3I69A

Apo glutathione transferase a1-1 gimf-helix mutant
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
219
structure length
219
Chain Sequence
AEKPKLHYFNGRGRMESTRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYIEGIADLGEMIIMLPFCPPEEKDAKLALIKEKIKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPPDEIYVRTVYNIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase A1
publication title Structural analysis of a glutathione transferase A1-1 mutant tailored for high catalytic efficiency with toxic alkenals.
pubmed doi rcsb
source organism Homo sapiens
total genus 82
structure length 219
sequence length 219
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2009-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3i69A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3i69A01
3ZL5A 4XTSA 5F06A 3ZYWA 5IPGA 4WBJA 2OE1A 3HDCA 3WGXA 4MPFA 1OKDA 4AJ8A 1B4QA 3LYKA 1O73A 1MTCA 4NMUA 4K0GA 4I6XA 1WP0A 4NXIA 1XVWA 4XS4A 4Q5NA 2AAWA 1SJ6A 3DD3A 3WT2A 1M0UA 3UIWA 3F6FA 4OD7A 1URMA 3QAWA 3RHBA 5HR2A 4I2UA 2YV7A 4ZL8A 2F9SA 4TXVA 2LQOA 3IA1A 3I6AA 1M9AA 4EL1A 6GSXA 2I81A 5AIVA 5JCWA 3CSIA 4K7IA 3NIVA 3PINA 3P8WA 1U3AA 3IDVA 2HQTA 5HR0A 1G7OA 3CBUA 3HKRA 3TRQA 1ERWA 1ILOA 5D73A 2B7KA 2N5FA 1PX7A 3IC4A 1A8LA 3DGQA 1E2YA 4BL7A 3Q19A 1MEKA 3ZZXA 4F82A 3ERFA 2M80A 1HNAA 2L5OA 1ZL9A 3A2VA 1EV9A 4GCIA 1Z6MA 2FCHA 1B9YC 1V40A 2HNLA 3MDKA 3QFAC 1K3YA 2H1AA 5ECQB 2CVDA 4LA1A 2F51A 3GX8A 4TN8A 2MMOA 2VLVA 2PVQA 4ZIJA 2DMMA 4RUVA 3GURA 2OE3A 4EUYA 3F0IA 1A23A 4IBPA 5J9BA 2CV4A 3HVSA 1TU8A 4KUNA 3ZITA 2RUEA 1W4VA 3CTFA 3HXSA 2CT6A 3L9UA 2CAQA 1KNGA 3FZ9A 2OBIA 3GHAA 2H19A 4G2EA 1B8XA 1Q4JA 4MJEA 1GNWA 4WF5A 2G2QA 3ZMLA 1X0RA 2MMNA 4N0ZA 3Q74A 4NAXA 4K6XA 4PQ1A 1WPIA 2V6KA 1RK4A 4WXTA 1Z5YE 4MP4A 1GUMA 1UN2A 2P5QA 2R2JA 3W8JA 2H70A 3EC3A 1ST9A 3DIEA 2YWNA 1N8JA 2R5GA 4F03A 4G0KA 3TGZA 4IKHA 2HXKA 3QDNA 5IMVA 3TJJA 6GSSA 1X5DA 3F4RA 4KF9A 1PMTA 1T3BA 1VF1A 3TJGA 4YAPA 4HI7A 3KIJA 4J57E 1WJKA 4MCUA 3H79A 3FZ4A 4G19A 1MD4A 2C8UA 5FWGA 1AUCA 3A2XA 3GKXA 4L8EA 2DIYA 2G0FA 4HQZA 2WULA 5G1LA 1XWBA 2MBTA 1EOHA 1XCCA 3GNJA 1GSDA 3CRTA 1TTZA 2FGXA 1BYEA 5JWOB 2C3TA 2DLXA 1FAAA 1TRUA 5ECOB 1S3AA 4OFNA 5H5QA 2PWJA 4PUAA 3KP8A 1F37A 4ZB6A 1M2BA 1EEMA 4X43A 2P5RA 3M8NA 5HFKA 2FY6A 1NW2A 1S3CA 4XS1A 5GAPD 4HOJA 3IBHA 4GLTA 3VI7A 1TU7A 2B5EA 3PR8A 5G30A 3UVHA 1OVNA 1F9MA 2QKEA 3F3QA 5HR1A 1OKTA 3RPNA 2KLXA 2FWGA 4KGIA 1XIYA 1TRWA 3K8NA 1J9BA 1TI3A 5B6NA 4BVXB 4ECCA 3FR6A 3FHKA 1WE0A 3KTBA 5AGYA 1X5CA 5IMAA 5HFIA 3CXGA 4JRRA 2IFQA 1ML6A 2KP1A 3GH9A 4GWRA 4X0XA 2YWOA 2IMDA 1GUHA 1NM3A 1VF2A 3ERWA 1WRYA 2WFCA 3H4KA 2H0GA 1FG4A 1M7TA 4POMA 2CZ3A 2IMFA 3GL3A 3R3EA 4N30A 2GQKA 5F0GA 1JZOA 4V1Ag 4IQ1A 17GSA 4WETA 2AV4A 2H1DA 2OJLA 3GSTA 2YZHA 5EL8A 1A2MA 1GSYA 1RQMA 3G7YA 3VWUA 2ZCTA 2IWTA 2K8SA 3RHCA 4L0UA 3CSHA 3TB2A 4MF5A 1CQHA 2GZYA 3E9JB 1K0CA 4G0IA 4LMWA 5D9VA 2H1GA 1TOFA 4V2LA 1OE7A 5DJMA 3O6TA 1AQXA 4KDXA 4O92A 1UC7A 4TR1B 3Q6OA 1K0NA 1GH2A 2C3NA 4AGSA 4IP1A 2A4VA 4KH7A 4TVEA 4MJAA 1F2EA 5HFGA 3GYKA 4IW9A 1VGLA 3LWAA 3U5RE 2O89A 2MZCA 4GSSA 3F4SA 3FR9A 4PURA 4OFMA 5G5EA 2REMA 4RQXA 2GTUA 3LXTA 1LJRA 3W6GA 2AJQB 3FRCA 2HSMA 3V1WA 1PX6A 3C8EA 2R6KA 4PQHA 1SL0B 2CZ2A 2X8CA 1THXA 1W89A 5HQPA 4HZ2A 3CRUA 1WWJA 4EF0A 1C72A 1ZOFA 4FYBA 4ECBA 1WMJA 1YY7A 3FY7A 5D96A 5IM9A 3TOTA 2RM6A 3HHVA 1DE1A 5G1KA 4WKWA 2CQ9A 3ED3A 3HYPA 1ZZYA 5IQYA 5J4UA 2L4QA 2V32A 1Z6NA 3TKPA 4JE1A 1GTIA 2LRNA 2HZEB 4KA0A 3ZLPA 2PU9C 3BCKA 2QSIA 1M9BA 3F63A 4WBRD 5F8BA 2E0QA 2LTKA 1A2JA 5GSTA 1KBNA 1OE8A 1GSFA 1G6YA 2NDOA 2YV9A 5INYA 3P2AA 3M1GA 1U3IA 1SYRA 5E4WA 3IK7A 4JEDA 5KN3A 4HJ2A 2JZSA 1MDJA 5IMCA 3PGTA 3US3A 2KP2A 2DJ1A 4KDYA 3FK8A 3FZ5A 2B3SA 1HNCA 2B7JA 2R37A 3AY8A 4GSTA 5IMZA 3F8UA 1M2DA 4ML6A 3DWVA 4BVYA 2LV3A 3M9KA 3QMXA 3D4MA 1DSBA 1X9WB 1NHOA 1V98A 2H74A 1A0FA 1U87A 5KN0A 2GVPA 3ZIJA 14GSA 1T4ZA 2LJAA 4EVMA 2IL3A 1NSWA 2X8GA 4FQUA 5B8BA 2B1KA 3KJYA 3RBTA 1MD3A 3ME8A 2LUSA 2H0IA 5DCHA 3ISOA 5CP1A 4FO5A 1QXHA 5CRDA 3EWLA 2JZTA 3TCOA 2FUG2 4KCAA 2HSNB 4CW9A 1AC1A 3IAS2 5ECHB 4JR4A 1QMVA 2H66A 5FT3A 1M99A 4GTUA 2VD1A 3P7XA 1GNEA 4K9ZA 2DBCA 1PL2A 3PPUA 3DRNA 5COHA 2YJ7A 4EE0A 3I9V2 4YH2A 3O3TA 3EVIA 3TOUA 2JL4A 4MK3A 4IN0A 1AXDA 2VCTA 1Z7RA 5CNWA 4WR5A 3DYRA 5LCZA 3GTUA 1TI1A 4FIWA 2IMIA 4HEA2 2HYXA 1ZGNA 2F8FA 3IOSA 5ECIB 5C00A 1G0TA 1SD9A 2YCDA 2P31A 11GSA 2VM2A 2LRCA 3UAPA 2PUKC 2GT6A 4ZBAA 3KH7A 2AYTA 5GAND 1O85A 4IGJA 2KOKA 4JZQA 4G0LA 3APSA 5J9CA 12GSA 2VL2C 1HQOA 4HU9A 4MF6A 6GSTA 2DSAA 4LL1B 3GIXA 4IVFA 2O7KA 2IN3A 4MDCA 1B4PA 1K3LA 1MDIA 4J56E 5GZZB 4GQFA 4GXZA 1GSSA 5IO2A 4DSSA 3TUEA 20GSA 3VWWA 2FA8A 1AQWA 2O8VB 3RPPA 2HT9A 3DEXA 2RIIA 2J9HA 5DCGA 3D21A 1FO5A 4KSOA 2GQLA 3KEBA 2RM5A 5BMUA 4FYUA 4K7OA 4ZL7A 1TK5B 3QAVA 3D4TA 3HZ4A 4HJMA 3IHQA 3CMIA 2WRTA 2K8VA 2C1YA 5DBQA 4EKZA 3Q18A 3KXOA 4OO5A 4FH8A 3M0FA 5D9TA 2EIRA 4ZXGA 1OAZA 5DALB 1KEBA 5EVOA 2YN1A 4EDZA 1CQGA 2M46A 2FHEA 2DJ3A 2BTOT 3GKMA 4KCEA 2GZZA 1SKSB 4YQMA 2JZRA 3C73A 3ZRDA 1N2AA 2H8LA 2A2RA 3KMNA 4L0WA 3KTLA 2WB9A 2PGTA 16GSA 2A2SA 1SENA 2K18A 1G7EA 1XZOA 4ISDA 1BAYA 4EDYA 4BVYB 3UJ1A 4PNGA 4YQUA 4PGTA 1I9DA 3ZVJD 3WGEA 2YANA 3F6DA 3HD5A 1OC3A 2GSSA 3G9BA 4IELA 1V9WA 3F9UA 1SYXA 4QQ7A 3DVWA 1JLWA 2QGVA 1K0DA 2OADA 2XHFA 1XBSA 1YQ1A 4HQSA 2TRCP 1YJ6A 2NPBA 1ON4A 2NTOA 2H71A 4MH3A 2BJXA 3DXBA 1U6TA 3GKKA 1EOGA 4DSQA 4Q5FA 4NHWA 2HSHA 3KD0A 4GSNA 4IP6A 3IK9A 2X64A 2WZ9A 3RDWA 7GSSA 2C0DA 4KB3A 4XS4B 4JU5A 1H75A 5IO0A 1FVKA 4G10A 4ZILA 4WEYA 3ZIVA 5B6MA 2PMTA 2DJ2A 5IPHA 2HFDA 4NV5A 2HRAA 5JCGA 4IHUA 1IYHA 4PUFC 2ALBA 1SK1A 3ZFLA 2I3YA 2GSRA 2WGRA 2YJHA 3BBYA 5G31A 5ECNB 4G9HA 3ZVJA 4Z7XA 1K0AA 4DVCA 1SK0A 4BWSA 4DSRA 1I5GA 3DVXA 5KEJA 1XWCA 1ZMAA 4F0CA 2C0EA 2CX4A 2J23A 5DQSA 5ABRA 3EURA 4HS1A 3ZMKA 5DQYA 2I9HA 4BA7A 5IMFA 2OE0A 4E8EA 5IIZA 4TKYA 1YKAA 4EO3A 1HYUA 4XS6A 4YAVA 4MA9A 3EU4A 4BL7B 1FVJA 3WGDA 2VCZA 3UBLA 2VLUA 2OACA 1R4WA 2H0HA 2HRKA 3KP9A 4LL4B 3TDGA 1TXXA 3VI5A 2FA4A 2B6MA 2GQMA 3F4TA 5ID2A 4TXOA 1X5EA 4X1UA 1JHBA 2H6XA 1GULA 3FKFA 4GRFA 1EV4A 1Q98A 1GSQA 4KAEA 5IMDA 2HI7A 3GX0A 4LMVA 1GTBA 3TKRA 3VPQA 5JWRB 2VOCA 1GUKA 1K0OA 4IJIA 3MAKA 1USBA 1F6MC 2KHPA 4IS0A 3QFBC 1AIUA 3L9VA 2M72A 1HD2A 4AF2A 2C3QA 2C4JA 1YDKA 2ZNMA 5IOWA 5CO3A 5GSSA 3IPZA 3LG6A 5J5NA 2RUFA 4MPGA 1GL8A 1FB0A 4OMVA 2UZ8A 3TJFA 4MJBA 1XW6A 1ZYQB 1R5AA 5FHIA 2DC5A 4XRDA 3L0HA 1VF3A 4KE3A 3QPMA 4FYCA 2QC7A 1EZKA 3APQA 1FOVA 22GSA 1SL1B 3TKSC 2X8HA 3U6VA 4PXOA 1JLVA 3BJ5A 2OKAA 5KN1A 2F3MA 1K0BA 2WJUA 5CRWA 2PN8A 1VF4A 2CAIA 2FWHA 4ILFA 4D73A 4F9ZA 5J3RA 1TDIA 3FYGA 4I2TA 2VCXA 1T4YA 2F8AA 3LXZA 2VCWA 1TK8B 3UVTA 4L5LA 1BJXA 2WDUA 2N5BA 2XBQA 1ERUA 3EU3A 2VLTA 2LEGA 2PPTA 4Q5QA 3WD6A 3TKQA 3D6IA 1XXUA 4KNDA 3J7Yk 1QQ2A 2YOIA 2R4VA 1O7UA 4RQRA 5A4UA 1GSEA 3GKNA 6GSUA 1TW9A 3IAM2 4LLRA 2EIQA 2V41A 1QUWA 3ERGA 1BEDA 2LJKA 3GMFA 2LNTA 2LSTA 1HNBA 2VM1A 3L9SA 1YZXA 1PN9A 1KTEA 1PKWA 3KMOA 5F07A 2B5YA 2VIMA 2LS5A 1PL1A 3KZQA 4F0BA 2E7PA 2H72A 1PRXA 3UMAA 4BPYA 1DE2A 3ZFBA 3VPTA 2HE3A 1FHEA 2K6VA 4WF4A 3GFKA 4N11A 2IMKA 2IFQB 2CVKA 2PVOC 2HRFA 2VCVA 3L78A 5CYYA 5ECLB 4CHSA 4O32A 3HVXA 2D2ZA 2PERA 4POKA 1JZRA 1R5PA 4CDOA 3NOFA 1JZWA 2FNOA 4H86A 4ID0A 2KUCA 5D9WA 1AQVA 3KH9A 5EY6A 4NHZA 1XVQA 4ZBBA 2L57A 3TRPA 1E6BA 1AW9A 3G7JA 3GUSA 4XRAA 1ZCPA 2OA7A 2L6CA 4IQAA 2AUVA 3GRXA 4TR0A 2TRXA 1BX9A 3KM6A 2GDRA 5CREA 1SD8A 3S9FA 3H93A 1VRSD 3KCMA 1PKZA 4RI6A 1V2AA 1ERTA 1LU4A 3A5WA 4MH2A 3VK9A 1A8YA 2O87A 4V2NA 3BD2A 1XOAA 1UVZA 4POLA 4QL7A 2ON7A 1PA3A 1X9SB 2HSMB 2L59A 5ECPB 3LGCA 4V2MA 2GZPA 1SKWB 2VL2A 2VL9A 3BCIA 2LRTA 2WCIA 2FWFA 3QAGA 2B5XA 4D73B 2LKUA 4XCSA 3EE2A 2HZFA 4P3YB 4OFTA 1NHYA 5HR3A 5F05A 1EWXA 1XPVA 3IRAA 1EP7A 2I1UA 1A2LA 4IJ3A 3C1SA 4USSA 5JCUA 3UARA 2E2GA 3UEMA 5AIXA 3BOAA 4NV2A 3CSJA 1PGTA 3W8SA 4I97A 2VL3A 4BVXA 10GSA 3MSZA 1TRVA 3GA4A 2Z9SA 3MWHA 1ABAA 5H5RA 13GSA 2H75A 4ZBDA 2MYGA 2HRNA 4E8HA 3F3RA 1T00A 2H6ZA 1OC9A 1SKRB 3IR4A 4I5QA 5ECMB 5DAKA 3IE3A 3E3EA 1GTUA 2GT5A 3VWXA 2AHEA 2JU5A 3QCPA 3PH9A 4GQCA 4O5RA 2CA8A 1H4OA 3EINA 4DEJA 2V1MA 3C71A 2HLSA 1SL2B 1BG5A 4N0VA 5A4WA 2C0GA 1B48A 3CTGA 3KGKA 3H1NA 2PBJA 1YEXA 3LJRA 2RLIA 4ZB9A 2DJKA 1Z9HA 1TJDA 4TR1A 2XPEA 5A5KA 3LSZA 3FZAA 5L71A 1Z7PA 2E2MA 2XPDA 2IIYA 4QL9A 4K0NA 2BMXA 1FB6A 2FD3A 4HUAA 3VURA 3NZNA 3HY2A 4KSMA 2I4AA 2V6OA 2YWMA 5ELGA 5E59A 4JR6A 1DBYA 1GLQA 2N5AA 1EGRA 3L4NA 4MABA 2L5LA 2L4CA 3VWVA 1ERVA 4J2FA 3I69A 1T7PB 2VO4A 4KX4A 1DUGA 4I8BA 6GSWA 4MZWA 4OCFA 3WT1A 2GGTA 3GTUB 1Z3EA 2IMEA 3I43A 1PQNA 3HJOA 3LYPA 2XBIA 1F3BA 1T8EB 1PD21 2WS2A 1O8WA 1PSQA 2GSQA 5B7CA 1XWAA 1IYIA 5B8AA 3MNGA 4MZCA 2H01A 2GSTA 3GH6A 4V1Ap 3GV1A 1J08A 4ECJA 1ZYEA 3CYNA 1SK2A 3R2QA 5ECSA 2MBSA 1Y25A 2HZEA 5KN2A 4K2DA 2H1BA 1YF1A 3DMLA 2YNXA 4TOPA 4MF7A 1WOUA 4ZL9A 9GSSA 2H30A 5J41A 1RW1A 2V2GA 6GSVA 2LJRA 2EIOA 4PTSA 4Q5RA 2L6DA 3SBCA 1QGVA 3UL3A 3TRXA 4DSSB 2FLSA 4PQIA 1GTAA 1K3OA 3GL5A 1EGOA 3LQ7A 4ZB8A 3QOUA 4NWYA 1JZDA 5ENUA 4ACSA 1XOBA 5DJLA 1EEJA 2VAFA 1QFNA 2DJJA 3D22A 4KDUA 5JWQB 2CX3A 3J7Yb 1EP8A 1O8XA 3C1RA 3GN3A 2MMAA 5D93A 5AISA 2JADA 18GSA 3APOA 1WIKA 1OC9B 2OBKA 5DAKB 2K9FA 3ME7A 19GSA 2DMLA 3G7IA 1V58A 4TW5A 3TKSE 2DIZA 5AN1A 2LNSA 4NPBA 5ELAA 5G5FA 8GSSA 2O85A 4ULXA 2VUPA 1UA5A 4F2IA 4RI7A 5IOXA 2TIRA 5CAXA 5ECKB 1A24A 2C0FA 3VLNA 4HZ4A 3A2WA 3H8QA 5A4VA 2B1LA 2VD0A 3LORA 1R7HA 5D8IA 1XW5A 3ZTLA 1XWKA 1B9XC 4EC0A 1TKDB 3N9JA 4YQVA 4MLYA 1T1VA 4OO4A 1GLPA 3WYWA 4JBBA 1YF0A 1M2AA 1SU9A 5G2ZA 1TRSA 3TKSA 1LBKA 1YEPA 1OYJA 5LD0A 3RAZA 3SWLA 3TJBA 1Y6EA 4XIHA 3QD9A 2YZUA 1YKCA 3IC8A 1GP1A 3HJPA 1TP9A 4MJCA 3M3MA 4PNFA 2H76A 2AB6A 3E0UA 3IV4A 3IXRA 2JSZA 3D5JA 1G6WA 1K0MA 2FWEA 4AJ6A 4TRXA 2GS3A 4OCEA 1V57A 4MZBA 4TR4A 5D9XA 2HSYA 4K8MA 3VFIA 3OR5A 1AAZA 4MMMA 4K7NA 4GF0A 3A3TA 3N5OA 4N10A 3O76A 3LEFA 3HA9A 1U88A 1GWCA 2ON5A 1MDKA 1FW1A 2CVBA 3EMPA 4XHMA 3UOMA 5LNKe 3JCML 3EYTA 2NBSA 4HDEA 2IPAA 2ZUPA 1XFLA 4EXJA 4PX1A 2IJYA 1JFUA 4O7HA 2YP6A 2YPMA 4OWYA 4BWQA 1XW9A 4TR3A 1TK0B 5C04A 3HZ8A 4HU7A 5DALA 1XWGA 1GSUA 2P0GA 5H5SA 4POBA 1BQ7A 2HRKB 2ES7A 3LFLA 5EPFA 1A0RP 2DJ0A 1S3DA 3HVVA 5ID2B 1O81A 4TXOB 2MMZA 1OC8A 2VCQA 2JSYA 4ECIA 2YWIA 3C7MA 4ML1A 4AJ7A 1J0FA 3FR3A 2EC4A 1O6JA 2LQQA 2XC2A 5ECRB 2NVLA 4L5OA 5DVBA 3HJMA 6GSYA 1X9MB 2R3XA 3TJKA 1SJZA 3HCZA 3FW2A 2H6YA 1F3AA 3P90A 3QR6A 3FEUA 1R26A 1ACVA 5DDLA 2C80A 3UBKA 1SJIA 4WR4A 4KW6A 2X99A 2JACA 3EMXA 3ZREA 3M9JA 1THOA 3GSSA 1GRXA 2H73A 4K1FA 5CRGA 3D0ZA 3DKSA 5CRHA 2GLRA 1QK8A
