2N5FA

Solution structure of the dehydroascorbate reductase 3a from populus trichocarpa
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
212
structure length
212
Chain Sequence
MALEICVKAAVGAPNILGDCPFCQRVLLSLEEKKIPYKSHLINLGDKPQWFLEISPEGKVPVVKIDDKWVADSDVIVGILEEKNPEPPLATPPEFASVGSKIFPSFVKFLKSKDPNDGTEQALLEELKALDGHLKVHGPFIAGEKITAVDLSLAPKLYHLEVALGHFKNWPIPDNLTHVLNYIKLLFSRESFKKTRAAEEHVIAGWEPKVNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dehydroascorbate reductase family protein
publication title Insights into ascorbate regeneration in plants: investigating the redox and structural properties of dehydroascorbate reductases from Populus trichocarpa.
pubmed doi rcsb
source organism Populus trichocarpa
molecule tags Oxidoreductase
total genus 55
structure length 212
sequence length 212
ec nomenclature ec 1.8.5.1: Glutathione dehydrogenase (ascorbate).
pdb deposition date 2015-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2n5fA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2n5fA01
1GSFA 3TJBA 1GTUA 3FW2A 1J9BA 3WT1A 4TRXA 3EINA 3RHBA 3KH9A 1AQXA 2HFDA 1FB6A 1A2JA 4KAEA 2C1YA 4ZXGA 4FYBA 5ECOB 3G7JA 2YV7A 1Z6NA 4ECJA 2O87A 4ACSA 4F03A 1NW2A 3CRUA 5ECKB 3IAS2 4GF0A 1XOAA 5B6NA 2R2JA 1V40A 2AB6A 4MLYA 2LQQA 3H8QA 4TR3A 3L9UA 1THXA 3F0IA 5DQYA 2F51A 3QAWA 5HFGA 2E2GA 2V2GA 2RIIA 2PGTA 4OFTA 4PQHA 2HQTA 5ENUA 2JACA 16GSA 3TJJA 2OBKA 1JZRA 2L5LA 2M46A 3GL5A 2IMFA 2Z9SA 1A2MA 1HNCA 4O5RA 5J41A 4EDYA 3JCML 3P7XA 5HQPA 4IW9A 1WMJA 2H74A 4TXVA 5KN1A 2KHPA 4I2TA 2DJ1A 3M9KA 4WBJA 2VL2C 1K0DA 4NXIA 4JR4A 5HFKA 6GSTA 5A4UA 4V1Ag 1Y6EA 2J9HA 1QXHA 2DC5A 4O92A 4ZB9A 4IBPA 1LU4A 3WT2A 1ERVA 3HA9A 4XS4B 4BWSA 5IOWA 6GSXA 2GGTA 2GSRA 2LJKA 4K0GA 4XRAA 2GSTA 4MH3A 2VM2A 2YWOA 4WR4A 2B3SA 1ZL9A 3DYRA 3FKFA 5IMZA 2HRAA 3GMFA 19GSA 2VCQA 3IC4A 3UVTA 2YWNA 4MJBA 5FT3A 3QDNA 4WKWA 1GSUA 4ZBAA 2PWJA 1TOFA 4TR1B 3L9VA 3MNGA 5B7CA 3V1WA 1K0AA 3GH6A 3DEXA 5H5RA 3GUSA 5LNKe 2XPEA 2VL3A 1GTAA 5LD0A 5ECIB 4EVMA 1O7UA 1URMA 5E59A 1GSSA 2V6KA 2YJ7A 1O6JA 3GSTA 3VWUA 4K9ZA 2VCTA 1MDIA 3MSZA 4P3YB 1T1VA 1R26A 1VF4A 1V58A 3VPQA 2R37A 4BVXA 2TIRA 5HFIA 5ECSA 4G0IA 3VLNA 3CSHA 3P90A 1TI3A 3KMNA 4MH2A 1GUHA 4NV2A 3E9JB 1K3OA 5D9WA 3RPNA 4KH7A 4GXZA 2WRTA 1GSDA 2GLRA 3F8UA 2LRCA 1EGOA 1PSQA 1MD4A 5J4UA 4Q5RA 2EIQA 2MZCA 4DSSB 1YY7A 5F8BA 4Z7XA 1Z5YE 4XIHA 2MBTA 3RPPA 1SL1B 4F9ZA 2OA7A 4F2IA 1V2AA 4K8MA 3M1GA 1O73A 1H4OA 2H66A 2MMOA 3TKSA 4KCEA 4LMVA 2O8VB 5BMUA 1PD21 1QFNA 1YJ6A 3GKMA 4GSNA 3IV4A 1Z6MA 4J2FA 3KP8A 4L8EA 1UN2A 3GURA 1AW9A 4L5LA 4J56E 5JCGA 4OO4A 5FWGA 3H1NA 1ERUA 4PX1A 2CZ3A 4ILFA 1R4WA 2IPAA 3LJRA 4G0KA 3I9V2 3IR4A 3LYPA 2AHEA 2OACA 8GSSA 3IXRA 4X1UA 4MF5A 2B1LA 1PA3A 3QAVA 5F0GA 5AIVA 1EEJA 5DDLA 4KW6A 3EU4A 1SU9A 3I69A 3ZMLA 1BYEA 4DEJA 2ON7A 1T7PB 1EV9A 3QPMA 2MYGA 1EZKA 4EDZA 1XXUA 4TN8A 2ALBA 1B8XA 4G9HA 5F06A 2I3YA 3TRQA 1R5AA 3F4RA 1CQHA 2L4QA 4POKA 1H75A 3TOUA 2HSMA 1A23A 4MZCA 2PVOC 3L9SA 5EPFA 2WJUA 3GV1A 6GSWA 2WCIA 2XBIA 4MA9A 2O89A 3QOUA 4FIWA 2LJAA 2HRFA 5J5NA 1X9MB 2CVKA 3FZ4A 1SKSB 5DJMA 5ABRA 4BPYA 2AUVA 1M2BA 5ID2A 1SL2B 4PUFC 1J0FA 3BCKA 1SJZA 3R3EA 4DSRA 4NV5A 4ZBBA 4HU7A 3ZLPA 1JLVA 1T3BA 2OKAA 3FR6A 4N11A 5FHIA 3ZMKA 2IJYA 10GSA 2CX3A 3HVVA 2LV3A 2CVDA 3DXBA 5DAKA 2LTKA 3LEFA 1U3AA 4OWYA 1SK1A 2HT9A 4OO5A 1TK8B 2F8FA 3VWWA 4KGIA 4BVXB 5CP1A 3CYNA 2VCXA 4L0WA 1GNWA 4KF9A 3E3EA 2DJ2A 2GSQA 2K6VA 4OFNA 1T00A 3O6TA 1YKAA 2OBIA 4GQCA 3D4TA 3TJGA 3TJFA 1I9DA 2H6YA 5GAND 1GSQA 2VL9A 5DBQA 2GZYA 2G0FA 2OE1A 3KGKA 3DVXA 3L0HA 5IPHA 2GDRA 4K7IA 3FK8A 1C72A 1UVZA 1MDKA 1NM3A 1SENA 1Z3EA 