3UVHA

Crystal structure analysis of e81m mutant of human clic1
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
238
structure length
231
Chain Sequence
EQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIMEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Chloride intracellular channel protein 1
publication title Crystal Structure Analysis of E81M mutant of human CLIC1
rcsb
source organism Homo sapiens
total genus 80
structure length 231
sequence length 238
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13409 GST_N_2 Glutathione S-transferase, N-terminal domain
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3uvhA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3uvhA01
2DBCA 2DJ0A 3PGTA 5IMZA 4EE0A 3TKSE 2MBTA 1GP1A 1F2EA 2GDRA 2H8LA 3MSZA 1K3YA 1I5GA 3EE2A 5IMFA 4J2FA 4PUAA 3FK8A 1WOUA 2H0GA 4DSSB 1M9BA 4KSOA 2O7KA 1OC3A 5H5SA 4XRDA 1R5PA 2N5BA 4MK3A 3UVHA 4V2NA 3BOAA 6GSSA 4NAXA 1XOAA 2ON5A 3GL5A 3KJYA 3LYKA 4FIWA 5INYA 3UARA 5ECPB 5HFIA 3ZRDA 1GTIA 3CRTA 4ZB9A 1A23A 2C3QA 5CNWA 2VL3A 5ENUA 2GGTA 2HSYA 4N0ZA 2LTKA 3A2XA 2AHEA 5HQPA 1V58A 1KEBA 1H4OA 4E8HA 1A2JA 1PSQA 4QL7A 3M3MA 3Q18A 4TRXA 3A2WA 2JU5A 3HVSA 2C1YA 5G5EA 4IP1A 2IPAA 4MJCA 3IK9A 1QGVA 4EC0A 1I9DA 4MF6A 3LXTA 1WWJA 2HNLA 5HR1A 2B6MA 3ERFA 3IA1A 2MYGA 1Z6NA 3CXGA 5B8AA 3EVIA 4KUNA 3D22A 4MMMA 1XWGA 2EIRA 2L5OA 3HJPA 2LKUA 4NWYA 4O32A 2YJ7A 4PGTA 1PQNA 5J4UA 2J23A 4AGSA 5IPHA 2ES7A 2YWOA 2VLTA 4RQRA 2RUFA 1HNCA 1BQ7A 5F0GA 5D73A 4K7IA 5F8BA 2VIMA 1SK1A 3QFAC 3VWWA 3L78A 1C72A 19GSA 2VL2C 2JZTA 2H30A 2MMAA 1XPVA 4PQHA 4L0WA 1X9SB 2PPTA 5ECRB 1DSBA 3A2VA 3KTBA 5F06A 3SWLA 1FG4A 3KP9A 2QKEA 3E0UA 1JHBA 1EGOA 5FWGA 2H01A 3UAPA 2HSMB 3TGZA 17GSA 4WR4A 3US3A 4K7OA 5DJLA 3F9UA 3RPNA 3CSIA 1W89A 1SKWB 5G5FA 4TOPA 2WJUA 3FR3A 1U6TA 3GKXA 2V6KA 4IVFA 2I9HA 1MD4A 2WRTA 2G2QA 4MH2A 2Z9SA 1AIUA 1YDKA 2PMTA 4IN0A 6GSTA 1OC9A 3UEMA 4NMUA 1OE8A 5J9BA 3IAS2 3FW2A 3LSZA 1M2BA 1DBYA 3C7MA 2JACA 3MWHA 1NHYA 1XVWA 4PQ1A 4FO5A 4YQMA 1O8WA 2H74A 2FCHA 1XCCA 4LMVA 1RW1A 2H75A 2WZ9A 3Q74A 3QOUA 1Z6MA 3HVXA 4J57E 3LJRA 1F9MA 3GFKA 1SENA 1DE2A 2HYXA 1A8YA 1OKTA 5ECNB 4ZBDA 2DIZA 2PWJA 1TU8A 3TJKA 1MDIA 2VCXA 3GL3A 2O89A 1SK2A 2WULA 1ML6A 2QGVA 5GAPD 4CHSA 2H0HA 3KIJA 1TTZA 3ZVJD 1ZYQB 1SD8A 3H79A 1ERVA 3DGQA 4OFTA 2DSAA 3TDGA 1T8EB 1QXHA 3OR5A 3VI7A 4H86A 4MJAA 4AJ7A 2JADA 3A5WA 3CTGA 2X8CA 2XPDA 4RUVA 1UC7A 2OACA 3HJOA 1WP0A 4IHUA 2H66A 11GSA 2IMKA 1R7HA 3GX0A 3BJ5A 3LFLA 4GSSA 2LRTA 1SJ6A 4IS0A 4E8EA 3LGCA 4F2IA 1SKSB 4FH8A 5JWQB 3PPUA 1ERWA 3GH9A 3CSJA 3Q19A 4BPYA 1BX9A 3NOFA 5J3RA 5AGYA 3M9JA 4N11A 3WT2A 1XW5A 3F63A 3D21A 3QDNA 4HOJA 5JWRB 4K6XA 4QQ7A 4K0GA 4V1Ap 4XS1A 1TRWA 1YEXA 3KCMA 2DC5A 12GSA 1AXDA 1Z3EA 1ZCPA 3DXBA 2NVLA 4G9HA 5CYYA 2J9HA 2RUEA 2C0GA 5E59A 1F6MC 4ZL8A 1F37A 1VF3A 4KH7A 3TKRA 5CRWA 1BAYA 4GTUA 4ECIA 1K0NA 3TJJA 3IDVA 3I69A 3P7XA 1SD9A 2HZEA 4Q5QA 1J0FA 3APQA 2H0IA 2B7KA 3ZIVA 4GQFA 2NDOA 3W8SA 3CSHA 3HJMA 2MMOA 1OC9B 4MLYA 2HXKA 4MZCA 4OFMA 2B5XA 1RQMA 4G19A 2VCZA 2IL3A 2I3YA 2FHEA 2GLRA 1B8XA 4MDCA 2XC2A 5D93A 2KUCA 1SL0B 2VO4A 1EOHA 2H6YA 3TRXA 3PINA 3RDWA 4LL4B 2B5EA 4XHMA 4MABA 1HYUA 1Y25A 2AAWA 2GSSA 2CX4A 4FQUA 2OBKA 5ECKB 3QFBC 5ECOB 4TVEA 4HEA2 3H1NA 2TIRA 3G9BA 1ERTA 1TJDA 1WPIA 4WBRD 1GSYA 1GTBA 2EIOA 4G0IA 4EL1A 3QMXA 2AV4A 3L4NA 2GZPA 5CREA 2E2MA 5DCHA 1DE1A 1XW6A 2V32A 1EV4A 5J5NA 1QUWA 2CVDA 1B4PA 4GQCA 3NIVA 1Q98A 3ZREA 3LORA 3DVWA 1XIYA 3LWAA 5A4WA 1A0FA 1U3IA 4ZBAA 2VCWA 1AQVA 4MZWA 3U6VA 2C4JA 1YQ1A 4XS4B 4YAPA 4JE1A 1GWCA 1YJ6A 1XVQA 3ME8A 1K0OA 2KLXA 4L0UA 3UVTA 2O85A 1T00A 3ZMKA 4I6XA 7GSSA 1KNGA 4ECBA 1O73A 4DEJA 2JZSA 3GX8A 3C73A 1MDJA 3AY8A 4ZL7A 4IQAA 3IXRA 2A2SA 5AISA 2B7JA 3IAM2 1U88A 1XW9A 3P90A 1PA3A 2KHPA 4MF7A 2ZCTA 1M99A 2IFQA 2CVKA 1M7TA 2IMFA 3ZVJA 2VM2A 3DVXA 2L6CA 2LV3A 3F6FA 2H72A 1XWCA 2R37A 2DJJA 4OO5A 2IWTA 4ILFA 3HVVA 3F0IA 4HI7A 3C1SA 3ED3A 1CQHA 3KGKA 2GZZA 2GQLA 4IJ3A 3TOUA 3GRXA 3CYNA 2LJKA 1SL1B 2GQMA 1EP8A 2CQ9A 2FWGA 1B9XC 4NXIA 1NM3A 2KP2A 1JZOA 3HZ8A 5GAND 2O8VB 2XBIA 3ZL5A 1X5EA 1BYEA 2LJRA 4PURA 1KTEA 3LYPA 5G2ZA 3QCPA 2JSZA 4KF9A 1BEDA 2WFCA 2LQQA 3HY2A 4IW9A 5D9VA 4PNGA 3GNJA 3GV1A 4JZQA 3QAGA 5KN2A 3EURA 4MH3A 5A4UA 2R2JA 4AJ6A 1K0MA 1XFLA 1G6YA 2F9SA 1VF1A 2YCDA 4EVMA 2L4CA 2YV7A 4OFNA 2HZEB 3FRCA 1THOA 2R6KA 1J9BA 1JFUA 3GYKA 1TRUA 1XZOA 1XWKA 4KSMA 3FZ4A 5DJMA 1T3BA 2FA8A 2VAFA 2IN3A 2AUVA 3WGXA 1HNBA 1XWBA 1OC8A 3QAVA 1G7OA 1MDKA 2CVBA 4ULXA 3L9UA 3UBLA 2CZ2A 1IYIA 2YZUA 4Q5FA 2YWMA 5D96A 1E2YA 3ZTLA 4PUFC 4JRRA 4QL9A 1AW9A 3MNGA 2VCVA 3RHCA 1TXXA 1TK8B 1N2AA 4ECJA 2DJKA 2O87A 1GSQA 2NTOA 3F3QA 4BVYA 2H73A 5EVOA 2FY6A 2F3MA 3GIXA 2N5FA 5GZZB 2VL9A 4N30A 3EYTA 2CZ3A 20GSA 5CO3A 2VD0A 2F8FA 1J08A 2HRKA 4IP6A 2ON7A 1B9YC 2I4AA 3R2QA 1URMA 5J9CA 5L71A 4GLTA 1LBKA 1HNAA 1UN2A 3BCIA 1DUGA 4X43A 4ML6A 5EY6A 3FZAA 3U5RE 4TN8A 2GS3A 2VCQA 4Q5NA 3BD2A 4JEDA 2DLXA 4KCAA 5E4WA 4EDYA 4G2EA 3GHAA 5ABRA 4K8MA 4WR5A 1TW9A 2YN1A 4LA1A 1FW1A 5CP1A 2FUG2 2QC7A 3FYGA 2YPMA 2C0FA 2K8SA 2AB6A 2FNOA 4ZB6A 4K0NA 4ML1A 1G6WA 2E0QA 5HFKA 3VPTA 5DCGA 1LU4A 5G31A 1BJXA 4P3YB 4K9ZA 4Z7XA 4PXOA 3ZMLA 3IK7A 2CV4A 3M8NA 5KN0A 2HZFA 2IFQB 5CRHA 4O5RA 4F82A 1EV9A 2HFDA 4MA9A 3FZ9A 2AYTA 2B3SA 2HRAA 3FEUA 4ECCA 1XOBA 3WYWA 1EGRA 4G0LA 2FWFA 2V1MA 2R5GA 1GLQA 2YWNA 3IC8A 4HDEA 1T4ZA 3VPQA 1QQ2A 4KAEA 2BJXA 2FGXA 5B6MA 2C3TA 3FY7A 2PVQA 4XS4A 2UZ8A 4FYBA 4IKHA 4TR4A 5GSSA 2MZCA 4LMWA 5D9TA 1ZMAA 3UBKA 2RM6A 4NV5A 2HRNA 4BL7A 2AJQB 3TKSA 3D5JA 5DALB 4KDUA 2P5RA 3TJFA 1TK0B 1GTAA 3LXZA 2GT6A 3K8NA 4YQUA 3HA9A 2DMLA 2OKAA 1FB0A 1ZGNA 1AUCA 3PR8A 3FR6A 3QR6A 1EEJA 3F8UA 3KZQA 1Z9HA 4DSQA 4PQIA 3RHBA 2E2GA 1V2AA 1SU9A 2H71A 5G30A 4G10A 1W4VA 4NHZA 1YF1A 5A5KA 1EWXA 1ST9A 3MAKA 2H76A 5LCZA 1TOFA 4TXOB 4Q5RA 1GUHA 1WRYA 3Q6OA 2LS5A 1YZXA 3EMXA 1JZRA 2N5AA 1FVJA 1H75A 1ACVA 1SJZA 5HR0A 1M0UA 4N10A 4TKYA 4POBA 4MZBA 1ERUA 1HQOA 3BCKA 3KMOA 2E7PA 5ECHB 1USBA 3EC3A 3GTUB 2HT9A 2LUSA 1TI3A 2R3XA 4CDOA 3TJBA 3NZNA 2OADA 4JR4A 3LG6A 4BVYB 2MMNA 4I2UA 4IBPA 3F4RA 4KW6A 4AJ8A 1HD2A 4L5LA 3C8EA 3HKRA 2HRKB 3EU4A 2C80A 3GUSA 3GMFA 1X9WB 3HCZA 1FVKA 2FD3A 2LSTA 1GSEA 3F4TA 2HRFA 4V1Ag 2JL4A 2LQOA 1QFNA 4F0CA 3O3TA 1GRXA 2CT6A 3HYPA 1A24A 2FWHA 1AAZA 5H5QA 1PRXA 5EL8A 4OCEA 1ILOA 3IV4A 1T7PB 1QMVA 4POLA 2JZRA 8GSSA 2GVPA 3F4SA 1GH2A 3KH7A 4V2LA 4XIHA 3CTFA 2K6VA 1TK5B 4GSNA 1QK8A 2GQKA 3N5OA 5IMDA 3WGEA 4F9ZA 1TRSA 2OE0A 2LRNA 4DSRA 5A4VA 5CRGA 3UOMA 2H19A 4OO4A 2MMZA 2VM1A 3CMIA 2OJLA 4HUAA 2C0DA 2I81A 3ME7A 5JCGA 4WBJA 1VGLA 4OMVA 4WF5A 2DMMA 3W8JA 1YY7A 4IJIA 3FKFA 1SKRB 1GSFA 3FHKA 1F3BA 2R4VA 2C3NA 3IR4A 1E6BA 1YF0A 4RQXA 4TR1A 3GN3A 1X5CA 1Z7PA 4K7NA 4GCIA 3EMPA 4HU9A 2RLIA 2YWIA 2BMXA 3TKPA 2XHFA 1IYHA 2H1GA 2HLSA 5HR2A 1GTUA 3G7YA 2OA7A 3H93A 2L57A 3DYRA 2D2ZA 4L8EA 3LEFA 3E9JB 4HZ4A 1T4YA 1ZZYA 1R5AA 4CW9A 4BL7B 4EDZA 3C1RA 1MTCA 1SK0A 4ZB8A 1OE7A 4O7HA 3VWXA 3ZFLA 3TJGA 2K8VA 1RK4A 2M46A 2REMA 1GUKA 2IMDA 1FO5A 3J7Yb 1SJIA 4YAVA 3KH9A 3WGDA 4JR6A 1A2MA 2MBSA 1GNWA 2F8AA 1AQWA 5IM9A 1KBNA 1X0RA 3M1GA 22GSA 4NHWA 4POKA 1WE0A 4WKWA 5EPFA 4MF5A 1JLWA 3M0FA 1FB6A 2B1KA 4GWRA 3GH6A 4FYCA 2TRCP 2OE1A 4KE3A 5B6NA 3QD9A 4KX4A 3VWUA 5AN1A 4KA0A 2VLVA 5F05A 3H4KA 3A3TA 3TKQA 2L5LA 1GL8A 1BG5A 3I6AA 1FOVA 3JCML 2CX3A 1UVZA 2A4VA 2P0GA 1PX7A 1ABAA 3DIEA 2P5QA 2DJ1A 2DJ3A 1YKAA 2YV9A 3TRPA 2WB9A 2PUKC 1PGTA 1PKWA 1O8XA 3HZ4A 1Z7RA 5DALA 2HSNB 1GNEA 2X8HA 3EU3A 1S3CA 4HQSA 5JCUA 4ID0A 5DBQA 2YP6A 4YH2A 1WIKA 2L59A 3D0ZA 1U3AA 6GSXA 5CAXA 4KNDA 3BBYA 1ZYEA 5DDLA 3KXOA 4TW5A 4I8BA 2M80A 4OWYA 2X64A 3GKMA 3VI5A 4ZIJA 1R26A 4TXOA 4OD7A 4JBBA 5IOXA 10GSA 2GT5A 2XBQA 3R3EA 2WCIA 2B5YA 4IQ1A 1GUMA 4XTSA 1VRSD 4EXJA 1JZDA 1AC1A 1NW2A 2DIYA 1FAAA 2LNSA 1B48A 3VFIA 3KP8A 5ID2B 1PL1A 3D6IA 3TRQA 5DAKB 1EP7A 4F0BA 1UA5A 2X8GA 4AF2A 3GTUA 5LD0A 3EINA 4N0VA 4EKZA 3ERWA 1ON4A 3EWLA 1PN9A 2V41A 3HDCA 2HQTA 2LJAA 4MCUA 3QPMA 5ECLB 1G7EA 5ECSA 4I5QA 13GSA 2TRXA 2H1DA 4EUYA 1TU7A 1S3AA 4HU7A 1TI1A 1K0AA 2YZHA 3UL3A 3RPPA 1A8LA 4TR1B 1TKDB 3VWVA 3WD6A 5G1KA 4PNFA 4KDYA 3ZYWA 2QSIA 4ZXGA 2G0FA 2H70A 4FYUA 5IMCA 9GSSA 2K9FA 1GSDA 2WGRA 3RAZA 1YKCA 2A2RA 1NSWA 4BVXA 4K1FA 5DQYA 3I9V2 2PVOC 5GSTA 4ZILA 2VUPA 5IOWA 1NHOA 5G1LA 3GURA 2H1AA 5CRDA 4WETA 4BA7A 3TCOA 4D73B 3D4TA 2GSQA 1EEMA 1YEPA 3ZITA 1X9MB 1EOGA 18GSA 1M2DA 5IMVA 2VL2A 2V6OA 1SYRA 1A0RP 5ELGA 5J41A 4WEYA 1LJRA 4EF0A 1N8JA 5JWOB 5IO2A 3CBUA 4MJBA 14GSA 3TOTA 1Q4JA 4PTSA 2LEGA 4KGIA 2JSYA 1PD21 2DJ2A 4ZL9A 3TKSC 2NBSA 1TDIA 1PX6A 4NPBA 3G7JA 3ZIJA 3HXSA 2OBIA 3N9JA 3PH9A 2WS2A 2PU9C 5FT3A 2GSRA 3KTLA 6GSVA 2M72A 4L5OA 4HQZA 3S9FA 2BTOT 2RIIA 4MP4A 2YOIA 1OYJA 3GSSA 3VLNA 1PKZA 3VURA 4MJEA 5COHA 4LL1B 1K0DA 3TB2A 5DVBA 3G7IA 1R4WA 3IHQA 1V40A 3IRAA 2VCTA 5IQYA 3C71A 2PERA 3RBTA 3F3RA 1GLPA 1GSUA 2IJYA 1K3OA 3L0HA 4HS1A 2H6XA 3SBCA 1FHEA 6GSUA 2FA4A 3FR9A 5B8BA 1ZL9A 2ZNMA 1WMJA 1PMTA 2IMIA 2YNXA 1PL2A 3ISOA 3KEBA 4NV2A 2HSHA 1Z5YE 2YJHA 4USSA 4KCEA 4POMA 2YANA 4ISDA 2HE3A 4K2DA 2PGTA 1CQGA 3J7Yk 5HR3A 3O6TA 1XBSA 1AQXA 4WF4A 4IGJA 3IC4A 2L4QA 3F6DA 1SL2B 4DSSA 1F3AA 5IMAA 3DRNA 2L6DA 3O76A 2V2GA 1T1VA 5KEJA 4DVCA 1WJKA 3GKNA 1OAZA 5AIVA 1EZKA 4GXZA 2WDUA 3W6GA 2HI7A 2GSTA 1JZWA 4EO3A 2H1BA 1GSSA 3V1WA 4O92A 2H6ZA 2FWEA 1SYXA 1GULA 2GZYA 2VLUA 2LRCA 3GSTA 4RI6A 3UJ1A 4HZ2A 2LNTA 1O6JA 5HFGA 1A2LA 1TRVA 4WXTA 3UIWA 4KDXA 5D9XA 5BMUA 3DEXA 3D4MA 4RI7A 5KN1A 4PX1A 4BVXB 2PBJA 5ECIB 4GF0A 3M9KA 2X99A 4ACSA 1G0TA 5H5RA 3FZ5A 3P8WA 2PN8A 1XXUA 2CAQA 3GA4A 3ZLPA 3DD3A 3ERGA 1V9WA 2IIYA 1JLVA 4GRFA 1M2AA 2EC4A 3VK9A 3HHVA 1V98A 1K3LA 1MD3A 3HD5A 1O81A 4HJ2A 4MPGA 5ID2A 1B4QA 4XRAA 4V2MA 2KOKA 4JU5A 3LQ7A 5DAKA 2K18A 3TUEA 3ZZXA 2VD1A 2B1LA 3P2AA 1O7UA 1VF4A 4G0KA 3IE3A 3APSA 3DMLA 2GTUA 1Y6EA 6GSWA 4XCSA 4X1UA 3CRUA 2CA8A 4ZBBA 16GSA 3KD0A 3MDKA 5DQSA 1OVNA 1V57A 3KM6A 2KP1A 4GSTA 5B7CA 4TR0A 5F07A 3ZFBA 5C04A 2RM5A 5JCWA 4BWSA 2VOCA 4OCFA 3L9VA 4X0XA 4HJMA 2OE3A 3IBHA 3I43A 5D9WA 2CAIA 4J56E 5LNKe 4XS6A 3GKKA 5KN3A 4TR3A 5ELAA 1XWAA 4I2TA 5IPGA 5FHIA 4KB3A 3KMNA 2ZUPA 4BWQA 1OKDA 1MEKA 1M9AA 4TXVA 3IPZA 2HSMA 3UMAA 2XPEA 4D73A 2P31A 3APOA 4LLRA 5IIZA 5ECMB 4IELA 1VF2A 2F51A 4MPFA 5D8IA 5IO0A 3WT1A 1K0CA 1O85A 3L9SA 2FLSA 1S3DA 2C8UA 2IMEA 3IOSA 3QAWA 6GSYA 1ZOFA 2I1UA 5AIXA 1X5DA 3DKSA 1U87A 2C0EA 2EIQA 1THXA 4YQVA 3H8QA 3E3EA 5ECQB 1K0BA 2ALBA 4I97A 4F03A 3DWVA 1TP9A 5C00A 2NPBA
