1BX9A

Glutathione s-transferase in complex with herbicide
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
210
structure length
210
Chain Sequence
GIKVFGHPASIATRRVLIALHEKNLDFELVHVELKDGEHKKEPFLSRNPFGQVPAFEDGDLKLFESRAITQYIAHRYENQGTNLLQTDSKNISQYAIMAIGMQVEDHQFDPVASKLAFEQIFKSIYGLTTDEAVVAEEEAKLAKVLDVYEARLKEFKYLAGETFTLTDLHHIPAIQYLLGTPTKKLFTERPRVNEWVAEITKRPASEKVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/peptide
molecule keywords GLUTATHIONE S-TRANSFERASE
publication title Structures of herbicides in complex with their detoxifying enzyme glutathione S-transferase - explanations for the selectivity of the enzyme in plants.
pubmed doi rcsb
total genus 77
structure length 210
sequence length 210
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1998-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1bx9A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1bx9A01
4N11A 3M0FA 1Z7RA 1R26A 3ZYWA 2NDOA 2VIMA 2MYGA 1PKZA 2IMFA 3HD5A 2CX4A 1MDIA 5C04A 4WKWA 3QFBC 5ECPB 2FWEA 2QGVA 3GYKA 1W4VA 1SL2B 2GGTA 3WYWA 2HI7A 2VLUA 1O7UA 2K8SA 2H1GA 2GT6A 1B9YC 4G9HA 20GSA 2C0EA 3EE2A 2XBQA 4EO3A 4N0VA 3ZRDA 2DC5A 3TRQA 5F0GA 2JACA 1K0DA 4K8MA 3D21A 2C0DA 4BWQA 1SYRA 2FWHA 2H1AA 4J57E 2IIYA 2L59A 1E2YA 5HQPA 3GHAA 2TRXA 3F6DA 5F06A 3I43A 2KP1A 3D0ZA 2JZRA 1XWBA 5DAKA 1MD4A 3IK9A 2OJLA 1TRVA 5B7CA 4YQVA 2I9HA 3L78A 1AW9A 1ERVA 3MNGA 4G2EA 4HU7A 1I5GA 3HVXA 5G2ZA 3GIXA 1XCCA 1TOFA 1GTAA 4K2DA 1GTIA 1SKRB 2A2RA 2GLRA 1KNGA 2DBCA 2AUVA 1NM3A 2ALBA 3ISOA 5IMAA 4X1UA 4KDXA 5A4WA 2LNSA 4F9ZA 2YZHA 6GSYA 5G1LA 4GF0A 2B3SA 4J2FA 2HRKB 1GNWA 2E2GA 1ERUA 4F0CA 1T4ZA 3D4TA 4GLTA 2ZCTA 5GSTA 3HJPA 4KX4A 4RQRA 4JEDA 3CSHA 4KAEA 1HNCA 4PQ1A 4PQIA 1MDJA 1T8EB 3F4SA 4OWYA 4WF5A 3HDCA 4OCFA 4E8EA 2YANA 3GSSA 3TCOA 4V1Ag 1R5AA 2PPTA 3HCZA 5BMUA 1GULA 3ZIVA 1DE2A 2F9SA 2VLTA 2HRAA 3FZAA 3KM6A 4I2UA 2OE1A 5GAND 2R3XA 5L71A 1AIUA 2J23A 3C1SA 2NBSA 2VCXA 4HU9A 2MBTA 2CAIA 5ECNB 3ZMKA 3L0HA 3DIEA 1T7PB 2LNTA 3IRAA 4FO5A 3UJ1A 2REMA 1XVQA 4KSMA 2CQ9A 3O3TA 1QQ2A 2OE0A 1ST9A 2CV4A 1XFLA 3HHVA 3GH9A 4X0XA 4IP1A 1GSSA 2YZUA 5J3RA 1A24A 2GZYA 2HYXA 3BCKA 3IE3A 5ELAA 2FCHA 3TKRA 1K0NA 3LFLA 4OFMA 3ZIJA 2F3MA 1BYEA 2R37A 2EIRA 1U87A 2GSQA 3FY7A 3S9FA 6GSSA 1K3OA 1WE0A 3PR8A 4WR4A 4ZBDA 1G7EA 3E0UA 5FT3A 4IBPA 4PGTA 1AQWA 4GQFA 1EOHA 1HD2A 4WR5A 5ECOB 3MSZA 2FWFA 2G0FA 2I81A 2NPBA 3U5RE 5ELGA 1GRXA 2HNLA 1LU4A 2H01A 1M9BA 5HR2A 3CSJA 5A4VA 3WGXA 2XPDA 1SK0A 1GLPA 5D73A 1GSEA 2GQMA 5J5NA 2HRKA 1TU7A 2B5YA 2MMNA 5ABRA 1QMVA 4KNDA 2K6VA 3ZLPA 2H75A 3PPUA 2H1BA 4OO5A 3EURA 2GS3A 2HSMB 1K3LA 2CX3A 3IOSA 1FVJA 2IFQB 1N8JA 2H0GA 4D73B 3TRXA 1GSFA 1PQNA 1GSQA 3TKSE 3HXSA 1XIYA 2YPMA 9GSSA 4KSOA 1HNAA 4F03A 2VCZA 5IMVA 1SK1A 5E4WA 2RM6A 1S3AA 1CQGA 2RM5A 3GRXA 1IYHA 2F8FA 3ZMLA 3ZITA 4TR4A 1F9MA 1SENA 4XS1A 1TW9A 5J9CA 2FD3A 3ZFLA 2HZEB 4LMWA 2LRTA 3FR6A 2VLVA 4MCUA 1T00A 2AYTA 1M0UA 2OBIA 2OKAA 3TB2A 4E8HA 2B7KA 2L6DA 1XW9A 2CZ3A 1Q98A 3CYNA 1NSWA 1T4YA 1EGOA 1SJ6A 2V32A 4PTSA 2B1LA 3IR4A 5ECMB 2IL3A 4IKHA 3UEMA 1AC1A 2EC4A 1K0AA 4YH2A 2MZCA 4BVYB 1MDKA 1USBA 4LA1A 1VF1A 5J9BA 3GURA 3FR3A 4MF6A 4FQUA 4MZBA 5F07A 3ERFA 2L6CA 8GSSA 1WWJA 1X5DA 3TJKA 2VL2A 2WCIA 3UBKA 2YWIA 4ILFA 3UMAA 5HR0A 2RLIA 1O6JA 2O87A 1DBYA 3OR5A 5JCGA 4NHZA 3APQA 1NHOA 4PUFC 3HJOA 2CA8A 4K0NA 3G7JA 1SJIA 5GSSA 1J0FA 4G10A 1PGTA 2RIIA 2H0IA 3EYTA 3H8QA 3TKSA 2HXKA 1RK4A 1MEKA 1ON4A 1ML6A 5ID2A 1EV4A 1VF3A 2LV3A 2VO4A 1M99A 1A8YA 1A2MA 4GSNA 2JZTA 4POBA 4LL1B 2HSMA 3LXTA 4IS0A 1EP8A 2CVBA 4D73A 4MA9A 3EMXA 2L4CA 2C3NA 3PINA 1HNBA 2KP2A 4MH2A 1GNEA 4G0IA 2L5OA 5ECSA 4MDCA 3EU4A 1CQHA 1ZMAA 1QK8A 3FHKA 5EVOA 2V41A 2HSYA 4ZL7A 1Y6EA 1WIKA 1X9SB 4XHMA 4ZXGA 4JU5A 3FR9A 4L0WA 5HFIA 3HY2A 5LD0A 2FY6A 1C72A 3GKKA 3C7MA 4G0KA 3P2AA 5HR3A 5G30A 2YV7A 5JCUA 3HKRA 2M72A 5IM9A 4IJIA 5JWOB 3FRCA 2X8CA 3CSIA 5G5EA 3QAVA 2GZZA 3EU3A 1IYIA 2B7JA 3P7XA 4L0UA 1OE8A 1NHYA 5IPGA 4HJMA 1BQ7A 2ZUPA 1O8XA 3F63A 1BAYA 2X8GA 2R6KA 2IMEA 1YY7A 4DSRA 4MMMA 4L5LA 2E0QA 5CRDA 3GFKA 5AIVA 2CVDA 3VK9A 5ECQB 2UZ8A 3N5OA 4BVYA 1OE7A 4OO4A 2CT6A 1GSUA 3SWLA 3ZZXA 4FIWA 3RAZA 2ES7A 2GSTA 2LJKA 5G31A 2VD1A 4LMVA 4PX1A 2XHFA 2GT5A 1URMA 2EIOA 4DVCA 4H86A 3LSZA 2DJKA 4G19A 5CREA 2DIZA 1GUHA 1V40A 3RHBA 5AIXA 3DMLA 5ECRB 2ON7A 1XVWA 1FB0A 4ZIJA 1YF1A 3F0IA 4DSSB 1OC9B 1F3BA 2JU5A 1S3CA 4ECBA 2LQOA 1GL8A 1X0RA 3MAKA 1FOVA 4GWRA 4HI7A 4USSA 1SL1B 5DQSA 3C1RA 3VWWA 1G6YA 4WETA 3UIWA 1TJDA 1Z6NA 3I6AA 2V2GA 3LG6A 4ECCA 4NV5A 3BJ5A 1PSQA 2VM2A 4WBJA 1AUCA 1V57A 1GUMA 2HRNA 1HQOA 2YCDA 3TJFA 4QL7A 3N9JA 6GSWA 4XS6A 3DEXA 3GNJA 2V1MA 2X8HA 4ULXA 4MABA 3KD0A 3F4RA 3D4MA 4XCSA 4G0LA 1A0FA 12GSA 3ZREA 2B1KA 1Q4JA 4ISDA 1SL0B 1XPVA 3F9UA 3F6FA 2BTOT 4HDEA 2X99A 2DSAA 2YP6A 3GL3A 4MP4A 16GSA 4CW9A 3GUSA 2IPAA 4P3YB 3VI7A 2H6XA 1PX6A 5DJMA 4K7IA 2YN1A 1B4QA 3FW2A 1PKWA 2VM1A 2C80A 3EINA 4OFNA 1XW5A 5CAXA 2VD0A 1VGLA 3DRNA 1ZOFA 5ECKB 1JFUA 1Y25A 5KN3A 4IN0A 2GDRA 5CNWA 3M9JA 5AN1A 3DWVA 2VAFA 5A5KA 1XWAA 1J08A 1PD21 3LQ7A 3ED3A 2AHEA 3QR6A 4KGIA 5E59A 2QSIA 3IAS2 4MF7A 5IMCA 3P8WA 1XOBA 2TRCP 2H8LA 5DCGA 4MJEA 2LSTA 2GTUA 3ZL5A 4IELA 4KE3A 4Q5RA 4POLA 4TR1B 4DSSA 1TRWA 2GVPA 1OC9A 1YZXA 3HJMA 3KMNA 4F2IA 1B8XA 1GUKA 4POMA 3ME7A 3IPZA 2VCWA 4I2TA 3ZTLA 4YQMA 5CYYA 1FAAA 3F4TA 2FLSA 4KW6A 2VCTA 2CVKA 4N10A 3GH6A 3LEFA 5KN1A 2AAWA 3D6IA 2WZ9A 2JL4A 4IHUA 1YEXA 5D9VA 1JZRA 2YWOA 1PN9A 5JWQB 3GKMA 1EP7A 2WFCA 3IXRA 4IW9A 1SU9A 3FZ9A 4AF2A 1SK2A 4NPBA 3L9VA 3KP9A 1PA3A 3RBTA 1JZOA 2DJ1A 3RHCA 3HZ8A 5C00A 4TXVA 4NHWA 4ECJA 1KTEA 3KH9A 3F3RA 3TJJA 1FO5A 1U6TA 1FG4A 3HA9A 5JWRB 1TTZA 4Q5NA 2N5AA 4DSQA 4NMUA 2LQQA 1ZYEA 3EC3A 3R2QA 3TKQA 4K7OA 3LYPA 1B48A 3HYPA 4Q5QA 2FGXA 1ILOA 2H74A 4IVFA 1A8LA 4O7HA 2XBIA 3RPNA 5GZZB 1EWXA 3CBUA 3CTFA 4O5RA 1QGVA 1GTUA 3KH7A 2LTKA 3RPPA 3L9SA 4GXZA 3UBLA 4ZB9A 1WRYA 1A0RP 2MMZA 3KEBA 2VL9A 4V2NA 4I8BA 1RQMA 1K3YA 4RQXA 2ZNMA 4RUVA 3UOMA 4TR1A 1VF2A 1ERWA 4AGSA 4EUYA 2P0GA 3FK8A 5DJLA 4CHSA 1SYXA 5IO0A 1VF4A 2P5RA 5FWGA 4V2MA 2LS5A 5IMFA 3GN3A 1TK0B 3IDVA 4HQSA 1ZCPA 2AB6A 2L5LA 3J7Yk 3EMPA 5F8BA 3C71A 5IOXA 1K0OA 1XW6A 3TOUA 1WPIA 3UVTA 2V6OA 2WGRA 3GX0A 3KJYA 2OACA 2OA7A 3D22A 4PNFA 3QMXA 4BA7A 4BPYA 4X43A 3H1NA 3GA4A 1BJXA 2FWGA 4TW5A 4V2LA 3KMOA 1EV9A 3TJBA 4KH7A 2H70A 1DE1A 4HUAA 5IOWA 4EXJA 4L5OA 3U6VA 1T1VA 2MMAA 2K18A 2YNXA 2H66A 2H73A 1MTCA 1J9BA 4CDOA 3VLNA 1ERTA 1EZKA 3TKPA 4KA0A 2B5EA 4JZQA 4TKYA 2LKUA 1K0MA 1DUGA 2P31A 1V98A 3BBYA 2DJ0A 2HE3A 3KP8A 1A23A 4HOJA 5ENUA 5D93A 5AGYA 1T3BA 2JADA 2PVOC 4MJCA 3DVXA 2JSZA 3A2WA 5B6NA 4TN8A 2WULA 4ACSA 1Z6MA 3DXBA 6GSUA 2WRTA 2E2MA 1O8WA 1QFNA 3GV1A 3PGTA 2IFQA 5F05A 1S3DA 4FYUA 4N30A 1FB6A 2OE3A 4V1Ap 1AAZA 2K9FA 2KLXA 2IMKA 2RUFA 3GMFA 3VWVA 3IHQA 4MJBA 5D9XA 2YV9A 1Z3EA 1M2BA 1PL1A 4WXTA 2R2JA 2A4VA 2H0HA 2VL3A 3FKFA 3ERWA 2BJXA 2IN3A 1R5PA 3ERGA 1U3IA 2DMLA 5DDLA 4EDYA 3NIVA 1GH2A 5DBQA 1PMTA 3NZNA 2C3TA 2G2QA 5KN0A 1W89A 3I69A 2HZEA 1YKAA 3G7YA 1THOA 4YAPA 1V2AA 1ACVA 2XC2A 1XWGA 2GQKA 1M2AA 4DEJA 1XZOA 4JR4A 1XWCA 2YJHA 3ZFBA 3DGQA 3GSTA 1XXUA 5DQYA 2XPEA 4KUNA 5HFGA 13GSA 2VCVA 2C0GA 1M2DA 2TIRA 3QFAC 4AJ6A 3M9KA 2H72A 2GSRA 1OVNA 2IWTA 1HYUA 2MMOA 1OAZA 2HFDA 1TRSA 1WJKA 3IC4A 3MDKA 3KTLA 1GSDA 5DCHA 5D9TA 1NW2A 5IMDA 4KCEA 2R4VA 4L8EA 2WB9A 4IGJA 3R3EA 1PX7A 5H5QA 3KIJA 2L57A 4PXOA 4ZB8A 4TXOB 2Z9SA 4JBBA 14GSA 4K7NA 2J9HA 3UAPA 4BL7B 2F51A 1TK8B 5H5SA 4WF4A 2LRCA 2FA4A 4MPFA 3IC8A 1TI3A 22GSA 4XTSA 4EVMA 1X5CA 3H79A 4MF5A 3NOFA 3TRPA 3C8EA 2FUG2 3TGZA 4HEA2 3KGKA 1V58A 2I3YA 3TDGA 1F6MC 3RDWA 2DMMA 3QCPA 4K1FA 4K9ZA 5EY6A 3A3TA 1TDIA 6GSVA 11GSA 1DSBA 2NTOA 2VL2C 2N5FA 3K8NA 1JZDA 2PVQA 2BMXA 2WJUA 18GSA 4Q5FA 1TP9A 2FNOA 4K0GA 1R4WA 3ZVJA 1X9MB 3E9JB 2M80A 3GTUB 3TKSC 3WGDA 3US3A 6GSTA 3H4KA 2YWMA 3QDNA 4TOPA 4F82A 2DLXA 1UC7A 2I1UA 4PURA 2C4JA 4XRDA 3M8NA 4EKZA 3A2VA 1YKCA 1TK5B 3VI5A 4XIHA 2B6MA 4FYBA 4I6XA 3A2XA 1SD9A 5ECLB 4ZB6A 1G6WA 2LUSA 1UVZA 2PU9C 1X9WB 3HVSA 2QC7A 4FYCA 4XRAA 1FHEA 1ZGNA 5ECIB 3CRUA 1QXHA 1GLQA 3VWXA 2QKEA 1H4OA 3CRTA 2VOCA 1LBKA 4KDYA 4EC0A 2DJ3A 1YF0A 1AXDA 3UARA 2F8AA 1OKTA 3KTBA 1KEBA 1XOAA 3LXZA 3FZ5A 1YQ1A 2A2SA 2OADA 2CAQA 2DJ2A 3GKXA 1BG5A 1EGRA 4TXOA 4AJ8A 2IJYA 3UVHA 3F8UA 4F0BA 3AY8A 1RW1A 1U3AA 17GSA 4GSTA 4BL7A 2FHEA 4MH3A 3W6GA 1G7OA 4WEYA 3DYRA 5IIZA 19GSA 3VFIA 2CZ2A 1A2LA 4MLYA 2R5GA 4Z7XA 1UA5A 2RUEA 3LORA 3TOTA 1GWCA 5G1KA 1F2EA 4AJ7A 5H5RA 2HSNB 1Z5YE 1YJ6A 4TVEA 3IK7A 2B5XA 2HZFA 5LCZA 2WDUA 4YAVA 4PUAA 4MK3A 3Q6OA 4QQ7A 5D96A 4LL4B 2GZPA 5CRGA 1GTBA 4KB3A 3WGEA 5KEJA 1A2JA 1JZWA 5J4UA 4MPGA 5INYA 5DALB 4POKA 1O73A 4ZBAA 3LJRA 4GSSA 2H1DA 4NV2A 2H76A 4JE1A 3J7Yb 1XBSA 2V6KA 2IMDA 1GP1A 4K6XA 3GTUA 3FEUA 5HR1A 1AQVA 2I4AA 4IJ3A 3L9UA 3QOUA 4OCEA 5IO2A 3VURA 1SJZA 5IQYA 3QAWA 4TR0A 2OBKA 4OMVA 4BVXB 4GTUA 2M46A 1ZL9A 5A4UA 1Z7PA 2H30A 1M7TA 4YQUA 5HFKA 5D9WA 3QAGA 3PH9A 2HT9A 2JSYA 3IBHA 7GSSA 1GSYA 2DJJA 4PQHA 4OFTA 4N0ZA 3KCMA 3WT1A 3IV4A 3M3MA 4ECIA 3EVIA 1TI1A 4FH8A 2LJRA 4EL1A 3KXOA 2LEGA 1Z9HA 1XWKA 1O81A 2JZSA 4MJAA 3TJGA 5ID2B 1K0BA 1ABAA 4OD7A 5B8AA 2AJQB 3APOA 3V1WA 1H75A 3G9BA 3DKSA 3BOAA 4I97A 1UN2A 5LNKe 2H6ZA 1B4PA 1QUWA 4EDZA 3P90A 4GRFA 3DD3A 4O32A 4XS4B 1ZYQB 2H71A 5D8IA 1X5EA 4LLRA 5CO3A 4MZCA 4MZWA 3LWAA 4HJ2A 1TU8A 3I9V2 3F3QA 2HSHA 2KOKA 4NXIA 1EEMA 4HS1A 2K8VA 4QL9A 3HZ4A 1FW1A 3IAM2 1BX9A 1LJRA 4ID0A 4EE0A 4ZL8A 5ECHB 1OYJA 1FVKA 2X64A 4ZBBA 1TRUA 3DVWA 5DALA 3GX8A 1SKSB 2VUPA 3UL3A 4IQAA 4J56E 4HZ4A 1K0CA 2PERA 3VPQA 4ML6A 5CP1A 5EPFA 2L4QA 5AISA 3Q18A 2HQTA 4KDUA 4RI7A 2KHPA 1SKWB 1F37A 3M1GA 4PNGA 1OC3A 1B9XC 3TUEA 1JLVA 3O76A 4TRXA 3BD2A 2KUCA 2GSSA 5CRHA 4IQ1A 3VPTA 1R7HA 2LRNA 3O6TA 5EL8A 3ME8A 4BVXA 3H93A 1E6BA 2O7KA 4KF9A 4HZ2A 2P5QA 3GKNA 1OKDA 2NVLA 1KBNA 3CXGA 3APSA 4NWYA 4BWSA 5JCWA 1PL2A 2HRFA 3LGCA 4O92A 3SBCA 1V9WA 4GQCA 3KZQA 2PN8A 3Q74A 3GL5A 5IPHA 2N5BA 2MBSA 1WMJA 3D5JA 2E7PA 3MWHA 3A5WA 4JR6A 2C3QA 1VRSD 5KN2A 2C0FA 3FYGA 4ZL9A 1SD8A 3LYKA 2PUKC 2YJ7A 4EF0A 2ON5A 3G7IA 1TXXA 10GSA 1YDKA 3VWUA 3QPMA 2WS2A 3BCIA 3ZVJD 4I5QA 2PMTA 2HLSA 1U88A 3IA1A 5G5FA 2H19A 2VCQA 2YWNA 3CTGA 4XS4A 3QD9A 1N2AA 2PBJA 2C1YA 3EWLA 5IMZA 1M9AA 1WOUA 2H6YA 4KCAA 5DAKB 3FZ4A 2LJAA 4WBRD 1PRXA 5GAPD 3CMIA 2O85A 5COHA 1TKDB 2PWJA 1ZZYA 4NAXA 1O85A 4IP6A 1MD3A 1F3AA 2IMIA 1YEPA 2YOIA 1I9DA 1BEDA 3W8JA 4ZILA 2AV4A 2PGTA 4ML1A 3WD6A 5B6MA 5FHIA 2C8UA 3C73A 4JRRA 1OC8A 3L4NA 5DVBA 2O89A 3E3EA 3JCML 2D2ZA 3HVVA 5CRWA 5B8BA 2FA8A 1JHBA 1G0TA 2DIYA 2EIQA 1WP0A 6GSXA 1JLWA 3WT2A 1THXA 1EEJA 4TR3A 1EOGA 3Q19A 4GCIA 2GQLA 4HQZA 5J41A 2O8VB 4RI6A 1AQXA 3W8SA