5G30A 2GTUA 1E6BA 3R2QA 3D22A 3GSSA 3LORA 4GSSA 4AF2A 3I43A 4HDEA 4I2UA 3J7Yb 2WULA 2BMXA 1M7TA 5D93A 2H01A 4MZBA 5COHA 3KTBA 3EE2A 4MABA 1K0MA 4PQ1A 2K9FA 1SKWB 1FAAA 1PX7A 1EOHA 2HSHA 2QSIA 1F9MA 1PX6A 1QK8A 2L5OA 1E2YA 1O8XA 4XCSA 1FW1A 3D5JA 4FQUA 5IM9A 2R6KA 22GSA 9GSSA 4IP6A 3TDGA 17GSA 1ON4A 2H71A 3UOMA 3D0ZA 3K8NA 3GKXA 2P5RA 4CW9A 1SK0A 4IQAA 3IK9A 3ZIJA 1OYJA 3IDVA 1PN9A 1BEDA 2HSYA 3GNJA 2DIYA 3H4KA 4TKYA 4F0CA 1X9WB 3UVHA 2IMDA 4AJ8A 1QUWA 3IRAA 3VPTA 3KMOA 1GL8A 2HSMB 2EC4A 2HRNA 1TJDA 4O7HA 20GSA 3TCOA 2D2ZA 2AV4A 4OCFA 5CNWA 3CSIA 4E8EA 2PUKC 1XBSA 2CA8A 3G7IA 4KCAA 5ID2B 2C0GA 1EP8A 2H76A 3TRPA 2IMIA 1EP7A 2C0DA 4IQ1A 1S3DA 3GX8A 1TRSA 1KNGA 3BJ5A 4HU9A 3ZIVA 2FGXA 1TRVA 1GRXA 4V1Ap 2TRXA 1FOVA 1S3CA 3N5OA 2CAQA 2VLVA 5DAKB 5A5KA 3A5WA 3UMAA 4G10A 3UBLA 4J57E 3I6AA 3WGXA 3HVSA 3G9BA 1XWKA 3NIVA 1OC8A 3F63A 2RLIA 1TW9A 2M72A 3PR8A 5CYYA 3VI5A 1QMVA 4N30A 3HHVA 3ZRDA 4YQUA 1M99A 1MEKA 2YWMA 4MF7A 5ECNB 2GQMA 2X8GA 3LGCA 5D9TA 3W6GA 1TKDB 4HS1A 3HCZA 4L0UA 2GZPA 1X9SB 1T4YA 3IHQA 2DLXA 2DJKA 2DMMA 1LJRA 4EXJA 6GSSA 2FWHA 3IK7A 3M0FA 1ERWA 1TTZA 2FA8A 4PURA 4TW5A 5IMVA 1A8LA 1F3AA 1G6YA 3QD9A 5AN1A 4KA0A 3TJKA 2GSSA 2DIZA 2X8CA 4O32A 2N5AA 2NPBA 2H70A 1BQ7A 2L4CA 3M9JA 2LRNA 4MPGA 1SYRA 3MAKA 2I1UA 1ZZYA 1Z9HA 2H1BA 2VL2A 3HJPA 1Z7PA 1XW6A 4YAPA 3F6DA 3EU3A 2QKEA 4ML1A 1U88A 5ECQB 2H73A 1BJXA 4XS1A 4HOJA 2LS5A 3CXGA 4FH8A 3C71A 4GTUA 2A2SA 3ZREA 3F4TA 3VWVA 1SK2A 1JLWA 1N8JA 3HZ8A 4MJAA 4EE0A 1HNAA 2IL3A 3GTUA 2GQKA 2FWEA 4NMUA 1B48A 1M9BA 2GS3A 5IMDA 1M0UA 4ML6A 1OAZA 4PQIA 1YZXA 3H79A 2GT5A 2E2MA 1T4ZA 2FCHA 4K1FA 1KBNA 4L5OA 1XPVA 3HKRA 4USSA 1TK0B 5HR3A 3DKSA 4HI7A 3A2XA 2C3TA 2LKUA 1FO5A 3RDWA 2H1AA 2C0EA 3HXSA 3PINA 2LSTA 4RQRA 1VF1A 5IMCA 4G0LA 1JHBA 5IIZA 1ILOA 5DVBA 5INYA 2FA4A 5G31A 3D6IA 3MWHA 1WRYA 2L6DA 5ELAA 2B6MA 4F82A 1UA5A 4KDYA 3KD0A 2DJ0A 1ZGNA 5CRWA 3FZ5A 2CZ2A 1M9AA 1N2AA 2CQ9A 4PXOA 3F4SA 3GFKA 1O81A 3SBCA 4ZL7A 2A2RA 2HZEB 3ZFBA 1A2LA 2FHEA 3MDKA 3CSJA 5CAXA 1OKDA 1JZDA 3QR6A 5ECRB 1TU8A 2HZFA 3AY8A 1NHOA 4MPFA 2ES7A 3F6FA 1V57A 5EVOA 1DE1A 2PERA 3VI7A 3UARA 4G2EA 3RBTA 4I97A 5EY6A 1TXXA 1ACVA 1GLPA 2P31A 5DQSA 5KEJA 2CV4A 4AJ7A 1X5CA 1HD2A 3ZVJD 2L59A 3BD2A 1XW9A 1TI1A 4ECIA 1AXDA 4ZBDA 4GSTA 6GSUA 5F07A 2YWIA 4XHMA 2B5YA 2H72A 4MP4A 5CREA 2NDOA 1GTIA 4HJ2A 2HYXA 1NSWA 13GSA 2DJJA 4POMA 2VLUA 4KNDA 3P2AA 2REMA 4MCUA 2H6XA 4IJIA 4CDOA 2X64A 2IMKA 2YJHA 3UEMA 4NPBA 1BG5A 3TKRA 3HJOA 3ERWA 2VM1A 4MJCA 4MJEA 1M2DA 4HQSA 2JL4A 2F8AA 3FZAA 1GUMA 2XC2A 2CAIA 3WD6A 1G0TA 1SYXA 3C7MA 3DMLA 2K8SA 5D96A 4EL1A 3DD3A 2EIOA 3PPUA 3EURA 2CVBA 4BVYA 2A4VA 1XWCA 2VIMA 5G2ZA 4QQ7A 1SD8A 5KN3A 4YAVA 2KP2A 3IBHA 5L71A 2VCZA 1K0OA 3HY2A 4ZB6A 1DBYA 3GTUB 3GHAA 4YQVA 4WBRD 2KOKA 3QCPA 4Q5NA 5AIXA 1YEXA 3IE3A 2N5FA 2JZRA 2BTOT 1XFLA 3A3TA 2C80A 3GH9A 1F3BA 5HR2A 2N5BA 2VAFA 3ME7A 1FVJA 2YANA 2O85A 4JU5A 1ML6A 4K0NA 1X5EA 3TUEA 2JZSA 1FG4A 4EUYA 2FWFA 2H1GA 5KN0A 1AQVA 3BCIA 2HSNB 4POLA 1JFUA 1RK4A 3ZITA 3GX0A 3UIWA 2RUEA 4V2MA 3VWXA 4FYCA 3GL3A 5B6MA 3U5RE 3A2VA 2LEGA 2GVPA 3ERFA 4JEDA 3SWLA 4E8HA 2DMLA 2HLSA 3GKNA 2B5EA 1B4PA 2WZ9A 3F3QA 4WETA 1IYIA 1YF1A 2KUCA 3OR5A 1Q98A 5G5FA 3TOTA 2HRKA 1X0RA 4X43A 2PPTA 3QFAC 4PUAA 1R7HA 1A0RP 2G2QA 4DVCA 6GSYA 1EOGA 1G7OA 4GLTA 3W8JA 1MTCA 4ECCA 4FO5A 1TDIA 1GSYA 4RI7A 3ZTLA 3LYKA 4F0BA 2UZ8A 2IFQA 3IC8A 3KCMA 5DALA 3FRCA 4KSMA 4OCEA 2LNSA 3HZ4A 4XTSA 1SKRB 2LRTA 5IO2A 3UBKA 1PKZA 2B5XA 4I8BA 2V6OA 2OJLA 3S9FA 2H75A 2FY6A 4GWRA 1FHEA 1GNEA 1K3YA 1Z7RA 5C00A 4EF0A 4LL1B 5HR0A 3QFBC 1O8WA 3U6VA 2H6ZA 3EWLA 4KB3A 3QAGA 1WP0A 2NTOA 2QGVA 