5AIVA

Complex of human hematopoietic prostagandin d2 synthase (hh-pgds) in complex with an active site inhibitor.
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
198
structure length
198
Chain Sequence
PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTENTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords HEMATOPOIETIC PROSTAGLANDIN D SYNTHASE
publication title Identification of Indole Inhibitors of Human Hematopoietic Prostaglandin D2 Synthase (Hh-Pgds).
pubmed doi rcsb
source organism Homo sapiens
total genus 72
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2015-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5aivA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5aivA01
2B6MA 1SJZA 3GL5A 1M2AA 1I9DA 1OE8A 5G1LA 4FQUA 4PNFA 3DXBA 1SKWB 3TUEA 5ECSA 1OKDA 1AQVA 2GGTA 2PGTA 5ELGA 3QR6A 4LMWA 5LCZA 3ZFBA 4PURA 1U87A 2CX3A 4KDXA 3M9JA 2AB6A 1YEXA 5JCGA 4FYCA 1WJKA 1ILOA 1XWKA 3ZVJD 3KJYA 5CRDA 4PTSA 3DD3A 5ID2B 2G2QA 3S9FA 2GTUA 4Q5FA 3CTGA 5CRHA 1GSYA 1MD4A 2E2MA 3E0UA 5ENUA 1PMTA 2LKUA 4TVEA 4PUAA 5AGYA 3TCOA 5DQSA 1QQ2A 3IRAA 3F3QA 2FA8A 4RQXA 1K0NA 4YH2A 3MAKA 3HZ4A 2E0QA 4TR4A 4GQCA 3QAGA 1TOFA 2X8HA 2RUFA 4JRRA 1OYJA 4WBRD 2DIZA 4NPBA 2DJKA 2XPDA 4WF5A 2YWOA 4WF4A 3GV1A 4IVFA 5ECLB 4XS1A 3IE3A 3DVWA 4TR3A 1OC9A 2V32A 3US3A 2N5FA 3BOAA 5IMCA 2NVLA 1S3DA 2H74A 5C04A 3WT2A 2ON7A 1EZKA 2PVQA 1EEMA 5D73A 5JWRB 2WRTA 2H0IA 1N2AA 5F8BA 5HFGA 4KH7A 2TIRA 4F2IA 1GL8A 3CXGA 2F9SA 2H1DA 2IMKA 4K7NA 2OKAA 5J9BA 3IXRA 1K0BA 2JL4A 3IC4A 4FYBA 1TI1A 2GQKA 4ZXGA 5AN1A 2H0HA 2P31A 4AF2A 1FG4A 2VM2A 5CRGA 3OR5A 2VM1A 1BG5A 5F05A 1PX6A 4N30A 2AV4A 2L6DA 2H6YA 2CAIA 4ZBBA 2H1AA 1DE2A 4MZWA 1M9BA 3FK8A 3FZ9A 2QSIA 1ABAA 1V57A 5KEJA 2E2GA 1RQMA 4XTSA 2EIRA 13GSA 3KZQA 1EGOA 1K0MA 4EC0A 1AUCA 4AGSA 1HNAA 3F6FA 1Y6EA 4PQIA 5KN3A 5JWQB 4ECBA 2P5QA 1KNGA 3ME8A 1NM3A 2EIOA 3ZTLA 3VPTA 8GSSA 5LD0A 3DIEA 4NWYA 1THXA 5J9CA 4CHSA 3WGDA 1VGLA 3IAM2 1T4YA 4NXIA 1X0RA 4IJ3A 2YOIA 3FKFA 4N10A 5FWGA 1B9XC 1Z9HA 2H6ZA 2LJAA 2XC2A 3U5RE 2B5EA 4G0KA 4K0GA 4XIHA 4GQFA 4PGTA 4G0IA 2P0GA 1YY7A 3M1GA 2C3TA 1QUWA 2OE1A 1SJ6A 3ZITA 3MWHA 5ELAA 1V40A 5LNKe 1LJRA 2NBSA 1GRXA 1GTBA 4CW9A 2H70A 3Q74A 1SD8A 3GHAA 1HNBA 1B4PA 2VD0A 1JFUA 4KDUA 1R7HA 1G6WA 3I43A 4GTUA 3MSZA 3IDVA 4DSSB 5G1KA 5ECMB 2HE3A 2A2SA 5L71A 1UN2A 1WRYA 2MMOA 4TXVA 3CSJA 5HFIA 1YZXA 1SYRA 1EV4A 5G5EA 2OE0A 3UAPA 1BAYA 2YANA 4ZBDA 4POLA 9GSSA 1HQOA 3UMAA 1U88A 1Z7RA 3RPPA 4Q5NA 4XRDA 4PNGA 1H75A 2FLSA 2H8LA 4LLRA 2CVBA 1VF4A 4RI7A 4V2MA 4K2DA 1GNWA 2LRTA 2HXKA 1R4WA 4HQSA 1U3IA 3QAVA 4TRXA 1GWCA 3ZMLA 4L0WA 3A3TA 5B7CA 1EV9A 1HNCA 3J7Yb 4DSRA 3QPMA 1M0UA 1R26A 2CZ3A 4OWYA 1SU9A 4ZL9A 2G0FA 2GSQA 2BTOT 4WR5A 2PUKC 5IO2A 2J9HA 3UARA 3HA9A 4BWQA 4EE0A 4KNDA 2P5RA 4POKA 1DBYA 3R2QA 2VLVA 3DYRA 5CYYA 4ILFA 3W8JA 4XS6A 2VL3A 3DMLA 1G7EA 1YJ6A 2DJ1A 1TDIA 4EVMA 3DKSA 4ECJA 4HI7A 1GUMA 3ME7A 2HI7A 4I8BA 1GSEA 7GSSA 1OC8A 1XFLA 3KGKA 1K3YA 5DCGA 2V41A 2OADA 1NSWA 1BEDA 1GSSA 2M80A 5A4UA 3A2XA 4K9ZA 4ECIA 1USBA 4N0VA 3GSSA 4MF5A 2FWEA 1SL1B 3ZZXA 1QK8A 5ABRA 4XRAA 3J7Yk 5EY6A 2AHEA 3IBHA 1ZYQB 3KTBA 2AAWA 4K0NA 5D9WA 3FR6A 2FY6A 4BL7B 2KLXA 1NHYA 1DE1A 3PR8A 2R37A 2OJLA 3LJRA 1ZCPA 4ZL8A 2IPAA 1WMJA 1FB0A 5B6MA 2VL2A 1B48A 2ON5A 2HSMB 3APOA 4K8MA 1H4OA 3HDCA 2WB9A 3CBUA 3NOFA 1QXHA 1TRVA 3WGEA 2FNOA 2CV4A 3LYPA 2CX4A 4YAPA 1YEPA 3I9V2 1A8LA 4P3YB 2AYTA 4GCIA 1GSDA 4BWSA 4ZBAA 1A0RP 4E8HA 1XWCA 2JADA 3FHKA 4MPFA 3KM6A 1KTEA 2IJYA 1X9SB 2FWGA 4KF9A 3KD0A 1YKCA 2PVOC 4NHWA 1EP8A 1W89A 3GMFA 4MMMA 3TKQA 4EKZA 5KN0A 1TW9A 5FT3A 2H66A 2IFQB 4EDZA 3FZAA 4XCSA 1AW9A 1E6BA 4KGIA 3LGCA 3TRPA 3KH7A 2D2ZA 4QL9A 4EF0A 3UVHA 2YJHA 3QMXA 2GLRA 3M8NA 1UA5A 4DVCA 2DIYA 1QFNA 1TRUA 1ZOFA 5IIZA 4GSSA 3F0IA 2N5AA 4I2TA 3MNGA 2RLIA 2HZEA 4IBPA 4JBBA 2L4QA 4V1Ap 3VFIA 1XW9A 2R4VA 3WGXA 3HVVA 3RPNA 2LS5A 2F3MA 2GVPA 2IMEA 4MJBA 2CAQA 1URMA 3TB2A 3F3RA 1AQXA 1SYXA 2FHEA 2DMLA 4GSTA 2I81A 4ZIJA 4MZBA 1M99A 3EINA 2H6XA 4ID0A 1J9BA 1PQNA 2ES7A 1TU7A 4J57E 3G7YA 1X9MB 3G7JA 2F51A 2WCIA 4HU9A 3APQA 3A5WA 4TKYA 3E3EA 4KA0A 3FEUA 1EGRA 1WE0A 2VLTA 3GN3A 3APSA 4PX1A 2FGXA 1M2DA 1FW1A 1R5PA 2FCHA 22GSA 2I1UA 4ML6A 2VLUA 1C72A 1S3CA 3LEFA 2DJJA 3PINA 4TR0A 2VIMA 3HJOA 1V2AA 2OE3A 1MDIA 2LNTA 4G19A 4FYUA 1PSQA 4JU5A 6GSSA 1TXXA 4YAVA 1SD9A 3IPZA 4IKHA 4ZL7A 3HKRA 1GSUA 2OBKA 4X1UA 2IMFA 1PN9A 20GSA 2I4AA 4HUAA 3EMXA 5AIVA 6GSUA 4OO4A 2EIQA 2B1KA 2LSTA 4TR1B 1O8XA 3GA4A 1Z6MA 3GKNA 2IN3A 2C1YA 3LORA 5DAKB 3KP9A 4IJIA 3WT1A 2YPMA 4NV5A 2GSRA 3F4TA 2VCXA 2L5OA 4HJMA 2OACA 3LXZA 4OFMA 3C8EA 3FYGA 1WP0A 2HRKA 2ALBA 2H75A 2R2JA 5E4WA 1JLWA 2PPTA 1E2YA 4FO5A 1IYIA 6GSYA 2HSYA 1ML6A 3PPUA 4K6XA 3BCIA 1THOA 3N9JA 3TOUA 4WEYA 4L0UA 1K0DA 2C3QA 1T3BA 1T4ZA 5B8AA 3FRCA 2CA8A 3VWVA 2B7KA 4JE1A 1RW1A 2VCQA 1SJIA 1Q4JA 5A5KA 2B1LA 4N11A 2PU9C 3DEXA 2RIIA 1VF1A 1EOHA 3O3TA 1B9YC 2H76A 2REMA 3SWLA 1FVKA 3LWAA 10GSA 1GUKA 4TN8A 3GTUA 2HT9A 3CMIA 4L5LA 1MD3A 4EDYA 4TXOA 3WD6A 1TRSA 2XBQA 2X8GA 4KDYA 3C73A 1UVZA 1ON4A 4YQUA 2QGVA 2YZUA 1GSFA 4AJ6A 1O73A 1V9WA 2H19A 3GFKA 4G10A 4OD7A 2FA4A 1YF0A 4GSNA 3F63A 1GTUA 2GSTA 4OMVA 1OC9B 4I5QA 3KMOA 2R6KA 5HR3A 5A4WA 3D22A 4RQRA 2IWTA 2YNXA 1SK2A 2KUCA 3GH6A 1XWGA 3LQ7A 3TDGA 1IYHA 1W4VA 2K18A 2VOCA 5G30A 1F6MC 2MMNA 4ECCA 3GRXA 2JZRA 1GLQA 2VD1A 1PL2A 4MPGA 4PQHA 4ZB9A 3ERWA 3TJJA 4KAEA 4RI6A 1VF3A 3VURA 3FR3A 3G7IA 4EUYA 1YQ1A 1G0TA 3F8UA 3A2WA 3M0FA 1PKZA 1G6YA 3KP8A 2OA7A 4ACSA 3H8QA 5CO3A 1B8XA 2KHPA 3VK9A 1FB6A 1K3OA 3W6GA 2L59A 4O92A 2HNLA 2LV3A 1WWJA 5DDLA 4V1Ag 1WOUA 3LSZA 2K8VA 1ACVA 4MZCA 3CSHA 2NDOA 3TKRA 3HVXA 3W8SA 4KUNA 4V2NA 4X0XA 5HQPA 2L57A 4J56E 4ISDA 1SL2B 4NMUA 2O7KA 2X64A 2VL2C 5ECOB 3EVIA 4HZ2A 1XBSA 2F8FA 4MDCA 5INYA 4EXJA 3GX8A 1T8EB 3TJFA 1SL0B 4MH2A 1XCCA 4KSOA 4KCEA 2A2RA 1FVJA 5DALA 2VL9A 3A2VA 3GSTA 1BJXA 2I3YA 3H1NA 5HFKA 3GX0A 1PRXA 3KTLA 3KH9A 3UBKA 5F06A 3P2AA 5GZZB 3ZIVA 4BVYA 1MEKA 3EURA 2A4VA 4OCFA 5IMAA 5IMFA 2C80A 2MBSA 3ZL5A 4KB3A 2C8UA 2KP1A 4IP1A 2HRAA 4V2LA 3ZFLA 3DVXA 3D21A 5IPGA 2HRFA 2C0GA 4BVXA 5DVBA 2R5GA 1N8JA 1OAZA 5J3RA 4Q5QA 1AIUA 2YWMA 3RAZA 4D73A 2RUEA 3IV4A 4MF6A 4F82A 4IQAA 1TKDB 2LJRA 4JR4A 3VI7A 2WJUA 2MMAA 1QGVA 4GWRA 1UC7A 4MJEA 2V6OA 3F9UA 1M9AA 4IN0A 1XWAA 4YQVA 4L5OA 3BD2A 4I6XA 1YF1A 3EU3A 2M72A 3HXSA 2HYXA 5G2ZA 2JSYA 3D6IA 1ZGNA 2VCTA 2H0GA 2GDRA 2CVKA 1MDKA 1F3AA 2X99A 2GQLA 2GZPA 1GNEA 1EP7A 4JZQA 3R3EA 2R3XA 1CQGA 3UBLA 1K0AA 4J2FA 3UOMA 3BBYA 3ZIJA 2YP6A 4NHZA 1X5EA 3TKSA 4CDOA 4WBJA 4XHMA 2LNSA 1GULA 1V58A 1PKWA 1NW2A 4IQ1A 2V1MA 4MH3A 1XWBA 5H5SA 5GAND 5HR2A 2KP2A 4MF7A 3Q19A 2O8VB 2JU5A 3TKSE 5EVOA 5ID2A 1NHOA 1K3LA 1XXUA 1F2EA 3F4SA 1GTAA 2CQ9A 5F0GA 1T1VA 3PH9A 2DJ0A 2F8AA 1O81A 3GYKA 5CAXA 1F3BA 1KBNA 3HJPA 1A8YA 3HYPA 3GUSA 3IK7A 2DC5A 4O32A 3CRTA 4ZB6A 2QC7A 5J5NA 1Q98A 3IK9A 4KX4A 4F03A 2IL3A 2QKEA 1TI3A 4MA9A 5JCUA 2HRNA 1GH2A 2IMDA 3VI5A 4K7IA 3C7MA 1CQHA 5IOXA 2H71A 4ZB8A 2C3NA 5G31A 2GQMA 3UEMA 3VPQA 4HOJA 4MP4A 1XW6A 3FZ4A 3GL3A 4BPYA 4G0LA 1TK8B 3UL3A 2LQOA 5DJLA 2MZCA 5C00A 3FR9A 2VCZA 1PA3A 4JEDA 5DQYA 2H1GA 4MABA 2JZSA 1LBKA 4MLYA 2LRNA 4F0CA 4PQ1A 4QQ7A 5D9VA 4HJ2A 2WGRA 2C0FA 3C1SA 1EOGA 4EL1A 1OE7A 4I2UA 3IR4A 1PGTA 3RDWA 1PL1A 3QFAC 1JHBA 1X5CA 4G2EA 1AXDA 3QOUA 5CRWA 3LFLA 2PWJA 1ZZYA 3EE2A 3TGZA 1ERUA 2H01A 5ECHB 2FWHA 2VCWA 4WXTA 2AUVA 2VCVA 3Q18A 2RM6A 3TRQA 3VWUA 1RK4A 3JCML 3Q6OA 3MDKA 4NAXA 5IM9A 1EEJA 1GP1A 3GKXA 1HD2A 3EU4A 2HSHA 4LL1B 4HU7A 1FO5A 3BCKA 3L9SA 3D0ZA 3KIJA 2DBCA 1O8WA 3L9UA 3VWXA 1YDKA 2EC4A 1SK1A 3GIXA 1ZL9A 1ST9A 1WPIA 1DUGA 4FH8A 1M7TA 3LXTA 2K8SA 3P7XA 3I69A 3N5OA 5AISA 4ULXA 2IMIA 3FZ5A 5IMDA 2LRCA 4OFNA 5ECQB 1HYUA 4ZILA 1X9WB 1XOBA 1AAZA 1TJDA 3ZRDA 2TRXA 2OBIA 2FUG2 2LTKA 2GT6A 4GF0A 3RBTA 1JZDA 3HVSA 2V2GA 5COHA 1ERWA 17GSA 16GSA 2FWFA 5GSSA 2MBTA 3ZVJA 2WZ9A 1PD21 3UIWA 4DSSA 1AC1A 2HZEB 4F9ZA 4HZ4A 1SENA 1AQWA 2L5LA 3CSIA 3QDNA 2AJQB 2TRCP 5DJMA 4IHUA 4NV2A 1YKAA 4G9HA 2YZHA 1VRSD 1MTCA 1JZOA 5KN1A 3VWWA 2V6KA 1MDJA 2H1BA 4DEJA 4KE3A 3LYKA 4X43A 3HCZA 12GSA 3GKMA 3TKPA 1S3AA 2PBJA 5ECPB 2VUPA 1A2MA 4OCEA 1ZMAA 1SKRB 5EPFA 1SKSB 1XIYA 3O76A 3IAS2 5IQYA 5GAPD 4BA7A 4N0ZA 3IA1A 3NIVA 1LU4A 3HD5A 2M46A 3HJMA 4Z7XA 1OC3A 4POMA 4GLTA 5F07A 1U6TA 3H79A 5DBQA 3ISOA 2WS2A 3L0HA 2O89A 5B6NA 3H93A 2YV7A 2VO4A 5J41A 2HQTA 3BJ5A 1TU8A 3D5JA 4XS4A 3QD9A 4IP6A 3IC8A 2YV9A 2WDUA 3GURA 11GSA 3ERFA 2K6VA 3RHCA 4MK3A 4IW9A 5IMZA 3ERGA 3F4RA 3O6TA 2LEGA 2LJKA 1O7UA 3HHVA 4WETA 4OFTA 2LQQA 3GNJA 5EL8A 4IELA 2DJ2A 2GT5A 2NPBA 2YWNA 5ECKB 4K1FA 3M3MA 3FY7A 5HR0A 3K8NA 2MYGA 3CYNA 5J4UA 1I5GA 2H73A 2ZUPA 3KCMA 1KEBA 1Z5YE 4HDEA 4F0BA 1PX7A 2C0EA 1R5AA 5BMUA 3TOTA 1GSQA 2B5XA 2JZTA 3ED3A 4YQMA 5A4VA 1FAAA 4LL4B 6GSWA 2CVDA 3HZ8A 2HRKB 5IPHA 3C1RA 3TJGA 2B3SA 3QFBC 5ECNB 5E59A 1U3AA 3CRUA 4HS1A 1FOVA 1J0FA 1B4QA 2HLSA 3ZYWA 3H4KA 1XPVA 4OO5A 3KMNA 2FD3A 3C71A 1GLPA 4BL7A 4MCUA 3QAWA 2O85A 3EYTA 3FW2A 2E7PA 1JZRA 1XVWA 4GXZA 2H72A 3TKSC 4L8EA 2KOKA 1Z6NA 4Q5RA 2N5BA 4LA1A 2GSSA 4LMVA 3VLNA 1ZYEA 4JR6A 5D96A 2HSMA 3NZNA 1GUHA 1VF2A 5JWOB 2PN8A 3ZMKA 4KSMA 1WIKA 1T7PB 4QL7A 2UZ8A 1O85A 3GKKA 3EWLA 4EO3A 3GTUB 4WKWA 5CNWA 4I97A 4TXOB 1TTZA 5D9XA 1TK5B 3IHQA 3GH9A 5ECRB 1A0FA 5D9TA 2X8CA 3SBCA 4USSA 3V1WA 2PMTA 1SK0A 3TJKA 2J23A 5JCWA 4HEA2 4XS4B 4IGJA 2JACA 1DSBA 2I9HA 2XHFA 5FHIA 2GZZA 3CTFA 2IFQA 3DGQA 5CP1A 4AJ7A 1GTIA 3TJBA 4IS0A 3L4NA 3L78A 4ML1A 4DSQA 2B5YA 3EC3A 1TRWA 5HR1A 2DJ3A 19GSA 3RHBA 4TOPA 2BMXA 5AIXA 4O5RA 3EMPA 2LUSA 5CREA 2L6CA 1ERVA 1XVQA 2DSAA 3P90A 6GSXA 4H86A 1BX9A 1X5DA 1O6JA 1EWXA 3QCPA 5H5RA 4O7HA 2ZNMA 1V98A 4POBA 1F9MA 3P8WA 4WR4A 2WULA 4GRFA 3LG6A 1XW5A 1Y25A 4TW5A 2HSNB 2DMMA 5IOWA 3U6VA 4AJ8A 1TP9A 1K0OA 3KXOA 5ECIB 6GSTA 2K9FA 2Z9SA 4K7OA 1A24A 4PXOA 1BQ7A 5DCHA 2VAFA 1TK0B 2PERA 1JLVA 2YN1A 1BYEA 1OKTA 3TRXA 5GSTA 3UJ1A 2B7JA 4KW6A 2HFDA 2L4CA 1FHEA 6GSVA 2C4JA 1XOAA 2O87A 4HQZA 1F37A 2C0DA 5D93A 1Z7PA 2RM5A 2YWIA 5IO0A 5DALB 1JZWA 1T00A 1A2LA 1QMVA 3ZREA 3WYWA 14GSA 4FIWA 3D4MA 4RUVA 5B8BA 2IIYA 3M9KA 1OVNA 5IMVA 2YJ7A 4BVYB 1K0CA 3IOSA 3DWVA 3AY8A 2GS3A 2XBIA 3D4TA 3G9BA 1XZOA 5KN2A 2CT6A 5G5FA 2BJXA 1J08A 3I6AA 2NTOA 4E8EA 3E9JB 2ZCTA 2H30A 2HZFA 3HY2A 1M2BA 2XPEA 4MJCA 2CZ2A 3PGTA 2DLXA 4MJAA 4BVXB 3UVTA 4KCAA 4D73B 4PUFC 3F6DA 2WFCA 1A2JA 5H5QA 4TR1A 3KEBA 3ZLPA 2JSZA 2MMZA 18GSA 1ERTA 1Z3EA 1G7OA 2GZYA 5DAKA 3L9VA 1A23A 2YCDA 5D8IA 3DRNA
