2GTUA

Ligand-free human glutathione s-transferase m2-2 (e.c.2.5.1.18), monoclinic crystal form
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
217
structure length
217
Chain Sequence
PMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVWGNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLUTATHIONE S-TRANSFERASE
publication title The enhanced affinity for thiolate anion and activation of enzyme-bound glutathione is governed by an arginine residue of human Mu class glutathione S-transferases.
pubmed doi rcsb
source organism Homo sapiens
total genus 78
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1998-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2gtuA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2gtuA01
3L9SA 3QMXA 3GKXA 4G9HA 4ACSA 4ZL9A 4Q5RA 4MZWA 2V2GA 3F9UA 3C8EA 2E2MA 3V1WA 2KP2A 5B7CA 3EWLA 3IRAA 3WD6A 3DWVA 2WULA 2HI7A 3GH9A 2P5QA 5AN1A 2VLUA 4V2LA 3HCZA 2LJAA 1SD8A 1GUHA 3FR6A 2RIIA 5LD0A 1QUWA 4PGTA 1PGTA 5F0GA 1K3LA 3ZIVA 2BTOT 2RM6A 2H71A 4LL1B 1YY7A 1A2JA 1XFLA 2X8HA 2N5AA 5J3RA 4MH3A 3BOAA 3W6GA 2PN8A 4OCEA 2OE3A 1PL1A 2H70A 2YV7A 3GKMA 3TRQA 3VK9A 1B48A 2DMMA 1Q4JA 4HI7A 2L4CA 2I1UA 1CQGA 2YJHA 2LNTA 1EP7A 1XWCA 1EV9A 1PL2A 5CRDA 3U5RE 1WRYA 3GSTA 2NBSA 1B4QA 3HVVA 1GRXA 3MAKA 5HR2A 4XS4B 2ON7A 3Q19A 1PMTA 6GSYA 1TJDA 1G0TA 3KMOA 3TB2A 5IQYA 2I9HA 3KD0A 2H73A 2DLXA 1GWCA 3HDCA 1M9BA 1WWJA 2CVBA 4BL7B 4J56E 3H4KA 5D9VA 3D4TA 5ABRA 4FYBA 5GAPD 3ERGA 1TRVA 3A2WA 4MH2A 1K0OA 1MDIA 1WP0A 2AB6A 1UN2A 1SK1A 3VWVA 2VLVA 2A4VA 1HD2A 1NHOA 3GX8A 4ZB6A 3NIVA 1A0RP 2MMZA 3SWLA 2GTUA 1FW1A 2NTOA 5JWOB 2MMNA 1GNWA 3ME8A 2L4QA 4MK3A 1A24A 3O6TA 4TR4A 1Y25A 4HZ4A 4O5RA 2YV9A 3KM6A 1PQNA 2DMLA 2FHEA 3H1NA 3R3EA 1QK8A 4MPGA 3F6DA 3WGDA 2YANA 4EDYA 2O89A 2QC7A 3CSHA 4H86A 4ZBAA 3FY7A 1ON4A 4N10A 3ERWA 4ECIA 5ECKB 3TKSE 3H79A 2JZRA 4PNGA 4TXOB 5D73A 1UC7A 3G9BA 3D22A 4PQHA 4NAXA 1F6MC 3J7Yk 3LJRA 2LUSA 4ZBBA 2R4VA 5IMZA 5D96A 5EL8A 3F4RA 3CRUA 3UOMA 4AJ6A 2EIOA 1EGOA 1X9WB 2C0GA 4KW6A 4WBRD 4XTSA 3F3QA 4HJMA 4QL9A 4GSTA 1THXA 1S3DA 1HQOA 1MTCA 2E0QA 2GS3A 4QL7A 1G6WA 1QMVA 3WT2A 5IMVA 3M3MA 1R7HA 4KSMA 4GXZA 2H76A 2DIYA 1B4PA 2L6DA 3BBYA 3HJPA 4KDXA 2C0FA 3MDKA 1BG5A 6GSUA 2VCQA 4XS4A 1WIKA 1IYHA 4HZ2A 1UVZA 4KUNA 2LEGA 1SL1B 5DJLA 3LSZA 2HZFA 3KTBA 1R4WA 2HSYA 2B6MA 4PURA 4JR4A 5KN3A 4N0VA 1GSSA 1GSDA 3GFKA 1VF2A 3ZTLA 5C00A 5EVOA 3F8UA 2CT6A 5FHIA 4WF4A 2VCTA 4BL7A 1TK5B 5CRHA 1T1VA 3A2VA 1BAYA 2HSMB 3TKQA 2GT6A 2K8SA 2M80A 4L5OA 2DIZA 1SK2A 1ACVA 5ECMB 1OE7A 2OKAA 1GH2A 1W89A 18GSA 1V57A 2MYGA 1TRUA 1H75A 2H0HA 1SKWB 1JFUA 5B6NA 3M8NA 3IC4A 3APQA 3G7YA 2HZEB 2YZUA 2GQMA 4HDEA 2G0FA 1K0AA 1KBNA 3TDGA 2YJ7A 3H8QA 4IJIA 1R26A 1GUKA 4IW9A 1EEMA 5CO3A 3HJMA 4OO5A 4HS1A 4MJEA 2CAIA 1PA3A 4EUYA 1K0CA 1SJ6A 3GHAA 2R37A 3UEMA 2PUKC 1VF1A 3DXBA 3W8JA 3TKPA 3DMLA 4IHUA 3MNGA 1URMA 4AJ8A 2A2RA 5B8AA 5IOXA 2XPEA 2FLSA 1M2BA 4TXOA 3LYKA 3IHQA 2HQTA 4K6XA 2JADA 6GSVA 2GT5A 1X9SB 4I2UA 2C0EA 2GSTA 4BPYA 1PD21 1O7UA 3VWWA 4N11A 3GUSA 1M2DA 4I6XA 3KXOA 3LQ7A 2P5RA 1XW6A 4BWQA 2HRKB 4WETA 5J5NA 3EYTA 4XCSA 3DEXA 2L6CA 3FK8A 4POMA 5JWRB 4P3YB 3PH9A 4MJBA 3TJBA 1ERUA 2IN3A 3PPUA 4WEYA 1XZOA 2X99A 3APOA 1TRWA 5IO0A 1J0FA 2YCDA 6GSSA 4K7OA 1G7EA 4PQIA 1YZXA 5KN2A 2H6XA 4N0ZA 1JLVA 1K0DA 3GURA 2V6OA 3FZ9A 3GYKA 8GSSA 2GZYA 2RUFA 2PBJA 3TKSC 1VRSD 2VM1A 3ZYWA 1GUMA 1QFNA 4FH8A 1PN9A 4MP4A 3A3TA 1QQ2A 3WT1A 4K8MA 1CQHA 4PTSA 2XHFA 3KGKA 2KUCA 5A5KA 2GDRA 3LFLA 4G0LA 1B9XC 3P7XA 4GRFA 5CREA 2HSMA 3HA9A 1KTEA 2G2QA 2BJXA 1Y6EA 1MEKA 1OYJA 3I6AA 3HYPA 1KNGA 4WBJA 4QQ7A 3H93A 3EE2A 5BMUA 3ED3A 3EURA 5AIVA 1BQ7A 1DE2A 5H5RA 3FYGA 1RK4A 4DSQA 1TP9A 1F9MA 4OFNA 4KAEA 1U88A 3RAZA 2HZEA 2NVLA 3VLNA 2F51A 3HHVA 3KEBA 5A4UA 2H8LA 1JLWA 5H5QA 2MZCA 3GX0A 2DJ1A 3VFIA 3L9UA 3LGCA 4Z7XA 5IPGA 3GIXA 3GMFA 2O87A 2F8AA 2VUPA 3FR9A 2B7JA 4I2TA 4OMVA 2V6KA 2B5EA 2JACA 3TRXA 4I8BA 2H0GA 4KDYA 5CAXA 1SL2B 1EP8A 3DRNA 3L4NA 4L5LA 1Z6MA 1FVKA 3GH6A 2X8CA 4TRXA 1Z9HA 3N5OA 4FO5A 3GTUB 4ZXGA 2HRNA 4OFMA 5HFKA 4TR0A 3ZIJA 4KSOA 5IMAA 2L5OA 4PUFC 3M0FA 2N5BA 4KCAA 3PR8A 1LJRA 5JWQB 1U87A 2HE3A 1FG4A 3UJ1A 1ILOA 6GSWA 2HRKA 3TOUA 3IOSA 2TRCP 1GLQA 4KB3A 3G7IA 4JE1A 3D6IA 13GSA 3IV4A 1X0RA 3TKSA 3IXRA 4IQAA 4G0KA 3BCIA 2LSTA 5D9TA 1OKDA 3BCKA 4KGIA 2O8VB 4NV2A 5CRGA 2FWGA 1A2MA 5J4UA 4I5QA 5G30A 4TN8A 4BA7A 1USBA 3GNJA 4WXTA 2V32A 3PINA 5IMDA 5CYYA 4JBBA 3VPQA 3KIJA 3UMAA 3CRTA 4NHWA 1T4YA 5ECSA 1TW9A 2I4AA 5G1KA 4MCUA 3HY2A 4POKA 1XIYA 1M0UA 4OWYA 3NOFA 1T3BA 4EO3A 3BJ5A 1OE8A 3DVWA 5AIXA 3GKKA 1Z3EA 4F0CA 2C3NA 2DBCA 2FWFA 3TJFA 11GSA 3VI5A 1T00A 1Z6NA 1JZWA 2OJLA 4CW9A 4K7NA 1SJZA 2LRCA 2C3QA 3FR3A 2FCHA 4IVFA 3C1RA 4J2FA 2H6YA 2IMEA 1DE1A 5G2ZA 1BYEA 5DALB 5G5EA 5EY6A 1M2AA 3KMNA 5DCGA 2YN1A 1V9WA 1MDJA 1GNEA 5G31A 3J7Yb 5IMCA 5ECOB 4ZL8A 2QSIA 2EIRA 4K0NA 2IMIA 4EVMA 4TXVA 1JZDA 1ZYQB 4PNFA 3EU3A 2IMDA 2H1DA 2C0DA 1A8YA 4MDCA 3CTFA 3GN3A 4YQUA 3FEUA 5B8BA 3FHKA 2REMA 4KCEA 5ECNB 1A0FA 4KE3A 2OE1A 3GV1A 1U6TA 5D9XA 2GSQA 3AY8A 1X5CA 3EU4A 4F2IA 1O81A 1J08A 3CMIA 3GTUA 3R2QA 2YWIA 1O73A 3I9V2 4MZCA 4NXIA 4ECJA 3CSJA 2UZ8A 1EEJA 5FWGA 4MZBA 3WGEA 2HNLA 4USSA 3HKRA 2PVOC 1E2YA 2B1KA 5HQPA 3FZ4A 1XVWA 2WRTA 1ZL9A 2RM5A 2KOKA 4WF5A 3OR5A 1K0MA 4RI6A 2MMOA 1AUCA 1GTUA 2DJ2A 4HUAA 2E2GA 3I69A 4GSSA 4MJAA 2CZ3A 1F3AA 2TIRA 4K7IA 3IPZA 4XIHA 2LTKA 2F3MA 1RQMA 1EOGA 3IAM2 20GSA 3EC3A 4PUAA 1T7PB 4NV5A 3FZ5A 4OCFA 4G0IA 3P90A 2H1GA 5DBQA 2LRNA 3G7JA 2O85A 3UVHA 2VL2C 2YNXA 1O85A 1JZRA 4GQCA 3NZNA 2L57A 2R5GA 2GGTA 2DJ3A 5KEJA 3TCOA 3I43A 4JRRA 4NHZA 5E4WA 5ELAA 2K6VA 3US3A 2H01A 1EZKA 1SD9A 4ECBA 2VCWA 3ISOA 2WS2A 5KN1A 2OBKA 4BWSA 5HFGA 5L71A 5HR3A 1GP1A 1TU8A 3UAPA 5DAKB 1XBSA 2QKEA 4EXJA 1O6JA 5ECPB 1TU7A 4BVYB 3WYWA 4F03A 2EIQA 2AUVA 2HFDA 3KH9A 2VIMA 5DALA 4KF9A 1HNAA 5G5FA 2OE0A 2K18A 3BD2A 1ZMAA 3ZVJD 1YQ1A 3E0UA 2N5FA 1GSEA 4WR4A 1LU4A 2A2SA 2I81A 2HSHA 5AGYA 3ZFLA 2L5LA 3HD5A 3LORA 1VGLA 2AYTA 5ENUA 2KP1A 1GTIA 3LWAA 2GZPA 4ZB8A 4EKZA 2XBIA 2E7PA 2YWOA 4EF0A 3RBTA 4EE0A 1K0NA 1ST9A 3VPTA 1ZGNA 3KP8A 4ML6A 5CRWA 1G7OA 3Q18A 1AAZA 3FRCA 5JCWA 2VO4A 4ML1A 2JZTA 1VF4A 1W4VA 2H72A 3F0IA 4MF5A 5F8BA 1Q98A 3TJKA 2CA8A 1ERTA 3C73A 3ZRDA 1ERWA 1GSQA 4F0BA 4ULXA 2MBTA 3EVIA 1YJ6A 5DQYA 3MWHA 3D21A 4HQZA 1TTZA 3Q74A 2LS5A 1PKWA 2ON5A 2WB9A 2J9HA 1WPIA 19GSA 3DKSA 5B6MA 2OACA 2VCZA 1F37A 4Q5FA 4GQFA 2TRXA 4E8EA 1PX6A 1QXHA 3GL3A 4PX1A 3ZITA 2QGVA 1XWKA 1K3YA 3F63A 2H75A 1SL0B 3K8NA 1SKSB 4AJ7A 2GZZA 2HLSA 2H1BA 3M1GA 1XWGA 4FIWA 4HQSA 5EPFA 5J41A 5DQSA 1FOVA 3F3RA 2B5XA 1XOBA 3CYNA 2OADA 4ZILA 1E6BA 2M46A 5COHA 1THOA 3KZQA 2IMKA 1GSUA 2IPAA 5J9BA 3UBLA 3GSSA 4NPBA 3RDWA 2ES7A 2FGXA 2RLIA 5IIZA 4JU5A 4KX4A 1FHEA 5ID2B 2B5YA 6GSXA 4LL4B 2C80A 4HJ2A 4YH2A 2IWTA 5DAKA 1T8EB 3IK9A 1U3IA 4K0GA 1A8LA 5F06A 3RHBA 1X5EA 4BVYA 2K9FA 2CX4A 2HSNB 4ZIJA 2HRAA 5IM9A 3ZL5A 5GZZB 1QGVA 3CTGA 4O32A 3EINA 1ABAA 4RQRA 4EL1A 1BEDA 3IDVA 4XS6A 4LMVA 3ME7A 2F9SA 1GTBA 3QFBC 4TKYA 1TXXA 2MBSA 6GSTA 2B1LA 3C71A 1SYRA 2ZCTA 3QR6A 4ZL7A 3KCMA 3TGZA 3HVSA 3IAS2 2WGRA 3ZMLA 3FZAA 2X64A 2RUEA 1AQXA 1ZYEA 2AJQB 2BMXA 4IGJA 5GSTA 1R5AA 1MD3A 1PRXA 1YKCA 1J9BA 5ECLB 5JCGA 3QOUA 4E8HA 4IP6A 2O7KA 4ZBDA 1V98A 1O8XA 2LKUA 2GSSA 4TR1B 4ZB9A 3ZZXA 2VD0A 1KEBA 5IOWA 4IN0A 5HR1A 5LNKe 4K9ZA 4HU9A 2M72A 3GL5A 1EOHA 2WFCA 4N30A 4GCIA 1X9MB 4MPFA 1MDKA 1FO5A 5G1LA 16GSA 4X43A 2PPTA 4X0XA 3IA1A 1XVQA 1N2AA 2R2JA 2AHEA 2GLRA 4OFTA 2VM2A 1N8JA 2V41A 1TKDB 1NHYA 2PMTA 2AAWA 3W8SA 1AQWA 1BX9A 2PVQA 3KJYA 1XW9A 3S9FA 5ECIB 2LQOA 3QAVA 2LJRA 3UIWA 5GSSA 4WKWA 3VI7A 4TR3A 3L0HA 2C3TA 2KHPA 22GSA 3KP9A 2YP6A 4YQVA 4GSNA 3PGTA 1EGRA 4O92A 1MD4A 1WE0A 4V2NA 1F2EA 5IO2A 10GSA 5ID2A 3FKFA 4EC0A 1DBYA 1XXUA 1OAZA 4IKHA 2JL4A 1S3AA 1K3OA 1AQVA 3TOTA 4AF2A 3M9JA 2VOCA 3LYPA 4ECCA 2AV4A 2DJKA 1ZOFA 4LLRA 2D2ZA 2FUG2 2VCXA 3E9JB 4J57E 4IELA 3IE3A 1AXDA 3KTLA 1YEPA 3TJJA 3VWUA 4IQ1A 1IYIA 1YF0A 3WGXA 4TVEA 4K1FA 2CVKA 4JEDA 2NPBA 3RPPA 3D4MA 2JZSA 3VURA 2IL3A 1B9YC 1XPVA 2LNSA 3RPNA 4D73B 4IS0A 1JHBA 3CXGA 3GA4A 3F4TA 3HJOA 3QAGA 4DSSB 2GQKA 2LQQA 3U6VA 5D9WA 2PGTA 5H5SA 2YWNA 3DD3A 4OO4A 5DVBA 2CQ9A 3QD9A 5KN0A 4RUVA 3LG6A 4MABA 1TK8B 1OKTA 3TUEA 4TOPA 2I3YA 4HEA2 4KA0A 2V1MA 3ZMKA 1GULA 4YAVA 4MMMA 5E59A 2VL3A 3GRXA 1BJXA 4XRAA 1ML6A 4TR1A 4L8EA 3D0ZA 1OC3A 1UA5A 1TDIA 9GSSA 1H4OA 2F8FA 2R3XA 4I97A 1XWBA 2HYXA 4CHSA 3TKRA 2WCIA 2L59A 3QAWA 2PERA 2YOIA 5DCHA 1S3CA 1JZOA 4MJCA 2ZNMA 2X8GA 5A4VA 1Z5YE 3LXTA 2R6KA 2CZ2A 4FYCA 4XS1A 3IR4A 2LRTA 4L0UA 1OC8A 2P0GA 1DUGA 1T4ZA 1B8XA 5D8IA 3Q6OA 2H30A 1SENA 1DSBA 4IP1A 2WJUA 1G6YA 3RHCA 1WJKA 3QFAC 3ZLPA 2VD1A 1AW9A 4V2MA 1Z7RA 4G2EA 1OVNA 1XW5A 2GSRA 1NM3A 2H74A 1EWXA 1YF1A 1GLPA 2IFQB 2LV3A 2OA7A 3UL3A 3C1SA 4RI7A 1ZZYA 3UBKA 4Q5NA 2K8VA 3N9JA 4IJ3A 3ZREA 4ISDA 5J9CA 1OC9B 2HT9A 3O76A 2ALBA 2JSZA 3L78A 1M99A 4L0WA 5AISA 7GSSA 2DJ0A 2HRFA 1SK0A 4POBA 2KLXA 2PU9C 5CNWA 4XRDA 4AGSA 4BVXB 1YEXA 2GQLA 5D93A 5INYA 2CX3A 1VF3A 5FT3A 1HYUA 5ECHB 4F9ZA 3EMXA 1GTAA 2H1AA 3HZ4A 2C8UA 4O7HA 5IMFA 4F82A 2P31A 1V2AA 2CVDA 2XBQA 1SYXA 2VLTA 2FA4A 1GL8A 5ECQB 2H19A 2YWMA 1TRSA 2PWJA 1ERVA 3E3EA 4EDZA 4LMWA 1XCCA 4D73A 1WMJA 2DC5A 1M9AA 3L9VA 4DSSA 1NSWA 2WZ9A 5F05A 5ECRB 2FY6A 3IK7A 3CSIA 1U3AA 4HOJA 1ZCPA 1R5PA 3M9KA 1FB0A 3IC8A 5LCZA 3F4SA 4FYUA 12GSA 2CV4A 1O8WA 2WDUA 2FD3A 3DVXA 2EC4A 2H66A 3QCPA 5HR0A 2FA8A 1PKZA 4KDUA 2YPMA 1C72A 1GSFA 3CBUA 1PX7A 5IPHA 2FNOA 4GTUA 4NMUA 4RQXA 1TK0B 3HZ8A 4Q5QA 2JU5A 3HVXA 3TRPA 2FWHA 1YKAA 5DDLA 1AIUA 1TI3A 4HU7A 3HXSA 3F6FA 3DGQA 1AC1A 3FW2A 2VAFA 3JCML 1YDKA 1SKRB 4KNDA 2C4JA 4MA9A 3UARA 2LJKA 1FB6A 2H6ZA 4GWRA 1TI1A 2VL2A 4KH7A 2B3SA 2JSYA 3MSZA 4OD7A 5GAND 3DYRA 3QDNA 1F3BA 2B7KA 1XOAA 4LA1A 4XHMA 3A5WA 4TW5A 2J23A 2VL9A 3QPMA 1X5DA 3P8WA 3KH7A 4MF6A 2VCVA 1WOUA 3EMPA 4GF0A 1M7TA 4G10A 4IBPA 2HXKA 5HFIA 1HNBA 2Z9SA 2IFQA 5A4WA 4K2DA 1FVJA 2DSAA 4JR6A 5DJMA 1V40A 1HNCA 14GSA 5F07A 1OC9A 3D5JA 1TOFA 2IIYA 5ELGA 4ID0A 4POLA 4PQ1A 1XWAA 4MF7A 3ZVJA 3LXZA 2XC2A 4DEJA 1A2LA 2OBIA 17GSA 4WR5A 3ZFBA 3A2XA 4BVXA 1FAAA 3C7MA 1RW1A 4GLTA 5JCUA 2GVPA 4V1Ap 3O3TA 1NW2A 1V58A 1K0BA 3APSA 4DSRA 1PSQA 5CP1A 1GSYA 4ILFA 1EV4A 3LEFA 3P2AA 3ERFA 2ZUPA 2FWEA 1SJIA 3VWXA 4V1Ag 1I5GA 3DIEA 1LBKA 3UVTA 2IMFA 2C1YA 3GKNA 4FQUA 1A23A 4YAPA 4MLYA 3SBCA 2YZHA 4X1UA 2MMAA 2IJYA 4JZQA 2DJJA 4DVCA 1SU9A 2CAQA 2XPDA 4G19A 3TJGA 4YQMA 1Z7PA 4CDOA 2NDOA 4PXOA 5C04A 2H0IA 3IBHA 1I9DA 4NWYA
