3UVHA

Crystal structure analysis of e81m mutant of human clic1
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
238
structure length
231
Chain Sequence
b'EQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIMEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chloride intracellular channel protein 1
publication title Crystal Structure Analysis of E81M mutant of human CLIC1
rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 80
structure length 231
sequence length 238
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13409 GST_N_2 Glutathione S-transferase, N-terminal domain
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3uvhA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3uvhA01
3DVXA 3QPMA 4WETA 2V1MA 5KN2A 3IOSA 5ECHB 3VWWA 4LMWA 1XIYA 2E7PA 5HR3A 2J23A 4MZWA 2OE0A 1TRWA 2N5AA 5H5QA 1Z6NA 3TOUA 1U3IA 3EINA 1JZWA 3F4SA 3F6FA 3TRPA 3TRXA 3EE2A 1B9XC 1GUKA 3APQA 4KE3A 1VF4A 3EU3A 2X8HA 3ZITA 3LG6A 4BL7A 1YDKA 1V57A 3SWLA 4K8MA 2VCZA 1XXUA 1X9MB 3C73A 1YF0A 1H75A 2OA7A 2IL3A 3QAWA 4JE1A 3MNGA 4KNDA 3L9SA 2X8CA 4X1UA 1T8EB 2ES7A 1S3CA 2XBQA 4EXJA 1F9MA 4HU7A 1B48A 4MK3A 4EKZA 2V32A 4ILFA 3Q19A 1TKDB 5D9VA 2H1BA 2PU9C 4RI7A 2JZRA 1F2EA 2DBCA 2B7KA 1SL2B 2H75A 3IC8A 4TOPA 3LEFA 1YY7A 3TKPA 2CVBA 3KJYA 3KIJA 2ZUPA 3E3EA 1SD8A 4FH8A 1VRSD 2H19A 2FLSA 3EVIA 7GSSA 2LS5A 3Q6OA 2H76A 2H1GA 4ISDA 3VK9A 2WB9A 5JWRB 1OKTA 1WWJA 5J3RA 2XC2A 2LJRA 3GL3A 3HHVA 3O76A 1J0FA 3M9KA 1QQ2A 1O73A 19GSA 2B1LA 5DQYA 1PMTA 1R5AA 4PX1A 4G0KA 2VLTA 2HZEA 1BX9A 4DSQA 2FGXA 5G5EA 5E59A 4K0GA 2YZHA 4O5RA 4G2EA 3FEUA 4BWQA 3LWAA 5EPFA 4IGJA 4ZB9A 4HS1A 5AIXA 4GRFA 2L5OA 3HZ4A 3P7XA 2F8FA 1FG4A 4ZBAA 3UVHA 1OKDA 6GSYA 3KD0A 3G9BA 1TK0B 1YEXA 2YN1A 5DDLA 2IMEA 4HU9A 3GX0A 2HFDA 4D73B 4BVXA 3WGDA 5J4UA 3PH9A 3HVXA 1XCCA 2YWNA 1M7TA 4GSTA 2KP2A 2YP6A 5DBQA 4NV2A 3O6TA 2OBIA 1SK2A 2WZ9A 1ZGNA 2HRNA 1B9YC 4ZBBA 1SL1B 6GSVA 2VUPA 2GSTA 5KN3A 3ERGA 5ECLB 2H0GA 4TXOB 2R5GA 4L5LA 1C72A 3FZAA 3GNJA 3DKSA 8GSSA 4KH7A 1TRVA 2B5YA 1G7OA 4YAVA 4HQSA 1USBA 2CA8A 3FR9A 3C71A 2GZPA 1FAAA 1SKWB 4HDEA 2HLSA 3KTBA 1T4YA 3IAS2 2GZYA 2L4QA 4LL1B 3HKRA 3HY2A 1PN9A 3NIVA 5AIVA 1EGOA 1DBYA 3CYNA 3VWUA 3GSTA 3VPTA 3H93A 1M9BA 3ZYWA 3UIWA 2NPBA 5IMVA 5J9CA 4POLA 3PPUA 4F03A 3TGZA 5CRWA 1T7PB 2HZFA 3F8UA 3RDWA 5D9XA 2LV3A 4ZB8A 3FW2A 1TI1A 1PRXA 4POMA 2DJ1A 2O85A 3GH6A 1PL1A 3GTUB 2BTOT 5B8BA 1XW5A 3VWXA 1BAYA 1PX6A 4PURA 1DSBA 1GSDA 2N5FA 4O32A 5FHIA 2R6KA 3TB2A 1V2AA 1BQ7A 1M2AA 2OE1A 5IMDA 2B5EA 5GAPD 5HQPA 5AISA 4RQXA 4IBPA 2GTUA 1F3BA 4KDXA 5F0GA 3ZTLA 2AHEA 1HD2A 3WGXA 1EWXA 5ECQB 1HYUA 2YCDA 3WT2A 1HNAA 2VLVA 4ECIA 4TW5A 3P90A 2I3YA 1I5GA 1YQ1A 2J9HA 3L4NA 1G6WA 4I5QA 4HI7A 3FY7A 1WPIA 1OC9A 4TXVA 4EF0A 2PBJA 4NMUA 4KF9A 4EVMA 2CT6A 1THXA 2RLIA 1M0UA 2NBSA 1AAZA 2FUG2 1YF1A 3FK8A 3TJGA 1Y6EA 2DMLA 3PGTA 3GHAA 3FZ9A 3HYPA 3GKXA 2PVOC 3N5OA 5HFGA 2FD3A 1S3DA 1R5PA 1GULA 1ZZYA 9GSSA 3WGEA 4MP4A 1HNBA 4IQAA 4K7IA 2YZUA 3GYKA 1O81A 1GUHA 1LU4A 3D22A 5ELGA 5JWQB 1OC8A 2DJJA 3HZ8A 2HSMA 1B4PA 4XHMA 4KW6A 5DJMA 4DSSA 5DAKB 2B3SA 3M9JA 4AF2A 3TKSA 1GTIA 5LCZA 2HI7A 3GN3A 3BD2A 4HJMA 3IR4A 3AY8A 2HRFA 2CX4A 3TRQA 5INYA 4P3YB 2I4AA 2KP1A 3FKFA 2L5LA 3P2AA 3JCML 3GX8A 4TR0A 3GFKA 2MYGA 1U88A 2H8LA 4N10A 3HVSA 1UN2A 5GSTA 1OYJA 2LEGA 5D9TA 5FT3A 1ABAA 3M3MA 4MDCA 4TR1A 2C3QA 3ZMLA 4ULXA 2VL2A 1SJIA 1QGVA 3CBUA 5IIZA 5CP1A 2KLXA 16GSA 1YZXA 4MCUA 1T3BA 2IMKA 5H5RA 1M2DA 5EL8A 4POKA 2H6YA 1GNEA 3GL5A 2O87A 2VM2A 2HE3A 3NOFA 4TVEA 2MMOA 1JFUA 5ECSA 2EIOA 2JSZA 2CVDA 2VCQA 4AJ8A 1EV9A 4YAPA 1SENA 5A4VA 5KN1A 1KNGA 5BMUA 3DXBA 2F3MA 1TTZA 1N2AA 4WF5A 1YEPA 1RQMA 3DIEA 3ZFBA 2VOCA 1O7UA 3PR8A 2WJUA 4YH2A 5H5SA 2IFQB 1SD9A 3I9V2 2MMNA 5CAXA 1XWAA 4YQMA 3KEBA 1XWBA 3D4MA 2QKEA 4CHSA 2VM1A 5IQYA 1ERUA 2YPMA 3DGQA 2K8SA 3A2VA 5G1KA 5ECOB 14GSA 4K9ZA 4QQ7A 4IS0A 2HSNB 1FB6A 5ECPB 3W8SA 1N8JA 4MH3A 2AJQB 2MBTA 4F9ZA 4WR4A 5DALB 3H4KA 3K8NA 5LD0A 3HXSA 2PPTA 5B8AA 3CTFA 5ID2A 2VAFA 5DCHA 5E4WA 4E8HA 1EP7A 1J08A 3F0IA 4HEA2 4GQFA 3ZMKA 2O89A 5CRHA 3GMFA 2IPAA 1TP9A 2NTOA 2CVKA 1PSQA 1ZCPA 1S3AA 4G0LA 2H01A 3I43A 3BBYA 3ERFA 4ACSA 3TJFA 1K0OA 2VCTA 2QC7A 4POBA 4XS6A 4TKYA 2A2RA 2K18A 1SK0A 3QDNA 4KGIA 4RQRA 4LL4B 2AB6A 4FQUA 3EMPA 2OKAA 10GSA 2H72A 4KB3A 1EOGA 1K0NA 4OO4A 3BCKA 3I69A 4KX4A 4KUNA 1V9WA 1GSFA 2KHPA 1X5EA 2A4VA 4JU5A 2ZNMA 5GZZB 3IRAA 1K0CA 4LMVA 2LUSA 3CTGA 1GSQA 4MABA 1G6YA 1CQHA 4XRAA 4EUYA 1MDKA 4V2LA 1JLWA 1VF3A 3Q18A 2H6ZA 4FYBA 4MLYA 1PD21 3R2QA 2HT9A 1X9WB 3ED3A 3KH7A 5GAND 5G31A 3U6VA 2VCVA 4TR4A 4GQCA 4G19A 13GSA 1OVNA 1B8XA 2F8AA 2F9SA 3LYPA 3UMAA 2GQLA 3TOTA 2YOIA 3L78A 3RHCA 2FWFA 2G0FA 2VD1A 4EE0A 3UAPA 4KDYA 2ZCTA 1PKZA 3CXGA 1WP0A 4XS4B 1XW6A 3CSJA 5D96A 2O8VB 1K0AA 3C1SA 3IHQA 1KBNA 3GKNA 3ERWA 4J57E 3C8EA 4DSRA 3IPZA 2XPDA 12GSA 4L8EA 5CYYA 4F0BA 2DC5A 3TKSC 3IV4A 3N9JA 1PX7A 1K3LA 4ML6A 3IK9A 2DJKA 3F63A 2K6VA 2M46A 4K0NA 4HJ2A 1ERTA 1U87A 1Z6MA 1UA5A 6GSWA 2HRKB 2AV4A 4BA7A 4ZXGA 2JSYA 1DUGA 3GA4A 5D9WA 2LRNA 5IPHA 2LNTA 3LORA 4EC0A 3IK7A 5HR1A 2V41A 2LNSA 5CRDA 5DVBA 3ME7A 4NHZA 3MAKA 5C00A 4PXOA 1E2YA 4F0CA 1SKRB 5G2ZA 4JBBA 3A5WA 1PQNA 1JZDA 1MEKA 3WYWA 4HOJA 2PERA 3BCIA 1Y25A 1A24A 5IMAA 2N5BA 3LGCA 2H66A 4YQUA 1A2JA 2LRCA 3PINA 3H79A 4KCAA 2DJ3A 2GT5A 3FYGA 4GWRA 4BL7B 4OCFA 4JEDA 3RHBA 2L59A 3ZIVA 2LKUA 1SK1A 3GRXA 5GSSA 2GSQA 4QL9A 1K3YA 4BVYA 3D21A 4QL7A 3TJKA 4DVCA 3QD9A 4MF7A 1TI3A 4G9HA 1TRUA 1SU9A 3D6IA 4ID0A 1WOUA 2LQOA 4H86A 3EC3A 1A8YA 1GP1A 4N30A 4ZL7A 5JCWA 2GVPA 4I6XA 4LA1A 1T1VA 4O7HA 4PGTA 4K6XA 1DE1A 1QUWA 2AUVA 2YWOA 2JL4A 1GRXA 3SBCA 2H0IA 4KSMA 4CW9A 4GSNA 5J5NA 3VI5A 5D73A 3QMXA 5J9BA 1H4OA 1KTEA 3UARA 1IYHA 3ZREA 3I6AA 3E0UA 3EMXA 4IHUA 2GQKA 2XBIA 2NDOA 2CAQA 1VGLA 2G2QA 1SYXA 3HJOA 2OBKA 4BWSA 3G7IA 2PVQA 3FRCA 4HUAA 2HZEB 3OR5A 3RAZA 1X5DA 5IO2A 2H1AA 3FHKA 3HA9A 1QFNA 4ML1A 1XPVA 3G7JA 4IELA 4L0WA 2DIYA 1YKAA 2KOKA 3VURA 1Q4JA 2C0DA 1NSWA 4JR6A 3F3QA 2PN8A 4ZBDA 1V40A 4XCSA 2VL9A 1O8XA 4HZ4A 2IMDA 4IKHA 2IWTA 3DYRA 4OMVA 1R4WA 2P5QA 1CQGA 4HQZA 4XS1A 4WXTA 4F2IA 2WRTA 1GH2A 3U5RE 3TKRA 4BVXB 2FCHA 1R26A 2PUKC 2ON5A 3C1RA 1LBKA 2WGRA 1FB0A 1B4QA 3UOMA 1MD4A 3CSHA 2XHFA 5IMCA 2EIQA 1EP8A 1GTBA 2GGTA 2WS2A 1TU7A 4WR5A 4MH2A 5F06A 4ZILA 2R2JA 1V58A 2X64A 4TR3A 2V6KA 1ML6A 4WEYA 4EO3A 4ECCA 5ECNB 1JHBA 3KP9A 2JU5A 5B7CA 4GTUA 1A23A 4E8EA 4IN0A 5DCGA 2DIZA 3W6GA 3KM6A 3GKKA 2AYTA 1GLQA 5D8IA 4V1Ap 1XWGA 4ZB6A 2X8GA 2MBSA 1F6MC 1Z3EA 4AJ6A 5IPGA 4RUVA 5ECKB 5ECMB 1XOBA 3QFBC 4NAXA 1AQXA 2TIRA 1TU8A 2EIRA 3HD5A 22GSA 3A3TA 2D2ZA 2H70A 2P31A 4GLTA 4ECBA 2KUCA 1QK8A 3VLNA 3QAGA 4XRDA 4OFNA 4GXZA 5IMZA 5C04A 2HSHA 2OACA 4TRXA 3Q74A 1E6BA 1A2MA 1RK4A 4D73A 5IM9A 5B6NA 4GCIA 1JLVA 1ON4A 3TJJA 2LRTA 1SKSB 1JZOA 1A8LA 1XZOA 3DEXA 1OE8A 2GT6A 4L0UA 2PMTA 1SJ6A 4NXIA 3DVWA 5ELAA 3TJBA 4IJIA 1TOFA 3LJRA 1YKCA 4MF6A 3F3RA 3GURA 1Z5YE 3MWHA 2HRKA 3ZLPA 4L5OA 4TXOA 3RPPA 3O3TA 3H1NA 2FY6A 4JRRA 3L9UA 2C0FA 2PWJA 4WKWA 3KTLA 3US3A 4USSA 4KSOA 4PQ1A 3EU4A 1ZMAA 1GSSA 2YJHA 3IA1A 1X5CA 3GH9A 5LNKe 2YANA 3F9UA 2E2GA 4Q5FA 1GTUA 4KCEA 1GLPA 1TK5B 4BPYA 1OC9B 2C0EA 4I8BA 3QOUA 3KXOA 1U3AA 3KH9A 6GSSA 3C7MA 2FA4A 1JZRA 2GLRA 2UZ8A 1VF2A 1MDJA 2E0QA 2P0GA 1PGTA 1ERVA 5CRGA 2B5XA 4N0VA 4I2TA 1J9BA 2CQ9A 5JWOB 2JZTA 1YJ6A 4MPFA 3GUSA 3GKMA 3DD3A 4V2NA 2WFCA 3UVTA 3GTUA 5ECIB 4K7OA 2AAWA 2GQMA 1URMA 1MDIA 4V2MA 1PA3A 4I97A 3APSA 2DSAA 1W89A 3D0ZA 4MPGA 1GTAA 2FHEA 4GSSA 2EC4A 2HSMB 6GSTA 3KZQA 4PUFC 2R3XA 4G10A 4FIWA 2VD0A 1NHOA 4PTSA 5EVOA 5IO0A 4DSSB 3VI7A 3ZRDA 5HFKA 2VCXA 5HFIA 1GSEA 2WCIA 4WBJA 17GSA 4N11A 2XPEA 4PQIA 2FWEA 2VCWA 1GNWA 1XBSA 3CRTA 3R3EA 5DQSA 2K9FA 1XFLA 2JADA 3TKQA 3ZL5A 2MZCA 1M99A 1K0BA 5HR2A 4AJ7A 3J7Yb 3IC4A 3MSZA 4Z7XA 2LQQA 1PKWA 2HYXA 5IMFA 2NVLA 2RUFA 4FYCA 2HNLA 2FA8A 4EDYA 4EL1A 1BJXA 1FW1A 4TR1B 1WRYA 3DRNA 1AUCA 4WF4A 1AC1A 1Z7PA 6GSXA 3GSSA 5JCGA 2DLXA 4NHWA 1EZKA 3P8WA 6GSUA 5KEJA 1ACVA 1GSYA 2HRAA 4Q5QA 4YQVA 1HNCA 1EOHA 1O85A 1TK8B 4FO5A 1SYRA 3QR6A 2YJ7A 2TRXA 5CREA 1EEJA 3DWVA 3ZFLA 1AXDA 2L4CA 1TDIA 1O6JA 2LJAA 3QFAC 20GSA 4AGSA 3A2WA 3EYTA 4IVFA 4PNFA 3TKSE 4J2FA 3RPNA 3ME8A 1ILOA 3IXRA 3BOAA 5DAKA 2IJYA 3LYKA 2VLUA 2REMA 4K1FA 4OD7A 4EDZA 3LSZA 1TJDA 1SJZA 1A2LA 1UC7A 1XW9A 4NWYA 4FYUA 3E9JB 2BMXA 2IN3A 1K0DA 1TRSA 2HXKA 2I1UA 1TXXA 2H30A 3IDVA 4MA9A 5AN1A 3H8QA 3HJPA 3TUEA 2ON7A 2QSIA 5HR0A 5L71A 2FWHA 5CO3A 4OFMA 2A2SA 1Q98A 1FOVA 4ZL9A 2VL2C 2BJXA 2H1DA 4MF5A 3ZZXA 1Z9HA 1UVZA 4IP6A 5COHA 3VPQA 1WMJA 3V1WA 2YWIA 2YNXA 1ZYEA 5ID2B 1ZYQB 1XVQA 1V98A 1GSUA 3UJ1A 3UBKA 3VWVA 4OCEA 3F6DA 2C1YA 1GWCA 5KN0A 4KA0A 1R7HA 2RM5A 3QCPA 1BEDA 4HZ2A 2VO4A 3ISOA 2TRCP 3TCOA 3KMOA 5G5FA 1G7EA 3BJ5A 3LFLA 2CAIA 2I9HA 3RBTA 3D5JA 3FR6A 1XOAA 1M2BA 5J41A 1FVJA 3IE3A 2O7KA 1QXHA 3KP8A 5D93A 2H73A 3UBLA 4V1Ag 5ECRB 2IFQA 4TN8A 2Z9SA 3L0HA 4RI6A 2RUEA 4MJAA 2K8VA 1THOA 3ZVJD 1WE0A 3HVVA 4ECJA 1BG5A 3IBHA 3NZNA 4XIHA 4IJ3A 5CNWA 2IIYA 4ZL8A 4J56E 1F37A 3M0FA 2CX3A 1KEBA 3ZVJA 1XWCA 2V2GA 2DMMA 5DALA 1K3OA 3EWLA 1OAZA 2CZ2A 1AW9A 2DJ0A 3WT1A 3CRUA 3EURA 4JZQA 3CMIA 4DEJA 4NV5A 1DE2A 2F51A 3A2XA 2OE3A 2V6OA 2H0HA 2RM6A 5ABRA 4PUAA 4OO5A 2C80A 2R37A 3FZ4A 1OE7A 1W4VA 5JCUA 1FHEA 2M72A 4IP1A 2IMIA 1IYIA 2P5RA 1X0RA 1ERWA 4GF0A 3W8JA 1O8WA 4KDUA 4MJEA 1WJKA 5IOXA 5B6MA 3GIXA 5A4UA 5AGYA 4IW9A 5F07A 4K7NA 4G0IA 3FR3A 4Q5NA 1GL8A 3UEMA 5G1LA 2LTKA 3FZ5A 3QAVA 4PQHA 2LSTA 5EY6A 4OFTA 2RIIA 3UL3A 4MZCA 3ZIJA 5A4WA 5DJLA 2GSSA 3LXZA 1EV4A 2H6XA 3DMLA 1LJRA 4LLRA 2FNOA 1T4ZA 4CDOA 5A5KA 2ALBA 2FWGA 1T00A 3G7YA 4F82A 2HQTA 1SL0B 2CZ3A 2GDRA 1A0RP 1AQVA 4K2DA 2X99A 2OADA 4O92A 4MZBA 3M1GA 1Z7RA 11GSA 3HJMA 2GZZA 4Q5RA 1FVKA 2L6CA 2QGVA 1GUMA 18GSA 3F4RA 1FO5A 1NW2A 2PGTA 3MDKA 3D4TA 2MMAA 4WBRD 2CV4A 1BYEA 1MD3A 1WIKA 3APOA 2C3TA 1MTCA 4IQ1A 1VF1A 3S9FA 4I2UA 2C3NA 4MJBA 2HSYA 5FWGA 2B7JA 5G30A 2GSRA 3M8NA 1RW1A 1EEMA 2E2MA 2YWMA 3HDCA 1OC3A 4XTSA 1X9SB 1K0MA 3F4TA 2IMFA 4OWYA 4NPBA 1ZL9A 2R4VA 1HQOA 3KMNA 1ZOFA 3IAM2 1XWKA 2VIMA 1F3AA 1QMVA 3WD6A 3J7Yk 2MMZA 2H71A 3GV1A 4ZIJA 2JZSA 3KCMA 4XS4A 1I9DA 1EGRA 5F8BA 4JR4A 3L9VA 3CSIA 3LQ7A 1XVWA 1AQWA 4PNGA 1U6TA 1AIUA 2B1KA 2JACA 4N0ZA 3VFIA 2WDUA 5F05A 2I81A 5IOWA 2C0GA 4BVYB 4KAEA 2GS3A 2WULA 5ENUA 4X43A 1TW9A 1A0FA 1ST9A 2YV7A 2C8UA 1NHYA 1PL2A 3TDGA 4MMMA 4MJCA 2YV9A 2H74A 3KGKA 1NM3A 2DJ2A 2L6DA 2VL3A 2L57A 2M80A 3HCZA 3LXTA 2C4JA 2LJKA 2OJLA 1G0TA 4X0XA 2B6MA 1M9AA
