1BX9A

Glutathione s-transferase in complex with herbicide
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
210
structure length
210
Chain Sequence
GIKVFGHPASIATRRVLIALHEKNLDFELVHVELKDGEHKKEPFLSRNPFGQVPAFEDGDLKLFESRAITQYIAHRYENQGTNLLQTDSKNISQYAIMAIGMQVEDHQFDPVASKLAFEQIFKSIYGLTTDEAVVAEEEAKLAKVLDVYEARLKEFKYLAGETFTLTDLHHIPAIQYLLGTPTKKLFTERPRVNEWVAEITKRPASEKVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE
publication title Structures of herbicides in complex with their detoxifying enzyme glutathione S-transferase - explanations for the selectivity of the enzyme in plants.
pubmed doi rcsb
molecule tags Transferase/peptide
total genus 77
structure length 210
sequence length 210
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1998-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1bx9A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1bx9A01
1U3IA 5IM9A 3ME8A 2GVPA 1ABAA 4RI6A 1R26A 2C3NA 5JWOB 2VL2A 5KEJA 1K3YA 1GUHA 2RLIA 2WB9A 2V1MA 3H79A 2HYXA 4LMVA 3D4TA 3UMAA 1BAYA 2N5BA 1X9MB 4GWRA 1RK4A 3PH9A 4TR1A 3HD5A 4G10A 2F3MA 3GIXA 3ZYWA 1FB6A 2C1YA 4KB3A 4GSSA 5DDLA 3DYRA 3CRTA 3A2XA 3GL3A 3KP9A 3R2QA 1XCCA 4PQ1A 4WKWA 2O87A 5B8AA 1ZZYA 4K1FA 3UL3A 3ISOA 2IL3A 1F6MC 5DALA 2J23A 2KUCA 5B8BA 5COHA 4IN0A 4KGIA 1TOFA 2JZSA 4ML6A 1A24A 3UVTA 5ABRA 4HZ4A 2YWOA 5CO3A 1TKDB 1V58A 5EY6A 4YQUA 3G7JA 2JU5A 1Z3EA 4ZB8A 2R37A 3P2AA 1JLVA 1PL1A 3BCIA 4MH3A 2MMOA 2PUKC 5DAKB 4XS4B 1T3BA 4FYCA 2F8AA 3ZMKA 3JCML 5IOWA 4XS1A 20GSA 2CVDA 3TKQA 4MF5A 1FOVA 3QFAC 2XBIA 4O5RA 1WOUA 2YV9A 3P90A 3BJ5A 3VPTA 3ZLPA 1WRYA 1PQNA 3ERWA 3TCOA 1AW9A 4L5LA 2VCWA 3IAS2 3LYPA 1PRXA 3DVXA 1GTUA 2N5FA 5CYYA 2YPMA 3D4MA 3E3EA 2LJAA 2K8VA 4KDXA 5LD0A 2H8LA 2LQQA 4BPYA 1VF3A 2GSQA 3A3TA 1K0AA 4IGJA 2H66A 3VFIA 4DVCA 2YJ7A 2K8SA 2MZCA 1U6TA 1GUKA 1SL1B 1ZYEA 3SWLA 4V1Ag 1TTZA 2H75A 2V32A 2B7JA 3F4TA 4BVYB 2VO4A 2CX4A 2HZFA 2ES7A 1EV9A 3DEXA 2RIIA 4GLTA 3IXRA 1X9WB 4OD7A 2IN3A 3TB2A 2PGTA 5IQYA 1O85A 3QOUA 2MBSA 2BJXA 4O92A 3D22A 2GZPA 3IC8A 1R4WA 16GSA 2OBKA 2WRTA 1K0NA 2AB6A 4JZQA 3ZZXA 1AIUA 2HZEA 3CRUA 4N30A 3J7Yb 6GSVA 4XTSA 1XWAA 3P8WA 1JZWA 2LRTA 1SENA 5A5KA 8GSSA 2NBSA 4DSQA 4K0NA 3GKNA 2AYTA 3FR3A 1TJDA 4EL1A 4FIWA 3KCMA 4D73A 4TR1B 4MZCA 5EPFA 2DIZA 3LFLA 3A5WA 4MABA 2DJ1A 3IK7A 5IO2A 2YJHA 2P5RA 5CAXA 1VF4A 2N5AA 2L6CA 5ECRB 5A4VA 2C3TA 3GKKA 3FEUA 4NXIA 2MYGA 4J56E 4N0ZA 3GURA 4IVFA 4FO5A 3RPPA 2RM5A 4IS0A 5A4WA 4NAXA 2CV4A 3HKRA 4GQFA 3TRXA 4F82A 3U5RE 11GSA 1S3AA 5H5RA 3F9UA 3IV4A 2H0GA 4GF0A 1EEMA 4X43A 3F4RA 1GNEA 4Z7XA 3FRCA 2F8FA 1XOBA 3HY2A 2IMFA 3IK9A 1MEKA 3EC3A 5D9WA 3HZ8A 4E8HA 3QD9A 2L4QA 1JZDA 2B5XA 1XZOA 2LQOA 3ZVJD 5G31A 1KBNA 5F05A 2C0DA 2DMLA 5ECLB 4LL4B 1U87A 3F0IA 3TKPA 4YQMA 3GX0A 1YJ6A 2WULA 4XCSA 2PERA 4EDYA 4O32A 4KNDA 4OFNA 2YCDA 4L0WA 1PMTA 4N10A 4PGTA 1HNBA 4RQXA 2EC4A 4OCFA 4TR3A 2B7KA 1MD3A 2DJ2A 1X0RA 4V2LA 4EO3A 1VF2A 2GGTA 3HDCA 2GTUA 1K3OA 3CYNA 2GSTA 2FA8A 4QQ7A 1B9YC 1PX7A 3H93A 3HJOA 4L8EA 4EVMA 3KJYA 2R6KA 1QMVA 1EV4A 1VGLA 2GQKA 3HVVA 5IMFA 3WD6A 4RUVA 3NIVA 5ECKB 2FWHA 3TJFA 5FT3A 4KCAA 2KP1A 2HZEB 2FGXA 4J57E 1M0UA 2OA7A 3GYKA 1XVWA 1CQGA 1H4OA 1XIYA 1JZRA 5G5FA 1XBSA 3VK9A 1BG5A 2H1AA 4OO5A 1BX9A 3HYPA 2HXKA 1TW9A 3KTLA 4D73B 1V57A 1ML6A 1ST9A 2FHEA 2HRAA 2E2MA 2VM1A 6GSWA 3HJPA 4XRAA 2FNOA 1A23A 3IA1A 4PQIA 2GQMA 3IE3A 2DIYA 4F9ZA 1XWGA 3G7IA 1ZYQB 3DWVA 3EE2A 1ERVA 3C7MA 3FK8A 1ON4A 2YN1A 3KMNA 4BL7A 1PGTA 3A2VA 4JRRA 5A4UA 3DXBA 1YEPA 1GTAA 3ME7A 13GSA 4ZL7A 1E2YA 2C0EA 2LNTA 2XPDA 4USSA 3UJ1A 2ALBA 1S3CA 4L5OA 1SKRB 2ZNMA 5B6MA 1QXHA 5F07A 2GT6A 3PR8A 3GN3A 5ECQB 1KTEA 3WGDA 2TRCP 5LCZA 5H5QA 3QCPA 6GSSA 1IYIA 2VL3A 2OE0A 3TDGA 4JE1A 3KZQA 2PU9C 5E4WA 1A8LA 3VWVA 3GA4A 2L6DA 3VLNA 4K8MA 2CX3A 5DCHA 2HNLA 3IRAA 2FD3A 2MMAA 2NVLA 4WETA 2B6MA 5KN2A 1PN9A 1I5GA 4TVEA 5GZZB 2CZ3A 1RW1A 4I6XA 2FA4A 4ECCA 2B3SA 5G1LA 4NMUA 4GRFA 4HU7A 4F2IA 4BA7A 4PX1A 1F37A 2C3QA 4ZB6A 3IPZA 3GSSA 3DMLA 5AISA 3OR5A 1Z5YE 2FUG2 1HNAA 3FY7A 6GSYA 3LJRA 1UA5A 3QDNA 2O85A 4ML1A 2H19A 4MP4A 3UAPA 4EC0A 1OE7A 5KN3A 1OC9A 3EWLA 4WF5A 1V2AA 5HR1A 2H6ZA 4IW9A 2KOKA 1GULA 1SYRA 4HZ2A 2IMEA 4PXOA 1SKWB 1GSYA 2WJUA 3C71A 2JSZA 1K0BA 1GSSA 3KGKA 5ID2A 2V6OA 3NZNA 5ECIB 4N11A 1G6YA 1BEDA 3L9VA 3FR9A 2I81A 1JZOA 4MJCA 4WEYA 1NM3A 3TRQA 4IKHA 4ZXGA 4WF4A 3APQA 2A2SA 1F3AA 4MLYA 4PNFA 2YANA 2IFQA 3GMFA 4G0IA 3W8JA 2OADA 3BBYA 2JZRA 2VL2C 1JFUA 4IP6A 4ZIJA 1AQWA 2REMA 3CMIA 2JSYA 4I5QA 2IWTA 3LXTA 3W6GA 2B1KA 4HQSA 1H75A 3FKFA 2LRNA 1SD8A 2DBCA 3C73A 3VPQA 3KM6A 3VWWA 5IMCA 3HJMA 1DE2A 4ZBBA 2LSTA 2YZUA 4MH2A 5HFGA 2IMDA 3TJGA 4POMA 4EKZA 3CTFA 3DRNA 2DJ0A 1TDIA 4ZB9A 3D0ZA 2ON7A 4RQRA 3C1SA 1G7OA 2L4CA 3UBLA 2WGRA 4KSMA 2XC2A 4FH8A 3GH9A 3M9JA 1A0FA 1PA3A 2E7PA 2C80A 5F8BA 4PQHA 3QMXA 4V1Ap 1OC3A 3GV1A 4TOPA 3P7XA 5DBQA 2OE1A 2VLTA 3F3QA 4ZILA 3TUEA 1UN2A 22GSA 2GZZA 1T7PB 3PINA 2HRKB 3EMXA 3K8NA 2HT9A 3PPUA 2H0HA 2AV4A 4QL7A 4MZBA 1LBKA 4JEDA 3ZRDA 4G0LA 3TJKA 4EF0A 4PURA 2X8CA 1XWBA 5GSSA 2H1GA 5CREA 1PSQA 4YQVA 1HQOA 4F03A 2MMNA 3C1RA 3CSJA 2R5GA 2H73A 2IIYA 3HVXA 5ID2B 4ECIA 6GSUA 1Z9HA 5ELAA 2ON5A 3GSTA 5CP1A 1AUCA 4OMVA 1SKSB 4I2TA 5GAND 3GUSA 4Q5FA 1JLWA 2WZ9A 3M0FA 7GSSA 2H01A 5HR0A 5EVOA 4AGSA 4KDUA 5EL8A 2VUPA 2PVQA 3GTUA 5GAPD 3L78A 5L71A 2IFQB 2TRXA 5FHIA 3TKRA 3AY8A 2GT5A 2PVOC 4KCEA 5IMZA 4EXJA 5D96A 1Z7PA 4Q5QA 1YKAA 5HFKA 4HEA2 2YOIA 2H1DA 1USBA 3RDWA 1MDIA 3KEBA 1TI3A 5DALB 1A8YA 3F3RA 5FWGA 1MD4A 2LUSA 3MNGA 1CQHA 5JWRB 3D5JA 1SJIA 2G0FA 4MMMA 3WT2A 1ERWA 3H8QA 2XBQA 4TR4A 4DSRA 1FAAA 2XHFA 1T1VA 4RI7A 1WJKA 4POLA 4H86A 4IBPA 5JWQB 1GSUA 2HLSA 1XOAA 3APSA 3APOA 3GKXA 1AQXA 4YAPA 3MWHA 2LEGA 1X5DA 2E0QA 1EOGA 1YZXA 5DVBA 5C00A 1KEBA 1OAZA 1THXA 3LQ7A 2L5LA 2I1UA 5F06A 5KN0A 5ELGA 3HZ4A 1XW6A 3I9V2 2EIOA 2H30A 4TKYA 1GSQA 1DUGA 1SYXA 2H70A 5AIVA 2H1BA 4MK3A 1EOHA 2HRNA 1U88A 2YNXA 1TK8B 1XW9A 2EIRA 1AAZA 3QR6A 4FQUA 1A2MA 3ED3A 2AAWA 1SJ6A 1Y6EA 3J7Yk 4OWYA 2QSIA 3QAGA 4IJIA 5G5EA 1F9MA 2DJKA 3LWAA 1V9WA 1B4PA 3TJJA 2YP6A 12GSA 4IJ3A 4K7OA 2HSYA 2I9HA 2MBTA 3UOMA 3M3MA 5DJMA 2CZ2A 2O89A 1TXXA 3IHQA 4WBJA 5CRWA 4XRDA 5J5NA 4NV2A 3L9SA 1T4YA 4EUYA 2BTOT 1O8WA 1GWCA 1GH2A 3HCZA 4HDEA 4X0XA 3MDKA 4G19A 1YF0A 3GL5A 1AC1A 1GTBA 1ZCPA 4XS6A 2QGVA 2PBJA 1HYUA 4AF2A 1GSDA 2VD1A 3F6DA 2RUEA 4YH2A 1A2JA 1R5AA 3GTUB 2K6VA 4X1UA 1U3AA 2GS3A 1THOA 5DQYA 2P0GA 4MJBA 3H1NA 2M80A 3D21A 3WGXA 5E59A 4KE3A 2GDRA 3LSZA 1FW1A 3FZ5A 2HRFA 4K2DA 5F0GA 4WR5A 3EVIA 4ID0A 4TN8A 3O3TA 1X5CA 1GTIA 5ENUA 1M9BA 4XHMA 10GSA 3TKSA 3LYKA 3VI5A 5CRGA 1FHEA 1YEXA 17GSA 2R3XA 4ZL9A 2F9SA 2Z9SA 1M2AA 3VURA 1QK8A 2G2QA 2DSAA 5IMVA 3VWXA 3IOSA 3CSIA 2CT6A 2YWMA 5IMAA 4HS1A 1YF1A 5CRDA 1PKZA 2OE3A 1ERUA 1EEJA 2A2RA 3TGZA 2ZCTA 3LEFA 3A2WA 3TKSC 4MJAA 3H4KA 1HNCA 3L4NA 1M9AA 2DLXA 4HJ2A 4GSNA 2YWIA 3QFBC 5J3RA 2J9HA 3CXGA 3TRPA 4HU9A 2HSHA 1ACVA 2NPBA 3HVSA 2L59A 2PWJA 2I3YA 4XS4A 5G1KA 1AXDA 3EINA 2H6YA 4CDOA 3IR4A 3LGCA 3Q18A 19GSA 3MAKA 3N9JA 1XPVA 4NWYA 3RPNA 2E2GA 6GSXA 4NPBA 2GLRA 2V41A 2LKUA 3ZIVA 5HQPA 3I69A 4PUAA 2H6XA 1EGRA 1WPIA 3UARA 1TRVA 2VM2A 3F4SA 5HR2A 4DEJA 4I2UA 4ZBAA 1MDKA 3UIWA 3ERGA 1TK0B 3ZFLA 1XVQA 2QC7A 1W89A 2M72A 1KNGA 2CAQA 5D8IA 5JCUA 4IQ1A 4KDYA 4WXTA 4PUFC 1LU4A 5D9XA 3ZVJA 2FLSA 4TR0A 6GSTA 3GFKA 2VLUA 2C4JA 4GSTA 1A2LA 3F8UA 3N5OA 4TXVA 5CNWA 1G7EA 5DJLA 5B7CA 5AIXA 1O8XA 5IPGA 2VCTA 1M99A 3M8NA 3ZREA 5C04A 2M46A 1RQMA 3O6TA 1TK5B 1NW2A 5DQSA 2EIQA 4HOJA 2FWGA 2RM6A 3ERFA 1J9BA 3E0UA 2VLVA 1TRWA 2VCVA 4MCUA 1FO5A 2OACA 4KSOA 3O76A 2DJ3A 1YDKA 2C0FA 1XFLA 1GLQA 2PPTA 5HR3A 1GSFA 1FVKA 1IYHA 1C72A 3RHBA 1X5EA 1FG4A 2RUFA 2B5EA 4BL7B 4POKA 5LNKe 3FR6A 2GSRA 1ZL9A 4JBBA 5IIZA 5G30A 3RAZA 5AN1A 3KH7A 1BJXA 1HD2A 4GQCA 2C8UA 1V40A 3VWUA 1UVZA 4NHZA 1DSBA 4NV5A 1XWKA 3R3EA 5H5SA 2VCXA 3KTBA 3M1GA 2CQ9A 5BMUA 1M7TA 3I43A 1GRXA 2JACA 4I8BA 5ECSA 2HSNB 2LNSA 4ECBA 2B5YA 3L9UA 4IQAA 1S3DA 5G2ZA 3GNJA 4OCEA 3KH9A 1G0TA 1ILOA 1TI1A 1B8XA 1QFNA 4ZL8A 4EE0A 3D6IA 3TOTA 3CTGA 1TU8A 2LJRA 4V2NA 1VRSD 3FZ9A 2CA8A 1G6WA 3LORA 1BYEA 4BWQA 4BVXA 4POBA 1DE1A 4ECJA 4JR4A 2VAFA 4K9ZA 2FWEA 1B48A 4MDCA 2H74A 1ERTA 1NHOA 1F3BA 1OYJA 4K7NA 3HA9A 2VCZA 2B1LA 1XXUA 5CRHA 2AUVA 1ZOFA 5ECMB 3ZTLA 2LV3A 1WMJA 3S9FA 2GQLA 4GCIA 2DMMA 2GZYA 3FZ4A 1TRUA 4WBRD 1OC9B 3BD2A 4OFTA 3DIEA 1SJZA 2AJQB 4LA1A 1EGOA 3RHCA 1PKWA 5IPHA 1ZGNA 1K3LA 1K0DA 4IP1A 4FYUA 1DBYA 3ZMLA 4GXZA 1Z6MA 1PL2A 1SL2B 2H72A 3WYWA 4MA9A 3F6FA 4Q5RA 3MSZA 2P31A 2IJYA 3ZL5A 2WDUA 2VOCA 2KHPA 4N0VA 4J2FA 3E9JB 4MJEA 4NHWA 4MF7A 4OO4A 1OVNA 5INYA 5ECHB 1WIKA 3EMPA 1JHBA 5D9VA 1M2DA 2V6KA 1SD9A 1MDJA 2LTKA 3IAM2 1ZMAA 3SBCA 2VD0A 4ACSA 2FY6A 3WT1A 1LJRA 1FB0A 1O73A 3QAVA 1GLPA 1M2BA 4KF9A 4LL1B 1Z7RA 1YQ1A 2ZUPA 5IO0A 2NTOA 1Z6NA 5J9BA 4BWSA 2HQTA 1PX6A 2HFDA 1TRSA 14GSA 1N8JA 2HI7A 4I97A 2V2GA 1YKCA 5D73A 4V2MA 3M9KA 4L0UA 2KLXA 4DSSA 1SK0A 3GH6A 3DKSA 4HI7A 2X8GA 4KW6A 3CBUA 4KH7A 5KN1A 2NDOA 3EURA 3QPMA 2KP2A 4XIHA 2CVBA 4AJ7A 3KMOA 1EZKA 3IC4A 2GSSA 3KIJA 2K9FA 4KA0A 4MF6A 2JZTA 5GSTA 2LRCA 2TIRA 4K6XA 4K0GA 4LLRA 1YY7A 4TXOA 4BVXB 3W8SA 2F51A 3HXSA 4CHSA 1GSEA 2DC5A 2O8VB 3BCKA 3ZITA 2HSMA 1WWJA 2YZHA 3KD0A 9GSSA 1UC7A 1Y25A 1EP8A 2VCQA 5HFIA 3UBKA 3CSHA 3G9BA 1PD21 2MMZA 4F0CA 2I4AA 4HQZA 2WFCA 4TW5A 3Q19A 5J41A 2PN8A 3F63A 3DGQA 1T00A 4CW9A 2QKEA 2H76A 4TRXA 1FVJA 2L57A 4PNGA 1O81A 2O7KA 4P3YB 4HJMA 4ILFA 2DJJA 2X64A 1EWXA 4OFMA 1XWCA 3KXOA 3FZAA 3GKMA 2K18A 3FHKA 1Q98A 4LMWA 4Q5NA 1XW5A 3EU4A 2YV7A 3GHAA 1QGVA 2H71A 3V1WA 2VIMA 1T8EB 3KP8A 4F0BA 5AGYA 4KX4A 4PTSA 4IELA 4YAVA 2H0IA 2PMTA 3Q6OA 1K0CA 3LXZA 4KAEA 2WCIA 1SK2A 3DVWA 1TP9A 1B4QA 5ECOB 1MTCA 1I9DA 3WGEA 1GNWA 2LJKA 1J0FA 1K0OA 1R5PA 5B6NA 1Q4JA 2OBIA 4E8EA 4QL9A 2R2JA 5ECNB 5J9CA 2JADA 3BOAA 5IOXA 1K0MA 1NHYA 2BMXA 3EYTA 3UVHA 4KUNA 1QQ2A 2A4VA 3GX8A 1SK1A 3UEMA 2AHEA 2UZ8A 3Q74A 4K7IA 1AQVA 4GTUA 4FYBA 2C0GA 2L5OA 4ISDA 5D93A 1GUMA 1O7UA 4JR6A 5ECPB 1O6JA 3C8EA 3US3A 1NSWA 3TJBA 3IBHA 1OKTA 3ZIJA 4DSSB 5JCGA 1GP1A 1WP0A 2CAIA 1URMA 3G7YA 1OC8A 2WS2A 5DCGA 5DAKA 3QAWA 4ZBDA 1R7HA 1SL0B 1BQ7A 2XPEA 2R4VA 3TOUA 1J08A 2IMIA 4TXOB 4HUAA 2FWFA 2VL9A 4ULXA 1WE0A 4G0KA 1TU7A 1SU9A 4JU5A 4G2EA 2HSMB 1OE8A 2OJLA 4EDZA 5J4UA 2OKAA 1N2AA 1QUWA 4G9HA 1F2EA 2HE3A 1V98A 1B9XC 3GRXA 3DD3A 4O7HA 3PGTA 3FW2A 3TKSE 4AJ8A 4MPGA 2X99A 2IPAA 2LS5A 5JCWA 4MZWA 3EU3A 1VF1A 2CVKA 3VI7A 2IMKA 5D9TA 2X8HA 1E6BA 3ZFBA 1GL8A 1EP7A 4BVYA 4IHUA 1A0RP 3L0HA 2HRKA 5IMDA 3RBTA 18GSA 1T4ZA 3HHVA 4WR4A 3LG6A 3U6VA 3FYGA 2P5QA 3IDVA 2FCHA 4MPFA 1W4VA 1OKDA 3NOFA 3I6AA 2D2ZA 1X9SB 4AJ6A 2JL4A 2YWNA