chains in the Genus database with same CATH superfamily
2DBCA 2DJ0A 3PGTA 5IMZA 4EE0A 3TKSE 2MBTA 1GP1A 1F2EA 5A34B 2GDRA 2H8LA 3MSZA 1K3YA 1I5GA 5A5HA 3EE2A 5IMFA 4J2FA 4PUAA 3FK8A 1WOUA 2H0GA 4DSSB 1M9BA 4KSOA 2O7KA 1OC3A 5H5SA 3TU3B 4XRDA 1R5PA 2N5BA 4MK3A 3UVHA 4V2NA 3BOAA 6GSSA 4NAXA 1XOAA 4K5RA 2ON5A 3GL5A 3KJYA 3LYKA 4FIWA 5INYA 1XG8A 3UARA 5ECPB 5HFIA 3ZRDA 1GTIA 3CRTA 4ZB9A 1A23A 2C3QA 5CNWA 2VL3A 5ENUA 2GGTA 2HSYA 4N0ZA 2LTKA 3A2XA 2AHEA 5HQPA 1V58A 1KEBA 1H4OA 4E8HA 1A2JA 1PSQA 4QL7A 3M3MA 3Q18A 4TRXA 3A2WA 2JU5A 3HVSA 2C1YA 5G5EA 4IP1A 2IPAA 4MJCA 3IK9A 1QGVA 4EC0A 1I9DA 4MF6A 4O5UA 4O5QA 3LXTA 1WWJA 2HNLA 5HR1A 2B6MA 3ERFA 3IA1A 2MYGA 1Z6NA 3CXGA 5B8AA 3EVIA 4KUNA 3D22A 4MMMA 1XWGA 2EIRA 2L5OA 3HJPA 2LKUA 4NWYA 4O32A 2YJ7A 4PGTA 1PQNA 5J4UA 2J23A 4AGSA 5IPHA 2ES7A 2YWOA 2VLTA 4RQRA 2RUFA 1HNCA 3RGBC 1BQ7A 5F0GA 5D73A 4K7IA 5F8BA 2VIMA 1SK1A 3QFAC 3VWWA 3L78A 1C72A 19GSA 2WW1A 2VL2C 2JZTA 2H30A 2MMAA 1XPVA 4PQHA 4L0WA 1X9SB 2PPTA 5ECRB 1DSBA 3A2VA 3KTBA 5F06A 3SWLA 1FG4A 3KP9A 2QKEA 3E0UA 1JHBA 1EGOA 5FWGA 2H01A 3UAPA 5BRTA 2HSMB 3TGZA 17GSA 4WR4A 3US3A 4K7OA 5DJLA 3F9UA 3RPNA 3CSIA 1W89A 1SKWB 5G5FA 4TOPA 2WJUA 4K5SA 1M3JA 3FR3A 4PI0C 1U6TA 3GKXA 2V6KA 4IVFA 2I9HA 1MD4A 2WRTA 2G2QA 5A1NA 4MH2A 2X4AA 2Z9SA 1AIUA 1YDKA 2PMTA 4IN0A 5J47A 6GSTA 1OC9A 3UEMA 4NMUA 1OE8A 5J9BA 3IAS2 3FW2A 3LSZA 1M2BA 1DBYA 3C7MA 2JACA 3MWHA 2R0CA 1NHYA 1XVWA 4PQ1A 4FO5A 4YQMA 1O8WA 2H74A 2FCHA 1XCCA 4LMVA 1RW1A 2H75A 2WZ9A 3Q74A 5J4VA 1Z6MA 3QOUA 3HVXA 4J57E 3LJRA 1F9MA 3GFKA 1SENA 1DE2A 2HYXA 1A8YA 1OKTA 5ECNB 4ZBDA 2DIZA 2PWJA 1TU8A 3TJKA 1MDIA 2VCXA 3GL3A 2O89A 1SK2A 2WULA 1ML6A 2QGVA 1YVLA 5GAPD 4CHSA 2H0HA 3KIJA 1TTZA 3ZVJD 1ZYQB 1SD8A 3H79A 2H1LA 1ERVA 3DGQA 4OFTA 2DSAA 3TDGA 1T8EB 1QXHA 3OR5A 3VI7A 4H86A 4MJAA 4AJ7A 2O5VA 2JADA 3A5WA 3CTGA 2X8CA 2XPDA 1ZYPA 4RUVA 1UC7A 2OACA 3HJOA 1WP0A 4IHUA 2H66A 4BIKA 11GSA 2IMKA 1R7HA 3GX0A 3BJ5A 3LFLA 4GSSA 2LRTA 1SJ6A 5A34A 4IS0A 4E8EA 3LGCA 4F2IA 1SKSB 4FH8A 5JWQB 3PPUA 1BG1A 2OT3A 1ERWA 3GH9A 3CSJA 3Q19A 4BPYA 1BX9A 3NOFA 5J3RA 5AGYA 3M9JA 4N11A 3WT2A 1XW5A 3F63A 3D21A 3QDNA 4HOJA 5JWRB 4K6XA 4QQ7A 4K0GA 4V1Ap 4MNNA 4QMKA 4XS1A 1TRWA 1YEXA 3KCMA 2DC5A 12GSA 1AXDA 1Z3EA 1ZCPA 3DXBA 2NVLA 4G9HA 5CYYA 2J9HA 2RUEA 2C0GA 5E59A 1F6MC 4ZL8A 1F37A 1VF3A 4KH7A 3TKRA 5CRWA 1BAYA 4GTUA 4ECIA 1K0NA 3TJJA 3IDVA 3I69A 2WVXB 3P7XA 1SD9A 2HZEA 4Q5QA 1J0FA 3APQA 2H0IA 2B7KA 3ZIVA 5A1NB 4GQFA 2NDOA 3W8SA 3CSHA 3HJMA 2MMOA 1OC9B 4MLYA 2HXKA 4MZCA 4OFMA 2B5XA 1RQMA 4G19A 1Y1UA 2VCZA 2IL3A 2I3YA 2FHEA 2GLRA 1B8XA 4MDCA 2XC2A 5D93A 2KUCA 1SL0B 2VO4A 1EOHA 2H6YA 3TRXA 3PINA 3RDWA 4LL4B 2B5EA 4XHMA 4MABA 1HYUA 1Y25A 2AAWA 2GSSA 1PFOA 2CX4A 4FQUA 2OBKA 5ECKB 3QFBC 5ECOB 2X49A 4TVEA 4HEA2 3H1NA 2TIRA 1FOHA 3G9BA 1ERTA 1TJDA 1WPIA 4WBRD 1GSYA 1GTBA 2EIOA 4G0IA 4EL1A 3QMXA 2AV4A 3L4NA 2GZPA 5CREA 2E2MA 5DCHA 1DE1A 1XW6A 2V32A 1EV4A 5J5NA 1PN0A 1QUWA 2CVDA 1B4PA 4GQCA 3NIVA 1Q98A 3ZREA 3LORA 3DVWA 1XIYA 3LWAA 5A4WA 1A0FA 1U3IA 4ZBAA 2VCWA 1AQVA 4MZWA 3U6VA 2C4JA 2EFDA 1YQ1A 4XS4B 4YAPA 4JE1A 1GWCA 1YJ6A 1XVQA 3ME8A 1K0OA 2KLXA 4L0UA 3UVTA 2O85A 4X4JA 1T00A 3ZMKA 4I6XA 7GSSA 1KNGA 4ECBA 1O73A 4DEJA 2JZSA 3GX8A 3C73A 1MDJA 3AY8A 4ZL7A 4IQAA 3IXRA 1I1IP 3IHGA 2A2SA 5AISA 2B7JA 3IAM2 1U88A 1XW9A 4EIQA 3P90A 1PA3A 2KHPA 4MF7A 2ZCTA 1M99A 2IFQA 2CVKA 1M7TA 2IMFA 3ZVJA 2VM2A 2DKIA 3DVXA 2L6CA 2LV3A 3F6FA 2H72A 1XWCA 4CY8A 2R37A 2DJJA 4OO5A 2IWTA 4ILFA 3HVVA 3F0IA 4HI7A 3C1SA 3ED3A 1CQHA 3KGKA 2GZZA 2UV8G 2GQLA 4IJ3A 3TOUA 3GRXA 3CYNA 2LJKA 1SL1B 2GQMA 1EP8A 2CQ9A 2FWGA 1B9XC 4NXIA 1NM3A 2KP2A 1JZOA 3HZ8A 5GAND 2O8VB 2XBIA 3ZL5A 1X5EA 2R0GA 1BYEA 2LJRA 4PURA 1KTEA 3LYPA 5G2ZA 3QCPA 2JSZA 4KF9A 1BEDA 2WFCA 2LQQA 3HY2A 4IW9A 5D9VA 4PNGA 3GNJA 3GV1A 4JZQA 3QAGA 5KN2A 3EURA 4MH3A 5A4UA 2R2JA 3CWGA 4AJ6A 1K0MA 1XFLA 1G6YA 2F9SA 1VF1A 2YCDA 4EVMA 2L4CA 2YV7A 4OFNA 2HZEB 3FRCA 4K2XA 1THOA 2R6KA 1J9BA 1JFUA 3GYKA 1TRUA 1XZOA 1XWKA 4KSMA 3FZ4A 5DJMA 1T3BA 2FA8A 2VAFA 2IN3A 2AUVA 3WGXA 1HNBA 1XWBA 1OC8A 3QAVA 1G7OA 1MDKA 2CVBA 4ULXA 3L9UA 3UBLA 2CZ2A 1IYIA 2YZUA 4Q5FA 2YWMA 5D96A 1E2YA 2VKZG 3ZTLA 4PUFC 4JRRA 4QL9A 1AW9A 3MNGA 2VCVA 3RHCA 1TXXA 1TK8B 1N2AA 4ECJA 2DJKA 2O87A 1GSQA 2NTOA 3F3QA 4BVYA 2H73A 5EVOA 2FY6A 2F3MA 3MYDA 3GIXA 2N5FA 5GZZB 2O3EA 2VL9A 4N30A 3EYTA 2CZ3A 20GSA 5CO3A 2VD0A 2F8FA 1J08A 2HRKA 4IP6A 2ON7A 1B9YC 2I4AA 3R2QA 1URMA 5J9CA 5L71A 4GLTA 1LBKA 1HNAA 1UN2A 3BCIA 1DUGA 4X43A 2WVXA 4ML6A 5EY6A 3FZAA 3U5RE 4TN8A 2GS3A 2VCQA 4Q5NA 3BD2A 4JEDA 2DLXA 4KCAA 4PHZC 5E4WA 4EDYA 4G2EA 3GHAA 5ABRA 4K8MA 4WR5A 1TW9A 2YN1A 4LA1A 1FW1A 5CP1A 2FUG2 2QC7A 3FYGA 2YPMA 2WVZA 2C0FA 2K8SA 2AB6A 2FNOA 4ZB6A 4K0NA 2EFCA 4ML1A 1G6WA 5J40A 2E0QA 5HFKA 3VPTA 5DCGA 1LU4A 5G31A 1BJXA 4P3YB 3MIXA 4W66A 1N25A 4K9ZA 4Z7XA 4PXOA 3ZMLA 3IK7A 2CV4A 3M8NA 5KN0A 2HZFA 2IFQB 5CRHA 4O5RA 4F82A 1EV9A 2HFDA 4MA9A 3FZ9A 2AYTA 2B3SA 2HRAA 3FEUA 4ECCA 4FXYP 1XOBA 3WYWA 1EGRA 4G0LA 2FWFA 2V1MA 2R5GA 1GLQA 2YWNA 3IC8A 4HDEA 1T4ZA 3VPQA 1QQ2A 4KAEA 2BJXA 2FGXA 5B6MA 2C3TA 3FY7A 2PVQA 4XS4A 2UZ8A 4FYBA 4IKHA 4TR4A 5GSSA 2MZCA 4LMWA 5D9TA 1ZMAA 3UBKA 2RM6A 4NV5A 4G01A 2HRNA 4BL7A 2AJQB 3TKSA 3D5JA 5DALB 4KDUA 2P5RA 3LW9A 3TJFA 1TK0B 1GTAA 2WVYA 3LXZA 2GT6A 3K8NA 4YQUA 3HA9A 2DMLA 2OKAA 1FB0A 1ZGNA 1AUCA 3PR8A 3FR6A 3QR6A 1EEJA 3EPTA 3FMWA 3F8UA 3KZQA 1Z9HA 4DSQA 4PQIA 3RHBA 2E2GA 1V2AA 2WW2A 1SU9A 2H71A 5G30A 4G10A 1W4VA 4NHZA 1YF1A 5A5KA 1EWXA 1ST9A 3MAKA 2H76A 5LCZA 1TOFA 4TXOB 4Q5RA 1GUHA 1WRYA 3Q6OA 2LS5A 1YZXA 3EMXA 1JZRA 2N5AA 1FVJA 1H75A 1ACVA 1SJZA 5HR0A 1M0UA 4N10A 4TKYA 4POBA 4MZBA 1ERUA 1HQOA 3BCKA 4ICYA 3KMOA 2E7PA 5ECHB 1USBA 3EC3A 3GTUB 2HT9A 2LUSA 1TI3A 2R3XA 4CDOA 4Z2TA 3TJBA 3NZNA 2OADA 4JR4A 3LG6A 4BVYB 2MMNA 4I2UA 4IBPA 3F4RA 4KW6A 4AJ8A 1HD2A 4L5LA 3C8EA 2HSNA 5KOWA 3HKRA 2HRKB 3EU4A 2C80A 3GUSA 3GMFA 1X9WB 3HCZA 1FVKA 2FD3A 2LSTA 1GSEA 3F4TA 5KOXA 2HRFA 4V1Ag 2JL4A 2LQOA 1QFNA 4Z2UA 4F0CA 3O3TA 1GRXA 2CT6A 3HYPA 1A24A 2FWHA 1AAZA 5H5QA 1PRXA 5EL8A 4OCEA 1ILOA 3IV4A 4EIPA 1T7PB 1QMVA 4POLA 2JZRA 8GSSA 2GVPA 3F4SA 1GH2A 3KH7A 4V2LA 4XIHA 3CTFA 2K6VA 4A5PA 1TK5B 4GSNA 1QK8A 2GQKA 3N5OA 5IMDA 3WGEA 4F9ZA 1TRSA 2OE0A 2LRNA 4DSRA 5A4VA 5CRGA 3UOMA 2H19A 4OO4A 4AI6A 2MMZA 2VM1A 3CMIA 3HVNA 2OJLA 4HUAA 2C0DA 2I81A 3ME7A 5JCGA 4WBJA 1VGLA 4YKGA 4OMVA 4WF5A 2DMMA 3W8JA 1YY7A 4IJIA 3FKFA 1SKRB 1GSFA 3FHKA 1F3BA 2R4VA 2C3NA 3IR4A 2EFEA 1E6BA 1YF0A 4RQXA 4TR1A 3GN3A 1X5CA 1Z7PA 4K7NA 4GCIA 3EMPA 4HU9A 2RLIA 2YWIA 2BMXA 3TKPA 2XHFA 1IYHA 2H1GA 2HLSA 5HR2A 1GTUA 3G7YA 2OA7A 3H93A 2L57A 3DYRA 2D2ZA 4L8EA 3LEFA 1SVMA 4HZ4A 3E9JB 1T4YA 4Z2RA 1ZZYA 1R5AA 2WW0A 4CW9A 4BL7B 4EDZA 3C1RA 1MTCA 1SK0A 4ZB8A 1OE7A 4O7HA 3VWXA 2QA2A 3ZFLA 3TJGA 2K8VA 1RK4A 2M46A 2REMA 1GUKA 2IMDA 1FO5A 3J7Yb 1SJIA 4YAVA 3KH9A 3WGDA 4JR6A 1A2MA 1YEWC 2MBSA 1GNWA 2F8AA 1AQWA 5IM9A 1KBNA 1X0RA 3M1GA 22GSA 4NHWA 4POKA 1WE0A 4WKWA 5EPFA 4MF5A 2A2PA 1JLWA 3M0FA 1FB6A 2B1KA 4GWRA 3GH6A 4YKFA 4FYCA 2TRCP 2OE1A 4KE3A 5B6NA 3QD9A 4KX4A 3VWUA 5AN1A 4KA0A 2VLVA 5F05A 3H4KA 3A3TA 3TKQA 2L5LA 1GL8A 4AKXB 1BG5A 3I6AA 1FOVA 3JCML 2CX3A 1UVZA 2A4VA 2P0GA 1PX7A 1ABAA 3DIEA 2P5QA 2DJ1A 2DJ3A 1YKAA 2YV9A 3TRPA 2WB9A 2PUKC 1PGTA 1PKWA 1O8XA 3HZ4A 1Z7RA 5DALA 2HSNB 1GNEA 2X8HA 3EU3A 1S3CA 4HQSA 5JCUA 4ID0A 5DBQA 2YP6A 4YH2A 1WIKA 2L59A 3D0ZA 1U3AA 5BMUB 6GSXA 5CAXA 4KNDA 2DKHA 3BBYA 1ZYEA 5DDLA 3KXOA 4TW5A 4I8BA 2M80A 4OWYA 2X64A 3GKMA 3VI5A 2A4HA 4ZIJA 1R26A 4TXOA 4OD7A 4JBBA 5IOXA 10GSA 2GT5A 2XBQA 3R3EA 2WCIA 2B5YA 4IQ1A 1GUMA 4XTSA 1VRSD 4EXJA 1JZDA 1AC1A 1NW2A 2DIYA 1FAAA 2LNSA 1B48A 3VFIA 3KP8A 5ID2B 1PL1A 3D6IA 3TRQA 5DAKB 1EP7A 2QA1A 4F0BA 1UA5A 2X8GA 4AF2A 3GTUA 5LD0A 1SVOA 3EINA 4N0VA 4EKZA 3ERWA 1ON4A 3EWLA 1PN9A 2V41A 3HDCA 2HQTA 2LJAA 4MCUA 3QPMA 5ECLB 1G7EA 5ECSA 4I5QA 13GSA 2TRXA 4GDFA 2H1DA 4EUYA 1TU7A 1S3AA 4HU7A 1TI1A 1K0AA 2YZHA 3UL3A 3RPPA 1A8LA 4TR1B 3A5IA 1TKDB 3VWVA 3WD6A 5G1KA 4PNFA 4KDYA 1ZYNA 3ZYWA 2QSIA 4ZXGA 2G0FA 2H70A 4FYUA 5IMCA 9GSSA 2K9FA 1GSDA 2WGRA 3RAZA 1YKCA 2A2RA 1NSWA 4BVXA 4K1FA 5DQYA 3I9V2 1TXUA 2PVOC 5GSTA 4ZILA 2VUPA 5IOWA 1NHOA 5G1LA 3GURA 2H1AA 5CRDA 4WETA 4BA7A 3TCOA 4D73B 3D4TA 2GSQA 1EEMA 4AKHA 1YEPA 3ZITA 1X9MB 1EOGA 18GSA 1M2DA 5IMVA 2VL2A 2V6OA 1SYRA 1A0RP 5ELGA 5J41A 4WEYA 1LJRA 2WZSA 4EF0A 1N8JA 5JWOB 5IO2A 3CBUA 4MJBA 4ZB7A 14GSA 3TOTA 1Q4JA 4PTSA 2LEGA 4KGIA 2JSYA 1PD21 2DJ2A 4ZL9A 3TKSC 2NBSA 1TDIA 1PX6A 4NPBA 3G7JA 3ZIJA 3HXSA 2OBIA 3N9JA 3PH9A 2WS2A 2PU9C 5FT3A 2GSRA 3KTLA 6GSVA 5A5HB 2M72A 4L5OA 4HQZA 3S9FA 2BTOT 2RIIA 4MP4A 2YOIA 1OYJA 3GSSA 3VLNA 1PKZA 3VURA 1BF5A 4MJEA 5COHA 4LL1B 1K0DA 3TB2A 5DVBA 3G7IA 1R4WA 3IHQA 1V40A 3IRAA 2VCTA 5IQYA 3C71A 2PERA 3RBTA 5J4YA 4AKIA 3F3RA 1GLPA 1GSUA 2IJYA 1K3OA 3L0HA 4HS1A 