chains in the Genus database with same CATH superfamily
3DVXA 3QPMA 4WETA 2V1MA 5KN2A 3IOSA 5ECHB 3VWWA 4LMWA 1XIYA 2E7PA 5HR3A 2J23A 4MZWA 2OE0A 1TRWA 2N5AA 5H5QA 1Z6NA 4BIKA 3TOUA 4ICYA 1U3IA 3EINA 1JZWA 3F4SA 3F6FA 3TRPA 3TRXA 3EE2A 1B9XC 1GUKA 3APQA 4KE3A 1VF4A 3EU3A 2X8HA 3ZITA 3LG6A 4BL7A 1YDKA 1V57A 3SWLA 4K8MA 2VCZA 1XXUA 1X9MB 3C73A 1YF0A 4PHZC 1H75A 2OA7A 2IL3A 3QAWA 4JE1A 3MNGA 4KNDA 3L9SA 2X8CA 4X1UA 1T8EB 2ES7A 1S3CA 2XBQA 4EXJA 1F9MA 4HU7A 1B48A 3CHXC 4MK3A 4EKZA 2V32A 4ILFA 3Q19A 1TKDB 5D9VA 2H1BA 2PU9C 4RI7A 2JZRA 1F2EA 2DBCA 2B7KA 1SL2B 2H75A 3IC8A 5J47A 4TOPA 3LEFA 1YY7A 3TKPA 2CVBA 3KJYA 3KIJA 2ZUPA 3E3EA 1SD8A 4FH8A 1VRSD 2H19A 2FLSA 3EVIA 7GSSA 2LS5A 2WZSA 3Q6OA 2H76A 2H1GA 4ISDA 4CY8A 3VK9A 2WB9A 5JWRB 1OKTA 1N25A 1WWJA 5J3RA 2XC2A 2LJRA 3GL3A 3HHVA 3O76A 1J0FA 3M9KA 1QQ2A 1O73A 19GSA 2B1LA 5DQYA 5A5HB 1PMTA 1R5AA 4PX1A 4G0KA 2VLTA 2HZEA 1BX9A 4DSQA 2FGXA 5G5EA 5E59A 4K0GA 2YZHA 4EIPA 4O5RA 4G2EA 3FEUA 4BWQA 3LWAA 5EPFA 4IGJA 4ZB9A 4HS1A 5AIXA 4GRFA 2L5OA 3HZ4A 3P7XA 2F8FA 1FG4A 1XG8A 4ZBAA 3UVHA 1OKDA 4Z2TA 5J4VA 6GSYA 3KD0A 3G9BA 1TK0B 1YEXA 2YN1A 5DDLA 2IMEA 4HU9A 3GX0A 2HFDA 4D73B 4BVXA 3WGDA 5J4UA 3PH9A 3HVXA 1XCCA 2YWNA 1M7TA 4GSTA 2KP2A 2YP6A 5DBQA 4NV2A 3O6TA 2DKHA 2OBIA 1SK2A 2WZ9A 1ZGNA 2HRNA 1B9YC 4ZBBA 1SL1B 6GSVA 2VUPA 2GSTA 3IHGA 5KN3A 3ERGA 5ECLB 2H0GA 2O5VA 4TXOB 2R5GA 4L5LA 1C72A 3FZAA 3GNJA 3DKSA 8GSSA 4KH7A 1TRVA 2B5YA 1G7OA 4YAVA 4HQSA 1USBA 2CA8A 3FR9A 4N3ZA 3C71A 2GZPA 1FAAA 1SKWB 4HDEA 2HLSA 3KTBA 1T4YA 3IAS2 2GZYA 2L4QA 4LL1B 3HKRA 3HY2A 1PN9A 3NIVA 5AIVA 1EGOA 1DBYA 3CYNA 3VWUA 3GSTA 3VPTA 1TXUA 3H93A 1M9BA 3ZYWA 3UIWA 2NPBA 5IMVA 5J9CA 4POLA 3PPUA 4F03A 3TGZA 5CRWA 1PN0A 1T7PB 2HZFA 3F8UA 3RDWA 5D9XA 2LV3A 4ZB8A 3FW2A 1TI1A 1PRXA 4POMA 2DJ1A 2O85A 3GH6A 1PL1A 3GTUB 2VKZG 2BTOT 5B8BA 1XW5A 3LW9A 3VWXA 1BAYA 1PX6A 4PURA 1DSBA 1GSDA 2N5FA 4O32A 5FHIA 2R6KA 3CQFA 3TB2A 1V2AA 1BQ7A 1M2AA 2OE1A 5IMDA 2B5EA 5GAPD 5HQPA 5AISA 4RQXA 4IBPA 2GTUA 1F3BA 4KDXA 5F0GA 3ZTLA 2AHEA 1HD2A 3WGXA 1EWXA 5ECQB 1HYUA 2YCDA 3WT2A 1HNAA 2VLVA 4ECIA 4TW5A 3P90A 1S4BP 2I3YA 1I5GA 1YQ1A 2J9HA 3L4NA 1G6WA 4QMKA 4I5QA 4HI7A 3FY7A 1WPIA 1OC9A 4TXVA 4EF0A 2PBJA 4NMUA 4KF9A 4EVMA 2CT6A 4Z2UA 1THXA 4GDFA 2RLIA 2EFHA 3TU3B 1M0UA 2NBSA 1AAZA 2FUG2 1YF1A 2DKIA 3FK8A 3TJGA 1Y6EA 2DMLA 3PGTA 3GHAA 3FZ9A 3HYPA 3GKXA 2PVOC 3N5OA 5HFGA 2FD3A 2QA1A 1S3DA 1R5PA 1GULA 1ZZYA 3MIXA 9GSSA 3WGEA 4MP4A 1HNBA 4IQAA 4K7IA 2YZUA 3GYKA 1O81A 1GUHA 1LU4A 3D22A 2WVXB 5ELGA 5JWQB 1OC8A 2DJJA 3HZ8A 2UV8G 2HSMA 1B4PA 4XHMA 4KW6A 5DJMA 4DSSA 5DAKB 2B3SA 3M9JA 4AF2A 3TKSA 1GTIA 5LCZA 2HI7A 3GN3A 3BD2A 4HJMA 3IR4A 3AY8A 2HRFA 2CX4A 3TRQA 5INYA 4P3YB 2I4AA 2KP1A 3FKFA 2L5LA 4AKXB 3P2AA 3JCML 3GX8A 4TR0A 3GFKA 2MYGA 1U88A 2H8LA 4N10A 3HVSA 1UN2A 5GSTA 1OYJA 2LEGA 2O36A 5D9TA 5FT3A 3M3MA 4MDCA 1ABAA 4TR1A 2C3QA 3ZMLA 4ULXA 2VL2A 1SJIA 1QGVA 3CBUA 5IIZA 5CP1A 2KLXA 16GSA 1YZXA 4MCUA 2OT3A 1T3BA 2IMKA 5H5RA 1M2DA 5EL8A 4POKA 2H6YA 1GNEA 4E68A 3GL5A 2O87A 2VM2A 2HE3A 3NOFA 4TVEA 2MMOA 1JFUA 5ECSA 2EIOA 2JSZA 2CVDA 2VCQA 5A34A 4AJ8A 1EV9A 4YAPA 1SENA 5A4VA 5KN1A 1KNGA 5BMUA 3DXBA 2F3MA 1TTZA 1N2AA 4WF5A 1YEPA 1RQMA 3DIEA 3ZFBA 2VOCA 1O7UA 3PR8A 2WJUA 4YH2A 5H5SA 4AI6A 1SD9A 2IFQB 3I9V2 2MMNA 5CAXA 1XWAA 4YQMA 3KEBA 1XWBA 4K2XA 3D4MA 2QKEA 4CHSA 2VM1A 2WVZA 5IQYA 1ERUA 2YPMA 3DGQA 2K8SA 3A2VA 5G1KA 5ECOB 14GSA 4K9ZA 4QQ7A 4IS0A 2HSNB 1FB6A 5ECPB 3W8SA 1N8JA 4MH3A 2AJQB 2MBTA 4F9ZA 4WR4A 5DALB 3H4KA 4MNNA 3K8NA 5LD0A 3HXSA 2PPTA 5B8AA 3CTFA 5ID2A 2WW3A 2VAFA 5DCHA 5E4WA 4E8HA 1EP7A 1J08A 3F0IA 4HEA2 4GQFA 3ZMKA 2O89A 5CRHA 3GMFA 2IPAA 1TP9A 2NTOA 2CVKA 1PSQA 1ZCPA 1S3AA 4G0LA 2H01A 3I43A 3BBYA 3ERFA 4ACSA 3TJFA 1SVLA 1K0OA 2VCTA 2QC7A 4POBA 4XS6A 4TKYA 2A2RA 2K18A 1SK0A 3QDNA 4KGIA 4RQRA 4LL4B 2AB6A 4FQUA 3EMPA 2OKAA 10GSA 2H72A 4KB3A 1EOGA 3A5IA 1K0NA 4OO4A 3BCKA 3I69A 4KX4A 4KUNA 1V9WA 1GSFA 2KHPA 1X5EA 2A4VA 4JU5A 2ZNMA 5GZZB 3IRAA 1K0CA 4LMVA 2LUSA 3CTGA 1GSQA 4MABA 1G6YA 3RGBC 1CQHA 4XRAA 4EUYA 1MDKA 4V2LA 1JLWA 1VF3A 3Q18A 2H6ZA 4FYBA 4MLYA 1PD21 3R2QA 2HT9A 1X9WB 3ED3A 3KH7A 1Y1UA 5GAND 5G31A 3U6VA 2VCVA 4TR4A 4GQCA 4G19A 13GSA 1OVNA 1B8XA 2F8AA 2F9SA 3LYPA 3UMAA 2GQLA 3TOTA 2YOIA 3L78A 3RHCA 2FWFA 2G0FA 2VD1A 4EE0A 3UAPA 4KDYA 2ZCTA 1PKZA 3CXGA 3CWGA 1WP0A 4XS4B 1XW6A 3CSJA 5D96A 2O8VB 1K0AA 3C1SA 3IHQA 1KBNA 3GKNA 3ERWA 4J57E 3C8EA 4DSRA 3IPZA 2H1LA 2XPDA 12GSA 4L8EA 5CYYA 4F0BA 2DC5A 3TKSC 1PFOA 3IV4A 3N9JA 1PX7A 1K3LA 4ML6A 3IK9A 2DJKA 3F63A 2K6VA 2M46A 4K0NA 5A1NA 4HJ2A 1ERTA 1U87A 1Z6MA 2A2PA 1UA5A 6GSWA 2HRKB 2AV4A 4BA7A 4ZXGA 2JSYA 1DUGA 3GA4A 3MYDA 5D9WA 2LRNA 5IPHA 2LNTA 3LORA 1BF5A 4EC0A 2WW2A 3IK7A 5HR1A 2V41A 2LNSA 5CRDA 4Z2RA 5DVBA 3ME7A 4NHZA 3MAKA 5C00A 4PXOA 1E2YA 4F0CA 1SKRB 5G2ZA 4JBBA 3A5WA 1PQNA 1JZDA 1MEKA 3WYWA 4AKHA 4HOJA 2PERA 3BCIA 1Y25A 1A24A 5IMAA 2N5BA 3LGCA 2H66A 4YQUA 1A2JA 2LRCA 3PINA 3H79A 4KCAA 2DJ3A 2GT5A 3FYGA 4GWRA 4BL7B 4OCFA 3HVNA 4JEDA 3RHBA 2L59A 3ZIVA 2LKUA 1SK1A 3GRXA 5GSSA 2GSQA 4QL9A 1K3YA 4BVYA 3D21A 4QL7A 3TJKA 4DVCA 3QD9A 2EFEA 4MF7A 1TI3A 4G9HA 1TRUA 1SU9A 3D6IA 4ID0A 1WOUA 2LQOA 4H86A 3EC3A 1A8YA 1GP1A 4N30A 4ZL7A 5JCWA 2GVPA 4I6XA 4LA1A 1T1VA 4O7HA 4PGTA 4K6XA 1DE1A 4FXYP 1QUWA 2AUVA 1YEWC 2YWOA 2JL4A 1GRXA 3SBCA 2H0IA 4KSMA 4CW9A 4GSNA 5J5NA 3VI5A 2R0GA 5D73A 3QMXA 5J9BA 1H4OA 1KTEA 3UARA 1IYHA 3ZREA 3I6AA 3E0UA 3EMXA 4IHUA 2GQKA 2XBIA 2NDOA 2CAQA 1VGLA 4O5QA 2G2QA 1SYXA 3HJOA 2OBKA 4BWSA 3G7IA 2PVQA 3FRCA 4HUAA 2HZEB 3OR5A 3RAZA 1X5DA 5IO2A 2H1AA 3FHKA 3HA9A 1QFNA 4ML1A 1XPVA 3G7JA 4IELA 4L0WA 2DIYA 1YKAA 2KOKA 3VURA 1Q4JA 2C0DA 1NSWA 4JR6A 4W66A 3F3QA 2PN8A 4ZBDA 1V40A 4XCSA 2VL9A 1O8XA 4HZ4A 2IMDA 4IKHA 2IWTA 4AKGA 3DYRA 4OMVA 1R4WA 2P5QA 1CQGA 4HQZA 4XS1A 4WXTA 4F2IA 2WRTA 1GH2A 3U5RE 3TKRA 4BVXB 2FCHA 1R26A 2PUKC 2ON5A 3C1RA 1LBKA 2WGRA 1FB0A 1B4QA 3UOMA 1MD4A 3CSHA 2XHFA 5IMCA 2EIQA 1EP8A 1GTBA 2GGTA 2WS2A 1TU7A 4WR5A 4MH2A 5F06A 4ZILA 2R2JA 1V58A 2X64A 4EIQA 4TR3A 2V6KA 1ML6A 4WEYA 4EO3A 4ECCA 5ECNB 1JHBA 3KP9A 2JU5A 5B7CA 4GTUA 1A23A 4E8EA 4IN0A 5DCGA 2DIZA 3W6GA 5J40A 5A5HA 3KM6A 3GKKA 2AYTA 1GLQA 5D8IA 4V1Ap 1XWGA 4ZB6A 2X8GA 2MBSA 1F6MC 1Z3EA 4AJ6A 5IPGA 4RUVA 5ECKB 5ECMB 1XOBA 4NAXA 3QFBC 1AQXA 2TIRA 1TU8A 2EIRA 3HD5A 22GSA 3A3TA 2D2ZA 2H70A 2EFCA 2P31A 4GLTA 4ECBA 2KUCA 1QK8A 3VLNA 3QAGA 4XRDA 4OFNA 4GXZA 5IMZA 5C04A 4O5UA 1BG1A 2HSHA 2OACA 4TRXA 3Q74A 1YVLA 1E6BA 3FMWA 4K5SA 1A2MA 1RK4A 4D73A 5IM9A 5B6NA 4GCIA 1JLVA 1ON4A 3EPTA 3TJJA 2LRTA 1SKSB 1JZOA 1A8LA 1XZOA 3DEXA 1OE8A 2GT6A 4L0UA 2PMTA 3HMJG 1SJ6A 2WW1A 4NXIA 1ZYPA 3DVWA 5ELAA 3TJBA 4IJIA 1TOFA 3LJRA 1YKCA 4MF6A 3F3RA 3GURA 1Z5YE 2WVYA 3MWHA 2HRKA 3ZLPA 4L5OA 4TXOA 3RPPA 3O3TA 3H1NA 2FY6A 4JRRA 3L9UA 2C0FA 2PWJA 4WKWA 3KTLA 3US3A 4USSA 4KSOA 4PQ1A 3EU4A 1SVOA 1ZMAA 1GSSA 2YJHA 3IA1A 1X5CA 3GH9A 5LNKe 2YANA 3F9UA 2E2GA 4Q5FA 1GTUA 4KCEA 1GLPA 1TK5B 4BPYA 1OC9B 2C0EA 4I8BA 3QOUA 3KXOA 1U3AA 3KH9A 6GSSA 3C7MA 2FA4A 1JZRA 3RFRC 4X4JA 2GLRA 2UZ8A 1VF2A 1MDJA 2E0QA 2P0GA 1PGTA 1ERVA 5CRGA 2B5XA 2R0PA 4N0VA 4I2TA 1S3RA 1J9BA 2CQ9A 5JWOB 2JZTA 1YJ6A 4MPFA 3GUSA 3GKMA 3DD3A 4V2NA 2WFCA 3UVTA 3GTUA 5ECIB 4K7OA 2AAWA 2GQMA 1URMA 1MDIA 4V2MA 1PA3A 4I97A 3APSA 2DSAA 1W89A 3D0ZA 4MPGA 1GTAA 2FHEA 4GSSA 2EC4A 2HSMB 6GSTA 3KZQA 4PUFC 2R3XA 4G10A 4PI2C 4FIWA 2VD0A 1NHOA 4PTSA 5EVOA 5IO0A 4DSSB 3VI7A 3ZRDA 4ZB7A 5HFKA 2VCXA 5HFIA 1GSEA 2WCIA 4WBJA 2X49A 17GSA 4N11A 2XPEA 4PQIA 2FWEA 2VCWA 1GNWA 1XBSA 3CRTA 3R3EA 4K5RA 5DQSA 2K9FA 1XFLA 2JADA 3TKQA 3ZL5A 2MZCA 1M99A 1K0BA 2A4HA 5HR2A 4AJ7A 3J7Yb 3IC4A 3MSZA 4Z7XA 2LQQA 1PKWA 2HYXA 5IMFA 1SVMA 2NVLA 2RUFA 4FYCA 2HNLA 2FA8A 4EDYA 4EL1A 1BJXA 1FW1A 4TR1B 1WRYA 3DRNA 1AUCA 4WF4A 1AC1A 1Z7PA 2WW0A 6GSXA 3GSSA 4A5PA 1ZYNA 5JCGA 2DLXA 4NHWA 1EZKA 3P8WA 6GSUA 5KEJA 1ACVA 1GSYA 2HRAA 2O3EA 4Q5QA 4YQVA 1HNCA 1EOHA 1O85A 1TK8B 2WVXA 4FO5A 1SYRA 5KOWA 3QR6A 2YJ7A 2TRXA 5CREA 1EEJA 3DWVA 3ZFLA 1AXDA 2L4CA 1TDIA 1O6JA 2LJAA 3QFAC 20GSA 4AGSA 3A2WA 3EYTA 5A34B 4IVFA 4PNFA 3TKSE 5BMUB 4J2FA 3RPNA 3ME8A 1ILOA 4G01A 3IXRA 3BOAA 5DAKA 2IJYA 3LYKA 4HSCX 2VLUA 2REMA 4K1FA 1I1IP 4OD7A 4EDZA 3LSZA 1TJDA 1SJZA 1A2LA 1UC7A 1XW9A 4NWYA 4FYUA 1M3IA 3E9JB 2BMXA 2IN3A 1K0DA 1TRSA 2HXKA 2I1UA 1TXXA 2H30A 3IDVA 4MA9A 5AN1A 3H8QA 3HJPA 3TUEA 2ON7A 2QSIA 5HR0A 5L71A 2FWHA 5CO3A 4OFMA 2A2SA 1Q98A 1FOVA 4ZL9A 2VL2C 2BJXA 2H1DA 4MF5A 3ZZXA 1Z9HA 1UVZA 4IP6A 5COHA 3VPQA 1WMJA 3V1WA 2YWIA 2YNXA 1ZYEA 4YKFA 5ID2B 1ZYQB 1XVQA 1V98A 1GSUA 3UJ1A 3UBKA 3VWVA 4OCEA 3F6DA 2C1YA 1GWCA 5KOXA 5KN0A 4KA0A 1R7HA 2RM5A 3QCPA 1BEDA 4HZ2A 2VO4A 3ISOA 2TRCP 3TCOA 3KMOA 5G5FA 1G7EA 3BJ5A 3LFLA 2CAIA 2I9HA 3RBTA 3D5JA 3FR6A 1XOAA 1M2BA 5J41A 1FVJA 3IE3A 2O7KA 1QXHA 3KP8A 5D93A 2H73A 3UBLA 4V1Ag 5ECRB 2IFQA 