chains in the Genus database with same CATH superfamily
4Z2RA 3L9SA 3QMXA 3GKXA 4G9HA 4ACSA 4ZL9A 4Q5RA 4MZWA 2V2GA 3F9UA 3C8EA 2E2MA 3V1WA 2KP2A 5B7CA 3EWLA 3IRAA 3WD6A 3DWVA 2WULA 2HI7A 3GH9A 2P5QA 5AN1A 2VLUA 4V2LA 3HCZA 2LJAA 1SD8A 1GUHA 3FR6A 2RIIA 5LD0A 1QUWA 4PGTA 1PGTA 5F0GA 1K3LA 3ZIVA 2BTOT 2RM6A 2H71A 4LL1B 1YY7A 1A2JA 3RGBC 1XFLA 2X8HA 2N5AA 5J3RA 4MH3A 3BOAA 3W6GA 2PN8A 4OCEA 2OE3A 1PL1A 2H70A 2YV7A 3GKMA 4ICYA 3TRQA 3VK9A 1B48A 2DMMA 5KOWA 1Q4JA 4HI7A 2L4CA 2I1UA 1CQGA 2YJHA 2LNTA 1EP7A 1XWCA 1EV9A 1PL2A 5CRDA 3U5RE 1WRYA 3GSTA 4PI2C 2NBSA 1B4QA 3HVVA 1GRXA 3MAKA 5HR2A 4XS4B 2ON7A 3Q19A 1PMTA 6GSYA 1TJDA 1G0TA 3KMOA 3TB2A 5IQYA 2I9HA 3KD0A 2H73A 2DLXA 1GWCA 3HDCA 1M9BA 1WWJA 2CVBA 4BL7B 4J56E 3H4KA 5D9VA 3D4TA 5ABRA 4Z2UA 4FYBA 5GAPD 3ERGA 1TRVA 3A2WA 4MH2A 1K0OA 4E68A 1MDIA 1WP0A 2AB6A 1UN2A 1SK1A 3VWVA 2VLVA 2A4VA 1HD2A 1NHOA 3GX8A 4ZB6A 3NIVA 1A0RP 2MMZA 3SWLA 2GTUA 1FW1A 2NTOA 5JWOB 2MMNA 1GNWA 3ME8A 2L4QA 4MK3A 1A24A 3O6TA 4TR4A 1Y25A 4HZ4A 4O5RA 2YV9A 3KM6A 1PQNA 2DMLA 2FHEA 3H1NA 3R3EA 1QK8A 4MPGA 3F6DA 3WGDA 2YANA 4EDYA 2O89A 2QC7A 3CSHA 4H86A 4ZBAA 3FY7A 1ON4A 4N10A 3ERWA 4ECIA 5ECKB 3TKSE 2QA2A 3H79A 2JZRA 3HVNA 4PNGA 4TXOB 5D73A 1UC7A 3G9BA 3D22A 4PQHA 4NAXA 1F6MC 3J7Yk 3LJRA 2LUSA 3RFRC 4ZBBA 2R4VA 5IMZA 5A5HB 5D96A 5EL8A 3F4RA 3CRUA 3UOMA 4AJ6A 2EIOA 1EGOA 1X9WB 2C0GA 4KW6A 1N25A 4WBRD 4XTSA 3F3QA 4HJMA 4QL9A 4GSTA 1THXA 2DKIA 1S3DA 1HQOA 1MTCA 2E0QA 2GS3A 4QL7A 1G6WA 1QMVA 3WT2A 5IMVA 3M3MA 1R7HA 4KSMA 4GXZA 2H76A 2DIYA 1B4PA 2L6DA 3BBYA 3HJPA 4KDXA 2C0FA 3MDKA 1BG5A 6GSUA 2VCQA 4XS4A 1WIKA 1IYHA 4HZ2A 1UVZA 4KUNA 2LEGA 1SL1B 5DJLA 3LSZA 2HZFA 3KTBA 1R4WA 2HSYA 5J40A 2B6MA 4PURA 4JR4A 5KN3A 4N0VA 1GSSA 1GSDA 1SVMA 3GFKA 1VF2A 3ZTLA 5C00A 5EVOA 3F8UA 2CT6A 5FHIA 4WF4A 2VCTA 4BL7A 1TK5B 5CRHA 1T1VA 3A2VA 1BAYA 2HSMB 3TKQA 2GT6A 2K8SA 2UV8G 2M80A 4L5OA 2DIZA 1SK2A 1ACVA 5A34B 5BMUB 5ECMB 4X4JA 1OE7A 2OKAA 1GH2A 1W89A 18GSA 1V57A 2MYGA 1TRUA 1H75A 2H0HA 1SKWB 1JFUA 5B6NA 3M8NA 3IC4A 3APQA 3G7YA 2EFDA 2HZEB 2YZUA 2GQMA 4HDEA 2G0FA 1K0AA 1KBNA 3TDGA 2YJ7A 3H8QA 4IJIA 1R26A 5J47A 4QMKA 1GUKA 4O5QA 4IW9A 1EEMA 5CO3A 3HJMA 5A1NB 4OO5A 4HS1A 4MJEA 2CAIA 1PA3A 4EUYA 1K0CA 1SJ6A 1ZYNA 3GHAA 2R37A 3UEMA 2PUKC 2WZSA 1VF1A 3DXBA 3W8JA 3TKPA 3DMLA 4IHUA 3MNGA 1URMA 4AJ8A 2A2RA 5B8AA 5IOXA 2XPEA 2FLSA 1M2BA 4TXOA 3LYKA 3IHQA 2HQTA 4K6XA 1M3IA 2JADA 6GSVA 2GT5A 1X9SB 5A5HA 4I2UA 2C0EA 2GSTA 4BPYA 1PD21 1O7UA 2EFCA 3VWWA 4N11A 3GUSA 1M2DA 4I6XA 3KXOA 3LQ7A 2P5RA 1XW6A 4BWQA 2HRKB 4WETA 5J5NA 3EYTA 3CQFA 4XCSA 3DEXA 2L6CA 3FK8A 4POMA 5JWRB 4P3YB 3PH9A 4MJBA 3TJBA 4GDFA 1ERUA 2IN3A 3PPUA 2WVXB 4WEYA 1XZOA 2X99A 3APOA 1TRWA 5IO0A 1J0FA 2YCDA 6GSSA 4K7OA 1G7EA 4PQIA 4O5UA 1YZXA 5KN2A 2H6XA 4N0ZA 1JLVA 4MNNA 1K0DA 3GURA 2V6OA 3FZ9A 3GYKA 8GSSA 2GZYA 2RUFA 2PBJA 4K2XA 4A5PA 3TKSC 1VRSD 2VM1A 3ZYWA 1GUMA 1QFNA 4CY8A 4FH8A 1PN9A 4MP4A 3A3TA 1QQ2A 3WT1A 4K8MA 1CQHA 4PTSA 4N3ZA 2XHFA 3KGKA 2KUCA 5A5KA 2GDRA 3LFLA 4G0LA 1B9XC 3P7XA 4GRFA 4K5SA 5CREA 2HSMA 3HA9A 1KTEA 2G2QA 2BJXA 1Y6EA 1MEKA 4AI6A 1OYJA 3I6AA 3HYPA 1KNGA 4WBJA 4QQ7A 3H93A 5A34A 3EE2A 5BMUA 3ED3A 3EURA 5AIVA 1BQ7A 1DE2A 5H5RA 3FYGA 1RK4A 4DSQA 1TP9A 1F9MA 4OFNA 4KAEA 1U88A 3RAZA 2HZEA 2NVLA 3VLNA 2F51A 3HHVA 3KEBA 5A4UA 2H8LA 1JLWA 5H5QA 2MZCA 3GX0A 2DJ1A 3VFIA 3L9UA 3LGCA 4Z7XA 5IPGA 3GIXA 3GMFA 2O87A 5A1NA 2F8AA 2VUPA 3FR9A 2B7JA 4I2TA 4OMVA 2V6KA 4EIPA 2B5EA 2JACA 3TRXA 4I8BA 2H0GA 4KDYA 5CAXA 1SL2B 1EP8A 4AKXB 3DRNA 3L4NA 4L5LA 1Z6MA 2H1LA 1FVKA 3GH6A 2X8CA 2A2PA 4TRXA 1Z9HA 3N5OA 4FO5A 3GTUB 4ZXGA 2HRNA 4OFMA 5HFKA 4TR0A 3ZIJA 4KSOA 5IMAA 2L5OA 4PUFC 3M0FA 2N5BA 4KCAA 3PR8A 1LJRA 5JWQB 1U87A 2HE3A 1FG4A 3UJ1A 1ILOA 6GSWA 2HRKA 3TOUA 3IOSA 2TRCP 1GLQA 4KB3A 3G7IA 4JE1A 3D6IA 13GSA 3IV4A 1X0RA 3TKSA 3IXRA 4IQAA 4G0KA 3BCIA 2LSTA 5D9TA 1OKDA 3BCKA 2WVXA 4KGIA 2O8VB 4NV2A 5CRGA 2FWGA 1A2MA 5J4UA 4I5QA 1PN0A 5G30A 4TN8A 4BA7A 1USBA 3GNJA 4WXTA 2V32A 3PINA 5IMDA 5CYYA 4JBBA 3VPQA 3KIJA 3UMAA 3CRTA 4NHWA 1T4YA 5ECSA 1TW9A 2I4AA 5G1KA 4MCUA 3HY2A 4POKA 1XIYA 1M0UA 4OWYA 3NOFA 1T3BA 4EO3A 3BJ5A 1OE8A 3DVWA 2WW3A 5AIXA 3GKKA 1Z3EA 4F0CA 3LW9A 2WVZA 2C3NA 2DBCA 2FWFA 3TJFA 11GSA 3VI5A 1T00A 1M3JA 1Z6NA 1JZWA 2OJLA 4CW9A 4K7NA 1SJZA 2LRCA 2C3QA 3FR3A 2FCHA 4IVFA 2VKZG 1ZYPA 3C1RA 4J2FA 2H6YA 2IMEA 1DE1A 5G2ZA 1BYEA 5DALB 5G5EA 5EY6A 1M2AA 3KMNA 5DCGA 2YN1A 3EPTA 1V9WA 1MDJA 1GNEA 5G31A 3J7Yb 5IMCA 5ECOB 4ZL8A 2QSIA 2EIRA 4K0NA 2IMIA 4EVMA 4TXVA 1JZDA 1ZYQB 4PNFA 3EU3A 2IMDA 2H1DA 2C0DA 1A8YA 4MDCA 3CTFA 3GN3A 4YQUA 3FEUA 5B8BA 3FHKA 2REMA 4KCEA 5ECNB 1A0FA 4KE3A 2OE1A 3GV1A 1U6TA 5D9XA 2GSQA 3AY8A 1X5CA 3EU4A 4F2IA 1O81A 1J08A 3CMIA 3GTUA 3R2QA 2YWIA 4FXYP 1O73A 3I9V2 4MZCA 4NXIA 4ECJA 3CSJA 2UZ8A 1EEJA 5FWGA 4MZBA 3WGEA 2HNLA 4USSA 3HKRA 2PVOC 1E2YA 2B1KA 5HQPA 3FZ4A 1XVWA 2WRTA 1ZL9A 2RM5A 2KOKA 4WF5A 3OR5A 1K0MA 4RI6A 2MMOA 1AUCA 1GTUA 2DJ2A 4HUAA 2E2GA 2O36A 3I69A 4GSSA 4MJAA 2CZ3A 1F3AA 2TIRA 4K7IA 3IPZA 4XIHA 2LTKA 2F3MA 1RQMA 1EOGA 3IAM2 3HMJG 20GSA 3EC3A 4PUAA 1T7PB 4NV5A 3FZ5A 4OCFA 4G0IA 3P90A 2H1GA 5DBQA 2LRNA 3G7JA 2O85A 3UVHA 2VL2C 2YNXA 1O85A 1JZRA 4GQCA 3NZNA 2L57A 2R5GA 2GGTA 2DJ3A 5KEJA 3TCOA 3I43A 4JRRA 4NHZA 5E4WA 5ELAA 2K6VA 3US3A 2H01A 1EZKA 1SD9A 4ECBA 2VCWA 3ISOA 2WS2A 5KN1A 2OT3A 2OBKA 4BWSA 5HFGA 5L71A 4CY6A 5HR3A 4PHZC 1GP1A 1TU8A 3UAPA 5DAKB 1XBSA 2QKEA 4EXJA 1O6JA 5ECPB 1TU7A 2WW0A 4BVYB 3WYWA 4F03A 2EIQA 2AUVA 2R0GA 2HFDA 3KH9A 2VIMA 5DALA 4KF9A 1HNAA 5G5FA 2OE0A 2K18A 3BD2A 1ZMAA 3ZVJD 1YQ1A 3E0UA 2N5FA 1GSEA 4WR4A 1LU4A 2A2SA 2I81A 2HSHA 5AGYA 3ZFLA 2L5LA 3HD5A 3LORA 1VGLA 2AYTA 1PFOA 5ENUA 2KP1A 1GTIA 3LWAA 2GZPA 4ZB8A 4EKZA 2XBIA 2E7PA 2YWOA 4EF0A 3RBTA 2O5VA 4EE0A 1K0NA 1ST9A 3VPTA 1ZGNA 3KP8A 4ML6A 3MYDA 5CRWA 1G7OA 3A5IA 3Q18A 1AAZA 3FRCA 5JCWA 2VO4A 4ML1A 4PI0C 2JZTA 1VF4A 1W4VA 2H72A 3F0IA 4MF5A 5F8BA 1Q98A 3TJKA 2CA8A 1ERTA 3C73A 3ZRDA 1ERWA 1GSQA 4F0BA 4ULXA 2MBTA 3EVIA 1YJ6A 5DQYA 3MWHA 3D21A 4HQZA 1TTZA 3Q74A 2LS5A 1PKWA 2ON5A 2WB9A 2J9HA 4AKIA 1WPIA 19GSA 3DKSA 5B6MA 2OACA 2VCZA 1F37A 4Q5FA 4GQFA 2TRXA 4E8EA 1PX6A 1QXHA 3GL3A 4PX1A 3ZITA 2QGVA 1XWKA 1K3YA 3F63A 2H75A 1SL0B 3K8NA 4HSCX 1SKSB 4AJ7A 2GZZA 2HLSA 2H1BA 3M1GA 1XWGA 4FIWA 4HQSA 5EPFA 5J41A 5DQSA 1FOVA 3F3RA 2B5XA 1XOBA 3CYNA 2OADA 4ZILA 1E6BA 2M46A 5COHA 1THOA 3KZQA 2IMKA 1GSUA 2IPAA 5J9BA 3UBLA 3GSSA 4NPBA 3RDWA 2ES7A 2FGXA 2RLIA 5IIZA 4JU5A 4KX4A 1FHEA 5ID2B 2B5YA 6GSXA 4LL4B 2C80A 4HJ2A 4YH2A 2IWTA 1TXUA 5DAKA 1T8EB 3IK9A 1U3IA 4K0GA 1A8LA 4BIKA 5F06A 2R0PA 3RHBA 1X5EA 4BVYA 2K9FA 2A4HA 2CX4A 2HSNB 4ZIJA 2HRAA 5IM9A 3ZL5A 5GZZB 1QGVA 3CTGA 2WW2A 4YKGA 4O32A 3EINA 1ABAA 4RQRA 4EL1A 1BEDA 3IDVA 4XS6A 4LMVA 3ME7A 2F9SA 1GTBA 3QFBC 4TKYA 1TXXA 2MBSA 6GSTA 2B1LA 3C71A 1SYRA 2ZCTA 3QR6A 4ZL7A 3KCMA 3TGZA 3HVSA 3IAS2 2WGRA 3ZMLA 4Z2TA 3FZAA 2X64A 2RUEA 1AQXA 1ZYEA 2AJQB 2BMXA 4IGJA 5GSTA 1R5AA 1MD3A 1PRXA 1YKCA 1J9BA 5ECLB 3IHGA 5JCGA 3QOUA 4E8HA 4IP6A 2O7KA 4ZBDA 1V98A 1O8XA 2LKUA 2GSSA 4TR1B 4ZB9A 3ZZXA 2VD0A 1KEBA 5IOWA 4IN0A 5HR1A 5LNKe 4K9ZA 4HU9A 2M72A 3GL5A 1EOHA 2WFCA 4N30A 4GCIA 1X9MB 4MPFA 1MDKA 1FO5A 5G1LA 16GSA 5KOXA 4X43A 2PPTA 4X0XA 3IA1A 1XVQA 1N2AA 2R2JA 2AHEA 2GLRA 4OFTA 2VM2A 1N8JA 2V41A 1TKDB 1NHYA 4EIQA 2PMTA 2AAWA 3W8SA 3CWGA 1AQWA 1BX9A 2PVQA 3KJYA 1XW9A 3S9FA 5ECIB 2LQOA 3QAVA 2LJRA 3UIWA 5GSSA 4WKWA 3VI7A 4TR3A 3L0HA 2C3TA 2KHPA 22GSA 3KP9A 2YP6A 4YQVA 4GSNA 2X4AA 4AKGA 3PGTA 1EGRA 4O92A 1MD4A 1WE0A 4W66A 4V2NA 1F2EA 5IO2A 10GSA 5ID2A 3FKFA 2WW1A 4EC0A 1DBYA 1XXUA 1OAZA 4IKHA 2JL4A 1S3AA 1K3OA 4YKFA 1AQVA 3TOTA 4AF2A 3M9JA 2VOCA 3LYPA 4ECCA 2AV4A 2DJKA 1ZOFA 1XG8A 4LLRA 2D2ZA 2HSNA 2FUG2 2VCXA 3E9JB 4J57E 4IELA 3IE3A 1AXDA 3KTLA 1YEPA 3TJJA 3VWUA 4IQ1A 1IYIA 1YF0A 3WGXA 4TVEA 4K1FA 2CVKA 4JEDA 2NPBA 3RPPA 3D4MA 2JZSA 3VURA 2IL3A 1B9YC 1XPVA 2LNSA 3RPNA 4D73B 4IS0A 1JHBA 3CXGA 3GA4A 3F4TA 3HJOA 3QAGA 4DSSB 2GQKA 2LQQA 2R0CA 3U6VA 5D9WA 2PGTA 5H5SA 2YWNA 3DD3A 4OO4A 5DVBA 1SVLA 2CQ9A 3QD9A 5KN0A 4RUVA 3LG6A 4MABA 1TK8B 1OKTA 3TUEA 4TOPA 2I3YA 4HEA2 4KA0A 5BRTA 2V1MA 3ZMKA 1GULA 4YAVA 4MMMA 5E59A 2VL3A 3GRXA 1BJXA 4XRAA 1ML6A 4TR1A 4L8EA 3D0ZA 1OC3A 1UA5A 1TDIA 9GSSA 1H4OA 2F8FA 2R3XA 4I97A 1XWBA 2HYXA 4CHSA 3TKRA 2WCIA 2L59A 3QAWA 2PERA 2YOIA 5DCHA 1S3CA 1JZOA 4MJCA 2ZNMA 2X8GA 2QA1A 5A4VA 1Z5YE 3LXTA 2R6KA 2CZ2A 4FYCA 4XS1A 3IR4A 2LRTA 4L0UA 1OC8A 2P0GA 1DUGA 1T4ZA 1B8XA 5D8IA 3Q6OA 2H30A 1SENA 1DSBA 4IP1A 2WJUA 1G6YA 3RHCA 1WJKA 3QFAC 3ZLPA 2VD1A 1AW9A 4V2MA 1Z7RA 4G2EA 1OVNA 1XW5A 2GSRA 1NM3A 2H74A 1EWXA 1YF1A 1GLPA 2IFQB 2LV3A 2OA7A 2EFEA 3UL3A 3C1SA 4RI7A 1ZZYA 4ZB7A 3TU3B 3UBKA 4Q5NA 2K8VA 3N9JA 4IJ3A 5J4VA 3ZREA 4ISDA 5J9CA 1OC9B 2HT9A 3O76A 2ALBA 2JSZA 3FMWA 3L78A 1M99A 4L0WA 5AISA 