chains in the Genus database with same CATH superfamily
1U3IA 5IM9A 3ME8A 2GVPA 1ABAA 4RI6A 1R26A 2C3NA 2EFDA 1M3JA 5JWOB 2VL2A 5KEJA 1K3YA 1GUHA 2RLIA 2WB9A 2V1MA 3H79A 2HYXA 4LMVA 3D4TA 3UMAA 1BAYA 2N5BA 1X9MB 4GWRA 1RK4A 3PH9A 4TR1A 3HD5A 4G10A 2F3MA 3GIXA 3ZYWA 1FB6A 2C1YA 4KB3A 4GSSA 5DDLA 3DYRA 3CRTA 3A2XA 3GL3A 3KP9A 3R2QA 1XCCA 4PQ1A 4WKWA 2O87A 5B8AA 1ZZYA 4K1FA 3UL3A 3ISOA 2IL3A 2R0GA 1F6MC 5DALA 2J23A 2KUCA 5B8BA 5COHA 4IN0A 4KGIA 1TOFA 2JZSA 4ML6A 1A24A 3UVTA 5ABRA 4HZ4A 2YWOA 5CO3A 1TKDB 5BRTA 1V58A 5EY6A 4YQUA 3G7JA 2JU5A 1Z3EA 4ZB8A 2R37A 3P2AA 1JLVA 1PL1A 3BCIA 4MH3A 2MMOA 2PUKC 5DAKB 4XS4B 1T3BA 4FYCA 2F8AA 3ZMKA 5J47A 3JCML 5IOWA 4XS1A 20GSA 2CVDA 3TKQA 4MF5A 1FOVA 3QFAC 2XBIA 4O5RA 1WOUA 2YV9A 3P90A 3BJ5A 3VPTA 3ZLPA 1WRYA 1PQNA 3ERWA 3TCOA 4ZB7A 1AW9A 4CY8A 4L5LA 2VCWA 3IAS2 4K5SA 3LYPA 1PRXA 3DVXA 1GTUA 5A1NB 2N5FA 3CQFA 2YPMA 3D4MA 5CYYA 3E3EA 2LJAA 2K8VA 4AKGA 4KDXA 5LD0A 2H8LA 2LQQA 4BPYA 1VF3A 2GSQA 3A3TA 1K0AA 4IGJA 2H66A 3VFIA 4DVCA 2YJ7A 2K8SA 2MZCA 1U6TA 1GUKA 1SL1B 4N3ZA 1ZYEA 3SWLA 4V1Ag 1TTZA 2H75A 2V32A 2B7JA 3F4TA 1S3RA 4BVYB 2VO4A 2CX4A 2HZFA 2ES7A 1EV9A 3DEXA 2RIIA 4GLTA 3IXRA 1X9WB 4OD7A 2IN3A 3TB2A 2PGTA 5IQYA 1O85A 3QOUA 2MBSA 2BJXA 4O92A 3D22A 2GZPA 3IC8A 1R4WA 2X4AA 16GSA 2OBKA 2WRTA 1K0NA 2AB6A 4JZQA 3ZZXA 1AIUA 2HZEA 3CRUA 4N30A 3J7Yb 6GSVA 4XTSA 1XWAA 3P8WA 1JZWA 4Z2UA 2LRTA 1SENA 5A5KA 8GSSA 2NBSA 4DSQA 4K0NA 3GKNA 2AYTA 3FR3A 1TJDA 4EL1A 4FIWA 5J40A 3KCMA 4D73A 4TR1B 2A4HA 4MZCA 5EPFA 2DIZA 3LFLA 3A5WA 4MABA 1FOHA 2DJ1A 3IK7A 5IO2A 2YJHA 2P5RA 5CAXA 1VF4A 2N5AA 2L6CA 5ECRB 5A4VA 2C3TA 3GKKA 3FEUA 4NXIA 2MYGA 4J56E 4N0ZA 3GURA 4IVFA 4FO5A 3RPPA 2RM5A 4IS0A 5A4WA 4NAXA 2CV4A 3HKRA 4GQFA 3TRXA 4F82A 3U5RE 11GSA 1S3AA 5H5RA 3F9UA 3IV4A 2H0GA 4GF0A 1EEMA 4X43A 3F4RA 1GNEA 4Z7XA 3FRCA 2F8FA 1XOBA 3HY2A 2IMFA 2DKHA 3IK9A 1MEKA 3EC3A 5D9WA 3HZ8A 4E8HA 3QD9A 2L4QA 1JZDA 2B5XA 1XZOA 2LQOA 3ZVJD 5G31A 1KBNA 5F05A 2C0DA 2DMLA 5ECLB 4LL4B 1U87A 3F0IA 3TKPA 4YQMA 3GX0A 1YJ6A 2WULA 4XCSA 2PERA 2EFEA 4EDYA 4O32A 4KNDA 4OFNA 2YCDA 4L0WA 1PMTA 4N10A 4PGTA 1HNBA 4RQXA 1BG1A 2EC4A 4OCFA 4TR3A 2B7KA 1MD3A 4K5RA 2DJ2A 1X0RA 4V2LA 4EO3A 1VF2A 2GGTA 3HDCA 2GTUA 1K3OA 3CYNA 5A5HA 2GSTA 2FA8A 4QQ7A 1B9YC 1PX7A 3H93A 3HJOA 4L8EA 3FMWA 4EVMA 3KJYA 2R6KA 1QMVA 1EV4A 4ICYA 1VGLA 2GQKA 3HVVA 5IMFA 3WD6A 4RUVA 3NIVA 5ECKB 2FWHA 3TJFA 5FT3A 4KCAA 2KP1A 2HZEB 2FGXA 4J57E 1M0UA 2OA7A 3GYKA 1XVWA 3HVNA 1CQGA 1H4OA 1XIYA 1JZRA 5G5FA 1XBSA 3VK9A 1BG5A 2H1AA 4OO5A 1ZYNA 1BX9A 3HYPA 2HXKA 1TW9A 3KTLA 4D73B 1V57A 2WZSA 1ML6A 1ST9A 2FHEA 2HRAA 2E2MA 2VM1A 6GSWA 3HJPA 4XRAA 2FNOA 1A23A 3IA1A 4PQIA 2GQMA 3IE3A 2DIYA 4F9ZA 1XWGA 3G7IA 1ZYQB 3DWVA 3EE2A 1ERVA 3C7MA 3FK8A 4EIQA 1ON4A 2YN1A 3KMNA 4BL7A 4AKIA 1PGTA 3A2VA 4JRRA 5J4YA 5A4UA 3DXBA 1YEPA 1GTAA 3ME7A 13GSA 4ZL7A 1E2YA 2C0EA 2LNTA 2XPDA 4USSA 3UJ1A 2ALBA 1S3CA 4L5OA 1SKRB 2ZNMA 5B6MA 1PN0A 1QXHA 5F07A 2GT6A 3PR8A 4AKHA 3GN3A 5ECQB 1KTEA 3WGDA 2TRCP 5LCZA 5H5QA 3QCPA 4YKGA 6GSSA 1IYIA 2VL3A 2OE0A 3TDGA 4JE1A 3KZQA 2PU9C 5E4WA 1A8LA 3VWVA 3GA4A 2L6DA 3VLNA 4K8MA 2CX3A 5DCHA 2HNLA 2WW0A 3IRAA 2FD3A 2MMAA 2NVLA 4WETA 2B6MA 5KN2A 1PN9A 1I5GA 4TVEA 5GZZB 2CZ3A 1RW1A 4I6XA 2FA4A 4ECCA 4Z2RA 2B3SA 2X49A 5G1LA 4NMUA 4GRFA 4HU7A 4F2IA 4BA7A 4PX1A 1F37A 2C3QA 4ZB6A 3IPZA 2UV8G 5A5HB 3GSSA 3DMLA 5AISA 3OR5A 1Z5YE 2FUG2 3FY7A 1HNAA 6GSYA 3LJRA 1UA5A 3QDNA 2O85A 4ML1A 2H19A 4MP4A 3UAPA 4EC0A 1OE7A 5KN3A 1OC9A 3EWLA 4WF5A 1V2AA 5HR1A 2H6ZA 4IW9A 2KOKA 3A5IA 1GULA 1SYRA 4HZ2A 2IMEA 4PXOA 1SKWB 1GSYA 2WJUA 3C71A 2JSZA 1K0BA 1GSSA 3KGKA 5ID2A 2V6OA 3NZNA 5ECIB 4X4JA 4N11A 2WW2A 1G6YA 1BEDA 3L9VA 3FR9A 2I81A 1JZOA 4MJCA 4WEYA 1NM3A 3TRQA 4IKHA 4ZXGA 4WF4A 3APQA 2A2SA 1F3AA 4MLYA 4PNFA 2YANA 2IFQA 3GMFA 2QA1A 4G0IA 3W8JA 4AI6A 2OADA 3BBYA 2JZRA 2VL2C 1JFUA 4IP6A 4ZIJA 1AQWA 2REMA 3CMIA 2JSYA 4I5QA 2IWTA 4EIPA 3LXTA 3W6GA 2B1KA 4HQSA 1H75A 3FKFA 2LRNA 1SD8A 2DBCA 4BIKA 3C73A 3VPQA 3KM6A 2EFHA 3VWWA 5IMCA 3HJMA 1DE2A 4ZBBA 2LSTA 2YZUA 4MH2A 5HFGA 2IMDA 3TJGA 4POMA 4EKZA 3CTFA 1ZYPA 3DRNA 2DJ0A 1TDIA 4ZB9A 3D0ZA 2ON7A 4RQRA 3C1SA 1G7OA 2L4CA 3UBLA 2WGRA 4KSMA 2XC2A 4FH8A 3EPTA 3GH9A 3M9JA 1A0FA 1PA3A 2WVXA 2E7PA 2C80A 4Z2TA 5F8BA 4PQHA 3QMXA 4V1Ap 1OC3A 3GV1A 4TOPA 3P7XA 5DBQA 2OE1A 2VLTA 2H1LA 3F3QA 4ZILA 3TUEA 1UN2A 22GSA 2GZZA 1T7PB 3PINA 2HRKB 3EMXA 3K8NA 2HT9A 3PPUA 2H0HA 2AV4A 2EFCA 4QL7A 4MZBA 1LBKA 4JEDA 3ZRDA 4G0LA 3TJKA 4EF0A 4PURA 2X8CA 1I1IP 1XWBA 5GSSA 2H1GA 5CREA 1PSQA 4YQVA 1HQOA 2A2PA 4F03A 2MMNA 3C1RA 3CSJA 4MNNA 2R5GA 2H73A 2IIYA 3HVXA 5ID2B 4ECIA 6GSUA 1Z9HA 5ELAA 2ON5A 3GSTA 5CP1A 1AUCA 4OMVA 1SKSB 4I2TA 5GAND 3GUSA 4Q5FA 1JLWA 2WZ9A 3M0FA 7GSSA 2H01A 5HR0A 5EVOA 4AGSA 4KDUA 5EL8A 2VUPA 2PVQA 3GTUA 5GAPD 3L78A 5L71A 2IFQB 2TRXA 5FHIA 3TKRA 3AY8A 2GT5A 2PVOC 4KCEA 5IMZA 4EXJA 5D96A 1Z7PA 4Q5QA 1YKAA 5HFKA 4HEA2 2YOIA 2H1DA 1USBA 3RDWA 1MDIA 3KEBA 1TI3A 5DALB 1A8YA 3F3RA 5FWGA 1MD4A 2LUSA 3MNGA 1CQHA 5JWRB 3D5JA 1SJIA 2G0FA 4MMMA 3WT2A 1ERWA 3H8QA 2XBQA 4TR4A 4DSRA 1FAAA 2XHFA 1T1VA 4RI7A 1BF5A 1WJKA 4POLA 4H86A 4IBPA 5JWQB 4AKXB 1GSUA 2HLSA 1XOAA 3APSA 3APOA 3GKXA 4E68A 1AQXA 4YAPA 3MWHA 2LEGA 1X5DA 2E0QA 1EOGA 1TXUA 1YZXA 3RGBC 5DVBA 5C00A 1KEBA 1OAZA 1THXA 3LQ7A 2L5LA 2I1UA 3RFRC 5F06A 5KN0A 5ELGA 3HZ4A 3MYDA 1XW6A 3I9V2 2EIOA 2H30A 4TKYA 1GSQA 1Y1UA 2WVXB 1DUGA 1SYXA 2H70A 5AIVA 2H1BA 2WVZA 1EOHA 4MK3A 4K2XA 2HRNA 1U88A 2YNXA 1TK8B 1XW9A 2EIRA 1AAZA 3QR6A 4FQUA 1A2MA 3ED3A 2AAWA 1SJ6A 1Y6EA 3J7Yk 4OWYA 2QSIA 3QAGA 4IJIA 5G5EA 1F9MA 2DJKA 3LWAA 1V9WA 5KOWA 1B4PA 3TJJA 2YP6A 12GSA 4IJ3A 4K7OA 2HSYA 2I9HA 2MBTA 3UOMA 3M3MA 5DJMA 4PHZC 2CZ2A 4G01A 2O89A 1TXXA 3IHQA 4WBJA 5CRWA 4XRDA 5J5NA 4NV2A 3L9SA 1T4YA 4EUYA 2BTOT 1SVOA 1O8WA 1GWCA 1GH2A 4CY6A 3HCZA 4HDEA 4O5QA 4X0XA 3MDKA 4G19A 1YF0A 3GL5A 1YVLA 1AC1A 1GTBA 1ZCPA 4XS6A 2QGVA 2PBJA 1HYUA 4AF2A 1GSDA 1N25A 2VD1A 3F6DA 2RUEA 2O5VA 4YH2A 1A2JA 1R5AA 3GTUB 2K6VA 4X1UA 1U3AA 2GS3A 1THOA 5DQYA 2P0GA 4MJBA 3H1NA 2M80A 3D21A 3WGXA 5E59A 4KE3A 2GDRA 3LSZA 1FW1A 3FZ5A 2HRFA 4K2DA 5F0GA 4WR5A 3IHGA 3EVIA 4ID0A 4TN8A 4HSCX 3O3TA 1X5CA 1GTIA 5ENUA 1M9BA 4XHMA 10GSA 3TKSA 3LYKA 3VI5A 2DKIA 5CRGA 1FHEA 1YEXA 17GSA 2R3XA 4ZL9A 2F9SA 2Z9SA 1M2AA 3VURA 1QK8A 2G2QA 2DSAA 5IMVA 3VWXA 3IOSA 3CSIA 2CT6A 2YWMA 5IMAA 4HS1A 1YF1A 5CRDA 1PKZA 2OE3A 1ERUA 1EEJA 2A2RA 3TGZA 2ZCTA 3LEFA 3A2WA 3TKSC 4MJAA 4QMKA 3H4KA 1HNCA 3L4NA 1M9AA 2DLXA 2HSNA 4HJ2A 4GSNA 4FXYP 2YWIA 3QFBC 5J3RA 2J9HA 3CXGA 3TRPA 4HU9A 2HSHA 1ACVA 2NPBA 3HVSA 2L59A 2PWJA 2I3YA 4XS4A 5G1KA 1AXDA 3EINA 2H6YA 4CDOA 3IR4A 3LGCA 3Q18A 19GSA 3MAKA 3N9JA 1XPVA 4NWYA 3RPNA 2E2GA 4PI2C 6GSXA 4NPBA 2GLRA 2V41A 2LKUA 3ZIVA 5HQPA 3I69A 4PUAA 3HMJG 2H6XA 1EGRA 1WPIA 3UARA 1TRVA 2VM2A 3F4SA 5HR2A 4DEJA 4I2UA 4ZBAA 1MDKA 3UIWA 3ERGA 1TK0B 3ZFLA 1XVQA 2QC7A 1W89A 2M72A 1KNGA 2CAQA 5D8IA 5JCUA 4IQ1A 4KDYA 4WXTA 4PUFC 1LU4A 5D9XA 3ZVJA 2FLSA 4TR0A 6GSTA 3GFKA 2VLUA 2C4JA 4GSTA 1A2LA 3F8UA 3N5OA 4TXVA 5CNWA 1G7EA 5DJLA 5B7CA 5AIXA 1O8XA 5IPGA 2VCTA 1M99A 3M8NA 3ZREA 5C04A 2M46A 1RQMA 3O6TA 1TK5B 1NW2A 5DQSA 2EIQA 4HOJA 2FWGA 2RM6A 1XG8A 3ERFA 1J9BA 3E0UA 2VLVA 1TRWA 2VCVA 4MCUA 1FO5A 2OACA 4KSOA 1SVLA 3O76A 2DJ3A 1YDKA 2C0FA 4O5UA 1XFLA 1GLQA 2PPTA 5HR3A 1GSFA 1FVKA 1IYHA 1C72A 3RHBA 2RUFA 1FG4A 1X5EA 2B5EA 4BL7B 4POKA 5LNKe 3FR6A 2GSRA 1ZL9A 4JBBA 5IIZA 5G30A 3RAZA 5AN1A 3KH7A 1BJXA 1HD2A 4GQCA 2C8UA 1V40A 3VWUA 1UVZA 4NHZA 1DSBA 4NV5A 1XWKA 3R3EA 5H5SA 2VCXA 3KTBA 3M1GA 2CQ9A 5BMUA 1M7TA 3I43A 1GRXA 2JACA 4I8BA 5ECSA 2WW1A 2HSNB 2LNSA 4ECBA 2B5YA 3L9UA 4IQAA 1S3DA 5G2ZA 3GNJA 4OCEA 3KH9A 1G0TA 1ILOA 1TI1A 1B8XA 1QFNA 4ZL8A 4EE0A 3D6IA 3TOTA 3CTGA 1TU8A 2LJRA 4V2NA 1VRSD 3FZ9A 2CA8A 1G6WA 3LORA 1BYEA 4BWQA 3CHXC 4BVXA 4POBA 1DE1A 4ECJA 4JR4A 2VAFA 4K9ZA 2FWEA 1B48A 4MDCA 2H74A 1ERTA 1NHOA 1F3BA 1OYJA 2WW3A 4K7NA 3HA9A 2VCZA 2B1LA 1XXUA 5CRHA 2AUVA 1ZOFA 5ECMB 3ZTLA 2LV3A 1WMJA 3S9FA 2GQLA 4GCIA 2DMMA 2GZYA 4A5PA 3FZ4A 1TRUA 4WBRD 1OC9B 3BD2A 2O3EA 4OFTA 3DIEA 1SJZA 2AJQB 4LA1A 1EGOA 3RHCA 1PKWA 5IPHA 1ZGNA 1K3LA 1K0DA 4IP1A 4FYUA 1DBYA 3ZMLA 4GXZA 1Z6MA 1PL2A 1SL2B 2H72A 3WYWA 4MA9A 3F6FA 4Q5RA 3MSZA 2P31A 5A34A 2IJYA 3ZL5A 2WDUA 2VOCA 2KHPA 4N0VA 4J2FA 3E9JB 4MJEA 4NHWA 4MF7A 4OO4A 1OVNA 2WVYA 5INYA 5ECHB 1WIKA 1YEWC 3EMPA 1JHBA 5D9VA 1M2DA 2V6KA 1SD9A 1MDJA 2LTKA 2O36A 3IAM2 3MIXA 1ZMAA 3SBCA 2VD0A 4ACSA 2FY6A 3WT1A 1LJRA 1FB0A 1O73A 3QAVA 1GLPA 1M2BA 4KF9A 4LL1B 1Z7RA 1YQ1A 2ZUPA 5IO0A 2NTOA 1Z6NA 5J9BA 4BWSA 2HQTA 1PX6A 2HFDA 1TRSA 2R0PA 14GSA 1N8JA 2HI7A 4I97A 5BMUB 2V2GA 1YKCA 5D73A 4V2MA 3M9KA 4L0UA 2KLXA 4DSSA 1SK0A 3GH6A 3DKSA 4HI7A 2X8GA 