chains in the Genus database with same CATH superfamily
3ZL5A 4XTSA 5F06A 3ZYWA 5IPGA 4WBJA 2OE1A 3HDCA 3WGXA 4MPFA 1OKDA 4AJ8A 1B4QA 3LYKA 1O73A 1MTCA 3FMWA 4NMUA 4K0GA 4I6XA 1WP0A 4NXIA 1XVWA 4XS4A 4Q5NA 2AAWA 1SJ6A 3DD3A 3WT2A 1M0UA 3UIWA 3F6FA 2A4HA 4OD7A 1URMA 3QAWA 3RHBA 5HR2A 4I2UA 2YV7A 4ZL8A 2F9SA 4TXVA 2LQOA 3IA1A 3I6AA 2EFDA 1M9AA 4EL1A 6GSXA 2I81A 5AIVA 5JCWA 3CSIA 4K7IA 3NIVA 3PINA 3P8WA 1U3AA 3IDVA 3CWGA 2HQTA 5HR0A 1G7OA 3CBUA 3HKRA 3TRQA 1ERWA 1ILOA 5D73A 2B7KA 2N5FA 1PX7A 3IC4A 1A8LA 3DGQA 1E2YA 4BL7A 3Q19A 2WW3A 1MEKA 3ZZXA 4F82A 3ERFA 2M80A 1HNAA 2L5OA 1ZL9A 3A2VA 1EV9A 4GCIA 1Z6MA 2FCHA 1B9YC 1V40A 1BG1A 2HNLA 3MDKA 3QFAC 1K3YA 5BRTA 2H1AA 5ECQB 2CVDA 4LA1A 5KOXA 2F51A 4HSCX 3GX8A 4TN8A 2MMOA 2WVXA 2VLVA 2PVQA 4ZIJA 2DMMA 4RUVA 3GURA 2OE3A 4EUYA 3F0IA 1A23A 4IBPA 5J9BA 2CV4A 3HVSA 1TU8A 4KUNA 3ZITA 2RUEA 1W4VA 4EIQA 3CTFA 3HXSA 2CT6A 2WZSA 3L9UA 2CAQA 1KNGA 1YEWC 3FZ9A 2OBIA 3GHAA 2H19A 4G2EA 1B8XA 1Q4JA 4MJEA 1GNWA 4WF5A 2G2QA 3ZMLA 1X0RA 2MMNA 4N0ZA 3Q74A 4NAXA 4K6XA 4PQ1A 1WPIA 2V6KA 1RK4A 4WXTA 2WW1A 1Z5YE 4MP4A 1GUMA 1UN2A 2P5QA 2R2JA 3W8JA 2H70A 3EC3A 1ST9A 3DIEA 2YWNA 1N8JA 2R5GA 4F03A 4G0KA 3TGZA 4IKHA 2HXKA 3QDNA 5IMVA 3TJJA 6GSSA 1X5DA 3F4RA 4KF9A 1PMTA 1T3BA 1VF1A 3TJGA 4YAPA 4HI7A 3KIJA 4J57E 1WJKA 4MCUA 3H79A 3FZ4A 4G19A 1MD4A 2C8UA 5FWGA 1AUCA 5A5HB 3A2XA 3GKXA 4L8EA 2DIYA 2G0FA 4HQZA 2WULA 5G1LA 1XWBA 2MBTA 1EOHA 1XCCA 3GNJA 1GSDA 3CRTA 1TTZA 2FGXA 1PN0A 1BYEA 5JWOB 2C3TA 2DLXA 1FAAA 1TRUA 5ECOB 1S3AA 4OFNA 5H5QA 2PWJA 4PUAA 3KP8A 1F37A 4ZB6A 1M2BA 1EEMA 4X43A 2P5RA 3M8NA 5HFKA 2FY6A 1NW2A 1S3CA 4XS1A 5GAPD 4HOJA 3IBHA 4GLTA 3VI7A 4AKXB 1TU7A 2B5EA 3PR8A 5G30A 3UVHA 1OVNA 1F9MA 2QKEA 2UV8G 4FXYP 3F3QA 5HR1A 1OKTA 3RPNA 2KLXA 2FWGA 4KGIA 1XIYA 4CY8A 1TRWA 3K8NA 1J9BA 1TI3A 5B6NA 4BVXB 4ECCA 3FR6A 3FHKA 5A1NB 1WE0A 3KTBA 5AGYA 1SVLA 1X5CA 5IMAA 5HFIA 3CXGA 4JRRA 2IFQA 1ML6A 2KP1A 3GH9A 4GWRA 4X0XA 2YWOA 2IMDA 3MYDA 1GUHA 1NM3A 1VF2A 2WW0A 3ERWA 4G01A 1WRYA 2WFCA 3H4KA 2H0GA 1FG4A 1M7TA 4POMA 2CZ3A 2O3EA 2IMFA 3GL3A 3R3EA 4N30A 2WVXB 2GQKA 5F0GA 1JZOA 4V1Ag 4IQ1A 17GSA 4WETA 2AV4A 2H1DA 2OJLA 3GSTA 2YZHA 5EL8A 1A2MA 1GSYA 1RQMA 3G7YA 3VWUA 2ZCTA 2IWTA 2K8SA 3RHCA 4L0UA 3CSHA 3TB2A 4MF5A 2H1LA 1CQHA 2GZYA 3E9JB 1K0CA 4G0IA 4LMWA 5D9VA 2H1GA 1TOFA 4V2LA 1OE7A 5DJMA 3O6TA 1AQXA 4KDXA 4O92A 1UC7A 4TR1B 3Q6OA 1K0NA 1GH2A 2C3NA 4AGSA 4IP1A 2A4VA 4KH7A 4TVEA 4MJAA 1F2EA 3EPTA 5HFGA 3GYKA 4IW9A 1VGLA 3LWAA 3U5RE 2O89A 2MZCA 4GSSA 3F4SA 3FR9A 4PURA 4OFMA 5G5EA 2REMA 4RQXA 2GTUA 3LXTA 1LJRA 4YKFA 3W6GA 2AJQB 3FRCA 2HSMA 3V1WA 1PX6A 3C8EA 2R6KA 4PQHA 1SL0B 2CZ2A 4PI2C 2VKZG 3A5IA 2X8CA 1THXA 1W89A 2A2PA 5HQPA 4HZ2A 3CRUA 1WWJA 4EF0A 1C72A 1ZOFA 4FYBA 4ECBA 1WMJA 1YY7A 3FY7A 5D96A 5IM9A 4YKGA 3TOTA 2RM6A 3HHVA 1DE1A 5G1KA 4WKWA 2CQ9A 3ED3A 3HYPA 1ZZYA 5IQYA 5J4UA 2L4QA 2V32A 1Z6NA 3TKPA 4JE1A 4K2XA 1GTIA 2LRNA 2HZEB 4KA0A 3ZLPA 2PU9C 3BCKA 2QSIA 1M9BA 3F63A 4WBRD 1N25A 5F8BA 2E0QA 2LTKA 1A2JA 5GSTA 1KBNA 1OE8A 1GSFA 5J47A 1G6YA 2NDOA 4PHZC 2YV9A 5INYA 3P2AA 3M1GA 1U3IA 1SYRA 5E4WA 3IK7A 4JEDA 5KN3A 4HJ2A 4X4JA 2JZSA 1MDJA 5IMCA 3PGTA 3US3A 2KP2A 2DJ1A 4KDYA 3FK8A 3FZ5A 2B3SA 1HNCA 2B7JA 4AKHA 2R37A 3AY8A 4GSTA 5IMZA 3F8UA 1M2DA 4ML6A 5A34B 3DWVA 4BVYA 2LV3A 3M9KA 3QMXA 3D4MA 1DSBA 1X9WB 1NHOA 1V98A 2H74A 1A0FA 1U87A 5KN0A 2GVPA 3ZIJA 14GSA 1T4ZA 2LJAA 4EVMA 2IL3A 1NSWA 2X8GA 4FQUA 5B8BA 2B1KA 3KJYA 3RBTA 1MD3A 3ME8A 2LUSA 2H0IA 5DCHA 3ISOA 5CP1A 4FO5A 1QXHA 5CRDA 3EWLA 2JZTA 3TCOA 2FUG2 4KCAA 4ZB7A 2HSNB 4CW9A 1AC1A 3IAS2 1S3RA 5ECHB 4JR4A 1QMVA 2H66A 5FT3A 1M99A 4GTUA 2DKHA 2VD1A 3P7XA 1GNEA 4K9ZA 2DBCA 1PL2A 3PPUA 3DRNA 5COHA 2YJ7A 4EE0A 3I9V2 4YH2A 3O3TA 3EVIA 3TOUA 2JL4A 4MK3A 4IN0A 1AXDA 2VCTA 1Z7RA 5KOWA 5CNWA 4WR5A 3DYRA 5LCZA 3GTUA 1TI1A 4FIWA 2IMIA 4HEA2 2HYXA 1ZGNA 2F8FA 3IOSA 5ECIB 3LW9A 5C00A 3TU3B 1G0TA 1SD9A 2YCDA 2P31A 11GSA 2VM2A 2LRCA 3UAPA 2PUKC 3MIXA 2GT6A 4ZBAA 3KH7A 2AYTA 5GAND 1O85A 2O36A 4IGJA 2KOKA 4JZQA 4G0LA 3APSA 5J9CA 12GSA 2EFHA 2VL2C 1HQOA 4HU9A 4MF6A 6GSTA 2DSAA 4LL1B 3GIXA 4IVFA 2O7KA 2IN3A 4MDCA 1B4PA 1K3LA 1MDIA 4J56E 5GZZB 4GQFA 4GXZA 1GSSA 5IO2A 4DSSA 3TUEA 20GSA 3VWWA 2FA8A 1AQWA 2O8VB 3RPPA 2HT9A 3DEXA 2RIIA 2J9HA 5DCGA 3D21A 1FO5A 4KSOA 2GQLA 3KEBA 2RM5A 5BMUA 4FYUA 4K7OA 4ZL7A 4EIPA 1TK5B 3QAVA 3D4TA 3HZ4A 4HJMA 4O5UA 3IHQA 3CMIA 4K5SA 2WRTA 2K8VA 2C1YA 5DBQA 4EKZA 3Q18A 3KXOA 4OO5A 4FH8A 3M0FA 5D9TA 2EIRA 4ZXGA 1OAZA 5DALB 1KEBA 5EVOA 2YN1A 4EDZA 1CQGA 2M46A 2FHEA 2DJ3A 2BTOT 3GKMA 4KCEA 2GZZA 1SKSB 4YQMA 2JZRA 3C73A 3ZRDA 1N2AA 4PI0C 2H8LA 2A2RA 3KMNA 4L0WA 3KTLA 2WB9A 2PGTA 16GSA 2A2SA 1SENA 2K18A 1G7EA 1XZOA 4ISDA 1BAYA 4EDYA 4BVYB 3UJ1A 4PNGA 4YQUA 4PGTA 1I9DA 3ZVJD 3WGEA 2YANA 3F6DA 3HD5A 3RGBC 1OC3A 2GSSA 3G9BA 4IELA 1V9WA 3F9UA 1SYXA 4QQ7A 3DVWA 1JLWA 2QGVA 1K0DA 2OADA 2XHFA 1XBSA 1YQ1A 4HQSA 2TRCP 1YJ6A 2NPBA 1ON4A 2NTOA 2H71A 4MH3A 2BJXA 3DXBA 1U6TA 3GKKA 1PFOA 1EOGA 4DSQA 4Q5FA 4NHWA 2HSHA 3KD0A 4GSNA 4IP6A 3IK9A 4E68A 2X64A 2WZ9A 3RDWA 7GSSA 2C0DA 4KB3A 4XS4B 4JU5A 1H75A 5IO0A 1FVKA 4G10A 4ZILA 4WEYA 3ZIVA 5B6MA 2PMTA 2DJ2A 5IPHA 2HFDA 4NV5A 2HRAA 5JCGA 4IHUA 1IYHA 4PUFC 2ALBA 1TXUA 1SK1A 3CHXC 3ZFLA 2I3YA 4AKGA 2GSRA 2WGRA 2YJHA 3BBYA 5G31A 5ECNB 4G9HA 3ZVJA 4Z7XA 1K0AA 4DVCA 1SK0A 4BWSA 4DSRA 4ICYA 1I5GA 3DVXA 5KEJA 1XWCA 1ZMAA 4F0CA 2C0EA 2CX4A 2J23A 5DQSA 5ABRA 3EURA 4HS1A 3ZMKA 5DQYA 2I9HA 4BA7A 5IMFA 2OE0A 4E8EA 5IIZA 4TKYA 1YKAA 4EO3A 1HYUA 4XS6A 4YAVA 4MA9A 3EU4A 4BL7B 1FVJA 3WGDA 2VCZA 3UBLA 2VLUA 2OACA 2QA1A 1R4WA 2H0HA 2HRKA 3KP9A 4LL4B 3TDGA 5J4YA 1TXXA 3VI5A 2FA4A 2B6MA 2GQMA 3F4TA 5ID2A 4TXOA 1X5EA 1FOHA 4X1UA 1JHBA 2H6XA 1GULA 3FKFA 4GRFA 1EV4A 1Q98A 1GSQA 4KAEA 5IMDA 1S4BP 2HI7A 3GX0A 4LMVA 1GTBA 3TKRA 3VPQA 3HVNA 5JWRB 4W66A 2VOCA 1GUKA 1K0OA 4GDFA 4N3ZA 4IJIA 3MAKA 1USBA 1F6MC 2KHPA 4IS0A 3QFBC 1AIUA 3L9VA 2M72A 1HD2A 4AF2A 2C3QA 2C4JA 1YDKA 2ZNMA 5IOWA 5CO3A 5GSSA 2QA2A 1M3IA 3IPZA 3LG6A 5J5NA 2RUFA 4MPGA 1GL8A 1FB0A 4OMVA 2UZ8A 3TJFA 4MJBA 1XW6A 1ZYQB 1R5AA 5FHIA 2DC5A 4XRDA 3L0HA 1VF3A 4KE3A 3QPMA 4FYCA 2QC7A 1EZKA 3APQA 1FOVA 22GSA 1SL1B 3TKSC 2X8HA 3U6VA 4PXOA 1JLVA 3BJ5A 2OKAA 5KN1A 2F3MA 1K0BA 2WJUA 5CRWA 2PN8A 1VF4A 2CAIA 2FWHA 4ILFA 4A5PA 4D73A 4F9ZA 5J3RA 1TDIA 3FYGA 4I2TA 2VCXA 2X49A 1T4YA 2F8AA 3LXZA 2VCWA 1TK8B 3UVTA 4L5LA 1BJXA 2WDUA 2N5BA 2XBQA 1ERUA 3EU3A 2VLTA 2LEGA 2PPTA 4Q5QA 3WD6A 3TKQA 3D6IA 1XXUA 4KNDA 3J7Yk 2WVZA 1QQ2A 1BF5A 2YOIA 2R4VA 1O7UA 4Z2RA 4RQRA 5A4UA 1GSEA 3GKNA 6GSUA 1TW9A 3IAM2 4LLRA 2EIQA 2V41A 1QUWA 3ERGA 1BEDA 2LJKA 3GMFA 2LNTA 2LSTA 1HNBA 2VM1A 3L9SA 1YZXA 1PN9A 1KTEA 1PKWA 3KMOA 5F07A 2B5YA 2VIMA 2LS5A 1PL1A 3KZQA 4F0BA 2E7PA 2H72A 1PRXA 2EFEA 3UMAA 4BPYA 1DE2A 3ZFBA 3VPTA 2HE3A 1FHEA 2K6VA 3CQFA 4WF4A 3GFKA 4N11A 2IMKA 2IFQB 2CVKA 2PVOC 2HRFA 2VCVA 3L78A 5CYYA 5ECLB 4CHSA 4O32A 3HVXA 2D2ZA 2PERA 4POKA 1JZRA 1R5PA 4CDOA 3NOFA 1JZWA 2FNOA 4H86A 4ID0A 2KUCA 5D9WA 1AQVA 3KH9A 5EY6A 4NHZA 1XVQA 4ZBBA 2L57A 3TRPA 1E6BA 1AW9A 3G7JA 3GUSA 4XRAA 1ZCPA 2OA7A 2L6CA 2OT3A 4IQAA 2AUVA 3GRXA 4TR0A 2TRXA 1BX9A 3KM6A 2GDRA 5CREA 1SD8A 3S9FA 3H93A 1VRSD 3KCMA 1PKZA 4RI6A 5A5HA 1V2AA 1ERTA 1LU4A 3A5WA 4MH2A 3VK9A 1A8YA 2O87A 4V2NA 3BD2A 1XOAA 1UVZA 4POLA 4QL7A 2ON7A 1PA3A 1X9SB 2HSMB 2L59A 5ECPB 3LGCA 4V2MA 2GZPA 1SKWB 2VL2A 2VL9A 3BCIA 2LRTA 2WCIA 2FWFA 3QAGA 2B5XA 4D73B 2LKUA 4XCSA 3EE2A 2HZFA 4P3YB 4OFTA 1NHYA 5HR3A 5F05A 1EWXA 1XPVA 3IRAA 1M3JA 1EP7A 2I1UA 1A2LA 4IJ3A 3C1SA 4USSA 5JCUA 3UARA 2E2GA 5J40A 3UEMA 5AIXA 3BOAA 4NV2A 3CSJA 1PGTA 3W8SA 4I97A 2VL3A 4BVXA 10GSA 3MSZA 1TRVA 5A1NA 4K5RA 3GA4A 2Z9SA 3MWHA 1ABAA 5H5RA 1I1IP 13GSA 2H75A 4ZBDA 2MYGA 2HRNA 4E8HA 3F3RA 1T00A 2H6ZA 1OC9A 1SKRB 3IR4A 4I5QA 5ECMB 5DAKA 3IE3A 3E3EA 2X4AA 1GTUA 2GT5A 5J4VA 3VWXA 2AHEA 2JU5A 3QCPA 3PH9A 4GQCA 4O5RA 2CA8A 1H4OA 3EINA 4DEJA 2V1MA 3C71A 2HLSA 1SL2B 1BG5A 4N0VA 5A4WA 2C0GA 1B48A 3CTGA 3KGKA 3H1NA 2PBJA 1YEXA 3LJRA 2RLIA 4ZB9A 4AKIA 2DJKA 1Z9HA 1TJDA 4TR1A 2XPEA 5A5KA 3LSZA 3FZAA 5L71A 1Z7PA 2E2MA 4QMKA 2XPDA 2IIYA 4QL9A 4K0NA 1Y1UA 2BMXA 1FB6A 2FD3A 4HUAA 3VURA 3NZNA 2R0GA 2EFCA 3HY2A 4KSMA 2I4AA 2V6OA 2YWMA 5ELGA 5E59A 4JR6A 1DBYA 1GLQA 2N5AA 1EGRA 3L4NA 4MABA 2L5LA 4Z2UA 2L4CA 3VWVA 1ERVA 4J2FA 4O5QA 3I69A 1T7PB 2VO4A 4KX4A 1DUGA 4I8BA 6GSWA 4MZWA 4OCFA 3WT1A 2GGTA 3GTUB 3HMJG 1Z3EA 2IMEA 3I43A 1PQNA 3HJOA 3LYPA 2XBIA 1F3BA 1T8EB 1PD21 2WS2A 1SVMA 1O8WA 1PSQA 2GSQA 5B7CA 1XWAA 1IYIA 5B8AA 3MNGA 4MZCA 2H01A 2GSTA 3GH6A 4V1Ap 3RFRC 3GV1A 1J08A 4ECJA 1ZYEA 3CYNA 1SK2A 3R2QA 4CY6A 5ECSA 2MBSA 1Y25A 2HZEA 5KN2A 4K2DA 2H1BA 1YF1A 3DMLA 2YNXA 4TOPA 4MF7A 1WOUA 4ZL9A 9GSSA 2H30A 5J41A 1RW1A 2R0PA 2V2GA 6GSVA 2LJRA 2EIOA 4PTSA 