5AIVA

Complex of human hematopoietic prostagandin d2 synthase (hh-pgds) in complex with an active site inhibitor.
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
198
structure length
198
Chain Sequence
PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTENTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEMATOPOIETIC PROSTAGLANDIN D SYNTHASE
publication title Identification of Indole Inhibitors of Human Hematopoietic Prostaglandin D2 Synthase (Hh-Pgds).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 72
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2015-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5aivA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5aivA01
3M1GA 2ES7A 4NWYA 2HE3A 1QQ2A 2KP1A 6GSVA 1YJ6A 1GTBA 5DAKA 2CA8A 4OFNA 3IC8A 1T4YA 3CYNA 3ERGA 2IN3A 1YEPA 4ZIJA 3IDVA 3LJRA 1PL2A 2HFDA 3FZ4A 5ABRA 3EYTA 4F0BA 4Q5FA 1EGOA 1XFLA 5JCGA 3ZREA 3UIWA 4PUAA 1O8XA 4KCEA 3J7Yb 1MTCA 4ZB8A 2FNOA 2OADA 5L71A 5J4UA 2H70A 4G2EA 5CNWA 3LXTA 5GAND 1ACVA 3PINA 4FYCA 4POLA 3BD2A 4K0GA 4MF6A 3TJKA 2C0GA 3W8SA 1MDJA 1ML6A 2M72A 4KSMA 2H30A 3TOTA 3N9JA 1VF3A 2IMDA 5DCGA 3GSSA 4IVFA 2PGTA 5G5FA 1GULA 2F8FA 4PTSA 2YV7A 4LL4B 5FHIA 1JHBA 3CBUA 5B7CA 2DIYA 4IP1A 3R2QA 2GDRA 1EZKA 5ELAA 17GSA 2H01A 3D4MA 1ZZYA 3GHAA 2WB9A 2Z9SA 4WETA 3RHCA 5IQYA 1OC8A 4BVYB 4FIWA 3D0ZA 3OR5A 1RK4A 2QC7A 3IK9A 1O81A 4K8MA 2YJHA 2H0IA 1EGRA 3APQA 1FVJA 3APOA 1GSEA 2C3QA 2B7JA 1YKAA 1XW9A 2H1BA 4XIHA 2HSHA 3VURA 1AUCA 2CAQA 1K3YA 4HUAA 1USBA 1PSQA 1T4ZA 3FZ5A 3GFKA 1AIUA 4FYUA 2JL4A 2O89A 3H4KA 2HQTA 4PNGA 4OFMA 1GL8A 3DGQA 2OE0A 4MCUA 1LJRA 2LUSA 2CX3A 4KAEA 2K8VA 3R3EA 5HR1A 1OKTA 3UBLA 2H6ZA 2AHEA 3ZFLA 6GSTA 3TKSC 1O7UA 3M8NA 2E2GA 1GTUA 3CSIA 4HJ2A 1ZMAA 4KGIA 4F0CA 2CVBA 2B5EA 1RW1A 4DVCA 3UMAA 1FW1A 1A0RP 2LKUA 4GQCA 1ON4A 3MWHA 3KMNA 5G30A 1VRSD 4ZB6A 3QCPA 4WBRD 2GQKA 3TRQA 4YAVA 3M9KA 2AUVA 1TP9A 5J9BA 3GKNA 3ZITA 3GV1A 3H8QA 3BCIA 3QFAC 1ZYEA 2K8SA 2FD3A 3CRUA 3UOMA 4J57E 1YF1A 1LBKA 4EC0A 3ED3A 1B9XC 2KHPA 2JACA 4HS1A 2GSSA 4AF2A 4ILFA 3FYGA 4MZBA 2PU9C 1OC9B 3C1RA 4KNDA 4QQ7A 1TKDB 1GUMA 1K0DA 2LEGA 2LNTA 4LL1B 2FA8A 3EU4A 5E4WA 2VCWA 5DJMA 2P5QA 1GSQA 3HJMA 2LQOA 2PPTA 4I8BA 2O7KA 1FHEA 2DSAA 2MMZA 4IGJA 5CYYA 3KZQA 3LFLA 3SBCA 3WGDA 1TU8A 2FWHA 1Y6EA 3W8JA 2VL9A 3KIJA 3WD6A 3TJJA 2L59A 4BWQA 4EKZA 4L8EA 1G0TA 1MDKA 22GSA 2VLUA 3E0UA 1TK8B 1G7EA 1XPVA 3DYRA 5ECLB 2MMAA 2ON5A 3RPNA 4GRFA 3KH9A 3QR6A 4AJ8A 3O76A 1XIYA 1T8EB 3A2XA 4MH2A 1ABAA 4ZBBA 2YJ7A 3HCZA 2H6XA 1ZGNA 2V41A 3IHQA 2R6KA 1CQGA 2VCVA 4AJ6A 1Z6MA 1IYHA 1J08A 4POMA 4AGSA 2AYTA 2LQQA 1QFNA 3KGKA 1FB6A 4H86A 2K6VA 4ID0A 2I3YA 4NMUA 2DJJA 3L9VA 2IWTA 4YAPA 4ZILA 1YY7A 3MAKA 3DRNA 3Q19A 1GNWA 3GX8A 4MP4A 1M9BA 5G1LA 5D73A 2H6YA 4EO3A 2FA4A 1K0BA 4ZL8A 1UN2A 1ZCPA 3CRTA 2MMOA 4BA7A 1XXUA 1XW5A 3GURA 2K9FA 3ME8A 3LGCA 1BJXA 3Q18A 4HJMA 3FHKA 9GSSA 2H1GA 2JU5A 2N5AA 2R2JA 2PMTA 2PVOC 2IMIA 1GUKA 1WP0A 2IMEA 2FUG2 3VWXA 1J9BA 2KLXA 2RM5A 3KXOA 3QOUA 5ECSA 3A2WA 4MDCA 3QDNA 3E3EA 2CVKA 3C73A 5CO3A 4PUFC 3NIVA 4JBBA 3GTUB 1FG4A 2F9SA 4MMMA 4MJEA 5IMFA 4D73A 3CXGA 4GLTA 3D21A 11GSA 1EEMA 1BQ7A 2X8HA 2MBSA 1QGVA 4GQFA 2X64A 4FO5A 4IKHA 8GSSA 3ZMLA 4MF5A 3F6FA 1JZOA 4E8HA 1F6MC 1Q98A 4F82A 3TRXA 3EMPA 1SD8A 2IJYA 3HZ4A 1ZOFA 5GSTA 1HQOA 4K7OA 3I43A 2P5RA 2L6CA 5HR3A 2A2SA 3HJOA 1TJDA 4TR1A 3IE3A 5ECMB 1H4OA 2FY6A 4F2IA 5D9WA 1R4WA 1BYEA 5KN0A 1THXA 5JWRB 3P2AA 4RI7A 4XRAA 1I5GA 1TRVA 3GKMA 4IN0A 3HDCA 4KH7A 3FZAA 3TCOA 3TKPA 2GVPA 4IHUA 4X0XA 3FK8A 5H5SA 1QUWA 3TKQA 4XRDA 2EC4A 4HDEA 5C00A 1F9MA 2REMA 3TKSE 2KOKA 4TR1B 1DE2A 1MD4A 3PGTA 1U88A 3BJ5A 2RUFA 2HZFA 4KA0A 2IMKA 2BMXA 2YWOA 1ERUA 3L0HA 3FEUA 5INYA 2YZUA 4X43A 2VL2A 2VCZA 1BG5A 4BWSA 1XOAA 3ZYWA 2DJKA 5ECPB 3KP9A 4HZ2A 3F4RA 2PVQA 10GSA 5IMZA 5H5QA 3F8UA 2YV9A 2JADA 4J2FA 1PKZA 3LQ7A 3DXBA 5ECOB 3ZTLA 1T1VA 4MJAA 5D93A 3IAS2 3IA1A 4KDXA 2GQLA 5G5EA 1CQHA 2JZSA 4J56E 3Q74A 1V98A 3GH6A 2HSYA 1QK8A 1K0NA 3GRXA 5DCHA 1EEJA 2E2MA 2YOIA 3RPPA 1PX6A 4WF5A 2C4JA 3GUSA 2CAIA 2V6KA 4GWRA 3EE2A 3UVTA 2O8VB 4USSA 4TOPA 3VK9A 1SU9A 1XW6A 1PD21 5DAKB 4N11A 1A24A 3EURA 3DWVA 1F3AA 5ELGA 2HI7A 1TU7A 5AN1A 1A0FA 13GSA 1R5PA 4IS0A 2YWNA 5A4VA 2VCTA 6GSUA 1WIKA 2V32A 5JWQB 4CW9A 4G9HA 3TB2A 1W4VA 3NZNA 2ZCTA 2B7KA 1AQWA 1HNAA 4ZXGA 2FWEA 1GRXA 1TK0B 4HQZA 1FO5A 1U87A 2HSMA 3MDKA 1JLWA 5DALA 3HHVA 5COHA 1GSYA 4GXZA 1V57A 1PMTA 1B4QA 4GSSA 2GZZA 2LV3A 2TIRA 4HQSA 2MBTA 5DBQA 4IP6A 14GSA 1MD3A 1TTZA 4G0KA 2AB6A 3F6DA 1Z3EA 4KE3A 2L5LA 4L5OA 3APSA 1B4PA 5B8BA 1EOGA 2H66A 4FQUA 4N10A 1A8LA 4N0VA 1HYUA 3D5JA 4EUYA 5CRWA 1X5DA 4WR5A 2V6OA 5ECQB 2L6DA 2WGRA 3M0FA 3TKRA 1XZOA 4XHMA 4NHZA 5GSSA 3CMIA 5EY6A 4CHSA 2B5YA 3HVXA 3KTBA 5JWOB 2B1LA 2MYGA 5IOWA 1AXDA 2ZNMA 1GWCA 4JZQA 1BEDA 2GZYA 5HFIA 3WGXA 5J9CA 5ECIB 4XTSA 1UC7A 2DMLA 3ZIVA 5CRDA 1NW2A 4MPGA 2L4QA 2OE1A 3TKSA 3P8WA 1FB0A 1SL2B 2WJUA 1M9AA 4XS4A 3I69A 2N5BA 2C3NA 3GL3A 4OCFA 3IBHA 1SYRA 4TN8A 3EVIA 3H1NA 2LTKA 1YQ1A 1XWCA 3LSZA 1XWKA 5F07A 1K0MA 4LMVA 2VIMA 3DMLA 4MLYA 5IMCA 4WF4A 3TRPA 4GCIA 4TRXA 4K9ZA 5FT3A 4PX1A 2H8LA 2B3SA 4I2TA 3L9SA 1GP1A 4ZBAA 2KUCA 2GGTA 3GIXA 5LCZA 3WT2A 4HZ4A 3VWVA 2FCHA 2L4CA 1OAZA 3DVWA 1X9SB 1GNEA 5AISA 2LRCA 12GSA 2GTUA 2LSTA 1W89A 1GSDA 3US3A 1FOVA 1JZWA 1NM3A 3VI5A 1TRSA 3GSTA 2C3TA 3G7YA 2O85A 1JLVA 2WZ9A 4TR4A 2PBJA 3KJYA 4JRRA 2NVLA 6GSXA 4WXTA 2H0GA 5ID2A 3KMOA 4DEJA 4ECJA 3ZVJA 3QMXA 4Q5RA 1J0FA 5D9VA 2X8GA 2TRXA 2JZTA 4MPFA 3F3RA 3VFIA 1R26A 3FKFA 4IW9A 3WT1A 2WULA 4DSRA 3HD5A 5DVBA 5KN2A 2H74A 4EE0A 1M2AA 4DSSA 2HZEA 1UVZA 1PN9A 4NPBA 2LJKA 2OBIA 4ISDA 5C04A 2IFQA 5IO0A 1NHYA 3ME7A 4V2LA 2UZ8A 1G6YA 4I2UA 1OC3A 3BOAA 1A2LA 2GSQA 4EL1A 7GSSA 3L78A 2A4VA 2QGVA 2H1AA 3VI7A 1Z7RA 3GA4A 3EMXA 4YQMA 4OD7A 1Z5YE 1TI3A 5KN1A 4OO5A 5B8AA 3ERWA 1AC1A 4LLRA 1F37A 5F06A 2E7PA 3LEFA 3ZLPA 5DQSA 2VL3A 2HT9A 1GUHA 2IFQB 1SD9A 1DSBA 3IRAA 5G1KA 2WS2A 3F9UA 2YCDA 3QFBC 2IMFA 3ZIJA 1XWGA 4OMVA 2C0EA 2NPBA 1MDIA 4QL7A 1R5AA 2HRKA 3HKRA 1X5CA 1ST9A 2WRTA 5IIZA 5HQPA 2P0GA 5CAXA 2GSRA 2G0FA 5KEJA 3RBTA 4N0ZA 4TXVA 1TW9A 1XWAA 4TR3A 3FR6A 4KDYA 2C0FA 3IXRA 1ERVA 2O87A 1Q4JA 5CRHA 3K8NA 3QAGA 4KF9A 2YWMA 4G19A 1TK5B 1XOBA 2M46A 1EOHA 4JR6A 1F2EA 3IC4A 1AQVA 4CDOA 4K7NA 1PKWA 2OBKA 1S3CA 3CTGA 3F0IA 2YANA 3D6IA 3IOSA 2R4VA 3GN3A 2A2RA 2LRNA 2KP2A 2NTOA 3DD3A 3KTLA 2VAFA 5IPGA 2LJAA 3QAVA 4L5LA 1XVQA 2RIIA 3F4TA 1K3LA 2RLIA 4BVXA 2X99A 1VF1A 1E2YA 4O5RA 2AV4A 5DQYA 5J3RA 2F3MA 4NXIA 3ZZXA 2CX4A 4G10A 1WMJA 1B8XA 2ON7A 4OO4A 4HEA2 4I97A 2GT5A 5HR2A 2HRAA 2J9HA 2JZRA 4I6XA 3HVSA 4D73B 2VLTA 2HRFA 4MF7A 2EIQA 1EV9A 3GL5A 2FWGA 2D2ZA 1A8YA 1JZDA 1U3AA 2CZ3A 4AJ7A 3JCML 1M0UA 1YKCA 4V2NA 4K1FA 3F63A 1U6TA 4BVXB 4KCAA 1SK0A 4ML6A 2RM6A 4POBA 3UVHA 1SJ6A 4XCSA 5JCWA 5KN3A 4HU7A 2GQMA 1T7PB 2GLRA 4K6XA 5B6MA 2OACA 1WJKA 5G2ZA 4KDUA 2VD0A 3H93A 3FRCA 1X5EA 3G7JA 5A4UA 4TXOA 1E6BA 2C0DA 1SKRB 1XWBA 2VOCA 4O92A 3CTFA 2RUEA 1K0AA 3TJBA 2M80A 1EV4A 4GSTA 2GS3A 3TGZA 2NDOA 1FAAA 2DJ2A 3NOFA 2YN1A 3GYKA 1BAYA 1EP8A 4MJBA 4Q5QA 4EDZA 2V1MA 3RAZA 2GSTA 1GLPA 4TR0A 4YH2A 1A23A 4EVMA 1THOA 2PN8A 4TXOB 2CV4A 3LWAA 19GSA 1GLQA 2C8UA 4GSNA 4MJCA 4G0LA 1SL0B 3CSJA 1PGTA 2R5GA 2H71A 3UJ1A 2QSIA 1T00A 2OKAA 3IR4A 3A3TA 1HNBA 2DJ3A 2HYXA 4ZB9A 3LXZA 2B5XA 5CP1A 1DBYA 4MA9A 1O85A 3LYPA 5D9TA 3ZL5A 1S3DA 5ECHB 3HA9A 1V40A 2V2GA 1TI1A 3KH7A 1VF4A 1K0OA 1Z9HA 4WBJA 5ENUA 2WDUA 1OE8A 4GTUA 1V2AA 2JSZA 5BMUA 3ERFA 4JU5A 1C72A 4BVYA 4I5QA 3DIEA 1WRYA 1T3BA 1XBSA 2H75A 3WGEA 1GTIA 4IJ3A 1X9MB 2YP6A 3IV4A 1O8WA 3GKXA 2L5OA 2VM2A 3I9V2 4MH3A 2GZPA 3DVXA 4Z7XA 3QAWA 1PX7A 2VD1A 3HJPA 5LNKe 3LORA 3GX0A 4KUNA 3U5RE 5DDLA 3EINA 5HR0A 1TXXA 3A5WA 3ZMKA 3EU3A 4KX4A 3G9BA 1VF2A 1ERWA 2IIYA 1SKWB 4BL7A 2EIRA 1Z7PA 3KM6A 2JSYA 1GTAA 2YNXA 4JEDA 1QXHA 1ZYQB 2FGXA 3C8EA 5G31A 1JZRA 2DJ1A 4EF0A 2P31A 4OWYA 1KNGA 1SKSB 4PNFA 4V1Ag 2QKEA 1GSSA 2I81A 1TDIA 2IL3A 2XBIA 1AW9A 3S9FA 2HSMB 3M3MA 2TRCP 3FY7A 5DALB 2R3XA 4X1UA 3A2VA 3E9JB 5CREA 4LA1A 2F51A 3ISOA 1OKDA 1WOUA 1V58A 2HSNB 1A2JA 1WWJA 1PA3A 3SWLA 3UARA 4ZL7A 5HFGA 4BL7B 5EPFA 3F3QA 4PQ1A 3MNGA 1YEXA 1G7OA 1M2DA 3U6VA 2LJRA 1TRWA 4BPYA 5LD0A 3PH9A 4P3YB 3RHBA 1GSFA 4TW5A 2VLVA 3KP8A 3V1WA 3L4NA 5EL8A 4NAXA 4LMWA 3ZFBA 2DJ0A 2VCXA 1Z6NA 3TUEA 4L0UA 1KEBA 4HU9A 3UEMA 1SJIA 4N30A 3ZRDA 4NHWA 1OC9A 2I4AA 2H76A 2HRNA 2LNSA 3GH9A 5JCUA 1HNCA 1BX9A 2DC5A 3DEXA 3IPZA 1PL1A 1M99A 4PGTA 3G7IA 2H1DA 3M9JA 4YQUA 2YZHA 4JR4A 3AY8A 1AAZA 2H19A 2DBCA 1N8JA 3FW2A 3HXSA 1OE7A 2HXKA 2FHEA 3GMFA 1F3BA 5IPHA 3VPQA 2B1KA 4XS4B 4ECCA 1O6JA 1X0RA 3VWWA 3TDGA 4K7IA 3TJFA 1PQNA 1URMA 1RQMA 3BBYA 2CQ9A 3CSHA 18GSA 5AIVA 1N2AA 2XC2A 1YZXA 2LRTA 3DKSA 5DJLA 4HOJA 3IAM2 4WKWA 2C80A 4FH8A 4JE1A 3GNJA 5CRGA 2WCIA 4RQRA 2VM1A 2H73A 5HFKA 3HY2A 2AJQB 4KB3A 1VGLA 1WE0A 5D8IA 3P7XA 5A4WA 4FYBA 1K0CA 2XHFA 5F05A 3H79A 2OE3A 4XS1A 3EC3A 1U3IA 5IO2A 2L57A 4PQIA 2HNLA 1FVKA 1GSUA 3C71A 4PXOA 2E0QA 4L0WA 1YF0A 5F8BA 4PURA 2BTOT 1MEKA 1XCCA 4Q5NA 2H72A 5ID2B 1QMVA 2XPDA 1GH2A 2G2QA 2X8CA 4POKA 5F0GA 4NV2A 2B6MA 1DE1A 3N5OA 4EXJA 1EP7A 3PR8A 1TOFA 3VPTA 4GF0A 1WPIA 4PQHA 1M2BA 4DSSB 2HZEB 1JFUA 3Q6OA 4MZCA 2EIOA 4DSQA 1KBNA 1SK1A 5B6NA 3MSZA 4ULXA 5D96A 3UL3A 1NHOA 4V1Ap 2OA7A 4WR4A 5ECRB 3BCKA 3GKKA 2DMMA 5J5NA 2I9HA 4O32A 2YPMA 5IMVA 1ZL9A 1B9YC 3C7MA 2VCQA 1G6WA 3O3TA 1V9WA 2C1YA 2DLXA 4ZBDA 20GSA 2DIZA 1SJZA 2MZCA 1LU4A 3GTUA 5ECKB 4KSOA 16GSA 1OYJA 2WFCA 2CVDA 1S3AA 1R7HA 5GAPD 2CT6A 5E59A 5J41A 4NV5A 2FWFA 2H0HA 2HRKB 4F03A 4IELA 1XVWA 4MABA 3KEBA 2J23A 5AIXA 1M7TA 4XS6A 2PWJA 5IOXA 6GSSA 1UA5A 1X9WB 2FLSA 3P90A 4YQVA 4TVEA 5EVOA 3D22A 4ML1A 3ZVJD 4OFTA 3HYPA 3J7Yk 1DUGA 4ACSA 3HZ8A 1IYIA 3VWUA 3C1SA 4E8EA 4WEYA 1A2MA 3I6AA 2N5FA 5AGYA 4IBPA 1ILOA 4MZWA 3D4TA 4F9ZA 3FR9A 4OCEA 4RQXA 1B48A 2PUKC 5IM9A 4RUVA 3WYWA 2VO4A 1PRXA 2HLSA 2YWIA 5GZZB 3QD9A 3UBKA 4TKYA 2AAWA 4IJIA 4ECIA 4K2DA 3UAPA 2OJLA 4HI7A 2GT6A 1SENA 4ZL9A 3LYKA 1Y25A 4G0IA 3TOUA 1SL1B 5H5RA 2VUPA 1SK2A 1KTEA 3VLNA 2PERA 1ERTA 4RI6A 1NSWA 3L9UA 3O6TA 2BJXA 3HVVA 5IMDA 2NBSA 2ZUPA 2K18A 6GSWA 1YDKA 2F8AA 1AQXA 5D9XA 3EWLA 3QPMA 1H75A 3KD0A 3PPUA 3RDWA 5A5KA 5ECNB 5FWGA 1TRUA 4V2MA 4MK3A 2LS5A 3FR3A 4K0NA 2XBQA 4IQ1A 4IQAA 1HD2A 4KW6A 2I1UA 3W6GA 1OVNA 2MMNA 3F4SA 1O73A 2XPEA 2R37A 1I9DA 3LG6A 3FZ9A 2VL2C 1SYXA 4O7HA 3TJGA 4ECBA 3KCMA 2CZ2A 5IMAA 4EDYA 1EWXA 2ALBA 4QL9A 3IK7A 1K3OA 6GSYA 2IPAA