chains in the Genus database with same CATH superfamily
4N11A 3M0FA 1S3RA 1Z7RA 1R26A 3ZYWA 2NDOA 2VIMA 2MYGA 1PKZA 2IMFA 3HD5A 2CX4A 1MDIA 5C04A 4WKWA 3QFBC 5ECPB 4N3ZA 1BF5A 2FWEA 2QGVA 3GYKA 1W4VA 1SL2B 2GGTA 3WYWA 2HI7A 2VLUA 1O7UA 2K8SA 2H1GA 2GT6A 1B9YC 4G9HA 20GSA 2C0EA 3EE2A 2XBQA 2WVXA 4EO3A 4N0VA 3ZRDA 2DC5A 3TRQA 5F0GA 2JACA 1K0DA 4K8MA 3D21A 2C0DA 2UV8G 4BWQA 1SYRA 2FWHA 2H1AA 4J57E 2IIYA 2L59A 1E2YA 5HQPA 3GHAA 2TRXA 3F6DA 5F06A 3I43A 2KP1A 3D0ZA 2JZRA 1XWBA 5DAKA 1MD4A 1M3JA 3IK9A 2OJLA 1TRVA 5B7CA 4YQVA 2I9HA 3L78A 1AW9A 1ERVA 3MNGA 4G2EA 4HU7A 1I5GA 3HVXA 5G2ZA 3GIXA 1XCCA 1TOFA 1GTAA 4K2DA 1GTIA 1SKRB 2A2RA 2GLRA 1KNGA 2DBCA 2AUVA 1NM3A 2ALBA 3ISOA 5IMAA 4X1UA 4KDXA 5A4WA 2LNSA 2WVZA 4F9ZA 2YZHA 6GSYA 5G1LA 5A1NA 4GF0A 2B3SA 4J2FA 2HRKB 1GNWA 2E2GA 1ERUA 2VKZG 4F0CA 1T4ZA 3D4TA 4GLTA 2ZCTA 5GSTA 3HJPA 4KX4A 4RQRA 4JEDA 1FOHA 3CSHA 4KAEA 1HNCA 4PQ1A 4PQIA 1MDJA 1T8EB 3F4SA 4OWYA 4WF5A 3HDCA 4OCFA 4E8EA 2YANA 3GSSA 3TCOA 4V1Ag 1R5AA 2PPTA 3HCZA 5BMUA 1GULA 3ZIVA 1DE2A 2F9SA 2VLTA 1M3IA 2HRAA 3FZAA 3KM6A 4I2UA 2OE1A 5GAND 2R3XA 5L71A 1AIUA 2J23A 3C1SA 2NBSA 2VCXA 4HU9A 5J47A 2MBTA 2CAIA 5ECNB 3ZMKA 3L0HA 3DIEA 1T7PB 2LNTA 3IRAA 4FO5A 3UJ1A 2REMA 1XVQA 4KSMA 2CQ9A 3O3TA 1QQ2A 2OE0A 1ST9A 2CV4A 1XFLA 3HHVA 3GH9A 4X0XA 4IP1A 1GSSA 2YZUA 5J3RA 1A24A 2GZYA 2HYXA 3BCKA 3IE3A 5ELAA 2FCHA 3TKRA 1K0NA 3LFLA 4OFMA 3ZIJA 2F3MA 2X49A 1BYEA 2R37A 2EIRA 1U87A 2GSQA 3FY7A 3S9FA 6GSSA 1K3OA 1WE0A 3PR8A 4WR4A 4ZBDA 1G7EA 3E0UA 5FT3A 4IBPA 4PGTA 1AQWA 4GQFA 1EOHA 1HD2A 4WR5A 5ECOB 3MSZA 2FWFA 2G0FA 2I81A 2NPBA 3U5RE 1TXUA 5ELGA 1GRXA 2HNLA 1LU4A 2H01A 1M9BA 5HR2A 3CSJA 2O3EA 5A4VA 3WGXA 2XPDA 1XG8A 1SK0A 1GLPA 5D73A 1GSEA 2GQMA 5J5NA 2HRKA 1TU7A 2B5YA 2MMNA 5ABRA 1QMVA 4KNDA 2K6VA 1S4BP 3ZLPA 2H75A 3PPUA 2H1BA 4OO5A 3EURA 2GS3A 2HSMB 1K3LA 2CX3A 3IOSA 1FVJA 2IFQB 1N8JA 2H0GA 4D73B 4ZB7A 3TRXA 1GSFA 1PQNA 1ZYPA 1GSQA 3TKSE 3HXSA 1XIYA 2YPMA 9GSSA 4KSOA 1HNAA 4F03A 2VCZA 5IMVA 1SK1A 5E4WA 2RM6A 1S3AA 1CQGA 2RM5A 3GRXA 1IYHA 2F8FA 3ZMLA 3ZITA 4TR4A 1F9MA 1SENA 4XS1A 1TW9A 2DKHA 4AKIA 5J9CA 2FD3A 3ZFLA 2HZEB 4LMWA 2LRTA 3FR6A 2VLVA 4MCUA 1T00A 2AYTA 1M0UA 1SVMA 2OBIA 2OKAA 3TB2A 4E8HA 2B7KA 2L6DA 1XW9A 2CZ3A 1Q98A 3CYNA 1NSWA 1T4YA 1EGOA 1SJ6A 2V32A 4PTSA 2B1LA 3IR4A 5ECMB 2IL3A 4IKHA 3UEMA 1AC1A 2EC4A 1K0AA 4YH2A 2MZCA 4BVYB 1MDKA 1USBA 4LA1A 1VF1A 5J9BA 3GURA 3FR3A 4MF6A 4FQUA 4MZBA 3FMWA 5F07A 3ERFA 2L6CA 8GSSA 1WWJA 1X5DA 3TJKA 2VL2A 2WCIA 3UBKA 2EFDA 2YWIA 2EFHA 4ILFA 3UMAA 5HR0A 2RLIA 1O6JA 2O87A 1DBYA 3OR5A 1ZYNA 5JCGA 4NHZA 3APQA 1NHOA 4PUFC 3HJOA 2CA8A 4K0NA 3G7JA 1SJIA 5GSSA 1J0FA 4G10A 1PGTA 2RIIA 2H0IA 3EYTA 3H8QA 3TKSA 2HXKA 1RK4A 1MEKA 1ON4A 1ML6A 5ID2A 1EV4A 1VF3A 2LV3A 2VO4A 1M99A 1A8YA 1A2MA 4GSNA 3RGBC 2JZTA 4POBA 4LL1B 2HSMA 3LXTA 4IS0A 1EP8A 2CVBA 4D73A 4MA9A 3EMXA 2L4CA 3A5IA 2C3NA 3PINA 3TU3B 1HNBA 2KP2A 4MH2A 1GNEA 4G0IA 2L5OA 5ECSA 4MDCA 3EU4A 1CQHA 5KOWA 1ZMAA 1QK8A 3FHKA 5EVOA 2V41A 3MYDA 2HSYA 4ZL7A 1Y6EA 1WIKA 1X9SB 4XHMA 4ZXGA 4JU5A 3FR9A 4L0WA 5HFIA 3HY2A 5LD0A 2FY6A 1C72A 3GKKA 3C7MA 4G0KA 4AI6A 3P2AA 5HR3A 5G30A 2A4HA 1N25A 2YV7A 5JCUA 3HKRA 2M72A 5IM9A 4IJIA 5JWOB 3FRCA 2X8CA 3CSIA 5G5EA 3QAVA 2GZZA 3EU3A 1IYIA 2B7JA 3P7XA 4L0UA 1OE8A 1NHYA 5IPGA 4HJMA 1BQ7A 2ZUPA 1O8XA 3F63A 1BAYA 2X8GA 2R6KA 2IMEA 1YY7A 4DSRA 4MMMA 4L5LA 2E0QA 5CRDA 3GFKA 5AIVA 2CVDA 3VK9A 5ECQB 2UZ8A 3N5OA 4BVYA 4CY6A 3CHXC 1OE7A 4OO4A 2CT6A 1GSUA 3SWLA 3ZZXA 4FIWA 3RAZA 2ES7A 2GSTA 2LJKA 5G31A 2VD1A 4LMVA 4PX1A 5A34B 2XHFA 4YKGA 2GT5A 1URMA 2EIOA 4DVCA 4H86A 1I1IP 3LSZA 2DJKA 4G19A 5CREA 2DIZA 1GUHA 1V40A 3RHBA 5AIXA 3DMLA 5ECRB 2ON7A 3MIXA 3CWGA 1XVWA 1FB0A 4ZIJA 1YF1A 3F0IA 4DSSB 5J4YA 5BRTA 1OC9B 1F3BA 2JU5A 1S3CA 4ECBA 2LQOA 1GL8A 1X0RA 3MAKA 1FOVA 4GWRA 4HI7A 4USSA 1SL1B 5DQSA 3C1RA 3VWWA 1G6YA 4WETA 3UIWA 1TJDA 1Z6NA 3I6AA 2V2GA 3LG6A 4ECCA 4NV5A 3BJ5A 1PSQA 2VM2A 4WBJA 1AUCA 3RFRC 1V57A 1GUMA 2HRNA 4K5RA 1HQOA 2YCDA 3TJFA 4QL7A 3N9JA 6GSWA 4XS6A 3DEXA 3GNJA 2V1MA 2X8HA 4ULXA 4MABA 3KD0A 3F4RA 3D4MA 4XCSA 4G0LA 1A0FA 12GSA 3ZREA 2B1KA 1Q4JA 4ISDA 1SL0B 1XPVA 3F9UA 3F6FA 2BTOT 4HDEA 2X99A 2DSAA 2YP6A 3GL3A 4MP4A 16GSA 4CW9A 3GUSA 2IPAA 4P3YB 3VI7A 2H6XA 1PX6A 4FXYP 5DJMA 4K7IA 2YN1A 1B4QA 3FW2A 1PKWA 2VM1A 2C80A 3EINA 4OFNA 1XW5A 5CAXA 2VD0A 1VGLA 3DRNA 1ZOFA 5ECKB 1JFUA 1Y25A 5KN3A 4IN0A 2GDRA 5CNWA 3M9JA 5A34A 5AN1A 3DWVA 2VAFA 5A5KA 1XWAA 1J08A 1PD21 3LQ7A 4YKFA 3ED3A 2AHEA 3QR6A 4KGIA 5E59A 2QSIA 3IAS2 4MF7A 5IMCA 2R0CA 3P8WA 1XOBA 2TRCP 2H8LA 5A5HB 5DCGA 4MJEA 4O5QA 2LSTA 2GTUA 3ZL5A 4IELA 4KE3A 4Q5RA 4POLA 4TR1B 4DSSA 1TRWA 2GVPA 1OC9A 1YZXA 3HJMA 3KMNA 4F2IA 4W66A 1B8XA 1GUKA 4POMA 3ME7A 3IPZA 2VCWA 4I2TA 3ZTLA 4YQMA 5CYYA 1FAAA 3F4TA 2FLSA 4KW6A 2VCTA 2CVKA 4N10A 3GH6A 3LEFA 5KN1A 2AAWA 3D6IA 2WZ9A 2JL4A 3HVNA 4IHUA 1YEXA 5D9VA 1JZRA 2YWOA 1PN9A 5JWQB 1PN0A 3GKMA 1EP7A 2WFCA 3IXRA 4IW9A 1SU9A 3FZ9A 4AF2A 1SK2A 4NPBA 3L9VA 3KP9A 1PA3A 3RBTA 1JZOA 2DJ1A 3RHCA 3HZ8A 5C00A 4X4JA 4TXVA 4NHWA 4ECJA 1KTEA 3KH9A 3F3RA 3TJJA 1FO5A 1U6TA 1FG4A 3HA9A 5JWRB 1TTZA 4Q5NA 2N5AA 4DSQA 4NMUA 2LQQA 1ZYEA 3EC3A 3R2QA 3TKQA 4K7OA 3LYPA 1B48A 1SVLA 3HYPA 4Q5QA 2FGXA 1ILOA 2H74A 4IVFA 1A8LA 4O7HA 2XBIA 3RPNA 5GZZB 1EWXA 3CBUA 3CTFA 4O5RA 5J40A 3HMJG 1QGVA 1GTUA 4MNNA 3KH7A 2LTKA 3RPPA 3L9SA 4GXZA 3UBLA 4ZB9A 1WRYA 1A0RP 2MMZA 3KEBA 2VL9A 4V2NA 4I8BA 1RQMA 1K3YA 4RQXA 5A5HA 2ZNMA 4RUVA 3UOMA 4TR1A 1VF2A 1ERWA 4AGSA 4EUYA 2P0GA 3FK8A 5DJLA 4CHSA 1SYXA 5IO0A 1VF4A 1YVLA 2P5RA 5FWGA 4V2MA 2LS5A 5IMFA 3GN3A 1TK0B 3IDVA 4HQSA 2O36A 1ZCPA 4ICYA 2AB6A 2L5LA 3J7Yk 3EMPA 5F8BA 3C71A 5IOXA 1K0OA 1XW6A 3TOUA 1WPIA 3UVTA 4A5PA 3LW9A 2QA2A 2V6OA 2WGRA 3GX0A 3KJYA 2OACA 2OA7A 3D22A 4PNFA 3QMXA 4BA7A 4BPYA 4X43A 3H1NA 3GA4A 1BJXA 2FWGA 4TW5A 4EIQA 4V2LA 3KMOA 1EV9A 3TJBA 4KH7A 2H70A 1DE1A 4HUAA 5IOWA 4EXJA 4L5OA 3U6VA 1T1VA 2MMAA 2K18A 2YNXA 2H66A 2H73A 1MTCA 1J9BA 4CDOA 3VLNA 1ERTA 1EZKA 3TKPA 4KA0A 2B5EA 4JZQA 4TKYA 2LKUA 1K0MA 1DUGA 2P31A 1V98A 3BBYA 2DJ0A 2HE3A 3KP8A 1A23A 4HOJA 5ENUA 5D93A 5AGYA 1T3BA 2JADA 2PVOC 3CQFA 4MJCA 3DVXA 2JSZA 3A2WA 5B6NA 4TN8A 2WULA 4ACSA 1Z6MA 4AKGA 3DXBA 6GSUA 2WRTA 2E2MA 1O8WA 1QFNA 3GV1A 3PGTA 2DKIA 2IFQA 5F05A 1S3DA 4FYUA 4N30A 1FB6A 2OE3A 4V1Ap 1AAZA 2K9FA 2KLXA 2IMKA 2RUFA 3GMFA 3VWVA 3IHQA 4MJBA 5D9XA 2YV9A 1Z3EA 1M2BA 1PL1A 4WXTA 2R2JA 2A4VA 2H0HA 2VL3A 3FKFA 3ERWA 2BJXA 2IN3A 1R5PA 4PI2C 3ERGA 1U3IA 2DMLA 5DDLA 4EDYA 3NIVA 1GH2A 5DBQA 1PMTA 3NZNA 2C3TA 2G2QA 5KN0A 1W89A 3I69A 2HZEA 1YKAA 3G7YA 1THOA 4E68A 4YAPA 1V2AA 1ACVA 2XC2A 1XWGA 2GQKA 1M2AA 4DEJA 1XZOA 4JR4A 1XWCA 2YJHA 3ZFBA 3DGQA 3GSTA 1XXUA 5DQYA 2XPEA 4KUNA 5HFGA 13GSA 2VCVA 2C0GA 1M2DA 2TIRA 3QFAC 4AJ6A 3M9KA 3EPTA 2H72A 2GSRA 1OVNA 2IWTA 1HYUA 5A1NB 2MMOA 4G01A 1OAZA 4AKXB 2HFDA 1TRSA 1WJKA 3IC4A 3MDKA 3KTLA 1GSDA 5DCHA 5D9TA 1NW2A 5IMDA 4KCEA 2R4VA 4L8EA 2WB9A 4IGJA 1PFOA 3R3EA 4CY8A 1PX7A 5H5QA 3KIJA 2L57A 4PXOA 4ZB8A 4TXOB 2Z9SA 4JBBA 14GSA 5J4VA 4K7NA 2J9HA 3UAPA 4BL7B 2F51A 1TK8B 5H5SA 4WF4A 2LRCA 2FA4A 4MPFA 3IC8A 1TI3A 22GSA 4XTSA 4EVMA 1X5CA 3H79A 4MF5A 3NOFA 3TRPA 3C8EA 2FUG2 3TGZA 4HEA2 3KGKA 1V58A 2I3YA 3TDGA 1F6MC 3RDWA 2DMMA 3QCPA 4K1FA 1SVOA 4K9ZA 5EY6A 3A3TA 1TDIA 6GSVA 11GSA 1DSBA 2NTOA 2VL2C 2N5FA 3K8NA 1JZDA 2PVQA 2BMXA 2WJUA 18GSA 4Q5FA 2EFCA 1TP9A 2FNOA 4K0GA 1R4WA 3ZVJA 1YEWC 1X9MB 3E9JB 2M80A 3GTUB 3TKSC 3WGDA 3US3A 6GSTA 3H4KA 2H1LA 2YWMA 4K5SA 3QDNA 4K2XA 4TOPA 4F82A 2DLXA 1UC7A 2I1UA 4PURA 4QMKA 2C4JA 4XRDA 3M8NA 4EKZA 3A2VA 1YKCA 4O5UA 1TK5B 3VI5A 4XIHA 2B6MA 4FYBA 4I6XA 3A2XA 1SD9A 5ECLB 4ZB6A 1G6WA 2OT3A 2LUSA 1UVZA 2PU9C 1X9WB 3HVSA 2QC7A 2WW0A 4FYCA 4XRAA 1FHEA 1ZGNA 5ECIB 3CRUA 1QXHA 1GLQA 3VWXA 2QKEA 1H4OA 3CRTA 2VOCA 1LBKA 4KDYA 4EC0A 2DJ3A 1YF0A 1AXDA 3UARA 2WW3A 2F8AA 1OKTA 3KTBA 1KEBA 1XOAA 3LXZA 2R0GA 3FZ5A 1YQ1A 2A2SA 2OADA 2CAQA 2DJ2A 3GKXA 1BG5A 1EGRA 4TXOA 4AJ8A 4PHZC 2IJYA 3UVHA 3F8UA 4F0BA 3AY8A 1RW1A 1U3AA 17GSA 4GSTA 4BL7A 2FHEA 4MH3A 2WVYA 3W6GA 1G7OA 2QA1A 4WEYA 3DYRA 5IIZA 19GSA 3VFIA 2CZ2A 1A2LA 4MLYA 2R5GA 4Z7XA 1UA5A 2RUEA 3LORA 3TOTA 1GWCA 5G1KA 1F2EA 4AJ7A 5H5RA 2R0PA 2HSNB 1Z5YE 1YJ6A 4TVEA 3IK7A 2B5XA 2HZFA 5LCZA 2WDUA 4YAVA 4PUAA 4MK3A 3Q6OA 4QQ7A 5D96A 4LL4B 2GZPA 5CRGA 1GTBA 4KB3A 3WGEA 5KEJA 1A2JA 1JZWA 5J4UA 4MPGA 5INYA 5DALB 4POKA 1O73A 4ZBAA 3LJRA 4GSSA 2H1DA 4NV2A 2H76A 4JE1A 3J7Yb 1XBSA 2V6KA 2IMDA 1GP1A 4K6XA 3GTUA 3FEUA 5HR1A 1AQVA 2I4AA 4IJ3A 3L9UA 3QOUA 4OCEA 5IO2A 3VURA 1SJZA 5IQYA 3QAWA 4TR0A 2OBKA 4OMVA 4BVXB 4GTUA 2M46A 1ZL9A 5A4UA 1Z7PA 2H30A 1M7TA 4YQUA 5HFKA 5D9WA 3QAGA 3PH9A 2HT9A 2WW1A 2JSYA 4Z2TA 4HSCX 3IBHA 7GSSA 