3RBTA

Crystal structure of glutathione s-transferase omega 3 from the silkworm bombyx mori
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
230
structure length
230
Chain Sequence
VIPPPALTDKLRLYHVDMNPYGHRVLLVLEAKRIKYEVYRLDPLRLPEWFRAKNPRLKIPVLEIPTDQGDRFLFESVVICDYLDEKYTRHTLHSHDPYVKAQDRLLIERFNELIKGSLECFDTNFAFGSEQIIQTLEIFEKELTNRGTNYFGGNRPGMLDYMVWPWVERLYLLRCVNDRKFVEKKSLFPNFADWGDQMQLDDIVKKHAHSPQEYFDYYKNARAHSMGYYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione transferase o1
publication title Structure-guided activity restoration of the silkworm glutathione transferase Omega GSTO3-3
pubmed doi rcsb
source organism Bombyx mori
molecule tags Transferase
total genus 73
structure length 230
sequence length 230
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2011-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3rbtA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3rbtA01
4TN8A 2PVOC 3JCML 5IOXA 3MNGA 4AJ7A 1YZXA 1OC9B 5DCGA 1BAYA 1DE1A 4HQSA 2LJKA 3D4TA 2ES7A 1NM3A 3DRNA 1B8XA 4EDYA 1I5GA 4V2MA 2IMDA 1A23A 2VM2A 2CA8A 2GTUA 3F6FA 1HYUA 5CRDA 1X5DA 3I6AA 1B4PA 4K0NA 4ZILA 5FT3A 2HQTA 4ID0A 4KSMA 3IAS2 5ELAA 1OE7A 1MDIA 2B7KA 2V41A 2VOCA 4HS1A 1F37A 1X9SB 5J4UA 1W4VA 3EVIA 4ZB8A 2JU5A 4HOJA 2ON7A 1GSSA 2VCTA 2YJ7A 2H8LA 3RHBA 2I4AA 4I6XA 1GULA 5J9CA 2ZNMA 4MH3A 4XRDA 3TJKA 2H70A 2L5OA 3J7Yk 4G19A 1GSEA 3FK8A 3W8SA 3EU3A 4E8EA 4TXOA 4GTUA 2H1GA 1YKCA 3ZLPA 3FR3A 4O5RA 2AAWA 3LGCA 3IDVA 4MF5A 1PMTA 3ZMLA 2A4VA 1XBSA 1QK8A 2OE1A 1MEKA 2L4QA 3K8NA 3CRTA 5ID2B 2AV4A 4BPYA 1KBNA 5KN2A 12GSA 1QFNA 4ZBBA 3TGZA 3I9V2 1ZCPA 5G31A 2E0QA 3FY7A 2KP1A 5E59A 4JR4A 3GL5A 2PGTA 2I3YA 2NTOA 2H6YA 1TOFA 1XW5A 1XW9A 5AN1A 1T7PB 3TRQA 2P5QA 1OC8A 1TRSA 3F8UA 2CAIA 3R2QA 4KH7A 5ECPB 3QOUA 1FO5A 1TI1A 3ED3A 5GSSA 1VRSD 4OD7A 1SYRA 4PURA 4DEJA 1T4YA 5DBQA 2GZYA 1B48A 3A2VA 3TKSA 3APQA 2OA7A 3TKRA 4ZL9A 3LYKA 3GMFA 4K9ZA 2WULA 2OE3A 3EYTA 2GZZA 1W89A 5EPFA 1R5AA 2FD3A 1GUMA 3FR9A 4Q5RA 2H73A 2LRTA 4MA9A 4PXOA 1FHEA 3CXGA 4MLYA 1HD2A 2YANA 4PGTA 1ZZYA 1SKSB 2YCDA 4BVYA 5HR3A 1GH2A 4PUAA 4LL1B 1EZKA 3L9SA 1N8JA 4J2FA 1SU9A 3HA9A 3QAGA 2RUEA 5DQSA 1VF4A 4BL7A 3C73A 5B6NA 1BJXA 4K7IA 1GNWA 3BD2A 2V6OA 4EL1A 1SD8A 3UBLA 2MMAA 3I43A 4N10A 3FZ4A 4BA7A 5ELGA 5G5FA 3IRAA 1GTAA 3LG6A 4RQXA 3IK9A 2B5EA 3GYKA 1EOHA 2PMTA 4BWSA 5CRWA 3OR5A 3DYRA 3UEMA 2B1KA 4G10A 18GSA 4DSQA 4HZ2A 4IJIA 5ECLB 1FG4A 3BBYA 3LEFA 2AHEA 1PL2A 2BJXA 1MD4A 5DAKB 1BYEA 2M72A 1J9BA 2R2JA 1XWCA 1GSUA 1O85A 2OBKA 3HVSA 3M1GA 1XIYA 5IM9A 3IAM2 4D73A 3O6TA 6GSWA 2VUPA 4LMWA 2MZCA 4ML6A 4K0GA 3IA1A 1XOBA 2VCQA 1PX6A 3D21A 2WB9A 3TCOA 3FZ9A 2LKUA 3MWHA 1U3IA 1X5EA 1U87A 4ECBA 4HU7A 3G7JA 1EOGA 2DC5A 3CTFA 2AB6A 4ECCA 4BVXB 2I9HA 4TR1A 4L0UA 3PINA 1WPIA 4RQRA 1GTUA 4OFMA 5LNKe 1U6TA 3BCIA 1V40A 3VPQA 3QAWA 1URMA 3ZL5A 2PPTA 4WETA 2FHEA 2DJ2A 3KH9A 1ACVA 1HNAA 1M7TA 3ZYWA 2K9FA 4FO5A 3GUSA 3CBUA 2YWMA 2C8UA 1GLQA 2HSMB 3ZIJA 4L8EA 1SKWB 2YV9A 4F2IA 4XIHA 4HZ4A 2HNLA 2HRAA 2R6KA 4TR1B 1O6JA 3UJ1A 1SJIA 4NV5A 3UAPA 2MBTA 3EU4A 2B7JA 1K0CA 2C3QA 2FCHA 4IP6A 3W8JA 4NAXA 3TB2A 4G0KA 2F8FA 5B7CA 4PQHA 3IXRA 2H19A 2WFCA 2VCWA 1Z7RA 3D22A 1GSYA 4X43A 5COHA 3LXZA 1TRUA 2OE0A 2I81A 5HQPA 4MK3A 1F9MA 1TXXA 2VLUA 1DUGA 2IFQB 5H5QA 2VO4A 1PRXA 4IGJA 3MAKA 4YAPA 1GWCA 2HRFA 4FQUA 3A3TA 1GRXA 1SENA 2XPEA 4ECJA 2VCZA 4KA0A 3UARA 5J41A 3FKFA 4KGIA 2CX4A 1M9BA 3HVVA 1DSBA 1AC1A 2DJ1A 4N0VA 16GSA 5AIXA 2CQ9A 2ON5A 3UL3A 1O73A 1AIUA 4MPGA 1UVZA 1K0DA 4TXVA 1K0BA 2DLXA 3IPZA 4G9HA 2C3NA 4EXJA 2AJQB 5IIZA 2HSHA 5LD0A 4PUFC 3F6DA 1FVJA 5JCWA 4V1Ag 3M0FA 1PL1A 1T00A 2O87A 4E8HA 3TKQA 3W6GA 3FHKA 3CSJA 3N5OA 4Q5NA 4O92A 1A8YA 2CT6A 1T3BA 1G6WA 4F9ZA 1FB6A 4XS4B 2CVBA 3TKSE 3HYPA 4FH8A 3LSZA 4TR3A 1EWXA 3C71A 4RUVA 5JCGA 1GSDA 4AGSA 1H4OA 2C3TA 4N11A 5ECQB 3DGQA 2O89A 3DMLA 2GQKA 4DSSA 3HCZA 2L6DA 2VL2C 2FWGA 1A2LA 3HKRA 5CAXA 3HJMA 1OVNA 1TW9A 1NHOA 3VLNA 5CRGA 4ZBAA 3M3MA 4OMVA 2KP2A 2X8GA 1Q4JA 4V1Ap 1GNEA 2FA8A 3H4KA 2WJUA 3BJ5A 1MDKA 1AXDA 3Q6OA 1CQHA 1SK2A 1NSWA 1G7OA 4K6XA 3PGTA 4CW9A 4CHSA 2PERA 1ZYQB 3GTUB 2C1YA 5JWRB 5C04A 4G0LA 1T1VA 1XZOA 3LJRA 4F82A 4TRXA 4TW5A 3DKSA 4IJ3A 2ALBA 6GSSA 3GNJA 3FRCA 2UZ8A 2LJRA 3LQ7A 1EV4A 3TRXA 3P2AA 1JHBA 5IMCA 2VD0A 1Z6NA 3AY8A 3TOTA 4AF2A 3ME7A 4WF5A 1K3YA 3TJFA 3ZVJA 5IO2A 2LEGA 1EGRA 1E2YA 5CO3A 2PUKC 4I5QA 1EEMA 4GSSA 3U5RE 4G0IA 4TKYA 3APSA 3A2XA 2PN8A 2IMKA 5JCUA 4ECIA 5IO0A 2PWJA 4KE3A 11GSA 2JSZA 3DXBA 5BMUA 1FOVA 4HQZA 2NPBA 3KMOA 4DVCA 2VLVA 4ISDA 4OCFA 2WGRA 1OKDA 3IC4A 2CZ2A 1GUHA 1R26A 2ZUPA 4HDEA 4FYUA 1PKWA 2LQOA 4K2DA 2H75A 1J0FA 1PKZA 2FGXA 4MJAA 1Y25A 5FWGA 2A2RA 1YY7A 2DJJA 2P0GA 4YQMA 3KM6A 2RLIA 1VF1A 1MD3A 5IMDA 5JWQB 2M46A 2H66A 3KEBA 4GWRA 9GSSA 1YF1A 3DD3A 3F0IA 4WBRD 2G0FA 1QUWA 2V6KA 1ERTA 2WCIA 5DJMA 3FYGA 1O8XA 5A4UA 2B1LA 1M0UA 5JWOB 2H0GA 1XVQA 2J9HA 6GSXA 1SK0A 2JSYA 3F3QA 1TJDA 2OKAA 3M9JA 4TXOB 1R5PA 5IMFA 2MMOA 5F07A 3SWLA 4KSOA 4POLA 4KDUA 3QDNA 5D93A 2DMMA 4GSTA 2H1DA 5GAPD 4JZQA 2VLTA 4IKHA 1A2MA 1JLVA 2RUFA 4O32A 5CP1A 4LLRA 2GVPA 4TR4A 4WBJA 5KN0A 4IP1A 2CVDA 4XS1A 5F06A 4NWYA 3VWVA 4OCEA 4Q5QA 1AUCA 3E0UA 1TU7A 4EVMA 4EUYA 2EIOA 2OBIA 3GX8A 2MYGA 2IMIA 3C8EA 1OAZA 3L9UA 3IHQA 2EIRA 3GL3A 3ERFA 4FIWA 3WGXA 3US3A 1T4ZA 5J5NA 3RPPA 5ECSA 1K0NA 5DVBA 1GTBA 3PR8A 2HRKA 4WR4A 5ECMB 1ZGNA 4L5LA 2I1UA 5H5SA 4EO3A 1X9MB 4Z7XA 4RI7A 2HZEA 4F03A 2P31A 3DIEA 1ST9A 3O3TA 1MDJA 1XWGA 2H6XA 3ZTLA 3V1WA 2V32A 3BOAA 5CNWA 3FW2A 4BVYB 1DE2A 1PSQA 1M9AA 4I97A 2GZPA 1XWAA 3GSSA 1K0OA 2FWFA 3KGKA 2XC2A 1A0RP 1TP9A 1EV9A 2VL2A 4BL7B 3IOSA 2LTKA 3ZITA 2C80A 1PX7A 1BQ7A 3HZ4A 1LBKA 4I2TA 2TRCP 4WEYA 1BX9A 3VWUA 3TRPA 3TDGA 3O76A 2H72A 3WD6A 3G7IA 2AUVA 3MSZA 2GSSA 5GSTA 2TRXA 4KCAA 5DALA 1ML6A 1PA3A 4GRFA 2LRCA 3CMIA 3GFKA 2H6ZA 1HNBA 4H86A 14GSA 1WWJA 3ZFBA 2C0DA 1JZWA 2DBCA 2KHPA 4DSRA 5EVOA 5AISA 2B6MA 1BEDA 3GKNA 4J56E 2IPAA 4EC0A 2X8CA 3CTGA 2V1MA 5KEJA 2YP6A 4D73B 1ERWA 1WIKA 1XWBA 3LWAA 5ECHB 3LFLA 7GSSA 2NBSA 5D9VA 2VM1A 2JZTA 3GKMA 4PNFA 1PN9A 2YWIA 3GKXA 3ERGA 1RQMA 5ECRB 2N5FA 1R4WA 1OC3A 2HFDA 1JZRA 1C72A 2YV7A 5L71A 3F4SA 1G0TA 2JADA 2B5YA 1CQGA 1AW9A 3P7XA 4XHMA 1M99A 2YOIA 2DSAA 3A5WA 1M2AA 1TKDB 1O7UA 2VL9A 2J23A 3IC8A 3UMAA 4FYCA 5IPHA 4ULXA 3ZVJD 1S3AA 3QFBC 4KF9A 2AYTA 3HJPA 1HNCA 3VWWA 4JR6A 4HU9A 1OKTA 2N5AA 17GSA 1F3AA 2OJLA 4IQ1A 1AQWA 4K7OA 3F4RA 5GZZB 4N30A 5B8BA 2FLSA 5D8IA 1GP1A 4ZIJA 4OFTA 2V2GA 4YQUA 1QMVA 1VGLA 3RBTA 1WJKA 3KH7A 2O8VB 2M80A 2A2SA 2Z9SA 2G2QA 10GSA 2LSTA 5DDLA 2MMNA 3VWXA 6GSVA 1GLPA 2K6VA 4OFNA 2X8HA 4MJCA 2XHFA 4IN0A 4NV2A 4ML1A 3D5JA 1RK4A 1USBA 4Q5FA 3TOUA 1F3BA 3ZREA 2JZRA 2K18A 2L6CA 3GN3A 3H8QA 3WYWA 1ZL9A 3IK7A 3KD0A 5KN3A 2KLXA 1YEPA 2D2ZA 1JLWA 2GSRA 5IOWA 4BWQA 3QAVA 3TJJA 2GSTA 3F3RA 2H1AA 1ZYEA 1NW2A 1ZMAA 4KCEA 1VF2A 3ZIVA 3GHAA 1EP8A 2HSYA 3KXOA 2JACA 1QGVA 3CYNA 3FZ5A 3KIJA 1LU4A 1U3AA 1M2BA 3ZRDA 3EE2A 1SK1A 3FEUA 3D4MA 2GQMA 2YPMA 1K0AA 2B3SA 1X5CA 5AIVA 1ZOFA 2C4JA 5E4WA 1XPVA 3GKKA 1KNGA 1WP0A 4ZBDA 3PH9A 3PPUA 4IVFA 4USSA 4POMA 1SL0B 4TR0A 1S3DA 5F8BA 2VCXA 3L9VA 3QFAC 4POBA 4KUNA 3QD9A 1V2AA 2GT5A 4ACSA 3LORA 4V2LA 1KTEA 4DSSB 5AGYA 2HLSA 5HFKA 3IE3A 4L0WA 4CDOA 3IBHA 4X0XA 1PQNA 1XOAA 5INYA 1M2DA 3KMNA 1SL2B 3KJYA 1OC9A 3EINA 1WOUA 4X1UA 4WXTA 1GSQA 3QPMA 4TVEA 5DQYA 4F0CA 3EWLA 1X0RA 4RI6A 4LA1A 3M9KA 1TU8A 2FUG2 3KZQA 5C00A 4ZB6A 1SD9A 1V57A 1A2JA 1ON4A 2DJ3A 4JEDA 3P8WA 1LJRA 3NZNA 1YF0A 2MBSA 3GA4A 3E3EA 2R4VA 2F3MA 3H79A 4J57E 2K8SA 1MTCA 3R3EA 2HI7A 1SJZA 1AAZA 4HI7A 2IMEA 4GXZA 3DEXA 8GSSA 5D9WA 2DIZA 3UVTA 5HR2A 2KOKA 3L78A 3WGEA 2XBIA 3DWVA 2C0EA 6GSTA 2WS2A 2E2MA 1TDIA 4FYBA 4KW6A 2IJYA 2YZUA 4OO5A 3RPNA 1SYXA 1TTZA 3TJGA 3EC3A 3VI5A 3D6IA 1TK8B 3UIWA 4JE1A 4I2UA 4HUAA 5H5RA 3KP9A 5HR1A 2PBJA 5ID2A 1AQXA 3UOMA 2H71A 19GSA 2X99A 1XFLA 3C7MA 3ZMKA 5GAND 1GL8A 5LCZA 4PTSA 3HXSA 2WZ9A 1V9WA 4G2EA 1A24A 1PGTA 4JBBA 4AJ8A 2RIIA 1R7HA 4AJ6A 4KNDA 2GDRA 5B6MA 2TIRA 4MDCA 4QQ7A 3IR4A 1A8LA 5D9TA 1ABAA 3RDWA 1UC7A 4P3YB 3TKPA 2GS3A 2O7KA 5IQYA 3GSTA 1B4QA 5A5KA 2NVLA 1KEBA 4MP4A 3CSHA 1V58A 4YQVA 5D9XA 1IYHA 1UN2A 2YNXA 2R37A 5G2ZA 3G7YA 3CSIA 1OE8A 4MZCA 3QMXA 4MMMA 2EC4A 2FNOA 5HFIA 4NHZA 4MF7A 2XPDA 2L57A 2IIYA 2LNTA 2FA4A 1Z6MA 4ILFA 2FWHA 2QSIA 1BG5A 3LXTA 3NIVA 2VIMA 2LNSA 5DCHA 2IN3A 2WRTA 2CX3A 3TUEA 3GRXA 3GX0A 5A4VA 3EURA 2DIYA 2PU9C 3DVWA 2E2GA 4ZL7A 1V98A 3HDCA 5IMVA 2CV4A 5D73A 4IW9A 2LUSA 4NPBA 1XWKA 2QKEA 3A2WA 1GSFA 3MDKA 1K3LA 3ISOA 3I69A 1G6YA 1GUKA 2LJAA 3KCMA 2B5XA 5G30A 2FY6A 2MMZA 1YDKA 3L0HA 2RM5A 1X9WB 3F63A 6GSUA 2FWEA 1JZOA 4K7NA 4WR5A 1YJ6A 2VD1A 3QR6A 1EEJA 4JRRA 1FAAA 3GH6A 4L5OA 4ZXGA 3BCKA 1B9YC 3VURA 5DAKA 1Z3EA 1VF3A 3H93A 2K8VA 4XTSA 2DJKA 3VI7A 4LL4B 1THXA 1YEXA 3WT2A 5ECOB 3HD5A 2YN1A 2HRKB 3ZFLA 2VL3A 2GGTA 2X64A 4GLTA 1QXHA 5FHIA 1SKRB 3HVXA 1S3CA 4NHWA 1TRVA 2H74A 13GSA 2E7PA 4HJ2A 3VK9A 2F9SA 3TJBA 2HZEB 5IPGA 2YWOA 1G7EA 1WRYA 4MZBA 4BVXA 2VAFA 5A4WA 2CAQA 1XW6A 1F2EA 1YQ1A 3QCPA 1Z5YE 1JZDA 4NXIA 4LMVA 5F0GA 3CRUA 2H1BA 2YZHA 3RAZA 2VCVA 2JZSA 2ZCTA 2F8AA 4QL7A 2BMXA 1QQ2A 4MCUA 5ABRA 2HSMA 1B9XC 1XXUA 5EY6A 5HR0A 3LYPA 3Q19A 3EMXA 1RW1A 2H0IA 1XCCA 2RM6A 3FR6A 2H0HA 2C0FA 3N9JA 2DMLA 2GSQA 3KTBA 5DALB 2IL3A 3C1RA 1FW1A 3NOFA 4JU5A 5IMZA 2R5GA 1T8EB 4EF0A 3Q74A 5ECNB 3ZZXA 1PD21 1HQOA 4IELA 4EE0A 3KP8A 1FB0A 1THOA 4EDZA 2N5BA 3EMPA 5ECIB 4MZWA 2R3XA 5CYYA 2IFQA 4ZL8A 3GURA 5DJLA 5J9BA 4XRAA 1Z9HA 2WDUA 4GSNA 5CREA 4KX4A 4MABA 4MF6A 1WE0A 5B8AA 1UA5A 4MPFA 2HT9A 1A0FA 4MJBA 2KUCA 3UBKA 2DJ0A 4WF4A 2HYXA 4YAVA 2LS5A 1Y6EA 4MH2A 2YWNA 1ERVA 2HRNA 1IYIA 1AQVA 2L5LA 1I9DA 1GTIA 1TK5B 4PX1A 3KTLA 1YKAA 20GSA 3TKSC 3HZ8A 5CRHA 2YJHA 2XBQA 3ERWA 4QL9A 2EIQA 1J08A 3C1SA 4NMUA 1ERUA 4IQAA 1EGOA 2GT6A 4KAEA 2IMFA 4XS4A 1K0MA 2BTOT 4OWYA 2LV3A 5EL8A 2HSNB 4PQIA 4GCIA 2P5RA 3RHCA 4I8BA 1XVWA 1H75A 4K8MA 3D0ZA 3DVXA 3APOA 4PQ1A 5J3RA 1EP7A 3ME8A 4IHUA 4OO4A 1TK0B 3HY2A 2GQLA 3J7Yb 1TRWA 4PNGA 3L4NA 4XCSA 2CZ3A 1NHYA 3GH9A 1SL1B 2OACA 4TOPA 2O85A 5G5EA 3GIXA 2HXKA 4POKA 2GLRA 4K1FA 4WKWA 2JL4A 2H30A 4GQCA 3IV4A 1FVKA 3FZAA 4IS0A 4O7HA 3Q18A 1Z7PA 5G1LA 3HHVA 4EKZA 1O81A 1Q98A 3GTUA 4IBPA 1E6BA 5KN1A 1U88A 3VPTA 5ECKB 3GV1A 3U6VA 22GSA 3M8NA 1OYJA 2IWTA 1SJ6A 2OADA 2H76A 5G1KA 3G9BA 4KDXA 3S9FA 4F0BA 4MJEA 4N0ZA 3WGDA 4KDYA 2HE3A 2PVQA 1ILOA 3UVHA 2LRNA 4YH2A 5IMAA 2L59A 4KB3A 3F9UA 2L4CA 5D96A 6GSYA 1O8WA 2F51A 3F4TA 2HZFA 3P90A 2CVKA 3E9JB 4HEA2 1N2AA 1DBYA 3WT1A 2H01A 4GF0A 5F05A 3VFIA 2QGVA 3SBCA 4XS6A 1K3OA 2REMA 5ENUA 4GQFA 4ZB9A 1TI3A 1F6MC 3HJOA 2LQQA 1WMJA 2NDOA 4HJMA 4V2NA 1JFUA 2QC7A 2C0GA 5HFGA 3H1NA