4Q5RA 2L6DA 3SBCA 1QGVA 3UL3A 3TRXA 4DSSB 2FLSA 4PQIA 1GTAA 1K3OA 3GL5A 1EGOA 3LQ7A 4ZB8A 3QOUA 4NWYA 1JZDA 5ENUA 4ACSA 1XOBA 5DJLA 1EEJA 2VAFA 1QFNA 2DJJA 3D22A 5BMUB 4KDUA 5JWQB 5A34A 2CX3A 2DKIA 3J7Yb 1EP8A 1O8XA 3C1RA 3GN3A 2MMAA 5D93A 5AISA 2JADA 18GSA 3APOA 1WIKA 1OC9B 2OBKA 5DAKB 2K9FA 3ME7A 19GSA 2DMLA 3G7IA 1V58A 2R0CA 4TW5A 3TKSE 2DIZA 5AN1A 2LNSA 2O5VA 4NPBA 5ELAA 5G5FA 8GSSA 2O85A 4ULXA 2VUPA 1UA5A 4F2IA 4RI7A 5IOXA 2TIRA 2HSNA 5CAXA 4AI6A 5ECKB 1A24A 2C0FA 1SVOA 3VLNA 4HZ4A 3A2WA 3H8QA 5A4VA 2B1LA 2VD0A 3LORA 1R7HA 5D8IA 1XW5A 4Z2TA 3ZTLA 1XWKA 1B9XC 4EC0A 1TKDB 3N9JA 4YQVA 4MLYA 1T1VA 4OO4A 1GLPA 3WYWA 1ZYPA 4JBBA 1YF0A 1M2AA 1SU9A 5G2ZA 1TRSA 3TKSA 1LBKA 1YEPA 1OYJA 5LD0A 3RAZA 3SWLA 3TJBA 1Y6EA 4XIHA 2YZUA 3QD9A 1YKCA 3IC8A 1GP1A 3HJPA 1TP9A 4MJCA 3M3MA 4PNFA 2H76A 2AB6A 3E0UA 3IV4A 3IXRA 2JSZA 3D5JA 1G6WA 1K0MA 2FWEA 4AJ6A 4TRXA 2GS3A 4OCEA 1V57A 4MZBA 4TR4A 5D9XA 2HSYA 4K8MA 3VFIA 3OR5A 1AAZA 4MMMA 4K7NA 4GF0A 3A3TA 3N5OA 4N10A 3O76A 3LEFA 3HA9A 1U88A 1GWCA 2ON5A 1MDKA 1FW1A 2CVBA 3EMPA 4XHMA 3UOMA 5LNKe 3JCML 3EYTA 2NBSA 4HDEA 2IPAA 2ZUPA 1XFLA 4EXJA 4PX1A 2IJYA 1JFUA 4O7HA 2YP6A 2YPMA 4OWYA 4BWQA 1XW9A 4TR3A 1TK0B 5C04A 3HZ8A 4HU7A 5DALA 1XWGA 1GSUA 2P0GA 5H5SA 4POBA 1BQ7A 2HRKB 4MNNA 2ES7A 3LFLA 5EPFA 1A0RP 2DJ0A 1S3DA 3HVVA 1ZYNA 5ID2B 1O81A 4TXOB 2MMZA 1OC8A 2VCQA 2JSYA 4ECIA 2YWIA 3C7MA 3IHGA 4ML1A 4AJ7A 1J0FA 3FR3A 2EC4A 1O6JA 2LQQA 2XC2A 5ECRB 2NVLA 4L5OA 5DVBA 3HJMA 6GSYA 1X9MB 1XG8A 2R3XA 3TJKA 1SJZA 3HCZA 3FW2A 2H6YA 1F3AA 3P90A 3QR6A 3FEUA 1R26A 1ACVA 5DDLA 2WVYA 2C80A 3UBKA 1SJIA 4WR4A 4KW6A 2X99A 2JACA 3EMXA 3ZREA 3M9JA 2WW2A 4BIKA 1YVLA 1THOA 3GSSA 1GRXA 2H73A 4K1FA 5CRGA 3D0ZA 3DKSA 5CRHA 2GLRA 1QK8A
chains in the Genus database with same CATH topology
3ZL5A 4XTSA 5F06A 3ZYWA 5IPGA 4WBJA 2OE1A 3HDCA 3WGXA 4MPFA 1OKDA 4AJ8A 1B4QA 3LYKA 1O73A 1MTCA 3FMWA 4NMUA 4K0GA 4I6XA 1WP0A 4NXIA 1XVWA 4XS4A 4Q5NA 2AAWA 1SJ6A 3DD3A 3WT2A 1M0UA 3UIWA 3F6FA 2A4HA 4OD7A 1URMA 3QAWA 3RHBA 5HR2A 4I2UA 2YV7A 4ZL8A 2F9SA 4TXVA 2LQOA 3IA1A 3I6AA 2EFDA 1M9AA 4EL1A 6GSXA 2I81A 5AIVA 5JCWA 3CSIA 4K7IA 3NIVA 3PINA 3P8WA 1U3AA 3IDVA 3CWGA 2HQTA 5HR0A 1G7OA 3CBUA 3HKRA 3TRQA 1ERWA 1ILOA 5D73A 2B7KA 2N5FA 1PX7A 3IC4A 1A8LA 3DGQA 1E2YA 4BL7A 3Q19A 1MEKA 3ZZXA 4F82A 3ERFA 2M80A 1HNAA 2L5OA 1ZL9A 3A2VA 1EV9A 4GCIA 1Z6MA 2FCHA 1B9YC 1V40A 1BG1A 2HNLA 3MDKA 3QFAC 1K3YA 5BRTA 2H1AA 5ECQB 2CVDA 4LA1A 5KOXA 2F51A 3GX8A 4TN8A 2MMOA 2VLVA 2PVQA 4ZIJA 2DMMA 4RUVA 3GURA 2OE3A 4EUYA 3F0IA 1A23A 4IBPA 5J9BA 2CV4A 3HVSA 1TU8A 4KUNA 3ZITA 2RUEA 1W4VA 4EIQA 3CTFA 3HXSA 2CT6A 3L9UA 2CAQA 1KNGA 3FZ9A 2OBIA 3GHAA 2H19A 4G2EA 1B8XA 1Q4JA 4MJEA 1GNWA 4WF5A 2G2QA 3ZMLA 1X0RA 2MMNA 4N0ZA 3Q74A 4NAXA 4K6XA 4PQ1A 1WPIA 2V6KA 1RK4A 4WXTA 1Z5YE 4MP4A 1GUMA 1UN2A 2P5QA 2R2JA 3W8JA 2H70A 3EC3A 1ST9A 3DIEA 2YWNA 1N8JA 2R5GA 4F03A 4G0KA 3TGZA 4IKHA 2HXKA 3QDNA 5IMVA 3TJJA 6GSSA 1X5DA 3F4RA 4KF9A 1PMTA 1T3BA 1VF1A 3TJGA 4YAPA 4HI7A 3KIJA 4J57E 1WJKA 4MCUA 3H79A 3FZ4A 4G19A 1MD4A 2C8UA 5FWGA 1AUCA 5A5HB 3A2XA 3GKXA 4L8EA 2DIYA 2G0FA 4HQZA 2WULA 5G1LA 1XWBA 2MBTA 1EOHA 1XCCA 3GNJA 1GSDA 3CRTA 1TTZA 2FGXA 1PN0A 1BYEA 5JWOB 2C3TA 2DLXA 1FAAA 1TRUA 5ECOB 1S3AA 4OFNA 5H5QA 2PWJA 4PUAA 3KP8A 1F37A 4ZB6A 1M2BA 1EEMA 4X43A 2P5RA 3M8NA 5HFKA 2FY6A 1NW2A 1S3CA 4XS1A 5GAPD 4HOJA 3IBHA 4GLTA 3VI7A 4AKXB 1TU7A 2B5EA 3PR8A 5G30A 3UVHA 1OVNA 1F9MA 2QKEA 2UV8G 3F3QA 5HR1A 1OKTA 3RPNA 2KLXA 2FWGA 4KGIA 1XIYA 4CY8A 1TRWA 3K8NA 1J9BA 1TI3A 5B6NA 4BVXB 4ECCA 3FR6A 3FHKA 5A1NB 1WE0A 3KTBA 5AGYA 1SVLA 1X5CA 5IMAA 5HFIA 3CXGA 4JRRA 2IFQA 1ML6A 2KP1A 3GH9A 4GWRA 4X0XA 2YWOA 2IMDA 3MYDA 1GUHA 1NM3A 1VF2A 3ERWA 4G01A 1WRYA 2WFCA 3H4KA 2H0GA 1FG4A 1M7TA 4POMA 2CZ3A 2IMFA 3GL3A 3R3EA 4N30A 2GQKA 5F0GA 1JZOA 4V1Ag 4IQ1A 17GSA 4WETA 2AV4A 2H1DA 2OJLA 3GSTA 2YZHA 5EL8A 1A2MA 1GSYA 1RQMA 3G7YA 3VWUA 2ZCTA 2IWTA 2K8SA 3RHCA 4L0UA 3CSHA 3TB2A 4MF5A 2H1LA 1CQHA 2GZYA 3E9JB 1K0CA 4G0IA 4LMWA 5D9VA 2H1GA 1TOFA 4V2LA 1OE7A 5DJMA 3O6TA 1AQXA 4KDXA 4O92A 1UC7A 4TR1B 3Q6OA 1K0NA 1GH2A 2C3NA 4AGSA 4IP1A 2A4VA 4KH7A 4TVEA 4MJAA 1F2EA 3EPTA 5HFGA 3GYKA 4IW9A 1VGLA 3LWAA 3U5RE 2O89A 2MZCA 4GSSA 3F4SA 3FR9A 4PURA 4OFMA 5G5EA 2REMA 4RQXA 2GTUA 3LXTA 1LJRA 4YKFA 3W6GA 2AJQB 3FRCA 2HSMA 3V1WA 1PX6A 3C8EA 2R6KA 4PQHA 1SL0B 2CZ2A 2VKZG 3A5IA 2X8CA 1THXA 1W89A 2A2PA 5HQPA 4HZ2A 3CRUA 1WWJA 4EF0A 1C72A 1ZOFA 4FYBA 4ECBA 1WMJA 1YY7A 3FY7A 5D96A 5IM9A 4YKGA 3TOTA 2RM6A 3HHVA 1DE1A 5G1KA 4WKWA 2CQ9A 3ED3A 3HYPA 1ZZYA 5IQYA 5J4UA 2L4QA 2V32A 1Z6NA 3TKPA 4JE1A 4K2XA 1GTIA 2LRNA 2HZEB 4KA0A 3ZLPA 2PU9C 3BCKA 2QSIA 1M9BA 3F63A 4WBRD 1N25A 5F8BA 2E0QA 2LTKA 1A2JA 5GSTA 1KBNA 1OE8A 1GSFA 5J47A 1G6YA 2NDOA 2YV9A 5INYA 3P2AA 3M1GA 1U3IA 1SYRA 5E4WA 3IK7A 4JEDA 5KN3A 4HJ2A 4X4JA 2JZSA 1MDJA 5IMCA 3PGTA 3US3A 2KP2A 2DJ1A 4KDYA 3FK8A 3FZ5A 2B3SA 1HNCA 2B7JA 4AKHA 2R37A 3AY8A 4GSTA 5IMZA 3F8UA 1M2DA 4ML6A 5A34B 3DWVA 4BVYA 2LV3A 3M9KA 3QMXA 3D4MA 1DSBA 1X9WB 1NHOA 1V98A 2H74A 1A0FA 1U87A 5KN0A 2GVPA 3ZIJA 14GSA 1T4ZA 2LJAA 4EVMA 2IL3A 1NSWA 2X8GA 4FQUA 5B8BA 2B1KA 3KJYA 3RBTA 1MD3A 3ME8A 2LUSA 2H0IA 5DCHA 3ISOA 5CP1A 4FO5A 1QXHA 5CRDA 3EWLA 2JZTA 3TCOA 2FUG2 4KCAA 4ZB7A 2HSNB 4CW9A 1AC1A 3IAS2 5ECHB 4JR4A 1QMVA 2H66A 5FT3A 1M99A 4GTUA 2DKHA 2VD1A 3P7XA 1GNEA 4K9ZA 2DBCA 1PL2A 3PPUA 3DRNA 5COHA 2YJ7A 4EE0A 3I9V2 4YH2A 3O3TA 3EVIA 3TOUA 2JL4A 4MK3A 4IN0A 1AXDA 2VCTA 1Z7RA 5KOWA 5CNWA 4WR5A 3DYRA 5LCZA 3GTUA 1TI1A 4FIWA 2IMIA 4HEA2 2HYXA 1ZGNA 2F8FA 3IOSA 5ECIB 3LW9A 5C00A 3TU3B 1G0TA 1SD9A 2YCDA 2P31A 11GSA 2VM2A 2LRCA 3UAPA 2PUKC 3MIXA 2GT6A 4ZBAA 3KH7A 2AYTA 5GAND 1O85A 4IGJA 2KOKA 4JZQA 4G0LA 3APSA 5J9CA 12GSA 2EFHA 2VL2C 1HQOA 4HU9A 4MF6A 6GSTA 2DSAA 4LL1B 3GIXA 4IVFA 2O7KA 2IN3A 4MDCA 1B4PA 1K3LA 1MDIA 4J56E 5GZZB 4GQFA 4GXZA 1GSSA 5IO2A 4DSSA 3TUEA 20GSA 3VWWA 2FA8A 1AQWA 2O8VB 3RPPA 2HT9A 3DEXA 2RIIA 2J9HA 5DCGA 3D21A 1FO5A 4KSOA 2GQLA 3KEBA 2RM5A 5BMUA 4FYUA 4K7OA 4ZL7A 4EIPA 1TK5B 3QAVA 3D4TA 3HZ4A 4HJMA 4O5UA 3IHQA 3CMIA 4K5SA 2WRTA 2K8VA 2C1YA 5DBQA 4EKZA 3Q18A 3KXOA 4OO5A 4FH8A 3M0FA 5D9TA 2EIRA 4ZXGA 1OAZA 5DALB 1KEBA 5EVOA 2YN1A 4EDZA 1CQGA 2M46A 2FHEA 2DJ3A 2BTOT 3GKMA 4KCEA 2GZZA 1SKSB 4YQMA 2JZRA 3C73A 3ZRDA 1N2AA 2H8LA 2A2RA 3KMNA 4L0WA 3KTLA 2WB9A 2PGTA 16GSA 2A2SA 1SENA 2K18A 1G7EA 1XZOA 4ISDA 1BAYA 4EDYA 4BVYB 3UJ1A 4PNGA 4YQUA 4PGTA 1I9DA 3ZVJD 3WGEA 2YANA 3F6DA 3HD5A 1OC3A 2GSSA 3G9BA 4IELA 1V9WA 3F9UA 1SYXA 4QQ7A 3DVWA 1JLWA 2QGVA 1K0DA 2OADA 2XHFA 1XBSA 1YQ1A 4HQSA 2TRCP 1YJ6A 2NPBA 1ON4A 2NTOA 2H71A 4MH3A 2BJXA 3DXBA 1U6TA 3GKKA 1EOGA 4DSQA 4Q5FA 4NHWA 2HSHA 3KD0A 4GSNA 4IP6A 3IK9A 4E68A 2X64A 2WZ9A 3RDWA 7GSSA 2C0DA 4KB3A 4XS4B 4JU5A 1H75A 5IO0A 1FVKA 4G10A 4ZILA 4WEYA 3ZIVA 5B6MA 2PMTA 2DJ2A 5IPHA 2HFDA 4NV5A 2HRAA 5JCGA 4IHUA 1IYHA 4PUFC 2ALBA 1TXUA 1SK1A 3ZFLA 2I3YA 4AKGA 2GSRA 2WGRA 2YJHA 3BBYA 5G31A 5ECNB 4G9HA 3ZVJA 4Z7XA 1K0AA 4DVCA 1SK0A 4BWSA 4DSRA 4ICYA 1I5GA 3DVXA 5KEJA 1XWCA 1ZMAA 4F0CA 2C0EA 2CX4A 2J23A 5DQSA 5ABRA 3EURA 4HS1A 3ZMKA 5DQYA 2I9HA 4BA7A 5IMFA 2OE0A 4E8EA 5IIZA 4TKYA 1YKAA 4EO3A 1HYUA 4XS6A 4YAVA 4MA9A 3EU4A 4BL7B 1FVJA 3WGDA 2VCZA 3UBLA 2VLUA 2OACA 2QA1A 1R4WA 2H0HA 2HRKA 3KP9A 4LL4B 3TDGA 5J4YA 1TXXA 3VI5A 2FA4A 2B6MA 2GQMA 3F4TA 5ID2A 4TXOA 1X5EA 1FOHA 4X1UA 1JHBA 2H6XA 1GULA 3FKFA 4GRFA 1EV4A 1Q98A 1GSQA 4KAEA 5IMDA 2HI7A 3GX0A 4LMVA 1GTBA 3TKRA 3VPQA 5JWRB 4W66A 2VOCA 1GUKA 1K0OA 4GDFA 4N3ZA 4IJIA 3MAKA 1USBA 1F6MC 2KHPA 4IS0A 3QFBC 1AIUA 3L9VA 2M72A 1HD2A 4AF2A 2C3QA 2C4JA 1YDKA 2ZNMA 5IOWA 5CO3A 5GSSA 2QA2A 3IPZA 3LG6A 5J5NA 2RUFA 4MPGA 1GL8A 1FB0A 4OMVA 2UZ8A 3TJFA 4MJBA 1XW6A 1ZYQB 1R5AA 5FHIA 2DC5A 4XRDA 3L0HA 1VF3A 4KE3A 3QPMA 4FYCA 2QC7A 1EZKA 3APQA 1FOVA 22GSA 1SL1B 3TKSC 2X8HA 3U6VA 4PXOA 1JLVA 3BJ5A 2OKAA 5KN1A 2F3MA 1K0BA 2WJUA 5CRWA 2PN8A 1VF4A 2CAIA 2FWHA 4ILFA 4A5PA 4D73A 4F9ZA 5J3RA 1TDIA 3FYGA 4I2TA 2VCXA 2X49A 1T4YA 2F8AA 3LXZA 2VCWA 1TK8B 3UVTA 4L5LA 1BJXA 2WDUA 2N5BA 2XBQA 1ERUA 3EU3A 2VLTA 2LEGA 2PPTA 4Q5QA 3WD6A 3TKQA 3D6IA 1XXUA 4KNDA 3J7Yk 1QQ2A 1BF5A 2YOIA 2R4VA 1O7UA 4Z2RA 4RQRA 5A4UA 1GSEA 3GKNA 6GSUA 1TW9A 3IAM2 4LLRA 2EIQA 2V41A 1QUWA 3ERGA 1BEDA 2LJKA 3GMFA 2LNTA 2LSTA 1HNBA 2VM1A 3L9SA 1YZXA 1PN9A 1KTEA 1PKWA 3KMOA 5F07A 2B5YA 2VIMA 2LS5A 1PL1A 3KZQA 4F0BA 2E7PA 2H72A 1PRXA 2EFEA 3UMAA 4BPYA 1DE2A 3ZFBA 3VPTA 2HE3A 1FHEA 2K6VA 4WF4A 3GFKA 4N11A 2IMKA 2IFQB 2CVKA 2PVOC 2HRFA 2VCVA 3L78A 5CYYA 5ECLB 4CHSA 4O32A 3HVXA 2D2ZA 2PERA 4POKA 1JZRA 1R5PA 4CDOA 3NOFA 1JZWA 2FNOA 4H86A 4ID0A 2KUCA 5D9WA 1AQVA 3KH9A 5EY6A 4NHZA 1XVQA 4ZBBA 2L57A 3TRPA 1E6BA 1AW9A 3G7JA 3GUSA 4XRAA 1ZCPA 2OA7A 2L6CA 2OT3A 4IQAA 2AUVA 3GRXA 4TR0A 2TRXA 1BX9A 3KM6A 2GDRA 5CREA 1SD8A 3S9FA 3H93A 1VRSD 3KCMA 1PKZA 4RI6A 5A5HA 1V2AA 1ERTA 1LU4A 3A5WA 4MH2A 3VK9A 1A8YA 2O87A 4V2NA 3BD2A 1XOAA 1UVZA 4POLA 4QL7A 2ON7A 1PA3A 1X9SB 2HSMB 2L59A 5ECPB 3LGCA 4V2MA 2GZPA 1SKWB 2VL2A 2VL9A 3BCIA 2LRTA 2WCIA 2FWFA 3QAGA 2B5XA 4D73B 2LKUA 4XCSA 3EE2A 2HZFA 4P3YB 4OFTA 1NHYA 5HR3A 5F05A 1EWXA 1XPVA 3IRAA 1EP7A 2I1UA 1A2LA 4IJ3A 3C1SA 4USSA 5JCUA 3UARA 2E2GA 5J40A 3UEMA 5AIXA 3BOAA 4NV2A 3CSJA 1PGTA 3W8SA 4I97A 2VL3A 4BVXA 10GSA 3MSZA 1TRVA 5A1NA 4K5RA 3GA4A 2Z9SA 3MWHA 1ABAA 5H5RA 13GSA 2H75A 4ZBDA 2MYGA 2HRNA 4E8HA 3F3RA 1T00A 2H6ZA 1OC9A 1SKRB 3IR4A 4I5QA 5ECMB 5DAKA 3IE3A 3E3EA 2X4AA 1GTUA 2GT5A 5J4VA 3VWXA 2AHEA 2JU5A 3QCPA 3PH9A 4GQCA 4O5RA 2CA8A 1H4OA 3EINA 4DEJA 2V1MA 3C71A 2HLSA 1SL2B 1BG5A 4N0VA 5A4WA 2C0GA 1B48A 3CTGA 3KGKA 3H1NA 2PBJA 1YEXA 3LJRA 2RLIA 4ZB9A 4AKIA 2DJKA 1Z9HA 1TJDA 4TR1A 2XPEA 5A5KA 3LSZA 3FZAA 