4KW6A 3CBUA 4KH7A 5KN1A 2NDOA 3EURA 3QPMA 2KP2A 4XIHA 2CVBA 4AJ7A 3KMOA 1EZKA 3IC4A 2GSSA 3KIJA 2K9FA 4KA0A 4MF6A 2JZTA 5GSTA 2LRCA 2TIRA 4K6XA 4K0GA 4LLRA 1YY7A 5J4VA 4TXOA 4BVXB 3W8SA 2F51A 3HXSA 4CHSA 1GSEA 2DC5A 2O8VB 3BCKA 3ZITA 2HSMA 1WWJA 2YZHA 2R0CA 3KD0A 9GSSA 1UC7A 1Y25A 1EP8A 2VCQA 5HFIA 3UBKA 4YKFA 3CSHA 3G9BA 1PD21 2MMZA 4F0CA 2QA2A 2I4AA 4HQZA 2WFCA 4TW5A 3Q19A 5J41A 2PN8A 1M3IA 3F63A 3DGQA 1T00A 4CW9A 2QKEA 2H76A 4TRXA 1FVJA 2L57A 4PNGA 3LW9A 1O81A 5KOXA 2O7KA 4P3YB 4HJMA 4ILFA 2DJJA 2X64A 1EWXA 4OFMA 1XWCA 5A34B 3KXOA 3FZAA 3GKMA 2K18A 3FHKA 1Q98A 4LMWA 4Q5NA 1XW5A 3EU4A 2YV7A 3GHAA 1PFOA 1QGVA 2H71A 3V1WA 1SVMA 2VIMA 1T8EB 3KP8A 4F0BA 5AGYA 4KX4A 4PTSA 4IELA 4YAVA 2H0IA 2PMTA 3Q6OA 1K0CA 3LXZA 4KAEA 2WCIA 1SK2A 4PI0C 1TP9A 3DVWA 2OT3A 1B4QA 5ECOB 1MTCA 1I9DA 4W66A 3WGEA 1GNWA 2LJKA 1J0FA 1K0OA 1R5PA 5B6NA 1Q4JA 2OBIA 4E8EA 4QL9A 2R2JA 5ECNB 5J9CA 2JADA 3BOAA 5IOXA 1K0MA 1NHYA 2BMXA 3EYTA 3UVHA 4KUNA 1QQ2A 2A4VA 3GX8A 1SK1A 3UEMA 2AHEA 2UZ8A 3Q74A 4K7IA 1AQVA 4GTUA 4FYBA 2C0GA 2L5OA 4ISDA 5D93A 1GUMA 1O7UA 4JR6A 5ECPB 1O6JA 3C8EA 3US3A 1NSWA 3TJBA 3IBHA 1OKTA 3ZIJA 4DSSB 5JCGA 3TU3B 1GP1A 1WP0A 2CAIA 1URMA 3G7YA 1OC8A 2WS2A 5DCGA 5DAKA 3QAWA 4ZBDA 1R7HA 1SL0B 1BQ7A 2XPEA 2R4VA 3TOUA 1J08A 2IMIA 4TXOB 4HUAA 2FWFA 2VL9A 4ULXA 1WE0A 4G0KA 1TU7A 1SU9A 4JU5A 4GDFA 4G2EA 2HSMB 1OE8A 2OJLA 4EDZA 5J4UA 2OKAA 1N2AA 1QUWA 4G9HA 1F2EA 2HE3A 1V98A 5A1NA 1B9XC 3CWGA 3GRXA 3DD3A 4O7HA 3PGTA 3FW2A 3TKSE 4AJ8A 4MPGA 2X99A 2IPAA 2LS5A 5JCWA 4MZWA 3EU3A 1VF1A 2CVKA 3VI7A 2IMKA 5D9TA 2X8HA 1E6BA 3ZFBA 1S4BP 1GL8A 1EP7A 4BVYA 4IHUA 1A0RP 3L0HA 2HRKA 5IMDA 3RBTA 18GSA 1T4ZA 3HHVA 2VKZG 4WR4A 3LG6A 3U6VA 3FYGA 2P5QA 3IDVA 2FCHA 4MPFA 1W4VA 1OKDA 3NOFA 3I6AA 2D2ZA 1X9SB 4AJ6A 2JL4A 2YWNA
chains in the Genus database with same CATH topology
1U3IA 5IM9A 3ME8A 2GVPA 1ABAA 4RI6A 1R26A 2C3NA 2EFDA 5JWOB 2VL2A 5KEJA 1K3YA 1GUHA 2RLIA 2WB9A 2V1MA 3H79A 2HYXA 4LMVA 3D4TA 3UMAA 1BAYA 2N5BA 1X9MB 4GWRA 1RK4A 3PH9A 4TR1A 3HD5A 4G10A 2F3MA 3GIXA 3ZYWA 1FB6A 2C1YA 4KB3A 4GSSA 5DDLA 3DYRA 3CRTA 3A2XA 3GL3A 3KP9A 3R2QA 1XCCA 4PQ1A 4WKWA 2O87A 5B8AA 1ZZYA 4K1FA 3UL3A 3ISOA 2IL3A 2R0GA 1F6MC 5DALA 2J23A 2KUCA 5B8BA 5COHA 4IN0A 4KGIA 1TOFA 2JZSA 4ML6A 1A24A 3UVTA 5ABRA 4HZ4A 2YWOA 5CO3A 1TKDB 5BRTA 1V58A 5EY6A 4YQUA 3G7JA 2JU5A 1Z3EA 4ZB8A 2R37A 3P2AA 1JLVA 1PL1A 3BCIA 4MH3A 2MMOA 2PUKC 5DAKB 4XS4B 1T3BA 4FYCA 2F8AA 3ZMKA 5J47A 3JCML 5IOWA 4XS1A 20GSA 2CVDA 3TKQA 4MF5A 1FOVA 3QFAC 2XBIA 4O5RA 1WOUA 2YV9A 3P90A 3BJ5A 3VPTA 3ZLPA 1WRYA 1PQNA 3ERWA 3TCOA 4ZB7A 1AW9A 4CY8A 4L5LA 2VCWA 3IAS2 4K5SA 3LYPA 1PRXA 3DVXA 1GTUA 5A1NB 2N5FA 5CYYA 2YPMA 3D4MA 3E3EA 2LJAA 2K8VA 4AKGA 4KDXA 5LD0A 2H8LA 2LQQA 4BPYA 1VF3A 2GSQA 3A3TA 1K0AA 4IGJA 2H66A 3VFIA 4DVCA 2YJ7A 2K8SA 2MZCA 1U6TA 1GUKA 1SL1B 4N3ZA 1ZYEA 3SWLA 4V1Ag 1TTZA 2H75A 2V32A 2B7JA 3F4TA 4BVYB 2VO4A 2CX4A 2HZFA 2ES7A 1EV9A 3DEXA 2RIIA 4GLTA 3IXRA 1X9WB 4OD7A 2IN3A 3TB2A 2PGTA 5IQYA 1O85A 3QOUA 2MBSA 2BJXA 4O92A 3D22A 2GZPA 3IC8A 1R4WA 2X4AA 16GSA 2OBKA 2WRTA 1K0NA 2AB6A 4JZQA 3ZZXA 1AIUA 2HZEA 3CRUA 4N30A 3J7Yb 6GSVA 4XTSA 1XWAA 3P8WA 1JZWA 4Z2UA 2LRTA 1SENA 5A5KA 8GSSA 2NBSA 4DSQA 4K0NA 3GKNA 2AYTA 3FR3A 1TJDA 4EL1A 4FIWA 5J40A 3KCMA 4D73A 4TR1B 2A4HA 4MZCA 5EPFA 2DIZA 3LFLA 3A5WA 4MABA 1FOHA 2DJ1A 3IK7A 5IO2A 2YJHA 2P5RA 5CAXA 1VF4A 2N5AA 2L6CA 5ECRB 5A4VA 2C3TA 3GKKA 3FEUA 4NXIA 2MYGA 4J56E 4N0ZA 3GURA 4IVFA 4FO5A 3RPPA 2RM5A 4IS0A 5A4WA 4NAXA 2CV4A 3HKRA 4GQFA 3TRXA 4F82A 3U5RE 11GSA 1S3AA 5H5RA 3F9UA 3IV4A 2H0GA 4GF0A 1EEMA 4X43A 3F4RA 1GNEA 4Z7XA 3FRCA 2F8FA 1XOBA 3HY2A 2IMFA 2DKHA 3IK9A 1MEKA 3EC3A 5D9WA 3HZ8A 4E8HA 3QD9A 2L4QA 1JZDA 2B5XA 1XZOA 2LQOA 3ZVJD 5G31A 1KBNA 5F05A 2C0DA 2DMLA 5ECLB 4LL4B 1U87A 3F0IA 3TKPA 4YQMA 3GX0A 1YJ6A 2WULA 4XCSA 2PERA 2EFEA 4EDYA 4O32A 4KNDA 4OFNA 2YCDA 4L0WA 1PMTA 4N10A 4PGTA 1HNBA 4RQXA 1BG1A 2EC4A 4OCFA 4TR3A 2B7KA 1MD3A 4K5RA 2DJ2A 1X0RA 4V2LA 4EO3A 1VF2A 2GGTA 3HDCA 2GTUA 1K3OA 3CYNA 5A5HA 2GSTA 2FA8A 4QQ7A 1B9YC 1PX7A 3H93A 3HJOA 4L8EA 3FMWA 4EVMA 3KJYA 2R6KA 1QMVA 1EV4A 4ICYA 1VGLA 2GQKA 3HVVA 5IMFA 3WD6A 4RUVA 3NIVA 5ECKB 2FWHA 3TJFA 5FT3A 4KCAA 2KP1A 2HZEB 2FGXA 4J57E 1M0UA 2OA7A 3GYKA 1XVWA 1CQGA 1H4OA 1XIYA 1JZRA 5G5FA 1XBSA 3VK9A 1BG5A 2H1AA 4OO5A 1ZYNA 1BX9A 3HYPA 2HXKA 1TW9A 3KTLA 4D73B 1V57A 1ML6A 1ST9A 2FHEA 2HRAA 2E2MA 2VM1A 6GSWA 3HJPA 4XRAA 2FNOA 1A23A 3IA1A 4PQIA 2GQMA 3IE3A 2DIYA 4F9ZA 1XWGA 3G7IA 1ZYQB 3DWVA 3EE2A 1ERVA 3C7MA 3FK8A 4EIQA 1ON4A 2YN1A 3KMNA 4BL7A 4AKIA 1PGTA 3A2VA 4JRRA 5J4YA 5A4UA 3DXBA 1YEPA 1GTAA 3ME7A 13GSA 4ZL7A 1E2YA 2C0EA 2LNTA 2XPDA 4USSA 3UJ1A 2ALBA 1S3CA 4L5OA 1SKRB 2ZNMA 5B6MA 1PN0A 1QXHA 5F07A 2GT6A 3PR8A 4AKHA 3GN3A 5ECQB 1KTEA 3WGDA 2TRCP 5LCZA 5H5QA 3QCPA 4YKGA 6GSSA 1IYIA 2VL3A 2OE0A 3TDGA 4JE1A 3KZQA 2PU9C 5E4WA 1A8LA 3VWVA 3GA4A 2L6DA 3VLNA 4K8MA 2CX3A 5DCHA 2HNLA 3IRAA 2FD3A 2MMAA 2NVLA 4WETA 2B6MA 5KN2A 1PN9A 1I5GA 4TVEA 5GZZB 2CZ3A 1RW1A 4I6XA 2FA4A 4ECCA 4Z2RA 2B3SA 2X49A 5G1LA 4NMUA 4GRFA 4HU7A 4F2IA 4BA7A 4PX1A 1F37A 2C3QA 4ZB6A 3IPZA 2UV8G 5A5HB 3GSSA 3DMLA 5AISA 3OR5A 1Z5YE 2FUG2 3FY7A 1HNAA 6GSYA 3LJRA 1UA5A 3QDNA 2O85A 4ML1A 2H19A 4MP4A 3UAPA 4EC0A 1OE7A 5KN3A 1OC9A 3EWLA 4WF5A 1V2AA 5HR1A 2H6ZA 4IW9A 2KOKA 3A5IA 1GULA 1SYRA 4HZ2A 2IMEA 4PXOA 1SKWB 1GSYA 2WJUA 3C71A 2JSZA 1K0BA 1GSSA 3KGKA 5ID2A 2V6OA 3NZNA 5ECIB 4X4JA 4N11A 1G6YA 1BEDA 3L9VA 3FR9A 2I81A 1JZOA 4MJCA 4WEYA 1NM3A 3TRQA 4IKHA 4ZXGA 4WF4A 3APQA 2A2SA 1F3AA 4MLYA 4PNFA 2YANA 2IFQA 3GMFA 2QA1A 4G0IA 3W8JA 4AI6A 2OADA 3BBYA 2JZRA 2VL2C 1JFUA 4IP6A 4ZIJA 1AQWA 2REMA 3CMIA 2JSYA 4I5QA 2IWTA 4EIPA 3LXTA 3W6GA 2B1KA 4HQSA 1H75A 3FKFA 2LRNA 1SD8A 2DBCA 3C73A 3VPQA 3KM6A 2EFHA 3VWWA 5IMCA 3HJMA 1DE2A 4ZBBA 2LSTA 2YZUA 4MH2A 5HFGA 2IMDA 3TJGA 4POMA 4EKZA 3CTFA 1ZYPA 3DRNA 2DJ0A 1TDIA 4ZB9A 3D0ZA 2ON7A 4RQRA 3C1SA 1G7OA 2L4CA 3UBLA 2WGRA 4KSMA 2XC2A 4FH8A 3EPTA 3GH9A 3M9JA 1A0FA 1PA3A 2E7PA 2C80A 4Z2TA 5F8BA 4PQHA 3QMXA 4V1Ap 1OC3A 3GV1A 4TOPA 3P7XA 5DBQA 2OE1A 2VLTA 2H1LA 3F3QA 4ZILA 3TUEA 1UN2A 22GSA 2GZZA 1T7PB 3PINA 2HRKB 3EMXA 3K8NA 2HT9A 3PPUA 2H0HA 2AV4A 2EFCA 4QL7A 4MZBA 1LBKA 4JEDA 3ZRDA 4G0LA 3TJKA 4EF0A 4PURA 2X8CA 1XWBA 5GSSA 2H1GA 5CREA 1PSQA 4YQVA 1HQOA 2A2PA 4F03A 2MMNA 3C1RA 3CSJA 4MNNA 2R5GA 2H73A 2IIYA 3HVXA 5ID2B 4ECIA 6GSUA 1Z9HA 5ELAA 2ON5A 3GSTA 5CP1A 1AUCA 4OMVA 1SKSB 4I2TA 5GAND 3GUSA 4Q5FA 1JLWA 2WZ9A 3M0FA 7GSSA 2H01A 5HR0A 5EVOA 4AGSA 4KDUA 5EL8A 2VUPA 2PVQA 3GTUA 5GAPD 3L78A 5L71A 2IFQB 2TRXA 5FHIA 3TKRA 3AY8A 2GT5A 2PVOC 4KCEA 5IMZA 4EXJA 5D96A 1Z7PA 4Q5QA 1YKAA 5HFKA 4HEA2 2YOIA 2H1DA 1USBA 3RDWA 1MDIA 3KEBA 1TI3A 5DALB 1A8YA 3F3RA 5FWGA 1MD4A 2LUSA 3MNGA 1CQHA 5JWRB 3D5JA 1SJIA 2G0FA 4MMMA 3WT2A 1ERWA 3H8QA 2XBQA 4TR4A 4DSRA 1FAAA 2XHFA 1T1VA 4RI7A 1BF5A 1WJKA 4POLA 4H86A 4IBPA 5JWQB 4AKXB 1GSUA 2HLSA 1XOAA 3APSA 3APOA 3GKXA 4E68A 1AQXA 4YAPA 3MWHA 2LEGA 1X5DA 2E0QA 1EOGA 1TXUA 1YZXA 5DVBA 5C00A 1KEBA 1OAZA 1THXA 3LQ7A 2L5LA 2I1UA 5F06A 5KN0A 5ELGA 3HZ4A 3MYDA 1XW6A 3I9V2 2EIOA 2H30A 4TKYA 1GSQA 1Y1UA 1DUGA 1SYXA 2H70A 5AIVA 2H1BA 4MK3A 1EOHA 4K2XA 2HRNA 1U88A 2YNXA 1TK8B 1XW9A 2EIRA 1AAZA 3QR6A 4FQUA 1A2MA 3ED3A 2AAWA 1SJ6A 1Y6EA 3J7Yk 4OWYA 2QSIA 3QAGA 4IJIA 5G5EA 1F9MA 2DJKA 3LWAA 1V9WA 5KOWA 1B4PA 3TJJA 2YP6A 12GSA 4IJ3A 4K7OA 2HSYA 2I9HA 2MBTA 3UOMA 3M3MA 5DJMA 2CZ2A 4G01A 2O89A 1TXXA 3IHQA 4WBJA 5CRWA 4XRDA 5J5NA 4NV2A 3L9SA 1T4YA 4EUYA 2BTOT 1SVOA 1O8WA 1GWCA 1GH2A 4CY6A 3HCZA 4HDEA 4O5QA 4X0XA 3MDKA 4G19A 1YF0A 3GL5A 1YVLA 1AC1A 1GTBA 1ZCPA 4XS6A 2QGVA 2PBJA 1HYUA 4AF2A 1GSDA 1N25A 2VD1A 3F6DA 2RUEA 2O5VA 4YH2A 1A2JA 1R5AA 3GTUB 2K6VA 4X1UA 1U3AA 2GS3A 1THOA 5DQYA 2P0GA 4MJBA 3H1NA 2M80A 3D21A 3WGXA 5E59A 4KE3A 2GDRA 3LSZA 1FW1A 3FZ5A 2HRFA 4K2DA 5F0GA 4WR5A 3IHGA 3EVIA 4ID0A 4TN8A 3O3TA 1X5CA 1GTIA 5ENUA 1M9BA 4XHMA 10GSA 3TKSA 3LYKA 3VI5A 2DKIA 5CRGA 1FHEA 1YEXA 17GSA 2R3XA 4ZL9A 2F9SA 2Z9SA 1M2AA 3VURA 1QK8A 2G2QA 2DSAA 5IMVA 3VWXA 3IOSA 3CSIA 2CT6A 2YWMA 5IMAA 4HS1A 1YF1A 5CRDA 1PKZA 2OE3A 1ERUA 1EEJA 2A2RA 3TGZA 2ZCTA 3LEFA 3A2WA 3TKSC 4MJAA 4QMKA 3H4KA 1HNCA 3L4NA 1M9AA 2DLXA 2HSNA 4HJ2A 4GSNA 2YWIA 3QFBC 5J3RA 2J9HA 3CXGA 3TRPA 4HU9A 2HSHA 1ACVA 2NPBA 3HVSA 2L59A 2PWJA 2I3YA 4XS4A 5G1KA 1AXDA 3EINA 2H6YA 4CDOA 3IR4A 3LGCA 3Q18A 19GSA 3MAKA 3N9JA 1XPVA 4NWYA 3RPNA 2E2GA 6GSXA 4NPBA 2GLRA 2V41A 2LKUA 3ZIVA 5HQPA 3I69A 4PUAA 3HMJG 2H6XA 1EGRA 1WPIA 3UARA 1TRVA 2VM2A 3F4SA 5HR2A 4DEJA 4I2UA 4ZBAA 1MDKA 3UIWA 3ERGA 1TK0B 3ZFLA 1XVQA 2QC7A 1W89A 2M72A 1KNGA 2CAQA 5D8IA 5JCUA 4IQ1A 4KDYA 4WXTA 4PUFC 1LU4A 5D9XA 3ZVJA 2FLSA 4TR0A 6GSTA 3GFKA 2VLUA 2C4JA 4GSTA 1A2LA 3F8UA 3N5OA 4TXVA 5CNWA 1G7EA 5DJLA 5B7CA 5AIXA 1O8XA 5IPGA 2VCTA 1M99A 3M8NA 3ZREA 5C04A 2M46A 1RQMA 3O6TA 1TK5B 1NW2A 5DQSA 2EIQA 4HOJA 2FWGA 2RM6A 3ERFA 1J9BA 3E0UA 2VLVA 1TRWA 2VCVA 4MCUA 1FO5A 2OACA 4KSOA 1SVLA 3O76A 2DJ3A 1YDKA 2C0FA 4O5UA 1XFLA 1GLQA 2PPTA 5HR3A 1GSFA 1FVKA 1IYHA 1C72A 3RHBA 2RUFA 1FG4A 1X5EA 2B5EA 4BL7B 4POKA 5LNKe 3FR6A 2GSRA 1ZL9A 4JBBA 5IIZA 5G30A 3RAZA 5AN1A 3KH7A 1BJXA 1HD2A 4GQCA 2C8UA 1V40A 3VWUA 1UVZA 4NHZA 1DSBA 4NV5A 1XWKA 3R3EA 5H5SA 2VCXA 3KTBA 3M1GA 2CQ9A 5BMUA 1M7TA 3I43A 1GRXA 2JACA 4I8BA 5ECSA 2HSNB 2LNSA 4ECBA 2B5YA 3L9UA 4IQAA 1S3DA 5G2ZA 3GNJA 4OCEA 3KH9A 1G0TA 1ILOA 1TI1A 1B8XA 1QFNA 4ZL8A 4EE0A 3D6IA 3TOTA 3CTGA 1TU8A 2LJRA 4V2NA 1VRSD 3FZ9A 2CA8A 1G6WA 3LORA 1BYEA 4BWQA 4BVXA 4POBA 1DE1A 4ECJA 4JR4A 2VAFA 4K9ZA 2FWEA 1B48A 4MDCA 2H74A 1ERTA 1NHOA 1F3BA 1OYJA 4K7NA 3HA9A 2VCZA 2B1LA 1XXUA 5CRHA 2AUVA 1ZOFA 5ECMB 3ZTLA 2LV3A 1WMJA 3S9FA 2GQLA 