4TN8A 2Z9SA 3L0HA 4RI6A 2RUEA 4MJAA 2K8VA 1THOA 3ZVJD 1WE0A 3HVVA 4ECJA 4YKGA 1BG5A 3IBHA 3NZNA 4XIHA 4IJ3A 5CNWA 2IIYA 2HSNA 4ZL8A 4J56E 1M3JA 1F37A 3M0FA 2CX3A 1KEBA 3ZVJA 1XWCA 2V2GA 2DMMA 5DALA 1K3OA 3EWLA 1OAZA 2CZ2A 1AW9A 2DJ0A 3WT1A 3CRUA 3EURA 4JZQA 3CMIA 4DEJA 4NV5A 2X4AA 1DE2A 2F51A 3A2XA 2OE3A 2V6OA 2H0HA 2RM6A 5ABRA 4PUAA 4OO5A 2C80A 2R37A 3FZ4A 1OE7A 1W4VA 5JCUA 1FHEA 2M72A 4IP1A 2IMIA 1IYIA 2P5RA 1X0RA 1ERWA 4GF0A 3W8JA 1O8WA 4KDUA 4MJEA 1WJKA 2EFDA 5B6MA 5IOXA 3GIXA 5A4UA 5AGYA 4IW9A 5F07A 4K7NA 4G0IA 3FR3A 4Q5NA 1GL8A 3UEMA 5G1LA 2LTKA 3FZ5A 3QAVA 4PQHA 2LSTA 5EY6A 4OFTA 2RIIA 3UL3A 4MZCA 3ZIJA 5A4WA 4AKIA 5DJLA 2GSSA 3LXZA 1EV4A 2H6XA 3DMLA 1LJRA 4LLRA 2FNOA 1T4ZA 4CDOA 5A5KA 2ALBA 2FWGA 1T00A 3G7YA 4F82A 2HQTA 1SL0B 2CZ3A 2GDRA 1A0RP 1AQVA 4K2DA 5A1NB 2X99A 2OADA 4O92A 4MZBA 3M1GA 1Z7RA 11GSA 3HJMA 2GZZA 4Q5RA 1FVKA 2L6CA 2QGVA 1GUMA 18GSA 3F4RA 1FO5A 1NW2A 2PGTA 3MDKA 3D4TA 2MMAA 4WBRD 2CV4A 1BYEA 1MD3A 1WIKA 3APOA 2C3TA 1MTCA 4IQ1A 1VF1A 5BRTA 3S9FA 4I2UA 2C3NA 4MJBA 2HSYA 5FWGA 2B7JA 5G30A 2GSRA 3M8NA 1RW1A 1EEMA 2E2MA 4CY6A 2YWMA 3HDCA 1OC3A 4XTSA 1X9SB 1K0MA 3F4TA 2IMFA 4OWYA 4NPBA 1ZL9A 2R4VA 1HQOA 3KMNA 1ZOFA 3IAM2 1XWKA 2VIMA 1F3AA 1QMVA 3WD6A 4PI0C 3J7Yk 2MMZA 2H71A 3GV1A 4ZIJA 2JZSA 3KCMA 4XS4A 1I9DA 1EGRA 5F8BA 4JR4A 3L9VA 3CSIA 2R0CA 3LQ7A 2QA2A 1XVWA 1AQWA 4PNGA 1U6TA 1AIUA 2B1KA 2JACA 4N0ZA 3VFIA 2WDUA 5F05A 2I81A 5IOWA 2C0GA 4BVYB 4KAEA 2GS3A 2WULA 5ENUA 4X43A 1TW9A 1A0FA 1ST9A 2YV7A 2C8UA 5J4YA 1NHYA 1PL2A 3TDGA 4MMMA 4MJCA 2YV9A 2H74A 3KGKA 1NM3A 2DJ2A 2L6DA 2VL3A 2L57A 2M80A 3HCZA 3LXTA 2C4JA 2LJKA 2OJLA 1FOHA 1G0TA 4X0XA 2B6MA 1M9AA
chains in the Genus database with same CATH topology
3DVXA 3QPMA 4WETA 2V1MA 5KN2A 3IOSA 5ECHB 3VWWA 4LMWA 1XIYA 2E7PA 5HR3A 2J23A 4MZWA 2OE0A 1TRWA 2N5AA 5H5QA 1Z6NA 3TOUA 4ICYA 1U3IA 3EINA 1JZWA 3F4SA 3F6FA 3TRPA 3TRXA 3EE2A 1B9XC 1GUKA 3APQA 4KE3A 1VF4A 3EU3A 2X8HA 3ZITA 3LG6A 4BL7A 1YDKA 1V57A 3SWLA 4K8MA 2VCZA 1XXUA 1X9MB 3C73A 1YF0A 1H75A 2OA7A 2IL3A 3QAWA 4JE1A 3MNGA 4KNDA 3L9SA 2X8CA 4X1UA 1T8EB 2ES7A 1S3CA 2XBQA 4EXJA 1F9MA 4HU7A 1B48A 4MK3A 4EKZA 2V32A 4ILFA 3Q19A 1TKDB 5D9VA 2H1BA 2PU9C 4RI7A 2JZRA 1F2EA 2DBCA 2B7KA 1SL2B 2H75A 3IC8A 5J47A 4TOPA 3LEFA 1YY7A 3TKPA 2CVBA 3KJYA 3KIJA 2ZUPA 3E3EA 1SD8A 4FH8A 1VRSD 2H19A 2FLSA 3EVIA 7GSSA 2LS5A 3Q6OA 2H76A 2H1GA 4ISDA 4CY8A 3VK9A 2WB9A 5JWRB 1OKTA 1N25A 1WWJA 5J3RA 2XC2A 2LJRA 3GL3A 3HHVA 3O76A 1J0FA 3M9KA 1QQ2A 1O73A 19GSA 2B1LA 5DQYA 5A5HB 1PMTA 1R5AA 4PX1A 4G0KA 2VLTA 2HZEA 1BX9A 4DSQA 2FGXA 5G5EA 5E59A 4K0GA 2YZHA 4EIPA 4O5RA 4G2EA 3FEUA 4BWQA 3LWAA 5EPFA 4IGJA 4ZB9A 4HS1A 5AIXA 4GRFA 2L5OA 3HZ4A 3P7XA 2F8FA 1FG4A 4ZBAA 3UVHA 1OKDA 4Z2TA 5J4VA 6GSYA 3KD0A 3G9BA 1TK0B 1YEXA 2YN1A 5DDLA 2IMEA 4HU9A 3GX0A 2HFDA 4D73B 4BVXA 3WGDA 5J4UA 3PH9A 3HVXA 1XCCA 2YWNA 1M7TA 4GSTA 2KP2A 2YP6A 5DBQA 4NV2A 3O6TA 2DKHA 2OBIA 1SK2A 2WZ9A 1ZGNA 2HRNA 1B9YC 4ZBBA 1SL1B 6GSVA 2VUPA 2GSTA 3IHGA 5KN3A 3ERGA 5ECLB 2H0GA 2O5VA 4TXOB 2R5GA 4L5LA 1C72A 3FZAA 3GNJA 3DKSA 8GSSA 4KH7A 1TRVA 2B5YA 1G7OA 4YAVA 4HQSA 1USBA 2CA8A 3FR9A 4N3ZA 3C71A 2GZPA 1FAAA 1SKWB 4HDEA 2HLSA 3KTBA 1T4YA 3IAS2 2GZYA 2L4QA 4LL1B 3HKRA 3HY2A 1PN9A 3NIVA 5AIVA 1EGOA 1DBYA 3CYNA 3VWUA 3GSTA 3VPTA 1TXUA 3H93A 1M9BA 3ZYWA 3UIWA 2NPBA 5IMVA 5J9CA 4POLA 3PPUA 4F03A 3TGZA 5CRWA 1PN0A 1T7PB 2HZFA 3F8UA 3RDWA 5D9XA 2LV3A 4ZB8A 3FW2A 1TI1A 1PRXA 4POMA 2DJ1A 2O85A 3GH6A 1PL1A 3GTUB 2VKZG 2BTOT 5B8BA 1XW5A 3LW9A 3VWXA 1BAYA 1PX6A 4PURA 1DSBA 1GSDA 2N5FA 4O32A 5FHIA 2R6KA 3TB2A 1V2AA 1BQ7A 1M2AA 2OE1A 5IMDA 2B5EA 5GAPD 5HQPA 5AISA 4RQXA 4IBPA 2GTUA 1F3BA 4KDXA 5F0GA 3ZTLA 2AHEA 1HD2A 3WGXA 1EWXA 5ECQB 1HYUA 2YCDA 3WT2A 1HNAA 2VLVA 4ECIA 4TW5A 3P90A 2I3YA 1I5GA 1YQ1A 2J9HA 3L4NA 1G6WA 4QMKA 4I5QA 4HI7A 3FY7A 1WPIA 1OC9A 4TXVA 4EF0A 2PBJA 4NMUA 4KF9A 4EVMA 2CT6A 4Z2UA 1THXA 4GDFA 2RLIA 2EFHA 3TU3B 1M0UA 2NBSA 1AAZA 2FUG2 1YF1A 2DKIA 3FK8A 3TJGA 1Y6EA 2DMLA 3PGTA 3GHAA 3FZ9A 3HYPA 3GKXA 2PVOC 3N5OA 5HFGA 2FD3A 2QA1A 1S3DA 1R5PA 1GULA 1ZZYA 3MIXA 9GSSA 3WGEA 4MP4A 1HNBA 4IQAA 4K7IA 2YZUA 3GYKA 1O81A 1GUHA 1LU4A 3D22A 5ELGA 5JWQB 1OC8A 2DJJA 3HZ8A 2UV8G 2HSMA 1B4PA 4XHMA 4KW6A 5DJMA 4DSSA 5DAKB 2B3SA 3M9JA 4AF2A 3TKSA 1GTIA 5LCZA 2HI7A 3GN3A 3BD2A 4HJMA 3IR4A 3AY8A 2HRFA 2CX4A 3TRQA 5INYA 4P3YB 2I4AA 2KP1A 3FKFA 2L5LA 4AKXB 3P2AA 3JCML 3GX8A 4TR0A 3GFKA 2MYGA 1U88A 2H8LA 4N10A 3HVSA 1UN2A 5GSTA 1OYJA 2LEGA 5D9TA 5FT3A 1ABAA 3M3MA 4MDCA 4TR1A 2C3QA 3ZMLA 4ULXA 2VL2A 1SJIA 1QGVA 3CBUA 5IIZA 5CP1A 2KLXA 16GSA 1YZXA 4MCUA 2OT3A 1T3BA 2IMKA 5H5RA 1M2DA 5EL8A 4POKA 2H6YA 1GNEA 4E68A 3GL5A 2O87A 2VM2A 2HE3A 3NOFA 4TVEA 2MMOA 1JFUA 5ECSA 2EIOA 2JSZA 2CVDA 2VCQA 5A34A 4AJ8A 1EV9A 4YAPA 1SENA 5A4VA 5KN1A 1KNGA 5BMUA 3DXBA 2F3MA 1TTZA 1N2AA 4WF5A 1YEPA 1RQMA 3DIEA 3ZFBA 2VOCA 1O7UA 3PR8A 2WJUA 4YH2A 5H5SA 4AI6A 1SD9A 2IFQB 3I9V2 2MMNA 5CAXA 1XWAA 4YQMA 3KEBA 1XWBA 4K2XA 3D4MA 2QKEA 4CHSA 2VM1A 5IQYA 1ERUA 2YPMA 3DGQA 2K8SA 3A2VA 5G1KA 5ECOB 14GSA 4K9ZA 4QQ7A 4IS0A 2HSNB 1FB6A 5ECPB 3W8SA 1N8JA 4MH3A 2AJQB 2MBTA 4F9ZA 4WR4A 5DALB 3H4KA 4MNNA 3K8NA 5LD0A 3HXSA 2PPTA 5B8AA 3CTFA 5ID2A 2VAFA 5DCHA 5E4WA 4E8HA 1EP7A 1J08A 3F0IA 4HEA2 4GQFA 3ZMKA 2O89A 5CRHA 3GMFA 2IPAA 1TP9A 2NTOA 2CVKA 1PSQA 1ZCPA 1S3AA 4G0LA 2H01A 3I43A 3BBYA 3ERFA 4ACSA 3TJFA 1SVLA 1K0OA 2VCTA 2QC7A 4POBA 4XS6A 4TKYA 2A2RA 2K18A 1SK0A 3QDNA 4KGIA 4RQRA 4LL4B 2AB6A 4FQUA 3EMPA 2OKAA 10GSA 2H72A 4KB3A 1EOGA 3A5IA 1K0NA 4OO4A 3BCKA 3I69A 4KX4A 4KUNA 1V9WA 1GSFA 2KHPA 1X5EA 2A4VA 4JU5A 2ZNMA 5GZZB 3IRAA 1K0CA 4LMVA 2LUSA 3CTGA 1GSQA 4MABA 1G6YA 1CQHA 4XRAA 4EUYA 1MDKA 4V2LA 1JLWA 1VF3A 3Q18A 2H6ZA 4FYBA 4MLYA 1PD21 3R2QA 2HT9A 1X9WB 3ED3A 3KH7A 1Y1UA 5GAND 5G31A 3U6VA 2VCVA 4TR4A 4GQCA 4G19A 13GSA 1OVNA 1B8XA 2F8AA 2F9SA 3LYPA 3UMAA 2GQLA 3TOTA 2YOIA 3L78A 3RHCA 2FWFA 2G0FA 2VD1A 4EE0A 3UAPA 4KDYA 2ZCTA 1PKZA 3CXGA 3CWGA 1WP0A 4XS4B 1XW6A 3CSJA 5D96A 2O8VB 1K0AA 3C1SA 3IHQA 1KBNA 3GKNA 3ERWA 4J57E 3C8EA 4DSRA 3IPZA 2H1LA 2XPDA 12GSA 4L8EA 5CYYA 4F0BA 2DC5A 3TKSC 3IV4A 3N9JA 1PX7A 1K3LA 4ML6A 3IK9A 2DJKA 3F63A 2K6VA 2M46A 4K0NA 5A1NA 4HJ2A 1ERTA 1U87A 1Z6MA 2A2PA 1UA5A 6GSWA 2HRKB 2AV4A 4BA7A 4ZXGA 2JSYA 1DUGA 3GA4A 3MYDA 5D9WA 2LRNA 5IPHA 2LNTA 3LORA 1BF5A 4EC0A 3IK7A 5HR1A 2V41A 2LNSA 5CRDA 4Z2RA 5DVBA 3ME7A 4NHZA 3MAKA 5C00A 4PXOA 1E2YA 4F0CA 1SKRB 5G2ZA 4JBBA 3A5WA 1PQNA 1JZDA 1MEKA 3WYWA 4AKHA 4HOJA 2PERA 3BCIA 1Y25A 1A24A 5IMAA 2N5BA 3LGCA 2H66A 4YQUA 1A2JA 2LRCA 3PINA 3H79A 4KCAA 2DJ3A 2GT5A 3FYGA 4GWRA 4BL7B 4OCFA 4JEDA 3RHBA 2L59A 3ZIVA 2LKUA 1SK1A 3GRXA 5GSSA 2GSQA 4QL9A 1K3YA 4BVYA 3D21A 4QL7A 3TJKA 4DVCA 3QD9A 2EFEA 4MF7A 1TI3A 4G9HA 1TRUA 1SU9A 3D6IA 4ID0A 1WOUA 2LQOA 4H86A 3EC3A 1A8YA 1GP1A 4N30A 4ZL7A 5JCWA 2GVPA 4I6XA 4LA1A 1T1VA 4O7HA 4PGTA 4K6XA 1DE1A 1QUWA 2AUVA 2YWOA 2JL4A 1GRXA 3SBCA 2H0IA 4KSMA 4CW9A 4GSNA 5J5NA 3VI5A 2R0GA 5D73A 3QMXA 5J9BA 1H4OA 1KTEA 3UARA 1IYHA 3ZREA 3I6AA 3E0UA 3EMXA 4IHUA 2GQKA 2XBIA 2NDOA 2CAQA 1VGLA 4O5QA 2G2QA 1SYXA 3HJOA 2OBKA 4BWSA 3G7IA 2PVQA 3FRCA 4HUAA 2HZEB 3OR5A 3RAZA 1X5DA 5IO2A 2H1AA 3FHKA 3HA9A 1QFNA 4ML1A 1XPVA 3G7JA 4IELA 4L0WA 2DIYA 1YKAA 2KOKA 3VURA 1Q4JA 2C0DA 1NSWA 4JR6A 4W66A 3F3QA 2PN8A 4ZBDA 1V40A 4XCSA 2VL9A 1O8XA 4HZ4A 2IMDA 4IKHA 2IWTA 4AKGA 3DYRA 4OMVA 1R4WA 2P5QA 1CQGA 4HQZA 4XS1A 4WXTA 4F2IA 2WRTA 1GH2A 3U5RE 3TKRA 4BVXB 2FCHA 1R26A 2PUKC 2ON5A 3C1RA 1LBKA 2WGRA 1FB0A 1B4QA 3UOMA 1MD4A 3CSHA 2XHFA 5IMCA 2EIQA 1EP8A 1GTBA 2GGTA 2WS2A 1TU7A 4WR5A 4MH2A 5F06A 4ZILA 2R2JA 1V58A 2X64A 4EIQA 4TR3A 2V6KA 1ML6A 4WEYA 4EO3A 4ECCA 5ECNB 1JHBA 3KP9A 2JU5A 5B7CA 4GTUA 1A23A 4E8EA 4IN0A 5DCGA 2DIZA 3W6GA 5J40A 5A5HA 3KM6A 3GKKA 2AYTA 1GLQA 5D8IA 4V1Ap 1XWGA 4ZB6A 2X8GA 2MBSA 1F6MC 1Z3EA 4AJ6A 5IPGA 4RUVA 5ECKB 5ECMB 1XOBA 4NAXA 3QFBC 1AQXA 2TIRA 1TU8A 2EIRA 3HD5A 22GSA 3A3TA 2D2ZA 2H70A 2EFCA 2P31A 4GLTA 4ECBA 2KUCA 1QK8A 3VLNA 3QAGA 4XRDA 4OFNA 4GXZA 5IMZA 5C04A 4O5UA 1BG1A 2HSHA 2OACA 4TRXA 3Q74A 1YVLA 1E6BA 3FMWA 4K5SA 1A2MA 1RK4A 4D73A 5IM9A 5B6NA 4GCIA 1JLVA 1ON4A 3EPTA 3TJJA 2LRTA 1SKSB 1JZOA 1A8LA 1XZOA 3DEXA 1OE8A 2GT6A 4L0UA 2PMTA 3HMJG 1SJ6A 4NXIA 1ZYPA 3DVWA 5ELAA 3TJBA 4IJIA 1TOFA 3LJRA 1YKCA 4MF6A 3F3RA 3GURA 1Z5YE 3MWHA 2HRKA 3ZLPA 4L5OA 4TXOA 3RPPA 3O3TA 3H1NA 2FY6A 4JRRA 3L9UA 2C0FA 2PWJA 4WKWA 3KTLA 3US3A 4USSA 4KSOA 4PQ1A 3EU4A 1SVOA 1ZMAA 1GSSA 2YJHA 3IA1A 1X5CA 3GH9A 5LNKe 2YANA 3F9UA 2E2GA 4Q5FA 1GTUA 4KCEA 1GLPA 1TK5B 4BPYA 1OC9B 2C0EA 4I8BA 3QOUA 3KXOA 1U3AA 3KH9A 6GSSA 3C7MA 2FA4A 1JZRA 4X4JA 2GLRA 2UZ8A 1VF2A 1MDJA 2E0QA 2P0GA 1PGTA 1ERVA 5CRGA 2B5XA 2R0PA 4N0VA 4I2TA 1J9BA 2CQ9A 5JWOB 2JZTA 1YJ6A 4MPFA 3GUSA 3GKMA 3DD3A 4V2NA 2WFCA 3UVTA 3GTUA 5ECIB 4K7OA 2AAWA 2GQMA 1URMA 1MDIA 4V2MA 1PA3A 4I97A 3APSA 2DSAA 1W89A 3D0ZA 4MPGA 1GTAA 2FHEA 4GSSA 2EC4A 2HSMB 6GSTA 3KZQA 4PUFC 2R3XA 4G10A 4FIWA 2VD0A 1NHOA 4PTSA 5EVOA 5IO0A 4DSSB 3VI7A 3ZRDA 4ZB7A 5HFKA 2VCXA 5HFIA 1GSEA 2WCIA 4WBJA 2X49A 17GSA 4N11A 2XPEA 4PQIA 2FWEA 2VCWA 1GNWA 1XBSA 3CRTA 3R3EA 4K5RA 5DQSA 2K9FA 1XFLA 2JADA 3TKQA 3ZL5A 2MZCA 1M99A 1K0BA 2A4HA 5HR2A 4AJ7A 3J7Yb 3IC4A 3MSZA 4Z7XA 2LQQA 1PKWA 2HYXA 5IMFA 1SVMA 2NVLA 2RUFA 4FYCA 2HNLA 2FA8A 4EDYA 4EL1A 1BJXA 1FW1A 4TR1B 1WRYA 3DRNA 1AUCA 4WF4A 1AC1A 1Z7PA 6GSXA 3GSSA 4A5PA 1ZYNA 5JCGA 2DLXA 4NHWA 1EZKA 3P8WA 6GSUA 5KEJA 1ACVA 1GSYA 2HRAA 4Q5QA 4YQVA 1HNCA 1EOHA 1O85A 1TK8B 4FO5A 1SYRA 5KOWA 3QR6A 2YJ7A 2TRXA 5CREA 1EEJA 3DWVA 3ZFLA 1AXDA 2L4CA 1TDIA 1O6JA 2LJAA 3QFAC 20GSA 4AGSA 3A2WA 3EYTA 5A34B 4IVFA 4PNFA 3TKSE 5BMUB 4J2FA 3RPNA 3ME8A 1ILOA 