5L71A 1Z7PA 2E2MA 4QMKA 2XPDA 2IIYA 4QL9A 4K0NA 1Y1UA 2BMXA 1FB6A 2FD3A 4HUAA 3VURA 3NZNA 2R0GA 2EFCA 3HY2A 4KSMA 2I4AA 2V6OA 2YWMA 5ELGA 5E59A 4JR6A 1DBYA 1GLQA 2N5AA 1EGRA 3L4NA 4MABA 2L5LA 4Z2UA 2L4CA 3VWVA 1ERVA 4J2FA 4O5QA 3I69A 1T7PB 2VO4A 4KX4A 1DUGA 4I8BA 6GSWA 4MZWA 4OCFA 3WT1A 2GGTA 3GTUB 3HMJG 1Z3EA 2IMEA 3I43A 1PQNA 3HJOA 3LYPA 2XBIA 1F3BA 1T8EB 1PD21 2WS2A 1SVMA 1O8WA 1PSQA 2GSQA 5B7CA 1XWAA 1IYIA 5B8AA 3MNGA 4MZCA 2H01A 2GSTA 3GH6A 4V1Ap 3GV1A 1J08A 4ECJA 1ZYEA 3CYNA 1SK2A 3R2QA 4CY6A 5ECSA 2MBSA 1Y25A 2HZEA 5KN2A 4K2DA 2H1BA 1YF1A 3DMLA 2YNXA 4TOPA 4MF7A 1WOUA 4ZL9A 9GSSA 2H30A 5J41A 1RW1A 2R0PA 2V2GA 6GSVA 2LJRA 2EIOA 4PTSA 4Q5RA 2L6DA 3SBCA 1QGVA 3UL3A 3TRXA 4DSSB 2FLSA 4PQIA 1GTAA 1K3OA 3GL5A 1EGOA 3LQ7A 4ZB8A 3QOUA 4NWYA 1JZDA 5ENUA 4ACSA 1XOBA 5DJLA 1EEJA 2VAFA 1QFNA 2DJJA 3D22A 5BMUB 4KDUA 5JWQB 5A34A 2CX3A 2DKIA 3J7Yb 1EP8A 1O8XA 3C1RA 3GN3A 2MMAA 5D93A 5AISA 2JADA 18GSA 3APOA 1WIKA 1OC9B 2OBKA 5DAKB 2K9FA 3ME7A 19GSA 2DMLA 3G7IA 1V58A 2R0CA 4TW5A 3TKSE 2DIZA 5AN1A 2LNSA 2O5VA 4NPBA 5ELAA 5G5FA 8GSSA 2O85A 4ULXA 2VUPA 1UA5A 4F2IA 4RI7A 5IOXA 2TIRA 2HSNA 5CAXA 4AI6A 5ECKB 1A24A 2C0FA 1SVOA 3VLNA 4HZ4A 3A2WA 3H8QA 5A4VA 2B1LA 2VD0A 3LORA 1R7HA 5D8IA 1XW5A 4Z2TA 3ZTLA 1XWKA 1B9XC 4EC0A 1TKDB 3N9JA 4YQVA 4MLYA 1T1VA 4OO4A 1GLPA 3WYWA 1ZYPA 4JBBA 1YF0A 1M2AA 1SU9A 5G2ZA 1TRSA 3TKSA 1LBKA 1YEPA 1OYJA 5LD0A 3RAZA 3SWLA 3TJBA 1Y6EA 4XIHA 2YZUA 3QD9A 1YKCA 3IC8A 1GP1A 3HJPA 1TP9A 4MJCA 3M3MA 4PNFA 2H76A 2AB6A 3E0UA 3IV4A 3IXRA 2JSZA 3D5JA 1G6WA 1K0MA 2FWEA 4AJ6A 4TRXA 2GS3A 4OCEA 1V57A 4MZBA 4TR4A 5D9XA 2HSYA 4K8MA 3VFIA 3OR5A 1AAZA 4MMMA 4K7NA 4GF0A 3A3TA 3N5OA 4N10A 3O76A 3LEFA 3HA9A 1U88A 1GWCA 2ON5A 1MDKA 1FW1A 2CVBA 3EMPA 4XHMA 3UOMA 5LNKe 3JCML 3EYTA 2NBSA 4HDEA 2IPAA 2ZUPA 1XFLA 4EXJA 4PX1A 2IJYA 1JFUA 4O7HA 2YP6A 2YPMA 4OWYA 4BWQA 1XW9A 4TR3A 1TK0B 5C04A 3HZ8A 4HU7A 5DALA 1XWGA 1GSUA 2P0GA 5H5SA 4POBA 1BQ7A 2HRKB 4MNNA 2ES7A 3LFLA 5EPFA 1A0RP 2DJ0A 1S3DA 3HVVA 1ZYNA 5ID2B 1O81A 4TXOB 2MMZA 1OC8A 2VCQA 2JSYA 4ECIA 2YWIA 3C7MA 3IHGA 4ML1A 4AJ7A 1J0FA 3FR3A 2EC4A 1O6JA 2LQQA 2XC2A 5ECRB 2NVLA 4L5OA 5DVBA 3HJMA 6GSYA 1X9MB 2R3XA 3TJKA 1SJZA 3HCZA 3FW2A 2H6YA 1F3AA 3P90A 3QR6A 3FEUA 1R26A 1ACVA 5DDLA 2C80A 3UBKA 1SJIA 4WR4A 4KW6A 2X99A 2JACA 3EMXA 3ZREA 3M9JA 1YVLA 1THOA 3GSSA 1GRXA 2H73A 4K1FA 5CRGA 3D0ZA 3DKSA 5CRHA 2GLRA 1QK8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZL5 A;  4XTS A;  5F06 A;  3ZYW A;  5IPG A;  4WBJ A;  2OE1 A;  3HDC A;  3WGX A;  4MPF A;  1OKD A;  4AJ8 A;  1B4Q A;  3LYK A;  1O73 A;  1MTC A;  4NMU A;  4K0G A;  4I6X A;  1WP0 A;  4NXI A;  1XVW A;  4XS4 A;  4Q5N A;  2AAW A;  1SJ6 A;  3DD3 A;  3WT2 A;  1M0U A;  3UIW A;  3F6F A;  4OD7 A;  1URM A;  3QAW A;  3RHB A;  5HR2 A;  4I2U A;  2YV7 A;  4ZL8 A;  2F9S A;  4TXV A;  2LQO A;  3IA1 A;  3I6A A;  1M9A A;  4EL1 A;  6GSX A;  2I81 A;  5AIV A;  5JCW A;  3CSI A;  4K7I A;  3NIV A;  3PIN A;  3P8W A;  1U3A A;  3IDV A;  2HQT A;  5HR0 A;  1G7O A;  3CBU A;  3HKR A;  3TRQ A;  1ERW A;  1ILO A;  5D73 A;  2B7K A;  2N5F A;  1PX7 A;  3IC4 A;  1A8L A;  3DGQ A;  1E2Y A;  4BL7 A;  3Q19 A;  1MEK A;  3ZZX A;  4F82 A;  3ERF A;  2M80 A;  1HNA A;  2L5O A;  1ZL9 A;  3A2V A;  1EV9 A;  4GCI A;  1Z6M A;  2FCH A;  1B9Y C;  1V40 A;  2HNL A;  3MDK A;  3QFA C;  1K3Y A;  2H1A A;  5ECQ B;  2CVD A;  4LA1 A;  2F51 A;  3GX8 A;  4TN8 A;  2MMO A;  2VLV A;  2PVQ A;  4ZIJ A;  2DMM A;  4RUV A;  3GUR A;  2OE3 A;  4EUY A;  3F0I A;  1A23 A;  4IBP A;  5J9B A;  2CV4 A;  3HVS A;  1TU8 A;  4KUN A;  3ZIT A;  2RUE A;  1W4V A;  3CTF A;  3HXS A;  2CT6 A;  3L9U A;  2CAQ A;  1KNG A;  3FZ9 A;  2OBI A;  3GHA A;  2H19 A;  4G2E A;  1B8X A;  1Q4J A;  4MJE A;  1GNW A;  4WF5 A;  2G2Q A;  3ZML A;  1X0R A;  2MMN A;  4N0Z A;  3Q74 A;  4NAX A;  4K6X A;  4PQ1 A;  1WPI A;  2V6K A;  1RK4 A;  4WXT A;  1Z5Y E;  4MP4 A;  1GUM A;  1UN2 A;  2P5Q A;  2R2J A;  3W8J A;  2H70 A;  3EC3 A;  1ST9 A;  3DIE A;  2YWN A;  1N8J A;  2R5G A;  4F03 A;  4G0K A;  3TGZ A;  4IKH A;  2HXK A;  3QDN A;  5IMV A;  3TJJ A;  6GSS A;  1X5D A;  3F4R A;  4KF9 A;  1PMT A;  1T3B A;  1VF1 A;  3TJG A;  4YAP A;  4HI7 A;  3KIJ A;  4J57 E;  1WJK A;  4MCU A;  3H79 A;  3FZ4 A;  4G19 A;  1MD4 A;  2C8U A;  5FWG A;  1AUC A;  3A2X A;  3GKX A;  4L8E A;  2DIY A;  2G0F A;  4HQZ A;  2WUL A;  5G1L A;  1XWB A;  2MBT A;  1EOH A;  1XCC A;  3GNJ A;  1GSD A;  3CRT A;  1TTZ A;  2FGX A;  1BYE A;  5JWO B;  2C3T A;  2DLX A;  1FAA A;  1TRU A;  5ECO B;  1S3A A;  4OFN A;  5H5Q A;  2PWJ A;  4PUA A;  3KP8 A;  1F37 A;  4ZB6 A;  1M2B A;  1EEM A;  4X43 A;  2P5R A;  3M8N A;  5HFK A;  2FY6 A;  1NW2 A;  1S3C A;  4XS1 A;  5GAP D;  4HOJ A;  3IBH A;  4GLT A;  3VI7 A;  1TU7 A;  2B5E A;  3PR8 A;  5G30 A;  3UVH A;  1OVN A;  1F9M A;  2QKE A;  3F3Q A;  5HR1 A;  1OKT A;  3RPN A;  2KLX A;  2FWG A;  4KGI A;  1XIY A;  1TRW A;  3K8N A;  1J9B A;  1TI3 A;  5B6N A;  4BVX B;  4ECC A;  3FR6 A;  3FHK A;  1WE0 A;  3KTB A;  5AGY A;  1X5C A;  5IMA A;  5HFI A;  3CXG A;  4JRR A;  2IFQ A;  1ML6 A;  2KP1 A;  3GH9 A;  4GWR A;  4X0X A;  2YWO A;  2IMD A;  1GUH A;  1NM3 A;  1VF2 A;  3ERW A;  1WRY A;  2WFC A;  3H4K A;  2H0G A;  1FG4 A;  1M7T A;  4POM A;  2CZ3 A;  2IMF A;  3GL3 A;  3R3E A;  4N30 A;  2GQK A;  5F0G A;  1JZO A;  4V1A g;  4IQ1 A;  17GS A;  4WET A;  2AV4 A;  2H1D A;  2OJL A;  3GST A;  2YZH A;  5EL8 A;  1A2M A;  1GSY A;  1RQM A;  3G7Y A;  3VWU A;  2ZCT A;  2IWT A;  2K8S A;  3RHC A;  4L0U A;  3CSH A;  3TB2 A;  4MF5 A;  1CQH A;  2GZY A;  3E9J B;  1K0C A;  4G0I A;  4LMW A;  5D9V A;  2H1G A;  1TOF A;  4V2L A;  1OE7 A;  5DJM A;  3O6T A;  1AQX A;  4KDX A;  4O92 A;  1UC7 A;  4TR1 B;  3Q6O A;  1K0N A;  1GH2 A;  2C3N A;  4AGS A;  4IP1 A;  2A4V A;  4KH7 A;  4TVE A;  4MJA A;  1F2E A;  5HFG A;  3GYK A;  4IW9 A;  1VGL A;  3LWA A;  3U5R E;  2O89 A;  2MZC A;  4GSS A;  3F4S A;  3FR9 A;  4PUR A;  4OFM A;  5G5E A;  2REM A;  4RQX A;  2GTU A;  3LXT A;  1LJR A;  3W6G A;  2AJQ B;  3FRC A;  2HSM A;  3V1W A;  1PX6 A;  3C8E A;  2R6K A;  4PQH A;  1SL0 B;  2CZ2 A;  2X8C A;  1THX A;  1W89 A;  5HQP A;  4HZ2 A;  3CRU A;  1WWJ A;  4EF0 A;  1C72 A;  1ZOF A;  4FYB A;  4ECB A;  1WMJ A;  1YY7 A;  3FY7 A;  5D96 A;  5IM9 A;  3TOT A;  2RM6 A;  3HHV A;  1DE1 A;  5G1K A;  4WKW A;  2CQ9 A;  3ED3 A;  3HYP A;  1ZZY A;  5IQY A;  5J4U A;  2L4Q A;  2V32 A;  1Z6N A;  3TKP A;  4JE1 A;  1GTI A;  2LRN A;  2HZE B;  4KA0 A;  3ZLP A;  2PU9 C;  3BCK A;  2QSI A;  1M9B A;  3F63 A;  4WBR D;  5F8B A;  2E0Q A;  2LTK A;  1A2J A;  5GST A;  1KBN A;  1OE8 A;  1GSF A;  1G6Y A;  2NDO A;  2YV9 A;  5INY A;  3P2A A;  3M1G A;  1U3I A;  1SYR A;  5E4W A;  3IK7 A;  4JED A;  5KN3 A;  4HJ2 A;  2JZS A;  1MDJ A;  5IMC A;  3PGT A;  3US3 A;  2KP2 A;  2DJ1 A;  4KDY A;  3FK8 A;  3FZ5 A;  2B3S A;  1HNC A;  2B7J A;  2R37 A;  3AY8 A;  4GST A;  5IMZ A;  3F8U A;  1M2D A;  4ML6 A;  3DWV A;  4BVY A;  2LV3 A;  3M9K A;  3QMX A;  3D4M A;  1DSB A;  1X9W B;  1NHO A;  1V98 A;  2H74 A;  1A0F A;  1U87 A;  5KN0 A;  2GVP A;  3ZIJ A;  14GS A;  1T4Z A;  2LJA A;  4EVM A;  2IL3 A;  1NSW A;  2X8G A;  4FQU A;  5B8B A;  2B1K A;  3KJY A;  3RBT A;  1MD3 A;  3ME8 A;  2LUS A;  2H0I A;  5DCH A;  3ISO A;  5CP1 A;  4FO5 A;  1QXH A;  5CRD A;  3EWL A;  2JZT A;  3TCO A;  2FUG 2;  4KCA A;  2HSN B;  4CW9 A;  1AC1 A;  3IAS 2;  5ECH B;  4JR4 A;  1QMV A;  2H66 A;  5FT3 A;  1M99 A;  4GTU A;  2VD1 A;  3P7X A;  1GNE A;  4K9Z A;  2DBC A;  1PL2 A;  3PPU A;  3DRN A;  5COH A;  2YJ7 A;  4EE0 A;  3I9V 2;  4YH2 A;  3O3T A;  3EVI A;  3TOU A;  2JL4 A;  4MK3 A;  4IN0 A;  1AXD A;  2VCT A;  1Z7R A;  5CNW A;  4WR5 A;  3DYR A;  5LCZ A;  3GTU A;  1TI1 A;  4FIW A;  2IMI A;  4HEA 2;  2HYX A;  1ZGN A;  2F8F A;  3IOS A;  5ECI B;  5C00 A;  1G0T A;  1SD9 A;  2YCD A;  2P31 A;  11GS A;  2VM2 A;  2LRC A;  3UAP A;  2PUK C;  2GT6 A;  4ZBA A;  3KH7 A;  2AYT A;  5GAN D;  1O85 A;  4IGJ A;  2KOK A;  4JZQ A;  4G0L A;  3APS A;  5J9C A;  12GS A;  2VL2 C;  1HQO A;  4HU9 A;  4MF6 A;  6GST A;  2DSA A;  4LL1 B;  3GIX A;  4IVF A;  2O7K A;  2IN3 A;  4MDC A;  1B4P A;  1K3L A;  1MDI A;  4J56 E;  5GZZ B;  4GQF A;  4GXZ A;  1GSS A;  5IO2 A;  4DSS A;  3TUE A;  20GS A;  3VWW A;  2FA8 A;  1AQW A;  2O8V B;  3RPP A;  2HT9 A;  3DEX A;  2RII A;  2J9H A;  5DCG A;  3D21 A;  1FO5 A;  4KSO A;  2GQL A;  3KEB A;  2RM5 A;  5BMU A;  4FYU A;  4K7O A;  4ZL7 A;  1TK5 B;  3QAV A;  3D4T A;  3HZ4 A;  4HJM A;  3IHQ A;  3CMI A;  2WRT A;  2K8V A;  2C1Y A;  5DBQ A;  4EKZ A;  3Q18 A;  3KXO A;  4OO5 A;  4FH8 A;  3M0F A;  5D9T A;  2EIR A;  4ZXG A;  1OAZ A;  5DAL B;  1KEB A;  5EVO A;  2YN1 A;  4EDZ A;  1CQG A;  2M46 A;  2FHE A;  2DJ3 A;  2BTO T;  3GKM A;  4KCE A;  2GZZ A;  1SKS B;  4YQM A;  2JZR A;  3C73 A;  3ZRD A;  1N2A A;  2H8L A;  2A2R A;  3KMN A;  4L0W A;  3KTL A;  2WB9 A;  2PGT A;  16GS A;  2A2S A;  1SEN A;  2K18 A;  1G7E A;  1XZO A;  4ISD A;  1BAY A;  4EDY A;  4BVY B;  3UJ1 A;  4PNG A;  4YQU A;  4PGT A;  1I9D A;  3ZVJ D;  3WGE A;  2YAN A;  3F6D A;  3HD5 A;  1OC3 A;  2GSS A;  3G9B A;  4IEL A;  1V9W A;  3F9U A;  1SYX A;  4QQ7 A;  3DVW A;  1JLW A;  2QGV A;  1K0D A;  2OAD A;  2XHF A;  1XBS A;  1YQ1 A;  4HQS A;  2TRC P;  1YJ6 A;  2NPB A;  1ON4 A;  2NTO A;  2H71 A;  4MH3 A;  2BJX A;  3DXB A;  1U6T A;  3GKK A;  1EOG A;  4DSQ A;  4Q5F A;  4NHW A;  2HSH A;  3KD0 A;  4GSN A;  4IP6 A;  3IK9 A;  2X64 A;  2WZ9 A;  3RDW A;  7GSS A;  2C0D A;  4KB3 A;  4XS4 B;  4JU5 A;  1H75 A;  5IO0 A;  1FVK A;  4G10 A;  4ZIL A;  4WEY A;  3ZIV A;  5B6M A;  2PMT A;  2DJ2 A;  5IPH A;  2HFD A;  4NV5 A;  2HRA A;  5JCG A;  4IHU A;  1IYH A;  4PUF C;  