7GSSA 1YEWC 2DJ0A 2HRFA 1SK0A 4POBA 2KLXA 2PU9C 5CNWA 4XRDA 4AGSA 4BVXB 1YEXA 2GQLA 5D93A 5INYA 2CX3A 1VF3A 5FT3A 1HYUA 5ECHB 4F9ZA 3EMXA 4AKHA 1GTAA 2H1AA 3HZ4A 2C8UA 4O7HA 5IMFA 4F82A 2P31A 1V2AA 2CVDA 2XBQA 1SYXA 2VLTA 2FA4A 1GL8A 5ECQB 2H19A 2YWMA 1TRSA 2PWJA 1ERVA 3E3EA 4EDZA 4LMWA 1XCCA 4D73A 1WMJA 2DC5A 1M9AA 1S4BP 5J4YA 3L9VA 4DSSA 1NSWA 2WZ9A 5F05A 5ECRB 4K5RA 2FY6A 3IK7A 3CSIA 1U3AA 4HOJA 1ZCPA 1R5PA 3M9KA 1I1IP 1FB0A 3IC8A 5LCZA 3F4SA 1BG1A 4FYUA 12GSA 2CV4A 1O8WA 2WDUA 2FD3A 3DVXA 2EC4A 2H66A 3QCPA 5HR0A 2FA8A 1PKZA 4KDUA 2YPMA 1C72A 1GSFA 3CBUA 1PX7A 5IPHA 2FNOA 4GTUA 4NMUA 4RQXA 1TK0B 3HZ8A 4Q5QA 2JU5A 3HVXA 3TRPA 2FWHA 1YKAA 5DDLA 1AIUA 1TI3A 4HU7A 3HXSA 3F6FA 3DGQA 1AC1A 3FW2A 2VAFA 3JCML 1YDKA 1SKRB 4KNDA 2C4JA 4MA9A 3UARA 2LJKA 1FB6A 2H6ZA 4GWRA 1S3RA 1TI1A 1FOHA 2VL2A 4KH7A 2B3SA 2JSYA 3MSZA 4OD7A 5GAND 3DYRA 3QDNA 1F3BA 2B7KA 1XOAA 4LA1A 4XHMA 1SVOA 3A5WA 4TW5A 2J23A 2VL9A 3QPMA 1X5DA 3P8WA 3KH7A 4MF6A 2VCVA 1WOUA 3EMPA 4GF0A 1M7TA 4G10A 4IBPA 2HXKA 5HFIA 1HNBA 2Z9SA 2IFQA 5A4WA 4K2DA 1FVJA 2DSAA 2EFHA 4JR6A 2O3EA 5DJMA 1V40A 3CHXC 1HNCA 1BF5A 14GSA 5F07A 1OC9A 3D5JA 1YVLA 1TOFA 2IIYA 5ELGA 4ID0A 4POLA 4PQ1A 1XWAA 4MF7A 3ZVJA 3LXZA 2XC2A 4DEJA 1A2LA 2OBIA 17GSA 4WR5A 3ZFBA 3A2XA 4BVXA 1FAAA 3C7MA 4G01A 1RW1A 4GLTA 5JCUA 2GVPA 4V1Ap 3O3TA 1NW2A 1V58A 1K0BA 3APSA 4DSRA 1PSQA 5CP1A 1GSYA 4ILFA 1EV4A 3LEFA 3P2AA 3ERFA 2ZUPA 2FWEA 1SJIA 3VWXA 4V1Ag 1I5GA 3DIEA 1LBKA 3UVTA 2IMFA 2C1YA 3GKNA 4FQUA 1A23A 4YAPA 4MLYA 3SBCA 2YZHA 4X1UA 2DKHA 2X49A 2MMAA 2IJYA 4JZQA 2DJJA 1Y1UA 2WVYA 4DVCA 1SU9A 2CAQA 2XPDA 4G19A 3TJGA 4YQMA 1Z7PA 4CDOA 2NDOA 4PXOA 5C04A 3MIXA 2H0IA 3IBHA 1I9DA 4NWYA
chains in the Genus database with same CATH topology
4Z2RA 3L9SA 3QMXA 3GKXA 4G9HA 4ACSA 4ZL9A 4Q5RA 4MZWA 2V2GA 3F9UA 3C8EA 2E2MA 3V1WA 2KP2A 5B7CA 3EWLA 3IRAA 3WD6A 3DWVA 2WULA 2HI7A 3GH9A 2P5QA 5AN1A 2VLUA 4V2LA 3HCZA 2LJAA 1SD8A 1GUHA 3FR6A 2RIIA 5LD0A 1QUWA 4PGTA 1PGTA 5F0GA 1K3LA 3ZIVA 2BTOT 2RM6A 2H71A 4LL1B 1YY7A 1A2JA 1XFLA 2X8HA 2N5AA 5J3RA 4MH3A 3BOAA 3W6GA 2PN8A 4OCEA 2OE3A 1PL1A 2H70A 2YV7A 3GKMA 4ICYA 3TRQA 3VK9A 1B48A 2DMMA 5KOWA 1Q4JA 4HI7A 2L4CA 2I1UA 1CQGA 2YJHA 2LNTA 1EP7A 1XWCA 1EV9A 1PL2A 5CRDA 3U5RE 1WRYA 3GSTA 2NBSA 1B4QA 3HVVA 1GRXA 3MAKA 5HR2A 4XS4B 2ON7A 3Q19A 1PMTA 6GSYA 1TJDA 1G0TA 3KMOA 3TB2A 5IQYA 2I9HA 3KD0A 2H73A 2DLXA 1GWCA 3HDCA 1M9BA 1WWJA 2CVBA 4BL7B 4J56E 3H4KA 5D9VA 3D4TA 5ABRA 4Z2UA 4FYBA 5GAPD 3ERGA 1TRVA 3A2WA 4MH2A 1K0OA 4E68A 1MDIA 1WP0A 2AB6A 1UN2A 1SK1A 3VWVA 2VLVA 2A4VA 1HD2A 1NHOA 3GX8A 4ZB6A 3NIVA 1A0RP 2MMZA 3SWLA 2GTUA 1FW1A 2NTOA 5JWOB 2MMNA 1GNWA 3ME8A 2L4QA 4MK3A 1A24A 3O6TA 4TR4A 1Y25A 4HZ4A 4O5RA 2YV9A 3KM6A 1PQNA 2DMLA 2FHEA 3H1NA 3R3EA 1QK8A 4MPGA 3F6DA 3WGDA 2YANA 4EDYA 2O89A 2QC7A 3CSHA 4H86A 4ZBAA 3FY7A 1ON4A 4N10A 3ERWA 4ECIA 5ECKB 3TKSE 2QA2A 3H79A 2JZRA 4PNGA 4TXOB 5D73A 1UC7A 3G9BA 3D22A 4PQHA 4NAXA 1F6MC 3J7Yk 3LJRA 2LUSA 4ZBBA 2R4VA 5IMZA 5A5HB 5D96A 5EL8A 3F4RA 3CRUA 3UOMA 4AJ6A 2EIOA 1EGOA 1X9WB 2C0GA 4KW6A 1N25A 4WBRD 4XTSA 3F3QA 4HJMA 4QL9A 4GSTA 1THXA 2DKIA 1S3DA 1HQOA 1MTCA 2E0QA 2GS3A 4QL7A 1G6WA 1QMVA 3WT2A 5IMVA 3M3MA 1R7HA 4KSMA 4GXZA 2H76A 2DIYA 1B4PA 2L6DA 3BBYA 3HJPA 4KDXA 2C0FA 3MDKA 1BG5A 6GSUA 2VCQA 4XS4A 1WIKA 1IYHA 4HZ2A 1UVZA 4KUNA 2LEGA 1SL1B 5DJLA 3LSZA 2HZFA 3KTBA 1R4WA 2HSYA 5J40A 2B6MA 4PURA 4JR4A 5KN3A 4N0VA 1GSSA 1GSDA 1SVMA 3GFKA 1VF2A 3ZTLA 5C00A 5EVOA 3F8UA 2CT6A 5FHIA 4WF4A 2VCTA 4BL7A 1TK5B 5CRHA 1T1VA 3A2VA 1BAYA 2HSMB 3TKQA 2GT6A 2K8SA 2UV8G 2M80A 4L5OA 2DIZA 1SK2A 1ACVA 5A34B 5BMUB 5ECMB 4X4JA 1OE7A 2OKAA 1GH2A 1W89A 18GSA 1V57A 2MYGA 1TRUA 1H75A 2H0HA 1SKWB 1JFUA 5B6NA 3M8NA 3IC4A 3APQA 3G7YA 2EFDA 2HZEB 2YZUA 2GQMA 4HDEA 2G0FA 1K0AA 1KBNA 3TDGA 2YJ7A 3H8QA 4IJIA 1R26A 5J47A 4QMKA 1GUKA 4O5QA 4IW9A 1EEMA 5CO3A 3HJMA 5A1NB 4OO5A 4HS1A 4MJEA 2CAIA 1PA3A 4EUYA 1K0CA 1SJ6A 1ZYNA 3GHAA 2R37A 3UEMA 2PUKC 1VF1A 3DXBA 3W8JA 3TKPA 3DMLA 4IHUA 3MNGA 1URMA 4AJ8A 2A2RA 5B8AA 5IOXA 2XPEA 2FLSA 1M2BA 4TXOA 3LYKA 3IHQA 2HQTA 4K6XA 2JADA 6GSVA 2GT5A 1X9SB 5A5HA 4I2UA 2C0EA 2GSTA 4BPYA 1PD21 1O7UA 2EFCA 3VWWA 4N11A 3GUSA 1M2DA 4I6XA 3KXOA 3LQ7A 2P5RA 1XW6A 4BWQA 2HRKB 4WETA 5J5NA 3EYTA 4XCSA 3DEXA 2L6CA 3FK8A 4POMA 5JWRB 4P3YB 3PH9A 4MJBA 3TJBA 4GDFA 1ERUA 2IN3A 3PPUA 4WEYA 1XZOA 2X99A 3APOA 1TRWA 5IO0A 1J0FA 2YCDA 6GSSA 4K7OA 1G7EA 4PQIA 4O5UA 1YZXA 5KN2A 2H6XA 4N0ZA 1JLVA 4MNNA 1K0DA 3GURA 2V6OA 3FZ9A 3GYKA 8GSSA 2GZYA 2RUFA 2PBJA 4K2XA 4A5PA 3TKSC 1VRSD 2VM1A 3ZYWA 1GUMA 1QFNA 4CY8A 4FH8A 1PN9A 4MP4A 3A3TA 1QQ2A 3WT1A 4K8MA 1CQHA 4PTSA 4N3ZA 2XHFA 3KGKA 2KUCA 5A5KA 2GDRA 3LFLA 4G0LA 1B9XC 3P7XA 4GRFA 4K5SA 5CREA 2HSMA 3HA9A 1KTEA 2G2QA 2BJXA 1Y6EA 1MEKA 4AI6A 1OYJA 3I6AA 3HYPA 1KNGA 4WBJA 4QQ7A 3H93A 5A34A 3EE2A 5BMUA 3ED3A 3EURA 5AIVA 1BQ7A 1DE2A 5H5RA 3FYGA 1RK4A 4DSQA 1TP9A 1F9MA 4OFNA 4KAEA 1U88A 3RAZA 2HZEA 2NVLA 3VLNA 2F51A 3HHVA 3KEBA 5A4UA 2H8LA 1JLWA 5H5QA 2MZCA 3GX0A 2DJ1A 3VFIA 3L9UA 3LGCA 4Z7XA 5IPGA 3GIXA 3GMFA 2O87A 5A1NA 2F8AA 2VUPA 3FR9A 2B7JA 4I2TA 4OMVA 2V6KA 4EIPA 2B5EA 2JACA 3TRXA 4I8BA 2H0GA 4KDYA 5CAXA 1SL2B 1EP8A 4AKXB 3DRNA 3L4NA 4L5LA 1Z6MA 2H1LA 1FVKA 3GH6A 2X8CA 2A2PA 4TRXA 1Z9HA 3N5OA 4FO5A 3GTUB 4ZXGA 2HRNA 4OFMA 5HFKA 4TR0A 3ZIJA 4KSOA 5IMAA 2L5OA 4PUFC 3M0FA 2N5BA 4KCAA 3PR8A 1LJRA 5JWQB 1U87A 2HE3A 1FG4A 3UJ1A 1ILOA 6GSWA 2HRKA 3TOUA 3IOSA 2TRCP 1GLQA 4KB3A 3G7IA 4JE1A 3D6IA 13GSA 3IV4A 1X0RA 3TKSA 3IXRA 4IQAA 4G0KA 3BCIA 2LSTA 5D9TA 1OKDA 3BCKA 4KGIA 2O8VB 4NV2A 5CRGA 2FWGA 1A2MA 5J4UA 4I5QA 1PN0A 5G30A 4TN8A 4BA7A 1USBA 3GNJA 4WXTA 2V32A 3PINA 5IMDA 5CYYA 4JBBA 3VPQA 3KIJA 3UMAA 3CRTA 4NHWA 1T4YA 5ECSA 1TW9A 2I4AA 5G1KA 4MCUA 3HY2A 4POKA 1XIYA 1M0UA 4OWYA 3NOFA 1T3BA 4EO3A 3BJ5A 1OE8A 3DVWA 5AIXA 3GKKA 1Z3EA 4F0CA 3LW9A 2C3NA 2DBCA 2FWFA 3TJFA 11GSA 3VI5A 1T00A 1Z6NA 1JZWA 2OJLA 4CW9A 4K7NA 1SJZA 2LRCA 2C3QA 3FR3A 2FCHA 4IVFA 2VKZG 1ZYPA 3C1RA 4J2FA 2H6YA 2IMEA 1DE1A 5G2ZA 1BYEA 5DALB 5G5EA 5EY6A 1M2AA 3KMNA 5DCGA 2YN1A 3EPTA 1V9WA 1MDJA 1GNEA 5G31A 3J7Yb 5IMCA 5ECOB 4ZL8A 2QSIA 2EIRA 4K0NA 2IMIA 4EVMA 4TXVA 1JZDA 1ZYQB 4PNFA 3EU3A 2IMDA 2H1DA 2C0DA 1A8YA 4MDCA 3CTFA 3GN3A 4YQUA 3FEUA 5B8BA 3FHKA 2REMA 4KCEA 5ECNB 1A0FA 4KE3A 2OE1A 3GV1A 1U6TA 5D9XA 2GSQA 3AY8A 1X5CA 3EU4A 4F2IA 1O81A 1J08A 3CMIA 3GTUA 3R2QA 2YWIA 1O73A 3I9V2 4MZCA 4NXIA 4ECJA 3CSJA 2UZ8A 1EEJA 5FWGA 4MZBA 3WGEA 2HNLA 4USSA 3HKRA 2PVOC 1E2YA 2B1KA 5HQPA 3FZ4A 1XVWA 2WRTA 1ZL9A 2RM5A 2KOKA 4WF5A 3OR5A 1K0MA 4RI6A 2MMOA 1AUCA 1GTUA 2DJ2A 4HUAA 2E2GA 3I69A 4GSSA 4MJAA 2CZ3A 1F3AA 2TIRA 4K7IA 3IPZA 4XIHA 2LTKA 2F3MA 1RQMA 1EOGA 3IAM2 3HMJG 20GSA 3EC3A 4PUAA 1T7PB 4NV5A 3FZ5A 4OCFA 4G0IA 3P90A 2H1GA 5DBQA 2LRNA 3G7JA 2O85A 3UVHA 2VL2C 2YNXA 1O85A 1JZRA 4GQCA 3NZNA 2L57A 2R5GA 2GGTA 2DJ3A 5KEJA 3TCOA 3I43A 4JRRA 4NHZA 5E4WA 5ELAA 2K6VA 3US3A 2H01A 1EZKA 1SD9A 4ECBA 2VCWA 3ISOA 2WS2A 5KN1A 2OT3A 2OBKA 4BWSA 5HFGA 5L71A 4CY6A 5HR3A 1GP1A 1TU8A 3UAPA 5DAKB 1XBSA 2QKEA 4EXJA 1O6JA 5ECPB 1TU7A 4BVYB 3WYWA 4F03A 2EIQA 2AUVA 2R0GA 2HFDA 3KH9A 2VIMA 5DALA 4KF9A 1HNAA 5G5FA 2OE0A 2K18A 3BD2A 1ZMAA 3ZVJD 1YQ1A 3E0UA 2N5FA 1GSEA 4WR4A 1LU4A 2A2SA 2I81A 2HSHA 5AGYA 3ZFLA 2L5LA 3HD5A 3LORA 1VGLA 2AYTA 5ENUA 2KP1A 1GTIA 3LWAA 2GZPA 4ZB8A 4EKZA 2XBIA 2E7PA 2YWOA 4EF0A 3RBTA 2O5VA 4EE0A 1K0NA 1ST9A 3VPTA 1ZGNA 3KP8A 4ML6A 3MYDA 5CRWA 1G7OA 3A5IA 3Q18A 1AAZA 3FRCA 5JCWA 2VO4A 4ML1A 2JZTA 1VF4A 1W4VA 2H72A 3F0IA 4MF5A 5F8BA 1Q98A 3TJKA 2CA8A 1ERTA 3C73A 3ZRDA 1ERWA 1GSQA 4F0BA 4ULXA 2MBTA 3EVIA 1YJ6A 5DQYA 3MWHA 3D21A 4HQZA 1TTZA 3Q74A 2LS5A 1PKWA 2ON5A 2WB9A 2J9HA 4AKIA 1WPIA 19GSA 3DKSA 5B6MA 2OACA 2VCZA 1F37A 4Q5FA 4GQFA 2TRXA 4E8EA 1PX6A 1QXHA 3GL3A 4PX1A 3ZITA 2QGVA 1XWKA 1K3YA 3F63A 2H75A 1SL0B 3K8NA 1SKSB 4AJ7A 2GZZA 2HLSA 2H1BA 3M1GA 1XWGA 4FIWA 4HQSA 5EPFA 5J41A 5DQSA 1FOVA 3F3RA 2B5XA 1XOBA 3CYNA 2OADA 4ZILA 1E6BA 2M46A 5COHA 1THOA 3KZQA 2IMKA 1GSUA 2IPAA 5J9BA 3UBLA 3GSSA 4NPBA 3RDWA 2ES7A 2FGXA 2RLIA 5IIZA 4JU5A 4KX4A 1FHEA 5ID2B 2B5YA 6GSXA 4LL4B 2C80A 4HJ2A 4YH2A 2IWTA 1TXUA 5DAKA 1T8EB 3IK9A 1U3IA 4K0GA 1A8LA 5F06A 2R0PA 3RHBA 1X5EA 4BVYA 2K9FA 2A4HA 2CX4A 2HSNB 4ZIJA 2HRAA 5IM9A 3ZL5A 5GZZB 1QGVA 3CTGA 4YKGA 4O32A 3EINA 1ABAA 4RQRA 4EL1A 1BEDA 3IDVA 4XS6A 4LMVA 3ME7A 2F9SA 1GTBA 3QFBC 4TKYA 1TXXA 2MBSA 6GSTA 2B1LA 3C71A 1SYRA 2ZCTA 3QR6A 4ZL7A 3KCMA 3TGZA 3HVSA 3IAS2 2WGRA 3ZMLA 4Z2TA 3FZAA 2X64A 2RUEA 1AQXA 1ZYEA 2AJQB 2BMXA 4IGJA 5GSTA 1R5AA 1MD3A 1PRXA 1YKCA 1J9BA 5ECLB 3IHGA 5JCGA 3QOUA 4E8HA 4IP6A 2O7KA 4ZBDA 1V98A 1O8XA 2LKUA 2GSSA 4TR1B 4ZB9A 3ZZXA 2VD0A 1KEBA 5IOWA 4IN0A 5HR1A 5LNKe 4K9ZA 4HU9A 2M72A 3GL5A 1EOHA 2WFCA 4N30A 4GCIA 1X9MB 4MPFA 1MDKA 1FO5A 5G1LA 16GSA 5KOXA 4X43A 2PPTA 4X0XA 3IA1A 1XVQA 1N2AA 2R2JA 2AHEA 2GLRA 4OFTA 2VM2A 1N8JA 2V41A 1TKDB 1NHYA 4EIQA 2PMTA 2AAWA 3W8SA 3CWGA 1AQWA 1BX9A 2PVQA 3KJYA 1XW9A 3S9FA 5ECIB 2LQOA 3QAVA 2LJRA 3UIWA 5GSSA 4WKWA 3VI7A 4TR3A 3L0HA 2C3TA 2KHPA 22GSA 3KP9A 2YP6A 4YQVA 4GSNA 2X4AA 4AKGA 3PGTA 1EGRA 4O92A 1MD4A 1WE0A 4W66A 4V2NA 1F2EA 5IO2A 10GSA 5ID2A 3FKFA 4EC0A 1DBYA 1XXUA 1OAZA 4IKHA 2JL4A 1S3AA 1K3OA 4YKFA 1AQVA 3TOTA 4AF2A 3M9JA 2VOCA 3LYPA 4ECCA 2AV4A 2DJKA 1ZOFA 4LLRA 2D2ZA 2HSNA 2FUG2 2VCXA 3E9JB 4J57E 4IELA 3IE3A 1AXDA 3KTLA 1YEPA 3TJJA 3VWUA 4IQ1A 1IYIA 1YF0A 3WGXA 4TVEA 4K1FA 2CVKA 4JEDA 2NPBA 3RPPA 3D4MA 2JZSA 3VURA 2IL3A 1B9YC 1XPVA 2LNSA 3RPNA 4D73B 4IS0A 1JHBA 3CXGA 3GA4A 3F4TA 3HJOA 3QAGA 4DSSB 2GQKA 2LQQA 2R0CA 3U6VA 5D9WA 2PGTA 5H5SA 2YWNA 3DD3A 4OO4A 5DVBA 1SVLA 2CQ9A 3QD9A 5KN0A 4RUVA 3LG6A 4MABA 1TK8B 1OKTA 