4G01A 3IXRA 3BOAA 5DAKA 2IJYA 3LYKA 2VLUA 2REMA 4K1FA 4OD7A 4EDZA 3LSZA 1TJDA 1SJZA 1A2LA 1UC7A 1XW9A 4NWYA 4FYUA 3E9JB 2BMXA 2IN3A 1K0DA 1TRSA 2HXKA 2I1UA 1TXXA 2H30A 3IDVA 4MA9A 5AN1A 3H8QA 3HJPA 3TUEA 2ON7A 2QSIA 5HR0A 5L71A 2FWHA 5CO3A 4OFMA 2A2SA 1Q98A 1FOVA 4ZL9A 2VL2C 2BJXA 2H1DA 4MF5A 3ZZXA 1Z9HA 1UVZA 4IP6A 5COHA 3VPQA 1WMJA 3V1WA 2YWIA 2YNXA 1ZYEA 4YKFA 5ID2B 1ZYQB 1XVQA 1V98A 1GSUA 3UJ1A 3UBKA 3VWVA 4OCEA 3F6DA 2C1YA 1GWCA 5KOXA 5KN0A 4KA0A 1R7HA 2RM5A 3QCPA 1BEDA 4HZ2A 2VO4A 3ISOA 2TRCP 3TCOA 3KMOA 5G5FA 1G7EA 3BJ5A 3LFLA 2CAIA 2I9HA 3RBTA 3D5JA 3FR6A 1XOAA 1M2BA 5J41A 1FVJA 3IE3A 2O7KA 1QXHA 3KP8A 5D93A 2H73A 3UBLA 4V1Ag 5ECRB 2IFQA 4TN8A 2Z9SA 3L0HA 4RI6A 2RUEA 4MJAA 2K8VA 1THOA 3ZVJD 1WE0A 3HVVA 4ECJA 4YKGA 1BG5A 3IBHA 3NZNA 4XIHA 4IJ3A 5CNWA 2IIYA 2HSNA 4ZL8A 4J56E 1F37A 3M0FA 2CX3A 1KEBA 3ZVJA 1XWCA 2V2GA 2DMMA 5DALA 1K3OA 3EWLA 1OAZA 2CZ2A 1AW9A 2DJ0A 3WT1A 3CRUA 3EURA 4JZQA 3CMIA 4DEJA 4NV5A 2X4AA 1DE2A 2F51A 3A2XA 2OE3A 2V6OA 2H0HA 2RM6A 5ABRA 4PUAA 4OO5A 2C80A 2R37A 3FZ4A 1OE7A 1W4VA 5JCUA 1FHEA 2M72A 4IP1A 2IMIA 1IYIA 2P5RA 1X0RA 1ERWA 4GF0A 3W8JA 1O8WA 4KDUA 4MJEA 1WJKA 2EFDA 5B6MA 5IOXA 3GIXA 5A4UA 5AGYA 4IW9A 5F07A 4K7NA 4G0IA 3FR3A 4Q5NA 1GL8A 3UEMA 5G1LA 2LTKA 3FZ5A 3QAVA 4PQHA 2LSTA 5EY6A 4OFTA 2RIIA 3UL3A 4MZCA 3ZIJA 5A4WA 4AKIA 5DJLA 2GSSA 3LXZA 1EV4A 2H6XA 3DMLA 1LJRA 4LLRA 2FNOA 1T4ZA 4CDOA 5A5KA 2ALBA 2FWGA 1T00A 3G7YA 4F82A 2HQTA 1SL0B 2CZ3A 2GDRA 1A0RP 1AQVA 4K2DA 5A1NB 2X99A 2OADA 4O92A 4MZBA 3M1GA 1Z7RA 11GSA 3HJMA 2GZZA 4Q5RA 1FVKA 2L6CA 2QGVA 1GUMA 18GSA 3F4RA 1FO5A 1NW2A 2PGTA 3MDKA 3D4TA 2MMAA 4WBRD 2CV4A 1BYEA 1MD3A 1WIKA 3APOA 2C3TA 1MTCA 4IQ1A 1VF1A 5BRTA 3S9FA 4I2UA 2C3NA 4MJBA 2HSYA 5FWGA 2B7JA 5G30A 2GSRA 3M8NA 1RW1A 1EEMA 2E2MA 4CY6A 2YWMA 3HDCA 1OC3A 4XTSA 1X9SB 1K0MA 3F4TA 2IMFA 4OWYA 4NPBA 1ZL9A 2R4VA 1HQOA 3KMNA 1ZOFA 3IAM2 1XWKA 2VIMA 1F3AA 1QMVA 3WD6A 3J7Yk 2MMZA 2H71A 3GV1A 4ZIJA 2JZSA 3KCMA 4XS4A 1I9DA 1EGRA 5F8BA 4JR4A 3L9VA 3CSIA 2R0CA 3LQ7A 2QA2A 1XVWA 1AQWA 4PNGA 1U6TA 1AIUA 2B1KA 2JACA 4N0ZA 3VFIA 2WDUA 5F05A 2I81A 5IOWA 2C0GA 4BVYB 4KAEA 2GS3A 2WULA 5ENUA 4X43A 1TW9A 1A0FA 1ST9A 2YV7A 2C8UA 5J4YA 1NHYA 1PL2A 3TDGA 4MMMA 4MJCA 2YV9A 2H74A 3KGKA 1NM3A 2DJ2A 2L6DA 2VL3A 2L57A 2M80A 3HCZA 3LXTA 2C4JA 2LJKA 2OJLA 1FOHA 1G0TA 4X0XA 2B6MA 1M9AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DVX A;  3QPM A;  4WET A;  2V1M A;  5KN2 A;  3IOS A;  5ECH B;  3VWW A;  4LMW A;  1XIY A;  2E7P A;  5HR3 A;  2J23 A;  4MZW A;  2OE0 A;  1TRW A;  2N5A A;  5H5Q A;  1Z6N A;  3TOU A;  1U3I A;  3EIN A;  1JZW A;  3F4S A;  3F6F A;  3TRP A;  3TRX A;  3EE2 A;  1B9X C;  1GUK A;  3APQ A;  4KE3 A;  1VF4 A;  3EU3 A;  2X8H A;  3ZIT A;  3LG6 A;  4BL7 A;  1YDK A;  1V57 A;  3SWL A;  4K8M A;  2VCZ A;  1XXU A;  1X9M B;  3C73 A;  1YF0 A;  1H75 A;  2OA7 A;  2IL3 A;  3QAW A;  4JE1 A;  3MNG A;  4KND A;  3L9S A;  2X8C A;  4X1U A;  1T8E B;  2ES7 A;  1S3C A;  2XBQ A;  4EXJ A;  1F9M A;  4HU7 A;  1B48 A;  4MK3 A;  4EKZ A;  2V32 A;  4ILF A;  3Q19 A;  1TKD B;  5D9V A;  2H1B A;  2PU9 C;  4RI7 A;  2JZR A;  1F2E A;  2DBC A;  2B7K A;  1SL2 B;  2H75 A;  3IC8 A;  4TOP A;  3LEF A;  1YY7 A;  3TKP A;  2CVB A;  3KJY A;  3KIJ A;  2ZUP A;  3E3E A;  1SD8 A;  4FH8 A;  1VRS D;  2H19 A;  2FLS A;  3EVI A;  7GSS A;  2LS5 A;  3Q6O A;  2H76 A;  2H1G A;  4ISD A;  3VK9 A;  2WB9 A;  5JWR B;  1OKT A;  1WWJ A;  5J3R A;  2XC2 A;  2LJR A;  3GL3 A;  3HHV A;  3O76 A;  1J0F A;  3M9K A;  1QQ2 A;  1O73 A;  19GS A;  2B1L A;  5DQY A;  1PMT A;  1R5A A;  4PX1 A;  4G0K A;  2VLT A;  2HZE A;  1BX9 A;  4DSQ A;  2FGX A;  5G5E A;  5E59 A;  4K0G A;  2YZH A;  4O5R A;  4G2E A;  3FEU A;  4BWQ A;  3LWA A;  5EPF A;  4IGJ A;  4ZB9 A;  4HS1 A;  5AIX A;  4GRF A;  2L5O A;  3HZ4 A;  3P7X A;  2F8F A;  1FG4 A;  4ZBA A;  3UVH A;  1OKD A;  6GSY A;  3KD0 A;  3G9B A;  1TK0 B;  1YEX A;  2YN1 A;  5DDL A;  2IME A;  4HU9 A;  3GX0 A;  2HFD A;  4D73 B;  4BVX A;  3WGD A;  5J4U A;  3PH9 A;  3HVX A;  1XCC A;  2YWN A;  1M7T A;  4GST A;  2KP2 A;  2YP6 A;  5DBQ A;  4NV2 A;  3O6T A;  2OBI A;  1SK2 A;  2WZ9 A;  1ZGN A;  2HRN A;  1B9Y C;  4ZBB A;  1SL1 B;  6GSV A;  2VUP A;  2GST A;  5KN3 A;  3ERG A;  5ECL B;  2H0G A;  4TXO B;  2R5G A;  4L5L A;  1C72 A;  3FZA A;  3GNJ A;  3DKS A;  8GSS A;  4KH7 A;  1TRV A;  2B5Y A;  1G7O A;  4YAV A;  4HQS A;  1USB A;  2CA8 A;  3FR9 A;  3C71 A;  2GZP A;  1FAA A;  1SKW B;  4HDE A;  2HLS A;  3KTB A;  1T4Y A;  3IAS 2;  2GZY A;  2L4Q A;  4LL1 B;  3HKR A;  3HY2 A;  1PN9 A;  3NIV A;  5AIV A;  1EGO A;  1DBY A;  3CYN A;  3VWU A;  3GST A;  3VPT A;  3H93 A;  1M9B A;  3ZYW A;  3UIW A;  2NPB A;  5IMV A;  5J9C A;  4POL A;  3PPU A;  4F03 A;  3TGZ A;  5CRW A;  1T7P B;  2HZF A;  3F8U A;  3RDW A;  5D9X A;  2LV3 A;  4ZB8 A;  3FW2 A;  1TI1 A;  1PRX A;  4POM A;  2DJ1 A;  2O85 A;  3GH6 A;  1PL1 A;  3GTU B;  2BTO T;  5B8B A;  1XW5 A;  3VWX A;  1BAY A;  1PX6 A;  4PUR A;  1DSB A;  1GSD A;  2N5F A;  4O32 A;  5FHI A;  2R6K A;  3TB2 A;  1V2A A;  1BQ7 A;  1M2A A;  2OE1 A;  5IMD A;  2B5E A;  5GAP D;  5HQP A;  5AIS A;  4RQX A;  4IBP A;  2GTU A;  1F3B A;  4KDX A;  5F0G A;  3ZTL A;  2AHE A;  1HD2 A;  3WGX A;  1EWX A;  5ECQ B;  1HYU A;  2YCD A;  3WT2 A;  1HNA A;  2VLV A;  4ECI A;  4TW5 A;  3P90 A;  2I3Y A;  1I5G A;  1YQ1 A;  2J9H A;  3L4N A;  1G6W A;  4I5Q A;  4HI7 A;  3FY7 A;  1WPI A;  1OC9 A;  4TXV A;  4EF0 A;  2PBJ A;  4NMU A;  4KF9 A;  4EVM A;  2CT6 A;  1THX A;  2RLI A;  1M0U A;  2NBS A;  1AAZ A;  2FUG 2;  1YF1 A;  3FK8 A;  3TJG A;  1Y6E A;  2DML A;  3PGT A;  3GHA A;  3FZ9 A;  3HYP A;  3GKX A;  2PVO C;  3N5O A;  5HFG A;  2FD3 A;  1S3D A;  1R5P A;  1GUL A;  1ZZY A;  9GSS A;  3WGE A;  4MP4 A;  1HNB A;  4IQA A;  4K7I A;  2YZU A;  3GYK A;  1O81 A;  1GUH A;  1LU4 A;  3D22 A;  5ELG A;  5JWQ B;  1OC8 A;  2DJJ A;  3HZ8 A;  2HSM A;  1B4P A;  4XHM A;  4KW6 A;  5DJM A;  4DSS A;  5DAK B;  2B3S A;  3M9J A;  4AF2 A;  3TKS A;  1GTI A;  5LCZ A;  2HI7 A;  3GN3 A;  3BD2 A;  4HJM A;  3IR4 A;  3AY8 A;  2HRF A;  2CX4 A;  3TRQ A;  5INY A;  4P3Y B;  2I4A A;  2KP1 A;  3FKF A;  2L5L A;  3P2A A;  3JCM L;  3GX8 A;  4TR0 A;  3GFK A;  2MYG A;  1U88 A;  2H8L A;  4N10 A;  3HVS A;  1UN2 A;  5GST A;  1OYJ A;  2LEG A;  5D9T A;  5FT3 A;  1ABA A;  3M3M A;  4MDC A;  4TR1 A;  2C3Q A;  3ZML A;  4ULX A;  2VL2 A;  1SJI A;  1QGV A;  3CBU A;  5IIZ A;  5CP1 A;  2KLX A;  16GS A;  1YZX A;  4MCU A;  1T3B A;  2IMK A;  5H5R A;  1M2D A;  5EL8 A;  4POK A;  2H6Y A;  1GNE A;  3GL5 A;  2O87 A;  2VM2 A;  2HE3 A;  3NOF A;  4TVE A;  2MMO A;  1JFU A;  5ECS A;  2EIO A;  2JSZ A;  2CVD A;  2VCQ A;  4AJ8 A;  1EV9 A;  4YAP A;  1SEN A;  5A4V A;  5KN1 A;  1KNG A;  5BMU A;  3DXB A;  2F3M A;  1TTZ A;  1N2A A;  4WF5 A;  1YEP A;  1RQM A;  3DIE A;  3ZFB A;  2VOC A;  1O7U A;  3PR8 A;  2WJU A;  4YH2 A;  5H5S A;  2IFQ B;  1SD9 A;  3I9V 2;  2MMN A;  5CAX A;  1XWA A;  4YQM A;  3KEB A;  1XWB A;  3D4M A;  2QKE A;  4CHS A;  2VM1 A;  5IQY A;  1ERU A;  2YPM A;  3DGQ A;  2K8S A;  3A2V A;  5G1K A;  5ECO B;  14GS A;  4K9Z A;  4QQ7 A;  4IS0 A;  2HSN B;  1FB6 A;  5ECP B;  3W8S A;  1N8J A;  4MH3 A;  2AJQ B;  2MBT A;  4F9Z A;  4WR4 A;  5DAL B;  3H4K A;  3K8N A;  5LD0 A;  3HXS A;  2PPT A;  5B8A A;  3CTF A;  5ID2 A;  2VAF A;  5DCH A;  5E4W A;  4E8H A;  1EP7 A;  1J08 A;  3F0I A;  4HEA 2;  4GQF A;  3ZMK A;  2O89 A;  5CRH A;  3GMF A;  2IPA A;  1TP9 A;  2NTO A;  2CVK A;  1PSQ A;  1ZCP A;  1S3A A;  4G0L A;  2H01 A;  3I43 A;  3BBY A;  3ERF A;  4ACS A;  3TJF A;  1K0O A;  2VCT A;  2QC7 A;  4POB A;  4XS6 A;  4TKY A;  2A2R A;  2K18 A;  1SK0 A;  3QDN A;  4KGI A;  4RQR A;  4LL4 B;  2AB6 A;  4FQU A;  3EMP A;  2OKA A;  10GS A;  2H72 A;  4KB3 A;  1EOG A;  1K0N A;  4OO4 A;  3BCK A;  3I69 A;  4KX4 A;  4KUN A;  1V9W A;  1GSF A;  2KHP A;  1X5E A;  2A4V A;  4JU5 A;  2ZNM A;  5GZZ B;  3IRA A;  1K0C A;  4LMV A;  2LUS A;  3CTG A;  1GSQ A;  4MAB A;  1G6Y A;  1CQH A;  4XRA A;  4EUY A;  1MDK A;  4V2L A;  1JLW A;  1VF3 A;  3Q18 A;  2H6Z A;  4FYB A;  4MLY A;  1PD2 1;  3R2Q A;  2HT9 A;  1X9W B;  3ED3 A;  3KH7 A;  5GAN D;  5G31 A;  3U6V A;  2VCV A;  4TR4 A;  4GQC A;  4G19 A;  13GS A;  1OVN A;  1B8X A;  2F8A A;  2F9S A;  3LYP A;  3UMA A;  2GQL A;  3TOT A;  2YOI A;  3L78 A;  3RHC A;  2FWF A;  2G0F A;  2VD1 A;  4EE0 A;  3UAP A;  4KDY A;  2ZCT A;  1PKZ A;  3CXG A;  1WP0 A;  4XS4 B;  1XW6 A;  3CSJ A;  5D96 A;  2O8V B;  1K0A A;  3C1S A;  3IHQ A;  1KBN A;  3GKN A;  3ERW A;  4J57 E;  3C8E A;  4DSR A;  3IPZ A;  2XPD A;  12GS A;  4L8E A;  5CYY A;  4F0B A;  2DC5 A;  3TKS C;  3IV4 A;  3N9J A;  1PX7 A;  1K3L A;  4ML6 A;  3IK9 A;  2DJK A;  3F63 A;  2K6V A;  2M46 A;  4K0N A;  4HJ2 A;  1ERT A;  1U87 A;  1Z6M A;  1UA5 A;  6GSW A;  2HRK B;  2AV4 A;  4BA7 A;  4ZXG A;  2JSY A;  1DUG A;  3GA4 A;  5D9W A;  2LRN A;  5IPH A;  2LNT A;  3LOR A;  4EC0 A;  3IK7 A;  5HR1 A;  2V41 A;  2LNS A;  5CRD A;  5DVB A;  3ME7 A;  4NHZ A;  3MAK A;  5C00 A;  4PXO A;  1E2Y A;  4F0C A;  1SKR B;  5G2Z A;  4JBB A;  3A5W A;  1PQN A;  1JZD A;  1MEK A;  3WYW A;  4HOJ A;  2PER A;  3BCI A;  1Y25 A;  1A24 A;  5IMA A;  2N5B A;  3LGC A;  2H66 A;  4YQU A;  1A2J A;  2LRC A;  3PIN A;  3H79 A;  4KCA A;  2DJ3 A;  2GT5 A;  3FYG A;  4GWR A;  4BL7 B;  4OCF A;  4JED A;  3RHB A;  2L59 A;  3ZIV A;  2LKU A;  1SK1 A;  3GRX A;  5GSS A;  2GSQ A;  4QL9 A;  1K3Y A;  4BVY A;  3D21 A;  4QL7 A;  3TJK A;  4DVC A;  3QD9 A;  4MF7 A;  1TI3 A;  4G9H A;  1TRU A;  1SU9 A;  3D6I A;  4ID0 A;  1WOU A;  2LQO A;  4H86 A;  3EC3 A;  1A8Y A;  1GP1 A;  4N30 A;  4ZL7 A;  5JCW A;  2GVP A;  4I6X A;  4LA1 A;  1T1V