1DE2A 1U3IA 2F3MA 5GSSA 3EVIA 2ON5A 2B7KA 3FHKA 4D73A 3C8EA 1K3LA 2X8HA 2RM6A 1FB0A 5J3RA 3CMIA 2PU9C 2CT6A 4POBA 1A24A 4WEYA 2FLSA 2YN1A 1THOA 4MMMA 1A0FA 2YP6A 1AAZA 5IMAA 5JWQB 2VUPA 1SJ6A 1ZMAA 4MDCA 4RUVA 1PKWA 4JR6A 1PL1A 2JZTA 1TP9A 1VF2A 5DCHA 4WR5A 2HZEA 4WXTA 3WGEA 2KLXA 1XCCA 2K8VA 1EV4A 3LWAA 5ECMB 4AGSA 1KEBA 4EC0A 3ISOA 3KM6A 3D4MA 4IHUA 4I5QA 4BVYB 1HNBA 3KZQA 4WF4A 4YQMA 3TB2A 1OC9A 3EC3A 4HUAA 4AJ6A 4KUNA 5IPGA 2RUFA 3KJYA 3L4NA 1AQWA 3LQ7A 1V98A 12GSA 4PTSA 4HJMA 1YQ1A 1TU7A 3IPZA 1TRWA 1WOUA 3LXTA 3BOAA 3RHCA 2M80A 1VRSD 2I81A 3KTLA 1SJIA 4EKZA 5JWOB 14GSA 2LUSA 3GIXA 4CHSA 2I4AA 5LCZA 1QQ2A 2NVLA 5GZZB 4K2DA 2VCWA 5JCUA 3W8SA 1BX9A 1K0NA 3P8WA 4NAXA 2LJRA 5CRGA 1F37A 3ZVJA 3NZNA 4OMVA 3APSA 4ECBA 3TKSE 2XBQA 2H0IA 5ELGA 2HNLA 4BL7A 2I9HA 3E0UA 2JU5A 3WGDA 5CO3A 1S3AA 2VLTA 1JZOA 5GAPD 4K6XA 4GCIA 3APOA 2CX4A 2MBSA 1MD3A 1G7EA 4H86A 4ZIJA 4JRRA 1HQOA 2LNTA 2HRKB 3N9JA 5J9BA 2H19A 2V41A 5G1KA 4OFMA 1TK5B 4BWQA 1F2EA 5H5SA 3EMPA 3KIJA 3NOFA 2HI7A 3UJ1A 2AJQB 3L78A 4IKHA 4KDUA 4V2LA 3ME8A 3UL3A 1WJKA 2H1DA 4NWYA 2IFQB 2C3NA 5DALB 1USBA 2EIRA 4JE1A 1AC1A 1WE0A 5D9VA 1A8YA 2V1MA 4LL4B 3O3TA 5IO0A 3TKSC 1ZOFA 2WDUA 4V2NA 2LQOA 1MDJA 1VF3A 1O85A 4LLRA 1XVQA 1EEMA 1WPIA 2AYTA 3DWVA 5ECPB 3FR3A 2VD1A 3H93A 5JCWA 4GRFA 5KN2A 1J08A 1RQMA 2PVQA 5CRDA 3ED3A 5G1LA 1K0CA 4TXOA 2RM5A 2JSZA 1AUCA 1DUGA 4IELA 3C73A 1VGLA 3KEBA 2J23A 2PBJA 1F6MC 4BA7A 3BBYA 4D73B 3FR9A 1YF0A 4MZWA 5G5EA 3ZZXA 1XWBA 1ZYEA 1GUKA 4IGJA 4WF5A 1GH2A 2C4JA 1KTEA 3EYTA 2YZUA 2WS2A 5ECHB 3PGTA 3J7Yk 2HE3A 2HXKA 3GA4A 3TKQA 3C1SA 2P0GA 4Q5FA 2V32A 4Q5QA 4KX4A 3O76A 3IOSA 5CRHA 3Q19A 3KP9A 2ZNMA 3GRXA 3A2WA 4QL7A 1GWCA 5F05A 1ERTA 3CTGA 4MK3A 2PN8A 1T8EB 1Y25A 1FVKA 4RQXA 4GQFA 2YV9A 3CRTA 2H0HA 3APQA 7GSSA 1OC9B 2FNOA 4KDXA 3HJMA 1XVWA 3DRNA 2L57A 4YH2A 3LG6A 1GULA 5EL8A 2OE0A 3GN3A 2H0GA 1W4VA 4LMWA 1XZOA 4JZQA 4TR0A 4QL9A 5DCGA 2WFCA 3QMXA 3Q74A 3HD5A 4EO3A 1SD9A 3DIEA 3VK9A 5HR1A 1B9XC 2P5QA 2K18A 1BAYA 1CQGA 4K7NA 2R4VA 5IQYA 3FY7A 3C1RA 1OE8A 2FWGA 1RW1A 3F9UA 1PL2A 2VO4A 3Q18A 4IP1A 2O7KA 2JADA 1W89A 2H8LA 2FUG2 2DSAA 1DSBA 2R3XA 5A4WA 4IN0A 2IMEA 2XPDA 4BL7B 1M2AA 1U87A 3LSZA 4HZ4A 1XWAA 5A4VA 1ZCPA 1K0BA 1XIYA 4G19A 4PNFA 3IA1A 2L6CA 4RI6A 11GSA 3ZYWA 1GLQA 5IOXA 1NHYA 1WWJA 3KXOA 2ZCTA 2B1KA 1GSEA 4PNGA 2MMAA 4N0VA 1U6TA 4LA1A 1WIKA 4KSOA 1PQNA 1OVNA 1GTBA 5D9XA 2YPMA 3VFIA 6GSVA 5IMFA 4TVEA 4K7OA 1ST9A 2H30A 3LXZA 3FYGA 2KP1A 4DSQA 5AISA 1UC7A 3DGQA 2VOCA 3D21A 2TRCP 2X99A 1EWXA 1PMTA 4ZL9A 2YCDA 2WB9A 4KE3A 3FZ9A 2YNXA 2DJ3A 2DBCA 1YKCA 2BJXA 2MMZA 2VCVA 2PMTA 1OKTA 4TXOB 4ISDA 3EMXA 1PGTA 4IVFA 5D73A 1YEPA 2YOIA 3F3RA 2E7PA 4TOPA 3IAM2 2IIYA 1TRUA 4ZL8A 3FEUA 2GZZA 5B8AA 1G6WA 5E4WA 2JSYA 3HDCA 1B4QA 3WYWA 2XHFA 3DVWA 4XS4A 2OE3A 5J9CA 2MMNA 4N10A 3TGZA 1XOBA 2C8UA 1X5DA 4TR4A 4HQZA 4IS0A 4X0XA 1ZYQB 2VD0A 3ERGA 4PGTA 2GQLA 2IN3A 3GYKA 1R5PA 3PH9A 4JBBA 1OC3A 3ZL5A 4N0ZA 2R5GA 5B8BA 4HEA2 5GSTA 2IWTA 2C3QA 3RAZA 1XWGA 2QC7A 4TR1A 18GSA 1YDKA 5C04A 3HVXA 5H5QA 3ZFLA 3VURA 3LFLA 2NBSA 4ZILA 5D8IA 1EGRA 3CBUA 2WGRA 3TRXA 3US3A 3M3MA 2E0QA 3HYPA 4IJ3A 2B7JA 3G7YA 2GT6A 4XRDA 1OE7A 1QGVA 2ZUPA 4ID0A 5DJLA 2OADA 3Q6OA 4FYUA 4ULXA 5JWRB 3TKPA 2FD3A 1PRXA 1SL0B 1ABAA 4MF6A 1IYHA 2F9SA 1GP1A 3GKKA 4I6XA 1LBKA 3M8NA 1XW5A 5ECLB 1Q4JA 2YZHA 4NHZA 1V9WA 1B9YC 1AIUA 1JZWA 4ZB8A 3CTFA 4OD7A 2AAWA 1I5GA 4HZ2A 3UAPA 4NHWA 4DSSA 5AGYA 4XS6A 3KH7A 1HYUA 2C0FA
chains in the Genus database with same CATH superfamily