chains in the Genus database with same CATH superfamily
4TN8A 2PVOC 2WW1A 3JCML 5IOXA 3MNGA 4Z2RA 4AJ7A 1YZXA 1OC9B 5DCGA 1BAYA 1DE1A 4HQSA 2LJKA 3D4TA 2ES7A 1NM3A 3DRNA 1B8XA 4EDYA 1I5GA 4V2MA 2IMDA 1A23A 2VM2A 2CA8A 2GTUA 3F6FA 1HYUA 5CRDA 1X5DA 3I6AA 1B4PA 4K0NA 4ZILA 5FT3A 2EFEA 2HQTA 4ID0A 4KSMA 3IAS2 1S3RA 5ELAA 1OE7A 1MDIA 2B7KA 2V41A 2VOCA 4HS1A 1F37A 1X9SB 5J4UA 1W4VA 2EFHA 3EVIA 4ZB8A 2JU5A 4HOJA 2ON7A 1GSSA 2VCTA 2YJ7A 2H8LA 3RHBA 2I4AA 4I6XA 1GULA 5J9CA 2ZNMA 4MH3A 4XRDA 3TJKA 2H70A 2L5OA 3J7Yk 4G19A 1GSEA 3FK8A 3W8SA 3EU3A 4E8EA 4TXOA 4GTUA 2H1GA 1YKCA 3ZLPA 3FR3A 4O5RA 2AAWA 3LGCA 4AKHA 1I1IP 3IDVA 4MF5A 1PMTA 3ZMLA 2A4VA 1XBSA 1QK8A 2OE1A 1MEKA 2L4QA 3K8NA 3CRTA 5ID2B 2AV4A 4BPYA 1KBNA 5KN2A 12GSA 1QFNA 4ZBBA 3TGZA 3I9V2 1ZCPA 1PN0A 4CY6A 5G31A 2E0QA 3FY7A 2KP1A 5E59A 4JR4A 3MIXA 3GL5A 2PGTA 2I3YA 2NTOA 2H6YA 1TOFA 1XW5A 1XW9A 5AN1A 2WW3A 1T7PB 3TRQA 2P5QA 1OC8A 1TRSA 3F8UA 2CAIA 3R2QA 5A1NA 4KH7A 5ECPB 3QOUA 1FO5A 1TI1A 3ED3A 5GSSA 1VRSD 4OD7A 1SYRA 4PURA 4DEJA 1T4YA 5DBQA 2GZYA 1B48A 3A2VA 3TKSA 3APQA 2OA7A 3TKRA 4ZL9A 2WW0A 3LYKA 3GMFA 4K9ZA 2WULA 2OE3A 3EYTA 2GZZA 1W89A 5EPFA 1R5AA 2FD3A 1GUMA 3FR9A 4Q5RA 2H73A 2LRTA 4MA9A 4PXOA 1FHEA 3CXGA 4MLYA 5KOWA 1HD2A 2YANA 4PGTA 1ZZYA 1SKSB 2YCDA 4BVYA 5HR3A 1GH2A 5A34A 4PUAA 4LL1B 1EZKA 3L9SA 1N8JA 2DKIA 4J2FA 2OT3A 1SU9A 3HA9A 3QAGA 3CQFA 2RUEA 5DQSA 1VF4A 4BL7A 3C73A 5B6NA 1BJXA 4K7IA 1GNWA 3BD2A 2V6OA 4EL1A 1SD8A 3UBLA 2MMAA 3I43A 4N10A 3FZ4A 4BA7A 5ELGA 5G5FA 3IRAA 1GTAA 3LG6A 4RQXA 3IK9A 2B5EA 5J4VA 3GYKA 1EOHA 4ICYA 2PMTA 4BWSA 5CRWA 3OR5A 3DYRA 3UEMA 2B1KA 4G10A 18GSA 4DSQA 4HZ2A 4IJIA 5ECLB 3TU3B 1FG4A 3BBYA 3LEFA 2AHEA 1PL2A 2BJXA 1MD4A 5DAKB 1BYEA 2M72A 1J9BA 2R2JA 1XWCA 1GSUA 1O85A 2OBKA 3HVSA 3M1GA 1XIYA 5IM9A 3IAM2 4D73A 3O6TA 6GSWA 2VUPA 4LMWA 4PI0C 2MZCA 4ML6A 4K0GA 3IA1A 1XOBA 2VCQA 1PX6A 3D21A 2WB9A 3TCOA 3FZ9A 2LKUA 3MWHA 1U3IA 1X5EA 1U87A 4ECBA 4HU7A 3G7JA 1EOGA 2DC5A 3CTFA 2AB6A 4ECCA 4BVXB 2I9HA 4TR1A 4L0UA 3PINA 1WPIA 4RQRA 1GTUA 4OFMA 5LNKe 1U6TA 3BCIA 1N25A 1V40A 3VPQA 3QAWA 1URMA 3ZL5A 2PPTA 4WETA 2FHEA 2DJ2A 3KH9A 1ACVA 1HNAA 1M7TA 3ZYWA 2K9FA 4FO5A 3GUSA 3CBUA 2YWMA 2C8UA 1GLQA 2HSMB 3ZIJA 4L8EA 1SKWB 2YV9A 4F2IA 4XIHA 4HZ4A 1S4BP 2HNLA 2HRAA 2R6KA 4TR1B 1O6JA 3UJ1A 1SJIA 4NV5A 3UAPA 2MBTA 3EU4A 2B7JA 1K0CA 2C3QA 2FCHA 2H1LA 4IP6A 3W8JA 4NAXA 3TB2A 4G0KA 2F8FA 5B7CA 4PQHA 3IXRA 2H19A 2WFCA 2VCWA 1Z7RA 3D22A 1GSYA 4X43A 5COHA 3LXZA 1TRUA 2OE0A 2I81A 1M3IA 5HQPA 1FOHA 4MK3A 1F9MA 1TXXA 2VLUA 1DUGA 2IFQB 4QMKA 5H5QA 2VO4A 1PRXA 4IGJA 3MAKA 4YAPA 1GWCA 2HRFA 4FQUA 2WVXA 3A3TA 1GRXA 1SENA 4Z2TA 2XPEA 4ECJA 2VCZA 4KA0A 3UARA 5J41A 3FKFA 4KGIA 2CX4A 1M9BA 3HVVA 1DSBA 1AC1A 2DJ1A 4N0VA 16GSA 5AIXA 2CQ9A 2ON5A 3UL3A 4O5QA 1O73A 1AIUA 4MPGA 1UVZA 1K0DA 4CY8A 4TXVA 4YKFA 1K0BA 2DLXA 3IPZA 4G9HA 2C3NA 4EXJA 2AJQB 5IIZA 2HSHA 5LD0A 4PUFC 3F6DA 4O5UA 1FVJA 5JCWA 4V1Ag 3M0FA 1PL1A 1T00A 2O87A 4E8HA 3TKQA 3W6GA 3FHKA 3CSJA 3N5OA 4Q5NA 4O92A 1A8YA 2CT6A 1T3BA 1G6WA 4F9ZA 1FB6A 4XS4B 2CVBA 3TKSE 3HYPA 4FH8A 3LSZA 4TR3A 1EWXA 3C71A 4RUVA 5JCGA 1GSDA 4AGSA 1H4OA 2C3TA 4N11A 5ECQB 3DGQA 2O89A 3DMLA 2GQKA 4DSSA 3HCZA 1YEWC 2L6DA 2VL2C 2FWGA 1A2LA 3HKRA 5CAXA 3HJMA 1OVNA 1TW9A 1NHOA 3VLNA 5CRGA 4ZBAA 3M3MA 4OMVA 1ZYNA 2KP2A 2X8GA 1Q4JA 4V1Ap 1GNEA 2DKHA 2FA8A 3H4KA 2WJUA 3BJ5A 1MDKA 1AXDA 3Q6OA 1CQHA 1SK2A 1NSWA 5A5HA 1G7OA 4K6XA 3PGTA 4CW9A 4CHSA 2PERA 1ZYQB 3GTUB 2C1YA 5JWRB 1PFOA 4MNNA 5C04A 4G0LA 1T1VA 1XZOA 3LJRA 4F82A 2A2PA 4TRXA 4TW5A 3DKSA 4IJ3A 2ALBA 6GSSA 3GNJA 3FRCA 2UZ8A 2LJRA 3LQ7A 1EV4A 3TRXA 3A5IA 3P2AA 1JHBA 5IMCA 2VD0A 1Z6NA 3AY8A 3TOTA 4AF2A 3ME7A 4WF5A 1K3YA 3TJFA 3ZVJA 5IO2A 2LEGA 1EGRA 1E2YA 5CO3A 2PUKC 4I5QA 1SVLA 1EEMA 4GSSA 3U5RE 4G0IA 4TKYA 3APSA 3A2XA 2PN8A 2IMKA 5JCUA 4PI2C 4ECIA 5IO0A 2PWJA 4KE3A 11GSA 2JSZA 3DXBA 5BMUA 1FOVA 4HQZA 2NPBA 3KMOA 4DVCA 2VLVA 4ISDA 4OCFA 2WGRA 1OKDA 3IC4A 2CZ2A 1GUHA 1R26A 2ZUPA 4HDEA 4FYUA 1PKWA 2LQOA 4K2DA 2H75A 1J0FA 1PKZA 2FGXA 4MJAA 1Y25A 4N3ZA 5FWGA 2A2RA 1YY7A 2DJJA 2P0GA 4YQMA 3KM6A 2RLIA 1VF1A 1MD3A 5IMDA 5JWQB 2M46A 2H66A 3KEBA 4GWRA 9GSSA 3RGBC 1YF1A 1BF5A 3DD3A 3F0IA 4WBRD 2G0FA 1QUWA 2V6KA 1ERTA 3CHXC 2WCIA 5DJMA 3FYGA 1O8XA 5A4UA 2B1LA 1M0UA 5JWOB 2H0GA 1XVQA 2J9HA 6GSXA 1SK0A 2JSYA 3F3QA 4K5SA 1TJDA 2OKAA 3M9JA 4TXOB 1R5PA 5IMFA 2MMOA 5F07A 3SWLA 4KSOA 4POLA 4KDUA 3QDNA 5D93A 2EFCA 2DMMA 4GSTA 2H1DA 5GAPD 4JZQA 2VLTA 4IKHA 1A2MA 1JLVA 4PHZC 2RUFA 4O32A 5CP1A 4LLRA 2GVPA 4TR4A 4WBJA 5KN0A 4IP1A 2CVDA 4XS1A 5F06A 4NWYA 3VWVA 4OCEA 4Q5QA 1AUCA 3E0UA 1TU7A 4EVMA 4EUYA 2EIOA 2OBIA 3GX8A 2MYGA 2IMIA 3C8EA 1OAZA 3L9UA 3IHQA 5A1NB 2EIRA 3GL3A 3ERFA 4FIWA 3WGXA 3US3A 1T4ZA 3IHGA 5J5NA 3RPPA 5ECSA 1K0NA 4AI6A 5DVBA 1GTBA 3PR8A 2HRKA 4WR4A 5ECMB 1ZGNA 4L5LA 2I1UA 5H5SA 4EO3A 1X9MB 4Z7XA 4ZB7A 4RI7A 2HZEA 4F03A 2P31A 3DIEA 1ST9A 3O3TA 1MDJA 1XWGA 2H6XA 3ZTLA 3V1WA 2X4AA 2V32A 3BOAA 5CNWA 3FW2A 4BVYB 5A34B 1DE2A 1PSQA 1M9AA 4I97A 2GZPA 1XWAA 3GSSA 4A5PA 1K0OA 2FWFA 3KGKA 2XC2A 1A0RP 1TP9A 1EV9A 2VL2A 4BL7B 3IOSA 2LTKA 3ZITA 2C80A 1PX7A 1BQ7A 3HZ4A 1LBKA 4I2TA 2TRCP 4WEYA 1BX9A 3VWUA 3TRPA 3TDGA 3O76A 2H72A 3WD6A 3G7IA 2AUVA 3MSZA 2GSSA 5GSTA 2TRXA 4KCAA 5DALA 1ML6A 1PA3A 4GRFA 2LRCA 3CMIA 3GFKA 2H6ZA 1HNBA 4H86A 14GSA 1WWJA 3ZFBA 2C0DA 1JZWA 2DBCA 2KHPA 4DSRA 5EVOA 5AISA 2B6MA 1BEDA 3GKNA 4J56E 2IPAA 4EC0A 2X8CA 3CTGA 2V1MA 5KEJA 2YP6A 4D73B 1ERWA 1WIKA 1XWBA 3LWAA 5ECHB 3LFLA 7GSSA 2NBSA 5D9VA 2VM1A 2JZTA 3GKMA 4PNFA 1PN9A 2YWIA 3GKXA 3ERGA 1RQMA 5ECRB 2N5FA 1R4WA 1OC3A 2HFDA 1JZRA 1C72A 2YV7A 5L71A 3F4SA 1G0TA 2JADA 2B5YA 1CQGA 1AW9A 3P7XA 4XHMA 1M99A 2YOIA 2DSAA 3A5WA 1M2AA 1TKDB 1O7UA 2VL9A 5KOXA 3FMWA 2J23A 3IC8A 3UMAA 4FYCA 5IPHA 4ULXA 3ZVJD 1Y1UA 1S3AA 3QFBC 2O36A 4KF9A 2AYTA 3HJPA 1HNCA 3VWWA 4JR6A 4HU9A 1OKTA 2N5AA 17GSA 1F3AA 2OJLA 4IQ1A 1AQWA 4K7OA 3F4RA 2HSNA 5GZZB 4N30A 5B8BA 2FLSA 5D8IA 1GP1A 4ZIJA 4OFTA 2V2GA 4YQUA 1QMVA 1VGLA 3RBTA 1WJKA 3KH7A 2O8VB 2M80A 2A2SA 2Z9SA 2G2QA 10GSA 2LSTA 5DDLA 2X49A 2MMNA 3VWXA 6GSVA 1GLPA 2K6VA 4OFNA 2X8HA 4MJCA 2XHFA 4IN0A 4NV2A 4ML1A 3D5JA 1RK4A 1USBA 4Q5FA 3TOUA 1F3BA 3ZREA 2WVYA 2JZRA 2K18A 2WVXB 2L6CA 3GN3A 3H8QA 3WYWA 1ZL9A 3IK7A 3KD0A 5KN3A 2KLXA 1YEPA 2D2ZA 1JLWA 2GSRA 5IOWA 4BWQA 3QAVA 3TJJA 2GSTA 3F3RA 2H1AA 1ZYEA 1NW2A 1ZMAA 2QA1A 4KCEA 1VF2A 3ZIVA 3GHAA 1EP8A 2HSYA 3KXOA 2JACA 1QGVA 3CYNA 3FZ5A 3KIJA 1LU4A 1U3AA 1M2BA 3ZRDA 3EE2A 2VKZG 4K2XA 1SK1A 4HSCX 3FEUA 3D4MA 2GQMA 2YPMA 1K0AA 2B3SA 4E68A 1X5CA 3MYDA 5AIVA 1ZOFA 2C4JA 5E4WA 1XPVA 3GKKA 1KNGA 1WP0A 4ZBDA 3PH9A 3PPUA 4G01A 4IVFA 4USSA 4POMA 1SL0B 4TR0A 1S3DA 5F8BA 2VCXA 3L9VA 3QFAC 4POBA 4KUNA 3QD9A 1V2AA 2GT5A 4ACSA 3LORA 4V2LA 1KTEA 4DSSB 5AGYA 2HLSA 5HFKA 3IE3A 4L0WA 4CDOA 3IBHA 4X0XA 1PQNA 1XOAA 5INYA 1M2DA 3KMNA 1SL2B 3KJYA 1OC9A 3EINA 1WOUA 4X1UA 4WXTA 1GSQA 3QPMA 4TVEA 5DQYA 4F0CA 3EWLA 1X0RA 4RI6A 4LA1A 3M9KA 1TU8A 2FUG2 3KZQA 1SVOA 5C00A 4ZB6A 1SD9A 1V57A 5A5HB 1A2JA 1ON4A 2DJ3A 4JEDA 2R0CA 3P8WA 1LJRA 3NZNA 1YF0A 2MBSA 3GA4A 2WVZA 3E3EA 2R4VA 2F3MA 2O5VA 3H79A 4J57E 2K8SA 2EFDA 1MTCA 3R3EA 2HI7A 1SJZA 1AAZA 4HI7A 2IMEA 4GXZA 3DEXA 8GSSA 5D9WA 2DIZA 3UVTA 5HR2A 2KOKA 3L78A 3WGEA 2XBIA 3DWVA 2C0EA 6GSTA 2WS2A 2E2MA 1TDIA 4FYBA 4KW6A 2IJYA 2YZUA 4OO5A 3RPNA 1SYXA 1TTZA 3TJGA 3EC3A 3VI5A 5BMUB 3D6IA 1TK8B 3UIWA 4JE1A 4I2UA 4HUAA 5H5RA 3KP9A 5HR1A 2PBJA 5ID2A 1AQXA 3UOMA 2H71A 19GSA 2X99A 1XFLA 3C7MA 3ZMKA 5GAND 1GL8A 5LCZA 4PTSA 3HXSA 2WZ9A 1V9WA 4G2EA 1A24A 1PGTA 4JBBA 4AJ8A 2RIIA 1R7HA 4AJ6A 4KNDA 2GDRA 5B6MA 2TIRA 4MDCA 4QQ7A 3IR4A 1A8LA 5D9TA 1ABAA 3RDWA 1UC7A 4P3YB 3TKPA 2GS3A 2O7KA 5IQYA 3GSTA 1B4QA 5A5KA 2NVLA 1KEBA 4MP4A 3CSHA 1V58A 4YQVA 5D9XA 1IYHA 1UN2A 2YNXA 2R37A 5G2ZA 3G7YA 3CSIA 1OE8A 4MZCA 3QMXA 4MMMA 2EC4A 2FNOA 5HFIA 4NHZA 4MF7A 2XPDA 2L57A 2IIYA 2LNTA 2FA4A 1Z6MA 2O3EA 4ILFA 2FWHA 2QSIA 1BG5A 3LXTA 3NIVA 2VIMA 2LNSA 5DCHA 2IN3A 2WRTA 2R0PA 2CX3A 3TUEA 3GRXA 3GX0A 5A4VA 3EURA 2DIYA 4AKXB 2PU9C 3DVWA 2E2GA 4ZL7A 1V98A 2A4HA 3HDCA 5IMVA 5J40A 2CV4A 5D73A 4IW9A 2LUSA 4GDFA 4NPBA 1XWKA 2QKEA 4AKGA 3A2WA 1GSFA 3MDKA 1K3LA 3ISOA 3I69A 1G6YA 1GUKA 2LJAA 3KCMA 2B5XA 5G30A 2FY6A 2MMZA 1YDKA 3L0HA 2RM5A 1X9WB 2WW2A 3F63A 6GSUA 2FWEA 1JZOA 4K7NA 4WR5A 1YJ6A 2VD1A 3QR6A 1EEJA 4JRRA 1FAAA 3GH6A 4L5OA 5BRTA 4ZXGA 3BCKA 1B9YC 3VURA 5DAKA 1Z3EA 1VF3A 3H93A 2K8VA 4XTSA 2DJKA 3VI7A 4LL4B 1THXA 1YEXA 3WT2A 5ECOB 3HD5A 2YN1A 2HRKB 3ZFLA 2VL3A 2GGTA 2X64A 4GLTA 1QXHA 5FHIA 1SKRB 3HVXA 1S3CA 4NHWA 1TRVA 2H74A 13GSA 2E7PA 4HJ2A 3VK9A 2F9SA 3TJBA 2HZEB 5IPGA 2YWOA 1G7EA 4YKGA 1WRYA 4MZBA 3HVNA 4BVXA 4K5RA 2VAFA 5A4WA 