4GCIA 2DMMA 2GZYA 4A5PA 3FZ4A 1TRUA 4WBRD 1OC9B 3BD2A 4OFTA 3DIEA 1SJZA 2AJQB 4LA1A 1EGOA 3RHCA 1PKWA 5IPHA 1ZGNA 1K3LA 1K0DA 4IP1A 4FYUA 1DBYA 3ZMLA 4GXZA 1Z6MA 1PL2A 1SL2B 2H72A 3WYWA 4MA9A 3F6FA 4Q5RA 3MSZA 2P31A 5A34A 2IJYA 3ZL5A 2WDUA 2VOCA 2KHPA 4N0VA 4J2FA 3E9JB 4MJEA 4NHWA 4MF7A 4OO4A 1OVNA 5INYA 5ECHB 1WIKA 3EMPA 1JHBA 5D9VA 1M2DA 2V6KA 1SD9A 1MDJA 2LTKA 3IAM2 3MIXA 1ZMAA 3SBCA 2VD0A 4ACSA 2FY6A 3WT1A 1LJRA 1FB0A 1O73A 3QAVA 1GLPA 1M2BA 4KF9A 4LL1B 1Z7RA 1YQ1A 2ZUPA 5IO0A 2NTOA 1Z6NA 5J9BA 4BWSA 2HQTA 1PX6A 2HFDA 1TRSA 2R0PA 14GSA 1N8JA 2HI7A 4I97A 5BMUB 2V2GA 1YKCA 5D73A 4V2MA 3M9KA 4L0UA 2KLXA 4DSSA 1SK0A 3GH6A 3DKSA 4HI7A 2X8GA 4KW6A 3CBUA 4KH7A 5KN1A 2NDOA 3EURA 3QPMA 2KP2A 4XIHA 2CVBA 4AJ7A 3KMOA 1EZKA 3IC4A 2GSSA 3KIJA 2K9FA 4KA0A 4MF6A 2JZTA 5GSTA 2LRCA 2TIRA 4K6XA 4K0GA 4LLRA 1YY7A 5J4VA 4TXOA 4BVXB 3W8SA 2F51A 3HXSA 4CHSA 1GSEA 2DC5A 2O8VB 3BCKA 3ZITA 2HSMA 1WWJA 2YZHA 2R0CA 3KD0A 9GSSA 1UC7A 1Y25A 1EP8A 2VCQA 5HFIA 3UBKA 4YKFA 3CSHA 3G9BA 1PD21 2MMZA 4F0CA 2QA2A 2I4AA 4HQZA 2WFCA 4TW5A 3Q19A 5J41A 2PN8A 3F63A 3DGQA 1T00A 4CW9A 2QKEA 2H76A 4TRXA 1FVJA 2L57A 4PNGA 3LW9A 1O81A 5KOXA 2O7KA 4P3YB 4HJMA 4ILFA 2DJJA 2X64A 1EWXA 4OFMA 1XWCA 5A34B 3KXOA 3FZAA 3GKMA 2K18A 3FHKA 1Q98A 4LMWA 4Q5NA 1XW5A 3EU4A 2YV7A 3GHAA 1QGVA 2H71A 3V1WA 1SVMA 2VIMA 1T8EB 3KP8A 4F0BA 5AGYA 4KX4A 4PTSA 4IELA 4YAVA 2H0IA 2PMTA 3Q6OA 1K0CA 3LXZA 4KAEA 2WCIA 1SK2A 3DVWA 1TP9A 2OT3A 1B4QA 5ECOB 1MTCA 1I9DA 4W66A 3WGEA 1GNWA 2LJKA 1J0FA 1K0OA 1R5PA 5B6NA 1Q4JA 2OBIA 4E8EA 4QL9A 2R2JA 5ECNB 5J9CA 2JADA 3BOAA 5IOXA 1K0MA 1NHYA 2BMXA 3EYTA 3UVHA 4KUNA 1QQ2A 2A4VA 3GX8A 1SK1A 3UEMA 2AHEA 2UZ8A 3Q74A 4K7IA 1AQVA 4GTUA 4FYBA 2C0GA 2L5OA 4ISDA 5D93A 1GUMA 1O7UA 4JR6A 5ECPB 1O6JA 3C8EA 3US3A 1NSWA 3TJBA 3IBHA 1OKTA 3ZIJA 4DSSB 5JCGA 3TU3B 1GP1A 1WP0A 2CAIA 1URMA 3G7YA 1OC8A 2WS2A 5DCGA 5DAKA 3QAWA 4ZBDA 1R7HA 1SL0B 1BQ7A 2XPEA 2R4VA 3TOUA 1J08A 2IMIA 4TXOB 4HUAA 2FWFA 2VL9A 4ULXA 1WE0A 4G0KA 1TU7A 1SU9A 4JU5A 4GDFA 4G2EA 2HSMB 1OE8A 2OJLA 4EDZA 5J4UA 2OKAA 1N2AA 1QUWA 4G9HA 1F2EA 2HE3A 1V98A 5A1NA 1B9XC 3CWGA 3GRXA 3DD3A 4O7HA 3PGTA 3FW2A 3TKSE 4AJ8A 4MPGA 2X99A 2IPAA 2LS5A 5JCWA 4MZWA 3EU3A 1VF1A 2CVKA 3VI7A 2IMKA 5D9TA 2X8HA 1E6BA 3ZFBA 1GL8A 1EP7A 4BVYA 4IHUA 1A0RP 3L0HA 2HRKA 5IMDA 3RBTA 18GSA 1T4ZA 3HHVA 2VKZG 4WR4A 3LG6A 3U6VA 3FYGA 2P5QA 3IDVA 2FCHA 4MPFA 1W4VA 1OKDA 3NOFA 3I6AA 2D2ZA 1X9SB 4AJ6A 2JL4A 2YWNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U3I A;  5IM9 A;  3ME8 A;  2GVP A;  1ABA A;  4RI6 A;  1R26 A;  2C3N A;  5JWO B;  2VL2 A;  5KEJ A;  1K3Y A;  1GUH A;  2RLI A;  2WB9 A;  2V1M A;  3H79 A;  2HYX A;  4LMV A;  3D4T A;  3UMA A;  1BAY A;  2N5B A;  1X9M B;  4GWR A;  1RK4 A;  3PH9 A;  4TR1 A;  3HD5 A;  4G10 A;  2F3M A;  3GIX A;  3ZYW A;  1FB6 A;  2C1Y A;  4KB3 A;  4GSS A;  5DDL A;  3DYR A;  3CRT A;  3A2X A;  3GL3 A;  3KP9 A;  3R2Q A;  1XCC A;  4PQ1 A;  4WKW A;  2O87 A;  5B8A A;  1ZZY A;  4K1F A;  3UL3 A;  3ISO A;  2IL3 A;  1F6M C;  5DAL A;  2J23 A;  2KUC A;  5B8B A;  5COH A;  4IN0 A;  4KGI A;  1TOF A;  2JZS A;  4ML6 A;  1A24 A;  3UVT A;  5ABR A;  4HZ4 A;  2YWO A;  5CO3 A;  1TKD B;  1V58 A;  5EY6 A;  4YQU A;  3G7J A;  2JU5 A;  1Z3E A;  4ZB8 A;  2R37 A;  3P2A A;  1JLV A;  1PL1 A;  3BCI A;  4MH3 A;  2MMO A;  2PUK C;  5DAK B;  4XS4 B;  1T3B A;  4FYC A;  2F8A A;  3ZMK A;  3JCM L;  5IOW A;  4XS1 A;  20GS A;  2CVD A;  3TKQ A;  4MF5 A;  1FOV A;  3QFA C;  2XBI A;  4O5R A;  1WOU A;  2YV9 A;  3P90 A;  3BJ5 A;  3VPT A;  3ZLP A;  1WRY A;  1PQN A;  3ERW A;  3TCO A;  1AW9 A;  4L5L A;  2VCW A;  3IAS 2;  3LYP A;  1PRX A;  3DVX A;  1GTU A;  2N5F A;  5CYY A;  2YPM A;  3D4M A;  3E3E A;  2LJA A;  2K8V A;  4KDX A;  5LD0 A;  2H8L A;  2LQQ A;  4BPY A;  1VF3 A;  2GSQ A;  3A3T A;  1K0A A;  4IGJ A;  2H66 A;  3VFI A;  4DVC A;  2YJ7 A;  2K8S A;  2MZC A;  1U6T A;  1GUK A;  1SL1 B;  1ZYE A;  3SWL A;  4V1A g;  1TTZ A;  2H75 A;  2V32 A;  2B7J A;  3F4T A;  4BVY B;  2VO4 A;  2CX4 A;  2HZF A;  2ES7 A;  1EV9 A;  3DEX A;  2RII A;  4GLT A;  3IXR A;  1X9W B;  4OD7 A;  2IN3 A;  3TB2 A;  2PGT A;  5IQY A;  1O85 A;  3QOU A;  2MBS A;  2BJX A;  4O92 A;  3D22 A;  2GZP A;  3IC8 A;  1R4W A;  16GS A;  2OBK A;  2WRT A;  1K0N A;  2AB6 A;  4JZQ A;  3ZZX A;  1AIU A;  2HZE A;  3CRU A;  4N30 A;  3J7Y b;  6GSV A;  4XTS A;  1XWA A;  3P8W A;  1JZW A;  2LRT A;  1SEN A;  5A5K A;  8GSS A;  2NBS A;  4DSQ A;  4K0N A;  3GKN A;  2AYT A;  3FR3 A;  1TJD A;  4EL1 A;  4FIW A;  3KCM A;  4D73 A;  4TR1 B;  4MZC A;  5EPF A;  2DIZ A;  3LFL A;  3A5W A;  4MAB A;  2DJ1 A;  3IK7 A;  5IO2 A;  2YJH A;  2P5R A;  5CAX A;  1VF4 A;  2N5A A;  2L6C A;  5ECR B;  5A4V A;  2C3T A;  3GKK A;  3FEU A;  4NXI A;  2MYG A;  4J56 E;  4N0Z A;  3GUR A;  4IVF A;  4FO5 A;  3RPP A;  2RM5 A;  4IS0 A;  5A4W A;  4NAX A;  2CV4 A;  3HKR A;  4GQF A;  3TRX A;  4F82 A;  3U5R E;  11GS A;  1S3A A;  5H5R A;  3F9U A;  3IV4 A;  2H0G A;  4GF0 A;  1EEM A;  4X43 A;  3F4R A;  1GNE A;  4Z7X A;  3FRC A;  2F8F A;  1XOB A;  3HY2 A;  2IMF A;  3IK9 A;  1MEK A;  3EC3 A;  5D9W A;  3HZ8 A;  4E8H A;  3QD9 A;  2L4Q A;  1JZD A;  2B5X A;  1XZO A;  2LQO A;  3ZVJ D;  5G31 A;  1KBN A;  5F05 A;  2C0D A;  2DML A;  5ECL B;  4LL4 B;  1U87 A;  3F0I A;  3TKP A;  4YQM A;  3GX0 A;  1YJ6 A;  2WUL A;  4XCS A;  2PER A;  4EDY A;  4O32 A;  4KND A;  4OFN A;  2YCD A;  4L0W A;  1PMT A;  4N10 A;  4PGT A;  1HNB A;  4RQX A;  2EC4 A;  4OCF A;  4TR3 A;  2B7K A;  1MD3 A;  2DJ2 A;  1X0R A;  4V2L A;  4EO3 A;  1VF2 A;  2GGT A;  3HDC A;  2GTU A;  1K3O A;  3CYN A;  2GST A;  2FA8 A;  4QQ7 A;  1B9Y C;  1PX7 A;  3H93 A;  3HJO A;  4L8E A;  4EVM A;  3KJY A;  2R6K A;  1QMV A;  1EV4 A;  1VGL A;  2GQK A;  3HVV A;  5IMF A;  3WD6 A;  4RUV A;  3NIV A;  5ECK B;  2FWH A;  3TJF A;  5FT3 A;  4KCA A;  2KP1 A;  2HZE B;  2FGX A;  4J57 E;  1M0U A;  2OA7 A;  3GYK A;  1XVW A;  1CQG A;  1H4O A;  1XIY A;  1JZR A;  5G5F A;  1XBS A;  3VK9 A;  1BG5 A;  2H1A A;  4OO5 A;  1BX9 A;  3HYP A;  2HXK A;  1TW9 A;  3KTL A;  4D73 B;  1V57 A;  1ML6 A;  1ST9 A;  2FHE A;  2HRA A;  2E2M A;  2VM1 A;  6GSW A;  3HJP A;  4XRA A;  2FNO A;  1A23 A;  3IA1 A;  4PQI A;  2GQM A;  3IE3 A;  2DIY A;  4F9Z A;  1XWG A;  3G7I A;  1ZYQ B;  3DWV A;  3EE2 A;  1ERV A;  3C7M A;  3FK8 A;  1ON4 A;  2YN1 A;  3KMN A;  4BL7 A;  1PGT A;  3A2V A;  4JRR A;  5A4U A;  3DXB A;  1YEP A;  1GTA A;  3ME7 A;  13GS A;  4ZL7 A;  1E2Y A;  2C0E A;  2LNT A;  2XPD A;  4USS A;  3UJ1 A;  2ALB A;  1S3C A;  4L5O A;  1SKR B;  2ZNM A;  5B6M A;  1QXH A;  5F07 A;  2GT6 A;  3PR8 A;  3GN3 A;  5ECQ B;  1KTE A;  3WGD A;  2TRC P;  5LCZ A;  5H5Q A;  3QCP A;  6GSS A;  1IYI A;  2VL3 A;  2OE0 A;  3TDG A;  4JE1 A;  3KZQ A;  2PU9 C;  5E4W A;  1A8L A;  3VWV A;  3GA4 A;  2L6D A;  3VLN A;  4K8M A;  2CX3 A;  5DCH A;  2HNL A;  3IRA A;  2FD3 A;  2MMA A;  2NVL A;  4WET A;  2B6M A;  5KN2 A;  1PN9 A;  1I5G A;  4TVE A;  5GZZ B;  2CZ3 A;  1RW1 A;  4I6X A;  2FA4 A;  4ECC A;  2B3S A;  5G1L A;  4NMU A;  4GRF A;  4HU7 A;  4F2I A;  4BA7 A;  4PX1 A;  1F37 A;  2C3Q A;  4ZB6 A;  3IPZ A;  3GSS A;  3DML A;  5AIS A;  3OR5 A;  1Z5Y E;  2FUG 2;  1HNA A;  3FY7 A;  6GSY A;  3LJR A;  1UA5 A;  3QDN A;  2O85 A;  4ML1 A;  2H19 A;  4MP4 A;  3UAP A;  4EC0 A;  1OE7 A;  5KN3 A;  1OC9 A;  3EWL A;  4WF5 A;  1V2A A;  5HR1 A;  2H6Z A;  4IW9 A;  2KOK A;  1GUL A;  1SYR A;  4HZ2 A;  2IME A;  4PXO A;  1SKW B;  1GSY A;  2WJU A;  3C71 A;  2JSZ A;  1K0B A;  1GSS A;  3KGK A;  5ID2 A;  2V6O A;  3NZN A;  5ECI B;  4N11 A;  1G6Y A;  1BED A;  3L9V A;  3FR9 A;  2I81 A;  1JZO A;  4MJC A;  4WEY A;  1NM3 A;  3TRQ A;  4IKH A;  4ZXG A;  4WF4 A;  3APQ A;  2A2S A;  1F3A A;  4MLY A;  4PNF A;  2YAN A;  2IFQ A;  3GMF A;  4G0I A;  3W8J A;  2OAD A;  3BBY A;  2JZR A;  2VL2 C;  1JFU A;  4IP6 A;  4ZIJ A;  1AQW A;  2REM A;  3CMI A;  2JSY A;  4I5Q A;  2IWT A;  3LXT A;  3W6G A;  2B1K A;  4HQS A;  1H75 A;  3FKF A;  2LRN A;  1SD8 A;  2DBC A;  3C73 A;  3VPQ A;  3KM6 A;  3VWW A;  5IMC A;  3HJM A;  1DE2 A;  4ZBB A;  2LST A;  2YZU A;  4MH2 A;  5HFG A;  2IMD A;  3TJG A;  4POM A;  4EKZ A;  3CTF A;  3DRN A;  2DJ0 A;  1TDI A;  4ZB9 A;  3D0Z A;  2ON7 A;  4RQR A;  3C1S A;  1G7O A;  2L4C A;  3UBL A;  2WGR A;  4KSM A;  2XC2 A;  4FH8 A;  3GH9 A;  3M9J A;  1A0F A;  1PA3 A;  2E7P A;  2C80 A;  5F8B A;  4PQH A;  3QMX A;  4V1A p;  1OC3 A;  3GV1 A;  4TOP A;  3P7X A;  5DBQ A;  2OE1 A;  2VLT A;  3F3Q A;  4ZIL A;  3TUE A;  1UN2 A;  22GS A;  2GZZ A;  1T7P B;  3PIN A;  2HRK B;  3EMX A;  3K8N A;  2HT9 A;  3PPU A;  2H0H A;  2AV4 A;  4QL7 A;  4MZB A;  1LBK A;  4JED A;  3ZRD A;  4G0L A;  3TJK A;  4EF0 A;  4PUR A;  2X8C A;  1XWB A;  5GSS A;  2H1G A;  5CRE A;  1PSQ A;  4YQV A;  1HQO A;  4F03 A;  2MMN A;  3C1R A;  3CSJ A;  2R5G A;  2H73 A;  2IIY A;  3HVX A;  5ID2 B;  4ECI A;  6GSU A;  1Z9H A;  5ELA A;  2ON5 A;  3GST A;  5CP1 A;  1AUC A;  4OMV A;  1SKS B;  4I2T A;  5GAN D;  3GUS A;  4Q5F A;  1JLW A;  2WZ9 A;  3M0F A;  7GSS A;  2H01 A;  5HR0 A;  5EVO A;  4AGS A;  4KDU A;  5EL8 A;  2VUP A;  2PVQ A;  3GTU A;  5GAP D;  3L78 A;  5L71 A;  2IFQ B;  2TRX A;  5FHI A;  3TKR A;  3AY8 A;  2GT5 A;  2PVO C;  4KCE A;  5IMZ A;  4EXJ A;  5D96 A;  1Z7P A;  4Q5Q A;  1YKA A;  5HFK A;  4HEA 2;  2YOI A;  2H1D A;  1USB A;  3RDW A;  1MDI A;  3KEB A;  1TI3 A;  5DAL B;  1A8Y A;  3F3R A;  5FWG A;  1MD4 A;  2LUS A;  3MNG A;  1CQH A;  5JWR B;  3D5J A;  1SJI A;  2G0F A;  4MMM A;  3WT2 A;  1ERW A;  3H8Q A;  2XBQ A;  4TR4 A;  4DSR A;  1FAA A;  2XHF A;  1T1V A;  4RI7 A;  1WJK A;  4POL A;  4H86 A;  4IBP A;  5JWQ B;  1GSU A;  2HLS A;  1XOA A;  3APS A;  3APO A;  3GKX A;  