1GSFA 3TJBA 1GTUA 3FW2A 1J9BA 3WT1A 4TRXA 3EINA 3RHBA 3KH9A 1AQXA 2HFDA 4GDFA 1FB6A 1A2JA 4KAEA 2C1YA 4ZXGA 4EIQA 2X4AA 4FYBA 2DKIA 3MYDA 5ECOB 3G7JA 2YV7A 1Z6NA 4ECJA 2O87A 4ACSA 4F03A 1NW2A 3CRUA 5ECKB 3IAS2 4GF0A 1XOAA 5B6NA 2R2JA 1V40A 2AB6A 4MLYA 2LQQA 1SVOA 3H8QA 4TR3A 3L9UA 1THXA 3F0IA 5DQYA 4G01A 2F51A 3QAWA 4ZB7A 5HFGA 2E2GA 2V2GA 2RIIA 2PGTA 4OFTA 4PQHA 2HQTA 5ENUA 2JACA 16GSA 3TJJA 2OBKA 1JZRA 2L5LA 2M46A 3GL5A 2IMFA 2Z9SA 1A2MA 1HNCA 4O5RA 5J41A 4EDYA 3JCML 1ZYPA 3P7XA 5HQPA 4IW9A 1WMJA 2H74A 1YVLA 4TXVA 5KN1A 2KHPA 4I2TA 2DJ1A 3M9KA 4WBJA 2VL2C 1K0DA 4NXIA 4JR4A 5HFKA 6GSTA 5A4UA 1XG8A 4V1Ag 1Y6EA 2J9HA 1QXHA 2DC5A 4O92A 4ZB9A 4IBPA 1LU4A 3WT2A 1ERVA 3HA9A 4XS4B 4BWSA 5IOWA 6GSXA 2GGTA 2GSRA 3RGBC 2LJKA 4K0GA 4XRAA 2GSTA 4MH3A 2VM2A 2YWOA 4WR4A 2B3SA 1ZL9A 3DYRA 3FKFA 5IMZA 2HRAA 3GMFA 19GSA 2VCQA 3IC4A 3UVTA 2YWNA 4MJBA 5FT3A 3QDNA 4WKWA 1GSUA 4ZBAA 2PWJA 1TOFA 4TR1B 3L9VA 3MNGA 5B7CA 3V1WA 1K0AA 3GH6A 3DEXA 5H5RA 3GUSA 5LNKe 2XPEA 2VL3A 1GTAA 5LD0A 5ECIB 4EVMA 1O7UA 1URMA 5E59A 1GSSA 2V6KA 2YJ7A 1O6JA 3GSTA 3VWUA 4K9ZA 2VCTA 1MDIA 3MSZA 4P3YB 1T1VA 1R26A 1VF4A 1V58A 3VPQA 2R37A 4BVXA 2TIRA 5HFIA 5ECSA 4G0IA 3VLNA 3CSHA 3P90A 1TI3A 3KMNA 4MH2A 1GUHA 4NV2A 3E9JB 1K3OA 5D9WA 3RPNA 4KH7A 4GXZA 2WRTA 1GSDA 2GLRA 3F8UA 2LRCA 1EGOA 1PSQA 1MD4A 5J4UA 4Q5RA 2EIQA 2MZCA 2WW1A 4DSSB 1YY7A 5F8BA 4Z7XA 1Z5YE 4XIHA 2MBTA 3RPPA 3EPTA 1SL1B 4F9ZA 2OA7A 4F2IA 1V2AA 4K8MA 3M1GA 1O73A 1H4OA 2H66A 2MMOA 3TKSA 2EFEA 4KCEA 4LMVA 2O8VB 5BMUA 1PD21 1QFNA 4MNNA 1YJ6A 3GKMA 4GSNA 3IV4A 1Z6MA 4J2FA 3KP8A 4L8EA 1UN2A 3GURA 1AW9A 4L5LA 4J56E 5JCGA 4OO4A 5FWGA 3H1NA 1ERUA 4PX1A 2CZ3A 4ILFA 1R4WA 2IPAA 1TXUA 3LJRA 4G0KA 3I9V2 1I1IP 3IR4A 3LYPA 2AHEA 2OACA 8GSSA 2R0GA 3IXRA 4X1UA 5J47A 4MF5A 2B1LA 1PA3A 3QAVA 5F0GA 5AIVA 1EEJA 5DDLA 4KW6A 3EU4A 1SU9A 3I69A 3ZMLA 1BYEA 4DEJA 2ON7A 1T7PB 1EV9A 3QPMA 3RFRC 2MYGA 1EZKA 4PI0C 4EDZA 1XXUA 4TN8A 2ALBA 1B8XA 4G9HA 5F06A 2I3YA 3TRQA 1R5AA 3F4RA 1CQHA 2L4QA 4POKA 1H75A 3TOUA 2HSMA 1A23A 4HSCX 4W66A 4MZCA 4AKXB 2QA1A 2PVOC 3L9SA 5EPFA 2WJUA 3GV1A 4QMKA 6GSWA 2WCIA 2QA2A 2XBIA 4MA9A 2O89A 3QOUA 4FIWA 2LJAA 2HRFA 5J5NA 1X9MB 2CVKA 3FZ4A 1SKSB 5DJMA 5ABRA 4BPYA 2AUVA 1M2BA 5ID2A 1SL2B 4PUFC 1J0FA 3BCKA 1SJZA 3R3EA 4DSRA 4NV5A 4ZBBA 4HU7A 3ZLPA 1JLVA 1T3BA 2OKAA 3FR6A 4N11A 5FHIA 3ZMKA 2WW3A 2IJYA 10GSA 2CX3A 3HVVA 2LV3A 2CVDA 3DXBA 5DAKA 1BF5A 4K5SA 2LTKA 3LEFA 1U3AA 4OWYA 1SK1A 2HT9A 4OO5A 1TK8B 2F8FA 3VWWA 4KGIA 4BVXB 5CP1A 3CYNA 2VCXA 4L0WA 1GNWA 4KF9A 3E3EA 2DJ2A 2GSQA 2K6VA 4OFNA 1T00A 3O6TA 1YKAA 2OBIA 4GQCA 3D4TA 3TJGA 3TJFA 3MIXA 1I9DA 2H6YA 5GAND 1GSQA 2VL9A 5DBQA 2GZYA 2G0FA 2OE1A 3KGKA 3DVXA 3L0HA 5IPHA 2GDRA 4K7IA 3FK8A 1C72A 1UVZA 1MDKA 1NM3A 1SENA 1Z3EA 5G30A 2GTUA 5KOXA 1E6BA 3R2QA 3D22A 5BMUB 3GSSA 3LORA 4GSSA 4AF2A 3I43A 4HDEA 4I2UA 3J7Yb 2WULA 2BMXA 1M7TA 5D93A 2H01A 4MZBA 5COHA 3KTBA 3EE2A 4MABA 1K0MA 4PQ1A 2K9FA 1SKWB 1FAAA 1PX7A 1EOHA 2HSHA 2QSIA 1S4BP 1F9MA 1PX6A 2O36A 1QK8A 2L5OA 1E2YA 1O8XA 4XCSA 1FW1A 3D5JA 4FQUA 4CY8A 5IM9A 2R6KA 22GSA 9GSSA 4IP6A 3TDGA 17GSA 1ON4A 2H71A 3UOMA 3D0ZA 4AKGA 3K8NA 3GKXA 2P5RA 4CW9A 2WW2A 1SK0A 4IQAA 3IK9A 3ZIJA 1OYJA 3IDVA 1PN9A 1BEDA 2HSYA 3GNJA 2DIYA 3H4KA 4TKYA 4F0CA 1X9WB 3UVHA 2IMDA 4AJ8A 1QUWA 3IRAA 3VPTA 3KMOA 2DKHA 1GL8A 2HSMB 2EC4A 2HRNA 1TJDA 4O7HA 20GSA 3TCOA 2D2ZA 2AV4A 4OCFA 5CNWA 2O5VA 3CSIA 4E8EA 2PUKC 1XBSA 2CA8A 3G7IA 4Z2RA 4KCAA 5ID2B 2C0GA 1EP8A 2H76A 3TRPA 2IMIA 1EP7A 2C0DA 4IQ1A 1S3DA 3GX8A 1TRSA 1KNGA 3BJ5A 4HU9A 3ZIVA 2FGXA 1TRVA 1GRXA 4V1Ap 2TRXA 1FOVA 3LW9A 1S3CA 3N5OA 2EFHA 2CAQA 2VLVA 5DAKB 5A5KA 3A5WA 3UMAA 4G10A 3UBLA 4J57E 3I6AA 3WGXA 3HVSA 4PI2C 3G9BA 3HMJG 1XWKA 3NIVA 1OC8A 3F63A 