2H6XA 3SBCA 1FHEA 6GSUA 2FA4A 3FR9A 5B8BA 1ZL9A 2ZNMA 1WMJA 1PMTA 2IMIA 2YNXA 1PL2A 3ISOA 3KEBA 4NV2A 2HSHA 1Z5YE 2YJHA 4USSA 4KCEA 4POMA 2YANA 4ISDA 2HE3A 4K2DA 2PGTA 1CQGA 3J7Yk 5HR3A 2O36A 3O6TA 1XBSA 1AQXA 4WF4A 4IGJA 3IC4A 2L4QA 3F6DA 3CHXC 4E68A 2WW3A 1SL2B 4DSSA 1F3AA 5IMAA 3DRNA 4N3ZA 2L6DA 3O76A 2V2GA 1T1VA 5KEJA 4DVCA 1WJKA 1S4BP 3GKNA 1OAZA 5AIVA 1EZKA 4GXZA 2WDUA 3W6GA 2HI7A 2GSTA 1JZWA 4EO3A 2H1BA 1GSSA 3V1WA 4O92A 2H6ZA 2FWEA 1SYXA 1GULA 2GZYA 2VLUA 2LRCA 3GSTA 4RI6A 3UJ1A 4HZ2A 2LNTA 1O6JA 5HFGA 1A2LA 1TRVA 4WXTA 3UIWA 4KDXA 5D9XA 5BMUA 3DEXA 3D4MA 1SVLA 4RI7A 5KN1A 4PX1A 4BVXB 2PBJA 5ECIB 4GF0A 3M9KA 2X99A 4ACSA 1G0TA 5H5RA 3FZ5A 3P8WA 2EFHA 2PN8A 3RFRC 1XXUA 2CAQA 3GA4A 3ZLPA 3DD3A 3ERGA 1V9WA 2IIYA 1JLVA 4GRFA 1M2AA 2EC4A 3VK9A 3HHVA 1V98A 2R0PA 4PI2C 1K3LA 1MD3A 3HD5A 1O81A 4HJ2A 4MPGA 4CY6A 5ID2A 4XRAA 4V2MA 1B4QA 2KOKA 4JU5A 3LQ7A 5DAKA 2K18A 3TUEA 3ZZXA 2VD1A 2B1LA 3P2AA 1O7UA 1VF4A 4G0KA 3IE3A 3APSA 3DMLA 2GTUA 1Y6EA 6GSWA 4XCSA 4X1UA 3CRUA 2CA8A 4ZBBA 16GSA 3KD0A 3MDKA 5DQSA 1OVNA 1V57A 3KM6A 2KP1A 4GSTA 5B7CA 4TR0A 5F07A 3ZFBA 5C04A 2RM5A 5JCWA 4BWSA 2VOCA 4OCFA 3L9VA 4X0XA 4HJMA 2OE3A 3IBHA 3I43A 5D9WA 2CAIA 4J56E 5LNKe 1M3IA 4XS6A 3GKKA 5KN3A 4TR3A 5ELAA 1XWAA 4I2TA 5IPGA 5FHIA 4KB3A 3KMNA 2ZUPA 1S3RA 4BWQA 1OKDA 3CQFA 1MEKA 1M9AA 4TXVA 3IPZA 2HSMA 3UMAA 2XPEA 4D73A 2P31A 3APOA 4LLRA 5IIZA 5ECMB 4IELA 1VF2A 2F51A 4MPFA 5D8IA 5IO0A 3WT1A 1K0CA 1O85A 3L9SA 2FLSA 1S3DA 3HMJG 4HSCX 2C8UA 2IMEA 3IOSA 3QAWA 6GSYA 1ZOFA 2I1UA 5AIXA 4AKGA 1X5DA 3DKSA 1U87A 2C0EA 2EIQA 1THXA 4YQVA 3H8QA 3E3EA 5ECQB 1K0BA 2ALBA 4I97A 4F03A 3DWVA 1TP9A 5C00A 2NPBA
chains in the Genus database with same CATH topology
2DBCA 2DJ0A 3PGTA 5IMZA 4EE0A 3TKSE 2MBTA 1GP1A 1F2EA 5A34B 2GDRA 2H8LA 3MSZA 1K3YA 1I5GA 5A5HA 3EE2A 5IMFA 4J2FA 4PUAA 3FK8A 1WOUA 2H0GA 4DSSB 1M9BA 4KSOA 2O7KA 1OC3A 5H5SA 3TU3B 4XRDA 1R5PA 2N5BA 4MK3A 3UVHA 4V2NA 3BOAA 6GSSA 4NAXA 1XOAA 4K5RA 2ON5A 3GL5A 3KJYA 3LYKA 4FIWA 5INYA 3UARA 5ECPB 5HFIA 3ZRDA 1GTIA 3CRTA 4ZB9A 1A23A 2C3QA 5CNWA 2VL3A 5ENUA 2GGTA 2HSYA 4N0ZA 2LTKA 3A2XA 2AHEA 5HQPA 1V58A 1KEBA 1H4OA 4E8HA 1A2JA 1PSQA 4QL7A 3M3MA 3Q18A 4TRXA 3A2WA 2JU5A 3HVSA 2C1YA 5G5EA 4IP1A 2IPAA 4MJCA 3IK9A 1QGVA 4EC0A 1I9DA 4MF6A 4O5UA 4O5QA 3LXTA 1WWJA 2HNLA 5HR1A 2B6MA 3ERFA 3IA1A 2MYGA 1Z6NA 3CXGA 5B8AA 3EVIA 4KUNA 3D22A 4MMMA 1XWGA 2EIRA 2L5OA 3HJPA 2LKUA 4NWYA 4O32A 2YJ7A 4PGTA 1PQNA 5J4UA 2J23A 4AGSA 5IPHA 2ES7A 2YWOA 2VLTA 4RQRA 2RUFA 1HNCA 1BQ7A 5F0GA 5D73A 4K7IA 5F8BA 2VIMA 1SK1A 3QFAC 3VWWA 3L78A 1C72A 19GSA 2VL2C 2JZTA 2H30A 2MMAA 1XPVA 4PQHA 4L0WA 1X9SB 2PPTA 5ECRB 1DSBA 3A2VA 3KTBA 5F06A 3SWLA 1FG4A 3KP9A 2QKEA 3E0UA 1JHBA 1EGOA 5FWGA 2H01A 3UAPA 5BRTA 2HSMB 3TGZA 17GSA 4WR4A 3US3A 4K7OA 5DJLA 3F9UA 3RPNA 3CSIA 1W89A 1SKWB 5G5FA 4TOPA 2WJUA 4K5SA 3FR3A 1U6TA 3GKXA 2V6KA 4IVFA 2I9HA 1MD4A 2WRTA 2G2QA 5A1NA 4MH2A 2X4AA 2Z9SA 1AIUA 1YDKA 2PMTA 4IN0A 5J47A 6GSTA 1OC9A 3UEMA 4NMUA 1OE8A 5J9BA 3IAS2 3FW2A 3LSZA 1M2BA 1DBYA 3C7MA 2JACA 3MWHA 2R0CA 1NHYA 1XVWA 4PQ1A 4FO5A 4YQMA 1O8WA 2H74A 2FCHA 1XCCA 4LMVA 1RW1A 2H75A 2WZ9A 3Q74A 5J4VA 1Z6MA 3QOUA 3HVXA 4J57E 3LJRA 1F9MA 3GFKA 1SENA 1DE2A 2HYXA 1A8YA 1OKTA 5ECNB 4ZBDA 2DIZA 2PWJA 1TU8A 3TJKA 1MDIA 2VCXA 3GL3A 2O89A 1SK2A 2WULA 1ML6A 2QGVA 1YVLA 5GAPD 4CHSA 2H0HA 3KIJA 1TTZA 3ZVJD 1ZYQB 1SD8A 3H79A 2H1LA 1ERVA 3DGQA 4OFTA 2DSAA 3TDGA 1T8EB 1QXHA 3OR5A 3VI7A 4H86A 4MJAA 4AJ7A 2O5VA 2JADA 3A5WA 3CTGA 2X8CA 2XPDA 1ZYPA 4RUVA 1UC7A 2OACA 3HJOA 1WP0A 4IHUA 2H66A 11GSA 2IMKA 1R7HA 3GX0A 3BJ5A 3LFLA 4GSSA 2LRTA 1SJ6A 5A34A 4IS0A 4E8EA 3LGCA 4F2IA 1SKSB 4FH8A 5JWQB 3PPUA 1BG1A 2OT3A 1ERWA 3GH9A 3CSJA 3Q19A 4BPYA 1BX9A 3NOFA 5J3RA 5AGYA 3M9JA 4N11A 3WT2A 1XW5A 3F63A 3D21A 3QDNA 4HOJA 5JWRB 4K6XA 4QQ7A 4K0GA 4V1Ap 4MNNA 4QMKA 4XS1A 1TRWA 1YEXA 3KCMA 2DC5A 12GSA 1AXDA 1Z3EA 1ZCPA 3DXBA 2NVLA 4G9HA 5CYYA 2J9HA 2RUEA 2C0GA 5E59A 1F6MC 4ZL8A 1F37A 1VF3A 4KH7A 3TKRA 5CRWA 1BAYA 4GTUA 4ECIA 1K0NA 3TJJA 3IDVA 3I69A 3P7XA 1SD9A 2HZEA 4Q5QA 1J0FA 3APQA 2H0IA 2B7KA 3ZIVA 5A1NB 4GQFA 2NDOA 3W8SA 3CSHA 3HJMA 2MMOA 1OC9B 4MLYA 2HXKA 4MZCA 4OFMA 2B5XA 1RQMA 4G19A 1Y1UA 2VCZA 2IL3A 2I3YA 2FHEA 2GLRA 1B8XA 4MDCA 2XC2A 5D93A 2KUCA 1SL0B 2VO4A 1EOHA 2H6YA 3TRXA 3PINA 3RDWA 4LL4B 2B5EA 4XHMA 4MABA 1HYUA 1Y25A 2AAWA 2GSSA 2CX4A 4FQUA 2OBKA 5ECKB 3QFBC 5ECOB 2X49A 4TVEA 4HEA2 3H1NA 2TIRA 1FOHA 3G9BA 1ERTA 1TJDA 1WPIA 4WBRD 1GSYA 1GTBA 2EIOA 4G0IA 4EL1A 3QMXA 2AV4A 3L4NA 2GZPA 5CREA 2E2MA 5DCHA 1DE1A 1XW6A 2V32A 1EV4A 5J5NA 1PN0A 1QUWA 2CVDA 1B4PA 4GQCA 3NIVA 1Q98A 3ZREA 3LORA 3DVWA 1XIYA 3LWAA 5A4WA 1A0FA 1U3IA 4ZBAA 2VCWA 1AQVA 4MZWA 3U6VA 2C4JA 2EFDA 1YQ1A 4XS4B 4YAPA 4JE1A 1GWCA 1YJ6A 1XVQA 3ME8A 1K0OA 2KLXA 4L0UA 3UVTA 2O85A 4X4JA 1T00A 3ZMKA 4I6XA 7GSSA 1KNGA 4ECBA 1O73A 4DEJA 2JZSA 3GX8A 3C73A 1MDJA 3AY8A 4ZL7A 4IQAA 3IXRA 3IHGA 2A2SA 5AISA 2B7JA 3IAM2 1U88A 1XW9A 4EIQA 3P90A 1PA3A 2KHPA 4MF7A 2ZCTA 1M99A 2IFQA 2CVKA 1M7TA 2IMFA 3ZVJA 2VM2A 2DKIA 3DVXA 2L6CA 2LV3A 3F6FA 2H72A 1XWCA 4CY8A 2R37A 2DJJA 4OO5A 2IWTA 4ILFA 3HVVA 3F0IA 4HI7A 3C1SA 3ED3A 1CQHA 3KGKA 2GZZA 2UV8G 2GQLA 4IJ3A 3TOUA 3GRXA 3CYNA 2LJKA 1SL1B 2GQMA 1EP8A 2CQ9A 2FWGA 1B9XC 4NXIA 1NM3A 2KP2A 1JZOA 3HZ8A 5GAND 2O8VB 2XBIA 3ZL5A 1X5EA 2R0GA 1BYEA 2LJRA 4PURA 1KTEA 3LYPA 5G2ZA 3QCPA 2JSZA 4KF9A 1BEDA 2WFCA 2LQQA 3HY2A 4IW9A 5D9VA 4PNGA 3GNJA 3GV1A 4JZQA 3QAGA 5KN2A 3EURA 4MH3A 5A4UA 2R2JA 3CWGA 4AJ6A 1K0MA 1XFLA 1G6YA 2F9SA 1VF1A 2YCDA 4EVMA 2L4CA 2YV7A 4OFNA 2HZEB 3FRCA 4K2XA 1THOA 2R6KA 1J9BA 1JFUA 3GYKA 1TRUA 1XZOA 1XWKA 4KSMA 3FZ4A 5DJMA 1T3BA 2FA8A 2VAFA 2IN3A 2AUVA 3WGXA 1HNBA 1XWBA 1OC8A 3QAVA 1G7OA 1MDKA 2CVBA 4ULXA 3L9UA 3UBLA 2CZ2A 1IYIA 2YZUA 4Q5FA 2YWMA 5D96A 1E2YA 2VKZG 3ZTLA 4PUFC 4JRRA 4QL9A 1AW9A 3MNGA 2VCVA 3RHCA 1TXXA 1TK8B 1N2AA 4ECJA 2DJKA 2O87A 1GSQA 2NTOA 3F3QA 4BVYA 2H73A 5EVOA 2FY6A 2F3MA 3MYDA 3GIXA 2N5FA 5GZZB 2VL9A 4N30A 3EYTA 2CZ3A 20GSA 5CO3A 2VD0A 2F8FA 1J08A 2HRKA 4IP6A 2ON7A 1B9YC 2I4AA 3R2QA 1URMA 5J9CA 5L71A 4GLTA 1LBKA 1HNAA 1UN2A 3BCIA 1DUGA 4X43A 4ML6A 5EY6A 3FZAA 3U5RE 4TN8A 2GS3A 2VCQA 4Q5NA 3BD2A 4JEDA 2DLXA 4KCAA 5E4WA 4EDYA 4G2EA 3GHAA 5ABRA 4K8MA 4WR5A 1TW9A 2YN1A 4LA1A 1FW1A 5CP1A 2FUG2 2QC7A 3FYGA 2YPMA 2C0FA 2K8SA 2AB6A 2FNOA 4ZB6A 4K0NA 2EFCA 4ML1A 1G6WA 5J40A 2E0QA 5HFKA 3VPTA 5DCGA 1LU4A 5G31A 1BJXA 4P3YB 3MIXA 4W66A 1N25A 4K9ZA 4Z7XA 4PXOA 3ZMLA 3IK7A 2CV4A 3M8NA 5KN0A 2HZFA 2IFQB 5CRHA 4O5RA 4F82A 1EV9A 2HFDA 4MA9A 3FZ9A 2AYTA 2B3SA 2HRAA 3FEUA 4ECCA 1XOBA 3WYWA 1EGRA 4G0LA 2FWFA 2V1MA 2R5GA 1GLQA 2YWNA 3IC8A 4HDEA 1T4ZA 3VPQA 1QQ2A 4KAEA 2BJXA 2FGXA 5B6MA 2C3TA 3FY7A 2PVQA 4XS4A 2UZ8A 4FYBA 4IKHA 4TR4A 5GSSA 2MZCA 4LMWA 5D9TA 1ZMAA 3UBKA 2RM6A 4NV5A 4G01A 2HRNA 4BL7A 2AJQB 3TKSA 3D5JA 5DALB 4KDUA 3LW9A 2P5RA 3TJFA 1TK0B 1GTAA 3LXZA 2GT6A 3K8NA 4YQUA 3HA9A 2DMLA 2OKAA 1FB0A 1ZGNA 1AUCA 3PR8A 3FR6A 3QR6A 1EEJA 3EPTA 3FMWA 3F8UA 3KZQA 1Z9HA 4DSQA 4PQIA 3RHBA 2E2GA 1V2AA 1SU9A 2H71A 5G30A 4G10A 1W4VA 4NHZA 1YF1A 5A5KA 1EWXA 1ST9A 3MAKA 2H76A 5LCZA 1TOFA 4TXOB 4Q5RA 1GUHA 1WRYA 3Q6OA 2LS5A 1YZXA 3EMXA 1JZRA 2N5AA 1FVJA 1H75A 1ACVA 1SJZA 5HR0A 1M0UA 4N10A 4TKYA 4POBA 4MZBA 1ERUA 1HQOA 3BCKA 4ICYA 3KMOA 2E7PA 5ECHB 1USBA 3EC3A 3GTUB 2HT9A 2LUSA 1TI3A 2R3XA 4CDOA 4Z2TA 3TJBA 3NZNA 2OADA 4JR4A 3LG6A 4BVYB 2MMNA 4I2UA 4IBPA 3F4RA 4KW6A 4AJ8A 1HD2A 4L5LA 3C8EA 2HSNA 5KOWA 3HKRA 2HRKB 3EU4A 2C80A 3GUSA 3GMFA 1X9WB 3HCZA 1FVKA 2FD3A 2LSTA 1GSEA 3F4TA 5KOXA 2HRFA 4V1Ag 2JL4A 2LQOA 1QFNA 4Z2UA 4F0CA 3O3TA 1GRXA 2CT6A 3HYPA 1A24A 2FWHA 1AAZA 5H5QA 1PRXA 5EL8A 4OCEA 1ILOA 3IV4A 4EIPA 1T7PB 1QMVA 4POLA 2JZRA 8GSSA 2GVPA 3F4SA 1GH2A 3KH7A 4V2LA 4XIHA 3CTFA 2K6VA 4A5PA 1TK5B 4GSNA 1QK8A 2GQKA 3N5OA 5IMDA 3WGEA 4F9ZA 1TRSA 2OE0A 2LRNA 4DSRA 5A4VA 5CRGA 3UOMA 2H19A 4OO4A 4AI6A 2MMZA 2VM1A 3CMIA 2OJLA 4HUAA 2C0DA 2I81A 3ME7A 5JCGA 4WBJA 1VGLA 4YKGA 4OMVA 4WF5A 2DMMA 3W8JA 1YY7A 4IJIA 3FKFA 1SKRB 1GSFA 3FHKA 1F3BA 2R4VA 2C3NA 3IR4A 2EFEA 1E6BA 1YF0A 4RQXA 4TR1A 3GN3A 1X5CA 1Z7PA 4K7NA 4GCIA 3EMPA 4HU9A 2RLIA 2YWIA 2BMXA 3TKPA 2XHFA 1IYHA 2H1GA 2HLSA 5HR2A 1GTUA 3G7YA 2OA7A 3H93A 2L57A 3DYRA 2D2ZA 4L8EA 3LEFA 1SVMA 4HZ4A 3E9JB 1T4YA 4Z2RA 1ZZYA 1R5AA 4CW9A 4BL7B 4EDZA 3C1RA 1MTCA 1SK0A 4ZB8A 1OE7A 4O7HA 3VWXA 2QA2A 3ZFLA 3TJGA 2K8VA 1RK4A 2M46A 2REMA 1GUKA 2IMDA 1FO5A 3J7Yb 1SJIA 4YAVA 3KH9A 3WGDA 4JR6A 1A2MA 2MBSA 1GNWA 2F8AA 1AQWA 5IM9A 1KBNA 1X0RA 3M1GA 22GSA 4NHWA 4POKA 1WE0A 4WKWA 5EPFA 4MF5A 2A2PA 1JLWA 3M0FA 1FB6A 2B1KA 4GWRA 3GH6A 4YKFA 4FYCA 2TRCP 2OE1A 4KE3A 5B6NA 3QD9A 4KX4A 3VWUA 5AN1A 4KA0A 2VLVA 5F05A 3H4KA 3A3TA 3TKQA 2L5LA 1GL8A 4AKXB 1BG5A 3I6AA 1FOVA 3JCML 2CX3A 1UVZA 2A4VA 2P0GA 1PX7A 1ABAA 3DIEA 2P5QA 2DJ1A 2DJ3A 1YKAA 2YV9A 3TRPA 2WB9A 2PUKC 1PGTA 1PKWA 1O8XA 3HZ4A 1Z7RA 5DALA 2HSNB 1GNEA 2X8HA 3EU3A 1S3CA 4HQSA 5JCUA 4ID0A 5DBQA 2YP6A 4YH2A 1WIKA 2L59A 3D0ZA 1U3AA 5BMUB 6GSXA 5CAXA 4KNDA 2DKHA 3BBYA 1ZYEA 5DDLA 3KXOA 4TW5A 4I8BA 2M80A 4OWYA 2X64A 3GKMA 3VI5A 2A4HA 4ZIJA 1R26A 4TXOA 4OD7A 4JBBA 5IOXA 10GSA 2GT5A 2XBQA 3R3EA 2WCIA 2B5YA 4IQ1A 1GUMA 4XTSA 1VRSD 4EXJA 1JZDA 1AC1A 1NW2A 2DIYA 1FAAA 2LNSA 1B48A 3VFIA 3KP8A 5ID2B 1PL1A 3D6IA 3TRQA 5DAKB 1EP7A 2QA1A 4F0BA 1UA5A 2X8GA 4AF2A 3GTUA 5LD0A 1SVOA 3EINA 4N0VA 4EKZA 3ERWA 1ON4A 3EWLA 1PN9A 2V41A 3HDCA 2HQTA 2LJAA 4MCUA 3QPMA 5ECLB 1G7EA 5ECSA 4I5QA 13GSA 2TRXA 4GDFA 2H1DA 4EUYA 1TU7A 1S3AA 4HU7A 1TI1A 1K0AA 2YZHA 3UL3A 3RPPA 1A8LA 4TR1B 3A5IA 1TKDB 3VWVA 3WD6A 5G1KA 4PNFA 4KDYA 1ZYNA 3ZYWA 2QSIA 4ZXGA 2G0FA 2H70A 4FYUA 5IMCA 9GSSA 2K9FA 1GSDA 2WGRA 