3RBTA

Crystal structure of glutathione s-transferase omega 3 from the silkworm bombyx mori
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
230
structure length
230
Chain Sequence
VIPPPALTDKLRLYHVDMNPYGHRVLLVLEAKRIKYEVYRLDPLRLPEWFRAKNPRLKIPVLEIPTDQGDRFLFESVVICDYLDEKYTRHTLHSHDPYVKAQDRLLIERFNELIKGSLECFDTNFAFGSEQIIQTLEIFEKELTNRGTNYFGGNRPGMLDYMVWPWVERLYLLRCVNDRKFVEKKSLFPNFADWGDQMQLDDIVKKHAHSPQEYFDYYKNARAHSMGYYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione transferase o1
publication title Structure-guided activity restoration of the silkworm glutathione transferase Omega GSTO3-3
pubmed doi rcsb
source organism Bombyx mori
total genus 73
structure length 230
sequence length 230
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2011-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3rbtA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3rbtA01
3BBYA 4O92A 5GAPD 3VLNA 3A5WA 3W6GA 5D93A 2GDRA 1ON4A 4WBJA 3ZMLA 4DSQA 3PINA 3K8NA 1FOVA 4EVMA 1TRSA 2G0FA 4V2NA 1G7EA 1X9WB 4EDYA 3G9BA 4I5QA 6GSWA 1GLQA 3GSTA 3HVSA 6GSUA 5A5KA 20GSA 4FQUA 3ZVJD 2IFQB 3UL3A 4HQZA 2GSRA 3P90A 4O7HA 2TIRA 4K2DA 3IV4A 4FYCA 1Y25A 5HR3A 5HFKA 5GAND 1TJDA 1M9BA 3KP8A 1PL1A 4DSSB 4V2LA 2VLVA 5CO3A 2K8VA 3G7JA 1K3OA 3HY2A 1GSEA 4OFNA 4JE1A 2GT6A 2HNLA 2PGTA 3IA1A 3KEBA 2K8SA 3DYRA 1EOHA 1TDIA 4JR6A 1BEDA 2GGTA 1YEXA 4XTSA 3TB2A 2FA4A 2IL3A 1S3AA 2H66A 2GT5A 1OC8A 1A0RP 2B7KA 2GQLA 4HI7A 4HEA2 3TGZA 3RPNA 2P5RA 4I8BA 1UN2A 2FLSA 1O81A 4KDYA 1NSWA 1GSFA 2MMZA 3PPUA 1Y6EA 1E6BA 5ELAA 3VWXA 4POBA 3GURA 1XOBA 2BTOT 5L71A 2JZTA 5F06A 4GXZA 2A2SA 2CX4A 3F8UA 4ZL7A 1MDJA 4GSNA 3F4SA 1F6MC 3APOA 5CRHA 1CQGA 4ID0A 4F0BA 2CQ9A 1GTUA 1MDIA 3TJGA 2YWNA 1OC3A 5GSTA 3NZNA 4KA0A 4TR1B 3HVXA 3ZFLA 1SYRA 4MCUA 3CTFA 4ZBDA 2VCTA 4IHUA 2PERA 4TKYA 2H8LA 4OFMA 3D22A 4N10A 3TRQA 5G31A 4IELA 3GX8A 2HSYA 2ALBA 4AJ6A 2HRAA 1TU7A 4KSOA 5ECKB 1ERUA 4OCEA 2YJ7A 2E0QA 5IM9A 2M80A 5JCGA 1K0OA 4K7OA 2L6CA 2OBIA 1OVNA 2YWIA 1BQ7A 1M7TA 1PD21 2V6OA 5AIXA 5DAKB 4WR4A 3JCML 3QFAC 1GNEA 4MJCA 4K9ZA 1XVWA 1B48A 4F2IA 3KH7A 1X9SB 4IVFA 3GFKA 4YQUA 4K6XA 5DALB 3FZ4A 4Q5QA 1RK4A 2HSHA 4XS6A 1YKCA 1R7HA 1YZXA 1A8YA 1GTIA 5IMFA 3IE3A 3GX0A 5G5FA 1VF1A 1MD3A 4GRFA 1XWAA 4WETA 3UJ1A 5EY6A 4PXOA 4MZBA 1PKWA 2LUSA 3VURA 1OE8A 3EMPA 2KP1A 2C3QA 2X99A 4F0CA 3NOFA 4WF4A 2VCXA 3U5RE 3WGXA 2RUFA 5ECHB 3IXRA 3DIEA 5DQSA 1AIUA 4XRAA 3QAGA 4GWRA 3KXOA 4PNFA 4I6XA 5F07A 1K0MA 2O7KA 1JLWA 4MH2A 3FHKA 1T4ZA 2HZEB 4FO5A 1XW9A 5J3RA 3A2XA 4RI7A 3FR3A 1X5DA 4KUNA 4YQVA 2MMAA 3UMAA 4IS0A 2DJ1A 4POKA 1Q4JA 4BWSA 1UC7A 4G19A 3MNGA 2QGVA 4WKWA 3EVIA 2H6XA 2OE0A 1TRWA 1JZWA 3IDVA 3PGTA 5JCUA 3KP9A 1GSDA 2HLSA 3HZ4A 2DJ3A 1U88A 3A3TA 1X5EA 3ZITA 2OADA 4MZWA 5E59A 2GLRA 2F9SA 5IO0A 3RHBA 1PN9A 1ZGNA 1SKWB 2OE1A 5HQPA 1ZOFA 4CHSA 3LFLA 2IIYA 4HUAA 1ML6A 3HVVA 3IK9A 1PQNA 2I4AA 3HJMA 2BMXA 2DIYA 1BX9A 4PGTA 2YWMA 5IIZA 1J9BA 3UBKA 3MAKA 3FY7A 1KBNA 3H4KA 1V58A 1W4VA 3HD5A 1ZL9A 4MP4A 4EUYA 4KNDA 3VK9A 3GMFA 4K7IA 3WGDA 4BVYB 4MPGA 1U3AA 1YY7A 3GTUA 4L0WA 1SU9A 1LU4A 3L78A 1SL1B 1ZCPA 4TXOA 3ZL5A 4CDOA 5CRWA 1TRVA 3QDNA 1SJIA 2KLXA 4NHWA 3R2QA 4BVXB 1M9AA 2PU9C 1XVQA 4XS4B 2I9HA 1IYIA 2DLXA 5CNWA 2C0EA 3SWLA 4MDCA 4KGIA 1OC9A 5ECQB 4USSA 2XBIA 1UVZA 4MJBA 1AQWA 1VGLA 1J0FA 1A2LA 2N5AA 2NVLA 1F9MA 1QK8A 2O8VB 3I69A 4GSTA 2ZNMA 2L6DA 2NDOA 2GZPA 3LEFA 2GSTA 4TR0A 1T1VA 2QKEA 1XWGA 4L5OA 2HFDA 2ZUPA 4EL1A 1DBYA 2LJRA 3NIVA 4K0NA 4IJIA 3HJPA 1M2BA 1A2JA 1ERWA 3V1WA 2E2GA 4AJ8A 2OKAA 1GWCA 2CAIA 3UEMA 3TOTA 4HZ4A 4GLTA 4GSSA 1T3BA 3CRUA 1M0UA 13GSA 4MZCA 3BCIA 3E9JB 3QFBC 2JU5A 4KH7A 2J9HA 3CXGA 1R4WA 4PQHA 1V9WA 1XPVA 1B9XC 1PGTA 3MWHA 3GYKA 2HYXA 5IOWA 1B8XA 19GSA 4PUFC 1GP1A 4YAPA 2GQMA 4HZ2A 3L9VA 4O5RA 1TP9A 1WPIA 1O6JA 1M2AA 2V32A 2LRNA 2LKUA 1XBSA 3ZTLA 3J7Yk 3HHVA 4P3YB 1BAYA 1T00A 2H19A 5FT3A 3GSSA 2YOIA 2RM5A 3KMOA 1J08A 1C72A 4TR3A 4K7NA 1Q98A 5H5RA 7GSSA 1EZKA 4HU7A 2HRKB 3UVTA 1PL2A 2WULA 1HD2A 2VL3A 5ID2B 4HOJA 4GQCA 4BPYA 4KDXA 2B7JA 4KW6A 1SL2B 1O85A 1QQ2A 1A8LA 3D5JA 3ZFBA 3RPPA 4X43A 1FVJA 4EKZA 1S3CA 2RLIA 1ZMAA 5J9CA 3TKQA 3KM6A 3LXTA 1QXHA 6GSXA 2H72A 2B3SA 3DEXA 1URMA 3P8WA 1MEKA 4DSRA 3TRXA 3QAWA 2R5GA 1K0DA 5ECNB 1AAZA 5HR1A 1TK5B 3TKSA 5LCZA 17GSA 2HQTA 3VI7A 4OWYA 1G0TA 2DMMA 4EC0A 1GTAA 3EMXA 3CMIA 3TRPA 3Q74A 2YANA 2YZUA 1ACVA 2NTOA 2REMA 2K9FA 3DXBA 2H01A 2VLTA 4MF7A 2GSQA 2WJUA 2MZCA 1TXXA 4Q5NA 1IYHA 2V6KA 2NPBA 4E8EA 5F8BA 4DEJA 10GSA 4MH3A 2VD0A 3KJYA 9GSSA 1XWKA 1G7OA 2AV4A 6GSVA 5HR2A 4WXTA 3F4TA 3TKSE 4D73A 2IPAA 1GSQA 2JZSA 1G6WA 2VCWA 5IMCA 1O8WA 2JZRA 4YAVA 2I1UA 3L9SA 1FHEA 3TOUA 3EU3A 1XOAA 4IQ1A 3I43A 1OKTA 3GUSA 1MDKA 3L4NA 4N30A 2P0GA 5BMUA 1YDKA 2RM6A 2Z9SA 5JWRB 2DSAA 4KB3A 1Z6MA 1GULA 1M99A 3M3MA 4NHZA 3QOUA 4IJ3A 2AHEA 1K0AA 2LNTA 3ME8A 4OO4A 1SJ6A 3S9FA 2WCIA 11GSA 1BG5A 2DMLA 5DJMA 2C8UA 1T4YA 5LD0A 3EU4A 2GQKA 3CYNA 2VIMA 4G2EA 3ZRDA 1T8EB 2CT6A 2VUPA 16GSA 4N11A 3O76A 2L57A 1X5CA 2H1AA 2X64A 2H1DA 3BOAA 1EOGA 2VL2A 1SD8A 1F3BA 4LL1B 5CYYA 5D9VA 4HJMA 3EWLA 2DBCA 2A2RA 1EP7A 3QAVA 2VM2A 2HRFA 3QD9A 2LJAA 1YKAA 2FWHA 3IAS2 4JZQA 3QMXA 2IFQA 18GSA 5IPGA 3CSJA 3WYWA 3EURA 4MJAA 1ST9A 4RQXA 1MTCA 4L5LA 3O6TA 3M9JA 2FWFA 1FVKA 1K3LA 4L8EA 3F0IA 4GQFA 5D8IA 2H76A 4DSSA 2KOKA 5INYA 1SK2A 3L9UA 4TW5A 4YH2A 4XRDA 2FWGA 1Z7PA 4FH8A 4ECCA 2JADA 2IMDA 1JHBA 2XPDA 3IBHA 3IRAA 2CV4A 3KH9A 2HSMA 4PNGA 2FGXA 2GZYA 4ML6A 4ML1A 5G5EA 2WB9A 2ON5A 3PH9A 1TU8A 2WS2A 3TKSC 1YF0A 2VAFA 4BL7A 4EDZA 4TRXA 4KDUA 4ZBBA 3DD3A 2V41A 2C0FA 3WT2A 2O87A 3UVHA 1F37A 3FEUA 3GTUB 2GTUA 2VCVA 2JSYA 2HT9A 5ECSA 3F4RA 4EXJA 3ZREA 2YN1A 5HFGA 2H75A 1OYJA 3UIWA 1HNAA 4KSMA 3HJOA 3BJ5A 4KCAA 3LXZA 3UBLA 1TTZA 4AGSA 2FD3A 3G7IA 3WD6A 4O32A 4IQAA 3C71A 1AXDA 2LS5A 4MF6A 3OR5A 1PSQA 2A4VA 4RUVA 6GSSA 3FK8A 5B6MA 3F6FA 2O85A 4ZB8A 2I81A 3ED3A 2H1BA 3TKRA 2H1GA 5D73A 4PURA 3C8EA 1H4OA 4HQSA 3A2VA 1HNBA 2WDUA 3ZIVA 4MPFA 3GHAA 3HCZA 3FR9A 12GSA 1XXUA 4POMA 3PR8A 1HNCA 2C80A 1Z6NA 4J56E 2C1YA 3ZYWA 2CZ3A 1VF2A 4YQMA 3E3EA 5J41A 2WRTA 1R5PA 4V1Ag 1TK8B 1GL8A 4K1FA 2L5LA 1XCCA 5ENUA 3IR4A 1PA3A 5IOXA 4ECIA 2DJ0A 4FYBA 4BWQA 5JWOB 2LQOA 1WRYA 1SKSB 1VF3A 1ZYEA 3F3QA 4G0KA 2RUEA 2C4JA 2H0HA 5A4UA 1XWCA 5C00A 3GRXA 3GH9A 4GTUA 5CRGA 3RAZA 1B4QA 4POLA 1X9MB 2E2MA 5D9TA 2FUG2 3A2WA 2CVBA 4X0XA 2GSSA 1N8JA 5FWGA 4G9HA 3M9KA 3LJRA 3W8JA 4EE0A 5FHIA 5DJLA 2L4CA 5ABRA 4OFTA 5ECMB 1X0RA 4MABA 1QGVA 2HXKA 3F3RA 3KD0A 2WGRA 4IW9A 2VOCA 1R5AA 4K8MA 5G1KA 3IC4A 3IHQA 4ZXGA 2R2JA 1YEPA 5F05A 2QSIA 5ECIB 2AYTA 3CSHA 1NM3A 5LNKe 3GA4A 1TOFA 22GSA 3KZQA 1Z7RA 4NV2A 4DVCA 2KP2A 1WMJA 1GSSA 2CA8A 3RBTA 3UARA 5D9WA 1F3AA 2K6VA 4F03A 1KTEA 1SYXA 2IJYA 3HKRA 4XHMA 3RHCA 4TR4A 5IQYA 2X8CA 2F51A 5DCHA 4IGJA 1K0BA 2FCHA 2XC2A 3GV1A 4J2FA 2VO4A 1SENA 3E0UA 3ZVJA 2B5EA 4Z7XA 1K0CA 1AUCA 2CVDA 2PVOC 1HQOA 3FZ5A 2VLUA 3R3EA 2YV9A 2D2ZA 3HZ8A 3WGEA 3GKMA 4D73B 2B1LA 3KTBA 5B8BA 2PVQA 4BVYA 1PX6A 1USBA 2MBTA 2JL4A 5IMDA 2V1MA 5HR0A 4OMVA 1SJZA 1VF4A 4ACSA 3LG6A 4BVXA 2AAWA 3DGQA 5CRDA 4EO3A 4L0UA 1DSBA 2GZZA 4LA1A 5DDLA 1GUHA 2OA7A 5H5QA 3VWVA 4AF2A 3WT1A 3P7XA 1R26A 2J23A 3J7Yb 4JR4A 4XCSA 4EF0A 4Q5RA 1GSYA 3KMNA 3GKXA 1RW1A 5EVOA 3FW2A 2LV3A 1G6YA 1CQHA 1XZOA 1V40A 4IP1A 3EINA 3EYTA 2H30A 2OACA 1SK1A 2BJXA 1ILOA 3SBCA 3LGCA 3TJBA 1WIKA 1JZDA 2I3YA 3C1RA 3VWWA 1GSUA 1SL0B 3F63A 1O8XA 5KN2A 1GRXA 2VL9A 3DMLA 2H6YA 4LLRA 2MMOA 2LTKA 3N9JA 4WBRD 2CAQA 1A2MA 1YF1A 2LQQA 4QQ7A 2MMNA 2X8GA 4NV5A 2DJJA 3ERGA 1GTBA 2AUVA 1YJ6A 2PMTA 1FW1A 1N2AA 2LRCA 4KX4A 3US3A 2EIOA 4QL7A 2OE3A 3IC8A 1KNGA 4F9ZA 1WP0A 3ISOA 4MF5A 3GKNA 2R6KA 1EP8A 1K0NA 4X1UA 1ABAA 1JZOA 4PX1A 5B7CA 2PBJA 3Q18A 2HRKA 1VRSD 5IMZA 3ME7A 4OCFA 2H0IA 3HA9A 5ID2A 2HSMB 3QR6A 4JEDA 2XPEA 4ILFA 5CREA 2EC4A 4OO5A 5A4VA 4TOPA 2CX3A 2LNSA 4BL7B 4NPBA 2IWTA 2PPTA 3N5OA 1K3YA 1BYEA 3ZLPA 3CTGA 3VPQA 1U87A 4GF0A 4XIHA 3BD2A 2MYGA 3D4MA 1I5GA 2GS3A 2JSZA 1LBKA 2M72A 3I9V2 2DIZA 6GSTA 2DC5A 2H0GA 4BA7A 5AN1A 3Q19A 4MJEA 1YQ1A 4KE3A 3ERFA 3O3TA 5IMVA 2EIQA 4QL9A 2C0GA 2FHEA 2CVKA 5ECOB 4ZILA 2H70A 1TW9A 1NHOA 3CSIA 4KAEA 3L0HA 2CZ2A 2HRNA 2L5OA 3QPMA 3KGKA 1TRUA 2V2GA 3APQA 3W8SA 2R4VA 5ECPB 5AIVA 2B5XA 4NWYA 3LWAA 3TKPA 1XW5A 3D4TA 3LSZA 1WJKA 3Q6OA 1Z9HA 2UZ8A 4ULXA 5D9XA 1A0FA 2H6ZA 5G2ZA 1NHYA 2AB6A 1O7UA 1AQVA 5HFIA 2E7PA 1H75A 4ISDA 5DCGA 3LORA 4V2MA 5EPFA 3FRCA 4N0ZA 4TVEA 2YP6A 1B4PA 5DBQA 3C73A 2JACA 1TI1A 2YWOA 3FKFA 3HYPA 3M0FA 5GSSA 3RDWA 3TJFA 5IMAA 5H5SA 4AJ7A 3GH6A 5KEJA 3D6IA 1QFNA 5ECLB 2YZHA 5AGYA 3GN3A 1ZZYA 4RI6A 4LL4B 2YCDA 2YNXA 3DVXA 3HXSA 2XHFA 2M46A 5B8AA 2P31A 1FB0A 4JRRA 5KN3A 1DUGA 4WEYA 2WFCA 1GH2A 4HDEA 4I2TA 1EEJA 1OAZA 4WR5A 1A23A 3KTLA 2KUCA 2H73A 5KN0A 1DE1A 1JZRA 5JCWA 3D0ZA 3GL3A 1KEBA 4TXOB 5KN1A 3H93A 1GNWA 4I2UA 2DJ2A 3MSZA 1JLVA 3LYKA 2GVPA 3H79A 2FNOA 3CRTA 2ES7A 1PMTA 2P5QA 1OKDA 2N5BA 4ZBAA 2DJKA 1OC9B 4TR1A 5JWQB 1Z5YE 2OBKA 1TK0B 2VCQA 3IK7A 2FY6A 2X8HA 2MBSA 1BJXA 3GL5A 3EC3A 3ZIJA 1U3IA 4OD7A 2QC7A 2LRTA 4FYUA 2EIRA 1EGRA 3TDGA 2IMFA 2XBQA 5IO2A 5A4WA 3UOMA 8GSSA 4MMMA 1SD9A 2F8AA 2H74A 1A24A 4ZB9A 1F2EA 1GUKA 5G1LA 1V57A 2OJLA 1V98A 4LMVA 3ZMKA 3FZAA 4ZB6A 1PRXA 4ZL9A 1GLPA 5DAKA 1LJRA 5G30A 4K0GA 2ON7A 5ECRB 2FWEA 2LJKA 3GKKA 1XFLA 1AW9A 2B6MA 1WOUA 5F0GA 2IMIA 1RQMA 3FZ9A 4XS1A 4ECJA 4MA9A 4PQIA 5DALA 4IP6A 5ELGA 1NW2A 2AJQB 2FA8A 3I6AA 4HJ2A 3MDKA 4MK3A 1SKRB 5DQYA 1EV4A 2R3XA 4FIWA 2VL2C 1MD4A 1EGOA 3IOSA 4HU9A 2C3NA 2B1KA 2H71A 1TKDB 4G10A 2NBSA 4JU5A 1I9DA 4PQ1A 3DRNA 3GIXA 4G0LA 5D96A 1EV9A 3APSA 1O73A 1T7PB 1JFUA 3EE2A 1B9YC 5DVBA 3IPZA 3ZZXA 1UA5A 2WZ9A 4PTSA 2G2QA 5CP1A 5EL8A 4KCEA 6GSYA 3KCMA 1V2AA 3VWUA 3LQ7A 3VPTA 4GCIA 3UAPA 2C3TA 2LSTA 2L4QA 3ERWA 3AY8A 1QMVA 3H8QA 2HZEA 2KHPA 4IBPA 2RIIA 4I97A 2B5YA 1Z3EA 3KIJA 1QUWA 1WE0A 5C04A 3VFIA 3C1SA 2F8FA 4J57E 4N0VA 1THOA 3TCOA 4E8HA 2YJHA 4NAXA 3M1GA 1ERTA 3TJKA 3P2AA 1U6TA 4WF5A 1OE7A 3F6DA 3D21A 3IAM2 1PX7A 2IN3A 2YPMA 1WWJA 5J4UA 4HS1A 4RQRA 1GUMA 3LYPA 5CAXA 2F3MA 3DKSA 4KF9A 5GZZB 4NMUA 2YV7A 1ERVA 1PKZA 1XW6A 1E2YA 2LEGA 1EWXA 2HZFA 1M2DA 4IN0A 3G7YA 4LMWA 4JBBA 1TI3A 2HSNB 2N5FA 2IMEA 3M8NA 3F9UA 5AISA 3GNJA 2VD1A 5COHA 1SK0A 3FYGA 3HDCA 2TRCP 4PUAA 1HYUA 3CBUA 2ZCTA 2L59A 4ECBA 2VCZA 4V1Ap 1FO5A 3QCPA 1XIYA 1EEMA 4XS4A 2PWJA 3C7MA 2PN8A 5E4WA 3BCKA 1FG4A 5J9BA 1S3DA 2TRXA 3VI5A 2K18A 4H86A 4IKHA 4ZL8A 1AQXA 2O89A 4F82A 2R37A 4TN8A 5B6NA 3DWVA 5IPHA 1W89A 1THXA 14GSA 1FAAA 3DVWA 4G0IA 4CW9A 2HE3A 3TUEA 1XWBA 5J5NA 1AC1A 3H1NA 4MLYA 3TJJA 3U6VA 2HI7A 2VM1A 4Q5FA 2PUKC 4NXIA 2C0DA 4ZIJA 3FR6A 1DE2A 1FB6A 4TXVA 2IMKA 1ZYQB