2CAQA 1XW6A 1F2EA 1YQ1A 3QCPA 1Z5YE 1JZDA 4NXIA 4LMVA 5F0GA 3CRUA 2H1BA 2YZHA 3RAZA 2VCVA 2JZSA 2ZCTA 2F8AA 4QL7A 2BMXA 1QQ2A 4MCUA 5ABRA 2HSMA 1B9XC 1XXUA 5EY6A 5HR0A 3LYPA 3Q19A 3EMXA 1RW1A 2H0IA 1YVLA 1XCCA 2RM6A 3FR6A 2H0HA 2C0FA 3N9JA 2DMLA 2GSQA 3KTBA 5DALB 2IL3A 3C1RA 1FW1A 3NOFA 4JU5A 5IMZA 2R5GA 5J4YA 1T8EB 4EF0A 3Q74A 5ECNB 3ZZXA 1PD21 1HQOA 4IELA 4EE0A 3KP8A 1FB0A 1THOA 4EDZA 2N5BA 3EMPA 5ECIB 4MZWA 2R3XA 5CYYA 2IFQA 4ZL8A 1ZYPA 3GURA 5DJLA 3EPTA 4XRAA 5J9BA 1Z9HA 2WDUA 4GSNA 5CREA 4KX4A 4EIQA 4MABA 4MF6A 3HMJG 1WE0A 5B8AA 1UA5A 4MPFA 2HT9A 1A0FA 4MJBA 2KUCA 3UBKA 2DJ0A 4WF4A 2HYXA 4YAVA 2LS5A 1Y6EA 4MH2A 2R0GA 2YWNA 2QA2A 1ERVA 2HRNA 1XG8A 1IYIA 3LW9A 1AQVA 4W66A 2L5LA 1I9DA 1GTIA 1TK5B 4PX1A 3KTLA 1YKAA 2UV8G 20GSA 3TKSC 3HZ8A 5CRHA 2YJHA 2WZSA 2XBQA 3ERWA 4QL9A 2EIQA 1J08A 1TXUA 3C1SA 4NMUA 1ERUA 4IQAA 1EGOA 5J47A 2GT6A 2IMFA 4KAEA 1SVMA 4XS4A 1K0MA 2BTOT 4OWYA 2LV3A 5EL8A 2HSNB 4PQIA 4GCIA 2P5RA 3RHCA 4I8BA 1XVWA 1H75A 4K8MA 3D0ZA 3DVXA 3APOA 4PQ1A 5J3RA 1EP7A 3ME8A 4IHUA 4OO4A 1TK0B 3HY2A 2GQLA 3J7Yb 1TRWA 4PNGA 3L4NA 4XCSA 2CZ3A 1NHYA 3GH9A 1SL1B 2OACA 4TOPA 3CWGA 2O85A 5G5EA 3GIXA 2HXKA 4POKA 2GLRA 4K1FA 4WKWA 2JL4A 2H30A 4GQCA 3IV4A 1FVKA 3FZAA 4IS0A 4O7HA 4FXYP 3Q18A 1Z7PA 5G1LA 3HHVA 4EKZA 4BIKA 1O81A 1Q98A 3GTUA 4IBPA 1E6BA 5KN1A 1U88A 3VPTA 5ECKB 3GV1A 3U6VA 22GSA 3M8NA 1OYJA 2IWTA 1SJ6A 2OADA 2H76A 5G1KA 3G9BA 4KDXA 3S9FA 4F0BA 4MJEA 4N0ZA 3WGDA 4KDYA 2HE3A 2PVQA 1ILOA 4Z2UA 3UVHA 4EIPA 1BG1A 2LRNA 4YH2A 5IMAA 4X4JA 2L59A 4KB3A 3F9UA 2L4CA 5D96A 6GSYA 1O8WA 2F51A 3F4TA 2HZFA 3P90A 2CVKA 3E9JB 4HEA2 1N2AA 1DBYA 3WT1A 2H01A 4GF0A 5F05A 3VFIA 2QGVA 3SBCA 4XS6A 1K3OA 2REMA 5ENUA 4GQFA 4ZB9A 1TI3A 1F6MC 3HJOA 2LQQA 1WMJA 1M3JA 2NDOA 4HJMA 4V2NA 1JFUA 2QC7A 2C0GA 5HFGA 3RFRC 4AKIA 3H1NA
chains in the Genus database with same CATH topology
4TN8A 2PVOC 3JCML 5IOXA 3MNGA 4Z2RA 4AJ7A 1YZXA 1OC9B 5DCGA 1BAYA 1DE1A 4HQSA 2LJKA 3D4TA 2ES7A 1NM3A 3DRNA 1B8XA 4EDYA 1I5GA 4V2MA 2IMDA 1A23A 2VM2A 2CA8A 2GTUA 3F6FA 1HYUA 5CRDA 1X5DA 3I6AA 1B4PA 4K0NA 4ZILA 5FT3A 2EFEA 2HQTA 4ID0A 4KSMA 3IAS2 5ELAA 1OE7A 1MDIA 2B7KA 2V41A 2VOCA 4HS1A 1F37A 1X9SB 5J4UA 1W4VA 2EFHA 3EVIA 4ZB8A 2JU5A 4HOJA 2ON7A 1GSSA 2VCTA 2YJ7A 2H8LA 3RHBA 2I4AA 4I6XA 1GULA 5J9CA 2ZNMA 4MH3A 4XRDA 3TJKA 2H70A 2L5OA 3J7Yk 4G19A 1GSEA 3FK8A 3W8SA 3EU3A 4E8EA 4TXOA 4GTUA 2H1GA 1YKCA 3ZLPA 3FR3A 4O5RA 2AAWA 3LGCA 4AKHA 3IDVA 4MF5A 1PMTA 3ZMLA 2A4VA 1XBSA 1QK8A 2OE1A 1MEKA 2L4QA 3K8NA 3CRTA 5ID2B 2AV4A 4BPYA 1KBNA 5KN2A 12GSA 1QFNA 4ZBBA 3TGZA 3I9V2 1ZCPA 1PN0A 4CY6A 5G31A 2E0QA 3FY7A 2KP1A 5E59A 4JR4A 3MIXA 3GL5A 2PGTA 2I3YA 2NTOA 2H6YA 1TOFA 1XW5A 1XW9A 5AN1A 1T7PB 3TRQA 2P5QA 1OC8A 1TRSA 3F8UA 2CAIA 3R2QA 5A1NA 4KH7A 5ECPB 3QOUA 1FO5A 1TI1A 3ED3A 5GSSA 1VRSD 4OD7A 1SYRA 4PURA 4DEJA 1T4YA 5DBQA 2GZYA 1B48A 3A2VA 3TKSA 3APQA 2OA7A 3TKRA 4ZL9A 3LYKA 3GMFA 4K9ZA 2WULA 2OE3A 3EYTA 2GZZA 1W89A 5EPFA 1R5AA 2FD3A 1GUMA 3FR9A 4Q5RA 2H73A 2LRTA 4MA9A 4PXOA 1FHEA 3CXGA 4MLYA 5KOWA 1HD2A 2YANA 4PGTA 1ZZYA 1SKSB 2YCDA 4BVYA 5HR3A 1GH2A 5A34A 4PUAA 4LL1B 1EZKA 3L9SA 1N8JA 2DKIA 4J2FA 2OT3A 1SU9A 3HA9A 3QAGA 2RUEA 5DQSA 1VF4A 4BL7A 3C73A 5B6NA 1BJXA 4K7IA 1GNWA 3BD2A 2V6OA 4EL1A 1SD8A 3UBLA 2MMAA 3I43A 4N10A 3FZ4A 4BA7A 5ELGA 5G5FA 3IRAA 1GTAA 3LG6A 4RQXA 3IK9A 2B5EA 5J4VA 3GYKA 1EOHA 4ICYA 2PMTA 4BWSA 5CRWA 3OR5A 3DYRA 3UEMA 2B1KA 4G10A 18GSA 4DSQA 4HZ2A 4IJIA 5ECLB 3TU3B 1FG4A 3BBYA 3LEFA 2AHEA 1PL2A 2BJXA 1MD4A 5DAKB 1BYEA 2M72A 1J9BA 2R2JA 1XWCA 1GSUA 1O85A 2OBKA 3HVSA 3M1GA 1XIYA 5IM9A 3IAM2 4D73A 3O6TA 6GSWA 2VUPA 4LMWA 2MZCA 4ML6A 4K0GA 3IA1A 1XOBA 2VCQA 1PX6A 3D21A 2WB9A 3TCOA 3FZ9A 2LKUA 3MWHA 1U3IA 1X5EA 1U87A 4ECBA 4HU7A 3G7JA 1EOGA 2DC5A 3CTFA 2AB6A 4ECCA 4BVXB 2I9HA 4TR1A 4L0UA 3PINA 1WPIA 4RQRA 1GTUA 4OFMA 5LNKe 1U6TA 3BCIA 1N25A 1V40A 3VPQA 3QAWA 1URMA 3ZL5A 2PPTA 4WETA 2FHEA 2DJ2A 3KH9A 1ACVA 1HNAA 1M7TA 3ZYWA 2K9FA 4FO5A 3GUSA 3CBUA 2YWMA 2C8UA 1GLQA 2HSMB 3ZIJA 4L8EA 1SKWB 2YV9A 4F2IA 4XIHA 4HZ4A 2HNLA 2HRAA 2R6KA 4TR1B 1O6JA 3UJ1A 1SJIA 4NV5A 3UAPA 2MBTA 3EU4A 2B7JA 1K0CA 2C3QA 2FCHA 2H1LA 4IP6A 3W8JA 4NAXA 3TB2A 4G0KA 2F8FA 5B7CA 4PQHA 3IXRA 2H19A 2WFCA 2VCWA 1Z7RA 3D22A 1GSYA 4X43A 5COHA 3LXZA 1TRUA 2OE0A 2I81A 5HQPA 1FOHA 4MK3A 1F9MA 1TXXA 2VLUA 1DUGA 2IFQB 4QMKA 5H5QA 2VO4A 1PRXA 4IGJA 3MAKA 4YAPA 1GWCA 2HRFA 4FQUA 3A3TA 1GRXA 1SENA 4Z2TA 2XPEA 4ECJA 2VCZA 4KA0A 3UARA 5J41A 3FKFA 4KGIA 2CX4A 1M9BA 3HVVA 1DSBA 1AC1A 2DJ1A 4N0VA 16GSA 5AIXA 2CQ9A 2ON5A 3UL3A 4O5QA 1O73A 1AIUA 4MPGA 1UVZA 1K0DA 4CY8A 4TXVA 4YKFA 1K0BA 2DLXA 3IPZA 4G9HA 2C3NA 4EXJA 2AJQB 5IIZA 2HSHA 5LD0A 4PUFC 3F6DA 4O5UA 1FVJA 5JCWA 4V1Ag 3M0FA 1PL1A 1T00A 2O87A 4E8HA 3TKQA 3W6GA 3FHKA 3CSJA 3N5OA 4Q5NA 4O92A 1A8YA 2CT6A 1T3BA 1G6WA 4F9ZA 1FB6A 4XS4B 2CVBA 3TKSE 3HYPA 4FH8A 3LSZA 4TR3A 1EWXA 3C71A 4RUVA 5JCGA 1GSDA 4AGSA 1H4OA 2C3TA 4N11A 5ECQB 3DGQA 2O89A 3DMLA 2GQKA 4DSSA 3HCZA 2L6DA 2VL2C 2FWGA 1A2LA 3HKRA 5CAXA 3HJMA 1OVNA 1TW9A 1NHOA 3VLNA 5CRGA 4ZBAA 3M3MA 4OMVA 1ZYNA 2KP2A 2X8GA 1Q4JA 4V1Ap 1GNEA 2DKHA 2FA8A 3H4KA 2WJUA 3BJ5A 1MDKA 1AXDA 3Q6OA 1CQHA 1SK2A 1NSWA 5A5HA 1G7OA 4K6XA 3PGTA 4CW9A 4CHSA 2PERA 1ZYQB 3GTUB 2C1YA 5JWRB 4MNNA 5C04A 4G0LA 1T1VA 1XZOA 3LJRA 4F82A 2A2PA 4TRXA 4TW5A 3DKSA 4IJ3A 2ALBA 6GSSA 3GNJA 3FRCA 2UZ8A 2LJRA 3LQ7A 1EV4A 3TRXA 3A5IA 3P2AA 1JHBA 5IMCA 2VD0A 1Z6NA 3AY8A 3TOTA 4AF2A 3ME7A 4WF5A 1K3YA 3TJFA 3ZVJA 5IO2A 2LEGA 1EGRA 1E2YA 5CO3A 2PUKC 4I5QA 1SVLA 1EEMA 4GSSA 3U5RE 4G0IA 4TKYA 3APSA 3A2XA 2PN8A 2IMKA 5JCUA 4ECIA 5IO0A 2PWJA 4KE3A 11GSA 2JSZA 3DXBA 5BMUA 1FOVA 4HQZA 2NPBA 3KMOA 4DVCA 2VLVA 4ISDA 4OCFA 2WGRA 1OKDA 3IC4A 2CZ2A 1GUHA 1R26A 2ZUPA 4HDEA 4FYUA 1PKWA 2LQOA 4K2DA 2H75A 1J0FA 1PKZA 2FGXA 4MJAA 1Y25A 4N3ZA 5FWGA 2A2RA 1YY7A 2DJJA 2P0GA 4YQMA 3KM6A 2RLIA 1VF1A 1MD3A 5IMDA 5JWQB 2M46A 2H66A 3KEBA 4GWRA 9GSSA 1YF1A 1BF5A 3DD3A 3F0IA 4WBRD 2G0FA 1QUWA 2V6KA 1ERTA 2WCIA 5DJMA 3FYGA 1O8XA 5A4UA 2B1LA 1M0UA 5JWOB 2H0GA 1XVQA 2J9HA 6GSXA 1SK0A 2JSYA 3F3QA 4K5SA 1TJDA 2OKAA 3M9JA 4TXOB 1R5PA 5IMFA 2MMOA 5F07A 3SWLA 4KSOA 4POLA 4KDUA 3QDNA 5D93A 2EFCA 2DMMA 4GSTA 2H1DA 5GAPD 4JZQA 2VLTA 4IKHA 1A2MA 1JLVA 2RUFA 4O32A 5CP1A 4LLRA 2GVPA 4TR4A 4WBJA 5KN0A 4IP1A 2CVDA 4XS1A 5F06A 4NWYA 3VWVA 4OCEA 4Q5QA 1AUCA 3E0UA 1TU7A 4EVMA 4EUYA 2EIOA 2OBIA 3GX8A 2MYGA 2IMIA 3C8EA 1OAZA 3L9UA 3IHQA 5A1NB 2EIRA 3GL3A 3ERFA 4FIWA 3WGXA 3US3A 1T4ZA 3IHGA 5J5NA 3RPPA 5ECSA 1K0NA 4AI6A 5DVBA 1GTBA 3PR8A 2HRKA 4WR4A 5ECMB 1ZGNA 4L5LA 2I1UA 5H5SA 4EO3A 1X9MB 4Z7XA 4ZB7A 4RI7A 2HZEA 4F03A 2P31A 3DIEA 1ST9A 3O3TA 1MDJA 1XWGA 2H6XA 3ZTLA 3V1WA 2X4AA 2V32A 3BOAA 5CNWA 3FW2A 4BVYB 5A34B 1DE2A 1PSQA 1M9AA 4I97A 2GZPA 1XWAA 3GSSA 4A5PA 1K0OA 2FWFA 3KGKA 2XC2A 1A0RP 1TP9A 1EV9A 2VL2A 4BL7B 3IOSA 2LTKA 3ZITA 2C80A 1PX7A 1BQ7A 3HZ4A 1LBKA 4I2TA 2TRCP 4WEYA 1BX9A 3VWUA 3TRPA 3TDGA 3O76A 2H72A 3WD6A 3G7IA 2AUVA 3MSZA 2GSSA 5GSTA 2TRXA 4KCAA 5DALA 1ML6A 1PA3A 4GRFA 2LRCA 3CMIA 3GFKA 2H6ZA 1HNBA 4H86A 14GSA 1WWJA 3ZFBA 2C0DA 1JZWA 2DBCA 2KHPA 4DSRA 5EVOA 5AISA 2B6MA 1BEDA 3GKNA 4J56E 2IPAA 4EC0A 2X8CA 3CTGA 2V1MA 5KEJA 2YP6A 4D73B 1ERWA 1WIKA 1XWBA 3LWAA 5ECHB 3LFLA 7GSSA 2NBSA 5D9VA 2VM1A 2JZTA 3GKMA 4PNFA 1PN9A 2YWIA 3GKXA 3ERGA 1RQMA 5ECRB 2N5FA 1R4WA 1OC3A 2HFDA 1JZRA 1C72A 2YV7A 5L71A 3F4SA 1G0TA 2JADA 2B5YA 1CQGA 1AW9A 3P7XA 4XHMA 1M99A 2YOIA 2DSAA 3A5WA 1M2AA 1TKDB 1O7UA 2VL9A 5KOXA 3FMWA 2J23A 3IC8A 3UMAA 4FYCA 5IPHA 4ULXA 3ZVJD 1Y1UA 1S3AA 3QFBC 4KF9A 2AYTA 3HJPA 1HNCA 3VWWA 4JR6A 4HU9A 1OKTA 2N5AA 17GSA 1F3AA 2OJLA 4IQ1A 1AQWA 4K7OA 3F4RA 2HSNA 5GZZB 4N30A 5B8BA 2FLSA 5D8IA 1GP1A 4ZIJA 4OFTA 2V2GA 4YQUA 1QMVA 1VGLA 3RBTA 1WJKA 3KH7A 2O8VB 2M80A 2A2SA 2Z9SA 2G2QA 10GSA 2LSTA 5DDLA 2X49A 2MMNA 3VWXA 6GSVA 1GLPA 2K6VA 4OFNA 2X8HA 4MJCA 2XHFA 4IN0A 4NV2A 4ML1A 3D5JA 1RK4A 1USBA 4Q5FA 3TOUA 1F3BA 3ZREA 2JZRA 2K18A 2L6CA 3GN3A 3H8QA 3WYWA 1ZL9A 3IK7A 3KD0A 5KN3A 2KLXA 1YEPA 2D2ZA 1JLWA 2GSRA 5IOWA 4BWQA 3QAVA 3TJJA 2GSTA 3F3RA 2H1AA 1ZYEA 1NW2A 1ZMAA 2QA1A 4KCEA 1VF2A 3ZIVA 3GHAA 1EP8A 2HSYA 3KXOA 2JACA 1QGVA 3CYNA 3FZ5A 3KIJA 1LU4A 1U3AA 1M2BA 3ZRDA 3EE2A 2VKZG 4K2XA 1SK1A 3FEUA 3D4MA 2GQMA 2YPMA 1K0AA 2B3SA 4E68A 1X5CA 3MYDA 5AIVA 1ZOFA 2C4JA 5E4WA 1XPVA 3GKKA 1KNGA 1WP0A 4ZBDA 3PH9A 3PPUA 4G01A 4IVFA 4USSA 4POMA 1SL0B 4TR0A 1S3DA 5F8BA 2VCXA 3L9VA 3QFAC 4POBA 4KUNA 3QD9A 1V2AA 2GT5A 4ACSA 3LORA 4V2LA 1KTEA 4DSSB 5AGYA 2HLSA 5HFKA 3IE3A 4L0WA 4CDOA 3IBHA 4X0XA 1PQNA 1XOAA 5INYA 1M2DA 3KMNA 1SL2B 3KJYA 1OC9A 3EINA 1WOUA 4X1UA 4WXTA 1GSQA 3QPMA 4TVEA 5DQYA 4F0CA 3EWLA 1X0RA 4RI6A 4LA1A 3M9KA 1TU8A 2FUG2 3KZQA 1SVOA 5C00A 4ZB6A 1SD9A 1V57A 5A5HB 1A2JA 1ON4A 2DJ3A 4JEDA 2R0CA 3P8WA 1LJRA 3NZNA 1YF0A 2MBSA 3GA4A 3E3EA 2R4VA 2F3MA 2O5VA 3H79A 4J57E 2K8SA 2EFDA 1MTCA 3R3EA 2HI7A 1SJZA 1AAZA 4HI7A 2IMEA 4GXZA 3DEXA 8GSSA 5D9WA 2DIZA 3UVTA 5HR2A 2KOKA 3L78A 3WGEA 2XBIA 3DWVA 2C0EA 6GSTA 2WS2A 2E2MA 1TDIA 4FYBA 4KW6A 2IJYA 2YZUA 4OO5A 3RPNA 1SYXA 1TTZA 3TJGA 3EC3A 3VI5A 5BMUB 3D6IA 1TK8B 3UIWA 4JE1A 4I2UA 4HUAA 5H5RA 3KP9A 5HR1A 2PBJA 5ID2A 1AQXA 3UOMA 2H71A 19GSA 2X99A 1XFLA 3C7MA 3ZMKA 5GAND 1GL8A 5LCZA 4PTSA 3HXSA 2WZ9A 1V9WA 4G2EA 1A24A 1PGTA 4JBBA 4AJ8A 2RIIA 1R7HA 4AJ6A 4KNDA 2GDRA 5B6MA 2TIRA 4MDCA 4QQ7A 3IR4A 1A8LA 5D9TA 1ABAA 3RDWA 1UC7A 4P3YB 3TKPA 2GS3A 2O7KA 5IQYA 3GSTA 1B4QA 5A5KA 2NVLA 1KEBA 4MP4A 3CSHA 1V58A 4YQVA 5D9XA 1IYHA 1UN2A 2YNXA 2R37A 5G2ZA 3G7YA 3CSIA 1OE8A 4MZCA 3QMXA 4MMMA 2EC4A 2FNOA 5HFIA 4NHZA 4MF7A 2XPDA 2L57A 2IIYA 2LNTA 2FA4A 1Z6MA 4ILFA 2FWHA 2QSIA 1BG5A 3LXTA 3NIVA 2VIMA 2LNSA 5DCHA 2IN3A 2WRTA 2R0PA 