2RLIA 1TW9A 2M72A 3PR8A 1SVLA 4K5RA 5CYYA 4Z2UA 3VI5A 1QMVA 4N30A 3HHVA 5J4YA 3ZRDA 4YQUA 1M99A 1MEKA 2YWMA 4MF7A 5ECNB 2GQMA 2X8GA 3LGCA 5D9TA 3W6GA 1TKDB 4HS1A 3HCZA 4L0UA 2GZPA 1X9SB 1T4YA 3IHQA 1N25A 2DLXA 2DJKA 2DMMA 1LJRA 4EXJA 6GSSA 2FWHA 3IK7A 3M0FA 1ERWA 1TTZA 2FA8A 4PURA 4TW5A 5IMVA 1A8LA 1F3AA 1G6YA 3QD9A 5AN1A 4KA0A 3TJKA 2GSSA 2DIZA 1Y1UA 2X8CA 4O32A 2N5AA 2NPBA 2H70A 1BQ7A 2L4CA 3M9JA 2LRNA 4MPGA 1SYRA 3MAKA 2I1UA 1ZZYA 1Z9HA 2H1BA 2VL2A 3HJPA 1Z7PA 1XW6A 4YAPA 3F6DA 3EU3A 2QKEA 4ML1A 1U88A 5ECQB 2H73A 1BJXA 4XS1A 4HOJA 5J40A 1PN0A 2LS5A 3CXGA 4FH8A 3C71A 4GTUA 2A2SA 3ZREA 3F4TA 3VWVA 1SK2A 1JLWA 1N8JA 3HZ8A 1S3RA 4MJAA 4BIKA 4EE0A 1HNAA 2IL3A 3GTUA 2GQKA 5A34A 2FWEA 4NMUA 1B48A 1M9BA 2GS3A 5IMDA 1M0UA 4ML6A 1OAZA 4PQIA 1YZXA 3H79A 3IHGA 3TU3B 2GT5A 2E2MA 1T4ZA 2FCHA 4K1FA 1KBNA 4L5OA 1XPVA 3HKRA 4USSA 1TK0B 5HR3A 3DKSA 4HI7A 3A2XA 2C3TA 2HSNA 2LKUA 1FO5A 3RDWA 2H1AA 2C0EA 3HXSA 3PINA 2LSTA 4RQRA 1VF1A 5IMCA 4G0LA 1JHBA 5IIZA 1ILOA 5DVBA 4AI6A 5INYA 2FA4A 5G31A 3D6IA 3MWHA 1WRYA 2L6DA 5ELAA 2B6MA 4F82A 1UA5A 4KDYA 3KD0A 2DJ0A 1ZGNA 5CRWA 3FZ5A 2CZ2A 1M9AA 1N2AA 2CQ9A 4PXOA 3F4SA 3GFKA 4PHZC 1O81A 3SBCA 4ZL7A 2A2RA 2HZEB 3ZFBA 1A2LA 2FHEA 3MDKA 3CSJA 5CAXA 1OKDA 1JZDA 3QR6A 5ECRB 1TU8A 2HZFA 3AY8A 1NHOA 4MPFA 2ES7A 3F6FA 1V57A 5EVOA 1DE1A 2PERA 3VI7A 3UARA 4G2EA 3RBTA 4I97A 5EY6A 1TXXA 1ACVA 1GLPA 2P31A 5DQSA 2A2PA 5KEJA 2CV4A 4AJ7A 1YEWC 1X5CA 1HD2A 3ZVJD 2L59A 3BD2A 1XW9A 1TI1A 4ECIA 1AXDA 4ZBDA 4GSTA 6GSUA 5F07A 2YWIA 4XHMA 2B5YA 2H72A 4MP4A 5CREA 2NDOA 1GTIA 4HJ2A 2EFCA 2HYXA 1NSWA 13GSA 2DJJA 4POMA 2VLUA 3HVNA 4KNDA 3P2AA 2REMA 4MCUA 2H6XA 4IJIA 4CDOA 2X64A 2IMKA 2YJHA 3UEMA 4NPBA 1BG5A 3TKRA 3HJOA 3ERWA 5KOWA 2VM1A 4MJCA 4MJEA 1M2DA 4HQSA 2JL4A 2F8AA 3FZAA 2XC2A 1GUMA 2CAIA 3WD6A 1G0TA 1SYXA 4E68A 3C7MA 3DMLA 2K8SA 5D96A 4EL1A 3DD3A 2EIOA 3PPUA 1ZYNA 3EURA 2CVBA 4BVYA 2A4VA 1XWCA 2VIMA 5G2ZA 4QQ7A 1SD8A 5KN3A 4YAVA 2KP2A 3IBHA 5L71A 2VCZA 1K0OA 3HY2A 4ZB6A 1DBYA 3GTUB 3GHAA 5A34B 4YQVA 4WBRD 2KOKA 3QCPA 4Q5NA 5AIXA 1YEXA 3IE3A 2N5FA 2JZRA 2BTOT 1XFLA 5A1NA 3A3TA 2C80A 3GH9A 3CWGA 1F3BA 5HR2A 2N5BA 2VAFA 3ME7A 1FVJA 2YANA 2O85A 4JU5A 1ML6A 4K0NA 1X5EA 3TUEA 2JZSA 1FG4A 4EUYA 2FWFA 2H1GA 5KN0A 1AQVA 3BCIA 2HSNB 4POLA 1JFUA 1M3IA 1RK4A 3ZITA 3GX0A 3UIWA 2RUEA 4V2MA 2OT3A 3VWXA 2WVZA 4FYCA 4O5QA 3GL3A 5B6MA 2WVYA 3U5RE 3A2VA 2LEGA 2GVPA 3ERFA 4JEDA 3SWLA 4E8HA 2DMLA 2HLSA 3GKNA 2B5EA 1B4PA 2WZ9A 3F3QA 4WETA 1IYIA 1YF1A 2KUCA 3OR5A 4AKHA 1Q98A 5G5FA 3TOTA 2HRKA 1X0RA 4X43A 3A5IA 2PPTA 3QFAC 4PUAA 1R7HA 1A0RP 2G2QA 4DVCA 1BG1A 6GSYA 2H1LA 1EOGA 1G7OA 4GLTA 3W8JA 1MTCA 4ECCA 4FO5A 1TDIA 1GSYA 4RI7A 3ZTLA 3LYKA 4F0BA 2UZ8A 2IFQA 3IC8A 3KCMA 5DALA 3FRCA 4KSMA 4OCEA 2LNSA 3HZ4A 2X49A 3FMWA 4XTSA 1SKRB 2LRTA 5IO2A 3UBKA 1PKZA 2B5XA 4I8BA 2V6OA 2OJLA 3S9FA 2H75A 2FY6A 4GWRA 1FHEA 1GNEA 1K3YA 1Z7RA 5C00A 4EF0A 4LL1B 5HR0A 3QFBC 1O8WA 3U6VA 2H6ZA 3EWLA 4KB3A 3QAGA 1WP0A 2NTOA 2QGVA 1DE2A 1U3IA 2F3MA 5GSSA 3EVIA 2ON5A 4YKGA 2B7KA 4ICYA 3FHKA 4D73A 3C8EA 1K3LA 3CQFA 1SVMA 2O3EA 2X8HA 4CY6A 2RM6A 1FB0A 5J3RA 3CMIA 2PU9C 2CT6A 4POBA 1A24A 4WEYA 2FLSA 2YN1A 1THOA 4MMMA 1A0FA 2YP6A 1AAZA 5IMAA 5JWQB 2VUPA 1SJ6A 1ZMAA 4EIPA 4MDCA 4RUVA 1PKWA 4JR6A 1PL1A 2JZTA 1TP9A 1VF2A 5DCHA 4WR5A 2HZEA 4WXTA 2WZSA 3WGEA 2KLXA 1XCCA 2K8VA 1EV4A 3LWAA 5ECMB 4AGSA 1KEBA 4EC0A 3ISOA 3KM6A 3D4MA 4IHUA 4I5QA 4BVYB 1HNBA 3KZQA 4WF4A 4N3ZA 4YQMA 3TB2A 1OC9A 3EC3A 4HUAA 4AJ6A 4KUNA 4O5UA 5IPGA 2RUFA 3KJYA 3L4NA 1AQWA 3LQ7A 1V98A 12GSA 4PTSA 4HJMA 1YQ1A 1TU7A 3IPZA 1TRWA 1WOUA 5A1NB 3LXTA 3BOAA 3RHCA 2M80A 1VRSD 