 A;  4ZB9 A;  4MMM A;  3GTU B;  3D5J A;  2YP6 A;  4NXI A;  1EV4 A;  3M9K A;  4MA9 A;  3GSS A;  1TRU A;  3F6D A;  1NW2 A;  2M80 A;  2H8L A;  2H1G A;  4EE0 A;  5D93 A;  3UVT A;  1VF1 A;  1FW1 A;  1EGO A;  4GQF A;  1TK5 B;  2FWF A;  4I8B A;  2PN8 A;  4XS4 A;  5CNW A;  5DBQ A;  3HMJ G;  1ON4 A;  1ERU A;  2GZY A;  2C1Y A;  3EE2 A;  3VWW A;  1EP8 A;  3GL5 A;  4TW5 A;  3RAZ A;  20GS A;  2FA8 A;  1UVZ A;  1FHE A;  2J9H A;  5D8I A;  4MZW A;  1HQO A;  3Q18 A;  2LST A;  1B9Y C;  2FHE A;  4CY6 A;  2P5R A;  1GSD A;  3TRQ A;  1XIY A;  2H76 A;  3Q19 A;  2VLT A;  1OC9 A;  5AIX A;  1FOH A;  3GH6 A;  3TKP A;  3TOT A;  2R0C A;  1ABA A;  1N2A A;  1E2Y A;  2A2S A;  4ML1 A;  2C80 A;  4XS1 A;  1WWJ A;  1DBY A;  2JZS A;  1PKW A;  2PER A;  2HSH A;  1XXU A;  3QPM A;  1Z9H A;  4TR3 A;  1G7E A;  2JSY A;  1AW9 A;  2WCI A;  5A1N B;  2RUE A;  2LTK A;  1ZL9 A;  2K18 A;  4KB3 A;  4TXO B;  4MF6 A;  3DML A;  2HXK A;  4RI7 A;  3S9F A;  3CSH A;  5KN0 A;  3HYP A;  2GQL A;  1M7T A;  5JWR B;  5A5K A;  3HVV A;  1U88 A;  3A2W A;  4G9H A;  4F9Z A;  4GSS A;  6GSY A;  1X5D A;  2I3Y A;  3D6I A;  3TJB A;  3KMO A;  2P5Q A;  1BED A;  1B48 A;  4X0X A;  4J57 E;  4MH2 A;  5DAL B;  2AV4 A;  3F3R A;  3WGD A;  2BMX A;  2HQT A;  5FWG A;  4XCS A;  4EUY A;  4KSO A;  2IFQ B;  3OR5 A;  2H66 A;  3ZYW A;  3QFB C;  3CTF A;  4KDU A;  3GHA A;  2LKU A;  4WR5 A;  1S3A A;  2QKE A;  1M0U A;  2GT6 A;  1MD3 A;  2IMI A;  1USB A;  4GXZ A;  4BVY A;  4PXO A;  3ME7 A;  3H1N A;  4IHU A;  4GWR A;  2YV9 A;  2V6K A;  8GSS A;  1GTU A;  1XWC A;  3VFI A;  3DRN A;  5BRT A;  5EY6 A;  3PGT A;  1WP0 A;  3PIN A;  3TKR A;  3ZTL A;  4YQU A;  3RHC A;  2GST A;  5KN2 A;  4G0I A;  1VF3 A;  3G7J A;  1JLV A;  3ERG A;  4MDC A;  3TCO A;  1S3C A;  1PRX A;  3ZVJ A;  3H4K A;  4EIQ A;  4GCI A;  1O73 A;  3APO A;  4K5S A;  1B4P A;  5B8A A;  1GNE A;  2L5O A;  3DIE A;  5H5S A;  1Y6E A;  4LMV A;  3EWL A;  2DIZ A;  4V2L A;  2R0G A;  4YAP A;  5EPF A;  4XHM A;  3EC3 A;  5B7C A;  4OFT A;  3UAR A;  2B1L A;  2I4A A;  1TI1 A;  2XPE A;  4JRR A;  2DLX A;  1O8X A;  1X5C A;  3DD3 A;  2IWT A;  5IMC A;  4DVC A;  2R0P A;  4V1A g;  2AAW A;  4N30 A;  1V2A A;  3KCM A;  4JU5 A;  4G01 A;  1B9X C;  3KJY A;  1OVN A;  5LNK e;  4EIP A;  2V2G A;  1TOF A;  4XRA A;  2JAC