chains in the Genus database with same CATH superfamily
3M1GA 2ES7A 4NWYA 2HE3A 1QQ2A 2KP1A 6GSVA 1YJ6A 1GTBA 5DAKA 2CA8A 4OFNA 3IC8A 1T4YA 3CYNA 3ERGA 2IN3A 1YEPA 4ZIJA 3IDVA 3LJRA 1PL2A 2HFDA 3FZ4A 5ABRA 3EYTA 4F0BA 4AI6A 4Q5FA 1EGOA 1XFLA 5JCGA 3ZREA 3UIWA 4PUAA 1O8XA 4KCEA 3J7Yb 1MTCA 4ZB8A 1PN0A 2FNOA 2EFCA 2OADA 5L71A 5J4UA 2H70A 4G2EA 5CNWA 3LXTA 5GAND 1SVMA 1ACVA 3PINA 4FYCA 4POLA 3BD2A 4K0GA 4MF6A 3TJKA 2C0GA 3W8SA 1MDJA 2WVZA 1ML6A 2M72A 4KSMA 2H30A 3TOTA 3N9JA 1VF3A 2IMDA 5DCGA 3GSSA 4IVFA 2OT3A 2PGTA 5G5FA 1GULA 2F8FA 4PTSA 2YV7A 4LL4B 5FHIA 1JHBA 3CBUA 5B7CA 2DIYA 4IP1A 3R2QA 2GDRA 1EZKA 5ELAA 17GSA 2H01A 3D4MA 1ZZYA 3GHAA 2WB9A 2Z9SA 5BMUB 4WETA 3RHCA 3EPTA 3LW9A 5IQYA 1OC8A 4BVYB 4FIWA 3D0ZA 3OR5A 1RK4A 2QC7A 3IK9A 1O81A 4K8MA 2YJHA 2H0IA 1EGRA 3APQA 1FVJA 3APOA 1GSEA 2C3QA 2B7JA 1YKAA 1XW9A 2H1BA 4XIHA 2HSHA 3VURA 1AUCA 2CAQA 1K3YA 4HUAA 1USBA 1PSQA 1T4ZA 3FZ5A 3GFKA 1AIUA 4FYUA 1YEWC 2JL4A 2O89A 3H4KA 2HQTA 4PNGA 4OFMA 1GL8A 3DGQA 2OE0A 4MCUA 1LJRA 2LUSA 2CX3A 4KAEA 2K8VA 3R3EA 5HR1A 1OKTA 3UBLA 2H6ZA 2AHEA 2O36A 3ZFLA 6GSTA 3TKSC 1O7UA 3M8NA 2E2GA 1GTUA 3CSIA 4G01A 4HJ2A 1ZMAA 4KGIA 4F0CA 2CVBA 2B5EA 1RW1A 4DVCA 3UMAA 1FW1A 1A0RP 2LKUA 4K5RA 4GQCA 1ON4A 3MWHA 3KMNA 5G30A 1VRSD 2UV8G 4ZB6A 3QCPA 4WBRD 2GQKA 3TRQA 4YAVA 3M9KA 2AUVA 1TP9A 5J9BA 3GKNA 3ZITA 3GV1A 3H8QA 3BCIA 3QFAC 1ZYEA 2K8SA 2FD3A 3CRUA 3UOMA 4J57E 1YF1A 1LBKA 4EC0A 3ED3A 1B9XC 2KHPA 2JACA 4HS1A 2GSSA 4AF2A 4ILFA 3FYGA 4MZBA 2PU9C 1OC9B 3C1RA 4KNDA 4QQ7A 1TKDB 1GUMA 1K0DA 2LEGA 2LNTA 2A2PA 2FA8A 3EU4A 4LL1B 5E4WA 2VCWA 5DJMA 2P5QA 1GSQA 3HJMA 5J4YA 2LQOA 2PPTA 4I8BA 2O7KA 1FHEA 2DSAA 2MMZA 4IGJA 5CYYA 4PHZC 3KZQA 3LFLA 3SBCA 3WGDA 1TU8A 2FWHA 1Y6EA 3W8JA 2VL9A 3KIJA 4MNNA 3WD6A 3TJJA 2L59A 4BWQA 4EKZA 4L8EA 1G0TA 1MDKA 22GSA 2VLUA 3E0UA 1TK8B 1G7EA 1XPVA 3DYRA 5ECLB 2MMAA 2ON5A 3RPNA 2VKZG 4GRFA 3KH9A 3QR6A 4AJ8A 3O76A 1XIYA 1T8EB 3A2XA 4MH2A 1ABAA 4ZBBA 2YJ7A 3HCZA 2H6XA 1ZGNA 2V41A 3IHQA 2R6KA 1CQGA 2VCVA 4AJ6A 1Z6MA 1IYHA 1J08A 4POMA 1SVLA 4AGSA 2AYTA 2LQQA 1QFNA 3KGKA 1FB6A 4H86A 2K6VA 4ID0A 2I3YA 4NMUA 2DJJA 3L9VA 2IWTA 4YAPA 5KOXA 4ZILA 1YY7A 3MAKA 4FXYP 3DRNA 3Q19A 1GNWA 4AKXB 3GX8A 2WZSA 4MP4A 1M9BA 5G1LA 2QA1A 5D73A 2H6YA 4EO3A 2FA4A 1K0BA 4ZL8A 1UN2A 1ZCPA 3CRTA 4AKGA 2MMOA 4BA7A 1XXUA 1XW5A 3GURA 2K9FA 3ME8A 3LGCA 2A4HA 3Q18A 3FHKA 9GSSA 2H1GA 4HJMA 2JU5A 1BJXA 2N5AA 2R2JA 2PMTA 2PVOC 2IMIA 1GUKA 1WP0A 2IMEA 2FUG2 3VWXA 1J9BA 2KLXA 4K2XA 2RM5A 3KXOA 3QOUA 5ECSA 3A2WA 4MDCA 3QDNA 3E3EA 2CVKA 3C73A 5CO3A 4PUFC 3NIVA 4JBBA 3GTUB 1FG4A 2F9SA 4MMMA 4MJEA 5IMFA 4D73A 3CXGA 4GLTA 3D21A 11GSA 1EEMA 1BQ7A 2X8HA 2MBSA 4EIQA 1QGVA 4GQFA 4PI2C 1XG8A 2X64A 4FO5A 4IKHA 8GSSA 3ZMLA 4MF5A 3F6FA 1JZOA 4E8HA 1F6MC 1Q98A 4F82A 3TRXA 3EMPA 1SD8A 2IJYA 3HZ4A 1ZOFA 5GSTA 1HQOA 4K7OA 3I43A 2P5RA 2L6CA 5HR3A 2A2SA 3HJOA 1TJDA 4TR1A 3IE3A 5ECMB 1H4OA 2FY6A 5J4VA 4F2IA 5D9WA 1R4WA 1BYEA 5KN0A 1THXA 5JWRB 3P2AA 4RI7A 4XRAA 1I5GA 2WW1A 4CY8A 1TRVA 3GKMA 3HVNA 4IN0A 3HDCA 4KH7A 3FZAA 3TCOA 3TKPA 2GVPA 4IHUA 4Z2UA 4X0XA 3FK8A 5H5SA 3RGBC 1QUWA 3TKQA 4EIPA 4XRDA 2EC4A 4HDEA 5C00A 1F9MA 2REMA 3TKSE 2KOKA 4TR1B 1DE2A 1MD4A 3PGTA 1U88A 3BJ5A 2RUFA 2HZFA 4KA0A 2IMKA 2BMXA 2YWOA 1ERUA 3L0HA 3FEUA 5INYA 2YZUA 4X43A 1TXUA 2VCZA 3TU3B 2VL2A 3CHXC 1BG5A 4BWSA 1XOAA 3ZYWA 2DJKA 5ECPB 3KP9A 4HZ2A 3F4RA 2PVQA 10GSA 5IMZA 5H5QA 3F8UA 2YV9A 2JADA 4J2FA 1PKZA 3LQ7A 3DXBA 5ECOB 5A1NA 3ZTLA 1T1VA 4MJAA 5D93A 3IAS2 3IA1A 4KDXA 2GQLA 5G5EA 1CQHA 2JZSA 4J56E 3Q74A 1V98A 2O5VA 3GH6A 2HSYA 1QK8A 1K0NA 3GRXA 5DCHA 2R0GA 1EEJA 2E2MA 2YOIA 3RPPA 1PX6A 4WF5A 2C4JA 3GUSA 2CAIA 2V6KA 4GWRA 2WW0A 3EE2A 3UVTA 2O8VB 4USSA 4TOPA 3VK9A 1SU9A 1XW6A 1PD21 5DAKB 4N11A 1A24A 3EURA 3DWVA 1F3AA 5ELGA 2HI7A 1TU7A 5AN1A 1A0FA 13GSA 4YKFA 1R5PA 4IS0A 2YWNA 1ZYPA 5A4VA 2VCTA 6GSUA 1WIKA 4Z2RA 2V32A 5JWQB 4CW9A 4G9HA 1N25A 3TB2A 1W4VA 3NZNA 2ZCTA 2EFDA 2B7KA 1AQWA 1HNAA 4ZXGA 4ICYA 2FWEA 1GRXA 1TK0B 4HQZA 1FO5A 1U87A 2HSMA 3MDKA 1JLWA 5DALA 3HMJG 3HHVA 5COHA 1GSYA 4GXZA 1V57A 1PMTA 2DKIA 1B4QA 4GSSA 4O5UA 2GZZA 2LV3A 2TIRA 4HQSA 2MBTA 5DBQA 4IP6A 14GSA 1MD3A 4AKIA 1TTZA 4G0KA 2AB6A 3F6DA 1Z3EA 4KE3A 2L5LA 4L5OA 3APSA 1B4PA 5B8BA 1EOGA 2H66A 4FQUA 4N10A 1A8LA 4N0VA 1HYUA 3D5JA 4EUYA 5CRWA 1X5DA 4WR5A 5A34A 2V6OA 5ECQB 2L6DA 2WGRA 3M0FA 3TKRA 1XZOA 4XHMA 4NHZA 5GSSA 3CMIA 5EY6A 4CHSA 2B5YA 3HVXA 3KTBA 5JWOB 2B1LA 2MYGA 5IOWA 1AXDA 2ZNMA 1ZYNA 4O5QA 1GWCA 4JZQA 1BEDA 2GZYA 5HFIA 3WGXA 5J9CA 5ECIB 4XTSA 1UC7A 2DMLA 3ZIVA 5CRDA 1NW2A 4MPGA 2L4QA 2OE1A 3TKSA 3P8WA 1FB0A 1SL2B 2WJUA 5A34B 1M9AA 4XS4A 3I69A 2N5BA 2C3NA 3GL3A 4OCFA 3IBHA 1SYRA 4TN8A 3EVIA 3H1NA 2LTKA 1YQ1A 1XWCA 3LSZA 1XWKA 5F07A 1K0MA 4LMVA 2VIMA 3DMLA 4MLYA 5IMCA 4WF4A 3TRPA 4GCIA 4TRXA 4K9ZA 5FT3A 4PX1A 2WVYA 2H8LA 2B3SA 4I2TA 3L9SA 1GP1A 4ZBAA 2KUCA 4AKHA 2GGTA 3GIXA 5LCZA 1Y1UA 3WT2A 4HZ4A 3VWVA 2R0PA 2FCHA 2L4CA 1OAZA 3DVWA 1X9SB 1GNEA 5AISA 2LRCA 12GSA 2GTUA 2LSTA 1W89A 1GSDA 3US3A 1FOVA 1JZWA 1NM3A 3VI5A 1TRSA 3GSTA 2C3TA 3G7YA 2O85A 1JLVA 2WZ9A 4TR4A 2PBJA 3KJYA 4JRRA 2NVLA 6GSXA 4WXTA 2H0GA 5ID2A 3KMOA 4DEJA 4ECJA 3ZVJA 3QMXA 4Q5RA 1J0FA 5D9VA 2X8GA 2TRXA 2JZTA 4MPFA 3F3RA 3VFIA 1R26A 3FKFA 4IW9A 3WT1A 2WULA 4DSRA 3HD5A 5DVBA 5KN2A 2H74A 4EE0A 1M2AA 4DSSA 2HZEA 1UVZA 1PN9A 4NPBA 2LJKA 2OBIA 4ISDA 5C04A 2IFQA 5IO0A 1NHYA 5A5HA 3ME7A 4V2LA 2UZ8A 1G6YA 3IHGA 4I2UA 1OC3A 3BOAA 1A2LA 2GSQA 4EL1A 7GSSA 3L78A 2A4VA 2QGVA 2H1AA 3VI7A 1Z7RA 3GA4A 3EMXA 4YQMA 4OD7A 1Z5YE 1TI3A 5KN1A 4OO5A 5B8AA 3ERWA 1AC1A 1S4BP 4LLRA 1F37A 5F06A 2E7PA 3LEFA 3ZLPA 5DQSA 2VL3A 2HT9A 1GUHA 2IFQB 1SD9A 1DSBA 3IRAA 5G1KA 2WS2A 3F9UA 2YCDA 3QFBC 2IMFA 3ZIJA 1XWGA 4OMVA 2C0EA 2NPBA 1MDIA 4QL7A 1R5AA 2HRKA 3HKRA 1X5CA 1ST9A 2WRTA 5IIZA 5HQPA 2P0GA 5CAXA 2GSRA 2G0FA 5KEJA 3RBTA 4N0ZA 4TXVA 1TW9A 1XWAA 4TR3A 3FR6A 4KDYA 2C0FA 3IXRA 1ERVA 2O87A 1Q4JA 5CRHA 2EFEA 3K8NA 3QAGA 4KF9A 2YWMA 4G19A 1TK5B 1XOBA 2M46A 1EOHA 4JR6A 1F2EA 3IC4A 1AQVA 4CDOA 2DKHA 4K7NA 1PKWA 2OBKA 3MYDA 1S3CA 3CTGA 3F0IA 2YANA 3D6IA 3IOSA 2R4VA 3GN3A 2A2RA 2LRNA 2KP2A 2NTOA 3DD3A 3KTLA 2VAFA 5IPGA 2LJAA 3QAVA 4L5LA 1XVQA 2RIIA 3F4TA 1K3LA 2RLIA 4BVXA 2X99A 1VF1A 1E2YA 4O5RA 2AV4A 5DQYA 5J3RA 2F3MA 4NXIA 3ZZXA 2CX4A 4G10A 1WMJA 1B8XA 2ON7A 4OO4A 4HEA2 4I97A 2GT5A 5HR2A 2HRAA 2J9HA 2JZRA 4I6XA 3HVSA 4D73B 2VLTA 2HRFA 4MF7A 2EIQA 1EV9A 3GL5A 2FWGA 2D2ZA 1A8YA 1JZDA 1U3AA 2CZ3A 4AJ7A 3JCML 1M0UA 1YKCA 2WW3A 4V2NA 4K1FA 3F63A 1U6TA 4BVXB 4KCAA 1SK0A 4ML6A 2RM6A 4POBA 3UVHA 1SJ6A 4XCSA 5JCWA 5KN3A 4HU7A 1SVOA 2GQMA 1T7PB 2GLRA 4K6XA 5B6MA 2OACA 1WJKA 5G2ZA 4KDUA 2EFHA 3CQFA 2VD0A 3H93A 3FRCA 1X5EA 3G7JA 5A4UA 4TXOA 1E6BA 2C0DA 1SKRB 2X4AA 1XWBA 2VOCA 4O92A 3CTFA 2RUEA 1K0AA 3TJBA 2M80A 1EV4A 4GSTA 2GS3A 3TGZA 2NDOA 1FAAA 2DJ2A 3NOFA 2YN1A 3GYKA 1BAYA 1EP8A 4MJBA 4Q5QA 4EDZA 2V1MA 3RAZA 2GSTA 1GLPA 4TR0A 4YH2A 1A23A 1M3JA 4EVMA 1THOA 2PN8A 4TXOB 2CV4A 3LWAA 19GSA 1GLQA 2C8UA 4GSNA 4MJCA 4G0LA 1SL0B 5J47A 3CSJA 1PGTA 2R5GA 2H71A 3UJ1A 2QSIA 1T00A 2OKAA 3IR4A 3A3TA 3MIXA 1HNBA 2DJ3A 2HYXA 4ZB9A 3LXZA 2B5XA 5CP1A 1DBYA 4MA9A 1O85A 1BF5A 5A1NB 3LYPA 5D9TA 3ZL5A 1S3DA 5ECHB 3HA9A 1V40A 2V2GA 1TI1A 3KH7A 1VF4A 1K0OA 1Z9HA 4WBJA 5ENUA 2WDUA 1OE8A 4GTUA 1V2AA 2JSZA 5BMUA 4BIKA 4ZB7A 3ERFA 4JU5A 1C72A 4BVYA 4I5QA 3DIEA 1WRYA 1T3BA 1XBSA 2H75A 3WGEA 1GTIA 4IJ3A 1X9MB 2YP6A 3IV4A 1O8WA 3GKXA 2L5OA 2VM2A 3I9V2 4MH3A 2O3EA 2GZPA 3DVXA 4QMKA 4Z7XA 3QAWA 1PX7A 2VD1A 3HJPA 5LNKe 3LORA 3GX0A 4KUNA 3U5RE 5J40A 5DDLA 3EINA 5HR0A 2HSNA 1TXXA 2H1LA 3A5WA 3ZMKA 3EU3A 4KX4A 3G9BA 1VF2A 1ERWA 2IIYA 1SKWB 4BL7A 2EIRA 1Z7PA 3KM6A 2JSYA 1GTAA 2YNXA 4JEDA 1QXHA 1ZYQB 2FGXA 3C8EA 5G31A 1JZRA 2DJ1A 4EF0A 2P31A 4CY6A 4OWYA 1KNGA 1SKSB 4PNFA 4V1Ag 4W66A 2QKEA 1GSSA 2I81A 1TDIA 2IL3A 2XBIA 1AW9A 3S9FA 2HSMB 3M3MA 2TRCP 3FY7A 5DALB 2R3XA 4X1UA 3A2VA 3E9JB 5CREA 4LA1A 2F51A 3ISOA 1OKDA 1WOUA 1V58A 2HSNB 1A2JA 1WWJA 1PA3A 3SWLA 3UARA 4ZL7A 5HFGA 4BL7B 5EPFA 3F3QA 4PQ1A 3MNGA 1YEXA 1G7OA 1M2DA 3U6VA 2LJRA 1TRWA 4BPYA 5LD0A 3CWGA 3PH9A 4P3YB 3RHBA 1GSFA 4TW5A 2VLVA 3KP8A 3V1WA 3L4NA 5EL8A 4NAXA 4LMWA 1PFOA 3ZFBA 2DJ0A 2VCXA 1Z6NA 3TUEA 4L0UA 1KEBA 4HU9A 3UEMA 1SJIA 4N30A 3ZRDA 4NHWA 1OC9A 2I4AA 3FMWA 2H76A 3A5IA 2HRNA 2LNSA 3GH9A 5JCUA 1HNCA 1BX9A 2DC5A 3DEXA 3IPZA 1PL1A 1M99A 4PGTA 3G7IA 2H1DA 3M9JA 4YQUA 2YZHA 4JR4A 3AY8A 1AAZA 1YVLA 2H19A 2DBCA 1N8JA 3FW2A 3HXSA 4YKGA 1OE7A 2HXKA 2FHEA 3GMFA 1F3BA 5BRTA 5IPHA 3VPQA 2B1KA 4XS4B 4ECCA 1O6JA 1X0RA 3VWWA 3TDGA 4K7IA 3TJFA 1PQNA 1M3IA 1URMA 1RQMA 3BBYA 2CQ9A 3CSHA 18GSA 5AIVA 1N2AA 2XC2A 1YZXA 2LRTA 3DKSA 5DJLA 4HOJA 3IAM2 4WKWA 2C80A 4FH8A 4JE1A 4PI0C 3GNJA 2R0CA 5CRGA 4N3ZA 2WCIA 4RQRA 2VM1A 2H73A 5HFKA 3HY2A 2AJQB 4KB3A 1VGLA 1WE0A 5D8IA 3P7XA 1BG1A 5A4WA 4FYBA 1K0CA 