2ALB A;  1SK1 A;  3ZFL A;  2I3Y A;  2GSR A;  2WGR A;  2YJH A;  3BBY A;  5G31 A;  5ECN B;  4G9H A;  3ZVJ A;  4Z7X A;  1K0A A;  4DVC A;  1SK0 A;  4BWS A;  4DSR A;  1I5G A;  3DVX A;  5KEJ A;  1XWC A;  1ZMA A;  4F0C A;  2C0E A;  2CX4 A;  2J23 A;  5DQS A;  5ABR A;  3EUR A;  4HS1 A;  3ZMK A;  5DQY A;  2I9H A;  4BA7 A;  5IMF A;  2OE0 A;  4E8E A;  5IIZ A;  4TKY A;  1YKA A;  4EO3 A;  1HYU A;  4XS6 A;  4YAV A;  4MA9 A;  3EU4 A;  4BL7 B;  1FVJ A;  3WGD A;  2VCZ A;  3UBL A;  2VLU A;  2OAC A;  1R4W A;  2H0H A;  2HRK A;  3KP9 A;  4LL4 B;  3TDG A;  1TXX A;  3VI5 A;  2FA4 A;  2B6M A;  2GQM A;  3F4T A;  5ID2 A;  4TXO A;  1X5E A;  4X1U A;  1JHB A;  2H6X A;  1GUL A;  3FKF A;  4GRF A;  1EV4 A;  1Q98 A;  1GSQ A;  4KAE A;  5IMD A;  2HI7 A;  3GX0 A;  4LMV A;  1GTB A;  3TKR A;  3VPQ A;  5JWR B;  2VOC A;  1GUK A;  1K0O A;  4IJI A;  3MAK A;  1USB A;  1F6M C;  2KHP A;  4IS0 A;  3QFB C;  1AIU A;  3L9V A;  2M72 A;  1HD2 A;  4AF2 A;  2C3Q A;  2C4J A;  1YDK A;  2ZNM A;  5IOW A;  5CO3 A;  5GSS A;  3IPZ A;  3LG6 A;  5J5N A;  2RUF A;  4MPG A;  1GL8 A;  1FB0 A;  4OMV A;  2UZ8 A;  3TJF A;  4MJB A;  1XW6 A;  1ZYQ B;  1R5A A;  5FHI A;  2DC5 A;  4XRD A;  3L0H A;  1VF3 A;  4KE3 A;  3QPM A;  4FYC A;  2QC7 A;  1EZK A;  3APQ A;  1FOV A;  22GS A;  1SL1 B;  3TKS C;  2X8H A;  3U6V A;  4PXO A;  1JLV A;  3BJ5 A;  2OKA A;  5KN1 A;  2F3M A;  1K0B A;  2WJU A;  5CRW A;  2PN8 A;  1VF4 A;  2CAI A;  2FWH A;  4ILF A;  4D73 A;  4F9Z A;  5J3R A;  1TDI A;  3FYG A;  4I2T A;  2VCX A;  1T4Y A;  2F8A A;  3LXZ A;  2VCW A;  1TK8 B;  3UVT A;  4L5L A;  1BJX A;  2WDU A;  2N5B A;  2XBQ A;  1ERU A;  3EU3 A;  2VLT A;  2LEG A;  2PPT A;  4Q5Q A;  3WD6 A;  3TKQ A;  3D6I A;  1XXU A;  4KND A;  3J7Y k;  1QQ2 A;  2YOI A;  2R4V A;  1O7U A;  4RQR A;  5A4U A;  1GSE A;  3GKN A;  6GSU A;  1TW9 A;  3IAM 2;  4LLR A;  2EIQ A;  2V41 A;  1QUW A;  3ERG A;  1BED A;  2LJK A;  3GMF A;  2LNT A;  2LST A;  1HNB A;  2VM1 A;  3L9S A;  1YZX A;  1PN9 A;  1KTE A;  1PKW A;  3KMO A;  5F07 A;  2B5Y A;  2VIM A;  2LS5 A;  1PL1 A;  3KZQ A;  4F0B A;  2E7P A;  2H72 A;  1PRX A;  3UMA A;  4BPY A;  1DE2 A;  3ZFB A;  3VPT A;  2HE3 A;  1FHE A;  2K6V A;  4WF4 A;  3GFK A;  4N11 A;  2IMK A;  2IFQ B;  2CVK A;  2PVO C;  2HRF A;  2VCV A;  3L78 A;  5CYY A;  5ECL B;  4CHS A;  4O32 A;  3HVX A;  2D2Z A;  2PER A;  4POK A;  1JZR A;  1R5P A;  4CDO A;  3NOF A;  1JZW A;  2FNO A;  4H86 A;  4ID0 A;  2KUC A;  5D9W A;  1AQV A;  3KH9 A;  5EY6 A;  4NHZ A;  1XVQ A;  4ZBB A;  2L57 A;  3TRP A;  1E6B A;  1AW9 A;  3G7J A;  3GUS A;  4XRA A;  1ZCP A;  2OA7 A;  2L6C A;  4IQA A;  2AUV A;  3GRX A;  4TR0 A;  2TRX A;  1BX9 A;  3KM6 A;  2GDR A;  5CRE A;  1SD8 A;  3S9F A;  3H93 A;  1VRS D;  3KCM A;  1PKZ A;  4RI6 A;  1V2A A;  1ERT A;  1LU4 A;  3A5W A;  4MH2 A;  3VK9 A;  1A8Y A;  2O87 A;  4V2N A;  3BD2 A;  1XOA A;  1UVZ A;  4POL A;  4QL7 A;  2ON7 A;  1PA3 A;  1X9S B;  2HSM B;  2L59 A;  5ECP B;  3LGC A;  4V2M A;  2GZP A;  1SKW B;  2VL2 A;  2VL9 A;  3BCI A;  2LRT A;  2WCI A;  2FWF A;  3QAG A;  2B5X A;  4D73 B;  2LKU A;  4XCS A;  3EE2 A;  2HZF A;  4P3Y B;  4OFT A;  1NHY A;  5HR3 A;  5F05 A;  1EWX A;  1XPV A;  3IRA A;  1EP7 A;  2I1U A;  1A2L A;  4IJ3 A;  3C1S A;  4USS A;  5JCU A;  3UAR A;  2E2G A;  3UEM A;  5AIX A;  3BOA A;  4NV2 A;  3CSJ A;  1PGT A;  3W8S A;  4I97 A;  2VL3 A;  4BVX A;  10GS A;  3MSZ A;  1TRV A;  3GA4 A;  2Z9S A;  3MWH A;  1ABA A;  5H5R A;  13GS A;  2H75 A;  4ZBD A;  2MYG A;  2HRN A;  4E8H A;  3F3R A;  1T00 A;  2H6Z A;  1OC9 A;  1SKR B;  3IR4 A;  4I5Q A;  5ECM B;  5DAK A;  3IE3 A;  3E3E A;  1GTU A;  2GT5 A;  3VWX A;  2AHE A;  2JU5 A;  3QCP A;  3PH9 A;  4GQC A;  4O5R A;  2CA8 A;  1H4O A;  3EIN A;  4DEJ A;  2V1M A;  3C71 A;  2HLS A;  1SL2 B;  1BG5 A;  4N0V A;  5A4W A;  2C0G A;  1B48 A;  3CTG A;  3KGK A;  3H1N A;  2PBJ A;  1YEX A;  3LJR A;  2RLI A;  4ZB9 A;  2DJK A;  1Z9H A;  1TJD A;  4TR1 A;  2XPE A;  5A5K A;  3LSZ A;  3FZA A;  5L71 A;  1Z7P A;  2E2M A;  2XPD A;  2IIY A;  4QL9 A;  4K0N A;  2BMX A;  1FB6 A;  2FD3 A;  4HUA A;  3VUR A;  3NZN A;  3HY2 A;  4KSM A;  2I4A A;  2V6O A;  2YWM A;  5ELG A;  5E59 A;  4JR6 A;  1DBY A;  1GLQ A;  2N5A A;  1EGR A;  3L4N A;  4MAB A;  2L5L A;  2L4C A;  3VWV A;  1ERV A;  4J2F A;  3I69 A;  1T7P B;  2VO4 A;  4KX4 A;  1DUG A;  4I8B A;  6GSW A;  4MZW A;  4OCF A;  3WT1 A;  2GGT A;  3GTU B;  1Z3E A;  2IME A;  3I43 A;  1PQN A;  3HJO A;  3LYP A;  2XBI A;  1F3B A;  1T8E B;  1PD2 1;  2WS2 A;  1O8W A;  1PSQ A;  2GSQ A;  5B7C A;  1XWA A;  1IYI A;  5B8A A;  3MNG A;  4MZC A;  2H01 A;  2GST A;  3GH6 A;  4V1A p;  3GV1 A;  1J08 A;  4ECJ A;  1ZYE A;  3CYN A;  1SK2 A;  3R2Q A;  5ECS A;  2MBS A;  1Y25 A;  2HZE A;  5KN2 A;  4K2D A;  2H1B A;  1YF1 A;  3DML A;  2YNX A;  4TOP A;  4MF7 A;  1WOU A;  4ZL9 A;  9GSS A;  2H30 A;  5J41 A;  1RW1 A;  2V2G A;  6GSV A;  2LJR A;  2EIO A;  4PTS A;  4Q5R A;  2L6D A;  3SBC A;  1QGV A;  3UL3 A;  3TRX A;  4DSS B;  2FLS A;  4PQI A;  1GTA A;  1K3O A;  3GL5 A;  1EGO A;  3LQ7 A;  4ZB8 A;  3QOU A;  4NWY A;  1JZD A;  5ENU A;  4ACS A;  1XOB A;  5DJL A;  1EEJ A;  2VAF A;  1QFN A;  2DJJ A;  3D22 A;  4KDU A;  5JWQ B;  2CX3 A;  3J7Y b;  1EP8 A;  1O8X A;  3C1R A;  3GN3 A;  2MMA A;  5D93 A;  5AIS A;  2JAD A;  18GS A;  3APO A;  1WIK A;  1OC9 B;  2OBK A;  5DAK B;  2K9F A;  3ME7 A;  19GS A;  2DML A;  3G7I A;  1V58 A;  4TW5 A;  3TKS E;  2DIZ A;  5AN1 A;  2LNS A;  4NPB A;  5ELA A;  5G5F A;  8GSS A;  2O85 A;  4ULX A;  2VUP A;  1UA5 A;  4F2I A;  4RI7 A;  5IOX A;  2TIR A;  5CAX A;  5ECK B;  1A24 A;  2C0F A;  3VLN A;  4HZ4 A;  3A2W A;  3H8Q A;  5A4V A;  2B1L A;  2VD0 A;  3LOR A;  1R7H A;  5D8I A;  1XW5 A;  3ZTL A;  1XWK A;  1B9X C;  4EC0 A;  1TKD B;  3N9J A;  4YQV A;  4MLY A;  1T1V A;  4OO4 A;  1GLP A;  3WYW A;  4JBB A;  1YF0 A;  1M2A A;  1SU9 A;  5G2Z A;  1TRS A;  3TKS A;  1LBK A;  1YEP A;  1OYJ A;  5LD0 A;  3RAZ A;  3SWL A;  3TJB A;  1Y6E A;  4XIH A;  3QD9 A;  2YZU A;  1YKC A;  3IC8 A;  1GP1 A;  3HJP A;  1TP9 A;  4MJC A;  3M3M A;  4PNF A;  2H76 A;  2AB6 A;  3E0U A;  3IV4 A;  3IXR A;  2JSZ A;  3D5J A;  1G6W A;  1K0M A;  2FWE A;  4AJ6 A;  4TRX A;  2GS3 A;  4OCE A;  1V57 A;  4MZB A;  4TR4 A;  5D9X A;  2HSY A;  4K8M A;  3VFI A;  3OR5 A;  1AAZ A;  4MMM A;  4K7N A;  4GF0 A;  3A3T A;  3N5O A;  4N10 A;  3O76 A;  3LEF A;  3HA9 A;  1U88 A;  1GWC A;  2ON5 A;  1MDK A;  1FW1 A;  2CVB A;  3EMP A;  4XHM A;  3UOM A;  5LNK e;  3JCM L;  3EYT A;  2NBS A;  4HDE A;  2IPA A;  2ZUP A;  1XFL A;  4EXJ A;  4PX1 A;  2IJY A;  1JFU A;  4O7H A;  2YP6 A;  2YPM A;  4OWY A;  4BWQ A;  1XW9 A;  4TR3 A;  1TK0 B;  5C04 A;  3HZ8 A;  4HU7 A;  5DAL A;  1XWG A;  1GSU A;  2P0G A;  5H5S A;  4POB A;  1BQ7 A;  2HRK B;  2ES7 A;  3LFL A;  5EPF A;  1A0R P;  2DJ0 A;  1S3D A;  3HVV A;  5ID2 B;  1O81 A;  4TXO B;  2MMZ A;  1OC8 A;  2VCQ A;  2JSY A;  4ECI A;  2YWI A;  3C7M A;  4ML1 A;  4AJ7 A;  1J0F A;  3FR3 A;  2EC4 A;  1O6J A;  2LQQ A;  2XC2 A;  5ECR B;  2NVL A;  4L5O A;  5DVB A;  3HJM A;  6GSY A;  1X9M B;  2R3X A;  3TJK A;  1SJZ A;  3HCZ A;  3FW2 A;  2H6Y A;  1F3A A;  3P90 A;  3QR6 A;  3FEU A;  1R26 A;  1ACV A;  5DDL A;  2C80 A;  3UBK A;  1SJI A;  4WR4 A;  4KW6 A;  2X99 A;  2JAC A;  3EMX A;  3ZRE A;  3M9J A;  1THO A;  3GSS A;  1GRX A;  2H73 A;  4K1F A;  5CRG A;  3D0Z A;  3DKS A;  5CRH A;  2GLR A;  1QK8 A; 
#chains in the Genus database with same CATH topology
 3ZL5 A;  4XTS A;  5F06 A;  3ZYW A;  5IPG A;  4WBJ A;  2OE1 A;  3HDC A;  3WGX A;  4MPF A;  1OKD A;  4AJ8 A;  1B4Q A;  3LYK A;  1O73 A;  1MTC A;  3FMW A;  4NMU A;  4K0G A;  4I6X A;  1WP0 A;  4NXI A;  1XVW A;  4XS4 A;  4Q5N A;  2AAW A;  1SJ6 A;  3DD3 A;  3WT2 A;  1M0U A;  3UIW A;  3F6F A;  2A4H A;  4OD7 A;  1URM A;  3QAW A;  3RHB A;  5HR2 A;  4I2U A;  2YV7 A;  4ZL8 A;  2F9S A;  4TXV A;  2LQO A;  3IA1 A;  3I6A A;  2EFD A;  1M9A A;  4EL1 A;  6GSX A;  2I81 A;  5AIV A;  5JCW A;  3CSI A;  4K7I A;  3NIV A;  3PIN A;  3P8W A;  1U3A A;  3IDV A;  3CWG A;  2HQT A;  5HR0 A;  1G7O A;  3CBU A;  3HKR A;  3TRQ A;  1ERW A;  1ILO A;  5D73 A;  2B7K A;  2N5F A;  1PX7 A;  3IC4 A;  1A8L A;  3DGQ A;  1E2Y A;  4BL7 A;  3Q19 A;  2WW3 A;  1MEK A;  3ZZX A;  4F82 A;  3ERF A;  2M80 A;  1HNA A;  2L5O A;  1ZL9 A;  3A2V A;  1EV9 A;  4GCI A;  1Z6M A;  2FCH A;  1B9Y C;  1V40 A;  1BG1 A;  2HNL A;  3MDK A;  3QFA C;  1K3Y A;  5BRT A;  2H1A A;  5ECQ B;  2CVD A;  4LA1 A;  5KOX A;  2F51 A;  4HSC X;  3GX8 A;  4TN8 A;  2MMO A;  2WVX A;  2VLV A;  2PVQ A;  4ZIJ A;  2DMM A;  4RUV A;  3GUR A;  2OE3 A;  4EUY A;  3F0I A;  1A23 A;  4IBP A;  5J9B A;  2CV4 A;  3HVS A;  1TU8 A;  4KUN A;  3ZIT A;  2RUE A;  1W4V A;  4EIQ A;  3CTF A;  3HXS A;  2CT6 A;  2WZS A;  3L9U A;  2CAQ A;  1KNG A;  1YEW C;  3FZ9 A;  2OBI A;  3GHA A;  2H19 A;  4G2E A;  1B8X A;  1Q4J A;  4MJE A;  1GNW A;  4WF5 A;  2G2Q A;  3ZML A;  1X0R A;  2MMN A;  4N0Z A;  3Q74 A;  4NAX A;  4K6X A;  4PQ1 A;  1WPI A;  2V6K A;  1RK4 A;  4WXT A;  2WW1 A;  1Z5Y E;  4MP4 A;  1GUM A;  1UN2 A;  2P5Q A;  2R2J A;  3W8J A;  2H70 A;  3EC3 A;  1ST9 A;  3DIE A;  2YWN A;  1N8J A;  2R5G A;  4F03 A;  4G0K A;  3TGZ A;  4IKH A;  2HXK A;  3QDN A;  5IMV A;  3TJJ A;  6GSS A;  1X5D A;  3F4R A;  4KF9 A;  1PMT A;  1T3B A;  1VF1 A;  3TJG A;  4YAP A;  4HI7 A;  3KIJ A;  4J57 E;  1WJK A;  4MCU A;  3H79 A;  3FZ4 A;  4G19 A;  1MD4 A;  2C8U A;  5FWG A;  1AUC A;  5A5H B;  3A2X A;  3GKX A;  4L8E A;  2DIY A;  2G0F A;  4HQZ A;  2WUL A;  5G1L A;  1XWB A;  2MBT A;  1EOH A;  1XCC A;  3GNJ A;  1GSD A;  3CRT A;  1TTZ A;  2FGX A;  1PN0 A;  1BYE A;  5JWO B;  2C3T A;  2DLX A;  1FAA A;  1TRU A;  5ECO B;  1S3A