A;  2YCD A;  3LOR A;  2L4Q A;  4AGS A;  4KAE A;  3IHQ A;  1TKD B;  2NBS A;  1B8X A;  2KUC A;  5IPG A;  1XWK A;  4WBJ A;  3TGZ A;  3IAM 2;  4DEJ A;  3CTG A;  2F3M A;  1K0B A;  3LYK A;  2K8V A;  2REM A;  1J08 A;  3VK9 A;  1BF5 A;  1K3Y A;  3QAG A;  2GVP A;  2NDO A;  5COH A;  4GTU A;  2B5X A;  2FLS A;  2XBI A;  2CVD A;  4E68 A;  2MZC A;  4BPY A;  1GNW A;  2EFC A;  4ILF A;  5ECR B;  5ECM B;  1N8J A;  5CYY A;  5A5H B;  4V1A p;  3MYD A;  2HSN B;  2HRK B;  1WPI A;  2YPM A;  5DQS A;  5GST A;  3A5W A;  9GSS A;  3KD0 A;  2HZE A;  1A2L A;  4ZB8 A;  3CSI A;  2DBC A;  5HFG A;  3IHG A;  1SKW B;  3WT2 A;  6GSW A;  5F07 A;  2K9F A;  3G9B A;  3KGK A;  2RM6 A;  2F8A A;  3DYR A;  4ACS A;  1TXX A;  1HNC A;  1EWX A;  3GFK A;  5DJM A;  3R3E A;  1R4W A;  2YOI A;  1GSE A;  2MMO A;  1PX6 A;  2C3T A;  2YJH A;  5G1K A;  1O8W A;  2AHE A;  2QSI A;  3DVX A;  2IMF A;  4Z2U A;  2WFC A;  5ENU A;  1K3L A;  5GSS A;  1X9S B;  3ME8 A;  2FWE A;  3FZ4 A;  1T4Z A;  4V2N A;  2X8C A;  4YQM A;  1X9W B;  1I5G A;  3JCM L;  4POB A;  5G31 A;  5D9T A;  6GSU A;  3TKS E;  1S3D A;  1EOG A;  1MDJ A;  2N5F A;  3RBT A;  4AF2 A;  2JU5 A;  2I9H A;  3IA1 A;  4F03 A;  2R4V A;  4G10 A;  1LU4 A;  5A34 B;  2YAN A;  3ISO A;  2H01 A;  5G2Z A;  1QMV A;  1EEJ A;  1SD8 A;  3TKS C;  4BWQ A;  4JBB A;  2LRT A;  1ZYP A;  3CRT A;  2V6O A;  2DJK A;  1TRW A;  1Z7P A;  3QR6 A;  4D73 A;  4PGT A;  4TR4 A;  2VLV A;  4KDY A;  2H75 A;  5IO2 A;  1SVO A;  1TK8 B;  4TR1 B;  2PMT A;  1G6W A;  4J56 E;  3LFL A;  2YV7 A;  3O6T A;  4X43 A;  3FEU A;  2WS2 A;  18GS A;  3GX8 A;  1M9A A;  2LNS A;  4PQH A;  5A4U A;  3ERW A;  3F9U A;  3TU3 B;  3HHV A;  4CW9 A;  2IN3 A;  1EV9 A;  1ZYE A;  3LQ7 A;  2WUL A;  1GH2 A;  2OE3 A;  4HS1 A;  3F63 A;  4MF7 A;  4GSN A;  4I5Q A;  4PX1 A;  3KEB A;  4OD7 A;  2IMK A;  1JZO A;  2WZ9 A;  1OC9 B;  4W66 A;  4USS A;  5E4W A;  1DSB A;  3QDN A;  5J9B A;  3IOS A;  1DE2 A;  2V32 A;  5HR2 A;  4EKZ A;  2LV3 A;  4I2T A;  1WJK A;  1WOU A;  2X99 A;  4KSM A;  3SWL A;  1FAA A;  4ZBA A;  1G0T A;  1MEK A;  3GX0 A;  4JR6 A;  4HEA 2;  3PPU A;  2GT5 A;  4GST A;  2OBK A;  5BMU A;  2VL9 A;  4CDO A;  2EFE A;  1ERT A;  3IAS 2;  1J9B A;  2YNX A;  3HCZ A;  3LJR A;  1FO5 A;  1PSQ A;  3IV4 A;  2GZZ A;  3GA4 A;  4KCA A;  4L5O A;  