A;  4O7H A;  4PGT A;  4K6X A;  1DE1 A;  1QUW A;  2AUV A;  2YWO A;  2JL4 A;  1GRX A;  3SBC A;  2H0I A;  4KSM A;  4CW9 A;  4GSN A;  5J5N A;  3VI5 A;  5D73 A;  3QMX A;  5J9B A;  1H4O A;  1KTE A;  3UAR A;  1IYH A;  3ZRE A;  3I6A A;  3E0U A;  3EMX A;  4IHU A;  2GQK A;  2XBI A;  2NDO A;  2CAQ A;  1VGL A;  2G2Q A;  1SYX A;  3HJO A;  2OBK A;  4BWS A;  3G7I A;  2PVQ A;  3FRC A;  4HUA A;  2HZE B;  3OR5 A;  3RAZ A;  1X5D A;  5IO2 A;  2H1A A;  3FHK A;  3HA9 A;  1QFN A;  4ML1 A;  1XPV A;  3G7J A;  4IEL A;  4L0W A;  2DIY A;  1YKA A;  2KOK A;  3VUR A;  1Q4J A;  2C0D A;  1NSW A;  4JR6 A;  3F3Q A;  2PN8 A;  4ZBD A;  1V40 A;  4XCS A;  2VL9 A;  1O8X A;  4HZ4 A;  2IMD A;  4IKH A;  2IWT A;  3DYR A;  4OMV A;  1R4W A;  2P5Q A;  1CQG A;  4HQZ A;  4XS1 A;  4WXT A;  4F2I A;  2WRT A;  1GH2 A;  3U5R E;  3TKR A;  4BVX B;  2FCH A;  1R26 A;  2PUK C;  2ON5 A;  3C1R A;  1LBK A;  2WGR A;  1FB0 A;  1B4Q A;  3UOM A;  1MD4 A;  3CSH A;  2XHF A;  5IMC A;  2EIQ A;  1EP8 A;  1GTB A;  2GGT A;  2WS2 A;  1TU7 A;  4WR5 A;  4MH2 A;  5F06 A;  4ZIL A;  2R2J A;  1V58 A;  2X64 A;  4TR3 A;  2V6K A;  1ML6 A;  4WEY A;  4EO3 A;  4ECC A;  5ECN B;  1JHB A;  3KP9 A;  2JU5 A;  5B7C A;  4GTU A;  1A23 A;  4E8E A;  4IN0 A;  5DCG A;  2DIZ A;  3W6G A;  3KM6 A;  3GKK A;  2AYT A;  1GLQ A;  5D8I A;  4V1A p;  1XWG A;  4ZB6 A;  2X8G A;  2MBS A;  1F6M C;  1Z3E A;  4AJ6 A;  5IPG A;  4RUV A;  5ECK B;  5ECM B;  1XOB A;  3QFB C;  4NAX A;  1AQX A;  2TIR A;  1TU8 A;  2EIR A;  3HD5 A;  22GS A;  3A3T A;  2D2Z A;  2H70 A;  2P31 A;  4GLT A;  4ECB A;  2KUC A;  1QK8 A;  3VLN A;  3QAG A;  4XRD A;  4OFN A;  4GXZ A;  5IMZ A;  5C04 A;  2HSH A;  2OAC A;  4TRX A;  3Q74 A;  1E6B A;  1A2M A;  1RK4 A;  4D73 A;  5IM9 A;  5B6N A;  4GCI A;  1JLV A;  1ON4 A;  3TJJ A;  2LRT A;  1SKS B;  1JZO A;  1A8L A;  1XZO A;  3DEX A;  1OE8 A;  2GT6 A;  4L0U A;  2PMT A;  1SJ6 A;  4NXI A;  3DVW A;  5ELA A;  3TJB A;  4IJI A;  1TOF A;  3LJR A;  1YKC A;  4MF6 A;  3F3R A;  3GUR A;  1Z5Y E;  3MWH A;  2HRK A;  3ZLP A;  4L5O A;  4TXO A;  3RPP A;  3O3T A;  3H1N A;  2FY6 A;  4JRR A;  3L9U A;  2C0F A;  2PWJ A;  4WKW A;  3KTL A;  3US3 A;  4USS A;  4KSO A;  4PQ1 A;  3EU4 A;  1ZMA A;  1GSS A;  2YJH A;  3IA1 A;  1X5C A;  3GH9 A;  5LNK e;  2YAN A;  3F9U A;  2E2G A;  4Q5F A;  1GTU A;  4KCE A;  1GLP A;  1TK5 B;  4BPY A;  1OC9 B;  2C0E A;  4I8B A;  3QOU A;  3KXO A;  1U3A A;  3KH9 A;  6GSS A;  3C7M A;  2FA4 A;  1JZR A;  2GLR A;  2UZ8 A;  1VF2 A;  1MDJ A;  2E0Q A;  2P0G A;  1PGT A;  1ERV A;  5CRG A;  2B5X A;  4N0V A;  4I2T A;  1J9B A;  2CQ9 A;  5JWO B;  2JZT A;  1YJ6 A;  4MPF A;  3GUS A;  3GKM A;  3DD3 A;  4V2N A;  2WFC A;  3UVT A;  3GTU A;  5ECI B;  4K7O A;  2AAW A;  2GQM A;  1URM A;  1MDI A;  4V2M A;  1PA3 A;  4I97 A;  3APS A;  2DSA A;  1W89 A;  3D0Z A;  4MPG A;  1GTA A;  2FHE A;  4GSS A;  2EC4 A;  2HSM B;  6GST A;  3KZQ A;  4PUF C;  2R3X A;  4G10 A;  4FIW A;  2VD0 A;  1NHO A;  4PTS A;  5EVO A;  5IO0 A;  4DSS B;  3VI7 A;  3ZRD A;  5HFK A;  2VCX A;  5HFI A;  1GSE A;  2WCI A;  4WBJ A;  17GS A;  4N11 A;  2XPE A;  4PQI A;  2FWE A;  2VCW A;  1GNW A;  1XBS A;  3CRT A;  3R3E A;  5DQS A;  2K9F A;  1XFL A;  2JAD A;  3TKQ A;  3ZL5 A;  2MZC A;  1M99 A;  1K0B A;  5HR2 A;  4AJ7 A;  3J7Y b;  3IC4 A;  3MSZ A;  4Z7X A;  2LQQ A;  1PKW A;  2HYX A;  5IMF A;  2NVL A;  2RUF A;  4FYC A;  2HNL A;  2FA8 A;  4EDY A;  4EL1 A;  1BJX A;  1FW1 A;  4TR1 B;  1WRY A;  3DRN A;  1AUC A;  4WF4 A;  1AC1 A;  1Z7P A;  6GSX A;  3GSS A;  5JCG A;  2DLX A;  4NHW A;  1EZK A;  3P8W A;  6GSU A;  5KEJ A;  1ACV A;  1GSY A;  2HRA A;  4Q5Q A;  4YQV A;  1HNC A;  1EOH A;  1O85 A;  1TK8 B;  4FO5 A;  1SYR A;  3QR6 A;  2YJ7 A;  2TRX A;  5CRE A;  1EEJ A;  3DWV A;  3ZFL A;  1AXD A;  2L4C A;  1TDI A;  1O6J A;  2LJA A;  3QFA C;  20GS A;  4AGS A;  3A2W A;  3EYT A;  4IVF A;  4PNF A;  3TKS E;  4J2F A;  3RPN A;  3ME8 A;  1ILO A;  3IXR A;  3BOA A;  5DAK A;  2IJY A;  3LYK A;  2VLU A;  2REM A;  4K1F A;  4OD7 A;  4EDZ A;  3LSZ A;  1TJD A;  1SJZ A;  1A2L A;  1UC7 A;  1XW9 A;  4NWY A;  4FYU A;  3E9J B;  2BMX A;  2IN3 A;  1K0D A;  1TRS A;  2HXK A;  2I1U A;  1TXX A;  2H30 A;  3IDV A;  4MA9 A;  5AN1 A;  3H8Q A;  3HJP A;  3TUE A;  2ON7 A;  2QSI A;  5HR0 A;  5L71 A;  2FWH A;  5CO3 A;  4OFM A;  2A2S A;  1Q98 A;  1FOV A;  4ZL9 A;  2VL2 C;  2BJX A;  2H1D A;  4MF5 A;  3ZZX A;  1Z9H A;  1UVZ A;  4IP6 A;  5COH A;  3VPQ A;  1WMJ A;  3V1W A;  2YWI A;  2YNX A;  1ZYE A;  5ID2 B;  1ZYQ B;  1XVQ A;  1V98 A;  1GSU A;  3UJ1 A;  3UBK A;  3VWV A;  4OCE A;  3F6D A;  2C1Y A;  1GWC A;  5KN0 A;  4KA0 A;  1R7H A;  2RM5 A;  3QCP A;  1BED A;  4HZ2 A;  2VO4 A;  3ISO A;  2TRC P;  3TCO A;  3KMO A;  5G5F A;  1G7E A;  3BJ5 A;  3LFL A;  2CAI A;  2I9H A;  3RBT A;  3D5J A;  3FR6 A;  1XOA A;  1M2B A;  5J41 A;  1FVJ A;  3IE3 A;  2O7K A;  1QXH A;  3KP8 A;  5D93 A;  2H73 A;  3UBL A;  4V1A g;  5ECR B;  2IFQ A;  4TN8 A;  2Z9S A;  3L0H A;  4RI6 A;  2RUE A;  4MJA A;  2K8V A;  1THO A;  3ZVJ D;  1WE0 A;  3HVV A;  4ECJ A;  1BG5 A;  3IBH A;  3NZN A;  4XIH A;  4IJ3 A;  5CNW A;  2IIY A;  4ZL8 A;  4J56 E;  1F37 A;  3M0F A;  2CX3 A;  1KEB A;  3ZVJ A;  1XWC A;  2V2G A;  2DMM A;  5DAL A;  1K3O A;  3EWL A;  1OAZ A;  2CZ2 A;  1AW9 A;  2DJ0 A;  3WT1 A;  3CRU A;  3EUR A;  4JZQ A;  3CMI A;  4DEJ A;  4NV5 A;  1DE2 A;  2F51 A;  3A2X A;  2OE3 A;  2V6O A;  2H0H A;  2RM6 A;  5ABR A;  4PUA A;  4OO5 A;  2C80 A;  2R37 A;  3FZ4 A;  1OE7 A;  1W4V A;  5JCU A;  1FHE A;  2M72 A;  4IP1 A;  2IMI A;  1IYI A;  2P5R A;  1X0R A;  1ERW A;  4GF0 A;  3W8J A;  1O8W A;  4KDU A;  4MJE A;  1WJK A;  5IOX A;  5B6M A;  3GIX A;  5A4U A;  5AGY A;  4IW9 A;  5F07 A;  4K7N A;  4G0I A;  3FR3 A;  4Q5N A;  1GL8 A;  3UEM A;  5G1L A;  2LTK A;  3FZ5 A;  3QAV A;  4PQH A;  2LST A;  5EY6 A;  4OFT A;  2RII A;  3UL3 A;  4MZC A;  3ZIJ A;  5A4W A;  5DJL A;  2GSS A;  3LXZ A;  1EV4 A;  2H6X A;  3DML A;  1LJR A;  4LLR A;  2FNO A;  1T4Z A;  4CDO A;  5A5K A;  2ALB A;  2FWG A;  1T00 A;  3G7Y A;  4F82 A;  2HQT A;  1SL0 B;  2CZ3 A;  2GDR A;  1A0R P;  1AQV A;  4K2D A;  2X99 A;  2OAD A;  4O92 A;  4MZB A;  3M1G A;  1Z7R A;  11GS A;  3HJM A;  2GZZ A;  4Q5R A;  1FVK A;  2L6C A;  2QGV A;  1GUM A;  18GS A;  3F4R A;  1FO5 A;  1NW2 A;  2PGT A;  3MDK A;  3D4T A;  2MMA A;  4WBR D;  2CV4 A;  1BYE A;  1MD3 A;  1WIK A;  3APO A;  2C3T A;  1MTC A;  4IQ1 A;  1VF1 A;  3S9F A;  4I2U A;  2C3N A;  4MJB A;  2HSY A;  5FWG A;  2B7J A;  5G30 A;  2GSR A;  3M8N A;  1RW1 A;  1EEM A;  2E2M A;  2YWM A;  3HDC A;  1OC3 A;  4XTS A;  1X9S B;  1K0M A;  3F4T A;  2IMF A;  4OWY A;  4NPB A;  1ZL9 A;  2R4V A;  1HQO A;  3KMN A;  1ZOF A;  3IAM 2;  1XWK A;  2VIM A;  1F3A A;  1QMV A;  3WD6 A;  3J7Y k;  2MMZ A;  2H71 A;  3GV1 A;  4ZIJ A;  2JZS A;  3KCM A;  4XS4 A;  1I9D A;  1EGR A;  5F8B A;  4JR4 A;  3L9V A;  3CSI A;  3LQ7 A;  1XVW A;  1AQW A;  4PNG A;  1U6T A;  1AIU A;  2B1K A;  2JAC A;  4N0Z A;  3VFI A;  2WDU A;  5F05 A;  2I81 A;  5IOW A;  2C0G A;  4BVY B;  4KAE A;  2GS3 A;  2WUL A;  5ENU A;  4X43 A;  1TW9 A;  1A0F A;  1ST9 A;  2YV7 A;  2C8U A;  1NHY A;  1PL2 A;  3TDG A;  4MMM A;  4MJC A;  2YV9 A;  2H74 A;  3KGK A;  1NM3 A;  2DJ2 A;  2L6D A;  2VL3 A;  2L57 A;  2M80 A;  3HCZ A;  3LXT A;  2C4J A;  2LJK A;  2OJL A;  1G0T A;  4X0X A;  2B6M A;  1M9A A; 
#chains in the Genus database with same CATH topology
 3DVX A;  3QPM A;  4WET A;  2V1M A;  5KN2 A;  3IOS A;  5ECH B;  3VWW A;  4LMW A;  1XIY A;  2E7P A;  5HR3 A;  2J23 A;  4MZW A;  2OE0 A;  1TRW A;  2N5A A;  5H5Q A;  1Z6N A;  4BIK A;  3TOU A;  4ICY A;  1U3I A;  3EIN A;  1JZW A;  3F4S A;  3F6F A;  3TRP A;  3TRX A;  3EE2 A;  1B9X C;  1GUK A;  3APQ A;  4KE3 A;  1VF4 A;  3EU3 A;  2X8H A;  3ZIT A;  3LG6 A;  4BL7 A;  1YDK A;  1V57 A;  3SWL A;  4K8M A;  2VCZ A;  1XXU A;  1X9M B;  3C73 A;  1YF0 A;  4PHZ C;  1H75 A;  2OA7 A;  2IL3 A;  3QAW A;  4JE1 A;  3MNG A;  4KND A;  3L9S A;  2X8C A;  4X1U A;  1T8E B;  2ES7 A;  1S3C A;  2XBQ A;  4EXJ A;  1F9M A;  4HU7 A;  1B48 A;  3CHX C;  4MK3 A;  4EKZ A;  2V32 A;  4ILF A;  3Q19 A;  1TKD B;  5D9V A;  2H1B A;  2PU9 C;  4RI7 A;  2JZR A;  1F2E A;  2DBC A;  2B7K A;  1SL2 B;  2H75 A;  3IC8 A;  5J47 A;  4TOP A;  3LEF A;  1YY7 A;  3TKP A;  2CVB A;  3KJY A;  3KIJ A;  2ZUP A;  3E3E A;  1SD8 A;  4FH8 A;  1VRS D;  2H19 A;  2FLS A;  3EVI A;  7GSS A;  2LS5 A;  2WZS A;  3Q6O A;  2H76 A;  2H1G A;  4ISD A;  4CY8 A;  3VK9 A;  2WB9 A;  5JWR B;  1OKT A;  1N25 A;  1WWJ A;  5J3R A;  2XC2 A;  2LJR A;  3GL3 A;  3HHV A;  3O76 A;  1J0F A;  3M9K A;  1QQ2 A;  1O73 A;  19GS A;  2B1L A;  5DQY A;  5A5H B;  1PMT A;  1R5A A;  4PX1 A;  4G0K A;  2VLT A;  2HZE A;  1BX9 A;  4DSQ A;  2FGX A;  5G5E A;  5E59 A;  4K0G A;  2YZH A;  4EIP A;  4O5R A;  4G2E A;  3FEU A;  4BWQ A;  3LWA A;  5EPF A;  4IGJ A;  4ZB9 A;  4HS1 A;  5AIX A;  4GRF A;  2L5O A;  3HZ4 A;  3P7X A;  2F8F A;  1FG4 A;  1XG8 A;  4ZBA A;  3UVH A;  1OKD A;  4Z2T A;  5J4V A;  6GSY A;  3KD0 A;  3G9B A;  1TK0 B;  1YEX A;  2YN1 A;  5DDL A;  2IME A;  4HU9 A;  3GX0 A;  2HFD A;  4D73 B;  4BVX A;  3WGD A;  5J4U A;  3PH9 A;  3HVX A;  1XCC A;  2YWN A;  1M7T A;  4GST A;  2KP2 A;  2YP6 A;  5DBQ A;  4NV2 A;  3O6T A;  2DKH A;  2OBI A;  1SK2 A;  2WZ9 A;  1ZGN A;  2HRN A;  1B9Y C;  4ZBB A;  1SL1 B;  6GSV A;  2VUP A;  2GST A;  3IHG A;  5KN3 A;  3ERG A;  5ECL B;  2H0G A;  2O5V A;  4TXO B;  2R5G A;  4L5L A;  1C72 A;  3FZA A;  3GNJ A;  3DKS A;  8GSS A;  4KH7 A;  1TRV A;  2B5Y A;  1G7O A;  4YAV A;  4HQS A;  1USB A;  2CA8 A;  3FR9 A;  4N3Z A;  3C71 A;  2GZP A;  1FAA A;  1SKW B;  4HDE A;  2HLS A;  3KTB A;  1T4Y A;  3IAS 2;  