A;  4OFN A;  5H5Q A;  2PWJ A;  4PUA A;  3KP8 A;  1F37 A;  4ZB6 A;  1M2B A;  1EEM A;  4X43 A;  2P5R A;  3M8N A;  5HFK A;  2FY6 A;  1NW2 A;  1S3C A;  4XS1 A;  5GAP D;  4HOJ A;  3IBH A;  4GLT A;  3VI7 A;  4AKX B;  1TU7 A;  2B5E A;  3PR8 A;  5G30 A;  3UVH A;  1OVN A;  1F9M A;  2QKE A;  2UV8 G;  4FXY P;  3F3Q A;  5HR1 A;  1OKT A;  3RPN A;  2KLX A;  2FWG A;  4KGI A;  1XIY A;  4CY8 A;  1TRW A;  3K8N A;  1J9B A;  1TI3 A;  5B6N A;  4BVX B;  4ECC A;  3FR6 A;  3FHK A;  5A1N B;  1WE0 A;  3KTB A;  5AGY A;  1SVL A;  1X5C A;  5IMA A;  5HFI A;  3CXG A;  4JRR A;  2IFQ A;  1ML6 A;  2KP1 A;  3GH9 A;  4GWR A;  4X0X A;  2YWO A;  2IMD A;  3MYD A;  1GUH A;  1NM3 A;  1VF2 A;  2WW0 A;  3ERW A;  4G01 A;  1WRY A;  2WFC A;  3H4K A;  2H0G A;  1FG4 A;  1M7T A;  4POM A;  2CZ3 A;  2O3E A;  2IMF A;  3GL3 A;  3R3E A;  4N30 A;  2WVX B;  2GQK A;  5F0G A;  1JZO A;  4V1A g;  4IQ1 A;  17GS A;  4WET A;  2AV4 A;  2H1D A;  2OJL A;  3GST A;  2YZH A;  5EL8 A;  1A2M A;  1GSY A;  1RQM A;  3G7Y A;  3VWU A;  2ZCT A;  2IWT A;  2K8S A;  3RHC A;  4L0U A;  3CSH A;  3TB2 A;  4MF5 A;  2H1L A;  1CQH A;  2GZY A;  3E9J B;  1K0C A;  4G0I A;  4LMW A;  5D9V A;  2H1G A;  1TOF A;  4V2L A;  1OE7 A;  5DJM A;  3O6T A;  1AQX A;  4KDX A;  4O92 A;  1UC7 A;  4TR1 B;  3Q6O A;  1K0N A;  1GH2 A;  2C3N A;  4AGS A;  4IP1 A;  2A4V A;  4KH7 A;  4TVE A;  4MJA A;  1F2E A;  3EPT A;  5HFG A;  3GYK A;  4IW9 A;  1VGL A;  3LWA A;  3U5R E;  2O89 A;  2MZC A;  4GSS A;  3F4S A;  3FR9 A;  4PUR A;  4OFM A;  5G5E A;  2REM A;  4RQX A;  2GTU A;  3LXT A;  1LJR A;  4YKF A;  3W6G A;  2AJQ B;  3FRC A;  2HSM A;  3V1W A;  1PX6 A;  3C8E A;  2R6K A;  4PQH A;  1SL0 B;  2CZ2 A;  4PI2 C;  2VKZ G;  3A5I A;  2X8C A;  1THX A;  1W89 A;  2A2P A;  5HQP A;  4HZ2 A;  3CRU A;  1WWJ A;  4EF0 A;  1C72 A;  1ZOF A;  4FYB A;  4ECB A;  1WMJ A;  1YY7 A;  3FY7 A;  5D96 A;  5IM9 A;  4YKG A;  3TOT A;  2RM6 A;  3HHV A;  1DE1 A;  5G1K A;  4WKW A;  2CQ9 A;  3ED3 A;  3HYP A;  1ZZY A;  5IQY A;  5J4U A;  2L4Q A;  2V32 A;  1Z6N A;  3TKP A;  4JE1 A;  4K2X A;  1GTI A;  2LRN A;  2HZE B;  4KA0 A;  3ZLP A;  2PU9 C;  3BCK A;  2QSI A;  1M9B A;  3F63 A;  4WBR D;  1N25 A;  5F8B A;  2E0Q A;  2LTK A;  1A2J A;  5GST A;  1KBN A;  1OE8 A;  1GSF A;  5J47 A;  1G6Y A;  2NDO A;  4PHZ C;  2YV9 A;  5INY A;  3P2A A;  3M1G A;  1U3I A;  1SYR A;  5E4W A;  3IK7 A;  4JED A;  5KN3 A;  4HJ2 A;  4X4J A;  2JZS A;  1MDJ A;  5IMC A;  3PGT A;  3US3 A;  2KP2 A;  2DJ1 A;  4KDY A;  3FK8 A;  3FZ5 A;  2B3S A;  1HNC A;  2B7J A;  4AKH A;  2R37 A;  3AY8 A;  4GST A;  5IMZ A;  3F8U A;  1M2D A;  4ML6 A;  5A34 B;  3DWV A;  4BVY A;  2LV3 A;  3M9K A;  3QMX A;  3D4M A;  1DSB A;  1X9W B;  1NHO A;  1V98 A;  2H74 A;  1A0F A;  1U87 A;  5KN0 A;  2GVP A;  3ZIJ A;  14GS A;  1T4Z A;  2LJA A;  4EVM A;  2IL3 A;  1NSW A;  2X8G A;  4FQU A;  5B8B A;  2B1K A;  3KJY A;  3RBT A;  1MD3 A;  3ME8 A;  2LUS A;  2H0I A;  5DCH A;  3ISO A;  5CP1 A;  4FO5 A;  1QXH A;  5CRD A;  3EWL A;  2JZT A;  3TCO A;  2FUG 2;  4KCA A;  4ZB7 A;  2HSN B;  4CW9 A;  1AC1 A;  3IAS 2;  1S3R A;  5ECH B;  4JR4 A;  1QMV A;  2H66 A;  5FT3 A;  1M99 A;  4GTU A;  2DKH A;  2VD1 A;  3P7X A;  1GNE A;  4K9Z A;  2DBC A;  1PL2 A;  3PPU A;  3DRN A;  5COH A;  2YJ7 A;  4EE0 A;  3I9V 2;  4YH2 A;  3O3T A;  3EVI A;  3TOU A;  2JL4 A;  4MK3 A;  4IN0 A;  1AXD A;  2VCT A;  1Z7R A;  5KOW A;  5CNW A;  4WR5 A;  3DYR A;  5LCZ A;  3GTU A;  1TI1 A;  4FIW A;  2IMI A;  4HEA 2;  2HYX A;  1ZGN A;  2F8F A;  3IOS A;  5ECI B;  3LW9 A;  5C00 A;  3TU3 B;  1G0T A;  1SD9 A;  2YCD A;  2P31 A;  11GS A;  2VM2 A;  2LRC A;  3UAP A;  2PUK C;  3MIX A;  2GT6 A;  4ZBA A;  3KH7 A;  2AYT A;  5GAN D;  1O85 A;  2O36 A;  4IGJ A;  2KOK A;  4JZQ A;  4G0L A;  3APS A;  5J9C A;  12GS A;  2EFH A;  2VL2 C;  1HQO A;  4HU9 A;  4MF6 A;  6GST A;  2DSA A;  4LL1 B;  3GIX A;  4IVF A;  2O7K A;  2IN3 A;  4MDC A;  1B4P A;  1K3L A;  1MDI A;  4J56 E;  5GZZ B;  4GQF A;  4GXZ A;  1GSS A;  5IO2 A;  4DSS A;  3TUE A;  20GS A;  3VWW A;  2FA8 A;  1AQW A;  2O8V B;  3RPP A;  2HT9 A;  3DEX A;  2RII A;  2J9H A;  5DCG A;  3D21 A;  1FO5 A;  4KSO A;  2GQL A;  3KEB A;  2RM5 A;  5BMU A;  4FYU A;  4K7O A;  4ZL7 A;  4EIP A;  1TK5 B;  3QAV A;  3D4T A;  3HZ4 A;  4HJM A;  4O5U A;  3IHQ A;  3CMI A;  4K5S A;  2WRT A;  2K8V A;  2C1Y A;  5DBQ A;  4EKZ A;  3Q18 A;  3KXO A;  4OO5 A;  4FH8 A;  3M0F A;  5D9T A;  2EIR A;  4ZXG A;  1OAZ A;  5DAL B;  1KEB A;  5EVO A;  2YN1 A;  4EDZ A;  1CQG A;  2M46 A;  2FHE A;  2DJ3 A;  2BTO T;  3GKM A;  4KCE A;  2GZZ A;  1SKS B;  4YQM A;  2JZR A;  3C73 A;  3ZRD A;  1N2A A;  4PI0 C;  2H8L A;  2A2R A;  3KMN A;  4L0W A;  3KTL A;  2WB9 A;  2PGT A;  16GS A;  2A2S A;  1SEN A;  2K18 A;  1G7E A;  1XZO A;  4ISD A;  1BAY A;  4EDY A;  4BVY B;  3UJ1 A;  4PNG A;  4YQU A;  4PGT A;  1I9D A;  3ZVJ D;  3WGE A;  2YAN A;  3F6D A;  3HD5 A;  3RGB C;  1OC3 A;  2GSS A;  3G9B A;  4IEL A;  1V9W A;  3F9U A;  1SYX A;  4QQ7 A;  3DVW A;  1JLW A;  2QGV A;  1K0D A;  2OAD A;  2XHF A;  1XBS A;  1YQ1 A;  4HQS A;  2TRC P;  1YJ6 A;  2NPB A;  1ON4 A;  2NTO A;  2H71 A;  4MH3 A;  2BJX A;  3DXB A;  1U6T A;  3GKK A;  1PFO A;  1EOG A;  4DSQ A;  4Q5F A;  4NHW A;  2HSH A;  3KD0 A;  4GSN A;  4IP6 A;  3IK9 A;  4E68 A;  2X64 A;  2WZ9 A;  3RDW A;  7GSS A;  2C0D A;  4KB3 A;  4XS4 B;  4JU5 A;  1H75 A;  5IO0 A;  1FVK A;  4G10 A;  4ZIL A;  4WEY A;  3ZIV A;  5B6M A;  2PMT A;  2DJ2 A;  5IPH A;  2HFD A;  4NV5 A;  2HRA A;  5JCG A;  4IHU A;  1IYH A;  4PUF C;  2ALB A;  1TXU A;  1SK1 A;  3CHX C;  3ZFL A;  2I3Y A;  4AKG A;  2GSR A;  2WGR A;  2YJH A;  3BBY A;  5G31 A;  5ECN B;  4G9H A;  3ZVJ A;  4Z7X A;  1K0A A;  4DVC A;  1SK0 A;  4BWS A;  4DSR A;  4ICY A;  1I5G A;  3DVX A;  5KEJ A;  1XWC A;  1ZMA A;  4F0C A;  2C0E A;  2CX4 A;  2J23 A;  5DQS A;  5ABR A;  3EUR A;  4HS1 A;  3ZMK A;  5DQY A;  2I9H A;  4BA7 A;  5IMF A;  2OE0 A;  4E8E A;  5IIZ A;  4TKY A;  1YKA A;  4EO3 A;  1HYU A;  4XS6 A;  4YAV A;  4MA9 A;  3EU4 A;  4BL7 B;  1FVJ A;  3WGD A;  2VCZ A;  3UBL A;  2VLU A;  2OAC A;  2QA1 A;  1R4W A;  2H0H A;  2HRK A;  3KP9 A;  4LL4 B;  3TDG A;  5J4Y A;  1TXX A;  3VI5 A;  2FA4 A;  2B6M A;  2GQM A;  3F4T A;  5ID2 A;  4TXO A;  1X5E A;  1FOH A;  4X1U A;  1JHB A;  2H6X A;  1GUL A;  3FKF A;  4GRF A;  1EV4 A;  1Q98 A;  1GSQ A;  4KAE A;  5IMD A;  1S4B P;  2HI7 A;  3GX0 A;  4LMV A;  1GTB A;  3TKR A;  3VPQ A;  3HVN A;  5JWR B;  4W66 A;  2VOC A;  1GUK A;  1K0O A;  4GDF A;  4N3Z A;  4IJI A;  3MAK A;  1USB A;  1F6M C;  2KHP A;  4IS0 A;  3QFB C;  1AIU A;  3L9V A;  2M72 A;  1HD2 A;  4AF2 A;  2C3Q A;  2C4J A;  1YDK A;  2ZNM A;  5IOW A;  5CO3 A;  5GSS A;  2QA2 A;  1M3I A;  3IPZ A;  3LG6 A;  5J5N A;  2RUF A;  4MPG A;  1GL8 A;  1FB0 A;  4OMV A;  2UZ8 A;  3TJF A;  4MJB A;  1XW6 A;  1ZYQ B;  1R5A A;  5FHI A;  2DC5 A;  4XRD A;  3L0H A;  1VF3 A;  4KE3 A;  3QPM A;  4FYC A;  2QC7 A;  1EZK A;  3APQ A;  1FOV A;  22GS A;  1SL1 B;  3TKS C;  2X8H A;  3U6V A;  4PXO A;  1JLV A;  3BJ5 A;  2OKA A;  5KN1 A;  2F3M A;  1K0B A;  2WJU A;  5CRW A;  2PN8 A;  1VF4 A;  2CAI A;  2FWH A;  4ILF A;  4A5P A;  4D73 A;  4F9Z A;  5J3R A;  1TDI A;  3FYG A;  4I2T A;  2VCX A;  2X49 A;  1T4Y A;  2F8A A;  3LXZ A;  2VCW A;  1TK8 B;  3UVT A;  4L5L A;  1BJX A;  2WDU A;  2N5B A;  2XBQ A;  1ERU A;  3EU3 A;  2VLT A;  2LEG A;  2PPT A;  4Q5Q A;  3WD6 A;  3TKQ A;  3D6I A;  1XXU A;  4KND A;  3J7Y k;  2WVZ A;  1QQ2 A;  1BF5 A;  2YOI A;  2R4V A;  1O7U A;  4Z2R A;  4RQR A;  5A4U A;  1GSE A;  3GKN A;  6GSU A;  1TW9 A;  3IAM 2;  4LLR A;  2EIQ A;  2V41 A;  1QUW A;  3ERG A;  1BED A;  2LJK A;  3GMF A;  2LNT A;  2LST A;  1HNB A;  2VM1 A;  3L9S A;  1YZX A;  1PN9 A;  1KTE A;  1PKW A;  3KMO A;  5F07 A;  2B5Y A;  2VIM A;  2LS5 A;  1PL1 A;  3KZQ A;  4F0B A;  2E7P A;  2H72 A;  1PRX A;  2EFE A;  3UMA A;  4BPY A;  1DE2 A;  3ZFB A;  3VPT A;  2HE3 A;  1FHE A;  2K6V A;  3CQF A;  4WF4 A;  3GFK A;  4N11 A;  2IMK A;  2IFQ B;  2CVK A;  2PVO C;  2HRF A;  2VCV A;  3L78 A;  5CYY A;  5ECL B;  4CHS A;  4O32 A;  3HVX A;  2D2Z A;  2PER A;  4POK A;  1JZR A;  1R5P A;  4CDO A;  3NOF A;  1JZW A;  2FNO A;  4H86 A;  4ID0 A;  2KUC A;  5D9W A;  1AQV A;  3KH9 A;  5EY6 A;  4NHZ A;  1XVQ A;  4ZBB A;  2L57 A;  3TRP A;  1E6B A;  1AW9 A;  3G7J A;  3GUS A;  4XRA A;  1ZCP A;  2OA7 A;  2L6C A;  2OT3 A;  4IQA A;  2AUV A;  3GRX A;  4TR0 A;  2TRX A;  1BX9 A;  3KM6 A;  2GDR A;  5CRE A;  1SD8 A;  3S9F A;  3H93 A;  1VRS D;  3KCM A;  1PKZ A;  4RI6 A;  5A5H A;  1V2A A;  1ERT A;  1LU4 A;  3A5W A;  4MH2 A;  3VK9 A;  1A8Y A;  2O87 A;  4V2N A;  3BD2 A;  1XOA A;  1UVZ A;  4POL A;  4QL7 A;  2ON7 A;  1PA3 A;  1X9S B;  2HSM B;  2L59 A;  5ECP B;  3LGC A;  4V2M A;  2GZP A;  1SKW B;  2VL2 A;  2VL9 A;  3BCI A;  2LRT A;  2WCI A;  2FWF A;  3QAG A;  2B5X A;  4D73 B;  2LKU A;  4XCS A;  3EE2 A;  2HZF A;  4P3Y B;  4OFT A;  1NHY A;  5HR3 A;  5F05 A;  1EWX A;  1XPV A;  3IRA A;  1M3J A;  1EP7 A;  2I1U A;  1A2L A;  4IJ3 A;  3C1S A;  4USS A;  5JCU A;  3UAR A;  2E2G A;  5J40 A;  3UEM A;  5AIX A;  3BOA A;  4NV2 A;  3CSJ A;  1PGT A;  3W8S A;  4I97 A;  2VL3 A;  4BVX A;  10GS A;  3MSZ A;  1TRV A;  5A1N A;  4K5R A;  3GA4 A;  2Z9S A;  3MWH A;  1ABA A;  5H5R A;  1I1I P;  13GS A;  2H75 A;  4ZBD A;  2MYG A;  2HRN A;  4E8H A;  3F3R A;  1T00 A;  2H6Z A;  1OC9 A;  1SKR B;  3IR4 A;  4I5Q A;  5ECM B;  5DAK A;  3IE3 A;  3E3E A;  2X4A A;  1GTU A;  2GT5 A;  5J4V A;  3VWX A;  2AHE A;  2JU5 A;  3QCP A;  3PH9 A;  4GQC A;  4O5R A;  2CA8 A;  1H4O A;  3EIN A;  4DEJ A;  2V1M A;  3C71 A;  2HLS A;  1SL2 B;  1BG5 A;  4N0V A;  5A4W A;  2C0G A;  1B48 A;  3CTG A;  3KGK A;  3H1N A;  