2N5FA

Solution structure of the dehydroascorbate reductase 3a from populus trichocarpa
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
212
structure length
212
Chain Sequence
MALEICVKAAVGAPNILGDCPFCQRVLLSLEEKKIPYKSHLINLGDKPQWFLEISPEGKVPVVKIDDKWVADSDVIVGILEEKNPEPPLATPPEFASVGSKIFPSFVKFLKSKDPNDGTEQALLEELKALDGHLKVHGPFIAGEKITAVDLSLAPKLYHLEVALGHFKNWPIPDNLTHVLNYIKLLFSRESFKKTRAAEEHVIAGWEPKVNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Dehydroascorbate reductase family protein
publication title Insights into ascorbate regeneration in plants: investigating the redox and structural properties of dehydroascorbate reductases from Populus trichocarpa.
pubmed doi rcsb
source organism Populus trichocarpa
total genus 55
structure length 212
sequence length 212
ec nomenclature ec 1.8.5.1: Glutathione dehydrogenase (ascorbate).
pdb deposition date 2015-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2n5fA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2n5fA01
3QMXA 5DCGA 1O81A 4TN8A 5G30A 1JZOA 2UZ8A 4WBJA 4ZBDA 2C3NA 3M8NA 4O5RA 4Q5RA 4RI6A 2HFDA 3KM6A 4DEJA 2NTOA 4F9ZA 5DAKB 1A23A 5CAXA 2VCTA 1YEPA 2X8HA 1EOHA 4XS1A 3WD6A 2C0FA 1K3YA 2LJRA 4HOJA 2FNOA 3BOAA 3ZYWA 4LMWA 4PXOA 4ML6A 2GQLA 1XW9A 2DBCA 3QDNA 4MPGA 2JZTA 2TRXA 5B8BA 4HU9A 1XVWA 2P0GA 4LLRA 2DJ0A 1M2AA 2ZUPA 3E9JB 1TW9A 5G5EA 2H74A 2C0DA 5F0GA 6GSXA 3QFAC 2DC5A 6GSYA 4TXVA 4GXZA 3ZIJA 1TDIA 3EINA 3EE2A 1TK8B 2DMMA 5J9CA 1ERVA 4MDCA 2OBIA 2GSTA 4KW6A 3UL3A 2QC7A 3ZFLA 5GZZB 1PL2A 3L9VA 4NHZA 1I5GA 2IL3A 5LCZA 4ZB6A 3DEXA 1EEMA 4EO3A 1LBKA 2O8VB 4MCUA 3H79A 2WGRA 3HJOA 4FO5A 3J7Yb 3LFLA 1OE8A 2C0GA 3D6IA 3ZFBA 2H19A 2AUVA 4K0NA 4L5OA 4GWRA 3ZL5A 1DUGA 4KB3A 1X5EA 3DKSA 4PQIA 2HI7A 4XCSA 5HQPA 5ECLB 2WULA 3N5OA 1TXXA 4EKZA 2LSTA 2TRCP 3F4TA 1F3AA 4TR0A 3TGZA 1AAZA 1I9DA 3IOSA 4HDEA 1PX6A 3CRTA 3TKSE 3TJFA 3SWLA 5J3RA 1T4YA 4LMVA 4N0ZA 4BWQA 1X9SB 5DQYA 1Q98A 6GSVA 5COHA 2VCZA 1XCCA 1T4ZA 1XZOA 3F0IA 2V41A 4E8HA 4EF0A 3U5RE 3VWVA 2BTOT 3BCIA 2QGVA 1HNAA 1K0OA 1GTBA 2L4QA 4V2NA 2DLXA 5ECOB 3F3QA 2C80A 4K7NA 3IE3A 2YJHA 2G0FA 3QAVA 4HZ2A 4DVCA 3G7JA 3C7MA 2A2RA 5EY6A 3EVIA 2RM6A 4IN0A 2EIRA 4TR1B 3BCKA 4KX4A 2C4JA 2DJKA 3IK9A 4TXOA 2ALBA 2HRAA 3UVTA 2OE0A 1S3CA 3TKSC 3GL5A 3IK7A 1SENA 2N5AA 3TRXA 1UC7A 3VFIA 5D9TA 1WIKA 5G31A 2ZNMA 3Q19A 2GSRA 4EC0A 2HRKB 1O73A 4MJEA 3GX8A 1GUMA 3WT2A 4TR4A 1G0TA 2YN1A 1E6BA 4L8EA 3ERGA 2H73A 1AQXA 2HE3A 4TR3A 2V6OA 1T3BA 4E8EA 3QPMA 5GSTA 1A2MA 2MMNA 3U6VA 2FWFA 3BBYA 5IQYA 3QCPA 3N9JA 3HJMA 13GSA 2LEGA 1SK2A 1B4QA 4IQAA 3PR8A 1AC1A 2H1AA 1JZDA 4O7HA 4IP6A 4XS4A 1FG4A 3GL3A 2YPMA 2JL4A 5G2ZA 4EDZA 4ECCA 2B6MA 1VRSD 3F6DA 1GSYA 2C0EA 3VI7A 1ZCPA 2H6ZA 1U3AA 4ZBAA 2E0QA 1HNBA 1GRXA 2R37A 1BX9A 3GTUA 1V2AA 1TP9A 2YWMA 3VI5A 4V2LA 4BA7A 1GNWA 3L9UA 2FWHA 3APOA 4OFMA 4OD7A 3NIVA 3MAKA 1LU4A 1DE1A 3ZMKA 2HRNA 5HFGA 2GQKA 1ZZYA 2LNSA 1XXUA 2JADA 1PKZA 2RUEA 4CHSA 3GKKA 3EWLA 5DJMA 3UVHA 2R4VA 1EGRA 1JZRA 3HXSA 4H86A 3HY2A 3W6GA 1BEDA 3GMFA 3ZREA 1A24A 1R7HA 1Z7RA 1TKDB 3NOFA 5GAPD 2LQOA 3RDWA 1JLWA 5DBQA 1K3OA 4KDUA 2DIYA 4PGTA 2H76A 2IN3A 2WB9A 1KNGA 19GSA 2RLIA 4V1Ag 2C3TA 3J7Yk 5G1KA 2GSQA 2PVQA 3O6TA 2AJQB 1O8WA 2C3QA 3M3MA 4L0UA 3TCOA 3ZVJA 2IMDA 5IPHA 3GV1A 3D4TA 3I6AA 1XW6A 3IDVA 1MDJA 4ECBA 2P5QA 4D73A 4GCIA 3E3EA 4N11A 1HD2A 1UN2A 1U3IA 4KE3A 5D9WA 3G7IA 4MP4A 3EYTA 5EPFA 3GH6A 2FWGA 5CRDA 5J4UA 2CX4A 2V1MA 5FWGA 1Z9HA 4EVMA 1YZXA 1NHYA 4FIWA 3LXTA 2PWJA 2L5OA 3ME7A 2D2ZA 3MSZA 2HYXA 2H70A 1K0CA 4X0XA 4IELA 1F9MA 2L57A 2GT6A 2H0IA 4GTUA 2VO4A 3GFKA 1Z3EA 3D21A 2NPBA 3UOMA 2H6YA 5FT3A 1MDKA 2DJ2A 3ISOA 1XWCA 4PQHA 5DALA 2VD0A 1V40A 1AQVA 3VURA 18GSA 1PRXA 3UEMA 4IVFA 2EIQA 3ZZXA 3G9BA 22GSA 4GF0A 3S9FA 3HVSA 2V32A 4NXIA 4POKA 1Z6MA 1SL0B 2H01A 4TXOB 3TB2A 5E4WA 2PGTA 2HLSA 2GGTA 1GP1A 3D4MA 2VUPA 4ULXA 4CW9A 2CA8A 3VWWA 1DBYA 4K1FA 4OO4A 1OKTA 2HNLA 2VL2A 4PUFC 1UVZA 2FLSA 4KA0A 4MABA 1TU7A 1R4WA 4HS1A 3IA1A 4MF6A 2DJJA 5ELGA 2O7KA 1ACVA 3LJRA 1T1VA 3L9SA 3HZ8A 4DSRA 2XPEA 2XHFA 5D8IA 3EMXA 2AV4A 3FR6A 3CBUA 2CX3A 2AYTA 5ECRB 2A4VA 1O6JA 3D0ZA 3LWAA 4LL1B 4XS4B 17GSA 5A5KA 2NVLA 2I9HA 2CAIA 2DSAA 1RQMA 5IOWA 1PKWA 4X43A 5ECNB 2M80A 2R3XA 3FKFA 4AJ6A 5IMCA 4FYCA 3P90A 2RM5A 1BJXA 2N5FA 5IMAA 2REMA 4POMA 2V6KA 2KP1A 4WXTA 3HA9A 1NHOA 3GTUB 2GT5A 1M7TA 1FVJA 3RAZA 3GKXA 5KN3A 2IMEA 4Q5QA 3L78A 4AJ7A 1GTAA 1M99A 4K2DA 3IC4A 1SJIA 3C8EA 5AN1A 4BVXA 2QSIA 3KIJA 2IIYA 4IQ1A 2P31A 1JLVA 5CP1A 2ON7A 5CNWA 1FW1A 4F0CA 2E7PA 3GRXA 4PNGA 1YY7A 1E2YA 3CSJA 5KN1A 4XIHA 3CSIA 1YKAA 3GIXA 1GL8A 5G1LA 2O87A 3TOTA 1GUHA 5A4WA 5F07A 4ACSA 4JR4A 2H0GA 1XOBA 2PMTA 5JCUA 3WGEA 3EU3A 1S3AA 2H1DA 2VL3A 4GLTA 5J5NA 2YV9A 3QFBC 2X99A 2AHEA 2F3MA 2CQ9A 4KSOA 1Z5YE 5F06A 8GSSA 1X9MB 4I6XA 3MDKA 3E0UA 1EP7A 4MH3A 5IM9A 1B9XC 1MEKA 1ON4A 5AIXA 2YWNA 3QR6A 2IPAA 4D73B 5FHIA 1DSBA 4MJCA 4IJ3A 3KXOA 2YANA 3IHQA 1TI3A 2IJYA 5F8BA 3KJYA 3HVVA 4ZL8A 4FYUA 1HQOA 1YF0A 1B8XA 2VCVA 2LV3A 4MZCA 1NW2A 4KSMA 1GSEA 5J41A 4G19A 4G2EA 1XW5A 3DIEA 2XBQA 1THOA 2FGXA 3APSA 3ZIVA 4FYBA 4IBPA 3Q6OA 3KMOA 1F6MC 2LUSA 3IRAA 2J23A 1PGTA 3G7YA 2K9FA 3CMIA 1SJ6A 4HJMA 3UAPA 3BJ5A 3FR3A 5IPGA 3I9V2 4I2UA 4K8MA 5DALB 3HD5A 2B1KA 2LRNA 3ED3A 4ECJA 1B4PA 3LYKA 3WT1A 4KDXA 1JHBA 2MMZA 2H75A 4V2MA 3C1SA 3IAS2 3C73A 4NWYA 5ECIB 1TRVA 1TOFA 4EL1A 1KTEA 1A2LA 1VF4A 5IOXA 2C8UA 1FHEA 1GUKA 2A2SA 1JZWA 2X64A 3ZVJD 2H72A 4N10A 2M46A 4GSSA 3H93A 2PBJA 4DSSA 3ERWA 4TVEA 1B9YC 3GKNA 3D5JA 1YKCA 2CV4A 2HXKA 2GZPA 5D96A 3KTLA 3LG6A 2WZ9A 2VLUA 3UARA 1GTIA 4HZ4A 4L0WA 3TKRA 1WE0A 5D73A 4KNDA 4XHMA 2VM2A 3FR9A 2KHPA 4I8BA 1PL1A 1C72A 1ZGNA 1A0FA 1OAZA 5D93A 4OFTA 1K0MA 2F8FA 2I1UA 5ENUA 4G0LA 3TJJA 4YQMA 2YWIA 4K6XA 1M0UA 4EUYA 2OADA 2FHEA 3FEUA 6GSWA 4YH2A 1WRYA 3DVXA 16GSA 3FZ4A 4OFNA 3MWHA 1RW1A 1EOGA 1J9BA 1YEXA 4RUVA 1WMJA 3MNGA 4IS0A 1VGLA 2XC2A 2FA8A 3GURA 3GX0A 3PGTA 4OWYA 4WR4A 1U6TA 4GRFA 4RQXA 1Q4JA 3W8SA 1YJ6A 1GNEA 4BVXB 1FAAA 1TRUA 2GSSA 3AY8A 4ZL9A 3DGQA 5AGYA 1USBA 3HZ4A 5H5QA 5IMVA 3GA4A 5ECQB 3CRUA 1ZL9A 1G7OA 3A2VA 1PX7A 4XRAA 5HR1A 1A0RP 5EVOA 2DIZA 1TJDA 1XBSA 3TKSA 3TJBA 4MZWA 3A3TA 3GN3A 3A2XA 5DDLA 4HEA2 1IYHA 2PN8A 2KOKA 1QQ2A 2OE3A 5BMUA 4CDOA 2B5EA 5B6NA 3UBLA 1QXHA 2CZ3A 1TK0B 1X5DA 4ISDA 2MBTA 4J2FA 2JU5A 3H8QA 2H6XA 3RBTA 2B5XA 4KUNA 14GSA 1SK1A 4I97A 1KBNA 4KCAA 5H5RA 4QQ7A 3FRCA 3IAM2 1PN9A 2VAFA 3GNJA 5L71A 5E59A 4MJBA 1EWXA 2EIOA 1X0RA 4WBRD 1YDKA 3A5WA 3KMNA 1M2BA 3A2WA 3KZQA 5DVBA 5ECKB 1QK8A 3WYWA 2C1YA 2ON5A 5IIZA 1THXA 1XFLA 3CTGA 2LJKA 5AISA 1XWGA 1SKSB 3DRNA 3CYNA 1W4VA 4HU7A 2LQQA 4K7IA 3ERFA 4GQFA 3JCML 4N0VA 4JE1A 5DCHA 1SL1B 3SBCA 1T7PB 12GSA 4POLA 2LKUA 1V58A 4BWSA 3I43A 2VOCA 2MMOA 3DYRA 1AXDA 4YAVA 2L6DA 5GSSA 2K8VA 2MMAA 2OBKA 3ZRDA 3KGKA 2N5BA 1SYXA 3C1RA 4QL9A 5ECMB 1Z6NA 1ERUA 2F9SA 4MF7A 5DJLA 4I2TA 1XWAA 4NMUA 4GSNA 3IC8A 4F82A 5J9BA 4MLYA 2YZHA 3D22A 5LNKe 1AQWA 1TRSA 2K8SA 1YF1A 4DSSB 4G9HA 3IPZA 3GUSA 4K0GA 2CZ2A 2HT9A 1K0AA 4RI7A 2XPDA 1Y25A 3F8UA 1U87A 3F4SA 3QAWA 5JCGA 1FVKA 3EU4A 1F3BA 2M72A 2X8CA 1ZMAA 1QGVA 4J56E 4PURA 3FYGA 1ABAA 3M9KA 1M9AA 1JFUA 3WGXA 1SYRA 1GSUA 3RHCA 4BL7A 4WF4A 2VL9A 2HZFA 1XOAA 3IV4A 3HJPA 2R5GA 2JZSA 1FO5A 4YQVA 4FH8A 2I81A 5CREA 1O7UA 5LD0A 1CQHA 3HDCA 3TJGA 3KD0A 2IFQA 4EE0A 2VLVA 4LA1A 4I5QA 4XTSA 4OCFA 3GHAA 4YQUA 4JBBA 2OA7A 3NZNA 4HJ2A 3UJ1A 1NM3A 3KH9A 1WJKA 3DD3A 4EDYA 2WFCA 1QUWA 2HSMB 4Z7XA 1GLQA 2OKAA 1AIUA 1VF2A 2PVOC 2AB6A 2FA4A 1XPVA 2CT6A 4K7OA 2B1LA 4HI7A 11GSA 2YJ7A 1GULA 1H4OA 1VF1A 3VLNA 4BVYA 3RHBA 3IR4A 3CXGA 1GSDA 5ID2A 2OJLA 2PPTA 4LL4B 3I69A 4PTSA 2WJUA 2ES7A 1QFNA 4KGIA 1WOUA 4FQUA 1XWKA 3K8NA 4KH7A 1V57A 2FY6A 2TIRA 2B5YA 1M2DA 1X5CA 3QAGA 2XBIA 1K3LA 5JWOB 3L0HA 3CTFA 1SKWB 2FWEA 2H66A 4YAPA 4IHUA 4ZL7A 5INYA 4Q5NA 1ERTA 5KN2A 3KP8A 1PSQA 1O85A 3QD9A 3UBKA 1FOVA 3V1WA 5ECHB 2B7JA 2O89A 1QMVA 2WRTA 2P5RA 2WS2A 1OVNA 3DMLA 1U88A 4JEDA 1RK4A 2ZCTA 2CVKA 2VCXA 3GSSA 1H75A 3ZITA 3HYPA 3LQ7A 2PERA 2GZYA 4PQ1A 1K0BA 5C00A 5F05A 2IMKA 4MPFA 1TU8A 1GH2A 1N8JA 1G6YA 3HHVA 3EMPA 3L4NA 4IKHA 1A2JA 2PU9C 5HR3A 4WKWA 3TJKA 2MYGA 1M9BA 3KH7A 1GSFA 4OO5A 5IMZA 2EC4A 1AW9A 3QOUA 5JWRB 1BAYA 2DJ3A 4ILFA 1A8YA 1XVQA 2VCQA 1CQGA 4KAEA 2HRFA 1TI1A 3DVWA 3EURA 2Z9SA 2DJ1A 3HCZA 1G6WA 1PMTA 3LORA 2QKEA 1OKDA 2GVPA 3PH9A 3FW2A 5EL8A 2K18A 5B6MA 1EV4A 1Y6EA 4F03A 1GTUA 10GSA 1TRWA 1EEJA 2BMXA 3GYKA 3BD2A 2IMIA 3VPQA 1SD8A 2CVDA 1SD9A 2RUFA 4V1Ap 1ERWA 2HZEA 1DE2A 3F3RA 2GDRA 4N30A 2H1GA 5H5SA 3VK9A 2GQMA 3CSHA 4ECIA 4GQCA 4ML1A 1T00A 4PNFA 1MD4A 4K9ZA 3TKQA 2FUG2 1AUCA 2NDOA 2LRCA 2MBSA 2F8AA 3TRQA 3R3EA 2JZRA 3TOUA 1GWCA 5HR2A 3FY7A 5D9VA 3TDGA 4TOPA 5JCWA 3PPUA 4BL7B 2B7KA 2PUKC 2YV7A 1VF3A 3LYPA 2GTUA 3LGCA 2CVBA 1HYUA 5B7CA 3R2QA 4IW9A 1J0FA 1OC9A 3GH9A 2JACA 5C04A 1XWBA 2JSZA 1V9WA 4BPYA 2IFQB 3FZ5A 1X9WB 4G0KA 2LJAA 1MD3A 4IJIA 1UA5A 3O76A 4MA9A 1W89A 2NBSA 6GSUA 4MJAA 2HQTA 2RIIA 4OCEA 2YNXA 3FZ9A 1K0DA 3PINA 4TW5A 3EC3A 2YZUA 2HSNB 4IGJA 2H8LA 4ZIJA 4POBA 3UMAA 1OC8A 1PQNA 1BG5A 2YP6A 1PD21 3F6FA 3KTBA 6GSTA 3FZAA 4F0BA 4USSA 4O92A 3IXRA 1T8EB 2I3YA 4Q5FA 4MZBA 4G10A 1V98A 4JZQA 4JRRA 4ZBBA 4BVYB 2V2GA 1MDIA 3VWXA 1O8XA 1WP0A 1K0NA 3Q74A 4IP1A 1BYEA 2HSMA 5ID2B 4PUAA 2DMLA 2H71A 1OYJA 2YOIA 1BQ7A 1GSSA 4MF5A 3HVXA 3ZMLA 1ST9A 5KN0A 2L6CA 2F51A 3KEBA 5GAND 1TK5B 2K6VA 1N2AA 1J08A 2H30A 4DSQA 2J9HA 4MK3A 3LSZA 3APQA 1MTCA 1LJRA 1ZOFA 2R2JA 4KDYA 2YWOA 2HSHA 5CO3A 1ZYQB 2VIMA 3M9JA 2VD1A 1B48A 3F63A 3ZLPA 2CAQA 5D9XA 3IBHA 5DAKA 1URMA 3TRPA 5ECPB 4ID0A 4P3YB 4AF2A 5IMFA 3C71A 1GLPA 2YCDA 4NV5A 1R5AA 1Z7PA 3OR5A 4NAXA 3UIWA 2VM1A 4ZB9A 2LTKA 4PX1A 2GZZA 2LS5A 3F4RA 3WGDA 3M0FA 5AIVA 2B3SA 4JU5A 2L4CA 5CYYA 20GSA 1SL2B 2GS3A 1R26A 4WF5A 2HSYA 2WDUA 2KUCA 2WCIA 3O3TA 5CRWA 3ZTLA 1ML6A 3DWVA 4L5LA 5IMDA 5ELAA 4AGSA 3LEFA 5ECSA 4QL7A 3HKRA 1WWJA 9GSSA 1R5PA 2FD3A 3TUEA 5KEJA 5G5FA 3TKPA 5JWQB 5IO0A 4EXJA 5ABRA 6GSSA 3KCMA 4O32A 1GSQA 3FK8A 1HNCA 4NHWA 1OC3A 1SKRB 1YQ1A 2O85A 4ZB8A 3P8WA 2HZEB 3P2AA 3GSTA 2E2GA 2FCHA 4AJ8A 1EZKA 4J57E 2VL2C 3ME8A 5B8AA 2G2QA 3H1NA 3GKMA 2JSYA 1SJZA 4HQZA 4G0IA 4NPBA 2LNTA 3FHKA 3F9UA 3Q18A 2H1BA 2L59A 1G7EA 4WEYA 3VWUA 2VCWA 3LXZA 5A4UA 1ZYEA 1A8LA 1SU9A 2X8GA 5CRGA 5HFIA 1IYIA 2BJXA 2MZCA 3RPPA 1ILOA 4NV2A 1TTZA 3US3A 1PA3A 1OC9B 4OMVA 4GSTA 4MMMA 4HUAA 3M1GA 2I4AA 2GLRA 2OE1A 4XS6A 3RPNA 3VPTA 1EV9A 4RQRA 1EGOA 1S3DA 4TKYA 4TRXA 2IWTA 2E2MA 5CRHA 5HFKA 2OACA 2KP2A 2LRTA 1FB6A 4KF9A 2H0HA 4WR5A 4KCEA 1NSWA 4WETA 4ZILA 1F2EA 3H4KA 1SK0A 4MH2A 5HR0A 2R6KA 5DQSA 3DXBA 4TR1A 1WPIA 1XIYA 2AAWA 1OE7A 3W8JA 1KEBA 1FB0A 4JR6A 5IO2A 2KLXA 4XRDA 4ZXGA 1EP8A 2VLTA 3P7XA 4HQSA 4X1UA 4F2IA 2IMFA 7GSSA 3KP9A 5A4VA 2L5LA 1F37A 2HRKA