2XHFA 5F05A 3H79A 2OE3A 4XS1A 3EC3A 1U3IA 5IO2A 2L57A 4PQIA 2HNLA 1FVKA 1GSUA 2WVXA 3C71A 4PXOA 2E0QA 4L0WA 4E68A 1YF0A 5F8BA 4PURA 2BTOT 1MEKA 1XCCA 4Q5NA 2H72A 5ID2B 1QMVA 2XPDA 1GH2A 2G2QA 2X8CA 4POKA 5F0GA 4NV2A 2B6MA 1DE1A 3N5OA 4EXJA 1EP7A 3PR8A 1TOFA 3VPTA 4GF0A 1WPIA 4PQHA 1M2BA 4DSSB 2HZEB 1JFUA 3Q6OA 4MZCA 2EIOA 4DSQA 1KBNA 1SK1A 5B6NA 2WVXB 3MSZA 4ULXA 5D96A 3UL3A 1NHOA 4V1Ap 5A5HB 2OA7A 4WR4A 5ECRB 3BCKA 3GKKA 2DMMA 5KOWA 5J5NA 2I9HA 4O32A 2YPMA 5IMVA 1ZL9A 1B9YC 3C7MA 2VCQA 1G6WA 3O3TA 1V9WA 2C1YA 2DLXA 4ZBDA 20GSA 2DIZA 1SJZA 2WW2A 2MZCA 1LU4A 3GTUA 1I1IP 5ECKB 4KSOA 16GSA 1OYJA 2WFCA 2CVDA 1S3AA 1R7HA 5GAPD 2CT6A 5E59A 5J41A 4NV5A 2FWFA 2H0HA 2HRKB 4F03A 4IELA 1XVWA 4MABA 3KEBA 2J23A 5AIXA 1M7TA 4XS6A 2PWJA 5IOXA 6GSSA 1UA5A 1X9WB 2FLSA 3P90A 4YQVA 4TVEA 5EVOA 3D22A 4ML1A 3ZVJD 4OFTA 3HYPA 3J7Yk 1DUGA 4ACSA 3HZ8A 1IYIA 1S3RA 3VWUA 3C1SA 4E8EA 4WEYA 1A2MA 3I6AA 2X49A 2N5FA 5AGYA 4IBPA 1ILOA 4MZWA 3D4TA 4F9ZA 3FR9A 4OCEA 4RQXA 1B48A 2PUKC 5IM9A 4RUVA 3WYWA 2VO4A 1PRXA 2HLSA 2YWIA 5GZZB 3QD9A 3UBKA 4TKYA 2AAWA 4IJIA 4ECIA 4K2DA 3UAPA 1FOHA 2OJLA 4HI7A 2GT6A 1SENA 4ZL9A 3LYKA 1Y25A 4G0IA 3TOUA 1SL1B 5H5RA 2VUPA 1SK2A 4A5PA 1KTEA 3VLNA 2PERA 1ERTA 4RI6A 1NSWA 3L9UA 3O6TA 4K5SA 2BJXA 4X4JA 3HVVA 5IMDA 2NBSA 2ZUPA 2K18A 6GSWA 1YDKA 2F8AA 1AQXA 5D9XA 3EWLA 3QPMA 3RFRC 1H75A 3KD0A 3PPUA 3RDWA 5A5KA 5ECNB 5FWGA 1TRUA 4GDFA 4V2MA 4MK3A 2LS5A 3FR3A 4K0NA 2XBQA 4IQ1A 4Z2TA 4IQAA 1HD2A 4KW6A 2I1UA 3W6GA 1OVNA 2MMNA 3F4SA 4HSCX 1O73A 2XPEA 2R37A 1I9DA 2QA2A 3LG6A 3FZ9A 2VL2C 1SYXA 4O7HA 3TJGA 4ECBA 3KCMA 2CZ2A 5IMAA 4EDYA 1EWXA 2ALBA 4QL9A 3IK7A 1K3OA 6GSYA 2IPAA
chains in the Genus database with same CATH topology
3M1GA 2ES7A 4NWYA 2HE3A 1QQ2A 2KP1A 6GSVA 1YJ6A 1GTBA 5DAKA 2CA8A 4OFNA 3IC8A 1T4YA 3CYNA 3ERGA 2IN3A 1YEPA 4ZIJA 3IDVA 3LJRA 1PL2A 2HFDA 3FZ4A 5ABRA 3EYTA 4F0BA 4AI6A 4Q5FA 1EGOA 1XFLA 5JCGA 3ZREA 3UIWA 4PUAA 1O8XA 4KCEA 3J7Yb 1MTCA 4ZB8A 1PN0A 2FNOA 2EFCA 2OADA 5L71A 5J4UA 2H70A 4G2EA 5CNWA 3LXTA 5GAND 1SVMA 1ACVA 3PINA 4FYCA 4POLA 3BD2A 4K0GA 4MF6A 3TJKA 2C0GA 3W8SA 1MDJA 1ML6A 2M72A 4KSMA 2H30A 3TOTA 3N9JA 1VF3A 2IMDA 5DCGA 3GSSA 4IVFA 2OT3A 2PGTA 5G5FA 1GULA 2F8FA 4PTSA 2YV7A 4LL4B 5FHIA 1JHBA 3CBUA 5B7CA 2DIYA 4IP1A 3R2QA 2GDRA 1EZKA 5ELAA 17GSA 2H01A 3D4MA 1ZZYA 3GHAA 2WB9A 2Z9SA 5BMUB 4WETA 3RHCA 3EPTA 3LW9A 5IQYA 1OC8A 4BVYB 4FIWA 3D0ZA 3OR5A 1RK4A 2QC7A 3IK9A 1O81A 4K8MA 2YJHA 2H0IA 1EGRA 3APQA 1FVJA 3APOA 1GSEA 2C3QA 2B7JA 1YKAA 1XW9A 2H1BA 4XIHA 2HSHA 3VURA 1AUCA 2CAQA 1K3YA 4HUAA 1USBA 1PSQA 1T4ZA 3FZ5A 3GFKA 1AIUA 4FYUA 2JL4A 2O89A 3H4KA 2HQTA 4PNGA 4OFMA 1GL8A 3DGQA 2OE0A 4MCUA 1LJRA 2LUSA 2CX3A 4KAEA 2K8VA 3R3EA 5HR1A 1OKTA 3UBLA 2H6ZA 2AHEA 3ZFLA 6GSTA 3TKSC 1O7UA 3M8NA 2E2GA 1GTUA 3CSIA 4G01A 4HJ2A 1ZMAA 4KGIA 4F0CA 2CVBA 2B5EA 1RW1A 4DVCA 3UMAA 1FW1A 1A0RP 2LKUA 4K5RA 4GQCA 1ON4A 3MWHA 3KMNA 5G30A 1VRSD 2UV8G 4ZB6A 3QCPA 4WBRD 2GQKA 3TRQA 4YAVA 3M9KA 2AUVA 1TP9A 5J9BA 3GKNA 3ZITA 3GV1A 3H8QA 3BCIA 3QFAC 1ZYEA 2K8SA 2FD3A 3CRUA 3UOMA 4J57E 1YF1A 1LBKA 4EC0A 3ED3A 1B9XC 2KHPA 2JACA 4HS1A 2GSSA 4AF2A 4ILFA 3FYGA 4MZBA 2PU9C 1OC9B 3C1RA 4KNDA 4QQ7A 1TKDB 1GUMA 1K0DA 2LEGA 2LNTA 2A2PA 2FA8A 3EU4A 4LL1B 5E4WA 2VCWA 5DJMA 2P5QA 1GSQA 3HJMA 5J4YA 2LQOA 2PPTA 4I8BA 2O7KA 1FHEA 2DSAA 2MMZA 4IGJA 5CYYA 3KZQA 3LFLA 3SBCA 3WGDA 1TU8A 2FWHA 1Y6EA 3W8JA 2VL9A 3KIJA 4MNNA 3WD6A 3TJJA 2L59A 4BWQA 4EKZA 4L8EA 1G0TA 1MDKA 22GSA 2VLUA 3E0UA 1TK8B 1G7EA 1XPVA 3DYRA 5ECLB 2MMAA 2ON5A 3RPNA 2VKZG 4GRFA 3KH9A 3QR6A 4AJ8A 3O76A 1XIYA 1T8EB 3A2XA 4MH2A 1ABAA 4ZBBA 2YJ7A 3HCZA 2H6XA 1ZGNA 2V41A 3IHQA 2R6KA 1CQGA 2VCVA 4AJ6A 1Z6MA 1IYHA 1J08A 4POMA 1SVLA 4AGSA 2AYTA 2LQQA 1QFNA 3KGKA 1FB6A 4H86A 2K6VA 4ID0A 2I3YA 4NMUA 2DJJA 3L9VA 2IWTA 4YAPA 5KOXA 4ZILA 1YY7A 3MAKA 3DRNA 3Q19A 1GNWA 4AKXB 3GX8A 4MP4A 1M9BA 5G1LA 2QA1A 5D73A 2H6YA 4EO3A 2FA4A 1K0BA 4ZL8A 1UN2A 1ZCPA 3CRTA 4AKGA 2MMOA 4BA7A 1XXUA 1XW5A 3GURA 2K9FA 3ME8A 3LGCA 2A4HA 3Q18A 3FHKA 9GSSA 2H1GA 4HJMA 2JU5A 1BJXA 2N5AA 2R2JA 2PMTA 2PVOC 2IMIA 1GUKA 1WP0A 2IMEA 2FUG2 3VWXA 1J9BA 2KLXA 4K2XA 2RM5A 3KXOA 3QOUA 5ECSA 3A2WA 4MDCA 3QDNA 3E3EA 2CVKA 3C73A 5CO3A 4PUFC 3NIVA 4JBBA 3GTUB 1FG4A 2F9SA 4MMMA 4MJEA 5IMFA 4D73A 3CXGA 4GLTA 3D21A 11GSA 1EEMA 1BQ7A 2X8HA 2MBSA 4EIQA 1QGVA 4GQFA 2X64A 4FO5A 4IKHA 8GSSA 3ZMLA 4MF5A 3F6FA 1JZOA 4E8HA 1F6MC 1Q98A 4F82A 3TRXA 3EMPA 1SD8A 2IJYA 3HZ4A 1ZOFA 5GSTA 1HQOA 4K7OA 3I43A 2P5RA 2L6CA 5HR3A 2A2SA 3HJOA 1TJDA 4TR1A 3IE3A 5ECMB 1H4OA 2FY6A 5J4VA 4F2IA 5D9WA 1R4WA 1BYEA 5KN0A 1THXA 5JWRB 3P2AA 4RI7A 4XRAA 1I5GA 4CY8A 1TRVA 3GKMA 4IN0A 3HDCA 4KH7A 3FZAA 3TCOA 3TKPA 2GVPA 4IHUA 4Z2UA 4X0XA 3FK8A 5H5SA 1QUWA 3TKQA 4EIPA 4XRDA 2EC4A 4HDEA 5C00A 1F9MA 2REMA 3TKSE 2KOKA 4TR1B 1DE2A 1MD4A 3PGTA 1U88A 3BJ5A 2RUFA 2HZFA 4KA0A 2IMKA 2BMXA 2YWOA 1ERUA 3L0HA 3FEUA 5INYA 2YZUA 4X43A 1TXUA 2VCZA 3TU3B 2VL2A 1BG5A 4BWSA 1XOAA 3ZYWA 2DJKA 5ECPB 3KP9A 4HZ2A 3F4RA 2PVQA 10GSA 5IMZA 5H5QA 3F8UA 2YV9A 2JADA 4J2FA 1PKZA 3LQ7A 3DXBA 5ECOB 5A1NA 3ZTLA 1T1VA 4MJAA 5D93A 3IAS2 3IA1A 4KDXA 2GQLA 5G5EA 1CQHA 2JZSA 4J56E 3Q74A 1V98A 2O5VA 3GH6A 2HSYA 1QK8A 1K0NA 3GRXA 5DCHA 2R0GA 1EEJA 2E2MA 2YOIA 3RPPA 1PX6A 4WF5A 2C4JA 3GUSA 2CAIA 2V6KA 4GWRA 3EE2A 3UVTA 2O8VB 4USSA 4TOPA 3VK9A 1SU9A 1XW6A 1PD21 5DAKB 4N11A 1A24A 3EURA 3DWVA 1F3AA 5ELGA 2HI7A 1TU7A 5AN1A 1A0FA 13GSA 4YKFA 1R5PA 4IS0A 2YWNA 1ZYPA 5A4VA 2VCTA 6GSUA 1WIKA 4Z2RA 2V32A 5JWQB 4CW9A 4G9HA 1N25A 3TB2A 1W4VA 3NZNA 2ZCTA 2EFDA 2B7KA 1AQWA 1HNAA 4ZXGA 4ICYA 2FWEA 1GRXA 1TK0B 4HQZA 1FO5A 1U87A 2HSMA 3MDKA 1JLWA 5DALA 3HMJG 3HHVA 5COHA 1GSYA 4GXZA 1V57A 1PMTA 2DKIA 1B4QA 4GSSA 4O5UA 2GZZA 2LV3A 2TIRA 4HQSA 2MBTA 5DBQA 4IP6A 14GSA 1MD3A 4AKIA 1TTZA 4G0KA 2AB6A 3F6DA 1Z3EA 4KE3A 2L5LA 4L5OA 3APSA 1B4PA 5B8BA 1EOGA 2H66A 4FQUA 4N10A 1A8LA 4N0VA 1HYUA 3D5JA 4EUYA 5CRWA 1X5DA 4WR5A 5A34A 2V6OA 5ECQB 2L6DA 2WGRA 3M0FA 3TKRA 1XZOA 4XHMA 4NHZA 5GSSA 3CMIA 5EY6A 4CHSA 2B5YA 3HVXA 3KTBA 5JWOB 2B1LA 2MYGA 5IOWA 1AXDA 2ZNMA 1ZYNA 4O5QA 1GWCA 4JZQA 1BEDA 2GZYA 5HFIA 3WGXA 5J9CA 5ECIB 4XTSA 1UC7A 2DMLA 3ZIVA 5CRDA 1NW2A 4MPGA 2L4QA 2OE1A 3TKSA 3P8WA 1FB0A 1SL2B 2WJUA 5A34B 1M9AA 4XS4A 3I69A 2N5BA 2C3NA 3GL3A 4OCFA 3IBHA 1SYRA 4TN8A 3EVIA 3H1NA 2LTKA 1YQ1A 1XWCA 3LSZA 1XWKA 5F07A 1K0MA 4LMVA 2VIMA 3DMLA 4MLYA 5IMCA 4WF4A 3TRPA 4GCIA 4TRXA 4K9ZA 5FT3A 4PX1A 2H8LA 2B3SA 4I2TA 3L9SA 1GP1A 4ZBAA 2KUCA 4AKHA 2GGTA 3GIXA 5LCZA 1Y1UA 3WT2A 4HZ4A 3VWVA 2R0PA 2FCHA 2L4CA 1OAZA 3DVWA 1X9SB 1GNEA 5AISA 2LRCA 12GSA 2GTUA 2LSTA 1W89A 1GSDA 3US3A 1FOVA 1JZWA 1NM3A 3VI5A 1TRSA 3GSTA 2C3TA 3G7YA 2O85A 1JLVA 2WZ9A 4TR4A 2PBJA 3KJYA 4JRRA 2NVLA 6GSXA 4WXTA 2H0GA 5ID2A 3KMOA 4DEJA 4ECJA 3ZVJA 3QMXA 4Q5RA 1J0FA 5D9VA 2X8GA 2TRXA 2JZTA 4MPFA 3F3RA 3VFIA 1R26A 3FKFA 4IW9A 3WT1A 2WULA 4DSRA 3HD5A 5DVBA 5KN2A 2H74A 4EE0A 1M2AA 4DSSA 2HZEA 1UVZA 1PN9A 4NPBA 2LJKA 2OBIA 4ISDA 5C04A 2IFQA 5IO0A 1NHYA 5A5HA 3ME7A 4V2LA 2UZ8A 1G6YA 3IHGA 4I2UA 1OC3A 3BOAA 1A2LA 2GSQA 4EL1A 7GSSA 3L78A 2A4VA 2QGVA 2H1AA 3VI7A 1Z7RA 3GA4A 3EMXA 4YQMA 4OD7A 1Z5YE 1TI3A 5KN1A 4OO5A 5B8AA 3ERWA 1AC1A 4LLRA 1F37A 5F06A 2E7PA 3LEFA 3ZLPA 5DQSA 2VL3A 2HT9A 1GUHA 2IFQB 1SD9A 1DSBA 3IRAA 5G1KA 2WS2A 3F9UA 2YCDA 3QFBC 2IMFA 3ZIJA 1XWGA 4OMVA 2C0EA 2NPBA 1MDIA 4QL7A 1R5AA 2HRKA 3HKRA 1X5CA 1ST9A 2WRTA 5IIZA 5HQPA 2P0GA 5CAXA 2GSRA 2G0FA 5KEJA 3RBTA 4N0ZA 4TXVA 1TW9A 1XWAA 4TR3A 3FR6A 4KDYA 2C0FA 3IXRA 1ERVA 2O87A 1Q4JA 5CRHA 2EFEA 3K8NA 3QAGA 4KF9A 2YWMA 4G19A 1TK5B 1XOBA 2M46A 1EOHA 4JR6A 1F2EA 3IC4A 1AQVA 4CDOA 2DKHA 4K7NA 1PKWA 2OBKA 3MYDA 1S3CA 3CTGA 3F0IA 2YANA 3D6IA 3IOSA 2R4VA 3GN3A 2A2RA 2LRNA 2KP2A 2NTOA 3DD3A 3KTLA 2VAFA 5IPGA 2LJAA 3QAVA 4L5LA 1XVQA 2RIIA 3F4TA 1K3LA 2RLIA 4BVXA 2X99A 1VF1A 1E2YA 4O5RA 2AV4A 5DQYA 5J3RA 2F3MA 4NXIA 3ZZXA 2CX4A 4G10A 1WMJA 1B8XA 2ON7A 4OO4A 4HEA2 4I97A 2GT5A 5HR2A 2HRAA 2J9HA 2JZRA 4I6XA 3HVSA 4D73B 2VLTA 2HRFA 4MF7A 2EIQA 1EV9A 3GL5A 2FWGA 2D2ZA 1A8YA 1JZDA 1U3AA 2CZ3A 4AJ7A 3JCML 1M0UA 1YKCA 4V2NA 4K1FA 3F63A 1U6TA 4BVXB 4KCAA 1SK0A 4ML6A 2RM6A 4POBA 3UVHA 1SJ6A 4XCSA 5JCWA 5KN3A 4HU7A 1SVOA 2GQMA 1T7PB 2GLRA 4K6XA 5B6MA 2OACA 1WJKA 5G2ZA 4KDUA 2EFHA 2VD0A 3H93A 3FRCA 1X5EA 3G7JA 5A4UA 4TXOA 1E6BA 2C0DA 1SKRB 2X4AA 1XWBA 2VOCA 4O92A 3CTFA 2RUEA 1K0AA 3TJBA 2M80A 1EV4A 4GSTA 2GS3A 3TGZA 2NDOA 1FAAA 2DJ2A 3NOFA 2YN1A 3GYKA 1BAYA 1EP8A 4MJBA 4Q5QA 4EDZA 2V1MA 3RAZA 2GSTA 1GLPA 4TR0A 4YH2A 1A23A 4EVMA 1THOA 2PN8A 4TXOB 2CV4A 3LWAA 19GSA 1GLQA 2C8UA 4GSNA 4MJCA 4G0LA 1SL0B 5J47A 3CSJA 1PGTA 2R5GA 2H71A 3UJ1A 2QSIA 1T00A 2OKAA 3IR4A 3A3TA 3MIXA 1HNBA 2DJ3A 2HYXA 4ZB9A 3LXZA 2B5XA 5CP1A 1DBYA 4MA9A 1O85A 1BF5A 5A1NB 3LYPA 5D9TA 3ZL5A 1S3DA 5ECHB 3HA9A 1V40A 2V2GA 1TI1A 3KH7A 1VF4A 1K0OA 1Z9HA 4WBJA 5ENUA 2WDUA 1OE8A 4GTUA 1V2AA 2JSZA 5BMUA 4ZB7A 3ERFA 4JU5A 1C72A 4BVYA 4I5QA 3DIEA 1WRYA 1T3BA 1XBSA 2H75A 3WGEA 1GTIA 4IJ3A 1X9MB 2YP6A 3IV4A 1O8WA 3GKXA 2L5OA 2VM2A 3I9V2 4MH3A 2GZPA 3DVXA 4QMKA 4Z7XA 3QAWA 1PX7A 2VD1A 3HJPA 5LNKe 3LORA 3GX0A 4KUNA 3U5RE 5J40A 5DDLA 3EINA 5HR0A 2HSNA 1TXXA 2H1LA 3A5WA 3ZMKA 3EU3A 4KX4A 3G9BA 1VF2A 1ERWA 2IIYA 1SKWB 4BL7A 2EIRA 1Z7PA 3KM6A 2JSYA 1GTAA 2YNXA 4JEDA 1QXHA 1ZYQB 2FGXA 3C8EA 5G31A 1JZRA 2DJ1A 4EF0A 2P31A 4CY6A 4OWYA 1KNGA 1SKSB 4PNFA 4V1Ag 4W66A 2QKEA 1GSSA 2I81A 1TDIA 2IL3A 2XBIA 1AW9A 3S9FA 2HSMB 3M3MA 2TRCP 3FY7A 5DALB 2R3XA 4X1UA 3A2VA 3E9JB 5CREA 4LA1A 2F51A 3ISOA 1OKDA 1WOUA 1V58A 2HSNB 1A2JA 1WWJA 1PA3A 3SWLA 3UARA 4ZL7A 5HFGA 4BL7B 5EPFA 3F3QA 4PQ1A 3MNGA 1YEXA 1G7OA 1M2DA 3U6VA 2LJRA 1TRWA 4BPYA 5LD0A 3CWGA 3PH9A 