2GZY A;  2L4Q A;  4LL1 B;  3HKR A;  3HY2 A;  1PN9 A;  3NIV A;  5AIV A;  1EGO A;  1DBY A;  3CYN A;  3VWU A;  3GST A;  3VPT A;  1TXU A;  3H93 A;  1M9B A;  3ZYW A;  3UIW A;  2NPB A;  5IMV A;  5J9C A;  4POL A;  3PPU A;  4F03 A;  3TGZ A;  5CRW A;  1PN0 A;  1T7P B;  2HZF A;  3F8U A;  3RDW A;  5D9X A;  2LV3 A;  4ZB8 A;  3FW2 A;  1TI1 A;  1PRX A;  4POM A;  2DJ1 A;  2O85 A;  3GH6 A;  1PL1 A;  3GTU B;  2VKZ G;  2BTO T;  5B8B A;  1XW5 A;  3LW9 A;  3VWX A;  1BAY A;  1PX6 A;  4PUR A;  1DSB A;  1GSD A;  2N5F A;  4O32 A;  5FHI A;  2R6K A;  3CQF A;  3TB2 A;  1V2A A;  1BQ7 A;  1M2A A;  2OE1 A;  5IMD A;  2B5E A;  5GAP D;  5HQP A;  5AIS A;  4RQX A;  4IBP A;  2GTU A;  1F3B A;  4KDX A;  5F0G A;  3ZTL A;  2AHE A;  1HD2 A;  3WGX A;  1EWX A;  5ECQ B;  1HYU A;  2YCD A;  3WT2 A;  1HNA A;  2VLV A;  4ECI A;  4TW5 A;  3P90 A;  1S4B P;  2I3Y A;  1I5G A;  1YQ1 A;  2J9H A;  3L4N A;  1G6W A;  4QMK A;  4I5Q A;  4HI7 A;  3FY7 A;  1WPI A;  1OC9 A;  4TXV A;  4EF0 A;  2PBJ A;  4NMU A;  4KF9 A;  4EVM A;  2CT6 A;  4Z2U A;  1THX A;  4GDF A;  2RLI A;  2EFH A;  3TU3 B;  1M0U A;  2NBS A;  1AAZ A;  2FUG 2;  1YF1 A;  2DKI A;  3FK8 A;  3TJG A;  1Y6E A;  2DML A;  3PGT A;  3GHA A;  3FZ9 A;  3HYP A;  3GKX A;  2PVO C;  3N5O A;  5HFG A;  2FD3 A;  2QA1 A;  1S3D A;  1R5P A;  1GUL A;  1ZZY A;  3MIX A;  9GSS A;  3WGE A;  4MP4 A;  1HNB A;  4IQA A;  4K7I A;  2YZU A;  3GYK A;  1O81 A;  1GUH A;  1LU4 A;  3D22 A;  2WVX B;  5ELG A;  5JWQ B;  1OC8 A;  2DJJ A;  3HZ8 A;  2UV8 G;  2HSM A;  1B4P A;  4XHM A;  4KW6 A;  5DJM A;  4DSS A;  5DAK B;  2B3S A;  3M9J A;  4AF2 A;  3TKS A;  1GTI A;  5LCZ A;  2HI7 A;  3GN3 A;  3BD2 A;  4HJM A;  3IR4 A;  3AY8 A;  2HRF A;  2CX4 A;  3TRQ A;  5INY A;  4P3Y B;  2I4A A;  2KP1 A;  3FKF A;  2L5L A;  4AKX B;  3P2A A;  3JCM L;  3GX8 A;  4TR0 A;  3GFK A;  2MYG A;  1U88 A;  2H8L A;  4N10 A;  3HVS A;  1UN2 A;  5GST A;  1OYJ A;  2LEG A;  2O36 A;  5D9T A;  5FT3 A;  3M3M A;  4MDC A;  1ABA A;  4TR1 A;  2C3Q A;  3ZML A;  4ULX A;  2VL2 A;  1SJI A;  1QGV A;  3CBU A;  5IIZ A;  5CP1 A;  2KLX A;  16GS A;  1YZX A;  4MCU A;  2OT3 A;  1T3B A;  2IMK A;  5H5R A;  1M2D A;  5EL8 A;  4POK A;  2H6Y A;  1GNE A;  4E68 A;  3GL5 A;  2O87 A;  2VM2 A;  2HE3 A;  3NOF A;  4TVE A;  2MMO A;  1JFU A;  5ECS A;  2EIO A;  2JSZ A;  2CVD A;  2VCQ A;  5A34 A;  4AJ8 A;  1EV9 A;  4YAP A;  1SEN A;  5A4V A;  5KN1 A;  1KNG A;  5BMU A;  3DXB A;  2F3M A;  1TTZ A;  1N2A A;  4WF5 A;  1YEP A;  1RQM A;  3DIE A;  3ZFB A;  2VOC A;  1O7U A;  3PR8 A;  2WJU A;  4YH2 A;  5H5S A;  4AI6 A;  1SD9 A;  2IFQ B;  3I9V 2;  2MMN A;  5CAX A;  1XWA A;  4YQM A;  3KEB A;  1XWB A;  4K2X A;  3D4M A;  2QKE A;  4CHS A;  2VM1 A;  2WVZ A;  5IQY A;  1ERU A;  2YPM A;  3DGQ A;  2K8S A;  3A2V A;  5G1K A;  5ECO B;  14GS A;  4K9Z A;  4QQ7 A;  4IS0 A;  2HSN B;  1FB6 A;  5ECP B;  3W8S A;  1N8J A;  4MH3 A;  2AJQ B;  2MBT A;  4F9Z A;  4WR4 A;  5DAL B;  3H4K A;  4MNN A;  3K8N A;  5LD0 A;  3HXS A;  2PPT A;  5B8A A;  3CTF A;  5ID2 A;  2WW3 A;  2VAF A;  5DCH A;  5E4W A;  4E8H A;  1EP7 A;  1J08 A;  3F0I A;  4HEA 2;  4GQF A;  3ZMK A;  2O89 A;  5CRH A;  3GMF A;  2IPA A;  1TP9 A;  2NTO A;  2CVK A;  1PSQ A;  1ZCP A;  1S3A A;  4G0L A;  2H01 A;  3I43 A;  3BBY A;  3ERF A;  4ACS A;  3TJF A;  1SVL A;  1K0O A;  2VCT A;  2QC7 A;  4POB A;  4XS6 A;  4TKY A;  2A2R A;  2K18 A;  1SK0 A;  3QDN A;  4KGI A;  4RQR A;  4LL4 B;  2AB6 A;  4FQU A;  3EMP A;  2OKA A;  10GS A;  2H72 A;  4KB3 A;  1EOG A;  3A5I A;  1K0N A;  4OO4 A;  3BCK A;  3I69 A;  4KX4 A;  4KUN A;  1V9W A;  1GSF A;  2KHP A;  1X5E A;  2A4V A;  4JU5 A;  2ZNM A;  5GZZ B;  3IRA A;  1K0C A;  4LMV A;  2LUS A;  3CTG A;  1GSQ A;  4MAB A;  1G6Y A;  3RGB C;  1CQH A;  4XRA A;  4EUY A;  1MDK A;  4V2L A;  1JLW A;  1VF3 A;  3Q18 A;  2H6Z A;  4FYB A;  4MLY A;  1PD2 1;  3R2Q A;  2HT9 A;  1X9W B;  3ED3 A;  3KH7 A;  1Y1U A;  5GAN D;  5G31 A;  3U6V A;  2VCV A;  4TR4 A;  4GQC A;  4G19 A;  13GS A;  1OVN A;  1B8X A;  2F8A A;  2F9S A;  3LYP A;  3UMA A;  2GQL A;  3TOT A;  2YOI A;  3L78 A;  3RHC A;  2FWF A;  2G0F A;  2VD1 A;  4EE0 A;  3UAP A;  4KDY A;  2ZCT A;  1PKZ A;  3CXG A;  3CWG A;  1WP0 A;  4XS4 B;  1XW6 A;  3CSJ A;  5D96 A;  2O8V B;  1K0A A;  3C1S A;  3IHQ A;  1KBN A;  3GKN A;  3ERW A;  4J57 E;  3C8E A;  4DSR A;  3IPZ A;  2H1L A;  2XPD A;  12GS A;  4L8E A;  5CYY A;  4F0B A;  2DC5 A;  3TKS C;  1PFO A;  3IV4 A;  3N9J A;  1PX7 A;  1K3L A;  4ML6 A;  3IK9 A;  2DJK A;  3F63 A;  2K6V A;  2M46 A;  4K0N A;  5A1N A;  4HJ2 A;  1ERT A;  1U87 A;  1Z6M A;  2A2P A;  1UA5 A;  6GSW A;  2HRK B;  2AV4 A;  4BA7 A;  4ZXG A;  2JSY A;  1DUG A;  3GA4 A;  3MYD A;  5D9W A;  2LRN A;  5IPH A;  2LNT A;  3LOR A;  1BF5 A;  4EC0 A;  2WW2 A;  3IK7 A;  5HR1 A;  2V41 A;  2LNS A;  5CRD A;  4Z2R A;  5DVB A;  3ME7 A;  4NHZ A;  3MAK A;  5C00 A;  4PXO A;  1E2Y A;  4F0C A;  1SKR B;  5G2Z A;  4JBB A;  3A5W A;  1PQN A;  1JZD A;  1MEK A;  3WYW A;  4AKH A;  4HOJ A;  2PER A;  3BCI A;  1Y25 A;  1A24 A;  5IMA A;  2N5B A;  3LGC A;  2H66 A;  4YQU A;  1A2J A;  2LRC A;  3PIN A;  3H79 A;  4KCA A;  2DJ3 A;  2GT5 A;  3FYG A;  4GWR A;  4BL7 B;  4OCF A;  3HVN A;  4JED A;  3RHB A;  2L59 A;  3ZIV A;  2LKU A;  1SK1 A;  3GRX A;  5GSS A;  2GSQ A;  4QL9 A;  1K3Y A;  4BVY A;  3D21 A;  4QL7 A;  3TJK A;  4DVC A;  3QD9 A;  2EFE A;  4MF7 A;  1TI3 A;  4G9H A;  1TRU A;  1SU9 A;  3D6I A;  4ID0 A;  1WOU A;  2LQO A;  4H86 A;  3EC3 A;  1A8Y A;  1GP1 A;  4N30 A;  4ZL7 A;  5JCW A;  2GVP A;  4I6X A;  4LA1 A;  1T1V A;  4O7H A;  4PGT A;  4K6X A;  1DE1 A;  4FXY P;  1QUW A;  2AUV A;  1YEW C;  2YWO A;  2JL4 A;  1GRX A;  3SBC A;  2H0I A;  4KSM A;  4CW9 A;  4GSN A;  5J5N A;  3VI5 A;  2R0G A;  5D73 A;  3QMX A;  5J9B A;  1H4O A;  1KTE A;  3UAR A;  1IYH A;  3ZRE A;  3I6A A;  3E0U A;  3EMX A;  4IHU A;  2GQK A;  2XBI A;  2NDO A;  2CAQ A;  1VGL A;  4O5Q A;  2G2Q A;  1SYX A;  3HJO A;  2OBK A;  4BWS A;  3G7I A;  2PVQ A;  3FRC A;  4HUA A;  2HZE B;  3OR5 A;  3RAZ A;  1X5D A;  5IO2 A;  2H1A A;  3FHK A;  3HA9 A;  1QFN A;  4ML1 A;  1XPV A;  3G7J A;  4IEL A;  4L0W A;  2DIY A;  1YKA A;  2KOK A;  3VUR A;  1Q4J A;  2C0D A;  1NSW A;  4JR6 A;  4W66 A;  3F3Q A;  2PN8 A;  4ZBD A;  1V40 A;  4XCS A;  2VL9 A;  1O8X A;  4HZ4 A;  2IMD A;  4IKH A;  2IWT A;  4AKG A;  3DYR A;  4OMV A;  1R4W A;  2P5Q A;  1CQG A;  4HQZ A;  4XS1 A;  4WXT A;  4F2I A;  2WRT A;  1GH2 A;  3U5R E;  3TKR A;  4BVX B;  2FCH A;  1R26 A;  2PUK C;  2ON5 A;  3C1R A;  1LBK A;  2WGR A;  1FB0 A;  1B4Q A;  3UOM A;  1MD4 A;  3CSH A;  2XHF A;  5IMC A;  2EIQ A;  1EP8 A;  1GTB A;  2GGT A;  2WS2 A;  1TU7 A;  4WR5 A;  4MH2 A;  5F06 A;  4ZIL A;  2R2J A;  1V58 A;  2X64 A;  4EIQ A;  4TR3 A;  2V6K A;  1ML6 A;  4WEY A;  4EO3 A;  4ECC A;  5ECN B;  1JHB A;  3KP9 A;  2JU5 A;  5B7C A;  4GTU A;  1A23 A;  4E8E A;  4IN0 A;  5DCG A;  2DIZ A;  3W6G A;  5J40 A;  5A5H A;  3KM6 A;  3GKK A;  2AYT A;  1GLQ A;  5D8I A;  4V1A p;  1XWG A;  4ZB6 A;  2X8G A;  2MBS A;  1F6M C;  1Z3E A;  4AJ6 A;  5IPG A;  4RUV A;  5ECK B;  5ECM B;  1XOB A;  4NAX A;  3QFB C;  1AQX A;  2TIR A;  1TU8 A;  2EIR A;  3HD5 A;  22GS A;  3A3T A;  2D2Z A;  2H70 A;  2EFC A;  2P31 A;  4GLT A;  4ECB A;  2KUC A;  1QK8 A;  3VLN A;  3QAG A;  4XRD A;  4OFN A;  4GXZ A;  5IMZ A;  5C04 A;  4O5U A;  1BG1 A;  2HSH A;  2OAC A;  4TRX A;  3Q74 A;  1YVL A;  1E6B A;  3FMW A;  4K5S A;  1A2M A;  1RK4 A;  4D73 A;  5IM9 A;  5B6N A;  4GCI A;  1JLV A;  1ON4 A;  3EPT A;  3TJJ A;  2LRT A;  1SKS B;  1JZO A;  1A8L A;  1XZO A;  3DEX A;  1OE8 A;  2GT6 A;  4L0U A;  2PMT A;  3HMJ G;  1SJ6 A;  2WW1 A;  4NXI A;  1ZYP A;  3DVW A;  5ELA A;  3TJB A;  4IJI A;  1TOF A;  3LJR A;  1YKC A;  4MF6 A;  3F3R A;  3GUR A;  1Z5Y E;  2WVY A;  3MWH A;  2HRK A;  3ZLP A;  4L5O A;  4TXO A;  3RPP A;  3O3T A;  3H1N A;  2FY6 A;  4JRR A;  3L9U A;  2C0F A;  2PWJ A;  4WKW A;  3KTL A;  3US3 A;  4USS A;  4KSO A;  4PQ1 A;  3EU4 A;  1SVO A;  1ZMA A;  1GSS A;  2YJH A;  3IA1 A;  1X5C A;  3GH9 A;  5LNK e;  2YAN A;  3F9U A;  2E2G A;  4Q5F A;  1GTU A;  4KCE A;  1GLP A;  1TK5 B;  4BPY A;  1OC9 B;  2C0E A;  4I8B A;  3QOU A;  3KXO A;  1U3A A;  3KH9 A;  6GSS A;  3C7M A;  2FA4 A;  1JZR A;  3RFR C;  4X4J A;  2GLR A;  2UZ8 A;  1VF2 A;  1MDJ A;  2E0Q A;  2P0G A;  1PGT A;  1ERV A;  5CRG A;  2B5X A;  2R0P A;  4N0V A;  4I2T A;  1S3R A;  1J9B A;  2CQ9 A;  5JWO B;  2JZT A;  1YJ6 A;  4MPF A;  3GUS A;  3GKM A;  3DD3 A;  4V2N A;  2WFC A;  3UVT A;  3GTU A;  5ECI B;  4K7O A;  2AAW A;  2GQM A;  1URM A;  1MDI A;  4V2M A;  1PA3 A;  4I97 A;  3APS A;  2DSA A;  1W89 A;  3D0Z A;  4MPG A;  1GTA A;  2FHE A;  4GSS A;  2EC4 A;  2HSM B;  6GST A;  3KZQ A;  4PUF C;  2R3X A;  4G10 A;  4PI2 C;  4FIW A;  2VD0 A;  1NHO A;  4PTS A;  5EVO A;  5IO0 A;  4DSS B;  3VI7 A;  3ZRD A;  4ZB7 A;  5HFK A;  2VCX A;  5HFI A;  1GSE A;  2WCI A;  4WBJ A;  2X49 A;  17GS A;  4N11 A;  2XPE A;  4PQI A;  2FWE A;  2VCW A;  1GNW A;  1XBS A;  3CRT A;  3R3E A;  4K5R A;  5DQS A;  2K9F A;  1XFL A;  2JAD A;  3TKQ A;  3ZL5 A;  2MZC A;  1M99 A;  1K0B A;  2A4H A;  5HR2 A;  4AJ7 A;  3J7Y b;  3IC4 A;  3MSZ A;  4Z7X A;  2LQQ A;  1PKW A;  2HYX A;  5IMF A;  1SVM A;  2NVL A;  2RUF A;  4FYC A;  2HNL A;  2FA8 A;  4EDY A;  4EL1 A;  1BJX A;  1FW1 A;  4TR1 B;  1WRY A;  3DRN A;  1AUC A;  4WF4 A;  1AC1 A;  1Z7P A;  2WW0 A;  6GSX A;  3GSS A;  4A5P A;  1ZYN A;  5JCG A;  2DLX A;  4NHW A;  1EZK A;  3P8W A;  6GSU A;  5KEJ A;  1ACV A;  1GSY A;  2HRA A;  2O3E A;  4Q5Q A;  4YQV A;  1HNC A;  1EOH A;  1O85 A;  1TK8 B;  2WVX A;  4FO5 A;  1SYR A;  5KOW A;  3QR6 A;  2YJ7 A;  2TRX A;  5CRE A;  1EEJ A;  3DWV A;  3ZFL