chains in the Genus database with same CATH superfamily
2B6MA 1SJZA 3GL5A 1M2AA 1I9DA 1OE8A 5G1LA 4FQUA 4PNFA 3DXBA 1SKWB 3TUEA 5J4VA 5ECSA 1OKDA 1AQVA 2GGTA 2WVZA 2PGTA 1PN0A 5ELGA 3QR6A 4LMWA 5LCZA 3ZFBA 4PURA 1U87A 2CX3A 4KDXA 3M9JA 2AB6A 1YEXA 5JCGA 4FYCA 1WJKA 1ILOA 1XWKA 3ZVJD 3KJYA 5CRDA 4PTSA 3DD3A 5ID2B 2G2QA 3S9FA 2GTUA 4Q5FA 3CTGA 5CRHA 1GSYA 1MD4A 2E2MA 3E0UA 5ENUA 1PMTA 2LKUA 2X49A 4TVEA 4PUAA 5AGYA 3TCOA 5DQSA 1QQ2A 3IRAA 3F3QA 2FA8A 4HSCX 4RQXA 1K0NA 4YH2A 3MAKA 3HZ4A 2E0QA 4TR4A 4GQCA 4CY8A 3QAGA 1TOFA 2X8HA 2RUFA 4JRRA 1OYJA 4WBRD 2DIZA 4NPBA 2DJKA 2XPDA 4WF5A 2YWOA 4WF4A 3GV1A 2EFCA 4IVFA 2UV8G 5ECLB 5J4YA 4XS1A 3IE3A 3DVWA 4TR3A 1OC9A 2V32A 3US3A 2N5FA 3BOAA 5IMCA 2NVLA 1S3DA 2H74A 5C04A 3WT2A 2ON7A 1EZKA 2PVQA 4AI6A 1EEMA 5D73A 5JWRB 2WRTA 2H0IA 1N2AA 5F8BA 5HFGA 4KH7A 2TIRA 4F2IA 1GL8A 3CXGA 2F9SA 2H1DA 2IMKA 4K7NA 2OKAA 5J9BA 5A5HB 3IXRA 1K0BA 2JL4A 3IC4A 4FYBA 1TI1A 2GQKA 4ZXGA 5AN1A 2H0HA 2P31A 4AF2A 1FG4A 2VM2A 5CRGA 4EIQA 3OR5A 2VM1A 1BG5A 5F05A 1PX6A 4N30A 2AV4A 2L6DA 2H6YA 2CAIA 4ZBBA 2H1AA 2OT3A 1DE2A 4MZWA 1M9BA 3CQFA 3FK8A 3FZ9A 2QSIA 1ABAA 1V57A 5KEJA 2E2GA 1RQMA 4XTSA 2EIRA 13GSA 3KZQA 1EGOA 1K0MA 4EC0A 1AUCA 4AGSA 1HNAA 3F6FA 1Y6EA 4PQIA 5KN3A 5JWQB 4ECBA 2P5QA 1KNGA 3ME8A 1NM3A 2EIOA 3ZTLA 3VPTA 8GSSA 5LD0A 3DIEA 4NWYA 1THXA 5J9CA 4CHSA 3WGDA 1VGLA 3IAM2 1T4YA 4NXIA 1X0RA 4IJ3A 2YOIA 3FKFA 4N10A 5FWGA 4A5PA 1B9XC 1Z9HA 2H6ZA 2LJAA 2XC2A 3U5RE 2B5EA 4G0KA 4K0GA 4AKHA 4XIHA 4GQFA 4PGTA 4G0IA 2P0GA 1YY7A 3M1GA 2C3TA 1QUWA 1ZYPA 2OE1A 1SJ6A 3ZITA 3MWHA 5ELAA 1V40A 5LNKe 1LJRA 2NBSA 1GRXA 1GTBA 4CW9A 2H70A 3Q74A 1SD8A 3GHAA 1HNBA 1B4PA 2VD0A 3LW9A 1JFUA 4KDUA 1R7HA 1G6WA 3I43A 4GTUA 3MSZA 3IDVA 4DSSB 5G1KA 5ECMB 2HE3A 2A2SA 5L71A 1UN2A 1WRYA 2MMOA 4TXVA 3CSJA 5HFIA 1YZXA 1SYRA 2WW3A 1EV4A 5G5EA 2OE0A 3UAPA 1BAYA 2YANA 4ZBDA 1XG8A 4POLA 9GSSA 1HQOA 3UMAA 1U88A 1Z7RA 3RPPA 4Q5NA 4XRDA 4PNGA 1H75A 2FLSA 5A1NA 2DKIA 2H8LA 4LLRA 2CVBA 1VF4A 4RI7A 4V2MA 4K2DA 1GNWA 2O5VA 2LRTA 2HXKA 1R4WA 4HQSA 1U3IA 3QAVA 4TRXA 1GWCA 2WVXA 3ZMLA 4L0WA 3A3TA 5B7CA 1EV9A 1HNCA 3J7Yb 4DSRA 3QPMA 1M0UA 1R26A 4BIKA 2CZ3A 4OWYA 1SU9A 4ZL9A 2G0FA 3RGBC 2GSQA 2BTOT 4WR5A 2PUKC 5IO2A 1PFOA 2J9HA 3UARA 3HA9A 4BWQA 4EE0A 4KNDA 2P5RA 4POKA 1DBYA 3R2QA 2VLVA 3DYRA 5CYYA 4ILFA 3W8JA 4XS6A 2VL3A 3DMLA 1G7EA 1SVMA 1YJ6A 2DJ1A 1TDIA 4N3ZA 4EVMA 3DKSA 4ECJA 4HI7A 1GUMA 3ME7A 2HI7A 4I8BA 1GSEA 7GSSA 1OC8A 1XFLA 3KGKA 1K3YA 5DCGA 2V41A 2OADA 1NSWA 1BEDA 1GSSA 2M80A 5A4UA 3A2XA 4K9ZA 5BMUB 4ECIA 1USBA 4N0VA 3GSSA 4MF5A 2FWEA 1SL1B 5BRTA 3ZZXA 1QK8A 5ABRA 4XRAA 3J7Yk 5EY6A 2AHEA 3IBHA 1ZYQB 4PHZC 3KTBA 2AAWA 4K0NA 5D9WA 3FR6A 2FY6A 4BL7B 2KLXA 1NHYA 1DE1A 4CY6A 3PR8A 2R37A 2OJLA 3LJRA 1ZCPA 4ZL8A 2IPAA 1WMJA 1FB0A 5B6MA 2VL2A 1B48A 2ON5A 2HSMB 3APOA 4K8MA 1H4OA 3HDCA 2WB9A 3CBUA 3NOFA 1QXHA 1TRVA 3WGEA 2FNOA 2CV4A 3LYPA 2CX4A 4YAPA 2WW2A 1YEPA 3I9V2 1A8LA 4P3YB 2AYTA 4AKXB 4GCIA 1GSDA 4BWSA 4ZBAA 1BF5A 1A0RP 4E8HA 1XWCA 2JADA 3FHKA 4MPFA 3KM6A 1KTEA 2IJYA 1X9SB 2FWGA 4KF9A 3KD0A 1YKCA 2PVOC 4NHWA 1EP8A 1W89A 3GMFA 4MMMA 3TKQA 4EKZA 5KN0A 1TW9A 5FT3A 2H66A 2IFQB 4EDZA 3FZAA 4XCSA 1AW9A 1E6BA 4KGIA 3A5IA 3LGCA 3TRPA 3KH7A 2D2ZA 4QL9A 4EF0A 3UVHA 2YJHA 3QMXA 2GLRA 3M8NA 1UA5A 4DVCA 2DIYA 1QFNA 1TRUA 1ZOFA 5IIZA 4GSSA 3F0IA 2N5AA 4I2TA 3MNGA 2RLIA 2HZEA 4IBPA 4JBBA 2L4QA 3MYDA 4ICYA 4V1Ap 3VFIA 1XW9A 2R4VA 3WGXA 3HVVA 3RPNA 2LS5A 2F3MA 2GVPA 2IMEA 4MJBA 2CAQA 1URMA 3TB2A 3F3RA 1AQXA 1SYXA 2FHEA 2DMLA 4GSTA 2I81A 4ZIJA 4MZBA 1M99A 3EINA 2H6XA 4ID0A 1J9BA 1PQNA 2ES7A 1TU7A 4J57E 3G7YA 1X9MB 4FXYP 3G7JA 2F51A 2WCIA 4HU9A 3APQA 3A5WA 4TKYA 3E3EA 4KA0A 3FEUA 1EGRA 1WE0A 2VLTA 3GN3A 3APSA 4PX1A 2FGXA 1M2DA 1FW1A 1R5PA 2FCHA 22GSA 2I1UA 4ML6A 1ZYNA 2VLUA 1C72A 1S3CA 3LEFA 2DJJA 3PINA 4TR0A 2VIMA 3HJOA 1V2AA 2O36A 2OE3A 1MDIA 2LNTA 4G19A 4FYUA 1PSQA 5A34B 4JU5A 6GSSA 1TXXA 4YAVA 1SD9A 3IPZA 4IKHA 4ZL7A 3HKRA 2R0GA 1GSUA 2OBKA 4X1UA 2IMFA 1PN9A 20GSA 2H1LA 2I4AA 4HUAA 3EMXA 5AIVA 6GSUA 4OO4A 2EIQA 2B1KA 2LSTA 4TR1B 1O8XA 3GA4A 1Z6MA 3GKNA 2IN3A 2C1YA 3LORA 5DAKB 3KP9A 4IJIA 3WT1A 2YPMA 4NV5A 2GSRA 3F4TA 2VCXA 3EPTA 2L5OA 4HJMA 2OACA 3LXZA 4OFMA 3C8EA 3FYGA 1WP0A 2HRKA 2ALBA 2H75A 2R2JA 1SVLA 5E4WA 1JLWA 2A4HA 2PPTA 1E2YA 4FO5A 4YKFA 2WW0A 1IYIA 1TXUA 6GSYA 2HSYA 1ML6A 3PPUA 4K6XA 3BCIA 1THOA 3N9JA 3TOUA 4WEYA 4L0UA 1K0DA 2C3QA 1T3BA 1T4ZA 5B8AA 3FRCA 2CA8A 3VWVA 2B7KA 4JE1A 1RW1A 2VCQA 1SJIA 1Q4JA 2VKZG 5A5KA 2B1LA 3HVNA 4N11A 2PU9C 3DEXA 3MIXA 2RIIA 1VF1A 1EOHA 3O3TA 1B9YC 2H76A 2REMA 3SWLA 1FVKA 3LWAA 10GSA 1GUKA 4TN8A 3GTUA 2HT9A 3CMIA 4L5LA 1MD3A 4EDYA 4TXOA 3WD6A 4K5SA 1TRSA 2XBQA 2X8GA 4KDYA 3C73A 1UVZA 1ON4A 4YQUA 2QGVA 2YZUA 1GSFA 4AJ6A 1O73A 1V9WA 2H19A 3GFKA 4G10A 4OD7A 2FA4A 1YF0A 4GSNA 3F63A 1M3IA 3RFRC 1GTUA 2GSTA 4OMVA 1OC9B 4I5QA 3KMOA 2R6KA 5HR3A 5A4WA 3D22A 4RQRA 2IWTA 2YNXA 4O5UA 1SK2A 2KUCA 3GH6A 1XWGA 3LQ7A 3TDGA 1IYHA 1W4VA 2K18A 2VOCA 5G30A 1F6MC 2MMNA 4ECCA 3GRXA 2JZRA 1GLQA 2VD1A 1PL2A 4MPGA 4PQHA 4ZB9A 3ERWA 3TJJA 4KAEA 4RI6A 1VF3A 3CHXC 3VURA 3FR3A 3G7IA 4EUYA 1YQ1A 1G0TA 3F8UA 3A2WA 3M0FA 1PKZA 1G6YA 3KP8A 2OA7A 4ACSA 3H8QA 5CO3A 1B8XA 2KHPA 3VK9A 1FB6A 1K3OA 3W6GA 2L59A 4O92A 2HNLA 2HSNA 2LV3A 1WWJA 5DDLA 4V1Ag 1WOUA 3LSZA 2EFDA 2K8VA 1ACVA 1YEWC 4MZCA 3CSHA 2NDOA 3TKRA 3HVXA 3W8SA 4KUNA 4V2NA 4X0XA 5HQPA 2L57A 4J56E 4ISDA 1SL2B 4NMUA 2O7KA 2X64A 1BG1A 2VL2C 5ECOB 3EVIA 4HZ2A 1XBSA 2F8FA 4MDCA 5INYA 4EXJA 3GX8A 1T8EB 3TJFA 1SL0B 4MH2A 1XCCA 4KSOA 4KCEA 2A2RA 1FVJA 5DALA 2VL9A 3A2VA 3GSTA 1BJXA 2I3YA 3H1NA 5HFKA 3GX0A 1PRXA 3KTLA 3KH9A 3UBKA 5F06A 3P2AA 5GZZB 3ZIVA 4BVYA 1MEKA 3EURA 2A4VA 4AKGA 4OCFA 5IMAA 5IMFA 2C80A 2MBSA 3ZL5A 4KB3A 2C8UA 2KP1A 2WZSA 4IP1A 2HRAA 3FMWA 4V2LA 3ZFLA 3DVXA 3D21A 5IPGA 2HRFA 2C0GA 4BVXA 5DVBA 2R5GA 1N8JA 1OAZA 5J3RA 4Q5QA 1AIUA 2YWMA 3RAZA 4D73A 2RUEA 3IV4A 4MF6A 4F82A 4IQAA 3HMJG 1TKDB 2LJRA 4JR4A 3VI7A 2WJUA 2MMAA 1QGVA 4GWRA 1UC7A 4MJEA 2V6OA 3F9UA 1M9AA 4IN0A 1XWAA 4YQVA 4L5OA 3BD2A 4I6XA 1YF1A 3EU3A 2M72A 3HXSA 2HYXA 5G2ZA 2JSYA 3D6IA 1ZGNA 2VCTA 2H0GA 4E68A 2GDRA 2CVKA 1MDKA 1F3AA 2X99A 2GQLA 2GZPA 1GNEA 1EP7A 4JZQA 3R3EA 2R3XA 1CQGA 3UBLA 1K0AA 4J2FA 3UOMA 3BBYA 3ZIJA 2YP6A 4NHZA 1X5EA 3TKSA 4CDOA 4WBJA 4XHMA 2LNSA 1GULA 1YVLA 1V58A 1PKWA 1NW2A 4IQ1A 2V1MA 4MH3A 1XWBA 5A1NB 5H5SA 5GAND 5HR2A 2KP2A 4MF7A 3Q19A 2O8VB 2JU5A 3TKSE 4Z2TA 5EVOA 5ID2A 1NHOA 1K3LA 1XXUA 1F2EA 3F4SA 1GTAA 2CQ9A 2WVXB 5F0GA 1T1VA 3PH9A 2DJ0A 2F8AA 1O81A 3GYKA 5CAXA 1F3BA 4QMKA 1KBNA 3HJPA 1A8YA 3HYPA 3GUSA 3IK7A 2DC5A 4O32A 3CRTA 2EFHA 4ZB6A 2QC7A 5J5NA 1Q98A 3IK9A 4KX4A 4F03A 2IL3A 1M3JA 2QKEA 1TI3A 4MA9A 5JCUA 2HRNA 1GH2A 2IMDA 3VI5A 4K7IA 3C7MA 1CQHA 5IOXA 2H71A 4ZB8A 2C3NA 5G31A 1FOHA 2GQMA 3UEMA 4G01A 4W66A 4HOJA 4MP4A 3VPQA 1XW6A 3FZ4A 3GL3A 3TU3B 4BPYA 4G0LA 4PI0C 1TK8B 1N25A 3UL3A 2LQOA 5DJLA 2DKHA 5A5HA 2MZCA 5C00A 3FR9A 2VCZA 1PA3A 4JEDA 5DQYA 2H1GA 4MABA 2JZSA 1LBKA 4MLYA 2LRNA 4F0CA 4PQ1A 4QQ7A 5D9VA 4HJ2A 2WGRA 2C0FA 3C1SA 1EOGA 4EL1A 1OE7A 4I2UA 3IR4A 1PGTA 3RDWA 1PL1A 3QFAC 1JHBA 1X5CA 4G2EA 1AXDA 3QOUA 5CRWA 3LFLA 2PWJA 1ZZYA 3EE2A 3TGZA 1ERUA 2H01A 5ECHB 2FWHA 2VCWA 4WXTA 2AUVA 2VCVA 4Z2RA 3Q18A 2RM6A 3TRQA 3VWUA 1RK4A 3JCML 3Q6OA 3MDKA 4NAXA 5IM9A 1EEJA 1GP1A 3GKXA 1HD2A 3EU4A 2HSHA 4LL1B 4HU7A 1FO5A 3BCKA 3L9SA 3D0ZA 3KIJA 4K2XA 2DBCA 1O8WA 3L9UA 3VWXA 5KOXA 1Y1UA 1YDKA 2EC4A 1SK1A 3GIXA 1ZL9A 1ST9A 1WPIA 1DUGA 2WVYA 4FH8A 1M7TA 3LXTA 2K8SA 3P7XA 3I69A 3N5OA 5AISA 4ULXA 2IMIA 3FZ5A 5IMDA 2LRCA 4OFNA 5ECQB 1HYUA 4ZILA 1X9WB 1XOBA 1AAZA 1TJDA 3ZRDA 2TRXA 2OBIA 2FUG2 2LTKA 2GT6A 4GF0A 3RBTA 1JZDA 3HVSA 2V2GA 1S3RA 5COHA 1ERWA 17GSA 16GSA 2FWFA 5GSSA 2MBTA 2O3EA 3ZVJA 2WZ9A 1PD21 3UIWA 4DSSA 1AC1A 2HZEB 4F9ZA 4HZ4A 1SENA 1AQWA 2L5LA 3CSIA 3QDNA 2AJQB 2TRCP 5DJMA 4IHUA 4NV2A 1YKAA 4G9HA 2YZHA 1VRSD 1MTCA 1JZOA 5KN1A 3VWWA 2V6KA 1MDJA 5KOWA 2H1BA 4DEJA 4KE3A 3LYKA 4X43A 3HCZA 12GSA 3GKMA 3TKPA 1S3AA 2PBJA 4YKGA 5ECPB 2VUPA 1A2MA 4OCEA 1ZMAA 1SKRB 5EPFA 1SKSB 1XIYA 3O76A 3IAS2 5IQYA 5GAPD 4BA7A 4N0ZA 4X4JA 3IA1A 3NIVA 1LU4A 3HD5A 2M46A 3HJMA 4Z7XA 1OC3A 4POMA 4GLTA 5F07A 1U6TA 3H79A 5DBQA 3ISOA 2WS2A 3L0HA 2O89A 5B6NA 3H93A 2YV7A 2VO4A 5J41A 2HQTA 3BJ5A 1TU8A 3D5JA 4XS4A 3QD9A 4IP6A 1SVOA 3IC8A 2YV9A 2WDUA 2X4AA 4PI2C 3GURA 11GSA 3ERFA 2K6VA 3RHCA 4MK3A 4IW9A 5IMZA 3ERGA 3F4RA 3O6TA 2LEGA 2LJKA 1O7UA 3HHVA 4WETA 4OFTA 2LQQA 3GNJA 5EL8A 4IELA 2DJ2A 2GT5A 2NPBA 2YWNA 1I1IP 5ECKB 4K1FA 3M3MA 3FY7A 5HR0A 3K8NA 2MYGA 3CYNA 5J4UA 1I5GA 2H73A 2ZUPA 3KCMA 4GDFA 5J47A 1KEBA 1Z5YE 4HDEA 4F0BA 1PX7A 2C0EA 1R5AA 5BMUA 2WW1A 2R0PA 3TOTA 1GSQA 2B5XA 2JZTA 3ED3A 4YQMA 5A4VA 1FAAA 4LL4B 6GSWA 2CVDA 3HZ8A 2HRKB 5IPHA 3C1RA 3TJGA 2B3SA 3QFBC 5ECNB 5E59A 1U3AA 3IHGA 3CRUA 4HS1A 2R0CA 