4P3YB 3RHBA 1GSFA 4TW5A 2VLVA 3KP8A 3V1WA 3L4NA 5EL8A 4NAXA 4LMWA 3ZFBA 2DJ0A 2VCXA 1Z6NA 3TUEA 4L0UA 1KEBA 4HU9A 3UEMA 1SJIA 4N30A 3ZRDA 4NHWA 1OC9A 2I4AA 3FMWA 2H76A 3A5IA 2HRNA 2LNSA 3GH9A 5JCUA 1HNCA 1BX9A 2DC5A 3DEXA 3IPZA 1PL1A 1M99A 4PGTA 3G7IA 2H1DA 3M9JA 4YQUA 2YZHA 4JR4A 3AY8A 1AAZA 1YVLA 2H19A 2DBCA 1N8JA 3FW2A 3HXSA 4YKGA 1OE7A 2HXKA 2FHEA 3GMFA 1F3BA 5BRTA 5IPHA 3VPQA 2B1KA 4XS4B 4ECCA 1O6JA 1X0RA 3VWWA 3TDGA 4K7IA 3TJFA 1PQNA 1URMA 1RQMA 3BBYA 2CQ9A 3CSHA 18GSA 5AIVA 1N2AA 2XC2A 1YZXA 2LRTA 3DKSA 5DJLA 4HOJA 3IAM2 4WKWA 2C80A 4FH8A 4JE1A 3GNJA 2R0CA 5CRGA 4N3ZA 2WCIA 4RQRA 2VM1A 2H73A 5HFKA 3HY2A 2AJQB 4KB3A 1VGLA 1WE0A 5D8IA 3P7XA 1BG1A 5A4WA 4FYBA 1K0CA 2XHFA 5F05A 3H79A 2OE3A 4XS1A 3EC3A 1U3IA 5IO2A 2L57A 4PQIA 2HNLA 1FVKA 1GSUA 3C71A 4PXOA 2E0QA 4L0WA 4E68A 1YF0A 5F8BA 4PURA 2BTOT 1MEKA 1XCCA 4Q5NA 2H72A 5ID2B 1QMVA 2XPDA 1GH2A 2G2QA 2X8CA 4POKA 5F0GA 4NV2A 2B6MA 1DE1A 3N5OA 4EXJA 1EP7A 3PR8A 1TOFA 3VPTA 4GF0A 1WPIA 4PQHA 1M2BA 4DSSB 2HZEB 1JFUA 3Q6OA 4MZCA 2EIOA 4DSQA 1KBNA 1SK1A 5B6NA 3MSZA 4ULXA 5D96A 3UL3A 1NHOA 4V1Ap 5A5HB 2OA7A 4WR4A 5ECRB 3BCKA 3GKKA 2DMMA 5KOWA 5J5NA 2I9HA 4O32A 2YPMA 5IMVA 1ZL9A 1B9YC 3C7MA 2VCQA 1G6WA 3O3TA 1V9WA 2C1YA 2DLXA 4ZBDA 20GSA 2DIZA 1SJZA 2MZCA 1LU4A 3GTUA 5ECKB 4KSOA 16GSA 1OYJA 2WFCA 2CVDA 1S3AA 1R7HA 5GAPD 2CT6A 5E59A 5J41A 4NV5A 2FWFA 2H0HA 2HRKB 4F03A 4IELA 1XVWA 4MABA 3KEBA 2J23A 5AIXA 1M7TA 4XS6A 2PWJA 5IOXA 6GSSA 1UA5A 1X9WB 2FLSA 3P90A 4YQVA 4TVEA 5EVOA 3D22A 4ML1A 3ZVJD 4OFTA 3HYPA 3J7Yk 1DUGA 4ACSA 3HZ8A 1IYIA 3VWUA 3C1SA 4E8EA 4WEYA 1A2MA 3I6AA 2X49A 2N5FA 5AGYA 4IBPA 1ILOA 4MZWA 3D4TA 4F9ZA 3FR9A 4OCEA 4RQXA 1B48A 2PUKC 5IM9A 4RUVA 3WYWA 2VO4A 1PRXA 2HLSA 2YWIA 5GZZB 3QD9A 3UBKA 4TKYA 2AAWA 4IJIA 4ECIA 4K2DA 3UAPA 1FOHA 2OJLA 4HI7A 2GT6A 1SENA 4ZL9A 3LYKA 1Y25A 4G0IA 3TOUA 1SL1B 5H5RA 2VUPA 1SK2A 4A5PA 1KTEA 3VLNA 2PERA 1ERTA 4RI6A 1NSWA 3L9UA 3O6TA 4K5SA 2BJXA 4X4JA 3HVVA 5IMDA 2NBSA 2ZUPA 2K18A 6GSWA 1YDKA 2F8AA 1AQXA 5D9XA 3EWLA 3QPMA 1H75A 3KD0A 3PPUA 3RDWA 5A5KA 5ECNB 5FWGA 1TRUA 4GDFA 4V2MA 4MK3A 2LS5A 3FR3A 4K0NA 2XBQA 4IQ1A 4Z2TA 4IQAA 1HD2A 4KW6A 2I1UA 3W6GA 1OVNA 2MMNA 3F4SA 1O73A 2XPEA 2R37A 1I9DA 2QA2A 3LG6A 3FZ9A 2VL2C 1SYXA 4O7HA 3TJGA 4ECBA 3KCMA 2CZ2A 5IMAA 4EDYA 1EWXA 2ALBA 4QL9A 3IK7A 1K3OA 6GSYA 2IPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M1G A;  2ES7 A;  4NWY A;  2HE3 A;  1QQ2 A;  2KP1 A;  6GSV A;  1YJ6 A;  1GTB A;  5DAK A;  2CA8 A;  4OFN A;  3IC8 A;  1T4Y A;  3CYN A;  3ERG A;  2IN3 A;  1YEP A;  4ZIJ A;  3IDV A;  3LJR A;  1PL2 A;  2HFD A;  3FZ4 A;  5ABR A;  3EYT A;  4F0B A;  4Q5F A;  1EGO A;  1XFL A;  5JCG A;  3ZRE A;  3UIW A;  4PUA A;  1O8X A;  4KCE A;  3J7Y b;  1MTC A;  4ZB8 A;  2FNO A;  2OAD A;  5L71 A;  5J4U A;  2H70 A;  4G2E A;  5CNW A;  3LXT A;  5GAN D;  1ACV A;  3PIN A;  4FYC A;  4POL A;  3BD2 A;  4K0G A;  4MF6 A;  3TJK A;  2C0G A;  3W8S A;  1MDJ A;  1ML6 A;  2M72 A;  4KSM A;  2H30 A;  3TOT A;  3N9J A;  1VF3 A;  2IMD A;  5DCG A;  3GSS A;  4IVF A;  2PGT A;  5G5F A;  1GUL A;  2F8F A;  4PTS A;  2YV7 A;  4LL4 B;  5FHI A;  1JHB A;  3CBU A;  5B7C A;  2DIY A;  4IP1 A;  3R2Q A;  2GDR A;  1EZK A;  5ELA A;  17GS A;  2H01 A;  3D4M A;  1ZZY A;  3GHA A;  2WB9 A;  2Z9S A;  4WET A;  3RHC A;  5IQY A;  1OC8 A;  4BVY B;  4FIW A;  3D0Z A;  3OR5 A;  1RK4 A;  2QC7 A;  3IK9 A;  1O81 A;  4K8M A;  2YJH A;  2H0I A;  1EGR A;  3APQ A;  1FVJ A;  3APO A;  1GSE A;  2C3Q A;  2B7J A;  1YKA A;  1XW9 A;  2H1B A;  4XIH A;  2HSH A;  3VUR A;  1AUC A;  2CAQ A;  1K3Y A;  4HUA A;  1USB A;  1PSQ A;  1T4Z A;  3FZ5 A;  3GFK A;  1AIU A;  4FYU A;  2JL4 A;  2O89 A;  3H4K A;  2HQT A;  4PNG A;  4OFM A;  1GL8 A;  3DGQ A;  2OE0 A;  4MCU A;  1LJR A;  2LUS A;  2CX3 A;  4KAE A;  2K8V A;  3R3E A;  5HR1 A;  1OKT A;  3UBL A;  2H6Z A;  2AHE A;  3ZFL A;  6GST A;  3TKS C;  1O7U A;  3M8N A;  2E2G A;  1GTU A;  3CSI A;  4HJ2 A;  1ZMA A;  4KGI A;  4F0C A;  2CVB A;  2B5E A;  1RW1 A;  4DVC A;  3UMA A;  1FW1 A;  1A0R P;  2LKU A;  4GQC A;  1ON4 A;  3MWH A;  3KMN A;  5G30 A;  1VRS D;  4ZB6 A;  3QCP A;  4WBR D;  2GQK A;  3TRQ A;  4YAV A;  3M9K A;  2AUV A;  1TP9 A;  5J9B A;  3GKN A;  3ZIT A;  3GV1 A;  3H8Q A;  3BCI A;  3QFA C;  1ZYE A;  2K8S A;  2FD3 A;  3CRU A;  3UOM A;  4J57 E;  1YF1 A;  1LBK A;  4EC0 A;  3ED3 A;  1B9X C;  2KHP A;  2JAC A;  4HS1 A;  2GSS A;  4AF2 A;  4ILF A;  3FYG A;  4MZB A;  2PU9 C;  1OC9 B;  3C1R A;  4KND A;  4QQ7 A;  1TKD B;  1GUM A;  1K0D A;  2LEG A;  2LNT A;  4LL1 B;  2FA8 A;  3EU4 A;  5E4W A;  2VCW A;  5DJM A;  2P5Q A;  1GSQ A;  3HJM A;  2LQO A;  2PPT A;  4I8B A;  2O7K A;  1FHE A;  2DSA A;  2MMZ A;  4IGJ A;  5CYY A;  3KZQ A;  3LFL A;  3SBC A;  3WGD A;  1TU8 A;  2FWH A;  1Y6E A;  3W8J A;  2VL9 A;  3KIJ A;  3WD6 A;  3TJJ A;  2L59 A;  4BWQ A;  4EKZ A;  4L8E A;  1G0T A;  1MDK A;  22GS A;  2VLU A;  3E0U A;  1TK8 B;  1G7E A;  1XPV A;  3DYR A;  5ECL B;  2MMA A;  2ON5 A;  3RPN A;  4GRF A;  3KH9 A;  3QR6 A;  4AJ8 A;  3O76 A;  1XIY A;  1T8E B;  3A2X A;  4MH2 A;  1ABA A;  4ZBB A;  2YJ7 A;  3HCZ A;  2H6X A;  1ZGN A;  2V41 A;  3IHQ A;  2R6K A;  1CQG A;  2VCV A;  4AJ6 A;  1Z6M A;  1IYH A;  1J08 A;  4POM A;  4AGS A;  2AYT A;  2LQQ A;  1QFN A;  3KGK A;  1FB6 A;  4H86 A;  2K6V A;  4ID0 A;  2I3Y A;  4NMU A;  2DJJ A;  3L9V A;  2IWT A;  4YAP A;  4ZIL A;  1YY7 A;  3MAK A;  3DRN A;  3Q19 A;  1GNW A;  3GX8 A;  4MP4 A;  1M9B A;  5G1L A;  5D73 A;  2H6Y A;  4EO3 A;  2FA4 A;  1K0B A;  4ZL8 A;  1UN2 A;  1ZCP A;  3CRT A;  2MMO A;  4BA7 A;  1XXU A;  1XW5 A;  3GUR A;  2K9F A;  3ME8 A;  3LGC A;  1BJX A;  3Q18 A;  4HJM A;  3FHK A;  9GSS A;  2H1G A;  2JU5 A;  2N5A A;  2R2J A;  2PMT A;  2PVO C;  2IMI A;  1GUK A;  1WP0 A;  2IME A;  2FUG 2;  3VWX A;  1J9B A;  2KLX A;  2RM5 A;  3KXO A;  3QOU A;  5ECS A;  3A2W A;  4MDC A;  3QDN A;  3E3E A;  2CVK A;  3C73 A;  5CO3 A;  4PUF C;  3NIV A;  4JBB A;  3GTU B;  1FG4 A;  2F9S A;  4MMM A;  4MJE A;  5IMF A;  4D73 A;  3CXG A;  4GLT A;  3D21 A;  11GS A;  1EEM A;  1BQ7 A;  2X8H A;  2MBS A;  1QGV A;  4GQF A;  2X64 A;  4FO5 A;  4IKH A;  8GSS A;  3ZML A;  4MF5 A;  3F6F A;  1JZO A;  4E8H A;  1F6M C;  1Q98 A;  4F82 A;  3TRX A;  3EMP A;  1SD8 A;  2IJY A;  3HZ4 A;  1ZOF A;  5GST A;  1HQO A;  4K7O A;  3I43 A;  2P5R A;  2L6C A;  5HR3 A;  2A2S A;  3HJO A;  1TJD A;  4TR1 A;  3IE3 A;  5ECM B;  1H4O A;  2FY6 A;  4F2I A;  5D9W A;  1R4W A;  1BYE A;  5KN0 A;  1THX A;  5JWR B;  3P2A A;  4RI7 A;  4XRA A;  1I5G A;  1TRV A;  3GKM A;  4IN0 A;  3HDC A;  4KH7 A;  3FZA A;  3TCO A;  3TKP A;  2GVP A;  4IHU A;  4X0X A;  3FK8 A;  5H5S A;  1QUW A;  3TKQ A;  4XRD A;  2EC4 A;  4HDE A;  5C00 A;  1F9M A;  2REM A;  3TKS E;  2KOK A;  4TR1 B;  1DE2 A;  1MD4 A;  3PGT A;  1U88 A;  3BJ5 A;  2RUF A;  2HZF A;  4KA0 A;  2IMK A;  2BMX A;  2YWO A;  1ERU A;  3L0H A;  3FEU A;  5INY A;  2YZU A;  4X43 A;  2VL2 A;  2VCZ A;  1BG5 A;  4BWS A;  1XOA A;  3ZYW A;  2DJK A;  5ECP B;  3KP9 A;  4HZ2 A;  3F4R A;  2PVQ A;  10GS A;  5IMZ A;  5H5Q A;  3F8U A;  2YV9 A;  2JAD A;  4J2F A;  1PKZ A;  3LQ7 A;  3DXB A;  5ECO B;  3ZTL A;  1T1V A;  4MJA A;  5D93 A;  3IAS 2;  3IA1 A;  4KDX A;  2GQL A;  5G5E A;  1CQH A;  2JZS A;  4J56 E;  3Q74 A;  1V98 A;  3GH6 A;  2HSY A;  1QK8 A;  1K0N A;  3GRX A;  5DCH A;  1EEJ A;  2E2M A;  2YOI A;  3RPP A;  1PX6 A;  4WF5 A;  2C4J A;  3GUS A;  2CAI A;  2V6K A;  4GWR A;  3EE2 A;  3UVT A;  2O8V B;  4USS A;  4TOP A;  3VK9 A;  1SU9 A;  1XW6 A;  1PD2 1;  5DAK B;  4N11 A;  1A24 A;  3EUR A;  3DWV A;  1F3A A;  5ELG A;  2HI7 A;  1TU7 A;  5AN1 A;  1A0F A;  13GS A;  1R5P A;  4IS0 A;  2YWN A;  5A4V A;  2VCT A;  6GSU A;  1WIK A;  2V32 A;  5JWQ B;  4CW9 A;  4G9H A;  3TB2 A;  1W4V A;  3NZN A;  2ZCT A;  2B7K A;  1AQW A;  1HNA A;  4ZXG A;  2FWE A;  1GRX A;  1TK0 B;  4HQZ A;  1FO5 A;  1U87 A;  2HSM A;  3MDK A;  1JLW A;  5DAL A;  3HHV A;  5COH A;  1GSY A;  4GXZ A;  1V57 A;  1PMT A;  1B4Q A;  4GSS A;  2GZZ A;  2LV3 A;  2TIR A;  4HQS A;  2MBT A;  5DBQ A;  4IP6 A;  14GS A;  1MD3 A;  1TTZ A;  4G0K A;  2AB6 A;  3F6D A;  1Z3E A;  4KE3 A;  2L5L A;  4L5O A;  3APS A;  1B4P A;  5B8B A;  1EOG A;  2H66 A;  4FQU A;  4N10 A;  1A8L A;  4N0V A;  1HYU A;  3D5J A;  4EUY A;  5CRW A;  1X5D A;  4WR5 A;  2V6O A;  5ECQ B;  2L6D A;  2WGR A;  3M0F A;  3TKR A;  1XZO A;  4XHM A;  4NHZ A;  5GSS A;  3CMI A;  5EY6 A;  4CHS A;  2B5Y A;  3HVX A;  3KTB A;  5JWO B;  2B1L A;  2MYG A;  5IOW A;  1AXD A;  2ZNM A;  1GWC A;  4JZQ A;  1BED A;  2GZY A;  5HFI A;  3WGX A;  5J9C A;  5ECI B;  4XTS A;  1UC7 A;  2DML A;  3ZIV A;  5CRD A;  1NW2 A;  4MPG A;  2L4Q A;  2OE1 A;  3TKS A;  3P8W A;  1FB0 A;  1SL2 B;  2WJU A;  1M9A A;  4XS4 A;  3I69 A;  2N5B A;  2C3N A;  3GL3 A;  4OCF A;  3IBH A;  1SYR A;  4TN8 A;  3EVI A;  3H1N A;  2LTK A;  1YQ1 A;  1XWC A;  3LSZ A;  1XWK A;  5F07 A;  1K0M A;  4LMV A;  2VIM A;  3DML A;  4MLY A;  5IMC A;  4WF4 A;  3TRP A;  4GCI A;  4TRX A;  4K9Z A;  5FT3 A;  4PX1 A;  2H8L A;  2B3S A;  4I2T A;  3L9S A;  1GP1 A;  4ZBA A;  2KUC A;  2GGT A;  3GIX A;  5LCZ A;  3WT2 A;  4HZ4 A;  3VWV A;  2FCH A;  2L4C A;  1OAZ A;  3DVW A;  1X9S B;  1GNE A;  5AIS A;  2LRC A;  12GS A;  2GTU A;  2LST A;  1W89 A;  1GSD A;  3US3 A;  1FOV A;  1JZW A;  1NM3 A;  3VI5 A;  1TRS A;  3GST A;  2C3T A;  3G7Y A;  2O85 A;  1JLV A;  2WZ9 A;  4TR4 A;  2PBJ A;  3KJY A;  4JRR A;  2NVL A;  6GSX A;  4WXT A;  2H0G A;  5ID2 A;  3KMO A;  4DEJ A;  4ECJ A;  3ZVJ A;  3QMX A;  4Q5R A;  1J0F A;  5D9V A;  2X8G A;  2TRX A;  2JZT A;  4MPF A;  3F3R A;  3VFI A;  1R26 A;  3FKF A;  4IW9 A;  3WT1 A;  2WUL A;  4DSR A;  