chains in the Genus database with same CATH superfamily
3QMXA 5DCGA 1O81A 4TN8A 4PI2C 5G30A 1JZOA 2UZ8A 4WBJA 4ZBDA 2R0GA 2C3NA 3M8NA 4O5RA 4Q5RA 4RI6A 2HFDA 3KM6A 4DEJA 2NTOA 4F9ZA 5DAKB 1A23A 5CAXA 2VCTA 1YEPA 2X8HA 1EOHA 4XS1A 3WD6A 2C0FA 3LW9A 1K3YA 2LJRA 1BF5A 4HOJA 2FNOA 3BOAA 3ZYWA 4LMWA 4PXOA 4ML6A 2GQLA 1XW9A 2DBCA 2X4AA 3QDNA 4MPGA 2JZTA 4YKGA 2TRXA 5A1NA 3HVNA 5B8BA 4HU9A 1XVWA 2P0GA 4LLRA 2DJ0A 1M2AA 2ZUPA 3E9JB 1TW9A 5G5EA 2H74A 2C0DA 1SVLA 5F0GA 6GSXA 3QFAC 2DC5A 6GSYA 4TXVA 4GXZA 3ZIJA 1TDIA 3EINA 3EE2A 1TK8B 2DMMA 5J9CA 1ERVA 4MDCA 2OBIA 2GSTA 4KW6A 3UL3A 2QC7A 3ZFLA 5GZZB 1PL2A 3L9VA 4NHZA 1I5GA 2IL3A 5LCZA 4ZB6A 3DEXA 1EEMA 4EO3A 1LBKA 2O8VB 4MCUA 5J4YA 2A2PA 2WVXB 3H79A 2WGRA 3HJOA 4FO5A 3J7Yb 3LFLA 1OE8A 2C0GA 3D6IA 3ZFBA 2H19A 2AUVA 4K0NA 4L5OA 4GWRA 3ZL5A 1DUGA 4KB3A 4HSCX 1X5EA 3DKSA 4PQIA 2HI7A 4XCSA 5HQPA 5ECLB 2WULA 3N5OA 1TXXA 4EKZA 2LSTA 2TRCP 3F4TA 1F3AA 2EFDA 4TR0A 3TGZA 1AAZA 1I9DA 3IOSA 4HDEA 1PX6A 3CRTA 3TKSE 3TJFA 3SWLA 5J3RA 1T4YA 4LMVA 4CY6A 4N0ZA 4BWQA 1X9SB 5DQYA 1Q98A 6GSVA 5COHA 2VCZA 1XCCA 1T4ZA 1XZOA 3F0IA 2V41A 4E8HA 4EF0A 3U5RE 3VWVA 2BTOT 3BCIA 2QGVA 1HNAA 1K0OA 1GTBA 2L4QA 1PFOA 4V2NA 2DLXA 5ECOB 3F3QA 2C80A 4K7NA 3IE3A 2YJHA 2G0FA 3QAVA 4HZ2A 4DVCA 3G7JA 3C7MA 2A2RA 5EY6A 3EVIA 2RM6A 4IN0A 2EIRA 4TR1B 3BCKA 4KX4A 2C4JA 2DJKA 3IK9A 4TXOA 2ALBA 2HRAA 3UVTA 5J4VA 2OE0A 2WZSA 1S3CA 5J47A 3TKSC 3GL5A 3IK7A 1SENA 2N5AA 3TRXA 1UC7A 3VFIA 5D9TA 5KOXA 1WIKA 5G31A 2ZNMA 3Q19A 3MYDA 2GSRA 4EC0A 2HRKB 1O73A 4MJEA 3GX8A 1GUMA 3WT2A 4TR4A 1G0TA 2YN1A 1E6BA 4L8EA 3ERGA 2H73A 1AQXA 2HE3A 4TR3A 2V6OA 1T3BA 4E8EA 3QPMA 2MMNA 5GSTA 1A2MA 3U6VA 2FWFA 3BBYA 5IQYA 3QCPA 3N9JA 3HJMA 13GSA 2LEGA 1SK2A 1B4QA 4IQAA 3PR8A 1AC1A 2H1AA 1JZDA 4O7HA 4IP6A 4XS4A 1FG4A 3GL3A 2YPMA 2JL4A 5G2ZA 5A34A 5A1NB 4EDZA 4ECCA 1YEWC 2B6MA 1VRSD 3F6DA 1GSYA 2C0EA 3VI7A 1ZCPA 2H6ZA 1U3AA 4ZBAA 4O5QA 2VKZG 2E0QA 1HNBA 1GRXA 2R37A 1BX9A 3GTUA 1V2AA 1TP9A 2UV8G 2YWMA 3VI5A 4V2LA 4BA7A 1GNWA 1I1IP 3L9UA 2FWHA 3APOA 4OFMA 4OD7A 3NIVA 1S4BP 3MAKA 1LU4A 1DE1A 3ZMKA 2HRNA 5HFGA 2GQKA 1ZZYA 2LNSA 1XXUA 2JADA 1PKZA 2WW3A 2RUEA 4CHSA 3GKKA 3EWLA 5DJMA 3UVHA 2R4VA 1EGRA 1JZRA 3HXSA 3HY2A 4H86A 3W6GA 1BEDA 3GMFA 3ZREA 1A24A 1R7HA 3IHGA 1Z7RA 1TKDB 3NOFA 5GAPD 2LQOA 3RDWA 1JLWA 5DBQA 1K3OA 4KDUA 2DIYA 4PGTA 4E68A 2H76A 2IN3A 2WB9A 1KNGA 19GSA 2RLIA 4V1Ag 2C3TA 3J7Yk 5G1KA 2GSQA 2PVQA 3O6TA 2AJQB 1O8WA 2C3QA 3M3MA 2WW0A 4L0UA 3TCOA 3ZVJA 2IMDA 5IPHA 3GV1A 3D4TA 3I6AA 1XW6A 3IDVA 1MDJA 4ECBA 2P5QA 3CHXC 4D73A 4AKIA 4GCIA 3E3EA 4N11A 1HD2A 1UN2A 1U3IA 4KE3A 5D9WA 3G7IA 4MP4A 3EYTA 5EPFA 3GH6A 2FWGA 5CRDA 5J4UA 2CX4A 2V1MA 5FWGA 1Z9HA 4EVMA 1YZXA 1NHYA 4FIWA 3LXTA 2PWJA 2L5OA 3ME7A 2D2ZA 3MSZA 2HYXA 2H70A 1K0CA 4X0XA 4IELA 1F9MA 2L57A 2GT6A 2H0IA 4GTUA 3TU3B 2VO4A 3GFKA 1Z3EA 3D21A 2NPBA 2O5VA 4Z2RA 3UOMA 2H6YA 5FT3A 1MDKA 2DJ2A 3ISOA 1XWCA 4PQHA 5DALA 2VD0A 1V40A 1AQVA 3VURA 18GSA 1PRXA 3UEMA 4IVFA 2EIQA 3ZZXA 3G9BA 22GSA 4GF0A 3S9FA 3HVSA 2V32A 4MNNA 4NXIA 4POKA 1Z6MA 1SL0B 2H01A 4TXOB 3TB2A 5E4WA 2PGTA 2HLSA 2GGTA 1GP1A 3D4MA 2VUPA 4ULXA 1N25A 4CW9A 2CA8A 3VWWA 1DBYA 4K1FA 1YVLA 4OO4A 1OKTA 2HNLA 2VL2A 4PUFC 1UVZA 2FLSA 4KA0A 4MABA 1TU7A 1R4WA 4HS1A 3IA1A 4MF6A 2DJJA 5ELGA 2O7KA 1ACVA 3LJRA 1T1VA 3L9SA 3HZ8A 4K5SA 4DSRA 2XPEA 2XHFA 5D8IA 3EMXA 2AV4A 3FR6A 3CBUA 2CX3A 2AYTA 5ECRB 2A4VA 1O6JA 3D0ZA 3LWAA 4LL1B 4XS4B 17GSA 5A5KA 2NVLA 2I9HA 5A34B 2CAIA 2DSAA 1RQMA 5IOWA 1PKWA 4X43A 5ECNB 2M80A 2R3XA 3FKFA 4AJ6A 5IMCA 4FYCA 3P90A 2RM5A 1BJXA 2N5FA 5IMAA 2REMA 4POMA 2V6KA 2KP1A 4WXTA 3HA9A 1NHOA 3GTUB 2GT5A 1M7TA 1FVJA 3RAZA 3GKXA 5KN3A 2IMEA 4Q5QA 3L78A 4AJ7A 1GTAA 1M99A 4K2DA 3IC4A 1SJIA 2OT3A 2R0CA 3C8EA 5AN1A 4BVXA 2QSIA 1M3JA 3KIJA 2IIYA 4IQ1A 2P31A 1JLVA 3RFRC 5CP1A 2ON7A 5CNWA 1FW1A 4F0CA 2E7PA 3GRXA 4PNGA 1YY7A 1E2YA 3CSJA 5KN1A 4XIHA 3CSIA 1YKAA 3GIXA 1GL8A 5G1LA 2O87A 3TOTA 1GUHA 5A4WA 5F07A 4ACSA 4JR4A 2H0GA 1XOBA 2PMTA 5JCUA 3WGEA 2A4HA 4K2XA 3EU3A 1S3AA 2H1DA 2VL3A 4GLTA 5J5NA 2YV9A 3QFBC 2X99A 4G01A 2AHEA 2F3MA 2CQ9A 4KSOA 1Z5YE 5F06A 8GSSA 1X9MB 4I6XA 3MDKA 3E0UA 1EP7A 4MH3A 5IM9A 1B9XC 1MEKA 1ON4A 5AIXA 2YWNA 3QR6A 2IPAA 4D73B 5FHIA 1DSBA 4MJCA 4IJ3A 2WW1A 4YKFA 3KXOA 2YANA 3IHQA 1TI3A 5KOWA 2IJYA 5F8BA 3KJYA 3HVVA 4ZL8A 4FYUA 1HQOA 2EFEA 4ZB7A 1YF0A 1B8XA 2VCVA 2LV3A 4MZCA 1NW2A 4KSMA 1GSEA 5J41A 4G19A 4G2EA 1XW5A 3DIEA 2XBQA 1THOA 2FGXA 3APSA 3ZIVA 4FYBA 4IBPA 4AKHA 3Q6OA 3KMOA 1F6MC 2LUSA 3IRAA 2J23A 1PGTA 3G7YA 3CQFA 2K9FA 3CMIA 1SJ6A 4HJMA 4EIQA 3UAPA 3BJ5A 3FR3A 5IPGA 3I9V2 4I2UA 4K8MA 5DALB 3HD5A 2B1KA 2LRNA 3ED3A 4ECJA 1B4PA 3LYKA 3WT1A 4KDXA 1JHBA 2MMZA 2H75A 4V2MA 3C1SA 3IAS2 3C73A 4NWYA 5ECIB 1TRVA 1TOFA 4EL1A 1KTEA 1A2LA 1VF4A 5IOXA 4A5PA 2C8UA 1FHEA 1GUKA 3FMWA 2A2SA 1JZWA 2X64A 3ZVJD 2H72A 4N10A 2M46A 4GSSA 4AI6A 3H93A 2PBJA 4DSSA 3ERWA 4TVEA 1B9YC 3GKNA 3D5JA 1YKCA 2CV4A 2HXKA 2GZPA 5D96A 3KTLA 3LG6A 2WZ9A 2VLUA 3UARA 1GTIA 4HZ4A 4L0WA 3TKRA 1WE0A 5D73A 4KNDA 4XHMA 2VM2A 3FR9A 2KHPA 4I8BA 1PL1A 1C72A 3A5IA 1ZGNA 1A0FA 1OAZA 5D93A 4OFTA 1K0MA 2F8FA 2I1UA 5ENUA 4G0LA 3TJJA 4YQMA 2YWIA 4K6XA 1M0UA 4EUYA 2OADA 2FHEA 3FEUA 6GSWA 4YH2A 1WRYA 3DVXA 16GSA 3FZ4A 4OFNA 3MWHA 1RW1A 1EOGA 1J9BA 1YEXA 2X49A 4RUVA 1WMJA 3MNGA 4IS0A 1VGLA 2XC2A 2FA8A 3GURA 3GX0A 3PGTA 4OWYA 4WR4A 1U6TA 4GRFA 4RQXA 1Q4JA 3W8SA 1YJ6A 1GNEA 4BVXB 1FAAA 1TRUA 2GSSA 3AY8A 4ZL9A 3DGQA 5AGYA 1USBA 3HZ4A 5H5QA 5IMVA 3GA4A 5ECQB 3CRUA 1ZL9A 1G7OA 3A2VA 4O5UA 1PX7A 4XRAA 5HR1A 1A0RP 1FOHA 5EVOA 2DIZA 2DKIA 1TJDA 1XBSA 3TKSA 3TJBA 4MZWA 3A3TA 3GN3A 3A2XA 5DDLA 4HEA2 1IYHA 2PN8A 2KOKA 1QQ2A 4W66A 5BMUA 2OE3A 4CDOA 2B5EA 5B6NA 3UBLA 1QXHA 2CZ3A 1TK0B 1X5DA 4ISDA 2MBTA 4J2FA 4AKXB 2JU5A 3H8QA 2H6XA 3RBTA 2B5XA 4KUNA 14GSA 1SK1A 4I97A 1KBNA 4KCAA 5H5RA 4QQ7A 3FRCA 3IAM2 1PN9A 2VAFA 3GNJA 5L71A 5E59A 4MJBA 1EWXA 2EIOA 1X0RA 3CWGA 4WBRD 1YDKA 3A5WA 3KMNA 1M2BA 3A2WA 3KZQA 5DVBA 5ECKB 1QK8A 3WYWA 2C1YA 2ON5A 5IIZA 1THXA 1XFLA 3CTGA 2LJKA 4N3ZA 5AISA 1XWGA 1SKSB 3DRNA 3CYNA 5A5HA 1W4VA 4HU7A 2LQQA 4K7IA 3ERFA 4GQFA 3JCML 4N0VA 4JE1A 5DCHA 1SL1B 3SBCA 1T7PB 12GSA 4POLA 2LKUA 1V58A 4BWSA 1SVOA 3I43A 2VOCA 2MMOA 3DYRA 1AXDA 4YAVA 2L6DA 5GSSA 2K8VA 2MMAA 2OBKA 3ZRDA 3KGKA 2N5BA 1SYXA 3C1RA 4QL9A 5ECMB 1Z6NA 1ERUA 2F9SA 4MF7A 5DJLA 4I2TA 1XWAA 4NMUA 4GSNA 3IC8A 4F82A 5J9BA 4MLYA 2YZHA 3D22A 5LNKe 1AQWA 1TRSA 2K8SA 4FXYP 2WVZA 1YF1A 4DSSB 4G9HA 3IPZA 3GUSA 4K0GA 2CZ2A 2HT9A 1K0AA 4RI7A 2XPDA 1Y25A 4EIPA 3F8UA 1U87A 3F4SA 3QAWA 5JCGA 2DKHA 1FVKA 3EU4A 1F3BA 4PI0C 2M72A 2X8CA 1ZMAA 1QGVA 4J56E 4PURA 3FYGA 1ABAA 2EFHA 3M9KA 1M9AA 1SVMA 1JFUA 3WGXA 1SYRA 1GSUA 3RHCA 4BL7A 4WF4A 2VL9A 2HZFA 1XOAA 3IV4A 3HJPA 2R5GA 2JZSA 1FO5A 4YQVA 4FH8A 2I81A 5CREA 1O7UA 5LD0A 1XG8A 1CQHA 3HDCA 3TJGA 1ZYPA 3KD0A 2IFQA 4EE0A 2VLVA 4LA1A 4I5QA 3EPTA 4XTSA 4OCFA 3GHAA 4YQUA 4JBBA 2OA7A 1PN0A 3NZNA 4HJ2A 3UJ1A 1NM3A 3KH9A 2HSNA 1WJKA 1TXUA 3DD3A 4EDYA 2WFCA 3MIXA 1QUWA 2HSMB 4Z7XA 1GLQA 2OKAA 1AIUA 1VF2A 2PVOC 2AB6A 2FA4A 1XPVA 2CT6A 4K7OA 2B1LA 4HI7A 11GSA 2YJ7A 2EFCA 1GULA 1H4OA 1VF1A 3VLNA 4BVYA 3RHBA 3IR4A 3CXGA 1GSDA 2O3EA 5ID2A 2OJLA 4PHZC 2PPTA 4LL4B 3I69A 4PTSA 2WJUA 2ES7A 1QFNA 4KGIA 1WOUA 4FQUA 1XWKA 3K8NA 4KH7A 1V57A 2FY6A 5BMUB 2TIRA 2B5YA 1M2DA 1X5CA 3QAGA 2XBIA 1K3LA 5JWOB 3L0HA 3CTFA 1SKWB 2FWEA 2H66A 4YAPA 4IHUA 4ZL7A 5INYA 4Q5NA 1ERTA 5KN2A 3KP8A 1PSQA 1O85A 3QD9A 3UBKA 1FOVA 3V1WA 5ECHB 1Y1UA 2B7JA 2O89A 1QMVA 2WRTA 2P5RA 2WS2A 1OVNA 3DMLA 1U88A 4JEDA 1RK4A 2ZCTA 2CVKA 2VCXA 3GSSA 1H75A 3ZITA 3HYPA 3LQ7A 2PERA 2GZYA 4PQ1A 1K0BA 5C00A 5F05A 2IMKA 4MPFA 1TU8A 1GH2A 1N8JA 1G6YA 3HHVA 3EMPA 3L4NA 4IKHA 1A2JA 2PU9C 5HR3A 4WKWA 3TJKA 2MYGA 1M9BA 3KH7A 1GSFA 4OO5A 5IMZA 2EC4A 1AW9A 3QOUA 5JWRB 1BAYA 2DJ3A 4ILFA 5A5HB 1A8YA 1XVQA 2VCQA 1CQGA 4KAEA 2HRFA 1TI1A 3DVWA 3EURA 2Z9SA 2DJ1A 3HCZA 1G6WA 1PMTA 4Z2TA 1BG1A 3LORA 2QKEA 1OKDA 2GVPA 3PH9A 3FW2A 5EL8A 2K18A 2R0PA 5B6MA 1M3IA 1EV4A 1Y6EA 4F03A 1GTUA 10GSA 1TRWA 1EEJA 2BMXA 3GYKA 3BD2A 2IMIA 3VPQA 1SD8A 2CVDA 1SD9A 2RUFA 4V1Ap 1ERWA 2HZEA 1DE2A 2H1LA 3F3RA 2GDRA 4N30A 2H1GA 5H5SA 3VK9A 2GQMA 3CSHA 4ECIA 4GQCA 4ML1A 2WVYA 1T00A 4PNFA 1MD4A 4K9ZA 3TKQA 2FUG2 1AUCA 2NDOA 2LRCA 2MBSA 2F8AA 3TRQA 3R3EA 2JZRA 3TOUA 1GWCA 2QA1A 5HR2A 3FY7A 5D9VA 3TDGA 4TOPA 5JCWA 3PPUA 4BL7B 2B7KA 2PUKC 2YV7A 1VF3A 2WW2A 3LYPA 2GTUA 3LGCA 2CVBA 1HYUA 5B7CA 3R2QA 4IW9A 1J0FA 1OC9A 3GH9A 2JACA 5C04A 1XWBA 2JSZA 1V9WA 4BPYA 2IFQB 3FZ5A 1X9WB 4G0KA 2LJAA 1MD3A 4IJIA 1UA5A 3O76A 4MA9A 1W89A 2NBSA 6GSUA 4MJAA 2HQTA 2RIIA 4OCEA 2YNXA 