2PBJ A;  1YEX A;  3LJR A;  2RLI A;  4ZB9 A;  4AKI A;  2DJK A;  1Z9H A;  1TJD A;  4TR1 A;  2XPE A;  5A5K A;  3LSZ A;  3FZA A;  5L71 A;  1Z7P A;  2E2M A;  4QMK A;  2XPD A;  2IIY A;  4QL9 A;  4K0N A;  1Y1U A;  2BMX A;  1FB6 A;  2FD3 A;  4HUA A;  3VUR A;  3NZN A;  2R0G A;  2EFC A;  3HY2 A;  4KSM A;  2I4A A;  2V6O A;  2YWM A;  5ELG A;  5E59 A;  4JR6 A;  1DBY A;  1GLQ A;  2N5A A;  1EGR A;  3L4N A;  4MAB A;  2L5L A;  4Z2U A;  2L4C A;  3VWV A;  1ERV A;  4J2F A;  4O5Q A;  3I69 A;  1T7P B;  2VO4 A;  4KX4 A;  1DUG A;  4I8B A;  6GSW A;  4MZW A;  4OCF A;  3WT1 A;  2GGT A;  3GTU B;  3HMJ G;  1Z3E A;  2IME A;  3I43 A;  1PQN A;  3HJO A;  3LYP A;  2XBI A;  1F3B A;  1T8E B;  1PD2 1;  2WS2 A;  1SVM A;  1O8W A;  1PSQ A;  2GSQ A;  5B7C A;  1XWA A;  1IYI A;  5B8A A;  3MNG A;  4MZC A;  2H01 A;  2GST A;  3GH6 A;  4V1A p;  3RFR C;  3GV1 A;  1J08 A;  4ECJ A;  1ZYE A;  3CYN A;  1SK2 A;  3R2Q A;  4CY6 A;  5ECS A;  2MBS A;  1Y25 A;  2HZE A;  5KN2 A;  4K2D A;  2H1B A;  1YF1 A;  3DML A;  2YNX A;  4TOP A;  4MF7 A;  1WOU A;  4ZL9 A;  9GSS A;  2H30 A;  5J41 A;  1RW1 A;  2R0P A;  2V2G A;  6GSV A;  2LJR A;  2EIO A;  4PTS A;  4Q5R A;  2L6D A;  3SBC A;  1QGV A;  3UL3 A;  3TRX A;  4DSS B;  2FLS A;  4PQI A;  1GTA A;  1K3O A;  3GL5 A;  1EGO A;  3LQ7 A;  4ZB8 A;  3QOU A;  4NWY A;  1JZD A;  5ENU A;  4ACS A;  1XOB A;  5DJL A;  1EEJ A;  2VAF A;  1QFN A;  2DJJ A;  3D22 A;  5BMU B;  4KDU A;  5JWQ B;  5A34 A;  2CX3 A;  2DKI A;  3J7Y b;  1EP8 A;  1O8X A;  3C1R A;  3GN3 A;  2MMA A;  5D93 A;  5AIS A;  2JAD A;  18GS A;  3APO A;  1WIK A;  1OC9 B;  2OBK A;  5DAK B;  2K9F A;  3ME7 A;  19GS A;  2DML A;  3G7I A;  1V58 A;  2R0C A;  4TW5 A;  3TKS E;  2DIZ A;  5AN1 A;  2LNS A;  2O5V A;  4NPB A;  5ELA A;  5G5F A;  8GSS A;  2O85 A;  4ULX A;  2VUP A;  1UA5 A;  4F2I A;  4RI7 A;  5IOX A;  2TIR A;  2HSN A;  5CAX A;  4AI6 A;  5ECK B;  1A24 A;  2C0F A;  1SVO A;  3VLN A;  4HZ4 A;  3A2W A;  3H8Q A;  5A4V A;  2B1L A;  2VD0 A;  3LOR A;  1R7H A;  5D8I A;  1XW5 A;  4Z2T A;  3ZTL A;  1XWK A;  1B9X C;  4EC0 A;  1TKD B;  3N9J A;  4YQV A;  4MLY A;  1T1V A;  4OO4 A;  1GLP A;  3WYW A;  1ZYP A;  4JBB A;  1YF0 A;  1M2A A;  1SU9 A;  5G2Z A;  1TRS A;  3TKS A;  1LBK A;  1YEP A;  1OYJ A;  5LD0 A;  3RAZ A;  3SWL A;  3TJB A;  1Y6E A;  4XIH A;  2YZU A;  3QD9 A;  1YKC A;  3IC8 A;  1GP1 A;  3HJP A;  1TP9 A;  4MJC A;  3M3M A;  4PNF A;  2H76 A;  2AB6 A;  3E0U A;  3IV4 A;  3IXR A;  2JSZ A;  3D5J A;  1G6W A;  1K0M A;  2FWE A;  4AJ6 A;  4TRX A;  2GS3 A;  4OCE A;  1V57 A;  4MZB A;  4TR4 A;  5D9X A;  2HSY A;  4K8M A;  3VFI A;  3OR5 A;  1AAZ A;  4MMM A;  4K7N A;  4GF0 A;  3A3T A;  3N5O A;  4N10 A;  3O76 A;  3LEF A;  3HA9 A;  1U88 A;  1GWC A;  2ON5 A;  1MDK A;  1FW1 A;  2CVB A;  3EMP A;  4XHM A;  3UOM A;  5LNK e;  3JCM L;  3EYT A;  2NBS A;  4HDE A;  2IPA A;  2ZUP A;  1XFL A;  4EXJ A;  4PX1 A;  2IJY A;  1JFU A;  4O7H A;  2YP6 A;  2YPM A;  4OWY A;  4BWQ A;  1XW9 A;  4TR3 A;  1TK0 B;  5C04 A;  3HZ8 A;  4HU7 A;  5DAL A;  1XWG A;  1GSU A;  2P0G A;  5H5S A;  4POB A;  1BQ7 A;  2HRK B;  4MNN A;  2ES7 A;  3LFL A;  5EPF A;  1A0R P;  2DJ0 A;  1S3D A;  3HVV A;  1ZYN A;  5ID2 B;  1O81 A;  4TXO B;  2MMZ A;  1OC8 A;  2VCQ A;  2JSY A;  4ECI A;  2YWI A;  3C7M A;  3IHG A;  4ML1 A;  4AJ7 A;  1J0F A;  3FR3 A;  2EC4 A;  1O6J A;  2LQQ A;  2XC2 A;  5ECR B;  2NVL A;  4L5O A;  5DVB A;  3HJM A;  6GSY A;  1X9M B;  1XG8 A;  2R3X A;  3TJK A;  1SJZ A;  3HCZ A;  3FW2 A;  2H6Y A;  1F3A A;  3P90 A;  3QR6 A;  3FEU A;  1R26 A;  1ACV A;  5DDL A;  2WVY A;  2C80 A;  3UBK A;  1SJI A;  4WR4 A;  4KW6 A;  2X99 A;  2JAC A;  3EMX A;  3ZRE A;  3M9J A;  2WW2 A;  4BIK A;  1YVL A;  1THO A;  3GSS A;  1GRX A;  2H73 A;  4K1F A;  5CRG A;  3D0Z A;  3DKS A;  5CRH A;  2GLR A;  1QK8 A; 
#chains in the Genus database with same CATH homology
 3ZL5 A;  4XTS A;  5F06 A;  3ZYW A;  5IPG A;  4WBJ A;  2OE1 A;  3HDC A;  3WGX A;  4MPF A;  1OKD A;  4AJ8 A;  1B4Q A;  3LYK A;  1O73 A;  1MTC A;  3FMW A;  4NMU A;  4K0G A;  4I6X A;  1WP0 A;  4NXI A;  1XVW A;  4XS4 A;  4Q5N A;  2AAW A;  1SJ6 A;  3DD3 A;  3WT2 A;  1M0U A;  3UIW A;  3F6F A;  2A4H A;  4OD7 A;  1URM A;  3QAW A;  3RHB A;  5HR2 A;  4I2U A;  2YV7 A;  4ZL8 A;  2F9S A;  4TXV A;  2LQO A;  3IA1 A;  3I6A A;  2EFD A;  1M9A A;  4EL1 A;  6GSX A;  2I81 A;  5AIV A;  5JCW A;  3CSI A;  4K7I A;  3NIV A;  3PIN A;  3P8W A;  1U3A A;  3IDV A;  3CWG A;  2HQT A;  5HR0 A;  1G7O A;  3CBU A;  3HKR A;  3TRQ A;  1ERW A;  1ILO A;  5D73 A;  2B7K A;  2N5F A;  1PX7 A;  3IC4 A;  1A8L A;  3DGQ A;  1E2Y A;  4BL7 A;  3Q19 A;  1MEK A;  3ZZX A;  4F82 A;  3ERF A;  2M80 A;  1HNA A;  2L5O A;  1ZL9 A;  3A2V A;  1EV9 A;  4GCI A;  1Z6M A;  2FCH A;  1B9Y C;  1V40 A;  1BG1 A;  2HNL A;  3MDK A;  3QFA C;  1K3Y A;  5BRT A;  2H1A A;  5ECQ B;  2CVD A;  4LA1 A;  5KOX A;  2F51 A;  3GX8 A;  4TN8 A;  2MMO A;  2VLV A;  2PVQ A;  4ZIJ A;  2DMM A;  4RUV A;  3GUR A;  2OE3 A;  4EUY A;  3F0I A;  1A23 A;  4IBP A;  5J9B A;  2CV4 A;  3HVS A;  1TU8 A;  4KUN A;  3ZIT A;  2RUE A;  1W4V A;  4EIQ A;  3CTF A;  3HXS A;  2CT6 A;  3L9U A;  2CAQ A;  1KNG A;  3FZ9 A;  2OBI A;  3GHA A;  2H19 A;  4G2E A;  1B8X A;  1Q4J A;  4MJE A;  1GNW A;  4WF5 A;  2G2Q A;  3ZML A;  1X0R A;  2MMN A;  4N0Z A;  3Q74 A;  4NAX A;  4K6X A;  4PQ1 A;  1WPI A;  2V6K A;  1RK4 A;  4WXT A;  1Z5Y E;  4MP4 A;  1GUM A;  1UN2 A;  2P5Q A;  2R2J A;  3W8J A;  2H70 A;  3EC3 A;  1ST9 A;  3DIE A;  2YWN A;  1N8J A;  2R5G A;  4F03 A;  4G0K A;  3TGZ A;  4IKH A;  2HXK A;  3QDN A;  5IMV A;  3TJJ A;  6GSS A;  1X5D A;  3F4R A;  4KF9 A;  1PMT A;  1T3B A;  1VF1 A;  3TJG A;  4YAP A;  4HI7 A;  3KIJ A;  4J57 E;  1WJK A;  4MCU A;  3H79 A;  3FZ4 A;  4G19 A;  1MD4 A;  2C8U A;  5FWG A;  1AUC A;  5A5H B;  3A2X A;  3GKX A;  4L8E A;  2DIY A;  2G0F A;  4HQZ A;  2WUL A;  5G1L A;  1XWB A;  2MBT A;  1EOH A;  1XCC A;  3GNJ A;  1GSD A;  3CRT A;  1TTZ A;  2FGX A;  1PN0 A;  1BYE A;  5JWO B;  2C3T A;  2DLX A;  1FAA A;  1TRU A;  5ECO B;  1S3A A;  4OFN A;  5H5Q A;  2PWJ A;  4PUA A;  3KP8 A;  1F37 A;  4ZB6 A;  1M2B A;  1EEM A;  4X43 A;  2P5R A;  3M8N A;  5HFK A;  2FY6 A;  1NW2 A;  1S3C A;  4XS1 A;  5GAP D;  4HOJ A;  3IBH A;  4GLT A;  3VI7 A;  4AKX B;  1TU7 A;  2B5E A;  3PR8 A;  5G30 A;  3UVH A;  1OVN A;  1F9M A;  2QKE A;  2UV8 G;  3F3Q A;  5HR1 A;  1OKT A;  3RPN A;  2KLX A;  2FWG A;  4KGI A;  1XIY A;  4CY8 A;  1TRW A;  3K8N A;  1J9B A;  1TI3 A;  5B6N A;  4BVX B;  4ECC A;  3FR6 A;  3FHK A;  5A1N B;  1WE0 A;  3KTB A;  5AGY A;  1SVL A;  1X5C A;  5IMA A;  5HFI A;  3CXG A;  4JRR A;  2IFQ A;  1ML6 A;  2KP1 A;  3GH9 A;  4GWR A;  4X0X A;  2YWO A;  2IMD A;  3MYD A;  1GUH A;  1NM3 A;  1VF2 A;  3ERW A;  4G01 A;  1WRY A;  2WFC A;  3H4K A;  2H0G A;  1FG4 A;  1M7T A;  4POM A;  2CZ3 A;  2IMF A;  3GL3 A;  3R3E A;  4N30 A;  2GQK A;  5F0G A;  1JZO A;  4V1A g;  4IQ1 A;  17GS A;  4WET A;  2AV4 A;  2H1D A;  2OJL A;  3GST A;  2YZH A;  5EL8 A;  1A2M A;  1GSY A;  1RQM A;  3G7Y A;  3VWU A;  2ZCT A;  2IWT A;  2K8S A;  3RHC A;  4L0U A;  3CSH A;  3TB2 A;  4MF5 A;  2H1L A;  1CQH A;  2GZY A;  3E9J B;  1K0C A;  4G0I A;  4LMW A;  5D9V A;  2H1G A;  1TOF A;  4V2L A;  1OE7 A;  5DJM A;  3O6T A;  1AQX A;  4KDX A;  4O92 A;  1UC7 A;  4TR1 B;  3Q6O A;  1K0N A;  1GH2 A;  2C3N A;  4AGS A;  4IP1 A;  2A4V A;  4KH7 A;  4TVE A;  4MJA A;  1F2E A;  3EPT A;  5HFG A;  3GYK A;  4IW9 A;  1VGL A;  3LWA A;  3U5R E;  2O89 A;  2MZC A;  4GSS A;  3F4S A;  3FR9 A;  4PUR A;  4OFM A;  5G5E A;  2REM A;  4RQX A;  2GTU A;  3LXT A;  1LJR A;  4YKF A;  3W6G A;  2AJQ B;  3FRC A;  2HSM A;  3V1W A;  1PX6 A;  3C8E A;  2R6K A;  4PQH A;  1SL0 B;  2CZ2 A;  2VKZ G;  3A5I A;  2X8C A;  1THX A;  1W89 A;  2A2P A;  5HQP A;  4HZ2 A;  3CRU A;  1WWJ A;  4EF0 A;  1C72 A;  1ZOF A;  4FYB A;  4ECB A;  1WMJ A;  1YY7 A;  3FY7 A;  5D96 A;  5IM9 A;  4YKG A;  3TOT A;  2RM6 A;  3HHV A;  1DE1 A;  5G1K A;  4WKW A;  2CQ9 A;  3ED3 A;  3HYP A;  1ZZY A;  5IQY A;  5J4U A;  2L4Q A;  2V32 A;  1Z6N A;  3TKP A;  4JE1 A;  4K2X A;  1GTI A;  2LRN A;  2HZE B;  4KA0 A;  3ZLP A;  2PU9 C;  3BCK A;  2QSI A;  1M9B A;  3F63 A;  4WBR D;  1N25 A;  5F8B A;  2E0Q A;  2LTK A;  1A2J A;  5GST A;  1KBN A;  1OE8 A;  1GSF A;  5J47 A;  1G6Y A;  2NDO A;  2YV9 A;  5INY A;  3P2A A;  3M1G A;  1U3I A;  1SYR A;  5E4W A;  3IK7 A;  4JED A;  5KN3 A;  4HJ2 A;  4X4J A;  2JZS A;  1MDJ A;  5IMC A;  3PGT A;  3US3 A;  2KP2 A;  2DJ1 A;  4KDY A;  3FK8 A;  3FZ5 A;  2B3S A;  1HNC A;  2B7J A;  4AKH A;  2R37 A;  3AY8 A;  4GST A;  5IMZ A;  3F8U A;  1M2D A;  4ML6 A;  5A34 B;  3DWV A;  4BVY A;  2LV3 A;  3M9K A;  3QMX A;  3D4M A;  1DSB A;  1X9W B;  1NHO A;  1V98 A;  2H74 A;  1A0F A;  1U87 A;  5KN0 A;  2GVP A;  3ZIJ A;  14GS A;  1T4Z A;  2LJA A;  4EVM A;  2IL3 A;  1NSW A;  2X8G A;  4FQU A;  5B8B A;  2B1K A;  3KJY A;  3RBT A;  1MD3 A;  3ME8 A;  2LUS A;  2H0I A;  5DCH A;  3ISO A;  5CP1 A;  4FO5 A;  1QXH A;  5CRD A;  3EWL A;  2JZT A;  3TCO A;  2FUG 2;  4KCA A;  4ZB7 A;  2HSN B;  4CW9 A;  1AC1 A;  3IAS 2;  5ECH B;  4JR4 A;  1QMV A;  2H66 A;  5FT3 A;  1M99 A;  4GTU A;  2DKH A;  2VD1 A;  3P7X A;  1GNE A;  4K9Z A;  2DBC A;  1PL2 A;  3PPU A;  3DRN A;  5COH A;  2YJ7 A;  4EE0 A;  3I9V 2;  4YH2 A;  3O3T A;  3EVI A;  3TOU A;  2JL4 A;  4MK3 A;  4IN0 A;  1AXD A;  2VCT A;  1Z7R A;  5KOW A;  5CNW A;  4WR5 A;  3DYR A;  5LCZ A;  3GTU A;  1TI1 A;  4FIW A;  2IMI A;  4HEA 2;  2HYX A;  1ZGN A;  2F8F A;  3IOS A;  5ECI B;  3LW9 A;  5C00 A;  3TU3 B;  1G0T A;  1SD9 A;  2YCD A;  2P31 A;  11GS A;  2VM2 A;  2LRC A;  3UAP A;  2PUK C;  3MIX A;  2GT6 A;  4ZBA A;  3KH7 A;  2AYT A;  5GAN D;  