A;  1AXD A;  2L4C A;  1TDI A;  1O6J A;  2LJA A;  3QFA C;  20GS A;  4AGS A;  3A2W A;  3EYT A;  5A34 B;  4IVF A;  4PNF A;  3TKS E;  5BMU B;  4J2F A;  3RPN A;  3ME8 A;  1ILO A;  4G01 A;  3IXR A;  3BOA A;  5DAK A;  2IJY A;  3LYK A;  4HSC X;  2VLU A;  2REM A;  4K1F A;  1I1I P;  4OD7 A;  4EDZ A;  3LSZ A;  1TJD A;  1SJZ A;  1A2L A;  1UC7 A;  1XW9 A;  4NWY A;  4FYU A;  1M3I A;  3E9J B;  2BMX A;  2IN3 A;  1K0D A;  1TRS A;  2HXK A;  2I1U A;  1TXX A;  2H30 A;  3IDV A;  4MA9 A;  5AN1 A;  3H8Q A;  3HJP A;  3TUE A;  2ON7 A;  2QSI A;  5HR0 A;  5L71 A;  2FWH A;  5CO3 A;  4OFM A;  2A2S A;  1Q98 A;  1FOV A;  4ZL9 A;  2VL2 C;  2BJX A;  2H1D A;  4MF5 A;  3ZZX A;  1Z9H A;  1UVZ A;  4IP6 A;  5COH A;  3VPQ A;  1WMJ A;  3V1W A;  2YWI A;  2YNX A;  1ZYE A;  4YKF A;  5ID2 B;  1ZYQ B;  1XVQ A;  1V98 A;  1GSU A;  3UJ1 A;  3UBK A;  3VWV A;  4OCE A;  3F6D A;  2C1Y A;  1GWC A;  5KOX A;  5KN0 A;  4KA0 A;  1R7H A;  2RM5 A;  3QCP A;  1BED A;  4HZ2 A;  2VO4 A;  3ISO A;  2TRC P;  3TCO A;  3KMO A;  5G5F A;  1G7E A;  3BJ5 A;  3LFL A;  2CAI A;  2I9H A;  3RBT A;  3D5J A;  3FR6 A;  1XOA A;  1M2B A;  5J41 A;  1FVJ A;  3IE3 A;  2O7K A;  1QXH A;  3KP8 A;  5D93 A;  2H73 A;  3UBL A;  4V1A g;  5ECR B;  2IFQ A;  4TN8 A;  2Z9S A;  3L0H A;  4RI6 A;  2RUE A;  4MJA A;  2K8V A;  1THO A;  3ZVJ D;  1WE0 A;  3HVV A;  4ECJ A;  4YKG A;  1BG5 A;  3IBH A;  3NZN A;  4XIH A;  4IJ3 A;  5CNW A;  2IIY A;  2HSN A;  4ZL8 A;  4J56 E;  1M3J A;  1F37 A;  3M0F A;  2CX3 A;  1KEB A;  3ZVJ A;  1XWC A;  2V2G A;  2DMM A;  5DAL A;  1K3O A;  3EWL A;  1OAZ A;  2CZ2 A;  1AW9 A;  2DJ0 A;  3WT1 A;  3CRU A;  3EUR A;  4JZQ A;  3CMI A;  4DEJ A;  4NV5 A;  2X4A A;  1DE2 A;  2F51 A;  3A2X A;  2OE3 A;  2V6O A;  2H0H A;  2RM6 A;  5ABR A;  4PUA A;  4OO5 A;  2C80 A;  2R37 A;  3FZ4 A;  1OE7 A;  1W4V A;  5JCU A;  1FHE A;  2M72 A;  4IP1 A;  2IMI A;  1IYI A;  2P5R A;  1X0R A;  1ERW A;  4GF0 A;  3W8J A;  1O8W A;  4KDU A;  4MJE A;  1WJK A;  2EFD A;  5B6M A;  5IOX A;  3GIX A;  5A4U A;  5AGY A;  4IW9 A;  5F07 A;  4K7N A;  4G0I A;  3FR3 A;  4Q5N A;  1GL8 A;  3UEM A;  5G1L A;  2LTK A;  3FZ5 A;  3QAV A;  4PQH A;  2LST A;  5EY6 A;  4OFT A;  2RII A;  3UL3 A;  4MZC A;  3ZIJ A;  5A4W A;  4AKI A;  5DJL A;  2GSS A;  3LXZ A;  1EV4 A;  2H6X A;  3DML A;  1LJR A;  4LLR A;  2FNO A;  1T4Z A;  4CDO A;  5A5K A;  2ALB A;  2FWG A;  1T00 A;  3G7Y A;  4F82 A;  2HQT A;  1SL0 B;  2CZ3 A;  2GDR A;  1A0R P;  1AQV A;  4K2D A;  5A1N B;  2X99 A;  2OAD A;  4O92 A;  4MZB A;  3M1G A;  1Z7R A;  11GS A;  3HJM A;  2GZZ A;  4Q5R A;  1FVK A;  2L6C A;  2QGV A;  1GUM A;  18GS A;  3F4R A;  1FO5 A;  1NW2 A;  2PGT A;  3MDK A;  3D4T A;  2MMA A;  4WBR D;  2CV4 A;  1BYE A;  1MD3 A;  1WIK A;  3APO A;  2C3T A;  1MTC A;  4IQ1 A;  1VF1 A;  5BRT A;  3S9F A;  4I2U A;  2C3N A;  4MJB A;  2HSY A;  5FWG A;  2B7J A;  5G30 A;  2GSR A;  3M8N A;  1RW1 A;  1EEM A;  2E2M A;  4CY6 A;  2YWM A;  3HDC A;  1OC3 A;  4XTS A;  1X9S B;  1K0M A;  3F4T A;  2IMF A;  4OWY A;  4NPB A;  1ZL9 A;  2R4V A;  1HQO A;  3KMN A;  1ZOF A;  3IAM 2;  1XWK A;  2VIM A;  1F3A A;  1QMV A;  3WD6 A;  4PI0 C;  3J7Y k;  2MMZ A;  2H71 A;  3GV1 A;  4ZIJ A;  2JZS A;  3KCM A;  4XS4 A;  1I9D A;  1EGR A;  5F8B A;  4JR4 A;  3L9V A;  3CSI A;  2R0C A;  3LQ7 A;  2QA2 A;  1XVW A;  1AQW A;  4PNG A;  1U6T A;  1AIU A;  2B1K A;  2JAC A;  4N0Z A;  3VFI A;  2WDU A;  5F05 A;  2I81 A;  5IOW A;  2C0G A;  4BVY B;  4KAE A;  2GS3 A;  2WUL A;  5ENU A;  4X43 A;  1TW9 A;  1A0F A;  1ST9 A;  2YV7 A;  2C8U A;  5J4Y A;  1NHY A;  1PL2 A;  3TDG A;  4MMM A;  4MJC A;  2YV9 A;  2H74 A;  3KGK A;  1NM3 A;  2DJ2 A;  2L6D A;  2VL3 A;  2L57 A;  2M80 A;  3HCZ A;  3LXT A;  2C4J A;  2LJK A;  2OJL A;  1FOH A;  1G0T A;  4X0X A;  2B6M A;  1M9A A; 
#chains in the Genus database with same CATH homology
 3DVX A;  3QPM A;  4WET A;  2V1M A;  5KN2 A;  3IOS A;  5ECH B;  3VWW A;  4LMW A;  1XIY A;  2E7P A;  5HR3 A;  2J23 A;  4MZW A;  2OE0 A;  1TRW A;  2N5A A;  5H5Q A;  1Z6N A;  3TOU A;  4ICY A;  1U3I A;  3EIN A;  1JZW A;  3F4S A;  3F6F A;  3TRP A;  3TRX A;  3EE2 A;  1B9X C;  1GUK A;  3APQ A;  4KE3 A;  1VF4 A;  3EU3 A;  2X8H A;  3ZIT A;  3LG6 A;  4BL7 A;  1YDK A;  1V57 A;  3SWL A;  4K8M A;  2VCZ A;  1XXU A;  1X9M B;  3C73 A;  1YF0 A;  1H75 A;  2OA7 A;  2IL3 A;  3QAW A;  4JE1 A;  3MNG A;  4KND A;  3L9S A;  2X8C A;  4X1U A;  1T8E B;  2ES7 A;  1S3C A;  2XBQ A;  4EXJ A;  1F9M A;  4HU7 A;  1B48 A;  4MK3 A;  4EKZ A;  2V32 A;  4ILF A;  3Q19 A;  1TKD B;  5D9V A;  2H1B A;  2PU9 C;  4RI7 A;  2JZR A;  1F2E A;  2DBC A;  2B7K A;  1SL2 B;  2H75 A;  3IC8 A;  5J47 A;  4TOP A;  3LEF A;  1YY7 A;  3TKP A;  2CVB A;  3KJY A;  3KIJ A;  2ZUP A;  3E3E A;  1SD8 A;  4FH8 A;  1VRS D;  2H19 A;  2FLS A;  3EVI A;  7GSS A;  2LS5 A;  3Q6O A;  2H76 A;  2H1G A;  4ISD A;  4CY8 A;  3VK9 A;  2WB9 A;  5JWR B;  1OKT A;  1N25 A;  1WWJ A;  5J3R A;  2XC2 A;  2LJR A;  3GL3 A;  3HHV A;  3O76 A;  1J0F A;  3M9K A;  1QQ2 A;  1O73 A;  19GS A;  2B1L A;  5DQY A;  5A5H B;  1PMT A;  1R5A A;  4PX1 A;  4G0K A;  2VLT A;  2HZE A;  1BX9 A;  4DSQ A;  2FGX A;  5G5E A;  5E59 A;  4K0G A;  2YZH A;  4EIP A;  4O5R A;  4G2E A;  3FEU A;  4BWQ A;  3LWA A;  5EPF A;  4IGJ A;  4ZB9 A;  4HS1 A;  5AIX A;  4GRF A;  2L5O A;  3HZ4 A;  3P7X A;  2F8F A;  1FG4 A;  4ZBA A;  3UVH A;  1OKD A;  4Z2T A;  5J4V A;  6GSY A;  3KD0 A;  3G9B A;  1TK0 B;  1YEX A;  2YN1 A;  5DDL A;  2IME A;  4HU9 A;  3GX0 A;  2HFD A;  4D73 B;  4BVX A;  3WGD A;  5J4U A;  3PH9 A;  3HVX A;  1XCC A;  2YWN A;  1M7T A;  4GST A;  2KP2 A;  2YP6 A;  5DBQ A;  4NV2 A;  3O6T A;  2DKH A;  2OBI A;  1SK2 A;  2WZ9 A;  1ZGN A;  2HRN A;  1B9Y C;  4ZBB A;  1SL1 B;  6GSV A;  2VUP A;  2GST A;  3IHG A;  5KN3 A;  3ERG A;  5ECL B;  2H0G A;  2O5V A;  4TXO B;  2R5G A;  4L5L A;  1C72 A;  3FZA A;  3GNJ A;  3DKS A;  8GSS A;  4KH7 A;  1TRV A;  2B5Y A;  1G7O A;  4YAV A;  4HQS A;  1USB A;  2CA8 A;  3FR9 A;  4N3Z A;  3C71 A;  2GZP A;  1FAA A;  1SKW B;  4HDE A;  2HLS A;  3KTB A;  1T4Y A;  3IAS 2;  2GZY A;  2L4Q A;  4LL1 B;  3HKR A;  3HY2 A;  1PN9 A;  3NIV A;  5AIV A;  1EGO A;  1DBY A;  3CYN A;  3VWU A;  3GST A;  3VPT A;  1TXU A;  3H93 A;  1M9B A;  3ZYW A;  3UIW A;  2NPB A;  5IMV A;  5J9C A;  4POL A;  3PPU A;  4F03 A;  3TGZ A;  5CRW A;  1PN0 A;  1T7P B;  2HZF A;  3F8U A;  3RDW A;  5D9X A;  2LV3 A;  4ZB8 A;  3FW2 A;  1TI1 A;  1PRX A;  4POM A;  2DJ1 A;  2O85 A;  3GH6 A;  1PL1 A;  3GTU B;  2VKZ G;  2BTO T;  5B8B A;  1XW5 A;  3LW9 A;  3VWX A;  1BAY A;  1PX6 A;  4PUR A;  1DSB A;  1GSD A;  2N5F A;  4O32 A;  5FHI A;  2R6K A;  3TB2 A;  1V2A A;  1BQ7 A;  1M2A A;  2OE1 A;  5IMD A;  2B5E A;  5GAP D;  5HQP A;  5AIS A;  4RQX A;  4IBP A;  2GTU A;  1F3B A;  4KDX A;  5F0G A;  3ZTL A;  2AHE A;  1HD2 A;  3WGX A;  1EWX A;  5ECQ B;  1HYU A;  2YCD A;  3WT2 A;  1HNA A;  2VLV A;  4ECI A;  4TW5 A;  3P90 A;  2I3Y A;  1I5G A;  1YQ1 A;  2J9H A;  3L4N A;  1G6W A;  4QMK A;  4I5Q A;  4HI7 A;  3FY7 A;  1WPI A;  1OC9 A;  4TXV A;  4EF0 A;  2PBJ A;  4NMU A;  4KF9 A;  4EVM A;  2CT6 A;  4Z2U A;  1THX A;  4GDF A;  2RLI A;  2EFH A;  3TU3 B;  1M0U A;  2NBS A;  1AAZ A;  2FUG 2;  1YF1 A;  2DKI A;  3FK8 A;  3TJG A;  1Y6E A;  2DML A;  3PGT A;  3GHA A;  3FZ9 A;  3HYP A;  3GKX A;  2PVO C;  3N5O A;  5HFG A;  2FD3 A;  2QA1 A;  1S3D A;  1R5P A;  1GUL A;  1ZZY A;  3MIX A;  9GSS A;  3WGE A;  4MP4 A;  1HNB A;  4IQA A;  4K7I A;  2YZU A;  3GYK A;  1O81 A;  1GUH A;  1LU4 A;  3D22 A;  5ELG A;  5JWQ B;  1OC8 A;  2DJJ A;  3HZ8 A;  2UV8 G;  2HSM A;  1B4P A;  4XHM A;  4KW6 A;  5DJM A;  4DSS A;  5DAK B;  2B3S A;  3M9J A;  4AF2 A;  3TKS A;  1GTI A;  5LCZ A;  2HI7 A;  3GN3 A;  3BD2 A;  4HJM A;  3IR4 A;  3AY8 A;  2HRF A;  2CX4 A;  3TRQ A;  5INY A;  4P3Y B;  2I4A A;  2KP1 A;  3FKF A;  2L5L A;  4AKX B;  3P2A A;  3JCM L;  3GX8 A;  4TR0 A;  3GFK A;  2MYG A;  1U88 A;  2H8L A;  4N10 A;  3HVS A;  1UN2 A;  5GST A;  1OYJ A;  2LEG A;  5D9T A;  5FT3 A;  1ABA A;  3M3M A;  4MDC A;  4TR1 A;  2C3Q A;  3ZML A;  4ULX A;  2VL2 A;  1SJI A;  1QGV A;  3CBU A;  5IIZ A;  5CP1 A;  2KLX A;  16GS A;  1YZX A;  4MCU A;  2OT3 A;  1T3B A;  2IMK A;  5H5R A;  1M2D A;  5EL8 A;  4POK A;  2H6Y A;  1GNE A;  4E68 A;  3GL5 A;  2O87 A;  2VM2 A;  2HE3 A;  3NOF A;  4TVE A;  2MMO A;  1JFU A;  5ECS A;  2EIO A;  2JSZ A;  2CVD A;  2VCQ A;  5A34 A;  4AJ8 A;  1EV9 A;  4YAP A;  1SEN A;  5A4V A;  5KN1 A;  1KNG A;  5BMU A;  3DXB A;  2F3M A;  1TTZ A;  1N2A A;  4WF5 A;  1YEP A;  1RQM A;  3DIE A;  3ZFB A;  2VOC A;  1O7U A;  3PR8 A;  2WJU A;  4YH2 A;  5H5S A;  4AI6 A;  1SD9 A;  2IFQ B;  3I9V 2;  2MMN A;  5CAX A;  1XWA A;  4YQM A;  3KEB A;  1XWB A;  4K2X A;  3D4M A;  2QKE A;  4CHS A;  2VM1 A;  5IQY A;  1ERU A;  2YPM A;  3DGQ A;  2K8S A;  3A2V A;  5G1K A;  5ECO B;  14GS A;  4K9Z A;  4QQ7 A;  4IS0 A;  2HSN B;  1FB6 A;  5ECP B;  3W8S A;  1N8J A;  4MH3 A;  2AJQ B;  2MBT A;  4F9Z A;  4WR4 A;  5DAL B;  3H4K A;  4MNN A;  3K8N A;  5LD0 A;  3HXS A;  2PPT A;  5B8A A;  3CTF A;  5ID2 A;  2VAF A;  5DCH A;  5E4W A;  4E8H A;  1EP7 A;  1J08 A;  3F0I A;  4HEA 2;  4GQF A;  3ZMK A;  2O89 A;  5CRH A;  3GMF A;  2IPA A;  1TP9 A;  2NTO A;  2CVK A;  1PSQ A;  1ZCP A;  1S3A A;  4G0L A;  2H01 A;  3I43 A;  3BBY A;  3ERF A;  4ACS A;  3TJF A;  1SVL A;  1K0O A;  2VCT A;  2QC7 A;  4POB A;  4XS6 A;  4TKY A;  2A2R A;  2K18 A;  1SK0 A;  3QDN A;  4KGI A;  4RQR A;  4LL4 B;  2AB6 A;  4FQU A;  3EMP A;  2OKA A;  10GS A;  2H72 A;  4KB3 A;  1EOG A;  3A5I A;  1K0N A;  4OO4 A;  3BCK A;  3I69 A;  4KX4 A;  4KUN A;  1V9W A;  1GSF A;  2KHP A;  1X5E A;  2A4V A;  4JU5 A;  2ZNM A;  5GZZ B;  3IRA A;  