4CY8A 3FZ9A 1K0DA 3PINA 4TW5A 3EC3A 2YZUA 2HSNB 4IGJA 2H8LA 4ZIJA 4POBA 3UMAA 1OC8A 1PQNA 1BG5A 2YP6A 1PD21 3F6FA 3KTBA 6GSTA 3FZAA 4F0BA 4USSA 4O92A 3IXRA 1T8EB 2I3YA 4Q5FA 4MZBA 5J40A 4G10A 1V98A 4JZQA 4JRRA 4ZBBA 4BVYB 4Z2UA 2V2GA 1MDIA 3VWXA 1O8XA 1WP0A 1K0NA 3Q74A 4IP1A 1BYEA 2HSMA 5ID2B 4PUAA 2DMLA 2H71A 1OYJA 2YOIA 1BQ7A 1GSSA 4MF5A 3HVXA 3ZMLA 1ST9A 5KN0A 2L6CA 2F51A 3RGBC 3KEBA 5GAND 1TK5B 2K6VA 1N2AA 1J08A 2H30A 4DSQA 2J9HA 4MK3A 3LSZA 3APQA 1MTCA 2QA2A 1LJRA 1ZOFA 4AKGA 2R2JA 5BRTA 4KDYA 2YWOA 2HSHA 5CO3A 1ZYQB 2VIMA 3M9JA 2VD1A 1B48A 3F63A 3ZLPA 2CAQA 5D9XA 3IBHA 5DAKA 1URMA 3TRPA 5ECPB 4ID0A 4X4JA 4P3YB 4AF2A 5IMFA 3C71A 1GLPA 2YCDA 4NV5A 1R5AA 1Z7PA 3OR5A 4NAXA 3UIWA 2VM1A 4ZB9A 2LTKA 4PX1A 2GZZA 2LS5A 3F4RA 3WGDA 3M0FA 5AIVA 2B3SA 2O36A 4JU5A 2L4CA 5CYYA 20GSA 1SL2B 2GS3A 1R26A 4WF5A 2HSYA 2WDUA 2KUCA 4ICYA 2WCIA 3O3TA 5CRWA 3ZTLA 1ML6A 3DWVA 4L5LA 5IMDA 5ELAA 4AGSA 3LEFA 5ECSA 4QL7A 3HKRA 1WWJA 9GSSA 1R5PA 2FD3A 3TUEA 2WVXA 5KEJA 5G5FA 3TKPA 5JWQB 5IO0A 4EXJA 5ABRA 6GSSA 3KCMA 4O32A 1GSQA 3FK8A 1HNCA 4NHWA 1OC3A 1SKRB 1YQ1A 2O85A 4ZB8A 3P8WA 2HZEB 3P2AA 3GSTA 2E2GA 2FCHA 4AJ8A 1EZKA 4J57E 2VL2C 3ME8A 5B8AA 2G2QA 3H1NA 3GKMA 2JSYA 1SJZA 4HQZA 1S3RA 4G0IA 4NPBA 2LNTA 3FHKA 3F9UA 3Q18A 2H1BA 2L59A 4GDFA 1G7EA 4WEYA 3VWUA 2VCWA 3LXZA 5A4UA 1ZYEA 1A8LA 1SU9A 2X8GA 5CRGA 5HFIA 1IYIA 2BJXA 2MZCA 3RPPA 1ILOA 4NV2A 1TTZA 3US3A 1PA3A 1OC9B 4OMVA 4GSTA 4MMMA 4HUAA 3M1GA 2I4AA 2GLRA 2OE1A 4XS6A 3RPNA 3VPTA 1EV9A 4RQRA 1EGOA 1S3DA 3HMJG 4TKYA 4TRXA 2IWTA 2E2MA 5CRHA 5HFKA 2OACA 2KP2A 2LRTA 1FB6A 4KF9A 2H0HA 4WR5A 4KCEA 1NSWA 4WETA 4ZILA 1F2EA 3H4KA 1SK0A 4MH2A 1ZYNA 5HR0A 2R6KA 5DQSA 3DXBA 4TR1A 1WPIA 4QMKA 1XIYA 2AAWA 1OE7A 3W8JA 1KEBA 1FB0A 4JR6A 4BIKA 5IO2A 2KLXA 4XRDA 4ZXGA 1EP8A 2VLTA 3P7XA 4HQSA 4X1UA 4F2IA 2IMFA 4K5RA 7GSSA 3KP9A 5A4VA 2L5LA 1F37A 2HRKA
chains in the Genus database with same CATH topology
3QMXA 5DCGA 1O81A 4TN8A 5G30A 1JZOA 2UZ8A 4WBJA 4ZBDA 2R0GA 2C3NA 3M8NA 4O5RA 4Q5RA 4RI6A 2HFDA 3KM6A 4DEJA 2NTOA 4F9ZA 5DAKB 1A23A 5CAXA 2VCTA 1YEPA 2X8HA 1EOHA 4XS1A 3WD6A 2C0FA 3LW9A 1K3YA 2LJRA 1BF5A 4HOJA 2FNOA 3BOAA 3ZYWA 4LMWA 4PXOA 4ML6A 2GQLA 1XW9A 2DBCA 2X4AA 3QDNA 4MPGA 2JZTA 4YKGA 2TRXA 5A1NA 5B8BA 4HU9A 1XVWA 2P0GA 4LLRA 2DJ0A 1M2AA 2ZUPA 3E9JB 1TW9A 5G5EA 2H74A 2C0DA 1SVLA 5F0GA 6GSXA 3QFAC 2DC5A 6GSYA 4TXVA 4GXZA 3ZIJA 1TDIA 3EINA 3EE2A 1TK8B 2DMMA 5J9CA 1ERVA 4MDCA 2OBIA 2GSTA 4KW6A 3UL3A 2QC7A 3ZFLA 5GZZB 1PL2A 3L9VA 4NHZA 1I5GA 2IL3A 5LCZA 4ZB6A 3DEXA 1EEMA 4EO3A 1LBKA 2O8VB 4MCUA 5J4YA 2A2PA 3H79A 2WGRA 3HJOA 4FO5A 3J7Yb 3LFLA 1OE8A 2C0GA 3D6IA 3ZFBA 2H19A 2AUVA 4K0NA 4L5OA 4GWRA 3ZL5A 1DUGA 4KB3A 1X5EA 3DKSA 4PQIA 2HI7A 4XCSA 5HQPA 5ECLB 2WULA 3N5OA 1TXXA 4EKZA 2LSTA 2TRCP 3F4TA 1F3AA 2EFDA 4TR0A 3TGZA 1AAZA 1I9DA 3IOSA 4HDEA 1PX6A 3CRTA 3TKSE 3TJFA 3SWLA 5J3RA 1T4YA 4LMVA 4CY6A 4N0ZA 4BWQA 1X9SB 5DQYA 1Q98A 6GSVA 5COHA 2VCZA 1XCCA 1T4ZA 1XZOA 3F0IA 2V41A 4E8HA 4EF0A 3U5RE 3VWVA 2BTOT 3BCIA 2QGVA 1HNAA 1K0OA 1GTBA 2L4QA 4V2NA 2DLXA 5ECOB 3F3QA 2C80A 4K7NA 3IE3A 2YJHA 2G0FA 3QAVA 4HZ2A 4DVCA 3G7JA 3C7MA 2A2RA 5EY6A 3EVIA 2RM6A 4IN0A 2EIRA 4TR1B 3BCKA 4KX4A 2C4JA 2DJKA 3IK9A 4TXOA 2ALBA 2HRAA 3UVTA 5J4VA 2OE0A 1S3CA 5J47A 3TKSC 3GL5A 3IK7A 1SENA 2N5AA 3TRXA 1UC7A 3VFIA 5D9TA 5KOXA 1WIKA 5G31A 2ZNMA 3Q19A 3MYDA 2GSRA 4EC0A 2HRKB 1O73A 4MJEA 3GX8A 1GUMA 3WT2A 4TR4A 1G0TA 2YN1A 1E6BA 4L8EA 3ERGA 2H73A 1AQXA 2HE3A 4TR3A 2V6OA 1T3BA 4E8EA 3QPMA 2MMNA 5GSTA 1A2MA 3U6VA 2FWFA 3BBYA 5IQYA 3QCPA 3N9JA 3HJMA 13GSA 2LEGA 1SK2A 1B4QA 4IQAA 3PR8A 1AC1A 2H1AA 1JZDA 4O7HA 4IP6A 4XS4A 1FG4A 3GL3A 2YPMA 2JL4A 5G2ZA 5A34A 5A1NB 4EDZA 4ECCA 2B6MA 1VRSD 3F6DA 1GSYA 2C0EA 3VI7A 1ZCPA 2H6ZA 1U3AA 4ZBAA 4O5QA 2VKZG 2E0QA 1HNBA 1GRXA 2R37A 1BX9A 3GTUA 1V2AA 1TP9A 2UV8G 2YWMA 3VI5A 4V2LA 4BA7A 1GNWA 3L9UA 2FWHA 3APOA 4OFMA 4OD7A 3NIVA 3MAKA 1LU4A 1DE1A 3ZMKA 2HRNA 5HFGA 2GQKA 1ZZYA 2LNSA 1XXUA 2JADA 1PKZA 2RUEA 4CHSA 3GKKA 3EWLA 5DJMA 3UVHA 2R4VA 1EGRA 1JZRA 3HXSA 3HY2A 4H86A 3W6GA 1BEDA 3GMFA 3ZREA 1A24A 1R7HA 3IHGA 1Z7RA 1TKDB 3NOFA 5GAPD 2LQOA 3RDWA 1JLWA 5DBQA 1K3OA 4KDUA 2DIYA 4PGTA 4E68A 2H76A 2IN3A 2WB9A 1KNGA 19GSA 2RLIA 4V1Ag 2C3TA 3J7Yk 5G1KA 2GSQA 2PVQA 3O6TA 2AJQB 1O8WA 2C3QA 3M3MA 4L0UA 3TCOA 3ZVJA 2IMDA 5IPHA 3GV1A 3D4TA 3I6AA 1XW6A 3IDVA 1MDJA 4ECBA 2P5QA 4D73A 4AKIA 4GCIA 3E3EA 4N11A 1HD2A 1UN2A 1U3IA 4KE3A 5D9WA 3G7IA 4MP4A 3EYTA 5EPFA 3GH6A 2FWGA 5CRDA 5J4UA 2CX4A 2V1MA 5FWGA 1Z9HA 4EVMA 1YZXA 1NHYA 4FIWA 3LXTA 2PWJA 2L5OA 3ME7A 2D2ZA 3MSZA 2HYXA 2H70A 1K0CA 4X0XA 4IELA 1F9MA 2L57A 2GT6A 2H0IA 4GTUA 3TU3B 2VO4A 3GFKA 1Z3EA 3D21A 2NPBA 2O5VA 4Z2RA 3UOMA 2H6YA 5FT3A 1MDKA 2DJ2A 3ISOA 1XWCA 4PQHA 5DALA 2VD0A 1V40A 1AQVA 3VURA 18GSA 1PRXA 3UEMA 4IVFA 2EIQA 3ZZXA 3G9BA 22GSA 4GF0A 3S9FA 3HVSA 2V32A 4MNNA 4NXIA 4POKA 1Z6MA 1SL0B 2H01A 4TXOB 3TB2A 5E4WA 2PGTA 2HLSA 2GGTA 1GP1A 3D4MA 2VUPA 4ULXA 1N25A 4CW9A 2CA8A 3VWWA 1DBYA 4K1FA 1YVLA 4OO4A 1OKTA 2HNLA 2VL2A 4PUFC 1UVZA 2FLSA 4KA0A 4MABA 1TU7A 1R4WA 4HS1A 3IA1A 4MF6A 2DJJA 5ELGA 2O7KA 1ACVA 3LJRA 1T1VA 3L9SA 3HZ8A 4K5SA 4DSRA 2XPEA 2XHFA 5D8IA 3EMXA 2AV4A 3FR6A 3CBUA 2CX3A 2AYTA 5ECRB 2A4VA 1O6JA 3D0ZA 3LWAA 4LL1B 4XS4B 17GSA 5A5KA 2NVLA 2I9HA 5A34B 2CAIA 2DSAA 1RQMA 5IOWA 1PKWA 4X43A 5ECNB 2M80A 2R3XA 3FKFA 4AJ6A 5IMCA 4FYCA 3P90A 2RM5A 1BJXA 2N5FA 5IMAA 2REMA 4POMA 2V6KA 2KP1A 4WXTA 3HA9A 1NHOA 3GTUB 2GT5A 1M7TA 1FVJA 3RAZA 3GKXA 5KN3A 2IMEA 4Q5QA 3L78A 4AJ7A 1GTAA 1M99A 4K2DA 3IC4A 1SJIA 2OT3A 2R0CA 3C8EA 5AN1A 4BVXA 2QSIA 3KIJA 2IIYA 4IQ1A 2P31A 1JLVA 5CP1A 2ON7A 5CNWA 1FW1A 4F0CA 2E7PA 3GRXA 4PNGA 1YY7A 1E2YA 3CSJA 5KN1A 4XIHA 3CSIA 1YKAA 3GIXA 1GL8A 5G1LA 2O87A 3TOTA 1GUHA 5A4WA 5F07A 4ACSA 4JR4A 2H0GA 1XOBA 2PMTA 5JCUA 3WGEA 2A4HA 4K2XA 3EU3A 1S3AA 2H1DA 2VL3A 4GLTA 5J5NA 2YV9A 3QFBC 2X99A 4G01A 2AHEA 2F3MA 2CQ9A 4KSOA 1Z5YE 5F06A 8GSSA 1X9MB 4I6XA 3MDKA 3E0UA 1EP7A 4MH3A 5IM9A 1B9XC 1MEKA 1ON4A 5AIXA 2YWNA 3QR6A 2IPAA 4D73B 5FHIA 1DSBA 4MJCA 4IJ3A 4YKFA 3KXOA 2YANA 3IHQA 1TI3A 5KOWA 2IJYA 5F8BA 3KJYA 3HVVA 4ZL8A 4FYUA 1HQOA 2EFEA 4ZB7A 1YF0A 1B8XA 2VCVA 2LV3A 4MZCA 1NW2A 4KSMA 1GSEA 5J41A 4G19A 4G2EA 1XW5A 3DIEA 2XBQA 1THOA 2FGXA 3APSA 3ZIVA 4FYBA 4IBPA 4AKHA 3Q6OA 3KMOA 1F6MC 2LUSA 3IRAA 2J23A 1PGTA 3G7YA 2K9FA 3CMIA 1SJ6A 4HJMA 4EIQA 3UAPA 3BJ5A 3FR3A 5IPGA 3I9V2 4I2UA 4K8MA 5DALB 3HD5A 2B1KA 2LRNA 3ED3A 4ECJA 1B4PA 3LYKA 3WT1A 4KDXA 1JHBA 2MMZA 2H75A 4V2MA 3C1SA 3IAS2 3C73A 4NWYA 5ECIB 1TRVA 1TOFA 4EL1A 1KTEA 1A2LA 1VF4A 5IOXA 4A5PA 2C8UA 1FHEA 1GUKA 3FMWA 2A2SA 1JZWA 2X64A 3ZVJD 2H72A 4N10A 2M46A 4GSSA 4AI6A 3H93A 2PBJA 4DSSA 3ERWA 4TVEA 1B9YC 3GKNA 3D5JA 1YKCA 2CV4A 2HXKA 2GZPA 5D96A 3KTLA 3LG6A 2WZ9A 2VLUA 3UARA 1GTIA 4HZ4A 4L0WA 3TKRA 1WE0A 5D73A 4KNDA 4XHMA 2VM2A 3FR9A 2KHPA 4I8BA 1PL1A 1C72A 3A5IA 1ZGNA 1A0FA 1OAZA 5D93A 4OFTA 1K0MA 2F8FA 2I1UA 5ENUA 4G0LA 3TJJA 4YQMA 2YWIA 4K6XA 1M0UA 4EUYA 2OADA 2FHEA 3FEUA 6GSWA 4YH2A 1WRYA 3DVXA 16GSA 3FZ4A 4OFNA 3MWHA 1RW1A 1EOGA 1J9BA 1YEXA 2X49A 4RUVA 1WMJA 3MNGA 4IS0A 1VGLA 2XC2A 2FA8A 3GURA 3GX0A 3PGTA 4OWYA 4WR4A 1U6TA 4GRFA 4RQXA 1Q4JA 3W8SA 1YJ6A 1GNEA 4BVXB 1FAAA 1TRUA 2GSSA 3AY8A 4ZL9A 3DGQA 5AGYA 1USBA 3HZ4A 5H5QA 5IMVA 3GA4A 5ECQB 3CRUA 1ZL9A 1G7OA 3A2VA 4O5UA 1PX7A 4XRAA 5HR1A 1A0RP 1FOHA 5EVOA 2DIZA 2DKIA 1TJDA 1XBSA 3TKSA 3TJBA 4MZWA 3A3TA 3GN3A 3A2XA 5DDLA 4HEA2 1IYHA 2PN8A 2KOKA 1QQ2A 4W66A 5BMUA 2OE3A 4CDOA 2B5EA 5B6NA 3UBLA 1QXHA 2CZ3A 1TK0B 1X5DA 4ISDA 2MBTA 4J2FA 4AKXB 2JU5A 3H8QA 2H6XA 3RBTA 2B5XA 4KUNA 14GSA 1SK1A 4I97A 1KBNA 4KCAA 5H5RA 4QQ7A 3FRCA 3IAM2 1PN9A 2VAFA 3GNJA 5L71A 5E59A 4MJBA 1EWXA 2EIOA 1X0RA 3CWGA 4WBRD 1YDKA 3A5WA 3KMNA 1M2BA 3A2WA 3KZQA 5DVBA 5ECKB 1QK8A 3WYWA 2C1YA 2ON5A 5IIZA 1THXA 1XFLA 3CTGA 2LJKA 4N3ZA 5AISA 1XWGA 1SKSB 3DRNA 3CYNA 5A5HA 1W4VA 4HU7A 2LQQA 4K7IA 3ERFA 4GQFA 3JCML 4N0VA 4JE1A 5DCHA 1SL1B 3SBCA 1T7PB 12GSA 4POLA 2LKUA 1V58A 4BWSA 1SVOA 3I43A 2VOCA 2MMOA 3DYRA 1AXDA 4YAVA 2L6DA 5GSSA 2K8VA 2MMAA 2OBKA 3ZRDA 3KGKA 2N5BA 1SYXA 3C1RA 4QL9A 5ECMB 1Z6NA 1ERUA 2F9SA 4MF7A 5DJLA 4I2TA 1XWAA 4NMUA 4GSNA 3IC8A 4F82A 5J9BA 4MLYA 2YZHA 3D22A 5LNKe 1AQWA 1TRSA 2K8SA 1YF1A 4DSSB 4G9HA 3IPZA 3GUSA 4K0GA 2CZ2A 2HT9A 1K0AA 4RI7A 2XPDA 1Y25A 4EIPA 3F8UA 1U87A 3F4SA 3QAWA 5JCGA 2DKHA 1FVKA 3EU4A 1F3BA 2M72A 2X8CA 1ZMAA 1QGVA 4J56E 4PURA 3FYGA 1ABAA 2EFHA 3M9KA 1M9AA 1SVMA 1JFUA 3WGXA 1SYRA 1GSUA 3RHCA 4BL7A 4WF4A 2VL9A 2HZFA 1XOAA 3IV4A 3HJPA 2R5GA 2JZSA 1FO5A 4YQVA 4FH8A 2I81A 5CREA 1O7UA 5LD0A 1CQHA 3HDCA 3TJGA 1ZYPA 3KD0A 2IFQA 4EE0A 2VLVA 4LA1A 4I5QA 3EPTA 4XTSA 4OCFA 3GHAA 4YQUA 4JBBA 2OA7A 1PN0A 3NZNA 4HJ2A 3UJ1A 1NM3A 3KH9A 2HSNA 1WJKA 1TXUA 3DD3A 4EDYA 2WFCA 3MIXA 1QUWA 2HSMB 4Z7XA 1GLQA 2OKAA 1AIUA 1VF2A 2PVOC 2AB6A 2FA4A 1XPVA 2CT6A 4K7OA 2B1LA 4HI7A 11GSA 2YJ7A 2EFCA 1GULA 1H4OA 1VF1A 3VLNA 4BVYA 3RHBA 3IR4A 3CXGA 1GSDA 5ID2A 2OJLA 2PPTA 4LL4B 3I69A 4PTSA 2WJUA 2ES7A 1QFNA 4KGIA 1WOUA 4FQUA 1XWKA 3K8NA 4KH7A 1V57A 2FY6A 5BMUB 2TIRA 2B5YA 1M2DA 1X5CA 3QAGA 2XBIA 1K3LA 5JWOB 3L0HA 3CTFA 1SKWB 2FWEA 2H66A 4YAPA 4IHUA 4ZL7A 5INYA 4Q5NA 1ERTA 5KN2A 3KP8A 1PSQA 1O85A 3QD9A 3UBKA 1FOVA 3V1WA 5ECHB 1Y1UA 2B7JA 2O89A 1QMVA 2WRTA 2P5RA 2WS2A 1OVNA 3DMLA 1U88A 4JEDA 1RK4A 2ZCTA 2CVKA 2VCXA 3GSSA 1H75A 3ZITA 3HYPA 3LQ7A 2PERA 2GZYA 4PQ1A 1K0BA 5C00A 5F05A 2IMKA 4MPFA 1TU8A 1GH2A 1N8JA 1G6YA 3HHVA 3EMPA 3L4NA 4IKHA 1A2JA 2PU9C 5HR3A 4WKWA 3TJKA 2MYGA 1M9BA 3KH7A 1GSFA 4OO5A 5IMZA 2EC4A 1AW9A 3QOUA 5JWRB 1BAYA 2DJ3A 4ILFA 5A5HB 1A8YA 1XVQA 2VCQA 1CQGA 4KAEA 2HRFA 1TI1A 3DVWA 3EURA 2Z9SA 2DJ1A 3HCZA 1G6WA 1PMTA 4Z2TA 1BG1A 