3HD5 A;  5DVB A;  5KN2 A;  2H74 A;  4EE0 A;  1M2A A;  4DSS A;  2HZE A;  1UVZ A;  1PN9 A;  4NPB A;  2LJK A;  2OBI A;  4ISD A;  5C04 A;  2IFQ A;  5IO0 A;  1NHY A;  3ME7 A;  4V2L A;  2UZ8 A;  1G6Y A;  4I2U A;  1OC3 A;  3BOA A;  1A2L A;  2GSQ A;  4EL1 A;  7GSS A;  3L78 A;  2A4V A;  2QGV A;  2H1A A;  3VI7 A;  1Z7R A;  3GA4 A;  3EMX A;  4YQM A;  4OD7 A;  1Z5Y E;  1TI3 A;  5KN1 A;  4OO5 A;  5B8A A;  3ERW A;  1AC1 A;  4LLR A;  1F37 A;  5F06 A;  2E7P A;  3LEF A;  3ZLP A;  5DQS A;  2VL3 A;  2HT9 A;  1GUH A;  2IFQ B;  1SD9 A;  1DSB A;  3IRA A;  5G1K A;  2WS2 A;  3F9U A;  2YCD A;  3QFB C;  2IMF A;  3ZIJ A;  1XWG A;  4OMV A;  2C0E A;  2NPB A;  1MDI A;  4QL7 A;  1R5A A;  2HRK A;  3HKR A;  1X5C A;  1ST9 A;  2WRT A;  5IIZ A;  5HQP A;  2P0G A;  5CAX A;  2GSR A;  2G0F A;  5KEJ A;  3RBT A;  4N0Z A;  4TXV A;  1TW9 A;  1XWA A;  4TR3 A;  3FR6 A;  4KDY A;  2C0F A;  3IXR A;  1ERV A;  2O87 A;  1Q4J A;  5CRH A;  3K8N A;  3QAG A;  4KF9 A;  2YWM A;  4G19 A;  1TK5 B;  1XOB A;  2M46 A;  1EOH A;  4JR6 A;  1F2E A;  3IC4 A;  1AQV A;  4CDO A;  4K7N A;  1PKW A;  2OBK A;  1S3C A;  3CTG A;  3F0I A;  2YAN A;  3D6I A;  3IOS A;  2R4V A;  3GN3 A;  2A2R A;  2LRN A;  2KP2 A;  2NTO A;  3DD3 A;  3KTL A;  2VAF A;  5IPG A;  2LJA A;  3QAV A;  4L5L A;  1XVQ A;  2RII A;  3F4T A;  1K3L A;  2RLI A;  4BVX A;  2X99 A;  1VF1 A;  1E2Y A;  4O5R A;  2AV4 A;  5DQY A;  5J3R A;  2F3M A;  4NXI A;  3ZZX A;  2CX4 A;  4G10 A;  1WMJ A;  1B8X A;  2ON7 A;  4OO4 A;  4HEA 2;  4I97 A;  2GT5 A;  5HR2 A;  2HRA A;  2J9H A;  2JZR A;  4I6X A;  3HVS A;  4D73 B;  2VLT A;  2HRF A;  4MF7 A;  2EIQ A;  1EV9 A;  3GL5 A;  2FWG A;  2D2Z A;  1A8Y A;  1JZD A;  1U3A A;  2CZ3 A;  4AJ7 A;  3JCM L;  1M0U A;  1YKC A;  4V2N A;  4K1F A;  3F63 A;  1U6T A;  4BVX B;  4KCA A;  1SK0 A;  4ML6 A;  2RM6 A;  4POB A;  3UVH A;  1SJ6 A;  4XCS A;  5JCW A;  5KN3 A;  4HU7 A;  2GQM A;  1T7P B;  2GLR A;  4K6X A;  5B6M A;  2OAC A;  1WJK A;  5G2Z A;  4KDU A;  2VD0 A;  3H93 A;  3FRC A;  1X5E A;  3G7J A;  5A4U A;  4TXO A;  1E6B A;  2C0D A;  1SKR B;  1XWB A;  2VOC A;  4O92 A;  3CTF A;  2RUE A;  1K0A A;  3TJB A;  2M80 A;  1EV4 A;  4GST A;  2GS3 A;  3TGZ A;  2NDO A;  1FAA A;  2DJ2 A;  3NOF A;  2YN1 A;  3GYK A;  1BAY A;  1EP8 A;  4MJB A;  4Q5Q A;  4EDZ A;  2V1M A;  3RAZ A;  2GST A;  1GLP A;  4TR0 A;  4YH2 A;  1A23 A;  4EVM A;  1THO A;  2PN8 A;  4TXO B;  2CV4 A;  3LWA A;  19GS A;  1GLQ A;  2C8U A;  4GSN A;  4MJC A;  4G0L A;  1SL0 B;  3CSJ A;  1PGT A;  2R5G A;  2H71 A;  3UJ1 A;  2QSI A;  1T00 A;  2OKA A;  3IR4 A;  3A3T A;  1HNB A;  2DJ3 A;  2HYX A;  4ZB9 A;  3LXZ A;  2B5X A;  5CP1 A;  1DBY A;  4MA9 A;  1O85 A;  3LYP A;  5D9T A;  3ZL5 A;  1S3D A;  5ECH B;  3HA9 A;  1V40 A;  2V2G A;  1TI1 A;  3KH7 A;  1VF4 A;  1K0O A;  1Z9H A;  4WBJ A;  5ENU A;  2WDU A;  1OE8 A;  4GTU A;  1V2A A;  2JSZ A;  5BMU A;  3ERF A;  4JU5 A;  1C72 A;  4BVY A;  4I5Q A;  3DIE A;  1WRY A;  1T3B A;  1XBS A;  2H75 A;  3WGE A;  1GTI A;  4IJ3 A;  1X9M B;  2YP6 A;  3IV4 A;  1O8W A;  3GKX A;  2L5O A;  2VM2 A;  3I9V 2;  4MH3 A;  2GZP A;  3DVX A;  4Z7X A;  3QAW A;  1PX7 A;  2VD1 A;  3HJP A;  5LNK e;  3LOR A;  3GX0 A;  4KUN A;  3U5R E;  5DDL A;  3EIN A;  5HR0 A;  1TXX A;  3A5W A;  3ZMK A;  3EU3 A;  4KX4 A;  3G9B A;  1VF2 A;  1ERW A;  2IIY A;  1SKW B;  4BL7 A;  2EIR A;  1Z7P A;  3KM6 A;  2JSY A;  1GTA A;  2YNX A;  4JED A;  1QXH A;  1ZYQ B;  2FGX A;  3C8E A;  5G31 A;  1JZR A;  2DJ1 A;  4EF0 A;  2P31 A;  4OWY A;  1KNG A;  1SKS B;  4PNF A;  4V1A g;  2QKE A;  1GSS A;  2I81 A;  1TDI A;  2IL3 A;  2XBI A;  1AW9 A;  3S9F A;  2HSM B;  3M3M A;  2TRC P;  3FY7 A;  5DAL B;  2R3X A;  4X1U A;  3A2V A;  3E9J B;  5CRE A;  4LA1 A;  2F51 A;  3ISO A;  1OKD A;  1WOU A;  1V58 A;  2HSN B;  1A2J A;  1WWJ A;  1PA3 A;  3SWL A;  3UAR A;  4ZL7 A;  5HFG A;  4BL7 B;  5EPF A;  3F3Q A;  4PQ1 A;  3MNG A;  1YEX A;  1G7O A;  1M2D A;  3U6V A;  2LJR A;  1TRW A;  4BPY A;  5LD0 A;  3PH9 A;  4P3Y B;  3RHB A;  1GSF A;  4TW5 A;  2VLV A;  3KP8 A;  3V1W A;  3L4N A;  5EL8 A;  4NAX A;  4LMW A;  3ZFB A;  2DJ0 A;  2VCX A;  1Z6N A;  3TUE A;  4L0U A;  1KEB A;  4HU9 A;  3UEM A;  1SJI A;  4N30 A;  3ZRD A;  4NHW A;  1OC9 A;  2I4A A;  2H76 A;  2HRN A;  2LNS A;  3GH9 A;  5JCU A;  1HNC A;  1BX9 A;  2DC5 A;  3DEX A;  3IPZ A;  1PL1 A;  1M99 A;  4PGT A;  3G7I A;  2H1D A;  3M9J A;  4YQU A;  2YZH A;  4JR4 A;  3AY8 A;  1AAZ A;  2H19 A;  2DBC A;  1N8J A;  3FW2 A;  3HXS A;  1OE7 A;  2HXK A;  2FHE A;  3GMF A;  1F3B A;  5IPH A;  3VPQ A;  2B1K A;  4XS4 B;  4ECC A;  1O6J A;  1X0R A;  3VWW A;  3TDG A;  4K7I A;  3TJF A;  1PQN A;  1URM A;  1RQM A;  3BBY A;  2CQ9 A;  3CSH A;  18GS A;  5AIV A;  1N2A A;  2XC2 A;  1YZX A;  2LRT A;  3DKS A;  5DJL A;  4HOJ A;  3IAM 2;  4WKW A;  2C80 A;  4FH8 A;  4JE1 A;  3GNJ A;  5CRG A;  2WCI A;  4RQR A;  2VM1 A;  2H73 A;  5HFK A;  3HY2 A;  2AJQ B;  4KB3 A;  1VGL A;  1WE0 A;  5D8I A;  3P7X A;  5A4W A;  4FYB A;  1K0C A;  2XHF A;  5F05 A;  3H79 A;  2OE3 A;  4XS1 A;  3EC3 A;  1U3I A;  5IO2 A;  2L57 A;  4PQI A;  2HNL A;  1FVK A;  1GSU A;  3C71 A;  4PXO A;  2E0Q A;  4L0W A;  1YF0 A;  5F8B A;  4PUR A;  2BTO T;  1MEK A;  1XCC A;  4Q5N A;  2H72 A;  5ID2 B;  1QMV A;  2XPD A;  1GH2 A;  2G2Q A;  2X8C A;  4POK A;  5F0G A;  4NV2 A;  2B6M A;  1DE1 A;  3N5O A;  4EXJ A;  1EP7 A;  3PR8 A;  1TOF A;  3VPT A;  4GF0 A;  1WPI A;  4PQH A;  1M2B A;  4DSS B;  2HZE B;  1JFU A;  3Q6O A;  4MZC A;  2EIO A;  4DSQ A;  1KBN A;  1SK1 A;  5B6N A;  3MSZ A;  4ULX A;  5D96 A;  3UL3 A;  1NHO A;  4V1A p;  2OA7 A;  4WR4 A;  5ECR B;  3BCK A;  3GKK A;  2DMM A;  5J5N A;  2I9H A;  4O32 A;  2YPM A;  5IMV A;  1ZL9 A;  1B9Y C;  3C7M A;  2VCQ A;  1G6W A;  3O3T A;  1V9W A;  2C1Y A;  2DLX A;  4ZBD A;  20GS A;  2DIZ A;  1SJZ A;  2MZC A;  1LU4 A;  3GTU A;  5ECK B;  4KSO A;  16GS A;  1OYJ A;  2WFC A;  2CVD A;  1S3A A;  1R7H A;  5GAP D;  2CT6 A;  5E59 A;  5J41 A;  4NV5 A;  2FWF A;  2H0H A;  2HRK B;  4F03 A;  4IEL A;  1XVW A;  4MAB A;  3KEB A;  2J23 A;  5AIX A;  1M7T A;  4XS6 A;  2PWJ A;  5IOX A;  6GSS A;  1UA5 A;  1X9W B;  2FLS A;  3P90 A;  4YQV A;  4TVE A;  5EVO A;  3D22 A;  4ML1 A;  3ZVJ D;  4OFT A;  3HYP A;  3J7Y k;  1DUG A;  4ACS A;  3HZ8 A;  1IYI A;  3VWU A;  3C1S A;  4E8E A;  4WEY A;  1A2M A;  3I6A A;  2N5F A;  5AGY A;  4IBP A;  1ILO A;  4MZW A;  3D4T A;  4F9Z A;  3FR9 A;  4OCE A;  4RQX A;  1B48 A;  2PUK C;  5IM9 A;  4RUV A;  3WYW A;  2VO4 A;  1PRX A;  2HLS A;  2YWI A;  5GZZ B;  3QD9 A;  3UBK A;  4TKY A;  2AAW A;  4IJI A;  4ECI A;  4K2D A;  3UAP A;  2OJL A;  4HI7 A;  2GT6 A;  1SEN A;  4ZL9 A;  3LYK A;  1Y25 A;  4G0I A;  3TOU A;  1SL1 B;  5H5R A;  2VUP A;  1SK2 A;  1KTE A;  3VLN A;  2PER A;  1ERT A;  4RI6 A;  1NSW A;  3L9U A;  3O6T A;  2BJX A;  3HVV A;  5IMD A;  2NBS A;  2ZUP A;  2K18 A;  6GSW A;  1YDK A;  2F8A A;  1AQX A;  5D9X A;  3EWL A;  3QPM A;  1H75 A;  3KD0 A;  3PPU A;  3RDW A;  5A5K A;  5ECN B;  5FWG A;  1TRU A;  4V2M A;  4MK3 A;  2LS5 A;  3FR3 A;  4K0N A;  2XBQ A;  4IQ1 A;  4IQA A;  1HD2 A;  4KW6 A;  2I1U A;  3W6G A;  1OVN A;  2MMN A;  3F4S A;  1O73 A;  2XPE A;  2R37 A;  1I9D A;  3LG6 A;  3FZ9 A;  2VL2 C;  1SYX A;  4O7H A;  3TJG A;  4ECB A;  3KCM A;  2CZ2 A;  5IMA A;  4EDY A;  1EWX A;  2ALB A;  4QL9 A;  3IK7 A;  1K3O A;  6GSY A;  2IPA A; 
#chains in the Genus database with same CATH topology
 3M1G A;  2ES7 A;  4NWY A;  2HE3 A;  1QQ2 A;  2KP1 A;  6GSV A;  1YJ6 A;  1GTB A;  5DAK A;  2CA8 A;  4OFN A;  3IC8 A;  1T4Y A;  3CYN A;  3ERG A;  2IN3 A;  1YEP A;  4ZIJ A;  3IDV A;  3LJR A;  1PL2 A;  2HFD A;  3FZ4 A;  5ABR A;  3EYT A;  4F0B A;  4AI6 A;  4Q5F A;  1EGO A;  1XFL A;  5JCG A;  3ZRE A;  3UIW A;  4PUA A;  1O8X A;  4KCE A;  3J7Y b;  1MTC A;  4ZB8 A;  1PN0 A;  2FNO A;  2EFC A;  2OAD A;  5L71 A;  5J4U A;  2H70 A;  4G2E A;  5CNW A;  3LXT A;  5GAN D;  1SVM A;  1ACV A;  3PIN A;  4FYC A;  4POL A;  3BD2 A;  4K0G A;  4MF6 A;  3TJK A;  2C0G A;  3W8S A;  1MDJ A;  2WVZ A;  1ML6 A;  2M72 A;  4KSM A;  2H30 A;  3TOT A;  3N9J A;  1VF3 A;  2IMD A;  5DCG A;  3GSS A;  4IVF A;  2OT3 A;  2PGT A;  5G5F A;  1GUL A;  2F8F A;  4PTS A;  2YV7 A;  4LL4 B;  5FHI A;  1JHB A;  3CBU A;  5B7C A;  2DIY A;  4IP1 A;  3R2Q A;  2GDR A;  1EZK A;  5ELA A;  17GS A;  2H01 A;  3D4M A;  1ZZY A;  3GHA A;  2WB9 A;  2Z9S A;  5BMU B;  4WET A;  3RHC A;  3EPT A;  3LW9 A;  5IQY A;  1OC8 A;  4BVY B;  4FIW A;  3D0Z A;  3OR5 A;  1RK4 A;  2QC7 A;  3IK9 A;  1O81 A;  4K8M A;  2YJH A;  2H0I A;  1EGR A;  3APQ A;  1FVJ A;  3APO A;  1GSE A;  2C3Q A;  2B7J A;  1YKA A;  1XW9 A;  2H1B A;  4XIH A;  2HSH A;  3VUR A;  1AUC A;  2CAQ A;  1K3Y A;  4HUA A;  1USB A;  1PSQ A;  1T4Z A;  3FZ5 A;  3GFK A;  1AIU A;  4FYU A;  1YEW C;  2JL4 A;  2O89 A;  3H4K A;  2HQT A;  4PNG A;  4OFM A;  1GL8 A;  3DGQ A;  2OE0 A;  4MCU A;  1LJR A;  2LUS A;  2CX3 A;  4KAE A;  2K8V A;  3R3E A;  5HR1 A;  1OKT A;  3UBL A;  2H6Z A;  2AHE A;  2O36 A;  3ZFL A;  6GST A;  3TKS C;  1O7U A;  3M8N A;  2E2G A;  1GTU A;  3CSI A;  4G01 A;  4HJ2 A;  1ZMA A;  4KGI A;  4F0C A;  2CVB A;  2B5E A;  1RW1 A;  4DVC A;  3UMA A;  1FW1 A;  1A0R P;  2LKU A;  4K5R A;  4GQC A;  1ON4 A;  3MWH A;  3KMN A;  5G30 A;  1VRS D;  2UV8 G;  4ZB6 A;  3QCP A;  4WBR D;  2GQK A;  3TRQ A;  4YAV A;  3M9K A;  2AUV A;  1TP9 A;  5J9B A;  3GKN A;  3ZIT A;  3GV1 A;  3H8Q A;  3BCI A;  3QFA C;  1ZYE A;  2K8S A;  2FD3 A;  3CRU A;  3UOM A;  4J57 E;  1YF1 A;  1LBK A;  4EC0 A;  3ED3 A;  1B9X C;  2KHP A;  2JAC A;  4HS1 A;  2GSS A;  4AF2 A;  4ILF A;  3FYG A;  4MZB A;  2PU9 C;  1OC9 B;  3C1R A;  4KND A;  4QQ7 A;  1TKD B;  1GUM A;  1K0D A;  2LEG