1A0F A;  3MNG A;  4CHS A;  3GUS A;  2E0Q A;  3LW9 A;  3QAV A;  3EUR A;  5D9W A;  4ECB A;  2RLI A;  2YJ7 A;  4ZB7 A;  2FWH A;  1ZZY A;  3GKK A;  1PA3 A;  4NPB A;  3C1S A;  2HFD A;  3EVI A;  2YZU A;  1T00 A;  4DSR A;  2JZR A;  2WRT A;  4RQR A;  4BVY B;  4XTS A;  2H0I A;  4LL4 B;  1DE1 A;  3CXG A;  3KTL A;  1XZO A;  3L4N A;  2GTU A;  2H1B A;  2M46 A;  2IPA A;  3PR8 A;  2VKZ G;  4HUA A;  3MWH A;  4BL7 A;  4ZL7 A;  1K0N A;  4AJ8 A;  1XW5 A;  2UV8 G;  4HZ2 A;  1TP9 A;  2LRN A;  4WBR D;  3ZRE A;  3UIW A;  3FZ9 A;  1AAZ A;  1Z6N A;  1HNA A;  22GS A;  1FG4 A;  3HJM A;  5F8B A;  4ECI A;  1YKA A;  4NHW A;  2AJQ B;  1GUK A;  2I81 A;  2CA8 A;  4V2M A;  1THO A;  1W89 A;  2UZ8 A;  2Z9S A;  2P31 A;  4NV5 A;  3FZA A;  4MJC A;  2HE3 A;  2FUG 2;  1XWA A;  3M9J A;  11GS A;  1NM3 A;  1UN2 A;  1VGL A;  4HJ2 A;  1SKR B;  1KBN A;  2DJ3 A;  1A8Y A;  1XBS A;  5ECO B;  2VCT A;  4AI6 A;  4YH2 A;  2AYT A;  3DGQ A;  4I2U A;  2GQK A;  3KH7 A;  4YKF A;  2QA2 A;  5G5E A;  2VL2 A;  1FB0 A;  2DJ0 A;  1SYR A;  1TRV A;  6GSV A;  5AN1 A;  4Q5R A;  4K7N A;  3F4R A;  2X64 A;  3GN3 A;  5CRD A;  2CT6 A;  2MMZ A;  2KLX A;  2H19 A;  1CQH A;  2AB6 A;  4AJ7 A;  2GSQ A;  2HSM B;  1OYJ A;  1PX7 A;  2X8G A;  4G19 A;  1EP7 A;  3VPT A;  4QL9 A;  1VF4 A;  1NSW A;  1EOH A;  1JLW A;  3A2V A;  1RW1 A;  2JL4 A;  4ML6 A;  5FT3 A;  3HJO A;  1M2A A;  3IXR A;  3A5I A;  1V98 A;  2N5A A;  2YWM A;  1MDI A;  4HDE A;  1U3I A;  3M3M A;  1YEX A;  2MYG A;  2VCQ A;  3O76 A;  1WMJ A;  1X9M B;  5IIZ A;  1A24 A;  3M1G A;  2A2R A;  2DML A;  1ZOF A;  2FGX A;  4MZB A;  5F06 A;  2V41 A;  2HSY A;  5DVB A;  4X1U A;  3GKN A;  3L9V A;  2B6M A;  3BJ5 A;  1SJI A;  5A4V A;  3UVH A;  2HZE B;  3UOM A;  2L5L A;  5IMV A;  2CAQ A;  4LLR A;  1EEM A;  2LQQ A;  5DDL A;  1Z6M A;  5ECP B;  2GSR A;  2JSZ A;  2L4C A;  4RUV A;  1O81 A;  2H70 A;  5HR0 A;  2C3N A;  4ZL9 A;  2HRA A;  4K5R A;  4ZBB A;  5HR3 A;  2HZF A;  4RQX A;  1SK0 A;  3GV1 A;  1V57 A;  5A4W A;  3F4T A;  5HFK A;  4QMK A;  4PTS A;  5ID2 B;  2RUF A;  2D2Z A;  2VM2 A;  2L59 A;  2XBQ A;  1U87 A;  3QFA C;  2X4A A;  3GTU A;  10GS A;  1X0R A;  4FIW A;  5CRG A;  4IQA A;  4MP4 A;  4F2I A;  3WT1 A;  2VCZ A;  1OKT A;  4LL1 B;  1GTB A;  4WEY A;  3C73 A;  4WR4 A;  3APQ A;  3Q74 A;  