3LORA 2QKEA 1OKDA 2GVPA 3PH9A 3FW2A 5EL8A 2K18A 2R0PA 5B6MA 1EV4A 1Y6EA 4F03A 1GTUA 10GSA 1TRWA 1EEJA 2BMXA 3GYKA 3BD2A 2IMIA 3VPQA 1SD8A 2CVDA 1SD9A 2RUFA 4V1Ap 1ERWA 2HZEA 1DE2A 2H1LA 3F3RA 2GDRA 4N30A 2H1GA 5H5SA 3VK9A 2GQMA 3CSHA 4ECIA 4GQCA 4ML1A 1T00A 4PNFA 1MD4A 4K9ZA 3TKQA 2FUG2 1AUCA 2NDOA 2LRCA 2MBSA 2F8AA 3TRQA 3R3EA 2JZRA 3TOUA 1GWCA 2QA1A 5HR2A 3FY7A 5D9VA 3TDGA 4TOPA 5JCWA 3PPUA 4BL7B 2B7KA 2PUKC 2YV7A 1VF3A 3LYPA 2GTUA 3LGCA 2CVBA 1HYUA 5B7CA 3R2QA 4IW9A 1J0FA 1OC9A 3GH9A 2JACA 5C04A 1XWBA 2JSZA 1V9WA 4BPYA 2IFQB 3FZ5A 1X9WB 4G0KA 2LJAA 1MD3A 4IJIA 1UA5A 3O76A 4MA9A 1W89A 2NBSA 6GSUA 4MJAA 2HQTA 2RIIA 4OCEA 2YNXA 4CY8A 3FZ9A 1K0DA 3PINA 4TW5A 3EC3A 2YZUA 2HSNB 4IGJA 2H8LA 4ZIJA 4POBA 3UMAA 1OC8A 1PQNA 1BG5A 2YP6A 1PD21 3F6FA 3KTBA 6GSTA 3FZAA 4F0BA 4USSA 4O92A 3IXRA 1T8EB 2I3YA 4Q5FA 4MZBA 5J40A 4G10A 1V98A 4JZQA 4JRRA 4ZBBA 4BVYB 4Z2UA 2V2GA 1MDIA 3VWXA 1O8XA 1WP0A 1K0NA 3Q74A 4IP1A 1BYEA 2HSMA 5ID2B 4PUAA 2DMLA 2H71A 1OYJA 2YOIA 1BQ7A 1GSSA 4MF5A 3HVXA 3ZMLA 1ST9A 5KN0A 2L6CA 2F51A 3KEBA 5GAND 1TK5B 2K6VA 1N2AA 1J08A 2H30A 4DSQA 2J9HA 4MK3A 3LSZA 3APQA 1MTCA 2QA2A 1LJRA 1ZOFA 4AKGA 2R2JA 5BRTA 4KDYA 2YWOA 2HSHA 5CO3A 1ZYQB 2VIMA 3M9JA 2VD1A 1B48A 3F63A 3ZLPA 2CAQA 5D9XA 3IBHA 5DAKA 1URMA 3TRPA 5ECPB 4ID0A 4X4JA 4P3YB 4AF2A 5IMFA 3C71A 1GLPA 2YCDA 4NV5A 1R5AA 1Z7PA 3OR5A 4NAXA 3UIWA 2VM1A 4ZB9A 2LTKA 4PX1A 2GZZA 2LS5A 3F4RA 3WGDA 3M0FA 5AIVA 2B3SA 4JU5A 2L4CA 5CYYA 20GSA 1SL2B 2GS3A 1R26A 4WF5A 2HSYA 2WDUA 2KUCA 4ICYA 2WCIA 3O3TA 5CRWA 3ZTLA 1ML6A 3DWVA 4L5LA 5IMDA 5ELAA 4AGSA 3LEFA 5ECSA 4QL7A 3HKRA 1WWJA 9GSSA 1R5PA 2FD3A 3TUEA 5KEJA 5G5FA 3TKPA 5JWQB 5IO0A 4EXJA 5ABRA 6GSSA 3KCMA 4O32A 1GSQA 3FK8A 1HNCA 4NHWA 1OC3A 1SKRB 1YQ1A 2O85A 4ZB8A 3P8WA 2HZEB 3P2AA 3GSTA 2E2GA 2FCHA 4AJ8A 1EZKA 4J57E 2VL2C 3ME8A 5B8AA 2G2QA 3H1NA 3GKMA 2JSYA 1SJZA 4HQZA 4G0IA 4NPBA 2LNTA 3FHKA 3F9UA 3Q18A 2H1BA 2L59A 4GDFA 1G7EA 4WEYA 3VWUA 2VCWA 3LXZA 5A4UA 1ZYEA 1A8LA 1SU9A 2X8GA 5CRGA 5HFIA 1IYIA 2BJXA 2MZCA 3RPPA 1ILOA 4NV2A 1TTZA 3US3A 1PA3A 1OC9B 4OMVA 4GSTA 4MMMA 4HUAA 3M1GA 2I4AA 2GLRA 2OE1A 4XS6A 3RPNA 3VPTA 1EV9A 4RQRA 1EGOA 1S3DA 3HMJG 4TKYA 4TRXA 2IWTA 2E2MA 5CRHA 5HFKA 2OACA 2KP2A 2LRTA 1FB6A 4KF9A 2H0HA 4WR5A 4KCEA 1NSWA 4WETA 4ZILA 1F2EA 3H4KA 1SK0A 4MH2A 1ZYNA 5HR0A 2R6KA 5DQSA 3DXBA 4TR1A 1WPIA 4QMKA 1XIYA 2AAWA 1OE7A 3W8JA 1KEBA 1FB0A 4JR6A 5IO2A 2KLXA 4XRDA 4ZXGA 1EP8A 2VLTA 3P7XA 4HQSA 4X1UA 4F2IA 2IMFA 4K5RA 7GSSA 3KP9A 5A4VA 2L5LA 1F37A 2HRKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QMX A;  5DCG A;  1O81 A;  4TN8 A;  5G30 A;  1JZO A;  2UZ8 A;  4WBJ A;  4ZBD A;  2C3N A;  3M8N A;  4O5R A;  4Q5R A;  4RI6 A;  2HFD A;  3KM6 A;  4DEJ A;  2NTO A;  4F9Z A;  5DAK B;  1A23 A;  5CAX A;  2VCT A;  1YEP A;  2X8H A;  1EOH A;  4XS1 A;  3WD6 A;  2C0F A;  1K3Y A;  2LJR A;  4HOJ A;  2FNO A;  3BOA A;  3ZYW A;  4LMW A;  4PXO A;  4ML6 A;  2GQL A;  1XW9 A;  2DBC A;  3QDN A;  4MPG A;  2JZT A;  2TRX A;  5B8B A;  4HU9 A;  1XVW A;  2P0G A;  4LLR A;  2DJ0 A;  1M2A A;  2ZUP A;  3E9J B;  1TW9 A;  5G5E A;  2H74 A;  2C0D A;  5F0G A;  6GSX A;  3QFA C;  2DC5 A;  6GSY A;  4TXV A;  4GXZ A;  3ZIJ A;  1TDI A;  3EIN A;  3EE2 A;  1TK8 B;  2DMM A;  5J9C A;  1ERV A;  4MDC A;  2OBI A;  2GST A;  4KW6 A;  3UL3 A;  2QC7 A;  3ZFL A;  5GZZ B;  1PL2 A;  3L9V A;  4NHZ A;  1I5G A;  2IL3 A;  5LCZ A;  4ZB6 A;  3DEX A;  1EEM A;  4EO3 A;  1LBK A;  2O8V B;  4MCU A;  3H79 A;  2WGR A;  3HJO A;  4FO5 A;  3J7Y b;  3LFL A;  1OE8 A;  2C0G A;  3D6I A;  3ZFB A;  2H19 A;  2AUV A;  4K0N A;  4L5O A;  4GWR A;  3ZL5 A;  1DUG A;  4KB3 A;  1X5E A;  3DKS A;  4PQI A;  2HI7 A;  4XCS A;  5HQP A;  5ECL B;  2WUL A;  3N5O A;  1TXX A;  4EKZ A;  2LST A;  2TRC P;  3F4T A;  1F3A A;  4TR0 A;  3TGZ A;  1AAZ A;  1I9D A;  3IOS A;  4HDE A;  1PX6 A;  3CRT A;  3TKS E;  3TJF A;  3SWL A;  5J3R A;  1T4Y A;  4LMV A;  4N0Z A;  4BWQ A;  1X9S B;  5DQY A;  1Q98 A;  6GSV A;  5COH A;  2VCZ A;  1XCC A;  1T4Z A;  1XZO A;  3F0I A;  2V41 A;  4E8H A;  4EF0 A;  3U5R E;  3VWV A;  2BTO T;  3BCI A;  2QGV A;  1HNA A;  1K0O A;  1GTB A;  2L4Q A;  4V2N A;  2DLX A;  5ECO B;  3F3Q A;  2C80 A;  4K7N A;  3IE3 A;  2YJH A;  2G0F A;  3QAV A;  4HZ2 A;  4DVC A;  3G7J A;  3C7M A;  2A2R A;  5EY6 A;  3EVI A;  2RM6 A;  4IN0 A;  2EIR A;  4TR1 B;  3BCK A;  4KX4 A;  2C4J A;  2DJK A;  3IK9 A;  4TXO A;  2ALB A;  2HRA A;  3UVT A;  2OE0 A;  1S3C A;  3TKS C;  3GL5 A;  3IK7 A;  1SEN A;  2N5A A;  3TRX A;  1UC7 A;  3VFI A;  5D9T A;  1WIK A;  5G31 A;  2ZNM A;  3Q19 A;  2GSR A;  4EC0 A;  2HRK B;  1O73 A;  4MJE A;  3GX8 A;  1GUM A;  3WT2 A;  4TR4 A;  1G0T A;  2YN1 A;  1E6B A;  4L8E A;  3ERG A;  2H73 A;  1AQX A;  2HE3 A;  4TR3 A;  2V6O A;  1T3B A;  4E8E A;  3QPM A;  5GST A;  1A2M A;  2MMN A;  3U6V A;  2FWF A;  3BBY A;  5IQY A;  3QCP A;  3N9J A;  3HJM A;  13GS A;  2LEG A;  1SK2 A;  1B4Q A;  4IQA A;  3PR8 A;  1AC1 A;  2H1A A;  1JZD A;  4O7H A;  4IP6 A;  4XS4 A;  1FG4 A;  3GL3 A;  2YPM A;  2JL4 A;  5G2Z A;  4EDZ A;  4ECC A;  2B6M A;  1VRS D;  3F6D A;  1GSY A;  2C0E A;  3VI7 A;  1ZCP A;  2H6Z A;  1U3A A;  4ZBA A;  2E0Q A;  1HNB A;  1GRX A;  2R37 A;  1BX9 A;  3GTU A;  1V2A A;  1TP9 A;  2YWM A;  3VI5 A;  4V2L A;  4BA7 A;  1GNW A;  3L9U A;  2FWH A;  3APO A;  4OFM A;  4OD7 A;  3NIV A;  3MAK A;  1LU4 A;  1DE1 A;  3ZMK A;  2HRN A;  5HFG A;  2GQK A;  1ZZY A;  2LNS A;  1XXU A;  2JAD A;  1PKZ A;  2RUE A;  4CHS A;  3GKK A;  3EWL A;  5DJM A;  3UVH A;  2R4V A;  1EGR A;  1JZR A;  3HXS A;  4H86 A;  3HY2 A;  3W6G A;  1BED A;  3GMF A;  3ZRE A;  1A24 A;  1R7H A;  1Z7R A;  1TKD B;  3NOF A;  5GAP D;  2LQO A;  3RDW A;  1JLW A;  5DBQ A;  1K3O A;  4KDU A;  2DIY A;  4PGT A;  2H76 A;  2IN3 A;  2WB9 A;  1KNG A;  19GS A;  2RLI A;  4V1A g;  2C3T A;  3J7Y k;  5G1K A;  2GSQ A;  2PVQ A;  3O6T A;  2AJQ B;  1O8W A;  2C3Q A;  3M3M A;  4L0U A;  3TCO A;  3ZVJ A;  2IMD A;  5IPH A;  3GV1 A;  3D4T A;  3I6A A;  1XW6 A;  3IDV A;  1MDJ A;  4ECB A;  2P5Q A;  4D73 A;  4GCI A;  3E3E A;  4N11 A;  1HD2 A;  1UN2 A;  1U3I A;  4KE3 A;  5D9W A;  3G7I A;  4MP4 A;  3EYT A;  5EPF A;  3GH6 A;  2FWG A;  5CRD A;  5J4U A;  2CX4 A;  2V1M A;  5FWG A;  1Z9H A;  4EVM A;  1YZX A;  1NHY A;  4FIW A;  3LXT A;  2PWJ A;  2L5O A;  3ME7 A;  2D2Z A;  3MSZ A;  2HYX A;  2H70 A;  1K0C A;  4X0X A;  4IEL A;  1F9M A;  2L57 A;  2GT6 A;  2H0I A;  4GTU A;  2VO4 A;  3GFK A;  1Z3E A;  3D21 A;  2NPB A;  3UOM A;  2H6Y A;  5FT3 A;  1MDK A;  2DJ2 A;  3ISO A;  1XWC A;  4PQH A;  5DAL A;  2VD0 A;  1V40 A;  1AQV A;  3VUR A;  18GS A;  1PRX A;  3UEM A;  4IVF A;  2EIQ A;  3ZZX A;  3G9B A;  22GS A;  4GF0 A;  3S9F A;  3HVS A;  2V32 A;  4NXI A;  4POK A;  1Z6M A;  1SL0 B;  2H01 A;  4TXO B;  3TB2 A;  5E4W A;  2PGT A;  2HLS A;  2GGT A;  1GP1 A;  3D4M A;  2VUP A;  4ULX A;  4CW9 A;  2CA8 A;  3VWW A;  1DBY A;  4K1F A;  4OO4 A;  1OKT A;  2HNL A;  2VL2 A;  4PUF C;  1UVZ A;  2FLS A;  4KA0 A;  4MAB A;  1TU7 A;  1R4W A;  4HS1 A;  3IA1 A;  4MF6 A;  2DJJ A;  5ELG A;  2O7K A;  1ACV A;  3LJR A;  1T1V A;  3L9S A;  3HZ8 A;  4DSR A;  2XPE A;  2XHF A;  5D8I A;  3EMX A;  2AV4 A;  3FR6 A;  3CBU A;  2CX3 A;  2AYT A;  5ECR B;  2A4V A;  1O6J A;  3D0Z A;  3LWA A;  4LL1 B;  4XS4 B;  17GS A;  5A5K A;  2NVL A;  2I9H A;  2CAI A;  2DSA A;  1RQM A;  5IOW A;  1PKW A;  4X43 A;  5ECN B;  2M80 A;  2R3X A;  3FKF A;  4AJ6 A;  5IMC A;  4FYC A;  3P90 A;  2RM5 A;  1BJX A;  2N5F A;  5IMA A;  2REM A;  4POM A;  2V6K A;  2KP1 A;  4WXT A;  3HA9 A;  1NHO A;  3GTU B;  2GT5 A;  1M7T A;  1FVJ A;  3RAZ A;  3GKX A;  5KN3 A;  2IME A;  4Q5Q A;  3L78 A;  4AJ7 A;  1GTA A;  1M99 A;  4K2D A;  3IC4 A;  1SJI A;  3C8E A;  5AN1 A;  4BVX A;  2QSI A;  3KIJ A;  2IIY A;  4IQ1 A;  2P31 A;  1JLV A;  5CP1 A;  2ON7 A;  5CNW A;  1FW1 A;  4F0C A;  2E7P A;  3GRX A;  4PNG A;  1YY7 A;  1E2Y A;  3CSJ A;  5KN1 A;  4XIH A;  3CSI A;  1YKA A;  3GIX A;  1GL8 A;  5G1L A;  2O87 A;  3TOT A;  1GUH A;  5A4W A;  5F07 A;  4ACS A;  4JR4 A;  2H0G A;  1XOB A;  2PMT A;  5JCU A;  3WGE A;  3EU3 A;  1S3A A;  2H1D A;  2VL3 A;  4GLT A;  5J5N A;  2YV9 A;  3QFB C;  2X99 A;  2AHE A;  2F3M A;  2CQ9 A;  4KSO A;  1Z5Y E;  5F06 A;  8GSS A;  1X9M B;  4I6X A;  3MDK A;  3E0U A;  1EP7 A;  4MH3 A;  5IM9 A;  1B9X C;  1MEK A;  1ON4 A;  5AIX A;  2YWN A;  3QR6 A;  2IPA A;  4D73 B;  5FHI A;  1DSB A;  4MJC A;  4IJ3 A;  3KXO A;  2YAN A;  3IHQ A;  1TI3 A;  2IJY A;  5F8B A;  3KJY A;  3HVV A;  4ZL8 A;  4FYU A;  1HQO A;  1YF0 A;  1B8X A;  2VCV A;  2LV3 A;  4MZC A;  1NW2 A;  4KSM A;  1GSE A;  5J41 A;  4G19 A;  4G2E A;  1XW5 A;  3DIE A;  2XBQ A;  1THO A;  2FGX A;  3APS A;  3ZIV A;  4FYB A;  4IBP A;  3Q6O A;  3KMO A;  1F6M C;  2LUS A;  3IRA A;  2J23 A;  1PGT A;  3G7Y A;  2K9F A;  3CMI A;  1SJ6 A;  4HJM A;  3UAP A;  3BJ5 A;  3FR3 A;  5IPG A;  3I9V 2;  4I2U A;  4K8M A;  5DAL B;  3HD5 A;  2B1K A;  2LRN A;  3ED3 A;  4ECJ A;  1B4P A;  3LYK A;  3WT1 A;  4KDX A;  1JHB A;  2MMZ A;  2H75 A;  4V2M A;  3C1S A;  3IAS 2;  3C73 A;  4NWY A;  5ECI B;  1TRV A;  1TOF A;  4EL1 A;  1KTE A;  1A2L A;  1VF4 A;  5IOX A;  2C8U A;  1FHE A;  1GUK A;  2A2S A;  1JZW A;  2X64 A;  3ZVJ D;  2H72 A;  4N10 A;  2M46 A;  4GSS A;  3H93 A;  2PBJ A;  4DSS A;  3ERW A;  4TVE A;  1B9Y C;  3GKN A;  3D5J A;  1YKC A;  2CV4 A;  2HXK A;  2GZP A;  5D96 A;  3KTL A;  3LG6 A;  2WZ9 A;  2VLU A;  3UAR A;  1GTI A;  4HZ4 A;  4L0W A;  3TKR A;  1WE0 A;  5D73 A;  4KND A;  4XHM A;  2VM2 A;  3FR9 A;  2KHP A;  4I8B A;  1PL1 A;  1C72 A;  1ZGN A;  1A0F A;  1OAZ A;  5D93 A;  4OFT A;  1K0M A;  2F8F A;  2I1U A;  5ENU A;  4G0L A;  3TJJ A;  4YQM A;  2YWI A;  4K6X A;  1M0U A;  