1FOVA 1J0FA 4EIPA 1B4QA 2HLSA 3ZYWA 3H4KA 1XPVA 4OO5A 3KMNA 2FD3A 3C71A 1GLPA 4BL7A 4MCUA 3QAWA 2O85A 3EYTA 3FW2A 2E7PA 1JZRA 1XVWA 4GXZA 4O5QA 2H72A 3TKSC 4L8EA 2KOKA 1Z6NA 4Q5RA 2N5BA 4LA1A 2GSSA 4LMVA 3VLNA 1ZYEA 4JR6A 5D96A 2HSMA 3NZNA 1GUHA 1VF2A 5JWOB 3CWGA 2PN8A 3ZMKA 4KSMA 1WIKA 1T7PB 4QL7A 2UZ8A 1O85A 3GKKA 3EWLA 4EO3A 3GTUB 4WKWA 5CNWA 4I97A 4TXOB 1TTZA 5D9XA 4MNNA 1TK5B 3IHQA 3GH9A 5ECRB 1A0FA 5D9TA 2X8CA 3SBCA 4USSA 3V1WA 2PMTA 1SK0A 3TJKA 2J23A 5JCWA 4HEA2 4XS4B 4IGJA 2JACA 1DSBA 2I9HA 2XHFA 5FHIA 2GZZA 4Z2UA 3CTFA 2IFQA 3DGQA 5CP1A 4AJ7A 1GTIA 3TJBA 4IS0A 3L4NA 3L78A 4ML1A 4DSQA 2B5YA 3EC3A 1TRWA 2QA1A 5HR1A 2DJ3A 19GSA 3RHBA 4TOPA 2BMXA 5AIXA 4O5RA 3EMPA 2LUSA 5CREA 2L6CA 1ERVA 1XVQA 2DSAA 3P90A 6GSXA 4H86A 1BX9A 2A2PA 1X5DA 1O6JA 1EWXA 4AKIA 3QCPA 5H5RA 4O7HA 2ZNMA 1V98A 4POBA 1F9MA 3P8WA 4WR4A 2WULA 2QA2A 4K5RA 4GRFA 3LG6A 1XW5A 1Y25A 4TW5A 2HSNB 2DMMA 5IOWA 3U6VA 4AJ8A 1TP9A 1K0OA 3KXOA 5ECIB 6GSTA 2K9FA 2Z9SA 4K7OA 1A24A 4PXOA 1BQ7A 5DCHA 2VAFA 1TK0B 2PERA 1JLVA 2YN1A 1BYEA 1OKTA 3TRXA 5GSTA 3UJ1A 2B7JA 4KW6A 2HFDA 2L4CA 1S4BP 1FHEA 6GSVA 2C4JA 1XOAA 2O87A 4HQZA 1F37A 2C0DA 5D93A 1Z7PA 2RM5A 2YWIA 5IO0A 5DALB 1JZWA 1T00A 1A2LA 1QMVA 3ZREA 3WYWA 14GSA 4FIWA 3D4MA 4RUVA 5B8BA 2IIYA 3M9KA 1OVNA 5IMVA 2YJ7A 4BVYB 1K0CA 3IOSA 3DWVA 3AY8A 2GS3A 5A34A 2XBIA 3D4TA 3G9BA 1XZOA 5KN2A 2CT6A 5G5FA 2BJXA 1J08A 3I6AA 2NTOA 4E8EA 3E9JB 2ZCTA 2H30A 2HZFA 3HY2A 1M2BA 4ZB7A 2XPEA 4MJCA 2CZ2A 3PGTA 2DLXA 4MJAA 4BVXB 3UVTA 4KCAA 4D73B 2EFEA 4PUFC 3F6DA 2WFCA 1A2JA 5H5QA 4TR1A 3KEBA 5J40A 3ZLPA 2JSZA 2MMZA 18GSA 1ERTA 1Z3EA 1G7OA 2GZYA 5DAKA 3L9VA 1A23A 2YCDA 5D8IA 3DRNA
chains in the Genus database with same CATH topology
2B6MA 1SJZA 3GL5A 1M2AA 1I9DA 1OE8A 5G1LA 4FQUA 4PNFA 3DXBA 1SKWB 3TUEA 5J4VA 5ECSA 1OKDA 1AQVA 2GGTA 2PGTA 1PN0A 5ELGA 3QR6A 4LMWA 5LCZA 3ZFBA 4PURA 1U87A 2CX3A 4KDXA 3M9JA 2AB6A 1YEXA 5JCGA 4FYCA 1WJKA 1ILOA 1XWKA 3ZVJD 3KJYA 5CRDA 4PTSA 3DD3A 5ID2B 2G2QA 3S9FA 2GTUA 4Q5FA 3CTGA 5CRHA 1GSYA 1MD4A 2E2MA 3E0UA 5ENUA 1PMTA 2LKUA 2X49A 4TVEA 4PUAA 5AGYA 3TCOA 5DQSA 1QQ2A 3IRAA 3F3QA 2FA8A 4RQXA 1K0NA 4YH2A 3MAKA 3HZ4A 2E0QA 4TR4A 4GQCA 4CY8A 3QAGA 1TOFA 2X8HA 2RUFA 4JRRA 1OYJA 4WBRD 2DIZA 4NPBA 2DJKA 2XPDA 4WF5A 2YWOA 4WF4A 3GV1A 2EFCA 4IVFA 2UV8G 5ECLB 5J4YA 4XS1A 3IE3A 3DVWA 4TR3A 1OC9A 2V32A 3US3A 2N5FA 3BOAA 5IMCA 2NVLA 1S3DA 2H74A 5C04A 3WT2A 2ON7A 1EZKA 2PVQA 4AI6A 1EEMA 5D73A 5JWRB 2WRTA 2H0IA 1N2AA 5F8BA 5HFGA 4KH7A 2TIRA 4F2IA 1GL8A 3CXGA 2F9SA 2H1DA 2IMKA 4K7NA 2OKAA 5J9BA 5A5HB 3IXRA 1K0BA 2JL4A 3IC4A 4FYBA 1TI1A 2GQKA 4ZXGA 5AN1A 2H0HA 2P31A 4AF2A 1FG4A 2VM2A 5CRGA 4EIQA 3OR5A 2VM1A 1BG5A 5F05A 1PX6A 4N30A 2AV4A 2L6DA 2H6YA 2CAIA 4ZBBA 2H1AA 2OT3A 1DE2A 4MZWA 1M9BA 3FK8A 3FZ9A 2QSIA 1ABAA 1V57A 5KEJA 2E2GA 1RQMA 4XTSA 2EIRA 13GSA 3KZQA 1EGOA 1K0MA 4EC0A 1AUCA 4AGSA 1HNAA 3F6FA 1Y6EA 4PQIA 5KN3A 5JWQB 4ECBA 2P5QA 1KNGA 3ME8A 1NM3A 2EIOA 3ZTLA 3VPTA 8GSSA 5LD0A 3DIEA 4NWYA 1THXA 5J9CA 4CHSA 3WGDA 1VGLA 3IAM2 1T4YA 4NXIA 1X0RA 4IJ3A 2YOIA 3FKFA 4N10A 5FWGA 4A5PA 1B9XC 1Z9HA 2H6ZA 2LJAA 2XC2A 3U5RE 2B5EA 4G0KA 4K0GA 4AKHA 4XIHA 4GQFA 4PGTA 4G0IA 2P0GA 1YY7A 3M1GA 2C3TA 1QUWA 1ZYPA 2OE1A 1SJ6A 3ZITA 3MWHA 5ELAA 1V40A 5LNKe 1LJRA 2NBSA 1GRXA 1GTBA 4CW9A 2H70A 3Q74A 1SD8A 3GHAA 1HNBA 1B4PA 2VD0A 3LW9A 1JFUA 4KDUA 1R7HA 1G6WA 3I43A 4GTUA 3MSZA 3IDVA 4DSSB 5G1KA 5ECMB 2HE3A 2A2SA 5L71A 1UN2A 1WRYA 2MMOA 4TXVA 3CSJA 5HFIA 1YZXA 1SYRA 1EV4A 5G5EA 2OE0A 3UAPA 1BAYA 2YANA 4ZBDA 4POLA 9GSSA 1HQOA 3UMAA 1U88A 1Z7RA 3RPPA 4Q5NA 4XRDA 4PNGA 1H75A 2FLSA 5A1NA 2DKIA 2H8LA 4LLRA 2CVBA 1VF4A 4RI7A 4V2MA 4K2DA 1GNWA 2O5VA 2LRTA 2HXKA 1R4WA 4HQSA 1U3IA 3QAVA 4TRXA 1GWCA 3ZMLA 4L0WA 3A3TA 5B7CA 1EV9A 1HNCA 3J7Yb 4DSRA 3QPMA 1M0UA 1R26A 2CZ3A 4OWYA 1SU9A 4ZL9A 2G0FA 2GSQA 2BTOT 4WR5A 2PUKC 5IO2A 2J9HA 3UARA 3HA9A 4BWQA 4EE0A 4KNDA 2P5RA 4POKA 1DBYA 3R2QA 2VLVA 3DYRA 5CYYA 4ILFA 3W8JA 4XS6A 2VL3A 3DMLA 1G7EA 1SVMA 1YJ6A 2DJ1A 1TDIA 4N3ZA 4EVMA 3DKSA 4ECJA 4HI7A 1GUMA 3ME7A 2HI7A 4I8BA 1GSEA 7GSSA 1OC8A 1XFLA 3KGKA 1K3YA 5DCGA 2V41A 2OADA 1NSWA 1BEDA 1GSSA 2M80A 5A4UA 3A2XA 4K9ZA 5BMUB 4ECIA 1USBA 4N0VA 3GSSA 4MF5A 2FWEA 1SL1B 5BRTA 3ZZXA 1QK8A 5ABRA 4XRAA 3J7Yk 5EY6A 2AHEA 3IBHA 1ZYQB 3KTBA 2AAWA 4K0NA 5D9WA 3FR6A 2FY6A 4BL7B 2KLXA 1NHYA 1DE1A 4CY6A 3PR8A 2R37A 2OJLA 3LJRA 1ZCPA 4ZL8A 2IPAA 1WMJA 1FB0A 5B6MA 2VL2A 1B48A 2ON5A 2HSMB 3APOA 4K8MA 1H4OA 3HDCA 2WB9A 3CBUA 3NOFA 1QXHA 1TRVA 3WGEA 2FNOA 2CV4A 3LYPA 2CX4A 4YAPA 1YEPA 3I9V2 1A8LA 4P3YB 2AYTA 4AKXB 4GCIA 1GSDA 4BWSA 4ZBAA 1BF5A 1A0RP 4E8HA 1XWCA 2JADA 3FHKA 4MPFA 3KM6A 1KTEA 2IJYA 1X9SB 2FWGA 4KF9A 3KD0A 1YKCA 2PVOC 4NHWA 1EP8A 1W89A 3GMFA 4MMMA 3TKQA 4EKZA 5KN0A 1TW9A 5FT3A 2H66A 2IFQB 4EDZA 3FZAA 4XCSA 1AW9A 1E6BA 4KGIA 3A5IA 3LGCA 3TRPA 3KH7A 2D2ZA 4QL9A 4EF0A 3UVHA 2YJHA 3QMXA 2GLRA 3M8NA 1UA5A 4DVCA 2DIYA 1QFNA 1TRUA 1ZOFA 5IIZA 4GSSA 3F0IA 2N5AA 4I2TA 3MNGA 2RLIA 2HZEA 4IBPA 4JBBA 2L4QA 3MYDA 4ICYA 4V1Ap 3VFIA 1XW9A 2R4VA 3WGXA 3HVVA 3RPNA 2LS5A 2F3MA 2GVPA 2IMEA 4MJBA 2CAQA 1URMA 3TB2A 3F3RA 1AQXA 1SYXA 2FHEA 2DMLA 4GSTA 2I81A 4ZIJA 4MZBA 1M99A 3EINA 2H6XA 4ID0A 1J9BA 1PQNA 2ES7A 1TU7A 4J57E 3G7YA 1X9MB 3G7JA 2F51A 2WCIA 4HU9A 3APQA 3A5WA 4TKYA 3E3EA 4KA0A 3FEUA 1EGRA 1WE0A 2VLTA 3GN3A 3APSA 4PX1A 2FGXA 1M2DA 1FW1A 1R5PA 2FCHA 22GSA 2I1UA 4ML6A 1ZYNA 2VLUA 1C72A 1S3CA 3LEFA 2DJJA 3PINA 4TR0A 2VIMA 3HJOA 1V2AA 2OE3A 1MDIA 2LNTA 4G19A 4FYUA 1PSQA 5A34B 4JU5A 6GSSA 1TXXA 4YAVA 1SD9A 3IPZA 4IKHA 4ZL7A 3HKRA 2R0GA 1GSUA 2OBKA 4X1UA 2IMFA 1PN9A 20GSA 2H1LA 2I4AA 4HUAA 3EMXA 5AIVA 6GSUA 4OO4A 2EIQA 2B1KA 2LSTA 4TR1B 1O8XA 3GA4A 1Z6MA 3GKNA 2IN3A 2C1YA 3LORA 5DAKB 3KP9A 4IJIA 3WT1A 2YPMA 4NV5A 2GSRA 3F4TA 2VCXA 3EPTA 2L5OA 4HJMA 2OACA 3LXZA 4OFMA 3C8EA 3FYGA 1WP0A 2HRKA 2ALBA 2H75A 2R2JA 1SVLA 5E4WA 1JLWA 2A4HA 2PPTA 1E2YA 4FO5A 4YKFA 1IYIA 1TXUA 6GSYA 2HSYA 1ML6A 3PPUA 4K6XA 3BCIA 1THOA 3N9JA 3TOUA 4WEYA 4L0UA 1K0DA 2C3QA 1T3BA 1T4ZA 5B8AA 3FRCA 2CA8A 3VWVA 2B7KA 4JE1A 1RW1A 2VCQA 1SJIA 1Q4JA 2VKZG 5A5KA 2B1LA 4N11A 2PU9C 3DEXA 3MIXA 2RIIA 1VF1A 1EOHA 3O3TA 1B9YC 2H76A 2REMA 3SWLA 1FVKA 3LWAA 10GSA 1GUKA 4TN8A 3GTUA 2HT9A 3CMIA 4L5LA 1MD3A 4EDYA 4TXOA 3WD6A 4K5SA 1TRSA 2XBQA 2X8GA 4KDYA 3C73A 1UVZA 1ON4A 4YQUA 2QGVA 2YZUA 1GSFA 4AJ6A 1O73A 1V9WA 2H19A 3GFKA 4G10A 4OD7A 2FA4A 1YF0A 4GSNA 3F63A 1GTUA 2GSTA 4OMVA 1OC9B 4I5QA 3KMOA 2R6KA 5HR3A 5A4WA 3D22A 4RQRA 2IWTA 2YNXA 4O5UA 1SK2A 2KUCA 3GH6A 1XWGA 3LQ7A 3TDGA 1IYHA 1W4VA 2K18A 2VOCA 5G30A 1F6MC 2MMNA 4ECCA 3GRXA 2JZRA 1GLQA 2VD1A 1PL2A 4MPGA 4PQHA 4ZB9A 3ERWA 3TJJA 4KAEA 4RI6A 1VF3A 3VURA 3FR3A 3G7IA 4EUYA 1YQ1A 1G0TA 3F8UA 3A2WA 3M0FA 1PKZA 1G6YA 3KP8A 2OA7A 4ACSA 3H8QA 5CO3A 1B8XA 2KHPA 3VK9A 1FB6A 1K3OA 3W6GA 2L59A 4O92A 2HNLA 2HSNA 2LV3A 1WWJA 5DDLA 4V1Ag 1WOUA 3LSZA 2EFDA 2K8VA 1ACVA 4MZCA 3CSHA 2NDOA 3TKRA 3HVXA 3W8SA 4KUNA 4V2NA 4X0XA 5HQPA 2L57A 4J56E 4ISDA 1SL2B 4NMUA 2O7KA 2X64A 1BG1A 2VL2C 5ECOB 3EVIA 4HZ2A 1XBSA 2F8FA 4MDCA 5INYA 4EXJA 3GX8A 1T8EB 3TJFA 1SL0B 4MH2A 1XCCA 4KSOA 4KCEA 2A2RA 1FVJA 5DALA 2VL9A 3A2VA 3GSTA 1BJXA 2I3YA 3H1NA 5HFKA 3GX0A 1PRXA 3KTLA 3KH9A 3UBKA 5F06A 3P2AA 5GZZB 3ZIVA 4BVYA 1MEKA 3EURA 2A4VA 4AKGA 4OCFA 5IMAA 5IMFA 2C80A 2MBSA 3ZL5A 4KB3A 2C8UA 2KP1A 4IP1A 2HRAA 3FMWA 4V2LA 3ZFLA 3DVXA 3D21A 5IPGA 2HRFA 2C0GA 4BVXA 5DVBA 2R5GA 1N8JA 1OAZA 5J3RA 4Q5QA 1AIUA 2YWMA 3RAZA 4D73A 2RUEA 3IV4A 4MF6A 4F82A 4IQAA 3HMJG 1TKDB 2LJRA 4JR4A 3VI7A 2WJUA 2MMAA 1QGVA 4GWRA 1UC7A 4MJEA 2V6OA 3F9UA 1M9AA 4IN0A 1XWAA 4YQVA 4L5OA 3BD2A 4I6XA 1YF1A 3EU3A 2M72A 3HXSA 2HYXA 5G2ZA 2JSYA 3D6IA 1ZGNA 2VCTA 2H0GA 4E68A 2GDRA 2CVKA 1MDKA 1F3AA 2X99A 2GQLA 2GZPA 1GNEA 1EP7A 4JZQA 3R3EA 2R3XA 1CQGA 3UBLA 1K0AA 4J2FA 3UOMA 3BBYA 3ZIJA 2YP6A 4NHZA 1X5EA 3TKSA 4CDOA 4WBJA 4XHMA 2LNSA 1GULA 1YVLA 1V58A 1PKWA 1NW2A 4IQ1A 2V1MA 4MH3A 1XWBA 5A1NB 5H5SA 5GAND 5HR2A 2KP2A 4MF7A 3Q19A 2O8VB 2JU5A 3TKSE 4Z2TA 5EVOA 5ID2A 1NHOA 1K3LA 1XXUA 1F2EA 3F4SA 1GTAA 2CQ9A 5F0GA 1T1VA 3PH9A 2DJ0A 2F8AA 1O81A 3GYKA 5CAXA 1F3BA 4QMKA 1KBNA 3HJPA 1A8YA 3HYPA 3GUSA 3IK7A 2DC5A 4O32A 3CRTA 2EFHA 4ZB6A 2QC7A 5J5NA 1Q98A 3IK9A 4KX4A 4F03A 2IL3A 2QKEA 1TI3A 4MA9A 5JCUA 2HRNA 1GH2A 2IMDA 3VI5A 4K7IA 3C7MA 1CQHA 5IOXA 2H71A 4ZB8A 2C3NA 5G31A 1FOHA 2GQMA 3UEMA 4G01A 4W66A 4HOJA 4MP4A 3VPQA 1XW6A 3FZ4A 3GL3A 3TU3B 4BPYA 4G0LA 1TK8B 1N25A 3UL3A 2LQOA 5DJLA 2DKHA 5A5HA 2MZCA 5C00A 3FR9A 2VCZA 1PA3A 4JEDA 5DQYA 2H1GA 4MABA 2JZSA 1LBKA 4MLYA 2LRNA 4F0CA 4PQ1A 4QQ7A 5D9VA 4HJ2A 2WGRA 2C0FA 3C1SA 1EOGA 4EL1A 1OE7A 4I2UA 3IR4A 1PGTA 3RDWA 1PL1A 3QFAC 1JHBA 1X5CA 4G2EA 1AXDA 3QOUA 5CRWA 3LFLA 2PWJA 1ZZYA 3EE2A 3TGZA 1ERUA 2H01A 5ECHB 2FWHA 2VCWA 4WXTA 2AUVA 2VCVA 4Z2RA 3Q18A 2RM6A 3TRQA 3VWUA 1RK4A 3JCML 3Q6OA 3MDKA 4NAXA 5IM9A 1EEJA 1GP1A 3GKXA 1HD2A 3EU4A 2HSHA 4LL1B 4HU7A 1FO5A 3BCKA 3L9SA 3D0ZA 3KIJA 4K2XA 2DBCA 1O8WA 3L9UA 3VWXA 5KOXA 1Y1UA 1YDKA 2EC4A 1SK1A 3GIXA 1ZL9A 1ST9A 1WPIA 1DUGA 4FH8A 1M7TA 3LXTA 2K8SA 3P7XA 3I69A 3N5OA 5AISA 4ULXA 2IMIA 3FZ5A 5IMDA 2LRCA 4OFNA 5ECQB 1HYUA 4ZILA 1X9WB 1XOBA 1AAZA 1TJDA 3ZRDA 2TRXA 2OBIA 2FUG2 2LTKA 2GT6A 4GF0A 3RBTA 1JZDA 3HVSA 2V2GA 5COHA 1ERWA 17GSA 16GSA 2FWFA 5GSSA 2MBTA 3ZVJA 2WZ9A 1PD21 3UIWA 4DSSA 1AC1A 2HZEB 4F9ZA 4HZ4A 1SENA 1AQWA 2L5LA 3CSIA 3QDNA 2AJQB 2TRCP 5DJMA 4IHUA 4NV2A 1YKAA 4G9HA 2YZHA 1VRSD 1MTCA 1JZOA 5KN1A 3VWWA 2V6KA 1MDJA 5KOWA 2H1BA 4DEJA 4KE3A 3LYKA 4X43A 3HCZA 12GSA 3GKMA 3TKPA 1S3AA 2PBJA 4YKGA 5ECPB 2VUPA 1A2MA 4OCEA 1ZMAA 1SKRB 5EPFA 1SKSB 1XIYA 3O76A 3IAS2 5IQYA 5GAPD 4BA7A 4N0ZA 4X4JA 3IA1A 3NIVA 