1SU9 A;  3P90 A;  2PVQ A;  1SK2 A;  3KZQ A;  4OO5 A;  1IYI A;  1EGR A;  2VCV A;  6GSX A;  1F9M A;  1T7P B;  3I69 A;  1PKZ A;  2HYX A;  2VD0 A;  5DAK B;  5EVO A;  1HYU A;  4ICY A;  2KOK A;  2V1M A;  3BCI A;  1R26 A;  2VLU A;  3WGX A;  4XS6 A;  1BYE A;  2LQO A;  1A2J A;  5GZZ B;  5IMD A;  4JR4 A;  1AIU A;  2C4J A;  1JZD A;  3CSJ A;  3KP9 A;  2G2Q A;  5IOX A;  4X4J A;  5JWO B;  1I9D A;  2GGT A;  3HZ4 A;  4E8H A;  1SJZ A;  4K8M A;  5J4V A;  4GRF A;  5ECL B;  3FY7 A;  3ZMK A;  2O7K A;  2WB9 A;  4TXO A;  2O85 A;  4XRD A;  5HR1 A;  1URM A;  4BVX B;  5ECQ B;  4ZIL A;  2GLR A;  4IN0 A;  2HNL A;  16GS A;  4IS0 A;  4AKX B;  1FVJ A;  3M0F A;  1XPV A;  1XVQ A;  2L57 A;  4ECJ A;  3FYG A;  4PNG A;  4GF0 A;  2MBS A;  5DAL A;  5B6M A;  3MAK A;  4N3Z A;  3HVX A;  4F0B A;  1FOV A;  3HKR A;  5ELA A;  4L0W A;  1BG1 A;  3ZFL A;  2WJU A;  3H93 A;  3LSZ A;  5BMU B;  4N11 A;  1XCC A;  2HLS A;  3CBU A;  3G7Y A;  2HRF A;  4HU9 A;  2LNT A;  1GL8 A;  3GH9 A;  2OAD A;  3KP8 A;  1SJ6 A;  1QFN A;  5E59 A;  5CAX A;  5DJL A;  4OFN A;  1PL2 A;  5CO3 A;  5D9V A;  4EDY A;  4FYC A;  2ON5 A;  3MDK A;  3QAW A;  3L9U A;  3FRC A;  4OMV A;  3VI5 A;  2VCX A;  2N5B A;  2OAC A;  3GL3 A;  2RM5 A;  1IYH A;  4K2X A;  1PMT A;  1A23 A;  2P0G A;  3RPP A;  1QXH A;  1ZYQ B;  3BOA A;  3C7M A;  4AKH A;  2CZ2 A;  2E2G A;  3DXB A;  1GTA A;  4FO5 A;  4NHZ A;  3L78 A;  4KX4 A;  4P3Y B;  3UBL A;  3RDW A;  4AKG A;  1F37 A;  2B5Y A;  2CZ3 A;  1AQX A;  3N9J A;  3UEM A;  1YDK A;  4NAX A;  3VWX A;  4WET A;  1SL0 B;  3ZIJ A;  3KMN A;  5C04 A;  2H6Y A;  4MJB A;  4BL7 B;  1W4V A;  2FCH A;  1AQW A;  3EU4 A;  3HVS A;  5HQP A;  1LJR A;  3ZFB A;  3ERF A;  3TKQ A;  2H74 A;  2NVL A;  3D4M A;  3V1W A;  3UMA A;  2DC5 A;  3HD5 A;  4KH7 A;  2QA1 A;  3W8J A;  1R5A A;  1AC1 A;  4OFM A;  3U5R E;  4XS4 B;  2LUS A;  3U6V A;  1YEP A;  5AGY A;  1GSF A;  1GSQ A;  2J23 A;  2OT3 A;  1R5P A;  2H71 A;  2FA4 A;  3US3 A;  4N0V A;  1OAZ A;  5DCG A;  5J3R A;  3ZL5 A;  4EO3 A;  5ELG A;  5D96 A;  4TVE A;  4OO4 A;  1YVL A;  3GST A;  3TJJ A;  3QMX A;  1YZX A;  5IO0 A;  1TDI A;  5G5F A;  1BG5 A;  2LJA A;  5HFI A;  3D0Z A;  1VRS D;  5JCG A;  2VM1 A;  4LA1 A;  1GTI A;  3F6F A;  1BAY A;  4IQ1 A;  2OBI A;  5KOX A;  5IMF A;  4HQZ A;  3UBK A;  