4EUY A;  2OAD A;  2FHE A;  3FEU A;  6GSW A;  4YH2 A;  1WRY A;  3DVX A;  16GS A;  3FZ4 A;  4OFN A;  3MWH A;  1RW1 A;  1EOG A;  1J9B A;  1YEX A;  4RUV A;  1WMJ A;  3MNG A;  4IS0 A;  1VGL A;  2XC2 A;  2FA8 A;  3GUR A;  3GX0 A;  3PGT A;  4OWY A;  4WR4 A;  1U6T A;  4GRF A;  4RQX A;  1Q4J A;  3W8S A;  1YJ6 A;  1GNE A;  4BVX B;  1FAA A;  1TRU A;  2GSS A;  3AY8 A;  4ZL9 A;  3DGQ A;  5AGY A;  1USB A;  3HZ4 A;  5H5Q A;  5IMV A;  3GA4 A;  5ECQ B;  3CRU A;  1ZL9 A;  1G7O A;  3A2V A;  1PX7 A;  4XRA A;  5HR1 A;  1A0R P;  5EVO A;  2DIZ A;  1TJD A;  1XBS A;  3TKS A;  3TJB A;  4MZW A;  3A3T A;  3GN3 A;  3A2X A;  5DDL A;  4HEA 2;  1IYH A;  2PN8 A;  2KOK A;  1QQ2 A;  2OE3 A;  5BMU A;  4CDO A;  2B5E A;  5B6N A;  3UBL A;  1QXH A;  2CZ3 A;  1TK0 B;  1X5D A;  4ISD A;  2MBT A;  4J2F A;  2JU5 A;  3H8Q A;  2H6X A;  3RBT A;  2B5X A;  4KUN A;  14GS A;  1SK1 A;  4I97 A;  1KBN A;  4KCA A;  5H5R A;  4QQ7 A;  3FRC A;  3IAM 2;  1PN9 A;  2VAF A;  3GNJ A;  5L71 A;  5E59 A;  4MJB A;  1EWX A;  2EIO A;  1X0R A;  4WBR D;  1YDK A;  3A5W A;  3KMN A;  1M2B A;  3A2W A;  3KZQ A;  5DVB A;  5ECK B;  1QK8 A;  3WYW A;  2C1Y A;  2ON5 A;  5IIZ A;  1THX A;  1XFL A;  3CTG A;  2LJK A;  5AIS A;  1XWG A;  1SKS B;  3DRN A;  3CYN A;  1W4V A;  4HU7 A;  2LQQ A;  4K7I A;  3ERF A;  4GQF A;  3JCM L;  4N0V A;  4JE1 A;  5DCH A;  1SL1 B;  3SBC A;  1T7P B;  12GS A;  4POL A;  2LKU A;  1V58 A;  4BWS A;  3I43 A;  2VOC A;  2MMO A;  3DYR A;  1AXD A;  4YAV A;  2L6D A;  5GSS A;  2K8V A;  2MMA A;  2OBK A;  3ZRD A;  3KGK A;  2N5B A;  1SYX A;  3C1R A;  4QL9 A;  5ECM B;  1Z6N A;  1ERU A;  2F9S A;  4MF7 A;  5DJL A;  4I2T A;  1XWA A;  4NMU A;  4GSN A;  3IC8 A;  4F82 A;  5J9B A;  4MLY A;  2YZH A;  3D22 A;  5LNK e;  1AQW A;  1TRS A;  2K8S A;  1YF1 A;  4DSS B;  4G9H A;  3IPZ A;  3GUS A;  4K0G A;  2CZ2 A;  2HT9 A;  1K0A A;  4RI7 A;  2XPD A;  1Y25 A;  3F8U A;  1U87 A;  3F4S A;  3QAW A;  5JCG A;  1FVK A;  3EU4 A;  1F3B A;  2M72 A;  2X8C A;  1ZMA A;  1QGV A;  4J56 E;  4PUR A;  3FYG A;  1ABA A;  3M9K A;  1M9A A;  1JFU A;  3WGX A;  1SYR A;  1GSU A;  3RHC A;  4BL7 A;  4WF4 A;  2VL9 A;  2HZF A;  1XOA A;  3IV4 A;  3HJP A;  2R5G A;  2JZS A;  1FO5 A;  4YQV A;  4FH8 A;  2I81 A;  5CRE A;  1O7U A;  5LD0 A;  1CQH A;  3HDC A;  3TJG A;  3KD0 A;  2IFQ A;  4EE0 A;  2VLV A;  4LA1 A;  4I5Q A;  4XTS A;  4OCF A;  3GHA A;  4YQU A;  4JBB A;  2OA7 A;  3NZN A;  4HJ2 A;  3UJ1 A;  1NM3 A;  3KH9 A;  1WJK A;  3DD3 A;  4EDY A;  2WFC A;  1QUW A;  2HSM B;  4Z7X A;  1GLQ A;  2OKA A;  1AIU A;  1VF2 A;  2PVO C;  2AB6 A;  2FA4 A;  1XPV A;  2CT6 A;  4K7O A;  2B1L A;  4HI7 A;  11GS A;  2YJ7 A;  1GUL A;  1H4O A;  1VF1 A;  3VLN A;  4BVY A;  3RHB A;  3IR4 A;  3CXG A;  1GSD A;  5ID2 A;  2OJL A;  2PPT A;  4LL4 B;  3I69 A;  4PTS A;  2WJU A;  2ES7 A;  1QFN A;  4KGI A;  1WOU A;  4FQU A;  1XWK A;  3K8N A;  4KH7 A;  1V57 A;  2FY6 A;  2TIR A;  2B5Y A;  1M2D A;  1X5C A;  3QAG A;  2XBI A;  1K3L A;  5JWO B;  3L0H A;  3CTF A;  1SKW B;  2FWE A;  2H66 A;  4YAP A;  4IHU A;  4ZL7 A;  5INY A;  4Q5N A;  1ERT A;  5KN2 A;  3KP8 A;  1PSQ A;  1O85 A;  3QD9 A;  3UBK A;  1FOV A;  3V1W A;  5ECH B;  2B7J A;  2O89 A;  1QMV A;  2WRT A;  2P5R A;  2WS2 A;  1OVN A;  3DML A;  1U88 A;  4JED A;  1RK4 A;  2ZCT A;  2CVK A;  2VCX A;  3GSS A;  1H75 A;  3ZIT A;  3HYP A;  3LQ7 A;  2PER A;  2GZY A;  4PQ1 A;  1K0B A;  5C00 A;  5F05 A;  2IMK A;  4MPF A;  1TU8 A;  1GH2 A;  1N8J A;  1G6Y A;  3HHV A;  3EMP A;  3L4N A;  4IKH A;  1A2J A;  2PU9 C;  5HR3 A;  4WKW A;  3TJK A;  2MYG A;  1M9B A;  3KH7 A;  1GSF A;  4OO5 A;  5IMZ A;  2EC4 A;  1AW9 A;  3QOU A;  5JWR B;  1BAY A;  2DJ3 A;  4ILF A;  1A8Y A;  1XVQ A;  2VCQ A;  1CQG A;  4KAE A;  2HRF A;  1TI1 A;  3DVW A;  3EUR A;  2Z9S A;  2DJ1 A;  3HCZ A;  1G6W A;  1PMT A;  3LOR A;  2QKE A;  1OKD A;  2GVP A;  3PH9 A;  3FW2 A;  5EL8 A;  2K18 A;  5B6M A;  1EV4 A;  1Y6E A;  4F03 A;  1GTU A;  10GS A;  1TRW A;  1EEJ A;  2BMX A;  3GYK A;  3BD2 A;  2IMI A;  3VPQ A;  1SD8 A;  2CVD A;  1SD9 A;  2RUF A;  4V1A p;  1ERW A;  2HZE A;  1DE2 A;  3F3R A;  2GDR A;  4N30 A;  2H1G A;  5H5S A;  3VK9 A;  2GQM A;  3CSH A;  4ECI A;  4GQC A;  4ML1 A;  1T00 A;  4PNF A;  1MD4 A;  4K9Z A;  3TKQ A;  2FUG 2;  1AUC A;  2NDO A;  2LRC A;  2MBS A;  2F8A A;  3TRQ A;  3R3E A;  2JZR A;  3TOU A;  1GWC A;  5HR2 A;  3FY7 A;  5D9V A;  3TDG A;  4TOP A;  5JCW A;  3PPU A;  4BL7 B;  2B7K A;  2PUK C;  2YV7 A;  1VF3 A;  3LYP A;  2GTU A;  3LGC A;  2CVB A;  1HYU A;  5B7C A;  3R2Q A;  4IW9 A;  1J0F A;  1OC9 A;  3GH9 A;  2JAC A;  5C04 A;  1XWB A;  2JSZ A;  1V9W A;  4BPY A;  2IFQ B;  3FZ5 A;  1X9W B;  4G0K A;  2LJA A;  1MD3 A;  4IJI A;  1UA5 A;  3O76 A;  4MA9 A;  1W89 A;  2NBS A;  6GSU A;  4MJA A;  2HQT A;  2RII A;  4OCE A;  2YNX A;  3FZ9 A;  1K0D A;  3PIN A;  4TW5 A;  3EC3 A;  2YZU A;  2HSN B;  4IGJ A;  2H8L A;  4ZIJ A;  4POB A;  3UMA A;  1OC8 A;  1PQN A;  1BG5 A;  2YP6 A;  1PD2 1;  3F6F A;  3KTB A;  6GST A;  3FZA A;  4F0B A;  4USS A;  4O92 A;  3IXR A;  1T8E B;  2I3Y A;  4Q5F A;  4MZB A;  4G10 A;  1V98 A;  4JZQ A;  4JRR A;  4ZBB A;  4BVY B;  2V2G A;  1MDI A;  3VWX A;  1O8X A;  1WP0 A;  1K0N A;  3Q74 A;  4IP1 A;  1BYE A;  2HSM A;  5ID2 B;  4PUA A;  2DML A;  2H71 A;  1OYJ A;  2YOI A;  1BQ7 A;  1GSS A;  4MF5 A;  3HVX A;  3ZML A;  1ST9 A;  5KN0 A;  2L6C A;  2F51 A;  3KEB A;  5GAN D;  1TK5 B;  2K6V A;  1N2A A;  1J08 A;  2H30 A;  4DSQ A;  2J9H A;  4MK3 A;  3LSZ A;  3APQ A;  1MTC A;  1LJR A;  1ZOF A;  2R2J A;  4KDY A;  2YWO A;  2HSH A;  5CO3 A;  1ZYQ B;  2VIM A;  3M9J A;  2VD1 A;  1B48 A;  3F63 A;  3ZLP A;  2CAQ A;  5D9X A;  3IBH A;  5DAK A;  1URM A;  3TRP A;  5ECP B;  4ID0 A;  4P3Y B;  4AF2 A;  5IMF A;  3C71 A;  1GLP A;  2YCD A;  4NV5 A;  1R5A A;  1Z7P A;  3OR5 A;  4NAX A;  3UIW A;  2VM1 A;  4ZB9 A;  2LTK A;  4PX1 A;  2GZZ A;  2LS5 A;  3F4R A;  3WGD A;  3M0F A;  5AIV A;  2B3S A;  4JU5 A;  2L4C A;  5CYY A;  20GS A;  1SL2 B;  2GS3 A;  1R26 A;  4WF5 A;  2HSY A;  2WDU A;  2KUC A;  2WCI A;  3O3T A;  5CRW A;  3ZTL A;  1ML6 A;  3DWV A;  4L5L A;  5IMD A;  5ELA A;  4AGS A;  3LEF A;  5ECS A;  4QL7 A;  3HKR A;  1WWJ A;  9GSS A;  1R5P A;  2FD3 A;  3TUE A;  5KEJ A;  5G5F A;  3TKP A;  5JWQ B;  5IO0 A;  4EXJ A;  5ABR A;  6GSS A;  3KCM A;  4O32 A;  1GSQ A;  3FK8 A;  1HNC A;  4NHW A;  1OC3 A;  1SKR B;  1YQ1 A;  2O85 A;  4ZB8 A;  3P8W A;  2HZE B;  3P2A A;  3GST A;  2E2G A;  2FCH A;  4AJ8 A;  1EZK A;  4J57 E;  2VL2 C;  3ME8 A;  5B8A A;  2G2Q A;  3H1N A;  3GKM A;  2JSY A;  1SJZ A;  4HQZ A;  4G0I A;  4NPB A;  2LNT A;  3FHK A;  3F9U A;  3Q18 A;  2H1B A;  2L59 A;  1G7E A;  4WEY A;  3VWU A;  2VCW A;  3LXZ A;  5A4U A;  1ZYE A;  1A8L A;  1SU9 A;  2X8G A;  5CRG A;  5HFI A;  1IYI A;  2BJX A;  2MZC A;  3RPP A;  1ILO A;  4NV2 A;  1TTZ A;  3US3 A;  1PA3 A;  1OC9 B;  4OMV A;  4GST A;  4MMM A;  4HUA A;  3M1G A;  2I4A A;  2GLR A;  2OE1 A;  4XS6 A;  3RPN A;  3VPT A;  1EV9 A;  4RQR A;  1EGO A;  1S3D A;  4TKY A;  4TRX A;  2IWT A;  2E2M A;  5CRH A;  5HFK A;  2OAC A;  2KP2 A;  2LRT A;  1FB6 A;  4KF9 A;  2H0H A;  4WR5 A;  4KCE A;  1NSW A;  4WET A;  4ZIL A;  1F2E A;  3H4K A;  1SK0 A;  4MH2 A;  5HR0 A;  2R6K A;  5DQS A;  3DXB A;  4TR1 A;  1WPI A;  1XIY A;  2AAW A;  1OE7 A;  3W8J A;  1KEB A;  1FB0 A;  4JR6 A;  5IO2 A;  2KLX A;  4XRD A;  4ZXG A;  1EP8 A;  2VLT A;  3P7X A;  4HQS A;  4X1U A;  4F2I A;  2IMF A;  7GSS A;  3KP9 A;  5A4V A;  2L5L A;  1F37 A;  2HRK A; 
#chains in the Genus database with same CATH topology
 3QMX A;  5DCG A;  1O81 A;  4TN8 A;  4PI2 C;  5G30 A;  1JZO A;  2UZ8 A;  4WBJ A;  4ZBD A;  2R0G A;  2C3N A;  3M8N A;  4O5R A;  4Q5R A;  4RI6 A;  2HFD A;  3KM6 A;  4DEJ A;  2NTO A;  4F9Z A;  5DAK B;  1A23 A;  5CAX A;  2VCT A;  1YEP A;  2X8H A;  1EOH A;  4XS1 A;  3WD6 A;  2C0F A;  3LW9 A;  1K3Y A;  2LJR A;  1BF5 A;  4HOJ A;  2FNO A;  3BOA A;  3ZYW A;  4LMW A;  4PXO A;  4ML6 A;  2GQL A;  1XW9 A;  2DBC A;  2X4A A;  3QDN A;  4MPG A;  2JZT A;  4YKG A;  2TRX A;  5A1N A;  3HVN A;  5B8B A;  4HU9 A;  1XVW A;  2P0G A;  4LLR A;  2DJ0 A;  1M2A A;  2ZUP A;  3E9J B;  1TW9 A;  5G5E A;  2H74 A;  2C0D A;  1SVL A;  5F0G A;  6GSX A;  3QFA C;  2DC5 A;  6GSY A;  4TXV A;  4GXZ A;  3ZIJ A;  1TDI A;  3EIN A;  3EE2 A;  1TK8 B;  2DMM A;  5J9C A;  1ERV A;  4MDC A;  2OBI A;  2GST A;  4KW6 A;  3UL3 A;  2QC7 A;  3ZFL A;  5GZZ B;  1PL2 A;  3L9V A;  4NHZ A;  1I5G A;  2IL3 A;  5LCZ A;  4ZB6 A;  3DEX A;  1EEM A;  4EO3 A;  1LBK A;  2O8V B;  4MCU A;  5J4Y A;  2A2P A;  2WVX B;  3H79 A;  2WGR A;  3HJO A;  4FO5 A;  3J7Y b;  3LFL A;  1OE8 A;  2C0G A;  3D6I A;  3ZFB A;  2H19 A;  2AUV A;  4K0N A;  4L5O A;  4GWR A;  3ZL5 A;  1DUG A;  4KB3 A;  4HSC X;  1X5E A;  3DKS A;  4PQI A;  2HI7 A;  4XCS A;  5HQP A;  5ECL B;  2WUL A;  3N5O A;  1TXX A;  4EKZ A;  2LST A;  2TRC P;  3F4T A;  1F3A A;  2EFD A;  4TR0 A;  3TGZ A;  1AAZ A;  1I9D A;  3IOS A;  4HDE A;  1PX6 A;  3CRT A;  3TKS E;  3TJF A;  3SWL A;  5J3R A;  1T4Y A;  4LMV A;  4CY6 A;  4N0Z A;  4BWQ A;  1X9S B;  5DQY A;  1Q98 A;  6GSV A;  5COH A;  2VCZ A;  1XCC A;  1T4Z A;  1XZO A;  3F0I A;  2V41 A;  4E8H A;  4EF0 A;  3U5R E;  3VWV A;  2BTO T;  3BCI A;  2QGV A;  1HNA A;  1K0O A;  1GTB A;  2L4Q A;  1PFO A;  4V2N A;  2DLX A;  5ECO B;  3F3Q A;  2C80 A;  4K7N A;  3IE3 A;  2YJH A;  2G0F A;  3QAV A;  4HZ2 A;  4DVC A;  3G7J A;  3C7M A;  2A2R A;  5EY6 A;  3EVI A;  2RM6 A;  4IN0 A;  2EIR A;  4TR1 B;  3BCK A;  4KX4 A;  2C4J A;  2DJK A;  3IK9 A;  4TXO A;  2ALB A;  2HRA A;  3UVT A;  5J4V A;  2OE0 A;  2WZS A;  1S3C A;  5J47 A;  3TKS C;  3GL5 A;  3IK7 A;  1SEN A;  2N5A A;  3TRX A;  1UC7 A;  3VFI A;  5D9T A;  5KOX A;  