1LU4A 3HD5A 2M46A 3HJMA 4Z7XA 1OC3A 4POMA 4GLTA 5F07A 1U6TA 3H79A 5DBQA 3ISOA 2WS2A 3L0HA 2O89A 5B6NA 3H93A 2YV7A 2VO4A 5J41A 2HQTA 3BJ5A 1TU8A 3D5JA 4XS4A 3QD9A 4IP6A 1SVOA 3IC8A 2YV9A 2WDUA 2X4AA 3GURA 11GSA 3ERFA 2K6VA 3RHCA 4MK3A 4IW9A 5IMZA 3ERGA 3F4RA 3O6TA 2LEGA 2LJKA 1O7UA 3HHVA 4WETA 4OFTA 2LQQA 3GNJA 5EL8A 4IELA 2DJ2A 2GT5A 2NPBA 2YWNA 5ECKB 4K1FA 3M3MA 3FY7A 5HR0A 3K8NA 2MYGA 3CYNA 5J4UA 1I5GA 2H73A 2ZUPA 3KCMA 4GDFA 5J47A 1KEBA 1Z5YE 4HDEA 4F0BA 1PX7A 2C0EA 1R5AA 5BMUA 2R0PA 3TOTA 1GSQA 2B5XA 2JZTA 3ED3A 4YQMA 5A4VA 1FAAA 4LL4B 6GSWA 2CVDA 3HZ8A 2HRKB 5IPHA 3C1RA 3TJGA 2B3SA 3QFBC 5ECNB 5E59A 1U3AA 3IHGA 3CRUA 4HS1A 2R0CA 1FOVA 1J0FA 4EIPA 1B4QA 2HLSA 3ZYWA 3H4KA 1XPVA 4OO5A 3KMNA 2FD3A 3C71A 1GLPA 4BL7A 4MCUA 3QAWA 2O85A 3EYTA 3FW2A 2E7PA 1JZRA 1XVWA 4GXZA 4O5QA 2H72A 3TKSC 4L8EA 2KOKA 1Z6NA 4Q5RA 2N5BA 4LA1A 2GSSA 4LMVA 3VLNA 1ZYEA 4JR6A 5D96A 2HSMA 3NZNA 1GUHA 1VF2A 5JWOB 3CWGA 2PN8A 3ZMKA 4KSMA 1WIKA 1T7PB 4QL7A 2UZ8A 1O85A 3GKKA 3EWLA 4EO3A 3GTUB 4WKWA 5CNWA 4I97A 4TXOB 1TTZA 5D9XA 4MNNA 1TK5B 3IHQA 3GH9A 5ECRB 1A0FA 5D9TA 2X8CA 3SBCA 4USSA 3V1WA 2PMTA 1SK0A 3TJKA 2J23A 5JCWA 4HEA2 4XS4B 4IGJA 2JACA 1DSBA 2I9HA 2XHFA 5FHIA 2GZZA 4Z2UA 3CTFA 2IFQA 3DGQA 5CP1A 4AJ7A 1GTIA 3TJBA 4IS0A 3L4NA 3L78A 4ML1A 4DSQA 2B5YA 3EC3A 1TRWA 2QA1A 5HR1A 2DJ3A 19GSA 3RHBA 4TOPA 2BMXA 5AIXA 4O5RA 3EMPA 2LUSA 5CREA 2L6CA 1ERVA 1XVQA 2DSAA 3P90A 6GSXA 4H86A 1BX9A 2A2PA 1X5DA 1O6JA 1EWXA 4AKIA 3QCPA 5H5RA 4O7HA 2ZNMA 1V98A 4POBA 1F9MA 3P8WA 4WR4A 2WULA 2QA2A 4K5RA 4GRFA 3LG6A 1XW5A 1Y25A 4TW5A 2HSNB 2DMMA 5IOWA 3U6VA 4AJ8A 1TP9A 1K0OA 3KXOA 5ECIB 6GSTA 2K9FA 2Z9SA 4K7OA 1A24A 4PXOA 1BQ7A 5DCHA 2VAFA 1TK0B 2PERA 1JLVA 2YN1A 1BYEA 1OKTA 3TRXA 5GSTA 3UJ1A 2B7JA 4KW6A 2HFDA 2L4CA 1FHEA 6GSVA 2C4JA 1XOAA 2O87A 4HQZA 1F37A 2C0DA 5D93A 1Z7PA 2RM5A 2YWIA 5IO0A 5DALB 1JZWA 1T00A 1A2LA 1QMVA 3ZREA 3WYWA 14GSA 4FIWA 3D4MA 4RUVA 5B8BA 2IIYA 3M9KA 1OVNA 5IMVA 2YJ7A 4BVYB 1K0CA 3IOSA 3DWVA 3AY8A 2GS3A 5A34A 2XBIA 3D4TA 3G9BA 1XZOA 5KN2A 2CT6A 5G5FA 2BJXA 1J08A 3I6AA 2NTOA 4E8EA 3E9JB 2ZCTA 2H30A 2HZFA 3HY2A 1M2BA 4ZB7A 2XPEA 4MJCA 2CZ2A 3PGTA 2DLXA 4MJAA 4BVXB 3UVTA 4KCAA 4D73B 2EFEA 4PUFC 3F6DA 2WFCA 1A2JA 5H5QA 4TR1A 3KEBA 5J40A 3ZLPA 2JSZA 2MMZA 18GSA 1ERTA 1Z3EA 1G7OA 2GZYA 5DAKA 3L9VA 1A23A 2YCDA 5D8IA 3DRNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B6M A;  1SJZ A;  3GL5 A;  1M2A A;  1I9D A;  1OE8 A;  5G1L A;  4FQU A;  4PNF A;  3DXB A;  1SKW B;  3TUE A;  5ECS A;  1OKD A;  1AQV A;  2GGT A;  2PGT A;  5ELG A;  3QR6 A;  4LMW A;  5LCZ A;  3ZFB A;  4PUR A;  1U87 A;  2CX3 A;  4KDX A;  3M9J A;  2AB6 A;  1YEX A;  5JCG A;  4FYC A;  1WJK A;  1ILO A;  1XWK A;  3ZVJ D;  3KJY A;  5CRD A;  4PTS A;  3DD3 A;  5ID2 B;  2G2Q A;  3S9F A;  2GTU A;  4Q5F A;  3CTG A;  5CRH A;  1GSY A;  1MD4 A;  2E2M A;  3E0U A;  5ENU A;  1PMT A;  2LKU A;  4TVE A;  4PUA A;  5AGY A;  3TCO A;  5DQS A;  1QQ2 A;  3IRA A;  3F3Q A;  2FA8 A;  4RQX A;  1K0N A;  4YH2 A;  3MAK A;  3HZ4 A;  2E0Q A;  4TR4 A;  4GQC A;  3QAG A;  1TOF A;  2X8H A;  2RUF A;  4JRR A;  1OYJ A;  4WBR D;  2DIZ A;  4NPB A;  2DJK A;  2XPD A;  4WF5 A;  2YWO A;  4WF4 A;  3GV1 A;  4IVF A;  5ECL B;  4XS1 A;  3IE3 A;  3DVW A;  4TR3 A;  1OC9 A;  2V32 A;  3US3 A;  2N5F A;  3BOA A;  5IMC A;  2NVL A;  1S3D A;  2H74 A;  5C04 A;  3WT2 A;  2ON7 A;  1EZK A;  2PVQ A;  1EEM A;  5D73 A;  5JWR B;  2WRT A;  2H0I A;  1N2A A;  5F8B A;  5HFG A;  4KH7 A;  2TIR A;  4F2I A;  1GL8 A;  3CXG A;  2F9S A;  2H1D A;  2IMK A;  4K7N A;  2OKA A;  5J9B A;  3IXR A;  1K0B A;  2JL4 A;  3IC4 A;  4FYB A;  1TI1 A;  2GQK A;  4ZXG A;  5AN1 A;  2H0H A;  2P31 A;  4AF2 A;  1FG4 A;  2VM2 A;  5CRG A;  3OR5 A;  2VM1 A;  1BG5 A;  5F05 A;  1PX6 A;  4N30 A;  2AV4 A;  2L6D A;  2H6Y A;  2CAI A;  4ZBB A;  2H1A A;  1DE2 A;  4MZW A;  1M9B A;  3FK8 A;  3FZ9 A;  2QSI A;  1ABA A;  1V57 A;  5KEJ A;  2E2G A;  1RQM A;  4XTS A;  2EIR A;  13GS A;  3KZQ A;  1EGO A;  1K0M A;  4EC0 A;  1AUC A;  4AGS A;  1HNA A;  3F6F A;  1Y6E A;  4PQI A;  5KN3 A;  5JWQ B;  4ECB A;  2P5Q A;  1KNG A;  3ME8 A;  1NM3 A;  2EIO A;  3ZTL A;  3VPT A;  8GSS A;  5LD0 A;  3DIE A;  4NWY A;  1THX A;  5J9C A;  4CHS A;  3WGD A;  1VGL A;  3IAM 2;  1T4Y A;  4NXI A;  1X0R A;  4IJ3 A;  2YOI A;  3FKF A;  4N10 A;  5FWG A;  1B9X C;  1Z9H A;  2H6Z A;  2LJA A;  2XC2 A;  3U5R E;  2B5E A;  4G0K A;  4K0G A;  4XIH A;  4GQF A;  4PGT A;  4G0I A;  2P0G A;  1YY7 A;  3M1G A;  2C3T A;  1QUW A;  2OE1 A;  1SJ6 A;  3ZIT A;  3MWH A;  5ELA A;  1V40 A;  5LNK e;  1LJR A;  2NBS A;  1GRX A;  1GTB A;  4CW9 A;  2H70 A;  3Q74 A;  1SD8 A;  3GHA A;  1HNB A;  1B4P A;  2VD0 A;  1JFU A;  4KDU A;  1R7H A;  1G6W A;  3I43 A;  4GTU A;  3MSZ A;  3IDV A;  4DSS B;  5G1K A;  5ECM B;  2HE3 A;  2A2S A;  5L71 A;  1UN2 A;  1WRY A;  2MMO A;  4TXV A;  3CSJ A;  5HFI A;  1YZX A;  1SYR A;  1EV4 A;  5G5E A;  2OE0 A;  3UAP A;  1BAY A;  2YAN A;  4ZBD A;  4POL A;  9GSS A;  1HQO A;  3UMA A;  1U88 A;  1Z7R A;  3RPP A;  4Q5N A;  4XRD A;  4PNG A;  1H75 A;  2FLS A;  2H8L A;  4LLR A;  2CVB A;  1VF4 A;  4RI7 A;  4V2M A;  4K2D A;  1GNW A;  2LRT A;  2HXK A;  1R4W A;  4HQS A;  1U3I A;  3QAV A;  4TRX A;  1GWC A;  3ZML A;  4L0W A;  3A3T A;  5B7C A;  1EV9 A;  1HNC A;  3J7Y b;  4DSR A;  3QPM A;  1M0U A;  1R26 A;  2CZ3 A;  4OWY A;  1SU9 A;  4ZL9 A;  2G0F A;  2GSQ A;  2BTO T;  4WR5 A;  2PUK C;  5IO2 A;  2J9H A;  3UAR A;  3HA9 A;  4BWQ A;  4EE0 A;  4KND A;  2P5R A;  4POK A;  1DBY A;  3R2Q A;  2VLV A;  3DYR A;  5CYY A;  4ILF A;  3W8J A;  4XS6 A;  2VL3 A;  3DML A;  1G7E A;  1YJ6 A;  2DJ1 A;  1TDI A;  4EVM A;  3DKS A;  4ECJ A;  4HI7 A;  1GUM A;  3ME7 A;  2HI7 A;  4I8B A;  1GSE A;  7GSS A;  1OC8 A;  1XFL A;  3KGK A;  1K3Y A;  5DCG A;  2V41 A;  2OAD A;  1NSW A;  1BED A;  1GSS A;  2M80 A;  5A4U A;  3A2X A;  4K9Z A;  4ECI A;  1USB A;  4N0V A;  3GSS A;  4MF5 A;  2FWE A;  1SL1 B;  3ZZX A;  1QK8 A;  5ABR A;  4XRA A;  3J7Y k;  5EY6 A;  2AHE A;  3IBH A;  1ZYQ B;  3KTB A;  2AAW A;  4K0N A;  5D9W A;  3FR6 A;  2FY6 A;  4BL7 B;  2KLX A;  1NHY A;  1DE1 A;  3PR8 A;  2R37 A;  2OJL A;  3LJR A;  1ZCP A;  4ZL8 A;  2IPA A;  1WMJ A;  1FB0 A;  5B6M A;  2VL2 A;  1B48 A;  2ON5 A;  2HSM B;  3APO A;  4K8M A;  1H4O A;  3HDC A;  2WB9 A;  3CBU A;  3NOF A;  1QXH A;  1TRV A;  3WGE A;  2FNO A;  2CV4 A;  3LYP A;  2CX4 A;  4YAP A;  1YEP A;  3I9V 2;  1A8L A;  4P3Y B;  2AYT A;  4GCI A;  1GSD A;  4BWS A;  4ZBA A;  1A0R P;  4E8H A;  1XWC A;  2JAD A;  3FHK A;  4MPF A;  3KM6 A;  1KTE A;  2IJY A;  1X9S B;  2FWG A;  4KF9 A;  3KD0 A;  1YKC A;  2PVO C;  4NHW A;  1EP8 A;  1W89 A;  3GMF A;  4MMM A;  3TKQ A;  4EKZ A;  5KN0 A;  1TW9 A;  5FT3 A;  2H66 A;  2IFQ B;  4EDZ A;  3FZA A;  4XCS A;  1AW9 A;  1E6B A;  4KGI A;  3LGC A;  3TRP A;  3KH7 A;  2D2Z A;  4QL9 A;  4EF0 A;  3UVH A;  2YJH A;  3QMX A;  2GLR A;  3M8N A;  1UA5 A;  4DVC A;  2DIY A;  1QFN A;  1TRU A;  1ZOF A;  5IIZ A;  4GSS A;  3F0I A;  2N5A A;  4I2T A;  3MNG A;  2RLI A;  2HZE A;  4IBP A;  4JBB A;  2L4Q A;  4V1A p;  3VFI A;  1XW9 A;  2R4V A;  3WGX A;  3HVV A;  3RPN A;  2LS5 A;  2F3M A;  2GVP A;  2IME A;  4MJB A;  2CAQ A;  1URM A;  3TB2 A;  3F3R A;  1AQX A;  1SYX A;  2FHE A;  2DML A;  4GST A;  2I81 A;  4ZIJ A;  4MZB A;  1M99 A;  3EIN A;  2H6X A;  4ID0 A;  1J9B A;  1PQN A;  2ES7 A;  1TU7 A;  4J57 E;  3G7Y A;  1X9M B;  3G7J A;  2F51 A;  2WCI A;  4HU9 A;  3APQ A;  3A5W A;  4TKY A;  3E3E A;  4KA0 A;  3FEU A;  1EGR A;  1WE0 A;  2VLT A;  3GN3 A;  3APS A;  4PX1 A;  2FGX A;  1M2D A;  1FW1 A;  1R5P A;  2FCH A;  22GS A;  2I1U A;  4ML6 A;  2VLU A;  1C72 A;  1S3C A;  3LEF A;  2DJJ A;  3PIN A;  4TR0 A;  2VIM A;  3HJO A;  1V2A A;  2OE3 A;  1MDI A;  2LNT A;  4G19 A;  4FYU A;  1PSQ A;  4JU5 A;  6GSS A;  1TXX A;  4YAV A;  1SD9 A;  3IPZ A;  4IKH A;  4ZL7 A;  3HKR A;  1GSU A;  2OBK A;  4X1U A;  2IMF A;  1PN9 A;  20GS A;  2I4A A;  4HUA A;  3EMX A;  5AIV A;  6GSU A;  4OO4 A;  2EIQ A;  2B1K A;  2LST A;  4TR1 B;  1O8X A;  3GA4 A;  1Z6M A;  3GKN A;  2IN3 A;  2C1Y A;  3LOR A;  5DAK B;  3KP9 A;  4IJI A;  3WT1 A;  2YPM A;  4NV5 A;  2GSR A;  3F4T A;  2VCX A;  2L5O A;  4HJM A;  2OAC A;  3LXZ A;  4OFM A;  3C8E A;  3FYG A;  1WP0 A;  2HRK A;  2ALB A;  2H75 A;  2R2J A;  5E4W A;  1JLW A;  2PPT A;  1E2Y A;  4FO5 A;  1IYI A;  6GSY A;  2HSY A;  1ML6 A;  3PPU A;  4K6X A;  3BCI A;  1THO A;  3N9J A;  3TOU A;  4WEY A;  4L0U A;  1K0D A;  2C3Q A;  1T3B A;  1T4Z A;  5B8A A;  3FRC A;  2CA8 A;  3VWV A;  2B7K A;  4JE1 A;  1RW1 A;  2VCQ A;  1SJI A;  1Q4J A;  5A5K A;  2B1L A;  4N11 A;  2PU9 C;  3DEX A;  2RII A;  1VF1 A;  1EOH A;  3O3T A;  1B9Y C;  2H76 A;  2REM A;  3SWL A;  1FVK A;  3LWA A;  10GS A;  1GUK A;  4TN8 A;  3GTU A;  2HT9 A;  3CMI A;  4L5L A;  1MD3 A;  4EDY A;  4TXO A;  3WD6 A;  1TRS A;  2XBQ A;  2X8G A;  4KDY A;  3C73 A;  1UVZ A;  1ON4 A;  4YQU A;  2QGV A;  2YZU A;  1GSF A;  4AJ6 A;  1O73 A;  1V9W A;  2H19 A;  3GFK A;  4G10 A;  4OD7 A;  2FA4 A;  1YF0 A;  4GSN A;  3F63 A;  1GTU A;  2GST A;  4OMV A;  1OC9 B;  4I5Q A;  3KMO A;  2R6K A;  5HR3 A;  5A4W A;  3D22 A;  4RQR A;  2IWT A;  2YNX A;  1SK2 A;  2KUC A;  3GH6 A;  1XWG A;  3LQ7 A;  3TDG A;  1IYH A;  1W4V A;  2K18 A;  2VOC A;  5G30 A;  1F6M C;  2MMN A;  4ECC A;  3GRX A;  2JZR A;  1GLQ A;  2VD1 A;  1PL2 A;  4MPG A;  4PQH A;  4ZB9 A;  3ERW A;  3TJJ A;  4KAE A;  4RI6 A;  1VF3 A;  3VUR A;  3FR3 A;  3G7I A;  4EUY A;  1YQ1 A;  1G0T A;  3F8U A;  3A2W A;  3M0F A;  1PKZ A;  1G6Y A;  3KP8 A;  2OA7 A;  4ACS A;  3H8Q A;  5CO3 A;  1B8X A;  2KHP A;  3VK9 A;  1FB6 A;  1K3O A;  3W6G A;  2L59 A;  4O92 