1GSYA 2DJJA 4PQHA 4OFTA 4N0ZA 3KCMA 3WT1A 3IV4A 3M3MA 4ECIA 3EVIA 1TI1A 4FH8A 2LJRA 3IHGA 4EL1A 3KXOA 2LEGA 1Z9HA 1XWKA 1O81A 2JZSA 4MJAA 3TJGA 5ID2B 1K0BA 1ABAA 4OD7A 5B8AA 2AJQB 3APOA 3V1WA 1H75A 3G9BA 3DKSA 3BOAA 1BG1A 4I97A 1UN2A 5LNKe 2H6ZA 1B4PA 1QUWA 4EDZA 3P90A 4GRFA 3DD3A 4O32A 4XS4B 1ZYQB 2H71A 5D8IA 1X5EA 4LLRA 5CO3A 4MZCA 4MZWA 3LWAA 4HJ2A 1TU8A 3I9V2 3F3QA 2HSHA 2KOKA 4NXIA 1EEMA 4HS1A 2HSNA 2K8VA 4QL9A 3HZ4A 1FW1A 3IAM2 1BX9A 1LJRA 4ID0A 4EE0A 4ZL8A 5ECHB 1OYJA 1FVKA 2X64A 4ZBBA 1TRUA 3DVWA 5DALA 3GX8A 1SKSB 2VUPA 3UL3A 1Y1UA 4IQAA 4J56E 4HZ4A 1K0CA 2PERA 3VPQA 4ML6A 5CP1A 5EPFA 2L4QA 5AISA 3Q18A 2HQTA 4KDUA 4RI7A 2KHPA 1SKWB 1F37A 3M1GA 4PNGA 5KOXA 1OC3A 1B9XC 3TUEA 1JLVA 3O76A 4TRXA 3BD2A 2KUCA 2GSSA 2A2PA 5CRHA 4IQ1A 3VPTA 1R7HA 2LRNA 3O6TA 5EL8A 3ME8A 4BVXA 3H93A 1E6BA 2O7KA 4KF9A 4HZ2A 2P5QA 3GKNA 1OKDA 2NVLA 1KBNA 3CXGA 3APSA 4NWYA 2WZSA 4BWSA 5JCWA 1PL2A 2HRFA 3LGCA 4O92A 3SBCA 1V9WA 4BIKA 4GQCA 3KZQA 2PN8A 3Q74A 3GL5A 5IPHA 2N5BA 2MBSA 1WMJA 3D5JA 4EIPA 2E7PA 3MWHA 3A5WA 4JR6A 2C3QA 1VRSD 5KN2A 2C0FA 3FYGA 4ZL9A 1SD8A 3LYKA 2PUKC 2YJ7A 2EFEA 2WVXB 4EF0A 2ON5A 3G7IA 1TXXA 10GSA 1YDKA 3VWUA 3QPMA 2WS2A 3BCIA 3ZVJD 4I5QA 4Z2UA 2PMTA 2HLSA 1U88A 4AKHA 3IA1A 5G5FA 2H19A 2VCQA 2YWNA 3CTGA 4XS4A 3QD9A 1N2AA 2PBJA 2C1YA 3EWLA 5IMZA 1M9AA 1WOUA 2H6YA 4KCAA 5DAKB 3FZ4A 2LJAA 4WBRD 1PRXA 5GAPD 3CMIA 2O85A 5COHA 1TKDB 2PWJA 1ZZYA 4NAXA 4GDFA 4Z2RA 1O85A 4IP6A 1MD3A 1F3AA 2X4AA 2WW2A 2IMIA 2O5VA 1YEPA 2YOIA 1I9DA 1BEDA 3W8JA 4ZILA 2AV4A 2PGTA 4ML1A 3WD6A 5B6MA 5FHIA 2C8UA 3C73A 4JRRA 1OC8A 3L4NA 5DVBA 2O89A 3E3EA 3JCML 2D2ZA 4PI0C 3HVVA 5CRWA 5B8BA 2FA8A 1JHBA 1G0TA 2DIYA 2EIQA 1WP0A 6GSXA 1JLWA 3WT2A 1THXA 1EEJA 4TR3A 1EOGA 3Q19A 5BMUB 4GCIA 2GQLA 4HQZA 5J41A 2O8VB 4RI6A 1AQXA 3W8SA
chains in the Genus database with same CATH topology
4N11A 3M0FA 1Z7RA 1R26A 3ZYWA 2NDOA 2VIMA 2MYGA 1PKZA 2IMFA 3HD5A 2CX4A 1MDIA 5C04A 4WKWA 3QFBC 5ECPB 4N3ZA 1BF5A 2FWEA 2QGVA 3GYKA 1W4VA 1SL2B 2GGTA 3WYWA 2HI7A 2VLUA 1O7UA 2K8SA 2H1GA 2GT6A 1B9YC 4G9HA 20GSA 2C0EA 3EE2A 2XBQA 4EO3A 4N0VA 3ZRDA 2DC5A 3TRQA 5F0GA 2JACA 1K0DA 4K8MA 3D21A 2C0DA 2UV8G 4BWQA 1SYRA 2FWHA 2H1AA 4J57E 2IIYA 2L59A 1E2YA 5HQPA 3GHAA 2TRXA 3F6DA 5F06A 3I43A 2KP1A 3D0ZA 2JZRA 1XWBA 5DAKA 1MD4A 3IK9A 2OJLA 1TRVA 5B7CA 4YQVA 2I9HA 3L78A 1AW9A 1ERVA 3MNGA 4G2EA 4HU7A 1I5GA 3HVXA 5G2ZA 3GIXA 1XCCA 1TOFA 1GTAA 4K2DA 1GTIA 1SKRB 2A2RA 2GLRA 1KNGA 2DBCA 2AUVA 1NM3A 2ALBA 3ISOA 5IMAA 4X1UA 4KDXA 5A4WA 2LNSA 4F9ZA 2YZHA 6GSYA 5G1LA 5A1NA 4GF0A 2B3SA 4J2FA 2HRKB 1GNWA 2E2GA 1ERUA 2VKZG 4F0CA 1T4ZA 3D4TA 4GLTA 2ZCTA 5GSTA 3HJPA 4KX4A 4RQRA 4JEDA 1FOHA 3CSHA 4KAEA 1HNCA 4PQ1A 4PQIA 1MDJA 1T8EB 3F4SA 4OWYA 4WF5A 3HDCA 4OCFA 4E8EA 2YANA 3GSSA 3TCOA 4V1Ag 1R5AA 2PPTA 3HCZA 5BMUA 1GULA 3ZIVA 1DE2A 2F9SA 2VLTA 2HRAA 3FZAA 3KM6A 4I2UA 2OE1A 5GAND 2R3XA 5L71A 1AIUA 2J23A 3C1SA 2NBSA 2VCXA 4HU9A 5J47A 2MBTA 2CAIA 5ECNB 3ZMKA 3L0HA 3DIEA 1T7PB 2LNTA 3IRAA 4FO5A 3UJ1A 2REMA 1XVQA 4KSMA 2CQ9A 3O3TA 1QQ2A 2OE0A 1ST9A 2CV4A 1XFLA 3HHVA 3GH9A 4X0XA 4IP1A 1GSSA 2YZUA 5J3RA 1A24A 2GZYA 2HYXA 3BCKA 3IE3A 5ELAA 2FCHA 3TKRA 1K0NA 3LFLA 4OFMA 3ZIJA 2F3MA 2X49A 1BYEA 2R37A 2EIRA 1U87A 2GSQA 3FY7A 3S9FA 6GSSA 1K3OA 1WE0A 3PR8A 4WR4A 4ZBDA 1G7EA 3E0UA 5FT3A 4IBPA 4PGTA 1AQWA 4GQFA 1EOHA 1HD2A 4WR5A 5ECOB 3MSZA 2FWFA 2G0FA 2I81A 2NPBA 3U5RE 1TXUA 5ELGA 1GRXA 2HNLA 1LU4A 2H01A 1M9BA 5HR2A 3CSJA 5A4VA 3WGXA 2XPDA 1SK0A 1GLPA 5D73A 1GSEA 2GQMA 5J5NA 2HRKA 1TU7A 2B5YA 2MMNA 5ABRA 1QMVA 4KNDA 2K6VA 3ZLPA 2H75A 3PPUA 2H1BA 4OO5A 3EURA 2GS3A 2HSMB 1K3LA 2CX3A 3IOSA 1FVJA 2IFQB 1N8JA 2H0GA 4D73B 4ZB7A 3TRXA 1GSFA 1PQNA 1ZYPA 1GSQA 3TKSE 3HXSA 1XIYA 2YPMA 9GSSA 4KSOA 1HNAA 4F03A 2VCZA 5IMVA 1SK1A 5E4WA 2RM6A 1S3AA 1CQGA 2RM5A 3GRXA 1IYHA 2F8FA 3ZMLA 3ZITA 4TR4A 1F9MA 1SENA 4XS1A 1TW9A 2DKHA 4AKIA 5J9CA 2FD3A 3ZFLA 2HZEB 4LMWA 2LRTA 3FR6A 2VLVA 4MCUA 1T00A 2AYTA 1M0UA 1SVMA 2OBIA 2OKAA 3TB2A 4E8HA 2B7KA 2L6DA 1XW9A 2CZ3A 1Q98A 3CYNA 1NSWA 1T4YA 1EGOA 1SJ6A 2V32A 4PTSA 2B1LA 3IR4A 5ECMB 2IL3A 4IKHA 3UEMA 1AC1A 2EC4A 1K0AA 4YH2A 2MZCA 4BVYB 1MDKA 1USBA 4LA1A 1VF1A 5J9BA 3GURA 3FR3A 4MF6A 4FQUA 4MZBA 3FMWA 5F07A 3ERFA 2L6CA 8GSSA 1WWJA 1X5DA 3TJKA 2VL2A 2WCIA 3UBKA 2EFDA 2YWIA 2EFHA 4ILFA 3UMAA 5HR0A 2RLIA 1O6JA 2O87A 1DBYA 3OR5A 1ZYNA 5JCGA 4NHZA 3APQA 1NHOA 4PUFC 3HJOA 2CA8A 4K0NA 3G7JA 1SJIA 5GSSA 1J0FA 4G10A 1PGTA 2RIIA 2H0IA 3EYTA 3H8QA 3TKSA 2HXKA 1RK4A 1MEKA 1ON4A 1ML6A 5ID2A 1EV4A 1VF3A 2LV3A 2VO4A 1M99A 1A8YA 1A2MA 4GSNA 2JZTA 4POBA 4LL1B 2HSMA 3LXTA 4IS0A 1EP8A 2CVBA 4D73A 4MA9A 3EMXA 2L4CA 3A5IA 2C3NA 3PINA 3TU3B 1HNBA 2KP2A 4MH2A 1GNEA 4G0IA 2L5OA 5ECSA 4MDCA 3EU4A 1CQHA 5KOWA 1ZMAA 1QK8A 3FHKA 5EVOA 2V41A 3MYDA 2HSYA 4ZL7A 1Y6EA 1WIKA 1X9SB 4XHMA 4ZXGA 4JU5A 3FR9A 4L0WA 5HFIA 3HY2A 5LD0A 2FY6A 1C72A 3GKKA 3C7MA 4G0KA 4AI6A 3P2AA 5HR3A 5G30A 2A4HA 1N25A 2YV7A 5JCUA 3HKRA 2M72A 5IM9A 4IJIA 5JWOB 3FRCA 2X8CA 3CSIA 5G5EA 3QAVA 2GZZA 3EU3A 1IYIA 2B7JA 3P7XA 4L0UA 1OE8A 1NHYA 5IPGA 4HJMA 1BQ7A 2ZUPA 1O8XA 3F63A 1BAYA 2X8GA 2R6KA 2IMEA 1YY7A 4DSRA 4MMMA 4L5LA 2E0QA 5CRDA 3GFKA 5AIVA 2CVDA 3VK9A 5ECQB 2UZ8A 3N5OA 4BVYA 4CY6A 1OE7A 4OO4A 2CT6A 1GSUA 3SWLA 3ZZXA 4FIWA 3RAZA 2ES7A 2GSTA 2LJKA 5G31A 2VD1A 4LMVA 4PX1A 5A34B 2XHFA 4YKGA 2GT5A 1URMA 2EIOA 4DVCA 4H86A 3LSZA 2DJKA 4G19A 5CREA 2DIZA 1GUHA 1V40A 3RHBA 5AIXA 3DMLA 5ECRB 2ON7A 3MIXA 3CWGA 1XVWA 1FB0A 4ZIJA 1YF1A 3F0IA 4DSSB 5J4YA 5BRTA 1OC9B 1F3BA 2JU5A 1S3CA 4ECBA 2LQOA 1GL8A 1X0RA 3MAKA 1FOVA 4GWRA 4HI7A 4USSA 1SL1B 5DQSA 3C1RA 3VWWA 1G6YA 4WETA 3UIWA 1TJDA 1Z6NA 3I6AA 2V2GA 3LG6A 4ECCA 4NV5A 3BJ5A 1PSQA 2VM2A 4WBJA 1AUCA 1V57A 1GUMA 2HRNA 4K5RA 1HQOA 2YCDA 3TJFA 4QL7A 3N9JA 6GSWA 4XS6A 3DEXA 3GNJA 2V1MA 2X8HA 4ULXA 4MABA 3KD0A 3F4RA 3D4MA 4XCSA 4G0LA 1A0FA 12GSA 3ZREA 2B1KA 1Q4JA 4ISDA 1SL0B 1XPVA 3F9UA 3F6FA 2BTOT 4HDEA 2X99A 2DSAA 2YP6A 3GL3A 4MP4A 16GSA 4CW9A 3GUSA 2IPAA 4P3YB 3VI7A 2H6XA 1PX6A 5DJMA 4K7IA 2YN1A 1B4QA 3FW2A 1PKWA 2VM1A 2C80A 3EINA 4OFNA 1XW5A 5CAXA 2VD0A 1VGLA 3DRNA 1ZOFA 5ECKB 1JFUA 1Y25A 5KN3A 4IN0A 2GDRA 5CNWA 3M9JA 5A34A 5AN1A 3DWVA 2VAFA 5A5KA 1XWAA 1J08A 1PD21 3LQ7A 4YKFA 3ED3A 2AHEA 3QR6A 4KGIA 5E59A 2QSIA 3IAS2 4MF7A 5IMCA 2R0CA 3P8WA 1XOBA 2TRCP 2H8LA 5A5HB 5DCGA 4MJEA 4O5QA 2LSTA 2GTUA 3ZL5A 4IELA 4KE3A 4Q5RA 4POLA 4TR1B 4DSSA 1TRWA 2GVPA 1OC9A 1YZXA 3HJMA 3KMNA 4F2IA 4W66A 1B8XA 1GUKA 4POMA 3ME7A 3IPZA 2VCWA 4I2TA 3ZTLA 4YQMA 5CYYA 1FAAA 3F4TA 2FLSA 4KW6A 2VCTA 2CVKA 4N10A 3GH6A 3LEFA 5KN1A 2AAWA 3D6IA 2WZ9A 2JL4A 4IHUA 1YEXA 5D9VA 1JZRA 2YWOA 1PN9A 5JWQB 1PN0A 3GKMA 1EP7A 2WFCA 3IXRA 4IW9A 1SU9A 3FZ9A 4AF2A 1SK2A 4NPBA 3L9VA 3KP9A 1PA3A 3RBTA 1JZOA 2DJ1A 3RHCA 3HZ8A 5C00A 4X4JA 4TXVA 4NHWA 4ECJA 1KTEA 3KH9A 3F3RA 3TJJA 1FO5A 1U6TA 1FG4A 3HA9A 5JWRB 1TTZA 4Q5NA 2N5AA 4DSQA 4NMUA 2LQQA 1ZYEA 3EC3A 3R2QA 3TKQA 4K7OA 3LYPA 1B48A 1SVLA 3HYPA 4Q5QA 2FGXA 1ILOA 2H74A 4IVFA 1A8LA 4O7HA 2XBIA 3RPNA 5GZZB 1EWXA 3CBUA 3CTFA 4O5RA 5J40A 3HMJG 1QGVA 1GTUA 4MNNA 3KH7A 2LTKA 3RPPA 3L9SA 4GXZA 3UBLA 4ZB9A 1WRYA 1A0RP 2MMZA 3KEBA 2VL9A 4V2NA 4I8BA 1RQMA 1K3YA 4RQXA 5A5HA 2ZNMA 4RUVA 3UOMA 4TR1A 1VF2A 1ERWA 4AGSA 4EUYA 2P0GA 3FK8A 5DJLA 4CHSA 1SYXA 5IO0A 1VF4A 1YVLA 2P5RA 5FWGA 4V2MA 2LS5A 5IMFA 3GN3A 1TK0B 3IDVA 4HQSA 1ZCPA 4ICYA 2AB6A 2L5LA 3J7Yk 3EMPA 5F8BA 3C71A 5IOXA 1K0OA 1XW6A 3TOUA 1WPIA 3UVTA 4A5PA 3LW9A 2QA2A 2V6OA 2WGRA 3GX0A 3KJYA 2OACA 2OA7A 3D22A 4PNFA 3QMXA 4BA7A 4BPYA 4X43A 3H1NA 3GA4A 1BJXA 2FWGA 4TW5A 4EIQA 4V2LA 3KMOA 1EV9A 3TJBA 4KH7A 2H70A 1DE1A 4HUAA 5IOWA 4EXJA 4L5OA 3U6VA 1T1VA 2MMAA 2K18A 2YNXA 2H66A 2H73A 1MTCA 1J9BA 4CDOA 3VLNA 1ERTA 1EZKA 3TKPA 4KA0A 2B5EA 4JZQA 4TKYA 2LKUA 1K0MA 1DUGA 2P31A 1V98A 3BBYA 2DJ0A 2HE3A 3KP8A 1A23A 4HOJA 5ENUA 5D93A 5AGYA 1T3BA 2JADA 2PVOC 4MJCA 3DVXA 2JSZA 3A2WA 5B6NA 4TN8A 2WULA 4ACSA 1Z6MA 4AKGA 3DXBA 6GSUA 2WRTA 2E2MA 1O8WA 1QFNA 3GV1A 3PGTA 2DKIA 2IFQA 5F05A 1S3DA 4FYUA 4N30A 1FB6A 2OE3A 4V1Ap 1AAZA 2K9FA 2KLXA 2IMKA 2RUFA 3GMFA 3VWVA 3IHQA 4MJBA 5D9XA 2YV9A 1Z3EA 1M2BA 1PL1A 4WXTA 2R2JA 2A4VA 2H0HA 2VL3A 3FKFA 3ERWA 2BJXA 2IN3A 1R5PA 3ERGA 1U3IA 2DMLA 5DDLA 4EDYA 3NIVA 1GH2A 5DBQA 1PMTA 3NZNA 2C3TA 2G2QA 5KN0A 1W89A 3I69A 2HZEA 1YKAA 3G7YA 1THOA 4E68A 4YAPA 1V2AA 1ACVA 2XC2A 1XWGA 2GQKA 1M2AA 4DEJA 1XZOA 4JR4A 1XWCA 2YJHA 3ZFBA 3DGQA 3GSTA 1XXUA 5DQYA 2XPEA 4KUNA 5HFGA 13GSA 2VCVA 2C0GA 1M2DA 2TIRA 3QFAC 4AJ6A 3M9KA 3EPTA 2H72A 2GSRA 1OVNA 2IWTA 1HYUA 5A1NB 2MMOA 4G01A 1OAZA 4AKXB 2HFDA 1TRSA 1WJKA 3IC4A 3MDKA 3KTLA 1GSDA 5DCHA 5D9TA 1NW2A 5IMDA 4KCEA 2R4VA 4L8EA 2WB9A 4IGJA 3R3EA 4CY8A 1PX7A 5H5QA 3KIJA 2L57A 4PXOA 4ZB8A 4TXOB 2Z9SA 4JBBA 14GSA 5J4VA 4K7NA 2J9HA 3UAPA 4BL7B 2F51A 1TK8B 5H5SA 4WF4A 2LRCA 2FA4A 4MPFA 3IC8A 1TI3A 22GSA 4XTSA 4EVMA 1X5CA 3H79A 4MF5A 3NOFA 3TRPA 3C8EA 2FUG2 3TGZA 4HEA2 3KGKA 1V58A 2I3YA 3TDGA 1F6MC 3RDWA 2DMMA 3QCPA 4K1FA 1SVOA 4K9ZA 5EY6A 3A3TA 1TDIA 6GSVA 11GSA 1DSBA 2NTOA 2VL2C 2N5FA 3K8NA 1JZDA 2PVQA 2BMXA 2WJUA 18GSA 4Q5FA 2EFCA 1TP9A 2FNOA 4K0GA 1R4WA 3ZVJA 1X9MB 3E9JB 2M80A 3GTUB 3TKSC 3WGDA 3US3A 6GSTA 3H4KA 2H1LA 2YWMA 4K5SA 3QDNA 4K2XA 4TOPA 4F82A 2DLXA 1UC7A 2I1UA 4PURA 4QMKA 2C4JA 4XRDA 3M8NA 4EKZA 3A2VA 1YKCA 4O5UA 1TK5B 3VI5A 4XIHA 2B6MA 4FYBA 4I6XA 3A2XA 1SD9A 5ECLB 4ZB6A 1G6WA 2OT3A 2LUSA 1UVZA 2PU9C 1X9WB 3HVSA 2QC7A 4FYCA 4XRAA 1FHEA 1ZGNA 5ECIB 3CRUA 1QXHA 1GLQA 3VWXA 2QKEA 1H4OA 3CRTA 2VOCA 1LBKA 4KDYA 4EC0A 2DJ3A 1YF0A 1AXDA 3UARA 2F8AA 1OKTA 3KTBA 1KEBA 1XOAA 3LXZA 2R0GA 3FZ5A 1YQ1A 2A2SA 2OADA 2CAQA 2DJ2A 3GKXA 1BG5A 1EGRA 4TXOA 4AJ8A 2IJYA 3UVHA 3F8UA 4F0BA 3AY8A 