chains in the Genus database with same CATH superfamily
3BBYA 4O92A 5GAPD 3VLNA 3A5WA 3W6GA 5D93A 2GDRA 1ON4A 4WBJA 3ZMLA 4DSQA 3PINA 3K8NA 1FOVA 4EVMA 1TRSA 2G0FA 4V2NA 1G7EA 1X9WB 4EDYA 3G9BA 4I5QA 6GSWA 1GLQA 3GSTA 3HVSA 6GSUA 5A5KA 2R0GA 20GSA 4FQUA 3ZVJD 2IFQB 3UL3A 4HQZA 2GSRA 3P90A 4O7HA 2DKIA 2TIRA 4K2DA 3IV4A 4FYCA 1Y25A 5HR3A 1M3JA 1SVMA 5HFKA 5GAND 1TJDA 1M9BA 3KP8A 1PL1A 4DSSB 4V2LA 2VLVA 5CO3A 2K8VA 4AKIA 4EIPA 3G7JA 1K3OA 3HY2A 1GSEA 4OFNA 4JE1A 2GT6A 2HNLA 2X49A 2PGTA 3IA1A 3KEBA 2K8SA 3DYRA 1EOHA 1TDIA 4JR6A 3RGBC 1BEDA 2GGTA 1YEXA 4XTSA 3TB2A 2FA4A 2IL3A 1S3AA 2H66A 2GT5A 4PI0C 1ZYPA 1OC8A 1A0RP 2B7KA 2GQLA 4HI7A 4HEA2 3TGZA 3RPNA 2P5RA 4I8BA 1UN2A 2FLSA 1O81A 4KDYA 2EFDA 1NSWA 1GSFA 2MMZA 3PPUA 1Y6EA 1E6BA 5ELAA 3VWXA 4POBA 3GURA 1XOBA 2BTOT 5L71A 2JZTA 5F06A 4GXZA 2A2SA 2CX4A 3F8UA 4ZL7A 1MDJA 4GSNA 3F4SA 1PN0A 1F6MC 3APOA 5CRHA 1CQGA 4ID0A 4F0BA 2CQ9A 1GTUA 1MDIA 3TJGA 2H1LA 2YWNA 1OC3A 5GSTA 3NZNA 4KA0A 4AI6A 4TR1B 3HVXA 3ZFLA 1SYRA 4MCUA 3CTFA 4ZBDA 2VCTA 4IHUA 2PERA 4TKYA 2H8LA 4OFMA 3D22A 4N10A 3TRQA 5G31A 4IELA 3GX8A 2HSYA 2ALBA 4AJ6A 2HRAA 1TU7A 4KSOA 5ECKB 1ERUA 4OCEA 2YJ7A 1BG1A 2E0QA 5IM9A 2M80A 5JCGA 1K0OA 4K7OA 2L6CA 2OBIA 1OVNA 2YWIA 1BQ7A 1M7TA 1PD21 2VKZG 2V6OA 5AIXA 5DAKB 4WR4A 3LW9A 3JCML 3QFAC 1GNEA 4MJCA 4K9ZA 1XVWA 1B48A 4F2IA 3KH7A 1X9SB 4IVFA 3GFKA 4YQUA 4K6XA 5DALB 3FZ4A 4Q5QA 1RK4A 2HSHA 4XS6A 1YKCA 1R7HA 1YZXA 1A8YA 1GTIA 5IMFA 3IE3A 3GX0A 5G5FA 1VF1A 1MD3A 4GRFA 1XWAA 4WETA 3UJ1A 5EY6A 4PXOA 4MZBA 1PKWA 4HSCX 2LUSA 3VURA 1OE8A 3EMPA 2KP1A 2C3QA 2X99A 4F0CA 3NOFA 4WF4A 2VCXA 3U5RE 3WGXA 2RUFA 5ECHB 2OT3A 3IXRA 3DIEA 5DQSA 1AIUA 4XRAA 3QAGA 4GWRA 3KXOA 4PNFA 4I6XA 4Z2RA 5F07A 1K0MA 2O7KA 1Y1UA 1JLWA 4MH2A 3FHKA 1T4ZA 2HZEB 4FO5A 1XW9A 5J3RA 3A2XA 4RI7A 3FR3A 1X5DA 4KUNA 4YQVA 2MMAA 3UMAA 4IS0A 2DJ1A 4POKA 1Q4JA 4BWSA 1UC7A 2WW2A 4G19A 3MNGA 2QGVA 4WKWA 3EVIA 2H6XA 2OE0A 1TRWA 1JZWA 3IDVA 3PGTA 5JCUA 3KP9A 4A5PA 1GSDA 2HLSA 3HZ4A 2DJ3A 1U88A 3A3TA 1X5EA 3HMJG 3ZITA 2OADA 4MZWA 5E59A 2GLRA 2F9SA 5IO0A 3RHBA 1PN9A 1ZGNA 1SKWB 2OE1A 5HQPA 1ZOFA 4CHSA 3LFLA 2IIYA 4HUAA 1ML6A 3HVVA 3IK9A 1PQNA 2I4AA 3HJMA 2BMXA 2DIYA 1BX9A 4PGTA 2YWMA 5IIZA 1J9BA 3UBKA 3MAKA 3FY7A 1KBNA 3H4KA 1V58A 1W4VA 3HD5A 1ZL9A 4MP4A 4EUYA 4KNDA 3VK9A 3GMFA 4K7IA 3WGDA 4BVYB 4MPGA 1U3AA 1YY7A 3GTUA 4L0WA 1SU9A 1LU4A 3L78A 1SL1B 1ZCPA 4TXOA 3ZL5A 4CDOA 5CRWA 1TRVA 3QDNA 5A34B 1SJIA 2KLXA 4NHWA 3R2QA 4BVXB 1M9AA 2PU9C 1BF5A 1XVQA 4XS4B 2I9HA 1IYIA 2DLXA 5CNWA 2C0EA 3SWLA 4MDCA 4KGIA 1OC9A 5ECQB 4USSA 2XBIA 1UVZA 4MJBA 1AQWA 1VGLA 1J0FA 1A2LA 2N5AA 2NVLA 1F9MA 1QK8A 2O8VB 3I69A 4GSTA 2ZNMA 2L6DA 2NDOA 2GZPA 3LEFA 2GSTA 4TR0A 1T1VA 2QKEA 1XWGA 4L5OA 2HFDA 2ZUPA 4EL1A 1DBYA 2LJRA 3NIVA 4K0NA 4IJIA 3HJPA 1M2BA 1A2JA 1ERWA 3V1WA 2E2GA 4AJ8A 2OKAA 1GWCA 2CAIA 3UEMA 3TOTA 4HZ4A 4AKHA 4GLTA 4GSSA 1T3BA 3CRUA 1M0UA 13GSA 4MZCA 2WVYA 3BCIA 3E9JB 3QFBC 4PI2C 2JU5A 4KH7A 2J9HA 3CXGA 3RFRC 1R4WA 4PQHA 1V9WA 1XPVA 1B9XC 1PGTA 3MWHA 3GYKA 2HYXA 5IOWA 1B8XA 19GSA 4PUFC 1GP1A 4YAPA 2GQMA 4O5QA 4HZ2A 3L9VA 4O5RA 1TP9A 1N25A 1WPIA 1O6JA 5A5HA 1M2AA 2V32A 2LRNA 2LKUA 1XBSA 3ZTLA 3J7Yk 3HHVA 4P3YB 1BAYA 1T00A 2H19A 5FT3A 3GSSA 2YOIA 2RM5A 3KMOA 1J08A 1C72A 4TR3A 4K7NA 1Q98A 5H5RA 7GSSA 1EZKA 4HU7A 2HRKB 3UVTA 5A1NB 1PL2A 2WULA 1HD2A 2VL3A 5ID2B 4HOJA 4GQCA 4BPYA 4KDXA 2B7JA 4KW6A 1SL2B 1O85A 1QQ2A 1A8LA 3D5JA 3ZFBA 3RPPA 4X43A 1FVJA 4EKZA 1S3CA 2RLIA 1ZMAA 5J9CA 3TKQA 3KM6A 3LXTA 1QXHA 1S3RA 6GSXA 2H72A 2B3SA 3DEXA 1URMA 3P8WA 1MEKA 4DSRA 3TRXA 3QAWA 2R5GA 1K0DA 5ECNB 1AAZA 5HR1A 1TK5B 3TKSA 5LCZA 17GSA 2HQTA 3VI7A 4OWYA 1G0TA 2DMMA 4EC0A 1GTAA 3EMXA 3CMIA 4AKXB 3TRPA 3Q74A 2YANA 2YZUA 1ACVA 2NTOA 2REMA 2K9FA 3DXBA 2H01A 3CQFA 2VLTA 4MF7A 2GSQA 2WJUA 2MZCA 1TXXA 4Q5NA 1IYHA 2V6KA 2NPBA 4E8EA 5F8BA 4DEJA 10GSA 4MH3A 2VD0A 3KJYA 2HSNA 9GSSA 1XWKA 1G7OA 2AV4A 6GSVA 5HR2A 4WXTA 3F4TA 3TKSE 4D73A 2IPAA 1FOHA 1GSQA 2JZSA 1G6WA 2VCWA 5IMCA 1O8WA 2JZRA 4YAVA 2I1UA 3L9SA 1FHEA 3TOUA 3EU3A 1XOAA 4IQ1A 3I43A 1OKTA 3GUSA 4CY6A 3FMWA 1MDKA 3L4NA 4N30A 2P0GA 5BMUA 1YDKA 2RM6A 2Z9SA 5JWRB 2DSAA 4KB3A 1Z6MA 1GULA 1M99A 3M3MA 4NHZA 3QOUA 4IJ3A 2AHEA 1K0AA 4FXYP 1XG8A 2LNTA 3ME8A 4OO4A 1SJ6A 3S9FA 2WCIA 11GSA 4G01A 1BG5A 2DMLA 5DJMA 2C8UA 1T4YA 5LD0A 3EU4A 2GQKA 3CYNA 2VIMA 4G2EA 3ZRDA 1T8EB 2CT6A 2VUPA 16GSA 3A5IA 4N11A 3O76A 2L57A 1X5CA 2H1AA 2X64A 2H1DA 3BOAA 1EOGA 2VL2A 1SD8A 1F3BA 4LL1B 5CYYA 5D9VA 4HJMA 3EWLA 2DBCA 2A2RA 1EP7A 3QAVA 2VM2A 2HRFA 3QD9A 2LJAA 1YKAA 2FWHA 3IAS2 4JZQA 3QMXA 2IFQA 5J47A 18GSA 5IPGA 3CSJA 3WYWA 3EURA 4MJAA 1ST9A 4RQXA 1MTCA 4L5LA 3O6TA 3M9JA 2FWFA 4Z2UA 1FVKA 1K3LA 4L8EA 3F0IA 4GQFA 5D8IA 2H76A 4DSSA 2KOKA 1YEWC 5INYA 1SK2A 3L9UA 4TW5A 4W66A 4YH2A 4XRDA 2FWGA 2O5VA 1Z7PA 1ZYNA 4FH8A 4ECCA 2JADA 2IMDA 4K5RA 1JHBA 2XPDA 3IBHA 3IRAA 2CV4A 3KH9A 2HSMA 4PNGA 2FGXA 2GZYA 4ML6A 4ML1A 5G5EA 2WB9A 2ON5A 3PH9A 1TU8A 1SVLA 2EFEA 2WS2A 3TKSC 4ICYA 1YF0A 2VAFA 4BL7A 4EDZA 4TRXA 4KDUA 4ZBBA 3DD3A 2V41A 2C0FA 3WT2A 2O87A 4YKFA 3UVHA 1F37A 3FEUA 3GTUB 2GTUA 2VCVA 2JSYA 2HT9A 5ECSA 3F4RA 4EXJA 3ZREA 2YN1A 5HFGA 2H75A 1OYJA 3UIWA 1HNAA 4KSMA 3HJOA 3BJ5A 4KCAA 3LXZA 3UBLA 4E68A 1TTZA 4AGSA 2FD3A 3G7IA 4BIKA 3WD6A 3CHXC 4O32A 4IQAA 3C71A 1AXDA 2LS5A 4MF6A 3OR5A 1PSQA 2A4VA 4RUVA 6GSSA 3FK8A 5B6MA 3F6FA 2O85A 4ZB8A 2I81A 3ED3A 2H1BA 2WW0A 3TKRA 2H1GA 5D73A 4PURA 3C8EA 1H4OA 4HQSA 4YKGA 3A2VA 1HNBA 2WDUA 3ZIVA 4MPFA 3GHAA 3HCZA 3FR9A 12GSA 1XXUA 4POMA 3PR8A 1HNCA 2C80A 1Z6NA 4J56E 2C1YA 3ZYWA 2CZ3A 1VF2A 4YQMA 3E3EA 2WVZA 5J41A 2WRTA 1R5PA 4V1Ag 1TK8B 1GL8A 4K1FA 2L5LA 1XCCA 5ENUA 3IR4A 1PA3A 5IOXA 4ECIA 2DJ0A 4FYBA 4BWQA 5JWOB 2LQOA 1WRYA 1SKSB 1VF3A 1ZYEA 3F3QA 4G0KA 2RUEA 2C4JA 2H0HA 5A4UA 1XWCA 5C00A 3GRXA 4GDFA 3GH9A 4GTUA 5CRGA 3RAZA 2R0CA 1B4QA 4POLA 1X9MB 2E2MA 5D9TA 2FUG2 3A2WA 2WVXA 2CVBA 4X0XA 2GSSA 1N8JA 5FWGA 4G9HA 3M9KA 3LJRA 3W8JA 1TXUA 4EE0A 5FHIA 5DJLA 2L4CA 5ABRA 4OFTA 5ECMB 1X0RA 4MABA 1QGVA 2HXKA 3F3RA 3KD0A 2WGRA 4IW9A 2VOCA 1R5AA 4K8MA 5G1KA 3IC4A 3IHQA 4ZXGA 2R2JA 1YEPA 5F05A 2QSIA 5ECIB 2AYTA 3MIXA 3CSHA 1NM3A 5LNKe 3GA4A 1TOFA 22GSA 3KZQA 1Z7RA 4NV2A 4DVCA 2KP2A 1WMJA 1GSSA 2CA8A 3RBTA 3UARA 5D9WA 1F3AA 2K6VA 4CY8A 4F03A 1KTEA 1SYXA 2IJYA 3HKRA 4XHMA 3RHCA 4TR4A 5IQYA 2X8CA 2F51A 1S4BP 5DCHA 4IGJA 1K0BA 2FCHA 2XC2A 3GV1A 4J2FA 2VO4A 1SENA 3E0UA 3ZVJA 2B5EA 4Z7XA 1K0CA 1AUCA 2CVDA 2WW3A 2PVOC 1HQOA 3FZ5A 2VLUA 3R3EA 2YV9A 2D2ZA 3HZ8A 3WGEA 3GKMA 4D73B 2B1LA 3KTBA 5B8BA 2PVQA 4BVYA 1PX6A 1USBA 2MBTA 2JL4A 5IMDA 2V1MA 5HR0A 4OMVA 1SJZA 1VF4A 4ACSA 3LG6A 4BVXA 2AAWA 4AKGA 3DGQA 5CRDA 4EO3A 4L0UA 1DSBA 2GZZA 4LA1A 5DDLA 1GUHA 2OA7A 5H5QA 3VWVA 4AF2A 3WT1A 3P7XA 1R26A 2J23A 3J7Yb 4JR4A 4XCSA 4EF0A 4Q5RA 1GSYA 3KMNA 3GKXA 1RW1A 5EVOA 3FW2A 2LV3A 1G6YA 1CQHA 1XZOA 1V40A 4IP1A 3EINA 3EYTA 2H30A 2OACA 1SK1A 2BJXA 1ILOA 4X4JA 3SBCA 1PFOA 4Z2TA 3LGCA 3TJBA 1WIKA 1JZDA 2I3YA 3C1RA 3VWWA 1GSUA 1SL0B 3F63A 1O8XA 5KN2A 1GRXA 2VL9A 3DMLA 2H6YA 4LLRA 5J40A 2QA1A 2MMOA 2LTKA 3N9JA 4WBRD 2CAQA 1A2MA 1YF1A 2LQQA 4QQ7A 2MMNA 2X8GA 4NV5A 3IHGA 2DJJA 3ERGA 1GTBA 2AUVA 1YJ6A 2PMTA 1FW1A 1N2AA 2LRCA 4KX4A 3US3A 2EIOA 4QL7A 2OE3A 3IC8A 1KNGA 4F9ZA 1WP0A 3ISOA 4MF5A 3GKNA 2R6KA 1EP8A 1K0NA 4X1UA 1ABAA 1JZOA 4PX1A 5B7CA 2PBJA 3Q18A 2HRKA 1VRSD 5A1NA 5IMZA 3ME7A 4OCFA 2H0IA 3HA9A 5ID2A 2HSMB 3QR6A 4JEDA 2XPEA 4ILFA 5CREA 2EC4A 4OO5A 5A4VA 4TOPA 2CX3A 2LNSA 4BL7B 1SVOA 4NPBA 2IWTA 2PPTA 3N5OA 4PHZC 1K3YA 2O3EA 1BYEA 3ZLPA 3CTGA 3VPQA 1U87A 4GF0A 4XIHA 3BD2A 2MYGA 3D4MA 1I5GA 2GS3A 2JSZA 1LBKA 2M72A 3I9V2 2DIZA 6GSTA 2DC5A 2WW1A 2H0GA 4BA7A 5AN1A 1I1IP 3Q19A 4MJEA 1YQ1A 4KE3A 3ERFA 3O3TA 5IMVA 2EIQA 4QL9A 2C0GA 2FHEA 2CVKA 5ECOB 4ZILA 2H70A 4K2XA 1TW9A 1NHOA 3CSIA 4KAEA 3L0HA 2CZ2A 2HRNA 2L5OA 3QPMA 3KGKA 1TRUA 2V2GA 3APQA 3W8SA 2R4VA 5ECPB 5AIVA 2B5XA 4NWYA 3LWAA 3TKPA 1XW5A 3D4TA 3LSZA 1WJKA 3Q6OA 1Z9HA 2UZ8A 3CWGA 4ULXA 2EFHA 5D9XA 5J4YA 1A0FA 2H6ZA 5G2ZA 1NHYA 2AB6A 2R0PA 1O7UA 1AQVA 5HFIA 2E7PA 1H75A 4ISDA 2QA2A 5DCGA 3LORA 4V2MA 5EPFA 3FRCA 4N0ZA 4TVEA 2YP6A 2O36A 1B4PA 5DBQA 3C73A 2JACA 1TI1A 2YWOA 3FKFA 3HYPA 3M0FA 5GSSA 3RDWA 3TJFA 5IMAA 5H5SA 4AJ7A 3GH6A 5KEJA 3D6IA 1QFNA 5ECLB 2YZHA 5AGYA 3GN3A 1ZZYA 4RI6A 4LL4B 2YCDA 2YNXA 5KOWA 3DVXA 3HXSA 2XHFA 2M46A 5B8AA 2P31A 1FB0A 5BRTA 4JRRA 5KN3A 1DUGA 4WEYA 2WFCA 4QMKA 1GH2A 4HDEA 4I2TA 1EEJA 1OAZA 4WR5A 1A23A 3KTLA 2KUCA 2H73A 5KN0A 1DE1A 1JZRA 5JCWA 3D0ZA 3GL3A 1KEBA 4TXOB 5KN1A 3H93A 1GNWA 4I2UA 2DJ2A 3MSZA 1JLVA 3LYKA 2GVPA 3H79A 2FNOA 4ZB7A 3CRTA 2ES7A 1PMTA 2P5QA 1OKDA 3HVNA 2N5BA 4ZBAA 2DJKA 2WVXB 1OC9B 4TR1A 5JWQB 1Z5YE 2OBKA 1TK0B 2VCQA 