2I81A 3KTLA 1SJIA 4EKZA 2A4HA 5JWOB 14GSA 2LUSA 3GIXA 4CHSA 2I4AA 5LCZA 1QQ2A 2NVLA 5GZZB 4K2DA 2VCWA 5JCUA 3W8SA 1BX9A 1K0NA 3P8WA 4NAXA 2LJRA 5CRGA 1F37A 3ZVJA 3NZNA 4OMVA 3APSA 4ECBA 3TKSE 2XBQA 2H0IA 5ELGA 2HNLA 4BL7A 2I9HA 3E0UA 2JU5A 3WGDA 5CO3A 1S3AA 2VLTA 1JZOA 5GAPD 4K6XA 4GCIA 3APOA 2CX4A 2MBSA 1MD3A 1G7EA 4H86A 4ZIJA 4JRRA 1HQOA 2LNTA 2HRKB 3N9JA 5J9BA 2WVXA 4AKIA 2H19A 2V41A 5G1KA 4OFMA 1TK5B 4BWQA 1F2EA 5H5SA 3EMPA 3KIJA 3NOFA 2HI7A 3UJ1A 2AJQB 3L78A 4IKHA 4KDUA 4V2LA 3ME8A 3UL3A 1WJKA 2H1DA 4NWYA 2IFQB 2C3NA 5DALB 1USBA 2EIRA 4JE1A 1AC1A 1WE0A 5D9VA 1A8YA 2V1MA 4Z2TA 4LL4B 2VKZG 3O3TA 5IO0A 3TKSC 1ZOFA 5J4VA 2WDUA 4V2NA 2LQOA 1MDJA 1VF3A 1O85A 4LLRA 1XVQA 1EEMA 1WPIA 2AYTA 3DWVA 5ECPB 3FR3A 2VD1A 3H93A 5JCWA 4GRFA 5KN2A 1J08A 1RQMA 2PVQA 5CRDA 3ED3A 5G1LA 1K0CA 4TXOA 2RM5A 1FOHA 2UV8G 2JSZA 1AUCA 1DUGA 4IELA 3C73A 1VGLA 3KEBA 2J23A 2PBJA 1F6MC 4BA7A 3BBYA 4D73B 3FR9A 1YF0A 4MZWA 5G5EA 3ZZXA 1XWBA 1ZYEA 1GUKA 4IGJA 4WF5A 1GH2A 2C4JA 1KTEA 3EYTA 2YZUA 2WS2A 5ECHB 3PGTA 3J7Yk 2HE3A 2HXKA 3GA4A 3TKQA 3C1SA 2P0GA 4Q5FA 2V32A 4Q5QA 4KX4A 3O76A 3IOSA 5CRHA 3Q19A 3KP9A 2ZNMA 3GRXA 3A2WA 4X4JA 2WW0A 4QL7A 1GWCA 5F05A 1ERTA 3CTGA 4MK3A 2PN8A 1T8EB 1Y25A 1FVKA 4RQXA 5A5HA 4GQFA 2YV9A 3CRTA 2H0HA 3APQA 4A5PA 7GSSA 1OC9B 2FNOA 4KDXA 3HJMA 1XVWA 3DRNA 2L57A 4YH2A 2R0PA 3LG6A 1GULA 5EL8A 2OE0A 1M3JA 3GN3A 2R0CA 2H0GA 1W4VA 4LMWA 1XZOA 4JZQA 4TR0A 4QL9A 5DCGA 2WFCA 3QMXA 3Q74A 3HD5A 4EO3A 1SD9A 3DIEA 3VK9A 5HR1A 1B9XC 2P5QA 2K18A 1BAYA 1CQGA 4K7NA 2R4VA 5IQYA 3FY7A 3C1RA 1OE8A 2FWGA 1RW1A 3F9UA 1PL2A 2VO4A 3Q18A 4IP1A 2O7KA 2JADA 1W89A 2H8LA 2FUG2 2DSAA 1DSBA 2R3XA 5A4WA 4IN0A 2IMEA 2XPDA 4BL7B 2EFDA 1M2AA 1U87A 3LSZA 4HZ4A 1XWAA 5A4VA 1ZCPA 1K0BA 1XIYA 4G19A 4PNFA 3IA1A 2L6CA 4RI6A 11GSA 3ZYWA 1GLQA 5IOXA 1NHYA 1WWJA 2WVXB 3KXOA 2ZCTA 2B1KA 1GSEA 4PNGA 2MMAA 4N0VA 1U6TA 4LA1A 1WIKA 4KSOA 1PQNA 4K2XA 1OVNA 1GTBA 5D9XA 2YPMA 3VFIA 6GSVA 5IMFA 4TVEA 4K7OA 1ST9A 2H30A 3LXZA 3FYGA 2KP1A 4DSQA 5AISA 1UC7A 3DGQA 2VOCA 3D21A 2TRCP 2X99A 1EWXA 1PMTA 4ZL9A 2YCDA 2WB9A 4KE3A 3FZ9A 2YNXA 2DJ3A 2DBCA 1YKCA 2BJXA 2MMZA 2VCVA 2PMTA 1PFOA 1OKTA 4TXOB 5BRTA 4ISDA 3EMXA 1PGTA 4IVFA 5D73A 1YEPA 2YOIA 3F3RA 2E7PA 4TOPA 3IAM2 2IIYA 1TRUA 4ZL8A 3FEUA 2GZZA 5B8AA 1G6WA 5E4WA 2JSYA 3HDCA 1B4QA 3WYWA 2XHFA 3DVWA 4XS4A 2OE3A 5J9CA 2MMNA 4N10A 3TGZA 1XOBA 2C8UA 1X5DA 4TR4A 4HQZA 4IS0A 4X0XA 1ZYQB 2VD0A 3ERGA 4PGTA 2GQLA 2IN3A 3GYKA 1R5PA 3PH9A 4JBBA 1OC3A 3ZL5A 4N0ZA 2R5GA 5B8BA 4HEA2 5GSTA 2IWTA 2C3QA 3RAZA 1XWGA 2QC7A 4TR1A 18GSA 1YDKA 5C04A 3HVXA 5H5QA 3ZFLA 3VURA 3LFLA 5A5HB 2NBSA 3CHXC 4ZILA 5D8IA 1EGRA 3CBUA 2WGRA 3TRXA 3US3A 3M3MA 2E0QA 3HYPA 4IJ3A 2B7JA 3G7YA 2GT6A 4YKFA 4XRDA 1OE7A 1QGVA 2ZUPA 4ID0A 5DJLA 2OADA 3Q6OA 4FYUA 4ULXA 5JWRB 3TKPA 2FD3A 1PRXA 1SL0B 1ABAA 4MF6A 1IYHA 4FXYP 2F9SA 1GP1A 3GKKA 4I6XA 1LBKA 3M8NA 1XW5A 5ECLB 1Q4JA 2YZHA 4NHZA 1V9WA 1B9YC 1AIUA 1JZWA 4ZB8A 3CTFA 4OD7A 2AAWA 1I5GA 4HZ2A 3UAPA 4NHWA 4DSSA 5AGYA 4XS6A 3KH7A 1HYUA 2C0FA
chains in the Genus database with same CATH topology