4O32 A;  2CAI A;  5INY A;  1Z5Y E;  3KTB A;  1BQ7 A;  5A5H A;  4O92 A;  2IJY A;  2HSN A;  3HZ8 A;  4IJI A;  1QK8 A;  2O89 A;  4TXV A;  14GS A;  4G2E A;  4IW9 A;  1ILO A;  4Z2R A;  2DMM A;  4ECC A;  1Z7R A;  3DKS A;  2JAD A;  2F51 A;  1GSU A;  2M72 A;  3N5O A;  1G6Y A;  3LG6 A;  4YAV A;  4FH8 A;  1E6B A;  2VOC A;  2OA7 A;  5CRE A;  4TOP A;  4ZXG A;  3TJF A;  2OJL A;  3F3Q A;  2YWI A;  3IK9 A;  2HRN A;  3HA9 A;  3FW2 A;  4FQU A;  2VUP A;  3DVW A;  1A8L A;  2H1A A;  1SVM A;  5B6N A;  3GKM A;  1K3O A;  1O7U A;  1GLP A;  3LGC A;  2IL3 A;  2CV4 A;  1UA5 A;  3ZZX A;  4KUN A;  3TB2 A;  1OE7 A;  1EZK A;  2H0G A;  1JZW A;  1PQN A;  4QL7 A;  3UAP A;  4MCU A;  1T4Y A;  3TJG A;  2R3X A;  3EPT A;  2YWO A;  2C0E A;  1Q98 A;  2TRC P;  2H0H A;  2OE0 A;  4IVF A;  3W6G A;  12GS A;  5J47 A;  2O5V A;  4WF4 A;  4EL1 A;  4TR0 A;  3GUR A;  4F0C A;  2EIQ A;  2H6Z A;  6GST A;  3F4S A;  3ZRD A;  3CRU A;  4O5R A;  2LEG A;  3ZLP A;  1XWB A;  3CYN A;  1F6M C;  3GIX A;  5DCH A;  3Q6O A;  5CP1 A;  2HI7 A;  3IDV A;  5A34 A;  3F0I A;  3ZML A;  4MPF A;  2LJK A;  3J7Y k;  3HJP A;  4J2F A;  3GKX A;  4EF0 A;  4OCE A;  1ZMA A;  2C0G A;  4MJA A;  4Q5Q A;  2XPD A;  5ECI B;  3NIV A;  1QUW A;  4DSS A;  2C8U A;  3A2X A;  3LYP A;  5ECS A;  3ZVJ D;  4TR1 A;  1TRS A;  2EC4 A;  3IC4 A;  3ZIV A;  1FVK A;  2K6V A;  1F2E A;  3C8E A;  5LD0 A;  4POM A;  2ZCT A;  2OKA A;  2B3S A;  2E7P A;  2VL2 C;  4N10 A;  3KM6 A;  4KDX A;  3GYK A;  1HNB A;  1YQ1 A;  3RHB A;  4HOJ A;  4I6X A;  3TRP A;  5LCZ A;  5IPH A;  5F0G A;  1O85 A;  3KIJ A;  2YZH A;  4EC0 A;  2LJR A;  3BBY A;  4WXT A;  4XIH A;  2CX3 A;  2ES7 A;  4JE1 A;  2L6D A;  1N25 A;  3EMX A;  2VD1 A;  1XW9 A;  1K0D A;  2QC7 A;  4MF5 A;  3CMI A;  4Z7X A;  1Z3E A;  1AUC A;  1TU7 A;  5AIV A;  4L0U A;  3VWV A;  1SD9 A;  2FNO A;  4TRX A;  1YY7 A;  3IC8 A;  2R37 A;  3TUE A;  17GS A;  5IMZ A;  3IE3 A;  1JHB A;  1PL1 A;  4FYB A;  4K7I A;  4ZL8 A;  1PN0 A;  4HQS A;  1VF2 A;  1U6T A;  3VUR A;  1R7H A;  2WGR A;  2EFH A;  3PH9 A;  1NHY A;  3WYW A;  4GLT A;  4BWS A;  3W8S A;  1ZYN A;  2QGV A;  5J9C A;  1GSY A;  2NTO A;  4ULX A;  2FD3 A;  2JZT A;  4AKI A;  3F8U A;  4I97 A;  2WDU A;  4ZBD A;  5H5Q A;  1UC7 A;  4K0G A;  2MMA A;  2YN1 A;  2PGT A;  3D4T A;  3D21 A;  3ED3 