A;  2HNL A;  2LV3 A;  1WWJ A;  5DDL A;  4V1A g;  1WOU A;  3LSZ A;  2K8V A;  1ACV A;  4MZC A;  3CSH A;  2NDO A;  3TKR A;  3HVX A;  3W8S A;  4KUN A;  4V2N A;  4X0X A;  5HQP A;  2L57 A;  4J56 E;  4ISD A;  1SL2 B;  4NMU A;  2O7K A;  2X64 A;  2VL2 C;  5ECO B;  3EVI A;  4HZ2 A;  1XBS A;  2F8F A;  4MDC A;  5INY A;  4EXJ A;  3GX8 A;  1T8E B;  3TJF A;  1SL0 B;  4MH2 A;  1XCC A;  4KSO A;  4KCE A;  2A2R A;  1FVJ A;  5DAL A;  2VL9 A;  3A2V A;  3GST A;  1BJX A;  2I3Y A;  3H1N A;  5HFK A;  3GX0 A;  1PRX A;  3KTL A;  3KH9 A;  3UBK A;  5F06 A;  3P2A A;  5GZZ B;  3ZIV A;  4BVY A;  1MEK A;  3EUR A;  2A4V A;  4OCF A;  5IMA A;  5IMF A;  2C80 A;  2MBS A;  3ZL5 A;  4KB3 A;  2C8U A;  2KP1 A;  4IP1 A;  2HRA A;  4V2L A;  3ZFL A;  3DVX A;  3D21 A;  5IPG A;  2HRF A;  2C0G A;  4BVX A;  5DVB A;  2R5G A;  1N8J A;  1OAZ A;  5J3R A;  4Q5Q A;  1AIU A;  2YWM A;  3RAZ A;  4D73 A;  2RUE A;  3IV4 A;  4MF6 A;  4F82 A;  4IQA A;  1TKD B;  2LJR A;  4JR4 A;  3VI7 A;  2WJU A;  2MMA A;  1QGV A;  4GWR A;  1UC7 A;  4MJE A;  2V6O A;  3F9U A;  1M9A A;  4IN0 A;  1XWA A;  4YQV A;  4L5O A;  3BD2 A;  4I6X A;  1YF1 A;  3EU3 A;  2M72 A;  3HXS A;  2HYX A;  5G2Z A;  2JSY A;  3D6I A;  1ZGN A;  2VCT A;  2H0G A;  2GDR A;  2CVK A;  1MDK A;  1F3A A;  2X99 A;  2GQL A;  2GZP A;  1GNE A;  1EP7 A;  4JZQ A;  3R3E A;  2R3X A;  1CQG A;  3UBL A;  1K0A A;  4J2F A;  3UOM A;  3BBY A;  3ZIJ A;  2YP6 A;  4NHZ A;  1X5E A;  3TKS A;  4CDO A;  4WBJ A;  4XHM A;  2LNS A;  1GUL A;  1V58 A;  1PKW A;  1NW2 A;  4IQ1 A;  2V1M A;  4MH3 A;  1XWB A;  5H5S A;  5GAN D;  5HR2 A;  2KP2 A;  4MF7 A;  3Q19 A;  2O8V B;  2JU5 A;  3TKS E;  5EVO A;  5ID2 A;  1NHO A;  1K3L A;  1XXU A;  1F2E A;  3F4S A;  1GTA A;  2CQ9 A;  5F0G A;  1T1V A;  3PH9 A;  2DJ0 A;  2F8A A;  1O81 A;  3GYK A;  5CAX A;  1F3B A;  1KBN A;  3HJP A;  1A8Y A;  3HYP A;  3GUS A;  3IK7 A;  2DC5 A;  4O32 A;  3CRT A;  4ZB6 A;  2QC7 A;  5J5N A;  1Q98 A;  3IK9 A;  4KX4 A;  4F03 A;  2IL3 A;  2QKE A;  1TI3 A;  4MA9 A;  5JCU A;  2HRN A;  1GH2 A;  2IMD A;  3VI5 A;  4K7I A;  3C7M A;  1CQH A;  5IOX A;  2H71 A;  4ZB8 A;  2C3N A;  5G31 A;  2GQM A;  3UEM A;  3VPQ A;  4HOJ A;  4MP4 A;  1XW6 A;  3FZ4 A;  3GL3 A;  4BPY A;  4G0L A;  1TK8 B;  3UL3 A;  2LQO A;  5DJL A;  2MZC A;  5C00 A;  3FR9 A;  2VCZ A;  1PA3 A;  4JED A;  5DQY A;  2H1G A;  4MAB A;  2JZS A;  1LBK A;  4MLY A;  2LRN A;  4F0C A;  4PQ1 A;  4QQ7 A;  5D9V A;  4HJ2 A;  2WGR A;  2C0F A;  3C1S A;  1EOG A;  4EL1 A;  1OE7 A;  4I2U A;  3IR4 A;  1PGT A;  3RDW A;  1PL1 A;  3QFA C;  1JHB A;  1X5C A;  4G2E A;  1AXD A;  3QOU A;  5CRW A;  3LFL A;  2PWJ A;  1ZZY A;  3EE2 A;  3TGZ A;  1ERU A;  2H01 A;  5ECH B;  2FWH A;  2VCW A;  4WXT A;  2AUV A;  2VCV A;  3Q18 A;  2RM6 A;  3TRQ A;  3VWU A;  1RK4 A;  3JCM L;  3Q6O A;  3MDK A;  4NAX A;  5IM9 A;  1EEJ A;  1GP1 A;  3GKX A;  1HD2 A;  3EU4 A;  2HSH A;  4LL1 B;  4HU7 A;  1FO5 A;  3BCK A;  3L9S A;  3D0Z A;  3KIJ A;  2DBC A;  1O8W A;  3L9U A;  3VWX A;  1YDK A;  2EC4 A;  1SK1 A;  3GIX A;  1ZL9 A;  1ST9 A;  1WPI A;  1DUG A;  4FH8 A;  1M7T A;  3LXT A;  2K8S A;  3P7X A;  3I69 A;  3N5O A;  5AIS A;  4ULX A;  2IMI A;  3FZ5 A;  5IMD A;  2LRC A;  4OFN A;  5ECQ B;  1HYU A;  4ZIL A;  1X9W B;  1XOB A;  1AAZ A;  1TJD A;  3ZRD A;  2TRX A;  2OBI A;  2FUG 2;  2LTK A;  2GT6 A;  4GF0 A;  3RBT A;  1JZD A;  3HVS A;  2V2G A;  5COH A;  1ERW A;  17GS A;  16GS A;  2FWF A;  5GSS A;  2MBT A;  3ZVJ A;  2WZ9 A;  1PD2 1;  3UIW A;  4DSS A;  1AC1 A;  2HZE B;  4F9Z A;  4HZ4 A;  1SEN A;  1AQW A;  2L5L A;  3CSI A;  3QDN A;  2AJQ B;  2TRC P;  5DJM A;  4IHU A;  4NV2 A;  1YKA A;  4G9H A;  2YZH A;  1VRS D;  1MTC A;  1JZO A;  5KN1 A;  3VWW A;  2V6K A;  1MDJ A;  2H1B A;  4DEJ A;  4KE3 A;  3LYK A;  4X43 A;  3HCZ A;  12GS A;  3GKM A;  3TKP A;  1S3A A;  2PBJ A;  5ECP B;  2VUP A;  1A2M A;  4OCE A;  1ZMA A;  1SKR B;  5EPF A;  1SKS B;  1XIY A;  3O76 A;  3IAS 2;  5IQY A;  5GAP D;  4BA7 A;  4N0Z A;  3IA1 A;  3NIV A;  1LU4 A;  3HD5 A;  2M46 A;  3HJM A;  4Z7X A;  1OC3 A;  4POM A;  4GLT A;  5F07 A;  1U6T A;  3H79 A;  5DBQ A;  3ISO A;  2WS2 A;  3L0H A;  2O89 A;  5B6N A;  3H93 A;  2YV7 A;  2VO4 A;  5J41 A;  2HQT A;  3BJ5 A;  1TU8 A;  3D5J A;  4XS4 A;  3QD9 A;  4IP6 A;  3IC8 A;  2YV9 A;  2WDU A;  3GUR A;  11GS A;  3ERF A;  2K6V A;  3RHC A;  4MK3 A;  4IW9 A;  5IMZ A;  3ERG A;  3F4R A;  3O6T A;  2LEG A;  2LJK A;  1O7U A;  3HHV A;  4WET A;  4OFT A;  2LQQ A;  3GNJ A;  5EL8 A;  4IEL A;  2DJ2 A;  2GT5 A;  2NPB A;  2YWN A;  5ECK B;  4K1F A;  3M3M A;  3FY7 A;  5HR0 A;  3K8N A;  2MYG A;  3CYN A;  5J4U A;  1I5G A;  2H73 A;  2ZUP A;  3KCM A;  1KEB A;  1Z5Y E;  4HDE A;  4F0B A;  1PX7 A;  2C0E A;  1R5A A;  5BMU A;  3TOT A;  1GSQ A;  2B5X A;  2JZT A;  3ED3 A;  4YQM A;  5A4V A;  1FAA A;  4LL4 B;  6GSW A;  2CVD A;  3HZ8 A;  2HRK B;  5IPH A;  3C1R A;  3TJG A;  2B3S A;  3QFB C;  5ECN B;  5E59 A;  1U3A A;  3CRU A;  4HS1 A;  1FOV A;  1J0F A;  1B4Q A;  2HLS A;  3ZYW A;  3H4K A;  1XPV A;  4OO5 A;  3KMN A;  2FD3 A;  3C71 A;  1GLP A;  4BL7 A;  4MCU A;  3QAW A;  2O85 A;  3EYT A;  3FW2 A;  2E7P A;  1JZR A;  1XVW A;  4GXZ A;  2H72 A;  3TKS C;  4L8E A;  2KOK A;  1Z6N A;  4Q5R A;  2N5B A;  4LA1 A;  2GSS A;  4LMV A;  3VLN A;  1ZYE A;  4JR6 A;  5D96 A;  2HSM A;  3NZN A;  1GUH A;  1VF2 A;  5JWO B;  2PN8 A;  3ZMK A;  4KSM A;  1WIK A;  1T7P B;  4QL7 A;  2UZ8 A;  1O85 A;  3GKK A;  3EWL A;  4EO3 A;  3GTU B;  4WKW A;  5CNW A;  4I97 A;  4TXO B;  1TTZ A;  5D9X A;  1TK5 B;  3IHQ A;  3GH9 A;  5ECR B;  1A0F A;  5D9T A;  2X8C A;  3SBC A;  4USS A;  3V1W A;  2PMT A;  1SK0 A;  3TJK A;  2J23 A;  5JCW A;  4HEA 2;  4XS4 B;  4IGJ A;  2JAC A;  1DSB A;  2I9H A;  2XHF A;  5FHI A;  2GZZ A;  3CTF A;  2IFQ A;  3DGQ A;  5CP1 A;  4AJ7 A;  1GTI A;  3TJB A;  4IS0 A;  3L4N A;  3L78 A;  4ML1 A;  4DSQ A;  2B5Y A;  3EC3 A;  1TRW A;  5HR1 A;  2DJ3 A;  19GS A;  3RHB A;  4TOP A;  2BMX A;  5AIX A;  4O5R A;  3EMP A;  2LUS A;  5CRE A;  2L6C A;  1ERV A;  1XVQ A;  2DSA A;  3P90 A;  6GSX A;  4H86 A;  1BX9 A;  1X5D A;  1O6J A;  1EWX A;  3QCP A;  5H5R A;  4O7H A;  2ZNM A;  1V98 A;  4POB A;  1F9M A;  3P8W A;  4WR4 A;  2WUL A;  4GRF A;  3LG6 A;  1XW5 A;  1Y25 A;  4TW5 A;  2HSN B;  2DMM A;  5IOW A;  3U6V A;  4AJ8 A;  1TP9 A;  1K0O A;  3KXO A;  5ECI B;  6GST A;  2K9F A;  2Z9S A;  4K7O A;  1A24 A;  4PXO A;  1BQ7 A;  5DCH A;  2VAF A;  1TK0 B;  2PER A;  1JLV A;  2YN1 A;  1BYE A;  1OKT A;  3TRX A;  5GST A;  3UJ1 A;  2B7J A;  4KW6 A;  2HFD A;  2L4C A;  1FHE A;  6GSV A;  2C4J A;  1XOA A;  2O87 A;  4HQZ A;  1F37 A;  2C0D A;  5D93 A;  1Z7P A;  2RM5 A;  2YWI A;  5IO0 A;  5DAL B;  1JZW A;  1T00 A;  1A2L A;  1QMV A;  3ZRE A;  3WYW A;  14GS A;  4FIW A;  3D4M A;  4RUV A;  5B8B A;  2IIY A;  3M9K A;  1OVN A;  5IMV A;  2YJ7 A;  4BVY B;  1K0C A;  3IOS A;  3DWV A;  3AY8 A;  2GS3 A;  2XBI A;  3D4T A;  3G9B A;  1XZO A;  5KN2 A;  2CT6 A;  5G5F A;  2BJX A;  1J08 A;  3I6A A;  2NTO A;  4E8E A;  3E9J B;  2ZCT A;  2H30 A;  2HZF A;  3HY2 A;  1M2B A;  2XPE A;  4MJC A;  2CZ2 A;  3PGT A;  2DLX A;  4MJA A;  4BVX B;  3UVT A;  4KCA A;  4D73 B;  4PUF C;  3F6D A;  2WFC A;  1A2J A;  5H5Q A;  4TR1 A;  3KEB A;  3ZLP A;  2JSZ A;  2MMZ A;  18GS A;  1ERT A;  1Z3E A;  1G7O A;  2GZY A;  5DAK A;  3L9V A;  1A23 A;  2YCD A;  5D8I A;  3DRN A; 
#chains in the Genus database with same CATH topology
 2B6M A;  1SJZ A;  3GL5 A;  1M2A A;  1I9D A;  1OE8 A;  5G1L A;  4FQU A;  4PNF A;  3DXB A;  1SKW B;  3TUE A;  5J4V A;  5ECS A;  1OKD A;  1AQV A;  2GGT A;  2WVZ A;  2PGT A;  1PN0 A;  5ELG A;  3QR6 A;  4LMW A;  5LCZ A;  3ZFB A;  4PUR A;  1U87 A;  2CX3 A;  4KDX A;  3M9J A;  2AB6 A;  1YEX A;  5JCG A;  4FYC A;  1WJK A;  1ILO A;  1XWK A;  3ZVJ D;  3KJY A;  5CRD A;  4PTS A;  3DD3 A;  5ID2 B;  2G2Q A;  3S9F A;  2GTU A;  4Q5F A;  3CTG A;  5CRH A;  1GSY A;  1MD4 A;  2E2M A;  3E0U A;  5ENU A;  1PMT A;  2LKU A;  2X49 A;  4TVE A;  4PUA A;  5AGY A;  3TCO A;  5DQS A;  1QQ2 A;  3IRA A;  3F3Q A;  2FA8 A;  4HSC X;  4RQX A;  1K0N A;  4YH2 A;  3MAK A;  3HZ4 A;  2E0Q A;  4TR4 A;  4GQC A;  4CY8 A;  3QAG A;  1TOF A;  2X8H A;  2RUF A;  4JRR A;  1OYJ A;  4WBR D;  2DIZ A;  4NPB A;  2DJK A;  2XPD A;  4WF5 A;  2YWO A;  4WF4 A;  3GV1 A;  2EFC A;  4IVF A;  2UV8 G;  5ECL B;  5J4Y A;  4XS1 A;  3IE3 A;  3DVW A;  4TR3 A;  1OC9 A;  2V32 A;  3US3 A;  2N5F A;  3BOA A;  5IMC A;  2NVL A;  1S3D A;  2H74 A;  5C04 A;  3WT2 A;  2ON7 A;  1EZK A;  2PVQ A;  4AI6 A;  1EEM A;  5D73 A;  5JWR B;  2WRT A;  2H0I A;  1N2A A;  5F8B A;  5HFG A;  4KH7 A;  2TIR A;  4F2I A;  1GL8 A;  3CXG A;  2F9S A;  2H1D A;  2IMK A;  4K7N A;  2OKA A;  5J9B A;  5A5H B;  3IXR A;  1K0B A;  2JL4 A;  3IC4 A;  4FYB A;  1TI1 A;  2GQK A;  4ZXG A;  5AN1 A;  2H0H A;  2P31 A;  4AF2 A;  1FG4 A;  2VM2 A;  5CRG A;  4EIQ A;  3OR5 A;  2VM1 A;  1BG5 A;  5F05 A;  1PX6 A;  4N30 A;  2AV4 A;  2L6D A;  2H6Y A;  2CAI A;  4ZBB A;  2H1A A;  2OT3 A;  1DE2 A;  4MZW A;  1M9B A;  3CQF A;  3FK8 A;  3FZ9 A;  2QSI A;  1ABA A;  1V57 A;  5KEJ A;  2E2G A;  1RQM A;  4XTS A;  2EIR A;  13GS A;  3KZQ A;  1EGO A;  1K0M A;  4EC0 A;  1AUC A;  4AGS A;  1HNA A;  3F6F A;  1Y6E A;  4PQI A;  5KN3 A;  5JWQ B;  4ECB A;  2P5Q A;  1KNG A;  3ME8 A;  1NM3 A;  2EIO A;  3ZTL A;  3VPT A;  8GSS A;  5LD0 A;  3DIE A;  4NWY A;  1THX A;  5J9C A;  4CHS A;  3WGD A;  1VGL A;  3IAM 2;  1T4Y A;  4NXI A;  1X0R A;  4IJ3 A;  2YOI A;  3FKF A;  4N10 A;  5FWG A;  4A5P A;  1B9X C;  1Z9H A;  2H6Z A;  2LJA A;  2XC2 A;  3U5R E;  2B5E A;  4G0K A;  4K0G A;  4AKH A;  4XIH A;  4GQF A;  4PGT A;  4G0I A;  2P0G A;  1YY7 A;  3M1G A;  2C3T A;  1QUW A;  