1GSFA 3TJBA 1GTUA 3FW2A 1J9BA 3WT1A 4TRXA 3EINA 3RHBA 3KH9A 1AQXA 2HFDA 4GDFA 1FB6A 1A2JA 4KAEA 2C1YA 4ZXGA 4EIQA 2X4AA 4FYBA 2DKIA 3MYDA 5ECOB 3G7JA 2YV7A 1Z6NA 4ECJA 2O87A 4ACSA 4F03A 1NW2A 3CRUA 5ECKB 3IAS2 4GF0A 1XOAA 5B6NA 2R2JA 1V40A 2AB6A 4MLYA 2LQQA 1SVOA 3H8QA 4TR3A 3L9UA 1THXA 3F0IA 5DQYA 4G01A 2F51A 3QAWA 4ZB7A 5HFGA 2E2GA 2V2GA 2RIIA 2PGTA 4OFTA 4PQHA 2HQTA 5ENUA 2JACA 16GSA 3TJJA 2OBKA 1JZRA 2L5LA 2M46A 3GL5A 2IMFA 2Z9SA 1A2MA 1HNCA 4O5RA 5J41A 4EDYA 3JCML 1ZYPA 3P7XA 5HQPA 4IW9A 1WMJA 2H74A 1YVLA 4TXVA 5KN1A 2KHPA 4I2TA 2DJ1A 3M9KA 4WBJA 2VL2C 1K0DA 4NXIA 4JR4A 5HFKA 6GSTA 5A4UA 4V1Ag 1Y6EA 2J9HA 1QXHA 2DC5A 4O92A 4ZB9A 4IBPA 1LU4A 3WT2A 1ERVA 3HA9A 4XS4B 4BWSA 5IOWA 6GSXA 2GGTA 2GSRA 2LJKA 4K0GA 4XRAA 2GSTA 4MH3A 2VM2A 2YWOA 4WR4A 2B3SA 1ZL9A 3DYRA 3FKFA 5IMZA 2HRAA 3GMFA 19GSA 2VCQA 3IC4A 3UVTA 2YWNA 4MJBA 5FT3A 3QDNA 4WKWA 1GSUA 4ZBAA 2PWJA 1TOFA 4TR1B 3L9VA 3MNGA 5B7CA 3V1WA 1K0AA 3GH6A 3DEXA 5H5RA 3GUSA 5LNKe 2XPEA 2VL3A 1GTAA 5LD0A 5ECIB 4EVMA 1O7UA 1URMA 5E59A 1GSSA 2V6KA 2YJ7A 1O6JA 3GSTA 3VWUA 4K9ZA 2VCTA 1MDIA 3MSZA 4P3YB 1T1VA 1R26A 1VF4A 1V58A 3VPQA 2R37A 4BVXA 2TIRA 5HFIA 5ECSA 4G0IA 3VLNA 3CSHA 3P90A 1TI3A 3KMNA 4MH2A 1GUHA 4NV2A 3E9JB 1K3OA 5D9WA 3RPNA 4KH7A 4GXZA 2WRTA 1GSDA 2GLRA 3F8UA 2LRCA 1EGOA 1PSQA 1MD4A 5J4UA 4Q5RA 2EIQA 2MZCA 4DSSB 1YY7A 5F8BA 4Z7XA 1Z5YE 4XIHA 2MBTA 3RPPA 3EPTA 1SL1B 4F9ZA 2OA7A 4F2IA 1V2AA 4K8MA 3M1GA 1O73A 1H4OA 2H66A 2MMOA 3TKSA 2EFEA 4KCEA 4LMVA 2O8VB 5BMUA 1PD21 1QFNA 4MNNA 1YJ6A 3GKMA 4GSNA 3IV4A 1Z6MA 4J2FA 3KP8A 4L8EA 1UN2A 3GURA 1AW9A 4L5LA 4J56E 5JCGA 4OO4A 5FWGA 3H1NA 1ERUA 4PX1A 2CZ3A 4ILFA 1R4WA 2IPAA 1TXUA 3LJRA 4G0KA 3I9V2 3IR4A 3LYPA 2AHEA 2OACA 8GSSA 2R0GA 3IXRA 4X1UA 5J47A 4MF5A 2B1LA 1PA3A 3QAVA 5F0GA 5AIVA 1EEJA 5DDLA 4KW6A 3EU4A 1SU9A 3I69A 3ZMLA 1BYEA 4DEJA 2ON7A 1T7PB 1EV9A 3QPMA 2MYGA 1EZKA 4EDZA 1XXUA 4TN8A 2ALBA 1B8XA 4G9HA 5F06A 2I3YA 3TRQA 1R5AA 3F4RA 1CQHA 2L4QA 4POKA 1H75A 3TOUA 2HSMA 1A23A 4W66A 4MZCA 4AKXB 2QA1A 2PVOC 3L9SA 5EPFA 2WJUA 3GV1A 4QMKA 6GSWA 2WCIA 2QA2A 2XBIA 4MA9A 2O89A 3QOUA 4FIWA 2LJAA 2HRFA 5J5NA 1X9MB 2CVKA 3FZ4A 1SKSB 5DJMA 5ABRA 4BPYA 2AUVA 1M2BA 5ID2A 1SL2B 4PUFC 1J0FA 3BCKA 1SJZA 3R3EA 4DSRA 4NV5A 4ZBBA 4HU7A 3ZLPA 1JLVA 1T3BA 2OKAA 3FR6A 4N11A 5FHIA 3ZMKA 2IJYA 10GSA 2CX3A 3HVVA 2LV3A 2CVDA 3DXBA 5DAKA 1BF5A 4K5SA 2LTKA 3LEFA 1U3AA 4OWYA 1SK1A 2HT9A 4OO5A 1TK8B 2F8FA 3VWWA 4KGIA 4BVXB 5CP1A 3CYNA 2VCXA 4L0WA 1GNWA 4KF9A 3E3EA 2DJ2A 2GSQA 2K6VA 4OFNA 1T00A 3O6TA 1YKAA 2OBIA 4GQCA 3D4TA 3TJGA 3TJFA 3MIXA 1I9DA 2H6YA 5GAND 1GSQA 2VL9A 5DBQA 2GZYA 2G0FA 2OE1A 3KGKA 3DVXA 3L0HA 5IPHA 2GDRA 4K7IA 3FK8A 1C72A 1UVZA 1MDKA 1NM3A 1SENA 1Z3EA 5G30A 2GTUA 5KOXA 1E6BA 3R2QA 3D22A 5BMUB 3GSSA 3LORA 4GSSA 4AF2A 3I43A 4HDEA 4I2UA 3J7Yb 2WULA 2BMXA 1M7TA 5D93A 2H01A 4MZBA 5COHA 3KTBA 3EE2A 4MABA 1K0MA 4PQ1A 2K9FA 1SKWB 1FAAA 1PX7A 1EOHA 2HSHA 2QSIA 1F9MA 1PX6A 1QK8A 2L5OA 1E2YA 1O8XA 4XCSA 1FW1A 3D5JA 4FQUA 4CY8A 5IM9A 2R6KA 22GSA 9GSSA 4IP6A 3TDGA 17GSA 1ON4A 2H71A 3UOMA 3D0ZA 4AKGA 3K8NA 3GKXA 2P5RA 4CW9A 1SK0A 4IQAA 3IK9A 3ZIJA 1OYJA 3IDVA 1PN9A 1BEDA 2HSYA 3GNJA 2DIYA 3H4KA 4TKYA 4F0CA 1X9WB 3UVHA 2IMDA 4AJ8A 1QUWA 3IRAA 3VPTA 3KMOA 2DKHA 1GL8A 2HSMB 2EC4A 2HRNA 1TJDA 4O7HA 20GSA 3TCOA 2D2ZA 2AV4A 4OCFA 5CNWA 2O5VA 3CSIA 4E8EA 2PUKC 1XBSA 2CA8A 3G7IA 4Z2RA 4KCAA 5ID2B 2C0GA 1EP8A 2H76A 3TRPA 2IMIA 1EP7A 2C0DA 4IQ1A 1S3DA 3GX8A 1TRSA 1KNGA 3BJ5A 4HU9A 3ZIVA 2FGXA 1TRVA 1GRXA 4V1Ap 2TRXA 1FOVA 3LW9A 1S3CA 3N5OA 2EFHA 2CAQA 2VLVA 5DAKB 5A5KA 3A5WA 3UMAA 4G10A 3UBLA 4J57E 3I6AA 3WGXA 3HVSA 3G9BA 3HMJG 1XWKA 3NIVA 1OC8A 3F63A 2RLIA 1TW9A 2M72A 3PR8A 1SVLA 4K5RA 5CYYA 4Z2UA 3VI5A 1QMVA 4N30A 3HHVA 5J4YA 3ZRDA 4YQUA 1M99A 1MEKA 2YWMA 4MF7A 5ECNB 2GQMA 2X8GA 3LGCA 5D9TA 3W6GA 1TKDB 4HS1A 3HCZA 4L0UA 2GZPA 1X9SB 1T4YA 3IHQA 1N25A 2DLXA 2DJKA 2DMMA 1LJRA 4EXJA 6GSSA 2FWHA 3IK7A 3M0FA 1ERWA 1TTZA 2FA8A 4PURA 4TW5A 5IMVA 1A8LA 1F3AA 1G6YA 3QD9A 5AN1A 4KA0A 3TJKA 2GSSA 2DIZA 1Y1UA 2X8CA 4O32A 2N5AA 2NPBA 2H70A 1BQ7A 2L4CA 3M9JA 2LRNA 4MPGA 1SYRA 3MAKA 2I1UA 1ZZYA 1Z9HA 2H1BA 2VL2A 3HJPA 1Z7PA 1XW6A 4YAPA 3F6DA 