3TUEA 4TOPA 2I3YA 4HEA2 4KA0A 5BRTA 2V1MA 3ZMKA 1GULA 4YAVA 4MMMA 5E59A 2VL3A 3GRXA 1BJXA 4XRAA 1ML6A 4TR1A 4L8EA 3D0ZA 1OC3A 1UA5A 1TDIA 9GSSA 1H4OA 2F8FA 2R3XA 4I97A 1XWBA 2HYXA 4CHSA 3TKRA 2WCIA 2L59A 3QAWA 2PERA 2YOIA 5DCHA 1S3CA 1JZOA 4MJCA 2ZNMA 2X8GA 2QA1A 5A4VA 1Z5YE 3LXTA 2R6KA 2CZ2A 4FYCA 4XS1A 3IR4A 2LRTA 4L0UA 1OC8A 2P0GA 1DUGA 1T4ZA 1B8XA 5D8IA 3Q6OA 2H30A 1SENA 1DSBA 4IP1A 2WJUA 1G6YA 3RHCA 1WJKA 3QFAC 3ZLPA 2VD1A 1AW9A 4V2MA 1Z7RA 4G2EA 1OVNA 1XW5A 2GSRA 1NM3A 2H74A 1EWXA 1YF1A 1GLPA 2IFQB 2LV3A 2OA7A 2EFEA 3UL3A 3C1SA 4RI7A 1ZZYA 4ZB7A 3TU3B 3UBKA 4Q5NA 2K8VA 3N9JA 4IJ3A 5J4VA 3ZREA 4ISDA 5J9CA 1OC9B 2HT9A 3O76A 2ALBA 2JSZA 3FMWA 3L78A 1M99A 4L0WA 5AISA 7GSSA 2DJ0A 2HRFA 1SK0A 4POBA 2KLXA 2PU9C 5CNWA 4XRDA 4AGSA 4BVXB 1YEXA 2GQLA 5D93A 5INYA 2CX3A 1VF3A 5FT3A 1HYUA 5ECHB 4F9ZA 3EMXA 4AKHA 1GTAA 2H1AA 3HZ4A 2C8UA 4O7HA 5IMFA 4F82A 2P31A 1V2AA 2CVDA 2XBQA 1SYXA 2VLTA 2FA4A 1GL8A 5ECQB 2H19A 2YWMA 1TRSA 2PWJA 1ERVA 3E3EA 4EDZA 4LMWA 1XCCA 4D73A 1WMJA 2DC5A 1M9AA 5J4YA 3L9VA 4DSSA 1NSWA 2WZ9A 5F05A 5ECRB 4K5RA 2FY6A 3IK7A 3CSIA 1U3AA 4HOJA 1ZCPA 1R5PA 3M9KA 1FB0A 3IC8A 5LCZA 3F4SA 1BG1A 4FYUA 12GSA 2CV4A 1O8WA 2WDUA 2FD3A 3DVXA 2EC4A 2H66A 3QCPA 5HR0A 2FA8A 1PKZA 4KDUA 2YPMA 1C72A 1GSFA 3CBUA 1PX7A 5IPHA 2FNOA 4GTUA 4NMUA 4RQXA 1TK0B 3HZ8A 4Q5QA 2JU5A 3HVXA 3TRPA 2FWHA 1YKAA 5DDLA 1AIUA 1TI3A 4HU7A 3HXSA 3F6FA 3DGQA 1AC1A 3FW2A 2VAFA 3JCML 1YDKA 1SKRB 4KNDA 2C4JA 4MA9A 3UARA 2LJKA 1FB6A 2H6ZA 4GWRA 1TI1A 1FOHA 2VL2A 4KH7A 2B3SA 2JSYA 3MSZA 4OD7A 5GAND 3DYRA 3QDNA 1F3BA 2B7KA 1XOAA 4LA1A 4XHMA 1SVOA 3A5WA 4TW5A 2J23A 2VL9A 3QPMA 1X5DA 3P8WA 3KH7A 4MF6A 2VCVA 1WOUA 3EMPA 4GF0A 1M7TA 4G10A 4IBPA 2HXKA 5HFIA 1HNBA 2Z9SA 2IFQA 5A4WA 4K2DA 1FVJA 2DSAA 2EFHA 4JR6A 5DJMA 1V40A 1HNCA 1BF5A 14GSA 5F07A 1OC9A 3D5JA 1YVLA 1TOFA 2IIYA 5ELGA 4ID0A 4POLA 4PQ1A 1XWAA 4MF7A 3ZVJA 3LXZA 2XC2A 4DEJA 1A2LA 2OBIA 17GSA 4WR5A 3ZFBA 3A2XA 4BVXA 1FAAA 3C7MA 4G01A 1RW1A 4GLTA 5JCUA 2GVPA 4V1Ap 3O3TA 1NW2A 1V58A 1K0BA 3APSA 4DSRA 1PSQA 5CP1A 1GSYA 4ILFA 1EV4A 3LEFA 3P2AA 3ERFA 2ZUPA 2FWEA 1SJIA 3VWXA 4V1Ag 1I5GA 3DIEA 1LBKA 3UVTA 2IMFA 2C1YA 3GKNA 4FQUA 1A23A 4YAPA 4MLYA 3SBCA 2YZHA 4X1UA 2DKHA 2X49A 2MMAA 2IJYA 4JZQA 2DJJA 1Y1UA 4DVCA 1SU9A 2CAQA 2XPDA 4G19A 3TJGA 4YQMA 1Z7PA 4CDOA 2NDOA 4PXOA 5C04A 3MIXA 2H0IA 3IBHA 1I9DA 4NWYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L9S A;  3QMX A;  3GKX A;  4G9H A;  4ACS A;  4ZL9 A;  4Q5R A;  4MZW A;  2V2G A;  3F9U A;  3C8E A;  2E2M A;  3V1W A;  2KP2 A;  5B7C A;  3EWL A;  3IRA A;  3WD6 A;  3DWV A;  2WUL A;  2HI7 A;  3GH9 A;  2P5Q A;  5AN1 A;  2VLU A;  4V2L A;  3HCZ A;  2LJA A;  1SD8 A;  1GUH A;  3FR6 A;  2RII A;  5LD0 A;  1QUW A;  4PGT A;  1PGT A;  5F0G A;  1K3L A;  3ZIV A;  2BTO T;  2RM6 A;  2H71 A;  4LL1 B;  1YY7 A;  1A2J A;  1XFL A;  2X8H A;  2N5A A;  5J3R A;  4MH3 A;  3BOA A;  3W6G A;  2PN8 A;  4OCE A;  2OE3 A;  1PL1 A;  2H70 A;  2YV7 A;  3GKM A;  3TRQ A;  3VK9 A;  1B48 A;  2DMM A;  1Q4J A;  4HI7 A;  2L4C A;  2I1U A;  1CQG A;  2YJH A;  2LNT A;  1EP7 A;  1XWC A;  1EV9 A;  1PL2 A;  5CRD A;  3U5R E;  1WRY A;  3GST A;  2NBS A;  1B4Q A;  3HVV A;  1GRX A;  3MAK A;  5HR2 A;  4XS4 B;  2ON7 A;  3Q19 A;  1PMT A;  6GSY A;  1TJD A;  1G0T A;  3KMO A;  3TB2 A;  5IQY A;  2I9H A;  3KD0 A;  2H73 A;  2DLX A;  1GWC A;  3HDC A;  1M9B A;  1WWJ A;  2CVB A;  4BL7 B;  4J56 E;  3H4K A;  5D9V A;  3D4T A;  5ABR A;  4FYB A;  5GAP D;  3ERG A;  1TRV A;  3A2W A;  4MH2 A;  1K0O A;  1MDI A;  1WP0 A;  2AB6 A;  1UN2 A;  1SK1 A;  3VWV A;  2VLV A;  2A4V A;  1HD2 A;  1NHO A;  3GX8 A;  4ZB6 A;  3NIV A;  1A0R P;  2MMZ A;  3SWL A;  2GTU A;  1FW1 A;  2NTO A;  5JWO B;  2MMN A;  1GNW A;  3ME8 A;  2L4Q A;  4MK3 A;  1A24 A;  3O6T A;  4TR4 A;  1Y25 A;  4HZ4 A;  4O5R A;  2YV9 A;  3KM6 A;  1PQN A;  2DML A;  2FHE A;  3H1N A;  3R3E A;  1QK8 A;  4MPG A;  3F6D A;  3WGD A;  2YAN A;  4EDY A;  2O89 A;  2QC7 A;  3CSH A;  4H86 A;  4ZBA A;  3FY7 A;  1ON4 A;  4N10 A;  3ERW A;  4ECI A;  5ECK B;  3TKS E;  3H79 A;  2JZR A;  4PNG A;  4TXO B;  5D73 A;  1UC7 A;  3G9B A;  3D22 A;  4PQH A;  4NAX A;  1F6M C;  3J7Y k;  3LJR A;  2LUS A;  4ZBB A;  2R4V A;  5IMZ A;  5D96 A;  5EL8 A;  3F4R A;  3CRU A;  3UOM A;  4AJ6 A;  2EIO A;  1EGO A;  1X9W B;  2C0G A;  4KW6 A;  4WBR D;  4XTS A;  3F3Q A;  4HJM A;  4QL9 A;  4GST A;  1THX A;  1S3D A;  1HQO A;  1MTC A;  2E0Q A;  2GS3 A;  4QL7 A;  1G6W A;  1QMV A;  3WT2 A;  5IMV A;  3M3M A;  1R7H A;  4KSM A;  4GXZ A;  2H76 A;  2DIY A;  1B4P A;  2L6D A;  3BBY A;  3HJP A;  4KDX A;  2C0F A;  3MDK A;  1BG5 A;  6GSU A;  2VCQ A;  4XS4 A;  1WIK A;  1IYH A;  4HZ2 A;  1UVZ A;  4KUN A;  2LEG A;  1SL1 B;  5DJL A;  3LSZ A;  2HZF A;  3KTB A;  1R4W A;  2HSY A;  2B6M A;  4PUR A;  4JR4 A;  5KN3 A;  4N0V A;  1GSS A;  1GSD A;  3GFK A;  1VF2 A;  3ZTL A;  5C00 A;  5EVO A;  3F8U A;  2CT6 A;  5FHI A;  4WF4 A;  2VCT A;  4BL7 A;  1TK5 B;  5CRH A;  1T1V A;  3A2V A;  1BAY A;  2HSM B;  3TKQ A;  2GT6 A;  2K8S A;  2M80 A;  4L5O A;  2DIZ A;  1SK2 A;  1ACV A;  5ECM B;  1OE7 A;  2OKA A;  1GH2 A;  1W89 A;  18GS A;  1V57 A;  2MYG A;  1TRU A;  1H75 A;  2H0H A;  1SKW B;  1JFU A;  5B6N A;  3M8N A;  3IC4 A;  3APQ A;  3G7Y A;  2HZE B;  2YZU A;  2GQM A;  4HDE A;  2G0F A;  1K0A A;  1KBN A;  3TDG A;  2YJ7 A;  3H8Q A;  4IJI A;  1R26 A;  1GUK A;  4IW9 A;  1EEM A;  5CO3 A;  3HJM A;  4OO5 A;  4HS1 A;  4MJE A;  2CAI A;  1PA3 A;  4EUY A;  1K0C A;  1SJ6 A;  3GHA A;  2R37 A;  3UEM A;  2PUK C;  1VF1 A;  3DXB A;  3W8J A;  3TKP A;  3DML A;  4IHU A;  3MNG A;  1URM A;  4AJ8 A;  2A2R A;  5B8A A;  5IOX A;  2XPE A;  2FLS A;  1M2B A;  4TXO A;  3LYK A;  3IHQ A;  2HQT A;  4K6X A;  2JAD A;  6GSV A;  2GT5 A;  1X9S B;  4I2U A;  2C0E A;  2GST A;  4BPY A;  1PD2 1;  1O7U A;  3VWW A;  4N11 A;  3GUS A;  1M2D A;  4I6X A;  3KXO A;  3LQ7 A;  2P5R A;  1XW6 A;  4BWQ A;  2HRK B;  4WET A;  5J5N A;  3EYT A;  4XCS A;  3DEX A;  2L6C A;  3FK8 A;  4POM A;  5JWR B;  4P3Y B;  3PH9 A;  4MJB A;  3TJB A;  1ERU A;  2IN3 A;  3PPU A;  4WEY A;  1XZO A;  2X99 A;  3APO A;  1TRW A;  5IO0 A;  1J0F A;  2YCD A;  6GSS A;  4K7O A;  1G7E A;  4PQI A;  1YZX A;  5KN2 A;  2H6X A;  4N0Z A;  1JLV A;  1K0D A;  3GUR A;  2V6O A;  3FZ9 A;  3GYK A;  8GSS A;  2GZY A;  2RUF A;  2PBJ A;  3TKS C;  1VRS D;  2VM1 A;  3ZYW A;  1GUM A;  1QFN A;  4FH8 A;  1PN9 A;  4MP4 A;  3A3T A;  1QQ2 A;  3WT1 A;  4K8M A;  1CQH A;  4PTS A;  2XHF A;  3KGK A;  2KUC A;  5A5K A;  2GDR A;  3LFL A;  4G0L A;  1B9X C;  3P7X A;  4GRF A;  5CRE A;  2HSM A;  3HA9 A;  1KTE A;  2G2Q A;  2BJX A;  1Y6E A;  1MEK A;  1OYJ A;  3I6A A;  3HYP A;  1KNG A;  4WBJ A;  4QQ7 A;  3H93 A;  3EE2 A;  5BMU A;  3ED3 A;  3EUR A;  5AIV A;  1BQ7 A;  1DE2 A;  5H5R A;  3FYG A;  1RK4 A;  4DSQ A;  1TP9 A;  1F9M A;  4OFN A;  4KAE A;  1U88 A;  3RAZ A;  2HZE A;  2NVL A;  3VLN A;  2F51 A;  3HHV A;  3KEB A;  5A4U A;  2H8L A;  1JLW A;  5H5Q A;  2MZC A;  3GX0 A;  2DJ1 A;  3VFI A;  3L9U A;  3LGC A;  4Z7X A;  5IPG A;  3GIX A;  3GMF A;  2O87 A;  2F8A A;  2VUP A;  3FR9 A;  2B7J A;  4I2T A;  4OMV A;  2V6K A;  2B5E A;  2JAC A;  3TRX A;  4I8B A;  2H0G A;  4KDY A;  5CAX A;  1SL2 B;  1EP8 A;  3DRN A;  3L4N A;  4L5L A;  1Z6M A;  1FVK A;  3GH6 A;  2X8C A;  4TRX A;  1Z9H A;  3N5O A;  4FO5 A;  3GTU B;  4ZXG A;  2HRN A;  4OFM A;  5HFK A;  4TR0 A;  3ZIJ A;  4KSO A;  5IMA A;  2L5O A;  4PUF C;  3M0F A;  2N5B A;  4KCA A;  3PR8 A;  1LJR A;  5JWQ B;  1U87 A;  2HE3 A;  1FG4 A;  3UJ1 A;  1ILO A;  6GSW A;  2HRK A;  3TOU A;  3IOS A;  2TRC P;  1GLQ A;  4KB3 A;  3G7I A;  4JE1 A;  3D6I A;  13GS A;  3IV4 A;  1X0R A;  3TKS A;  3IXR A;  4IQA A;  4G0K A;  3BCI A;  2LST A;  5D9T A;  1OKD A;  3BCK A;  4KGI A;  2O8V B;  4NV2 A;  5CRG A;  2FWG A;  1A2M A;  5J4U A;  4I5Q A;  5G30 A;  4TN8 A;  4BA7 A;  1USB A;  3GNJ A;  4WXT A;  2V32 A;  3PIN A;  5IMD A;  5CYY A;  4JBB A;  3VPQ A;  3KIJ A;  3UMA A;  3CRT A;  4NHW A;  1T4Y A;  5ECS A;  1TW9 A;  2I4A A;  5G1K A;  4MCU A;  3HY2 A;  4POK A;  1XIY A;  1M0U A;  4OWY A;  3NOF A;  1T3B A;  4EO3 A;  3BJ5 A;  1OE8 A;  3DVW A;  5AIX A;  3GKK A;  1Z3E A;  4F0C A;  2C3N A;  2DBC A;  2FWF A;  3TJF A;  11GS A;  3VI5 A;  1T00 A;  1Z6N A;  1JZW A;  2OJL A;  4CW9 A;  4K7N A;  1SJZ A;  2LRC A;  2C3Q A;  3FR3 A;  2FCH A;  4IVF A;  3C1R A;  4J2F A;  2H6Y A;  2IME A;  1DE1 A;  5G2Z A;  1BYE A;  5DAL B;  5G5E A;  5EY6 A;  1M2A A;  3KMN A;  5DCG A;  2YN1 A;  1V9W A;  1MDJ A;  1GNE A;  5G31 A;  3J7Y b;  5IMC A;  5ECO B;  4ZL8 A;  2QSI A;  2EIR A;  4K0N A;  2IMI A;  4EVM A;  4TXV A;  1JZD A;  1ZYQ B;  4PNF A;  3EU3 A;  2IMD A;  2H1D A;  2C0D A;  1A8Y A;  4MDC A;  3CTF A;  3GN3 A;  4YQU A;  3FEU A;  5B8B A;  3FHK A;  2REM A;  4KCE A;  5ECN B;  1A0F A;  4KE3 A;  2OE1 A;  3GV1 A;  1U6T A;  5D9X A;  2GSQ A;  3AY8 A;  1X5C A;  3EU4 A;  4F2I A;  1O81 A;  1J08 A;  3CMI A;  3GTU A;  3R2Q A;  2YWI A;  1O73 A;  3I9V 2;  4MZC A;  4NXI A;  4ECJ A;  3CSJ A;  2UZ8 A;  1EEJ A;  5FWG A;  4MZB A;  3WGE A;  2HNL A;  4USS A;  3HKR A;  2PVO C;  1E2Y A;  2B1K A;  5HQP A;  3FZ4 A;  1XVW A;  2WRT A;  1ZL9 A;  2RM5 A;  2KOK A;  4WF5 A;  3OR5 A;  1K0M A;  4RI6 A;  2MMO A;  1AUC A;  1GTU A;  2DJ2 A;  4HUA A;  2E2G A;  3I69 A;  4GSS A;  4MJA A;  2CZ3 A;  1F3A A;  2TIR A;  4K7I A;  3IPZ A;  4XIH A;  2LTK A;  2F3M A;  1RQM A;  1EOG A;  3IAM 2;  20GS A;  3EC3 A;  4PUA A;  1T7P B;  4NV5 A;  3FZ5 A;  4OCF A;  4G0I A;  3P90 A;  2H1G A;  5DBQ A;  2LRN A;  3G7J A;  2O85 A;  3UVH A;  2VL2 C;  2YNX A;  1O85 A;  1JZR A;  4GQC A;  3NZN A;  2L57 A;  2R5G A;  2GGT A;  2DJ3 A;  5KEJ A;  