1ZYP A;  2OE1 A;  1SJ6 A;  3ZIT A;  3MWH A;  5ELA A;  1V40 A;  5LNK e;  1LJR A;  2NBS A;  1GRX A;  1GTB A;  4CW9 A;  2H70 A;  3Q74 A;  1SD8 A;  3GHA A;  1HNB A;  1B4P A;  2VD0 A;  3LW9 A;  1JFU A;  4KDU A;  1R7H A;  1G6W A;  3I43 A;  4GTU A;  3MSZ A;  3IDV A;  4DSS B;  5G1K A;  5ECM B;  2HE3 A;  2A2S A;  5L71 A;  1UN2 A;  1WRY A;  2MMO A;  4TXV A;  3CSJ A;  5HFI A;  1YZX A;  1SYR A;  2WW3 A;  1EV4 A;  5G5E A;  2OE0 A;  3UAP A;  1BAY A;  2YAN A;  4ZBD A;  1XG8 A;  4POL A;  9GSS A;  1HQO A;  3UMA A;  1U88 A;  1Z7R A;  3RPP A;  4Q5N A;  4XRD A;  4PNG A;  1H75 A;  2FLS A;  5A1N A;  2DKI A;  2H8L A;  4LLR A;  2CVB A;  1VF4 A;  4RI7 A;  4V2M A;  4K2D A;  1GNW A;  2O5V A;  2LRT A;  2HXK A;  1R4W A;  4HQS A;  1U3I A;  3QAV A;  4TRX A;  1GWC A;  2WVX A;  3ZML A;  4L0W A;  3A3T A;  5B7C A;  1EV9 A;  1HNC A;  3J7Y b;  4DSR A;  3QPM A;  1M0U A;  1R26 A;  4BIK A;  2CZ3 A;  4OWY A;  1SU9 A;  4ZL9 A;  2G0F A;  3RGB C;  2GSQ A;  2BTO T;  4WR5 A;  2PUK C;  5IO2 A;  1PFO A;  2J9H A;  3UAR A;  3HA9 A;  4BWQ A;  4EE0 A;  4KND A;  2P5R A;  4POK A;  1DBY A;  3R2Q A;  2VLV A;  3DYR A;  5CYY A;  4ILF A;  3W8J A;  4XS6 A;  2VL3 A;  3DML A;  1G7E A;  1SVM A;  1YJ6 A;  2DJ1 A;  1TDI A;  4N3Z A;  4EVM A;  3DKS A;  4ECJ A;  4HI7 A;  1GUM A;  3ME7 A;  2HI7 A;  4I8B A;  1GSE A;  7GSS A;  1OC8 A;  1XFL A;  3KGK A;  1K3Y A;  5DCG A;  2V41 A;  2OAD A;  1NSW A;  1BED A;  1GSS A;  2M80 A;  5A4U A;  3A2X A;  4K9Z A;  5BMU B;  4ECI A;  1USB A;  4N0V A;  3GSS A;  4MF5 A;  2FWE A;  1SL1 B;  5BRT A;  3ZZX A;  1QK8 A;  5ABR A;  4XRA A;  3J7Y k;  5EY6 A;  2AHE A;  3IBH A;  1ZYQ B;  4PHZ C;  3KTB A;  2AAW A;  4K0N A;  5D9W A;  3FR6 A;  2FY6 A;  4BL7 B;  2KLX A;  1NHY A;  1DE1 A;  4CY6 A;  3PR8 A;  2R37 A;  2OJL A;  3LJR A;  1ZCP A;  4ZL8 A;  2IPA A;  1WMJ A;  1FB0 A;  5B6M A;  2VL2 A;  1B48 A;  2ON5 A;  2HSM B;  3APO A;  4K8M A;  1H4O A;  3HDC A;  2WB9 A;  3CBU A;  3NOF A;  1QXH A;  1TRV A;  3WGE A;  2FNO A;  2CV4 A;  3LYP A;  2CX4 A;  4YAP A;  2WW2 A;  1YEP A;  3I9V 2;  1A8L A;  4P3Y B;  2AYT A;  4AKX B;  4GCI A;  1GSD A;  4BWS A;  4ZBA A;  1BF5 A;  1A0R P;  4E8H A;  1XWC A;  2JAD A;  3FHK A;  4MPF A;  3KM6 A;  1KTE A;  2IJY A;  1X9S B;  2FWG A;  4KF9 A;  3KD0 A;  1YKC A;  2PVO C;  4NHW A;  1EP8 A;  1W89 A;  3GMF A;  4MMM A;  3TKQ A;  4EKZ A;  5KN0 A;  1TW9 A;  5FT3 A;  2H66 A;  2IFQ B;  4EDZ A;  3FZA A;  4XCS A;  1AW9 A;  1E6B A;  4KGI A;  3A5I A;  3LGC A;  3TRP A;  3KH7 A;  2D2Z A;  4QL9 A;  4EF0 A;  3UVH A;  2YJH A;  3QMX A;  2GLR A;  3M8N A;  1UA5 A;  4DVC A;  2DIY A;  1QFN A;  1TRU A;  1ZOF A;  5IIZ A;  4GSS A;  3F0I A;  2N5A A;  4I2T A;  3MNG A;  2RLI A;  2HZE A;  4IBP A;  4JBB A;  2L4Q A;  3MYD A;  4ICY A;  4V1A p;  3VFI A;  1XW9 A;  2R4V A;  3WGX A;  3HVV A;  3RPN A;  2LS5 A;  2F3M A;  2GVP A;  2IME A;  4MJB A;  2CAQ A;  1URM A;  3TB2 A;  3F3R A;  1AQX A;  1SYX A;  2FHE A;  2DML A;  4GST A;  2I81 A;  4ZIJ A;  4MZB A;  1M99 A;  3EIN A;  2H6X A;  4ID0 A;  1J9B A;  1PQN A;  2ES7 A;  1TU7 A;  4J57 E;  3G7Y A;  1X9M B;  4FXY P;  3G7J A;  2F51 A;  2WCI A;  4HU9 A;  3APQ A;  3A5W A;  4TKY A;  3E3E A;  4KA0 A;  3FEU A;  1EGR A;  1WE0 A;  2VLT A;  3GN3 A;  3APS A;  4PX1 A;  2FGX A;  1M2D A;  1FW1 A;  1R5P A;  2FCH A;  22GS A;  2I1U A;  4ML6 A;  1ZYN A;  2VLU A;  1C72 A;  1S3C A;  3LEF A;  2DJJ A;  3PIN A;  4TR0 A;  2VIM A;  3HJO A;  1V2A A;  2O36 A;  2OE3 A;  1MDI A;  2LNT A;  4G19 A;  4FYU A;  1PSQ A;  5A34 B;  4JU5 A;  6GSS A;  1TXX A;  4YAV A;  1SD9 A;  3IPZ A;  4IKH A;  4ZL7 A;  3HKR A;  2R0G A;  1GSU A;  2OBK A;  4X1U A;  2IMF A;  1PN9 A;  20GS A;  2H1L A;  2I4A A;  4HUA A;  3EMX A;  5AIV A;  6GSU A;  4OO4 A;  2EIQ A;  2B1K A;  2LST A;  4TR1 B;  1O8X A;  3GA4 A;  1Z6M A;  3GKN A;  2IN3 A;  2C1Y A;  3LOR A;  5DAK B;  3KP9 A;  4IJI A;  3WT1 A;  2YPM A;  4NV5 A;  2GSR A;  3F4T A;  2VCX A;  3EPT A;  2L5O A;  4HJM A;  2OAC A;  3LXZ A;  4OFM A;  3C8E A;  3FYG A;  1WP0 A;  2HRK A;  2ALB A;  2H75 A;  2R2J A;  1SVL A;  5E4W A;  1JLW A;  2A4H A;  2PPT A;  1E2Y A;  4FO5 A;  4YKF A;  2WW0 A;  1IYI A;  1TXU A;  6GSY A;  2HSY A;  1ML6 A;  3PPU A;  4K6X A;  3BCI A;  1THO A;  3N9J A;  3TOU A;  4WEY A;  4L0U A;  1K0D A;  2C3Q A;  1T3B A;  1T4Z A;  5B8A A;  3FRC A;  2CA8 A;  3VWV A;  2B7K A;  4JE1 A;  1RW1 A;  2VCQ A;  1SJI A;  1Q4J A;  2VKZ G;  5A5K A;  2B1L A;  3HVN A;  4N11 A;  2PU9 C;  3DEX A;  3MIX A;  2RII A;  1VF1 A;  1EOH A;  3O3T A;  1B9Y C;  2H76 A;  2REM A;  3SWL A;  1FVK A;  3LWA A;  10GS A;  1GUK A;  4TN8 A;  3GTU A;  2HT9 A;  3CMI A;  4L5L A;  1MD3 A;  4EDY A;  4TXO A;  3WD6 A;  4K5S A;  1TRS A;  2XBQ A;  2X8G A;  4KDY A;  3C73 A;  1UVZ A;  1ON4 A;  4YQU A;  2QGV A;  2YZU A;  1GSF A;  4AJ6 A;  1O73 A;  1V9W A;  2H19 A;  3GFK A;  4G10 A;  4OD7 A;  2FA4 A;  1YF0 A;  4GSN A;  3F63 A;  1M3I A;  3RFR C;  1GTU A;  2GST A;  4OMV A;  1OC9 B;  4I5Q A;  3KMO A;  2R6K A;  5HR3 A;  5A4W A;  3D22 A;  4RQR A;  2IWT A;  2YNX A;  4O5U A;  1SK2 A;  2KUC A;  3GH6 A;  1XWG A;  3LQ7 A;  3TDG A;  1IYH A;  1W4V A;  2K18 A;  2VOC A;  5G30 A;  1F6M C;  2MMN A;  4ECC A;  3GRX A;  2JZR A;  1GLQ A;  2VD1 A;  1PL2 A;  4MPG A;  4PQH A;  4ZB9 A;  3ERW A;  3TJJ A;  4KAE A;  4RI6 A;  1VF3 A;  3CHX C;  3VUR A;  3FR3 A;  3G7I A;  4EUY A;  1YQ1 A;  1G0T A;  3F8U A;  3A2W A;  3M0F A;  1PKZ A;  1G6Y A;  3KP8 A;  2OA7 A;  4ACS A;  3H8Q A;  5CO3 A;  1B8X A;  2KHP A;  3VK9 A;  1FB6 A;  1K3O A;  3W6G A;  2L59 A;  4O92 A;  2HNL A;  2HSN A;  2LV3 A;  1WWJ A;  5DDL A;  4V1A g;  1WOU A;  3LSZ A;  2EFD A;  2K8V A;  1ACV A;  1YEW C;  4MZC A;  3CSH A;  2NDO A;  3TKR A;  3HVX A;  3W8S A;  4KUN A;  4V2N A;  4X0X A;  5HQP A;  2L57 A;  4J56 E;  4ISD A;  1SL2 B;  4NMU A;  2O7K A;  2X64 A;  1BG1 A;  2VL2 C;  5ECO B;  3EVI A;  4HZ2 A;  1XBS A;  2F8F A;  4MDC A;  5INY A;  4EXJ A;  3GX8 A;  1T8E B;  3TJF A;  1SL0 B;  4MH2 A;  1XCC A;  4KSO A;  4KCE A;  2A2R A;  1FVJ A;  5DAL A;  2VL9 A;  3A2V A;  3GST A;  1BJX A;  2I3Y A;  3H1N A;  5HFK A;  3GX0 A;  1PRX A;  3KTL A;  3KH9 A;  3UBK A;  5F06 A;  3P2A A;  5GZZ B;  3ZIV A;  4BVY A;  1MEK A;  3EUR A;  2A4V A;  4AKG A;  4OCF A;  5IMA A;  5IMF A;  2C80 A;  2MBS A;  3ZL5 A;  4KB3 A;  2C8U A;  2KP1 A;  2WZS A;  4IP1 A;  2HRA A;  3FMW A;  4V2L A;  3ZFL A;  3DVX A;  3D21 A;  5IPG A;  2HRF A;  2C0G A;  4BVX A;  5DVB A;  2R5G A;  1N8J A;  1OAZ A;  5J3R A;  4Q5Q A;  1AIU A;  2YWM A;  3RAZ A;  4D73 A;  2RUE A;  3IV4 A;  4MF6 A;  4F82 A;  4IQA A;  3HMJ G;  1TKD B;  2LJR A;  4JR4 A;  3VI7 A;  2WJU A;  2MMA A;  1QGV A;  4GWR A;  1UC7 A;  4MJE A;  2V6O A;  3F9U A;  1M9A A;  4IN0 A;  1XWA A;  4YQV A;  4L5O A;  3BD2 A;  4I6X A;  1YF1 A;  3EU3 A;  2M72 A;  3HXS A;  2HYX A;  5G2Z A;  2JSY A;  3D6I A;  1ZGN A;  2VCT A;  2H0G A;  4E68 A;  2GDR A;  2CVK A;  1MDK A;  1F3A A;  2X99 A;  2GQL A;  2GZP A;  1GNE A;  1EP7 A;  4JZQ A;  3R3E A;  2R3X A;  1CQG A;  3UBL A;  1K0A A;  4J2F A;  3UOM A;  3BBY A;  3ZIJ A;  2YP6 A;  4NHZ A;  1X5E A;  3TKS A;  4CDO A;  4WBJ A;  4XHM A;  2LNS A;  1GUL A;  1YVL A;  1V58 A;  1PKW A;  1NW2 A;  4IQ1 A;  2V1M A;  4MH3 A;  1XWB A;  5A1N B;  5H5S A;  5GAN D;  5HR2 A;  2KP2 A;  4MF7 A;  3Q19 A;  2O8V B;  2JU5 A;  3TKS E;  4Z2T A;  5EVO A;  5ID2 A;  1NHO A;  1K3L A;  1XXU A;  1F2E A;  3F4S A;  1GTA A;  2CQ9 A;  2WVX B;  5F0G A;  1T1V A;  3PH9 A;  2DJ0 A;  2F8A A;  1O81 A;  3GYK A;  5CAX A;  1F3B A;  4QMK A;  1KBN A;  3HJP A;  1A8Y A;  3HYP A;  3GUS A;  3IK7 A;  2DC5 A;  4O32 A;  3CRT A;  2EFH A;  4ZB6 A;  2QC7 A;  5J5N A;  1Q98 A;  3IK9 A;  4KX4 A;  4F03 A;  2IL3 A;  1M3J A;  2QKE A;  1TI3 A;  4MA9 A;  5JCU A;  2HRN A;  1GH2 A;  2IMD A;  3VI5 A;  4K7I A;  3C7M A;  1CQH A;  5IOX A;  2H71 A;  4ZB8 A;  2C3N A;  5G31 A;  1FOH A;  2GQM A;  3UEM A;  4G01 A;  4W66 A;  4HOJ A;  4MP4 A;  3VPQ A;  1XW6 A;  3FZ4 A;  3GL3 A;  3TU3 B;  4BPY A;  4G0L A;  4PI0 C;  1TK8 B;  1N25 A;  3UL3 A;  2LQO A;  5DJL A;  2DKH A;  5A5H A;  2MZC A;  5C00 A;  3FR9 A;  2VCZ A;  1PA3 A;  4JED A;  5DQY A;  2H1G A;  4MAB A;  2JZS A;  1LBK A;  4MLY A;  2LRN A;  4F0C A;  4PQ1 A;  4QQ7 A;  5D9V A;  4HJ2 A;  2WGR A;  2C0F A;  3C1S A;  1EOG A;  4EL1 A;  1OE7 A;  4I2U A;  3IR4 A;  1PGT A;  3RDW A;  1PL1 A;  3QFA C;  1JHB A;  1X5C A;  4G2E A;  1AXD A;  3QOU A;  5CRW A;  3LFL A;  2PWJ A;  1ZZY A;  3EE2 A;  3TGZ A;  1ERU A;  2H01 A;  5ECH B;  2FWH A;  2VCW A;  4WXT A;  2AUV A;  2VCV A;  4Z2R A;  3Q18 A;  2RM6 A;  3TRQ A;  3VWU A;  1RK4 A;  3JCM L;  3Q6O A;  3MDK A;  4NAX A;  5IM9 A;  1EEJ A;  1GP1 A;  3GKX A;  1HD2 A;  3EU4 A;  2HSH A;  4LL1 B;  4HU7 A;  1FO5 A;  3BCK A;  3L9S A;  3D0Z A;  3KIJ A;  4K2X A;  2DBC A;  1O8W A;  3L9U A;  3VWX A;  5KOX A;  1Y1U A;  1YDK A;  2EC4 A;  1SK1 A;  3GIX A;  1ZL9 A;  1ST9 A;  1WPI A;  1DUG A;  2WVY A;  4FH8 A;  1M7T A;  3LXT A;  2K8S A;  3P7X A;  3I69 A;  3N5O A;  5AIS A;  4ULX A;  2IMI A;  3FZ5 A;  5IMD A;  2LRC A;  4OFN A;  5ECQ B;  1HYU A;  4ZIL A;  1X9W B;  1XOB A;  1AAZ A;  1TJD A;  3ZRD A;  2TRX A;  2OBI A;  2FUG 2;  2LTK A;  2GT6 A;  4GF0 A;  3RBT A;  1JZD A;  3HVS A;  2V2G A;  1S3R A;  5COH A;  1ERW A;  17GS A;  16GS A;  2FWF A;  5GSS A;  2MBT A;  2O3E A;  3ZVJ A;  2WZ9 A;  1PD2 1;  3UIW A;  4DSS A;  1AC1 A;  2HZE B;  4F9Z A;  4HZ4 A;  1SEN A;  1AQW A;  2L5L A;  3CSI A;  3QDN A;  2AJQ B;  2TRC P;  5DJM A;  4IHU A;  4NV2 A;  1YKA A;  4G9H A;  2YZH A;  1VRS D;  1MTC A;  1JZO A;  5KN1 A;  3VWW A;  2V6K A;  1MDJ A;  5KOW A;  2H1B A;  4DEJ A;  4KE3 A;  3LYK A;  4X43 A;  3HCZ A;  12GS A;  3GKM A;  3TKP