1AQX A;  4YAP A;  3MWH A;  2LEG A;  1X5D A;  2E0Q A;  1EOG A;  1YZX A;  5DVB A;  5C00 A;  1KEB A;  1OAZ A;  1THX A;  3LQ7 A;  2L5L A;  2I1U A;  5F06 A;  5KN0 A;  5ELG A;  3HZ4 A;  1XW6 A;  3I9V 2;  2EIO A;  2H30 A;  4TKY A;  1GSQ A;  1DUG A;  1SYX A;  2H70 A;  5AIV A;  2H1B A;  4MK3 A;  1EOH A;  2HRN A;  1U88 A;  2YNX A;  1TK8 B;  1XW9 A;  2EIR A;  1AAZ A;  3QR6 A;  4FQU A;  1A2M A;  3ED3 A;  2AAW A;  1SJ6 A;  1Y6E A;  3J7Y k;  4OWY A;  2QSI A;  3QAG A;  4IJI A;  5G5E A;  1F9M A;  2DJK A;  3LWA A;  1V9W A;  1B4P A;  3TJJ A;  2YP6 A;  12GS A;  4IJ3 A;  4K7O A;  2HSY A;  2I9H A;  2MBT A;  3UOM A;  3M3M A;  5DJM A;  2CZ2 A;  2O89 A;  1TXX A;  3IHQ A;  4WBJ A;  5CRW A;  4XRD A;  5J5N A;  4NV2 A;  3L9S A;  1T4Y A;  4EUY A;  2BTO T;  1O8W A;  1GWC A;  1GH2 A;  3HCZ A;  4HDE A;  4X0X A;  3MDK A;  4G19 A;  1YF0 A;  3GL5 A;  1AC1 A;  1GTB A;  1ZCP A;  4XS6 A;  2QGV A;  2PBJ A;  1HYU A;  4AF2 A;  1GSD A;  2VD1 A;  3F6D A;  2RUE A;  4YH2 A;  1A2J A;  1R5A A;  3GTU B;  2K6V A;  4X1U A;  1U3A A;  2GS3 A;  1THO A;  5DQY A;  2P0G A;  4MJB A;  3H1N A;  2M80 A;  3D21 A;  3WGX A;  5E59 A;  4KE3 A;  2GDR A;  3LSZ A;  1FW1 A;  3FZ5 A;  2HRF A;  4K2D A;  5F0G A;  4WR5 A;  3EVI A;  4ID0 A;  4TN8 A;  3O3T A;  1X5C A;  1GTI A;  5ENU A;  1M9B A;  4XHM A;  10GS A;  3TKS A;  3LYK A;  3VI5 A;  5CRG A;  1FHE A;  1YEX A;  17GS A;  2R3X A;  4ZL9 A;  2F9S A;  2Z9S A;  1M2A A;  3VUR A;  1QK8 A;  2G2Q A;  2DSA A;  5IMV A;  3VWX A;  3IOS A;  3CSI A;  2CT6 A;  2YWM A;  5IMA A;  4HS1 A;  1YF1 A;  5CRD A;  1PKZ A;  2OE3 A;  1ERU A;  1EEJ A;  2A2R A;  3TGZ A;  2ZCT A;  3LEF A;  3A2W A;  3TKS C;  4MJA A;  3H4K A;  1HNC A;  3L4N A;  1M9A A;  2DLX A;  4HJ2 A;  4GSN A;  2YWI A;  3QFB C;  5J3R A;  2J9H A;  3CXG A;  3TRP A;  4HU9 A;  2HSH A;  1ACV A;  2NPB A;  3HVS A;  2L59 A;  2PWJ A;  2I3Y A;  4XS4 A;  5G1K A;  1AXD A;  3EIN A;  2H6Y A;  4CDO A;  3IR4 A;  3LGC A;  3Q18 A;  19GS A;  3MAK A;  3N9J A;  1XPV A;  4NWY A;  3RPN A;  2E2G A;  6GSX A;  4NPB A;  2GLR A;  2V41 A;  2LKU A;  3ZIV A;  5HQP A;  3I69 A;  4PUA A;  2H6X A;  1EGR A;  1WPI A;  3UAR A;  1TRV A;  2VM2 A;  3F4S A;  5HR2 A;  4DEJ A;  4I2U A;  4ZBA A;  1MDK A;  3UIW A;  3ERG A;  1TK0 B;  3ZFL A;  1XVQ A;  2QC7 A;  1W89 A;  2M72 A;  1KNG A;  2CAQ A;  5D8I A;  5JCU A;  4IQ1 A;  4KDY A;  4WXT A;  4PUF C;  1LU4 A;  5D9X A;  3ZVJ A;  2FLS A;  4TR0 A;  6GST A;  3GFK A;  2VLU A;  2C4J A;  4GST A;  1A2L A;  3F8U A;  3N5O A;  4TXV A;  5CNW A;  1G7E A;  5DJL A;  5B7C A;  5AIX A;  1O8X A;  5IPG A;  2VCT A;  1M99 A;  3M8N A;  3ZRE A;  5C04 A;  2M46 A;  1RQM A;  3O6T A;  1TK5 B;  1NW2 A;  5DQS A;  2EIQ A;  4HOJ A;  2FWG A;  2RM6 A;  3ERF A;  1J9B A;  3E0U A;  2VLV A;  1TRW A;  2VCV A;  4MCU A;  1FO5 A;  2OAC A;  4KSO A;  3O76 A;  2DJ3 A;  1YDK A;  2C0F A;  1XFL A;  1GLQ A;  2PPT A;  5HR3 A;  1GSF A;  1FVK A;  1IYH A;  1C72 A;  3RHB A;  1X5E A;  1FG4 A;  2RUF A;  2B5E A;  4BL7 B;  4POK A;  5LNK e;  3FR6 A;  2GSR A;  1ZL9 A;  4JBB A;  5IIZ A;  5G30 A;  3RAZ A;  5AN1 A;  3KH7 A;  1BJX A;  1HD2 A;  4GQC A;  2C8U A;  1V40 A;  3VWU A;  1UVZ A;  4NHZ A;  1DSB A;  4NV5 A;  1XWK A;  3R3E A;  5H5S A;  2VCX A;  3KTB A;  3M1G A;  2CQ9 A;  5BMU A;  1M7T A;  3I43 A;  1GRX A;  2JAC A;  4I8B A;  5ECS A;  2HSN B;  2LNS A;  4ECB A;  2B5Y A;  3L9U A;  4IQA A;  1S3D A;  5G2Z A;  3GNJ A;  4OCE A;  3KH9 A;  1G0T A;  1ILO A;  1TI1 A;  1B8X A;  1QFN A;  4ZL8 A;  4EE0 A;  3D6I A;  3TOT A;  3CTG A;  1TU8 A;  2LJR A;  4V2N A;  1VRS D;  3FZ9 A;  2CA8 A;  1G6W A;  3LOR A;  1BYE A;  4BWQ A;  4BVX A;  4POB A;  1DE1 A;  4ECJ A;  4JR4 A;  2VAF A;  4K9Z A;  2FWE A;  1B48 A;  4MDC A;  2H74 A;  1ERT A;  1NHO A;  1F3B A;  1OYJ A;  4K7N A;  3HA9 A;  2VCZ A;  2B1L A;  1XXU A;  5CRH A;  2AUV A;  1ZOF A;  5ECM B;  3ZTL A;  2LV3 A;  1WMJ A;  3S9F A;  2GQL A;  4GCI A;  2DMM A;  2GZY A;  3FZ4 A;  1TRU A;  4WBR D;  1OC9 B;  3BD2 A;  4OFT A;  3DIE A;  1SJZ A;  2AJQ B;  4LA1 A;  1EGO A;  3RHC A;  1PKW A;  5IPH A;  1ZGN A;  1K3L A;  1K0D A;  4IP1 A;  4FYU A;  1DBY A;  3ZML A;  4GXZ A;  1Z6M A;  1PL2 A;  1SL2 B;  2H72 A;  3WYW A;  4MA9 A;  3F6F A;  4Q5R A;  3MSZ A;  2P31 A;  2IJY A;  3ZL5 A;  2WDU A;  2VOC A;  2KHP A;  4N0V A;  4J2F A;  3E9J B;  4MJE A;  4NHW A;  4MF7 A;  4OO4 A;  1OVN A;  5INY A;  5ECH B;  1WIK A;  3EMP A;  1JHB A;  5D9V A;  1M2D A;  2V6K A;  1SD9 A;  1MDJ A;  2LTK A;  3IAM 2;  1ZMA A;  3SBC A;  2VD0 A;  4ACS A;  2FY6 A;  3WT1 A;  1LJR A;  1FB0 A;  1O73 A;  3QAV A;  1GLP A;  1M2B A;  4KF9 A;  4LL1 B;  1Z7R A;  1YQ1 A;  2ZUP A;  5IO0 A;  2NTO A;  1Z6N A;  5J9B A;  4BWS A;  2HQT A;  1PX6 A;  2HFD A;  1TRS A;  14GS A;  1N8J A;  2HI7 A;  4I97 A;  2V2G A;  1YKC A;  5D73 A;  4V2M A;  3M9K A;  4L0U A;  2KLX A;  4DSS A;  1SK0 A;  3GH6 A;  3DKS A;  4HI7 A;  2X8G A;  4KW6 A;  3CBU A;  4KH7 A;  5KN1 A;  2NDO A;  3EUR A;  3QPM A;  2KP2 A;  4XIH A;  2CVB A;  4AJ7 A;  3KMO A;  1EZK A;  3IC4 A;  2GSS A;  3KIJ A;  2K9F A;  4KA0 A;  4MF6 A;  2JZT A;  5GST A;  2LRC A;  2TIR A;  4K6X A;  4K0G A;  4LLR A;  1YY7 A;  4TXO A;  4BVX B;  3W8S A;  2F51 A;  3HXS A;  4CHS A;  1GSE A;  2DC5 A;  2O8V B;  3BCK A;  3ZIT A;  2HSM A;  1WWJ A;  2YZH A;  3KD0 A;  9GSS A;  1UC7 A;  1Y25 A;  1EP8 A;  2VCQ A;  5HFI A;  3UBK A;  3CSH A;  3G9B A;  1PD2 1;  2MMZ A;  4F0C A;  2I4A A;  4HQZ A;  2WFC A;  4TW5 A;  3Q19 A;  5J41 A;  2PN8 A;  3F63 A;  3DGQ A;  1T00 A;  4CW9 A;  2QKE A;  2H76 A;  4TRX A;  1FVJ A;  2L57 A;  4PNG A;  1O81 A;  2O7K A;  4P3Y B;  4HJM A;  4ILF A;  2DJJ A;  2X64 A;  1EWX A;  4OFM A;  1XWC A;  3KXO A;  3FZA A;  3GKM A;  2K18 A;  3FHK A;  1Q98 A;  4LMW A;  4Q5N A;  1XW5 A;  3EU4 A;  2YV7 A;  3GHA A;  1QGV A;  2H71 A;  3V1W A;  2VIM A;  1T8E B;  3KP8 A;  4F0B A;  5AGY A;  4KX4 A;  4PTS A;  4IEL A;  4YAV A;  2H0I A;  2PMT A;  3Q6O A;  1K0C A;  3LXZ A;  4KAE A;  2WCI A;  1SK2 A;  3DVW A;  1TP9 A;  1B4Q A;  5ECO B;  1MTC A;  1I9D A;  3WGE A;  1GNW A;  2LJK A;  1J0F A;  1K0O A;  1R5P A;  5B6N A;  1Q4J A;  2OBI A;  4E8E A;  4QL9 A;  2R2J A;  5ECN B;  5J9C A;  2JAD A;  3BOA A;  5IOX A;  1K0M A;  1NHY A;  2BMX A;  3EYT A;  3UVH A;  4KUN A;  1QQ2 A;  2A4V A;  3GX8 A;  1SK1 A;  3UEM A;  2AHE A;  2UZ8 A;  3Q74 A;  4K7I A;  1AQV A;  4GTU A;  4FYB A;  2C0G A;  2L5O A;  4ISD A;  5D93 A;  1GUM A;  1O7U A;  4JR6 A;  5ECP B;  1O6J A;  3C8E A;  3US3 A;  1NSW A;  3TJB A;  3IBH A;  1OKT A;  3ZIJ A;  4DSS B;  5JCG A;  1GP1 A;  1WP0 A;  2CAI A;  1URM A;  3G7Y A;  1OC8 A;  2WS2 A;  5DCG A;  5DAK A;  3QAW A;  4ZBD A;  1R7H A;  1SL0 B;  1BQ7 A;  2XPE A;  2R4V A;  3TOU A;  1J08 A;  2IMI A;  4TXO B;  4HUA A;  2FWF A;  2VL9 A;  4ULX A;  1WE0 A;  4G0K A;  1TU7 A;  1SU9 A;  4JU5 A;  4G2E A;  2HSM B;  1OE8 A;  2OJL A;  4EDZ A;  5J4U A;  2OKA A;  1N2A A;  1QUW A;  4G9H A;  1F2E A;  2HE3 A;  1V98 A;  1B9X C;  3GRX A;  3DD3 A;  4O7H A;  3PGT A;  3FW2 A;  3TKS E;  4AJ8 A;  4MPG A;  2X99 A;  2IPA A;  2LS5 A;  5JCW A;  4MZW A;  3EU3 A;  1VF1 A;  2CVK A;  3VI7 A;  2IMK A;  5D9T A;  2X8H A;  1E6B A;  3ZFB A;  1GL8 A;  1EP7 A;  4BVY A;  4IHU A;  1A0R P;  3L0H A;  2HRK A;  5IMD A;  3RBT A;  18GS A;  1T4Z A;  3HHV A;  4WR4 A;  3LG6 A;  3U6V A;  3FYG A;  2P5Q A;  3IDV A;  2FCH A;  4MPF A;  1W4V A;  1OKD A;  3NOF A;  3I6A A;  2D2Z A;  1X9S B;  4AJ6 A;  2JL4 A;  2YWN A; 
#chains in the Genus database with same CATH topology
 1U3I A;  5IM9 A;  3ME8 A;  2GVP A;  1ABA A;  4RI6 A;  1R26 A;  2C3N A;  2EFD A;  1M3J A;  5JWO B;  2VL2 A;  5KEJ A;  1K3Y A;  1GUH A;  2RLI A;  2WB9 A;  2V1M A;  3H79 A;  2HYX A;  4LMV A;  3D4T A;  3UMA A;  1BAY A;  2N5B A;  1X9M B;  4GWR A;  1RK4 A;  3PH9 A;  4TR1 A;  3HD5 A;  4G10 A;  2F3M A;  3GIX A;  3ZYW A;  1FB6 A;  2C1Y A;  4KB3 A;  4GSS A;  5DDL A;  3DYR A;  3CRT A;  3A2X A;  3GL3 A;  3KP9 A;  3R2Q A;  1XCC A;  4PQ1 A;  4WKW A;  2O87 A;  5B8A A;  1ZZY A;  4K1F A;  3UL3 A;  3ISO A;  2IL3 A;  2R0G A;  1F6M C;  5DAL A;  2J23 A;  2KUC A;  5B8B A;  5COH A;  4IN0 A;  4KGI A;  1TOF A;  2JZS A;  4ML6 A;  1A24 A;  3UVT A;  5ABR A;  4HZ4 A;  2YWO A;  5CO3 A;  1TKD B;  5BRT A;  1V58 A;  5EY6 A;  4YQU A;  3G7J A;  2JU5 A;  1Z3E A;  4ZB8 A;  2R37 A;  3P2A A;  1JLV A;  1PL1 A;  3BCI A;  4MH3 A;  2MMO A;  2PUK C;  5DAK B;  4XS4 B;  1T3B A;  4FYC A;  2F8A A;  3ZMK A;  5J47 A;  3JCM L;  5IOW A;  4XS1 A;  20GS A;  2CVD A;  3TKQ A;  4MF5 A;  1FOV A;  3QFA C;  2XBI A;  4O5R A;  1WOU A;  2YV9 A;  3P90 A;  3BJ5 A;  3VPT A;  3ZLP A;  1WRY A;  1PQN A;  3ERW A;  3TCO A;  4ZB7 A;  1AW9 A;  4CY8 A;  4L5L A;  2VCW A;  3IAS 2;  4K5S A;  3LYP A;  1PRX A;  3DVX A;  1GTU A;  5A1N B;  2N5F A;  3CQF A;  2YPM A;  3D4M A;  5CYY A;  3E3E A;  2LJA A;  2K8V A;  4AKG A;  4KDX A;  5LD0 A;  2H8L A;  2LQQ A;  4BPY A;  1VF3 A;  2GSQ A;  3A3T A;  1K0A A;  4IGJ A;  2H66 A;  3VFI A;  4DVC A;  2YJ7 A;  2K8S A;  2MZC A;  1U6T A;  1GUK A;  1SL1 B;  4N3Z A;  1ZYE A;  3SWL A;  4V1A g;  1TTZ A;  2H75 A;  2V32 A;  2B7J A;  3F4T A;  1S3R A;  4BVY B;  2VO4 A;  2CX4 A;  2HZF A;  2ES7 A;  1EV9 A;  3DEX A;  2RII A;  4GLT A;  3IXR A;  1X9W B;  4OD7 A;  2IN3 A;  3TB2 A;  2PGT A;  5IQY A;  1O85 A;  3QOU A;  2MBS A;  2BJX A;  4O92 A;  3D22 A;  2GZP A;  3IC8 A;  1R4W A;  2X4A A;  16GS A;  2OBK A;  2WRT A;  1K0N A;  2AB6 A;  4JZQ A;  3ZZX A;  1AIU A;  2HZE A;  3CRU A;  4N30 A;  3J7Y b;  6GSV A;  4XTS A;  1XWA A;  3P8W A;  1JZW A;  4Z2U A;  2LRT A;  1SEN A;  5A5K A;  8GSS A;  2NBS A;  4DSQ A;  4K0N A;  3GKN A;  2AYT A;  3FR3 A;  1TJD A;  4EL1 A;  4FIW A;  5J40 A;  3KCM A;  4D73 A;  4TR1 B;  2A4H