3RAZA 1YKCA 2A2RA 1NSWA 4BVXA 4K1FA 5DQYA 3I9V2 1TXUA 2PVOC 5GSTA 4ZILA 2VUPA 5IOWA 1NHOA 5G1LA 3GURA 2H1AA 5CRDA 4WETA 4BA7A 3TCOA 4D73B 3D4TA 2GSQA 1EEMA 4AKHA 1YEPA 3ZITA 1X9MB 1EOGA 18GSA 1M2DA 5IMVA 2VL2A 2V6OA 1SYRA 1A0RP 5ELGA 5J41A 4WEYA 1LJRA 4EF0A 1N8JA 5JWOB 5IO2A 3CBUA 4MJBA 4ZB7A 14GSA 3TOTA 1Q4JA 4PTSA 2LEGA 4KGIA 2JSYA 1PD21 2DJ2A 4ZL9A 3TKSC 2NBSA 1TDIA 1PX6A 4NPBA 3G7JA 3ZIJA 3HXSA 2OBIA 3N9JA 3PH9A 2WS2A 2PU9C 5FT3A 2GSRA 3KTLA 6GSVA 5A5HB 2M72A 4L5OA 4HQZA 3S9FA 2BTOT 2RIIA 4MP4A 2YOIA 1OYJA 3GSSA 3VLNA 1PKZA 3VURA 1BF5A 4MJEA 5COHA 4LL1B 1K0DA 3TB2A 5DVBA 3G7IA 1R4WA 3IHQA 1V40A 3IRAA 2VCTA 5IQYA 3C71A 2PERA 3RBTA 5J4YA 4AKIA 3F3RA 1GLPA 1GSUA 2IJYA 1K3OA 3L0HA 4HS1A 2H6XA 3SBCA 1FHEA 6GSUA 2FA4A 3FR9A 5B8BA 1ZL9A 2ZNMA 1WMJA 1PMTA 2IMIA 2YNXA 1PL2A 3ISOA 3KEBA 4NV2A 2HSHA 1Z5YE 2YJHA 4USSA 4KCEA 4POMA 2YANA 4ISDA 2HE3A 4K2DA 2PGTA 1CQGA 3J7Yk 5HR3A 3O6TA 1XBSA 1AQXA 4WF4A 4IGJA 3IC4A 2L4QA 3F6DA 4E68A 1SL2B 4DSSA 1F3AA 5IMAA 3DRNA 4N3ZA 2L6DA 3O76A 2V2GA 1T1VA 5KEJA 4DVCA 1WJKA 3GKNA 1OAZA 5AIVA 1EZKA 4GXZA 2WDUA 3W6GA 2HI7A 2GSTA 1JZWA 4EO3A 2H1BA 1GSSA 3V1WA 4O92A 2H6ZA 2FWEA 1SYXA 1GULA 2GZYA 2VLUA 2LRCA 3GSTA 4RI6A 3UJ1A 4HZ2A 2LNTA 1O6JA 5HFGA 1A2LA 1TRVA 4WXTA 3UIWA 4KDXA 5D9XA 5BMUA 3DEXA 3D4MA 1SVLA 4RI7A 5KN1A 4PX1A 4BVXB 2PBJA 5ECIB 4GF0A 3M9KA 2X99A 4ACSA 1G0TA 5H5RA 3FZ5A 3P8WA 2EFHA 2PN8A 1XXUA 2CAQA 3GA4A 3ZLPA 3DD3A 3ERGA 1V9WA 2IIYA 1JLVA 4GRFA 1M2AA 2EC4A 3VK9A 3HHVA 1V98A 2R0PA 1K3LA 1MD3A 3HD5A 1O81A 4HJ2A 4MPGA 4CY6A 5ID2A 4XRAA 4V2MA 1B4QA 2KOKA 4JU5A 3LQ7A 5DAKA 2K18A 3TUEA 3ZZXA 2VD1A 2B1LA 3P2AA 1O7UA 1VF4A 4G0KA 3IE3A 3APSA 3DMLA 2GTUA 1Y6EA 6GSWA 4XCSA 4X1UA 3CRUA 2CA8A 4ZBBA 16GSA 3KD0A 3MDKA 5DQSA 1OVNA 1V57A 3KM6A 2KP1A 4GSTA 5B7CA 4TR0A 5F07A 3ZFBA 5C04A 2RM5A 5JCWA 4BWSA 2VOCA 4OCFA 3L9VA 4X0XA 4HJMA 2OE3A 3IBHA 3I43A 5D9WA 2CAIA 4J56E 5LNKe 4XS6A 3GKKA 5KN3A 4TR3A 5ELAA 1XWAA 4I2TA 5IPGA 5FHIA 4KB3A 3KMNA 2ZUPA 4BWQA 1OKDA 1MEKA 1M9AA 4TXVA 3IPZA 2HSMA 3UMAA 2XPEA 4D73A 2P31A 3APOA 4LLRA 5IIZA 5ECMB 4IELA 1VF2A 2F51A 4MPFA 5D8IA 5IO0A 3WT1A 1K0CA 1O85A 3L9SA 2FLSA 1S3DA 3HMJG 2C8UA 2IMEA 3IOSA 3QAWA 6GSYA 1ZOFA 2I1UA 5AIXA 4AKGA 1X5DA 3DKSA 1U87A 2C0EA 2EIQA 1THXA 4YQVA 3H8QA 3E3EA 5ECQB 1K0BA 2ALBA 4I97A 4F03A 3DWVA 1TP9A 5C00A 2NPBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DBC A;  2DJ0 A;  3PGT A;  5IMZ A;  4EE0 A;  3TKS E;  2MBT A;  1GP1 A;  1F2E A;  2GDR A;  2H8L A;  3MSZ A;  1K3Y A;  1I5G A;  3EE2 A;  5IMF A;  4J2F A;  4PUA A;  3FK8 A;  1WOU A;  2H0G A;  4DSS B;  1M9B A;  4KSO A;  2O7K A;  1OC3 A;  5H5S A;  4XRD A;  1R5P A;  2N5B A;  4MK3 A;  3UVH A;  4V2N A;  3BOA A;  6GSS A;  4NAX A;  1XOA A;  2ON5 A;  3GL5 A;  3KJY A;  3LYK A;  4FIW A;  5INY A;  3UAR A;  5ECP B;  5HFI A;  3ZRD A;  1GTI A;  3CRT A;  4ZB9 A;  1A23 A;  2C3Q A;  5CNW A;  2VL3 A;  5ENU A;  2GGT A;  2HSY A;  4N0Z A;  2LTK A;  3A2X A;  2AHE A;  5HQP A;  1V58 A;  1KEB A;  1H4O A;  4E8H A;  1A2J A;  1PSQ A;  4QL7 A;  3M3M A;  3Q18 A;  4TRX A;  3A2W A;  2JU5 A;  3HVS A;  2C1Y A;  5G5E A;  4IP1 A;  2IPA A;  4MJC A;  3IK9 A;  1QGV A;  4EC0 A;  1I9D A;  4MF6 A;  3LXT A;  1WWJ A;  2HNL A;  5HR1 A;  2B6M A;  3ERF A;  3IA1 A;  2MYG A;  1Z6N A;  3CXG A;  5B8A A;  3EVI A;  4KUN A;  3D22 A;  4MMM A;  1XWG A;  2EIR A;  2L5O A;  3HJP A;  2LKU A;  4NWY A;  4O32 A;  2YJ7 A;  4PGT A;  1PQN A;  5J4U A;  2J23 A;  4AGS A;  5IPH A;  2ES7 A;  2YWO A;  2VLT A;  4RQR A;  2RUF A;  1HNC A;  1BQ7 A;  5F0G A;  5D73 A;  4K7I A;  5F8B A;  2VIM A;  1SK1 A;  3QFA C;  3VWW A;  3L78 A;  1C72 A;  19GS A;  2VL2 C;  2JZT A;  2H30 A;  2MMA A;  1XPV A;  4PQH A;  4L0W A;  1X9S B;  2PPT A;  5ECR B;  1DSB A;  3A2V A;  3KTB A;  5F06 A;  3SWL A;  1FG4 A;  3KP9 A;  2QKE A;  3E0U A;  1JHB A;  1EGO A;  5FWG A;  2H01 A;  3UAP A;  2HSM B;  3TGZ A;  17GS A;  4WR4 A;  3US3 A;  4K7O A;  5DJL A;  3F9U A;  3RPN A;  3CSI A;  1W89 A;  1SKW B;  5G5F A;  4TOP A;  2WJU A;  3FR3 A;  1U6T A;  3GKX A;  2V6K A;  4IVF A;  2I9H A;  1MD4 A;  2WRT A;  2G2Q A;  4MH2 A;  2Z9S A;  1AIU A;  1YDK A;  2PMT A;  4IN0 A;  6GST A;  1OC9 A;  3UEM A;  4NMU A;  1OE8 A;  5J9B A;  3IAS 2;  3FW2 A;  3LSZ A;  1M2B A;  1DBY A;  3C7M A;  2JAC A;  3MWH A;  1NHY A;  1XVW A;  4PQ1 A;  4FO5 A;  4YQM A;  1O8W A;  2H74 A;  2FCH A;  1XCC A;  4LMV A;  1RW1 A;  2H75 A;  2WZ9 A;  3Q74 A;  3QOU A;  1Z6M A;  3HVX A;  4J57 E;  3LJR A;  1F9M A;  3GFK A;  1SEN A;  1DE2 A;  2HYX A;  1A8Y A;  1OKT A;  5ECN B;  4ZBD A;  2DIZ A;  2PWJ A;  1TU8 A;  3TJK A;  1MDI A;  2VCX A;  3GL3 A;  2O89 A;  1SK2 A;  2WUL A;  1ML6 A;  2QGV A;  5GAP D;  4CHS A;  2H0H A;  3KIJ A;  1TTZ A;  3ZVJ D;  1ZYQ B;  1SD8 A;  3H79 A;  1ERV A;  3DGQ A;  4OFT A;  2DSA A;  3TDG A;  1T8E B;  1QXH A;  3OR5 A;  3VI7 A;  4H86 A;  4MJA A;  4AJ7 A;  2JAD A;  3A5W A;  3CTG A;  2X8C A;  2XPD A;  4RUV A;  1UC7 A;  2OAC A;  3HJO A;  1WP0 A;  4IHU A;  2H66 A;  11GS A;  2IMK A;  1R7H A;  3GX0 A;  3BJ5 A;  3LFL A;  4GSS A;  2LRT A;  1SJ6 A;  4IS0 A;  4E8E A;  3LGC A;  4F2I A;  1SKS B;  4FH8 A;  5JWQ B;  3PPU A;  1ERW A;  3GH9 A;  3CSJ A;  3Q19 A;  4BPY A;  1BX9 A;  3NOF A;  5J3R A;  5AGY A;  3M9J A;  4N11 A;  3WT2 A;  1XW5 A;  3F63 A;  3D21 A;  3QDN A;  4HOJ A;  5JWR B;  4K6X A;  4QQ7 A;  4K0G A;  4V1A p;  4XS1 A;  1TRW A;  1YEX A;  3KCM A;  2DC5 A;  12GS A;  1AXD A;  1Z3E A;  1ZCP A;  3DXB A;  2NVL A;  4G9H A;  5CYY A;  2J9H A;  2RUE A;  2C0G A;  5E59 A;  1F6M C;  4ZL8 A;  1F37 A;  1VF3 A;  4KH7 A;  3TKR A;  5CRW A;  1BAY A;  4GTU A;  4ECI A;  1K0N A;  3TJJ A;  3IDV A;  3I69 A;  3P7X A;  1SD9 A;  2HZE A;  4Q5Q A;  1J0F A;  3APQ A;  2H0I A;  2B7K A;  3ZIV A;  4GQF A;  2NDO A;  3W8S A;  3CSH A;  3HJM A;  2MMO A;  1OC9 B;  4MLY A;  2HXK A;  4MZC A;  4OFM A;  2B5X A;  1RQM A;  4G19 A;  2VCZ A;  2IL3 A;  2I3Y A;  2FHE A;  2GLR A;  1B8X A;  4MDC A;  2XC2 A;  5D93 A;  2KUC A;  1SL0 B;  2VO4 A;  1EOH A;  2H6Y A;  3TRX A;  3PIN A;  3RDW A;  4LL4 B;  2B5E A;  4XHM A;  4MAB A;  1HYU A;  1Y25 A;  2AAW A;  2GSS A;  2CX4 A;  4FQU A;  2OBK A;  5ECK B;  3QFB C;  5ECO B;  4TVE A;  4HEA 2;  3H1N A;  2TIR A;  3G9B A;  1ERT A;  1TJD A;  1WPI A;  4WBR D;  1GSY A;  1GTB A;  2EIO A;  4G0I A;  4EL1 A;  3QMX A;  2AV4 A;  3L4N A;  2GZP A;  5CRE A;  2E2M A;  5DCH A;  1DE1 A;  1XW6 A;  2V32 A;  1EV4 A;  5J5N A;  1QUW A;  2CVD A;  1B4P A;  4GQC A;  3NIV A;  1Q98 A;  3ZRE A;  3LOR A;  3DVW A;  1XIY A;  3LWA A;  5A4W A;  1A0F A;  1U3I A;  4ZBA A;  2VCW A;  1AQV A;  4MZW A;  3U6V A;  2C4J A;  1YQ1 A;  4XS4 B;  4YAP A;  4JE1 A;  1GWC A;  1YJ6 A;  1XVQ A;  3ME8 A;  1K0O A;  2KLX A;  4L0U A;  3UVT A;  2O85 A;  1T00 A;  3ZMK A;  4I6X A;  7GSS A;  1KNG A;  4ECB A;  1O73 A;  4DEJ A;  2JZS A;  3GX8 A;  3C73 A;  1MDJ A;  3AY8 A;  4ZL7 A;  4IQA A;  3IXR A;  2A2S A;  5AIS A;  2B7J A;  3IAM 2;  1U88 A;  1XW9 A;  3P90 A;  1PA3 A;  2KHP A;  4MF7 A;  2ZCT A;  1M99 A;  2IFQ A;  2CVK A;  1M7T A;  2IMF A;  3ZVJ A;  2VM2 A;  3DVX A;  2L6C A;  2LV3 A;  3F6F A;  2H72 A;  1XWC A;  2R37 A;  2DJJ A;  4OO5 A;  2IWT A;  4ILF A;  3HVV A;  3F0I A;  4HI7 A;  3C1S A;  3ED3 A;  1CQH A;  3KGK A;  2GZZ A;  2GQL A;  4IJ3 A;  3TOU A;  3GRX A;  3CYN A;  2LJK A;  1SL1 B;  2GQM A;  1EP8 A;  2CQ9 A;  2FWG A;  1B9X C;  4NXI A;  1NM3 A;  2KP2 A;  1JZO A;  3HZ8 A;  5GAN D;  2O8V B;  2XBI A;  3ZL5 A;  1X5E A;  1BYE A;  2LJR A;  4PUR A;  1KTE A;  3LYP A;  5G2Z A;  3QCP A;  2JSZ A;  4KF9 A;  1BED A;  2WFC A;  2LQQ A;  3HY2 A;  4IW9 A;  5D9V A;  4PNG A;  3GNJ A;  3GV1 A;  4JZQ A;  3QAG A;  5KN2 A;  3EUR A;  4MH3 A;  5A4U A;  2R2J A;  4AJ6 A;  1K0M A;  1XFL A;  1G6Y A;  2F9S A;  1VF1 A;  2YCD A;  4EVM A;  2L4C A;  2YV7 A;  4OFN A;  2HZE B;  3FRC A;  1THO A;  2R6K A;  1J9B A;  1JFU A;  3GYK A;  1TRU A;  1XZO A;  1XWK A;  4KSM A;  3FZ4 A;  5DJM A;  1T3B A;  2FA8 A;  2VAF A;  2IN3 A;  2AUV A;  3WGX A;  1HNB A;  1XWB A;  1OC8 A;  3QAV A;  1G7O A;  1MDK A;  2CVB A;  4ULX A;  3L9U A;  3UBL A;  2CZ2 A;  1IYI A;  2YZU A;  4Q5F A;  2YWM A;  5D96 A;  1E2Y A;  3ZTL A;  4PUF C;  4JRR A;  4QL9 A;  1AW9 A;  3MNG A;  2VCV A;  3RHC A;  1TXX A;  1TK8 B;  1N2A A;  4ECJ A;  2DJK A;  2O87 A;  1GSQ A;  2NTO A;  3F3Q A;  4BVY A;  2H73 A;  5EVO A;  2FY6 A;  2F3M A;  3GIX A;  2N5F A;  5GZZ B;  2VL9 A;  4N30 A;  3EYT A;  2CZ3 A;  20GS A;  5CO3 A;  2VD0 A;  2F8F A;  1J08 A;  2HRK A;  4IP6 A;  2ON7 A;  1B9Y C;  2I4A A;  3R2Q A;  1URM A;  5J9C A;  5L71 A;  4GLT A;  1LBK A;  1HNA A;  1UN2 A;  3BCI A;  1DUG A;  4X43 A;  4ML6 A;  5EY6 A;  3FZA A;  3U5R E;  4TN8 A;  2GS3 A;  2VCQ A;  4Q5N A;  3BD2 A;  4JED A;  2DLX A;  4KCA A;  5E4W A;  4EDY A;  4G2E A;  3GHA A;  5ABR A;  4K8M A;  4WR5 A;  1TW9 A;  2YN1 A;  4LA1 A;  1FW1 A;  5CP1 A;  2FUG 2;  2QC7 A;  3FYG A;  2YPM A;  2C0F A;  2K8S A;  2AB6 A;  2FNO A;  4ZB6 A;  4K0N A;  4ML1 A;  1G6W A;  2E0Q A;  5HFK A;  3VPT A;  5DCG A;  1LU4 A;  5G31 A;  1BJX A;  4P3Y B;  4K9Z A;  4Z7X A;  4PXO A;  3ZML A;  3IK7 A;  2CV4 A;  3M8N A;  5KN0 A;  2HZF A;  2IFQ B;  5CRH A;  4O5R A;  4F82 A;  1EV9 A;  2HFD A;  4MA9 A;  3FZ9 A;  2AYT A;  2B3S A;  2HRA A;  3FEU A;  4ECC A;  1XOB A;  3WYW A;  1EGR A;  4G0L A;  2FWF A;  2V1M A;  2R5G A;  1GLQ A;  2YWN A;  3IC8 A;  4HDE A;  1T4Z A;  3VPQ A;  1QQ2 A;  4KAE A;  2BJX A;  2FGX A;  5B6M A;  2C3T A;  3FY7 A;  2PVQ A;  4XS4 A;  2UZ8 A;  4FYB A;  4IKH A;  4TR4 A;  5GSS A;  2MZC A;  4LMW A;  5D9T A;  1ZMA A;  3UBK A;  2RM6 A;  4NV5 A;  2HRN A;  4BL7 A;  2AJQ B;  3TKS A;  3D5J A;  5DAL B;  4KDU A;  