1WIK A;  5G31 A;  2ZNM A;  3Q19 A;  3MYD A;  2GSR A;  4EC0 A;  2HRK B;  1O73 A;  4MJE A;  3GX8 A;  1GUM A;  3WT2 A;  4TR4 A;  1G0T A;  2YN1 A;  1E6B A;  4L8E A;  3ERG A;  2H73 A;  1AQX A;  2HE3 A;  4TR3 A;  2V6O A;  1T3B A;  4E8E A;  3QPM A;  2MMN A;  5GST A;  1A2M A;  3U6V A;  2FWF A;  3BBY A;  5IQY A;  3QCP A;  3N9J A;  3HJM A;  13GS A;  2LEG A;  1SK2 A;  1B4Q A;  4IQA A;  3PR8 A;  1AC1 A;  2H1A A;  1JZD A;  4O7H A;  4IP6 A;  4XS4 A;  1FG4 A;  3GL3 A;  2YPM A;  2JL4 A;  5G2Z A;  5A34 A;  5A1N B;  4EDZ A;  4ECC A;  1YEW C;  2B6M A;  1VRS D;  3F6D A;  1GSY A;  2C0E A;  3VI7 A;  1ZCP A;  2H6Z A;  1U3A A;  4ZBA A;  4O5Q A;  2VKZ G;  2E0Q A;  1HNB A;  1GRX A;  2R37 A;  1BX9 A;  3GTU A;  1V2A A;  1TP9 A;  2UV8 G;  2YWM A;  3VI5 A;  4V2L A;  4BA7 A;  1GNW A;  1I1I P;  3L9U A;  2FWH A;  3APO A;  4OFM A;  4OD7 A;  3NIV A;  1S4B P;  3MAK A;  1LU4 A;  1DE1 A;  3ZMK A;  2HRN A;  5HFG A;  2GQK A;  1ZZY A;  2LNS A;  1XXU A;  2JAD A;  1PKZ A;  2WW3 A;  2RUE A;  4CHS A;  3GKK A;  3EWL A;  5DJM A;  3UVH A;  2R4V A;  1EGR A;  1JZR A;  3HXS A;  3HY2 A;  4H86 A;  3W6G A;  1BED A;  3GMF A;  3ZRE A;  1A24 A;  1R7H A;  3IHG A;  1Z7R A;  1TKD B;  3NOF A;  5GAP D;  2LQO A;  3RDW A;  1JLW A;  5DBQ A;  1K3O A;  4KDU A;  2DIY A;  4PGT A;  4E68 A;  2H76 A;  2IN3 A;  2WB9 A;  1KNG A;  19GS A;  2RLI A;  4V1A g;  2C3T A;  3J7Y k;  5G1K A;  2GSQ A;  2PVQ A;  3O6T A;  2AJQ B;  1O8W A;  2C3Q A;  3M3M A;  2WW0 A;  4L0U A;  3TCO A;  3ZVJ A;  2IMD A;  5IPH A;  3GV1 A;  3D4T A;  3I6A A;  1XW6 A;  3IDV A;  1MDJ A;  4ECB A;  2P5Q A;  3CHX C;  4D73 A;  4AKI A;  4GCI A;  3E3E A;  4N11 A;  1HD2 A;  1UN2 A;  1U3I A;  4KE3 A;  5D9W A;  3G7I A;  4MP4 A;  3EYT A;  5EPF A;  3GH6 A;  2FWG A;  5CRD A;  5J4U A;  2CX4 A;  2V1M A;  5FWG A;  1Z9H A;  4EVM A;  1YZX A;  1NHY A;  4FIW A;  3LXT A;  2PWJ A;  2L5O A;  3ME7 A;  2D2Z A;  3MSZ A;  2HYX A;  2H70 A;  1K0C A;  4X0X A;  4IEL A;  1F9M A;  2L57 A;  2GT6 A;  2H0I A;  4GTU A;  3TU3 B;  2VO4 A;  3GFK A;  1Z3E A;  3D21 A;  2NPB A;  2O5V A;  4Z2R A;  3UOM A;  2H6Y A;  5FT3 A;  1MDK A;  2DJ2 A;  3ISO A;  1XWC A;  4PQH A;  5DAL A;  2VD0 A;  1V40 A;  1AQV A;  3VUR A;  18GS A;  1PRX A;  3UEM A;  4IVF A;  2EIQ A;  3ZZX A;  3G9B A;  22GS A;  4GF0 A;  3S9F A;  3HVS A;  2V32 A;  4MNN A;  4NXI A;  4POK A;  1Z6M A;  1SL0 B;  2H01 A;  4TXO B;  3TB2 A;  5E4W A;  2PGT A;  2HLS A;  2GGT A;  1GP1 A;  3D4M A;  2VUP A;  4ULX A;  1N25 A;  4CW9 A;  2CA8 A;  3VWW A;  1DBY A;  4K1F A;  1YVL A;  4OO4 A;  1OKT A;  2HNL A;  2VL2 A;  4PUF C;  1UVZ A;  2FLS A;  4KA0 A;  4MAB A;  1TU7 A;  1R4W A;  4HS1 A;  3IA1 A;  4MF6 A;  2DJJ A;  5ELG A;  2O7K A;  1ACV A;  3LJR A;  1T1V A;  3L9S A;  3HZ8 A;  4K5S A;  4DSR A;  2XPE A;  2XHF A;  5D8I A;  3EMX A;  2AV4 A;  3FR6 A;  3CBU A;  2CX3 A;  2AYT A;  5ECR B;  2A4V A;  1O6J A;  3D0Z A;  3LWA A;  4LL1 B;  4XS4 B;  17GS A;  5A5K A;  2NVL A;  2I9H A;  5A34 B;  2CAI A;  2DSA A;  1RQM A;  5IOW A;  1PKW A;  4X43 A;  5ECN B;  2M80 A;  2R3X A;  3FKF A;  4AJ6 A;  5IMC A;  4FYC A;  3P90 A;  2RM5 A;  1BJX A;  2N5F A;  5IMA A;  2REM A;  4POM A;  2V6K A;  2KP1 A;  4WXT A;  3HA9 A;  1NHO A;  3GTU B;  2GT5 A;  1M7T A;  1FVJ A;  3RAZ A;  3GKX A;  5KN3 A;  2IME A;  4Q5Q A;  3L78 A;  4AJ7 A;  1GTA A;  1M99 A;  4K2D A;  3IC4 A;  1SJI A;  2OT3 A;  2R0C A;  3C8E A;  5AN1 A;  4BVX A;  2QSI A;  1M3J A;  3KIJ A;  2IIY A;  4IQ1 A;  2P31 A;  1JLV A;  3RFR C;  5CP1 A;  2ON7 A;  5CNW A;  1FW1 A;  4F0C A;  2E7P A;  3GRX A;  4PNG A;  1YY7 A;  1E2Y A;  3CSJ A;  5KN1 A;  4XIH A;  3CSI A;  1YKA A;  3GIX A;  1GL8 A;  5G1L A;  2O87 A;  3TOT A;  1GUH A;  5A4W A;  5F07 A;  4ACS A;  4JR4 A;  2H0G A;  1XOB A;  2PMT A;  5JCU A;  3WGE A;  2A4H A;  4K2X A;  3EU3 A;  1S3A A;  2H1D A;  2VL3 A;  4GLT A;  5J5N A;  2YV9 A;  3QFB C;  2X99 A;  4G01 A;  2AHE A;  2F3M A;  2CQ9 A;  4KSO A;  1Z5Y E;  5F06 A;  8GSS A;  1X9M B;  4I6X A;  3MDK A;  3E0U A;  1EP7 A;  4MH3 A;  5IM9 A;  1B9X C;  1MEK A;  1ON4 A;  5AIX A;  2YWN A;  3QR6 A;  2IPA A;  4D73 B;  5FHI A;  1DSB A;  4MJC A;  4IJ3 A;  2WW1 A;  4YKF A;  3KXO A;  2YAN A;  3IHQ A;  1TI3 A;  5KOW A;  2IJY A;  5F8B A;  3KJY A;  3HVV A;  4ZL8 A;  4FYU A;  1HQO A;  2EFE A;  4ZB7 A;  1YF0 A;  1B8X A;  2VCV A;  2LV3 A;  4MZC A;  1NW2 A;  4KSM A;  1GSE A;  5J41 A;  4G19 A;  4G2E A;  1XW5 A;  3DIE A;  2XBQ A;  1THO A;  2FGX A;  3APS A;  3ZIV A;  4FYB A;  4IBP A;  4AKH A;  3Q6O A;  3KMO A;  1F6M C;  2LUS A;  3IRA A;  2J23 A;  1PGT A;  3G7Y A;  3CQF A;  2K9F A;  3CMI A;  1SJ6 A;  4HJM A;  4EIQ A;  3UAP A;  3BJ5 A;  3FR3 A;  5IPG A;  3I9V 2;  4I2U A;  4K8M A;  5DAL B;  3HD5 A;  2B1K A;  2LRN A;  3ED3 A;  4ECJ A;  1B4P A;  3LYK A;  3WT1 A;  4KDX A;  1JHB A;  2MMZ A;  2H75 A;  4V2M A;  3C1S A;  3IAS 2;  3C73 A;  4NWY A;  5ECI B;  1TRV A;  1TOF A;  4EL1 A;  1KTE A;  1A2L A;  1VF4 A;  5IOX A;  4A5P A;  2C8U A;  1FHE A;  1GUK A;  3FMW A;  2A2S A;  1JZW A;  2X64 A;  3ZVJ D;  2H72 A;  4N10 A;  2M46 A;  4GSS A;  4AI6 A;  3H93 A;  2PBJ A;  4DSS A;  3ERW A;  4TVE A;  1B9Y C;  3GKN A;  3D5J A;  1YKC A;  2CV4 A;  2HXK A;  2GZP A;  5D96 A;  3KTL A;  3LG6 A;  2WZ9 A;  2VLU A;  3UAR A;  1GTI A;  4HZ4 A;  4L0W A;  3TKR A;  1WE0 A;  5D73 A;  4KND A;  4XHM A;  2VM2 A;  3FR9 A;  2KHP A;  4I8B A;  1PL1 A;  1C72 A;  3A5I A;  1ZGN A;  1A0F A;  1OAZ A;  5D93 A;  4OFT A;  1K0M A;  2F8F A;  2I1U A;  5ENU A;  4G0L A;  3TJJ A;  4YQM A;  2YWI A;  4K6X A;  1M0U A;  4EUY A;  2OAD A;  2FHE A;  3FEU A;  6GSW A;  4YH2 A;  1WRY A;  3DVX A;  16GS A;  3FZ4 A;  4OFN A;  3MWH A;  1RW1 A;  1EOG A;  1J9B A;  1YEX A;  2X49 A;  4RUV A;  1WMJ A;  3MNG A;  4IS0 A;  1VGL A;  2XC2 A;  2FA8 A;  3GUR A;  3GX0 A;  3PGT A;  4OWY A;  4WR4 A;  1U6T A;  4GRF A;  4RQX A;  1Q4J A;  3W8S A;  1YJ6 A;  1GNE A;  4BVX B;  1FAA A;  1TRU A;  2GSS A;  3AY8 A;  4ZL9 A;  3DGQ A;  5AGY A;  1USB A;  3HZ4 A;  5H5Q A;  5IMV A;  3GA4 A;  5ECQ B;  3CRU A;  1ZL9 A;  1G7O A;  3A2V A;  4O5U A;  1PX7 A;  4XRA A;  5HR1 A;  1A0R P;  1FOH A;  5EVO A;  2DIZ A;  2DKI A;  1TJD A;  1XBS A;  3TKS A;  3TJB A;  4MZW A;  3A3T A;  3GN3 A;  3A2X A;  5DDL A;  4HEA 2;  1IYH A;  2PN8 A;  2KOK A;  1QQ2 A;  4W66 A;  5BMU A;  2OE3 A;  4CDO A;  2B5E A;  5B6N A;  3UBL A;  1QXH A;  2CZ3 A;  1TK0 B;  1X5D A;  4ISD A;  2MBT A;  4J2F A;  4AKX B;  2JU5 A;  3H8Q A;  2H6X A;  3RBT A;  2B5X A;  4KUN A;  14GS A;  1SK1 A;  4I97 A;  1KBN A;  4KCA A;  5H5R A;  4QQ7 A;  3FRC A;  3IAM 2;  1PN9 A;  2VAF A;  3GNJ A;  5L71 A;  5E59 A;  4MJB A;  1EWX A;  2EIO A;  1X0R A;  3CWG A;  4WBR D;  1YDK A;  3A5W A;  3KMN A;  1M2B A;  3A2W A;  3KZQ A;  5DVB A;  5ECK B;  1QK8 A;  3WYW A;  2C1Y A;  2ON5 A;  5IIZ A;  1THX A;  1XFL A;  3CTG A;  2LJK A;  4N3Z A;  5AIS A;  1XWG A;  1SKS B;  3DRN A;  3CYN A;  5A5H A;  1W4V A;  4HU7 A;  2LQQ A;  4K7I A;  3ERF A;  4GQF A;  3JCM L;  4N0V A;  4JE1 A;  5DCH A;  1SL1 B;  3SBC A;  1T7P B;  12GS A;  4POL A;  2LKU A;  1V58 A;  4BWS A;  1SVO A;  3I43 A;  2VOC A;  2MMO A;  3DYR A;  1AXD A;  4YAV A;  2L6D A;  5GSS A;  2K8V A;  2MMA A;  2OBK A;  3ZRD A;  3KGK A;  2N5B A;  1SYX A;  3C1R A;  4QL9 A;  5ECM B;  1Z6N A;  1ERU A;  2F9S A;  4MF7 A;  5DJL A;  4I2T A;  1XWA A;  4NMU A;  4GSN A;  3IC8 A;  4F82 A;  5J9B A;  4MLY A;  2YZH A;  3D22 A;  5LNK e;  1AQW A;  1TRS A;  2K8S A;  4FXY P;  2WVZ A;  1YF1 A;  4DSS B;  4G9H A;  3IPZ A;  3GUS A;  4K0G A;  2CZ2 A;  2HT9 A;  1K0A A;  4RI7 A;  2XPD A;  1Y25 A;  4EIP A;  3F8U A;  1U87 A;  3F4S A;  3QAW A;  5JCG A;  2DKH A;  1FVK A;  3EU4 A;  1F3B A;  4PI0 C;  2M72 A;  2X8C A;  1ZMA A;  1QGV A;  4J56 E;  4PUR A;  3FYG A;  1ABA A;  2EFH A;  3M9K A;  1M9A A;  1SVM A;  1JFU A;  3WGX A;  1SYR A;  1GSU A;  3RHC A;  4BL7 A;  4WF4 A;  2VL9 A;  2HZF A;  1XOA A;  3IV4 A;  3HJP A;  2R5G A;  2JZS A;  1FO5 A;  4YQV A;  4FH8 A;  2I81 A;  5CRE A;  1O7U A;  5LD0 A;  1XG8 A;  1CQH A;  3HDC A;  3TJG A;  1ZYP A;  3KD0 A;  2IFQ A;  4EE0 A;  2VLV A;  4LA1 A;  4I5Q A;  3EPT A;  4XTS A;  4OCF A;  3GHA A;  4YQU A;  4JBB A;  2OA7 A;  1PN0 A;  3NZN A;  4HJ2 A;  3UJ1 A;  1NM3 A;  3KH9 A;  2HSN A;  1WJK A;  1TXU A;  3DD3 A;  4EDY A;  2WFC A;  3MIX A;  1QUW A;  2HSM B;  4Z7X A;  1GLQ A;  2OKA A;  1AIU A;  1VF2 A;  2PVO C;  2AB6 A;  2FA4 A;  1XPV A;  2CT6 A;  4K7O A;  2B1L A;  4HI7 A;  11GS A;  2YJ7 A;  2EFC A;  1GUL A;  1H4O A;  1VF1 A;  3VLN A;  4BVY A;  3RHB A;  3IR4 A;  3CXG A;  1GSD A;  2O3E A;  5ID2 A;  2OJL A;  4PHZ C;  2PPT A;  4LL4 B;  3I69 A;  4PTS A;  2WJU A;  2ES7 A;  1QFN A;  4KGI A;  1WOU A;  4FQU A;  1XWK A;  3K8N A;  4KH7 A;  1V57 A;  2FY6 A;  5BMU B;  2TIR A;  2B5Y A;  1M2D A;  1X5C A;  3QAG A;  2XBI A;  1K3L A;  5JWO B;  3L0H A;  3CTF A;  1SKW B;  2FWE A;  2H66 A;  4YAP A;  4IHU A;  4ZL7 A;  5INY A;  4Q5N A;  1ERT A;  5KN2 A;  3KP8 A;  1PSQ A;  1O85 A;  3QD9 A;  3UBK A;  1FOV A;  3V1W A;  5ECH B;  1Y1U A;  2B7J A;  2O89 A;  1QMV A;  2WRT A;  2P5R A;  2WS2 A;  1OVN A;  3DML A;  1U88 A;  4JED A;  1RK4 A;  2ZCT A;  2CVK A;  2VCX A;  3GSS A;  1H75 A;  3ZIT A;  3HYP A;  3LQ7 A;  2PER A;  2GZY A;  4PQ1 A;  1K0B A;  5C00 A;  5F05 A;  2IMK A;  4MPF A;  1TU8 A;  1GH2 A;  1N8J A;  1G6Y A;  3HHV A;  3EMP A;  3L4N A;  4IKH A;  1A2J A;  2PU9 C;  5HR3 A;  4WKW A;  3TJK A;  2MYG A;  1M9B A;  3KH7 A;  1GSF A;  4OO5 A;  5IMZ A;  2EC4 A;  1AW9 A;  3QOU A;  5JWR B;  1BAY A;  2DJ3 A;  4ILF A;  5A5H B;  1A8Y A;  1XVQ A;  2VCQ A;  1CQG A;  4KAE A;  2HRF A;  1TI1 A;  3DVW A;  3EUR A;  2Z9S A;  2DJ1 A;  3HCZ A;  1G6W A;  1PMT A;  4Z2T A;  1BG1 A;  3LOR A;  2QKE A;  1OKD A;  2GVP