A;  1M99 A;  4ZIJ A;  4O5Q A;  5DQY A;  4POL A;  2R2J A;  1GUL A;  4CY8 A;  4OCF A;  4TN8 A;  2KP1 A;  1PN9 A;  4FYU A;  1PD2 1;  2CVB A;  1KTE A;  2VL3 A;  3P2A A;  1GUM A;  2C0F A;  3KXO A;  1OC3 A;  4WKW A;  5IQY A;  3GMF A;  1V40 A;  4DSQ A;  4PUF C;  3GRX A;  3QOU A;  1KEB A;  2A4H A;  3L0H A;  4HJM A;  5J5N A;  2C3Q A;  2TRX A;  3TDG A;  4K6X A;  2PVO C;  3VI7 A;  3SBC A;  2FY6 A;  1SEN A;  5JCW A;  2C0D A;  1GSS A;  1PGT A;  1THX A;  3FZ5 A;  3TJK A;  2H6X A;  2R6K A;  1RK4 A;  3IK7 A;  5ECN B;  2R5G A;  3HY2 A;  5D9X A;  3BD2 A;  4MNN A;  4EXJ A;  2EIR A;  4KND A;  5J4Y A;  2HT9 A;  2B7J A;  2IMD A;  2IME A;  4K2D A;  1K0A A;  4G0K A;  1ERW A;  4IP1 A;  1TK0 B;  1GRX A;  4QQ7 A;  1O6J A;  4WF5 A;  1F3A A;  1WE0 A;  2VO4 A;  1ERV A;  2PUK C;  3EYT A;  4MJE A;  4O7H A;  4D73 B;  2ZUP A;  3FHK A;  3IR4 A;  3I9V 2;  2KHP A;  3C71 A;  2AUV A;  4KCE A;  1TU8 A;  4BA7 A;  2EIO A;  1T3B A;  3CWG A;  5A1N A;  3WGE A;  1SL2 B;  4IJ3 A;  1SL1 B;  4GDF A;  4ISD A;  1GP1 A;  5C00 A;  5J41 A;  1Y1U A;  5KN3 A;  1F3B A;  2HSM A;  3E3E A;  3NZN A;  2DJ1 A;  3IBH A;  1SKS B;  1H75 A;  5B8B A;  3R2Q A;  3RPN A;  1A2M A;  4NWY A;  5EL8 A;  2K8S A;  1X5E A;  2ALB A;  5D73 A;  1T1V A;  1TXU A;  2A4V A;  2H73 A;  3FK8 A;  1M2D A;  4H86 A;  1TW9 A;  2F9S A;  2PPT A;  3E0U A;  4K0N A;  1JFU A;  2IIY A;  2CX4 A;  2B7K A;  2BJX A;  3A3T A;  7GSS A;  1TTZ A;  1ZGN A;  4HU7 A;  2IFQ A;  4MLY A;  4O5U A;  1ZCP A;  3G7I A;  3DWV A;  2X8H A;  4RI6 A;  3BCK A;  1J0F A;  3FKF A;  4K7O A;  3AY8 A;  2ZNM A;  3LXT A;  1K0M A;  1ST9 A;  5CRW A;  1NHO A;  4Z2T A;  3EMP A;  4Q5F A;  1XOA A;  13GS A;  4ID0 A;  2VIM A;  1QGV A;  1OC8 A;  2PBJ A;  1TJD A;  4HI7 A;  3IRA A;  3KH9 A;  1XWG A;  1JZR A;  3H8Q A;  1K0C A;  1RQM A;  2H72 A;  2GDR A;  1WRY A;  1MDK A;  2LS5 A;  2NPB A;  3VWU A;  2CVK A;  3VPQ A;  2DJ2 A;  1YKC A;  4OWY A;  1V9W A;  5ID2 A;  2H1L A;  4KE3 A;  1XFL A;  2OE1 A;  2O8V B;  3MSZ A;  1BJX A;  3K8N A;  3FR9 A;  3DEX A;  3O3T A;  3UL3 A;  2TIR A;  4TKY A;  2G0F A;  4GQC A;  3TRX A;  4L5L A;  1ML6 A;  2GSS A;  1M2B A;  4MZC A;  5FHI A;  4IP6 A;  2DJJ A;  1QQ2 A;  1KNG A;  1GLQ A;  5G1L A;  1OKD A;  2LRC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...