2CX3A 3TUEA 3GRXA 3GX0A 5A4VA 3EURA 2DIYA 4AKXB 2PU9C 3DVWA 2E2GA 4ZL7A 1V98A 2A4HA 3HDCA 5IMVA 5J40A 2CV4A 5D73A 4IW9A 2LUSA 4GDFA 4NPBA 1XWKA 2QKEA 4AKGA 3A2WA 1GSFA 3MDKA 1K3LA 3ISOA 3I69A 1G6YA 1GUKA 2LJAA 3KCMA 2B5XA 5G30A 2FY6A 2MMZA 1YDKA 3L0HA 2RM5A 1X9WB 3F63A 6GSUA 2FWEA 1JZOA 4K7NA 4WR5A 1YJ6A 2VD1A 3QR6A 1EEJA 4JRRA 1FAAA 3GH6A 4L5OA 5BRTA 4ZXGA 3BCKA 1B9YC 3VURA 5DAKA 1Z3EA 1VF3A 3H93A 2K8VA 4XTSA 2DJKA 3VI7A 4LL4B 1THXA 1YEXA 3WT2A 5ECOB 3HD5A 2YN1A 2HRKB 3ZFLA 2VL3A 2GGTA 2X64A 4GLTA 1QXHA 5FHIA 1SKRB 3HVXA 1S3CA 4NHWA 1TRVA 2H74A 13GSA 2E7PA 4HJ2A 3VK9A 2F9SA 3TJBA 2HZEB 5IPGA 2YWOA 1G7EA 4YKGA 1WRYA 4MZBA 4BVXA 4K5RA 2VAFA 5A4WA 2CAQA 1XW6A 1F2EA 1YQ1A 3QCPA 1Z5YE 1JZDA 4NXIA 4LMVA 5F0GA 3CRUA 2H1BA 2YZHA 3RAZA 2VCVA 2JZSA 2ZCTA 2F8AA 4QL7A 2BMXA 1QQ2A 4MCUA 5ABRA 2HSMA 1B9XC 1XXUA 5EY6A 5HR0A 3LYPA 3Q19A 3EMXA 1RW1A 2H0IA 1YVLA 1XCCA 2RM6A 3FR6A 2H0HA 2C0FA 3N9JA 2DMLA 2GSQA 3KTBA 5DALB 2IL3A 3C1RA 1FW1A 3NOFA 4JU5A 5IMZA 2R5GA 5J4YA 1T8EB 4EF0A 3Q74A 5ECNB 3ZZXA 1PD21 1HQOA 4IELA 4EE0A 3KP8A 1FB0A 1THOA 4EDZA 2N5BA 3EMPA 5ECIB 4MZWA 2R3XA 5CYYA 2IFQA 4ZL8A 1ZYPA 3GURA 5DJLA 3EPTA 4XRAA 5J9BA 1Z9HA 2WDUA 4GSNA 5CREA 4KX4A 4EIQA 4MABA 4MF6A 3HMJG 1WE0A 5B8AA 1UA5A 4MPFA 2HT9A 1A0FA 4MJBA 2KUCA 3UBKA 2DJ0A 4WF4A 2HYXA 4YAVA 2LS5A 1Y6EA 4MH2A 2R0GA 2YWNA 2QA2A 1ERVA 2HRNA 1IYIA 3LW9A 1AQVA 4W66A 2L5LA 1I9DA 1GTIA 1TK5B 4PX1A 3KTLA 1YKAA 2UV8G 20GSA 3TKSC 3HZ8A 5CRHA 2YJHA 2XBQA 3ERWA 4QL9A 2EIQA 1J08A 1TXUA 3C1SA 4NMUA 1ERUA 4IQAA 1EGOA 5J47A 2GT6A 2IMFA 4KAEA 1SVMA 4XS4A 1K0MA 2BTOT 4OWYA 2LV3A 5EL8A 2HSNB 4PQIA 4GCIA 2P5RA 3RHCA 4I8BA 1XVWA 1H75A 4K8MA 3D0ZA 3DVXA 3APOA 4PQ1A 5J3RA 1EP7A 3ME8A 4IHUA 4OO4A 1TK0B 3HY2A 2GQLA 3J7Yb 1TRWA 4PNGA 3L4NA 4XCSA 2CZ3A 1NHYA 3GH9A 1SL1B 2OACA 4TOPA 3CWGA 2O85A 5G5EA 3GIXA 2HXKA 4POKA 2GLRA 4K1FA 4WKWA 2JL4A 2H30A 4GQCA 3IV4A 1FVKA 3FZAA 4IS0A 4O7HA 3Q18A 1Z7PA 5G1LA 3HHVA 4EKZA 1O81A 1Q98A 3GTUA 4IBPA 1E6BA 5KN1A 1U88A 3VPTA 5ECKB 3GV1A 3U6VA 22GSA 3M8NA 1OYJA 2IWTA 1SJ6A 2OADA 2H76A 5G1KA 3G9BA 4KDXA 3S9FA 4F0BA 4MJEA 4N0ZA 3WGDA 4KDYA 2HE3A 2PVQA 1ILOA 4Z2UA 3UVHA 4EIPA 1BG1A 2LRNA 4YH2A 5IMAA 4X4JA 2L59A 4KB3A 3F9UA 2L4CA 5D96A 6GSYA 1O8WA 2F51A 3F4TA 2HZFA 3P90A 2CVKA 3E9JB 4HEA2 1N2AA 1DBYA 3WT1A 2H01A 4GF0A 5F05A 3VFIA 2QGVA 3SBCA 4XS6A 1K3OA 2REMA 5ENUA 4GQFA 4ZB9A 1TI3A 1F6MC 3HJOA 2LQQA 1WMJA 2NDOA 4HJMA 4V2NA 1JFUA 2QC7A 2C0GA 5HFGA 4AKIA 3H1NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TN8 A;  2PVO C;  3JCM L;  5IOX A;  3MNG A;  4AJ7 A;  1YZX A;  1OC9 B;  5DCG A;  1BAY A;  1DE1 A;  4HQS A;  2LJK A;  3D4T A;  2ES7 A;  1NM3 A;  3DRN A;  1B8X A;  4EDY A;  1I5G A;  4V2M A;  2IMD A;  1A23 A;  2VM2 A;  2CA8 A;  2GTU A;  3F6F A;  1HYU A;  5CRD A;  1X5D A;  3I6A A;  1B4P A;  4K0N A;  4ZIL A;  5FT3 A;  2HQT A;  4ID0 A;  4KSM A;  3IAS 2;  5ELA A;  1OE7 A;  1MDI A;  2B7K A;  2V41 A;  2VOC A;  4HS1 A;  1F37 A;  1X9S B;  5J4U A;  1W4V A;  3EVI A;  4ZB8 A;  2JU5 A;  4HOJ A;  2ON7 A;  1GSS A;  2VCT A;  2YJ7 A;  2H8L A;  3RHB A;  2I4A A;  4I6X A;  1GUL A;  5J9C A;  2ZNM A;  4MH3 A;  4XRD A;  3TJK A;  2H70 A;  2L5O A;  3J7Y k;  4G19 A;  1GSE A;  3FK8 A;  3W8S A;  3EU3 A;  4E8E A;  4TXO A;  4GTU A;  2H1G A;  1YKC A;  3ZLP A;  3FR3 A;  4O5R A;  2AAW A;  3LGC A;  3IDV A;  4MF5 A;  1PMT A;  3ZML A;  2A4V A;  1XBS A;  1QK8 A;  2OE1 A;  1MEK A;  2L4Q A;  3K8N A;  3CRT A;  5ID2 B;  2AV4 A;  4BPY A;  1KBN A;  5KN2 A;  12GS A;  1QFN A;  4ZBB A;  3TGZ A;  3I9V 2;  1ZCP A;  5G31 A;  2E0Q A;  3FY7 A;  2KP1 A;  5E59 A;  4JR4 A;  3GL5 A;  2PGT A;  2I3Y A;  2NTO A;  2H6Y A;  1TOF A;  1XW5 A;  1XW9 A;  5AN1 A;  1T7P B;  3TRQ A;  2P5Q A;  1OC8 A;  1TRS A;  3F8U A;  2CAI A;  3R2Q A;  4KH7 A;  5ECP B;  3QOU A;  1FO5 A;  1TI1 A;  3ED3 A;  5GSS A;  1VRS D;  4OD7 A;  1SYR A;  4PUR A;  4DEJ A;  1T4Y A;  5DBQ A;  2GZY A;  1B48 A;  3A2V A;  3TKS A;  3APQ A;  2OA7 A;  3TKR A;  4ZL9 A;  3LYK A;  3GMF A;  4K9Z A;  2WUL A;  2OE3 A;  3EYT A;  2GZZ A;  1W89 A;  5EPF A;  1R5A A;  2FD3 A;  1GUM A;  3FR9 A;  4Q5R A;  2H73 A;  2LRT A;  4MA9 A;  4PXO A;  1FHE A;  3CXG A;  4MLY A;  1HD2 A;  2YAN A;  4PGT A;  1ZZY A;  1SKS B;  2YCD A;  4BVY A;  5HR3 A;  1GH2 A;  4PUA A;  4LL1 B;  1EZK A;  3L9S A;  1N8J A;  4J2F A;  1SU9 A;  3HA9 A;  3QAG A;  2RUE A;  5DQS A;  1VF4 A;  4BL7 A;  3C73 A;  5B6N A;  1BJX A;  4K7I A;  1GNW A;  3BD2 A;  2V6O A;  4EL1 A;  1SD8 A;  3UBL A;  2MMA A;  3I43 A;  4N10 A;  3FZ4 A;  4BA7 A;  5ELG A;  5G5F A;  3IRA A;  1GTA A;  3LG6 A;  4RQX A;  3IK9 A;  2B5E A;  3GYK A;  1EOH A;  2PMT A;  4BWS A;  5CRW A;  3OR5 A;  3DYR A;  3UEM A;  2B1K A;  4G10 A;  18GS A;  4DSQ A;  4HZ2 A;  4IJI A;  5ECL B;  1FG4 A;  3BBY A;  3LEF A;  2AHE A;  1PL2 A;  2BJX A;  1MD4 A;  5DAK B;  1BYE A;  2M72 A;  1J9B A;  2R2J A;  1XWC A;  1GSU A;  1O85 A;  2OBK A;  3HVS A;  3M1G A;  1XIY A;  5IM9 A;  3IAM 2;  4D73 A;  3O6T A;  6GSW A;  2VUP A;  4LMW A;  2MZC A;  4ML6 A;  4K0G A;  3IA1 A;  1XOB A;  2VCQ A;  1PX6 A;  3D21 A;  2WB9 A;  3TCO A;  3FZ9 A;  2LKU A;  3MWH A;  1U3I A;  1X5E A;  1U87 A;  4ECB A;  4HU7 A;  3G7J A;  1EOG A;  2DC5 A;  3CTF A;  2AB6 A;  4ECC A;  4BVX B;  2I9H A;  4TR1 A;  4L0U A;  3PIN A;  1WPI A;  4RQR A;  1GTU A;  4OFM A;  5LNK e;  1U6T A;  3BCI A;  1V40 A;  3VPQ A;  3QAW A;  1URM A;  3ZL5 A;  2PPT A;  4WET A;  2FHE A;  2DJ2 A;  3KH9 A;  1ACV A;  1HNA A;  1M7T A;  3ZYW A;  2K9F A;  4FO5 A;  3GUS A;  3CBU A;  2YWM A;  2C8U A;  1GLQ A;  2HSM B;  3ZIJ A;  4L8E A;  1SKW B;  2YV9 A;  4F2I A;  4XIH A;  4HZ4 A;  2HNL A;  2HRA A;  2R6K A;  4TR1 B;  1O6J A;  3UJ1 A;  1SJI A;  4NV5 A;  3UAP A;  2MBT A;  3EU4 A;  2B7J A;  1K0C A;  2C3Q A;  2FCH A;  4IP6 A;  3W8J A;  4NAX A;  3TB2 A;  4G0K A;  2F8F A;  5B7C A;  4PQH A;  3IXR A;  2H19 A;  2WFC A;  2VCW A;  1Z7R A;  3D22 A;  1GSY A;  4X43 A;  5COH A;  3LXZ A;  1TRU A;  2OE0 A;  2I81 A;  5HQP A;  4MK3 A;  1F9M A;  1TXX A;  2VLU A;  1DUG A;  2IFQ B;  5H5Q A;  2VO4 A;  1PRX A;  4IGJ A;  3MAK A;  4YAP A;  1GWC A;  2HRF A;  4FQU A;  3A3T A;  1GRX A;  1SEN A;  2XPE A;  4ECJ A;  2VCZ A;  4KA0 A;  3UAR A;  5J41 A;  3FKF A;  4KGI A;  2CX4 A;  1M9B A;  3HVV A;  1DSB A;  1AC1 A;  2DJ1 A;  4N0V A;  16GS A;  5AIX A;  2CQ9 A;  2ON5 A;  3UL3 A;  1O73 A;  1AIU A;  4MPG A;  1UVZ A;  1K0D A;  4TXV A;  1K0B A;  2DLX A;  3IPZ A;  4G9H A;  2C3N A;  4EXJ A;  2AJQ B;  5IIZ A;  2HSH A;  5LD0 A;  4PUF C;  3F6D A;  1FVJ A;  5JCW A;  4V1A g;  3M0F A;  1PL1 A;  1T00 A;  2O87 A;  4E8H A;  3TKQ A;  3W6G A;  3FHK A;  3CSJ A;  3N5O A;  4Q5N A;  4O92 A;  1A8Y A;  2CT6 A;  1T3B A;  1G6W A;  4F9Z A;  1FB6 A;  4XS4 B;  2CVB A;  3TKS E;  3HYP A;  4FH8 A;  3LSZ A;  4TR3 A;  1EWX A;  3C71 A;  4RUV A;  5JCG A;  1GSD A;  4AGS A;  1H4O A;  2C3T A;  4N11 A;  5ECQ B;  3DGQ A;  2O89 A;  3DML A;  2GQK A;  4DSS A;  3HCZ A;  2L6D A;  2VL2 C;  2FWG A;  1A2L A;  3HKR A;  5CAX A;  3HJM A;  1OVN A;  1TW9 A;  1NHO A;  3VLN A;  5CRG A;  4ZBA A;  3M3M A;  4OMV A;  2KP2 A;  2X8G A;  1Q4J A;  4V1A p;  1GNE A;  2FA8 A;  3H4K A;  2WJU A;  3BJ5 A;  1MDK A;  1AXD A;  3Q6O A;  1CQH A;  1SK2 A;  1NSW A;  1G7O A;  4K6X A;  3PGT A;  4CW9 A;  4CHS A;  2PER A;  1ZYQ B;  3GTU B;  2C1Y A;  5JWR B;  5C04 A;  4G0L A;  1T1V A;  1XZO A;  3LJR A;  4F82 A;  4TRX A;  4TW5 A;  3DKS A;  4IJ3 A;  2ALB A;  6GSS A;  3GNJ A;  3FRC A;  2UZ8 A;  2LJR A;  3LQ7 A;  1EV4 A;  3TRX A;  3P2A A;  1JHB A;  5IMC A;  2VD0 A;  1Z6N A;  3AY8 A;  3TOT A;  4AF2 A;  3ME7 A;  4WF5 A;  1K3Y A;  3TJF A;  3ZVJ A;  5IO2 A;  2LEG A;  1EGR A;  1E2Y A;  5CO3 A;  2PUK C;  4I5Q A;  1EEM A;  4GSS A;  3U5R E;  4G0I A;  4TKY A;  3APS A;  3A2X A;  2PN8 A;  2IMK A;  5JCU A;  4ECI A;  5IO0 A;  2PWJ A;  4KE3 A;  11GS A;  2JSZ A;  3DXB A;  5BMU A;  1FOV A;  4HQZ A;  2NPB A;  3KMO A;  4DVC A;  2VLV A;  4ISD A;  4OCF A;  2WGR A;  1OKD A;  3IC4 A;  2CZ2 A;  1GUH A;  1R26 A;  2ZUP A;  4HDE A;  4FYU A;  1PKW A;  2LQO A;  4K2D A;  2H75 A;  1J0F A;  1PKZ A;  2FGX A;  4MJA A;  1Y25 A;  5FWG A;  2A2R A;  1YY7 A;  2DJJ A;  2P0G A;  4YQM A;  3KM6 A;  2RLI A;  1VF1 A;  1MD3 A;  5IMD A;  5JWQ B;  2M46 A;  2H66 A;  3KEB A;  4GWR A;  9GSS A;  1YF1 A;  3DD3 A;  3F0I A;  4WBR D;  2G0F A;  1QUW A;  2V6K A;  1ERT A;  2WCI A;  5DJM A;  3FYG A;  1O8X A;  5A4U A;  2B1L A;  1M0U A;  5JWO B;  2H0G A;  1XVQ A;  2J9H A;  6GSX A;  1SK0 A;  2JSY A;  3F3Q A;  1TJD A;  2OKA A;  3M9J A;  4TXO B;  1R5P A;  5IMF A;  2MMO A;  5F07 A;  3SWL A;  4KSO A;  4POL A;  4KDU A;  3QDN A;  5D93 A;  2DMM A;  4GST A;  2H1D A;  5GAP D;  4JZQ A;  2VLT A;  4IKH A;  1A2M A;  1JLV A;  2RUF A;  4O32 A;  5CP1 A;  4LLR A;  2GVP A;  4TR4 A;  4WBJ A;  5KN0 A;  4IP1 A;  2CVD A;  4XS1 A;  5F06 A;  4NWY A;  3VWV A;  4OCE A;  4Q5Q A;  1AUC A;  3E0U A;  1TU7 A;  4EVM A;  4EUY A;  2EIO A;  2OBI A;  3GX8 A;  2MYG A;  2IMI A;  3C8E A;  1OAZ A;  3L9U A;  3IHQ A;  2EIR A;  3GL3 A;  3ERF A;  4FIW A;  3WGX A;  3US3 A;  1T4Z A;  5J5N A;  3RPP A;  5ECS A;  1K0N A;  5DVB A;  1GTB A;  3PR8 A;  2HRK A;  4WR4 A;  5ECM B;  1ZGN A;  4L5L A;  2I1U A;  5H5S A;  4EO3 A;  1X9M B;  4Z7X A;  4RI7 A;  2HZE A;  4F03 A;  2P31 A;  3DIE A;  1ST9 A;  3O3T A;  1MDJ A;  1XWG A;  2H6X A;  3ZTL A;  3V1W A;  2V32 A;  3BOA A;  5CNW A;  3FW2 A;  4BVY B;  1DE2 A;  1PSQ A;  1M9A A;  4I97 A;  2GZP A;  1XWA A;  3GSS A;  1K0O A;  2FWF A;  3KGK A;  2XC2 A;  1A0R P;  1TP9 A;  1EV9 A;  2VL2 A;  4BL7 B;  3IOS A;  2LTK A;  3ZIT A;  2C80 A;  1PX7 A;  1BQ7 A;  3HZ4 A;  1LBK A;  4I2T A;  2TRC P;  4WEY A;  1BX9 A;  3VWU A;  3TRP