A;  4MZC A;  5EPF A;  2DIZ A;  3LFL A;  3A5W A;  4MAB A;  1FOH A;  2DJ1 A;  3IK7 A;  5IO2 A;  2YJH A;  2P5R A;  5CAX A;  1VF4 A;  2N5A A;  2L6C A;  5ECR B;  5A4V A;  2C3T A;  3GKK A;  3FEU A;  4NXI A;  2MYG A;  4J56 E;  4N0Z A;  3GUR A;  4IVF A;  4FO5 A;  3RPP A;  2RM5 A;  4IS0 A;  5A4W A;  4NAX A;  2CV4 A;  3HKR A;  4GQF A;  3TRX A;  4F82 A;  3U5R E;  11GS A;  1S3A A;  5H5R A;  3F9U A;  3IV4 A;  2H0G A;  4GF0 A;  1EEM A;  4X43 A;  3F4R A;  1GNE A;  4Z7X A;  3FRC A;  2F8F A;  1XOB A;  3HY2 A;  2IMF A;  2DKH A;  3IK9 A;  1MEK A;  3EC3 A;  5D9W A;  3HZ8 A;  4E8H A;  3QD9 A;  2L4Q A;  1JZD A;  2B5X A;  1XZO A;  2LQO A;  3ZVJ D;  5G31 A;  1KBN A;  5F05 A;  2C0D A;  2DML A;  5ECL B;  4LL4 B;  1U87 A;  3F0I A;  3TKP A;  4YQM A;  3GX0 A;  1YJ6 A;  2WUL A;  4XCS A;  2PER A;  2EFE A;  4EDY A;  4O32 A;  4KND A;  4OFN A;  2YCD A;  4L0W A;  1PMT A;  4N10 A;  4PGT A;  1HNB A;  4RQX A;  1BG1 A;  2EC4 A;  4OCF A;  4TR3 A;  2B7K A;  1MD3 A;  4K5R A;  2DJ2 A;  1X0R A;  4V2L A;  4EO3 A;  1VF2 A;  2GGT A;  3HDC A;  2GTU A;  1K3O A;  3CYN A;  5A5H A;  2GST A;  2FA8 A;  4QQ7 A;  1B9Y C;  1PX7 A;  3H93 A;  3HJO A;  4L8E A;  3FMW A;  4EVM A;  3KJY A;  2R6K A;  1QMV A;  1EV4 A;  4ICY A;  1VGL A;  2GQK A;  3HVV A;  5IMF A;  3WD6 A;  4RUV A;  3NIV A;  5ECK B;  2FWH A;  3TJF A;  5FT3 A;  4KCA A;  2KP1 A;  2HZE B;  2FGX A;  4J57 E;  1M0U A;  2OA7 A;  3GYK A;  1XVW A;  3HVN A;  1CQG A;  1H4O A;  1XIY A;  1JZR A;  5G5F A;  1XBS A;  3VK9 A;  1BG5 A;  2H1A A;  4OO5 A;  1ZYN A;  1BX9 A;  3HYP A;  2HXK A;  1TW9 A;  3KTL A;  4D73 B;  1V57 A;  2WZS A;  1ML6 A;  1ST9 A;  2FHE A;  2HRA A;  2E2M A;  2VM1 A;  6GSW A;  3HJP A;  4XRA A;  2FNO A;  1A23 A;  3IA1 A;  4PQI A;  2GQM A;  3IE3 A;  2DIY A;  4F9Z A;  1XWG A;  3G7I A;  1ZYQ B;  3DWV A;  3EE2 A;  1ERV A;  3C7M A;  3FK8 A;  4EIQ A;  1ON4 A;  2YN1 A;  3KMN A;  4BL7 A;  4AKI A;  1PGT A;  3A2V A;  4JRR A;  5J4Y A;  5A4U A;  3DXB A;  1YEP A;  1GTA A;  3ME7 A;  13GS A;  4ZL7 A;  1E2Y A;  2C0E A;  2LNT A;  2XPD A;  4USS A;  3UJ1 A;  2ALB A;  1S3C A;  4L5O A;  1SKR B;  2ZNM A;  5B6M A;  1PN0 A;  1QXH A;  5F07 A;  2GT6 A;  3PR8 A;  4AKH A;  3GN3 A;  5ECQ B;  1KTE A;  3WGD A;  2TRC P;  5LCZ A;  5H5Q A;  3QCP A;  4YKG A;  6GSS A;  1IYI A;  2VL3 A;  2OE0 A;  3TDG A;  4JE1 A;  3KZQ A;  2PU9 C;  5E4W A;  1A8L A;  3VWV A;  3GA4 A;  2L6D A;  3VLN A;  4K8M A;  2CX3 A;  5DCH A;  2HNL A;  2WW0 A;  3IRA A;  2FD3 A;  2MMA A;  2NVL A;  4WET A;  2B6M A;  5KN2 A;  1PN9 A;  1I5G A;  4TVE A;  5GZZ B;  2CZ3 A;  1RW1 A;  4I6X A;  2FA4 A;  4ECC A;  4Z2R A;  2B3S A;  2X49 A;  5G1L A;  4NMU A;  4GRF A;  4HU7 A;  4F2I A;  4BA7 A;  4PX1 A;  1F37 A;  2C3Q A;  4ZB6 A;  3IPZ A;  2UV8 G;  5A5H B;  3GSS A;  3DML A;  5AIS A;  3OR5 A;  1Z5Y E;  2FUG 2;  3FY7 A;  1HNA A;  6GSY A;  3LJR A;  1UA5 A;  3QDN A;  2O85 A;  4ML1 A;  2H19 A;  4MP4 A;  3UAP A;  4EC0 A;  1OE7 A;  5KN3 A;  1OC9 A;  3EWL A;  4WF5 A;  1V2A A;  5HR1 A;  2H6Z A;  4IW9 A;  2KOK A;  3A5I A;  1GUL A;  1SYR A;  4HZ2 A;  2IME A;  4PXO A;  1SKW B;  1GSY A;  2WJU A;  3C71 A;  2JSZ A;  1K0B A;  1GSS A;  3KGK A;  5ID2 A;  2V6O A;  3NZN A;  5ECI B;  4X4J A;  4N11 A;  2WW2 A;  1G6Y A;  1BED A;  3L9V A;  3FR9 A;  2I81 A;  1JZO A;  4MJC A;  4WEY A;  1NM3 A;  3TRQ A;  4IKH A;  4ZXG A;  4WF4 A;  3APQ A;  2A2S A;  1F3A A;  4MLY A;  4PNF A;  2YAN A;  2IFQ A;  3GMF A;  2QA1 A;  4G0I A;  3W8J A;  4AI6 A;  2OAD A;  3BBY A;  2JZR A;  2VL2 C;  1JFU A;  4IP6 A;  4ZIJ A;  1AQW A;  2REM A;  3CMI A;  2JSY A;  4I5Q A;  2IWT A;  4EIP A;  3LXT A;  3W6G A;  2B1K A;  4HQS A;  1H75 A;  3FKF A;  2LRN A;  1SD8 A;  2DBC A;  4BIK A;  3C73 A;  3VPQ A;  3KM6 A;  2EFH A;  3VWW A;  5IMC A;  3HJM A;  1DE2 A;  4ZBB A;  2LST A;  2YZU A;  4MH2 A;  5HFG A;  2IMD A;  3TJG A;  4POM A;  4EKZ A;  3CTF A;  1ZYP A;  3DRN A;  2DJ0 A;  1TDI A;  4ZB9 A;  3D0Z A;  2ON7 A;  4RQR A;  3C1S A;  1G7O A;  2L4C A;  3UBL A;  2WGR A;  4KSM A;  2XC2 A;  4FH8 A;  3EPT A;  3GH9 A;  3M9J A;  1A0F A;  1PA3 A;  2WVX A;  2E7P A;  2C80 A;  4Z2T A;  5F8B A;  4PQH A;  3QMX A;  4V1A p;  1OC3 A;  3GV1 A;  4TOP A;  3P7X A;  5DBQ A;  2OE1 A;  2VLT A;  2H1L A;  3F3Q A;  4ZIL A;  3TUE A;  1UN2 A;  22GS A;  2GZZ A;  1T7P B;  3PIN A;  2HRK B;  3EMX A;  3K8N A;  2HT9 A;  3PPU A;  2H0H A;  2AV4 A;  2EFC A;  4QL7 A;  4MZB A;  1LBK A;  4JED A;  3ZRD A;  4G0L A;  3TJK A;  4EF0 A;  4PUR A;  2X8C A;  1I1I P;  1XWB A;  5GSS A;  2H1G A;  5CRE A;  1PSQ A;  4YQV A;  1HQO A;  2A2P A;  4F03 A;  2MMN A;  3C1R A;  3CSJ A;  4MNN A;  2R5G A;  2H73 A;  2IIY A;  3HVX A;  5ID2 B;  4ECI A;  6GSU A;  1Z9H A;  5ELA A;  2ON5 A;  3GST A;  5CP1 A;  1AUC A;  4OMV A;  1SKS B;  4I2T A;  5GAN D;  3GUS A;  4Q5F A;  1JLW A;  2WZ9 A;  3M0F A;  7GSS A;  2H01 A;  5HR0 A;  5EVO A;  4AGS A;  4KDU A;  5EL8 A;  2VUP A;  2PVQ A;  3GTU A;  5GAP D;  3L78 A;  5L71 A;  2IFQ B;  2TRX A;  5FHI A;  3TKR A;  3AY8 A;  2GT5 A;  2PVO C;  4KCE A;  5IMZ A;  4EXJ A;  5D96 A;  1Z7P A;  4Q5Q A;  1YKA A;  5HFK A;  4HEA 2;  2YOI A;  2H1D A;  1USB A;  3RDW A;  1MDI A;  3KEB A;  1TI3 A;  5DAL B;  1A8Y A;  3F3R A;  5FWG A;  1MD4 A;  2LUS A;  3MNG A;  1CQH A;  5JWR B;  3D5J A;  1SJI A;  2G0F A;  4MMM A;  3WT2 A;  1ERW A;  3H8Q A;  2XBQ A;  4TR4 A;  4DSR A;  1FAA A;  2XHF A;  1T1V A;  4RI7 A;  1BF5 A;  1WJK A;  4POL A;  4H86 A;  4IBP A;  5JWQ B;  4AKX B;  1GSU A;  2HLS A;  1XOA A;  3APS A;  3APO A;  3GKX A;  4E68 A;  1AQX A;  4YAP A;  3MWH A;  2LEG A;  1X5D A;  2E0Q A;  1EOG A;  1TXU A;  1YZX A;  3RGB C;  5DVB A;  5C00 A;  1KEB A;  1OAZ A;  1THX A;  3LQ7 A;  2L5L A;  2I1U A;  3RFR C;  5F06 A;  5KN0 A;  5ELG A;  3HZ4 A;  3MYD A;  1XW6 A;  3I9V 2;  2EIO A;  2H30 A;  4TKY A;  1GSQ A;  1Y1U A;  2WVX B;  1DUG A;  1SYX A;  2H70 A;  5AIV A;  2H1B A;  2WVZ A;  1EOH A;  4MK3 A;  4K2X A;  2HRN A;  1U88 A;  2YNX A;  1TK8 B;  1XW9 A;  2EIR A;  1AAZ A;  3QR6 A;  4FQU A;  1A2M A;  3ED3 A;  2AAW A;  1SJ6 A;  1Y6E A;  3J7Y k;  4OWY A;  2QSI A;  3QAG A;  4IJI A;  5G5E A;  1F9M A;  2DJK A;  3LWA A;  1V9W A;  5KOW A;  1B4P A;  3TJJ A;  2YP6 A;  12GS A;  4IJ3 A;  4K7O A;  2HSY A;  2I9H A;  2MBT A;  3UOM A;  3M3M A;  5DJM A;  4PHZ C;  2CZ2 A;  4G01 A;  2O89 A;  1TXX A;  3IHQ A;  4WBJ A;  5CRW A;  4XRD A;  5J5N A;  4NV2 A;  3L9S A;  1T4Y A;  4EUY A;  2BTO T;  1SVO A;  1O8W A;  1GWC A;  1GH2 A;  4CY6 A;  3HCZ A;  4HDE A;  4O5Q A;  4X0X A;  3MDK A;  4G19 A;  1YF0 A;  3GL5 A;  1YVL A;  1AC1 A;  1GTB A;  1ZCP A;  4XS6 A;  2QGV A;  2PBJ A;  1HYU A;  4AF2 A;  1GSD A;  1N25 A;  2VD1 A;  3F6D A;  2RUE A;  2O5V A;  4YH2 A;  1A2J A;  1R5A A;  3GTU B;  2K6V A;  4X1U A;  1U3A A;  2GS3 A;  1THO A;  5DQY A;  2P0G A;  4MJB A;  3H1N A;  2M80 A;  3D21 A;  3WGX A;  5E59 A;  4KE3 A;  2GDR A;  3LSZ A;  1FW1 A;  3FZ5 A;  2HRF A;  4K2D A;  5F0G A;  4WR5 A;  3IHG A;  3EVI A;  4ID0 A;  4TN8 A;  4HSC X;  3O3T A;  1X5C A;  1GTI A;  5ENU A;  1M9B A;  4XHM A;  10GS A;  3TKS A;  3LYK A;  3VI5 A;  2DKI A;  5CRG A;  1FHE A;  1YEX A;  17GS A;  2R3X A;  4ZL9 A;  2F9S A;  2Z9S A;  1M2A A;  3VUR A;  1QK8 A;  2G2Q A;  2DSA A;  5IMV A;  3VWX A;  3IOS A;  3CSI A;  2CT6 A;  2YWM A;  5IMA A;  4HS1 A;  1YF1 A;  5CRD A;  1PKZ A;  2OE3 A;  1ERU A;  1EEJ A;  2A2R A;  3TGZ A;  2ZCT A;  3LEF A;  3A2W A;  3TKS C;  4MJA A;  4QMK A;  3H4K A;  1HNC A;  3L4N A;  1M9A A;  2DLX A;  2HSN A;  4HJ2 A;  4GSN A;  4FXY P;  2YWI A;  3QFB C;  5J3R A;  2J9H A;  3CXG A;  3TRP A;  4HU9 A;  2HSH A;  1ACV A;  2NPB A;  3HVS A;  2L59 A;  2PWJ A;  2I3Y A;  4XS4 A;  5G1K A;  1AXD A;  3EIN A;  2H6Y A;  4CDO A;  3IR4 A;  3LGC A;  3Q18 A;  19GS A;  3MAK A;  3N9J A;  1XPV A;  4NWY A;  3RPN A;  2E2G A;  4PI2 C;  6GSX A;  4NPB A;  2GLR A;  2V41 A;  2LKU A;  3ZIV A;  5HQP A;  3I69 A;  4PUA A;  3HMJ G;  2H6X A;  1EGR A;  1WPI A;  3UAR A;  1TRV A;  2VM2 A;  3F4S A;  5HR2 A;  4DEJ A;  4I2U A;  4ZBA A;  1MDK A;  3UIW A;  3ERG A;  1TK0 B;  3ZFL A;  1XVQ A;  2QC7 A;  1W89 A;  2M72 A;  1KNG A;  2CAQ A;  5D8I A;  5JCU A;  4IQ1 A;  4KDY A;  4WXT A;  4PUF C;  1LU4 A;  5D9X A;  3ZVJ A;  2FLS A;  4TR0 A;  6GST A;  3GFK A;  2VLU A;  2C4J A;  4GST A;  1A2L A;  3F8U A;  3N5O A;  4TXV A;  5CNW A;  1G7E A;  5DJL A;  5B7C A;  5AIX A;  1O8X A;  5IPG A;  2VCT A;  1M99 A;  3M8N A;  3ZRE A;  5C04 A;  2M46 A;  1RQM A;  3O6T A;  1TK5 B;  1NW2 A;  5DQS A;  2EIQ A;  4HOJ A;  2FWG A;  2RM6 A;  1XG8 A;  3ERF A;  1J9B A;  3E0U A;  2VLV A;  1TRW A;  2VCV A;  4MCU A;  1FO5 A;  2OAC A;  4KSO A;  1SVL A;  3O76 A;  2DJ3 A;  1YDK A;  2C0F A;  4O5U A;  1XFL A;  1GLQ A;  2PPT A;  5HR3 A;  1GSF A;  1FVK A;  1IYH A;  1C72 A;  3RHB A;  2RUF A;  1FG4 A;  1X5E A;  2B5E A;  4BL7 B;  4POK A;  5LNK e;  3FR6 A;  2GSR A;  1ZL9 A;  4JBB A;  5IIZ A;  5G30 A;  3RAZ A;  5AN1 A;  3KH7 A;  1BJX A;  1HD2 A;  4GQC A;  2C8U A;  1V40 A;  3VWU A;  1UVZ A;  4NHZ A;  1DSB A;  4NV5 A;  1XWK A;  3R3E A;  5H5S A;  2VCX A;  3KTB A;  3M1G A;  2CQ9 A;  5BMU A;  1M7T A;  3I43 A;  1GRX A;  2JAC A;  4I8B A;  5ECS A;  2WW1 A;  2HSN B;  2LNS A;  4ECB A;  2B5Y A;  3L9U A;  4IQA A;  1S3D A;  5G2Z A;  3GNJ A;  4OCE A;  3KH9 A;  1G0T A;  1ILO A;  1TI1 A;  1B8X A;  1QFN A;  4ZL8 A;  4EE0 A;  3D6I A;  3TOT A;  3CTG A;  1TU8 A;  2LJR A;  4V2N A;  1VRS D;  3FZ9 A;  2CA8 A;  1G6W A;  3LOR A;  1BYE A;  4BWQ A;  3CHX C;  4BVX A;  4POB A;  1DE1 A;  4ECJ A;  4JR4 A;  2VAF A;  4K9Z A;  2FWE A;  1B48 A;  4MDC A;  2H74 A;  1ERT A;  1NHO A;  1F3B A;  1OYJ A;  2WW3 A;  4K7N A;  3HA9 A;  2VCZ A;  2B1L A;  1XXU A;  5CRH A;  2AUV A;  1ZOF A;  5ECM B;  3ZTL