A;  2LNT A;  2A2P A;  2FA8 A;  3EU4 A;  4LL1 B;  5E4W A;  2VCW A;  5DJM A;  2P5Q A;  1GSQ A;  3HJM A;  5J4Y A;  2LQO A;  2PPT A;  4I8B A;  2O7K A;  1FHE A;  2DSA A;  2MMZ A;  4IGJ A;  5CYY A;  4PHZ C;  3KZQ A;  3LFL A;  3SBC A;  3WGD A;  1TU8 A;  2FWH A;  1Y6E A;  3W8J A;  2VL9 A;  3KIJ A;  4MNN A;  3WD6 A;  3TJJ A;  2L59 A;  4BWQ A;  4EKZ A;  4L8E A;  1G0T A;  1MDK A;  22GS A;  2VLU A;  3E0U A;  1TK8 B;  1G7E A;  1XPV A;  3DYR A;  5ECL B;  2MMA A;  2ON5 A;  3RPN A;  2VKZ G;  4GRF A;  3KH9 A;  3QR6 A;  4AJ8 A;  3O76 A;  1XIY A;  1T8E B;  3A2X A;  4MH2 A;  1ABA A;  4ZBB A;  2YJ7 A;  3HCZ A;  2H6X A;  1ZGN A;  2V41 A;  3IHQ A;  2R6K A;  1CQG A;  2VCV A;  4AJ6 A;  1Z6M A;  1IYH A;  1J08 A;  4POM A;  1SVL A;  4AGS A;  2AYT A;  2LQQ A;  1QFN A;  3KGK A;  1FB6 A;  4H86 A;  2K6V A;  4ID0 A;  2I3Y A;  4NMU A;  2DJJ A;  3L9V A;  2IWT A;  4YAP A;  5KOX A;  4ZIL A;  1YY7 A;  3MAK A;  4FXY P;  3DRN A;  3Q19 A;  1GNW A;  4AKX B;  3GX8 A;  2WZS A;  4MP4 A;  1M9B A;  5G1L A;  2QA1 A;  5D73 A;  2H6Y A;  4EO3 A;  2FA4 A;  1K0B A;  4ZL8 A;  1UN2 A;  1ZCP A;  3CRT A;  4AKG A;  2MMO A;  4BA7 A;  1XXU A;  1XW5 A;  3GUR A;  2K9F A;  3ME8 A;  3LGC A;  2A4H A;  3Q18 A;  3FHK A;  9GSS A;  2H1G A;  4HJM A;  2JU5 A;  1BJX A;  2N5A A;  2R2J A;  2PMT A;  2PVO C;  2IMI A;  1GUK A;  1WP0 A;  2IME A;  2FUG 2;  3VWX A;  1J9B A;  2KLX A;  4K2X A;  2RM5 A;  3KXO A;  3QOU A;  5ECS A;  3A2W A;  4MDC A;  3QDN A;  3E3E A;  2CVK A;  3C73 A;  5CO3 A;  4PUF C;  3NIV A;  4JBB A;  3GTU B;  1FG4 A;  2F9S A;  4MMM A;  4MJE A;  5IMF A;  4D73 A;  3CXG A;  4GLT A;  3D21 A;  11GS A;  1EEM A;  1BQ7 A;  2X8H A;  2MBS A;  4EIQ A;  1QGV A;  4GQF A;  4PI2 C;  1XG8 A;  2X64 A;  4FO5 A;  4IKH A;  8GSS A;  3ZML A;  4MF5 A;  3F6F A;  1JZO A;  4E8H A;  1F6M C;  1Q98 A;  4F82 A;  3TRX A;  3EMP A;  1SD8 A;  2IJY A;  3HZ4 A;  1ZOF A;  5GST A;  1HQO A;  4K7O A;  3I43 A;  2P5R A;  2L6C A;  5HR3 A;  2A2S A;  3HJO A;  1TJD A;  4TR1 A;  3IE3 A;  5ECM B;  1H4O A;  2FY6 A;  5J4V A;  4F2I A;  5D9W A;  1R4W A;  1BYE A;  5KN0 A;  1THX A;  5JWR B;  3P2A A;  4RI7 A;  4XRA A;  1I5G A;  2WW1 A;  4CY8 A;  1TRV A;  3GKM A;  3HVN A;  4IN0 A;  3HDC A;  4KH7 A;  3FZA A;  3TCO A;  3TKP A;  2GVP A;  4IHU A;  4Z2U A;  4X0X A;  3FK8 A;  5H5S A;  3RGB C;  1QUW A;  3TKQ A;  4EIP A;  4XRD A;  2EC4 A;  4HDE A;  5C00 A;  1F9M A;  2REM A;  3TKS E;  2KOK A;  4TR1 B;  1DE2 A;  1MD4 A;  3PGT A;  1U88 A;  3BJ5 A;  2RUF A;  2HZF A;  4KA0 A;  2IMK A;  2BMX A;  2YWO A;  1ERU A;  3L0H A;  3FEU A;  5INY A;  2YZU A;  4X43 A;  1TXU A;  2VCZ A;  3TU3 B;  2VL2 A;  3CHX C;  1BG5 A;  4BWS A;  1XOA A;  3ZYW A;  2DJK A;  5ECP B;  3KP9 A;  4HZ2 A;  3F4R A;  2PVQ A;  10GS A;  5IMZ A;  5H5Q A;  3F8U A;  2YV9 A;  2JAD A;  4J2F A;  1PKZ A;  3LQ7 A;  3DXB A;  5ECO B;  5A1N A;  3ZTL A;  1T1V A;  4MJA A;  5D93 A;  3IAS 2;  3IA1 A;  4KDX A;  2GQL A;  5G5E A;  1CQH A;  2JZS A;  4J56 E;  3Q74 A;  1V98 A;  2O5V A;  3GH6 A;  2HSY A;  1QK8 A;  1K0N A;  3GRX A;  5DCH A;  2R0G A;  1EEJ A;  2E2M A;  2YOI A;  3RPP A;  1PX6 A;  4WF5 A;  2C4J A;  3GUS A;  2CAI A;  2V6K A;  4GWR A;  2WW0 A;  3EE2 A;  3UVT A;  2O8V B;  4USS A;  4TOP A;  3VK9 A;  1SU9 A;  1XW6 A;  1PD2 1;  5DAK B;  4N11 A;  1A24 A;  3EUR A;  3DWV A;  1F3A A;  5ELG A;  2HI7 A;  1TU7 A;  5AN1 A;  1A0F A;  13GS A;  4YKF A;  1R5P A;  4IS0 A;  2YWN A;  1ZYP A;  5A4V A;  2VCT A;  6GSU A;  1WIK A;  4Z2R A;  2V32 A;  5JWQ B;  4CW9 A;  4G9H A;  1N25 A;  3TB2 A;  1W4V A;  3NZN A;  2ZCT A;  2EFD A;  2B7K A;  1AQW A;  1HNA A;  4ZXG A;  4ICY A;  2FWE A;  1GRX A;  1TK0 B;  4HQZ A;  1FO5 A;  1U87 A;  2HSM A;  3MDK A;  1JLW A;  5DAL A;  3HMJ G;  3HHV A;  5COH A;  1GSY A;  4GXZ A;  1V57 A;  1PMT A;  2DKI A;  1B4Q A;  4GSS A;  4O5U A;  2GZZ A;  2LV3 A;  2TIR A;  4HQS A;  2MBT A;  5DBQ A;  4IP6 A;  14GS A;  1MD3 A;  4AKI A;  1TTZ A;  4G0K A;  2AB6 A;  3F6D A;  1Z3E A;  4KE3 A;  2L5L A;  4L5O A;  3APS A;  1B4P A;  5B8B A;  1EOG A;  2H66 A;  4FQU A;  4N10 A;  1A8L A;  4N0V A;  1HYU A;  3D5J A;  4EUY A;  5CRW A;  1X5D A;  4WR5 A;  5A34 A;  2V6O A;  5ECQ B;  2L6D A;  2WGR A;  3M0F A;  3TKR A;  1XZO A;  4XHM A;  4NHZ A;  5GSS A;  3CMI A;  5EY6 A;  4CHS A;  2B5Y A;  3HVX A;  3KTB A;  5JWO B;  2B1L A;  2MYG A;  5IOW A;  1AXD A;  2ZNM A;  1ZYN A;  4O5Q A;  1GWC A;  4JZQ A;  1BED A;  2GZY A;  5HFI A;  3WGX A;  5J9C A;  5ECI B;  4XTS A;  1UC7 A;  2DML A;  3ZIV A;  5CRD A;  1NW2 A;  4MPG A;  2L4Q A;  2OE1 A;  3TKS A;  3P8W A;  1FB0 A;  1SL2 B;  2WJU A;  5A34 B;  1M9A A;  4XS4 A;  3I69 A;  2N5B A;  2C3N A;  3GL3 A;  4OCF A;  3IBH A;  1SYR A;  4TN8 A;  3EVI A;  3H1N A;  2LTK A;  1YQ1 A;  1XWC A;  3LSZ A;  1XWK A;  5F07 A;  1K0M A;  4LMV A;  2VIM A;  3DML A;  4MLY A;  5IMC A;  4WF4 A;  3TRP A;  4GCI A;  4TRX A;  4K9Z A;  5FT3 A;  4PX1 A;  2WVY A;  2H8L A;  2B3S A;  4I2T A;  3L9S A;  1GP1 A;  4ZBA A;  2KUC A;  4AKH A;  2GGT A;  3GIX A;  5LCZ A;  1Y1U A;  3WT2 A;  4HZ4 A;  3VWV A;  2R0P A;  2FCH A;  2L4C A;  1OAZ A;  3DVW A;  1X9S B;  1GNE A;  5AIS A;  2LRC A;  12GS A;  2GTU A;  2LST A;  1W89 A;  1GSD A;  3US3 A;  1FOV A;  1JZW A;  1NM3 A;  3VI5 A;  1TRS A;  3GST A;  2C3T A;  3G7Y A;  2O85 A;  1JLV A;  2WZ9 A;  4TR4 A;  2PBJ A;  3KJY A;  4JRR A;  2NVL A;  6GSX A;  4WXT A;  2H0G A;  5ID2 A;  3KMO A;  4DEJ A;  4ECJ A;  3ZVJ A;  3QMX A;  4Q5R A;  1J0F A;  5D9V A;  2X8G A;  2TRX A;  2JZT A;  4MPF A;  3F3R A;  3VFI A;  1R26 A;  3FKF A;  4IW9 A;  3WT1 A;  2WUL A;  4DSR A;  3HD5 A;  5DVB A;  5KN2 A;  2H74 A;  4EE0 A;  1M2A A;  4DSS A;  2HZE A;  1UVZ A;  1PN9 A;  4NPB A;  2LJK A;  2OBI A;  4ISD A;  5C04 A;  2IFQ A;  5IO0 A;  1NHY A;  5A5H A;  3ME7 A;  4V2L A;  2UZ8 A;  1G6Y A;  3IHG A;  4I2U A;  1OC3 A;  3BOA A;  1A2L A;  2GSQ A;  4EL1 A;  7GSS A;  3L78 A;  2A4V A;  2QGV A;  2H1A A;  3VI7 A;  1Z7R A;  3GA4 A;  3EMX A;  4YQM A;  4OD7 A;  1Z5Y E;  1TI3 A;  5KN1 A;  4OO5 A;  5B8A A;  3ERW A;  1AC1 A;  1S4B P;  4LLR A;  1F37 A;  5F06 A;  2E7P A;  3LEF A;  3ZLP A;  5DQS A;  2VL3 A;  2HT9 A;  1GUH A;  2IFQ B;  1SD9 A;  1DSB A;  3IRA A;  5G1K A;  2WS2 A;  3F9U A;  2YCD A;  3QFB C;  2IMF A;  3ZIJ A;  1XWG A;  4OMV A;  2C0E A;  2NPB A;  1MDI A;  4QL7 A;  1R5A A;  2HRK A;  3HKR A;  1X5C A;  1ST9 A;  2WRT A;  5IIZ A;  5HQP A;  2P0G A;  5CAX A;  2GSR A;  2G0F A;  5KEJ A;  3RBT A;  4N0Z A;  4TXV A;  1TW9 A;  1XWA A;  4TR3 A;  3FR6 A;  4KDY A;  2C0F A;  3IXR A;  1ERV A;  2O87 A;  1Q4J A;  5CRH A;  2EFE A;  3K8N A;  3QAG A;  4KF9 A;  2YWM A;  4G19 A;  1TK5 B;  1XOB A;  2M46 A;  1EOH A;  4JR6 A;  1F2E A;  3IC4 A;  1AQV A;  4CDO A;  2DKH A;  4K7N A;  1PKW A;  2OBK A;  3MYD A;  1S3C A;  3CTG A;  3F0I A;  2YAN A;  3D6I A;  3IOS A;  2R4V A;  3GN3 A;  2A2R A;  2LRN A;  2KP2 A;  2NTO A;  3DD3 A;  3KTL A;  2VAF A;  5IPG A;  2LJA A;  3QAV A;  4L5L A;  1XVQ A;  2RII A;  3F4T A;  1K3L A;  2RLI A;  4BVX A;  2X99 A;  1VF1 A;  1E2Y A;  4O5R A;  2AV4 A;  5DQY A;  5J3R A;  2F3M A;  4NXI A;  3ZZX A;  2CX4 A;  4G10 A;  1WMJ A;  1B8X A;  2ON7 A;  4OO4 A;  4HEA 2;  4I97 A;  2GT5 A;  5HR2 A;  2HRA A;  2J9H A;  2JZR A;  4I6X A;  3HVS A;  4D73 B;  2VLT A;  2HRF A;  4MF7 A;  2EIQ A;  1EV9 A;  3GL5 A;  2FWG A;  2D2Z A;  1A8Y A;  1JZD A;  1U3A A;  2CZ3 A;  4AJ7 A;  3JCM L;  1M0U A;  1YKC A;  2WW3 A;  4V2N A;  4K1F A;  3F63 A;  1U6T A;  4BVX B;  4KCA A;  1SK0 A;  4ML6 A;  2RM6 A;  4POB A;  3UVH A;  1SJ6 A;  4XCS A;  5JCW A;  5KN3 A;  4HU7 A;  1SVO A;  2GQM A;  1T7P B;  2GLR A;  4K6X A;  5B6M A;  2OAC A;  1WJK A;  5G2Z A;  4KDU A;  2EFH A;  3CQF A;  2VD0 A;  3H93 A;  3FRC A;  1X5E A;  3G7J A;  5A4U A;  4TXO A;  1E6B A;  2C0D A;  1SKR B;  2X4A A;  1XWB A;  2VOC A;  4O92 A;  3CTF A;  2RUE A;  1K0A A;  3TJB A;  2M80 A;  1EV4 A;  4GST A;  2GS3 A;  3TGZ A;  2NDO A;  1FAA A;  2DJ2 A;  3NOF A;  2YN1 A;  3GYK A;  1BAY A;  1EP8 A;  4MJB A;  4Q5Q A;  4EDZ A;  2V1M A;  3RAZ A;  2GST A;  1GLP A;  4TR0 A;  4YH2 A;  1A23 A;  1M3J A;  4EVM A;  1THO A;  2PN8 A;  4TXO B;  2CV4 A;  3LWA A;  19GS A;  1GLQ A;  2C8U A;  4GSN A;  4MJC A;  4G0L A;  1SL0 B;  5J47 A;  3CSJ A;  1PGT A;  2R5G A;  2H71 A;  3UJ1 A;  2QSI A;  1T00 A;  2OKA A;  3IR4 A;  3A3T A;  3MIX A;  1HNB A;  2DJ3 A;  2HYX A;  4ZB9 A;  3LXZ A;  2B5X A;  5CP1 A;  1DBY A;  4MA9 A;  1O85 A;  1BF5 A;  5A1N B;  3LYP A;  5D9T A;  3ZL5 A;  1S3D A;  5ECH B;  3HA9 A;  1V40 A;  2V2G A;  1TI1 A;  3KH7 A;  1VF4 A;  1K0O A;  1Z9H A;  4WBJ A;  5ENU A;  2WDU A;  1OE8 A;  4GTU A;  1V2A A;  2JSZ A;  5BMU A;  4BIK A;  4ZB7 A;  3ERF A;  4JU5 A;  1C72 A;  4BVY A;  4I5Q A;  3DIE A;  1WRY A;  1T3B A;  1XBS A;  2H75 A;  3WGE A;  1GTI A;  4IJ3 A;  1X9M B;  2YP6 A;  3IV4 A;  1O8W A;  3GKX A;  2L5O A;  2VM2 A;  3I9V 2;  4MH3 A;  2O3E A;  2GZP A;  3DVX A;  4QMK A;  4Z7X A;  3QAW A;  1PX7 A;  2VD1 A;  3HJP A;  5LNK e;  3LOR A;  3GX0 A;  4KUN A;  3U5R E;  5J40 A;  5DDL A;  3EIN A;  5HR0 A;  2HSN A;  1TXX A;  2H1L A;  3A5W A;  3ZMK A;  3EU3 A;  4KX4 A;  3G9B A;  1VF2 A;  1ERW A;  2IIY A;  1SKW B;  4BL7 A;  2EIR A;  1Z7P A;  3KM6 A;  2JSY A;  1GTA A;  2YNX A;  4JED A;  1QXH A;  1ZYQ B;  2FGX A;  3C8E A;  5G31 A;  1JZR A;  2DJ1 A;  4EF0 A;  2P31 A;  4CY6 A;  4OWY A;  1KNG A;  1SKS B;  4PNF A;  4V1A g;  4W66 A;  2QKE A;  1GSS A;  2I81 A;  1TDI A;  2IL3 A;  2XBI A;  1AW9 A;  3S9F A;  2HSM B;  3M3M A;  2TRC P;  3FY7 A;  5DAL B;  2R3X A;  4X1U A;  3A2V A;  3E9J B;  5CRE A;  4LA1 A;  2F51 A;  3ISO A;  1OKD A;  1WOU A;  1V58 A;  2HSN B;  1A2J A;  1WWJ A;  1PA3 A;  3SWL A;  3UAR A;  4ZL7 A;  5HFG A;  4BL7 B;  5EPF A;  3F3Q A;  4PQ1 A;  3MNG A;  1YEX A;  1G7O A;  1M2D A;  3U6V A;  2LJR A;  1TRW A;  4BPY A;  5LD0 A;  3CWG A;  3PH9 A;  4P3Y B;  3RHB A;  1GSF A;  4TW5 A;  2VLV A;  3KP8 A;  3V1W A;  3L4N A;  5EL8 A;  4NAX A;  4LMW A;  1PFO A;  3ZFB A;  2DJ0 A;  2VCX A;  1Z6N A;  3TUE A;  4L0U A;  1KEB A;  4HU9 A;  3UEM A;  1SJI A;  4N30 A;  3ZRD A;  4NHW A;  1OC9 A;  2I4A A;  3FMW A;  2H76 A;  3A5I A;  2HRN A;  2LNS A;  3GH9 A;  5JCU A;  1HNC A;  1BX9 A;  2DC5 A;  3DEX A;  3IPZ A;  1PL1 A;  1M99 A;  4PGT A;  3G7I A;  2H1D A;  3M9J A;  4YQU A;  2YZH A;  4JR4 A;  3AY8 A;  1AAZ A;  1YVL A;  2H19 A;  2DBC A;  1N8J A;  3FW2 A;  3HXS A;  4YKG A;  1OE7 A;  2HXK A;  2FHE A;  3GMF A;  1F3B A;  5BRT A;  5IPH A;  3VPQ A;  2B1K A;  4XS4 B;  4ECC A;  1O6J A;  1X0R A;  3VWW A;  3TDG A;  4K7I A;  3TJF A;  1PQN A;  1M3I A;  1URM A;  1RQM A;  3BBY A;  2CQ9 A;  3CSH A;  18GS A;  5AIV A;  1N2A A;  2XC2 A;  1YZX A;  2LRT A;  3DKS A;  5DJL A;  4HOJ A;  3IAM 2;  4WKW A;  2C80 A;  4FH8 A;  4JE1 A;  4PI0 C;  3GNJ A;  2R0C A;  5CRG A;  4N3Z A;  2WCI A;  4RQR A;  2VM1 A;  2H73 A;  5HFK A;  3HY2 A;  2AJQ B;  4KB3 A;  1VGL A;  1WE0 A;  5D8I A;  3P7X A;  1BG1 A;  5A4W A;  4FYB A;  1K0C A;  2XHF A;  5F05 A;  3H79 A;  2OE3 A;  4XS1 A;  3EC3 A;  1U3I A;  5IO2 A;  2L57 A;  4PQI A;  2HNL A;  1FVK A;  1GSU A;  2WVX A;  3C71 A;  4PXO A;  2E0Q A;  4L0W A;  4E68 A;  1YF0 A;  5F8B A;  4PUR A;  2BTO T;  1MEK A;  1XCC A;  4Q5N A;  2H72 A;  5ID2 B;  1QMV A;  2XPD A;  1GH2 A;  2G2Q A;  2X8C A;  4POK A;  5F0G A;  4NV2 A;  2B6M A;  1DE1 A;  3N5O A;  4EXJ A;  1EP7 A;  3PR8 A;  1TOF A;  3VPT A;  4GF0 A;  1WPI A;  4PQH A;  1M2B A;  4DSS B;  2HZE B;  1JFU A;  3Q6O A;  4MZC A;  2EIO A;  4DSQ A;  1KBN A;  1SK1 A;  5B6N A;  2WVX B;  3MSZ A;  4ULX A;  5D96 A;  3UL3 A;  1NHO A;  4V1A p;  5A5H B;  2OA7 A;  4WR4 A;  5ECR B;  3BCK A;  3GKK A;  2DMM A;  5KOW A;  5J5N A;  2I9H A;  4O32 A;  2YPM A;  5IMV A;  1ZL9 A;  1B9Y C;  3C7M A;  2VCQ A;  1G6W A;  3O3T A;  1V9W A;  2C1Y A;  2DLX A;  4ZBD A;  20GS A;  2DIZ A;  1SJZ A;  2WW2 A;  2MZC A;  1LU4 A;  3GTU A;  1I1I P;  5ECK B;  4KSO A;  16GS A;  1OYJ A;  2WFC A;  2CVD A;  1S3A A;  1R7H A;  5GAP D;  2CT6 A;  5E59 A;  5J41 A;  4NV5 A;  2FWF A;  2H0H A;  2HRK B;  4F03 A;  4IEL A;  1XVW A;  4MAB A;  3KEB A;  2J23 A;  5AIX A;  1M7T A;  4XS6 A;  2PWJ A;  5IOX A;  6GSS A;  1UA5 A;  1X9W B;  2FLS A;  3P90 A;  4YQV A;  4TVE A;  5EVO A;  3D22 A;  4ML1 A;  3ZVJ D;  4OFT A;  3HYP A;  3J7Y k;  1DUG A;  4ACS A;  3HZ8 A;  1IYI A;  1S3R A;  3VWU A;  3C1S A;  4E8E A;  4WEY A;  1A2M A;  3I6A A;  2X49 A;  2N5F A;  5AGY A;  4IBP A;  1ILO A;  4MZW A;  3D4T A;  4F9Z A;  3FR9 A;  4OCE A;  4RQX A;  1B48 A;  2PUK C;  5IM9 A;  4RUV A;  3WYW A;  2VO4 A;  1PRX A;  2HLS A;  2YWI A;  5GZZ B;  3QD9 A;  3UBK A;  4TKY A;  2AAW A;  4IJI A;  4ECI A;  4K2D A;  3UAP A;  1FOH A;  2OJL A;  4HI7 A;  2GT6 A;  1SEN A;  4ZL9 A;  3LYK A;  1Y25 A;  4G0I A;  3TOU A;  1SL1 B;  5H5R A;  2VUP A;  1SK2 A;  4A5P A;  1KTE A;  3VLN A;  2PER A;  1ERT A;  4RI6 A;  1NSW A;  3L9U A;  3O6T A;  4K5S A;  2BJX A;  4X4J A;  3HVV A;  5IMD A;  2NBS A;  2ZUP A;  2K18 A;  6GSW A;  1YDK A;  2F8A A;  1AQX A;  5D9X A;  3EWL A;  3QPM A;  3RFR C;  1H75 A;  3KD0 A;  3PPU A;  3RDW A;  5A5K A;  5ECN B;  5FWG A;  1TRU A;  4GDF A;  4V2M A;  4MK3 A;  2LS5 A;  3FR3 A;  4K0N A;  2XBQ A;  4IQ1 A;  4Z2T A;  4IQA A;  1HD2 A;  4KW6 A;  2I1U A;  3W6G A;  1OVN A;  2MMN A;  3F4S A;  4HSC X;  1O73 A;  2XPE A;  2R37 A;  1I9D A;  2QA2 A;  3LG6 A;  3FZ9 A;  2VL2 C;  1SYX A;  4O7H A;  3TJG A;  4ECB A;  3KCM A;  2CZ2 A;  5IMA A;  4EDY A;  1EWX A;  2ALB A;  4QL9 A;  3IK7 A;  1K3O A;  6GSY A;  2IPA A; 
#chains in the Genus database with same CATH homology
 3M1G A;  2ES7 A;  4NWY A;  2HE3 A;  1QQ2 A;  2KP1 A;  6GSV A;  1YJ6 A;  1GTB A;  5DAK A;  2CA8 A;  4OFN A;  3IC8 A;  1T4Y A;  3CYN A;  3ERG A;  2IN3 A;  1YEP A;  4ZIJ A;  3IDV A;  3LJR A;  1PL2 A;  2HFD A;  3FZ4 A;  5ABR A;  3EYT A;  4F0B A;  4AI6 A;  4Q5F A;  1EGO A;  1XFL A;  5JCG A;  3ZRE A;  3UIW A;  4PUA A;  1O8X A;  4KCE A;  3J7Y b;  1MTC A;  4ZB8 A;  1PN0 A;  2FNO A;  2EFC A;  2OAD A;  5L71 A;  5J4U A;  2H70 A;  4G2E A;  5CNW A;  3LXT A;  5GAN D;  1SVM A;  1ACV A;  3PIN A;  4FYC A;  4POL A;  3BD2 A;  4K0G A;  4MF6 A;  3TJK A;  2C0G A;  3W8S A;  1MDJ A;  1ML6 A;  2M72 A;  4KSM A;  2H30 A;  3TOT A;  3N9J A;  1VF3 A;  2IMD A;  5DCG A;  3GSS A;  4IVF A;  2OT3 A;  2PGT A;  5G5F A;  1GUL A;  2F8F A;  4PTS A;  2YV7 A;  4LL4 B;  5FHI A;  1JHB A;  3CBU A;  5B7C A;  2DIY A;  4IP1 A;  3R2Q A;  2GDR A;  1EZK A;  5ELA A;  17GS A;  2H01 A;  3D4M A;  1ZZY A;  3GHA A;  2WB9 A;  2Z9S A;  5BMU B;  4WET A;  3RHC A;  3EPT A;  3LW9 A;  5IQY A;  1OC8 A;  4BVY B;  4FIW A;  3D0Z A;  3OR5 A;  1RK4 A;  2QC7 A;  3IK9 A;  1O81 A;  4K8M A;  2YJH A;  2H0I A;  1EGR A;  3APQ A;  1FVJ A;  3APO A;  1GSE A;  2C3Q A;  2B7J A;  1YKA A;  1XW9 A;  2H1B A;  4XIH A;  2HSH A;  3VUR A;  1AUC A;  2CAQ A;  1K3Y A;  4HUA A;  1USB A;  1PSQ A;  1T4Z A;  3FZ5 A;  3GFK A;  1AIU A;  4FYU A;  2JL4 A;  2O89 A;  3H4K A;  2HQT A;  4PNG A;  4OFM A;  1GL8 A;  3DGQ A;  2OE0 A;  4MCU A;  1LJR A;  2LUS A;  2CX3 A;  4KAE A;  2K8V A;  3R3E A;  5HR1 A;  1OKT A;  3UBL A;  2H6Z A;  2AHE A;  3ZFL A;  6GST A;  3TKS C;  1O7U A;  3M8N A;  2E2G A;  1GTU A;  3CSI A;  4G01 A;  4HJ2 A;  1ZMA A;  4KGI A;  4F0C A;  2CVB A;  2B5E A;  1RW1 A;  4DVC A;  3UMA A;  1FW1 A;  1A0R P;  2LKU A;  4K5R A;  4GQC A;  1ON4 A;  3MWH A;  3KMN A;  5G30 A;  1VRS D;  2UV8 G;  4ZB6 A;  3QCP A;  4WBR D;  2GQK A;  3TRQ A;  4YAV A;  3M9K A;  2AUV A;  1TP9 A;  5J9B A;  3GKN A;  3ZIT A;  3GV1 A;  3H8Q A;  3BCI A;  3QFA C;  1ZYE A;  2K8S A;  2FD3 A;  3CRU A;  3UOM A;  4J57 E;  1YF1 A;  1LBK A;  4EC0 A;  3ED3 A;  1B9X C;  2KHP A;  2JAC A;  4HS1 A;  2GSS A;  4AF2 A;  4ILF A;  3FYG A;  4MZB A;  2PU9 C;  1OC9 B;  3C1R A;  4KND A;  4QQ7 A;  1TKD B;  1GUM A;  1K0D A;  2LEG A;  2LNT A;  2A2P A;  2FA8 A;  3EU4 A;  4LL1 B;  5E4W A;  2VCW A;  5DJM A;  2P5Q A;  1GSQ A;  3HJM A;  5J4Y A;  2LQO A;  2PPT A;  4I8B A;  2O7K A;  1FHE A;  2DSA A;  2MMZ A;  4IGJ A;  5CYY A;  3KZQ A;  3LFL A;  3SBC A;  3WGD A;  1TU8 A;  2FWH A;  1Y6E A;  3W8J A;  2VL9 A;  3KIJ A;  4MNN A;  3WD6 A;  3TJJ A;  2L59 A;  4BWQ A;  4EKZ A;  4L8E A;  1G0T A;  1MDK A;  22GS A;  2VLU A;  3E0U A;  1TK8 B;  1G7E A;  1XPV A;  3DYR A;  5ECL B;  2MMA A;  2ON5 A;  3RPN A;  2VKZ G;  4GRF A;  3KH9 A;  3QR6 A;  4AJ8 A;  3O76 A;  1XIY A;  1T8E B;  3A2X A;  4MH2 A;  1ABA A;  4ZBB A;  2YJ7 A;  3HCZ A;  2H6X A;  1ZGN A;  2V41 A;  3IHQ A;  2R6K A;  1CQG A;  2VCV A;  4AJ6 A;  1Z6M A;  1IYH A;  1J08 A;  4POM A;  1SVL A;  4AGS A;  2AYT A;  2LQQ A;  1QFN A;  3KGK A;  1FB6 A;  4H86 A;  2K6V A;  4ID0 A;  2I3Y A;  4NMU A;  2DJJ A;  3L9V A;  2IWT A;  4YAP A;  5KOX A;  4ZIL A;  1YY7 A;  3MAK A;  3DRN A;  3Q19 A;  1GNW A;  4AKX B;  3GX8 A;  4MP4 A;  1M9B A;  5G1L A;  2QA1 A;  5D73 A;  2H6Y A;  4EO3 A;  2FA4 A;  1K0B A;  4ZL8 A;  1UN2 A;  1ZCP A;  3CRT A;  4AKG A;  2MMO A;  4BA7 A;  1XXU A;  1XW5 A;  3GUR A;  2K9F A;  3ME8 A;  3LGC A;  2A4H A;  3Q18 A;  3FHK A;  9GSS A;  2H1G A;  4HJM A;  2JU5 A;  1BJX A;  2N5A A;  2R2J A;  2PMT A;  2PVO C;  2IMI A;  1GUK A;  1WP0 A;  2IME A;  2FUG 2;  3VWX A;  1J9B A;  2KLX A;  4K2X A;  2RM5 A;  3KXO A;  3QOU A;  5ECS A;  3A2W A;  4MDC A;  3QDN A;  3E3E A;  2CVK A;  3C73 A;  5CO3 A;  4PUF C;  3NIV A;  4JBB A;  3GTU B;  1FG4 A;  2F9S A;  4MMM A;  4MJE A;  5IMF A;  4D73 A;  3CXG A;  4GLT A;  3D21 A;  11GS A;  1EEM A;  1BQ7 A;  2X8H A;  2MBS A;  4EIQ A;  1QGV A;  4GQF A;  2X64 A;  4FO5 A;  4IKH A;  8GSS A;  3ZML A;  4MF5 A;  3F6F A;  1JZO A;  4E8H A;  1F6M C;  1Q98 A;  4F82 A;  3TRX A;  3EMP A;  1SD8 A;  2IJY A;  3HZ4 A;  1ZOF A;  5GST A;  1HQO A;  4K7O A;  3I43 A;  2P5R A;  2L6C A;  5HR3 A;  2A2S A;  3HJO A;  1TJD A;  4TR1 A;  3IE3 A;  5ECM B;  1H4O A;  2FY6 A;  5J4V A;  4F2I A;  5D9W A;  1R4W A;  1BYE A;  5KN0 A;  1THX A;  5JWR B;  3P2A A;  4RI7 A;  4XRA A;  1I5G A;  4CY8 A;  1TRV A;  3GKM A;  4IN0 A;  3HDC A;  4KH7 A;  3FZA A;  3TCO A;  3TKP A;  2GVP A;  4IHU A;  4Z2U A;  4X0X A;  3FK8 A;  5H5S A;  1QUW A;  3TKQ A;  4EIP A;  4XRD A;  2EC4 A;  4HDE A;  5C00 A;  1F9M A;  2REM A;  3TKS E;  2KOK A;  4TR1 B;  1DE2 A;  1MD4 A;  3PGT A;  1U88 A;  3BJ5 A;  2RUF A;  2HZF A;  4KA0 A;  2IMK A;  2BMX A;  2YWO A;  1ERU A;  3L0H A;  3FEU A;  5INY A;  2YZU A;  4X43 A;  1TXU A;  2VCZ A;  3TU3 B;  2VL2 A;  1BG5 A;  4BWS A;  1XOA A;  3ZYW A;  2DJK A;  5ECP B;  3KP9 A;  4HZ2 A;  3F4R A;  2PVQ A;  10GS A;  5IMZ A;  5H5Q A;  3F8U A;  2YV9 A;  2JAD A;  4J2F A;  1PKZ A;  3LQ7 A;  3DXB A;  5ECO B;  5A1N A;  3ZTL A;  1T1V A;  4MJA A;  5D93 A;  3IAS 2;  3IA1 A;  4KDX A;  2GQL A;  5G5E A;  1CQH A;  2JZS A;  4J56 E;  3Q74 A;  1V98 A;  2O5V A;  3GH6 A;  2HSY A;  1QK8 A;  1K0N A;  3GRX A;  5DCH A;  2R0G A;  1EEJ A;  2E2M A;  2YOI A;  3RPP A;  1PX6 A;  4WF5 A;  2C4J A;  3GUS A;  2CAI A;  2V6K A;  4GWR A;  3EE2 A;  3UVT A;  2O8V B;  4USS A;  4TOP A;  3VK9 A;  1SU9 A;  1XW6 A;  1PD2 1;  5DAK B;  4N11 A;  1A24 A;  3EUR A;  3DWV A;  1F3A A;  5ELG A;  2HI7 A;  1TU7 A;  5AN1 A;  1A0F A;  13GS A;  4YKF A;  1R5P A;  4IS0 A;  2YWN A;  1ZYP A;  5A4V A;  2VCT A;  6GSU A;  1WIK A;  4Z2R A;  2V32 A;  5JWQ B;  4CW9 A;  4G9H A;  1N25 A;  3TB2 A;  1W4V A;  3NZN A;  2ZCT A;  2EFD A;  2B7K A;  1AQW A;  1HNA A;  4ZXG A;  4ICY A;  2FWE A;  1GRX A;  1TK0 B;  4HQZ A;  