1RW1A 1U3AA 17GSA 4GSTA 4BL7A 2FHEA 4MH3A 3W6GA 1G7OA 2QA1A 4WEYA 3DYRA 5IIZA 19GSA 3VFIA 2CZ2A 1A2LA 4MLYA 2R5GA 4Z7XA 1UA5A 2RUEA 3LORA 3TOTA 1GWCA 5G1KA 1F2EA 4AJ7A 5H5RA 2R0PA 2HSNB 1Z5YE 1YJ6A 4TVEA 3IK7A 2B5XA 2HZFA 5LCZA 2WDUA 4YAVA 4PUAA 4MK3A 3Q6OA 4QQ7A 5D96A 4LL4B 2GZPA 5CRGA 1GTBA 4KB3A 3WGEA 5KEJA 1A2JA 1JZWA 5J4UA 4MPGA 5INYA 5DALB 4POKA 1O73A 4ZBAA 3LJRA 4GSSA 2H1DA 4NV2A 2H76A 4JE1A 3J7Yb 1XBSA 2V6KA 2IMDA 1GP1A 4K6XA 3GTUA 3FEUA 5HR1A 1AQVA 2I4AA 4IJ3A 3L9UA 3QOUA 4OCEA 5IO2A 3VURA 1SJZA 5IQYA 3QAWA 4TR0A 2OBKA 4OMVA 4BVXB 4GTUA 2M46A 1ZL9A 5A4UA 1Z7PA 2H30A 1M7TA 4YQUA 5HFKA 5D9WA 3QAGA 3PH9A 2HT9A 2JSYA 4Z2TA 3IBHA 7GSSA 1GSYA 2DJJA 4PQHA 4OFTA 4N0ZA 3KCMA 3WT1A 3IV4A 3M3MA 4ECIA 3EVIA 1TI1A 4FH8A 2LJRA 3IHGA 4EL1A 3KXOA 2LEGA 1Z9HA 1XWKA 1O81A 2JZSA 4MJAA 3TJGA 5ID2B 1K0BA 1ABAA 4OD7A 5B8AA 2AJQB 3APOA 3V1WA 1H75A 3G9BA 3DKSA 3BOAA 1BG1A 4I97A 1UN2A 5LNKe 2H6ZA 1B4PA 1QUWA 4EDZA 3P90A 4GRFA 3DD3A 4O32A 4XS4B 1ZYQB 2H71A 5D8IA 1X5EA 4LLRA 5CO3A 4MZCA 4MZWA 3LWAA 4HJ2A 1TU8A 3I9V2 3F3QA 2HSHA 2KOKA 4NXIA 1EEMA 4HS1A 2HSNA 2K8VA 4QL9A 3HZ4A 1FW1A 3IAM2 1BX9A 1LJRA 4ID0A 4EE0A 4ZL8A 5ECHB 1OYJA 1FVKA 2X64A 4ZBBA 1TRUA 3DVWA 5DALA 3GX8A 1SKSB 2VUPA 3UL3A 1Y1UA 4IQAA 4J56E 4HZ4A 1K0CA 2PERA 3VPQA 4ML6A 5CP1A 5EPFA 2L4QA 5AISA 3Q18A 2HQTA 4KDUA 4RI7A 2KHPA 1SKWB 1F37A 3M1GA 4PNGA 5KOXA 1OC3A 1B9XC 3TUEA 1JLVA 3O76A 4TRXA 3BD2A 2KUCA 2GSSA 2A2PA 5CRHA 4IQ1A 3VPTA 1R7HA 2LRNA 3O6TA 5EL8A 3ME8A 4BVXA 3H93A 1E6BA 2O7KA 4KF9A 4HZ2A 2P5QA 3GKNA 1OKDA 2NVLA 1KBNA 3CXGA 3APSA 4NWYA 4BWSA 5JCWA 1PL2A 2HRFA 3LGCA 4O92A 3SBCA 1V9WA 4GQCA 3KZQA 2PN8A 3Q74A 3GL5A 5IPHA 2N5BA 2MBSA 1WMJA 3D5JA 4EIPA 2E7PA 3MWHA 3A5WA 4JR6A 2C3QA 1VRSD 5KN2A 2C0FA 3FYGA 4ZL9A 1SD8A 3LYKA 2PUKC 2YJ7A 2EFEA 4EF0A 2ON5A 3G7IA 1TXXA 10GSA 1YDKA 3VWUA 3QPMA 2WS2A 3BCIA 3ZVJD 4I5QA 4Z2UA 2PMTA 2HLSA 1U88A 4AKHA 3IA1A 5G5FA 2H19A 2VCQA 2YWNA 3CTGA 4XS4A 3QD9A 1N2AA 2PBJA 2C1YA 3EWLA 5IMZA 1M9AA 1WOUA 2H6YA 4KCAA 5DAKB 3FZ4A 2LJAA 4WBRD 1PRXA 5GAPD 3CMIA 2O85A 5COHA 1TKDB 2PWJA 1ZZYA 4NAXA 4GDFA 4Z2RA 1O85A 4IP6A 1MD3A 1F3AA 2X4AA 2IMIA 2O5VA 1YEPA 2YOIA 1I9DA 1BEDA 3W8JA 4ZILA 2AV4A 2PGTA 4ML1A 3WD6A 5B6MA 5FHIA 2C8UA 3C73A 4JRRA 1OC8A 3L4NA 5DVBA 2O89A 3E3EA 3JCML 2D2ZA 3HVVA 5CRWA 5B8BA 2FA8A 1JHBA 1G0TA 2DIYA 2EIQA 1WP0A 6GSXA 1JLWA 3WT2A 1THXA 1EEJA 4TR3A 1EOGA 3Q19A 5BMUB 4GCIA 2GQLA 4HQZA 5J41A 2O8VB 4RI6A 1AQXA 3W8SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N11 A;  3M0F A;  1Z7R A;  1R26 A;  3ZYW A;  2NDO A;  2VIM A;  2MYG A;  1PKZ A;  2IMF A;  3HD5 A;  2CX4 A;  1MDI A;  5C04 A;  4WKW A;  3QFB C;  5ECP B;  2FWE A;  2QGV A;  3GYK A;  1W4V A;  1SL2 B;  2GGT A;  3WYW A;  2HI7 A;  2VLU A;  1O7U A;  2K8S A;  2H1G A;  2GT6 A;  1B9Y C;  4G9H A;  20GS A;  2C0E A;  3EE2 A;  2XBQ A;  4EO3 A;  4N0V A;  3ZRD A;  2DC5 A;  3TRQ A;  5F0G A;  2JAC A;  1K0D A;  4K8M A;  3D21 A;  2C0D A;  4BWQ A;  1SYR A;  2FWH A;  2H1A A;  4J57 E;  2IIY A;  2L59 A;  1E2Y A;  5HQP A;  3GHA A;  2TRX A;  3F6D A;  5F06 A;  3I43 A;  2KP1 A;  3D0Z A;  2JZR A;  1XWB A;  5DAK A;  1MD4 A;  3IK9 A;  2OJL A;  1TRV A;  5B7C A;  4YQV A;  2I9H A;  3L78 A;  1AW9 A;  1ERV A;  3MNG A;  4G2E A;  4HU7 A;  1I5G A;  3HVX A;  5G2Z A;  3GIX A;  1XCC A;  1TOF A;  1GTA A;  4K2D A;  1GTI A;  1SKR B;  2A2R A;  2GLR A;  1KNG A;  2DBC A;  2AUV A;  1NM3 A;  2ALB A;  3ISO A;  5IMA A;  4X1U A;  4KDX A;  5A4W A;  2LNS A;  4F9Z A;  2YZH A;  6GSY A;  5G1L A;  4GF0 A;  2B3S A;  4J2F A;  2HRK B;  1GNW A;  2E2G A;  1ERU A;  4F0C A;  1T4Z A;  3D4T A;  4GLT A;  2ZCT A;  5GST A;  3HJP A;  4KX4 A;  4RQR A;  4JED A;  3CSH A;  4KAE A;  1HNC A;  4PQ1 A;  4PQI A;  1MDJ A;  1T8E B;  3F4S A;  4OWY A;  4WF5 A;  3HDC A;  4OCF A;  4E8E A;  2YAN A;  3GSS A;  3TCO A;  4V1A g;  1R5A A;  2PPT A;  3HCZ A;  5BMU A;  1GUL A;  3ZIV A;  1DE2 A;  2F9S A;  2VLT A;  2HRA A;  3FZA A;  3KM6 A;  4I2U A;  2OE1 A;  5GAN D;  2R3X A;  5L71 A;  1AIU A;  2J23 A;  3C1S A;  2NBS A;  2VCX A;  4HU9 A;  2MBT A;  2CAI A;  5ECN B;  3ZMK A;  3L0H A;  3DIE A;  1T7P B;  2LNT A;  3IRA A;  4FO5 A;  3UJ1 A;  2REM A;  1XVQ A;  4KSM A;  2CQ9 A;  3O3T A;  1QQ2 A;  2OE0 A;  1ST9 A;  2CV4 A;  1XFL A;  3HHV A;  3GH9 A;  4X0X A;  4IP1 A;  1GSS A;  2YZU A;  5J3R A;  1A24 A;  2GZY A;  2HYX A;  3BCK A;  3IE3 A;  5ELA A;  2FCH A;  3TKR A;  1K0N A;  3LFL A;  4OFM A;  3ZIJ A;  2F3M A;  1BYE A;  2R37 A;  2EIR A;  1U87 A;  2GSQ A;  3FY7 A;  3S9F A;  6GSS A;  1K3O A;  1WE0 A;  3PR8 A;  4WR4 A;  4ZBD A;  1G7E A;  3E0U A;  5FT3 A;  4IBP A;  4PGT A;  1AQW A;  4GQF A;  1EOH A;  1HD2 A;  4WR5 A;  5ECO B;  3MSZ A;  2FWF A;  2G0F A;  2I81 A;  2NPB A;  3U5R E;  5ELG A;  1GRX A;  2HNL A;  1LU4 A;  2H01 A;  1M9B A;  5HR2 A;  3CSJ A;  5A4V A;  3WGX A;  2XPD A;  1SK0 A;  1GLP A;  5D73 A;  1GSE A;  2GQM A;  5J5N A;  2HRK A;  1TU7 A;  2B5Y A;  2MMN A;  5ABR A;  1QMV A;  4KND A;  2K6V A;  3ZLP A;  2H75 A;  3PPU A;  2H1B A;  4OO5 A;  3EUR A;  2GS3 A;  2HSM B;  1K3L A;  2CX3 A;  3IOS A;  1FVJ A;  2IFQ B;  1N8J A;  2H0G A;  4D73 B;  3TRX A;  1GSF A;  1PQN A;  1GSQ A;  3TKS E;  3HXS A;  1XIY A;  2YPM A;  9GSS A;  4KSO A;  1HNA A;  4F03 A;  2VCZ A;  5IMV A;  1SK1 A;  5E4W A;  2RM6 A;  1S3A A;  1CQG A;  2RM5 A;  3GRX A;  1IYH A;  2F8F A;  3ZML A;  3ZIT A;  4TR4 A;  1F9M A;  1SEN A;  4XS1 A;  1TW9 A;  5J9C A;  2FD3 A;  3ZFL A;  2HZE B;  4LMW A;  2LRT A;  3FR6 A;  2VLV A;  4MCU A;  1T00 A;  2AYT A;  1M0U A;  2OBI A;  2OKA A;  3TB2 A;  4E8H A;  2B7K A;  2L6D A;  1XW9 A;  2CZ3 A;  1Q98 A;  3CYN A;  1NSW A;  1T4Y A;  1EGO A;  1SJ6 A;  2V32 A;  4PTS A;  2B1L A;  3IR4 A;  5ECM B;  2IL3 A;  4IKH A;  3UEM A;  1AC1 A;  2EC4 A;  1K0A A;  4YH2 A;  2MZC A;  4BVY B;  1MDK A;  1USB A;  4LA1 A;  1VF1 A;  5J9B A;  3GUR A;  3FR3 A;  4MF6 A;  4FQU A;  4MZB A;  5F07 A;  3ERF A;  2L6C A;  8GSS A;  1WWJ A;  1X5D A;  3TJK A;  2VL2 A;  2WCI A;  3UBK A;  2YWI A;  4ILF A;  3UMA A;  5HR0 A;  2RLI A;  1O6J A;  2O87 A;  1DBY A;  3OR5 A;  5JCG A;  4NHZ A;  3APQ A;  1NHO A;  4PUF C;  3HJO A;  2CA8 A;  4K0N A;  3G7J A;  1SJI A;  5GSS A;  1J0F A;  4G10 A;  1PGT A;  2RII A;  2H0I A;  3EYT A;  3H8Q A;  3TKS A;  2HXK A;  1RK4 A;  1MEK A;  1ON4 A;  1ML6 A;  5ID2 A;  1EV4 A;  1VF3 A;  2LV3 A;  2VO4 A;  1M99 A;  1A8Y A;  1A2M A;  4GSN A;  2JZT A;  4POB A;  4LL1 B;  2HSM A;  3LXT A;  4IS0 A;  1EP8 A;  2CVB A;  4D73 A;  4MA9 A;  3EMX A;  2L4C A;  2C3N A;  3PIN A;  1HNB A;  2KP2 A;  4MH2 A;  1GNE A;  4G0I A;  2L5O A;  5ECS A;  4MDC A;  3EU4 A;  1CQH A;  1ZMA A;  1QK8 A;  3FHK A;  5EVO A;  2V41 A;  2HSY A;  4ZL7 A;  1Y6E A;  1WIK A;  1X9S B;  4XHM A;  4ZXG A;  4JU5 A;  3FR9 A;  4L0W A;  5HFI A;  3HY2 A;  5LD0 A;  2FY6 A;  1C72 A;  3GKK A;  3C7M A;  4G0K A;  3P2A A;  5HR3 A;  5G30 A;  2YV7 A;  5JCU A;  3HKR A;  2M72 A;  5IM9 A;  4IJI A;  5JWO B;  3FRC A;  2X8C A;  3CSI A;  5G5E A;  3QAV A;  2GZZ A;  3EU3 A;  1IYI A;  2B7J A;  3P7X A;  4L0U A;  1OE8 A;  1NHY A;  5IPG A;  4HJM A;  1BQ7 A;  2ZUP A;  1O8X A;  3F63 A;  1BAY A;  2X8G A;  2R6K A;  2IME A;  1YY7 A;  4DSR A;  4MMM A;  4L5L A;  2E0Q A;  5CRD A;  3GFK A;  5AIV A;  2CVD A;  3VK9 A;  5ECQ B;  2UZ8 A;  3N5O A;  4BVY A;  1OE7 A;  4OO4 A;  2CT6 A;  1GSU A;  3SWL A;  3ZZX A;  4FIW A;  3RAZ A;  2ES7 A;  2GST A;  2LJK A;  5G31 A;  2VD1 A;  4LMV A;  4PX1 A;  2XHF A;  2GT5 A;  1URM A;  2EIO A;  4DVC A;  4H86 A;  3LSZ A;  2DJK A;  4G19 A;  5CRE A;  2DIZ A;  1GUH A;  1V40 A;  3RHB A;  5AIX A;  3DML A;  5ECR B;  2ON7 A;  1XVW A;  1FB0 A;  4ZIJ A;  1YF1 A;  3F0I A;  4DSS B;  1OC9 B;  1F3B A;  2JU5 A;  1S3C A;  4ECB A;  2LQO A;  1GL8 A;  1X0R A;  3MAK A;  1FOV A;  4GWR A;  4HI7 A;  4USS A;  1SL1 B;  5DQS A;  3C1R A;  3VWW A;  1G6Y A;  4WET A;  3UIW A;  1TJD A;  1Z6N A;  3I6A A;  2V2G A;  3LG6 A;  4ECC A;  4NV5 A;  3BJ5 A;  1PSQ A;  2VM2 A;  4WBJ A;  1AUC A;  1V57 A;  1GUM A;  2HRN A;  1HQO A;  2YCD A;  3TJF A;  4QL7 A;  3N9J A;  6GSW A;  4XS6 A;  3DEX A;  3GNJ A;  2V1M A;  2X8H A;  4ULX A;  4MAB A;  3KD0 A;  3F4R A;  3D4M A;  4XCS A;  4G0L A;  1A0F A;  12GS A;  3ZRE A;  2B1K A;  1Q4J A;  4ISD A;  1SL0 B;  1XPV A;  3F9U A;  3F6F A;  2BTO T;  4HDE A;  2X99 A;  2DSA A;  2YP6 A;  3GL3 A;  4MP4 A;  16GS A;  4CW9 A;  3GUS A;  2IPA A;  4P3Y B;  3VI7 A;  2H6X A;  1PX6 A;  5DJM A;  4K7I A;  2YN1 A;  1B4Q A;  3FW2 A;  1PKW A;  2VM1 A;  2C80 A;  3EIN A;  4OFN A;  1XW5 A;  5CAX A;  2VD0 A;  1VGL A;  3DRN A;  1ZOF A;  5ECK B;  1JFU A;  1Y25 A;  5KN3 A;  4IN0 A;  2GDR A;  5CNW A;  3M9J A;  5AN1 A;  3DWV A;  2VAF A;  5A5K A;  1XWA A;  1J08 A;  1PD2 1;  3LQ7 A;  3ED3 A;  2AHE A;  3QR6 A;  4KGI A;  5E59 A;  2QSI A;  3IAS 2;  4MF7 A;  5IMC A;  3P8W A;  1XOB A;  2TRC P;  2H8L A;  5DCG A;  4MJE A;  2LST A;  2GTU A;  3ZL5 A;  4IEL A;  4KE3 A;  4Q5R A;  4POL A;  4TR1 B;  4DSS A;  1TRW A;  2GVP A;  1OC9 A;  1YZX A;  3HJM A;  3KMN A;  4F2I A;  1B8X A;  1GUK A;  4POM A;  3ME7 A;  3IPZ A;  2VCW A;  4I2T A;  3ZTL A;  4YQM A;  5CYY A;  1FAA A;  3F4T A;  2FLS A;  4KW6 A;  2VCT A;  2CVK A;  4N10 A;  3GH6 A;  3LEF A;  5KN1 A;  2AAW A;  3D6I A;  2WZ9 A;  2JL4 A;  4IHU A;  1YEX A;  5D9V A;  1JZR A;  2YWO A;  1PN9 A;  5JWQ B;  3GKM A;  1EP7 A;  2WFC A;  3IXR A;  4IW9 A;  1SU9 A;  3FZ9 A;  4AF2 A;  1SK2 A;  4NPB A;  3L9V A;  3KP9 A;  1PA3 A;  3RBT A;  1JZO A;  2DJ1 A;  3RHC A;  3HZ8 A;  5C00 A;  4TXV A;  4NHW A;  4ECJ A;  1KTE A;  3KH9 A;  3F3R A;  3TJJ A;  1FO5 A;  1U6T A;  1FG4 A;  3HA9 A;  5JWR B;  1TTZ A;  4Q5N A;  2N5A A;  4DSQ A;  4NMU A;  2LQQ A;  1ZYE A;  