A;  2LV3 A;  1WMJ A;  3S9F A;  2GQL A;  4GCI A;  2DMM A;  2GZY A;  4A5P A;  3FZ4 A;  1TRU A;  4WBR D;  1OC9 B;  3BD2 A;  2O3E A;  4OFT A;  3DIE A;  1SJZ A;  2AJQ B;  4LA1 A;  1EGO A;  3RHC A;  1PKW A;  5IPH A;  1ZGN A;  1K3L A;  1K0D A;  4IP1 A;  4FYU A;  1DBY A;  3ZML A;  4GXZ A;  1Z6M A;  1PL2 A;  1SL2 B;  2H72 A;  3WYW A;  4MA9 A;  3F6F A;  4Q5R A;  3MSZ A;  2P31 A;  5A34 A;  2IJY A;  3ZL5 A;  2WDU A;  2VOC A;  2KHP A;  4N0V A;  4J2F A;  3E9J B;  4MJE A;  4NHW A;  4MF7 A;  4OO4 A;  1OVN A;  2WVY A;  5INY A;  5ECH B;  1WIK A;  1YEW C;  3EMP A;  1JHB A;  5D9V A;  1M2D A;  2V6K A;  1SD9 A;  1MDJ A;  2LTK A;  2O36 A;  3IAM 2;  3MIX A;  1ZMA A;  3SBC A;  2VD0 A;  4ACS A;  2FY6 A;  3WT1 A;  1LJR A;  1FB0 A;  1O73 A;  3QAV A;  1GLP A;  1M2B A;  4KF9 A;  4LL1 B;  1Z7R A;  1YQ1 A;  2ZUP A;  5IO0 A;  2NTO A;  1Z6N A;  5J9B A;  4BWS A;  2HQT A;  1PX6 A;  2HFD A;  1TRS A;  2R0P A;  14GS A;  1N8J A;  2HI7 A;  4I97 A;  5BMU B;  2V2G A;  1YKC A;  5D73 A;  4V2M A;  3M9K A;  4L0U A;  2KLX A;  4DSS A;  1SK0 A;  3GH6 A;  3DKS A;  4HI7 A;  2X8G A;  4KW6 A;  3CBU A;  4KH7 A;  5KN1 A;  2NDO A;  3EUR A;  3QPM A;  2KP2 A;  4XIH A;  2CVB A;  4AJ7 A;  3KMO A;  1EZK A;  3IC4 A;  2GSS A;  3KIJ A;  2K9F A;  4KA0 A;  4MF6 A;  2JZT A;  5GST A;  2LRC A;  2TIR A;  4K6X A;  4K0G A;  4LLR A;  1YY7 A;  5J4V A;  4TXO A;  4BVX B;  3W8S A;  2F51 A;  3HXS A;  4CHS A;  1GSE A;  2DC5 A;  2O8V B;  3BCK A;  3ZIT A;  2HSM A;  1WWJ A;  2YZH A;  2R0C A;  3KD0 A;  9GSS A;  1UC7 A;  1Y25 A;  1EP8 A;  2VCQ A;  5HFI A;  3UBK A;  4YKF A;  3CSH A;  3G9B A;  1PD2 1;  2MMZ A;  4F0C A;  2QA2 A;  2I4A A;  4HQZ A;  2WFC A;  4TW5 A;  3Q19 A;  5J41 A;  2PN8 A;  1M3I A;  3F63 A;  3DGQ A;  1T00 A;  4CW9 A;  2QKE A;  2H76 A;  4TRX A;  1FVJ A;  2L57 A;  4PNG A;  3LW9 A;  1O81 A;  5KOX A;  2O7K A;  4P3Y B;  4HJM A;  4ILF A;  2DJJ A;  2X64 A;  1EWX A;  4OFM A;  1XWC A;  5A34 B;  3KXO A;  3FZA A;  3GKM A;  2K18 A;  3FHK A;  1Q98 A;  4LMW A;  4Q5N A;  1XW5 A;  3EU4 A;  2YV7 A;  3GHA A;  1PFO A;  1QGV A;  2H71 A;  3V1W A;  1SVM A;  2VIM A;  1T8E B;  3KP8 A;  4F0B A;  5AGY A;  4KX4 A;  4PTS A;  4IEL A;  4YAV A;  2H0I A;  2PMT A;  3Q6O A;  1K0C A;  3LXZ A;  4KAE A;  2WCI A;  1SK2 A;  4PI0 C;  1TP9 A;  3DVW A;  2OT3 A;  1B4Q A;  5ECO B;  1MTC A;  1I9D A;  4W66 A;  3WGE A;  1GNW A;  2LJK A;  1J0F A;  1K0O A;  1R5P A;  5B6N A;  1Q4J A;  2OBI A;  4E8E A;  4QL9 A;  2R2J A;  5ECN B;  5J9C A;  2JAD A;  3BOA A;  5IOX A;  1K0M A;  1NHY A;  2BMX A;  3EYT A;  3UVH A;  4KUN A;  1QQ2 A;  2A4V A;  3GX8 A;  1SK1 A;  3UEM A;  2AHE A;  2UZ8 A;  3Q74 A;  4K7I A;  1AQV A;  4GTU A;  4FYB A;  2C0G A;  2L5O A;  4ISD A;  5D93 A;  1GUM A;  1O7U A;  4JR6 A;  5ECP B;  1O6J A;  3C8E A;  3US3 A;  1NSW A;  3TJB A;  3IBH A;  1OKT A;  3ZIJ A;  4DSS B;  5JCG A;  3TU3 B;  1GP1 A;  1WP0 A;  2CAI A;  1URM A;  3G7Y A;  1OC8 A;  2WS2 A;  5DCG A;  5DAK A;  3QAW A;  4ZBD A;  1R7H A;  1SL0 B;  1BQ7 A;  2XPE A;  2R4V A;  3TOU A;  1J08 A;  2IMI A;  4TXO B;  4HUA A;  2FWF A;  2VL9 A;  4ULX A;  1WE0 A;  4G0K A;  1TU7 A;  1SU9 A;  4JU5 A;  4GDF A;  4G2E A;  2HSM B;  1OE8 A;  2OJL A;  4EDZ A;  5J4U A;  2OKA A;  1N2A A;  1QUW A;  4G9H A;  1F2E A;  2HE3 A;  1V98 A;  5A1N A;  1B9X C;  3CWG A;  3GRX A;  3DD3 A;  4O7H A;  3PGT A;  3FW2 A;  3TKS E;  4AJ8 A;  4MPG A;  2X99 A;  2IPA A;  2LS5 A;  5JCW A;  4MZW A;  3EU3 A;  1VF1 A;  2CVK A;  3VI7 A;  2IMK A;  5D9T A;  2X8H A;  1E6B A;  3ZFB A;  1S4B P;  1GL8 A;  1EP7 A;  4BVY A;  4IHU A;  1A0R P;  3L0H A;  2HRK A;  5IMD A;  3RBT A;  18GS A;  1T4Z A;  3HHV A;  2VKZ G;  4WR4 A;  3LG6 A;  3U6V A;  3FYG A;  2P5Q A;  3IDV A;  2FCH A;  4MPF A;  1W4V A;  1OKD A;  3NOF A;  3I6A A;  2D2Z A;  1X9S B;  4AJ6 A;  2JL4 A;  2YWN A; 
#chains in the Genus database with same CATH homology
 1U3I A;  5IM9 A;  3ME8 A;  2GVP A;  1ABA A;  4RI6 A;  1R26 A;  2C3N A;  2EFD A;  5JWO B;  2VL2 A;  5KEJ A;  1K3Y A;  1GUH A;  2RLI A;  2WB9 A;  2V1M A;  3H79 A;  2HYX A;  4LMV A;  3D4T A;  3UMA A;  1BAY A;  2N5B A;  1X9M B;  4GWR A;  1RK4 A;  3PH9 A;  4TR1 A;  3HD5 A;  4G10 A;  2F3M A;  3GIX A;  3ZYW A;  1FB6 A;  2C1Y A;  4KB3 A;  4GSS A;  5DDL A;  3DYR A;  3CRT A;  3A2X A;  3GL3 A;  3KP9 A;  3R2Q A;  1XCC A;  4PQ1 A;  4WKW A;  2O87 A;  5B8A A;  1ZZY A;  4K1F A;  3UL3 A;  3ISO A;  2IL3 A;  2R0G A;  1F6M C;  5DAL A;  2J23 A;  2KUC A;  5B8B A;  5COH A;  4IN0 A;  4KGI A;  1TOF A;  2JZS A;  4ML6 A;  1A24 A;  3UVT A;  5ABR A;  4HZ4 A;  2YWO A;  5CO3 A;  1TKD B;  5BRT A;  1V58 A;  5EY6 A;  4YQU A;  3G7J A;  2JU5 A;  1Z3E A;  4ZB8 A;  2R37 A;  3P2A A;  1JLV A;  1PL1 A;  3BCI A;  4MH3 A;  2MMO A;  2PUK C;  5DAK B;  4XS4 B;  1T3B A;  4FYC A;  2F8A A;  3ZMK A;  5J47 A;  3JCM L;  5IOW A;  4XS1 A;  20GS A;  2CVD A;  3TKQ A;  4MF5 A;  1FOV A;  3QFA C;  2XBI A;  4O5R A;  1WOU A;  2YV9 A;  3P90 A;  3BJ5 A;  3VPT A;  3ZLP A;  1WRY A;  1PQN A;  3ERW A;  3TCO A;  4ZB7 A;  1AW9 A;  4CY8 A;  4L5L A;  2VCW A;  3IAS 2;  4K5S A;  3LYP A;  1PRX A;  3DVX A;  1GTU A;  5A1N B;  2N5F A;  5CYY A;  2YPM A;  3D4M A;  3E3E A;  2LJA A;  2K8V A;  4AKG A;  4KDX A;  5LD0 A;  2H8L A;  2LQQ A;  4BPY A;  1VF3 A;  2GSQ A;  3A3T A;  1K0A A;  4IGJ A;  2H66 A;  3VFI A;  4DVC A;  2YJ7 A;  2K8S A;  2MZC A;  1U6T A;  1GUK A;  1SL1 B;  4N3Z A;  1ZYE A;  3SWL A;  4V1A g;  1TTZ A;  2H75 A;  2V32 A;  2B7J A;  3F4T A;  4BVY B;  2VO4 A;  2CX4 A;  2HZF A;  2ES7 A;  1EV9 A;  3DEX A;  2RII A;  4GLT A;  3IXR A;  1X9W B;  4OD7 A;  2IN3 A;  3TB2 A;  2PGT A;  5IQY A;  1O85 A;  3QOU A;  2MBS A;  2BJX A;  4O92 A;  3D22 A;  2GZP A;  3IC8 A;  1R4W A;  2X4A A;  16GS A;  2OBK A;  2WRT A;  1K0N A;  2AB6 A;  4JZQ A;  3ZZX A;  1AIU A;  2HZE A;  3CRU A;  4N30 A;  3J7Y b;  6GSV A;  4XTS A;  1XWA A;  3P8W A;  1JZW A;  4Z2U A;  2LRT A;  1SEN A;  5A5K A;  8GSS A;  2NBS A;  4DSQ A;  4K0N A;  3GKN A;  2AYT A;  3FR3 A;  1TJD A;  4EL1 A;  4FIW A;  5J40 A;  3KCM A;  4D73 A;  4TR1 B;  2A4H A;  4MZC A;  5EPF A;  2DIZ A;  3LFL A;  3A5W A;  4MAB A;  1FOH A;  2DJ1 A;  3IK7 A;  5IO2 A;  2YJH A;  2P5R A;  5CAX A;  1VF4 A;  2N5A A;  2L6C A;  5ECR B;  5A4V A;  2C3T A;  3GKK A;  3FEU A;  4NXI A;  2MYG A;  4J56 E;  4N0Z A;  3GUR A;  4IVF A;  4FO5 A;  3RPP A;  2RM5 A;  4IS0 A;  5A4W A;  4NAX A;  2CV4 A;  3HKR A;  4GQF A;  3TRX A;  4F82 A;  3U5R E;  11GS A;  1S3A A;  5H5R A;  3F9U A;  3IV4 A;  2H0G A;  4GF0 A;  1EEM A;  4X43 A;  3F4R A;  1GNE A;  4Z7X A;  3FRC A;  2F8F A;  1XOB A;  3HY2 A;  2IMF A;  2DKH A;  3IK9 A;  1MEK A;  3EC3 A;  5D9W A;  3HZ8 A;  4E8H A;  3QD9 A;  2L4Q A;  1JZD A;  2B5X A;  1XZO A;  2LQO A;  3ZVJ D;  5G31 A;  1KBN A;  5F05 A;  2C0D A;  2DML A;  5ECL B;  4LL4 B;  1U87 A;  3F0I A;  3TKP A;  4YQM A;  3GX0 A;  1YJ6 A;  2WUL A;  4XCS A;  2PER A;  2EFE A;  4EDY A;  4O32 A;  4KND A;  4OFN A;  2YCD A;  4L0W A;  1PMT A;  4N10 A;  4PGT A;  1HNB A;  4RQX A;  1BG1 A;  2EC4 A;  4OCF A;  4TR3 A;  2B7K A;  1MD3 A;  4K5R A;  2DJ2 A;  1X0R A;  4V2L A;  4EO3 A;  1VF2 A;  2GGT A;  3HDC A;  2GTU A;  1K3O A;  3CYN A;  5A5H A;  2GST A;  2FA8 A;  4QQ7 A;  1B9Y C;  1PX7 A;  3H93 A;  3HJO A;  4L8E A;  3FMW A;  4EVM A;  3KJY A;  2R6K A;  1QMV A;  1EV4 A;  4ICY A;  1VGL A;  2GQK A;  3HVV A;  5IMF A;  3WD6 A;  4RUV A;  3NIV A;  5ECK B;  2FWH A;  3TJF A;  5FT3 A;  4KCA A;  2KP1 A;  2HZE B;  2FGX A;  4J57 E;  1M0U A;  2OA7 A;  3GYK A;  1XVW A;  1CQG A;  1H4O A;  1XIY A;  1JZR A;  5G5F A;  1XBS A;  3VK9 A;  1BG5 A;  2H1A A;  4OO5 A;  1ZYN A;  1BX9 A;  3HYP A;  2HXK A;  1TW9 A;  3KTL A;  4D73 B;  1V57 A;  1ML6 A;  1ST9 A;  2FHE A;  2HRA A;  2E2M A;  2VM1 A;  6GSW A;  3HJP A;  4XRA A;  2FNO A;  1A23 A;  3IA1 A;  4PQI A;  2GQM A;  3IE3 A;  2DIY A;  4F9Z A;  1XWG A;  3G7I A;  1ZYQ B;  3DWV A;  3EE2 A;  1ERV A;  3C7M A;  3FK8 A;  4EIQ A;  1ON4 A;  2YN1 A;  3KMN A;  4BL7 A;  4AKI A;  1PGT A;  3A2V A;  4JRR A;  5J4Y A;  5A4U A;  3DXB A;  1YEP A;  1GTA A;  3ME7 A;  13GS A;  4ZL7 A;  1E2Y A;  2C0E A;  2LNT A;  2XPD A;  4USS A;  3UJ1 A;  2ALB A;  1S3C A;  4L5O A;  1SKR B;  2ZNM A;  5B6M A;  1PN0 A;  1QXH A;  5F07 A;  2GT6 A;  3PR8 A;  4AKH A;  3GN3 A;  5ECQ B;  1KTE A;  3WGD A;  2TRC P;  5LCZ A;  5H5Q A;  3QCP A;  4YKG A;  6GSS A;  1IYI A;  2VL3 A;  2OE0 A;  3TDG A;  4JE1 A;  3KZQ A;  2PU9 C;  5E4W A;  1A8L A;  3VWV A;  3GA4 A;  2L6D A;  3VLN A;  4K8M A;  2CX3 A;  5DCH A;  2HNL A;  3IRA A;  2FD3 A;  2MMA A;  2NVL A;  4WET A;  2B6M A;  5KN2 A;  1PN9 A;  1I5G A;  4TVE A;  5GZZ B;  2CZ3 A;  1RW1 A;  4I6X A;  2FA4 A;  4ECC A;  4Z2R A;  2B3S A;  2X49 A;  5G1L A;  4NMU A;  4GRF A;  4HU7 A;  4F2I A;  4BA7 A;  4PX1 A;  1F37 A;  2C3Q A;  4ZB6 A;  3IPZ A;  2UV8 G;  5A5H B;  3GSS A;  3DML A;  5AIS A;  3OR5 A;  1Z5Y E;  2FUG 2;  3FY7 A;  1HNA A;  6GSY A;  3LJR A;  1UA5 A;  3QDN A;  2O85 A;  4ML1 A;  2H19 A;  4MP4 A;  3UAP A;  4EC0 A;  1OE7 A;  5KN3 A;  1OC9 A;  3EWL A;  4WF5 A;  1V2A A;  5HR1 A;  2H6Z A;  4IW9 A;  2KOK A;  3A5I A;  1GUL A;  1SYR A;  4HZ2 A;  2IME A;  4PXO A;  1SKW B;  1GSY A;  2WJU A;  3C71 A;  2JSZ A;  1K0B A;  1GSS A;  3KGK A;  5ID2 A;  2V6O A;  3NZN A;  5ECI B;  4X4J A;  4N11 A;  1G6Y A;  1BED A;  3L9V A;  3FR9 A;  2I81 A;  1JZO A;  4MJC A;  4WEY A;  1NM3 A;  3TRQ A;  4IKH A;  4ZXG A;  4WF4 A;  3APQ A;  2A2S A;  1F3A A;  4MLY A;  4PNF A;  2YAN A;  2IFQ A;  3GMF A;  2QA1 A;  4G0I A;  3W8J A;  4AI6 A;  2OAD A;  3BBY A;  2JZR A;  2VL2 C;  1JFU A;  4IP6 A;  4ZIJ A;  1AQW A;  2REM A;  3CMI A;  2JSY A;  4I5Q A;  2IWT A;  4EIP A;  3LXT A;  3W6G A;  2B1K A;  4HQS A;  1H75 A;  