3IK7A 2FY6A 2X8HA 2MBSA 1BJXA 3GL5A 3EC3A 3ZIJA 1U3IA 4OD7A 2QC7A 2LRTA 4FYUA 2EIRA 1EGRA 3TDGA 5J4VA 2IMFA 2XBQA 5IO2A 5A4WA 3UOMA 8GSSA 4MMMA 1SD9A 2F8AA 2H74A 1A24A 4ZB9A 1F2EA 1GUKA 5G1LA 1V57A 2OJLA 1V98A 4LMVA 1YVLA 3ZMKA 3FZAA 4ZB6A 1PRXA 4ZL9A 2WZSA 1GLPA 5DAKA 1LJRA 5G30A 4K0GA 2ON7A 5ECRB 2FWEA 2LJKA 3GKKA 1XFLA 1AW9A 2B6MA 1WOUA 5F0GA 2IMIA 1RQMA 3FZ9A 4XS1A 4ECJA 4MA9A 4PQIA 5DALA 4IP6A 5ELGA 1NW2A 2AJQB 2FA8A 3I6AA 4HJ2A 4K5SA 3MDKA 4MK3A 1SKRB 5DQYA 1EV4A 2R3XA 4FIWA 2VL2C 1MD4A 1EGOA 3IOSA 4HU9A 2C3NA 2B1KA 5A5HB 2H71A 1TKDB 4G10A 2NBSA 4JU5A 1I9DA 4PQ1A 3DRNA 3GIXA 1M3IA 4G0LA 5D96A 1EV9A 3APSA 1O73A 1T7PB 1JFUA 3EE2A 1B9YC 5DVBA 3IPZA 4N3ZA 1UA5A 2WZ9A 3ZZXA 4PTSA 2G2QA 5CP1A 5EL8A 4KCEA 6GSYA 2EFCA 3KCMA 1V2AA 3VWUA 3LQ7A 3VPTA 4GCIA 3UAPA 2C3TA 2LSTA 2L4QA 3ERWA 3AY8A 1QMVA 3H8QA 2HZEA 2KHPA 4IBPA 4O5UA 2RIIA 4I97A 2B5YA 1Z3EA 3KIJA 1QUWA 1WE0A 5C04A 3VFIA 3C1SA 2F8FA 4J57E 4N0VA 3EPTA 2X4AA 1THOA 3TCOA 4E8HA 2YJHA 4NAXA 3M1GA 1ERTA 3TJKA 3P2AA 1U6TA 4WF5A 1OE7A 3F6DA 3D21A 3IAM2 1PX7A 2IN3A 2YPMA 3MYDA 1WWJA 5J4UA 4HS1A 4RQRA 1GUMA 3LYPA 5CAXA 2F3MA 2UV8G 3DKSA 4KF9A 5GZZB 4NMUA 2YV7A 1ERVA 1PKZA 1XW6A 1E2YA 2LEGA 1EWXA 2HZFA 1M2DA 5KOXA 3G7YA 4IN0A 4LMWA 4JBBA 1TI3A 4EIQA 2HSNB 2N5FA 3F9UA 3M8NA 2IMEA 5AISA 3GNJA 2VD1A 5COHA 1SK0A 3FYGA 3HDCA 2DKHA 2TRCP 4PUAA 1HYUA 3CBUA 2ZCTA 2L59A 4ECBA 2A4HA 2VCZA 5A34A 4V1Ap 1FO5A 3QCPA 1XIYA 1EEMA 4XS4A 2PWJA 3C7MA 5BMUB 2PN8A 5E4WA 3BCKA 1FG4A 5J9BA 1S3DA 2TRXA 3VI5A 2K18A 4H86A 4IKHA 4ZL8A 1AQXA 2O89A 4F82A 2R37A 4TN8A 5B6NA 3DWVA 5IPHA 1W89A 1THXA 3TU3B 14GSA 1FAAA 3DVWA 4G0IA 4CW9A 2HE3A 3TUEA 1XWBA 5J5NA 1AC1A 3H1NA 4MLYA 3TJJA 3U6VA 4MNNA 2HI7A 2VM1A 4Q5FA 2PUKC 2A2PA 4NXIA 2C0DA 4ZIJA 3FR6A 1DE2A 1FB6A 4TXVA 2IMKA 1ZYQB
chains in the Genus database with same CATH topology
3BBYA 4O92A 5GAPD 3VLNA 3A5WA 3W6GA 5D93A 2GDRA 1ON4A 4WBJA 3ZMLA 4DSQA 3PINA 3K8NA 1FOVA 4EVMA 1TRSA 2G0FA 4V2NA 1G7EA 1X9WB 4EDYA 3G9BA 4I5QA 6GSWA 1GLQA 3GSTA 3HVSA 6GSUA 5A5KA 2R0GA 20GSA 4FQUA 3ZVJD 2IFQB 3UL3A 4HQZA 2GSRA 3P90A 4O7HA 2DKIA 2TIRA 4K2DA 3IV4A 4FYCA 1Y25A 5HR3A 1SVMA 5HFKA 5GAND 1TJDA 1M9BA 3KP8A 1PL1A 4DSSB 4V2LA 2VLVA 5CO3A 2K8VA 4AKIA 4EIPA 3G7JA 1K3OA 3HY2A 1GSEA 4OFNA 4JE1A 2GT6A 2HNLA 2X49A 2PGTA 3IA1A 3KEBA 2K8SA 3DYRA 1EOHA 1TDIA 4JR6A 1BEDA 2GGTA 1YEXA 4XTSA 3TB2A 2FA4A 2IL3A 1S3AA 2H66A 2GT5A 1ZYPA 1OC8A 1A0RP 2B7KA 2GQLA 4HI7A 4HEA2 3TGZA 3RPNA 2P5RA 4I8BA 1UN2A 2FLSA 1O81A 4KDYA 2EFDA 1NSWA 1GSFA 2MMZA 3PPUA 1Y6EA 1E6BA 5ELAA 3VWXA 4POBA 3GURA 1XOBA 2BTOT 5L71A 2JZTA 5F06A 4GXZA 2A2SA 2CX4A 3F8UA 4ZL7A 1MDJA 4GSNA 3F4SA 1PN0A 1F6MC 3APOA 5CRHA 1CQGA 4ID0A 4F0BA 2CQ9A 1GTUA 1MDIA 3TJGA 2H1LA 2YWNA 1OC3A 5GSTA 3NZNA 4KA0A 4AI6A 4TR1B 3HVXA 3ZFLA 1SYRA 4MCUA 3CTFA 4ZBDA 2VCTA 4IHUA 2PERA 4TKYA 2H8LA 4OFMA 3D22A 4N10A 3TRQA 5G31A 4IELA 3GX8A 2HSYA 2ALBA 4AJ6A 2HRAA 1TU7A 4KSOA 5ECKB 1ERUA 4OCEA 2YJ7A 1BG1A 2E0QA 5IM9A 2M80A 5JCGA 1K0OA 4K7OA 2L6CA 2OBIA 1OVNA 2YWIA 1BQ7A 1M7TA 1PD21 2VKZG 2V6OA 5AIXA 5DAKB 4WR4A 3LW9A 3JCML 3QFAC 1GNEA 4MJCA 4K9ZA 1XVWA 1B48A 4F2IA 3KH7A 1X9SB 4IVFA 3GFKA 4YQUA 4K6XA 5DALB 3FZ4A 4Q5QA 1RK4A 2HSHA 4XS6A 1YKCA 1R7HA 1YZXA 1A8YA 1GTIA 5IMFA 3IE3A 3GX0A 5G5FA 1VF1A 1MD3A 4GRFA 1XWAA 4WETA 3UJ1A 5EY6A 4PXOA 4MZBA 1PKWA 2LUSA 3VURA 1OE8A 3EMPA 2KP1A 2C3QA 2X99A 4F0CA 3NOFA 4WF4A 2VCXA 3U5RE 3WGXA 2RUFA 5ECHB 2OT3A 3IXRA 3DIEA 5DQSA 1AIUA 4XRAA 3QAGA 4GWRA 3KXOA 4PNFA 4I6XA 4Z2RA 5F07A 1K0MA 2O7KA 1Y1UA 1JLWA 4MH2A 3FHKA 1T4ZA 2HZEB 4FO5A 1XW9A 5J3RA 3A2XA 4RI7A 3FR3A 1X5DA 4KUNA 4YQVA 2MMAA 3UMAA 4IS0A 2DJ1A 4POKA 1Q4JA 4BWSA 1UC7A 4G19A 3MNGA 2QGVA 4WKWA 3EVIA 2H6XA 2OE0A 1TRWA 1JZWA 3IDVA 3PGTA 5JCUA 3KP9A 4A5PA 1GSDA 2HLSA 3HZ4A 2DJ3A 1U88A 3A3TA 1X5EA 3HMJG 3ZITA 2OADA 4MZWA 5E59A 2GLRA 2F9SA 5IO0A 3RHBA 1PN9A 1ZGNA 1SKWB 2OE1A 5HQPA 1ZOFA 4CHSA 3LFLA 2IIYA 4HUAA 1ML6A 3HVVA 3IK9A 1PQNA 2I4AA 3HJMA 2BMXA 2DIYA 1BX9A 4PGTA 2YWMA 5IIZA 1J9BA 3UBKA 3MAKA 3FY7A 1KBNA 3H4KA 1V58A 1W4VA 3HD5A 1ZL9A 4MP4A 4EUYA 4KNDA 3VK9A 3GMFA 4K7IA 3WGDA 4BVYB 4MPGA 1U3AA 1YY7A 3GTUA 4L0WA 1SU9A 1LU4A 3L78A 1SL1B 1ZCPA 4TXOA 3ZL5A 4CDOA 5CRWA 1TRVA 3QDNA 5A34B 1SJIA 2KLXA 4NHWA 3R2QA 4BVXB 1M9AA 2PU9C 1BF5A 1XVQA 4XS4B 2I9HA 1IYIA 2DLXA 5CNWA 2C0EA 3SWLA 4MDCA 4KGIA 1OC9A 5ECQB 4USSA 2XBIA 1UVZA 4MJBA 1AQWA 1VGLA 1J0FA 1A2LA 2N5AA 2NVLA 1F9MA 1QK8A 2O8VB 3I69A 4GSTA 2ZNMA 2L6DA 2NDOA 2GZPA 3LEFA 2GSTA 4TR0A 1T1VA 2QKEA 1XWGA 4L5OA 2HFDA 2ZUPA 4EL1A 1DBYA 2LJRA 3NIVA 4K0NA 4IJIA 3HJPA 1M2BA 1A2JA 1ERWA 3V1WA 2E2GA 4AJ8A 2OKAA 1GWCA 2CAIA 3UEMA 3TOTA 4HZ4A 4AKHA 4GLTA 4GSSA 1T3BA 3CRUA 1M0UA 13GSA 4MZCA 3BCIA 3E9JB 3QFBC 2JU5A 4KH7A 2J9HA 3CXGA 1R4WA 4PQHA 1V9WA 1XPVA 1B9XC 1PGTA 3MWHA 3GYKA 2HYXA 5IOWA 1B8XA 19GSA 4PUFC 1GP1A 4YAPA 2GQMA 4O5QA 4HZ2A 3L9VA 4O5RA 1TP9A 1N25A 1WPIA 1O6JA 5A5HA 1M2AA 2V32A 2LRNA 2LKUA 1XBSA 3ZTLA 3J7Yk 3HHVA 4P3YB 1BAYA 1T00A 2H19A 5FT3A 3GSSA 2YOIA 2RM5A 3KMOA 1J08A 1C72A 4TR3A 4K7NA 1Q98A 5H5RA 7GSSA 1EZKA 4HU7A 2HRKB 3UVTA 5A1NB 1PL2A 2WULA 1HD2A 2VL3A 5ID2B 4HOJA 4GQCA 4BPYA 4KDXA 2B7JA 4KW6A 1SL2B 1O85A 1QQ2A 1A8LA 3D5JA 3ZFBA 3RPPA 4X43A 1FVJA 4EKZA 1S3CA 2RLIA 1ZMAA 5J9CA 3TKQA 3KM6A 3LXTA 1QXHA 6GSXA 2H72A 2B3SA 3DEXA 1URMA 3P8WA 1MEKA 4DSRA 3TRXA 3QAWA 2R5GA 1K0DA 5ECNB 1AAZA 5HR1A 1TK5B 3TKSA 5LCZA 17GSA 2HQTA 3VI7A 4OWYA 1G0TA 2DMMA 4EC0A 1GTAA 3EMXA 3CMIA 4AKXB 3TRPA 3Q74A 2YANA 2YZUA 1ACVA 2NTOA 2REMA 2K9FA 3DXBA 2H01A 2VLTA 4MF7A 2GSQA 2WJUA 2MZCA 1TXXA 4Q5NA 1IYHA 2V6KA 2NPBA 4E8EA 5F8BA 4DEJA 10GSA 4MH3A 2VD0A 3KJYA 2HSNA 9GSSA 1XWKA 1G7OA 2AV4A 6GSVA 5HR2A 4WXTA 3F4TA 3TKSE 4D73A 2IPAA 1FOHA 1GSQA 2JZSA 1G6WA 2VCWA 5IMCA 1O8WA 2JZRA 4YAVA 2I1UA 3L9SA 1FHEA 3TOUA 3EU3A 1XOAA 4IQ1A 3I43A 1OKTA 3GUSA 4CY6A 3FMWA 1MDKA 3L4NA 4N30A 2P0GA 5BMUA 1YDKA 2RM6A 2Z9SA 5JWRB 2DSAA 4KB3A 1Z6MA 1GULA 1M99A 3M3MA 4NHZA 3QOUA 4IJ3A 2AHEA 1K0AA 2LNTA 3ME8A 4OO4A 1SJ6A 3S9FA 2WCIA 11GSA 4G01A 1BG5A 2DMLA 5DJMA 2C8UA 1T4YA 5LD0A 3EU4A 2GQKA 3CYNA 2VIMA 4G2EA 3ZRDA 1T8EB 2CT6A 2VUPA 16GSA 3A5IA 4N11A 3O76A 2L57A 1X5CA 2H1AA 2X64A 2H1DA 3BOAA 1EOGA 2VL2A 1SD8A 1F3BA 4LL1B 5CYYA 5D9VA 4HJMA 3EWLA 2DBCA 2A2RA 1EP7A 3QAVA 2VM2A 2HRFA 3QD9A 2LJAA 1YKAA 2FWHA 3IAS2 4JZQA 3QMXA 2IFQA 5J47A 18GSA 5IPGA 3CSJA 3WYWA 3EURA 4MJAA 1ST9A 4RQXA 1MTCA 4L5LA 3O6TA 3M9JA 2FWFA 4Z2UA 1FVKA 1K3LA 4L8EA 3F0IA 4GQFA 5D8IA 2H76A 4DSSA 2KOKA 5INYA 1SK2A 3L9UA 4TW5A 4W66A 4YH2A 4XRDA 2FWGA 2O5VA 1Z7PA 1ZYNA 4FH8A 4ECCA 2JADA 2IMDA 4K5RA 1JHBA 2XPDA 3IBHA 3IRAA 2CV4A 3KH9A 2HSMA 4PNGA 2FGXA 2GZYA 4ML6A 4ML1A 5G5EA 2WB9A 2ON5A 3PH9A 1TU8A 1SVLA 2EFEA 2WS2A 3TKSC 4ICYA 1YF0A 2VAFA 4BL7A 4EDZA 4TRXA 4KDUA 4ZBBA 3DD3A 2V41A 2C0FA 3WT2A 2O87A 4YKFA 3UVHA 1F37A 3FEUA 3GTUB 2GTUA 2VCVA 2JSYA 2HT9A 5ECSA 3F4RA 4EXJA 3ZREA 2YN1A 5HFGA 2H75A 1OYJA 3UIWA 1HNAA 4KSMA 3HJOA 3BJ5A 4KCAA 3LXZA 3UBLA 4E68A 1TTZA 4AGSA 2FD3A 3G7IA 3WD6A 4O32A 4IQAA 3C71A 1AXDA 2LS5A 4MF6A 3OR5A 1PSQA 2A4VA 4RUVA 6GSSA 3FK8A 5B6MA 3F6FA 2O85A 4ZB8A 2I81A 3ED3A 2H1BA 3TKRA 2H1GA 5D73A 4PURA 3C8EA 1H4OA 4HQSA 4YKGA 3A2VA 1HNBA 2WDUA 3ZIVA 4MPFA 3GHAA 3HCZA 3FR9A 12GSA 1XXUA 4POMA 3PR8A 1HNCA 2C80A 1Z6NA 4J56E 2C1YA 3ZYWA 2CZ3A 1VF2A 4YQMA 3E3EA 5J41A 2WRTA 1R5PA 4V1Ag 1TK8B 1GL8A 4K1FA 2L5LA 1XCCA 5ENUA 3IR4A 1PA3A 5IOXA 4ECIA 2DJ0A 4FYBA 4BWQA 5JWOB 2LQOA 1WRYA 1SKSB 1VF3A 1ZYEA 3F3QA 4G0KA 2RUEA 2C4JA 2H0HA 5A4UA 1XWCA 5C00A 3GRXA 4GDFA 3GH9A 4GTUA 5CRGA 3RAZA 2R0CA 1B4QA 4POLA 1X9MB 2E2MA 5D9TA 2FUG2 3A2WA 2CVBA 4X0XA 2GSSA 1N8JA 5FWGA 4G9HA 3M9KA 3LJRA 3W8JA 1TXUA 4EE0A 5FHIA 5DJLA 2L4CA 5ABRA 4OFTA 5ECMB 1X0RA 4MABA 1QGVA 2HXKA 3F3RA 3KD0A 2WGRA 4IW9A 2VOCA 1R5AA 4K8MA 5G1KA 3IC4A 3IHQA 4ZXGA 2R2JA 1YEPA 5F05A 2QSIA 5ECIB 2AYTA 3MIXA 3CSHA 1NM3A 5LNKe 3GA4A 1TOFA 22GSA 3KZQA 1Z7RA 4NV2A 4DVCA 2KP2A 1WMJA 1GSSA 2CA8A 3RBTA 3UARA 5D9WA 1F3AA 2K6VA 4CY8A 4F03A 1KTEA 1SYXA 2IJYA 3HKRA 4XHMA 3RHCA 4TR4A 5IQYA 2X8CA 2F51A 5DCHA 4IGJA 1K0BA 2FCHA 2XC2A 3GV1A 4J2FA 2VO4A 1SENA 3E0UA 3ZVJA 2B5EA 4Z7XA 1K0CA 1AUCA 2CVDA 2PVOC 1HQOA 3FZ5A 2VLUA 3R3EA 2YV9A 2D2ZA 3HZ8A 3WGEA 3GKMA 4D73B 2B1LA 3KTBA 5B8BA 2PVQA 4BVYA 1PX6A 1USBA 2MBTA 2JL4A 5IMDA 2V1MA 5HR0A 4OMVA 1SJZA 1VF4A 4ACSA 3LG6A 4BVXA 2AAWA 4AKGA 3DGQA 5CRDA 4EO3A 4L0UA 1DSBA 2GZZA 4LA1A 5DDLA 1GUHA 2OA7A 5H5QA 3VWVA 4AF2A 3WT1A 3P7XA 1R26A 2J23A 3J7Yb 4JR4A 4XCSA 4EF0A 4Q5RA 1GSYA 3KMNA 3GKXA 1RW1A 5EVOA 3FW2A 2LV3A 1G6YA 1CQHA 1XZOA 1V40A 4IP1A 3EINA 3EYTA 2H30A 2OACA 1SK1A 2BJXA 1ILOA 4X4JA 3SBCA 4Z2TA 3LGCA 3TJBA 1WIKA 1JZDA 2I3YA 3C1RA 3VWWA 1GSUA 1SL0B 3F63A 1O8XA 5KN2A 1GRXA 2VL9A 3DMLA 2H6YA 4LLRA 5J40A 2QA1A 2MMOA 2LTKA 3N9JA 4WBRD 2CAQA 1A2MA 1YF1A 2LQQA 4QQ7A 2MMNA 2X8GA 4NV5A 3IHGA 2DJJA 3ERGA 1GTBA 2AUVA 1YJ6A 2PMTA 1FW1A 1N2AA 2LRCA 4KX4A 3US3A 2EIOA 4QL7A 2OE3A 3IC8A 1KNGA 4F9ZA 1WP0A 3ISOA 4MF5A 3GKNA 2R6KA 1EP8A 1K0NA 4X1UA 1ABAA 1JZOA 4PX1A 5B7CA 2PBJA 3Q18A 2HRKA 1VRSD 5A1NA 5IMZA 3ME7A 4OCFA 2H0IA 3HA9A 5ID2A 2HSMB 3QR6A 4JEDA 2XPEA 4ILFA 5CREA 2EC4A 4OO5A 5A4VA 4TOPA 2CX3A 2LNSA 4BL7B 1SVOA 4NPBA 2IWTA 2PPTA 3N5OA 1K3YA 1BYEA 3ZLPA 3CTGA 3VPQA 1U87A 4GF0A 4XIHA 3BD2A 2MYGA 3D4MA 1I5GA 2GS3A 2JSZA 1LBKA 2M72A 3I9V2 2DIZA 6GSTA 2DC5A 2H0GA 4BA7A 5AN1A 3Q19A 4MJEA 1YQ1A 4KE3A 3ERFA 3O3TA 5IMVA 2EIQA 4QL9A 2C0GA 2FHEA 2CVKA 5ECOB 4ZILA 2H70A 4K2XA 1TW9A 1NHOA 3CSIA 4KAEA 3L0HA 2CZ2A 2HRNA 2L5OA 3QPMA 3KGKA 1TRUA 2V2GA 3APQA 3W8SA 2R4VA 5ECPB 5AIVA 2B5XA 4NWYA 3LWAA 3TKPA 1XW5A 3D4TA 3LSZA 1WJKA 3Q6OA 1Z9HA 2UZ8A 3CWGA 4ULXA 2EFHA 5D9XA 5J4YA 1A0FA 2H6ZA 5G2ZA 1NHYA 