3EC3 A;  3R2Q A;  3TKQ A;  4K7O A;  3LYP A;  1B48 A;  3HYP A;  4Q5Q A;  2FGX A;  1ILO A;  2H74 A;  4IVF A;  1A8L A;  4O7H A;  2XBI A;  3RPN A;  5GZZ B;  1EWX A;  3CBU A;  3CTF A;  4O5R A;  1QGV A;  1GTU A;  3KH7 A;  2LTK A;  3RPP A;  3L9S A;  4GXZ A;  3UBL A;  4ZB9 A;  1WRY A;  1A0R P;  2MMZ A;  3KEB A;  2VL9 A;  4V2N A;  4I8B A;  1RQM A;  1K3Y A;  4RQX A;  2ZNM A;  4RUV A;  3UOM A;  4TR1 A;  1VF2 A;  1ERW A;  4AGS A;  4EUY A;  2P0G A;  3FK8 A;  5DJL A;  4CHS A;  1SYX A;  5IO0 A;  1VF4 A;  2P5R A;  5FWG A;  4V2M A;  2LS5 A;  5IMF A;  3GN3 A;  1TK0 B;  3IDV A;  4HQS A;  1ZCP A;  2AB6 A;  2L5L A;  3J7Y k;  3EMP A;  5F8B A;  3C71 A;  5IOX A;  1K0O A;  1XW6 A;  3TOU A;  1WPI A;  3UVT A;  2V6O A;  2WGR A;  3GX0 A;  3KJY A;  2OAC A;  2OA7 A;  3D22 A;  4PNF A;  3QMX A;  4BA7 A;  4BPY A;  4X43 A;  3H1N A;  3GA4 A;  1BJX A;  2FWG A;  4TW5 A;  4V2L A;  3KMO A;  1EV9 A;  3TJB A;  4KH7 A;  2H70 A;  1DE1 A;  4HUA A;  5IOW A;  4EXJ A;  4L5O A;  3U6V A;  1T1V A;  2MMA A;  2K18 A;  2YNX A;  2H66 A;  2H73 A;  1MTC A;  1J9B A;  4CDO A;  3VLN A;  1ERT A;  1EZK A;  3TKP A;  4KA0 A;  2B5E A;  4JZQ A;  4TKY A;  2LKU A;  1K0M A;  1DUG A;  2P31 A;  1V98 A;  3BBY A;  2DJ0 A;  2HE3 A;  3KP8 A;  1A23 A;  4HOJ A;  5ENU A;  5D93 A;  5AGY A;  1T3B A;  2JAD A;  2PVO C;  4MJC A;  3DVX A;  2JSZ A;  3A2W A;  5B6N A;  4TN8 A;  2WUL A;  4ACS A;  1Z6M A;  3DXB A;  6GSU A;  2WRT A;  2E2M A;  1O8W A;  1QFN A;  3GV1 A;  3PGT A;  2IFQ A;  5F05 A;  1S3D A;  4FYU A;  4N30 A;  1FB6 A;  2OE3 A;  4V1A p;  1AAZ A;  2K9F A;  2KLX A;  2IMK A;  2RUF A;  3GMF A;  3VWV A;  3IHQ A;  4MJB A;  5D9X A;  2YV9 A;  1Z3E A;  1M2B A;  1PL1 A;  4WXT A;  2R2J A;  2A4V A;  2H0H A;  2VL3 A;  3FKF A;  3ERW A;  2BJX A;  2IN3 A;  1R5P A;  3ERG A;  1U3I A;  2DML A;  5DDL A;  4EDY A;  3NIV A;  1GH2 A;  5DBQ A;  1PMT A;  3NZN A;  2C3T A;  2G2Q A;  5KN0 A;  1W89 A;  3I69 A;  2HZE A;  1YKA A;  3G7Y A;  1THO A;  4YAP A;  1V2A A;  1ACV A;  2XC2 A;  1XWG A;  2GQK A;  1M2A A;  4DEJ A;  1XZO A;  4JR4 A;  1XWC A;  2YJH A;  3ZFB A;  3DGQ A;  3GST A;  1XXU A;  5DQY A;  2XPE A;  4KUN A;  5HFG A;  13GS A;  2VCV A;  2C0G A;  1M2D A;  2TIR A;  3QFA C;  4AJ6 A;  3M9K A;  2H72 A;  2GSR A;  1OVN A;  2IWT A;  1HYU A;  2MMO A;  1OAZ A;  2HFD A;  1TRS A;  1WJK A;  3IC4 A;  3MDK A;  3KTL A;  1GSD A;  5DCH A;  5D9T A;  1NW2 A;  5IMD A;  4KCE A;  2R4V A;  4L8E A;  2WB9 A;  4IGJ A;  3R3E A;  1PX7 A;  5H5Q A;  3KIJ A;  2L57 A;  4PXO A;  4ZB8 A;  4TXO B;  2Z9S A;  4JBB A;  14GS A;  4K7N A;  2J9H A;  3UAP A;  4BL7 B;  2F51 A;  1TK8 B;  5H5S A;  4WF4 A;  2LRC A;  2FA4 A;  4MPF A;  3IC8 A;  1TI3 A;  22GS A;  4XTS A;  4EVM A;  1X5C A;  3H79 A;  4MF5 A;  3NOF A;  3TRP A;  3C8E A;  2FUG 2;  3TGZ A;  4HEA 2;  3KGK A;  1V58 A;  2I3Y A;  3TDG A;  1F6M C;  3RDW A;  2DMM A;  3QCP A;  4K1F A;  4K9Z A;  5EY6 A;  3A3T A;  1TDI A;  6GSV A;  11GS A;  1DSB A;  2NTO A;  2VL2 C;  2N5F A;  3K8N A;  1JZD A;  2PVQ A;  2BMX A;  2WJU A;  18GS A;  4Q5F A;  1TP9 A;  2FNO A;  4K0G A;  1R4W A;  3ZVJ A;  1X9M B;  3E9J B;  2M80 A;  3GTU B;  3TKS C;  3WGD A;  3US3 A;  6GST A;  3H4K A;  2YWM A;  3QDN A;  4TOP A;  4F82 A;  2DLX A;  1UC7 A;  2I1U A;  4PUR A;  2C4J A;  4XRD A;  3M8N A;  4EKZ A;  3A2V A;  1YKC A;  1TK5 B;  3VI5 A;  4XIH A;  2B6M A;  4FYB A;  4I6X A;  3A2X A;  1SD9 A;  5ECL B;  4ZB6 A;  1G6W A;  2LUS A;  1UVZ A;  2PU9 C;  1X9W B;  3HVS A;  2QC7 A;  4FYC A;  4XRA A;  1FHE A;  1ZGN A;  5ECI B;  3CRU A;  1QXH A;  1GLQ A;  3VWX A;  2QKE A;  1H4O A;  3CRT A;  2VOC A;  1LBK A;  4KDY A;  4EC0 A;  2DJ3 A;  1YF0 A;  1AXD A;  3UAR A;  2F8A A;  1OKT A;  3KTB A;  1KEB A;  1XOA A;  3LXZ A;  3FZ5 A;  1YQ1 A;  2A2S A;  2OAD A;  2CAQ A;  2DJ2 A;  3GKX A;  1BG5 A;  1EGR A;  4TXO A;  4AJ8 A;  2IJY A;  3UVH A;  3F8U A;  4F0B A;  3AY8 A;  1RW1 A;  1U3A A;  17GS A;  4GST A;  4BL7 A;  2FHE A;  4MH3 A;  3W6G A;  1G7O A;  4WEY A;  3DYR A;  5IIZ A;  19GS A;  3VFI A;  2CZ2 A;  1A2L A;  4MLY A;  2R5G A;  4Z7X A;  1UA5 A;  2RUE A;  3LOR A;  3TOT A;  1GWC A;  5G1K A;  1F2E A;  4AJ7 A;  5H5R A;  2HSN B;  1Z5Y E;  1YJ6 A;  4TVE A;  3IK7 A;  2B5X A;  2HZF A;  5LCZ A;  2WDU A;  4YAV A;  4PUA A;  4MK3 A;  3Q6O A;  4QQ7 A;  5D96 A;  4LL4 B;  2GZP A;  5CRG A;  1GTB A;  4KB3 A;  3WGE A;  5KEJ A;  1A2J A;  1JZW A;  5J4U A;  4MPG A;  5INY A;  5DAL B;  4POK A;  1O73 A;  4ZBA A;  3LJR A;  4GSS A;  2H1D A;  4NV2 A;  2H76 A;  4JE1 A;  3J7Y b;  1XBS A;  2V6K A;  2IMD A;  1GP1 A;  4K6X A;  3GTU A;  3FEU A;  5HR1 A;  1AQV A;  2I4A A;  4IJ3 A;  3L9U A;  3QOU A;  4OCE A;  5IO2 A;  3VUR A;  1SJZ A;  5IQY A;  3QAW A;  4TR0 A;  2OBK A;  4OMV A;  4BVX B;  4GTU A;  2M46 A;  1ZL9 A;  5A4U A;  1Z7P A;  2H30 A;  1M7T A;  4YQU A;  5HFK A;  5D9W A;  3QAG A;  3PH9 A;  2HT9 A;  2JSY A;  3IBH A;  7GSS A;  1GSY A;  2DJJ A;  4PQH A;  4OFT A;  4N0Z A;  3KCM A;  3WT1 A;  3IV4 A;  3M3M A;  4ECI A;  3EVI A;  1TI1 A;  4FH8 A;  2LJR A;  4EL1 A;  3KXO A;  2LEG A;  1Z9H A;  1XWK A;  1O81 A;  2JZS A;  4MJA A;  3TJG A;  5ID2 B;  1K0B A;  1ABA A;  4OD7 A;  5B8A A;  2AJQ B;  3APO A;  3V1W A;  1H75 A;  3G9B A;  3DKS A;  3BOA A;  4I97 A;  1UN2 A;  5LNK e;  2H6Z A;  1B4P A;  1QUW A;  4EDZ A;  3P90 A;  4GRF A;  3DD3 A;  4O32 A;  4XS4 B;  1ZYQ B;  2H71 A;  5D8I A;  1X5E A;  4LLR A;  5CO3 A;  4MZC A;  4MZW A;  3LWA A;  4HJ2 A;  1TU8 A;  3I9V 2;  3F3Q A;  2HSH A;  2KOK A;  4NXI A;  1EEM A;  4HS1 A;  2K8V A;  4QL9 A;  3HZ4 A;  1FW1 A;  3IAM 2;  1BX9 A;  1LJR A;  4ID0 A;  4EE0 A;  4ZL8 A;  5ECH B;  1OYJ A;  1FVK A;  2X64 A;  4ZBB A;  1TRU A;  3DVW A;  5DAL A;  3GX8 A;  1SKS B;  2VUP A;  3UL3 A;  4IQA A;  4J56 E;  4HZ4 A;  1K0C A;  2PER A;  3VPQ A;  4ML6 A;  5CP1 A;  5EPF A;  2L4Q A;  5AIS A;  3Q18 A;  2HQT A;  4KDU A;  4RI7 A;  2KHP A;  1SKW B;  1F37 A;  3M1G A;  4PNG A;  1OC3 A;  1B9X C;  3TUE A;  1JLV A;  3O76 A;  4TRX A;  3BD2 A;  2KUC A;  2GSS A;  5CRH A;  4IQ1 A;  3VPT A;  1R7H A;  2LRN A;  3O6T A;  5EL8 A;  3ME8 A;  4BVX A;  3H93 A;  1E6B A;  2O7K A;  4KF9 A;  4HZ2 A;  2P5Q A;  3GKN A;  1OKD A;  2NVL A;  1KBN A;  3CXG A;  3APS A;  4NWY A;  4BWS A;  5JCW A;  1PL2 A;  2HRF A;  3LGC A;  4O92 A;  3SBC A;  1V9W A;  4GQC A;  3KZQ A;  2PN8 A;  3Q74 A;  3GL5 A;  5IPH A;  2N5B A;  2MBS A;  1WMJ A;  3D5J A;  2E7P A;  3MWH A;  3A5W A;  4JR6 A;  2C3Q A;  1VRS D;  5KN2 A;  2C0F A;  3FYG A;  4ZL9 A;  1SD8 A;  3LYK A;  2PUK C;  2YJ7 A;  4EF0 A;  2ON5 A;  3G7I A;  1TXX A;  10GS A;  1YDK A;  3VWU A;  3QPM A;  2WS2 A;  3BCI A;  3ZVJ D;  4I5Q A;  2PMT A;  2HLS A;  1U88 A;  3IA1 A;  5G5F A;  2H19 A;  2VCQ A;  2YWN A;  3CTG A;  4XS4 A;  3QD9 A;  1N2A A;  2PBJ A;  2C1Y A;  3EWL A;  5IMZ A;  1M9A A;  1WOU A;  2H6Y A;  4KCA A;  5DAK B;  3FZ4 A;  2LJA A;  4WBR D;  1PRX A;  5GAP D;  3CMI A;  2O85 A;  5COH A;  1TKD B;  2PWJ A;  1ZZY A;  4NAX A;  1O85 A;  4IP6 A;  1MD3 A;  1F3A A;  2IMI A;  1YEP A;  2YOI A;  1I9D A;  1BED A;  3W8J A;  4ZIL A;  2AV4 A;  2PGT A;  4ML1 A;  3WD6 A;  5B6M A;  5FHI A;  2C8U A;  3C73 A;  4JRR A;  1OC8 A;  3L4N A;  5DVB A;  2O89 A;  3E3E A;  3JCM L;  2D2Z A;  3HVV A;  5CRW A;  5B8B A;  2FA8 A;  1JHB A;  1G0T A;  2DIY A;  2EIQ A;  1WP0 A;  6GSX A;  1JLW A;  3WT2 A;  1THX A;  1EEJ A;  4TR3 A;  1EOG A;  3Q19 A;  4GCI A;  2GQL A;  4HQZ A;  5J41 A;  2O8V B;  4RI6 A;  1AQX A;  3W8S A; 
#chains in the Genus database with same CATH topology
 4N11 A;  3M0F A;  1S3R A;  1Z7R A;  1R26 A;  3ZYW A;  2NDO A;  2VIM A;  2MYG A;  1PKZ A;  2IMF A;  3HD5 A;  2CX4 A;  1MDI A;  5C04 A;  4WKW A;  3QFB C;  5ECP B;  4N3Z A;  1BF5 A;  2FWE A;  2QGV A;  3GYK A;  1W4V A;  1SL2 B;  2GGT A;  3WYW A;  2HI7 A;  2VLU A;  1O7U A;  2K8S A;  2H1G A;  2GT6 A;  1B9Y C;  4G9H A;  20GS A;  2C0E A;  3EE2 A;  2XBQ A;  2WVX A;  4EO3 A;  4N0V A;  3ZRD A;  2DC5 A;  3TRQ A;  5F0G A;  2JAC A;  1K0D A;  4K8M A;  3D21 A;  2C0D A;  2UV8 G;  4BWQ A;  1SYR A;  2FWH A;  2H1A A;  4J57 E;  2IIY A;  2L59 A;  1E2Y A;  5HQP A;  3GHA A;  2TRX A;  3F6D A;  5F06 A;  3I43 A;  2KP1 A;  3D0Z A;  2JZR A;  1XWB A;  5DAK A;  1MD4 A;  1M3J A;  3IK9 A;  2OJL A;  1TRV A;  5B7C A;  4YQV A;  2I9H A;  3L78 A;  1AW9 A;  1ERV A;  3MNG A;  4G2E A;  4HU7 A;  1I5G A;  3HVX A;  5G2Z A;  3GIX A;  1XCC A;  1TOF A;  1GTA A;  4K2D A;  1GTI A;  1SKR B;  2A2R A;  2GLR A;  1KNG A;  2DBC A;  2AUV A;  1NM3 A;  2ALB A;  3ISO A;  5IMA A;  4X1U A;  4KDX A;  5A4W A;  2LNS A;  2WVZ A;  4F9Z A;  2YZH A;  6GSY A;  5G1L A;  5A1N A;  4GF0 A;  2B3S A;  4J2F A;  2HRK B;  1GNW A;  2E2G A;  1ERU A;  2VKZ G;  4F0C A;  1T4Z A;  3D4T A;  4GLT A;  2ZCT A;  5GST A;  3HJP A;  4KX4 A;  4RQR A;  4JED A;  1FOH A;  3CSH A;  4KAE A;  1HNC A;  4PQ1 A;  4PQI A;  1MDJ A;  1T8E B;  3F4S A;  4OWY A;  4WF5 A;  3HDC A;  4OCF A;  4E8E A;  2YAN A;  3GSS A;  3TCO A;  4V1A g;  1R5A A;  2PPT A;  3HCZ A;  5BMU A;  1GUL A;  3ZIV A;  1DE2 A;  2F9S A;  2VLT A;  1M3I A;  2HRA A;  3FZA A;  3KM6 A;  4I2U A;  2OE1 A;  5GAN D;  2R3X A;  5L71 A;  1AIU A;  2J23 A;  3C1S A;  2NBS A;  2VCX A;  4HU9 A;  5J47 A;  2MBT A;  2CAI A;  5ECN B;  3ZMK A;  3L0H A;  3DIE A;  1T7P B;  2LNT A;  3IRA A;  4FO5 A;  3UJ1 A;  2REM A;  1XVQ A;  4KSM A;  2CQ9 A;  3O3T A;  1QQ2 A;  2OE0 A;  1ST9 A;  2CV4 A;  1XFL A;  3HHV A;  3GH9 A;  4X0X A;  4IP1 A;  1GSS A;  2YZU A;  5J3R A;  1A24 A;  2GZY A;  2HYX A;  3BCK A;  3IE3 A;  5ELA A;  2FCH A;  3TKR A;  1K0N A;  3LFL A;  4OFM A;  3ZIJ A;  2F3M A;  2X49 A;  1BYE A;  2R37 A;  2EIR A;  1U87 A;  2GSQ A;  3FY7 A;  3S9F A;  6GSS A;  1K3O A;  1WE0 A;  3PR8 A;  4WR4 A;  4ZBD A;  