2P5R A;  3TJF A;  1TK0 B;  1GTA A;  3LXZ A;  2GT6 A;  3K8N A;  4YQU A;  3HA9 A;  2DML A;  2OKA A;  1FB0 A;  1ZGN A;  1AUC A;  3PR8 A;  3FR6 A;  3QR6 A;  1EEJ A;  3F8U A;  3KZQ A;  1Z9H A;  4DSQ A;  4PQI A;  3RHB A;  2E2G A;  1V2A A;  1SU9 A;  2H71 A;  5G30 A;  4G10 A;  1W4V A;  4NHZ A;  1YF1 A;  5A5K A;  1EWX A;  1ST9 A;  3MAK A;  2H76 A;  5LCZ A;  1TOF A;  4TXO B;  4Q5R A;  1GUH A;  1WRY A;  3Q6O A;  2LS5 A;  1YZX A;  3EMX A;  1JZR A;  2N5A A;  1FVJ A;  1H75 A;  1ACV A;  1SJZ A;  5HR0 A;  1M0U A;  4N10 A;  4TKY A;  4POB A;  4MZB A;  1ERU A;  1HQO A;  3BCK A;  3KMO A;  2E7P A;  5ECH B;  1USB A;  3EC3 A;  3GTU B;  2HT9 A;  2LUS A;  1TI3 A;  2R3X A;  4CDO A;  3TJB A;  3NZN A;  2OAD A;  4JR4 A;  3LG6 A;  4BVY B;  2MMN A;  4I2U A;  4IBP A;  3F4R A;  4KW6 A;  4AJ8 A;  1HD2 A;  4L5L A;  3C8E A;  3HKR A;  2HRK B;  3EU4 A;  2C80 A;  3GUS A;  3GMF A;  1X9W B;  3HCZ A;  1FVK A;  2FD3 A;  2LST A;  1GSE A;  3F4T A;  2HRF A;  4V1A g;  2JL4 A;  2LQO A;  1QFN A;  4F0C A;  3O3T A;  1GRX A;  2CT6 A;  3HYP A;  1A24 A;  2FWH A;  1AAZ A;  5H5Q A;  1PRX A;  5EL8 A;  4OCE A;  1ILO A;  3IV4 A;  1T7P B;  1QMV A;  4POL A;  2JZR A;  8GSS A;  2GVP A;  3F4S A;  1GH2 A;  3KH7 A;  4V2L A;  4XIH A;  3CTF A;  2K6V A;  1TK5 B;  4GSN A;  1QK8 A;  2GQK A;  3N5O A;  5IMD A;  3WGE A;  4F9Z A;  1TRS A;  2OE0 A;  2LRN A;  4DSR A;  5A4V A;  5CRG A;  3UOM A;  2H19 A;  4OO4 A;  2MMZ A;  2VM1 A;  3CMI A;  2OJL A;  4HUA A;  2C0D A;  2I81 A;  3ME7 A;  5JCG A;  4WBJ A;  1VGL A;  4OMV A;  4WF5 A;  2DMM A;  3W8J A;  1YY7 A;  4IJI A;  3FKF A;  1SKR B;  1GSF A;  3FHK A;  1F3B A;  2R4V A;  2C3N A;  3IR4 A;  1E6B A;  1YF0 A;  4RQX A;  4TR1 A;  3GN3 A;  1X5C A;  1Z7P A;  4K7N A;  4GCI A;  3EMP A;  4HU9 A;  2RLI A;  2YWI A;  2BMX A;  3TKP A;  2XHF A;  1IYH A;  2H1G A;  2HLS A;  5HR2 A;  1GTU A;  3G7Y A;  2OA7 A;  3H93 A;  2L57 A;  3DYR A;  2D2Z A;  4L8E A;  3LEF A;  3E9J B;  4HZ4 A;  1T4Y A;  1ZZY A;  1R5A A;  4CW9 A;  4BL7 B;  4EDZ A;  3C1R A;  1MTC A;  1SK0 A;  4ZB8 A;  1OE7 A;  4O7H A;  3VWX A;  3ZFL A;  3TJG A;  2K8V A;  1RK4 A;  2M46 A;  2REM A;  1GUK A;  2IMD A;  1FO5 A;  3J7Y b;  1SJI A;  4YAV A;  3KH9 A;  3WGD A;  4JR6 A;  1A2M A;  2MBS A;  1GNW A;  2F8A A;  1AQW A;  5IM9 A;  1KBN A;  1X0R A;  3M1G A;  22GS A;  4NHW A;  4POK A;  1WE0 A;  4WKW A;  5EPF A;  4MF5 A;  1JLW A;  3M0F A;  1FB6 A;  2B1K A;  4GWR A;  3GH6 A;  4FYC A;  2TRC P;  2OE1 A;  4KE3 A;  5B6N A;  3QD9 A;  4KX4 A;  3VWU A;  5AN1 A;  4KA0 A;  2VLV A;  5F05 A;  3H4K A;  3A3T A;  3TKQ A;  2L5L A;  1GL8 A;  1BG5 A;  3I6A A;  1FOV A;  3JCM L;  2CX3 A;  1UVZ A;  2A4V A;  2P0G A;  1PX7 A;  1ABA A;  3DIE A;  2P5Q A;  2DJ1 A;  2DJ3 A;  1YKA A;  2YV9 A;  3TRP A;  2WB9 A;  2PUK C;  1PGT A;  1PKW A;  1O8X A;  3HZ4 A;  1Z7R A;  5DAL A;  2HSN B;  1GNE A;  2X8H A;  3EU3 A;  1S3C A;  4HQS A;  5JCU A;  4ID0 A;  5DBQ A;  2YP6 A;  4YH2 A;  1WIK A;  2L59 A;  3D0Z A;  1U3A A;  6GSX A;  5CAX A;  4KND A;  3BBY A;  1ZYE A;  5DDL A;  3KXO A;  4TW5 A;  4I8B A;  2M80 A;  4OWY A;  2X64 A;  3GKM A;  3VI5 A;  4ZIJ A;  1R26 A;  4TXO A;  4OD7 A;  4JBB A;  5IOX A;  10GS A;  2GT5 A;  2XBQ A;  3R3E A;  2WCI A;  2B5Y A;  4IQ1 A;  1GUM A;  4XTS A;  1VRS D;  4EXJ A;  1JZD A;  1AC1 A;  1NW2 A;  2DIY A;  1FAA A;  2LNS A;  1B48 A;  3VFI A;  3KP8 A;  5ID2 B;  1PL1 A;  3D6I A;  3TRQ A;  5DAK B;  1EP7 A;  4F0B A;  1UA5 A;  2X8G A;  4AF2 A;  3GTU A;  5LD0 A;  3EIN A;  4N0V A;  4EKZ A;  3ERW A;  1ON4 A;  3EWL A;  1PN9 A;  2V41 A;  3HDC A;  2HQT A;  2LJA A;  4MCU A;  3QPM A;  5ECL B;  1G7E A;  5ECS A;  4I5Q A;  13GS A;  2TRX A;  2H1D A;  4EUY A;  1TU7 A;  1S3A A;  4HU7 A;  1TI1 A;  1K0A A;  2YZH A;  3UL3 A;  3RPP A;  1A8L A;  4TR1 B;  1TKD B;  3VWV A;  3WD6 A;  5G1K A;  4PNF A;  4KDY A;  3ZYW A;  2QSI A;  4ZXG A;  2G0F A;  2H70 A;  4FYU A;  5IMC A;  9GSS A;  2K9F A;  1GSD A;  2WGR A;  3RAZ A;  1YKC A;  2A2R A;  1NSW A;  4BVX A;  4K1F A;  5DQY A;  3I9V 2;  2PVO C;  5GST A;  4ZIL A;  2VUP A;  5IOW A;  1NHO A;  5G1L A;  3GUR A;  2H1A A;  5CRD A;  4WET A;  4BA7 A;  3TCO A;  4D73 B;  3D4T A;  2GSQ A;  1EEM A;  1YEP A;  3ZIT A;  1X9M B;  1EOG A;  18GS A;  1M2D A;  5IMV A;  2VL2 A;  2V6O A;  1SYR A;  1A0R P;  5ELG A;  5J41 A;  4WEY A;  1LJR A;  4EF0 A;  1N8J A;  5JWO B;  5IO2 A;  3CBU A;  4MJB A;  14GS A;  3TOT A;  1Q4J A;  4PTS A;  2LEG A;  4KGI A;  2JSY A;  1PD2 1;  2DJ2 A;  4ZL9 A;  3TKS C;  2NBS A;  1TDI A;  1PX6 A;  4NPB A;  3G7J A;  3ZIJ A;  3HXS A;  2OBI A;  3N9J A;  3PH9 A;  2WS2 A;  2PU9 C;  5FT3 A;  2GSR A;  3KTL A;  6GSV A;  2M72 A;  4L5O A;  4HQZ A;  3S9F A;  2BTO T;  2RII A;  4MP4 A;  2YOI A;  1OYJ A;  3GSS A;  3VLN A;  1PKZ A;  3VUR A;  4MJE A;  5COH A;  4LL1 B;  1K0D A;  3TB2 A;  5DVB A;  3G7I A;  1R4W A;  3IHQ A;  1V40 A;  3IRA A;  2VCT A;  5IQY A;  3C71 A;  2PER A;  3RBT A;  3F3R A;  1GLP A;  1GSU A;  2IJY A;  1K3O A;  3L0H A;  4HS1 A;  2H6X A;  3SBC A;  1FHE A;  6GSU A;  2FA4 A;  3FR9 A;  5B8B A;  1ZL9 A;  2ZNM A;  1WMJ A;  1PMT A;  2IMI A;  2YNX A;  1PL2 A;  3ISO A;  3KEB A;  4NV2 A;  2HSH A;  1Z5Y E;  2YJH A;  4USS A;  4KCE A;  4POM A;  2YAN A;  4ISD A;  2HE3 A;  4K2D A;  2PGT A;  1CQG A;  3J7Y k;  5HR3 A;  3O6T A;  1XBS A;  1AQX A;  4WF4 A;  4IGJ A;  3IC4 A;  2L4Q A;  3F6D A;  1SL2 B;  4DSS A;  1F3A A;  5IMA A;  3DRN A;  2L6D A;  3O76 A;  2V2G A;  1T1V A;  5KEJ A;  4DVC A;  1WJK A;  3GKN A;  1OAZ A;  5AIV A;  1EZK A;  4GXZ A;  2WDU A;  3W6G A;  2HI7 A;  2GST A;  1JZW A;  4EO3 A;  2H1B A;  1GSS A;  3V1W A;  4O92 A;  2H6Z A;  2FWE A;  1SYX A;  1GUL A;  2GZY A;  2VLU A;  2LRC A;  3GST A;  4RI6 A;  3UJ1 A;  4HZ2 A;  2LNT A;  1O6J A;  5HFG A;  1A2L A;  1TRV A;  4WXT A;  3UIW A;  4KDX A;  5D9X A;  5BMU A;  3DEX A;  3D4M A;  4RI7 A;  5KN1 A;  4PX1 A;  4BVX B;  2PBJ A;  5ECI B;  4GF0 A;  3M9K A;  2X99 A;  4ACS A;  1G0T A;  5H5R A;  3FZ5 A;  3P8W A;  2PN8 A;  1XXU A;  2CAQ A;  3GA4 A;  3ZLP A;  3DD3 A;  3ERG A;  1V9W A;  2IIY A;  1JLV A;  4GRF A;  1M2A A;  2EC4 A;  3VK9 A;  3HHV A;  1V98 A;  1K3L A;  1MD3 A;  3HD5 A;  1O81 A;  4HJ2 A;  4MPG A;  5ID2 A;  1B4Q A;  4XRA A;  4V2M A;  2KOK A;  4JU5 A;  3LQ7 A;  5DAK A;  2K18 A;  3TUE A;  3ZZX A;  2VD1 A;  2B1L A;  3P2A A;  1O7U A;  1VF4 A;  4G0K A;  3IE3 A;  3APS A;  3DML A;  2GTU A;  1Y6E A;  6GSW A;  4XCS A;  4X1U A;  3CRU A;  2CA8 A;  4ZBB A;  16GS A;  3KD0 A;  3MDK A;  5DQS A;  1OVN A;  1V57 A;  3KM6 A;  2KP1 A;  4GST A;  5B7C A;  4TR0 A;  5F07 A;  3ZFB A;  5C04 A;  2RM5 A;  5JCW A;  4BWS A;  2VOC A;  4OCF A;  3L9V A;  4X0X A;  4HJM A;  2OE3 A;  3IBH A;  3I43 A;  5D9W A;  2CAI A;  4J56 E;  5LNK e;  4XS6 A;  3GKK A;  5KN3 A;  4TR3 A;  5ELA A;  1XWA A;  4I2T A;  5IPG A;  5FHI A;  4KB3 A;  3KMN A;  2ZUP A;  4BWQ A;  1OKD A;  1MEK A;  1M9A A;  4TXV A;  3IPZ A;  2HSM A;  3UMA A;  2XPE A;  4D73 A;  2P31 A;  3APO A;  4LLR A;  5IIZ A;  5ECM B;  4IEL A;  1VF2 A;  2F51 A;  4MPF A;  5D8I A;  5IO0 A;  3WT1 A;  1K0C A;  1O85 A;  3L9S A;  2FLS A;  1S3D A;  2C8U A;  2IME A;  3IOS A;  3QAW A;  6GSY A;  1ZOF A;  2I1U A;  5AIX A;  1X5D A;  3DKS A;  1U87 A;  2C0E A;  2EIQ A;  1THX A;  4YQV A;  3H8Q A;  3E3E A;  5ECQ B;  1K0B A;  2ALB A;  4I97 A;  4F03 A;  3DWV A;  1TP9 A;  5C00 A;  2NPB A; 
#chains in the Genus database with same CATH topology
 2DBC A;  2DJ0 A;  3PGT A;  5IMZ A;  4EE0 A;  3TKS E;  2MBT A;  1GP1 A;  1F2E A;  5A34 B;  2GDR A;  2H8L A;  3MSZ A;  1K3Y A;  1I5G A;  5A5H A;  3EE2 A;  5IMF A;  4J2F A;  4PUA A;  3FK8 A;  1WOU A;  2H0G A;  4DSS B;  1M9B A;  4KSO A;  2O7K A;  1OC3 A;  5H5S A;  3TU3 B;  4XRD A;  1R5P A;  2N5B A;  4MK3 A;  3UVH A;  4V2N A;  3BOA A;  6GSS A;  4NAX A;  1XOA A;  4K5R A;  2ON5 A;  3GL5 A;  3KJY A;  3LYK A;  4FIW A;  5INY A;  1XG8 A;  3UAR A;  5ECP B;  5HFI A;  3ZRD A;  1GTI A;  3CRT A;  4ZB9 A;  1A23 A;  2C3Q A;  5CNW A;  2VL3 A;  5ENU A;  2GGT A;  2HSY A;  4N0Z A;  2LTK A;  3A2X A;  2AHE A;  5HQP A;  1V58 A;  1KEB A;  1H4O A;  4E8H A;  1A2J A;  1PSQ A;  4QL7 A;  3M3M A;  3Q18 A;  4TRX A;  3A2W A;  2JU5 A;  3HVS A;  2C1Y A;  5G5E A;  4IP1 A;  2IPA A;  4MJC A;  3IK9 A;  1QGV A;  4EC0 A;  1I9D A;  4MF6 A;  4O5U A;  4O5Q A;  3LXT A;  1WWJ A;  2HNL A;  5HR1 A;  2B6M A;  3ERF A;  3IA1 A;  2MYG A;  1Z6N A;  3CXG A;  5B8A A;  3EVI A;  4KUN A;  3D22 A;  4MMM A;  1XWG A;  2EIR A;  2L5O A;  3HJP A;  2LKU A;  4NWY A;  4O32 A;  2YJ7 A;  4PGT A;  1PQN A;  5J4U A;  2J23 A;  4AGS A;  5IPH A;  2ES7 A;  2YWO A;  2VLT A;  4RQR A;  2RUF A;  1HNC A;  3RGB C;  1BQ7 A;  5F0G A;  5D73 A;  4K7I A;  5F8B A;  2VIM A;  1SK1 A;  3QFA C;  3VWW A;  3L78 A;  1C72 A;  19GS A;  2WW1 A;  2VL2 C;  2JZT A;  2H30 A;  2MMA A;  1XPV A;  4PQH A;  4L0W A;  1X9S B;  2PPT A;  5ECR B;  1DSB A;  3A2V A;  3KTB A;  5F06 A;  3SWL A;  1FG4 A;  3KP9 A;  2QKE A;  3E0U A;  1JHB A;  1EGO A;  5FWG A;  2H01 A;  3UAP A;  5BRT A;  2HSM B;  3TGZ A;  17GS A;  4WR4 A;  3US3 A;  4K7O A;  5DJL A;  3F9U A;  3RPN A;  3CSI A;  1W89 A;  1SKW B;  5G5F A;  4TOP A;  2WJU A;  4K5S A;  1M3J A;  3FR3 A;  4PI0 C;  1U6T A;  3GKX A;  2V6K A;  4IVF A;  2I9H A;  1MD4 A;  2WRT A;  2G2Q A;  5A1N A;  4MH2 A;  2X4A A;  2Z9S A;  1AIU A;  1YDK A;  2PMT A;  4IN0 A;  5J47 A;  6GST A;  1OC9 A;  3UEM A;  4NMU A;  1OE8 A;  5J9B A;  3IAS 2;  3FW2 A;  3LSZ A;  1M2B A;  1DBY A;  3C7M A;  2JAC A;  3MWH A;  2R0C A;  1NHY A;  1XVW A;  4PQ1 A;  4FO5 A;  4YQM A;  1O8W A;  2H74 A;  2FCH A;  1XCC A;  4LMV A;  1RW1 A;  2H75 A;  2WZ9 A;  3Q74 A;  5J4V A;  1Z6M A;  3QOU A;  3HVX A;  4J57 E;  3LJR A;  1F9M