3TCO A;  3I43 A;  4JRR A;  4NHZ A;  5E4W A;  5ELA A;  2K6V A;  3US3 A;  2H01 A;  1EZK A;  1SD9 A;  4ECB A;  2VCW A;  3ISO A;  2WS2 A;  5KN1 A;  2OBK A;  4BWS A;  5HFG A;  5L71 A;  5HR3 A;  1GP1 A;  1TU8 A;  3UAP A;  5DAK B;  1XBS A;  2QKE A;  4EXJ A;  1O6J A;  5ECP B;  1TU7 A;  4BVY B;  3WYW A;  4F03 A;  2EIQ A;  2AUV A;  2HFD A;  3KH9 A;  2VIM A;  5DAL A;  4KF9 A;  1HNA A;  5G5F A;  2OE0 A;  2K18 A;  3BD2 A;  1ZMA A;  3ZVJ D;  1YQ1 A;  3E0U A;  2N5F A;  1GSE A;  4WR4 A;  1LU4 A;  2A2S A;  2I81 A;  2HSH A;  5AGY A;  3ZFL A;  2L5L A;  3HD5 A;  3LOR A;  1VGL A;  2AYT A;  5ENU A;  2KP1 A;  1GTI A;  3LWA A;  2GZP A;  4ZB8 A;  4EKZ A;  2XBI A;  2E7P A;  2YWO A;  4EF0 A;  3RBT A;  4EE0 A;  1K0N A;  1ST9 A;  3VPT A;  1ZGN A;  3KP8 A;  4ML6 A;  5CRW A;  1G7O A;  3Q18 A;  1AAZ A;  3FRC A;  5JCW A;  2VO4 A;  4ML1 A;  2JZT A;  1VF4 A;  1W4V A;  2H72 A;  3F0I A;  4MF5 A;  5F8B A;  1Q98 A;  3TJK A;  2CA8 A;  1ERT A;  3C73 A;  3ZRD A;  1ERW A;  1GSQ A;  4F0B A;  4ULX A;  2MBT A;  3EVI A;  1YJ6 A;  5DQY A;  3MWH A;  3D21 A;  4HQZ A;  1TTZ A;  3Q74 A;  2LS5 A;  1PKW A;  2ON5 A;  2WB9 A;  2J9H A;  1WPI A;  19GS A;  3DKS A;  5B6M A;  2OAC A;  2VCZ A;  1F37 A;  4Q5F A;  4GQF A;  2TRX A;  4E8E A;  1PX6 A;  1QXH A;  3GL3 A;  4PX1 A;  3ZIT A;  2QGV A;  1XWK A;  1K3Y A;  3F63 A;  2H75 A;  1SL0 B;  3K8N A;  1SKS B;  4AJ7 A;  2GZZ A;  2HLS A;  2H1B A;  3M1G A;  1XWG A;  4FIW A;  4HQS A;  5EPF A;  5J41 A;  5DQS A;  1FOV A;  3F3R A;  2B5X A;  1XOB A;  3CYN A;  2OAD A;  4ZIL A;  1E6B A;  2M46 A;  5COH A;  1THO A;  3KZQ A;  2IMK A;  1GSU A;  2IPA A;  5J9B A;  3UBL A;  3GSS A;  4NPB A;  3RDW A;  2ES7 A;  2FGX A;  2RLI A;  5IIZ A;  4JU5 A;  4KX4 A;  1FHE A;  5ID2 B;  2B5Y A;  6GSX A;  4LL4 B;  2C80 A;  4HJ2 A;  4YH2 A;  2IWT A;  5DAK A;  1T8E B;  3IK9 A;  1U3I A;  4K0G A;  1A8L A;  5F06 A;  3RHB A;  1X5E A;  4BVY A;  2K9F A;  2CX4 A;  2HSN B;  4ZIJ A;  2HRA A;  5IM9 A;  3ZL5 A;  5GZZ B;  1QGV A;  3CTG A;  4O32 A;  3EIN A;  1ABA A;  4RQR A;  4EL1 A;  1BED A;  3IDV A;  4XS6 A;  4LMV A;  3ME7 A;  2F9S A;  1GTB A;  3QFB C;  4TKY A;  1TXX A;  2MBS A;  6GST A;  2B1L A;  3C71 A;  1SYR A;  2ZCT A;  3QR6 A;  4ZL7 A;  3KCM A;  3TGZ A;  3HVS A;  3IAS 2;  2WGR A;  3ZML A;  3FZA A;  2X64 A;  2RUE A;  1AQX A;  1ZYE A;  2AJQ B;  2BMX A;  4IGJ A;  5GST A;  1R5A A;  1MD3 A;  1PRX A;  1YKC A;  1J9B A;  5ECL B;  5JCG A;  3QOU A;  4E8H A;  4IP6 A;  2O7K A;  4ZBD A;  1V98 A;  1O8X A;  2LKU A;  2GSS A;  4TR1 B;  4ZB9 A;  3ZZX A;  2VD0 A;  1KEB A;  5IOW A;  4IN0 A;  5HR1 A;  5LNK e;  4K9Z A;  4HU9 A;  2M72 A;  3GL5 A;  1EOH A;  2WFC A;  4N30 A;  4GCI A;  1X9M B;  4MPF A;  1MDK A;  1FO5 A;  5G1L A;  16GS A;  4X43 A;  2PPT A;  4X0X A;  3IA1 A;  1XVQ A;  1N2A A;  2R2J A;  2AHE A;  2GLR A;  4OFT A;  2VM2 A;  1N8J A;  2V41 A;  1TKD B;  1NHY A;  2PMT A;  2AAW A;  3W8S A;  1AQW A;  1BX9 A;  2PVQ A;  3KJY A;  1XW9 A;  3S9F A;  5ECI B;  2LQO A;  3QAV A;  2LJR A;  3UIW A;  5GSS A;  4WKW A;  3VI7 A;  4TR3 A;  3L0H A;  2C3T A;  2KHP A;  22GS A;  3KP9 A;  2YP6 A;  4YQV A;  4GSN A;  3PGT A;  1EGR A;  4O92 A;  1MD4 A;  1WE0 A;  4V2N A;  1F2E A;  5IO2 A;  10GS A;  5ID2 A;  3FKF A;  4EC0 A;  1DBY A;  1XXU A;  1OAZ A;  4IKH A;  2JL4 A;  1S3A A;  1K3O A;  1AQV A;  3TOT A;  4AF2 A;  3M9J A;  2VOC A;  3LYP A;  4ECC A;  2AV4 A;  2DJK A;  1ZOF A;  4LLR A;  2D2Z A;  2FUG 2;  2VCX A;  3E9J B;  4J57 E;  4IEL A;  3IE3 A;  1AXD A;  3KTL A;  1YEP A;  3TJJ A;  3VWU A;  4IQ1 A;  1IYI A;  1YF0 A;  3WGX A;  4TVE A;  4K1F A;  2CVK A;  4JED A;  2NPB A;  3RPP A;  3D4M A;  2JZS A;  3VUR A;  2IL3 A;  1B9Y C;  1XPV A;  2LNS A;  3RPN A;  4D73 B;  4IS0 A;  1JHB A;  3CXG A;  3GA4 A;  3F4T A;  3HJO A;  3QAG A;  4DSS B;  2GQK A;  2LQQ A;  3U6V A;  5D9W A;  2PGT A;  5H5S A;  2YWN A;  3DD3 A;  4OO4 A;  5DVB A;  2CQ9 A;  3QD9 A;  5KN0 A;  4RUV A;  3LG6 A;  4MAB A;  1TK8 B;  1OKT A;  3TUE A;  4TOP A;  2I3Y A;  4HEA 2;  4KA0 A;  2V1M A;  3ZMK A;  1GUL A;  4YAV A;  4MMM A;  5E59 A;  2VL3 A;  3GRX A;  1BJX A;  4XRA A;  1ML6 A;  4TR1 A;  4L8E A;  3D0Z A;  1OC3 A;  1UA5 A;  1TDI A;  9GSS A;  1H4O A;  2F8F A;  2R3X A;  4I97 A;  1XWB A;  2HYX A;  4CHS A;  3TKR A;  2WCI A;  2L59 A;  3QAW A;  2PER A;  2YOI A;  5DCH A;  1S3C A;  1JZO A;  4MJC A;  2ZNM A;  2X8G A;  5A4V A;  1Z5Y E;  3LXT A;  2R6K A;  2CZ2 A;  4FYC A;  4XS1 A;  3IR4 A;  2LRT A;  4L0U A;  1OC8 A;  2P0G A;  1DUG A;  1T4Z A;  1B8X A;  5D8I A;  3Q6O A;  2H30 A;  1SEN A;  1DSB A;  4IP1 A;  2WJU A;  1G6Y A;  3RHC A;  1WJK A;  3QFA C;  3ZLP A;  2VD1 A;  1AW9 A;  4V2M A;  1Z7R A;  4G2E A;  1OVN A;  1XW5 A;  2GSR A;  1NM3 A;  2H74 A;  1EWX A;  1YF1 A;  1GLP A;  2IFQ B;  2LV3 A;  2OA7 A;  3UL3 A;  3C1S A;  4RI7 A;  1ZZY A;  3UBK A;  4Q5N A;  2K8V A;  3N9J A;  4IJ3 A;  3ZRE A;  4ISD A;  5J9C A;  1OC9 B;  2HT9 A;  3O76 A;  2ALB A;  2JSZ A;  3L78 A;  1M99 A;  4L0W A;  5AIS A;  7GSS A;  2DJ0 A;  2HRF A;  1SK0 A;  4POB A;  2KLX A;  2PU9 C;  5CNW A;  4XRD A;  4AGS A;  4BVX B;  1YEX A;  2GQL A;  5D93 A;  5INY A;  2CX3 A;  1VF3 A;  5FT3 A;  1HYU A;  5ECH B;  4F9Z A;  3EMX A;  1GTA A;  2H1A A;  3HZ4 A;  2C8U A;  4O7H A;  5IMF A;  4F82 A;  2P31 A;  1V2A A;  2CVD A;  2XBQ A;  1SYX A;  2VLT A;  2FA4 A;  1GL8 A;  5ECQ B;  2H19 A;  2YWM A;  1TRS A;  2PWJ A;  1ERV A;  3E3E A;  4EDZ A;  4LMW A;  1XCC A;  4D73 A;  1WMJ A;  2DC5 A;  1M9A A;  3L9V A;  4DSS A;  1NSW A;  2WZ9 A;  5F05 A;  5ECR B;  2FY6 A;  3IK7 A;  3CSI A;  1U3A A;  4HOJ A;  1ZCP A;  1R5P A;  3M9K A;  1FB0 A;  3IC8 A;  5LCZ A;  3F4S A;  4FYU A;  12GS A;  2CV4 A;  1O8W A;  2WDU A;  2FD3 A;  3DVX A;  2EC4 A;  2H66 A;  3QCP A;  5HR0 A;  2FA8 A;  1PKZ A;  4KDU A;  2YPM A;  1C72 A;  1GSF A;  3CBU A;  1PX7 A;  5IPH A;  2FNO A;  4GTU A;  4NMU A;  4RQX A;  1TK0 B;  3HZ8 A;  4Q5Q A;  2JU5 A;  3HVX A;  3TRP A;  2FWH A;  1YKA A;  5DDL A;  1AIU A;  1TI3 A;  4HU7 A;  3HXS A;  3F6F A;  3DGQ A;  1AC1 A;  3FW2 A;  2VAF A;  3JCM L;  1YDK A;  1SKR B;  4KND A;  2C4J A;  4MA9 A;  3UAR A;  2LJK A;  1FB6 A;  2H6Z A;  4GWR A;  1TI1 A;  2VL2 A;  4KH7 A;  2B3S A;  2JSY A;  3MSZ A;  4OD7 A;  5GAN D;  3DYR A;  3QDN A;  1F3B A;  2B7K A;  1XOA A;  4LA1 A;  4XHM A;  3A5W A;  4TW5 A;  2J23 A;  2VL9 A;  3QPM A;  1X5D A;  3P8W A;  3KH7 A;  4MF6 A;  2VCV A;  1WOU A;  3EMP A;  4GF0 A;  1M7T A;  4G10 A;  4IBP A;  2HXK A;  5HFI A;  1HNB A;  2Z9S A;  2IFQ A;  5A4W A;  4K2D A;  1FVJ A;  2DSA A;  4JR6 A;  5DJM A;  1V40 A;  1HNC A;  14GS A;  5F07 A;  1OC9 A;  3D5J A;  1TOF A;  2IIY A;  5ELG A;  4ID0 A;  4POL A;  4PQ1 A;  1XWA A;  4MF7 A;  3ZVJ A;  3LXZ A;  2XC2 A;  4DEJ A;  1A2L A;  2OBI A;  17GS A;  4WR5 A;  3ZFB A;  3A2X A;  4BVX A;  1FAA A;  3C7M A;  1RW1 A;  4GLT A;  5JCU A;  2GVP A;  4V1A p;  3O3T A;  1NW2 A;  1V58 A;  1K0B A;  3APS A;  4DSR A;  1PSQ A;  5CP1 A;  1GSY A;  4ILF A;  1EV4 A;  3LEF A;  3P2A A;  3ERF A;  2ZUP A;  2FWE A;  1SJI A;  3VWX A;  4V1A g;  1I5G A;  3DIE A;  1LBK A;  3UVT A;  2IMF A;  2C1Y A;  3GKN A;  4FQU A;  1A23 A;  4YAP A;  4MLY A;  3SBC A;  2YZH A;  4X1U A;  2MMA A;  2IJY A;  4JZQ A;  2DJJ A;  4DVC A;  1SU9 A;  2CAQ A;  2XPD A;  4G19 A;  3TJG A;  4YQM A;  1Z7P A;  4CDO A;  2NDO A;  4PXO A;  5C04 A;  2H0I A;  3IBH A;  1I9D A;  4NWY A; 
#chains in the Genus database with same CATH topology
 4Z2R A;  3L9S A;  3QMX A;  3GKX A;  4G9H A;  4ACS A;  4ZL9 A;  4Q5R A;  4MZW A;  2V2G A;  3F9U A;  3C8E A;  2E2M A;  3V1W A;  2KP2 A;  5B7C A;  3EWL A;  3IRA A;  3WD6 A;  3DWV A;  2WUL A;  2HI7 A;  3GH9 A;  2P5Q A;  5AN1 A;  2VLU A;  4V2L A;  3HCZ A;  2LJA A;  1SD8 A;  1GUH A;  3FR6 A;  2RII A;  5LD0 A;  1QUW A;  4PGT A;  1PGT A;  5F0G A;  1K3L A;  3ZIV A;  2BTO T;  2RM6 A;  2H71 A;  4LL1 B;  1YY7 A;  1A2J A;  3RGB C;  1XFL A;  2X8H A;  2N5A A;  5J3R A;  4MH3 A;  3BOA A;  3W6G A;  2PN8 A;  4OCE A;  2OE3 A;  1PL1 A;  2H70 A;  2YV7 A;  3GKM A;  4ICY A;  3TRQ A;  3VK9 A;  1B48 A;  2DMM A;  5KOW A;  1Q4J A;  4HI7 A;  2L4C A;  2I1U A;  1CQG A;  2YJH A;  2LNT A;  1EP7 A;  1XWC A;  1EV9 A;  1PL2 A;  5CRD A;  3U5R E;  1WRY A;  3GST A;  4PI2 C;  2NBS A;  1B4Q A;  3HVV A;  1GRX A;  3MAK A;  5HR2 A;  4XS4 B;  2ON7 A;  3Q19 A;  1PMT A;  6GSY A;  1TJD A;  1G0T A;  3KMO A;  3TB2 A;  5IQY A;  2I9H A;  3KD0 A;  2H73 A;  2DLX A;  1GWC A;  3HDC A;  1M9B A;  1WWJ A;  2CVB A;  4BL7 B;  4J56 E;  3H4K A;  5D9V A;  3D4T A;  5ABR A;  4Z2U A;  4FYB A;  5GAP D;  3ERG A;  1TRV A;  3A2W A;  4MH2 A;  1K0O A;  4E68 A;  1MDI A;  1WP0 A;  2AB6 A;  1UN2 A;  1SK1 A;  3VWV A;  2VLV A;  2A4V A;  1HD2 A;  1NHO A;  3GX8 A;  4ZB6 A;  3NIV A;  1A0R P;  2MMZ A;  3SWL A;  2GTU A;  1FW1 A;  2NTO A;  5JWO B;  2MMN A;  1GNW A;  3ME8 A;  2L4Q A;  4MK3 A;  1A24 A;  3O6T A;  4TR4 A;  1Y25 A;  4HZ4 A;  4O5R A;  2YV9 A;  3KM6 A;  1PQN A;  2DML A;  2FHE A;  3H1N A;  3R3E A;  1QK8 A;  4MPG A;  3F6D A;  3WGD A;  2YAN A;  4EDY A;  2O89 A;  2QC7 A;  3CSH A;  4H86 A;  4ZBA A;  3FY7 A;  1ON4 A;  4N10 A;  3ERW A;  4ECI A;  5ECK B;  3TKS E;  2QA2 A;  3H79 A;  2JZR A;  3HVN A;  4PNG A;  4TXO B;  5D73 A;  1UC7 A;  3G9B A;  3D22 A;  4PQH A;  4NAX A;  1F6M C;  3J7Y k;  3LJR A;  2LUS A;  3RFR C;  4ZBB A;  2R4V A;  5IMZ A;  5A5H B;  5D96 A;  5EL8 A;  3F4R A;  3CRU A;  3UOM A;  4AJ6 A;  2EIO A;  1EGO A;  1X9W B;  2C0G A;  4KW6 A;  1N25 A;  4WBR D;  4XTS A;  3F3Q A;  4HJM A;  4QL9 A;  4GST A;  1THX A;  2DKI A;  1S3D A;  1HQO A;  1MTC A;  2E0Q A;  2GS3 A;  4QL7 A;  1G6W A;  1QMV A;  3WT2 A;  5IMV A;  3M3M A;  1R7H A;  4KSM A;  4GXZ A;  2H76 A;  2DIY A;  