2AB6A 2R0PA 1O7UA 1AQVA 5HFIA 2E7PA 1H75A 4ISDA 2QA2A 5DCGA 3LORA 4V2MA 5EPFA 3FRCA 4N0ZA 4TVEA 2YP6A 1B4PA 5DBQA 3C73A 2JACA 1TI1A 2YWOA 3FKFA 3HYPA 3M0FA 5GSSA 3RDWA 3TJFA 5IMAA 5H5SA 4AJ7A 3GH6A 5KEJA 3D6IA 1QFNA 5ECLB 2YZHA 5AGYA 3GN3A 1ZZYA 4RI6A 4LL4B 2YCDA 2YNXA 5KOWA 3DVXA 3HXSA 2XHFA 2M46A 5B8AA 2P31A 1FB0A 5BRTA 4JRRA 5KN3A 1DUGA 4WEYA 2WFCA 4QMKA 1GH2A 4HDEA 4I2TA 1EEJA 1OAZA 4WR5A 1A23A 3KTLA 2KUCA 2H73A 5KN0A 1DE1A 1JZRA 5JCWA 3D0ZA 3GL3A 1KEBA 4TXOB 5KN1A 3H93A 1GNWA 4I2UA 2DJ2A 3MSZA 1JLVA 3LYKA 2GVPA 3H79A 2FNOA 4ZB7A 3CRTA 2ES7A 1PMTA 2P5QA 1OKDA 2N5BA 4ZBAA 2DJKA 1OC9B 4TR1A 5JWQB 1Z5YE 2OBKA 1TK0B 2VCQA 3IK7A 2FY6A 2X8HA 2MBSA 1BJXA 3GL5A 3EC3A 3ZIJA 1U3IA 4OD7A 2QC7A 2LRTA 4FYUA 2EIRA 1EGRA 3TDGA 5J4VA 2IMFA 2XBQA 5IO2A 5A4WA 3UOMA 8GSSA 4MMMA 1SD9A 2F8AA 2H74A 1A24A 4ZB9A 1F2EA 1GUKA 5G1LA 1V57A 2OJLA 1V98A 4LMVA 1YVLA 3ZMKA 3FZAA 4ZB6A 1PRXA 4ZL9A 1GLPA 5DAKA 1LJRA 5G30A 4K0GA 2ON7A 5ECRB 2FWEA 2LJKA 3GKKA 1XFLA 1AW9A 2B6MA 1WOUA 5F0GA 2IMIA 1RQMA 3FZ9A 4XS1A 4ECJA 4MA9A 4PQIA 5DALA 4IP6A 5ELGA 1NW2A 2AJQB 2FA8A 3I6AA 4HJ2A 4K5SA 3MDKA 4MK3A 1SKRB 5DQYA 1EV4A 2R3XA 4FIWA 2VL2C 1MD4A 1EGOA 3IOSA 4HU9A 2C3NA 2B1KA 5A5HB 2H71A 1TKDB 4G10A 2NBSA 4JU5A 1I9DA 4PQ1A 3DRNA 3GIXA 4G0LA 5D96A 1EV9A 3APSA 1O73A 1T7PB 1JFUA 3EE2A 1B9YC 5DVBA 3IPZA 4N3ZA 1UA5A 2WZ9A 3ZZXA 4PTSA 2G2QA 5CP1A 5EL8A 4KCEA 6GSYA 2EFCA 3KCMA 1V2AA 3VWUA 3LQ7A 3VPTA 4GCIA 3UAPA 2C3TA 2LSTA 2L4QA 3ERWA 3AY8A 1QMVA 3H8QA 2HZEA 2KHPA 4IBPA 4O5UA 2RIIA 4I97A 2B5YA 1Z3EA 3KIJA 1QUWA 1WE0A 5C04A 3VFIA 3C1SA 2F8FA 4J57E 4N0VA 3EPTA 2X4AA 1THOA 3TCOA 4E8HA 2YJHA 4NAXA 3M1GA 1ERTA 3TJKA 3P2AA 1U6TA 4WF5A 1OE7A 3F6DA 3D21A 3IAM2 1PX7A 2IN3A 2YPMA 3MYDA 1WWJA 5J4UA 4HS1A 4RQRA 1GUMA 3LYPA 5CAXA 2F3MA 2UV8G 3DKSA 4KF9A 5GZZB 4NMUA 2YV7A 1ERVA 1PKZA 1XW6A 1E2YA 2LEGA 1EWXA 2HZFA 1M2DA 5KOXA 3G7YA 4IN0A 4LMWA 4JBBA 1TI3A 4EIQA 2HSNB 2N5FA 3F9UA 3M8NA 2IMEA 5AISA 3GNJA 2VD1A 5COHA 1SK0A 3FYGA 3HDCA 2DKHA 2TRCP 4PUAA 1HYUA 3CBUA 2ZCTA 2L59A 4ECBA 2A4HA 2VCZA 5A34A 4V1Ap 1FO5A 3QCPA 1XIYA 1EEMA 4XS4A 2PWJA 3C7MA 5BMUB 2PN8A 5E4WA 3BCKA 1FG4A 5J9BA 1S3DA 2TRXA 3VI5A 2K18A 4H86A 4IKHA 4ZL8A 1AQXA 2O89A 4F82A 2R37A 4TN8A 5B6NA 3DWVA 5IPHA 1W89A 1THXA 3TU3B 14GSA 1FAAA 3DVWA 4G0IA 4CW9A 2HE3A 3TUEA 1XWBA 5J5NA 1AC1A 3H1NA 4MLYA 3TJJA 3U6VA 4MNNA 2HI7A 2VM1A 4Q5FA 2PUKC 2A2PA 4NXIA 2C0DA 4ZIJA 3FR6A 1DE2A 1FB6A 4TXVA 2IMKA 1ZYQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BBY A;  4O92 A;  5GAP D;  3VLN A;  3A5W A;  3W6G A;  5D93 A;  2GDR A;  1ON4 A;  4WBJ A;  3ZML A;  4DSQ A;  3PIN A;  3K8N A;  1FOV A;  4EVM A;  1TRS A;  2G0F A;  4V2N A;  1G7E A;  1X9W B;  4EDY A;  3G9B A;  4I5Q A;  6GSW A;  1GLQ A;  3GST A;  3HVS A;  6GSU A;  5A5K A;  20GS A;  4FQU A;  3ZVJ D;  2IFQ B;  3UL3 A;  4HQZ A;  2GSR A;  3P90 A;  4O7H A;  2TIR A;  4K2D A;  3IV4 A;  4FYC A;  1Y25 A;  5HR3 A;  5HFK A;  5GAN D;  1TJD A;  1M9B A;  3KP8 A;  1PL1 A;  4DSS B;  4V2L A;  2VLV A;  5CO3 A;  2K8V A;  3G7J A;  1K3O A;  3HY2 A;  1GSE A;  4OFN A;  4JE1 A;  2GT6 A;  2HNL A;  2PGT A;  3IA1 A;  3KEB A;  2K8S A;  3DYR A;  1EOH A;  1TDI A;  4JR6 A;  1BED A;  2GGT A;  1YEX A;  4XTS A;  3TB2 A;  2FA4 A;  2IL3 A;  1S3A A;  2H66 A;  2GT5 A;  1OC8 A;  1A0R P;  2B7K A;  2GQL A;  4HI7 A;  4HEA 2;  3TGZ A;  3RPN A;  2P5R A;  4I8B A;  1UN2 A;  2FLS A;  1O81 A;  4KDY A;  1NSW A;  1GSF A;  2MMZ A;  3PPU A;  1Y6E A;  1E6B A;  5ELA A;  3VWX A;  4POB A;  3GUR A;  1XOB A;  2BTO T;  5L71 A;  2JZT A;  5F06 A;  4GXZ A;  2A2S A;  2CX4 A;  3F8U A;  4ZL7 A;  1MDJ A;  4GSN A;  3F4S A;  1F6M C;  3APO A;  5CRH A;  1CQG A;  4ID0 A;  4F0B A;  2CQ9 A;  1GTU A;  1MDI A;  3TJG A;  2YWN A;  1OC3 A;  5GST A;  3NZN A;  4KA0 A;  4TR1 B;  3HVX A;  3ZFL A;  1SYR A;  4MCU A;  3CTF A;  4ZBD A;  2VCT A;  4IHU A;  2PER A;  4TKY A;  2H8L A;  4OFM A;  3D22 A;  4N10 A;  3TRQ A;  5G31 A;  4IEL A;  3GX8 A;  2HSY A;  2ALB A;  4AJ6 A;  2HRA A;  1TU7 A;  4KSO A;  5ECK B;  1ERU A;  4OCE A;  2YJ7 A;  2E0Q A;  5IM9 A;  2M80 A;  5JCG A;  1K0O A;  4K7O A;  2L6C A;  2OBI A;  1OVN A;  2YWI A;  1BQ7 A;  1M7T A;  1PD2 1;  2V6O A;  5AIX A;  5DAK B;  4WR4 A;  3JCM L;  3QFA C;  1GNE A;  4MJC A;  4K9Z A;  1XVW A;  1B48 A;  4F2I A;  3KH7 A;  1X9S B;  4IVF A;  3GFK A;  4YQU A;  4K6X A;  5DAL B;  3FZ4 A;  4Q5Q A;  1RK4 A;  2HSH A;  4XS6 A;  1YKC A;  1R7H A;  1YZX A;  1A8Y A;  1GTI A;  5IMF A;  3IE3 A;  3GX0 A;  5G5F A;  1VF1 A;  1MD3 A;  4GRF A;  1XWA A;  4WET A;  3UJ1 A;  5EY6 A;  4PXO A;  4MZB A;  1PKW A;  2LUS A;  3VUR A;  1OE8 A;  3EMP A;  2KP1 A;  2C3Q A;  2X99 A;  4F0C A;  3NOF A;  4WF4 A;  2VCX A;  3U5R E;  3WGX A;  2RUF A;  5ECH B;  3IXR A;  3DIE A;  5DQS A;  1AIU A;  4XRA A;  3QAG A;  4GWR A;  3KXO A;  4PNF A;  4I6X A;  5F07 A;  1K0M A;  2O7K A;  1JLW A;  4MH2 A;  3FHK A;  1T4Z A;  2HZE B;  4FO5 A;  1XW9 A;  5J3R A;  3A2X A;  4RI7 A;  3FR3 A;  1X5D A;  4KUN A;  4YQV A;  2MMA A;  3UMA A;  4IS0 A;  2DJ1 A;  4POK A;  1Q4J A;  4BWS A;  1UC7 A;  4G19 A;  3MNG A;  2QGV A;  4WKW A;  3EVI A;  2H6X A;  2OE0 A;  1TRW A;  1JZW A;  3IDV A;  3PGT A;  5JCU A;  3KP9 A;  1GSD A;  2HLS A;  3HZ4 A;  2DJ3 A;  1U88 A;  3A3T A;  1X5E A;  3ZIT A;  2OAD A;  4MZW A;  5E59 A;  2GLR A;  2F9S A;  5IO0 A;  3RHB A;  1PN9 A;  1ZGN A;  1SKW B;  2OE1 A;  5HQP A;  1ZOF A;  4CHS A;  3LFL A;  2IIY A;  4HUA A;  1ML6 A;  3HVV A;  3IK9 A;  1PQN A;  2I4A A;  3HJM A;  2BMX A;  2DIY A;  1BX9 A;  4PGT A;  2YWM A;  5IIZ A;  1J9B A;  3UBK A;  3MAK A;  3FY7 A;  1KBN A;  3H4K A;  1V58 A;  1W4V A;  3HD5 A;  1ZL9 A;  4MP4 A;  4EUY A;  4KND A;  3VK9 A;  3GMF A;  4K7I A;  3WGD A;  4BVY B;  4MPG A;  1U3A A;  1YY7 A;  3GTU A;  4L0W A;  1SU9 A;  1LU4 A;  3L78 A;  1SL1 B;  1ZCP A;  4TXO A;  3ZL5 A;  4CDO A;  5CRW A;  1TRV A;  3QDN A;  1SJI A;  2KLX A;  4NHW A;  3R2Q A;  4BVX B;  1M9A A;  2PU9 C;  1XVQ A;  4XS4 B;  2I9H A;  1IYI A;  2DLX A;  5CNW A;  2C0E A;  3SWL A;  4MDC A;  4KGI A;  1OC9 A;  5ECQ B;  4USS A;  2XBI A;  1UVZ A;  4MJB A;  1AQW A;  1VGL A;  1J0F A;  1A2L A;  2N5A A;  2NVL A;  1F9M A;  1QK8 A;  2O8V B;  3I69 A;  4GST A;  2ZNM A;  2L6D A;  2NDO A;  2GZP A;  3LEF A;  2GST A;  4TR0 A;  1T1V A;  2QKE A;  1XWG A;  4L5O A;  2HFD A;  2ZUP A;  4EL1 A;  1DBY A;  2LJR A;  3NIV A;  4K0N A;  4IJI A;  3HJP A;  1M2B A;  1A2J A;  1ERW A;  3V1W A;  2E2G A;  4AJ8 A;  2OKA A;  1GWC A;  2CAI A;  3UEM A;  3TOT A;  4HZ4 A;  4GLT A;  4GSS A;  1T3B A;  3CRU A;  1M0U A;  13GS A;  4MZC A;  3BCI A;  3E9J B;  3QFB C;  2JU5 A;  4KH7 A;  2J9H A;  3CXG A;  1R4W A;  4PQH A;  1V9W A;  1XPV A;  1B9X C;  1PGT A;  3MWH A;  3GYK A;  2HYX A;  5IOW A;  1B8X A;  19GS A;  4PUF C;  1GP1 A;  4YAP A;  2GQM A;  4HZ2 A;  3L9V A;  4O5R A;  1TP9 A;  1WPI A;  1O6J A;  1M2A A;  2V32 A;  2LRN A;  2LKU A;  1XBS A;  3ZTL A;  3J7Y k;  3HHV A;  4P3Y B;  1BAY A;  1T00 A;  2H19 A;  5FT3 A;  3GSS A;  2YOI A;  2RM5 A;  3KMO A;  1J08 A;  1C72 A;  4TR3 A;  4K7N A;  1Q98 A;  5H5R A;  7GSS A;  1EZK A;  4HU7 A;  2HRK B;  3UVT A;  1PL2 A;  2WUL A;  1HD2 A;  2VL3 A;  5ID2 B;  4HOJ A;  4GQC A;  4BPY A;  4KDX A;  2B7J A;  4KW6 A;  1SL2 B;  1O85 A;  1QQ2 A;  1A8L A;  3D5J A;  3ZFB A;  3RPP A;  4X43 A;  1FVJ A;  4EKZ A;  1S3C A;  2RLI A;  1ZMA A;  5J9C A;  3TKQ A;  3KM6 A;  3LXT A;  1QXH A;  6GSX A;  2H72 A;  2B3S A;  3DEX A;  1URM A;  3P8W A;  1MEK A;  4DSR A;  3TRX A;  3QAW A;  2R5G A;  1K0D A;  5ECN B;  1AAZ A;  5HR1 A;  1TK5 B;  3TKS A;  5LCZ A;  17GS A;  2HQT A;  3VI7 A;  4OWY A;  1G0T A;  2DMM A;  4EC0 A;  1GTA A;  3EMX A;  3CMI A;  3TRP A;  3Q74 A;  2YAN A;  2YZU A;  1ACV A;  2NTO A;  2REM A;  2K9F A;  3DXB A;  2H01 A;  2VLT A;  4MF7 A;  2GSQ A;  2WJU A;  2MZC A;  1TXX A;  4Q5N A;  1IYH A;  2V6K A;  2NPB A;  4E8E A;  5F8B A;  4DEJ A;  10GS A;  4MH3 A;  2VD0 A;  3KJY A;  9GSS A;  1XWK A;  1G7O A;  2AV4 A;  6GSV A;  5HR2 A;  4WXT A;  3F4T A;  3TKS E;  4D73 A;  2IPA A;  1GSQ A;  2JZS A;  1G6W A;  2VCW A;  5IMC A;  1O8W A;  2JZR A;  4YAV A;  2I1U A;  3L9S A;  1FHE A;  3TOU A;  3EU3 A;  1XOA A;  4IQ1 A;  3I43 A;  1OKT A;  3GUS A;  1MDK A;  3L4N A;  4N30 A;  2P0G A;  5BMU A;  1YDK A;  2RM6 A;  2Z9S A;  5JWR B;  2DSA A;  4KB3 A;  1Z6M A;  1GUL A;  1M99 A;  3M3M A;  4NHZ A;  3QOU A;  4IJ3 A;  2AHE A;  1K0A A;  2LNT A;  3ME8 A;  4OO4 A;  1SJ6 A;  3S9F A;  2WCI A;  11GS A;  1BG5 A;  2DML A;  5DJM A;  2C8U A;  1T4Y A;  5LD0 A;  3EU4 A;  2GQK A;  3CYN A;  2VIM A;  4G2E A;  3ZRD A;  1T8E B;  2CT6 A;  2VUP A;  16GS A;  4N11 A;  3O76 A;  2L57 A;  1X5C A;  2H1A A;  2X64 A;  2H1D A;  3BOA A;  1EOG A;  2VL2 A;  1SD8 A;  1F3B A;  4LL1 B;  5CYY A;  5D9V A;  4HJM A;  3EWL A;  2DBC A;  2A2R A;  1EP7 A;  3QAV A;  2VM2 A;  2HRF A;  3QD9 A;  2LJA A;  1YKA A;  2FWH A;  3IAS 2;  4JZQ A;  3QMX A;  2IFQ A;  18GS A;  5IPG A;  3CSJ A;  3WYW A;  3EUR A;  4MJA A;  1ST9 A;  4RQX A;  1MTC A;  4L5L A;  3O6T A;  3M9J A;  2FWF A;  1FVK A;  1K3L A;  4L8E A;  3F0I A;  4GQF A;  5D8I A;  2H76 A;  4DSS A;  2KOK A;  5INY A;  1SK2 A;  3L9U A;  4TW5 A;  4YH2 A;  4XRD A;  2FWG A;  1Z7P A;  4FH8 A;  4ECC A;  2JAD A;  2IMD A;  1JHB A;  2XPD A;  3IBH A;  3IRA A;  2CV4 A;  3KH9 A;  2HSM A;  4PNG A;  2FGX A;  2GZY A;  4ML6 A;  4ML1 A;  5G5E A;  2WB9 A;  2ON5 A;  3PH9 A;  1TU8 A;  2WS2 A;  3TKS C;  1YF0 A;  2VAF A;  4BL7 A;  4EDZ A;  4TRX A;  4KDU A;  4ZBB A;  3DD3 A;  2V41 A;  2C0F A;  3WT2 A;  2O87 A;  3UVH A;  1F37 A;  3FEU A;  3GTU B;  2GTU A;  2VCV A;  2JSY A;  2HT9 A;  5ECS A;  3F4R A;  4EXJ A;  3ZRE A;  2YN1 A;  5HFG A;  2H75 A;  1OYJ A;  