A;  3GFK A;  1SEN A;  1DE2 A;  2HYX A;  1A8Y A;  1OKT A;  5ECN B;  4ZBD A;  2DIZ A;  2PWJ A;  1TU8 A;  3TJK A;  1MDI A;  2VCX A;  3GL3 A;  2O89 A;  1SK2 A;  2WUL A;  1ML6 A;  2QGV A;  1YVL A;  5GAP D;  4CHS A;  2H0H A;  3KIJ A;  1TTZ A;  3ZVJ D;  1ZYQ B;  1SD8 A;  3H79 A;  2H1L A;  1ERV A;  3DGQ A;  4OFT A;  2DSA A;  3TDG A;  1T8E B;  1QXH A;  3OR5 A;  3VI7 A;  4H86 A;  4MJA A;  4AJ7 A;  2O5V A;  2JAD A;  3A5W A;  3CTG A;  2X8C A;  2XPD A;  1ZYP A;  4RUV A;  1UC7 A;  2OAC A;  3HJO A;  1WP0 A;  4IHU A;  2H66 A;  4BIK A;  11GS A;  2IMK A;  1R7H A;  3GX0 A;  3BJ5 A;  3LFL A;  4GSS A;  2LRT A;  1SJ6 A;  5A34 A;  4IS0 A;  4E8E A;  3LGC A;  4F2I A;  1SKS B;  4FH8 A;  5JWQ B;  3PPU A;  1BG1 A;  2OT3 A;  1ERW A;  3GH9 A;  3CSJ A;  3Q19 A;  4BPY A;  1BX9 A;  3NOF A;  5J3R A;  5AGY A;  3M9J A;  4N11 A;  3WT2 A;  1XW5 A;  3F63 A;  3D21 A;  3QDN A;  4HOJ A;  5JWR B;  4K6X A;  4QQ7 A;  4K0G A;  4V1A p;  4MNN A;  4QMK A;  4XS1 A;  1TRW A;  1YEX A;  3KCM A;  2DC5 A;  12GS A;  1AXD A;  1Z3E A;  1ZCP A;  3DXB A;  2NVL A;  4G9H A;  5CYY A;  2J9H A;  2RUE A;  2C0G A;  5E59 A;  1F6M C;  4ZL8 A;  1F37 A;  1VF3 A;  4KH7 A;  3TKR A;  5CRW A;  1BAY A;  4GTU A;  4ECI A;  1K0N A;  3TJJ A;  3IDV A;  3I69 A;  2WVX B;  3P7X A;  1SD9 A;  2HZE A;  4Q5Q A;  1J0F A;  3APQ A;  2H0I A;  2B7K A;  3ZIV A;  5A1N B;  4GQF A;  2NDO A;  3W8S A;  3CSH A;  3HJM A;  2MMO A;  1OC9 B;  4MLY A;  2HXK A;  4MZC A;  4OFM A;  2B5X A;  1RQM A;  4G19 A;  1Y1U A;  2VCZ A;  2IL3 A;  2I3Y A;  2FHE A;  2GLR A;  1B8X A;  4MDC A;  2XC2 A;  5D93 A;  2KUC A;  1SL0 B;  2VO4 A;  1EOH A;  2H6Y A;  3TRX A;  3PIN A;  3RDW A;  4LL4 B;  2B5E A;  4XHM A;  4MAB A;  1HYU A;  1Y25 A;  2AAW A;  2GSS A;  1PFO A;  2CX4 A;  4FQU A;  2OBK A;  5ECK B;  3QFB C;  5ECO B;  2X49 A;  4TVE A;  4HEA 2;  3H1N A;  2TIR A;  1FOH A;  3G9B A;  1ERT A;  1TJD A;  1WPI A;  4WBR D;  1GSY A;  1GTB A;  2EIO A;  4G0I A;  4EL1 A;  3QMX A;  2AV4 A;  3L4N A;  2GZP A;  5CRE A;  2E2M A;  5DCH A;  1DE1 A;  1XW6 A;  2V32 A;  1EV4 A;  5J5N A;  1PN0 A;  1QUW A;  2CVD A;  1B4P A;  4GQC A;  3NIV A;  1Q98 A;  3ZRE A;  3LOR A;  3DVW A;  1XIY A;  3LWA A;  5A4W A;  1A0F A;  1U3I A;  4ZBA A;  2VCW A;  1AQV A;  4MZW A;  3U6V A;  2C4J A;  2EFD A;  1YQ1 A;  4XS4 B;  4YAP A;  4JE1 A;  1GWC A;  1YJ6 A;  1XVQ A;  3ME8 A;  1K0O A;  2KLX A;  4L0U A;  3UVT A;  2O85 A;  4X4J A;  1T00 A;  3ZMK A;  4I6X A;  7GSS A;  1KNG A;  4ECB A;  1O73 A;  4DEJ A;  2JZS A;  3GX8 A;  3C73 A;  1MDJ A;  3AY8 A;  4ZL7 A;  4IQA A;  3IXR A;  1I1I P;  3IHG A;  2A2S A;  5AIS A;  2B7J A;  3IAM 2;  1U88 A;  1XW9 A;  4EIQ A;  3P90 A;  1PA3 A;  2KHP A;  4MF7 A;  2ZCT A;  1M99 A;  2IFQ A;  2CVK A;  1M7T A;  2IMF A;  3ZVJ A;  2VM2 A;  2DKI A;  3DVX A;  2L6C A;  2LV3 A;  3F6F A;  2H72 A;  1XWC A;  4CY8 A;  2R37 A;  2DJJ A;  4OO5 A;  2IWT A;  4ILF A;  3HVV A;  3F0I A;  4HI7 A;  3C1S A;  3ED3 A;  1CQH A;  3KGK A;  2GZZ A;  2UV8 G;  2GQL A;  4IJ3 A;  3TOU A;  3GRX A;  3CYN A;  2LJK A;  1SL1 B;  2GQM A;  1EP8 A;  2CQ9 A;  2FWG A;  1B9X C;  4NXI A;  1NM3 A;  2KP2 A;  1JZO A;  3HZ8 A;  5GAN D;  2O8V B;  2XBI A;  3ZL5 A;  1X5E A;  2R0G A;  1BYE A;  2LJR A;  4PUR A;  1KTE A;  3LYP A;  5G2Z A;  3QCP A;  2JSZ A;  4KF9 A;  1BED A;  2WFC A;  2LQQ A;  3HY2 A;  4IW9 A;  5D9V A;  4PNG A;  3GNJ A;  3GV1 A;  4JZQ A;  3QAG A;  5KN2 A;  3EUR A;  4MH3 A;  5A4U A;  2R2J A;  3CWG A;  4AJ6 A;  1K0M A;  1XFL A;  1G6Y A;  2F9S A;  1VF1 A;  2YCD A;  4EVM A;  2L4C A;  2YV7 A;  4OFN A;  2HZE B;  3FRC A;  4K2X A;  1THO A;  2R6K A;  1J9B A;  1JFU A;  3GYK A;  1TRU A;  1XZO A;  1XWK A;  4KSM A;  3FZ4 A;  5DJM A;  1T3B A;  2FA8 A;  2VAF A;  2IN3 A;  2AUV A;  3WGX A;  1HNB A;  1XWB A;  1OC8 A;  3QAV A;  1G7O A;  1MDK A;  2CVB A;  4ULX A;  3L9U A;  3UBL A;  2CZ2 A;  1IYI A;  2YZU A;  4Q5F A;  2YWM A;  5D96 A;  1E2Y A;  2VKZ G;  3ZTL A;  4PUF C;  4JRR A;  4QL9 A;  1AW9 A;  3MNG A;  2VCV A;  3RHC A;  1TXX A;  1TK8 B;  1N2A A;  4ECJ A;  2DJK A;  2O87 A;  1GSQ A;  2NTO A;  3F3Q A;  4BVY A;  2H73 A;  5EVO A;  2FY6 A;  2F3M A;  3MYD A;  3GIX A;  2N5F A;  5GZZ B;  2O3E A;  2VL9 A;  4N30 A;  3EYT A;  2CZ3 A;  20GS A;  5CO3 A;  2VD0 A;  2F8F A;  1J08 A;  2HRK A;  4IP6 A;  2ON7 A;  1B9Y C;  2I4A A;  3R2Q A;  1URM A;  5J9C A;  5L71 A;  4GLT A;  1LBK A;  1HNA A;  1UN2 A;  3BCI A;  1DUG A;  4X43 A;  2WVX A;  4ML6 A;  5EY6 A;  3FZA A;  3U5R E;  4TN8 A;  2GS3 A;  2VCQ A;  4Q5N A;  3BD2 A;  4JED A;  2DLX A;  4KCA A;  4PHZ C;  5E4W A;  4EDY A;  4G2E A;  3GHA A;  5ABR A;  4K8M A;  4WR5 A;  1TW9 A;  2YN1 A;  4LA1 A;  1FW1 A;  5CP1 A;  2FUG 2;  2QC7 A;  3FYG A;  2YPM A;  2WVZ A;  2C0F A;  2K8S A;  2AB6 A;  2FNO A;  4ZB6 A;  4K0N A;  2EFC A;  4ML1 A;  1G6W A;  5J40 A;  2E0Q A;  5HFK A;  3VPT A;  5DCG A;  1LU4 A;  5G31 A;  1BJX A;  4P3Y B;  3MIX A;  4W66 A;  1N25 A;  4K9Z A;  4Z7X A;  4PXO A;  3ZML A;  3IK7 A;  2CV4 A;  3M8N A;  5KN0 A;  2HZF A;  2IFQ B;  5CRH A;  4O5R A;  4F82 A;  1EV9 A;  2HFD A;  4MA9 A;  3FZ9 A;  2AYT A;  2B3S A;  2HRA A;  3FEU A;  4ECC A;  4FXY P;  1XOB A;  3WYW A;  1EGR A;  4G0L A;  2FWF A;  2V1M A;  2R5G A;  1GLQ A;  2YWN A;  3IC8 A;  4HDE A;  1T4Z A;  3VPQ A;  1QQ2 A;  4KAE A;  2BJX A;  2FGX A;  5B6M A;  2C3T A;  3FY7 A;  2PVQ A;  4XS4 A;  2UZ8 A;  4FYB A;  4IKH A;  4TR4 A;  5GSS A;  2MZC A;  4LMW A;  5D9T A;  1ZMA A;  3UBK A;  2RM6 A;  4NV5 A;  4G01 A;  2HRN A;  4BL7 A;  2AJQ B;  3TKS A;  3D5J A;  5DAL B;  4KDU A;  2P5R A;  3LW9 A;  3TJF A;  1TK0 B;  1GTA A;  2WVY A;  3LXZ A;  2GT6 A;  3K8N A;  4YQU A;  3HA9 A;  2DML A;  2OKA A;  1FB0 A;  1ZGN A;  1AUC A;  3PR8 A;  3FR6 A;  3QR6 A;  1EEJ A;  3EPT A;  3FMW A;  3F8U A;  3KZQ A;  1Z9H A;  4DSQ A;  4PQI A;  3RHB A;  2E2G A;  1V2A A;  2WW2 A;  1SU9 A;  2H71 A;  5G30 A;  4G10 A;  1W4V A;  4NHZ A;  1YF1 A;  5A5K A;  1EWX A;  1ST9 A;  3MAK A;  2H76 A;  5LCZ A;  1TOF A;  4TXO B;  4Q5R A;  1GUH A;  1WRY A;  3Q6O A;  2LS5 A;  1YZX A;  3EMX A;  1JZR A;  2N5A A;  1FVJ A;  1H75 A;  1ACV A;  1SJZ A;  5HR0 A;  1M0U A;  4N10 A;  4TKY A;  4POB A;  4MZB A;  1ERU A;  1HQO A;  3BCK A;  4ICY A;  3KMO A;  2E7P A;  5ECH B;  1USB A;  3EC3 A;  3GTU B;  2HT9 A;  2LUS A;  1TI3 A;  2R3X A;  4CDO A;  4Z2T A;  3TJB A;  3NZN A;  2OAD A;  4JR4 A;  3LG6 A;  4BVY B;  2MMN A;  4I2U A;  4IBP A;  3F4R A;  4KW6 A;  4AJ8 A;  1HD2 A;  4L5L A;  3C8E A;  2HSN A;  5KOW A;  3HKR A;  2HRK B;  3EU4 A;  2C80 A;  3GUS A;  3GMF A;  1X9W B;  3HCZ A;  1FVK A;  2FD3 A;  2LST A;  1GSE A;  3F4T A;  5KOX A;  2HRF A;  4V1A g;  2JL4 A;  2LQO A;  1QFN A;  4Z2U A;  4F0C A;  3O3T A;  1GRX A;  2CT6 A;  3HYP A;  1A24 A;  2FWH A;  1AAZ A;  5H5Q A;  1PRX A;  5EL8 A;  4OCE A;  1ILO A;  3IV4 A;  4EIP A;  1T7P B;  1QMV A;  4POL A;  2JZR A;  8GSS A;  2GVP A;  3F4S A;  1GH2 A;  3KH7 A;  4V2L A;  4XIH A;  3CTF A;  2K6V A;  4A5P A;  1TK5 B;  4GSN A;  1QK8 A;  2GQK A;  3N5O A;  5IMD A;  3WGE A;  4F9Z A;  1TRS A;  2OE0 A;  2LRN A;  4DSR A;  5A4V A;  5CRG A;  3UOM A;  2H19 A;  4OO4 A;  4AI6 A;  2MMZ A;  2VM1 A;  3CMI A;  3HVN A;  2OJL A;  4HUA A;  2C0D A;  2I81 A;  3ME7 A;  5JCG A;  4WBJ A;  1VGL A;  4YKG A;  4OMV A;  4WF5 A;  2DMM A;  3W8J A;  1YY7 A;  4IJI A;  3FKF A;  1SKR B;  1GSF A;  3FHK A;  1F3B A;  2R4V A;  2C3N A;  3IR4 A;  2EFE A;  1E6B A;  1YF0 A;  4RQX A;  4TR1 A;  3GN3 A;  1X5C A;  1Z7P A;  4K7N A;  4GCI A;  3EMP A;  4HU9 A;  2RLI A;  2YWI A;  2BMX A;  3TKP A;  2XHF A;  1IYH A;  2H1G A;  2HLS A;  5HR2 A;  1GTU A;  3G7Y A;  2OA7 A;  3H93 A;  2L57 A;  3DYR A;  2D2Z A;  4L8E A;  3LEF A;  1SVM A;  4HZ4 A;  3E9J B;  1T4Y A;  4Z2R A;  1ZZY A;  1R5A A;  2WW0 A;  4CW9 A;  4BL7 B;  4EDZ A;  3C1R A;  1MTC A;  1SK0 A;  4ZB8 A;  1OE7 A;  4O7H A;  3VWX A;  2QA2 A;  3ZFL A;  3TJG A;  2K8V A;  1RK4 A;  2M46 A;  2REM A;  1GUK A;  2IMD A;  1FO5 A;  3J7Y b;  1SJI A;  4YAV A;  3KH9 A;  3WGD A;  4JR6 A;  1A2M A;  1YEW C;  2MBS A;  1GNW A;  2F8A A;  1AQW A;  5IM9 A;  1KBN A;  1X0R A;  3M1G A;  22GS A;  4NHW A;  4POK A;  1WE0 A;  4WKW A;  5EPF A;  4MF5 A;  2A2P A;  1JLW A;  3M0F A;  1FB6 A;  2B1K A;  4GWR A;  3GH6 A;  4YKF A;  4FYC A;  2TRC P;  2OE1 A;  4KE3 A;  5B6N A;  3QD9 A;  4KX4 A;  3VWU A;  5AN1 A;  4KA0 A;  2VLV A;  5F05 A;  3H4K A;  3A3T A;  3TKQ A;  2L5L A;  1GL8 A;  4AKX B;  1BG5 A;  3I6A A;  1FOV A;  3JCM L;  2CX3 A;  1UVZ A;  2A4V A;  2P0G A;  1PX7 A;  1ABA A;  3DIE A;  2P5Q A;  2DJ1 A;  2DJ3 A;  1YKA A;  2YV9 A;  3TRP A;  2WB9 A;  2PUK C;  1PGT A;  1PKW A;  1O8X A;  3HZ4 A;  1Z7R A;  5DAL A;  2HSN B;  1GNE A;  2X8H A;  3EU3 A;  1S3C A;  4HQS A;  5JCU A;  4ID0 A;  5DBQ A;  2YP6 A;  4YH2 A;  1WIK A;  2L59 A;  3D0Z A;  1U3A A;  5BMU B;  6GSX A;  5CAX A;  4KND A;  2DKH A;  3BBY A;  1ZYE A;  5DDL A;  3KXO A;  4TW5 A;  4I8B A;  2M80 A;  4OWY A;  2X64 A;  3GKM A;  3VI5 A;  2A4H A;  4ZIJ A;  1R26 A;  4TXO A;  4OD7 A;  4JBB A;  5IOX A;  10GS A;  2GT5 A;  2XBQ A;  3R3E A;  2WCI A;  2B5Y A;  4IQ1 A;  1GUM A;  4XTS A;  1VRS D;  4EXJ A;  1JZD A;  1AC1 A;  1NW2 A;  2DIY A;  1FAA A;  2LNS A;  1B48 A;  3VFI A;  3KP8 A;  5ID2 B;  1PL1 A;  3D6I A;  3TRQ A;  5DAK B;  1EP7 A;  2QA1 A;  4F0B A;  1UA5 A;  2X8G A;  4AF2 A;  3GTU A;  5LD0 A;  1SVO A;  3EIN A;  4N0V A;  4EKZ A;  3ERW A;  1ON4 A;  3EWL A;  1PN9 A;  2V41 A;  3HDC A;  2HQT A;  2LJA A;  4MCU A;  3QPM A;  5ECL B;  1G7E A;  5ECS A;  4I5Q A;  13GS A;  2TRX A;  4GDF A;  2H1D A;  4EUY A;  1TU7 A;  1S3A A;  4HU7 A;  1TI1 A;  1K0A A;  2YZH A;  3UL3 A;  3RPP A;  1A8L A;  4TR1 B;  3A5I A;  1TKD B;  3VWV A;  3WD6 A;  