1G7E A;  3E0U A;  5FT3 A;  4IBP A;  4PGT A;  1AQW A;  4GQF A;  1EOH A;  1HD2 A;  4WR5 A;  5ECO B;  3MSZ A;  2FWF A;  2G0F A;  2I81 A;  2NPB A;  3U5R E;  1TXU A;  5ELG A;  1GRX A;  2HNL A;  1LU4 A;  2H01 A;  1M9B A;  5HR2 A;  3CSJ A;  2O3E A;  5A4V A;  3WGX A;  2XPD A;  1XG8 A;  1SK0 A;  1GLP A;  5D73 A;  1GSE A;  2GQM A;  5J5N A;  2HRK A;  1TU7 A;  2B5Y A;  2MMN A;  5ABR A;  1QMV A;  4KND A;  2K6V A;  1S4B P;  3ZLP A;  2H75 A;  3PPU A;  2H1B A;  4OO5 A;  3EUR A;  2GS3 A;  2HSM B;  1K3L A;  2CX3 A;  3IOS A;  1FVJ A;  2IFQ B;  1N8J A;  2H0G A;  4D73 B;  4ZB7 A;  3TRX A;  1GSF A;  1PQN A;  1ZYP A;  1GSQ A;  3TKS E;  3HXS A;  1XIY A;  2YPM A;  9GSS A;  4KSO A;  1HNA A;  4F03 A;  2VCZ A;  5IMV A;  1SK1 A;  5E4W A;  2RM6 A;  1S3A A;  1CQG A;  2RM5 A;  3GRX A;  1IYH A;  2F8F A;  3ZML A;  3ZIT A;  4TR4 A;  1F9M A;  1SEN A;  4XS1 A;  1TW9 A;  2DKH A;  4AKI A;  5J9C A;  2FD3 A;  3ZFL A;  2HZE B;  4LMW A;  2LRT A;  3FR6 A;  2VLV A;  4MCU A;  1T00 A;  2AYT A;  1M0U A;  1SVM A;  2OBI A;  2OKA A;  3TB2 A;  4E8H A;  2B7K A;  2L6D A;  1XW9 A;  2CZ3 A;  1Q98 A;  3CYN A;  1NSW A;  1T4Y A;  1EGO A;  1SJ6 A;  2V32 A;  4PTS A;  2B1L A;  3IR4 A;  5ECM B;  2IL3 A;  4IKH A;  3UEM A;  1AC1 A;  2EC4 A;  1K0A A;  4YH2 A;  2MZC A;  4BVY B;  1MDK A;  1USB A;  4LA1 A;  1VF1 A;  5J9B A;  3GUR A;  3FR3 A;  4MF6 A;  4FQU A;  4MZB A;  3FMW A;  5F07 A;  3ERF A;  2L6C A;  8GSS A;  1WWJ A;  1X5D A;  3TJK A;  2VL2 A;  2WCI A;  3UBK A;  2EFD A;  2YWI A;  2EFH A;  4ILF A;  3UMA A;  5HR0 A;  2RLI A;  1O6J A;  2O87 A;  1DBY A;  3OR5 A;  1ZYN A;  5JCG A;  4NHZ A;  3APQ A;  1NHO A;  4PUF C;  3HJO A;  2CA8 A;  4K0N A;  3G7J A;  1SJI A;  5GSS A;  1J0F A;  4G10 A;  1PGT A;  2RII A;  2H0I A;  3EYT A;  3H8Q A;  3TKS A;  2HXK A;  1RK4 A;  1MEK A;  1ON4 A;  1ML6 A;  5ID2 A;  1EV4 A;  1VF3 A;  2LV3 A;  2VO4 A;  1M99 A;  1A8Y A;  1A2M A;  4GSN A;  3RGB C;  2JZT A;  4POB A;  4LL1 B;  2HSM A;  3LXT A;  4IS0 A;  1EP8 A;  2CVB A;  4D73 A;  4MA9 A;  3EMX A;  2L4C A;  3A5I A;  2C3N A;  3PIN A;  3TU3 B;  1HNB A;  2KP2 A;  4MH2 A;  1GNE A;  4G0I A;  2L5O A;  5ECS A;  4MDC A;  3EU4 A;  1CQH A;  5KOW A;  1ZMA A;  1QK8 A;  3FHK A;  5EVO A;  2V41 A;  3MYD A;  2HSY A;  4ZL7 A;  1Y6E A;  1WIK A;  1X9S B;  4XHM A;  4ZXG A;  4JU5 A;  3FR9 A;  4L0W A;  5HFI A;  3HY2 A;  5LD0 A;  2FY6 A;  1C72 A;  3GKK A;  3C7M A;  4G0K A;  4AI6 A;  3P2A A;  5HR3 A;  5G30 A;  2A4H A;  1N25 A;  2YV7 A;  5JCU A;  3HKR A;  2M72 A;  5IM9 A;  4IJI A;  5JWO B;  3FRC A;  2X8C A;  3CSI A;  5G5E A;  3QAV A;  2GZZ A;  3EU3 A;  1IYI A;  2B7J A;  3P7X A;  4L0U A;  1OE8 A;  1NHY A;  5IPG A;  4HJM A;  1BQ7 A;  2ZUP A;  1O8X A;  3F63 A;  1BAY A;  2X8G A;  2R6K A;  2IME A;  1YY7 A;  4DSR A;  4MMM A;  4L5L A;  2E0Q A;  5CRD A;  3GFK A;  5AIV A;  2CVD A;  3VK9 A;  5ECQ B;  2UZ8 A;  3N5O A;  4BVY A;  4CY6 A;  3CHX C;  1OE7 A;  4OO4 A;  2CT6 A;  1GSU A;  3SWL A;  3ZZX A;  4FIW A;  3RAZ A;  2ES7 A;  2GST A;  2LJK A;  5G31 A;  2VD1 A;  4LMV A;  4PX1 A;  5A34 B;  2XHF A;  4YKG A;  2GT5 A;  1URM A;  2EIO A;  4DVC A;  4H86 A;  1I1I P;  3LSZ A;  2DJK A;  4G19 A;  5CRE A;  2DIZ A;  1GUH A;  1V40 A;  3RHB A;  5AIX A;  3DML A;  5ECR B;  2ON7 A;  3MIX A;  3CWG A;  1XVW A;  1FB0 A;  4ZIJ A;  1YF1 A;  3F0I A;  4DSS B;  5J4Y A;  5BRT A;  1OC9 B;  1F3B A;  2JU5 A;  1S3C A;  4ECB A;  2LQO A;  1GL8 A;  1X0R A;  3MAK A;  1FOV A;  4GWR A;  4HI7 A;  4USS A;  1SL1 B;  5DQS A;  3C1R A;  3VWW A;  1G6Y A;  4WET A;  3UIW A;  1TJD A;  1Z6N A;  3I6A A;  2V2G A;  3LG6 A;  4ECC A;  4NV5 A;  3BJ5 A;  1PSQ A;  2VM2 A;  4WBJ A;  1AUC A;  3RFR C;  1V57 A;  1GUM A;  2HRN A;  4K5R A;  1HQO A;  2YCD A;  3TJF A;  4QL7 A;  3N9J A;  6GSW A;  4XS6 A;  3DEX A;  3GNJ A;  2V1M A;  2X8H A;  4ULX A;  4MAB A;  3KD0 A;  3F4R A;  3D4M A;  4XCS A;  4G0L A;  1A0F A;  12GS A;  3ZRE A;  2B1K A;  1Q4J A;  4ISD A;  1SL0 B;  1XPV A;  3F9U A;  3F6F A;  2BTO T;  4HDE A;  2X99 A;  2DSA A;  2YP6 A;  3GL3 A;  4MP4 A;  16GS A;  4CW9 A;  3GUS A;  2IPA A;  4P3Y B;  3VI7 A;  2H6X A;  1PX6 A;  4FXY P;  5DJM A;  4K7I A;  2YN1 A;  1B4Q A;  3FW2 A;  1PKW A;  2VM1 A;  2C80 A;  3EIN A;  4OFN A;  1XW5 A;  5CAX A;  2VD0 A;  1VGL A;  3DRN A;  1ZOF A;  5ECK B;  1JFU A;  1Y25 A;  5KN3 A;  4IN0 A;  2GDR A;  5CNW A;  3M9J A;  5A34 A;  5AN1 A;  3DWV A;  2VAF A;  5A5K A;  1XWA A;  1J08 A;  1PD2 1;  3LQ7 A;  4YKF A;  3ED3 A;  2AHE A;  3QR6 A;  4KGI A;  5E59 A;  2QSI A;  3IAS 2;  4MF7 A;  5IMC A;  2R0C A;  3P8W A;  1XOB A;  2TRC P;  2H8L A;  5A5H B;  5DCG A;  4MJE A;  4O5Q A;  2LST A;  2GTU A;  3ZL5 A;  4IEL A;  4KE3 A;  4Q5R A;  4POL A;  4TR1 B;  4DSS A;  1TRW A;  2GVP A;  1OC9 A;  1YZX A;  3HJM A;  3KMN A;  4F2I A;  4W66 A;  1B8X A;  1GUK A;  4POM A;  3ME7 A;  3IPZ A;  2VCW A;  4I2T A;  3ZTL A;  4YQM A;  5CYY A;  1FAA A;  3F4T A;  2FLS A;  4KW6 A;  2VCT A;  2CVK A;  4N10 A;  3GH6 A;  3LEF A;  5KN1 A;  2AAW A;  3D6I A;  2WZ9 A;  2JL4 A;  3HVN A;  4IHU A;  1YEX A;  5D9V A;  1JZR A;  2YWO A;  1PN9 A;  5JWQ B;  1PN0 A;  3GKM A;  1EP7 A;  2WFC A;  3IXR A;  4IW9 A;  1SU9 A;  3FZ9 A;  4AF2 A;  1SK2 A;  4NPB A;  3L9V A;  3KP9 A;  1PA3 A;  3RBT A;  1JZO A;  2DJ1 A;  3RHC A;  3HZ8 A;  5C00 A;  4X4J A;  4TXV A;  4NHW A;  4ECJ A;  1KTE A;  3KH9 A;  3F3R A;  3TJJ A;  1FO5 A;  1U6T A;  1FG4 A;  3HA9 A;  5JWR B;  1TTZ A;  4Q5N A;  2N5A A;  4DSQ A;  4NMU A;  2LQQ A;  1ZYE A;  3EC3 A;  3R2Q A;  3TKQ A;  4K7O A;  3LYP A;  1B48 A;  1SVL A;  3HYP A;  4Q5Q A;  2FGX A;  1ILO A;  2H74 A;  4IVF A;  1A8L A;  4O7H A;  2XBI A;  3RPN A;  5GZZ B;  1EWX A;  3CBU A;  3CTF A;  4O5R A;  5J40 A;  3HMJ G;  1QGV A;  1GTU A;  4MNN A;  3KH7 A;  2LTK A;  3RPP A;  3L9S A;  4GXZ A;  3UBL A;  4ZB9 A;  1WRY A;  1A0R P;  2MMZ A;  3KEB A;  2VL9 A;  4V2N A;  4I8B A;  1RQM A;  1K3Y A;  4RQX A;  5A5H A;  2ZNM A;  4RUV A;  3UOM A;  4TR1 A;  1VF2 A;  1ERW A;  4AGS A;  4EUY A;  2P0G A;  3FK8 A;  5DJL A;  4CHS A;  1SYX A;  5IO0 A;  1VF4 A;  1YVL A;  2P5R A;  5FWG A;  4V2M A;  2LS5 A;  5IMF A;  3GN3 A;  1TK0 B;  3IDV A;  4HQS A;  2O36 A;  1ZCP A;  4ICY A;  2AB6 A;  2L5L A;  3J7Y k;  3EMP A;  5F8B A;  3C71 A;  5IOX A;  1K0O A;  1XW6 A;  3TOU A;  1WPI A;  3UVT A;  4A5P A;  3LW9 A;  2QA2 A;  2V6O A;  2WGR A;  3GX0 A;  3KJY A;  2OAC A;  2OA7 A;  3D22 A;  4PNF A;  3QMX A;  4BA7 A;  4BPY A;  4X43 A;  3H1N A;  3GA4 A;  1BJX A;  2FWG A;  4TW5 A;  4EIQ A;  4V2L A;  3KMO A;  1EV9 A;  3TJB A;  4KH7 A;  2H70 A;  1DE1 A;  4HUA A;  5IOW A;  4EXJ A;  4L5O A;  3U6V A;  1T1V A;  2MMA A;  2K18 A;  2YNX A;  2H66 A;  2H73 A;  1MTC A;  1J9B A;  4CDO A;  3VLN A;  1ERT A;  1EZK A;  3TKP A;  4KA0 A;  2B5E A;  4JZQ A;  4TKY A;  2LKU A;  1K0M A;  1DUG A;  2P31 A;  1V98 A;  3BBY A;  2DJ0 A;  2HE3 A;  3KP8 A;  1A23 A;  4HOJ A;  5ENU A;  5D93 A;  5AGY A;  1T3B A;  2JAD A;  2PVO C;  3CQF A;  4MJC A;  3DVX A;  2JSZ A;  3A2W A;  5B6N A;  4TN8 A;  2WUL A;  4ACS A;  1Z6M A;  4AKG A;  3DXB A;  6GSU A;  2WRT A;  2E2M A;  1O8W A;  1QFN A;  3GV1 A;  3PGT A;  2DKI A;  2IFQ A;  5F05 A;  1S3D A;  4FYU A;  4N30 A;  1FB6 A;  2OE3 A;  4V1A p;  1AAZ A;  2K9F A;  2KLX A;  2IMK A;  2RUF A;  3GMF A;  3VWV A;  3IHQ A;  4MJB A;  5D9X A;  2YV9 A;  1Z3E A;  1M2B A;  1PL1 A;  4WXT A;  2R2J A;  2A4V A;  2H0H A;  2VL3 A;  3FKF A;  3ERW A;  2BJX A;  2IN3 A;  1R5P A;  4PI2 C;  3ERG A;  1U3I A;  2DML A;  5DDL A;  4EDY A;  3NIV A;  1GH2 A;  5DBQ A;  1PMT A;  3NZN A;  2C3T A;  2G2Q A;  5KN0 A;  1W89 A;  3I69 A;  2HZE A;  1YKA A;  3G7Y A;  1THO A;  4E68 A;  4YAP A;  1V2A A;  1ACV A;  2XC2 A;  1XWG A;  2GQK A;  1M2A A;  4DEJ A;  1XZO A;  4JR4 A;  1XWC A;  2YJH A;  3ZFB A;  3DGQ A;  3GST A;  1XXU A;  5DQY A;  2XPE A;  4KUN A;  5HFG A;  13GS A;  2VCV A;  2C0G A;  1M2D A;  2TIR A;  3QFA C;  4AJ6 A;  3M9K A;  3EPT A;  2H72 A;  2GSR A;  1OVN A;  2IWT A;  1HYU A;  5A1N B;  2MMO A;  4G01 A;  1OAZ A;  4AKX B;  2HFD A;  1TRS A;  1WJK A;  3IC4 A;  3MDK A;  3KTL A;  1GSD A;  5DCH A;  5D9T A;  1NW2 A;  5IMD A;  4KCE A;  2R4V A;  4L8E A;  2WB9 A;  4IGJ A;  1PFO A;  3R3E A;  4CY8 A;  1PX7 A;  5H5Q A;  3KIJ A;  2L57 A;  4PXO A;  4ZB8 A;  4TXO B;  2Z9S A;  4JBB A;  14GS A;  5J4V A;  4K7N A;  2J9H A;  3UAP A;  4BL7 B;  2F51 A;  1TK8 B;  5H5S A;  4WF4 A;  2LRC A;  2FA4 A;  4MPF A;  3IC8 A;  1TI3 A;  22GS A;  4XTS A;  4EVM A;  1X5C A;  3H79 A;  4MF5 A;  3NOF A;  3TRP A;  3C8E A;  2FUG 2;  3TGZ A;  4HEA 2;  3KGK A;  1V58 A;  2I3Y A;  3TDG A;  1F6M C;  3RDW A;  2DMM A;  3QCP A;  4K1F A;  1SVO A;  4K9Z A;  5EY6 A;  3A3T A;  1TDI A;  6GSV A;  11GS A;  1DSB A;  2NTO A;  2VL2 C;  2N5F A;  3K8N A;  1JZD A;  2PVQ A;  2BMX A;  2WJU A;  18GS A;  4Q5F A;  2EFC A;  1TP9 A;  2FNO A;  4K0G A;  1R4W A;  3ZVJ A;  1YEW C;  1X9M B;  3E9J B;  2M80 A;  3GTU B;  3TKS C;  3WGD A;  3US3 A;  6GST A;  3H4K A;  2H1L A;  2YWM A;  4K5S A;  3QDN A;  4K2X A;  4TOP A;  4F82 A;  2DLX A;  1UC7 A;  2I1U A;  4PUR A;  4QMK A;  2C4J A;  4XRD A;  3M8N A;  4EKZ A;  3A2V A;  1YKC A;  4O5U A;  1TK5 B;  3VI5 A;  4XIH A;  2B6M A;  4FYB A;  4I6X A;  3A2X A;  1SD9 A;  5ECL B;  4ZB6 A;  1G6W A;  2OT3 A;  2LUS A;  1UVZ A;  2PU9 C;  1X9W B;  3HVS A;  2QC7 A;  2WW0 A;  4FYC A;  4XRA A;  1FHE A;  1ZGN A;  5ECI B;  3CRU A;  1QXH A;  1GLQ A;  3VWX A;  2QKE A;  1H4O A;  3CRT A;  2VOC A;  1LBK A;  4KDY A;  4EC0 A;  2DJ3 A;  1YF0 A;  1AXD A;  3UAR A;  2WW3 A;  2F8A A;  1OKT A;  3KTB A;  1KEB A;  1XOA A;  3LXZ A;  2R0G A;  3FZ5 A;  1YQ1 A;  2A2S A;  2OAD A;  2CAQ A;  2DJ2 A;  3GKX A;  1BG5 A;  1EGR A;  4TXO A;  4AJ8 A;  4PHZ C;  2IJY A;  