A;  3TDG A;  3O76 A;  2H72 A;  3WD6 A;  3G7I A;  2AUV A;  3MSZ A;  2GSS A;  5GST A;  2TRX A;  4KCA A;  5DAL A;  1ML6 A;  1PA3 A;  4GRF A;  2LRC A;  3CMI A;  3GFK A;  2H6Z A;  1HNB A;  4H86 A;  14GS A;  1WWJ A;  3ZFB A;  2C0D A;  1JZW A;  2DBC A;  2KHP A;  4DSR A;  5EVO A;  5AIS A;  2B6M A;  1BED A;  3GKN A;  4J56 E;  2IPA A;  4EC0 A;  2X8C A;  3CTG A;  2V1M A;  5KEJ A;  2YP6 A;  4D73 B;  1ERW A;  1WIK A;  1XWB A;  3LWA A;  5ECH B;  3LFL A;  7GSS A;  2NBS A;  5D9V A;  2VM1 A;  2JZT A;  3GKM A;  4PNF A;  1PN9 A;  2YWI A;  3GKX A;  3ERG A;  1RQM A;  5ECR B;  2N5F A;  1R4W A;  1OC3 A;  2HFD A;  1JZR A;  1C72 A;  2YV7 A;  5L71 A;  3F4S A;  1G0T A;  2JAD A;  2B5Y A;  1CQG A;  1AW9 A;  3P7X A;  4XHM A;  1M99 A;  2YOI A;  2DSA A;  3A5W A;  1M2A A;  1TKD B;  1O7U A;  2VL9 A;  2J23 A;  3IC8 A;  3UMA A;  4FYC A;  5IPH A;  4ULX A;  3ZVJ D;  1S3A A;  3QFB C;  4KF9 A;  2AYT A;  3HJP A;  1HNC A;  3VWW A;  4JR6 A;  4HU9 A;  1OKT A;  2N5A A;  17GS A;  1F3A A;  2OJL A;  4IQ1 A;  1AQW A;  4K7O A;  3F4R A;  5GZZ B;  4N30 A;  5B8B A;  2FLS A;  5D8I A;  1GP1 A;  4ZIJ A;  4OFT A;  2V2G A;  4YQU A;  1QMV A;  1VGL A;  3RBT A;  1WJK A;  3KH7 A;  2O8V B;  2M80 A;  2A2S A;  2Z9S A;  2G2Q A;  10GS A;  2LST A;  5DDL A;  2MMN A;  3VWX A;  6GSV A;  1GLP A;  2K6V A;  4OFN A;  2X8H A;  4MJC A;  2XHF A;  4IN0 A;  4NV2 A;  4ML1 A;  3D5J A;  1RK4 A;  1USB A;  4Q5F A;  3TOU A;  1F3B A;  3ZRE A;  2JZR A;  2K18 A;  2L6C A;  3GN3 A;  3H8Q A;  3WYW A;  1ZL9 A;  3IK7 A;  3KD0 A;  5KN3 A;  2KLX A;  1YEP A;  2D2Z A;  1JLW A;  2GSR A;  5IOW A;  4BWQ A;  3QAV A;  3TJJ A;  2GST A;  3F3R A;  2H1A A;  1ZYE A;  1NW2 A;  1ZMA A;  4KCE A;  1VF2 A;  3ZIV A;  3GHA A;  1EP8 A;  2HSY A;  3KXO A;  2JAC A;  1QGV A;  3CYN A;  3FZ5 A;  3KIJ A;  1LU4 A;  1U3A A;  1M2B A;  3ZRD A;  3EE2 A;  1SK1 A;  3FEU A;  3D4M A;  2GQM A;  2YPM A;  1K0A A;  2B3S A;  1X5C A;  5AIV A;  1ZOF A;  2C4J A;  5E4W A;  1XPV A;  3GKK A;  1KNG A;  1WP0 A;  4ZBD A;  3PH9 A;  3PPU A;  4IVF A;  4USS A;  4POM A;  1SL0 B;  4TR0 A;  1S3D A;  5F8B A;  2VCX A;  3L9V A;  3QFA C;  4POB A;  4KUN A;  3QD9 A;  1V2A A;  2GT5 A;  4ACS A;  3LOR A;  4V2L A;  1KTE A;  4DSS B;  5AGY A;  2HLS A;  5HFK A;  3IE3 A;  4L0W A;  4CDO A;  3IBH A;  4X0X A;  1PQN A;  1XOA A;  5INY A;  1M2D A;  3KMN A;  1SL2 B;  3KJY A;  1OC9 A;  3EIN A;  1WOU A;  4X1U A;  4WXT A;  1GSQ A;  3QPM A;  4TVE A;  5DQY A;  4F0C A;  3EWL A;  1X0R A;  4RI6 A;  4LA1 A;  3M9K A;  1TU8 A;  2FUG 2;  3KZQ A;  5C00 A;  4ZB6 A;  1SD9 A;  1V57 A;  1A2J A;  1ON4 A;  2DJ3 A;  4JED A;  3P8W A;  1LJR A;  3NZN A;  1YF0 A;  2MBS A;  3GA4 A;  3E3E A;  2R4V A;  2F3M A;  3H79 A;  4J57 E;  2K8S A;  1MTC A;  3R3E A;  2HI7 A;  1SJZ A;  1AAZ A;  4HI7 A;  2IME A;  4GXZ A;  3DEX A;  8GSS A;  5D9W A;  2DIZ A;  3UVT A;  5HR2 A;  2KOK A;  3L78 A;  3WGE A;  2XBI A;  3DWV A;  2C0E A;  6GST A;  2WS2 A;  2E2M A;  1TDI A;  4FYB A;  4KW6 A;  2IJY A;  2YZU A;  4OO5 A;  3RPN A;  1SYX A;  1TTZ A;  3TJG A;  3EC3 A;  3VI5 A;  3D6I A;  1TK8 B;  3UIW A;  4JE1 A;  4I2U A;  4HUA A;  5H5R A;  3KP9 A;  5HR1 A;  2PBJ A;  5ID2 A;  1AQX A;  3UOM A;  2H71 A;  19GS A;  2X99 A;  1XFL A;  3C7M A;  3ZMK A;  5GAN D;  1GL8 A;  5LCZ A;  4PTS A;  3HXS A;  2WZ9 A;  1V9W A;  4G2E A;  1A24 A;  1PGT A;  4JBB A;  4AJ8 A;  2RII A;  1R7H A;  4AJ6 A;  4KND A;  2GDR A;  5B6M A;  2TIR A;  4MDC A;  4QQ7 A;  3IR4 A;  1A8L A;  5D9T A;  1ABA A;  3RDW A;  1UC7 A;  4P3Y B;  3TKP A;  2GS3 A;  2O7K A;  5IQY A;  3GST A;  1B4Q A;  5A5K A;  2NVL A;  1KEB A;  4MP4 A;  3CSH A;  1V58 A;  4YQV A;  5D9X A;  1IYH A;  1UN2 A;  2YNX A;  2R37 A;  5G2Z A;  3G7Y A;  3CSI A;  1OE8 A;  4MZC A;  3QMX A;  4MMM A;  2EC4 A;  2FNO A;  5HFI A;  4NHZ A;  4MF7 A;  2XPD A;  2L57 A;  2IIY A;  2LNT A;  2FA4 A;  1Z6M A;  4ILF A;  2FWH A;  2QSI A;  1BG5 A;  3LXT A;  3NIV A;  2VIM A;  2LNS A;  5DCH A;  2IN3 A;  2WRT A;  2CX3 A;  3TUE A;  3GRX A;  3GX0 A;  5A4V A;  3EUR A;  2DIY A;  2PU9 C;  3DVW A;  2E2G A;  4ZL7 A;  1V98 A;  3HDC A;  5IMV A;  2CV4 A;  5D73 A;  4IW9 A;  2LUS A;  4NPB A;  1XWK A;  2QKE A;  3A2W A;  1GSF A;  3MDK A;  1K3L A;  3ISO A;  3I69 A;  1G6Y A;  1GUK A;  2LJA A;  3KCM A;  2B5X A;  5G30 A;  2FY6 A;  2MMZ A;  1YDK A;  3L0H A;  2RM5 A;  1X9W B;  3F63 A;  6GSU A;  2FWE A;  1JZO A;  4K7N A;  4WR5 A;  1YJ6 A;  2VD1 A;  3QR6 A;  1EEJ A;  4JRR A;  1FAA A;  3GH6 A;  4L5O A;  4ZXG A;  3BCK A;  1B9Y C;  3VUR A;  5DAK A;  1Z3E A;  1VF3 A;  3H93 A;  2K8V A;  4XTS A;  2DJK A;  3VI7 A;  4LL4 B;  1THX A;  1YEX A;  3WT2 A;  5ECO B;  3HD5 A;  2YN1 A;  2HRK B;  3ZFL A;  2VL3 A;  2GGT A;  2X64 A;  4GLT A;  1QXH A;  5FHI A;  1SKR B;  3HVX A;  1S3C A;  4NHW A;  1TRV A;  2H74 A;  13GS A;  2E7P A;  4HJ2 A;  3VK9 A;  2F9S A;  3TJB A;  2HZE B;  5IPG A;  2YWO A;  1G7E A;  1WRY A;  4MZB A;  4BVX A;  2VAF A;  5A4W A;  2CAQ A;  1XW6 A;  1F2E A;  1YQ1 A;  3QCP A;  1Z5Y E;  1JZD A;  4NXI A;  4LMV A;  5F0G A;  3CRU A;  2H1B A;  2YZH A;  3RAZ A;  2VCV A;  2JZS A;  2ZCT A;  2F8A A;  4QL7 A;  2BMX A;  1QQ2 A;  4MCU A;  5ABR A;  2HSM A;  1B9X C;  1XXU A;  5EY6 A;  5HR0 A;  3LYP A;  3Q19 A;  3EMX A;  1RW1 A;  2H0I A;  1XCC A;  2RM6 A;  3FR6 A;  2H0H A;  2C0F A;  3N9J A;  2DML A;  2GSQ A;  3KTB A;  5DAL B;  2IL3 A;  3C1R A;  1FW1 A;  3NOF A;  4JU5 A;  5IMZ A;  2R5G A;  1T8E B;  4EF0 A;  3Q74 A;  5ECN B;  3ZZX A;  1PD2 1;  1HQO A;  4IEL A;  4EE0 A;  3KP8 A;  1FB0 A;  1THO A;  4EDZ A;  2N5B A;  3EMP A;  5ECI B;  4MZW A;  2R3X A;  5CYY A;  2IFQ A;  4ZL8 A;  3GUR A;  5DJL A;  5J9B A;  4XRA A;  1Z9H A;  2WDU A;  4GSN A;  5CRE A;  4KX4 A;  4MAB A;  4MF6 A;  1WE0 A;  5B8A A;  1UA5 A;  4MPF A;  2HT9 A;  1A0F A;  4MJB A;  2KUC A;  3UBK A;  2DJ0 A;  4WF4 A;  2HYX A;  4YAV A;  2LS5 A;  1Y6E A;  4MH2 A;  2YWN A;  1ERV A;  2HRN A;  1IYI A;  1AQV A;  2L5L A;  1I9D A;  1GTI A;  1TK5 B;  4PX1 A;  3KTL A;  1YKA A;  20GS A;  3TKS C;  3HZ8 A;  5CRH A;  2YJH A;  2XBQ A;  3ERW A;  4QL9 A;  2EIQ A;  1J08 A;  3C1S A;  4NMU A;  1ERU A;  4IQA A;  1EGO A;  2GT6 A;  4KAE A;  2IMF A;  4XS4 A;  1K0M A;  2BTO T;  4OWY A;  2LV3 A;  5EL8 A;  2HSN B;  4PQI A;  4GCI A;  2P5R A;  3RHC A;  4I8B A;  1XVW A;  1H75 A;  4K8M A;  3D0Z A;  3DVX A;  3APO A;  4PQ1 A;  5J3R A;  1EP7 A;  3ME8 A;  4IHU A;  4OO4 A;  1TK0 B;  3HY2 A;  2GQL A;  3J7Y b;  1TRW A;  4PNG A;  3L4N A;  4XCS A;  2CZ3 A;  1NHY A;  3GH9 A;  1SL1 B;  2OAC A;  4TOP A;  2O85 A;  5G5E A;  3GIX A;  2HXK A;  4POK A;  2GLR A;  4K1F A;  4WKW A;  2JL4 A;  2H30 A;  4GQC A;  3IV4 A;  1FVK A;  3FZA A;  4IS0 A;  4O7H A;  3Q18 A;  1Z7P A;  5G1L A;  3HHV A;  4EKZ A;  1O81 A;  1Q98 A;  3GTU A;  4IBP A;  1E6B A;  5KN1 A;  1U88 A;  3VPT A;  5ECK B;  3GV1 A;  3U6V A;  22GS A;  3M8N A;  1OYJ A;  2IWT A;  1SJ6 A;  2OAD A;  2H76 A;  5G1K A;  3G9B A;  4KDX A;  3S9F A;  4F0B A;  4MJE A;  4N0Z A;  3WGD A;  4KDY A;  2HE3 A;  2PVQ A;  1ILO A;  3UVH A;  2LRN A;  4YH2 A;  5IMA A;  2L59 A;  4KB3 A;  3F9U A;  2L4C A;  5D96 A;  6GSY A;  1O8W A;  2F51 A;  3F4T A;  2HZF A;  3P90 A;  2CVK A;  3E9J B;  4HEA 2;  1N2A A;  1DBY A;  3WT1 A;  2H01 A;  4GF0 A;  5F05 A;  3VFI A;  2QGV A;  3SBC A;  4XS6 A;  1K3O A;  2REM A;  5ENU A;  4GQF A;  4ZB9 A;  1TI3 A;  1F6M C;  3HJO A;  2LQQ A;  1WMJ A;  2NDO A;  4HJM A;  4V2N A;  1JFU A;  2QC7 A;  2C0G A;  5HFG A;  3H1N A; 
#chains in the Genus database with same CATH topology
 4TN8 A;  2PVO C;  2WW1 A;  3JCM L;  5IOX A;  3MNG A;  4Z2R A;  4AJ7 A;  1YZX A;  1OC9 B;  5DCG A;  1BAY A;  1DE1 A;  4HQS A;  2LJK A;  3D4T A;  2ES7 A;  1NM3 A;  3DRN A;  1B8X A;  4EDY A;  1I5G A;  4V2M A;  2IMD A;  1A23 A;  2VM2 A;  2CA8 A;  2GTU A;  3F6F A;  1HYU A;  5CRD A;  1X5D A;  3I6A A;  1B4P A;  4K0N A;  4ZIL A;  5FT3 A;  2EFE A;  2HQT A;  4ID0 A;  4KSM A;  3IAS 2;  1S3R A;  5ELA A;  1OE7 A;  1MDI A;  2B7K A;  2V41 A;  2VOC A;  4HS1 A;  1F37 A;  1X9S B;  5J4U A;  1W4V A;  2EFH A;  3EVI A;  4ZB8 A;  2JU5 A;  4HOJ A;  2ON7 A;  1GSS A;  2VCT A;  2YJ7 A;  2H8L A;  3RHB A;  2I4A A;  4I6X A;  1GUL A;  5J9C A;  2ZNM A;  4MH3 A;  4XRD A;  3TJK A;  2H70 A;  2L5O A;  3J7Y k;  4G19 A;  1GSE A;  3FK8 A;  3W8S A;  3EU3 A;  4E8E A;  4TXO A;  4GTU A;  2H1G A;  1YKC A;  3ZLP A;  3FR3 A;  4O5R A;  2AAW A;  3LGC A;  4AKH A;  1I1I P;  3IDV A;  4MF5 A;  1PMT A;  3ZML A;  2A4V A;  1XBS A;  1QK8 A;  2OE1 A;  1MEK A;  2L4Q A;  3K8N A;  3CRT A;  5ID2 B;  2AV4 A;  4BPY A;  1KBN A;  5KN2 A;  12GS A;  1QFN A;  4ZBB A;  3TGZ A;  3I9V 2;  1ZCP A;  1PN0 A;  4CY6 A;  5G31 A;  2E0Q A;  3FY7 A;  2KP1 A;  5E59 A;  4JR4 A;  3MIX A;  3GL5 A;  2PGT A;  2I3Y A;  2NTO A;  2H6Y A;  1TOF A;  1XW5 A;  1XW9 A;  5AN1 A;  2WW3 A;  1T7P B;  3TRQ A;  2P5Q A;  1OC8 A;  1TRS A;  3F8U A;  2CAI A;  3R2Q A;  5A1N A;  4KH7 A;  5ECP B;  3QOU A;  1FO5 A;  1TI1 A;  3ED3 A;  5GSS A;  1VRS D;  4OD7 A;  1SYR A;  4PUR A;  4DEJ A;  1T4Y A;  5DBQ A;  2GZY A;  1B48 A;  3A2V A;  3TKS A;  3APQ A;  2OA7 A;  3TKR A;  4ZL9 A;  2WW0 A;  3LYK A;  3GMF A;  4K9Z A;  2WUL A;  2OE3 A;  3EYT A;  2GZZ A;  1W89 A;  5EPF A;  1R5A A;  2FD3 A;  1GUM A;  3FR9 A;  4Q5R A;  2H73 A;  2LRT A;  4MA9 A;  4PXO A;  1FHE A;  3CXG A;  4MLY A;  5KOW A;  1HD2 A;  2YAN A;  4PGT A;  1ZZY A;  1SKS B;  2YCD A;  4BVY A;  5HR3 A;  1GH2 A;  5A34 A;  4PUA A;  4LL1 B;  1EZK A;  3L9S A;  1N8J A;  2DKI A;  4J2F A;  2OT3 A;  1SU9 A;  3HA9 A;  3QAG A;  3CQF A;  2RUE A;  5DQS A;  1VF4 A;  4BL7 A;  3C73 A;  5B6N A;  1BJX A;  4K7I A;  1GNW A;  3BD2 A;  2V6O A;  4EL1 A;  1SD8 A;  3UBL A;  2MMA A;  3I43 A;  4N10 A;  3FZ4 A;  4BA7 