1K0C A;  4LMV A;  2LUS A;  3CTG A;  1GSQ A;  4MAB A;  1G6Y A;  1CQH A;  4XRA A;  4EUY A;  1MDK A;  4V2L A;  1JLW A;  1VF3 A;  3Q18 A;  2H6Z A;  4FYB A;  4MLY A;  1PD2 1;  3R2Q A;  2HT9 A;  1X9W B;  3ED3 A;  3KH7 A;  1Y1U A;  5GAN D;  5G31 A;  3U6V A;  2VCV A;  4TR4 A;  4GQC A;  4G19 A;  13GS A;  1OVN A;  1B8X A;  2F8A A;  2F9S A;  3LYP A;  3UMA A;  2GQL A;  3TOT A;  2YOI A;  3L78 A;  3RHC A;  2FWF A;  2G0F A;  2VD1 A;  4EE0 A;  3UAP A;  4KDY A;  2ZCT A;  1PKZ A;  3CXG A;  3CWG A;  1WP0 A;  4XS4 B;  1XW6 A;  3CSJ A;  5D96 A;  2O8V B;  1K0A A;  3C1S A;  3IHQ A;  1KBN A;  3GKN A;  3ERW A;  4J57 E;  3C8E A;  4DSR A;  3IPZ A;  2H1L A;  2XPD A;  12GS A;  4L8E A;  5CYY A;  4F0B A;  2DC5 A;  3TKS C;  3IV4 A;  3N9J A;  1PX7 A;  1K3L A;  4ML6 A;  3IK9 A;  2DJK A;  3F63 A;  2K6V A;  2M46 A;  4K0N A;  5A1N A;  4HJ2 A;  1ERT A;  1U87 A;  1Z6M A;  2A2P A;  1UA5 A;  6GSW A;  2HRK B;  2AV4 A;  4BA7 A;  4ZXG A;  2JSY A;  1DUG A;  3GA4 A;  3MYD A;  5D9W A;  2LRN A;  5IPH A;  2LNT A;  3LOR A;  1BF5 A;  4EC0 A;  3IK7 A;  5HR1 A;  2V41 A;  2LNS A;  5CRD A;  4Z2R A;  5DVB A;  3ME7 A;  4NHZ A;  3MAK A;  5C00 A;  4PXO A;  1E2Y A;  4F0C A;  1SKR B;  5G2Z A;  4JBB A;  3A5W A;  1PQN A;  1JZD A;  1MEK A;  3WYW A;  4AKH A;  4HOJ A;  2PER A;  3BCI A;  1Y25 A;  1A24 A;  5IMA A;  2N5B A;  3LGC A;  2H66 A;  4YQU A;  1A2J A;  2LRC A;  3PIN A;  3H79 A;  4KCA A;  2DJ3 A;  2GT5 A;  3FYG A;  4GWR A;  4BL7 B;  4OCF A;  4JED A;  3RHB A;  2L59 A;  3ZIV A;  2LKU A;  1SK1 A;  3GRX A;  5GSS A;  2GSQ A;  4QL9 A;  1K3Y A;  4BVY A;  3D21 A;  4QL7 A;  3TJK A;  4DVC A;  3QD9 A;  2EFE A;  4MF7 A;  1TI3 A;  4G9H A;  1TRU A;  1SU9 A;  3D6I A;  4ID0 A;  1WOU A;  2LQO A;  4H86 A;  3EC3 A;  1A8Y A;  1GP1 A;  4N30 A;  4ZL7 A;  5JCW A;  2GVP A;  4I6X A;  4LA1 A;  1T1V A;  4O7H A;  4PGT A;  4K6X A;  1DE1 A;  1QUW A;  2AUV A;  2YWO A;  2JL4 A;  1GRX A;  3SBC A;  2H0I A;  4KSM A;  4CW9 A;  4GSN A;  5J5N A;  3VI5 A;  2R0G A;  5D73 A;  3QMX A;  5J9B A;  1H4O A;  1KTE A;  3UAR A;  1IYH A;  3ZRE A;  3I6A A;  3E0U A;  3EMX A;  4IHU A;  2GQK A;  2XBI A;  2NDO A;  2CAQ A;  1VGL A;  4O5Q A;  2G2Q A;  1SYX A;  3HJO A;  2OBK A;  4BWS A;  3G7I A;  2PVQ A;  3FRC A;  4HUA A;  2HZE B;  3OR5 A;  3RAZ A;  1X5D A;  5IO2 A;  2H1A A;  3FHK A;  3HA9 A;  1QFN A;  4ML1 A;  1XPV A;  3G7J A;  4IEL A;  4L0W A;  2DIY A;  1YKA A;  2KOK A;  3VUR A;  1Q4J A;  2C0D A;  1NSW A;  4JR6 A;  4W66 A;  3F3Q A;  2PN8 A;  4ZBD A;  1V40 A;  4XCS A;  2VL9 A;  1O8X A;  4HZ4 A;  2IMD A;  4IKH A;  2IWT A;  4AKG A;  3DYR A;  4OMV A;  1R4W A;  2P5Q A;  1CQG A;  4HQZ A;  4XS1 A;  4WXT A;  4F2I A;  2WRT A;  1GH2 A;  3U5R E;  3TKR A;  4BVX B;  2FCH A;  1R26 A;  2PUK C;  2ON5 A;  3C1R A;  1LBK A;  2WGR A;  1FB0 A;  1B4Q A;  3UOM A;  1MD4 A;  3CSH A;  2XHF A;  5IMC A;  2EIQ A;  1EP8 A;  1GTB A;  2GGT A;  2WS2 A;  1TU7 A;  4WR5 A;  4MH2 A;  5F06 A;  4ZIL A;  2R2J A;  1V58 A;  2X64 A;  4EIQ A;  4TR3 A;  2V6K A;  1ML6 A;  4WEY A;  4EO3 A;  4ECC A;  5ECN B;  1JHB A;  3KP9 A;  2JU5 A;  5B7C A;  4GTU A;  1A23 A;  4E8E A;  4IN0 A;  5DCG A;  2DIZ A;  3W6G A;  5J40 A;  5A5H A;  3KM6 A;  3GKK A;  2AYT A;  1GLQ A;  5D8I A;  4V1A p;  1XWG A;  4ZB6 A;  2X8G A;  2MBS A;  1F6M C;  1Z3E A;  4AJ6 A;  5IPG A;  4RUV A;  5ECK B;  5ECM B;  1XOB A;  4NAX A;  3QFB C;  1AQX A;  2TIR A;  1TU8 A;  2EIR A;  3HD5 A;  22GS A;  3A3T A;  2D2Z A;  2H70 A;  2EFC A;  2P31 A;  4GLT A;  4ECB A;  2KUC A;  1QK8 A;  3VLN A;  3QAG A;  4XRD A;  4OFN A;  4GXZ A;  5IMZ A;  5C04 A;  4O5U A;  1BG1 A;  2HSH A;  2OAC A;  4TRX A;  3Q74 A;  1YVL A;  1E6B A;  3FMW A;  4K5S A;  1A2M A;  1RK4 A;  4D73 A;  5IM9 A;  5B6N A;  4GCI A;  1JLV A;  1ON4 A;  3EPT A;  3TJJ A;  2LRT A;  1SKS B;  1JZO A;  1A8L A;  1XZO A;  3DEX A;  1OE8 A;  2GT6 A;  4L0U A;  2PMT A;  3HMJ G;  1SJ6 A;  4NXI A;  1ZYP A;  3DVW A;  5ELA A;  3TJB A;  4IJI A;  1TOF A;  3LJR A;  1YKC A;  4MF6 A;  3F3R A;  3GUR A;  1Z5Y E;  3MWH A;  2HRK A;  3ZLP A;  4L5O A;  4TXO A;  3RPP A;  3O3T A;  3H1N A;  2FY6 A;  4JRR A;  3L9U A;  2C0F A;  2PWJ A;  4WKW A;  3KTL A;  3US3 A;  4USS A;  4KSO A;  4PQ1 A;  3EU4 A;  1SVO A;  1ZMA A;  1GSS A;  2YJH A;  3IA1 A;  1X5C A;  3GH9 A;  5LNK e;  2YAN A;  3F9U A;  2E2G A;  4Q5F A;  1GTU A;  4KCE A;  1GLP A;  1TK5 B;  4BPY A;  1OC9 B;  2C0E A;  4I8B A;  3QOU A;  3KXO A;  1U3A A;  3KH9 A;  6GSS A;  3C7M A;  2FA4 A;  1JZR A;  4X4J A;  2GLR A;  2UZ8 A;  1VF2 A;  1MDJ A;  2E0Q A;  2P0G A;  1PGT A;  1ERV A;  5CRG A;  2B5X A;  2R0P A;  4N0V A;  4I2T A;  1J9B A;  2CQ9 A;  5JWO B;  2JZT A;  1YJ6 A;  4MPF A;  3GUS A;  3GKM A;  3DD3 A;  4V2N A;  2WFC A;  3UVT A;  3GTU A;  5ECI B;  4K7O A;  2AAW A;  2GQM A;  1URM A;  1MDI A;  4V2M A;  1PA3 A;  4I97 A;  3APS A;  2DSA A;  1W89 A;  3D0Z A;  4MPG A;  1GTA A;  2FHE A;  4GSS A;  2EC4 A;  2HSM B;  6GST A;  3KZQ A;  4PUF C;  2R3X A;  4G10 A;  4FIW A;  2VD0 A;  1NHO A;  4PTS A;  5EVO A;  5IO0 A;  4DSS B;  3VI7 A;  3ZRD A;  4ZB7 A;  5HFK A;  2VCX A;  5HFI A;  1GSE A;  2WCI A;  4WBJ A;  2X49 A;  17GS A;  4N11 A;  2XPE A;  4PQI A;  2FWE A;  2VCW A;  1GNW A;  1XBS A;  3CRT A;  3R3E A;  4K5R A;  5DQS A;  2K9F A;  1XFL A;  2JAD A;  3TKQ A;  3ZL5 A;  2MZC A;  1M99 A;  1K0B A;  2A4H A;  5HR2 A;  4AJ7 A;  3J7Y b;  3IC4 A;  3MSZ A;  4Z7X A;  2LQQ A;  1PKW A;  2HYX A;  5IMF A;  1SVM A;  2NVL A;  2RUF A;  4FYC A;  2HNL A;  2FA8 A;  4EDY A;  4EL1 A;  1BJX A;  1FW1 A;  4TR1 B;  1WRY A;  3DRN A;  1AUC A;  4WF4 A;  1AC1 A;  1Z7P A;  6GSX A;  3GSS A;  4A5P A;  1ZYN A;  5JCG A;  2DLX A;  4NHW A;  1EZK A;  3P8W A;  6GSU A;  5KEJ A;  1ACV A;  1GSY A;  2HRA A;  4Q5Q A;  4YQV A;  1HNC A;  1EOH A;  1O85 A;  1TK8 B;  4FO5 A;  1SYR A;  5KOW A;  3QR6 A;  2YJ7 A;  2TRX A;  5CRE A;  1EEJ A;  3DWV A;  3ZFL A;  1AXD A;  2L4C A;  1TDI A;  1O6J A;  2LJA A;  3QFA C;  20GS A;  4AGS A;  3A2W A;  3EYT A;  5A34 B;  4IVF A;  4PNF A;  3TKS E;  5BMU B;  4J2F A;  3RPN A;  3ME8 A;  1ILO A;  4G01 A;  3IXR A;  3BOA A;  5DAK A;  2IJY A;  3LYK A;  2VLU A;  2REM A;  4K1F A;  4OD7 A;  4EDZ A;  3LSZ A;  1TJD A;  1SJZ A;  1A2L A;  1UC7 A;  1XW9 A;  4NWY A;  4FYU A;  3E9J B;  2BMX A;  2IN3 A;  1K0D A;  1TRS A;  2HXK A;  2I1U A;  1TXX A;  2H30 A;  3IDV A;  4MA9 A;  5AN1 A;  3H8Q A;  3HJP A;  3TUE A;  2ON7 A;  2QSI A;  5HR0 A;  5L71 A;  2FWH A;  5CO3 A;  4OFM A;  2A2S A;  1Q98 A;  1FOV A;  4ZL9 A;  2VL2 C;  2BJX A;  2H1D A;  4MF5 A;  3ZZX A;  1Z9H A;  1UVZ A;  4IP6 A;  5COH A;  3VPQ A;  1WMJ A;  3V1W A;  2YWI A;  2YNX A;  1ZYE A;  4YKF A;  5ID2 B;  1ZYQ B;  1XVQ A;  1V98 A;  1GSU A;  3UJ1 A;  3UBK A;  3VWV A;  4OCE A;  3F6D A;  2C1Y A;  1GWC A;  5KOX A;  5KN0 A;  4KA0 A;  1R7H A;  2RM5 A;  3QCP A;  1BED A;  4HZ2 A;  2VO4 A;  3ISO A;  2TRC P;  3TCO A;  3KMO A;  5G5F A;  1G7E A;  3BJ5 A;  3LFL A;  2CAI A;  2I9H A;  3RBT A;  3D5J A;  3FR6 A;  1XOA A;  1M2B A;  5J41 A;  1FVJ A;  3IE3 A;  2O7K A;  1QXH A;  3KP8 A;  5D93 A;  2H73 A;  3UBL A;  4V1A g;  5ECR B;  2IFQ A;  4TN8 A;  2Z9S A;  3L0H A;  4RI6 A;  2RUE A;  4MJA A;  2K8V A;  1THO A;  3ZVJ D;  1WE0 A;  3HVV A;  4ECJ A;  4YKG A;  1BG5 A;  3IBH A;  3NZN A;  4XIH A;  4IJ3 A;  5CNW A;  2IIY A;  2HSN A;  4ZL8 A;  4J56 E;  1F37 A;  3M0F A;  2CX3 A;  1KEB A;  3ZVJ A;  1XWC A;  2V2G A;  2DMM A;  5DAL A;  1K3O A;  3EWL A;  1OAZ A;  2CZ2 A;  1AW9 A;  2DJ0 A;  3WT1 A;  3CRU A;  3EUR A;  4JZQ A;  3CMI A;  4DEJ A;  4NV5 A;  2X4A A;  1DE2 A;  2F51 A;  3A2X A;  2OE3 A;  2V6O A;  2H0H A;  2RM6 A;  5ABR A;  4PUA A;  4OO5 A;  2C80 A;  2R37 A;  3FZ4 A;  1OE7 A;  1W4V A;  5JCU A;  1FHE A;  2M72 A;  4IP1 A;  2IMI A;  1IYI A;  2P5R A;  1X0R A;  1ERW A;  4GF0 A;  3W8J A;  1O8W A;  4KDU A;  4MJE A;  1WJK A;  2EFD A;  5B6M A;  5IOX A;  3GIX A;  5A4U A;  5AGY A;  4IW9 A;  5F07 A;  4K7N A;  4G0I A;  3FR3 A;  4Q5N A;  1GL8 A;  3UEM A;  5G1L A;  2LTK A;  3FZ5 A;  3QAV A;  4PQH A;  2LST A;  5EY6 A;  4OFT A;  2RII A;  3UL3 A;  4MZC A;  3ZIJ A;  5A4W A;  4AKI A;  5DJL A;  2GSS A;  3LXZ A;  1EV4 A;  2H6X A;  3DML A;  1LJR A;  4LLR A;  2FNO A;  1T4Z A;  4CDO A;  5A5K A;  2ALB A;  2FWG A;  1T00 A;  3G7Y A;  4F82 A;  2HQT A;  1SL0 B;  2CZ3 A;  2GDR A;  1A0R P;  1AQV A;  4K2D A;  5A1N B;  2X99 A;  2OAD A;  4O92 A;  4MZB A;  3M1G A;  1Z7R A;  11GS A;  3HJM A;  2GZZ A;  4Q5R A;  1FVK A;  2L6C A;  2QGV A;  1GUM A;  18GS A;  3F4R A;  1FO5 A;  1NW2 A;  2PGT A;  3MDK A;  3D4T A;  2MMA A;  4WBR D;  2CV4 A;  1BYE A;  1MD3 A;  1WIK A;  3APO A;  2C3T A;  1MTC A;  4IQ1 A;  1VF1 A;  5BRT A;  3S9F A;  4I2U A;  2C3N A;  4MJB A;  2HSY A;  5FWG A;  2B7J A;  5G30 A;  2GSR A;  3M8N A;  1RW1 A;  1EEM A;  2E2M A;  4CY6 A;  2YWM A;  3HDC A;  1OC3 A;  4XTS A;  1X9S B;  1K0M A;  3F4T A;  2IMF A;  4OWY A;  4NPB A;  1ZL9 A;  2R4V A;  1HQO A;  3KMN A;  1ZOF A;  3IAM 2;  1XWK A;  2VIM A;  1F3A A;  1QMV A;  3WD6 A;  3J7Y k;  2MMZ A;  2H71 A;  3GV1 A;  4ZIJ A;  2JZS A;  3KCM A;  4XS4 A;  1I9D A;  1EGR A;  5F8B A;  4JR4 A;  3L9V A;  3CSI A;  2R0C A;  3LQ7 A;  2QA2 A;  1XVW A;  1AQW A;  4PNG A;  1U6T A;  1AIU A;  2B1K A;  2JAC A;  4N0Z A;  3VFI A;  2WDU A;  5F05 A;  2I81 A;  5IOW A;  2C0G A;  4BVY B;  4KAE A;  2GS3 A;  2WUL A;  5ENU A;  4X43 A;  1TW9 A;  1A0F A;  1ST9 A;  2YV7 A;  2C8U A;  5J4Y A;  1NHY A;  1PL2 A;  3TDG A;  4MMM A;  4MJC A;  2YV9 A;  2H74 A;  3KGK A;  1NM3 A;  2DJ2 A;  2L6D A;  2VL3 A;  2L57 A;  2M80 A;  3HCZ A;  3LXT A;  2C4J A;  2LJK A;  2OJL A;  1FOH A;  1G0T A;  4X0X A;  2B6M A;  1M9A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...