1B4P A;  2L6D A;  3BBY A;  3HJP A;  4KDX A;  2C0F A;  3MDK A;  1BG5 A;  6GSU A;  2VCQ A;  4XS4 A;  1WIK A;  1IYH A;  4HZ2 A;  1UVZ A;  4KUN A;  2LEG A;  1SL1 B;  5DJL A;  3LSZ A;  2HZF A;  3KTB A;  1R4W A;  2HSY A;  5J40 A;  2B6M A;  4PUR A;  4JR4 A;  5KN3 A;  4N0V A;  1GSS A;  1GSD A;  1SVM A;  3GFK A;  1VF2 A;  3ZTL A;  5C00 A;  5EVO A;  3F8U A;  2CT6 A;  5FHI A;  4WF4 A;  2VCT A;  4BL7 A;  1TK5 B;  5CRH A;  1T1V A;  3A2V A;  1BAY A;  2HSM B;  3TKQ A;  2GT6 A;  2K8S A;  2UV8 G;  2M80 A;  4L5O A;  2DIZ A;  1SK2 A;  1ACV A;  5A34 B;  5BMU B;  5ECM B;  4X4J A;  1OE7 A;  2OKA A;  1GH2 A;  1W89 A;  18GS A;  1V57 A;  2MYG A;  1TRU A;  1H75 A;  2H0H A;  1SKW B;  1JFU A;  5B6N A;  3M8N A;  3IC4 A;  3APQ A;  3G7Y A;  2EFD A;  2HZE B;  2YZU A;  2GQM A;  4HDE A;  2G0F A;  1K0A A;  1KBN A;  3TDG A;  2YJ7 A;  3H8Q A;  4IJI A;  1R26 A;  5J47 A;  4QMK A;  1GUK A;  4O5Q A;  4IW9 A;  1EEM A;  5CO3 A;  3HJM A;  5A1N B;  4OO5 A;  4HS1 A;  4MJE A;  2CAI A;  1PA3 A;  4EUY A;  1K0C A;  1SJ6 A;  1ZYN A;  3GHA A;  2R37 A;  3UEM A;  2PUK C;  2WZS A;  1VF1 A;  3DXB A;  3W8J A;  3TKP A;  3DML A;  4IHU A;  3MNG A;  1URM A;  4AJ8 A;  2A2R A;  5B8A A;  5IOX A;  2XPE A;  2FLS A;  1M2B A;  4TXO A;  3LYK A;  3IHQ A;  2HQT A;  4K6X A;  1M3I A;  2JAD A;  6GSV A;  2GT5 A;  1X9S B;  5A5H A;  4I2U A;  2C0E A;  2GST A;  4BPY A;  1PD2 1;  1O7U A;  2EFC A;  3VWW A;  4N11 A;  3GUS A;  1M2D A;  4I6X A;  3KXO A;  3LQ7 A;  2P5R A;  1XW6 A;  4BWQ A;  2HRK B;  4WET A;  5J5N A;  3EYT A;  3CQF A;  4XCS A;  3DEX A;  2L6C A;  3FK8 A;  4POM A;  5JWR B;  4P3Y B;  3PH9 A;  4MJB A;  3TJB A;  4GDF A;  1ERU A;  2IN3 A;  3PPU A;  2WVX B;  4WEY A;  1XZO A;  2X99 A;  3APO A;  1TRW A;  5IO0 A;  1J0F A;  2YCD A;  6GSS A;  4K7O A;  1G7E A;  4PQI A;  4O5U A;  1YZX A;  5KN2 A;  2H6X A;  4N0Z A;  1JLV A;  4MNN A;  1K0D A;  3GUR A;  2V6O A;  3FZ9 A;  3GYK A;  8GSS A;  2GZY A;  2RUF A;  2PBJ A;  4K2X A;  4A5P A;  3TKS C;  1VRS D;  2VM1 A;  3ZYW A;  1GUM A;  1QFN A;  4CY8 A;  4FH8 A;  1PN9 A;  4MP4 A;  3A3T A;  1QQ2 A;  3WT1 A;  4K8M A;  1CQH A;  4PTS A;  4N3Z A;  2XHF A;  3KGK A;  2KUC A;  5A5K A;  2GDR A;  3LFL A;  4G0L A;  1B9X C;  3P7X A;  4GRF A;  4K5S A;  5CRE A;  2HSM A;  3HA9 A;  1KTE A;  2G2Q A;  2BJX A;  1Y6E A;  1MEK A;  4AI6 A;  1OYJ A;  3I6A A;  3HYP A;  1KNG A;  4WBJ A;  4QQ7 A;  3H93 A;  5A34 A;  3EE2 A;  5BMU A;  3ED3 A;  3EUR A;  5AIV A;  1BQ7 A;  1DE2 A;  5H5R A;  3FYG A;  1RK4 A;  4DSQ A;  1TP9 A;  1F9M A;  4OFN A;  4KAE A;  1U88 A;  3RAZ A;  2HZE A;  2NVL A;  3VLN A;  2F51 A;  3HHV A;  3KEB A;  5A4U A;  2H8L A;  1JLW A;  5H5Q A;  2MZC A;  3GX0 A;  2DJ1 A;  3VFI A;  3L9U A;  3LGC A;  4Z7X A;  5IPG A;  3GIX A;  3GMF A;  2O87 A;  5A1N A;  2F8A A;  2VUP A;  3FR9 A;  2B7J A;  4I2T A;  4OMV A;  2V6K A;  4EIP A;  2B5E A;  2JAC A;  3TRX A;  4I8B A;  2H0G A;  4KDY A;  5CAX A;  1SL2 B;  1EP8 A;  4AKX B;  3DRN A;  3L4N A;  4L5L A;  1Z6M A;  2H1L A;  1FVK A;  3GH6 A;  2X8C A;  2A2P A;  4TRX A;  1Z9H A;  3N5O A;  4FO5 A;  3GTU B;  4ZXG A;  2HRN A;  4OFM A;  5HFK A;  4TR0 A;  3ZIJ A;  4KSO A;  5IMA A;  2L5O A;  4PUF C;  3M0F A;  2N5B A;  4KCA A;  3PR8 A;  1LJR A;  5JWQ B;  1U87 A;  2HE3 A;  1FG4 A;  3UJ1 A;  1ILO A;  6GSW A;  2HRK A;  3TOU A;  3IOS A;  2TRC P;  1GLQ A;  4KB3 A;  3G7I A;  4JE1 A;  3D6I A;  13GS A;  3IV4 A;  1X0R A;  3TKS A;  3IXR A;  4IQA A;  4G0K A;  3BCI A;  2LST A;  5D9T A;  1OKD A;  3BCK A;  2WVX A;  4KGI A;  2O8V B;  4NV2 A;  5CRG A;  2FWG A;  1A2M A;  5J4U A;  4I5Q A;  1PN0 A;  5G30 A;  4TN8 A;  4BA7 A;  1USB A;  3GNJ A;  4WXT A;  2V32 A;  3PIN A;  5IMD A;  5CYY A;  4JBB A;  3VPQ A;  3KIJ A;  3UMA A;  3CRT A;  4NHW A;  1T4Y A;  5ECS A;  1TW9 A;  2I4A A;  5G1K A;  4MCU A;  3HY2 A;  4POK A;  1XIY A;  1M0U A;  4OWY A;  3NOF A;  1T3B A;  4EO3 A;  3BJ5 A;  1OE8 A;  3DVW A;  2WW3 A;  5AIX A;  3GKK A;  1Z3E A;  4F0C A;  3LW9 A;  2WVZ A;  2C3N A;  2DBC A;  2FWF A;  3TJF A;  11GS A;  3VI5 A;  1T00 A;  1M3J A;  1Z6N A;  1JZW A;  2OJL A;  4CW9 A;  4K7N A;  1SJZ A;  2LRC A;  2C3Q A;  3FR3 A;  2FCH A;  4IVF A;  2VKZ G;  1ZYP A;  3C1R A;  4J2F A;  2H6Y A;  2IME A;  1DE1 A;  5G2Z A;  1BYE A;  5DAL B;  5G5E A;  5EY6 A;  1M2A A;  3KMN A;  5DCG A;  2YN1 A;  3EPT A;  1V9W A;  1MDJ A;  1GNE A;  5G31 A;  3J7Y b;  5IMC A;  5ECO B;  4ZL8 A;  2QSI A;  2EIR A;  4K0N A;  2IMI A;  4EVM A;  4TXV A;  1JZD A;  1ZYQ B;  4PNF A;  3EU3 A;  2IMD A;  2H1D A;  2C0D A;  1A8Y A;  4MDC A;  3CTF A;  3GN3 A;  4YQU A;  3FEU A;  5B8B A;  3FHK A;  2REM A;  4KCE A;  5ECN B;  1A0F A;  4KE3 A;  2OE1 A;  3GV1 A;  1U6T A;  5D9X A;  2GSQ A;  3AY8 A;  1X5C A;  3EU4 A;  4F2I A;  1O81 A;  1J08 A;  3CMI A;  3GTU A;  3R2Q A;  2YWI A;  4FXY P;  1O73 A;  3I9V 2;  4MZC A;  4NXI A;  4ECJ A;  3CSJ A;  2UZ8 A;  1EEJ A;  5FWG A;  4MZB A;  3WGE A;  2HNL A;  4USS A;  3HKR A;  2PVO C;  1E2Y A;  2B1K A;  5HQP A;  3FZ4 A;  1XVW A;  2WRT A;  1ZL9 A;  2RM5 A;  2KOK A;  4WF5 A;  3OR5 A;  1K0M A;  4RI6 A;  2MMO A;  1AUC A;  1GTU A;  2DJ2 A;  4HUA A;  2E2G A;  2O36 A;  3I69 A;  4GSS A;  4MJA A;  2CZ3 A;  1F3A A;  2TIR A;  4K7I A;  3IPZ A;  4XIH A;  2LTK A;  2F3M A;  1RQM A;  1EOG A;  3IAM 2;  3HMJ G;  20GS A;  3EC3 A;  4PUA A;  1T7P B;  4NV5 A;  3FZ5 A;  4OCF A;  4G0I A;  3P90 A;  2H1G A;  5DBQ A;  2LRN A;  3G7J A;  2O85 A;  3UVH A;  2VL2 C;  2YNX A;  1O85 A;  1JZR A;  4GQC A;  3NZN A;  2L57 A;  2R5G A;  2GGT A;  2DJ3 A;  5KEJ A;  3TCO A;  3I43 A;  4JRR A;  4NHZ A;  5E4W A;  5ELA A;  2K6V A;  3US3 A;  2H01 A;  1EZK A;  1SD9 A;  4ECB A;  2VCW A;  3ISO A;  2WS2 A;  5KN1 A;  2OT3 A;  2OBK A;  4BWS A;  5HFG A;  5L71 A;  4CY6 A;  5HR3 A;  4PHZ C;  1GP1 A;  1TU8 A;  3UAP A;  5DAK B;  1XBS A;  2QKE A;  4EXJ A;  1O6J A;  5ECP B;  1TU7 A;  2WW0 A;  4BVY B;  3WYW A;  4F03 A;  2EIQ A;  2AUV A;  2R0G A;  2HFD A;  3KH9 A;  2VIM A;  5DAL A;  4KF9 A;  1HNA A;  5G5F A;  2OE0 A;  2K18 A;  3BD2 A;  1ZMA A;  3ZVJ D;  1YQ1 A;  3E0U A;  2N5F A;  1GSE A;  4WR4 A;  1LU4 A;  2A2S A;  2I81 A;  2HSH A;  5AGY A;  3ZFL A;  2L5L A;  3HD5 A;  3LOR A;  1VGL A;  2AYT A;  1PFO A;  5ENU A;  2KP1 A;  1GTI A;  3LWA A;  2GZP A;  4ZB8 A;  4EKZ A;  2XBI A;  2E7P A;  2YWO A;  4EF0 A;  3RBT A;  2O5V A;  4EE0 A;  1K0N A;  1ST9 A;  3VPT A;  1ZGN A;  3KP8 A;  4ML6 A;  3MYD A;  5CRW A;  1G7O A;  3A5I A;  3Q18 A;  1AAZ A;  3FRC A;  5JCW A;  2VO4 A;  4ML1 A;  4PI0 C;  2JZT A;  1VF4 A;  1W4V A;  2H72 A;  3F0I A;  4MF5 A;  5F8B A;  1Q98 A;  3TJK A;  2CA8 A;  1ERT A;  3C73 A;  3ZRD A;  1ERW A;  1GSQ A;  4F0B A;  4ULX A;  2MBT A;  3EVI A;  1YJ6 A;  5DQY A;  3MWH A;  3D21 A;  4HQZ A;  1TTZ A;  3Q74 A;  2LS5 A;  1PKW A;  2ON5 A;  2WB9 A;  2J9H A;  4AKI A;  1WPI A;  19GS A;  3DKS A;  5B6M A;  2OAC A;  2VCZ A;  1F37 A;  4Q5F A;  4GQF A;  2TRX A;  4E8E A;  1PX6 A;  1QXH A;  3GL3 A;  4PX1 A;  3ZIT A;  2QGV A;  1XWK A;  1K3Y A;  3F63 A;  2H75 A;  1SL0 B;  3K8N A;  4HSC X;  1SKS B;  4AJ7 A;  2GZZ A;  2HLS A;  2H1B A;  3M1G A;  1XWG A;  4FIW A;  4HQS A;  5EPF A;  5J41 A;  5DQS A;  1FOV A;  3F3R A;  2B5X A;  1XOB A;  3CYN A;  2OAD A;  4ZIL A;  1E6B A;  2M46 A;  5COH A;  1THO A;  3KZQ A;  2IMK A;  1GSU A;  2IPA A;  5J9B A;  3UBL A;  3GSS A;  4NPB A;  3RDW A;  2ES7 A;  2FGX A;  2RLI A;  5IIZ A;  4JU5 A;  4KX4 A;  1FHE A;  5ID2 B;  2B5Y A;  6GSX A;  4LL4 B;  2C80 A;  4HJ2 A;  4YH2 A;  2IWT A;  1TXU A;  5DAK A;  1T8E B;  3IK9 A;  1U3I A;  4K0G A;  1A8L A;  4BIK A;  5F06 A;  2R0P A;  3RHB A;  1X5E A;  4BVY A;  2K9F A;  2A4H A;  2CX4 A;  2HSN B;  4ZIJ A;  2HRA A;  5IM9 A;  3ZL5 A;  5GZZ B;  1QGV A;  3CTG A;  2WW2 A;  4YKG A;  4O32 A;  3EIN A;  1ABA A;  4RQR A;  4EL1 A;  1BED A;  3IDV A;  4XS6 A;  4LMV A;  3ME7 A;  2F9S A;  1GTB A;  3QFB C;  4TKY A;  1TXX A;  2MBS A;  6GST A;  2B1L A;  3C71 A;  1SYR A;  2ZCT A;  3QR6 A;  4ZL7 A;  3KCM A;  3TGZ A;  3HVS A;  3IAS 2;  2WGR A;  3ZML A;  4Z2T A;  3FZA A;  2X64 A;  2RUE A;  1AQX A;  1ZYE A;  2AJQ B;  2BMX A;  4IGJ A;  5GST A;  1R5A A;  1MD3 A;  1PRX A;  1YKC A;  1J9B A;  5ECL B;  3IHG A;  5JCG A;  3QOU A;  4E8H A;  4IP6 A;  2O7K A;  4ZBD A;  1V98 A;  1O8X A;  2LKU A;  2GSS A;  4TR1 B;  4ZB9 A;  3ZZX A;  2VD0 A;  1KEB A;  5IOW A;  4IN0 A;  5HR1 A;  5LNK e;  4K9Z A;  4HU9 A;  2M72 A;  3GL5 A;  1EOH A;  2WFC A;  4N30 A;  4GCI A;  1X9M B;  4MPF A;  1MDK A;  1FO5 A;  5G1L A;  16GS A;  5KOX A;  4X43 A;  2PPT A;  4X0X A;  3IA1 A;  1XVQ A;  1N2A A;  2R2J A;  2AHE A;  2GLR A;  4OFT A;  2VM2 A;  1N8J A;  2V41 A;  1TKD B;  1NHY A;  4EIQ A;  2PMT A;  2AAW A;  3W8S A;  3CWG A;  1AQW A;  1BX9 A;  2PVQ A;  3KJY A;  1XW9 A;  3S9F A;  5ECI B;  2LQO A;  3QAV A;  2LJR A;  3UIW A;  5GSS A;  4WKW A;  3VI7 A;  4TR3 A;  3L0H A;  2C3T A;  2KHP A;  22GS A;  3KP9 A;  2YP6 A;  4YQV A;  4GSN A;  2X4A A;  4AKG A;  3PGT A;  1EGR A;  4O92 A;  1MD4 A;  1WE0 A;  4W66 A;  4V2N A;  1F2E A;  5IO2 A;  10GS A;  5ID2 A;  3FKF A;  2WW1 A;  4EC0 A;  1DBY A;  1XXU A;  1OAZ A;  4IKH A;  2JL4 A;  1S3A A;  1K3O A;  4YKF A;  1AQV A;  3TOT A;  4AF2 A;  3M9J A;  2VOC A;  3LYP A;  4ECC A;  2AV4 A;  2DJK A;  1ZOF A;  1XG8 A;  4LLR A;  2D2Z A;  2HSN A;  2FUG 2;  2VCX A;  3E9J B;  4J57 E;  4IEL A;  3IE3 A;  1AXD A;  3KTL A;  1YEP A;  3TJJ A;  3VWU A;  4IQ1 A;  1IYI A;  1YF0 A;  3WGX A;  4TVE A;  4K1F A;  2CVK A;  4JED A;  2NPB A;  3RPP A;  3D4M A;  2JZS A;  3VUR A;  2IL3 A;  1B9Y C;  1XPV A;  2LNS A;  3RPN A;  4D73 B;  4IS0 A;  1JHB A;  3CXG A;  3GA4 A;  3F4T A;  3HJO A;  3QAG A;  4DSS B;  2GQK A;  2LQQ A;  2R0C A;  3U6V A;  5D9W A;  