3UIW A;  1HNA A;  4KSM A;  3HJO A;  3BJ5 A;  4KCA A;  3LXZ A;  3UBL A;  1TTZ A;  4AGS A;  2FD3 A;  3G7I A;  3WD6 A;  4O32 A;  4IQA A;  3C71 A;  1AXD A;  2LS5 A;  4MF6 A;  3OR5 A;  1PSQ A;  2A4V A;  4RUV A;  6GSS A;  3FK8 A;  5B6M A;  3F6F A;  2O85 A;  4ZB8 A;  2I81 A;  3ED3 A;  2H1B A;  3TKR A;  2H1G A;  5D73 A;  4PUR A;  3C8E A;  1H4O A;  4HQS A;  3A2V A;  1HNB A;  2WDU A;  3ZIV A;  4MPF A;  3GHA A;  3HCZ A;  3FR9 A;  12GS A;  1XXU A;  4POM A;  3PR8 A;  1HNC A;  2C80 A;  1Z6N A;  4J56 E;  2C1Y A;  3ZYW A;  2CZ3 A;  1VF2 A;  4YQM A;  3E3E A;  5J41 A;  2WRT A;  1R5P A;  4V1A g;  1TK8 B;  1GL8 A;  4K1F A;  2L5L A;  1XCC A;  5ENU A;  3IR4 A;  1PA3 A;  5IOX A;  4ECI A;  2DJ0 A;  4FYB A;  4BWQ A;  5JWO B;  2LQO A;  1WRY A;  1SKS B;  1VF3 A;  1ZYE A;  3F3Q A;  4G0K A;  2RUE A;  2C4J A;  2H0H A;  5A4U A;  1XWC A;  5C00 A;  3GRX A;  3GH9 A;  4GTU A;  5CRG A;  3RAZ A;  1B4Q A;  4POL A;  1X9M B;  2E2M A;  5D9T A;  2FUG 2;  3A2W A;  2CVB A;  4X0X A;  2GSS A;  1N8J A;  5FWG A;  4G9H A;  3M9K A;  3LJR A;  3W8J A;  4EE0 A;  5FHI A;  5DJL A;  2L4C A;  5ABR A;  4OFT A;  5ECM B;  1X0R A;  4MAB A;  1QGV A;  2HXK A;  3F3R A;  3KD0 A;  2WGR A;  4IW9 A;  2VOC A;  1R5A A;  4K8M A;  5G1K A;  3IC4 A;  3IHQ A;  4ZXG A;  2R2J A;  1YEP A;  5F05 A;  2QSI A;  5ECI B;  2AYT A;  3CSH A;  1NM3 A;  5LNK e;  3GA4 A;  1TOF A;  22GS A;  3KZQ A;  1Z7R A;  4NV2 A;  4DVC A;  2KP2 A;  1WMJ A;  1GSS A;  2CA8 A;  3RBT A;  3UAR A;  5D9W A;  1F3A A;  2K6V A;  4F03 A;  1KTE A;  1SYX A;  2IJY A;  3HKR A;  4XHM A;  3RHC A;  4TR4 A;  5IQY A;  2X8C A;  2F51 A;  5DCH A;  4IGJ A;  1K0B A;  2FCH A;  2XC2 A;  3GV1 A;  4J2F A;  2VO4 A;  1SEN A;  3E0U A;  3ZVJ A;  2B5E A;  4Z7X A;  1K0C A;  1AUC A;  2CVD A;  2PVO C;  1HQO A;  3FZ5 A;  2VLU A;  3R3E A;  2YV9 A;  2D2Z A;  3HZ8 A;  3WGE A;  3GKM A;  4D73 B;  2B1L A;  3KTB A;  5B8B A;  2PVQ A;  4BVY A;  1PX6 A;  1USB A;  2MBT A;  2JL4 A;  5IMD A;  2V1M A;  5HR0 A;  4OMV A;  1SJZ A;  1VF4 A;  4ACS A;  3LG6 A;  4BVX A;  2AAW A;  3DGQ A;  5CRD A;  4EO3 A;  4L0U A;  1DSB A;  2GZZ A;  4LA1 A;  5DDL A;  1GUH A;  2OA7 A;  5H5Q A;  3VWV A;  4AF2 A;  3WT1 A;  3P7X A;  1R26 A;  2J23 A;  3J7Y b;  4JR4 A;  4XCS A;  4EF0 A;  4Q5R A;  1GSY A;  3KMN A;  3GKX A;  1RW1 A;  5EVO A;  3FW2 A;  2LV3 A;  1G6Y A;  1CQH A;  1XZO A;  1V40 A;  4IP1 A;  3EIN A;  3EYT A;  2H30 A;  2OAC A;  1SK1 A;  2BJX A;  1ILO A;  3SBC A;  3LGC A;  3TJB A;  1WIK A;  1JZD A;  2I3Y A;  3C1R A;  3VWW A;  1GSU A;  1SL0 B;  3F63 A;  1O8X A;  5KN2 A;  1GRX A;  2VL9 A;  3DML A;  2H6Y A;  4LLR A;  2MMO A;  2LTK A;  3N9J A;  4WBR D;  2CAQ A;  1A2M A;  1YF1 A;  2LQQ A;  4QQ7 A;  2MMN A;  2X8G A;  4NV5 A;  2DJJ A;  3ERG A;  1GTB A;  2AUV A;  1YJ6 A;  2PMT A;  1FW1 A;  1N2A A;  2LRC A;  4KX4 A;  3US3 A;  2EIO A;  4QL7 A;  2OE3 A;  3IC8 A;  1KNG A;  4F9Z A;  1WP0 A;  3ISO A;  4MF5 A;  3GKN A;  2R6K A;  1EP8 A;  1K0N A;  4X1U A;  1ABA A;  1JZO A;  4PX1 A;  5B7C A;  2PBJ A;  3Q18 A;  2HRK A;  1VRS D;  5IMZ A;  3ME7 A;  4OCF A;  2H0I A;  3HA9 A;  5ID2 A;  2HSM B;  3QR6 A;  4JED A;  2XPE A;  4ILF A;  5CRE A;  2EC4 A;  4OO5 A;  5A4V A;  4TOP A;  2CX3 A;  2LNS A;  4BL7 B;  4NPB A;  2IWT A;  2PPT A;  3N5O A;  1K3Y A;  1BYE A;  3ZLP A;  3CTG A;  3VPQ A;  1U87 A;  4GF0 A;  4XIH A;  3BD2 A;  2MYG A;  3D4M A;  1I5G A;  2GS3 A;  2JSZ A;  1LBK A;  2M72 A;  3I9V 2;  2DIZ A;  6GST A;  2DC5 A;  2H0G A;  4BA7 A;  5AN1 A;  3Q19 A;  4MJE A;  1YQ1 A;  4KE3 A;  3ERF A;  3O3T A;  5IMV A;  2EIQ A;  4QL9 A;  2C0G A;  2FHE A;  2CVK A;  5ECO B;  4ZIL A;  2H70 A;  1TW9 A;  1NHO A;  3CSI A;  4KAE A;  3L0H A;  2CZ2 A;  2HRN A;  2L5O A;  3QPM A;  3KGK A;  1TRU A;  2V2G A;  3APQ A;  3W8S A;  2R4V A;  5ECP B;  5AIV A;  2B5X A;  4NWY A;  3LWA A;  3TKP A;  1XW5 A;  3D4T A;  3LSZ A;  1WJK A;  3Q6O A;  1Z9H A;  2UZ8 A;  4ULX A;  5D9X A;  1A0F A;  2H6Z A;  5G2Z A;  1NHY A;  2AB6 A;  1O7U A;  1AQV A;  5HFI A;  2E7P A;  1H75 A;  4ISD A;  5DCG A;  3LOR A;  4V2M A;  5EPF A;  3FRC A;  4N0Z A;  4TVE A;  2YP6 A;  1B4P A;  5DBQ A;  3C73 A;  2JAC A;  1TI1 A;  2YWO A;  3FKF A;  3HYP A;  3M0F A;  5GSS A;  3RDW A;  3TJF A;  5IMA A;  5H5S A;  4AJ7 A;  3GH6 A;  5KEJ A;  3D6I A;  1QFN A;  5ECL B;  2YZH A;  5AGY A;  3GN3 A;  1ZZY A;  4RI6 A;  4LL4 B;  2YCD A;  2YNX A;  3DVX A;  3HXS A;  2XHF A;  2M46 A;  5B8A A;  2P31 A;  1FB0 A;  4JRR A;  5KN3 A;  1DUG A;  4WEY A;  2WFC A;  1GH2 A;  4HDE A;  4I2T A;  1EEJ A;  1OAZ A;  4WR5 A;  1A23 A;  3KTL A;  2KUC A;  2H73 A;  5KN0 A;  1DE1 A;  1JZR A;  5JCW A;  3D0Z A;  3GL3 A;  1KEB A;  4TXO B;  5KN1 A;  3H93 A;  1GNW A;  4I2U A;  2DJ2 A;  3MSZ A;  1JLV A;  3LYK A;  2GVP A;  3H79 A;  2FNO A;  3CRT A;  2ES7 A;  1PMT A;  2P5Q A;  1OKD A;  2N5B A;  4ZBA A;  2DJK A;  1OC9 B;  4TR1 A;  5JWQ B;  1Z5Y E;  2OBK A;  1TK0 B;  2VCQ A;  3IK7 A;  2FY6 A;  2X8H A;  2MBS A;  1BJX A;  3GL5 A;  3EC3 A;  3ZIJ A;  1U3I A;  4OD7 A;  2QC7 A;  2LRT A;  4FYU A;  2EIR A;  1EGR A;  3TDG A;  2IMF A;  2XBQ A;  5IO2 A;  5A4W A;  3UOM A;  8GSS A;  4MMM A;  1SD9 A;  2F8A A;  2H74 A;  1A24 A;  4ZB9 A;  1F2E A;  1GUK A;  5G1L A;  1V57 A;  2OJL A;  1V98 A;  4LMV A;  3ZMK A;  3FZA A;  4ZB6 A;  1PRX A;  4ZL9 A;  1GLP A;  5DAK A;  1LJR A;  5G30 A;  4K0G A;  2ON7 A;  5ECR B;  2FWE A;  2LJK A;  3GKK A;  1XFL A;  1AW9 A;  2B6M A;  1WOU A;  5F0G A;  2IMI A;  1RQM A;  3FZ9 A;  4XS1 A;  4ECJ A;  4MA9 A;  4PQI A;  5DAL A;  4IP6 A;  5ELG A;  1NW2 A;  2AJQ B;  2FA8 A;  3I6A A;  4HJ2 A;  3MDK A;  4MK3 A;  1SKR B;  5DQY A;  1EV4 A;  2R3X A;  4FIW A;  2VL2 C;  1MD4 A;  1EGO A;  3IOS A;  4HU9 A;  2C3N A;  2B1K A;  2H71 A;  1TKD B;  4G10 A;  2NBS A;  4JU5 A;  1I9D A;  4PQ1 A;  3DRN A;  3GIX A;  4G0L A;  5D96 A;  1EV9 A;  3APS A;  1O73 A;  1T7P B;  1JFU A;  3EE2 A;  1B9Y C;  5DVB A;  3IPZ A;  3ZZX A;  1UA5 A;  2WZ9 A;  4PTS A;  2G2Q A;  5CP1 A;  5EL8 A;  4KCE A;  6GSY A;  3KCM A;  1V2A A;  3VWU A;  3LQ7 A;  3VPT A;  4GCI A;  3UAP A;  2C3T A;  2LST A;  2L4Q A;  3ERW A;  3AY8 A;  1QMV A;  3H8Q A;  2HZE A;  2KHP A;  4IBP A;  2RII A;  4I97 A;  2B5Y A;  1Z3E A;  3KIJ A;  1QUW A;  1WE0 A;  5C04 A;  3VFI A;  3C1S A;  2F8F A;  4J57 E;  4N0V A;  1THO A;  3TCO A;  4E8H A;  2YJH A;  4NAX A;  3M1G A;  1ERT A;  3TJK A;  3P2A A;  1U6T A;  4WF5 A;  1OE7 A;  3F6D A;  3D21 A;  3IAM 2;  1PX7 A;  2IN3 A;  2YPM A;  1WWJ A;  5J4U A;  4HS1 A;  4RQR A;  1GUM A;  3LYP A;  5CAX A;  2F3M A;  3DKS A;  4KF9 A;  5GZZ B;  4NMU A;  2YV7 A;  1ERV A;  1PKZ A;  1XW6 A;  1E2Y A;  2LEG A;  1EWX A;  2HZF A;  1M2D A;  4IN0 A;  3G7Y A;  4LMW A;  4JBB A;  1TI3 A;  2HSN B;  2N5F A;  2IME A;  3M8N A;  3F9U A;  5AIS A;  3GNJ A;  2VD1 A;  5COH A;  1SK0 A;  3FYG A;  3HDC A;  2TRC P;  4PUA A;  1HYU A;  3CBU A;  2ZCT A;  2L59 A;  4ECB A;  2VCZ A;  4V1A p;  1FO5 A;  3QCP A;  1XIY A;  1EEM A;  4XS4 A;  2PWJ A;  3C7M A;  2PN8 A;  5E4W A;  3BCK A;  1FG4 A;  5J9B A;  1S3D A;  2TRX A;  3VI5 A;  2K18 A;  4H86 A;  4IKH A;  4ZL8 A;  1AQX A;  2O89 A;  4F82 A;  2R37 A;  4TN8 A;  5B6N A;  3DWV A;  5IPH A;  1W89 A;  1THX A;  14GS A;  1FAA A;  3DVW A;  4G0I A;  4CW9 A;  2HE3 A;  3TUE A;  1XWB A;  5J5N A;  1AC1 A;  3H1N A;  4MLY A;  3TJJ A;  3U6V A;  2HI7 A;  2VM1 A;  4Q5F A;  2PUK C;  4NXI A;  2C0D A;  4ZIJ A;  3FR6 A;  1DE2 A;  1FB6 A;  4TXV A;  2IMK A;  1ZYQ B; 
#chains in the Genus database with same CATH topology
 3BBY A;  4O92 A;  5GAP D;  3VLN A;  3A5W A;  3W6G A;  5D93 A;  2GDR A;  1ON4 A;  4WBJ A;  3ZML A;  4DSQ A;  3PIN A;  3K8N A;  1FOV A;  4EVM A;  1TRS A;  2G0F A;  4V2N A;  1G7E A;  1X9W B;  4EDY A;  3G9B A;  4I5Q A;  6GSW A;  1GLQ A;  3GST A;  3HVS A;  6GSU A;  5A5K A;  2R0G A;  20GS A;  4FQU A;  3ZVJ D;  2IFQ B;  3UL3 A;  4HQZ A;  2GSR A;  3P90 A;  4O7H A;  2DKI A;  2TIR A;  4K2D A;  3IV4 A;  4FYC A;  1Y25 A;  5HR3 A;  1M3J A;  1SVM A;  5HFK A;  5GAN D;  1TJD A;  1M9B A;  3KP8 A;  1PL1 A;  4DSS B;  4V2L A;  2VLV A;  5CO3 A;  2K8V A;  4AKI A;  4EIP A;  3G7J A;  1K3O A;  3HY2 A;  1GSE A;  4OFN A;  4JE1 A;  2GT6 A;  2HNL A;  2X49 A;  2PGT A;  3IA1 A;  3KEB A;  2K8S A;  3DYR A;  1EOH A;  1TDI A;  4JR6 A;  3RGB C;  1BED A;  2GGT A;  1YEX A;  4XTS A;  3TB2 A;  2FA4 A;  2IL3 A;  1S3A A;  2H66 A;  2GT5 A;  4PI0 C;  1ZYP A;  1OC8 A;  1A0R P;  2B7K A;  2GQL A;  4HI7 A;  4HEA 2;  3TGZ A;  3RPN A;  2P5R A;  4I8B A;  1UN2 A;  2FLS A;  1O81 A;  4KDY A;  2EFD A;  1NSW A;  1GSF A;  2MMZ A;  3PPU A;  1Y6E A;  1E6B A;  5ELA A;  3VWX A;  4POB A;  3GUR A;  1XOB A;  2BTO T;  5L71 A;  2JZT A;  5F06 A;  4GXZ A;  2A2S A;  2CX4 A;  3F8U A;  4ZL7 A;  1MDJ A;  4GSN A;  3F4S A;  1PN0 A;  1F6M C;  3APO A;  5CRH A;  1CQG A;  4ID0 A;  4F0B A;  2CQ9 A;  1GTU A;  1MDI A;  3TJG A;  2H1L A;  2YWN A;  1OC3 A;  5GST A;  3NZN A;  4KA0 A;  4AI6 A;  4TR1 B;  3HVX A;  3ZFL A;  1SYR A;  4MCU A;  3CTF A;  4ZBD A;  2VCT A;  4IHU A;  2PER A;  4TKY A;  2H8L A;  4OFM A;  3D22 A;  4N10 A;  3TRQ A;  5G31 A;  4IEL A;  3GX8 A;  2HSY A;  2ALB A;  4AJ6 A;  2HRA A;  1TU7 A;  4KSO A;  5ECK B;  1ERU A;  4OCE A;  2YJ7 A;  1BG1 A;  2E0Q A;  5IM9 A;  2M80 A;  5JCG A;  1K0O A;  4K7O A;  2L6C A;  2OBI A;  1OVN A;  2YWI A;  1BQ7 A;  1M7T A;  1PD2 1;  2VKZ G;  2V6O A;  5AIX A;  5DAK B;  4WR4 A;  3LW9 A;  3JCM L;  3QFA C;  1GNE A;  4MJC A;  4K9Z A;  1XVW A;  1B48 A;  4F2I A;  3KH7 A;  1X9S B;  4IVF A;  3GFK A;  4YQU A;  4K6X A;  5DAL B;  3FZ4 A;  4Q5Q A;  1RK4 A;  2HSH A;  4XS6 A;  1YKC A;  1R7H A;  1YZX A;  1A8Y A;  1GTI A;  5IMF A;  3IE3 A;  3GX0 A;  5G5F A;  1VF1 A;  1MD3 A;  4GRF A;  1XWA A;  4WET