A;  3PH9 A;  3FW2 A;  5EL8 A;  2K18 A;  2R0P A;  5B6M A;  1M3I A;  1EV4 A;  1Y6E A;  4F03 A;  1GTU A;  10GS A;  1TRW A;  1EEJ A;  2BMX A;  3GYK A;  3BD2 A;  2IMI A;  3VPQ A;  1SD8 A;  2CVD A;  1SD9 A;  2RUF A;  4V1A p;  1ERW A;  2HZE A;  1DE2 A;  2H1L A;  3F3R A;  2GDR A;  4N30 A;  2H1G A;  5H5S A;  3VK9 A;  2GQM A;  3CSH A;  4ECI A;  4GQC A;  4ML1 A;  2WVY A;  1T00 A;  4PNF A;  1MD4 A;  4K9Z A;  3TKQ A;  2FUG 2;  1AUC A;  2NDO A;  2LRC A;  2MBS A;  2F8A A;  3TRQ A;  3R3E A;  2JZR A;  3TOU A;  1GWC A;  2QA1 A;  5HR2 A;  3FY7 A;  5D9V A;  3TDG A;  4TOP A;  5JCW A;  3PPU A;  4BL7 B;  2B7K A;  2PUK C;  2YV7 A;  1VF3 A;  2WW2 A;  3LYP A;  2GTU A;  3LGC A;  2CVB A;  1HYU A;  5B7C A;  3R2Q A;  4IW9 A;  1J0F A;  1OC9 A;  3GH9 A;  2JAC A;  5C04 A;  1XWB A;  2JSZ A;  1V9W A;  4BPY A;  2IFQ B;  3FZ5 A;  1X9W B;  4G0K A;  2LJA A;  1MD3 A;  4IJI A;  1UA5 A;  3O76 A;  4MA9 A;  1W89 A;  2NBS A;  6GSU A;  4MJA A;  2HQT A;  2RII A;  4OCE A;  2YNX A;  4CY8 A;  3FZ9 A;  1K0D A;  3PIN A;  4TW5 A;  3EC3 A;  2YZU A;  2HSN B;  4IGJ A;  2H8L A;  4ZIJ A;  4POB A;  3UMA A;  1OC8 A;  1PQN A;  1BG5 A;  2YP6 A;  1PD2 1;  3F6F A;  3KTB A;  6GST A;  3FZA A;  4F0B A;  4USS A;  4O92 A;  3IXR A;  1T8E B;  2I3Y A;  4Q5F A;  4MZB A;  5J40 A;  4G10 A;  1V98 A;  4JZQ A;  4JRR A;  4ZBB A;  4BVY B;  4Z2U A;  2V2G A;  1MDI A;  3VWX A;  1O8X A;  1WP0 A;  1K0N A;  3Q74 A;  4IP1 A;  1BYE A;  2HSM A;  5ID2 B;  4PUA A;  2DML A;  2H71 A;  1OYJ A;  2YOI A;  1BQ7 A;  1GSS A;  4MF5 A;  3HVX A;  3ZML A;  1ST9 A;  5KN0 A;  2L6C A;  2F51 A;  3RGB C;  3KEB A;  5GAN D;  1TK5 B;  2K6V A;  1N2A A;  1J08 A;  2H30 A;  4DSQ A;  2J9H A;  4MK3 A;  3LSZ A;  3APQ A;  1MTC A;  2QA2 A;  1LJR A;  1ZOF A;  4AKG A;  2R2J A;  5BRT A;  4KDY A;  2YWO A;  2HSH A;  5CO3 A;  1ZYQ B;  2VIM A;  3M9J A;  2VD1 A;  1B48 A;  3F63 A;  3ZLP A;  2CAQ A;  5D9X A;  3IBH A;  5DAK A;  1URM A;  3TRP A;  5ECP B;  4ID0 A;  4X4J A;  4P3Y B;  4AF2 A;  5IMF A;  3C71 A;  1GLP A;  2YCD A;  4NV5 A;  1R5A A;  1Z7P A;  3OR5 A;  4NAX A;  3UIW A;  2VM1 A;  4ZB9 A;  2LTK A;  4PX1 A;  2GZZ A;  2LS5 A;  3F4R A;  3WGD A;  3M0F A;  5AIV A;  2B3S A;  2O36 A;  4JU5 A;  2L4C A;  5CYY A;  20GS A;  1SL2 B;  2GS3 A;  1R26 A;  4WF5 A;  2HSY A;  2WDU A;  2KUC A;  4ICY A;  2WCI A;  3O3T A;  5CRW A;  3ZTL A;  1ML6 A;  3DWV A;  4L5L A;  5IMD A;  5ELA A;  4AGS A;  3LEF A;  5ECS A;  4QL7 A;  3HKR A;  1WWJ A;  9GSS A;  1R5P A;  2FD3 A;  3TUE A;  2WVX A;  5KEJ A;  5G5F A;  3TKP A;  5JWQ B;  5IO0 A;  4EXJ A;  5ABR A;  6GSS A;  3KCM A;  4O32 A;  1GSQ A;  3FK8 A;  1HNC A;  4NHW A;  1OC3 A;  1SKR B;  1YQ1 A;  2O85 A;  4ZB8 A;  3P8W A;  2HZE B;  3P2A A;  3GST A;  2E2G A;  2FCH A;  4AJ8 A;  1EZK A;  4J57 E;  2VL2 C;  3ME8 A;  5B8A A;  2G2Q A;  3H1N A;  3GKM A;  2JSY A;  1SJZ A;  4HQZ A;  1S3R A;  4G0I A;  4NPB A;  2LNT A;  3FHK A;  3F9U A;  3Q18 A;  2H1B A;  2L59 A;  4GDF A;  1G7E A;  4WEY A;  3VWU A;  2VCW A;  3LXZ A;  5A4U A;  1ZYE A;  1A8L A;  1SU9 A;  2X8G A;  5CRG A;  5HFI A;  1IYI A;  2BJX A;  2MZC A;  3RPP A;  1ILO A;  4NV2 A;  1TTZ A;  3US3 A;  1PA3 A;  1OC9 B;  4OMV A;  4GST A;  4MMM A;  4HUA A;  3M1G A;  2I4A A;  2GLR A;  2OE1 A;  4XS6 A;  3RPN A;  3VPT A;  1EV9 A;  4RQR A;  1EGO A;  1S3D A;  3HMJ G;  4TKY A;  4TRX A;  2IWT A;  2E2M A;  5CRH A;  5HFK A;  2OAC A;  2KP2 A;  2LRT A;  1FB6 A;  4KF9 A;  2H0H A;  4WR5 A;  4KCE A;  1NSW A;  4WET A;  4ZIL A;  1F2E A;  3H4K A;  1SK0 A;  4MH2 A;  1ZYN A;  5HR0 A;  2R6K A;  5DQS A;  3DXB A;  4TR1 A;  1WPI A;  4QMK A;  1XIY A;  2AAW A;  1OE7 A;  3W8J A;  1KEB A;  1FB0 A;  4JR6 A;  4BIK A;  5IO2 A;  2KLX A;  4XRD A;  4ZXG A;  1EP8 A;  2VLT A;  3P7X A;  4HQS A;  4X1U A;  4F2I A;  2IMF A;  4K5R A;  7GSS A;  3KP9 A;  5A4V A;  2L5L A;  1F37 A;  2HRK A; 
#chains in the Genus database with same CATH homology
 3QMX A;  5DCG A;  1O81 A;  4TN8 A;  5G30 A;  1JZO A;  2UZ8 A;  4WBJ A;  4ZBD A;  2R0G A;  2C3N A;  3M8N A;  4O5R A;  4Q5R A;  4RI6 A;  2HFD A;  3KM6 A;  4DEJ A;  2NTO A;  4F9Z A;  5DAK B;  1A23 A;  5CAX A;  2VCT A;  1YEP A;  2X8H A;  1EOH A;  4XS1 A;  3WD6 A;  2C0F A;  3LW9 A;  1K3Y A;  2LJR A;  1BF5 A;  4HOJ A;  2FNO A;  3BOA A;  3ZYW A;  4LMW A;  4PXO A;  4ML6 A;  2GQL A;  1XW9 A;  2DBC A;  2X4A A;  3QDN A;  4MPG A;  2JZT A;  4YKG A;  2TRX A;  5A1N A;  5B8B A;  4HU9 A;  1XVW A;  2P0G A;  4LLR A;  2DJ0 A;  1M2A A;  2ZUP A;  3E9J B;  1TW9 A;  5G5E A;  2H74 A;  2C0D A;  1SVL A;  5F0G A;  6GSX A;  3QFA C;  2DC5 A;  6GSY A;  4TXV A;  4GXZ A;  3ZIJ A;  1TDI A;  3EIN A;  3EE2 A;  1TK8 B;  2DMM A;  5J9C A;  1ERV A;  4MDC A;  2OBI A;  2GST A;  4KW6 A;  3UL3 A;  2QC7 A;  3ZFL A;  5GZZ B;  1PL2 A;  3L9V A;  4NHZ A;  1I5G A;  2IL3 A;  5LCZ A;  4ZB6 A;  3DEX A;  1EEM A;  4EO3 A;  1LBK A;  2O8V B;  4MCU A;  5J4Y A;  2A2P A;  3H79 A;  2WGR A;  3HJO A;  4FO5 A;  3J7Y b;  3LFL A;  1OE8 A;  2C0G A;  3D6I A;  3ZFB A;  2H19 A;  2AUV A;  4K0N A;  4L5O A;  4GWR A;  3ZL5 A;  1DUG A;  4KB3 A;  1X5E A;  3DKS A;  4PQI A;  2HI7 A;  4XCS A;  5HQP A;  5ECL B;  2WUL A;  3N5O A;  1TXX A;  4EKZ A;  2LST A;  2TRC P;  3F4T A;  1F3A A;  2EFD A;  4TR0 A;  3TGZ A;  1AAZ A;  1I9D A;  3IOS A;  4HDE A;  1PX6 A;  3CRT A;  3TKS E;  3TJF A;  3SWL A;  5J3R A;  1T4Y A;  4LMV A;  4CY6 A;  4N0Z A;  4BWQ A;  1X9S B;  5DQY A;  1Q98 A;  6GSV A;  5COH A;  2VCZ A;  1XCC A;  1T4Z A;  1XZO A;  3F0I A;  2V41 A;  4E8H A;  4EF0 A;  3U5R E;  3VWV A;  2BTO T;  3BCI A;  2QGV A;  1HNA A;  1K0O A;  1GTB A;  2L4Q A;  4V2N A;  2DLX A;  5ECO B;  3F3Q A;  2C80 A;  4K7N A;  3IE3 A;  2YJH A;  2G0F A;  3QAV A;  4HZ2 A;  4DVC A;  3G7J A;  3C7M A;  2A2R A;  5EY6 A;  3EVI A;  2RM6 A;  4IN0 A;  2EIR A;  4TR1 B;  3BCK A;  4KX4 A;  2C4J A;  2DJK A;  3IK9 A;  4TXO A;  2ALB A;  2HRA A;  3UVT A;  5J4V A;  2OE0 A;  1S3C A;  5J47 A;  3TKS C;  3GL5 A;  3IK7 A;  1SEN A;  2N5A A;  3TRX A;  1UC7 A;  3VFI A;  5D9T A;  5KOX A;  1WIK A;  5G31 A;  2ZNM A;  3Q19 A;  3MYD A;  2GSR A;  4EC0 A;  2HRK B;  1O73 A;  4MJE A;  3GX8 A;  1GUM A;  3WT2 A;  4TR4 A;  1G0T A;  2YN1 A;  1E6B A;  4L8E A;  3ERG A;  2H73 A;  1AQX A;  2HE3 A;  4TR3 A;  2V6O A;  1T3B A;  4E8E A;  3QPM A;  2MMN A;  5GST A;  1A2M A;  3U6V A;  2FWF A;  3BBY A;  5IQY A;  3QCP A;  3N9J A;  3HJM A;  13GS A;  2LEG A;  1SK2 A;  1B4Q A;  4IQA A;  3PR8 A;  1AC1 A;  2H1A A;  1JZD A;  4O7H A;  4IP6 A;  4XS4 A;  1FG4 A;  3GL3 A;  2YPM A;  2JL4 A;  5G2Z A;  5A34 A;  5A1N B;  4EDZ A;  4ECC A;  2B6M A;  1VRS D;  3F6D A;  1GSY A;  2C0E A;  3VI7 A;  1ZCP A;  2H6Z A;  1U3A A;  4ZBA A;  4O5Q A;  2VKZ G;  2E0Q A;  1HNB A;  1GRX A;  2R37 A;  1BX9 A;  3GTU A;  1V2A A;  1TP9 A;  2UV8 G;  2YWM A;  3VI5 A;  4V2L A;  4BA7 A;  1GNW A;  3L9U A;  2FWH A;  3APO A;  4OFM A;  4OD7 A;  3NIV A;  3MAK A;  1LU4 A;  1DE1 A;  3ZMK A;  2HRN A;  5HFG A;  2GQK A;  1ZZY A;  2LNS A;  1XXU A;  2JAD A;  1PKZ A;  2RUE A;  4CHS A;  3GKK A;  3EWL A;  5DJM A;  3UVH A;  2R4V A;  1EGR A;  1JZR A;  3HXS A;  3HY2 A;  4H86 A;  3W6G A;  1BED A;  3GMF A;  3ZRE A;  1A24 A;  1R7H A;  3IHG A;  1Z7R A;  1TKD B;  3NOF A;  5GAP D;  2LQO A;  3RDW A;  1JLW A;  5DBQ A;  1K3O A;  4KDU A;  2DIY A;  4PGT A;  4E68 A;  2H76 A;  2IN3 A;  2WB9 A;  1KNG A;  19GS A;  2RLI A;  4V1A g;  2C3T A;  3J7Y k;  5G1K A;  2GSQ A;  2PVQ A;  3O6T A;  2AJQ B;  1O8W A;  2C3Q A;  3M3M A;  4L0U A;  3TCO A;  3ZVJ A;  2IMD A;  5IPH A;  3GV1 A;  3D4T A;  3I6A A;  1XW6 A;  3IDV A;  1MDJ A;  4ECB A;  2P5Q A;  4D73 A;  4AKI A;  4GCI A;  3E3E A;  4N11 A;  1HD2 A;  1UN2 A;  1U3I A;  4KE3 A;  5D9W A;  3G7I A;  4MP4 A;  3EYT A;  5EPF A;  3GH6 A;  2FWG A;  5CRD A;  5J4U A;  2CX4 A;  2V1M A;  5FWG A;  1Z9H A;  4EVM A;  1YZX A;  1NHY A;  4FIW A;  3LXT A;  2PWJ A;  2L5O A;  3ME7 A;  2D2Z A;  3MSZ A;  2HYX A;  2H70 A;  1K0C A;  4X0X A;  4IEL A;  1F9M A;  2L57 A;  2GT6 A;  2H0I A;  4GTU A;  3TU3 B;  2VO4 A;  3GFK A;  1Z3E A;  3D21 A;  2NPB A;  2O5V A;  4Z2R A;  3UOM A;  2H6Y A;  5FT3 A;  1MDK A;  2DJ2 A;  3ISO A;  1XWC A;  4PQH A;  5DAL A;  2VD0 A;  1V40 A;  1AQV A;  3VUR A;  18GS A;  1PRX A;  3UEM A;  4IVF A;  2EIQ A;  3ZZX A;  3G9B A;  22GS A;  4GF0 A;  3S9F A;  3HVS A;  2V32 A;  4MNN A;  4NXI A;  4POK A;  1Z6M A;  1SL0 B;  2H01 A;  4TXO B;  3TB2 A;  5E4W A;  2PGT A;  2HLS A;  2GGT A;  1GP1 A;  3D4M A;  2VUP A;  4ULX A;  1N25 A;  4CW9 A;  2CA8 A;  3VWW A;  1DBY A;  4K1F A;  1YVL A;  4OO4 A;  1OKT A;  2HNL A;  2VL2 A;  4PUF C;  1UVZ A;  2FLS A;  4KA0 A;  4MAB A;  1TU7 A;  1R4W A;  4HS1 A;  3IA1 A;  4MF6 A;  2DJJ A;  5ELG A;  2O7K A;  1ACV A;  3LJR A;  1T1V A;  3L9S A;  3HZ8 A;  4K5S A;  4DSR A;  2XPE A;  2XHF A;  5D8I A;  3EMX A;  2AV4 A;  3FR6 A;  3CBU A;  2CX3 A;  2AYT A;  5ECR B;  2A4V A;  1O6J A;  3D0Z A;  3LWA A;  4LL1 B;  4XS4 B;  17GS A;  5A5K A;  2NVL A;  2I9H A;  5A34 B;  2CAI A;  2DSA A;  1RQM A;  5IOW A;  1PKW A;  4X43 A;  5ECN B;  2M80 A;  2R3X A;  3FKF A;  4AJ6 A;  5IMC A;  4FYC A;  3P90 A;  2RM5 A;  1BJX A;  2N5F A;  5IMA A;  2REM A;  4POM A;  2V6K A;  2KP1 A;  4WXT A;  3HA9 A;  1NHO A;  3GTU B;  2GT5 A;  1M7T A;  1FVJ A;  3RAZ A;  3GKX A;  5KN3 A;  2IME A;  4Q5Q A;  3L78 A;  4AJ7 A;  1GTA A;  1M99 A;  4K2D A;  3IC4 A;  1SJI A;  2OT3 A;  2R0C A;  3C8E A;  5AN1 A;  4BVX A;  2QSI A;  3KIJ A;  2IIY A;  4IQ1 A;  2P31 A;  1JLV A;  5CP1 A;  2ON7 A;  5CNW A;  1FW1 A;  4F0C A;  2E7P A;  3GRX A;  4PNG A;  1YY7 A;  1E2Y A;  3CSJ A;  5KN1 A;  4XIH A;  3CSI A;  1YKA A;  3GIX A;  1GL8 A;  5G1L A;  2O87 A;  3TOT A;  1GUH A;  5A4W A;  5F07 A;  4ACS A;  4JR4 A;  2H0G A;  1XOB A;  2PMT