5G1K A;  4PNF A;  4KDY A;  1ZYN A;  3ZYW A;  2QSI A;  4ZXG A;  2G0F A;  2H70 A;  4FYU A;  5IMC A;  9GSS A;  2K9F A;  1GSD A;  2WGR A;  3RAZ A;  1YKC A;  2A2R A;  1NSW A;  4BVX A;  4K1F A;  5DQY A;  3I9V 2;  1TXU A;  2PVO C;  5GST A;  4ZIL A;  2VUP A;  5IOW A;  1NHO A;  5G1L A;  3GUR A;  2H1A A;  5CRD A;  4WET A;  4BA7 A;  3TCO A;  4D73 B;  3D4T A;  2GSQ A;  1EEM A;  4AKH A;  1YEP A;  3ZIT A;  1X9M B;  1EOG A;  18GS A;  1M2D A;  5IMV A;  2VL2 A;  2V6O A;  1SYR A;  1A0R P;  5ELG A;  5J41 A;  4WEY A;  1LJR A;  2WZS A;  4EF0 A;  1N8J A;  5JWO B;  5IO2 A;  3CBU A;  4MJB A;  4ZB7 A;  14GS A;  3TOT A;  1Q4J A;  4PTS A;  2LEG A;  4KGI A;  2JSY A;  1PD2 1;  2DJ2 A;  4ZL9 A;  3TKS C;  2NBS A;  1TDI A;  1PX6 A;  4NPB A;  3G7J A;  3ZIJ A;  3HXS A;  2OBI A;  3N9J A;  3PH9 A;  2WS2 A;  2PU9 C;  5FT3 A;  2GSR A;  3KTL A;  6GSV A;  5A5H B;  2M72 A;  4L5O A;  4HQZ A;  3S9F A;  2BTO T;  2RII A;  4MP4 A;  2YOI A;  1OYJ A;  3GSS A;  3VLN A;  1PKZ A;  3VUR A;  1BF5 A;  4MJE A;  5COH A;  4LL1 B;  1K0D A;  3TB2 A;  5DVB A;  3G7I A;  1R4W A;  3IHQ A;  1V40 A;  3IRA A;  2VCT A;  5IQY A;  3C71 A;  2PER A;  3RBT A;  5J4Y A;  4AKI A;  3F3R A;  1GLP A;  1GSU A;  2IJY A;  1K3O A;  3L0H A;  4HS1 A;  2H6X A;  3SBC A;  1FHE A;  6GSU A;  2FA4 A;  3FR9 A;  5B8B A;  1ZL9 A;  2ZNM A;  1WMJ A;  1PMT A;  2IMI A;  2YNX A;  1PL2 A;  3ISO A;  3KEB A;  4NV2 A;  2HSH A;  1Z5Y E;  2YJH A;  4USS A;  4KCE A;  4POM A;  2YAN A;  4ISD A;  2HE3 A;  4K2D A;  2PGT A;  1CQG A;  3J7Y k;  5HR3 A;  2O36 A;  3O6T A;  1XBS A;  1AQX A;  4WF4 A;  4IGJ A;  3IC4 A;  2L4Q A;  3F6D A;  3CHX C;  4E68 A;  2WW3 A;  1SL2 B;  4DSS A;  1F3A A;  5IMA A;  3DRN A;  4N3Z A;  2L6D A;  3O76 A;  2V2G A;  1T1V A;  5KEJ A;  4DVC A;  1WJK A;  1S4B P;  3GKN A;  1OAZ A;  5AIV A;  1EZK A;  4GXZ A;  2WDU A;  3W6G A;  2HI7 A;  2GST A;  1JZW A;  4EO3 A;  2H1B A;  1GSS A;  3V1W A;  4O92 A;  2H6Z A;  2FWE A;  1SYX A;  1GUL A;  2GZY A;  2VLU A;  2LRC A;  3GST A;  4RI6 A;  3UJ1 A;  4HZ2 A;  2LNT A;  1O6J A;  5HFG A;  1A2L A;  1TRV A;  4WXT A;  3UIW A;  4KDX A;  5D9X A;  5BMU A;  3DEX A;  3D4M A;  1SVL A;  4RI7 A;  5KN1 A;  4PX1 A;  4BVX B;  2PBJ A;  5ECI B;  4GF0 A;  3M9K A;  2X99 A;  4ACS A;  1G0T A;  5H5R A;  3FZ5 A;  3P8W A;  2EFH A;  2PN8 A;  3RFR C;  1XXU A;  2CAQ A;  3GA4 A;  3ZLP A;  3DD3 A;  3ERG A;  1V9W A;  2IIY A;  1JLV A;  4GRF A;  1M2A A;  2EC4 A;  3VK9 A;  3HHV A;  1V98 A;  2R0P A;  4PI2 C;  1K3L A;  1MD3 A;  3HD5 A;  1O81 A;  4HJ2 A;  4MPG A;  4CY6 A;  5ID2 A;  4XRA A;  4V2M A;  1B4Q A;  2KOK A;  4JU5 A;  3LQ7 A;  5DAK A;  2K18 A;  3TUE A;  3ZZX A;  2VD1 A;  2B1L A;  3P2A A;  1O7U A;  1VF4 A;  4G0K A;  3IE3 A;  3APS A;  3DML A;  2GTU A;  1Y6E A;  6GSW A;  4XCS A;  4X1U A;  3CRU A;  2CA8 A;  4ZBB A;  16GS A;  3KD0 A;  3MDK A;  5DQS A;  1OVN A;  1V57 A;  3KM6 A;  2KP1 A;  4GST A;  5B7C A;  4TR0 A;  5F07 A;  3ZFB A;  5C04 A;  2RM5 A;  5JCW A;  4BWS A;  2VOC A;  4OCF A;  3L9V A;  4X0X A;  4HJM A;  2OE3 A;  3IBH A;  3I43 A;  5D9W A;  2CAI A;  4J56 E;  5LNK e;  1M3I A;  4XS6 A;  3GKK A;  5KN3 A;  4TR3 A;  5ELA A;  1XWA A;  4I2T A;  5IPG A;  5FHI A;  4KB3 A;  3KMN A;  2ZUP A;  1S3R A;  4BWQ A;  1OKD A;  3CQF A;  1MEK A;  1M9A A;  4TXV A;  3IPZ A;  2HSM A;  3UMA A;  2XPE A;  4D73 A;  2P31 A;  3APO A;  4LLR A;  5IIZ A;  5ECM B;  4IEL A;  1VF2 A;  2F51 A;  4MPF A;  5D8I A;  5IO0 A;  3WT1 A;  1K0C A;  1O85 A;  3L9S A;  2FLS A;  1S3D A;  3HMJ G;  4HSC X;  2C8U A;  2IME A;  3IOS A;  3QAW A;  6GSY A;  1ZOF A;  2I1U A;  5AIX A;  4AKG A;  1X5D A;  3DKS A;  1U87 A;  2C0E A;  2EIQ A;  1THX A;  4YQV A;  3H8Q A;  3E3E A;  5ECQ B;  1K0B A;  2ALB A;  4I97 A;  4F03 A;  3DWV A;  1TP9 A;  5C00 A;  2NPB A; 
#chains in the Genus database with same CATH homology
 2DBC A;  2DJ0 A;  3PGT A;  5IMZ A;  4EE0 A;  3TKS E;  2MBT A;  1GP1 A;  1F2E A;  5A34 B;  2GDR A;  2H8L A;  3MSZ A;  1K3Y A;  1I5G A;  5A5H A;  3EE2 A;  5IMF A;  4J2F A;  4PUA A;  3FK8 A;  1WOU A;  2H0G A;  4DSS B;  1M9B A;  4KSO A;  2O7K A;  1OC3 A;  5H5S A;  3TU3 B;  4XRD A;  1R5P A;  2N5B A;  4MK3 A;  3UVH A;  4V2N A;  3BOA A;  6GSS A;  4NAX A;  1XOA A;  4K5R A;  2ON5 A;  3GL5 A;  3KJY A;  3LYK A;  4FIW A;  5INY A;  3UAR A;  5ECP B;  5HFI A;  3ZRD A;  1GTI A;  3CRT A;  4ZB9 A;  1A23 A;  2C3Q A;  5CNW A;  2VL3 A;  5ENU A;  2GGT A;  2HSY A;  4N0Z A;  2LTK A;  3A2X A;  2AHE A;  5HQP A;  1V58 A;  1KEB A;  1H4O A;  4E8H A;  1A2J A;  1PSQ A;  4QL7 A;  3M3M A;  3Q18 A;  4TRX A;  3A2W A;  2JU5 A;  3HVS A;  2C1Y A;  5G5E A;  4IP1 A;  2IPA A;  4MJC A;  3IK9 A;  1QGV A;  4EC0 A;  1I9D A;  4MF6 A;  4O5U A;  4O5Q A;  3LXT A;  1WWJ A;  2HNL A;  5HR1 A;  2B6M A;  3ERF A;  3IA1 A;  2MYG A;  1Z6N A;  3CXG A;  5B8A A;  3EVI A;  4KUN A;  3D22 A;  4MMM A;  1XWG A;  2EIR A;  2L5O A;  3HJP A;  2LKU A;  4NWY A;  4O32 A;  2YJ7 A;  4PGT A;  1PQN A;  5J4U A;  2J23 A;  4AGS A;  5IPH A;  2ES7 A;  2YWO A;  2VLT A;  4RQR A;  2RUF A;  1HNC A;  1BQ7 A;  5F0G A;  5D73 A;  4K7I A;  5F8B A;  2VIM A;  1SK1 A;  3QFA C;  3VWW A;  3L78 A;  1C72 A;  19GS A;  2VL2 C;  2JZT A;  2H30 A;  2MMA A;  1XPV A;  4PQH A;  4L0W A;  1X9S B;  2PPT A;  5ECR B;  1DSB A;  3A2V A;  3KTB A;  5F06 A;  3SWL A;  1FG4 A;  3KP9 A;  2QKE A;  3E0U A;  1JHB A;  1EGO A;  5FWG A;  2H01 A;  3UAP A;  5BRT A;  2HSM B;  3TGZ A;  17GS A;  4WR4 A;  3US3 A;  4K7O A;  5DJL A;  3F9U A;  3RPN A;  3CSI A;  1W89 A;  1SKW B;  5G5F A;  4TOP A;  2WJU A;  4K5S A;  3FR3 A;  1U6T A;  3GKX A;  2V6K A;  4IVF A;  2I9H A;  1MD4 A;  2WRT A;  2G2Q A;  5A1N A;  4MH2 A;  2X4A A;  2Z9S A;  1AIU A;  1YDK A;  2PMT A;  4IN0 A;  5J47 A;  6GST A;  1OC9 A;  3UEM A;  4NMU A;  1OE8 A;  5J9B A;  3IAS 2;  3FW2 A;  3LSZ A;  1M2B A;  1DBY A;  3C7M A;  2JAC A;  3MWH A;  2R0C A;  1NHY A;  1XVW A;  4PQ1 A;  4FO5 A;  4YQM A;  1O8W A;  2H74 A;  2FCH A;  1XCC A;  4LMV A;  1RW1 A;  2H75 A;  2WZ9 A;  3Q74 A;  5J4V A;  1Z6M A;  3QOU A;  3HVX A;  4J57 E;  3LJR A;  1F9M A;  3GFK A;  1SEN A;  1DE2 A;  2HYX A;  1A8Y A;  1OKT A;  5ECN B;  4ZBD A;  2DIZ A;  2PWJ A;  1TU8 A;  3TJK A;  1MDI A;  2VCX A;  3GL3 A;  2O89 A;  1SK2 A;  2WUL A;  1ML6 A;  2QGV A;  1YVL A;  5GAP D;  4CHS A;  2H0H A;  3KIJ A;  1TTZ A;  3ZVJ D;  1ZYQ B;  1SD8 A;  3H79 A;  2H1L A;  1ERV A;  3DGQ A;  4OFT A;  2DSA A;  3TDG A;  1T8E B;  1QXH A;  3OR5 A;  3VI7 A;  4H86 A;  4MJA A;  4AJ7 A;  2O5V A;  2JAD A;  3A5W A;  3CTG A;  2X8C A;  2XPD A;  1ZYP A;  4RUV A;  1UC7 A;  2OAC A;  3HJO A;  1WP0 A;  4IHU A;  2H66 A;  11GS A;  2IMK A;  1R7H A;  3GX0 A;  3BJ5 A;  3LFL A;  4GSS A;  2LRT A;  1SJ6 A;  5A34 A;  4IS0 A;  4E8E A;  3LGC A;  4F2I A;  1SKS B;  4FH8 A;  5JWQ B;  3PPU A;  1BG1 A;  2OT3 A;  1ERW A;  3GH9 A;  3CSJ A;  3Q19 A;  4BPY A;  1BX9 A;  3NOF A;  5J3R A;  5AGY A;  3M9J A;  4N11 A;  3WT2 A;  1XW5 A;  3F63 A;  3D21 A;  3QDN A;  4HOJ A;  5JWR B;  4K6X A;  4QQ7 A;  4K0G A;  4V1A p;  4MNN A;  4QMK A;  4XS1 A;  1TRW A;  1YEX A;  3KCM A;  2DC5 A;  12GS A;  1AXD A;  1Z3E A;  1ZCP A;  3DXB A;  2NVL A;  4G9H A;  5CYY A;  2J9H A;  2RUE A;  2C0G A;  5E59 A;  1F6M C;  4ZL8 A;  1F37 A;  1VF3 A;  4KH7 A;  3TKR A;  5CRW A;  1BAY A;  4GTU A;  4ECI A;  1K0N A;  3TJJ A;  3IDV A;  3I69 A;  3P7X A;  1SD9 A;  2HZE A;  4Q5Q A;  1J0F A;  3APQ A;  2H0I A;  2B7K A;  3ZIV A;  5A1N B;  4GQF A;  2NDO A;  3W8S A;  3CSH A;  3HJM A;  2MMO A;  1OC9 B;  4MLY A;  2HXK A;  4MZC A;  4OFM A;  2B5X A;  1RQM A;  4G19 A;  1Y1U A;  2VCZ A;  2IL3 A;  2I3Y A;  2FHE A;  2GLR A;  1B8X A;  4MDC A;  2XC2 A;  5D93 A;  2KUC A;  1SL0 B;  2VO4 A;  1EOH A;  2H6Y A;  3TRX A;  3PIN A;  3RDW A;  4LL4 B;  2B5E A;  4XHM A;  4MAB A;  1HYU A;  1Y25 A;  2AAW A;  2GSS A;  2CX4 A;  4FQU A;  2OBK A;  5ECK B;  3QFB C;  5ECO B;  2X49 A;  4TVE A;  4HEA 2;  3H1N A;  2TIR A;  1FOH A;  3G9B A;  1ERT A;  1TJD A;  1WPI A;  4WBR D;  1GSY A;  1GTB A;  2EIO A;  4G0I A;  4EL1 A;  3QMX A;  2AV4 A;  3L4N A;  2GZP A;  5CRE A;  2E2M A;  5DCH A;  1DE1 A;  1XW6 A;  2V32 A;  1EV4 A;  5J5N A;  1PN0 A;  1QUW A;  2CVD A;  1B4P A;  4GQC A;  3NIV A;  1Q98 A;  3ZRE A;  3LOR A;  3DVW A;  1XIY A;  3LWA A;  5A4W A;  1A0F A;  1U3I A;  4ZBA A;  2VCW A;  1AQV A;  4MZW A;  3U6V A;  2C4J A;  2EFD A;  1YQ1 A;  4XS4 B;  4YAP A;  4JE1 A;  1GWC A;  1YJ6 A;  1XVQ A;  3ME8 A;  1K0O A;  2KLX A;  4L0U A;  3UVT A;  2O85 A;  4X4J A;  1T00 A;  3ZMK A;  4I6X A;  7GSS A;  1KNG A;  4ECB A;  1O73 A;  4DEJ A;  2JZS A;  3GX8 A;  3C73 A;  1MDJ A;  3AY8 A;  4ZL7 A;  4IQA A;  3IXR A;  3IHG A;  2A2S A;  5AIS A;  2B7J A;  3IAM 2;  1U88 A;  1XW9 A;  4EIQ A;  3P90 A;  1PA3 A;  2KHP A;  4MF7 A;  2ZCT A;  1M99 A;  2IFQ A;  2CVK A;  1M7T A;  2IMF A;  3ZVJ A;  2VM2 A;  2DKI A;  3DVX A;  2L6C A;  2LV3 A;  3F6F A;  2H72 A;  1XWC A;  4CY8 A;  2R37 A;  2DJJ A;  4OO5 A;  2IWT A;  4ILF A;  3HVV A;  3F0I A;  4HI7 A;  3C1S A;  3ED3 A;  1CQH A;  3KGK A;  2GZZ A;  2UV8 G;  2GQL A;  4IJ3 A;  3TOU A;  3GRX A;  3CYN A;  2LJK A;  1SL1 B;  2GQM A;  1EP8 A;  2CQ9 A;  2FWG A;  1B9X C;  4NXI A;  1NM3 A;  2KP2 A;  1JZO A;  3HZ8 A;  5GAN D;  2O8V B;  2XBI A;  3ZL5 A;  1X5E A;  2R0G A;  1BYE A;  2LJR A;  4PUR A;  1KTE A;  3LYP A;  5G2Z A;  3QCP A;  2JSZ A;  4KF9 A;  1BED A;  2WFC A;  2LQQ A;  3HY2 A;  4IW9 A;  5D9V A;  4PNG A;  3GNJ A;  3GV1 A;  4JZQ A;  3QAG A;  5KN2 A;  3EUR A;  4MH3 A;  5A4U A;  2R2J A;  3CWG A;  4AJ6 A;  1K0M A;  1XFL A;  1G6Y A;  2F9S A;  1VF1 A;  2YCD A;  4EVM A;  2L4C A;  2YV7 A;  4OFN A;  2HZE B;  3FRC A;  4K2X A;  1THO A;  2R6K A;  1J9B A;  1JFU A;  