A;  3UJ1 A;  5EY6 A;  4PXO A;  4MZB A;  1PKW A;  4HSC X;  2LUS A;  3VUR A;  1OE8 A;  3EMP A;  2KP1 A;  2C3Q A;  2X99 A;  4F0C A;  3NOF A;  4WF4 A;  2VCX A;  3U5R E;  3WGX A;  2RUF A;  5ECH B;  2OT3 A;  3IXR A;  3DIE A;  5DQS A;  1AIU A;  4XRA A;  3QAG A;  4GWR A;  3KXO A;  4PNF A;  4I6X A;  4Z2R A;  5F07 A;  1K0M A;  2O7K A;  1Y1U A;  1JLW A;  4MH2 A;  3FHK A;  1T4Z A;  2HZE B;  4FO5 A;  1XW9 A;  5J3R A;  3A2X A;  4RI7 A;  3FR3 A;  1X5D A;  4KUN A;  4YQV A;  2MMA A;  3UMA A;  4IS0 A;  2DJ1 A;  4POK A;  1Q4J A;  4BWS A;  1UC7 A;  2WW2 A;  4G19 A;  3MNG A;  2QGV A;  4WKW A;  3EVI A;  2H6X A;  2OE0 A;  1TRW A;  1JZW A;  3IDV A;  3PGT A;  5JCU A;  3KP9 A;  4A5P A;  1GSD A;  2HLS A;  3HZ4 A;  2DJ3 A;  1U88 A;  3A3T A;  1X5E A;  3HMJ G;  3ZIT A;  2OAD A;  4MZW A;  5E59 A;  2GLR A;  2F9S A;  5IO0 A;  3RHB A;  1PN9 A;  1ZGN A;  1SKW B;  2OE1 A;  5HQP A;  1ZOF A;  4CHS A;  3LFL A;  2IIY A;  4HUA A;  1ML6 A;  3HVV A;  3IK9 A;  1PQN A;  2I4A A;  3HJM A;  2BMX A;  2DIY A;  1BX9 A;  4PGT A;  2YWM A;  5IIZ A;  1J9B A;  3UBK A;  3MAK A;  3FY7 A;  1KBN A;  3H4K A;  1V58 A;  1W4V A;  3HD5 A;  1ZL9 A;  4MP4 A;  4EUY A;  4KND A;  3VK9 A;  3GMF A;  4K7I A;  3WGD A;  4BVY B;  4MPG A;  1U3A A;  1YY7 A;  3GTU A;  4L0W A;  1SU9 A;  1LU4 A;  3L78 A;  1SL1 B;  1ZCP A;  4TXO A;  3ZL5 A;  4CDO A;  5CRW A;  1TRV A;  3QDN A;  5A34 B;  1SJI A;  2KLX A;  4NHW A;  3R2Q A;  4BVX B;  1M9A A;  2PU9 C;  1BF5 A;  1XVQ A;  4XS4 B;  2I9H A;  1IYI A;  2DLX A;  5CNW A;  2C0E A;  3SWL A;  4MDC A;  4KGI A;  1OC9 A;  5ECQ B;  4USS A;  2XBI A;  1UVZ A;  4MJB A;  1AQW A;  1VGL A;  1J0F A;  1A2L A;  2N5A A;  2NVL A;  1F9M A;  1QK8 A;  2O8V B;  3I69 A;  4GST A;  2ZNM A;  2L6D A;  2NDO A;  2GZP A;  3LEF A;  2GST A;  4TR0 A;  1T1V A;  2QKE A;  1XWG A;  4L5O A;  2HFD A;  2ZUP A;  4EL1 A;  1DBY A;  2LJR A;  3NIV A;  4K0N A;  4IJI A;  3HJP A;  1M2B A;  1A2J A;  1ERW A;  3V1W A;  2E2G A;  4AJ8 A;  2OKA A;  1GWC A;  2CAI A;  3UEM A;  3TOT A;  4HZ4 A;  4AKH A;  4GLT A;  4GSS A;  1T3B A;  3CRU A;  1M0U A;  13GS A;  4MZC A;  2WVY A;  3BCI A;  3E9J B;  3QFB C;  4PI2 C;  2JU5 A;  4KH7 A;  2J9H A;  3CXG A;  3RFR C;  1R4W A;  4PQH A;  1V9W A;  1XPV A;  1B9X C;  1PGT A;  3MWH A;  3GYK A;  2HYX A;  5IOW A;  1B8X A;  19GS A;  4PUF C;  1GP1 A;  4YAP A;  2GQM A;  4O5Q A;  4HZ2 A;  3L9V A;  4O5R A;  1TP9 A;  1N25 A;  1WPI A;  1O6J A;  5A5H A;  1M2A A;  2V32 A;  2LRN A;  2LKU A;  1XBS A;  3ZTL A;  3J7Y k;  3HHV A;  4P3Y B;  1BAY A;  1T00 A;  2H19 A;  5FT3 A;  3GSS A;  2YOI A;  2RM5 A;  3KMO A;  1J08 A;  1C72 A;  4TR3 A;  4K7N A;  1Q98 A;  5H5R A;  7GSS A;  1EZK A;  4HU7 A;  2HRK B;  3UVT A;  5A1N B;  1PL2 A;  2WUL A;  1HD2 A;  2VL3 A;  5ID2 B;  4HOJ A;  4GQC A;  4BPY A;  4KDX A;  2B7J A;  4KW6 A;  1SL2 B;  1O85 A;  1QQ2 A;  1A8L A;  3D5J A;  3ZFB A;  3RPP A;  4X43 A;  1FVJ A;  4EKZ A;  1S3C A;  2RLI A;  1ZMA A;  5J9C A;  3TKQ A;  3KM6 A;  3LXT A;  1QXH A;  1S3R A;  6GSX A;  2H72 A;  2B3S A;  3DEX A;  1URM A;  3P8W A;  1MEK A;  4DSR A;  3TRX A;  3QAW A;  2R5G A;  1K0D A;  5ECN B;  1AAZ A;  5HR1 A;  1TK5 B;  3TKS A;  5LCZ A;  17GS A;  2HQT A;  3VI7 A;  4OWY A;  1G0T A;  2DMM A;  4EC0 A;  1GTA A;  3EMX A;  3CMI A;  4AKX B;  3TRP A;  3Q74 A;  2YAN A;  2YZU A;  1ACV A;  2NTO A;  2REM A;  2K9F A;  3DXB A;  2H01 A;  3CQF A;  2VLT A;  4MF7 A;  2GSQ A;  2WJU A;  2MZC A;  1TXX A;  4Q5N A;  1IYH A;  2V6K A;  2NPB A;  4E8E A;  5F8B A;  4DEJ A;  10GS A;  4MH3 A;  2VD0 A;  3KJY A;  2HSN A;  9GSS A;  1XWK A;  1G7O A;  2AV4 A;  6GSV A;  5HR2 A;  4WXT A;  3F4T A;  3TKS E;  4D73 A;  2IPA A;  1FOH A;  1GSQ A;  2JZS A;  1G6W A;  2VCW A;  5IMC A;  1O8W A;  2JZR A;  4YAV A;  2I1U A;  3L9S A;  1FHE A;  3TOU A;  3EU3 A;  1XOA A;  4IQ1 A;  3I43 A;  1OKT A;  3GUS A;  4CY6 A;  3FMW A;  1MDK A;  3L4N A;  4N30 A;  2P0G A;  5BMU A;  1YDK A;  2RM6 A;  2Z9S A;  5JWR B;  2DSA A;  4KB3 A;  1Z6M A;  1GUL A;  1M99 A;  3M3M A;  4NHZ A;  3QOU A;  4IJ3 A;  2AHE A;  1K0A A;  4FXY P;  1XG8 A;  2LNT A;  3ME8 A;  4OO4 A;  1SJ6 A;  3S9F A;  2WCI A;  11GS A;  4G01 A;  1BG5 A;  2DML A;  5DJM A;  2C8U A;  1T4Y A;  5LD0 A;  3EU4 A;  2GQK A;  3CYN A;  2VIM A;  4G2E A;  3ZRD A;  1T8E B;  2CT6 A;  2VUP A;  16GS A;  3A5I A;  4N11 A;  3O76 A;  2L57 A;  1X5C A;  2H1A A;  2X64 A;  2H1D A;  3BOA A;  1EOG A;  2VL2 A;  1SD8 A;  1F3B A;  4LL1 B;  5CYY A;  5D9V A;  4HJM A;  3EWL A;  2DBC A;  2A2R A;  1EP7 A;  3QAV A;  2VM2 A;  2HRF A;  3QD9 A;  2LJA A;  1YKA A;  2FWH A;  3IAS 2;  4JZQ A;  3QMX A;  2IFQ A;  5J47 A;  18GS A;  5IPG A;  3CSJ A;  3WYW A;  3EUR A;  4MJA A;  1ST9 A;  4RQX A;  1MTC A;  4L5L A;  3O6T A;  3M9J A;  2FWF A;  4Z2U A;  1FVK A;  1K3L A;  4L8E A;  3F0I A;  4GQF A;  5D8I A;  2H76 A;  4DSS A;  2KOK A;  1YEW C;  5INY A;  1SK2 A;  3L9U A;  4TW5 A;  4W66 A;  4YH2 A;  4XRD A;  2FWG A;  2O5V A;  1Z7P A;  1ZYN A;  4FH8 A;  4ECC A;  2JAD A;  2IMD A;  4K5R A;  1JHB A;  2XPD A;  3IBH A;  3IRA A;  2CV4 A;  3KH9 A;  2HSM A;  4PNG A;  2FGX A;  2GZY A;  4ML6 A;  4ML1 A;  5G5E A;  2WB9 A;  2ON5 A;  3PH9 A;  1TU8 A;  1SVL A;  2EFE A;  2WS2 A;  3TKS C;  4ICY A;  1YF0 A;  2VAF A;  4BL7 A;  4EDZ A;  4TRX A;  4KDU A;  4ZBB A;  3DD3 A;  2V41 A;  2C0F A;  3WT2 A;  2O87 A;  4YKF A;  3UVH A;  1F37 A;  3FEU A;  3GTU B;  2GTU A;  2VCV A;  2JSY A;  2HT9 A;  5ECS A;  3F4R A;  4EXJ A;  3ZRE A;  2YN1 A;  5HFG A;  2H75 A;  1OYJ A;  3UIW A;  1HNA A;  4KSM A;  3HJO A;  3BJ5 A;  4KCA A;  3LXZ A;  3UBL A;  4E68 A;  1TTZ A;  4AGS A;  2FD3 A;  3G7I A;  4BIK A;  3WD6 A;  3CHX C;  4O32 A;  4IQA A;  3C71 A;  1AXD A;  2LS5 A;  4MF6 A;  3OR5 A;  1PSQ A;  2A4V A;  4RUV A;  6GSS A;  3FK8 A;  5B6M A;  3F6F A;  2O85 A;  4ZB8 A;  2I81 A;  3ED3 A;  2H1B A;  2WW0 A;  3TKR A;  2H1G A;  5D73 A;  4PUR A;  3C8E A;  1H4O A;  4HQS A;  4YKG A;  3A2V A;  1HNB A;  2WDU A;  3ZIV A;  4MPF A;  3GHA A;  3HCZ A;  3FR9 A;  12GS A;  1XXU A;  4POM A;  3PR8 A;  1HNC A;  2C80 A;  1Z6N A;  4J56 E;  2C1Y A;  3ZYW A;  2CZ3 A;  1VF2 A;  4YQM A;  3E3E A;  2WVZ A;  5J41 A;  2WRT A;  1R5P A;  4V1A g;  1TK8 B;  1GL8 A;  4K1F A;  2L5L A;  1XCC A;  5ENU A;  3IR4 A;  1PA3 A;  5IOX A;  4ECI A;  2DJ0 A;  4FYB A;  4BWQ A;  5JWO B;  2LQO A;  1WRY A;  1SKS B;  1VF3 A;  1ZYE A;  3F3Q A;  4G0K A;  2RUE A;  2C4J A;  2H0H A;  5A4U A;  1XWC A;  5C00 A;  3GRX A;  4GDF A;  3GH9 A;  4GTU A;  5CRG A;  3RAZ A;  2R0C A;  1B4Q A;  4POL A;  1X9M B;  2E2M A;  5D9T A;  2FUG 2;  3A2W A;  2WVX A;  2CVB A;  4X0X A;  2GSS A;  1N8J A;  5FWG A;  4G9H A;  3M9K A;  3LJR A;  3W8J A;  1TXU A;  4EE0 A;  5FHI A;  5DJL A;  2L4C A;  5ABR A;  4OFT A;  5ECM B;  1X0R A;  4MAB A;  1QGV A;  2HXK A;  3F3R A;  3KD0 A;  2WGR A;  4IW9 A;  2VOC A;  1R5A A;  4K8M A;  5G1K A;  3IC4 A;  3IHQ A;  4ZXG A;  2R2J A;  1YEP A;  5F05 A;  2QSI A;  5ECI B;  2AYT A;  3MIX A;  3CSH A;  1NM3 A;  5LNK e;  3GA4 A;  1TOF A;  22GS A;  3KZQ A;  1Z7R A;  4NV2 A;  4DVC A;  2KP2 A;  1WMJ A;  1GSS A;  2CA8 A;  3RBT A;  3UAR A;  5D9W A;  1F3A A;  2K6V A;  4CY8 A;  4F03 A;  1KTE A;  1SYX A;  2IJY A;  3HKR A;  4XHM A;  3RHC A;  4TR4 A;  5IQY A;  2X8C A;  2F51 A;  1S4B P;  5DCH A;  4IGJ A;  1K0B A;  2FCH A;  2XC2 A;  3GV1 A;  4J2F A;  2VO4 A;  1SEN A;  3E0U A;  3ZVJ A;  2B5E A;  4Z7X A;  1K0C A;  1AUC A;  2CVD A;  2WW3 A;  2PVO C;  1HQO A;  3FZ5 A;  2VLU A;  3R3E A;  2YV9 A;  2D2Z A;  3HZ8 A;  3WGE A;  3GKM A;  4D73 B;  2B1L A;  3KTB A;  5B8B A;  2PVQ A;  4BVY A;  1PX6 A;  1USB A;  2MBT A;  2JL4 A;  5IMD A;  2V1M A;  5HR0 A;  4OMV A;  1SJZ A;  1VF4 A;  4ACS A;  3LG6 A;  4BVX A;  2AAW A;  4AKG A;  3DGQ A;  5CRD A;  4EO3 A;  4L0U A;  1DSB A;  2GZZ A;  4LA1 A;  5DDL A;  1GUH A;  2OA7 A;  5H5Q A;  3VWV A;  4AF2 A;  3WT1 A;  3P7X A;  1R26 A;  2J23 A;  3J7Y b;  4JR4 A;  4XCS A;  4EF0 A;  4Q5R A;  1GSY A;  3KMN A;  3GKX A;  1RW1 A;  5EVO A;  3FW2 A;  2LV3 A;  1G6Y A;  1CQH A;  1XZO A;  1V40 A;  4IP1 A;  3EIN A;  3EYT A;  2H30 A;  2OAC A;  1SK1 A;  2BJX A;  1ILO A;  4X4J A;  3SBC A;  1PFO A;  4Z2T A;  3LGC A;  3TJB A;  1WIK A;  1JZD A;  2I3Y A;  3C1R A;  3VWW A;  1GSU A;  1SL0 B;  3F63 A;  1O8X A;  5KN2 A;  1GRX A;  2VL9 A;  3DML A;  2H6Y A;  4LLR A;  5J40 A;  2QA1 A;  2MMO A;  2LTK A;  3N9J A;  4WBR D;  2CAQ A;  1A2M A;  1YF1 A;  2LQQ A;  4QQ7 A;  2MMN A;  2X8G A;  4NV5 A;  3IHG A;  2DJJ A;  3ERG A;  1GTB A;  2AUV A;  1YJ6 A;  2PMT A;  1FW1 A;  1N2A A;  2LRC A;  4KX4 A;  3US3 A;  2EIO A;  4QL7 A;  2OE3 A;  3IC8 A;  1KNG A;  4F9Z A;  1WP0 A;  3ISO A;  4MF5 A;  3GKN A;  2R6K A;  1EP8 A;  1K0N A;  4X1U A;  1ABA A;  1JZO A;  4PX1 A;  5B7C A;  2PBJ A;  3Q18 A;  2HRK A;  1VRS D;  5A1N A;  5IMZ A;  3ME7 A;  4OCF A;  2H0I A;  3HA9 A;  5ID2 A;  2HSM B;  3QR6 A;  4JED A;  2XPE A;  4ILF A;  5CRE A;  2EC4 A;  4OO5 A;  5A4V A;  4TOP A;  2CX3 A;  2LNS A;  4BL7 B;  1SVO A;  4NPB A;  2IWT A;  2PPT A;  3N5O A;  4PHZ C;  1K3Y A;  2O3E A;  1BYE A;  3ZLP A;  3CTG A;  3VPQ A;  1U87 A;  4GF0 A;  4XIH A;  3BD2 A;  2MYG A;  3D4M A;  1I5G A;  2GS3 A;  2JSZ A;  1LBK A;  2M72 A;  3I9V 2;  2DIZ A;  6GST A;  2DC5 A;  2WW1 A;  2H0G A;  4BA7 A;  5AN1 A;  1I1I P;  3Q19 A;  4MJE A;  1YQ1 A;  4KE3 A;  3ERF A;  3O3T A;  5IMV A;  2EIQ A;  4QL9 A;  2C0G A;  2FHE A;  2CVK A;  5ECO B;  4ZIL A;  2H70 A;  4K2X A;  1TW9 A;  1NHO A;  3CSI A;  4KAE A;  3L0H A;  2CZ2 A;  2HRN A;  2L5O A;  3QPM A;  3KGK A;  1TRU A;  2V2G A;  3APQ A;  3W8S A;  2R4V A;  5ECP B;  5AIV A;  2B5X A;  4NWY A;  3LWA A;  3TKP A;  1XW5 A;  3D4T A;  3LSZ A;  1WJK A;  3Q6O A;  1Z9H A;  2UZ8 A;  3CWG A;  