A;  5ELG A;  5G5F A;  3IRA A;  1GTA A;  3LG6 A;  4RQX A;  3IK9 A;  2B5E A;  5J4V A;  3GYK A;  1EOH A;  4ICY A;  2PMT A;  4BWS A;  5CRW A;  3OR5 A;  3DYR A;  3UEM A;  2B1K A;  4G10 A;  18GS A;  4DSQ A;  4HZ2 A;  4IJI A;  5ECL B;  3TU3 B;  1FG4 A;  3BBY A;  3LEF A;  2AHE A;  1PL2 A;  2BJX A;  1MD4 A;  5DAK B;  1BYE A;  2M72 A;  1J9B A;  2R2J A;  1XWC A;  1GSU A;  1O85 A;  2OBK A;  3HVS A;  3M1G A;  1XIY A;  5IM9 A;  3IAM 2;  4D73 A;  3O6T A;  6GSW A;  2VUP A;  4LMW A;  4PI0 C;  2MZC A;  4ML6 A;  4K0G A;  3IA1 A;  1XOB A;  2VCQ A;  1PX6 A;  3D21 A;  2WB9 A;  3TCO A;  3FZ9 A;  2LKU A;  3MWH A;  1U3I A;  1X5E A;  1U87 A;  4ECB A;  4HU7 A;  3G7J A;  1EOG A;  2DC5 A;  3CTF A;  2AB6 A;  4ECC A;  4BVX B;  2I9H A;  4TR1 A;  4L0U A;  3PIN A;  1WPI A;  4RQR A;  1GTU A;  4OFM A;  5LNK e;  1U6T A;  3BCI A;  1N25 A;  1V40 A;  3VPQ A;  3QAW A;  1URM A;  3ZL5 A;  2PPT A;  4WET A;  2FHE A;  2DJ2 A;  3KH9 A;  1ACV A;  1HNA A;  1M7T A;  3ZYW A;  2K9F A;  4FO5 A;  3GUS A;  3CBU A;  2YWM A;  2C8U A;  1GLQ A;  2HSM B;  3ZIJ A;  4L8E A;  1SKW B;  2YV9 A;  4F2I A;  4XIH A;  4HZ4 A;  1S4B P;  2HNL A;  2HRA A;  2R6K A;  4TR1 B;  1O6J A;  3UJ1 A;  1SJI A;  4NV5 A;  3UAP A;  2MBT A;  3EU4 A;  2B7J A;  1K0C A;  2C3Q A;  2FCH A;  2H1L A;  4IP6 A;  3W8J A;  4NAX A;  3TB2 A;  4G0K A;  2F8F A;  5B7C A;  4PQH A;  3IXR A;  2H19 A;  2WFC A;  2VCW A;  1Z7R A;  3D22 A;  1GSY A;  4X43 A;  5COH A;  3LXZ A;  1TRU A;  2OE0 A;  2I81 A;  1M3I A;  5HQP A;  1FOH A;  4MK3 A;  1F9M A;  1TXX A;  2VLU A;  1DUG A;  2IFQ B;  4QMK A;  5H5Q A;  2VO4 A;  1PRX A;  4IGJ A;  3MAK A;  4YAP A;  1GWC A;  2HRF A;  4FQU A;  2WVX A;  3A3T A;  1GRX A;  1SEN A;  4Z2T A;  2XPE A;  4ECJ A;  2VCZ A;  4KA0 A;  3UAR A;  5J41 A;  3FKF A;  4KGI A;  2CX4 A;  1M9B A;  3HVV A;  1DSB A;  1AC1 A;  2DJ1 A;  4N0V A;  16GS A;  5AIX A;  2CQ9 A;  2ON5 A;  3UL3 A;  4O5Q A;  1O73 A;  1AIU A;  4MPG A;  1UVZ A;  1K0D A;  4CY8 A;  4TXV A;  4YKF A;  1K0B A;  2DLX A;  3IPZ A;  4G9H A;  2C3N A;  4EXJ A;  2AJQ B;  5IIZ A;  2HSH A;  5LD0 A;  4PUF C;  3F6D A;  4O5U A;  1FVJ A;  5JCW A;  4V1A g;  3M0F A;  1PL1 A;  1T00 A;  2O87 A;  4E8H A;  3TKQ A;  3W6G A;  3FHK A;  3CSJ A;  3N5O A;  4Q5N A;  4O92 A;  1A8Y A;  2CT6 A;  1T3B A;  1G6W A;  4F9Z A;  1FB6 A;  4XS4 B;  2CVB A;  3TKS E;  3HYP A;  4FH8 A;  3LSZ A;  4TR3 A;  1EWX A;  3C71 A;  4RUV A;  5JCG A;  1GSD A;  4AGS A;  1H4O A;  2C3T A;  4N11 A;  5ECQ B;  3DGQ A;  2O89 A;  3DML A;  2GQK A;  4DSS A;  3HCZ A;  1YEW C;  2L6D A;  2VL2 C;  2FWG A;  1A2L A;  3HKR A;  5CAX A;  3HJM A;  1OVN A;  1TW9 A;  1NHO A;  3VLN A;  5CRG A;  4ZBA A;  3M3M A;  4OMV A;  1ZYN A;  2KP2 A;  2X8G A;  1Q4J A;  4V1A p;  1GNE A;  2DKH A;  2FA8 A;  3H4K A;  2WJU A;  3BJ5 A;  1MDK A;  1AXD A;  3Q6O A;  1CQH A;  1SK2 A;  1NSW A;  5A5H A;  1G7O A;  4K6X A;  3PGT A;  4CW9 A;  4CHS A;  2PER A;  1ZYQ B;  3GTU B;  2C1Y A;  5JWR B;  1PFO A;  4MNN A;  5C04 A;  4G0L A;  1T1V A;  1XZO A;  3LJR A;  4F82 A;  2A2P A;  4TRX A;  4TW5 A;  3DKS A;  4IJ3 A;  2ALB A;  6GSS A;  3GNJ A;  3FRC A;  2UZ8 A;  2LJR A;  3LQ7 A;  1EV4 A;  3TRX A;  3A5I A;  3P2A A;  1JHB A;  5IMC A;  2VD0 A;  1Z6N A;  3AY8 A;  3TOT A;  4AF2 A;  3ME7 A;  4WF5 A;  1K3Y A;  3TJF A;  3ZVJ A;  5IO2 A;  2LEG A;  1EGR A;  1E2Y A;  5CO3 A;  2PUK C;  4I5Q A;  1SVL A;  1EEM A;  4GSS A;  3U5R E;  4G0I A;  4TKY A;  3APS A;  3A2X A;  2PN8 A;  2IMK A;  5JCU A;  4PI2 C;  4ECI A;  5IO0 A;  2PWJ A;  4KE3 A;  11GS A;  2JSZ A;  3DXB A;  5BMU A;  1FOV A;  4HQZ A;  2NPB A;  3KMO A;  4DVC A;  2VLV A;  4ISD A;  4OCF A;  2WGR A;  1OKD A;  3IC4 A;  2CZ2 A;  1GUH A;  1R26 A;  2ZUP A;  4HDE A;  4FYU A;  1PKW A;  2LQO A;  4K2D A;  2H75 A;  1J0F A;  1PKZ A;  2FGX A;  4MJA A;  1Y25 A;  4N3Z A;  5FWG A;  2A2R A;  1YY7 A;  2DJJ A;  2P0G A;  4YQM A;  3KM6 A;  2RLI A;  1VF1 A;  1MD3 A;  5IMD A;  5JWQ B;  2M46 A;  2H66 A;  3KEB A;  4GWR A;  9GSS A;  3RGB C;  1YF1 A;  1BF5 A;  3DD3 A;  3F0I A;  4WBR D;  2G0F A;  1QUW A;  2V6K A;  1ERT A;  3CHX C;  2WCI A;  5DJM A;  3FYG A;  1O8X A;  5A4U A;  2B1L A;  1M0U A;  5JWO B;  2H0G A;  1XVQ A;  2J9H A;  6GSX A;  1SK0 A;  2JSY A;  3F3Q A;  4K5S A;  1TJD A;  2OKA A;  3M9J A;  4TXO B;  1R5P A;  5IMF A;  2MMO A;  5F07 A;  3SWL A;  4KSO A;  4POL A;  4KDU A;  3QDN A;  5D93 A;  2EFC A;  2DMM A;  4GST A;  2H1D A;  5GAP D;  4JZQ A;  2VLT A;  4IKH A;  1A2M A;  1JLV A;  4PHZ C;  2RUF A;  4O32 A;  5CP1 A;  4LLR A;  2GVP A;  4TR4 A;  4WBJ A;  5KN0 A;  4IP1 A;  2CVD A;  4XS1 A;  5F06 A;  4NWY A;  3VWV A;  4OCE A;  4Q5Q A;  1AUC A;  3E0U A;  1TU7 A;  4EVM A;  4EUY A;  2EIO A;  2OBI A;  3GX8 A;  2MYG A;  2IMI A;  3C8E A;  1OAZ A;  3L9U A;  3IHQ A;  5A1N B;  2EIR A;  3GL3 A;  3ERF A;  4FIW A;  3WGX A;  3US3 A;  1T4Z A;  3IHG A;  5J5N A;  3RPP A;  5ECS A;  1K0N A;  4AI6 A;  5DVB A;  1GTB A;  3PR8 A;  2HRK A;  4WR4 A;  5ECM B;  1ZGN A;  4L5L A;  2I1U A;  5H5S A;  4EO3 A;  1X9M B;  4Z7X A;  4ZB7 A;  4RI7 A;  2HZE A;  4F03 A;  2P31 A;  3DIE A;  1ST9 A;  3O3T A;  1MDJ A;  1XWG A;  2H6X A;  3ZTL A;  3V1W A;  2X4A A;  2V32 A;  3BOA A;  5CNW A;  3FW2 A;  4BVY B;  5A34 B;  1DE2 A;  1PSQ A;  1M9A A;  4I97 A;  2GZP A;  1XWA A;  3GSS A;  4A5P A;  1K0O A;  2FWF A;  3KGK A;  2XC2 A;  1A0R P;  1TP9 A;  1EV9 A;  2VL2 A;  4BL7 B;  3IOS A;  2LTK A;  3ZIT A;  2C80 A;  1PX7 A;  1BQ7 A;  3HZ4 A;  1LBK A;  4I2T A;  2TRC P;  4WEY A;  1BX9 A;  3VWU A;  3TRP A;  3TDG A;  3O76 A;  2H72 A;  3WD6 A;  3G7I A;  2AUV A;  3MSZ A;  2GSS A;  5GST A;  2TRX A;  4KCA A;  5DAL A;  1ML6 A;  1PA3 A;  4GRF A;  2LRC A;  3CMI A;  3GFK A;  2H6Z A;  1HNB A;  4H86 A;  14GS A;  1WWJ A;  3ZFB A;  2C0D A;  1JZW A;  2DBC A;  2KHP A;  4DSR A;  5EVO A;  5AIS A;  2B6M A;  1BED A;  3GKN A;  4J56 E;  2IPA A;  4EC0 A;  2X8C A;  3CTG A;  2V1M A;  5KEJ A;  2YP6 A;  4D73 B;  1ERW A;  1WIK A;  1XWB A;  3LWA A;  5ECH B;  3LFL A;  7GSS A;  2NBS A;  5D9V A;  2VM1 A;  2JZT A;  3GKM A;  4PNF A;  1PN9 A;  2YWI A;  3GKX A;  3ERG A;  1RQM A;  5ECR B;  2N5F A;  1R4W A;  1OC3 A;  2HFD A;  1JZR A;  1C72 A;  2YV7 A;  5L71 A;  3F4S A;  1G0T A;  2JAD A;  2B5Y A;  1CQG A;  1AW9 A;  3P7X A;  4XHM A;  1M99 A;  2YOI A;  2DSA A;  3A5W A;  1M2A A;  1TKD B;  1O7U A;  2VL9 A;  5KOX A;  3FMW A;  2J23 A;  3IC8 A;  3UMA A;  4FYC A;  5IPH A;  4ULX A;  3ZVJ D;  1Y1U A;  1S3A A;  3QFB C;  2O36 A;  4KF9 A;  2AYT A;  3HJP A;  1HNC A;  3VWW A;  4JR6 A;  4HU9 A;  1OKT A;  2N5A A;  17GS A;  1F3A A;  2OJL A;  4IQ1 A;  1AQW A;  4K7O A;  3F4R A;  2HSN A;  5GZZ B;  4N30 A;  5B8B A;  2FLS A;  5D8I A;  1GP1 A;  4ZIJ A;  4OFT A;  2V2G A;  4YQU A;  1QMV A;  1VGL A;  3RBT A;  1WJK A;  3KH7 A;  2O8V B;  2M80 A;  2A2S A;  2Z9S A;  2G2Q A;  10GS A;  2LST A;  5DDL A;  2X49 A;  2MMN A;  3VWX A;  6GSV A;  1GLP A;  2K6V A;  4OFN A;  2X8H A;  4MJC A;  2XHF A;  4IN0 A;  4NV2 A;  4ML1 A;  3D5J A;  1RK4 A;  1USB A;  4Q5F A;  3TOU A;  1F3B A;  3ZRE A;  2WVY A;  2JZR A;  2K18 A;  2WVX B;  2L6C A;  3GN3 A;  3H8Q A;  3WYW A;  1ZL9 A;  3IK7 A;  3KD0 A;  5KN3 A;  2KLX A;  1YEP A;  2D2Z A;  1JLW A;  2GSR A;  5IOW A;  4BWQ A;  3QAV A;  3TJJ A;  2GST A;  3F3R A;  2H1A A;  1ZYE A;  1NW2 A;  1ZMA A;  2QA1 A;  4KCE A;  1VF2 A;  3ZIV A;  3GHA A;  1EP8 A;  2HSY A;  3KXO A;  2JAC A;  1QGV A;  3CYN A;  3FZ5 A;  3KIJ A;  1LU4 A;  1U3A A;  1M2B A;  3ZRD A;  3EE2 A;  2VKZ G;  4K2X A;  1SK1 A;  4HSC X;  3FEU A;  3D4M A;  2GQM A;  2YPM A;  1K0A A;  2B3S A;  4E68 A;  1X5C A;  3MYD A;  5AIV A;  1ZOF A;  2C4J A;  5E4W A;  1XPV A;  3GKK A;  1KNG A;  1WP0 A;  4ZBD A;  3PH9 A;  3PPU A;  4G01 A;  4IVF A;  4USS A;  4POM A;  1SL0 B;  4TR0 A;  1S3D A;  5F8B A;  2VCX A;  3L9V A;  3QFA C;  4POB A;  4KUN A;  3QD9 A;  1V2A A;  2GT5 A;  4ACS A;  3LOR A;  4V2L A;  1KTE A;  4DSS B;  5AGY A;  2HLS A;  5HFK A;  3IE3 A;  4L0W A;  4CDO A;  3IBH A;  4X0X A;  1PQN A;  1XOA A;  5INY A;  1M2D A;  3KMN A;  1SL2 B;  3KJY A;  1OC9 A;  3EIN A;  1WOU A;  4X1U A;  4WXT A;  1GSQ A;  3QPM A;  4TVE A;  5DQY A;  4F0C A;  3EWL A;  1X0R A;  4RI6 A;  4LA1 A;  3M9K A;  1TU8 A;  2FUG 2;  3KZQ A;  1SVO A;  5C00 A;  4ZB6 A;  1SD9 A;  1V57 A;  5A5H B;  1A2J A;  1ON4 A;  2DJ3 A;  4JED A;  2R0C A;  3P8W A;  1LJR A;  3NZN A;  1YF0 A;  2MBS A;  3GA4 A;  2WVZ A;  3E3E A;  2R4V A;  2F3M A;  2O5V A;  3H79 A;  4J57 E;  2K8S A;  2EFD A;  1MTC A;  3R3E A;  2HI7 A;  1SJZ A;  1AAZ A;  4HI7 A;  2IME A;  4GXZ A;  3DEX A;  8GSS A;  5D9W A;  2DIZ A;  3UVT A;  5HR2 A;  2KOK A;  3L78 A;  3WGE A;  2XBI A;  3DWV A;  2C0E A;  6GST A;  2WS2 A;  2E2M A;  1TDI A;  4FYB A;  4KW6 A;  2IJY A;  2YZU A;  4OO5 A;  3RPN A;  1SYX A;  1TTZ A;  3TJG A;  3EC3 A;  3VI5 A;  5BMU B;  3D6I A;  1TK8 B;  3UIW A;  4JE1 A;  4I2U A;  4HUA A;  5H5R A;  3KP9 A;  5HR1 A;  2PBJ A;  5ID2 A;  1AQX A;  3UOM A;  2H71 A;  19GS A;  2X99 A;  1XFL A;  3C7M A;  3ZMK A;  5GAN D;  1GL8 A;  5LCZ A;  4PTS A;  3HXS A;  2WZ9 A;  1V9W A;  4G2E A;  1A24 A;  1PGT A;  4JBB A;  4AJ8 A;  2RII A;  1R7H A;  4AJ6 A;  4KND A;  2GDR A;  5B6M A;  2TIR A;  4MDC A;  4QQ7 A;  3IR4 A;  1A8L A;  5D9T A;  1ABA A;  3RDW A;  1UC7 A;  4P3Y B;  3TKP A;  2GS3 A;  2O7K A;  5IQY A;  3GST A;  1B4Q A;  5A5K A;  2NVL A;  1KEB A;  4MP4 A;  3CSH A;  1V58 A;  4YQV A;  5D9X A;  1IYH A;  1UN2 A;  2YNX A;  2R37 A;  5G2Z A;  3G7Y A;  3CSI A;  1OE8 A;  4MZC A;  3QMX A;  4MMM A;  2EC4 A;  2FNO A;  5HFI A;  4NHZ A;  4MF7 A;  2XPD A;  2L57 A;  2IIY A;  2LNT A;  2FA4 A;  1Z6M A;  2O3E A;  4ILF A;  2FWH A;  2QSI A;  1BG5 A;  3LXT A;  3NIV A;  2VIM A;  2LNS A;  5DCH A;  2IN3 