3UVH A;  3F8U A;  4F0B A;  3AY8 A;  1RW1 A;  1U3A A;  17GS A;  4GST A;  4BL7 A;  2FHE A;  4MH3 A;  2WVY A;  3W6G A;  1G7O A;  2QA1 A;  4WEY A;  3DYR A;  5IIZ A;  19GS A;  3VFI A;  2CZ2 A;  1A2L A;  4MLY A;  2R5G A;  4Z7X A;  1UA5 A;  2RUE A;  3LOR A;  3TOT A;  1GWC A;  5G1K A;  1F2E A;  4AJ7 A;  5H5R A;  2R0P A;  2HSN B;  1Z5Y E;  1YJ6 A;  4TVE A;  3IK7 A;  2B5X A;  2HZF A;  5LCZ A;  2WDU A;  4YAV A;  4PUA A;  4MK3 A;  3Q6O A;  4QQ7 A;  5D96 A;  4LL4 B;  2GZP A;  5CRG A;  1GTB A;  4KB3 A;  3WGE A;  5KEJ A;  1A2J A;  1JZW A;  5J4U A;  4MPG A;  5INY A;  5DAL B;  4POK A;  1O73 A;  4ZBA A;  3LJR A;  4GSS A;  2H1D A;  4NV2 A;  2H76 A;  4JE1 A;  3J7Y b;  1XBS A;  2V6K A;  2IMD A;  1GP1 A;  4K6X A;  3GTU A;  3FEU A;  5HR1 A;  1AQV A;  2I4A A;  4IJ3 A;  3L9U A;  3QOU A;  4OCE A;  5IO2 A;  3VUR A;  1SJZ A;  5IQY A;  3QAW A;  4TR0 A;  2OBK A;  4OMV A;  4BVX B;  4GTU A;  2M46 A;  1ZL9 A;  5A4U A;  1Z7P A;  2H30 A;  1M7T A;  4YQU A;  5HFK A;  5D9W A;  3QAG A;  3PH9 A;  2HT9 A;  2WW1 A;  2JSY A;  4Z2T A;  4HSC X;  3IBH A;  7GSS A;  1GSY A;  2DJJ A;  4PQH A;  4OFT A;  4N0Z A;  3KCM A;  3WT1 A;  3IV4 A;  3M3M A;  4ECI A;  3EVI A;  1TI1 A;  4FH8 A;  2LJR A;  3IHG A;  4EL1 A;  3KXO A;  2LEG A;  1Z9H A;  1XWK A;  1O81 A;  2JZS A;  4MJA A;  3TJG A;  5ID2 B;  1K0B A;  1ABA A;  4OD7 A;  5B8A A;  2AJQ B;  3APO A;  3V1W A;  1H75 A;  3G9B A;  3DKS A;  3BOA A;  1BG1 A;  4I97 A;  1UN2 A;  5LNK e;  2H6Z A;  1B4P A;  1QUW A;  4EDZ A;  3P90 A;  4GRF A;  3DD3 A;  4O32 A;  4XS4 B;  1ZYQ B;  2H71 A;  5D8I A;  1X5E A;  4LLR A;  5CO3 A;  4MZC A;  4MZW A;  3LWA A;  4HJ2 A;  1TU8 A;  3I9V 2;  3F3Q A;  2HSH A;  2KOK A;  4NXI A;  1EEM A;  4HS1 A;  2HSN A;  2K8V A;  4QL9 A;  3HZ4 A;  1FW1 A;  3IAM 2;  1BX9 A;  1LJR A;  4ID0 A;  4EE0 A;  4ZL8 A;  5ECH B;  1OYJ A;  1FVK A;  2X64 A;  4ZBB A;  1TRU A;  3DVW A;  5DAL A;  3GX8 A;  1SKS B;  2VUP A;  3UL3 A;  1Y1U A;  4IQA A;  4J56 E;  4HZ4 A;  1K0C A;  2PER A;  3VPQ A;  4ML6 A;  5CP1 A;  5EPF A;  2L4Q A;  5AIS A;  3Q18 A;  2HQT A;  4KDU A;  4RI7 A;  2KHP A;  1SKW B;  1F37 A;  3M1G A;  4PNG A;  5KOX A;  1OC3 A;  1B9X C;  3TUE A;  1JLV A;  3O76 A;  4TRX A;  3BD2 A;  2KUC A;  2GSS A;  2A2P A;  5CRH A;  4IQ1 A;  3VPT A;  1R7H A;  2LRN A;  3O6T A;  5EL8 A;  3ME8 A;  4BVX A;  3H93 A;  1E6B A;  2O7K A;  4KF9 A;  4HZ2 A;  2P5Q A;  3GKN A;  1OKD A;  2NVL A;  1KBN A;  3CXG A;  3APS A;  4NWY A;  2WZS A;  4BWS A;  5JCW A;  1PL2 A;  2HRF A;  3LGC A;  4O92 A;  3SBC A;  1V9W A;  4BIK A;  4GQC A;  3KZQ A;  2PN8 A;  3Q74 A;  3GL5 A;  5IPH A;  2N5B A;  2MBS A;  1WMJ A;  3D5J A;  4EIP A;  2E7P A;  3MWH A;  3A5W A;  4JR6 A;  2C3Q A;  1VRS D;  5KN2 A;  2C0F A;  3FYG A;  4ZL9 A;  1SD8 A;  3LYK A;  2PUK C;  2YJ7 A;  2EFE A;  2WVX B;  4EF0 A;  2ON5 A;  3G7I A;  1TXX A;  10GS A;  1YDK A;  3VWU A;  3QPM A;  2WS2 A;  3BCI A;  3ZVJ D;  4I5Q A;  4Z2U A;  2PMT A;  2HLS A;  1U88 A;  4AKH A;  3IA1 A;  5G5F A;  2H19 A;  2VCQ A;  2YWN A;  3CTG A;  4XS4 A;  3QD9 A;  1N2A A;  2PBJ A;  2C1Y A;  3EWL A;  5IMZ A;  1M9A A;  1WOU A;  2H6Y A;  4KCA A;  5DAK B;  3FZ4 A;  2LJA A;  4WBR D;  1PRX A;  5GAP D;  3CMI A;  2O85 A;  5COH A;  1TKD B;  2PWJ A;  1ZZY A;  4NAX A;  4GDF A;  4Z2R A;  1O85 A;  4IP6 A;  1MD3 A;  1F3A A;  2X4A A;  2WW2 A;  2IMI A;  2O5V A;  1YEP A;  2YOI A;  1I9D A;  1BED A;  3W8J A;  4ZIL A;  2AV4 A;  2PGT A;  4ML1 A;  3WD6 A;  5B6M A;  5FHI A;  2C8U A;  3C73 A;  4JRR A;  1OC8 A;  3L4N A;  5DVB A;  2O89 A;  3E3E A;  3JCM L;  2D2Z A;  4PI0 C;  3HVV A;  5CRW A;  5B8B A;  2FA8 A;  1JHB A;  1G0T A;  2DIY A;  2EIQ A;  1WP0 A;  6GSX A;  1JLW A;  3WT2 A;  1THX A;  1EEJ A;  4TR3 A;  1EOG A;  3Q19 A;  5BMU B;  4GCI A;  2GQL A;  4HQZ A;  5J41 A;  2O8V B;  4RI6 A;  1AQX A;  3W8S A; 
#chains in the Genus database with same CATH homology
 4N11 A;  3M0F A;  1Z7R A;  1R26 A;  3ZYW A;  2NDO A;  2VIM A;  2MYG A;  1PKZ A;  2IMF A;  3HD5 A;  2CX4 A;  1MDI A;  5C04 A;  4WKW A;  3QFB C;  5ECP B;  4N3Z A;  1BF5 A;  2FWE A;  2QGV A;  3GYK A;  1W4V A;  1SL2 B;  2GGT A;  3WYW A;  2HI7 A;  2VLU A;  1O7U A;  2K8S A;  2H1G A;  2GT6 A;  1B9Y C;  4G9H A;  20GS A;  2C0E A;  3EE2 A;  2XBQ A;  4EO3 A;  4N0V A;  3ZRD A;  2DC5 A;  3TRQ A;  5F0G A;  2JAC A;  1K0D A;  4K8M A;  3D21 A;  2C0D A;  2UV8 G;  4BWQ A;  1SYR A;  2FWH A;  2H1A A;  4J57 E;  2IIY A;  2L59 A;  1E2Y A;  5HQP A;  3GHA A;  2TRX A;  3F6D A;  5F06 A;  3I43 A;  2KP1 A;  3D0Z A;  2JZR A;  1XWB A;  5DAK A;  1MD4 A;  3IK9 A;  2OJL A;  1TRV A;  5B7C A;  4YQV A;  2I9H A;  3L78 A;  1AW9 A;  1ERV A;  3MNG A;  4G2E A;  4HU7 A;  1I5G A;  3HVX A;  5G2Z A;  3GIX A;  1XCC A;  1TOF A;  1GTA A;  4K2D A;  1GTI A;  1SKR B;  2A2R A;  2GLR A;  1KNG A;  2DBC A;  2AUV A;  1NM3 A;  2ALB A;  3ISO A;  5IMA A;  4X1U A;  4KDX A;  5A4W A;  2LNS A;  4F9Z A;  2YZH A;  6GSY A;  5G1L A;  5A1N A;  4GF0 A;  2B3S A;  4J2F A;  2HRK B;  1GNW A;  2E2G A;  1ERU A;  2VKZ G;  4F0C A;  1T4Z A;  3D4T A;  4GLT A;  2ZCT A;  5GST A;  3HJP A;  4KX4 A;  4RQR A;  4JED A;  1FOH A;  3CSH A;  4KAE A;  1HNC A;  4PQ1 A;  4PQI A;  1MDJ A;  1T8E B;  3F4S A;  4OWY A;  4WF5 A;  3HDC A;  4OCF A;  4E8E A;  2YAN A;  3GSS A;  3TCO A;  4V1A g;  1R5A A;  2PPT A;  3HCZ A;  5BMU A;  1GUL A;  3ZIV A;  1DE2 A;  2F9S A;  2VLT A;  2HRA A;  3FZA A;  3KM6 A;  4I2U A;  2OE1 A;  5GAN D;  2R3X A;  5L71 A;  1AIU A;  2J23 A;  3C1S A;  2NBS A;  2VCX A;  4HU9 A;  5J47 A;  2MBT A;  2CAI A;  5ECN B;  3ZMK A;  3L0H A;  3DIE A;  1T7P B;  2LNT A;  3IRA A;  4FO5 A;  3UJ1 A;  2REM A;  1XVQ A;  4KSM A;  2CQ9 A;  3O3T A;  1QQ2 A;  2OE0 A;  1ST9 A;  2CV4 A;  1XFL A;  3HHV A;  3GH9 A;  4X0X A;  4IP1 A;  1GSS A;  2YZU A;  5J3R A;  1A24 A;  2GZY A;  2HYX A;  3BCK A;  3IE3 A;  5ELA A;  2FCH A;  3TKR A;  1K0N A;  3LFL A;  4OFM A;  3ZIJ A;  2F3M A;  2X49 A;  1BYE A;  2R37 A;  2EIR A;  1U87 A;  2GSQ A;  3FY7 A;  3S9F A;  6GSS A;  1K3O A;  1WE0 A;  3PR8 A;  4WR4 A;  4ZBD A;  1G7E A;  3E0U A;  5FT3 A;  4IBP A;  4PGT A;  1AQW A;  4GQF A;  1EOH A;  1HD2 A;  4WR5 A;  5ECO B;  3MSZ A;  2FWF A;  2G0F A;  2I81 A;  2NPB A;  3U5R E;  1TXU A;  5ELG A;  1GRX A;  2HNL A;  1LU4 A;  2H01 A;  1M9B A;  5HR2 A;  3CSJ A;  5A4V A;  3WGX A;  2XPD A;  1SK0 A;  1GLP A;  5D73 A;  1GSE A;  2GQM A;  5J5N A;  2HRK A;  1TU7 A;  2B5Y A;  2MMN A;  5ABR A;  1QMV A;  4KND A;  2K6V A;  3ZLP A;  2H75 A;  3PPU A;  2H1B A;  4OO5 A;  3EUR A;  2GS3 A;  2HSM B;  1K3L A;  2CX3 A;  3IOS A;  1FVJ A;  2IFQ B;  1N8J A;  2H0G A;  4D73 B;  4ZB7 A;  3TRX A;  1GSF A;  1PQN A;  1ZYP A;  1GSQ A;  3TKS E;  3HXS A;  1XIY A;  2YPM A;  9GSS A;  4KSO A;  1HNA A;  4F03 A;  2VCZ A;  5IMV A;  1SK1 A;  5E4W A;  2RM6 A;  1S3A A;  1CQG A;  2RM5 A;  3GRX A;  1IYH A;  2F8F A;  3ZML A;  3ZIT A;  4TR4 A;  1F9M A;  1SEN A;  4XS1 A;  1TW9 A;  2DKH A;  4AKI A;  5J9C A;  2FD3 A;  3ZFL A;  2HZE B;  4LMW A;  2LRT A;  3FR6 A;  2VLV A;  4MCU A;  1T00 A;  2AYT A;  1M0U A;  1SVM A;  2OBI A;  2OKA A;  3TB2 A;  4E8H A;  2B7K A;  2L6D A;  1XW9 A;  2CZ3 A;  1Q98 A;  3CYN A;  1NSW A;  1T4Y A;  1EGO A;  1SJ6 A;  2V32 A;  4PTS A;  2B1L A;  3IR4 A;  5ECM B;  2IL3 A;  4IKH A;  3UEM A;  1AC1 A;  2EC4 A;  1K0A A;  4YH2 A;  2MZC A;  4BVY B;  1MDK A;  1USB A;  4LA1 A;  1VF1 A;  5J9B A;  3GUR A;  3FR3 A;  4MF6 A;  4FQU A;  4MZB A;  3FMW A;  5F07 A;  3ERF A;  2L6C A;  8GSS A;  1WWJ A;  1X5D A;  3TJK A;  2VL2 A;  2WCI A;  3UBK A;  2EFD A;  2YWI A;  2EFH A;  4ILF A;  3UMA A;  5HR0 A;  2RLI A;  1O6J A;  2O87 A;  1DBY A;  3OR5 A;  1ZYN A;  5JCG A;  4NHZ A;  3APQ A;  1NHO A;  4PUF C;  3HJO A;  2CA8 A;  4K0N A;  3G7J A;  1SJI A;  5GSS A;  1J0F A;  4G10 A;  1PGT A;  2RII A;  2H0I A;  3EYT A;  3H8Q A;  3TKS A;  2HXK A;  1RK4 A;  1MEK A;  1ON4 A;  1ML6 A;  5ID2 A;  1EV4 A;  1VF3 A;  2LV3 A;  2VO4 A;  1M99 A;  1A8Y A;  1A2M A;  4GSN A;  2JZT A;  4POB A;  4LL1 B;  2HSM A;  3LXT A;  4IS0 A;  1EP8 A;  2CVB A;  4D73 A;  4MA9 A;  3EMX A;  2L4C A;  3A5I A;  2C3N A;  3PIN A;  3TU3 B;  1HNB A;  2KP2 A;  4MH2 A;  1GNE A;  4G0I A;  2L5O A;  5ECS A;  4MDC A;  3EU4 A;  1CQH A;  5KOW A;  1ZMA A;  1QK8 A;  3FHK A;  5EVO A;  2V41 A;  3MYD A;  2HSY A;  4ZL7 A;  1Y6E A;  1WIK A;  1X9S B;  4XHM A;  4ZXG A;  4JU5 A;  3FR9 A;  4L0W A;  5HFI A;  3HY2 A;  5LD0 A;  2FY6 A;  1C72 A;  3GKK A;  3C7M A;  4G0K A;  4AI6 A;  3P2A A;  5HR3 A;  5G30 A;  2A4H A;  1N25 A;  2YV7 A;  5JCU A;  3HKR A;  2M72 A;  5IM9 A;  4IJI A;  5JWO B;  3FRC A;  2X8C A;  3CSI A;  5G5E A;  3QAV A;  2GZZ A;  3EU3 A;  1IYI A;  2B7J A;  3P7X A;  4L0U A;  1OE8 A;  1NHY A;  5IPG A;  4HJM A;  1BQ7 A;  2ZUP A;  1O8X A;  3F63 A;  1BAY A;  2X8G A;  2R6K A;  2IME A;  1YY7 A;  4DSR A;  4MMM A;  4L5L A;  2E0Q A;  5CRD A;  3GFK A;  5AIV A;  2CVD A;  3VK9 A;  5ECQ B;  2UZ8 A;  3N5O A;  4BVY A;  4CY6 A;  1OE7 A;  4OO4 A;  2CT6 A;  1GSU A;  3SWL A;  3ZZX A;  4FIW A;  3RAZ A;  2ES7 A;  2GST A;  2LJK A;  5G31 A;  2VD1 A;  4LMV A;  4PX1 A;  5A34 B;  2XHF A;  4YKG A;  2GT5 A;  1URM A;  2EIO A;  4DVC A;  4H86 A;  3LSZ A;  2DJK A;  4G19 A;  5CRE A;  2DIZ A;  1GUH A;  1V40 A;  3RHB A;  5AIX A;  3DML A;  5ECR B;  2ON7 A;  3MIX A;  3CWG A;  1XVW A;  1FB0 A;  4ZIJ A;  1YF1 A;  3F0I A;  4DSS B;  5J4Y A;  5BRT A;  1OC9 B;  1F3B A;  2JU5 A;  1S3C A;  4ECB A;  2LQO A;  1GL8 A;  1X0R A;  3MAK A;  1FOV A;  4GWR A;  4HI7 A;  4USS A;  1SL1 B;  5DQS A;  3C1R A;  3VWW A;  1G6Y A;  4WET A;  3UIW A;  1TJD A;  1Z6N A;  3I6A A;  2V2G A;  3LG6 A;  4ECC A;  4NV5 A;  3BJ5 A;  1PSQ A;  2VM2 A;  4WBJ A;  1AUC A;  1V57 A;  1GUM A;  2HRN A;  4K5R