4ULX A;  2EFH A;  5D9X A;  5J4Y A;  1A0F A;  2H6Z A;  5G2Z A;  1NHY A;  2AB6 A;  2R0P A;  1O7U A;  1AQV A;  5HFI A;  2E7P A;  1H75 A;  4ISD A;  2QA2 A;  5DCG A;  3LOR A;  4V2M A;  5EPF A;  3FRC A;  4N0Z A;  4TVE A;  2YP6 A;  2O36 A;  1B4P A;  5DBQ A;  3C73 A;  2JAC A;  1TI1 A;  2YWO A;  3FKF A;  3HYP A;  3M0F A;  5GSS A;  3RDW A;  3TJF A;  5IMA A;  5H5S A;  4AJ7 A;  3GH6 A;  5KEJ A;  3D6I A;  1QFN A;  5ECL B;  2YZH A;  5AGY A;  3GN3 A;  1ZZY A;  4RI6 A;  4LL4 B;  2YCD A;  2YNX A;  5KOW A;  3DVX A;  3HXS A;  2XHF A;  2M46 A;  5B8A A;  2P31 A;  1FB0 A;  5BRT A;  4JRR A;  5KN3 A;  1DUG A;  4WEY A;  2WFC A;  4QMK A;  1GH2 A;  4HDE A;  4I2T A;  1EEJ A;  1OAZ A;  4WR5 A;  1A23 A;  3KTL A;  2KUC A;  2H73 A;  5KN0 A;  1DE1 A;  1JZR A;  5JCW A;  3D0Z A;  3GL3 A;  1KEB A;  4TXO B;  5KN1 A;  3H93 A;  1GNW A;  4I2U A;  2DJ2 A;  3MSZ A;  1JLV A;  3LYK A;  2GVP A;  3H79 A;  2FNO A;  4ZB7 A;  3CRT A;  2ES7 A;  1PMT A;  2P5Q A;  1OKD A;  3HVN A;  2N5B A;  4ZBA A;  2DJK A;  2WVX B;  1OC9 B;  4TR1 A;  5JWQ B;  1Z5Y E;  2OBK A;  1TK0 B;  2VCQ A;  3IK7 A;  2FY6 A;  2X8H A;  2MBS A;  1BJX A;  3GL5 A;  3EC3 A;  3ZIJ A;  1U3I A;  4OD7 A;  2QC7 A;  2LRT A;  4FYU A;  2EIR A;  1EGR A;  3TDG A;  5J4V A;  2IMF A;  2XBQ A;  5IO2 A;  5A4W A;  3UOM A;  8GSS A;  4MMM A;  1SD9 A;  2F8A A;  2H74 A;  1A24 A;  4ZB9 A;  1F2E A;  1GUK A;  5G1L A;  1V57 A;  2OJL A;  1V98 A;  4LMV A;  1YVL A;  3ZMK A;  3FZA A;  4ZB6 A;  1PRX A;  4ZL9 A;  2WZS A;  1GLP A;  5DAK A;  1LJR A;  5G30 A;  4K0G A;  2ON7 A;  5ECR B;  2FWE A;  2LJK A;  3GKK A;  1XFL A;  1AW9 A;  2B6M A;  1WOU A;  5F0G A;  2IMI A;  1RQM A;  3FZ9 A;  4XS1 A;  4ECJ A;  4MA9 A;  4PQI A;  5DAL A;  4IP6 A;  5ELG A;  1NW2 A;  2AJQ B;  2FA8 A;  3I6A A;  4HJ2 A;  4K5S A;  3MDK A;  4MK3 A;  1SKR B;  5DQY A;  1EV4 A;  2R3X A;  4FIW A;  2VL2 C;  1MD4 A;  1EGO A;  3IOS A;  4HU9 A;  2C3N A;  2B1K A;  5A5H B;  2H71 A;  1TKD B;  4G10 A;  2NBS A;  4JU5 A;  1I9D A;  4PQ1 A;  3DRN A;  3GIX A;  1M3I A;  4G0L A;  5D96 A;  1EV9 A;  3APS A;  1O73 A;  1T7P B;  1JFU A;  3EE2 A;  1B9Y C;  5DVB A;  3IPZ A;  4N3Z A;  1UA5 A;  2WZ9 A;  3ZZX A;  4PTS A;  2G2Q A;  5CP1 A;  5EL8 A;  4KCE A;  6GSY A;  2EFC A;  3KCM A;  1V2A A;  3VWU A;  3LQ7 A;  3VPT A;  4GCI A;  3UAP A;  2C3T A;  2LST A;  2L4Q A;  3ERW A;  3AY8 A;  1QMV A;  3H8Q A;  2HZE A;  2KHP A;  4IBP A;  4O5U A;  2RII A;  4I97 A;  2B5Y A;  1Z3E A;  3KIJ A;  1QUW A;  1WE0 A;  5C04 A;  3VFI A;  3C1S A;  2F8F A;  4J57 E;  4N0V A;  3EPT A;  2X4A A;  1THO A;  3TCO A;  4E8H A;  2YJH A;  4NAX A;  3M1G A;  1ERT A;  3TJK A;  3P2A A;  1U6T A;  4WF5 A;  1OE7 A;  3F6D A;  3D21 A;  3IAM 2;  1PX7 A;  2IN3 A;  2YPM A;  3MYD A;  1WWJ A;  5J4U A;  4HS1 A;  4RQR A;  1GUM A;  3LYP A;  5CAX A;  2F3M A;  2UV8 G;  3DKS A;  4KF9 A;  5GZZ B;  4NMU A;  2YV7 A;  1ERV A;  1PKZ A;  1XW6 A;  1E2Y A;  2LEG A;  1EWX A;  2HZF A;  1M2D A;  5KOX A;  3G7Y A;  4IN0 A;  4LMW A;  4JBB A;  1TI3 A;  4EIQ A;  2HSN B;  2N5F A;  3F9U A;  3M8N A;  2IME A;  5AIS A;  3GNJ A;  2VD1 A;  5COH A;  1SK0 A;  3FYG A;  3HDC A;  2DKH A;  2TRC P;  4PUA A;  1HYU A;  3CBU A;  2ZCT A;  2L59 A;  4ECB A;  2A4H A;  2VCZ A;  5A34 A;  4V1A p;  1FO5 A;  3QCP A;  1XIY A;  1EEM A;  4XS4 A;  2PWJ A;  3C7M A;  5BMU B;  2PN8 A;  5E4W A;  3BCK A;  1FG4 A;  5J9B A;  1S3D A;  2TRX A;  3VI5 A;  2K18 A;  4H86 A;  4IKH A;  4ZL8 A;  1AQX A;  2O89 A;  4F82 A;  2R37 A;  4TN8 A;  5B6N A;  3DWV A;  5IPH A;  1W89 A;  1THX A;  3TU3 B;  14GS A;  1FAA A;  3DVW A;  4G0I A;  4CW9 A;  2HE3 A;  3TUE A;  1XWB A;  5J5N A;  1AC1 A;  3H1N A;  4MLY A;  3TJJ A;  3U6V A;  4MNN A;  2HI7 A;  2VM1 A;  4Q5F A;  2PUK C;  2A2P A;  4NXI A;  2C0D A;  4ZIJ A;  3FR6 A;  1DE2 A;  1FB6 A;  4TXV A;  2IMK A;  1ZYQ B; 
#chains in the Genus database with same CATH homology
 3BBY A;  4O92 A;  5GAP D;  3VLN A;  3A5W A;  3W6G A;  5D93 A;  2GDR A;  1ON4 A;  4WBJ A;  3ZML A;  4DSQ A;  3PIN A;  3K8N A;  1FOV A;  4EVM A;  1TRS A;  2G0F A;  4V2N A;  1G7E A;  1X9W B;  4EDY A;  3G9B A;  4I5Q A;  6GSW A;  1GLQ A;  3GST A;  3HVS A;  6GSU A;  5A5K A;  2R0G A;  20GS A;  4FQU A;  3ZVJ D;  2IFQ B;  3UL3 A;  4HQZ A;  2GSR A;  3P90 A;  4O7H A;  2DKI A;  2TIR A;  4K2D A;  3IV4 A;  4FYC A;  1Y25 A;  5HR3 A;  1SVM A;  5HFK A;  5GAN D;  1TJD A;  1M9B A;  3KP8 A;  1PL1 A;  4DSS B;  4V2L A;  2VLV A;  5CO3 A;  2K8V A;  4AKI A;  4EIP A;  3G7J A;  1K3O A;  3HY2 A;  1GSE A;  4OFN A;  4JE1 A;  2GT6 A;  2HNL A;  2X49 A;  2PGT A;  3IA1 A;  3KEB A;  2K8S A;  3DYR A;  1EOH A;  1TDI A;  4JR6 A;  1BED A;  2GGT A;  1YEX A;  4XTS A;  3TB2 A;  2FA4 A;  2IL3 A;  1S3A A;  2H66 A;  2GT5 A;  1ZYP A;  1OC8 A;  1A0R P;  2B7K A;  2GQL A;  4HI7 A;  4HEA 2;  3TGZ A;  3RPN A;  2P5R A;  4I8B A;  1UN2 A;  2FLS A;  1O81 A;  4KDY A;  2EFD A;  1NSW A;  1GSF A;  2MMZ A;  3PPU A;  1Y6E A;  1E6B A;  5ELA A;  3VWX A;  4POB A;  3GUR A;  1XOB A;  2BTO T;  5L71 A;  2JZT A;  5F06 A;  4GXZ A;  2A2S A;  2CX4 A;  3F8U A;  4ZL7 A;  1MDJ A;  4GSN A;  3F4S A;  1PN0 A;  1F6M C;  3APO A;  5CRH A;  1CQG A;  4ID0 A;  4F0B A;  2CQ9 A;  1GTU A;  1MDI A;  3TJG A;  2H1L A;  2YWN A;  1OC3 A;  5GST A;  3NZN A;  4KA0 A;  4AI6 A;  4TR1 B;  3HVX A;  3ZFL A;  1SYR A;  4MCU A;  3CTF A;  4ZBD A;  2VCT A;  4IHU A;  2PER A;  4TKY A;  2H8L A;  4OFM A;  3D22 A;  4N10 A;  3TRQ A;  5G31 A;  4IEL A;  3GX8 A;  2HSY A;  2ALB A;  4AJ6 A;  2HRA A;  1TU7 A;  4KSO A;  5ECK B;  1ERU A;  4OCE A;  2YJ7 A;  1BG1 A;  2E0Q A;  5IM9 A;  2M80 A;  5JCG A;  1K0O A;  4K7O A;  2L6C A;  2OBI A;  1OVN A;  2YWI A;  1BQ7 A;  1M7T A;  1PD2 1;  2VKZ G;  2V6O A;  5AIX A;  5DAK B;  4WR4 A;  3LW9 A;  3JCM L;  3QFA C;  1GNE A;  4MJC A;  4K9Z A;  1XVW A;  1B48 A;  4F2I A;  3KH7 A;  1X9S B;  4IVF A;  3GFK A;  4YQU A;  4K6X A;  5DAL B;  3FZ4 A;  4Q5Q A;  1RK4 A;  2HSH A;  4XS6 A;  1YKC A;  1R7H A;  1YZX A;  1A8Y A;  1GTI A;  5IMF A;  3IE3 A;  3GX0 A;  5G5F A;  1VF1 A;  1MD3 A;  4GRF A;  1XWA A;  4WET A;  3UJ1 A;  5EY6 A;  4PXO A;  4MZB A;  1PKW A;  2LUS A;  3VUR A;  1OE8 A;  3EMP A;  2KP1 A;  2C3Q A;  2X99 A;  4F0C A;  3NOF A;  4WF4 A;  2VCX A;  3U5R E;  3WGX A;  2RUF A;  5ECH B;  2OT3 A;  3IXR A;  3DIE A;  5DQS A;  1AIU A;  4XRA A;  3QAG A;  4GWR A;  3KXO A;  4PNF A;  4I6X A;  4Z2R A;  5F07 A;  1K0M A;  2O7K A;  1Y1U A;  1JLW A;  4MH2 A;  3FHK A;  1T4Z A;  2HZE B;  4FO5 A;  1XW9 A;  5J3R A;  3A2X A;  4RI7 A;  3FR3 A;  1X5D A;  4KUN A;  4YQV A;  2MMA A;  3UMA A;  4IS0 A;  2DJ1 A;  4POK A;  1Q4J A;  4BWS A;  1UC7 A;  4G19 A;  3MNG A;  2QGV A;  4WKW A;  3EVI A;  2H6X A;  2OE0 A;  1TRW A;  1JZW A;  3IDV A;  3PGT A;  5JCU A;  3KP9 A;  4A5P A;  1GSD A;  2HLS A;  3HZ4 A;  2DJ3 A;  1U88 A;  3A3T A;  1X5E A;  3HMJ G;  3ZIT A;  2OAD A;  4MZW A;  5E59 A;  2GLR A;  2F9S A;  5IO0 A;  3RHB A;  1PN9 A;  1ZGN A;  1SKW B;  2OE1 A;  5HQP A;  1ZOF A;  4CHS A;  3LFL A;  2IIY A;  4HUA A;  1ML6 A;  3HVV A;  3IK9 A;  1PQN A;  2I4A A;  3HJM A;  2BMX A;  2DIY A;  1BX9 A;  4PGT A;  2YWM A;  5IIZ A;  1J9B A;  3UBK A;  3MAK A;  3FY7 A;  1KBN A;  3H4K A;  1V58 A;  1W4V A;  3HD5 A;  1ZL9 A;  4MP4 A;  4EUY A;  4KND A;  3VK9 A;  3GMF A;  4K7I A;  3WGD A;  4BVY B;  4MPG A;  1U3A A;  1YY7 A;  3GTU A;  4L0W A;  1SU9 A;  1LU4 A;  3L78 A;  1SL1 B;  1ZCP A;  4TXO A;  3ZL5 A;  4CDO A;  5CRW A;  1TRV A;  3QDN A;  5A34 B;  1SJI A;  2KLX A;  4NHW A;  3R2Q A;  4BVX B;  1M9A A;  2PU9 C;  1BF5 A;  1XVQ A;  4XS4 B;  2I9H A;  1IYI A;  2DLX A;  5CNW A;  2C0E A;  3SWL A;  4MDC A;  4KGI A;  1OC9 A;  5ECQ B;  4USS A;  2XBI A;  1UVZ A;  4MJB A;  1AQW A;  1VGL A;  1J0F A;  1A2L A;  2N5A A;  2NVL A;  1F9M A;  1QK8 A;  2O8V B;  3I69 A;  4GST A;  2ZNM A;  2L6D A;  2NDO A;  2GZP A;  3LEF A;  2GST A;  4TR0 A;  1T1V A;  2QKE A;  1XWG A;  4L5O A;  2HFD A;  2ZUP A;  4EL1 A;  1DBY A;  2LJR A;  3NIV A;  4K0N A;  4IJI A;  3HJP A;  1M2B A;  1A2J A;  1ERW A;  3V1W A;  2E2G A;  4AJ8 A;  2OKA A;  1GWC A;  2CAI A;  3UEM A;  3TOT A;  4HZ4 A;  4AKH A;  4GLT A;  4GSS A;  1T3B A;  3CRU A;  1M0U A;  13GS A;  4MZC A;  3BCI A;  3E9J B;  3QFB C;  2JU5 A;  4KH7 A;  2J9H A;  3CXG A;  1R4W A;  4PQH A;  1V9W A;  1XPV A;  1B9X C;  1PGT A;  3MWH A;  3GYK A;  2HYX A;  5IOW A;  1B8X A;  19GS A;  4PUF C;  1GP1 A;  4YAP A;  2GQM A;  4O5Q A;  4HZ2 A;  3L9V A;  4O5R A;  1TP9 A;  1N25 A;  1WPI A;  1O6J A;  5A5H A;  1M2A A;  2V32 A;  2LRN A;  2LKU A;  1XBS A;  3ZTL A;  3J7Y k;  3HHV A;  4P3Y B;  1BAY A;  1T00 A;  2H19 A;  5FT3 A;  3GSS A;  2YOI A;  2RM5 A;  3KMO A;  1J08 A;  1C72 A;  4TR3 A;  4K7N A;  1Q98 A;  5H5R A;  7GSS A;  1EZK A;  4HU7 A;  2HRK B;  3UVT A;  5A1N B;  1PL2 A;  2WUL A;  1HD2 A;  2VL3 A;  5ID2 B;  4HOJ A;  4GQC A;  4BPY A;  4KDX A;  2B7J A;  4KW6 A;  1SL2 B;  1O85 A;  1QQ2 A;  1A8L A;  3D5J A;  3ZFB A;  3RPP A;  4X43 A;  1FVJ A;  4EKZ A;  1S3C A;  2RLI A;  1ZMA A;  5J9C A;  3TKQ A;  3KM6 A;  3LXT A;  1QXH A;  6GSX A;  2H72 A;  2B3S A;  3DEX A;  1URM A;  3P8W A;  1MEK A;  4DSR A;  3TRX A;  3QAW A;  2R5G A;  1K0D A;  5ECN B;  1AAZ A;  5HR1 A;  1TK5 B;  3TKS A;  5LCZ A;  17GS A;  2HQT A;  3VI7 A;  4OWY A;  1G0T A;  2DMM A;  4EC0 A;  1GTA A;  3EMX A;  3CMI A;  4AKX B;  3TRP A;  3Q74 A;  2YAN A;  2YZU A;  1ACV A;  2NTO A;  2REM A;  2K9F A;  3DXB A;  2H01 A;  2VLT A;  4MF7 A;  2GSQ A;  2WJU A;  2MZC A;  1TXX A;  4Q5N A;  1IYH A;  2V6K A;  2NPB A;  4E8E A;  5F8B A;  4DEJ A;  10GS A;  4MH3 A;  2VD0 A;  3KJY A;  2HSN A;  9GSS A;  1XWK A;  1G7O A;  2AV4 A;  6GSV A;  5HR2 A;  4WXT A;  3F4T A;  3TKS E;  4D73 A;  2IPA A;  1FOH A;  1GSQ A;  