A;  1S3A A;  2PBJ A;  4YKG A;  5ECP B;  2VUP A;  1A2M A;  4OCE A;  1ZMA A;  1SKR B;  5EPF A;  1SKS B;  1XIY A;  3O76 A;  3IAS 2;  5IQY A;  5GAP D;  4BA7 A;  4N0Z A;  4X4J A;  3IA1 A;  3NIV A;  1LU4 A;  3HD5 A;  2M46 A;  3HJM A;  4Z7X A;  1OC3 A;  4POM A;  4GLT A;  5F07 A;  1U6T A;  3H79 A;  5DBQ A;  3ISO A;  2WS2 A;  3L0H A;  2O89 A;  5B6N A;  3H93 A;  2YV7 A;  2VO4 A;  5J41 A;  2HQT A;  3BJ5 A;  1TU8 A;  3D5J A;  4XS4 A;  3QD9 A;  4IP6 A;  1SVO A;  3IC8 A;  2YV9 A;  2WDU A;  2X4A A;  4PI2 C;  3GUR A;  11GS A;  3ERF A;  2K6V A;  3RHC A;  4MK3 A;  4IW9 A;  5IMZ A;  3ERG A;  3F4R A;  3O6T A;  2LEG A;  2LJK A;  1O7U A;  3HHV A;  4WET A;  4OFT A;  2LQQ A;  3GNJ A;  5EL8 A;  4IEL A;  2DJ2 A;  2GT5 A;  2NPB A;  2YWN A;  1I1I P;  5ECK B;  4K1F A;  3M3M A;  3FY7 A;  5HR0 A;  3K8N A;  2MYG A;  3CYN A;  5J4U A;  1I5G A;  2H73 A;  2ZUP A;  3KCM A;  4GDF A;  5J47 A;  1KEB A;  1Z5Y E;  4HDE A;  4F0B A;  1PX7 A;  2C0E A;  1R5A A;  5BMU A;  2WW1 A;  2R0P A;  3TOT A;  1GSQ A;  2B5X A;  2JZT A;  3ED3 A;  4YQM A;  5A4V A;  1FAA A;  4LL4 B;  6GSW A;  2CVD A;  3HZ8 A;  2HRK B;  5IPH A;  3C1R A;  3TJG A;  2B3S A;  3QFB C;  5ECN B;  5E59 A;  1U3A A;  3IHG A;  3CRU A;  4HS1 A;  2R0C A;  1FOV A;  1J0F A;  4EIP A;  1B4Q A;  2HLS A;  3ZYW A;  3H4K A;  1XPV A;  4OO5 A;  3KMN A;  2FD3 A;  3C71 A;  1GLP A;  4BL7 A;  4MCU A;  3QAW A;  2O85 A;  3EYT A;  3FW2 A;  2E7P A;  1JZR A;  1XVW A;  4GXZ A;  4O5Q A;  2H72 A;  3TKS C;  4L8E A;  2KOK A;  1Z6N A;  4Q5R A;  2N5B A;  4LA1 A;  2GSS A;  4LMV A;  3VLN A;  1ZYE A;  4JR6 A;  5D96 A;  2HSM A;  3NZN A;  1GUH A;  1VF2 A;  5JWO B;  3CWG A;  2PN8 A;  3ZMK A;  4KSM A;  1WIK A;  1T7P B;  4QL7 A;  2UZ8 A;  1O85 A;  3GKK A;  3EWL A;  4EO3 A;  3GTU B;  4WKW A;  5CNW A;  4I97 A;  4TXO B;  1TTZ A;  5D9X A;  4MNN A;  1TK5 B;  3IHQ A;  3GH9 A;  5ECR B;  1A0F A;  5D9T A;  2X8C A;  3SBC A;  4USS A;  3V1W A;  2PMT A;  1SK0 A;  3TJK A;  2J23 A;  5JCW A;  4HEA 2;  4XS4 B;  4IGJ A;  2JAC A;  1DSB A;  2I9H A;  2XHF A;  5FHI A;  2GZZ A;  4Z2U A;  3CTF A;  2IFQ A;  3DGQ A;  5CP1 A;  4AJ7 A;  1GTI A;  3TJB A;  4IS0 A;  3L4N A;  3L78 A;  4ML1 A;  4DSQ A;  2B5Y A;  3EC3 A;  1TRW A;  2QA1 A;  5HR1 A;  2DJ3 A;  19GS A;  3RHB A;  4TOP A;  2BMX A;  5AIX A;  4O5R A;  3EMP A;  2LUS A;  5CRE A;  2L6C A;  1ERV A;  1XVQ A;  2DSA A;  3P90 A;  6GSX A;  4H86 A;  1BX9 A;  2A2P A;  1X5D A;  1O6J A;  1EWX A;  4AKI A;  3QCP A;  5H5R A;  4O7H A;  2ZNM A;  1V98 A;  4POB A;  1F9M A;  3P8W A;  4WR4 A;  2WUL A;  2QA2 A;  4K5R A;  4GRF A;  3LG6 A;  1XW5 A;  1Y25 A;  4TW5 A;  2HSN B;  2DMM A;  5IOW A;  3U6V A;  4AJ8 A;  1TP9 A;  1K0O A;  3KXO A;  5ECI B;  6GST A;  2K9F A;  2Z9S A;  4K7O A;  1A24 A;  4PXO A;  1BQ7 A;  5DCH A;  2VAF A;  1TK0 B;  2PER A;  1JLV A;  2YN1 A;  1BYE A;  1OKT A;  3TRX A;  5GST A;  3UJ1 A;  2B7J A;  4KW6 A;  2HFD A;  2L4C A;  1S4B P;  1FHE A;  6GSV A;  2C4J A;  1XOA A;  2O87 A;  4HQZ A;  1F37 A;  2C0D A;  5D93 A;  1Z7P A;  2RM5 A;  2YWI A;  5IO0 A;  5DAL B;  1JZW A;  1T00 A;  1A2L A;  1QMV A;  3ZRE A;  3WYW A;  14GS A;  4FIW A;  3D4M A;  4RUV A;  5B8B A;  2IIY A;  3M9K A;  1OVN A;  5IMV A;  2YJ7 A;  4BVY B;  1K0C A;  3IOS A;  3DWV A;  3AY8 A;  2GS3 A;  5A34 A;  2XBI A;  3D4T A;  3G9B A;  1XZO A;  5KN2 A;  2CT6 A;  5G5F A;  2BJX A;  1J08 A;  3I6A A;  2NTO A;  4E8E A;  3E9J B;  2ZCT A;  2H30 A;  2HZF A;  3HY2 A;  1M2B A;  4ZB7 A;  2XPE A;  4MJC A;  2CZ2 A;  3PGT A;  2DLX A;  4MJA A;  4BVX B;  3UVT A;  4KCA A;  4D73 B;  2EFE A;  4PUF C;  3F6D A;  2WFC A;  1A2J A;  5H5Q A;  4TR1 A;  3KEB A;  5J40 A;  3ZLP A;  2JSZ A;  2MMZ A;  18GS A;  1ERT A;  1Z3E A;  1G7O A;  2GZY A;  5DAK A;  3L9V A;  1A23 A;  2YCD A;  5D8I A;  3DRN A; 
#chains in the Genus database with same CATH homology
 2B6M A;  1SJZ A;  3GL5 A;  1M2A A;  1I9D A;  1OE8 A;  5G1L A;  4FQU A;  4PNF A;  3DXB A;  1SKW B;  3TUE A;  5J4V A;  5ECS A;  1OKD A;  1AQV A;  2GGT A;  2PGT A;  1PN0 A;  5ELG A;  3QR6 A;  4LMW A;  5LCZ A;  3ZFB A;  4PUR A;  1U87 A;  2CX3 A;  4KDX A;  3M9J A;  2AB6 A;  1YEX A;  5JCG A;  4FYC A;  1WJK A;  1ILO A;  1XWK A;  3ZVJ D;  3KJY A;  5CRD A;  4PTS A;  3DD3 A;  5ID2 B;  2G2Q A;  3S9F A;  2GTU A;  4Q5F A;  3CTG A;  5CRH A;  1GSY A;  1MD4 A;  2E2M A;  3E0U A;  5ENU A;  1PMT A;  2LKU A;  2X49 A;  4TVE A;  4PUA A;  5AGY A;  3TCO A;  5DQS A;  1QQ2 A;  3IRA A;  3F3Q A;  2FA8 A;  4RQX A;  1K0N A;  4YH2 A;  3MAK A;  3HZ4 A;  2E0Q A;  4TR4 A;  4GQC A;  4CY8 A;  3QAG A;  1TOF A;  2X8H A;  2RUF A;  4JRR A;  1OYJ A;  4WBR D;  2DIZ A;  4NPB A;  2DJK A;  2XPD A;  4WF5 A;  2YWO A;  4WF4 A;  3GV1 A;  2EFC A;  4IVF A;  2UV8 G;  5ECL B;  5J4Y A;  4XS1 A;  3IE3 A;  3DVW A;  4TR3 A;  1OC9 A;  2V32 A;  3US3 A;  2N5F A;  3BOA A;  5IMC A;  2NVL A;  1S3D A;  2H74 A;  5C04 A;  3WT2 A;  2ON7 A;  1EZK A;  2PVQ A;  4AI6 A;  1EEM A;  5D73 A;  5JWR B;  2WRT A;  2H0I A;  1N2A A;  5F8B A;  5HFG A;  4KH7 A;  2TIR A;  4F2I A;  1GL8 A;  3CXG A;  2F9S A;  2H1D A;  2IMK A;  4K7N A;  2OKA A;  5J9B A;  5A5H B;  3IXR A;  1K0B A;  2JL4 A;  3IC4 A;  4FYB A;  1TI1 A;  2GQK A;  4ZXG A;  5AN1 A;  2H0H A;  2P31 A;  4AF2 A;  1FG4 A;  2VM2 A;  5CRG A;  4EIQ A;  3OR5 A;  2VM1 A;  1BG5 A;  5F05 A;  1PX6 A;  4N30 A;  2AV4 A;  2L6D A;  2H6Y A;  2CAI A;  4ZBB A;  2H1A A;  2OT3 A;  1DE2 A;  4MZW A;  1M9B A;  3FK8 A;  3FZ9 A;  2QSI A;  1ABA A;  1V57 A;  5KEJ A;  2E2G A;  1RQM A;  4XTS A;  2EIR A;  13GS A;  3KZQ A;  1EGO A;  1K0M A;  4EC0 A;  1AUC A;  4AGS A;  1HNA A;  3F6F A;  1Y6E A;  4PQI A;  5KN3 A;  5JWQ B;  4ECB A;  2P5Q A;  1KNG A;  3ME8 A;  1NM3 A;  2EIO A;  3ZTL A;  3VPT A;  8GSS A;  5LD0 A;  3DIE A;  4NWY A;  1THX A;  5J9C A;  4CHS A;  3WGD A;  1VGL A;  3IAM 2;  1T4Y A;  4NXI A;  1X0R A;  4IJ3 A;  2YOI A;  3FKF A;  4N10 A;  5FWG A;  4A5P A;  1B9X C;  1Z9H A;  2H6Z A;  2LJA A;  2XC2 A;  3U5R E;  2B5E A;  4G0K A;  4K0G A;  4AKH A;  4XIH A;  4GQF A;  4PGT A;  4G0I A;  2P0G A;  1YY7 A;  3M1G A;  2C3T A;  1QUW A;  1ZYP A;  2OE1 A;  1SJ6 A;  3ZIT A;  3MWH A;  5ELA A;  1V40 A;  5LNK e;  1LJR A;  2NBS A;  1GRX A;  1GTB A;  4CW9 A;  2H70 A;  3Q74 A;  1SD8 A;  3GHA A;  1HNB A;  1B4P A;  2VD0 A;  3LW9 A;  1JFU A;  4KDU A;  1R7H A;  1G6W A;  3I43 A;  4GTU A;  3MSZ A;  3IDV A;  4DSS B;  5G1K A;  5ECM B;  2HE3 A;  2A2S A;  5L71 A;  1UN2 A;  1WRY A;  2MMO A;  4TXV A;  3CSJ A;  5HFI A;  1YZX A;  1SYR A;  1EV4 A;  5G5E A;  2OE0 A;  3UAP A;  1BAY A;  2YAN A;  4ZBD A;  4POL A;  9GSS A;  1HQO A;  3UMA A;  1U88 A;  1Z7R A;  3RPP A;  4Q5N A;  4XRD A;  4PNG A;  1H75 A;  2FLS A;  5A1N A;  2DKI A;  2H8L A;  4LLR A;  2CVB A;  1VF4 A;  4RI7 A;  4V2M A;  4K2D A;  1GNW A;  2O5V A;  2LRT A;  2HXK A;  1R4W A;  4HQS A;  1U3I A;  3QAV A;  4TRX A;  1GWC A;  3ZML A;  4L0W A;  3A3T A;  5B7C A;  1EV9 A;  1HNC A;  3J7Y b;  4DSR A;  3QPM A;  1M0U A;  1R26 A;  2CZ3 A;  4OWY A;  1SU9 A;  4ZL9 A;  2G0F A;  2GSQ A;  2BTO T;  4WR5 A;  2PUK C;  5IO2 A;  2J9H A;  3UAR A;  3HA9 A;  4BWQ A;  4EE0 A;  4KND A;  2P5R A;  4POK A;  1DBY A;  3R2Q A;  2VLV A;  3DYR A;  5CYY A;  4ILF A;  3W8J A;  4XS6 A;  2VL3 A;  3DML A;  1G7E A;  1SVM A;  1YJ6 A;  2DJ1 A;  1TDI A;  4N3Z A;  4EVM A;  3DKS A;  4ECJ A;  4HI7 A;  1GUM A;  3ME7 A;  2HI7 A;  4I8B A;  1GSE A;  7GSS A;  1OC8 A;  1XFL A;  3KGK A;  1K3Y A;  5DCG A;  2V41 A;  2OAD A;  1NSW A;  1BED A;  1GSS A;  2M80 A;  5A4U A;  3A2X A;  4K9Z A;  5BMU B;  4ECI A;  1USB A;  4N0V A;  3GSS A;  4MF5 A;  2FWE A;  1SL1 B;  5BRT A;  3ZZX A;  1QK8 A;  5ABR A;  4XRA A;  3J7Y k;  5EY6 A;  2AHE A;  3IBH A;  1ZYQ B;  3KTB A;  2AAW A;  4K0N A;  5D9W A;  3FR6 A;  2FY6 A;  4BL7 B;  2KLX A;  1NHY A;  1DE1 A;  4CY6 A;  3PR8 A;  2R37 A;  2OJL A;  3LJR A;  1ZCP A;  4ZL8 A;  2IPA A;  1WMJ A;  1FB0 A;  5B6M A;  2VL2 A;  1B48 A;  2ON5 A;  2HSM B;  3APO A;  4K8M A;  1H4O A;  3HDC A;  2WB9 A;  3CBU A;  3NOF A;  1QXH A;  1TRV A;  3WGE A;  2FNO A;  2CV4 A;  3LYP A;  2CX4 A;  4YAP A;  1YEP A;  3I9V 2;  1A8L A;  4P3Y B;  2AYT A;  4AKX B;  4GCI A;  1GSD A;  4BWS A;  4ZBA A;  1BF5 A;  1A0R P;  4E8H A;  1XWC A;  2JAD A;  3FHK A;  4MPF A;  3KM6 A;  1KTE A;  2IJY A;  1X9S B;  2FWG A;  4KF9 A;  3KD0 A;  1YKC A;  2PVO C;  4NHW A;  1EP8 A;  1W89 A;  3GMF A;  4MMM A;  3TKQ A;  4EKZ A;  5KN0 A;  1TW9 A;  5FT3 A;  2H66 A;  2IFQ B;  4EDZ A;  3FZA A;  4XCS A;  1AW9 A;  1E6B A;  4KGI A;  3A5I A;  3LGC A;  3TRP A;  3KH7 A;  2D2Z A;  4QL9 A;  4EF0 A;  3UVH A;  2YJH A;  3QMX A;  2GLR A;  3M8N A;  1UA5 A;  4DVC A;  2DIY A;  1QFN A;  1TRU A;  1ZOF A;  5IIZ A;  4GSS A;  3F0I A;  2N5A A;  4I2T A;  3MNG A;  2RLI A;  2HZE A;  4IBP A;  4JBB A;  2L4Q A;  3MYD A;  4ICY A;  4V1A p;  3VFI A;  1XW9 A;  2R4V A;  3WGX A;  3HVV A;  3RPN A;  2LS5 A;  2F3M A;  2GVP A;  2IME A;  4MJB A;  2CAQ A;  1URM A;  3TB2 A;  3F3R A;  1AQX A;  1SYX A;  2FHE A;  2DML A;  4GST A;  2I81 A;  4ZIJ A;  4MZB A;  1M99 A;  3EIN A;  2H6X A;  4ID0 A;  1J9B A;  1PQN A;  2ES7 A;  1TU7 A;  4J57 E;  3G7Y A;  1X9M B;  3G7J A;  2F51 A;  2WCI A;  4HU9 A;  3APQ A;  3A5W A;  4TKY A;  3E3E A;  4KA0 A;  3FEU A;  1EGR A;  1WE0 A;  2VLT A;  3GN3 A;  3APS A;  4PX1 A;  2FGX A;  1M2D A;  1FW1 A;  1R5P A;  2FCH A;  22GS A;  2I1U A;  4ML6 A;  1ZYN A;  2VLU A;  1C72 A;  1S3C A;  3LEF A;  2DJJ A;  3PIN A;  4TR0 A;  2VIM A;  3HJO A;  1V2A A;  2OE3 A;  1MDI A;  2LNT A;  4G19 A;  4FYU A;  1PSQ A;  5A34 B;  4JU5 A;  6GSS A;  1TXX A;  4YAV A;  1SD9 A;  3IPZ A;  4IKH A;  4ZL7 A;  3HKR A;  2R0G A;  1GSU A;  2OBK A;  4X1U A;  2IMF A;  1PN9 A;  20GS A;  