A;  1HQO A;  2YCD A;  3TJF A;  4QL7 A;  3N9J A;  6GSW A;  4XS6 A;  3DEX A;  3GNJ A;  2V1M A;  2X8H A;  4ULX A;  4MAB A;  3KD0 A;  3F4R A;  3D4M A;  4XCS A;  4G0L A;  1A0F A;  12GS A;  3ZRE A;  2B1K A;  1Q4J A;  4ISD A;  1SL0 B;  1XPV A;  3F9U A;  3F6F A;  2BTO T;  4HDE A;  2X99 A;  2DSA A;  2YP6 A;  3GL3 A;  4MP4 A;  16GS A;  4CW9 A;  3GUS A;  2IPA A;  4P3Y B;  3VI7 A;  2H6X A;  1PX6 A;  5DJM A;  4K7I A;  2YN1 A;  1B4Q A;  3FW2 A;  1PKW A;  2VM1 A;  2C80 A;  3EIN A;  4OFN A;  1XW5 A;  5CAX A;  2VD0 A;  1VGL A;  3DRN A;  1ZOF A;  5ECK B;  1JFU A;  1Y25 A;  5KN3 A;  4IN0 A;  2GDR A;  5CNW A;  3M9J A;  5A34 A;  5AN1 A;  3DWV A;  2VAF A;  5A5K A;  1XWA A;  1J08 A;  1PD2 1;  3LQ7 A;  4YKF A;  3ED3 A;  2AHE A;  3QR6 A;  4KGI A;  5E59 A;  2QSI A;  3IAS 2;  4MF7 A;  5IMC A;  2R0C A;  3P8W A;  1XOB A;  2TRC P;  2H8L A;  5A5H B;  5DCG A;  4MJE A;  4O5Q A;  2LST A;  2GTU A;  3ZL5 A;  4IEL A;  4KE3 A;  4Q5R A;  4POL A;  4TR1 B;  4DSS A;  1TRW A;  2GVP A;  1OC9 A;  1YZX A;  3HJM A;  3KMN A;  4F2I A;  4W66 A;  1B8X A;  1GUK A;  4POM A;  3ME7 A;  3IPZ A;  2VCW A;  4I2T A;  3ZTL A;  4YQM A;  5CYY A;  1FAA A;  3F4T A;  2FLS A;  4KW6 A;  2VCT A;  2CVK A;  4N10 A;  3GH6 A;  3LEF A;  5KN1 A;  2AAW A;  3D6I A;  2WZ9 A;  2JL4 A;  4IHU A;  1YEX A;  5D9V A;  1JZR A;  2YWO A;  1PN9 A;  5JWQ B;  1PN0 A;  3GKM A;  1EP7 A;  2WFC A;  3IXR A;  4IW9 A;  1SU9 A;  3FZ9 A;  4AF2 A;  1SK2 A;  4NPB A;  3L9V A;  3KP9 A;  1PA3 A;  3RBT A;  1JZO A;  2DJ1 A;  3RHC A;  3HZ8 A;  5C00 A;  4X4J A;  4TXV A;  4NHW A;  4ECJ A;  1KTE A;  3KH9 A;  3F3R A;  3TJJ A;  1FO5 A;  1U6T A;  1FG4 A;  3HA9 A;  5JWR B;  1TTZ A;  4Q5N A;  2N5A A;  4DSQ A;  4NMU A;  2LQQ A;  1ZYE A;  3EC3 A;  3R2Q A;  3TKQ A;  4K7O A;  3LYP A;  1B48 A;  1SVL A;  3HYP A;  4Q5Q A;  2FGX A;  1ILO A;  2H74 A;  4IVF A;  1A8L A;  4O7H A;  2XBI A;  3RPN A;  5GZZ B;  1EWX A;  3CBU A;  3CTF A;  4O5R A;  5J40 A;  3HMJ G;  1QGV A;  1GTU A;  4MNN A;  3KH7 A;  2LTK A;  3RPP A;  3L9S A;  4GXZ A;  3UBL A;  4ZB9 A;  1WRY A;  1A0R P;  2MMZ A;  3KEB A;  2VL9 A;  4V2N A;  4I8B A;  1RQM A;  1K3Y A;  4RQX A;  5A5H A;  2ZNM A;  4RUV A;  3UOM A;  4TR1 A;  1VF2 A;  1ERW A;  4AGS A;  4EUY A;  2P0G A;  3FK8 A;  5DJL A;  4CHS A;  1SYX A;  5IO0 A;  1VF4 A;  1YVL A;  2P5R A;  5FWG A;  4V2M A;  2LS5 A;  5IMF A;  3GN3 A;  1TK0 B;  3IDV A;  4HQS A;  1ZCP A;  4ICY A;  2AB6 A;  2L5L A;  3J7Y k;  3EMP A;  5F8B A;  3C71 A;  5IOX A;  1K0O A;  1XW6 A;  3TOU A;  1WPI A;  3UVT A;  4A5P A;  3LW9 A;  2QA2 A;  2V6O A;  2WGR A;  3GX0 A;  3KJY A;  2OAC A;  2OA7 A;  3D22 A;  4PNF A;  3QMX A;  4BA7 A;  4BPY A;  4X43 A;  3H1N A;  3GA4 A;  1BJX A;  2FWG A;  4TW5 A;  4EIQ A;  4V2L A;  3KMO A;  1EV9 A;  3TJB A;  4KH7 A;  2H70 A;  1DE1 A;  4HUA A;  5IOW A;  4EXJ A;  4L5O A;  3U6V A;  1T1V A;  2MMA A;  2K18 A;  2YNX A;  2H66 A;  2H73 A;  1MTC A;  1J9B A;  4CDO A;  3VLN A;  1ERT A;  1EZK A;  3TKP A;  4KA0 A;  2B5E A;  4JZQ A;  4TKY A;  2LKU A;  1K0M A;  1DUG A;  2P31 A;  1V98 A;  3BBY A;  2DJ0 A;  2HE3 A;  3KP8 A;  1A23 A;  4HOJ A;  5ENU A;  5D93 A;  5AGY A;  1T3B A;  2JAD A;  2PVO C;  4MJC A;  3DVX A;  2JSZ A;  3A2W A;  5B6N A;  4TN8 A;  2WUL A;  4ACS A;  1Z6M A;  4AKG A;  3DXB A;  6GSU A;  2WRT A;  2E2M A;  1O8W A;  1QFN A;  3GV1 A;  3PGT A;  2DKI A;  2IFQ A;  5F05 A;  1S3D A;  4FYU A;  4N30 A;  1FB6 A;  2OE3 A;  4V1A p;  1AAZ A;  2K9F A;  2KLX A;  2IMK A;  2RUF A;  3GMF A;  3VWV A;  3IHQ A;  4MJB A;  5D9X A;  2YV9 A;  1Z3E A;  1M2B A;  1PL1 A;  4WXT A;  2R2J A;  2A4V A;  2H0H A;  2VL3 A;  3FKF A;  3ERW A;  2BJX A;  2IN3 A;  1R5P A;  3ERG A;  1U3I A;  2DML A;  5DDL A;  4EDY A;  3NIV A;  1GH2 A;  5DBQ A;  1PMT A;  3NZN A;  2C3T A;  2G2Q A;  5KN0 A;  1W89 A;  3I69 A;  2HZE A;  1YKA A;  3G7Y A;  1THO A;  4E68 A;  4YAP A;  1V2A A;  1ACV A;  2XC2 A;  1XWG A;  2GQK A;  1M2A A;  4DEJ A;  1XZO A;  4JR4 A;  1XWC A;  2YJH A;  3ZFB A;  3DGQ A;  3GST A;  1XXU A;  5DQY A;  2XPE A;  4KUN A;  5HFG A;  13GS A;  2VCV A;  2C0G A;  1M2D A;  2TIR A;  3QFA C;  4AJ6 A;  3M9K A;  3EPT A;  2H72 A;  2GSR A;  1OVN A;  2IWT A;  1HYU A;  5A1N B;  2MMO A;  4G01 A;  1OAZ A;  4AKX B;  2HFD A;  1TRS A;  1WJK A;  3IC4 A;  3MDK A;  3KTL A;  1GSD A;  5DCH A;  5D9T A;  1NW2 A;  5IMD A;  4KCE A;  2R4V A;  4L8E A;  2WB9 A;  4IGJ A;  3R3E A;  4CY8 A;  1PX7 A;  5H5Q A;  3KIJ A;  2L57 A;  4PXO A;  4ZB8 A;  4TXO B;  2Z9S A;  4JBB A;  14GS A;  5J4V A;  4K7N A;  2J9H A;  3UAP A;  4BL7 B;  2F51 A;  1TK8 B;  5H5S A;  4WF4 A;  2LRC A;  2FA4 A;  4MPF A;  3IC8 A;  1TI3 A;  22GS A;  4XTS A;  4EVM A;  1X5C A;  3H79 A;  4MF5 A;  3NOF A;  3TRP A;  3C8E A;  2FUG 2;  3TGZ A;  4HEA 2;  3KGK A;  1V58 A;  2I3Y A;  3TDG A;  1F6M C;  3RDW A;  2DMM A;  3QCP A;  4K1F A;  1SVO A;  4K9Z A;  5EY6 A;  3A3T A;  1TDI A;  6GSV A;  11GS A;  1DSB A;  2NTO A;  2VL2 C;  2N5F A;  3K8N A;  1JZD A;  2PVQ A;  2BMX A;  2WJU A;  18GS A;  4Q5F A;  2EFC A;  1TP9 A;  2FNO A;  4K0G A;  1R4W A;  3ZVJ A;  1X9M B;  3E9J B;  2M80 A;  3GTU B;  3TKS C;  3WGD A;  3US3 A;  6GST A;  3H4K A;  2H1L A;  2YWM A;  4K5S A;  3QDN A;  4K2X A;  4TOP A;  4F82 A;  2DLX A;  1UC7 A;  2I1U A;  4PUR A;  4QMK A;  2C4J A;  4XRD A;  3M8N A;  4EKZ A;  3A2V A;  1YKC A;  4O5U A;  1TK5 B;  3VI5 A;  4XIH A;  2B6M A;  4FYB A;  4I6X A;  3A2X A;  1SD9 A;  5ECL B;  4ZB6 A;  1G6W A;  2OT3 A;  2LUS A;  1UVZ A;  2PU9 C;  1X9W B;  3HVS A;  2QC7 A;  4FYC A;  4XRA A;  1FHE A;  1ZGN A;  5ECI B;  3CRU A;  1QXH A;  1GLQ A;  3VWX A;  2QKE A;  1H4O A;  3CRT A;  2VOC A;  1LBK A;  4KDY A;  4EC0 A;  2DJ3 A;  1YF0 A;  1AXD A;  3UAR A;  2F8A A;  1OKT A;  3KTB A;  1KEB A;  1XOA A;  3LXZ A;  2R0G A;  3FZ5 A;  1YQ1 A;  2A2S A;  2OAD A;  2CAQ A;  2DJ2 A;  3GKX A;  1BG5 A;  1EGR A;  4TXO A;  4AJ8 A;  2IJY A;  3UVH A;  3F8U A;  4F0B A;  3AY8 A;  1RW1 A;  1U3A A;  17GS A;  4GST A;  4BL7 A;  2FHE A;  4MH3 A;  3W6G A;  1G7O A;  2QA1 A;  4WEY A;  3DYR A;  5IIZ A;  19GS A;  3VFI A;  2CZ2 A;  1A2L A;  4MLY A;  2R5G A;  4Z7X A;  1UA5 A;  2RUE A;  3LOR A;  3TOT A;  1GWC A;  5G1K A;  1F2E A;  4AJ7 A;  5H5R A;  2R0P A;  2HSN B;  1Z5Y E;  1YJ6 A;  4TVE A;  3IK7 A;  2B5X A;  2HZF A;  5LCZ A;  2WDU A;  4YAV A;  4PUA A;  4MK3 A;  3Q6O A;  4QQ7 A;  5D96 A;  4LL4 B;  2GZP A;  5CRG A;  1GTB A;  4KB3 A;  3WGE A;  5KEJ A;  1A2J A;  1JZW A;  5J4U A;  4MPG A;  5INY A;  5DAL B;  4POK A;  1O73 A;  4ZBA A;  3LJR A;  4GSS A;  2H1D A;  4NV2 A;  2H76 A;  4JE1 A;  3J7Y b;  1XBS A;  2V6K A;  2IMD A;  1GP1 A;  4K6X A;  3GTU A;  3FEU A;  5HR1 A;  1AQV A;  2I4A A;  4IJ3 A;  3L9U A;  3QOU A;  4OCE A;  5IO2 A;  3VUR A;  1SJZ A;  5IQY A;  3QAW A;  4TR0 A;  2OBK A;  4OMV A;  4BVX B;  4GTU A;  2M46 A;  1ZL9 A;  5A4U A;  1Z7P A;  2H30 A;  1M7T A;  4YQU A;  5HFK A;  5D9W A;  3QAG A;  3PH9 A;  2HT9 A;  2JSY A;  4Z2T A;  3IBH A;  7GSS A;  1GSY A;  2DJJ A;  4PQH A;  4OFT A;  4N0Z A;  3KCM A;  3WT1 A;  3IV4 A;  3M3M A;  4ECI A;  3EVI A;  1TI1 A;  4FH8 A;  2LJR A;  3IHG A;  4EL1 A;  3KXO A;  2LEG A;  1Z9H A;  1XWK A;  1O81 A;  2JZS A;  4MJA A;  3TJG A;  5ID2 B;  1K0B A;  1ABA A;  4OD7 A;  5B8A A;  2AJQ B;  3APO A;  3V1W A;  1H75 A;  3G9B A;  3DKS A;  3BOA A;  1BG1 A;  4I97 A;  1UN2 A;  5LNK e;  2H6Z A;  1B4P A;  1QUW A;  4EDZ A;  3P90 A;  4GRF A;  3DD3 A;  4O32 A;  4XS4 B;  1ZYQ B;  2H71 A;  5D8I A;  1X5E A;  4LLR A;  5CO3 A;  4MZC A;  4MZW A;  3LWA A;  4HJ2 A;  1TU8 A;  3I9V 2;  3F3Q A;  2HSH A;  2KOK A;  4NXI A;  1EEM A;  4HS1 A;  2HSN A;  2K8V A;  4QL9 A;  3HZ4 A;  1FW1 A;  3IAM 2;  1BX9 A;  1LJR A;  4ID0 A;  4EE0 A;  4ZL8 A;  5ECH B;  1OYJ A;  1FVK A;  2X64 A;  4ZBB A;  1TRU A;  3DVW A;  5DAL A;  3GX8 A;  1SKS B;  2VUP A;  3UL3 A;  1Y1U A;  4IQA A;  4J56 E;  4HZ4 A;  1K0C A;  2PER A;  3VPQ A;  4ML6 A;  5CP1 A;  5EPF A;  2L4Q A;  5AIS A;  3Q18 A;  2HQT A;  4KDU A;  4RI7 A;  2KHP A;  1SKW B;  1F37 A;  3M1G A;  4PNG A;  5KOX A;  1OC3 A;  1B9X C;  3TUE A;  1JLV A;  3O76 A;  4TRX A;  3BD2 A;  2KUC A;  2GSS A;  2A2P A;  5CRH A;  4IQ1 A;  3VPT A;  1R7H A;  2LRN A;  3O6T A;  5EL8 A;  3ME8 A;  4BVX A;  3H93 A;  1E6B A;  2O7K A;  4KF9 A;  4HZ2 A;  2P5Q A;  3GKN A;  1OKD A;  2NVL A;  1KBN A;  3CXG A;  3APS A;  4NWY A;  4BWS A;  5JCW A;  1PL2 A;  2HRF A;  3LGC A;  4O92 A;  3SBC A;  1V9W A;  4GQC A;  3KZQ A;  2PN8 A;  3Q74 A;  3GL5 A;  5IPH A;  2N5B A;  2MBS A;  1WMJ A;  3D5J A;  4EIP A;  2E7P A;  3MWH A;  3A5W A;  4JR6 A;  2C3Q A;  1VRS D;  5KN2 A;  2C0F A;  3FYG A;  4ZL9 A;  1SD8 A;  3LYK A;  2PUK C;  2YJ7 A;  2EFE A;  4EF0 A;  2ON5 A;  3G7I A;  1TXX A;  10GS A;  1YDK A;  3VWU A;  3QPM A;  2WS2 A;  3BCI A;  3ZVJ D;  4I5Q A;  4Z2U A;  2PMT A;  2HLS A;  1U88 A;  4AKH A;  3IA1 A;  5G5F A;  2H19 A;  2VCQ A;  2YWN A;  3CTG A;  4XS4 A;  3QD9 A;  1N2A A;  2PBJ A;  2C1Y A;  3EWL A;  5IMZ A;  1M9A A;  1WOU A;  2H6Y A;  4KCA A;  5DAK B;  3FZ4 A;  2LJA A;  4WBR D;  1PRX A;  5GAP D;  3CMI A;  2O85 A;  5COH A;  1TKD B;  2PWJ A;  1ZZY A;  4NAX A;  4GDF A;  4Z2R A;  1O85 A;  4IP6 A;  1MD3 A;  1F3A A;  2X4A A;  2IMI A;  2O5V A;  1YEP A;  2YOI A;  1I9D A;  1BED A;  3W8J A;  4ZIL A;  2AV4 A;  2PGT A;  4ML1 A;  3WD6 A;  5B6M A;  5FHI A;  2C8U A;  3C73 A;  4JRR A;  1OC8 A;  3L4N A;  5DVB A;  2O89 A;  3E3E A;  3JCM L;  2D2Z A;  3HVV A;  5CRW A;  5B8B A;  2FA8 A;  1JHB A;  1G0T A;  2DIY A;  2EIQ A;  1WP0 A;  6GSX A;  1JLW A;  3WT2 A;  1THX A;  1EEJ A;  4TR3 A;  1EOG A;  3Q19 A;  5BMU B;  4GCI A;  2GQL A;  4HQZ A;  5J41 A;  2O8V B;  4RI6 A;  1AQX A;  3W8S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...