1FO5 A;  1U87 A;  2HSM A;  3MDK A;  1JLW A;  5DAL A;  3HMJ G;  3HHV A;  5COH A;  1GSY A;  4GXZ A;  1V57 A;  1PMT A;  2DKI A;  1B4Q A;  4GSS A;  4O5U A;  2GZZ A;  2LV3 A;  2TIR A;  4HQS A;  2MBT A;  5DBQ A;  4IP6 A;  14GS A;  1MD3 A;  4AKI A;  1TTZ A;  4G0K A;  2AB6 A;  3F6D A;  1Z3E A;  4KE3 A;  2L5L A;  4L5O A;  3APS A;  1B4P A;  5B8B A;  1EOG A;  2H66 A;  4FQU A;  4N10 A;  1A8L A;  4N0V A;  1HYU A;  3D5J A;  4EUY A;  5CRW A;  1X5D A;  4WR5 A;  5A34 A;  2V6O A;  5ECQ B;  2L6D A;  2WGR A;  3M0F A;  3TKR A;  1XZO A;  4XHM A;  4NHZ A;  5GSS A;  3CMI A;  5EY6 A;  4CHS A;  2B5Y A;  3HVX A;  3KTB A;  5JWO B;  2B1L A;  2MYG A;  5IOW A;  1AXD A;  2ZNM A;  1ZYN A;  4O5Q A;  1GWC A;  4JZQ A;  1BED A;  2GZY A;  5HFI A;  3WGX A;  5J9C A;  5ECI B;  4XTS A;  1UC7 A;  2DML A;  3ZIV A;  5CRD A;  1NW2 A;  4MPG A;  2L4Q A;  2OE1 A;  3TKS A;  3P8W A;  1FB0 A;  1SL2 B;  2WJU A;  5A34 B;  1M9A A;  4XS4 A;  3I69 A;  2N5B A;  2C3N A;  3GL3 A;  4OCF A;  3IBH A;  1SYR A;  4TN8 A;  3EVI A;  3H1N A;  2LTK A;  1YQ1 A;  1XWC A;  3LSZ A;  1XWK A;  5F07 A;  1K0M A;  4LMV A;  2VIM A;  3DML A;  4MLY A;  5IMC A;  4WF4 A;  3TRP A;  4GCI A;  4TRX A;  4K9Z A;  5FT3 A;  4PX1 A;  2H8L A;  2B3S A;  4I2T A;  3L9S A;  1GP1 A;  4ZBA A;  2KUC A;  4AKH A;  2GGT A;  3GIX A;  5LCZ A;  1Y1U A;  3WT2 A;  4HZ4 A;  3VWV A;  2R0P A;  2FCH A;  2L4C A;  1OAZ A;  3DVW A;  1X9S B;  1GNE A;  5AIS A;  2LRC A;  12GS A;  2GTU A;  2LST A;  1W89 A;  1GSD A;  3US3 A;  1FOV A;  1JZW A;  1NM3 A;  3VI5 A;  1TRS A;  3GST A;  2C3T A;  3G7Y A;  2O85 A;  1JLV A;  2WZ9 A;  4TR4 A;  2PBJ A;  3KJY A;  4JRR A;  2NVL A;  6GSX A;  4WXT A;  2H0G A;  5ID2 A;  3KMO A;  4DEJ A;  4ECJ A;  3ZVJ A;  3QMX A;  4Q5R A;  1J0F A;  5D9V A;  2X8G A;  2TRX A;  2JZT A;  4MPF A;  3F3R A;  3VFI A;  1R26 A;  3FKF A;  4IW9 A;  3WT1 A;  2WUL A;  4DSR A;  3HD5 A;  5DVB A;  5KN2 A;  2H74 A;  4EE0 A;  1M2A A;  4DSS A;  2HZE A;  1UVZ A;  1PN9 A;  4NPB A;  2LJK A;  2OBI A;  4ISD A;  5C04 A;  2IFQ A;  5IO0 A;  1NHY A;  5A5H A;  3ME7 A;  4V2L A;  2UZ8 A;  1G6Y A;  3IHG A;  4I2U A;  1OC3 A;  3BOA A;  1A2L A;  2GSQ A;  4EL1 A;  7GSS A;  3L78 A;  2A4V A;  2QGV A;  2H1A A;  3VI7 A;  1Z7R A;  3GA4 A;  3EMX A;  4YQM A;  4OD7 A;  1Z5Y E;  1TI3 A;  5KN1 A;  4OO5 A;  5B8A A;  3ERW A;  1AC1 A;  4LLR A;  1F37 A;  5F06 A;  2E7P A;  3LEF A;  3ZLP A;  5DQS A;  2VL3 A;  2HT9 A;  1GUH A;  2IFQ B;  1SD9 A;  1DSB A;  3IRA A;  5G1K A;  2WS2 A;  3F9U A;  2YCD A;  3QFB C;  2IMF A;  3ZIJ A;  1XWG A;  4OMV A;  2C0E A;  2NPB A;  1MDI A;  4QL7 A;  1R5A A;  2HRK A;  3HKR A;  1X5C A;  1ST9 A;  2WRT A;  5IIZ A;  5HQP A;  2P0G A;  5CAX A;  2GSR A;  2G0F A;  5KEJ A;  3RBT A;  4N0Z A;  4TXV A;  1TW9 A;  1XWA A;  4TR3 A;  3FR6 A;  4KDY A;  2C0F A;  3IXR A;  1ERV A;  2O87 A;  1Q4J A;  5CRH A;  2EFE A;  3K8N A;  3QAG A;  4KF9 A;  2YWM A;  4G19 A;  1TK5 B;  1XOB A;  2M46 A;  1EOH A;  4JR6 A;  1F2E A;  3IC4 A;  1AQV A;  4CDO A;  2DKH A;  4K7N A;  1PKW A;  2OBK A;  3MYD A;  1S3C A;  3CTG A;  3F0I A;  2YAN A;  3D6I A;  3IOS A;  2R4V A;  3GN3 A;  2A2R A;  2LRN A;  2KP2 A;  2NTO A;  3DD3 A;  3KTL A;  2VAF A;  5IPG A;  2LJA A;  3QAV A;  4L5L A;  1XVQ A;  2RII A;  3F4T A;  1K3L A;  2RLI A;  4BVX A;  2X99 A;  1VF1 A;  1E2Y A;  4O5R A;  2AV4 A;  5DQY A;  5J3R A;  2F3M A;  4NXI A;  3ZZX A;  2CX4 A;  4G10 A;  1WMJ A;  1B8X A;  2ON7 A;  4OO4 A;  4HEA 2;  4I97 A;  2GT5 A;  5HR2 A;  2HRA A;  2J9H A;  2JZR A;  4I6X A;  3HVS A;  4D73 B;  2VLT A;  2HRF A;  4MF7 A;  2EIQ A;  1EV9 A;  3GL5 A;  2FWG A;  2D2Z A;  1A8Y A;  1JZD A;  1U3A A;  2CZ3 A;  4AJ7 A;  3JCM L;  1M0U A;  1YKC A;  4V2N A;  4K1F A;  3F63 A;  1U6T A;  4BVX B;  4KCA A;  1SK0 A;  4ML6 A;  2RM6 A;  4POB A;  3UVH A;  1SJ6 A;  4XCS A;  5JCW A;  5KN3 A;  4HU7 A;  1SVO A;  2GQM A;  1T7P B;  2GLR A;  4K6X A;  5B6M A;  2OAC A;  1WJK A;  5G2Z A;  4KDU A;  2EFH A;  2VD0 A;  3H93 A;  3FRC A;  1X5E A;  3G7J A;  5A4U A;  4TXO A;  1E6B A;  2C0D A;  1SKR B;  2X4A A;  1XWB A;  2VOC A;  4O92 A;  3CTF A;  2RUE A;  1K0A A;  3TJB A;  2M80 A;  1EV4 A;  4GST A;  2GS3 A;  3TGZ A;  2NDO A;  1FAA A;  2DJ2 A;  3NOF A;  2YN1 A;  3GYK A;  1BAY A;  1EP8 A;  4MJB A;  4Q5Q A;  4EDZ A;  2V1M A;  3RAZ A;  2GST A;  1GLP A;  4TR0 A;  4YH2 A;  1A23 A;  4EVM A;  1THO A;  2PN8 A;  4TXO B;  2CV4 A;  3LWA A;  19GS A;  1GLQ A;  2C8U A;  4GSN A;  4MJC A;  4G0L A;  1SL0 B;  5J47 A;  3CSJ A;  1PGT A;  2R5G A;  2H71 A;  3UJ1 A;  2QSI A;  1T00 A;  2OKA A;  3IR4 A;  3A3T A;  3MIX A;  1HNB A;  2DJ3 A;  2HYX A;  4ZB9 A;  3LXZ A;  2B5X A;  5CP1 A;  1DBY A;  4MA9 A;  1O85 A;  1BF5 A;  5A1N B;  3LYP A;  5D9T A;  3ZL5 A;  1S3D A;  5ECH B;  3HA9 A;  1V40 A;  2V2G A;  1TI1 A;  3KH7 A;  1VF4 A;  1K0O A;  1Z9H A;  4WBJ A;  5ENU A;  2WDU A;  1OE8 A;  4GTU A;  1V2A A;  2JSZ A;  5BMU A;  4ZB7 A;  3ERF A;  4JU5 A;  1C72 A;  4BVY A;  4I5Q A;  3DIE A;  1WRY A;  1T3B A;  1XBS A;  2H75 A;  3WGE A;  1GTI A;  4IJ3 A;  1X9M B;  2YP6 A;  3IV4 A;  1O8W A;  3GKX A;  2L5O A;  2VM2 A;  3I9V 2;  4MH3 A;  2GZP A;  3DVX A;  4QMK A;  4Z7X A;  3QAW A;  1PX7 A;  2VD1 A;  3HJP A;  5LNK e;  3LOR A;  3GX0 A;  4KUN A;  3U5R E;  5J40 A;  5DDL A;  3EIN A;  5HR0 A;  2HSN A;  1TXX A;  2H1L A;  3A5W A;  3ZMK A;  3EU3 A;  4KX4 A;  3G9B A;  1VF2 A;  1ERW A;  2IIY A;  1SKW B;  4BL7 A;  2EIR A;  1Z7P A;  3KM6 A;  2JSY A;  1GTA A;  2YNX A;  4JED A;  1QXH A;  1ZYQ B;  2FGX A;  3C8E A;  5G31 A;  1JZR A;  2DJ1 A;  4EF0 A;  2P31 A;  4CY6 A;  4OWY A;  1KNG A;  1SKS B;  4PNF A;  4V1A g;  4W66 A;  2QKE A;  1GSS A;  2I81 A;  1TDI A;  2IL3 A;  2XBI A;  1AW9 A;  3S9F A;  2HSM B;  3M3M A;  2TRC P;  3FY7 A;  5DAL B;  2R3X A;  4X1U A;  3A2V A;  3E9J B;  5CRE A;  4LA1 A;  2F51 A;  3ISO A;  1OKD A;  1WOU A;  1V58 A;  2HSN B;  1A2J A;  1WWJ A;  1PA3 A;  3SWL A;  3UAR A;  4ZL7 A;  5HFG A;  4BL7 B;  5EPF A;  3F3Q A;  4PQ1 A;  3MNG A;  1YEX A;  1G7O A;  1M2D A;  3U6V A;  2LJR A;  1TRW A;  4BPY A;  5LD0 A;  3CWG A;  3PH9 A;  4P3Y B;  3RHB A;  1GSF A;  4TW5 A;  2VLV A;  3KP8 A;  3V1W A;  3L4N A;  5EL8 A;  4NAX A;  4LMW A;  3ZFB A;  2DJ0 A;  2VCX A;  1Z6N A;  3TUE A;  4L0U A;  1KEB A;  4HU9 A;  3UEM A;  1SJI A;  4N30 A;  3ZRD A;  4NHW A;  1OC9 A;  2I4A A;  3FMW A;  2H76 A;  3A5I A;  2HRN A;  2LNS A;  3GH9 A;  5JCU A;  1HNC A;  1BX9 A;  2DC5 A;  3DEX A;  3IPZ A;  1PL1 A;  1M99 A;  4PGT A;  3G7I A;  2H1D A;  3M9J A;  4YQU A;  2YZH A;  4JR4 A;  3AY8 A;  1AAZ A;  1YVL A;  2H19 A;  2DBC A;  1N8J A;  3FW2 A;  3HXS A;  4YKG A;  1OE7 A;  2HXK A;  2FHE A;  3GMF A;  1F3B A;  5BRT A;  5IPH A;  3VPQ A;  2B1K A;  4XS4 B;  4ECC A;  1O6J A;  1X0R A;  3VWW A;  3TDG A;  4K7I A;  3TJF A;  1PQN A;  1URM A;  1RQM A;  3BBY A;  2CQ9 A;  3CSH A;  18GS A;  5AIV A;  1N2A A;  2XC2 A;  1YZX A;  2LRT A;  3DKS A;  5DJL A;  4HOJ A;  3IAM 2;  4WKW A;  2C80 A;  4FH8 A;  4JE1 A;  3GNJ A;  2R0C A;  5CRG A;  4N3Z A;  2WCI A;  4RQR A;  2VM1 A;  2H73 A;  5HFK A;  3HY2 A;  2AJQ B;  4KB3 A;  1VGL A;  1WE0 A;  5D8I A;  3P7X A;  1BG1 A;  5A4W A;  4FYB A;  1K0C A;  2XHF A;  5F05 A;  3H79 A;  2OE3 A;  4XS1 A;  3EC3 A;  1U3I A;  5IO2 A;  2L57 A;  4PQI A;  2HNL A;  1FVK A;  1GSU A;  3C71 A;  4PXO A;  2E0Q A;  4L0W A;  4E68 A;  1YF0 A;  5F8B A;  4PUR A;  2BTO T;  1MEK A;  1XCC A;  4Q5N A;  2H72 A;  5ID2 B;  1QMV A;  2XPD A;  1GH2 A;  2G2Q A;  2X8C A;  4POK A;  5F0G A;  4NV2 A;  2B6M A;  1DE1 A;  3N5O A;  4EXJ A;  1EP7 A;  3PR8 A;  1TOF A;  3VPT A;  4GF0 A;  1WPI A;  4PQH A;  1M2B A;  4DSS B;  2HZE B;  1JFU A;  3Q6O A;  4MZC A;  2EIO A;  4DSQ A;  1KBN A;  1SK1 A;  5B6N A;  3MSZ A;  4ULX A;  5D96 A;  3UL3 A;  1NHO A;  4V1A p;  5A5H B;  2OA7 A;  4WR4 A;  5ECR B;  3BCK A;  3GKK A;  2DMM A;  5KOW A;  5J5N A;  2I9H A;  4O32 A;  2YPM A;  5IMV A;  1ZL9 A;  1B9Y C;  3C7M A;  2VCQ A;  1G6W A;  3O3T A;  1V9W A;  2C1Y A;  2DLX A;  4ZBD A;  20GS A;  2DIZ A;  1SJZ A;  2MZC A;  1LU4 A;  3GTU A;  5ECK B;  4KSO A;  16GS A;  1OYJ A;  2WFC A;  2CVD A;  1S3A A;  1R7H A;  5GAP D;  2CT6 A;  5E59 A;  5J41 A;  4NV5 A;  2FWF A;  2H0H A;  2HRK B;  4F03 A;  4IEL A;  1XVW A;  4MAB A;  3KEB A;  2J23 A;  5AIX A;  1M7T A;  4XS6 A;  2PWJ A;  5IOX A;  6GSS A;  1UA5 A;  1X9W B;  2FLS A;  3P90 A;  4YQV A;  4TVE A;  5EVO A;  3D22 A;  4ML1 A;  3ZVJ D;  4OFT A;  3HYP A;  3J7Y k;  1DUG A;  4ACS A;  3HZ8 A;  1IYI A;  3VWU A;  3C1S A;  4E8E A;  4WEY A;  1A2M A;  3I6A A;  2X49 A;  2N5F A;  5AGY A;  4IBP A;  1ILO A;  4MZW A;  3D4T A;  4F9Z A;  3FR9 A;  4OCE A;  4RQX A;  1B48 A;  2PUK C;  5IM9 A;  4RUV A;  3WYW A;  2VO4 A;  1PRX A;  2HLS A;  2YWI A;  5GZZ B;  3QD9 A;  3UBK A;  4TKY A;  2AAW A;  4IJI A;  4ECI A;  4K2D A;  3UAP A;  1FOH A;  2OJL A;  4HI7 A;  2GT6 A;  1SEN A;  4ZL9 A;  3LYK A;  1Y25 A;  4G0I A;  3TOU A;  1SL1 B;  5H5R A;  2VUP A;  1SK2 A;  4A5P A;  1KTE A;  3VLN A;  2PER A;  1ERT A;  4RI6 A;  1NSW A;  3L9U A;  3O6T A;  4K5S A;  2BJX A;  4X4J A;  3HVV A;  5IMD A;  2NBS A;  2ZUP A;  2K18 A;  6GSW A;  1YDK A;  2F8A A;  1AQX A;  5D9X A;  3EWL A;  3QPM A;  1H75 A;  3KD0 A;  3PPU A;  3RDW A;  5A5K A;  5ECN B;  5FWG A;  1TRU A;  4GDF A;  4V2M A;  4MK3 A;  2LS5 A;  3FR3 A;  4K0N A;  2XBQ A;  4IQ1 A;  4Z2T A;  4IQA A;  1HD2 A;  4KW6 A;  2I1U A;  3W6G A;  1OVN A;  2MMN A;  3F4S A;  1O73 A;  2XPE A;  2R37 A;  1I9D A;  2QA2 A;  3LG6 A;  3FZ9 A;  2VL2 C;  1SYX A;  4O7H A;  3TJG A;  4ECB A;  3KCM A;  2CZ2 A;  5IMA A;  4EDY A;  1EWX A;  2ALB A;  4QL9 A;  3IK7 A;  1K3O A;  6GSY A;  2IPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...