2JZS A;  1G6W A;  2VCW A;  5IMC A;  1O8W A;  2JZR A;  4YAV A;  2I1U A;  3L9S A;  1FHE A;  3TOU A;  3EU3 A;  1XOA A;  4IQ1 A;  3I43 A;  1OKT A;  3GUS A;  4CY6 A;  3FMW A;  1MDK A;  3L4N A;  4N30 A;  2P0G A;  5BMU A;  1YDK A;  2RM6 A;  2Z9S A;  5JWR B;  2DSA A;  4KB3 A;  1Z6M A;  1GUL A;  1M99 A;  3M3M A;  4NHZ A;  3QOU A;  4IJ3 A;  2AHE A;  1K0A A;  2LNT A;  3ME8 A;  4OO4 A;  1SJ6 A;  3S9F A;  2WCI A;  11GS A;  4G01 A;  1BG5 A;  2DML A;  5DJM A;  2C8U A;  1T4Y A;  5LD0 A;  3EU4 A;  2GQK A;  3CYN A;  2VIM A;  4G2E A;  3ZRD A;  1T8E B;  2CT6 A;  2VUP A;  16GS A;  3A5I A;  4N11 A;  3O76 A;  2L57 A;  1X5C A;  2H1A A;  2X64 A;  2H1D A;  3BOA A;  1EOG A;  2VL2 A;  1SD8 A;  1F3B A;  4LL1 B;  5CYY A;  5D9V A;  4HJM A;  3EWL A;  2DBC A;  2A2R A;  1EP7 A;  3QAV A;  2VM2 A;  2HRF A;  3QD9 A;  2LJA A;  1YKA A;  2FWH A;  3IAS 2;  4JZQ A;  3QMX A;  2IFQ A;  5J47 A;  18GS A;  5IPG A;  3CSJ A;  3WYW A;  3EUR A;  4MJA A;  1ST9 A;  4RQX A;  1MTC A;  4L5L A;  3O6T A;  3M9J A;  2FWF A;  4Z2U A;  1FVK A;  1K3L A;  4L8E A;  3F0I A;  4GQF A;  5D8I A;  2H76 A;  4DSS A;  2KOK A;  5INY A;  1SK2 A;  3L9U A;  4TW5 A;  4W66 A;  4YH2 A;  4XRD A;  2FWG A;  2O5V A;  1Z7P A;  1ZYN A;  4FH8 A;  4ECC A;  2JAD A;  2IMD A;  4K5R A;  1JHB A;  2XPD A;  3IBH A;  3IRA A;  2CV4 A;  3KH9 A;  2HSM A;  4PNG A;  2FGX A;  2GZY A;  4ML6 A;  4ML1 A;  5G5E A;  2WB9 A;  2ON5 A;  3PH9 A;  1TU8 A;  1SVL A;  2EFE A;  2WS2 A;  3TKS C;  4ICY A;  1YF0 A;  2VAF A;  4BL7 A;  4EDZ A;  4TRX A;  4KDU A;  4ZBB A;  3DD3 A;  2V41 A;  2C0F A;  3WT2 A;  2O87 A;  4YKF A;  3UVH A;  1F37 A;  3FEU A;  3GTU B;  2GTU A;  2VCV A;  2JSY A;  2HT9 A;  5ECS A;  3F4R A;  4EXJ A;  3ZRE A;  2YN1 A;  5HFG A;  2H75 A;  1OYJ A;  3UIW A;  1HNA A;  4KSM A;  3HJO A;  3BJ5 A;  4KCA A;  3LXZ A;  3UBL A;  4E68 A;  1TTZ A;  4AGS A;  2FD3 A;  3G7I A;  3WD6 A;  4O32 A;  4IQA A;  3C71 A;  1AXD A;  2LS5 A;  4MF6 A;  3OR5 A;  1PSQ A;  2A4V A;  4RUV A;  6GSS A;  3FK8 A;  5B6M A;  3F6F A;  2O85 A;  4ZB8 A;  2I81 A;  3ED3 A;  2H1B A;  3TKR A;  2H1G A;  5D73 A;  4PUR A;  3C8E A;  1H4O A;  4HQS A;  4YKG A;  3A2V A;  1HNB A;  2WDU A;  3ZIV A;  4MPF A;  3GHA A;  3HCZ A;  3FR9 A;  12GS A;  1XXU A;  4POM A;  3PR8 A;  1HNC A;  2C80 A;  1Z6N A;  4J56 E;  2C1Y A;  3ZYW A;  2CZ3 A;  1VF2 A;  4YQM A;  3E3E A;  5J41 A;  2WRT A;  1R5P A;  4V1A g;  1TK8 B;  1GL8 A;  4K1F A;  2L5L A;  1XCC A;  5ENU A;  3IR4 A;  1PA3 A;  5IOX A;  4ECI A;  2DJ0 A;  4FYB A;  4BWQ A;  5JWO B;  2LQO A;  1WRY A;  1SKS B;  1VF3 A;  1ZYE A;  3F3Q A;  4G0K A;  2RUE A;  2C4J A;  2H0H A;  5A4U A;  1XWC A;  5C00 A;  3GRX A;  4GDF A;  3GH9 A;  4GTU A;  5CRG A;  3RAZ A;  2R0C A;  1B4Q A;  4POL A;  1X9M B;  2E2M A;  5D9T A;  2FUG 2;  3A2W A;  2CVB A;  4X0X A;  2GSS A;  1N8J A;  5FWG A;  4G9H A;  3M9K A;  3LJR A;  3W8J A;  1TXU A;  4EE0 A;  5FHI A;  5DJL A;  2L4C A;  5ABR A;  4OFT A;  5ECM B;  1X0R A;  4MAB A;  1QGV A;  2HXK A;  3F3R A;  3KD0 A;  2WGR A;  4IW9 A;  2VOC A;  1R5A A;  4K8M A;  5G1K A;  3IC4 A;  3IHQ A;  4ZXG A;  2R2J A;  1YEP A;  5F05 A;  2QSI A;  5ECI B;  2AYT A;  3MIX A;  3CSH A;  1NM3 A;  5LNK e;  3GA4 A;  1TOF A;  22GS A;  3KZQ A;  1Z7R A;  4NV2 A;  4DVC A;  2KP2 A;  1WMJ A;  1GSS A;  2CA8 A;  3RBT A;  3UAR A;  5D9W A;  1F3A A;  2K6V A;  4CY8 A;  4F03 A;  1KTE A;  1SYX A;  2IJY A;  3HKR A;  4XHM A;  3RHC A;  4TR4 A;  5IQY A;  2X8C A;  2F51 A;  5DCH A;  4IGJ A;  1K0B A;  2FCH A;  2XC2 A;  3GV1 A;  4J2F A;  2VO4 A;  1SEN A;  3E0U A;  3ZVJ A;  2B5E A;  4Z7X A;  1K0C A;  1AUC A;  2CVD A;  2PVO C;  1HQO A;  3FZ5 A;  2VLU A;  3R3E A;  2YV9 A;  2D2Z A;  3HZ8 A;  3WGE A;  3GKM A;  4D73 B;  2B1L A;  3KTB A;  5B8B A;  2PVQ A;  4BVY A;  1PX6 A;  1USB A;  2MBT A;  2JL4 A;  5IMD A;  2V1M A;  5HR0 A;  4OMV A;  1SJZ A;  1VF4 A;  4ACS A;  3LG6 A;  4BVX A;  2AAW A;  4AKG A;  3DGQ A;  5CRD A;  4EO3 A;  4L0U A;  1DSB A;  2GZZ A;  4LA1 A;  5DDL A;  1GUH A;  2OA7 A;  5H5Q A;  3VWV A;  4AF2 A;  3WT1 A;  3P7X A;  1R26 A;  2J23 A;  3J7Y b;  4JR4 A;  4XCS A;  4EF0 A;  4Q5R A;  1GSY A;  3KMN A;  3GKX A;  1RW1 A;  5EVO A;  3FW2 A;  2LV3 A;  1G6Y A;  1CQH A;  1XZO A;  1V40 A;  4IP1 A;  3EIN A;  3EYT A;  2H30 A;  2OAC A;  1SK1 A;  2BJX A;  1ILO A;  4X4J A;  3SBC A;  4Z2T A;  3LGC A;  3TJB A;  1WIK A;  1JZD A;  2I3Y A;  3C1R A;  3VWW A;  1GSU A;  1SL0 B;  3F63 A;  1O8X A;  5KN2 A;  1GRX A;  2VL9 A;  3DML A;  2H6Y A;  4LLR A;  5J40 A;  2QA1 A;  2MMO A;  2LTK A;  3N9J A;  4WBR D;  2CAQ A;  1A2M A;  1YF1 A;  2LQQ A;  4QQ7 A;  2MMN A;  2X8G A;  4NV5 A;  3IHG A;  2DJJ A;  3ERG A;  1GTB A;  2AUV A;  1YJ6 A;  2PMT A;  1FW1 A;  1N2A A;  2LRC A;  4KX4 A;  3US3 A;  2EIO A;  4QL7 A;  2OE3 A;  3IC8 A;  1KNG A;  4F9Z A;  1WP0 A;  3ISO A;  4MF5 A;  3GKN A;  2R6K A;  1EP8 A;  1K0N A;  4X1U A;  1ABA A;  1JZO A;  4PX1 A;  5B7C A;  2PBJ A;  3Q18 A;  2HRK A;  1VRS D;  5A1N A;  5IMZ A;  3ME7 A;  4OCF A;  2H0I A;  3HA9 A;  5ID2 A;  2HSM B;  3QR6 A;  4JED A;  2XPE A;  4ILF A;  5CRE A;  2EC4 A;  4OO5 A;  5A4V A;  4TOP A;  2CX3 A;  2LNS A;  4BL7 B;  1SVO A;  4NPB A;  2IWT A;  2PPT A;  3N5O A;  1K3Y A;  1BYE A;  3ZLP A;  3CTG A;  3VPQ A;  1U87 A;  4GF0 A;  4XIH A;  3BD2 A;  2MYG A;  3D4M A;  1I5G A;  2GS3 A;  2JSZ A;  1LBK A;  2M72 A;  3I9V 2;  2DIZ A;  6GST A;  2DC5 A;  2H0G A;  4BA7 A;  5AN1 A;  3Q19 A;  4MJE A;  1YQ1 A;  4KE3 A;  3ERF A;  3O3T A;  5IMV A;  2EIQ A;  4QL9 A;  2C0G A;  2FHE A;  2CVK A;  5ECO B;  4ZIL A;  2H70 A;  4K2X A;  1TW9 A;  1NHO A;  3CSI A;  4KAE A;  3L0H A;  2CZ2 A;  2HRN A;  2L5O A;  3QPM A;  3KGK A;  1TRU A;  2V2G A;  3APQ A;  3W8S A;  2R4V A;  5ECP B;  5AIV A;  2B5X A;  4NWY A;  3LWA A;  3TKP A;  1XW5 A;  3D4T A;  3LSZ A;  1WJK A;  3Q6O A;  1Z9H A;  2UZ8 A;  3CWG A;  4ULX A;  2EFH A;  5D9X A;  5J4Y A;  1A0F A;  2H6Z A;  5G2Z A;  1NHY A;  2AB6 A;  2R0P A;  1O7U A;  1AQV A;  5HFI A;  2E7P A;  1H75 A;  4ISD A;  2QA2 A;  5DCG A;  3LOR A;  4V2M A;  5EPF A;  3FRC A;  4N0Z A;  4TVE A;  2YP6 A;  1B4P A;  5DBQ A;  3C73 A;  2JAC A;  1TI1 A;  2YWO A;  3FKF A;  3HYP A;  3M0F A;  5GSS A;  3RDW A;  3TJF A;  5IMA A;  5H5S A;  4AJ7 A;  3GH6 A;  5KEJ A;  3D6I A;  1QFN A;  5ECL B;  2YZH A;  5AGY A;  3GN3 A;  1ZZY A;  4RI6 A;  4LL4 B;  2YCD A;  2YNX A;  5KOW A;  3DVX A;  3HXS A;  2XHF A;  2M46 A;  5B8A A;  2P31 A;  1FB0 A;  5BRT A;  4JRR A;  5KN3 A;  1DUG A;  4WEY A;  2WFC A;  4QMK A;  1GH2 A;  4HDE A;  4I2T A;  1EEJ A;  1OAZ A;  4WR5 A;  1A23 A;  3KTL A;  2KUC A;  2H73 A;  5KN0 A;  1DE1 A;  1JZR A;  5JCW A;  3D0Z A;  3GL3 A;  1KEB A;  4TXO B;  5KN1 A;  3H93 A;  1GNW A;  4I2U A;  2DJ2 A;  3MSZ A;  1JLV A;  3LYK A;  2GVP A;  3H79 A;  2FNO A;  4ZB7 A;  3CRT A;  2ES7 A;  1PMT A;  2P5Q A;  1OKD A;  2N5B A;  4ZBA A;  2DJK A;  1OC9 B;  4TR1 A;  5JWQ B;  1Z5Y E;  2OBK A;  1TK0 B;  2VCQ A;  3IK7 A;  2FY6 A;  2X8H A;  2MBS A;  1BJX A;  3GL5 A;  3EC3 A;  3ZIJ A;  1U3I A;  4OD7 A;  2QC7 A;  2LRT A;  4FYU A;  2EIR A;  1EGR A;  3TDG A;  5J4V A;  2IMF A;  2XBQ A;  5IO2 A;  5A4W A;  3UOM A;  8GSS A;  4MMM A;  1SD9 A;  2F8A A;  2H74 A;  1A24 A;  4ZB9 A;  1F2E A;  1GUK A;  5G1L A;  1V57 A;  2OJL A;  1V98 A;  4LMV A;  1YVL A;  3ZMK A;  3FZA A;  4ZB6 A;  1PRX A;  4ZL9 A;  1GLP A;  5DAK A;  1LJR A;  5G30 A;  4K0G A;  2ON7 A;  5ECR B;  2FWE A;  2LJK A;  3GKK A;  1XFL A;  1AW9 A;  2B6M A;  1WOU A;  5F0G A;  2IMI A;  1RQM A;  3FZ9 A;  4XS1 A;  4ECJ A;  4MA9 A;  4PQI A;  5DAL A;  4IP6 A;  5ELG A;  1NW2 A;  2AJQ B;  2FA8 A;  3I6A A;  4HJ2 A;  4K5S A;  3MDK A;  4MK3 A;  1SKR B;  5DQY A;  1EV4 A;  2R3X A;  4FIW A;  2VL2 C;  1MD4 A;  1EGO A;  3IOS A;  4HU9 A;  2C3N A;  2B1K A;  5A5H B;  2H71 A;  1TKD B;  4G10 A;  2NBS A;  4JU5 A;  1I9D A;  4PQ1 A;  3DRN A;  3GIX A;  4G0L A;  5D96 A;  1EV9 A;  3APS A;  1O73 A;  1T7P B;  1JFU A;  3EE2 A;  1B9Y C;  5DVB A;  3IPZ A;  4N3Z A;  1UA5 A;  2WZ9 A;  3ZZX A;  4PTS A;  2G2Q A;  5CP1 A;  5EL8 A;  4KCE A;  6GSY A;  2EFC A;  3KCM A;  1V2A A;  3VWU A;  3LQ7 A;  3VPT A;  4GCI A;  3UAP A;  2C3T A;  2LST A;  2L4Q A;  3ERW A;  3AY8 A;  1QMV A;  3H8Q A;  2HZE A;  2KHP A;  4IBP A;  4O5U A;  2RII A;  4I97 A;  2B5Y A;  1Z3E A;  3KIJ A;  1QUW A;  1WE0 A;  5C04 A;  3VFI A;  3C1S A;  2F8F A;  4J57 E;  4N0V A;  3EPT A;  2X4A A;  1THO A;  3TCO A;  4E8H A;  2YJH A;  4NAX A;  3M1G A;  1ERT A;  3TJK A;  3P2A A;  1U6T A;  4WF5 A;  1OE7 A;  3F6D A;  3D21 A;  3IAM 2;  1PX7 A;  2IN3 A;  2YPM A;  3MYD A;  1WWJ A;  5J4U A;  4HS1 A;  4RQR A;  1GUM A;  3LYP A;  5CAX A;  2F3M A;  2UV8 G;  3DKS A;  4KF9 A;  5GZZ B;  4NMU A;  2YV7 A;  1ERV A;  1PKZ A;  1XW6 A;  1E2Y A;  2LEG A;  1EWX A;  2HZF A;  1M2D A;  5KOX A;  3G7Y A;  4IN0 A;  4LMW A;  4JBB A;  1TI3 A;  4EIQ A;  2HSN B;  2N5F A;  3F9U A;  3M8N A;  2IME A;  5AIS A;  3GNJ A;  2VD1 A;  5COH A;  1SK0 A;  3FYG A;  3HDC A;  2DKH A;  2TRC P;  4PUA A;  1HYU A;  3CBU A;  2ZCT A;  2L59 A;  4ECB A;  2A4H A;  2VCZ A;  5A34 A;  4V1A p;  1FO5 A;  3QCP A;  1XIY A;  1EEM A;  4XS4 A;  2PWJ A;  3C7M A;  5BMU B;  2PN8 A;  5E4W A;  3BCK A;  1FG4 A;  5J9B A;  1S3D A;  2TRX A;  3VI5 A;  2K18 A;  4H86 A;  4IKH A;  4ZL8 A;  1AQX A;  2O89 A;  4F82 A;  2R37 A;  4TN8 A;  5B6N A;  3DWV A;  5IPH A;  1W89 A;  1THX A;  3TU3 B;  14GS A;  1FAA A;  3DVW A;  4G0I A;  4CW9 A;  2HE3 A;  3TUE A;  1XWB A;  5J5N A;  1AC1 A;  3H1N A;  4MLY A;  3TJJ A;  3U6V A;  4MNN A;  2HI7 A;  2VM1 A;  4Q5F A;  2PUK C;  2A2P A;  4NXI A;  2C0D A;  4ZIJ A;  3FR6 A;  1DE2 A;  1FB6 A;  4TXV A;  2IMK A;  1ZYQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...