1O85 A;  4IGJ A;  2KOK A;  4JZQ A;  4G0L A;  3APS A;  5J9C A;  12GS A;  2EFH A;  2VL2 C;  1HQO A;  4HU9 A;  4MF6 A;  6GST A;  2DSA A;  4LL1 B;  3GIX A;  4IVF A;  2O7K A;  2IN3 A;  4MDC A;  1B4P A;  1K3L A;  1MDI A;  4J56 E;  5GZZ B;  4GQF A;  4GXZ A;  1GSS A;  5IO2 A;  4DSS A;  3TUE A;  20GS A;  3VWW A;  2FA8 A;  1AQW A;  2O8V B;  3RPP A;  2HT9 A;  3DEX A;  2RII A;  2J9H A;  5DCG A;  3D21 A;  1FO5 A;  4KSO A;  2GQL A;  3KEB A;  2RM5 A;  5BMU A;  4FYU A;  4K7O A;  4ZL7 A;  4EIP A;  1TK5 B;  3QAV A;  3D4T A;  3HZ4 A;  4HJM A;  4O5U A;  3IHQ A;  3CMI A;  4K5S A;  2WRT A;  2K8V A;  2C1Y A;  5DBQ A;  4EKZ A;  3Q18 A;  3KXO A;  4OO5 A;  4FH8 A;  3M0F A;  5D9T A;  2EIR A;  4ZXG A;  1OAZ A;  5DAL B;  1KEB A;  5EVO A;  2YN1 A;  4EDZ A;  1CQG A;  2M46 A;  2FHE A;  2DJ3 A;  2BTO T;  3GKM A;  4KCE A;  2GZZ A;  1SKS B;  4YQM A;  2JZR A;  3C73 A;  3ZRD A;  1N2A A;  2H8L A;  2A2R A;  3KMN A;  4L0W A;  3KTL A;  2WB9 A;  2PGT A;  16GS A;  2A2S A;  1SEN A;  2K18 A;  1G7E A;  1XZO A;  4ISD A;  1BAY A;  4EDY A;  4BVY B;  3UJ1 A;  4PNG A;  4YQU A;  4PGT A;  1I9D A;  3ZVJ D;  3WGE A;  2YAN A;  3F6D A;  3HD5 A;  1OC3 A;  2GSS A;  3G9B A;  4IEL A;  1V9W A;  3F9U A;  1SYX A;  4QQ7 A;  3DVW A;  1JLW A;  2QGV A;  1K0D A;  2OAD A;  2XHF A;  1XBS A;  1YQ1 A;  4HQS A;  2TRC P;  1YJ6 A;  2NPB A;  1ON4 A;  2NTO A;  2H71 A;  4MH3 A;  2BJX A;  3DXB A;  1U6T A;  3GKK A;  1EOG A;  4DSQ A;  4Q5F A;  4NHW A;  2HSH A;  3KD0 A;  4GSN A;  4IP6 A;  3IK9 A;  4E68 A;  2X64 A;  2WZ9 A;  3RDW A;  7GSS A;  2C0D A;  4KB3 A;  4XS4 B;  4JU5 A;  1H75 A;  5IO0 A;  1FVK A;  4G10 A;  4ZIL A;  4WEY A;  3ZIV A;  5B6M A;  2PMT A;  2DJ2 A;  5IPH A;  2HFD A;  4NV5 A;  2HRA A;  5JCG A;  4IHU A;  1IYH A;  4PUF C;  2ALB A;  1TXU A;  1SK1 A;  3ZFL A;  2I3Y A;  4AKG A;  2GSR A;  2WGR A;  2YJH A;  3BBY A;  5G31 A;  5ECN B;  4G9H A;  3ZVJ A;  4Z7X A;  1K0A A;  4DVC A;  1SK0 A;  4BWS A;  4DSR A;  4ICY A;  1I5G A;  3DVX A;  5KEJ A;  1XWC A;  1ZMA A;  4F0C A;  2C0E A;  2CX4 A;  2J23 A;  5DQS A;  5ABR A;  3EUR A;  4HS1 A;  3ZMK A;  5DQY A;  2I9H A;  4BA7 A;  5IMF A;  2OE0 A;  4E8E A;  5IIZ A;  4TKY A;  1YKA A;  4EO3 A;  1HYU A;  4XS6 A;  4YAV A;  4MA9 A;  3EU4 A;  4BL7 B;  1FVJ A;  3WGD A;  2VCZ A;  3UBL A;  2VLU A;  2OAC A;  2QA1 A;  1R4W A;  2H0H A;  2HRK A;  3KP9 A;  4LL4 B;  3TDG A;  5J4Y A;  1TXX A;  3VI5 A;  2FA4 A;  2B6M A;  2GQM A;  3F4T A;  5ID2 A;  4TXO A;  1X5E A;  1FOH A;  4X1U A;  1JHB A;  2H6X A;  1GUL A;  3FKF A;  4GRF A;  1EV4 A;  1Q98 A;  1GSQ A;  4KAE A;  5IMD A;  2HI7 A;  3GX0 A;  4LMV A;  1GTB A;  3TKR A;  3VPQ A;  5JWR B;  4W66 A;  2VOC A;  1GUK A;  1K0O A;  4GDF A;  4N3Z A;  4IJI A;  3MAK A;  1USB A;  1F6M C;  2KHP A;  4IS0 A;  3QFB C;  1AIU A;  3L9V A;  2M72 A;  1HD2 A;  4AF2 A;  2C3Q A;  2C4J A;  1YDK A;  2ZNM A;  5IOW A;  5CO3 A;  5GSS A;  2QA2 A;  3IPZ A;  3LG6 A;  5J5N A;  2RUF A;  4MPG A;  1GL8 A;  1FB0 A;  4OMV A;  2UZ8 A;  3TJF A;  4MJB A;  1XW6 A;  1ZYQ B;  1R5A A;  5FHI A;  2DC5 A;  4XRD A;  3L0H A;  1VF3 A;  4KE3 A;  3QPM A;  4FYC A;  2QC7 A;  1EZK A;  3APQ A;  1FOV A;  22GS A;  1SL1 B;  3TKS C;  2X8H A;  3U6V A;  4PXO A;  1JLV A;  3BJ5 A;  2OKA A;  5KN1 A;  2F3M A;  1K0B A;  2WJU A;  5CRW A;  2PN8 A;  1VF4 A;  2CAI A;  2FWH A;  4ILF A;  4A5P A;  4D73 A;  4F9Z A;  5J3R A;  1TDI A;  3FYG A;  4I2T A;  2VCX A;  2X49 A;  1T4Y A;  2F8A A;  3LXZ A;  2VCW A;  1TK8 B;  3UVT A;  4L5L A;  1BJX A;  2WDU A;  2N5B A;  2XBQ A;  1ERU A;  3EU3 A;  2VLT A;  2LEG A;  2PPT A;  4Q5Q A;  3WD6 A;  3TKQ A;  3D6I A;  1XXU A;  4KND A;  3J7Y k;  1QQ2 A;  1BF5 A;  2YOI A;  2R4V A;  1O7U A;  4Z2R A;  4RQR A;  5A4U A;  1GSE A;  3GKN A;  6GSU A;  1TW9 A;  3IAM 2;  4LLR A;  2EIQ A;  2V41 A;  1QUW A;  3ERG A;  1BED A;  2LJK A;  3GMF A;  2LNT A;  2LST A;  1HNB A;  2VM1 A;  3L9S A;  1YZX A;  1PN9 A;  1KTE A;  1PKW A;  3KMO A;  5F07 A;  2B5Y A;  2VIM A;  2LS5 A;  1PL1 A;  3KZQ A;  4F0B A;  2E7P A;  2H72 A;  1PRX A;  2EFE A;  3UMA A;  4BPY A;  1DE2 A;  3ZFB A;  3VPT A;  2HE3 A;  1FHE A;  2K6V A;  4WF4 A;  3GFK A;  4N11 A;  2IMK A;  2IFQ B;  2CVK A;  2PVO C;  2HRF A;  2VCV A;  3L78 A;  5CYY A;  5ECL B;  4CHS A;  4O32 A;  3HVX A;  2D2Z A;  2PER A;  4POK A;  1JZR A;  1R5P A;  4CDO A;  3NOF A;  1JZW A;  2FNO A;  4H86 A;  4ID0 A;  2KUC A;  5D9W A;  1AQV A;  3KH9 A;  5EY6 A;  4NHZ A;  1XVQ A;  4ZBB A;  2L57 A;  3TRP A;  1E6B A;  1AW9 A;  3G7J A;  3GUS A;  4XRA A;  1ZCP A;  2OA7 A;  2L6C A;  2OT3 A;  4IQA A;  2AUV A;  3GRX A;  4TR0 A;  2TRX A;  1BX9 A;  3KM6 A;  2GDR A;  5CRE A;  1SD8 A;  3S9F A;  3H93 A;  1VRS D;  3KCM A;  1PKZ A;  4RI6 A;  5A5H A;  1V2A A;  1ERT A;  1LU4 A;  3A5W A;  4MH2 A;  3VK9 A;  1A8Y A;  2O87 A;  4V2N A;  3BD2 A;  1XOA A;  1UVZ A;  4POL A;  4QL7 A;  2ON7 A;  1PA3 A;  1X9S B;  2HSM B;  2L59 A;  5ECP B;  3LGC A;  4V2M A;  2GZP A;  1SKW B;  2VL2 A;  2VL9 A;  3BCI A;  2LRT A;  2WCI A;  2FWF A;  3QAG A;  2B5X A;  4D73 B;  2LKU A;  4XCS A;  3EE2 A;  2HZF A;  4P3Y B;  4OFT A;  1NHY A;  5HR3 A;  5F05 A;  1EWX A;  1XPV A;  3IRA A;  1EP7 A;  2I1U A;  1A2L A;  4IJ3 A;  3C1S A;  4USS A;  5JCU A;  3UAR A;  2E2G A;  5J40 A;  3UEM A;  5AIX A;  3BOA A;  4NV2 A;  3CSJ A;  1PGT A;  3W8S A;  4I97 A;  2VL3 A;  4BVX A;  10GS A;  3MSZ A;  1TRV A;  5A1N A;  4K5R A;  3GA4 A;  2Z9S A;  3MWH A;  1ABA A;  5H5R A;  13GS A;  2H75 A;  4ZBD A;  2MYG A;  2HRN A;  4E8H A;  3F3R A;  1T00 A;  2H6Z A;  1OC9 A;  1SKR B;  3IR4 A;  4I5Q A;  5ECM B;  5DAK A;  3IE3 A;  3E3E A;  2X4A A;  1GTU A;  2GT5 A;  5J4V A;  3VWX A;  2AHE A;  2JU5 A;  3QCP A;  3PH9 A;  4GQC A;  4O5R A;  2CA8 A;  1H4O A;  3EIN A;  4DEJ A;  2V1M A;  3C71 A;  2HLS A;  1SL2 B;  1BG5 A;  4N0V A;  5A4W A;  2C0G A;  1B48 A;  3CTG A;  3KGK A;  3H1N A;  2PBJ A;  1YEX A;  3LJR A;  2RLI A;  4ZB9 A;  4AKI A;  2DJK A;  1Z9H A;  1TJD A;  4TR1 A;  2XPE A;  5A5K A;  3LSZ A;  3FZA A;  5L71 A;  1Z7P A;  2E2M A;  4QMK A;  2XPD A;  2IIY A;  4QL9 A;  4K0N A;  1Y1U A;  2BMX A;  1FB6 A;  2FD3 A;  4HUA A;  3VUR A;  3NZN A;  2R0G A;  2EFC A;  3HY2 A;  4KSM A;  2I4A A;  2V6O A;  2YWM A;  5ELG A;  5E59 A;  4JR6 A;  1DBY A;  1GLQ A;  2N5A A;  1EGR A;  3L4N A;  4MAB A;  2L5L A;  4Z2U A;  2L4C A;  3VWV A;  1ERV A;  4J2F A;  4O5Q A;  3I69 A;  1T7P B;  2VO4 A;  4KX4 A;  1DUG A;  4I8B A;  6GSW A;  4MZW A;  4OCF A;  3WT1 A;  2GGT A;  3GTU B;  3HMJ G;  1Z3E A;  2IME A;  3I43 A;  1PQN A;  3HJO A;  3LYP A;  2XBI A;  1F3B A;  1T8E B;  1PD2 1;  2WS2 A;  1SVM A;  1O8W A;  1PSQ A;  2GSQ A;  5B7C A;  1XWA A;  1IYI A;  5B8A A;  3MNG A;  4MZC A;  2H01 A;  2GST A;  3GH6 A;  4V1A p;  3GV1 A;  1J08 A;  4ECJ A;  1ZYE A;  3CYN A;  1SK2 A;  3R2Q A;  4CY6 A;  5ECS A;  2MBS A;  1Y25 A;  2HZE A;  5KN2 A;  4K2D A;  2H1B A;  1YF1 A;  3DML A;  2YNX A;  4TOP A;  4MF7 A;  1WOU A;  4ZL9 A;  9GSS A;  2H30 A;  5J41 A;  1RW1 A;  2R0P A;  2V2G A;  6GSV A;  2LJR A;  2EIO A;  4PTS A;  4Q5R A;  2L6D A;  3SBC A;  1QGV A;  3UL3 A;  3TRX A;  4DSS B;  2FLS A;  4PQI A;  1GTA A;  1K3O A;  3GL5 A;  1EGO A;  3LQ7 A;  4ZB8 A;  3QOU A;  4NWY A;  1JZD A;  5ENU A;  4ACS A;  1XOB A;  5DJL A;  1EEJ A;  2VAF A;  1QFN A;  2DJJ A;  3D22 A;  5BMU B;  4KDU A;  5JWQ B;  5A34 A;  2CX3 A;  2DKI A;  3J7Y b;  1EP8 A;  1O8X A;  3C1R A;  3GN3 A;  2MMA A;  5D93 A;  5AIS A;  2JAD A;  18GS A;  3APO A;  1WIK A;  1OC9 B;  2OBK A;  5DAK B;  2K9F A;  3ME7 A;  19GS A;  2DML A;  3G7I A;  1V58 A;  2R0C A;  4TW5 A;  3TKS E;  2DIZ A;  5AN1 A;  2LNS A;  2O5V A;  4NPB A;  5ELA A;  5G5F A;  8GSS A;  2O85 A;  4ULX A;  2VUP A;  1UA5 A;  4F2I A;  4RI7 A;  5IOX A;  2TIR A;  2HSN A;  5CAX A;  4AI6 A;  5ECK B;  1A24 A;  2C0F A;  1SVO A;  3VLN A;  4HZ4 A;  3A2W A;  3H8Q A;  5A4V A;  2B1L A;  2VD0 A;  3LOR A;  1R7H A;  5D8I A;  1XW5 A;  4Z2T A;  3ZTL A;  1XWK A;  1B9X C;  4EC0 A;  1TKD B;  3N9J A;  4YQV A;  4MLY A;  1T1V A;  4OO4 A;  1GLP A;  3WYW A;  1ZYP A;  4JBB A;  1YF0 A;  1M2A A;  1SU9 A;  5G2Z A;  1TRS A;  3TKS A;  1LBK A;  1YEP A;  1OYJ A;  5LD0 A;  3RAZ A;  3SWL A;  3TJB A;  1Y6E A;  4XIH A;  2YZU A;  3QD9 A;  1YKC A;  3IC8 A;  1GP1 A;  3HJP A;  1TP9 A;  4MJC A;  3M3M A;  4PNF A;  2H76 A;  2AB6 A;  3E0U A;  3IV4 A;  3IXR A;  2JSZ A;  3D5J A;  1G6W A;  1K0M A;  2FWE A;  4AJ6 A;  4TRX A;  2GS3 A;  4OCE A;  1V57 A;  4MZB A;  4TR4 A;  5D9X A;  2HSY A;  4K8M A;  3VFI A;  3OR5 A;  1AAZ A;  4MMM A;  4K7N A;  4GF0 A;  3A3T A;  3N5O A;  4N10 A;  3O76 A;  3LEF A;  3HA9 A;  1U88 A;  1GWC A;  2ON5 A;  1MDK A;  1FW1 A;  2CVB A;  3EMP A;  4XHM A;  3UOM A;  5LNK e;  3JCM L;  3EYT A;  2NBS A;  4HDE A;  2IPA A;  2ZUP A;  1XFL A;  4EXJ A;  4PX1 A;  2IJY A;  1JFU A;  4O7H A;  2YP6 A;  2YPM A;  4OWY A;  4BWQ A;  1XW9 A;  4TR3 A;  1TK0 B;  5C04 A;  3HZ8 A;  4HU7 A;  5DAL A;  1XWG A;  1GSU A;  2P0G A;  5H5S A;  4POB A;  1BQ7 A;  2HRK B;  4MNN A;  2ES7 A;  3LFL A;  5EPF A;  1A0R P;  2DJ0 A;  1S3D A;  3HVV A;  1ZYN A;  5ID2 B;  1O81 A;  4TXO B;  2MMZ A;  1OC8 A;  2VCQ A;  2JSY A;  4ECI A;  2YWI A;  3C7M A;  3IHG A;  4ML1 A;  4AJ7 A;  1J0F A;  3FR3 A;  2EC4 A;  1O6J A;  2LQQ A;  2XC2 A;  5ECR B;  2NVL A;  4L5O A;  5DVB A;  3HJM A;  6GSY A;  1X9M B;  2R3X A;  3TJK A;  1SJZ A;  3HCZ A;  3FW2 A;  2H6Y A;  1F3A A;  3P90 A;  3QR6 A;  3FEU A;  1R26 A;  1ACV A;  5DDL A;  2C80 A;  3UBK A;  1SJI A;  4WR4 A;  4KW6 A;  2X99 A;  2JAC A;  3EMX A;  3ZRE A;  3M9J A;  1YVL A;  1THO A;  3GSS A;  1GRX A;  2H73 A;  4K1F A;  5CRG A;  3D0Z A;  3DKS A;  5CRH A;  2GLR A;  1QK8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...