A;  5JCU A;  3WGE A;  2A4H A;  4K2X A;  3EU3 A;  1S3A A;  2H1D A;  2VL3 A;  4GLT A;  5J5N A;  2YV9 A;  3QFB C;  2X99 A;  4G01 A;  2AHE A;  2F3M A;  2CQ9 A;  4KSO A;  1Z5Y E;  5F06 A;  8GSS A;  1X9M B;  4I6X A;  3MDK A;  3E0U A;  1EP7 A;  4MH3 A;  5IM9 A;  1B9X C;  1MEK A;  1ON4 A;  5AIX A;  2YWN A;  3QR6 A;  2IPA A;  4D73 B;  5FHI A;  1DSB A;  4MJC A;  4IJ3 A;  4YKF A;  3KXO A;  2YAN A;  3IHQ A;  1TI3 A;  5KOW A;  2IJY A;  5F8B A;  3KJY A;  3HVV A;  4ZL8 A;  4FYU A;  1HQO A;  2EFE A;  4ZB7 A;  1YF0 A;  1B8X A;  2VCV A;  2LV3 A;  4MZC A;  1NW2 A;  4KSM A;  1GSE A;  5J41 A;  4G19 A;  4G2E A;  1XW5 A;  3DIE A;  2XBQ A;  1THO A;  2FGX A;  3APS A;  3ZIV A;  4FYB A;  4IBP A;  4AKH A;  3Q6O A;  3KMO A;  1F6M C;  2LUS A;  3IRA A;  2J23 A;  1PGT A;  3G7Y A;  2K9F A;  3CMI A;  1SJ6 A;  4HJM A;  4EIQ A;  3UAP A;  3BJ5 A;  3FR3 A;  5IPG A;  3I9V 2;  4I2U A;  4K8M A;  5DAL B;  3HD5 A;  2B1K A;  2LRN A;  3ED3 A;  4ECJ A;  1B4P A;  3LYK A;  3WT1 A;  4KDX A;  1JHB A;  2MMZ A;  2H75 A;  4V2M A;  3C1S A;  3IAS 2;  3C73 A;  4NWY A;  5ECI B;  1TRV A;  1TOF A;  4EL1 A;  1KTE A;  1A2L A;  1VF4 A;  5IOX A;  4A5P A;  2C8U A;  1FHE A;  1GUK A;  3FMW A;  2A2S A;  1JZW A;  2X64 A;  3ZVJ D;  2H72 A;  4N10 A;  2M46 A;  4GSS A;  4AI6 A;  3H93 A;  2PBJ A;  4DSS A;  3ERW A;  4TVE A;  1B9Y C;  3GKN A;  3D5J A;  1YKC A;  2CV4 A;  2HXK A;  2GZP A;  5D96 A;  3KTL A;  3LG6 A;  2WZ9 A;  2VLU A;  3UAR A;  1GTI A;  4HZ4 A;  4L0W A;  3TKR A;  1WE0 A;  5D73 A;  4KND A;  4XHM A;  2VM2 A;  3FR9 A;  2KHP A;  4I8B A;  1PL1 A;  1C72 A;  3A5I A;  1ZGN A;  1A0F A;  1OAZ A;  5D93 A;  4OFT A;  1K0M A;  2F8F A;  2I1U A;  5ENU A;  4G0L A;  3TJJ A;  4YQM A;  2YWI A;  4K6X A;  1M0U A;  4EUY A;  2OAD A;  2FHE A;  3FEU A;  6GSW A;  4YH2 A;  1WRY A;  3DVX A;  16GS A;  3FZ4 A;  4OFN A;  3MWH A;  1RW1 A;  1EOG A;  1J9B A;  1YEX A;  2X49 A;  4RUV A;  1WMJ A;  3MNG A;  4IS0 A;  1VGL A;  2XC2 A;  2FA8 A;  3GUR A;  3GX0 A;  3PGT A;  4OWY A;  4WR4 A;  1U6T A;  4GRF A;  4RQX A;  1Q4J A;  3W8S A;  1YJ6 A;  1GNE A;  4BVX B;  1FAA A;  1TRU A;  2GSS A;  3AY8 A;  4ZL9 A;  3DGQ A;  5AGY A;  1USB A;  3HZ4 A;  5H5Q A;  5IMV A;  3GA4 A;  5ECQ B;  3CRU A;  1ZL9 A;  1G7O A;  3A2V A;  4O5U A;  1PX7 A;  4XRA A;  5HR1 A;  1A0R P;  1FOH A;  5EVO A;  2DIZ A;  2DKI A;  1TJD A;  1XBS A;  3TKS A;  3TJB A;  4MZW A;  3A3T A;  3GN3 A;  3A2X A;  5DDL A;  4HEA 2;  1IYH A;  2PN8 A;  2KOK A;  1QQ2 A;  4W66 A;  5BMU A;  2OE3 A;  4CDO A;  2B5E A;  5B6N A;  3UBL A;  1QXH A;  2CZ3 A;  1TK0 B;  1X5D A;  4ISD A;  2MBT A;  4J2F A;  4AKX B;  2JU5 A;  3H8Q A;  2H6X A;  3RBT A;  2B5X A;  4KUN A;  14GS A;  1SK1 A;  4I97 A;  1KBN A;  4KCA A;  5H5R A;  4QQ7 A;  3FRC A;  3IAM 2;  1PN9 A;  2VAF A;  3GNJ A;  5L71 A;  5E59 A;  4MJB A;  1EWX A;  2EIO A;  1X0R A;  3CWG A;  4WBR D;  1YDK A;  3A5W A;  3KMN A;  1M2B A;  3A2W A;  3KZQ A;  5DVB A;  5ECK B;  1QK8 A;  3WYW A;  2C1Y A;  2ON5 A;  5IIZ A;  1THX A;  1XFL A;  3CTG A;  2LJK A;  4N3Z A;  5AIS A;  1XWG A;  1SKS B;  3DRN A;  3CYN A;  5A5H A;  1W4V A;  4HU7 A;  2LQQ A;  4K7I A;  3ERF A;  4GQF A;  3JCM L;  4N0V A;  4JE1 A;  5DCH A;  1SL1 B;  3SBC A;  1T7P B;  12GS A;  4POL A;  2LKU A;  1V58 A;  4BWS A;  1SVO A;  3I43 A;  2VOC A;  2MMO A;  3DYR A;  1AXD A;  4YAV A;  2L6D A;  5GSS A;  2K8V A;  2MMA A;  2OBK A;  3ZRD A;  3KGK A;  2N5B A;  1SYX A;  3C1R A;  4QL9 A;  5ECM B;  1Z6N A;  1ERU A;  2F9S A;  4MF7 A;  5DJL A;  4I2T A;  1XWA A;  4NMU A;  4GSN A;  3IC8 A;  4F82 A;  5J9B A;  4MLY A;  2YZH A;  3D22 A;  5LNK e;  1AQW A;  1TRS A;  2K8S A;  1YF1 A;  4DSS B;  4G9H A;  3IPZ A;  3GUS A;  4K0G A;  2CZ2 A;  2HT9 A;  1K0A A;  4RI7 A;  2XPD A;  1Y25 A;  4EIP A;  3F8U A;  1U87 A;  3F4S A;  3QAW A;  5JCG A;  2DKH A;  1FVK A;  3EU4 A;  1F3B A;  2M72 A;  2X8C A;  1ZMA A;  1QGV A;  4J56 E;  4PUR A;  3FYG A;  1ABA A;  2EFH A;  3M9K A;  1M9A A;  1SVM A;  1JFU A;  3WGX A;  1SYR A;  1GSU A;  3RHC A;  4BL7 A;  4WF4 A;  2VL9 A;  2HZF A;  1XOA A;  3IV4 A;  3HJP A;  2R5G A;  2JZS A;  1FO5 A;  4YQV A;  4FH8 A;  2I81 A;  5CRE A;  1O7U A;  5LD0 A;  1CQH A;  3HDC A;  3TJG A;  1ZYP A;  3KD0 A;  2IFQ A;  4EE0 A;  2VLV A;  4LA1 A;  4I5Q A;  3EPT A;  4XTS A;  4OCF A;  3GHA A;  4YQU A;  4JBB A;  2OA7 A;  1PN0 A;  3NZN A;  4HJ2 A;  3UJ1 A;  1NM3 A;  3KH9 A;  2HSN A;  1WJK A;  1TXU A;  3DD3 A;  4EDY A;  2WFC A;  3MIX A;  1QUW A;  2HSM B;  4Z7X A;  1GLQ A;  2OKA A;  1AIU A;  1VF2 A;  2PVO C;  2AB6 A;  2FA4 A;  1XPV A;  2CT6 A;  4K7O A;  2B1L A;  4HI7 A;  11GS A;  2YJ7 A;  2EFC A;  1GUL A;  1H4O A;  1VF1 A;  3VLN A;  4BVY A;  3RHB A;  3IR4 A;  3CXG A;  1GSD A;  5ID2 A;  2OJL A;  2PPT A;  4LL4 B;  3I69 A;  4PTS A;  2WJU A;  2ES7 A;  1QFN A;  4KGI A;  1WOU A;  4FQU A;  1XWK A;  3K8N A;  4KH7 A;  1V57 A;  2FY6 A;  5BMU B;  2TIR A;  2B5Y A;  1M2D A;  1X5C A;  3QAG A;  2XBI A;  1K3L A;  5JWO B;  3L0H A;  3CTF A;  1SKW B;  2FWE A;  2H66 A;  4YAP A;  4IHU A;  4ZL7 A;  5INY A;  4Q5N A;  1ERT A;  5KN2 A;  3KP8 A;  1PSQ A;  1O85 A;  3QD9 A;  3UBK A;  1FOV A;  3V1W A;  5ECH B;  1Y1U A;  2B7J A;  2O89 A;  1QMV A;  2WRT A;  2P5R A;  2WS2 A;  1OVN A;  3DML A;  1U88 A;  4JED A;  1RK4 A;  2ZCT A;  2CVK A;  2VCX A;  3GSS A;  1H75 A;  3ZIT A;  3HYP A;  3LQ7 A;  2PER A;  2GZY A;  4PQ1 A;  1K0B A;  5C00 A;  5F05 A;  2IMK A;  4MPF A;  1TU8 A;  1GH2 A;  1N8J A;  1G6Y A;  3HHV A;  3EMP A;  3L4N A;  4IKH A;  1A2J A;  2PU9 C;  5HR3 A;  4WKW A;  3TJK A;  2MYG A;  1M9B A;  3KH7 A;  1GSF A;  4OO5 A;  5IMZ A;  2EC4 A;  1AW9 A;  3QOU A;  5JWR B;  1BAY A;  2DJ3 A;  4ILF A;  5A5H B;  1A8Y A;  1XVQ A;  2VCQ A;  1CQG A;  4KAE A;  2HRF A;  1TI1 A;  3DVW A;  3EUR A;  2Z9S A;  2DJ1 A;  3HCZ A;  1G6W A;  1PMT A;  4Z2T A;  1BG1 A;  3LOR A;  2QKE A;  1OKD A;  2GVP A;  3PH9 A;  3FW2 A;  5EL8 A;  2K18 A;  2R0P A;  5B6M A;  1EV4 A;  1Y6E A;  4F03 A;  1GTU A;  10GS A;  1TRW A;  1EEJ A;  2BMX A;  3GYK A;  3BD2 A;  2IMI A;  3VPQ A;  1SD8 A;  2CVD A;  1SD9 A;  2RUF A;  4V1A p;  1ERW A;  2HZE A;  1DE2 A;  2H1L A;  3F3R A;  2GDR A;  4N30 A;  2H1G A;  5H5S A;  3VK9 A;  2GQM A;  3CSH A;  4ECI A;  4GQC A;  4ML1 A;  1T00 A;  4PNF A;  1MD4 A;  4K9Z A;  3TKQ A;  2FUG 2;  1AUC A;  2NDO A;  2LRC A;  2MBS A;  2F8A A;  3TRQ A;  3R3E A;  2JZR A;  3TOU A;  1GWC A;  2QA1 A;  5HR2 A;  3FY7 A;  5D9V A;  3TDG A;  4TOP A;  5JCW A;  3PPU A;  4BL7 B;  2B7K A;  2PUK C;  2YV7 A;  1VF3 A;  3LYP A;  2GTU A;  3LGC A;  2CVB A;  1HYU A;  5B7C A;  3R2Q A;  4IW9 A;  1J0F A;  1OC9 A;  3GH9 A;  2JAC A;  5C04 A;  1XWB A;  2JSZ A;  1V9W A;  4BPY A;  2IFQ B;  3FZ5 A;  1X9W B;  4G0K A;  2LJA A;  1MD3 A;  4IJI A;  1UA5 A;  3O76 A;  4MA9 A;  1W89 A;  2NBS A;  6GSU A;  4MJA A;  2HQT A;  2RII A;  4OCE A;  2YNX A;  4CY8 A;  3FZ9 A;  1K0D A;  3PIN A;  4TW5 A;  3EC3 A;  2YZU A;  2HSN B;  4IGJ A;  2H8L A;  4ZIJ A;  4POB A;  3UMA A;  1OC8 A;  1PQN A;  1BG5 A;  2YP6 A;  1PD2 1;  3F6F A;  3KTB A;  6GST A;  3FZA A;  4F0B A;  4USS A;  4O92 A;  3IXR A;  1T8E B;  2I3Y A;  4Q5F A;  4MZB A;  5J40 A;  4G10 A;  1V98 A;  4JZQ A;  4JRR A;  4ZBB A;  4BVY B;  4Z2U A;  2V2G A;  1MDI A;  3VWX A;  1O8X A;  1WP0 A;  1K0N A;  3Q74 A;  4IP1 A;  1BYE A;  2HSM A;  5ID2 B;  4PUA A;  2DML A;  2H71 A;  1OYJ A;  2YOI A;  1BQ7 A;  1GSS A;  4MF5 A;  3HVX A;  3ZML A;  1ST9 A;  5KN0 A;  2L6C A;  2F51 A;  3KEB A;  5GAN D;  1TK5 B;  2K6V A;  1N2A A;  1J08 A;  2H30 A;  4DSQ A;  2J9H A;  4MK3 A;  3LSZ A;  3APQ A;  1MTC A;  2QA2 A;  1LJR A;  1ZOF A;  4AKG A;  2R2J A;  5BRT A;  4KDY A;  2YWO A;  2HSH A;  5CO3 A;  1ZYQ B;  2VIM A;  3M9J A;  2VD1 A;  1B48 A;  3F63 A;  3ZLP A;  2CAQ A;  5D9X A;  3IBH A;  5DAK A;  1URM A;  3TRP A;  5ECP B;  4ID0 A;  4X4J A;  4P3Y B;  4AF2 A;  5IMF A;  3C71 A;  1GLP A;  2YCD A;  4NV5 A;  1R5A A;  1Z7P A;  3OR5 A;  4NAX A;  3UIW A;  2VM1 A;  4ZB9 A;  2LTK A;  4PX1 A;  2GZZ A;  2LS5 A;  3F4R A;  3WGD A;  3M0F A;  5AIV A;  2B3S A;  4JU5 A;  2L4C A;  5CYY A;  20GS A;  1SL2 B;  2GS3 A;  1R26 A;  4WF5 A;  2HSY A;  2WDU A;  2KUC A;  4ICY A;  2WCI A;  3O3T A;  5CRW A;  3ZTL A;  1ML6 A;  3DWV A;  4L5L A;  5IMD A;  5ELA A;  4AGS A;  3LEF A;  5ECS A;  4QL7 A;  3HKR A;  1WWJ A;  9GSS A;  1R5P A;  2FD3 A;  3TUE A;  5KEJ A;  5G5F A;  3TKP A;  5JWQ B;  5IO0 A;  4EXJ A;  5ABR A;  6GSS A;  3KCM A;  4O32 A;  1GSQ A;  3FK8 A;  1HNC A;  4NHW A;  1OC3 A;  1SKR B;  1YQ1 A;  2O85 A;  4ZB8 A;  3P8W A;  2HZE B;  3P2A A;  3GST A;  2E2G A;  2FCH A;  4AJ8 A;  1EZK A;  4J57 E;  2VL2 C;  3ME8 A;  5B8A A;  2G2Q A;  3H1N A;  3GKM A;  2JSY A;  1SJZ A;  4HQZ A;  4G0I A;  4NPB A;  2LNT A;  3FHK A;  3F9U A;  3Q18 A;  2H1B A;  2L59 A;  4GDF A;  1G7E A;  4WEY A;  3VWU A;  2VCW A;  3LXZ A;  5A4U A;  1ZYE A;  1A8L A;  1SU9 A;  2X8G A;  5CRG A;  5HFI A;  1IYI A;  2BJX A;  2MZC A;  3RPP A;  1ILO A;  4NV2 A;  1TTZ A;  3US3 A;  1PA3 A;  1OC9 B;  4OMV A;  4GST A;  4MMM A;  4HUA A;  3M1G A;  2I4A A;  2GLR A;  2OE1 A;  4XS6 A;  3RPN A;  3VPT A;  1EV9 A;  4RQR A;  1EGO A;  1S3D A;  3HMJ G;  4TKY A;  4TRX A;  2IWT A;  2E2M A;  5CRH A;  5HFK A;  2OAC A;  2KP2 A;  2LRT A;  1FB6 A;  4KF9 A;  2H0H A;  4WR5 A;  4KCE A;  1NSW A;  4WET A;  4ZIL A;  1F2E A;  3H4K A;  1SK0 A;  4MH2 A;  1ZYN A;  5HR0 A;  2R6K A;  5DQS A;  3DXB A;  4TR1 A;  1WPI A;  4QMK A;  1XIY A;  2AAW A;  1OE7 A;  3W8J A;  1KEB A;  1FB0 A;  4JR6 A;  5IO2 A;  2KLX A;  4XRD A;  4ZXG A;  1EP8 A;  2VLT A;  3P7X A;  4HQS A;  4X1U A;  4F2I A;  2IMF A;  4K5R A;  7GSS A;  3KP9 A;  5A4V A;  2L5L A;  1F37 A;  2HRK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...