3FKF A;  2LRN A;  1SD8 A;  2DBC A;  3C73 A;  3VPQ A;  3KM6 A;  2EFH A;  3VWW A;  5IMC A;  3HJM A;  1DE2 A;  4ZBB A;  2LST A;  2YZU A;  4MH2 A;  5HFG A;  2IMD A;  3TJG A;  4POM A;  4EKZ A;  3CTF A;  1ZYP A;  3DRN A;  2DJ0 A;  1TDI A;  4ZB9 A;  3D0Z A;  2ON7 A;  4RQR A;  3C1S A;  1G7O A;  2L4C A;  3UBL A;  2WGR A;  4KSM A;  2XC2 A;  4FH8 A;  3EPT A;  3GH9 A;  3M9J A;  1A0F A;  1PA3 A;  2E7P A;  2C80 A;  4Z2T A;  5F8B A;  4PQH A;  3QMX A;  4V1A p;  1OC3 A;  3GV1 A;  4TOP A;  3P7X A;  5DBQ A;  2OE1 A;  2VLT A;  2H1L A;  3F3Q A;  4ZIL A;  3TUE A;  1UN2 A;  22GS A;  2GZZ A;  1T7P B;  3PIN A;  2HRK B;  3EMX A;  3K8N A;  2HT9 A;  3PPU A;  2H0H A;  2AV4 A;  2EFC A;  4QL7 A;  4MZB A;  1LBK A;  4JED A;  3ZRD A;  4G0L A;  3TJK A;  4EF0 A;  4PUR A;  2X8C A;  1XWB A;  5GSS A;  2H1G A;  5CRE A;  1PSQ A;  4YQV A;  1HQO A;  2A2P A;  4F03 A;  2MMN A;  3C1R A;  3CSJ A;  4MNN A;  2R5G A;  2H73 A;  2IIY A;  3HVX A;  5ID2 B;  4ECI A;  6GSU A;  1Z9H A;  5ELA A;  2ON5 A;  3GST A;  5CP1 A;  1AUC A;  4OMV A;  1SKS B;  4I2T A;  5GAN D;  3GUS A;  4Q5F A;  1JLW A;  2WZ9 A;  3M0F A;  7GSS A;  2H01 A;  5HR0 A;  5EVO A;  4AGS A;  4KDU A;  5EL8 A;  2VUP A;  2PVQ A;  3GTU A;  5GAP D;  3L78 A;  5L71 A;  2IFQ B;  2TRX A;  5FHI A;  3TKR A;  3AY8 A;  2GT5 A;  2PVO C;  4KCE A;  5IMZ A;  4EXJ A;  5D96 A;  1Z7P A;  4Q5Q A;  1YKA A;  5HFK A;  4HEA 2;  2YOI A;  2H1D A;  1USB A;  3RDW A;  1MDI A;  3KEB A;  1TI3 A;  5DAL B;  1A8Y A;  3F3R A;  5FWG A;  1MD4 A;  2LUS A;  3MNG A;  1CQH A;  5JWR B;  3D5J A;  1SJI A;  2G0F A;  4MMM A;  3WT2 A;  1ERW A;  3H8Q A;  2XBQ A;  4TR4 A;  4DSR A;  1FAA A;  2XHF A;  1T1V A;  4RI7 A;  1BF5 A;  1WJK A;  4POL A;  4H86 A;  4IBP A;  5JWQ B;  4AKX B;  1GSU A;  2HLS A;  1XOA A;  3APS A;  3APO A;  3GKX A;  4E68 A;  1AQX A;  4YAP A;  3MWH A;  2LEG A;  1X5D A;  2E0Q A;  1EOG A;  1TXU A;  1YZX A;  5DVB A;  5C00 A;  1KEB A;  1OAZ A;  1THX A;  3LQ7 A;  2L5L A;  2I1U A;  5F06 A;  5KN0 A;  5ELG A;  3HZ4 A;  3MYD A;  1XW6 A;  3I9V 2;  2EIO A;  2H30 A;  4TKY A;  1GSQ A;  1Y1U A;  1DUG A;  1SYX A;  2H70 A;  5AIV A;  2H1B A;  4MK3 A;  1EOH A;  4K2X A;  2HRN A;  1U88 A;  2YNX A;  1TK8 B;  1XW9 A;  2EIR A;  1AAZ A;  3QR6 A;  4FQU A;  1A2M A;  3ED3 A;  2AAW A;  1SJ6 A;  1Y6E A;  3J7Y k;  4OWY A;  2QSI A;  3QAG A;  4IJI A;  5G5E A;  1F9M A;  2DJK A;  3LWA A;  1V9W A;  5KOW A;  1B4P A;  3TJJ A;  2YP6 A;  12GS A;  4IJ3 A;  4K7O A;  2HSY A;  2I9H A;  2MBT A;  3UOM A;  3M3M A;  5DJM A;  2CZ2 A;  4G01 A;  2O89 A;  1TXX A;  3IHQ A;  4WBJ A;  5CRW A;  4XRD A;  5J5N A;  4NV2 A;  3L9S A;  1T4Y A;  4EUY A;  2BTO T;  1SVO A;  1O8W A;  1GWC A;  1GH2 A;  4CY6 A;  3HCZ A;  4HDE A;  4O5Q A;  4X0X A;  3MDK A;  4G19 A;  1YF0 A;  3GL5 A;  1YVL A;  1AC1 A;  1GTB A;  1ZCP A;  4XS6 A;  2QGV A;  2PBJ A;  1HYU A;  4AF2 A;  1GSD A;  1N25 A;  2VD1 A;  3F6D A;  2RUE A;  2O5V A;  4YH2 A;  1A2J A;  1R5A A;  3GTU B;  2K6V A;  4X1U A;  1U3A A;  2GS3 A;  1THO A;  5DQY A;  2P0G A;  4MJB A;  3H1N A;  2M80 A;  3D21 A;  3WGX A;  5E59 A;  4KE3 A;  2GDR A;  3LSZ A;  1FW1 A;  3FZ5 A;  2HRF A;  4K2D A;  5F0G A;  4WR5 A;  3IHG A;  3EVI A;  4ID0 A;  4TN8 A;  3O3T A;  1X5C A;  1GTI A;  5ENU A;  1M9B A;  4XHM A;  10GS A;  3TKS A;  3LYK A;  3VI5 A;  2DKI A;  5CRG A;  1FHE A;  1YEX A;  17GS A;  2R3X A;  4ZL9 A;  2F9S A;  2Z9S A;  1M2A A;  3VUR A;  1QK8 A;  2G2Q A;  2DSA A;  5IMV A;  3VWX A;  3IOS A;  3CSI A;  2CT6 A;  2YWM A;  5IMA A;  4HS1 A;  1YF1 A;  5CRD A;  1PKZ A;  2OE3 A;  1ERU A;  1EEJ A;  2A2R A;  3TGZ A;  2ZCT A;  3LEF A;  3A2W A;  3TKS C;  4MJA A;  4QMK A;  3H4K A;  1HNC A;  3L4N A;  1M9A A;  2DLX A;  2HSN A;  4HJ2 A;  4GSN A;  2YWI A;  3QFB C;  5J3R A;  2J9H A;  3CXG A;  3TRP A;  4HU9 A;  2HSH A;  1ACV A;  2NPB A;  3HVS A;  2L59 A;  2PWJ A;  2I3Y A;  4XS4 A;  5G1K A;  1AXD A;  3EIN A;  2H6Y A;  4CDO A;  3IR4 A;  3LGC A;  3Q18 A;  19GS A;  3MAK A;  3N9J A;  1XPV A;  4NWY A;  3RPN A;  2E2G A;  6GSX A;  4NPB A;  2GLR A;  2V41 A;  2LKU A;  3ZIV A;  5HQP A;  3I69 A;  4PUA A;  3HMJ G;  2H6X A;  1EGR A;  1WPI A;  3UAR A;  1TRV A;  2VM2 A;  3F4S A;  5HR2 A;  4DEJ A;  4I2U A;  4ZBA A;  1MDK A;  3UIW A;  3ERG A;  1TK0 B;  3ZFL A;  1XVQ A;  2QC7 A;  1W89 A;  2M72 A;  1KNG A;  2CAQ A;  5D8I A;  5JCU A;  4IQ1 A;  4KDY A;  4WXT A;  4PUF C;  1LU4 A;  5D9X A;  3ZVJ A;  2FLS A;  4TR0 A;  6GST A;  3GFK A;  2VLU A;  2C4J A;  4GST A;  1A2L A;  3F8U A;  3N5O A;  4TXV A;  5CNW A;  1G7E A;  5DJL A;  5B7C A;  5AIX A;  1O8X A;  5IPG A;  2VCT A;  1M99 A;  3M8N A;  3ZRE A;  5C04 A;  2M46 A;  1RQM A;  3O6T A;  1TK5 B;  1NW2 A;  5DQS A;  2EIQ A;  4HOJ A;  2FWG A;  2RM6 A;  3ERF A;  1J9B A;  3E0U A;  2VLV A;  1TRW A;  2VCV A;  4MCU A;  1FO5 A;  2OAC A;  4KSO A;  1SVL A;  3O76 A;  2DJ3 A;  1YDK A;  2C0F A;  4O5U A;  1XFL A;  1GLQ A;  2PPT A;  5HR3 A;  1GSF A;  1FVK A;  1IYH A;  1C72 A;  3RHB A;  2RUF A;  1FG4 A;  1X5E A;  2B5E A;  4BL7 B;  4POK A;  5LNK e;  3FR6 A;  2GSR A;  1ZL9 A;  4JBB A;  5IIZ A;  5G30 A;  3RAZ A;  5AN1 A;  3KH7 A;  1BJX A;  1HD2 A;  4GQC A;  2C8U A;  1V40 A;  3VWU A;  1UVZ A;  4NHZ A;  1DSB A;  4NV5 A;  1XWK A;  3R3E A;  5H5S A;  2VCX A;  3KTB A;  3M1G A;  2CQ9 A;  5BMU A;  1M7T A;  3I43 A;  1GRX A;  2JAC A;  4I8B A;  5ECS A;  2HSN B;  2LNS A;  4ECB A;  2B5Y A;  3L9U A;  4IQA A;  1S3D A;  5G2Z A;  3GNJ A;  4OCE A;  3KH9 A;  1G0T A;  1ILO A;  1TI1 A;  1B8X A;  1QFN A;  4ZL8 A;  4EE0 A;  3D6I A;  3TOT A;  3CTG A;  1TU8 A;  2LJR A;  4V2N A;  1VRS D;  3FZ9 A;  2CA8 A;  1G6W A;  3LOR A;  1BYE A;  4BWQ A;  4BVX A;  4POB A;  1DE1 A;  4ECJ A;  4JR4 A;  2VAF A;  4K9Z A;  2FWE A;  1B48 A;  4MDC A;  2H74 A;  1ERT A;  1NHO A;  1F3B A;  1OYJ A;  4K7N A;  3HA9 A;  2VCZ A;  2B1L A;  1XXU A;  5CRH A;  2AUV A;  1ZOF A;  5ECM B;  3ZTL A;  2LV3 A;  1WMJ A;  3S9F A;  2GQL A;  4GCI A;  2DMM A;  2GZY A;  4A5P A;  3FZ4 A;  1TRU A;  4WBR D;  1OC9 B;  3BD2 A;  4OFT A;  3DIE A;  1SJZ A;  2AJQ B;  4LA1 A;  1EGO A;  3RHC A;  1PKW A;  5IPH A;  1ZGN A;  1K3L A;  1K0D A;  4IP1 A;  4FYU A;  1DBY A;  3ZML A;  4GXZ A;  1Z6M A;  1PL2 A;  1SL2 B;  2H72 A;  3WYW A;  4MA9 A;  3F6F A;  4Q5R A;  3MSZ A;  2P31 A;  5A34 A;  2IJY A;  3ZL5 A;  2WDU A;  2VOC A;  2KHP A;  4N0V A;  4J2F A;  3E9J B;  4MJE A;  4NHW A;  4MF7 A;  4OO4 A;  1OVN A;  5INY A;  5ECH B;  1WIK A;  3EMP A;  1JHB A;  5D9V A;  1M2D A;  2V6K A;  1SD9 A;  1MDJ A;  2LTK A;  3IAM 2;  3MIX A;  1ZMA A;  3SBC A;  2VD0 A;  4ACS A;  2FY6 A;  3WT1 A;  1LJR A;  1FB0 A;  1O73 A;  3QAV A;  1GLP A;  1M2B A;  4KF9 A;  4LL1 B;  1Z7R A;  1YQ1 A;  2ZUP A;  5IO0 A;  2NTO A;  1Z6N A;  5J9B A;  4BWS A;  2HQT A;  1PX6 A;  2HFD A;  1TRS A;  2R0P A;  14GS A;  1N8J A;  2HI7 A;  4I97 A;  5BMU B;  2V2G A;  1YKC A;  5D73 A;  4V2M A;  3M9K A;  4L0U A;  2KLX A;  4DSS A;  1SK0 A;  3GH6 A;  3DKS A;  4HI7 A;  2X8G A;  4KW6 A;  3CBU A;  4KH7 A;  5KN1 A;  2NDO A;  3EUR A;  3QPM A;  2KP2 A;  4XIH A;  2CVB A;  4AJ7 A;  3KMO A;  1EZK A;  3IC4 A;  2GSS A;  3KIJ A;  2K9F A;  4KA0 A;  4MF6 A;  2JZT A;  5GST A;  2LRC A;  2TIR A;  4K6X A;  4K0G A;  4LLR A;  1YY7 A;  5J4V A;  4TXO A;  4BVX B;  3W8S A;  2F51 A;  3HXS A;  4CHS A;  1GSE A;  2DC5 A;  2O8V B;  3BCK A;  3ZIT A;  2HSM A;  1WWJ A;  2YZH A;  2R0C A;  3KD0 A;  9GSS A;  1UC7 A;  1Y25 A;  1EP8 A;  2VCQ A;  5HFI A;  3UBK A;  4YKF A;  3CSH A;  3G9B A;  1PD2 1;  2MMZ A;  4F0C A;  2QA2 A;  2I4A A;  4HQZ A;  2WFC A;  4TW5 A;  3Q19 A;  5J41 A;  2PN8 A;  3F63 A;  3DGQ A;  1T00 A;  4CW9 A;  2QKE A;  2H76 A;  4TRX A;  1FVJ A;  2L57 A;  4PNG A;  3LW9 A;  1O81 A;  5KOX A;  2O7K A;  4P3Y B;  4HJM A;  4ILF A;  2DJJ A;  2X64 A;  1EWX A;  4OFM A;  1XWC A;  5A34 B;  3KXO A;  3FZA A;  3GKM A;  2K18 A;  3FHK A;  1Q98 A;  4LMW A;  4Q5N A;  1XW5 A;  3EU4 A;  2YV7 A;  3GHA A;  1QGV A;  2H71 A;  3V1W A;  1SVM A;  2VIM A;  1T8E B;  3KP8 A;  4F0B A;  5AGY A;  4KX4 A;  4PTS A;  4IEL A;  4YAV A;  2H0I A;  2PMT A;  3Q6O A;  1K0C A;  3LXZ A;  4KAE A;  2WCI A;  1SK2 A;  3DVW A;  1TP9 A;  2OT3 A;  1B4Q A;  5ECO B;  1MTC A;  1I9D A;  4W66 A;  3WGE A;  1GNW A;  2LJK A;  1J0F A;  1K0O A;  1R5P A;  5B6N A;  1Q4J A;  2OBI A;  4E8E A;  4QL9 A;  2R2J A;  5ECN B;  5J9C A;  2JAD A;  3BOA A;  5IOX A;  1K0M A;  1NHY A;  2BMX A;  3EYT A;  3UVH A;  4KUN A;  1QQ2 A;  2A4V A;  3GX8 A;  1SK1 A;  3UEM A;  2AHE A;  2UZ8 A;  3Q74 A;  4K7I A;  1AQV A;  4GTU A;  4FYB A;  2C0G A;  2L5O A;  4ISD A;  5D93 A;  1GUM A;  1O7U A;  4JR6 A;  5ECP B;  1O6J A;  3C8E A;  3US3 A;  1NSW A;  3TJB A;  3IBH A;  1OKT A;  3ZIJ A;  4DSS B;  5JCG A;  3TU3 B;  1GP1 A;  1WP0 A;  2CAI A;  1URM A;  3G7Y A;  1OC8 A;  2WS2 A;  5DCG A;  5DAK A;  3QAW A;  4ZBD A;  1R7H A;  1SL0 B;  1BQ7 A;  2XPE A;  2R4V A;  3TOU A;  1J08 A;  2IMI A;  4TXO B;  4HUA A;  2FWF A;  2VL9 A;  4ULX A;  1WE0 A;  4G0K A;  1TU7 A;  1SU9 A;  4JU5 A;  4GDF A;  4G2E A;  2HSM B;  1OE8 A;  2OJL A;  4EDZ A;  5J4U A;  2OKA A;  1N2A A;  1QUW A;  4G9H A;  1F2E A;  2HE3 A;  1V98 A;  5A1N A;  1B9X C;  3CWG A;  3GRX A;  3DD3 A;  4O7H A;  3PGT A;  3FW2 A;  3TKS E;  4AJ8 A;  4MPG A;  2X99 A;  2IPA A;  2LS5 A;  5JCW A;  4MZW A;  3EU3 A;  1VF1 A;  2CVK A;  3VI7 A;  2IMK A;  5D9T A;  2X8H A;  1E6B A;  3ZFB A;  1GL8 A;  1EP7 A;  4BVY A;  4IHU A;  1A0R P;  3L0H A;  2HRK A;  5IMD A;  3RBT A;  18GS A;  1T4Z A;  3HHV A;  2VKZ G;  4WR4 A;  3LG6 A;  3U6V A;  3FYG A;  2P5Q A;  3IDV A;  2FCH A;  4MPF A;  1W4V A;  1OKD A;  3NOF A;  3I6A A;  2D2Z A;  1X9S B;  4AJ6 A;  2JL4 A;  2YWN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...