A;  2WRT A;  2R0P A;  2CX3 A;  3TUE A;  3GRX A;  3GX0 A;  5A4V A;  3EUR A;  2DIY A;  4AKX B;  2PU9 C;  3DVW A;  2E2G A;  4ZL7 A;  1V98 A;  2A4H A;  3HDC A;  5IMV A;  5J40 A;  2CV4 A;  5D73 A;  4IW9 A;  2LUS A;  4GDF A;  4NPB A;  1XWK A;  2QKE A;  4AKG A;  3A2W A;  1GSF A;  3MDK A;  1K3L A;  3ISO A;  3I69 A;  1G6Y A;  1GUK A;  2LJA A;  3KCM A;  2B5X A;  5G30 A;  2FY6 A;  2MMZ A;  1YDK A;  3L0H A;  2RM5 A;  1X9W B;  2WW2 A;  3F63 A;  6GSU A;  2FWE A;  1JZO A;  4K7N A;  4WR5 A;  1YJ6 A;  2VD1 A;  3QR6 A;  1EEJ A;  4JRR A;  1FAA A;  3GH6 A;  4L5O A;  5BRT A;  4ZXG A;  3BCK A;  1B9Y C;  3VUR A;  5DAK A;  1Z3E A;  1VF3 A;  3H93 A;  2K8V A;  4XTS A;  2DJK A;  3VI7 A;  4LL4 B;  1THX A;  1YEX A;  3WT2 A;  5ECO B;  3HD5 A;  2YN1 A;  2HRK B;  3ZFL A;  2VL3 A;  2GGT A;  2X64 A;  4GLT A;  1QXH A;  5FHI A;  1SKR B;  3HVX A;  1S3C A;  4NHW A;  1TRV A;  2H74 A;  13GS A;  2E7P A;  4HJ2 A;  3VK9 A;  2F9S A;  3TJB A;  2HZE B;  5IPG A;  2YWO A;  1G7E A;  4YKG A;  1WRY A;  4MZB A;  3HVN A;  4BVX A;  4K5R A;  2VAF A;  5A4W A;  2CAQ A;  1XW6 A;  1F2E A;  1YQ1 A;  3QCP A;  1Z5Y E;  1JZD A;  4NXI A;  4LMV A;  5F0G A;  3CRU A;  2H1B A;  2YZH A;  3RAZ A;  2VCV A;  2JZS A;  2ZCT A;  2F8A A;  4QL7 A;  2BMX A;  1QQ2 A;  4MCU A;  5ABR A;  2HSM A;  1B9X C;  1XXU A;  5EY6 A;  5HR0 A;  3LYP A;  3Q19 A;  3EMX A;  1RW1 A;  2H0I A;  1YVL A;  1XCC A;  2RM6 A;  3FR6 A;  2H0H A;  2C0F A;  3N9J A;  2DML A;  2GSQ A;  3KTB A;  5DAL B;  2IL3 A;  3C1R A;  1FW1 A;  3NOF A;  4JU5 A;  5IMZ A;  2R5G A;  5J4Y A;  1T8E B;  4EF0 A;  3Q74 A;  5ECN B;  3ZZX A;  1PD2 1;  1HQO A;  4IEL A;  4EE0 A;  3KP8 A;  1FB0 A;  1THO A;  4EDZ A;  2N5B A;  3EMP A;  5ECI B;  4MZW A;  2R3X A;  5CYY A;  2IFQ A;  4ZL8 A;  1ZYP A;  3GUR A;  5DJL A;  3EPT A;  4XRA A;  5J9B A;  1Z9H A;  2WDU A;  4GSN A;  5CRE A;  4KX4 A;  4EIQ A;  4MAB A;  4MF6 A;  3HMJ G;  1WE0 A;  5B8A A;  1UA5 A;  4MPF A;  2HT9 A;  1A0F A;  4MJB A;  2KUC A;  3UBK A;  2DJ0 A;  4WF4 A;  2HYX A;  4YAV A;  2LS5 A;  1Y6E A;  4MH2 A;  2R0G A;  2YWN A;  2QA2 A;  1ERV A;  2HRN A;  1XG8 A;  1IYI A;  3LW9 A;  1AQV A;  4W66 A;  2L5L A;  1I9D A;  1GTI A;  1TK5 B;  4PX1 A;  3KTL A;  1YKA A;  2UV8 G;  20GS A;  3TKS C;  3HZ8 A;  5CRH A;  2YJH A;  2WZS A;  2XBQ A;  3ERW A;  4QL9 A;  2EIQ A;  1J08 A;  1TXU A;  3C1S A;  4NMU A;  1ERU A;  4IQA A;  1EGO A;  5J47 A;  2GT6 A;  2IMF A;  4KAE A;  1SVM A;  4XS4 A;  1K0M A;  2BTO T;  4OWY A;  2LV3 A;  5EL8 A;  2HSN B;  4PQI A;  4GCI A;  2P5R A;  3RHC A;  4I8B A;  1XVW A;  1H75 A;  4K8M A;  3D0Z A;  3DVX A;  3APO A;  4PQ1 A;  5J3R A;  1EP7 A;  3ME8 A;  4IHU A;  4OO4 A;  1TK0 B;  3HY2 A;  2GQL A;  3J7Y b;  1TRW A;  4PNG A;  3L4N A;  4XCS A;  2CZ3 A;  1NHY A;  3GH9 A;  1SL1 B;  2OAC A;  4TOP A;  3CWG A;  2O85 A;  5G5E A;  3GIX A;  2HXK A;  4POK A;  2GLR A;  4K1F A;  4WKW A;  2JL4 A;  2H30 A;  4GQC A;  3IV4 A;  1FVK A;  3FZA A;  4IS0 A;  4O7H A;  4FXY P;  3Q18 A;  1Z7P A;  5G1L A;  3HHV A;  4EKZ A;  4BIK A;  1O81 A;  1Q98 A;  3GTU A;  4IBP A;  1E6B A;  5KN1 A;  1U88 A;  3VPT A;  5ECK B;  3GV1 A;  3U6V A;  22GS A;  3M8N A;  1OYJ A;  2IWT A;  1SJ6 A;  2OAD A;  2H76 A;  5G1K A;  3G9B A;  4KDX A;  3S9F A;  4F0B A;  4MJE A;  4N0Z A;  3WGD A;  4KDY A;  2HE3 A;  2PVQ A;  1ILO A;  4Z2U A;  3UVH A;  4EIP A;  1BG1 A;  2LRN A;  4YH2 A;  5IMA A;  4X4J A;  2L59 A;  4KB3 A;  3F9U A;  2L4C A;  5D96 A;  6GSY A;  1O8W A;  2F51 A;  3F4T A;  2HZF A;  3P90 A;  2CVK A;  3E9J B;  4HEA 2;  1N2A A;  1DBY A;  3WT1 A;  2H01 A;  4GF0 A;  5F05 A;  3VFI A;  2QGV A;  3SBC A;  4XS6 A;  1K3O A;  2REM A;  5ENU A;  4GQF A;  4ZB9 A;  1TI3 A;  1F6M C;  3HJO A;  2LQQ A;  1WMJ A;  1M3J A;  2NDO A;  4HJM A;  4V2N A;  1JFU A;  2QC7 A;  2C0G A;  5HFG A;  3RFR C;  4AKI A;  3H1N A; 
#chains in the Genus database with same CATH homology
 4TN8 A;  2PVO C;  3JCM L;  5IOX A;  3MNG A;  4Z2R A;  4AJ7 A;  1YZX A;  1OC9 B;  5DCG A;  1BAY A;  1DE1 A;  4HQS A;  2LJK A;  3D4T A;  2ES7 A;  1NM3 A;  3DRN A;  1B8X A;  4EDY A;  1I5G A;  4V2M A;  2IMD A;  1A23 A;  2VM2 A;  2CA8 A;  2GTU A;  3F6F A;  1HYU A;  5CRD A;  1X5D A;  3I6A A;  1B4P A;  4K0N A;  4ZIL A;  5FT3 A;  2EFE A;  2HQT A;  4ID0 A;  4KSM A;  3IAS 2;  5ELA A;  1OE7 A;  1MDI A;  2B7K A;  2V41 A;  2VOC A;  4HS1 A;  1F37 A;  1X9S B;  5J4U A;  1W4V A;  2EFH A;  3EVI A;  4ZB8 A;  2JU5 A;  4HOJ A;  2ON7 A;  1GSS A;  2VCT A;  2YJ7 A;  2H8L A;  3RHB A;  2I4A A;  4I6X A;  1GUL A;  5J9C A;  2ZNM A;  4MH3 A;  4XRD A;  3TJK A;  2H70 A;  2L5O A;  3J7Y k;  4G19 A;  1GSE A;  3FK8 A;  3W8S A;  3EU3 A;  4E8E A;  4TXO A;  4GTU A;  2H1G A;  1YKC A;  3ZLP A;  3FR3 A;  4O5R A;  2AAW A;  3LGC A;  4AKH A;  3IDV A;  4MF5 A;  1PMT A;  3ZML A;  2A4V A;  1XBS A;  1QK8 A;  2OE1 A;  1MEK A;  2L4Q A;  3K8N A;  3CRT A;  5ID2 B;  2AV4 A;  4BPY A;  1KBN A;  5KN2 A;  12GS A;  1QFN A;  4ZBB A;  3TGZ A;  3I9V 2;  1ZCP A;  1PN0 A;  4CY6 A;  5G31 A;  2E0Q A;  3FY7 A;  2KP1 A;  5E59 A;  4JR4 A;  3MIX A;  3GL5 A;  2PGT A;  2I3Y A;  2NTO A;  2H6Y A;  1TOF A;  1XW5 A;  1XW9 A;  5AN1 A;  1T7P B;  3TRQ A;  2P5Q A;  1OC8 A;  1TRS A;  3F8U A;  2CAI A;  3R2Q A;  5A1N A;  4KH7 A;  5ECP B;  3QOU A;  1FO5 A;  1TI1 A;  3ED3 A;  5GSS A;  1VRS D;  4OD7 A;  1SYR A;  4PUR A;  4DEJ A;  1T4Y A;  5DBQ A;  2GZY A;  1B48 A;  3A2V A;  3TKS A;  3APQ A;  2OA7 A;  3TKR A;  4ZL9 A;  3LYK A;  3GMF A;  4K9Z A;  2WUL A;  2OE3 A;  3EYT A;  2GZZ A;  1W89 A;  5EPF A;  1R5A A;  2FD3 A;  1GUM A;  3FR9 A;  4Q5R A;  2H73 A;  2LRT A;  4MA9 A;  4PXO A;  1FHE A;  3CXG A;  4MLY A;  5KOW A;  1HD2 A;  2YAN A;  4PGT A;  1ZZY A;  1SKS B;  2YCD A;  4BVY A;  5HR3 A;  1GH2 A;  5A34 A;  4PUA A;  4LL1 B;  1EZK A;  3L9S A;  1N8J A;  2DKI A;  4J2F A;  2OT3 A;  1SU9 A;  3HA9 A;  3QAG A;  2RUE A;  5DQS A;  1VF4 A;  4BL7 A;  3C73 A;  5B6N A;  1BJX A;  4K7I A;  1GNW A;  3BD2 A;  2V6O A;  4EL1 A;  1SD8 A;  3UBL A;  2MMA A;  3I43 A;  4N10 A;  3FZ4 A;  4BA7 A;  5ELG A;  5G5F A;  3IRA A;  1GTA A;  3LG6 A;  4RQX A;  3IK9 A;  2B5E A;  5J4V A;  3GYK A;  1EOH A;  4ICY A;  2PMT A;  4BWS A;  5CRW A;  3OR5 A;  3DYR A;  3UEM A;  2B1K A;  4G10 A;  18GS A;  4DSQ A;  4HZ2 A;  4IJI A;  5ECL B;  3TU3 B;  1FG4 A;  3BBY A;  3LEF A;  2AHE A;  1PL2 A;  2BJX A;  1MD4 A;  5DAK B;  1BYE A;  2M72 A;  1J9B A;  2R2J A;  1XWC A;  1GSU A;  1O85 A;  2OBK A;  3HVS A;  3M1G A;  1XIY A;  5IM9 A;  3IAM 2;  4D73 A;  3O6T A;  6GSW A;  2VUP A;  4LMW A;  2MZC A;  4ML6 A;  4K0G A;  3IA1 A;  1XOB A;  2VCQ A;  1PX6 A;  3D21 A;  2WB9 A;  3TCO A;  3FZ9 A;  2LKU A;  3MWH A;  1U3I A;  1X5E A;  1U87 A;  4ECB A;  4HU7 A;  3G7J A;  1EOG A;  2DC5 A;  3CTF A;  2AB6 A;  4ECC A;  4BVX B;  2I9H A;  4TR1 A;  4L0U A;  3PIN A;  1WPI A;  4RQR A;  1GTU A;  4OFM A;  5LNK e;  1U6T A;  3BCI A;  1N25 A;  1V40 A;  3VPQ A;  3QAW A;  1URM A;  3ZL5 A;  2PPT A;  4WET A;  2FHE A;  2DJ2 A;  3KH9 A;  1ACV A;  1HNA A;  1M7T A;  3ZYW A;  2K9F A;  4FO5 A;  3GUS A;  3CBU A;  2YWM A;  2C8U A;  1GLQ A;  2HSM B;  3ZIJ A;  4L8E A;  1SKW B;  2YV9 A;  4F2I A;  4XIH A;  4HZ4 A;  2HNL A;  2HRA A;  2R6K A;  4TR1 B;  1O6J A;  3UJ1 A;  1SJI A;  4NV5 A;  3UAP A;  2MBT A;  3EU4 A;  2B7J A;  1K0C A;  2C3Q A;  2FCH A;  2H1L A;  4IP6 A;  3W8J A;  4NAX A;  3TB2 A;  4G0K A;  2F8F A;  5B7C A;  4PQH A;  3IXR A;  2H19 A;  2WFC A;  2VCW A;  1Z7R A;  3D22 A;  1GSY A;  4X43 A;  5COH A;  3LXZ A;  1TRU A;  2OE0 A;  2I81 A;  5HQP A;  1FOH A;  4MK3 A;  1F9M A;  1TXX A;  2VLU A;  1DUG A;  2IFQ B;  4QMK A;  5H5Q A;  2VO4 A;  1PRX A;  4IGJ A;  3MAK A;  4YAP A;  1GWC A;  2HRF A;  4FQU A;  3A3T A;  1GRX A;  1SEN A;  4Z2T A;  2XPE A;  4ECJ A;  2VCZ A;  4KA0 A;  3UAR A;  5J41 A;  3FKF A;  4KGI A;  2CX4 A;  1M9B A;  3HVV A;  1DSB A;  1AC1 A;  2DJ1 A;  4N0V A;  16GS A;  5AIX A;  2CQ9 A;  2ON5 A;  3UL3 A;  4O5Q A;  1O73 A;  1AIU A;  4MPG A;  1UVZ A;  1K0D A;  4CY8 A;  4TXV A;  4YKF A;  1K0B A;  2DLX A;  3IPZ A;  4G9H A;  2C3N A;  4EXJ A;  2AJQ B;  5IIZ A;  2HSH A;  5LD0 A;  4PUF C;  3F6D A;  4O5U A;  1FVJ A;  5JCW A;  4V1A g;  3M0F A;  1PL1 A;  1T00 A;  2O87 A;  4E8H A;  3TKQ A;  3W6G A;  3FHK A;  3CSJ A;  3N5O A;  4Q5N A;  4O92 A;  1A8Y A;  2CT6 A;  1T3B A;  1G6W A;  4F9Z A;  1FB6 A;  4XS4 B;  2CVB A;  3TKS E;  3HYP A;  4FH8 A;  3LSZ A;  4TR3 A;  1EWX A;  3C71 A;  4RUV A;  5JCG A;  1GSD A;  4AGS A;  1H4O A;  2C3T A;  4N11 A;  5ECQ B;  3DGQ A;  2O89 A;  3DML A;  2GQK A;  4DSS A;  3HCZ A;  2L6D A;  2VL2 C;  2FWG A;  1A2L A;  3HKR A;  5CAX A;  3HJM A;  1OVN A;  1TW9 A;  1NHO A;  3VLN A;  5CRG A;  4ZBA A;  3M3M A;  4OMV A;  1ZYN A;  2KP2 A;  2X8G A;  1Q4J A;  4V1A p;  1GNE A;  2DKH A;  2FA8 A;  3H4K A;  2WJU A;  3BJ5 A;  1MDK A;  1AXD A;  3Q6O A;  1CQH A;  1SK2 A;  1NSW A;  5A5H A;  1G7O A;  4K6X A;  3PGT A;  4CW9 A;  4CHS A;  2PER A;  1ZYQ B;  3GTU B;  2C1Y A;  5JWR B;  4MNN A;  5C04 A;  4G0L A;  1T1V A;  1XZO A;  3LJR A;  4F82 A;  2A2P A;  4TRX A;  4TW5 A;  3DKS A;  4IJ3 A;  2ALB A;  6GSS A;  3GNJ A;  3FRC A;  2UZ8 A;  2LJR A;  3LQ7 A;  1EV4 A;  3TRX A;  3A5I A;  3P2A A;  1JHB A;  5IMC A;  2VD0 A;  1Z6N A;  3AY8 A;  3TOT A;  4AF2 A;  3ME7 A;  4WF5 A;  1K3Y A;  3TJF A;  3ZVJ A;  5IO2 A;  2LEG A;  1EGR A;  1E2Y A;  5CO3 A;  2PUK C;  4I5Q A;  1SVL A;  1EEM A;  4GSS A;  3U5R E;  4G0I A;  4TKY A;  3APS A;  3A2X A;  2PN8 A;  2IMK A;  5JCU A;  4ECI A;  5IO0 A;  2PWJ A;  4KE3 A;  11GS A;  2JSZ A;  3DXB A;  5BMU A;  1FOV A;  4HQZ A;  2NPB A;  3KMO A;  4DVC A;  2VLV A;  4ISD A;  4OCF A;  2WGR A;  1OKD A;  3IC4 A;  2CZ2 A;  1GUH A;  1R26 A;  2ZUP A;  4HDE A;  4FYU