2PGT A;  5H5S A;  2YWN A;  3DD3 A;  4OO4 A;  5DVB A;  1SVL A;  2CQ9 A;  3QD9 A;  5KN0 A;  4RUV A;  3LG6 A;  4MAB A;  1TK8 B;  1OKT A;  3TUE A;  4TOP A;  2I3Y A;  4HEA 2;  4KA0 A;  5BRT A;  2V1M A;  3ZMK A;  1GUL A;  4YAV A;  4MMM A;  5E59 A;  2VL3 A;  3GRX A;  1BJX A;  4XRA A;  1ML6 A;  4TR1 A;  4L8E A;  3D0Z A;  1OC3 A;  1UA5 A;  1TDI A;  9GSS A;  1H4O A;  2F8F A;  2R3X A;  4I97 A;  1XWB A;  2HYX A;  4CHS A;  3TKR A;  2WCI A;  2L59 A;  3QAW A;  2PER A;  2YOI A;  5DCH A;  1S3C A;  1JZO A;  4MJC A;  2ZNM A;  2X8G A;  2QA1 A;  5A4V A;  1Z5Y E;  3LXT A;  2R6K A;  2CZ2 A;  4FYC A;  4XS1 A;  3IR4 A;  2LRT A;  4L0U A;  1OC8 A;  2P0G A;  1DUG A;  1T4Z A;  1B8X A;  5D8I A;  3Q6O A;  2H30 A;  1SEN A;  1DSB A;  4IP1 A;  2WJU A;  1G6Y A;  3RHC A;  1WJK A;  3QFA C;  3ZLP A;  2VD1 A;  1AW9 A;  4V2M A;  1Z7R A;  4G2E A;  1OVN A;  1XW5 A;  2GSR A;  1NM3 A;  2H74 A;  1EWX A;  1YF1 A;  1GLP A;  2IFQ B;  2LV3 A;  2OA7 A;  2EFE A;  3UL3 A;  3C1S A;  4RI7 A;  1ZZY A;  4ZB7 A;  3TU3 B;  3UBK A;  4Q5N A;  2K8V A;  3N9J A;  4IJ3 A;  5J4V A;  3ZRE A;  4ISD A;  5J9C A;  1OC9 B;  2HT9 A;  3O76 A;  2ALB A;  2JSZ A;  3FMW A;  3L78 A;  1M99 A;  4L0W A;  5AIS A;  7GSS A;  1YEW C;  2DJ0 A;  2HRF A;  1SK0 A;  4POB A;  2KLX A;  2PU9 C;  5CNW A;  4XRD A;  4AGS A;  4BVX B;  1YEX A;  2GQL A;  5D93 A;  5INY A;  2CX3 A;  1VF3 A;  5FT3 A;  1HYU A;  5ECH B;  4F9Z A;  3EMX A;  4AKH A;  1GTA A;  2H1A A;  3HZ4 A;  2C8U A;  4O7H A;  5IMF A;  4F82 A;  2P31 A;  1V2A A;  2CVD A;  2XBQ A;  1SYX A;  2VLT A;  2FA4 A;  1GL8 A;  5ECQ B;  2H19 A;  2YWM A;  1TRS A;  2PWJ A;  1ERV A;  3E3E A;  4EDZ A;  4LMW A;  1XCC A;  4D73 A;  1WMJ A;  2DC5 A;  1M9A A;  1S4B P;  5J4Y A;  3L9V A;  4DSS A;  1NSW A;  2WZ9 A;  5F05 A;  5ECR B;  4K5R A;  2FY6 A;  3IK7 A;  3CSI A;  1U3A A;  4HOJ A;  1ZCP A;  1R5P A;  3M9K A;  1I1I P;  1FB0 A;  3IC8 A;  5LCZ A;  3F4S A;  1BG1 A;  4FYU A;  12GS A;  2CV4 A;  1O8W A;  2WDU A;  2FD3 A;  3DVX A;  2EC4 A;  2H66 A;  3QCP A;  5HR0 A;  2FA8 A;  1PKZ A;  4KDU A;  2YPM A;  1C72 A;  1GSF A;  3CBU A;  1PX7 A;  5IPH A;  2FNO A;  4GTU A;  4NMU A;  4RQX A;  1TK0 B;  3HZ8 A;  4Q5Q A;  2JU5 A;  3HVX A;  3TRP A;  2FWH A;  1YKA A;  5DDL A;  1AIU A;  1TI3 A;  4HU7 A;  3HXS A;  3F6F A;  3DGQ A;  1AC1 A;  3FW2 A;  2VAF A;  3JCM L;  1YDK A;  1SKR B;  4KND A;  2C4J A;  4MA9 A;  3UAR A;  2LJK A;  1FB6 A;  2H6Z A;  4GWR A;  1S3R A;  1TI1 A;  1FOH A;  2VL2 A;  4KH7 A;  2B3S A;  2JSY A;  3MSZ A;  4OD7 A;  5GAN D;  3DYR A;  3QDN A;  1F3B A;  2B7K A;  1XOA A;  4LA1 A;  4XHM A;  1SVO A;  3A5W A;  4TW5 A;  2J23 A;  2VL9 A;  3QPM A;  1X5D A;  3P8W A;  3KH7 A;  4MF6 A;  2VCV A;  1WOU A;  3EMP A;  4GF0 A;  1M7T A;  4G10 A;  4IBP A;  2HXK A;  5HFI A;  1HNB A;  2Z9S A;  2IFQ A;  5A4W A;  4K2D A;  1FVJ A;  2DSA A;  2EFH A;  4JR6 A;  2O3E A;  5DJM A;  1V40 A;  3CHX C;  1HNC A;  1BF5 A;  14GS A;  5F07 A;  1OC9 A;  3D5J A;  1YVL A;  1TOF A;  2IIY A;  5ELG A;  4ID0 A;  4POL A;  4PQ1 A;  1XWA A;  4MF7 A;  3ZVJ A;  3LXZ A;  2XC2 A;  4DEJ A;  1A2L A;  2OBI A;  17GS A;  4WR5 A;  3ZFB A;  3A2X A;  4BVX A;  1FAA A;  3C7M A;  4G01 A;  1RW1 A;  4GLT A;  5JCU A;  2GVP A;  4V1A p;  3O3T A;  1NW2 A;  1V58 A;  1K0B A;  3APS A;  4DSR A;  1PSQ A;  5CP1 A;  1GSY A;  4ILF A;  1EV4 A;  3LEF A;  3P2A A;  3ERF A;  2ZUP A;  2FWE A;  1SJI A;  3VWX A;  4V1A g;  1I5G A;  3DIE A;  1LBK A;  3UVT A;  2IMF A;  2C1Y A;  3GKN A;  4FQU A;  1A23 A;  4YAP A;  4MLY A;  3SBC A;  2YZH A;  4X1U A;  2DKH A;  2X49 A;  2MMA A;  2IJY A;  4JZQ A;  2DJJ A;  1Y1U A;  2WVY A;  4DVC A;  1SU9 A;  2CAQ A;  2XPD A;  4G19 A;  3TJG A;  4YQM A;  1Z7P A;  4CDO A;  2NDO A;  4PXO A;  5C04 A;  3MIX A;  2H0I A;  3IBH A;  1I9D A;  4NWY A; 
#chains in the Genus database with same CATH homology
 4Z2R A;  3L9S A;  3QMX A;  3GKX A;  4G9H A;  4ACS A;  4ZL9 A;  4Q5R A;  4MZW A;  2V2G A;  3F9U A;  3C8E A;  2E2M A;  3V1W A;  2KP2 A;  5B7C A;  3EWL A;  3IRA A;  3WD6 A;  3DWV A;  2WUL A;  2HI7 A;  3GH9 A;  2P5Q A;  5AN1 A;  2VLU A;  4V2L A;  3HCZ A;  2LJA A;  1SD8 A;  1GUH A;  3FR6 A;  2RII A;  5LD0 A;  1QUW A;  4PGT A;  1PGT A;  5F0G A;  1K3L A;  3ZIV A;  2BTO T;  2RM6 A;  2H71 A;  4LL1 B;  1YY7 A;  1A2J A;  1XFL A;  2X8H A;  2N5A A;  5J3R A;  4MH3 A;  3BOA A;  3W6G A;  2PN8 A;  4OCE A;  2OE3 A;  1PL1 A;  2H70 A;  2YV7 A;  3GKM A;  4ICY A;  3TRQ A;  3VK9 A;  1B48 A;  2DMM A;  5KOW A;  1Q4J A;  4HI7 A;  2L4C A;  2I1U A;  1CQG A;  2YJH A;  2LNT A;  1EP7 A;  1XWC A;  1EV9 A;  1PL2 A;  5CRD A;  3U5R E;  1WRY A;  3GST A;  2NBS A;  1B4Q A;  3HVV A;  1GRX A;  3MAK A;  5HR2 A;  4XS4 B;  2ON7 A;  3Q19 A;  1PMT A;  6GSY A;  1TJD A;  1G0T A;  3KMO A;  3TB2 A;  5IQY A;  2I9H A;  3KD0 A;  2H73 A;  2DLX A;  1GWC A;  3HDC A;  1M9B A;  1WWJ A;  2CVB A;  4BL7 B;  4J56 E;  3H4K A;  5D9V A;  3D4T A;  5ABR A;  4Z2U A;  4FYB A;  5GAP D;  3ERG A;  1TRV A;  3A2W A;  4MH2 A;  1K0O A;  4E68 A;  1MDI A;  1WP0 A;  2AB6 A;  1UN2 A;  1SK1 A;  3VWV A;  2VLV A;  2A4V A;  1HD2 A;  1NHO A;  3GX8 A;  4ZB6 A;  3NIV A;  1A0R P;  2MMZ A;  3SWL A;  2GTU A;  1FW1 A;  2NTO A;  5JWO B;  2MMN A;  1GNW A;  3ME8 A;  2L4Q A;  4MK3 A;  1A24 A;  3O6T A;  4TR4 A;  1Y25 A;  4HZ4 A;  4O5R A;  2YV9 A;  3KM6 A;  1PQN A;  2DML A;  2FHE A;  3H1N A;  3R3E A;  1QK8 A;  4MPG A;  3F6D A;  3WGD A;  2YAN A;  4EDY A;  2O89 A;  2QC7 A;  3CSH A;  4H86 A;  4ZBA A;  3FY7 A;  1ON4 A;  4N10 A;  3ERW A;  4ECI A;  5ECK B;  3TKS E;  2QA2 A;  3H79 A;  2JZR A;  4PNG A;  4TXO B;  5D73 A;  1UC7 A;  3G9B A;  3D22 A;  4PQH A;  4NAX A;  1F6M C;  3J7Y k;  3LJR A;  2LUS A;  4ZBB A;  2R4V A;  5IMZ A;  5A5H B;  5D96 A;  5EL8 A;  3F4R A;  3CRU A;  3UOM A;  4AJ6 A;  2EIO A;  1EGO A;  1X9W B;  2C0G A;  4KW6 A;  1N25 A;  4WBR D;  4XTS A;  3F3Q A;  4HJM A;  4QL9 A;  4GST A;  1THX A;  2DKI A;  1S3D A;  1HQO A;  1MTC A;  2E0Q A;  2GS3 A;  4QL7 A;  1G6W A;  1QMV A;  3WT2 A;  5IMV A;  3M3M A;  1R7H A;  4KSM A;  4GXZ A;  2H76 A;  2DIY A;  1B4P A;  2L6D A;  3BBY A;  3HJP A;  4KDX A;  2C0F A;  3MDK A;  1BG5 A;  6GSU A;  2VCQ A;  4XS4 A;  1WIK A;  1IYH A;  4HZ2 A;  1UVZ A;  4KUN A;  2LEG A;  1SL1 B;  5DJL A;  3LSZ A;  2HZF A;  3KTB A;  1R4W A;  2HSY A;  5J40 A;  2B6M A;  4PUR A;  4JR4 A;  5KN3 A;  4N0V A;  1GSS A;  1GSD A;  1SVM A;  3GFK A;  1VF2 A;  3ZTL A;  5C00 A;  5EVO A;  3F8U A;  2CT6 A;  5FHI A;  4WF4 A;  2VCT A;  4BL7 A;  1TK5 B;  5CRH A;  1T1V A;  3A2V A;  1BAY A;  2HSM B;  3TKQ A;  2GT6 A;  2K8S A;  2UV8 G;  2M80 A;  4L5O A;  2DIZ A;  1SK2 A;  1ACV A;  5A34 B;  5BMU B;  5ECM B;  4X4J A;  1OE7 A;  2OKA A;  1GH2 A;  1W89 A;  18GS A;  1V57 A;  2MYG A;  1TRU A;  1H75 A;  2H0H A;  1SKW B;  1JFU A;  5B6N A;  3M8N A;  3IC4 A;  3APQ A;  3G7Y A;  2EFD A;  2HZE B;  2YZU A;  2GQM A;  4HDE A;  2G0F A;  1K0A A;  1KBN A;  3TDG A;  2YJ7 A;  3H8Q A;  4IJI A;  1R26 A;  5J47 A;  4QMK A;  1GUK A;  4O5Q A;  4IW9 A;  1EEM A;  5CO3 A;  3HJM A;  5A1N B;  4OO5 A;  4HS1 A;  4MJE A;  2CAI A;  1PA3 A;  4EUY A;  1K0C A;  1SJ6 A;  1ZYN A;  3GHA A;  2R37 A;  3UEM A;  2PUK C;  1VF1 A;  3DXB A;  3W8J A;  3TKP A;  3DML A;  4IHU A;  3MNG A;  1URM A;  4AJ8 A;  2A2R A;  5B8A A;  5IOX A;  2XPE A;  2FLS A;  1M2B A;  4TXO A;  3LYK A;  3IHQ A;  2HQT A;  4K6X A;  2JAD A;  6GSV A;  2GT5 A;  1X9S B;  5A5H A;  4I2U A;  2C0E A;  2GST A;  4BPY A;  1PD2 1;  1O7U A;  2EFC A;  3VWW A;  4N11 A;  3GUS A;  1M2D A;  4I6X A;  3KXO A;  3LQ7 A;  2P5R A;  1XW6 A;  4BWQ A;  2HRK B;  4WET A;  5J5N A;  3EYT A;  4XCS A;  3DEX A;  2L6C A;  3FK8 A;  4POM A;  5JWR B;  4P3Y B;  3PH9 A;  4MJB A;  3TJB A;  4GDF A;  1ERU A;  2IN3 A;  3PPU A;  4WEY A;  1XZO A;  2X99 A;  3APO A;  1TRW A;  5IO0 A;  1J0F A;  2YCD A;  6GSS A;  4K7O A;  1G7E A;  4PQI A;  4O5U A;  1YZX A;  5KN2 A;  2H6X A;  4N0Z A;  1JLV A;  4MNN A;  1K0D A;  3GUR A;  2V6O A;  3FZ9 A;  3GYK A;  8GSS A;  2GZY A;  2RUF A;  2PBJ A;  4K2X A;  4A5P A;  3TKS C;  1VRS D;  2VM1 A;  3ZYW A;  1GUM A;  1QFN A;  4CY8 A;  4FH8 A;  1PN9 A;  4MP4 A;  3A3T A;  1QQ2 A;  3WT1 A;  4K8M A;  1CQH A;  4PTS A;  4N3Z A;  2XHF A;  3KGK A;  2KUC A;  5A5K A;  2GDR A;  3LFL A;  4G0L A;  1B9X C;  3P7X A;  4GRF A;  4K5S A;  5CRE A;  2HSM A;  3HA9 A;  1KTE A;  2G2Q A;  2BJX A;  1Y6E A;  1MEK A;  4AI6 A;  1OYJ A;  3I6A A;  3HYP A;  1KNG A;  4WBJ A;  4QQ7 A;  3H93 A;  5A34 A;  3EE2 A;  5BMU A;  3ED3 A;  3EUR A;  5AIV A;  1BQ7 A;  1DE2 A;  5H5R A;  3FYG A;  1RK4 A;  4DSQ A;  1TP9 A;  1F9M A;  4OFN A;  4KAE A;  1U88 A;  3RAZ A;  2HZE A;  2NVL A;  3VLN A;  2F51 A;  3HHV A;  3KEB A;  5A4U A;  2H8L A;  1JLW A;  5H5Q A;  2MZC A;  3GX0 A;  2DJ1 A;  3VFI A;  3L9U A;  3LGC A;  4Z7X A;  5IPG A;  3GIX A;  3GMF A;  2O87 A;  5A1N A;  2F8A A;  2VUP A;  3FR9 A;  2B7J A;  4I2T A;  4OMV A;  2V6K A;  4EIP A;  2B5E A;  2JAC A;  3TRX A;  4I8B A;  2H0G A;  4KDY A;  5CAX A;  1SL2 B;  1EP8 A;  4AKX B;  3DRN A;  3L4N A;  4L5L A;  1Z6M A;  2H1L A;  1FVK A;  3GH6 A;  2X8C A;  2A2P A;  4TRX A;  1Z9H A;  3N5O A;  4FO5 A;  3GTU B;  4ZXG A;  2HRN A;  4OFM A;  5HFK A;  4TR0 A;  3ZIJ A;  4KSO A;  5IMA A;  2L5O A;  4PUF C;  3M0F A;  2N5B A;  4KCA A;  3PR8 A;  1LJR A;  5JWQ B;  1U87 A;  2HE3 A;  1FG4 A;  3UJ1 A;  1ILO A;  6GSW A;  2HRK A;  3TOU A;  3IOS A;  2TRC P;  1GLQ A;  4KB3 A;  3G7I A;  4JE1 A;  3D6I A;  13GS A;  3IV4 A;  1X0R A;  3TKS A;  3IXR A;  4IQA A;  4G0K A;  3BCI A;  2LST A;  5D9T A;  1OKD A;  3BCK A;  4KGI A;  2O8V B;  4NV2 A;  5CRG A;  2FWG A;  1A2M A;  5J4U A;  4I5Q A;  1PN0 A;  5G30 A;  4TN8 A;  4BA7 A;  1USB A;  3GNJ A;  4WXT A;  2V32 A;  3PIN A;  5IMD A;  5CYY A;  4JBB A;  3VPQ A;  3KIJ A;  3UMA A;  3CRT A;  4NHW A;  1T4Y A;  5ECS A;  1TW9 A;  2I4A A;  5G1K A;  4MCU A;  3HY2 A;  4POK A;  1XIY A;  1M0U A;  4OWY A;  3NOF A;  1T3B A;  4EO3 A;  3BJ5 A;  1OE8 A;  3DVW A;  5AIX A;  3GKK A;  1Z3E A;  4F0C A;  3LW9 A;  2C3N A;  2DBC A;  2FWF A;  3TJF A;  11GS A;  3VI5 A;  1T00 A;  1Z6N A;  1JZW A;  2OJL A;  4CW9 A;  4K7N A;  1SJZ A;  2LRC A;  2C3Q A;  3FR3 A;  2FCH A;  4IVF A;  2VKZ G;  1ZYP A;  3C1R A;  4J2F A;  2H6Y A;  2IME A;  1DE1 A;  5G2Z A;  1BYE A;  5DAL B;  5G5E A;  5EY6 A;  1M2A A;  3KMN A;  5DCG A;  2YN1 A;  3EPT A;  1V9W A;  1MDJ A;  1GNE A;  5G31 A;  3J7Y b;  5IMC A;  5ECO B;  4ZL8 A;  2QSI A;  2EIR A;  4K0N A;  2IMI A;  4EVM A;  4TXV A;  1JZD A;  1ZYQ B;  4PNF A;  3EU3 A;  2IMD A;  2H1D A;  2C0D A;  1A8Y A;  4MDC A;  3CTF A;  3GN3 A;  4YQU A;  3FEU A;  5B8B A;  3FHK A;  2REM A;  4KCE A;  5ECN B;  1A0F A;  4KE3 A;  2OE1 A;  3GV1 A;  1U6T A;  5D9X A;  2GSQ A;  3AY8 A;  1X5C A;  3EU4 A;  4F2I A;  1O81 A;  1J08 A;  3CMI A;  3GTU A;  3R2Q A;  2YWI A;  1O73 A;  3I9V 2;  4MZC A;  4NXI A;  4ECJ A;  3CSJ A;  2UZ8 A;  1EEJ A;  5FWG A;  4MZB A;  3WGE A;  2HNL A;  4USS A;  3HKR A;  2PVO C;  1E2Y A;  2B1K A;  5HQP A;  3FZ4 A;  1XVW A;  2WRT A;  1ZL9 A;  2RM5 A;  2KOK A;  4WF5 A;  3OR5 A;  1K0M A;  4RI6 A;  2MMO A;  1AUC A;  1GTU A;  2DJ2 A;  4HUA A;  2E2G A;  3I69 A;  4GSS A;  4MJA A;  2CZ3 A;  1F3A A;  2TIR A;  4K7I A;  3IPZ A;  4XIH A;  2LTK A;  2F3M A;  1RQM A;  1EOG A;  3IAM 2;  3HMJ G;  20GS A;  3EC3 A;  4PUA A;  1T7P B;  4NV5 A;  3FZ5 A;  4OCF A;  4G0I A;  3P90 A;  2H1G A;  5DBQ A;  2LRN A;  3G7J A;  2O85 A;  3UVH A;  2VL2 C;  2YNX A;  1O85 A;  1JZR A;  4GQC A;  3NZN A;  2L57 A;  2R5G A;  2GGT A;  2DJ3 A;  5KEJ A;  3TCO A;  3I43 A;  4JRR A;  4NHZ A;  5E4W A;  5ELA A;  2K6V A;  3US3 A;  2H01 A;  1EZK A;  1SD9 A;  4ECB A;  2VCW A;  3ISO A;  2WS2 A;  5KN1 A;  2OT3 A;  2OBK A;  4BWS A;  5HFG A;  5L71 A;  4CY6 A;  5HR3 A;  1GP1 A;  1TU8 A;  3UAP A;  5DAK B;  1XBS A;  2QKE A;  4EXJ A;  1O6J A;  5ECP B;  1TU7 A;  4BVY B;  3WYW A;  4F03 A;  2EIQ A;  2AUV A;  2R0G A;  2HFD A;  3KH9 A;  2VIM A;  5DAL A;  4KF9 A;  1HNA A;  5G5F A;  2OE0 A;  2K18 A;  3BD2 A;  1ZMA A;  3ZVJ D;  1YQ1 A;  3E0U A;  2N5F A;  1GSE A;  4WR4 A;  1LU4 A;  2A2S A;  2I81 A;  2HSH A;  5AGY A;  3ZFL A;  2L5L A;  3HD5 A;  3LOR A;  1VGL A;  2AYT A;  5ENU A;  2KP1 A;  1GTI A;  3LWA A;  2GZP A;  4ZB8 A;  4EKZ A;  2XBI A;  2E7P A;  2YWO A;  4EF0 A;  3RBT A;  2O5V A;  4EE0 A;  1K0N A;  1ST9 A;  3VPT A;  1ZGN A;  3KP8 A;  4ML6 A;  3MYD A;  5CRW A;  1G7O A;  3A5I A;  3Q18 A;  1AAZ A;  3FRC A;  5JCW A;  2VO4 A;  4ML1 A;  2JZT A;  1VF4 A;  1W4V A;  2H72 A;  3F0I A;  4MF5 A;  5F8B A;  1Q98 A;  3TJK A;  2CA8 A;  1ERT A;  3C73 A;  3ZRD A;  1ERW A;  1GSQ A;  4F0B A;  4ULX A;  2MBT A;  3EVI A;  1YJ6 A;  5DQY A;  3MWH A;  3D21 A;  4HQZ A;  1TTZ A;  3Q74 A;  2LS5 A;  1PKW A;  2ON5 A;  2WB9 A;  2J9H A;  4AKI A;  1WPI A;  19GS A;  3DKS A;  5B6M A;  2OAC A;  2VCZ A;  1F37 A;  4Q5F A;  4GQF A;  2TRX A;  4E8E A;  1PX6 A;  1QXH A;  3GL3 A;  4PX1 A;  3ZIT A;  2QGV A;  1XWK A;  1K3Y A;  3F63 A;  2H75 A;  1SL0 B;  3K8N A;  1SKS B;  4AJ7 A;  2GZZ A;  2HLS A;  2H1B A;  3M1G A;  1XWG A;  4FIW A;  4HQS A;  5EPF A;  5J41 A;  5DQS A;  1FOV A;  3F3R A;  2B5X A;  1XOB A;  3CYN A;  2OAD A;  4ZIL A;  1E6B A;  2M46 A;  5COH A;  1THO A;  3KZQ A;  2IMK A;  1GSU A;  2IPA A;  5J9B A;  3UBL A;  3GSS A;  4NPB A;  3RDW A;  2ES7 A;  2FGX A;  2RLI A;  5IIZ A;  4JU5 A;  4KX4 A;  1FHE A;  5ID2 B;  2B5Y A;  6GSX A;  4LL4 B;  2C80 A;  4HJ2 A;  4YH2 A;  2IWT A;  1TXU A;  5DAK A;  1T8E B;  3IK9 A;  1U3I A;  4K0G A;  1A8L A;  5F06 A;  2R0P A;  3RHB A;  1X5E A;  4BVY A;  2K9F A;  2A4H A;  2CX4 A;  2HSN B;  4ZIJ A;  2HRA A;  5IM9 A;  3ZL5 A;  5GZZ B;  1QGV A;  3CTG A;  4YKG A;  4O32 A;  3EIN A;  1ABA A;  4RQR A;  4EL1 A;  1BED A;  3IDV A;  4XS6 A;  4LMV A;  3ME7 A;  2F9S A;  1GTB A;  3QFB C;  4TKY A;  1TXX A;  2MBS A;  6GST A;  2B1L A;  3C71 A;  1SYR A;  2ZCT A;  3QR6 A;  4ZL7 A;  3KCM A;  3TGZ A;  3HVS A;  3IAS 2;  2WGR A;  3ZML A;  4Z2T A;  3FZA A;  2X64 A;  2RUE A;  1AQX A;  1ZYE A;  2AJQ B;  2BMX A;  4IGJ A;  5GST A;  1R5A A;  1MD3 A;  1PRX A;  1YKC A;  1J9B A;  5ECL B;  3IHG A;  5JCG A;  3QOU A;  4E8H A;  4IP6 A;  2O7K A;  4ZBD A;  1V98 A;  1O8X A;  2LKU A;  2GSS A;  4TR1 B;  4ZB9 A;  3ZZX A;  2VD0 A;  1KEB A;  5IOW A;  4IN0 A;  5HR1 A;  5LNK e;  4K9Z A;  4HU9 A;  2M72 A;  3GL5 A;  1EOH A;  2WFC A;  4N30 A;  4GCI A;  1X9M B;  4MPF A;  1MDK A;  1FO5 A;  5G1L A;  16GS A;  5KOX A;  4X43 A;  2PPT A;  4X0X A;  3IA1 A;  1XVQ A;  1N2A A;  2R2J A;  2AHE A;  2GLR A;  4OFT A;  2VM2 A;  1N8J A;  2V41 A;  1TKD B;  1NHY A;  4EIQ A;  2PMT A;  2AAW A;  3W8S A;  3CWG A;  1AQW A;  1BX9 A;  2PVQ A;  3KJY A;  1XW9 A;  3S9F A;  5ECI B;  2LQO A;  3QAV A;  2LJR A;  3UIW A;  5GSS A;  4WKW A;  3VI7 A;  4TR3 A;  3L0H A;  2C3T A;  2KHP A;  22GS A;  3KP9 A;  2YP6 A;  4YQV A;  4GSN A;  2X4A A;  4AKG A;  3PGT A;  1EGR A;  4O92 A;  1MD4 A;  1WE0 A;  4W66 A;  4V2N A;  1F2E A;  5IO2 A;  10GS A;  5ID2 A;  3FKF A;  4EC0 A;  1DBY A;  1XXU A;  1OAZ A;  4IKH A;  2JL4 A;  1S3A A;  1K3O A;  4YKF A;  1AQV A;  3TOT A;  4AF2 A;  3M9J A;  2VOC A;  3LYP A;  4ECC A;  2AV4 A;  2DJK A;  1ZOF A;  4LLR A;  2D2Z A;  2HSN A;  2FUG 2;  2VCX A;  3E9J B;  4J57 E;  4IEL A;  3IE3 A;  1AXD A;  3KTL A;  1YEP A;  3TJJ A;  3VWU A;  4IQ1 A;  1IYI A;  1YF0 A;  3WGX A;  4TVE A;  4K1F A;  2CVK A;  4JED A;  2NPB A;  3RPP A;  3D4M A;  2JZS A;  3VUR A;  2IL3 A;  1B9Y C;  1XPV A;  2LNS A;  3RPN A;  4D73 B;  4IS0 A;  1JHB A;  3CXG A;  3GA4 A;  3F4T A;  3HJO A;  3QAG A;  4DSS B;  2GQK A;  2LQQ A;  2R0C A;  3U6V A;  5D9W A;  2PGT A;  5H5S A;  2YWN A;  3DD3 A;  4OO4 A;  5DVB A;  1SVL A;  2CQ9 A;  3QD9 A;  5KN0 A;  4RUV A;  3LG6 A;  4MAB A;  1TK8 B;  1OKT A;  3TUE A;  4TOP A;  2I3Y A;  4HEA 2;  4KA0 A;  5BRT A;  2V1M A;  3ZMK A;  1GUL A;  4YAV A;  4MMM A;  5E59 A;  2VL3 A;  3GRX A;  1BJX A;  4XRA A;  1ML6 A;  4TR1 A;  4L8E A;  3D0Z A;  1OC3 A;  1UA5 A;  1TDI A;  9GSS A;  1H4O A;  2F8F A;  2R3X A;  4I97 A;  1XWB A;  2HYX A;  4CHS A;  3TKR A;  2WCI A;  2L59 A;  3QAW A;  2PER A;  2YOI A;  5DCH A;  1S3C A;  1JZO A;  4MJC A;  2ZNM A;  2X8G A;  2QA1 A;  5A4V A;  1Z5Y E;  3LXT A;  2R6K A;  2CZ2 A;  4FYC A;  4XS1 A;  3IR4 A;  2LRT A;  4L0U A;  1OC8 A;  2P0G A;  1DUG A;  1T4Z A;  1B8X A;  5D8I A;  3Q6O A;  2H30 A;  1SEN A;  1DSB A;  4IP1 A;  2WJU A;  1G6Y A;  3RHC A;  1WJK A;  3QFA C;  3ZLP A;  2VD1 A;  1AW9 A;  4V2M A;  1Z7R A;  4G2E A;  1OVN A;  1XW5 A;  2GSR A;  1NM3 A;  2H74 A;  1EWX A;  1YF1 A;  1GLP A;  2IFQ B;  2LV3 A;  2OA7 A;  2EFE A;  3UL3 A;  3C1S A;  4RI7 A;  1ZZY A;  4ZB7 A;  3TU3 B;  3UBK A;  4Q5N A;  2K8V A;  3N9J A;  4IJ3 A;  5J4V A;  3ZRE A;  4ISD A;  5J9C A;  1OC9 B;  2HT9 A;  3O76 A;  2ALB A;  2JSZ A;  3FMW A;  3L78 A;  1M99 A;  4L0W A;  5AIS A;  7GSS A;  2DJ0 A;  2HRF A;  1SK0 A;  4POB A;  2KLX A;  2PU9 C;  5CNW A;  4XRD A;  4AGS A;  4BVX B;  1YEX A;  2GQL A;  5D93 A;  5INY A;  2CX3 A;  1VF3 A;  5FT3 A;  1HYU A;  5ECH B;  4F9Z A;  3EMX A;  4AKH A;  1GTA A;  2H1A A;  3HZ4 A;  2C8U A;  4O7H A;  5IMF A;  4F82 A;  2P31 A;  1V2A A;  2CVD A;  2XBQ A;  1SYX A;  2VLT A;  2FA4 A;  1GL8 A;  5ECQ B;  2H19 A;  2YWM A;  1TRS A;  2PWJ A;  1ERV A;  3E3E A;  4EDZ A;  4LMW A;  1XCC A;  4D73 A;  1WMJ A;  2DC5 A;  1M9A A;  5J4Y A;  3L9V A;  4DSS A;  1NSW A;  2WZ9 A;  5F05 A;  5ECR B;  4K5R A;  2FY6 A;  3IK7 A;  3CSI A;  1U3A A;  4HOJ A;  1ZCP A;  1R5P A;  3M9K A;  1FB0 A;  3IC8 A;  5LCZ A;  3F4S A;  1BG1 A;  4FYU A;  12GS A;  2CV4 A;  1O8W A;  2WDU A;  2FD3 A;  3DVX A;  2EC4 A;  2H66 A;  3QCP A;  5HR0 A;  2FA8 A;  1PKZ A;  4KDU A;  2YPM A;  1C72 A;  1GSF A;  3CBU A;  1PX7 A;  5IPH A;  2FNO A;  4GTU A;  4NMU A;  4RQX A;  1TK0 B;  3HZ8 A;  4Q5Q A;  2JU5 A;  3HVX A;  3TRP A;  2FWH A;  1YKA A;  5DDL A;  1AIU A;  1TI3 A;  4HU7 A;  3HXS A;  3F6F A;  3DGQ A;  1AC1 A;  3FW2 A;  2VAF A;  3JCM L;  1YDK A;  1SKR B;  4KND A;  2C4J A;  4MA9 A;  3UAR A;  2LJK A;  1FB6 A;  2H6Z A;  4GWR A;  1TI1 A;  1FOH A;  2VL2 A;  4KH7 A;  2B3S A;  2JSY A;  3MSZ A;  4OD7 A;  5GAN D;  3DYR A;  3QDN A;  1F3B A;  2B7K A;  1XOA A;  4LA1 A;  4XHM A;  1SVO A;  3A5W A;  4TW5 A;  2J23 A;  2VL9 A;  3QPM A;  1X5D A;  3P8W A;  3KH7 A;  4MF6 A;  2VCV A;  1WOU A;  3EMP A;  4GF0 A;  1M7T A;  4G10 A;  4IBP A;  2HXK A;  5HFI A;  1HNB A;  2Z9S A;  2IFQ A;  5A4W A;  4K2D A;  1FVJ A;  2DSA A;  2EFH A;  4JR6 A;  5DJM A;  1V40 A;  1HNC A;  1BF5 A;  14GS A;  5F07 A;  1OC9 A;  3D5J A;  1YVL A;  1TOF A;  2IIY A;  5ELG A;  4ID0 A;  4POL A;  4PQ1 A;  1XWA A;  4MF7 A;  3ZVJ A;  3LXZ A;  2XC2 A;  4DEJ A;  1A2L A;  2OBI A;  17GS A;  4WR5 A;  3ZFB A;  3A2X A;  4BVX A;  1FAA A;  3C7M A;  4G01 A;  1RW1 A;  4GLT A;  5JCU A;  2GVP A;  4V1A p;  3O3T A;  1NW2 A;  1V58 A;  1K0B A;  3APS A;  4DSR A;  1PSQ A;  5CP1 A;  1GSY A;  4ILF A;  1EV4 A;  3LEF A;  3P2A A;  3ERF A;  2ZUP A;  2FWE A;  1SJI A;  3VWX A;  4V1A g;  1I5G A;  3DIE A;  1LBK A;  3UVT A;  2IMF A;  2C1Y A;  3GKN A;  4FQU A;  1A23 A;  4YAP A;  4MLY A;  3SBC A;  2YZH A;  4X1U A;  2DKH A;  2X49 A;  2MMA A;  2IJY A;  4JZQ A;  2DJJ A;  1Y1U A;  4DVC A;  1SU9 A;  2CAQ A;  2XPD A;  4G19 A;  3TJG A;  4YQM A;  1Z7P A;  4CDO A;  2NDO A;  4PXO A;  5C04 A;  3MIX A;  2H0I A;  3IBH A;  1I9D A;  4NWY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...