3GYK A;  1TRU A;  1XZO A;  1XWK A;  4KSM A;  3FZ4 A;  5DJM A;  1T3B A;  2FA8 A;  2VAF A;  2IN3 A;  2AUV A;  3WGX A;  1HNB A;  1XWB A;  1OC8 A;  3QAV A;  1G7O A;  1MDK A;  2CVB A;  4ULX A;  3L9U A;  3UBL A;  2CZ2 A;  1IYI A;  2YZU A;  4Q5F A;  2YWM A;  5D96 A;  1E2Y A;  2VKZ G;  3ZTL A;  4PUF C;  4JRR A;  4QL9 A;  1AW9 A;  3MNG A;  2VCV A;  3RHC A;  1TXX A;  1TK8 B;  1N2A A;  4ECJ A;  2DJK A;  2O87 A;  1GSQ A;  2NTO A;  3F3Q A;  4BVY A;  2H73 A;  5EVO A;  2FY6 A;  2F3M A;  3MYD A;  3GIX A;  2N5F A;  5GZZ B;  2VL9 A;  4N30 A;  3EYT A;  2CZ3 A;  20GS A;  5CO3 A;  2VD0 A;  2F8F A;  1J08 A;  2HRK A;  4IP6 A;  2ON7 A;  1B9Y C;  2I4A A;  3R2Q A;  1URM A;  5J9C A;  5L71 A;  4GLT A;  1LBK A;  1HNA A;  1UN2 A;  3BCI A;  1DUG A;  4X43 A;  4ML6 A;  5EY6 A;  3FZA A;  3U5R E;  4TN8 A;  2GS3 A;  2VCQ A;  4Q5N A;  3BD2 A;  4JED A;  2DLX A;  4KCA A;  5E4W A;  4EDY A;  4G2E A;  3GHA A;  5ABR A;  4K8M A;  4WR5 A;  1TW9 A;  2YN1 A;  4LA1 A;  1FW1 A;  5CP1 A;  2FUG 2;  2QC7 A;  3FYG A;  2YPM A;  2C0F A;  2K8S A;  2AB6 A;  2FNO A;  4ZB6 A;  4K0N A;  2EFC A;  4ML1 A;  1G6W A;  5J40 A;  2E0Q A;  5HFK A;  3VPT A;  5DCG A;  1LU4 A;  5G31 A;  1BJX A;  4P3Y B;  3MIX A;  4W66 A;  1N25 A;  4K9Z A;  4Z7X A;  4PXO A;  3ZML A;  3IK7 A;  2CV4 A;  3M8N A;  5KN0 A;  2HZF A;  2IFQ B;  5CRH A;  4O5R A;  4F82 A;  1EV9 A;  2HFD A;  4MA9 A;  3FZ9 A;  2AYT A;  2B3S A;  2HRA A;  3FEU A;  4ECC A;  1XOB A;  3WYW A;  1EGR A;  4G0L A;  2FWF A;  2V1M A;  2R5G A;  1GLQ A;  2YWN A;  3IC8 A;  4HDE A;  1T4Z A;  3VPQ A;  1QQ2 A;  4KAE A;  2BJX A;  2FGX A;  5B6M A;  2C3T A;  3FY7 A;  2PVQ A;  4XS4 A;  2UZ8 A;  4FYB A;  4IKH A;  4TR4 A;  5GSS A;  2MZC A;  4LMW A;  5D9T A;  1ZMA A;  3UBK A;  2RM6 A;  4NV5 A;  4G01 A;  2HRN A;  4BL7 A;  2AJQ B;  3TKS A;  3D5J A;  5DAL B;  4KDU A;  3LW9 A;  2P5R A;  3TJF A;  1TK0 B;  1GTA A;  3LXZ A;  2GT6 A;  3K8N A;  4YQU A;  3HA9 A;  2DML A;  2OKA A;  1FB0 A;  1ZGN A;  1AUC A;  3PR8 A;  3FR6 A;  3QR6 A;  1EEJ A;  3EPT A;  3FMW A;  3F8U A;  3KZQ A;  1Z9H A;  4DSQ A;  4PQI A;  3RHB A;  2E2G A;  1V2A A;  1SU9 A;  2H71 A;  5G30 A;  4G10 A;  1W4V A;  4NHZ A;  1YF1 A;  5A5K A;  1EWX A;  1ST9 A;  3MAK A;  2H76 A;  5LCZ A;  1TOF A;  4TXO B;  4Q5R A;  1GUH A;  1WRY A;  3Q6O A;  2LS5 A;  1YZX A;  3EMX A;  1JZR A;  2N5A A;  1FVJ A;  1H75 A;  1ACV A;  1SJZ A;  5HR0 A;  1M0U A;  4N10 A;  4TKY A;  4POB A;  4MZB A;  1ERU A;  1HQO A;  3BCK A;  4ICY A;  3KMO A;  2E7P A;  5ECH B;  1USB A;  3EC3 A;  3GTU B;  2HT9 A;  2LUS A;  1TI3 A;  2R3X A;  4CDO A;  4Z2T A;  3TJB A;  3NZN A;  2OAD A;  4JR4 A;  3LG6 A;  4BVY B;  2MMN A;  4I2U A;  4IBP A;  3F4R A;  4KW6 A;  4AJ8 A;  1HD2 A;  4L5L A;  3C8E A;  2HSN A;  5KOW A;  3HKR A;  2HRK B;  3EU4 A;  2C80 A;  3GUS A;  3GMF A;  1X9W B;  3HCZ A;  1FVK A;  2FD3 A;  2LST A;  1GSE A;  3F4T A;  5KOX A;  2HRF A;  4V1A g;  2JL4 A;  2LQO A;  1QFN A;  4Z2U A;  4F0C A;  3O3T A;  1GRX A;  2CT6 A;  3HYP A;  1A24 A;  2FWH A;  1AAZ A;  5H5Q A;  1PRX A;  5EL8 A;  4OCE A;  1ILO A;  3IV4 A;  4EIP A;  1T7P B;  1QMV A;  4POL A;  2JZR A;  8GSS A;  2GVP A;  3F4S A;  1GH2 A;  3KH7 A;  4V2L A;  4XIH A;  3CTF A;  2K6V A;  4A5P A;  1TK5 B;  4GSN A;  1QK8 A;  2GQK A;  3N5O A;  5IMD A;  3WGE A;  4F9Z A;  1TRS A;  2OE0 A;  2LRN A;  4DSR A;  5A4V A;  5CRG A;  3UOM A;  2H19 A;  4OO4 A;  4AI6 A;  2MMZ A;  2VM1 A;  3CMI A;  2OJL A;  4HUA A;  2C0D A;  2I81 A;  3ME7 A;  5JCG A;  4WBJ A;  1VGL A;  4YKG A;  4OMV A;  4WF5 A;  2DMM A;  3W8J A;  1YY7 A;  4IJI A;  3FKF A;  1SKR B;  1GSF A;  3FHK A;  1F3B A;  2R4V A;  2C3N A;  3IR4 A;  2EFE A;  1E6B A;  1YF0 A;  4RQX A;  4TR1 A;  3GN3 A;  1X5C A;  1Z7P A;  4K7N A;  4GCI A;  3EMP A;  4HU9 A;  2RLI A;  2YWI A;  2BMX A;  3TKP A;  2XHF A;  1IYH A;  2H1G A;  2HLS A;  5HR2 A;  1GTU A;  3G7Y A;  2OA7 A;  3H93 A;  2L57 A;  3DYR A;  2D2Z A;  4L8E A;  3LEF A;  1SVM A;  4HZ4 A;  3E9J B;  1T4Y A;  4Z2R A;  1ZZY A;  1R5A A;  4CW9 A;  4BL7 B;  4EDZ A;  3C1R A;  1MTC A;  1SK0 A;  4ZB8 A;  1OE7 A;  4O7H A;  3VWX A;  2QA2 A;  3ZFL A;  3TJG A;  2K8V A;  1RK4 A;  2M46 A;  2REM A;  1GUK A;  2IMD A;  1FO5 A;  3J7Y b;  1SJI A;  4YAV A;  3KH9 A;  3WGD A;  4JR6 A;  1A2M A;  2MBS A;  1GNW A;  2F8A A;  1AQW A;  5IM9 A;  1KBN A;  1X0R A;  3M1G A;  22GS A;  4NHW A;  4POK A;  1WE0 A;  4WKW A;  5EPF A;  4MF5 A;  2A2P A;  1JLW A;  3M0F A;  1FB6 A;  2B1K A;  4GWR A;  3GH6 A;  4YKF A;  4FYC A;  2TRC P;  2OE1 A;  4KE3 A;  5B6N A;  3QD9 A;  4KX4 A;  3VWU A;  5AN1 A;  4KA0 A;  2VLV A;  5F05 A;  3H4K A;  3A3T A;  3TKQ A;  2L5L A;  1GL8 A;  4AKX B;  1BG5 A;  3I6A A;  1FOV A;  3JCM L;  2CX3 A;  1UVZ A;  2A4V A;  2P0G A;  1PX7 A;  1ABA A;  3DIE A;  2P5Q A;  2DJ1 A;  2DJ3 A;  1YKA A;  2YV9 A;  3TRP A;  2WB9 A;  2PUK C;  1PGT A;  1PKW A;  1O8X A;  3HZ4 A;  1Z7R A;  5DAL A;  2HSN B;  1GNE A;  2X8H A;  3EU3 A;  1S3C A;  4HQS A;  5JCU A;  4ID0 A;  5DBQ A;  2YP6 A;  4YH2 A;  1WIK A;  2L59 A;  3D0Z A;  1U3A A;  5BMU B;  6GSX A;  5CAX A;  4KND A;  2DKH A;  3BBY A;  1ZYE A;  5DDL A;  3KXO A;  4TW5 A;  4I8B A;  2M80 A;  4OWY A;  2X64 A;  3GKM A;  3VI5 A;  2A4H A;  4ZIJ A;  1R26 A;  4TXO A;  4OD7 A;  4JBB A;  5IOX A;  10GS A;  2GT5 A;  2XBQ A;  3R3E A;  2WCI A;  2B5Y A;  4IQ1 A;  1GUM A;  4XTS A;  1VRS D;  4EXJ A;  1JZD A;  1AC1 A;  1NW2 A;  2DIY A;  1FAA A;  2LNS A;  1B48 A;  3VFI A;  3KP8 A;  5ID2 B;  1PL1 A;  3D6I A;  3TRQ A;  5DAK B;  1EP7 A;  2QA1 A;  4F0B A;  1UA5 A;  2X8G A;  4AF2 A;  3GTU A;  5LD0 A;  1SVO A;  3EIN A;  4N0V A;  4EKZ A;  3ERW A;  1ON4 A;  3EWL A;  1PN9 A;  2V41 A;  3HDC A;  2HQT A;  2LJA A;  4MCU A;  3QPM A;  5ECL B;  1G7E A;  5ECS A;  4I5Q A;  13GS A;  2TRX A;  4GDF A;  2H1D A;  4EUY A;  1TU7 A;  1S3A A;  4HU7 A;  1TI1 A;  1K0A A;  2YZH A;  3UL3 A;  3RPP A;  1A8L A;  4TR1 B;  3A5I A;  1TKD B;  3VWV A;  3WD6 A;  5G1K A;  4PNF A;  4KDY A;  1ZYN A;  3ZYW A;  2QSI A;  4ZXG A;  2G0F A;  2H70 A;  4FYU A;  5IMC A;  9GSS A;  2K9F A;  1GSD A;  2WGR A;  3RAZ A;  1YKC A;  2A2R A;  1NSW A;  4BVX A;  4K1F A;  5DQY A;  3I9V 2;  1TXU A;  2PVO C;  5GST A;  4ZIL A;  2VUP A;  5IOW A;  1NHO A;  5G1L A;  3GUR A;  2H1A A;  5CRD A;  4WET A;  4BA7 A;  3TCO A;  4D73 B;  3D4T A;  2GSQ A;  1EEM A;  4AKH A;  1YEP A;  3ZIT A;  1X9M B;  1EOG A;  18GS A;  1M2D A;  5IMV A;  2VL2 A;  2V6O A;  1SYR A;  1A0R P;  5ELG A;  5J41 A;  4WEY A;  1LJR A;  4EF0 A;  1N8J A;  5JWO B;  5IO2 A;  3CBU A;  4MJB A;  4ZB7 A;  14GS A;  3TOT A;  1Q4J A;  4PTS A;  2LEG A;  4KGI A;  2JSY A;  1PD2 1;  2DJ2 A;  4ZL9 A;  3TKS C;  2NBS A;  1TDI A;  1PX6 A;  4NPB A;  3G7J A;  3ZIJ A;  3HXS A;  2OBI A;  3N9J A;  3PH9 A;  2WS2 A;  2PU9 C;  5FT3 A;  2GSR A;  3KTL A;  6GSV A;  5A5H B;  2M72 A;  4L5O A;  4HQZ A;  3S9F A;  2BTO T;  2RII A;  4MP4 A;  2YOI A;  1OYJ A;  3GSS A;  3VLN A;  1PKZ A;  3VUR A;  1BF5 A;  4MJE A;  5COH A;  4LL1 B;  1K0D A;  3TB2 A;  5DVB A;  3G7I A;  1R4W A;  3IHQ A;  1V40 A;  3IRA A;  2VCT A;  5IQY A;  3C71 A;  2PER A;  3RBT A;  5J4Y A;  4AKI A;  3F3R A;  1GLP A;  1GSU A;  2IJY A;  1K3O A;  3L0H A;  4HS1 A;  2H6X A;  3SBC A;  1FHE A;  6GSU A;  2FA4 A;  3FR9 A;  5B8B A;  1ZL9 A;  2ZNM A;  1WMJ A;  1PMT A;  2IMI A;  2YNX A;  1PL2 A;  3ISO A;  3KEB A;  4NV2 A;  2HSH A;  1Z5Y E;  2YJH A;  4USS A;  4KCE A;  4POM A;  2YAN A;  4ISD A;  2HE3 A;  4K2D A;  2PGT A;  1CQG A;  3J7Y k;  5HR3 A;  3O6T A;  1XBS A;  1AQX A;  4WF4 A;  4IGJ A;  3IC4 A;  2L4Q A;  3F6D A;  4E68 A;  1SL2 B;  4DSS A;  1F3A A;  5IMA A;  3DRN A;  4N3Z A;  2L6D A;  3O76 A;  2V2G A;  1T1V A;  5KEJ A;  4DVC A;  1WJK A;  3GKN A;  1OAZ A;  5AIV A;  1EZK A;  4GXZ A;  2WDU A;  3W6G A;  2HI7 A;  2GST A;  1JZW A;  4EO3 A;  2H1B A;  1GSS A;  3V1W A;  4O92 A;  2H6Z A;  2FWE A;  1SYX A;  1GUL A;  2GZY A;  2VLU A;  2LRC A;  3GST A;  4RI6 A;  3UJ1 A;  4HZ2 A;  2LNT A;  1O6J A;  5HFG A;  1A2L A;  1TRV A;  4WXT A;  3UIW A;  4KDX A;  5D9X A;  5BMU A;  3DEX A;  3D4M A;  1SVL A;  4RI7 A;  5KN1 A;  4PX1 A;  4BVX B;  2PBJ A;  5ECI B;  4GF0 A;  3M9K A;  2X99 A;  4ACS A;  1G0T A;  5H5R A;  3FZ5 A;  3P8W A;  2EFH A;  2PN8 A;  1XXU A;  2CAQ A;  3GA4 A;  3ZLP A;  3DD3 A;  3ERG A;  1V9W A;  2IIY A;  1JLV A;  4GRF A;  1M2A A;  2EC4 A;  3VK9 A;  3HHV A;  1V98 A;  2R0P A;  1K3L A;  1MD3 A;  3HD5 A;  1O81 A;  4HJ2 A;  4MPG A;  4CY6 A;  5ID2 A;  4XRA A;  4V2M A;  1B4Q A;  2KOK A;  4JU5 A;  3LQ7 A;  5DAK A;  2K18 A;  3TUE A;  3ZZX A;  2VD1 A;  2B1L A;  3P2A A;  1O7U A;  1VF4 A;  4G0K A;  3IE3 A;  3APS A;  3DML A;  2GTU A;  1Y6E A;  6GSW A;  4XCS A;  4X1U A;  3CRU A;  2CA8 A;  4ZBB A;  16GS A;  3KD0 A;  3MDK A;  5DQS A;  1OVN A;  1V57 A;  3KM6 A;  2KP1 A;  4GST A;  5B7C A;  4TR0 A;  5F07 A;  3ZFB A;  5C04 A;  2RM5 A;  5JCW A;  4BWS A;  2VOC A;  4OCF A;  3L9V A;  4X0X A;  4HJM A;  2OE3 A;  3IBH A;  3I43 A;  5D9W A;  2CAI A;  4J56 E;  5LNK e;  4XS6 A;  3GKK A;  5KN3 A;  4TR3 A;  5ELA A;  1XWA A;  4I2T A;  5IPG A;  5FHI A;  4KB3 A;  3KMN A;  2ZUP A;  4BWQ A;  1OKD A;  1MEK A;  1M9A A;  4TXV A;  3IPZ A;  2HSM A;  3UMA A;  2XPE A;  4D73 A;  2P31 A;  3APO A;  4LLR A;  5IIZ A;  5ECM B;  4IEL A;  1VF2 A;  2F51 A;  4MPF A;  5D8I A;  5IO0 A;  3WT1 A;  1K0C A;  1O85 A;  3L9S A;  2FLS A;  1S3D A;  3HMJ G;  2C8U A;  2IME A;  3IOS A;  3QAW A;  6GSY A;  1ZOF A;  2I1U A;  5AIX A;  4AKG A;  1X5D A;  3DKS A;  1U87 A;  2C0E A;  2EIQ A;  1THX A;  4YQV A;  3H8Q A;  3E3E A;  5ECQ B;  1K0B A;  2ALB A;  4I97 A;  4F03 A;  3DWV A;  1TP9 A;  5C00 A;  2NPB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...