A;  1PKW A;  2LQO A;  4K2D A;  2H75 A;  1J0F A;  1PKZ A;  2FGX A;  4MJA A;  1Y25 A;  4N3Z A;  5FWG A;  2A2R A;  1YY7 A;  2DJJ A;  2P0G A;  4YQM A;  3KM6 A;  2RLI A;  1VF1 A;  1MD3 A;  5IMD A;  5JWQ B;  2M46 A;  2H66 A;  3KEB A;  4GWR A;  9GSS A;  1YF1 A;  1BF5 A;  3DD3 A;  3F0I A;  4WBR D;  2G0F A;  1QUW A;  2V6K A;  1ERT A;  2WCI A;  5DJM A;  3FYG A;  1O8X A;  5A4U A;  2B1L A;  1M0U A;  5JWO B;  2H0G A;  1XVQ A;  2J9H A;  6GSX A;  1SK0 A;  2JSY A;  3F3Q A;  4K5S A;  1TJD A;  2OKA A;  3M9J A;  4TXO B;  1R5P A;  5IMF A;  2MMO A;  5F07 A;  3SWL A;  4KSO A;  4POL A;  4KDU A;  3QDN A;  5D93 A;  2EFC A;  2DMM A;  4GST A;  2H1D A;  5GAP D;  4JZQ A;  2VLT A;  4IKH A;  1A2M A;  1JLV A;  2RUF A;  4O32 A;  5CP1 A;  4LLR A;  2GVP A;  4TR4 A;  4WBJ A;  5KN0 A;  4IP1 A;  2CVD A;  4XS1 A;  5F06 A;  4NWY A;  3VWV A;  4OCE A;  4Q5Q A;  1AUC A;  3E0U A;  1TU7 A;  4EVM A;  4EUY A;  2EIO A;  2OBI A;  3GX8 A;  2MYG A;  2IMI A;  3C8E A;  1OAZ A;  3L9U A;  3IHQ A;  5A1N B;  2EIR A;  3GL3 A;  3ERF A;  4FIW A;  3WGX A;  3US3 A;  1T4Z A;  3IHG A;  5J5N A;  3RPP A;  5ECS A;  1K0N A;  4AI6 A;  5DVB A;  1GTB A;  3PR8 A;  2HRK A;  4WR4 A;  5ECM B;  1ZGN A;  4L5L A;  2I1U A;  5H5S A;  4EO3 A;  1X9M B;  4Z7X A;  4ZB7 A;  4RI7 A;  2HZE A;  4F03 A;  2P31 A;  3DIE A;  1ST9 A;  3O3T A;  1MDJ A;  1XWG A;  2H6X A;  3ZTL A;  3V1W A;  2X4A A;  2V32 A;  3BOA A;  5CNW A;  3FW2 A;  4BVY B;  5A34 B;  1DE2 A;  1PSQ A;  1M9A A;  4I97 A;  2GZP A;  1XWA A;  3GSS A;  4A5P A;  1K0O A;  2FWF A;  3KGK A;  2XC2 A;  1A0R P;  1TP9 A;  1EV9 A;  2VL2 A;  4BL7 B;  3IOS A;  2LTK A;  3ZIT A;  2C80 A;  1PX7 A;  1BQ7 A;  3HZ4 A;  1LBK A;  4I2T A;  2TRC P;  4WEY A;  1BX9 A;  3VWU A;  3TRP A;  3TDG A;  3O76 A;  2H72 A;  3WD6 A;  3G7I A;  2AUV A;  3MSZ A;  2GSS A;  5GST A;  2TRX A;  4KCA A;  5DAL A;  1ML6 A;  1PA3 A;  4GRF A;  2LRC A;  3CMI A;  3GFK A;  2H6Z A;  1HNB A;  4H86 A;  14GS A;  1WWJ A;  3ZFB A;  2C0D A;  1JZW A;  2DBC A;  2KHP A;  4DSR A;  5EVO A;  5AIS A;  2B6M A;  1BED A;  3GKN A;  4J56 E;  2IPA A;  4EC0 A;  2X8C A;  3CTG A;  2V1M A;  5KEJ A;  2YP6 A;  4D73 B;  1ERW A;  1WIK A;  1XWB A;  3LWA A;  5ECH B;  3LFL A;  7GSS A;  2NBS A;  5D9V A;  2VM1 A;  2JZT A;  3GKM A;  4PNF A;  1PN9 A;  2YWI A;  3GKX A;  3ERG A;  1RQM A;  5ECR B;  2N5F A;  1R4W A;  1OC3 A;  2HFD A;  1JZR A;  1C72 A;  2YV7 A;  5L71 A;  3F4S A;  1G0T A;  2JAD A;  2B5Y A;  1CQG A;  1AW9 A;  3P7X A;  4XHM A;  1M99 A;  2YOI A;  2DSA A;  3A5W A;  1M2A A;  1TKD B;  1O7U A;  2VL9 A;  5KOX A;  3FMW A;  2J23 A;  3IC8 A;  3UMA A;  4FYC A;  5IPH A;  4ULX A;  3ZVJ D;  1Y1U A;  1S3A A;  3QFB C;  4KF9 A;  2AYT A;  3HJP A;  1HNC A;  3VWW A;  4JR6 A;  4HU9 A;  1OKT A;  2N5A A;  17GS A;  1F3A A;  2OJL A;  4IQ1 A;  1AQW A;  4K7O A;  3F4R A;  2HSN A;  5GZZ B;  4N30 A;  5B8B A;  2FLS A;  5D8I A;  1GP1 A;  4ZIJ A;  4OFT A;  2V2G A;  4YQU A;  1QMV A;  1VGL A;  3RBT A;  1WJK A;  3KH7 A;  2O8V B;  2M80 A;  2A2S A;  2Z9S A;  2G2Q A;  10GS A;  2LST A;  5DDL A;  2X49 A;  2MMN A;  3VWX A;  6GSV A;  1GLP A;  2K6V A;  4OFN A;  2X8H A;  4MJC A;  2XHF A;  4IN0 A;  4NV2 A;  4ML1 A;  3D5J A;  1RK4 A;  1USB A;  4Q5F A;  3TOU A;  1F3B A;  3ZRE A;  2JZR A;  2K18 A;  2L6C A;  3GN3 A;  3H8Q A;  3WYW A;  1ZL9 A;  3IK7 A;  3KD0 A;  5KN3 A;  2KLX A;  1YEP A;  2D2Z A;  1JLW A;  2GSR A;  5IOW A;  4BWQ A;  3QAV A;  3TJJ A;  2GST A;  3F3R A;  2H1A A;  1ZYE A;  1NW2 A;  1ZMA A;  2QA1 A;  4KCE A;  1VF2 A;  3ZIV A;  3GHA A;  1EP8 A;  2HSY A;  3KXO A;  2JAC A;  1QGV A;  3CYN A;  3FZ5 A;  3KIJ A;  1LU4 A;  1U3A A;  1M2B A;  3ZRD A;  3EE2 A;  2VKZ G;  4K2X A;  1SK1 A;  3FEU A;  3D4M A;  2GQM A;  2YPM A;  1K0A A;  2B3S A;  4E68 A;  1X5C A;  3MYD A;  5AIV A;  1ZOF A;  2C4J A;  5E4W A;  1XPV A;  3GKK A;  1KNG A;  1WP0 A;  4ZBD A;  3PH9 A;  3PPU A;  4G01 A;  4IVF A;  4USS A;  4POM A;  1SL0 B;  4TR0 A;  1S3D A;  5F8B A;  2VCX A;  3L9V A;  3QFA C;  4POB A;  4KUN A;  3QD9 A;  1V2A A;  2GT5 A;  4ACS A;  3LOR A;  4V2L A;  1KTE A;  4DSS B;  5AGY A;  2HLS A;  5HFK A;  3IE3 A;  4L0W A;  4CDO A;  3IBH A;  4X0X A;  1PQN A;  1XOA A;  5INY A;  1M2D A;  3KMN A;  1SL2 B;  3KJY A;  1OC9 A;  3EIN A;  1WOU A;  4X1U A;  4WXT A;  1GSQ A;  3QPM A;  4TVE A;  5DQY A;  4F0C A;  3EWL A;  1X0R A;  4RI6 A;  4LA1 A;  3M9K A;  1TU8 A;  2FUG 2;  3KZQ A;  1SVO A;  5C00 A;  4ZB6 A;  1SD9 A;  1V57 A;  5A5H B;  1A2J A;  1ON4 A;  2DJ3 A;  4JED A;  2R0C A;  3P8W A;  1LJR A;  3NZN A;  1YF0 A;  2MBS A;  3GA4 A;  3E3E A;  2R4V A;  2F3M A;  2O5V A;  3H79 A;  4J57 E;  2K8S A;  2EFD A;  1MTC A;  3R3E A;  2HI7 A;  1SJZ A;  1AAZ A;  4HI7 A;  2IME A;  4GXZ A;  3DEX A;  8GSS A;  5D9W A;  2DIZ A;  3UVT A;  5HR2 A;  2KOK A;  3L78 A;  3WGE A;  2XBI A;  3DWV A;  2C0E A;  6GST A;  2WS2 A;  2E2M A;  1TDI A;  4FYB A;  4KW6 A;  2IJY A;  2YZU A;  4OO5 A;  3RPN A;  1SYX A;  1TTZ A;  3TJG A;  3EC3 A;  3VI5 A;  5BMU B;  3D6I A;  1TK8 B;  3UIW A;  4JE1 A;  4I2U A;  4HUA A;  5H5R A;  3KP9 A;  5HR1 A;  2PBJ A;  5ID2 A;  1AQX A;  3UOM A;  2H71 A;  19GS A;  2X99 A;  1XFL A;  3C7M A;  3ZMK A;  5GAN D;  1GL8 A;  5LCZ A;  4PTS A;  3HXS A;  2WZ9 A;  1V9W A;  4G2E A;  1A24 A;  1PGT A;  4JBB A;  4AJ8 A;  2RII A;  1R7H A;  4AJ6 A;  4KND A;  2GDR A;  5B6M A;  2TIR A;  4MDC A;  4QQ7 A;  3IR4 A;  1A8L A;  5D9T A;  1ABA A;  3RDW A;  1UC7 A;  4P3Y B;  3TKP A;  2GS3 A;  2O7K A;  5IQY A;  3GST A;  1B4Q A;  5A5K A;  2NVL A;  1KEB A;  4MP4 A;  3CSH A;  1V58 A;  4YQV A;  5D9X A;  1IYH A;  1UN2 A;  2YNX A;  2R37 A;  5G2Z A;  3G7Y A;  3CSI A;  1OE8 A;  4MZC A;  3QMX A;  4MMM A;  2EC4 A;  2FNO A;  5HFI A;  4NHZ A;  4MF7 A;  2XPD A;  2L57 A;  2IIY A;  2LNT A;  2FA4 A;  1Z6M A;  4ILF A;  2FWH A;  2QSI A;  1BG5 A;  3LXT A;  3NIV A;  2VIM A;  2LNS A;  5DCH A;  2IN3 A;  2WRT A;  2R0P A;  2CX3 A;  3TUE A;  3GRX A;  3GX0 A;  5A4V A;  3EUR A;  2DIY A;  4AKX B;  2PU9 C;  3DVW A;  2E2G A;  4ZL7 A;  1V98 A;  2A4H A;  3HDC A;  5IMV A;  5J40 A;  2CV4 A;  5D73 A;  4IW9 A;  2LUS A;  4GDF A;  4NPB A;  1XWK A;  2QKE A;  4AKG A;  3A2W A;  1GSF A;  3MDK A;  1K3L A;  3ISO A;  3I69 A;  1G6Y A;  1GUK A;  2LJA A;  3KCM A;  2B5X A;  5G30 A;  2FY6 A;  2MMZ A;  1YDK A;  3L0H A;  2RM5 A;  1X9W B;  3F63 A;  6GSU A;  2FWE A;  1JZO A;  4K7N A;  4WR5 A;  1YJ6 A;  2VD1 A;  3QR6 A;  1EEJ A;  4JRR A;  1FAA A;  3GH6 A;  4L5O A;  5BRT A;  4ZXG A;  3BCK A;  1B9Y C;  3VUR A;  5DAK A;  1Z3E A;  1VF3 A;  3H93 A;  2K8V A;  4XTS A;  2DJK A;  3VI7 A;  4LL4 B;  1THX A;  1YEX A;  3WT2 A;  5ECO B;  3HD5 A;  2YN1 A;  2HRK B;  3ZFL A;  2VL3 A;  2GGT A;  2X64 A;  4GLT A;  1QXH A;  5FHI A;  1SKR B;  3HVX A;  1S3C A;  4NHW A;  1TRV A;  2H74 A;  13GS A;  2E7P A;  4HJ2 A;  3VK9 A;  2F9S A;  3TJB A;  2HZE B;  5IPG A;  2YWO A;  1G7E A;  4YKG A;  1WRY A;  4MZB A;  4BVX A;  4K5R A;  2VAF A;  5A4W A;  2CAQ A;  1XW6 A;  1F2E A;  1YQ1 A;  3QCP A;  1Z5Y E;  1JZD A;  4NXI A;  4LMV A;  5F0G A;  3CRU A;  2H1B A;  2YZH A;  3RAZ A;  2VCV A;  2JZS A;  2ZCT A;  2F8A A;  4QL7 A;  2BMX A;  1QQ2 A;  4MCU A;  5ABR A;  2HSM A;  1B9X C;  1XXU A;  5EY6 A;  5HR0 A;  3LYP A;  3Q19 A;  3EMX A;  1RW1 A;  2H0I A;  1YVL A;  1XCC A;  2RM6 A;  3FR6 A;  2H0H A;  2C0F A;  3N9J A;  2DML A;  2GSQ A;  3KTB A;  5DAL B;  2IL3 A;  3C1R A;  1FW1 A;  3NOF A;  4JU5 A;  5IMZ A;  2R5G A;  5J4Y A;  1T8E B;  4EF0 A;  3Q74 A;  5ECN B;  3ZZX A;  1PD2 1;  1HQO A;  4IEL A;  4EE0 A;  3KP8 A;  1FB0 A;  1THO A;  4EDZ A;  2N5B A;  3EMP A;  5ECI B;  4MZW A;  2R3X A;  5CYY A;  2IFQ A;  4ZL8 A;  1ZYP A;  3GUR A;  5DJL A;  3EPT A;  4XRA A;  5J9B A;  1Z9H A;  2WDU A;  4GSN A;  5CRE A;  4KX4 A;  4EIQ A;  4MAB A;  4MF6 A;  3HMJ G;  1WE0 A;  5B8A A;  1UA5 A;  4MPF A;  2HT9 A;  1A0F A;  4MJB A;  2KUC A;  3UBK A;  2DJ0 A;  4WF4 A;  2HYX A;  4YAV A;  2LS5 A;  1Y6E A;  4MH2 A;  2R0G A;  2YWN A;  2QA2 A;  1ERV A;  2HRN A;  1IYI A;  3LW9 A;  1AQV A;  4W66 A;  2L5L A;  1I9D A;  1GTI A;  1TK5 B;  4PX1 A;  3KTL A;  1YKA A;  2UV8 G;  20GS A;  3TKS C;  3HZ8 A;  5CRH A;  2YJH A;  2XBQ A;  3ERW A;  4QL9 A;  2EIQ A;  1J08 A;  1TXU A;  3C1S A;  4NMU A;  1ERU A;  4IQA A;  1EGO A;  5J47 A;  2GT6 A;  2IMF A;  4KAE A;  1SVM A;  4XS4 A;  1K0M A;  2BTO T;  4OWY A;  2LV3 A;  5EL8 A;  2HSN B;  4PQI A;  4GCI A;  2P5R A;  3RHC A;  4I8B A;  1XVW A;  1H75 A;  4K8M A;  3D0Z A;  3DVX A;  3APO A;  4PQ1 A;  5J3R A;  1EP7 A;  3ME8 A;  4IHU A;  4OO4 A;  1TK0 B;  3HY2 A;  2GQL A;  3J7Y b;  1TRW A;  4PNG A;  3L4N A;  4XCS A;  2CZ3 A;  1NHY A;  3GH9 A;  1SL1 B;  2OAC A;  4TOP A;  3CWG A;  2O85 A;  5G5E A;  3GIX A;  2HXK A;  4POK A;  2GLR A;  4K1F A;  4WKW A;  2JL4 A;  2H30 A;  4GQC A;  3IV4 A;  1FVK A;  3FZA A;  4IS0 A;  4O7H A;  3Q18 A;  1Z7P A;  5G1L A;  3HHV A;  4EKZ A;  1O81 A;  1Q98 A;  3GTU A;  4IBP A;  1E6B A;  5KN1 A;  1U88 A;  3VPT A;  5ECK B;  3GV1 A;  3U6V A;  22GS A;  3M8N A;  1OYJ A;  2IWT A;  1SJ6 A;  2OAD A;  2H76 A;  5G1K A;  3G9B A;  4KDX A;  3S9F A;  4F0B A;  4MJE A;  4N0Z A;  3WGD A;  4KDY A;  2HE3 A;  2PVQ A;  1ILO A;  4Z2U A;  3UVH A;  4EIP A;  1BG1 A;  2LRN A;  4YH2 A;  5IMA A;  4X4J A;  2L59 A;  4KB3 A;  3F9U A;  2L4C A;  5D96 A;  6GSY A;  1O8W A;  2F51 A;  3F4T A;  2HZF A;  3P90 A;  2CVK A;  3E9J B;  4HEA 2;  1N2A A;  1DBY A;  3WT1 A;  2H01 A;  4GF0 A;  5F05 A;  3VFI A;  2QGV A;  3SBC A;  4XS6 A;  1K3O A;  2REM A;  5ENU A;  4GQF A;  4ZB9 A;  1TI3 A;  1F6M C;  3HJO A;  2LQQ A;  1WMJ A;  2NDO A;  4HJM A;  4V2N A;  1JFU A;  2QC7 A;  2C0G A;  5HFG A;  4AKI A;  3H1N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...