2H1L A;  2I4A A;  4HUA A;  3EMX A;  5AIV A;  6GSU A;  4OO4 A;  2EIQ A;  2B1K A;  2LST A;  4TR1 B;  1O8X A;  3GA4 A;  1Z6M A;  3GKN A;  2IN3 A;  2C1Y A;  3LOR A;  5DAK B;  3KP9 A;  4IJI A;  3WT1 A;  2YPM A;  4NV5 A;  2GSR A;  3F4T A;  2VCX A;  3EPT A;  2L5O A;  4HJM A;  2OAC A;  3LXZ A;  4OFM A;  3C8E A;  3FYG A;  1WP0 A;  2HRK A;  2ALB A;  2H75 A;  2R2J A;  1SVL A;  5E4W A;  1JLW A;  2A4H A;  2PPT A;  1E2Y A;  4FO5 A;  4YKF A;  1IYI A;  1TXU A;  6GSY A;  2HSY A;  1ML6 A;  3PPU A;  4K6X A;  3BCI A;  1THO A;  3N9J A;  3TOU A;  4WEY A;  4L0U A;  1K0D A;  2C3Q A;  1T3B A;  1T4Z A;  5B8A A;  3FRC A;  2CA8 A;  3VWV A;  2B7K A;  4JE1 A;  1RW1 A;  2VCQ A;  1SJI A;  1Q4J A;  2VKZ G;  5A5K A;  2B1L A;  4N11 A;  2PU9 C;  3DEX A;  3MIX A;  2RII A;  1VF1 A;  1EOH A;  3O3T A;  1B9Y C;  2H76 A;  2REM A;  3SWL A;  1FVK A;  3LWA A;  10GS A;  1GUK A;  4TN8 A;  3GTU A;  2HT9 A;  3CMI A;  4L5L A;  1MD3 A;  4EDY A;  4TXO A;  3WD6 A;  4K5S A;  1TRS A;  2XBQ A;  2X8G A;  4KDY A;  3C73 A;  1UVZ A;  1ON4 A;  4YQU A;  2QGV A;  2YZU A;  1GSF A;  4AJ6 A;  1O73 A;  1V9W A;  2H19 A;  3GFK A;  4G10 A;  4OD7 A;  2FA4 A;  1YF0 A;  4GSN A;  3F63 A;  1GTU A;  2GST A;  4OMV A;  1OC9 B;  4I5Q A;  3KMO A;  2R6K A;  5HR3 A;  5A4W A;  3D22 A;  4RQR A;  2IWT A;  2YNX A;  4O5U A;  1SK2 A;  2KUC A;  3GH6 A;  1XWG A;  3LQ7 A;  3TDG A;  1IYH A;  1W4V A;  2K18 A;  2VOC A;  5G30 A;  1F6M C;  2MMN A;  4ECC A;  3GRX A;  2JZR A;  1GLQ A;  2VD1 A;  1PL2 A;  4MPG A;  4PQH A;  4ZB9 A;  3ERW A;  3TJJ A;  4KAE A;  4RI6 A;  1VF3 A;  3VUR A;  3FR3 A;  3G7I A;  4EUY A;  1YQ1 A;  1G0T A;  3F8U A;  3A2W A;  3M0F A;  1PKZ A;  1G6Y A;  3KP8 A;  2OA7 A;  4ACS A;  3H8Q A;  5CO3 A;  1B8X A;  2KHP A;  3VK9 A;  1FB6 A;  1K3O A;  3W6G A;  2L59 A;  4O92 A;  2HNL A;  2HSN A;  2LV3 A;  1WWJ A;  5DDL A;  4V1A g;  1WOU A;  3LSZ A;  2EFD A;  2K8V A;  1ACV A;  4MZC A;  3CSH A;  2NDO A;  3TKR A;  3HVX A;  3W8S A;  4KUN A;  4V2N A;  4X0X A;  5HQP A;  2L57 A;  4J56 E;  4ISD A;  1SL2 B;  4NMU A;  2O7K A;  2X64 A;  1BG1 A;  2VL2 C;  5ECO B;  3EVI A;  4HZ2 A;  1XBS A;  2F8F A;  4MDC A;  5INY A;  4EXJ A;  3GX8 A;  1T8E B;  3TJF A;  1SL0 B;  4MH2 A;  1XCC A;  4KSO A;  4KCE A;  2A2R A;  1FVJ A;  5DAL A;  2VL9 A;  3A2V A;  3GST A;  1BJX A;  2I3Y A;  3H1N A;  5HFK A;  3GX0 A;  1PRX A;  3KTL A;  3KH9 A;  3UBK A;  5F06 A;  3P2A A;  5GZZ B;  3ZIV A;  4BVY A;  1MEK A;  3EUR A;  2A4V A;  4AKG A;  4OCF A;  5IMA A;  5IMF A;  2C80 A;  2MBS A;  3ZL5 A;  4KB3 A;  2C8U A;  2KP1 A;  4IP1 A;  2HRA A;  3FMW A;  4V2L A;  3ZFL A;  3DVX A;  3D21 A;  5IPG A;  2HRF A;  2C0G A;  4BVX A;  5DVB A;  2R5G A;  1N8J A;  1OAZ A;  5J3R A;  4Q5Q A;  1AIU A;  2YWM A;  3RAZ A;  4D73 A;  2RUE A;  3IV4 A;  4MF6 A;  4F82 A;  4IQA A;  3HMJ G;  1TKD B;  2LJR A;  4JR4 A;  3VI7 A;  2WJU A;  2MMA A;  1QGV A;  4GWR A;  1UC7 A;  4MJE A;  2V6O A;  3F9U A;  1M9A A;  4IN0 A;  1XWA A;  4YQV A;  4L5O A;  3BD2 A;  4I6X A;  1YF1 A;  3EU3 A;  2M72 A;  3HXS A;  2HYX A;  5G2Z A;  2JSY A;  3D6I A;  1ZGN A;  2VCT A;  2H0G A;  4E68 A;  2GDR A;  2CVK A;  1MDK A;  1F3A A;  2X99 A;  2GQL A;  2GZP A;  1GNE A;  1EP7 A;  4JZQ A;  3R3E A;  2R3X A;  1CQG A;  3UBL A;  1K0A A;  4J2F A;  3UOM A;  3BBY A;  3ZIJ A;  2YP6 A;  4NHZ A;  1X5E A;  3TKS A;  4CDO A;  4WBJ A;  4XHM A;  2LNS A;  1GUL A;  1YVL A;  1V58 A;  1PKW A;  1NW2 A;  4IQ1 A;  2V1M A;  4MH3 A;  1XWB A;  5A1N B;  5H5S A;  5GAN D;  5HR2 A;  2KP2 A;  4MF7 A;  3Q19 A;  2O8V B;  2JU5 A;  3TKS E;  4Z2T A;  5EVO A;  5ID2 A;  1NHO A;  1K3L A;  1XXU A;  1F2E A;  3F4S A;  1GTA A;  2CQ9 A;  5F0G A;  1T1V A;  3PH9 A;  2DJ0 A;  2F8A A;  1O81 A;  3GYK A;  5CAX A;  1F3B A;  4QMK A;  1KBN A;  3HJP A;  1A8Y A;  3HYP A;  3GUS A;  3IK7 A;  2DC5 A;  4O32 A;  3CRT A;  2EFH A;  4ZB6 A;  2QC7 A;  5J5N A;  1Q98 A;  3IK9 A;  4KX4 A;  4F03 A;  2IL3 A;  2QKE A;  1TI3 A;  4MA9 A;  5JCU A;  2HRN A;  1GH2 A;  2IMD A;  3VI5 A;  4K7I A;  3C7M A;  1CQH A;  5IOX A;  2H71 A;  4ZB8 A;  2C3N A;  5G31 A;  1FOH A;  2GQM A;  3UEM A;  4G01 A;  4W66 A;  4HOJ A;  4MP4 A;  3VPQ A;  1XW6 A;  3FZ4 A;  3GL3 A;  3TU3 B;  4BPY A;  4G0L A;  1TK8 B;  1N25 A;  3UL3 A;  2LQO A;  5DJL A;  2DKH A;  5A5H A;  2MZC A;  5C00 A;  3FR9 A;  2VCZ A;  1PA3 A;  4JED A;  5DQY A;  2H1G A;  4MAB A;  2JZS A;  1LBK A;  4MLY A;  2LRN A;  4F0C A;  4PQ1 A;  4QQ7 A;  5D9V A;  4HJ2 A;  2WGR A;  2C0F A;  3C1S A;  1EOG A;  4EL1 A;  1OE7 A;  4I2U A;  3IR4 A;  1PGT A;  3RDW A;  1PL1 A;  3QFA C;  1JHB A;  1X5C A;  4G2E A;  1AXD A;  3QOU A;  5CRW A;  3LFL A;  2PWJ A;  1ZZY A;  3EE2 A;  3TGZ A;  1ERU A;  2H01 A;  5ECH B;  2FWH A;  2VCW A;  4WXT A;  2AUV A;  2VCV A;  4Z2R A;  3Q18 A;  2RM6 A;  3TRQ A;  3VWU A;  1RK4 A;  3JCM L;  3Q6O A;  3MDK A;  4NAX A;  5IM9 A;  1EEJ A;  1GP1 A;  3GKX A;  1HD2 A;  3EU4 A;  2HSH A;  4LL1 B;  4HU7 A;  1FO5 A;  3BCK A;  3L9S A;  3D0Z A;  3KIJ A;  4K2X A;  2DBC A;  1O8W A;  3L9U A;  3VWX A;  5KOX A;  1Y1U A;  1YDK A;  2EC4 A;  1SK1 A;  3GIX A;  1ZL9 A;  1ST9 A;  1WPI A;  1DUG A;  4FH8 A;  1M7T A;  3LXT A;  2K8S A;  3P7X A;  3I69 A;  3N5O A;  5AIS A;  4ULX A;  2IMI A;  3FZ5 A;  5IMD A;  2LRC A;  4OFN A;  5ECQ B;  1HYU A;  4ZIL A;  1X9W B;  1XOB A;  1AAZ A;  1TJD A;  3ZRD A;  2TRX A;  2OBI A;  2FUG 2;  2LTK A;  2GT6 A;  4GF0 A;  3RBT A;  1JZD A;  3HVS A;  2V2G A;  5COH A;  1ERW A;  17GS A;  16GS A;  2FWF A;  5GSS A;  2MBT A;  3ZVJ A;  2WZ9 A;  1PD2 1;  3UIW A;  4DSS A;  1AC1 A;  2HZE B;  4F9Z A;  4HZ4 A;  1SEN A;  1AQW A;  2L5L A;  3CSI A;  3QDN A;  2AJQ B;  2TRC P;  5DJM A;  4IHU A;  4NV2 A;  1YKA A;  4G9H A;  2YZH A;  1VRS D;  1MTC A;  1JZO A;  5KN1 A;  3VWW A;  2V6K A;  1MDJ A;  5KOW A;  2H1B A;  4DEJ A;  4KE3 A;  3LYK A;  4X43 A;  3HCZ A;  12GS A;  3GKM A;  3TKP A;  1S3A A;  2PBJ A;  4YKG A;  5ECP B;  2VUP A;  1A2M A;  4OCE A;  1ZMA A;  1SKR B;  5EPF A;  1SKS B;  1XIY A;  3O76 A;  3IAS 2;  5IQY A;  5GAP D;  4BA7 A;  4N0Z A;  4X4J A;  3IA1 A;  3NIV A;  1LU4 A;  3HD5 A;  2M46 A;  3HJM A;  4Z7X A;  1OC3 A;  4POM A;  4GLT A;  5F07 A;  1U6T A;  3H79 A;  5DBQ A;  3ISO A;  2WS2 A;  3L0H A;  2O89 A;  5B6N A;  3H93 A;  2YV7 A;  2VO4 A;  5J41 A;  2HQT A;  3BJ5 A;  1TU8 A;  3D5J A;  4XS4 A;  3QD9 A;  4IP6 A;  1SVO A;  3IC8 A;  2YV9 A;  2WDU A;  2X4A A;  3GUR A;  11GS A;  3ERF A;  2K6V A;  3RHC A;  4MK3 A;  4IW9 A;  5IMZ A;  3ERG A;  3F4R A;  3O6T A;  2LEG A;  2LJK A;  1O7U A;  3HHV A;  4WET A;  4OFT A;  2LQQ A;  3GNJ A;  5EL8 A;  4IEL A;  2DJ2 A;  2GT5 A;  2NPB A;  2YWN A;  5ECK B;  4K1F A;  3M3M A;  3FY7 A;  5HR0 A;  3K8N A;  2MYG A;  3CYN A;  5J4U A;  1I5G A;  2H73 A;  2ZUP A;  3KCM A;  4GDF A;  5J47 A;  1KEB A;  1Z5Y E;  4HDE A;  4F0B A;  1PX7 A;  2C0E A;  1R5A A;  5BMU A;  2R0P A;  3TOT A;  1GSQ A;  2B5X A;  2JZT A;  3ED3 A;  4YQM A;  5A4V A;  1FAA A;  4LL4 B;  6GSW A;  2CVD A;  3HZ8 A;  2HRK B;  5IPH A;  3C1R A;  3TJG A;  2B3S A;  3QFB C;  5ECN B;  5E59 A;  1U3A A;  3IHG A;  3CRU A;  4HS1 A;  2R0C A;  1FOV A;  1J0F A;  4EIP A;  1B4Q A;  2HLS A;  3ZYW A;  3H4K A;  1XPV A;  4OO5 A;  3KMN A;  2FD3 A;  3C71 A;  1GLP A;  4BL7 A;  4MCU A;  3QAW A;  2O85 A;  3EYT A;  3FW2 A;  2E7P A;  1JZR A;  1XVW A;  4GXZ A;  4O5Q A;  2H72 A;  3TKS C;  4L8E A;  2KOK A;  1Z6N A;  4Q5R A;  2N5B A;  4LA1 A;  2GSS A;  4LMV A;  3VLN A;  1ZYE A;  4JR6 A;  5D96 A;  2HSM A;  3NZN A;  1GUH A;  1VF2 A;  5JWO B;  3CWG A;  2PN8 A;  3ZMK A;  4KSM A;  1WIK A;  1T7P B;  4QL7 A;  2UZ8 A;  1O85 A;  3GKK A;  3EWL A;  4EO3 A;  3GTU B;  4WKW A;  5CNW A;  4I97 A;  4TXO B;  1TTZ A;  5D9X A;  4MNN A;  1TK5 B;  3IHQ A;  3GH9 A;  5ECR B;  1A0F A;  5D9T A;  2X8C A;  3SBC A;  4USS A;  3V1W A;  2PMT A;  1SK0 A;  3TJK A;  2J23 A;  5JCW A;  4HEA 2;  4XS4 B;  4IGJ A;  2JAC A;  1DSB A;  2I9H A;  2XHF A;  5FHI A;  2GZZ A;  4Z2U A;  3CTF A;  2IFQ A;  3DGQ A;  5CP1 A;  4AJ7 A;  1GTI A;  3TJB A;  4IS0 A;  3L4N A;  3L78 A;  4ML1 A;  4DSQ A;  2B5Y A;  3EC3 A;  1TRW A;  2QA1 A;  5HR1 A;  2DJ3 A;  19GS A;  3RHB A;  4TOP A;  2BMX A;  5AIX A;  4O5R A;  3EMP A;  2LUS A;  5CRE A;  2L6C A;  1ERV A;  1XVQ A;  2DSA A;  3P90 A;  6GSX A;  4H86 A;  1BX9 A;  2A2P A;  1X5D A;  1O6J A;  1EWX A;  4AKI A;  3QCP A;  5H5R A;  4O7H A;  2ZNM A;  1V98 A;  4POB A;  1F9M A;  3P8W A;  4WR4 A;  2WUL A;  2QA2 A;  4K5R A;  4GRF A;  3LG6 A;  1XW5 A;  1Y25 A;  4TW5 A;  2HSN B;  2DMM A;  5IOW A;  3U6V A;  4AJ8 A;  1TP9 A;  1K0O A;  3KXO A;  5ECI B;  6GST A;  2K9F A;  2Z9S A;  4K7O A;  1A24 A;  4PXO A;  1BQ7 A;  5DCH A;  2VAF A;  1TK0 B;  2PER A;  1JLV A;  2YN1 A;  1BYE A;  1OKT A;  3TRX A;  5GST A;  3UJ1 A;  2B7J A;  4KW6 A;  2HFD A;  2L4C A;  1FHE A;  6GSV A;  2C4J A;  1XOA A;  2O87 A;  4HQZ A;  1F37 A;  2C0D A;  5D93 A;  1Z7P A;  2RM5 A;  2YWI A;  5IO0 A;  5DAL B;  1JZW A;  1T00 A;  1A2L A;  1QMV A;  3ZRE A;  3WYW A;  14GS A;  4FIW A;  3D4M A;  4RUV A;  5B8B A;  2IIY A;  3M9K A;  1OVN A;  5IMV A;  2YJ7 A;  4BVY B;  1K0C A;  3IOS A;  3DWV A;  3AY8 A;  2GS3 A;  5A34 A;  2XBI A;  3D4T A;  3G9B A;  1XZO A;  5KN2 A;  2CT6 A;  5G5F A;  2BJX A;  1J08 A;  3I6A A;  2NTO A;  4E8E A;  3E9J B;  2ZCT A;  2H30 A;  2HZF A;  3HY2 A;  1M2B A;  4ZB7 A;  2XPE A;  4MJC A;  2CZ2 A;  3PGT A;  2DLX A;  4MJA A;  4BVX B;  3UVT A;  4KCA A;  4D73 B;  2EFE A;  4PUF C;  3F6D A;  2WFC A;  1A2J A;  5H5Q A;  4TR1 A;  3KEB A;  5J40 A;  3ZLP A;  2JSZ A;  2MMZ A;  18GS A;  1ERT A;  1Z3E A;  1G7O A;  2GZY A;  5DAK A;  3L9V A;  1A23 A;  2YCD A;  5D8I A;  3DRN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...