3EU3A 2QKEA 4ML1A 1U88A 5ECQB 2H73A 1BJXA 4XS1A 4HOJA 5J40A 1PN0A 2LS5A 3CXGA 4FH8A 3C71A 4GTUA 2A2SA 3ZREA 3F4TA 3VWVA 1SK2A 1JLWA 1N8JA 3HZ8A 4MJAA 4EE0A 1HNAA 2IL3A 3GTUA 2GQKA 5A34A 2FWEA 4NMUA 1B48A 1M9BA 2GS3A 5IMDA 1M0UA 4ML6A 1OAZA 4PQIA 1YZXA 3H79A 3IHGA 3TU3B 2GT5A 2E2MA 1T4ZA 2FCHA 4K1FA 1KBNA 4L5OA 1XPVA 3HKRA 4USSA 1TK0B 5HR3A 3DKSA 4HI7A 3A2XA 2C3TA 2HSNA 2LKUA 1FO5A 3RDWA 2H1AA 2C0EA 3HXSA 3PINA 2LSTA 4RQRA 1VF1A 5IMCA 4G0LA 1JHBA 5IIZA 1ILOA 5DVBA 4AI6A 5INYA 2FA4A 5G31A 3D6IA 3MWHA 1WRYA 2L6DA 5ELAA 2B6MA 4F82A 1UA5A 4KDYA 3KD0A 2DJ0A 1ZGNA 5CRWA 3FZ5A 2CZ2A 1M9AA 1N2AA 2CQ9A 4PXOA 3F4SA 3GFKA 1O81A 3SBCA 4ZL7A 2A2RA 2HZEB 3ZFBA 1A2LA 2FHEA 3MDKA 3CSJA 5CAXA 1OKDA 1JZDA 3QR6A 5ECRB 1TU8A 2HZFA 3AY8A 1NHOA 4MPFA 2ES7A 3F6FA 1V57A 5EVOA 1DE1A 2PERA 3VI7A 3UARA 4G2EA 3RBTA 4I97A 5EY6A 1TXXA 1ACVA 1GLPA 2P31A 5DQSA 2A2PA 5KEJA 2CV4A 4AJ7A 1X5CA 1HD2A 3ZVJD 2L59A 3BD2A 1XW9A 1TI1A 4ECIA 1AXDA 4ZBDA 4GSTA 6GSUA 5F07A 2YWIA 4XHMA 2B5YA 2H72A 4MP4A 5CREA 2NDOA 1GTIA 4HJ2A 2EFCA 2HYXA 1NSWA 13GSA 2DJJA 4POMA 2VLUA 4KNDA 3P2AA 2REMA 4MCUA 2H6XA 4IJIA 4CDOA 2X64A 2IMKA 2YJHA 3UEMA 4NPBA 1BG5A 3TKRA 3HJOA 3ERWA 5KOWA 2VM1A 4MJCA 4MJEA 1M2DA 4HQSA 2JL4A 2F8AA 3FZAA 2XC2A 1GUMA 2CAIA 3WD6A 1G0TA 1SYXA 4E68A 3C7MA 3DMLA 2K8SA 5D96A 4EL1A 3DD3A 2EIOA 3PPUA 1ZYNA 3EURA 2CVBA 4BVYA 2A4VA 1XWCA 2VIMA 5G2ZA 4QQ7A 1SD8A 5KN3A 4YAVA 2KP2A 3IBHA 5L71A 2VCZA 1K0OA 3HY2A 4ZB6A 1DBYA 3GTUB 3GHAA 5A34B 4YQVA 4WBRD 2KOKA 3QCPA 4Q5NA 5AIXA 1YEXA 3IE3A 2N5FA 2JZRA 2BTOT 1XFLA 5A1NA 3A3TA 2C80A 3GH9A 3CWGA 1F3BA 5HR2A 2N5BA 2VAFA 3ME7A 1FVJA 2YANA 2O85A 4JU5A 1ML6A 4K0NA 1X5EA 3TUEA 2JZSA 1FG4A 4EUYA 2FWFA 2H1GA 5KN0A 1AQVA 3BCIA 2HSNB 4POLA 1JFUA 1RK4A 3ZITA 3GX0A 3UIWA 2RUEA 4V2MA 2OT3A 3VWXA 4FYCA 4O5QA 3GL3A 5B6MA 3U5RE 3A2VA 2LEGA 2GVPA 3ERFA 4JEDA 3SWLA 4E8HA 2DMLA 2HLSA 3GKNA 2B5EA 1B4PA 2WZ9A 3F3QA 4WETA 1IYIA 1YF1A 2KUCA 3OR5A 4AKHA 1Q98A 5G5FA 3TOTA 2HRKA 1X0RA 4X43A 3A5IA 2PPTA 3QFAC 4PUAA 1R7HA 1A0RP 2G2QA 4DVCA 1BG1A 6GSYA 2H1LA 1EOGA 1G7OA 4GLTA 3W8JA 1MTCA 4ECCA 4FO5A 1TDIA 1GSYA 4RI7A 3ZTLA 3LYKA 4F0BA 2UZ8A 2IFQA 3IC8A 3KCMA 5DALA 3FRCA 4KSMA 4OCEA 2LNSA 3HZ4A 2X49A 3FMWA 4XTSA 1SKRB 2LRTA 5IO2A 3UBKA 1PKZA 2B5XA 4I8BA 2V6OA 2OJLA 3S9FA 2H75A 2FY6A 4GWRA 1FHEA 1GNEA 1K3YA 1Z7RA 5C00A 4EF0A 4LL1B 5HR0A 3QFBC 1O8WA 3U6VA 2H6ZA 3EWLA 4KB3A 3QAGA 1WP0A 2NTOA 2QGVA 1DE2A 1U3IA 2F3MA 5GSSA 3EVIA 2ON5A 4YKGA 2B7KA 4ICYA 3FHKA 4D73A 3C8EA 1K3LA 1SVMA 4CY6A 2X8HA 2RM6A 1FB0A 5J3RA 3CMIA 2PU9C 2CT6A 4POBA 1A24A 4WEYA 2FLSA 2YN1A 1THOA 4MMMA 1A0FA 2YP6A 1AAZA 5IMAA 5JWQB 2VUPA 1SJ6A 1ZMAA 4EIPA 4MDCA 4RUVA 1PKWA 4JR6A 1PL1A 2JZTA 1TP9A 1VF2A 5DCHA 4WR5A 2HZEA 4WXTA 3WGEA 2KLXA 1XCCA 2K8VA 1EV4A 3LWAA 5ECMB 4AGSA 1KEBA 4EC0A 3ISOA 3KM6A 3D4MA 4IHUA 4I5QA 4BVYB 1HNBA 3KZQA 4WF4A 4N3ZA 4YQMA 3TB2A 1OC9A 3EC3A 4HUAA 4AJ6A 4KUNA 4O5UA 5IPGA 2RUFA 3KJYA 3L4NA 1AQWA 3LQ7A 1V98A 12GSA 4PTSA 4HJMA 1YQ1A 1TU7A 3IPZA 1TRWA 1WOUA 5A1NB 3LXTA 3BOAA 3RHCA 2M80A 1VRSD 2I81A 3KTLA 1SJIA 4EKZA 2A4HA 5JWOB 14GSA 2LUSA 3GIXA 4CHSA 2I4AA 5LCZA 1QQ2A 2NVLA 5GZZB 4K2DA 2VCWA 5JCUA 3W8SA 1BX9A 1K0NA 3P8WA 4NAXA 2LJRA 5CRGA 1F37A 3ZVJA 3NZNA 4OMVA 3APSA 4ECBA 3TKSE 2XBQA 2H0IA 5ELGA 2HNLA 4BL7A 2I9HA 3E0UA 2JU5A 3WGDA 5CO3A 1S3AA 2VLTA 1JZOA 5GAPD 4K6XA 4GCIA 3APOA 2CX4A 2MBSA 1MD3A 1G7EA 4H86A 4ZIJA 4JRRA 1HQOA 2LNTA 2HRKB 3N9JA 5J9BA 4AKIA 2H19A 2V41A 5G1KA 4OFMA 1TK5B 4BWQA 1F2EA 5H5SA 3EMPA 3KIJA 3NOFA 2HI7A 3UJ1A 2AJQB 3L78A 4IKHA 4KDUA 4V2LA 3ME8A 3UL3A 1WJKA 2H1DA 4NWYA 2IFQB 2C3NA 5DALB 1USBA 2EIRA 4JE1A 1AC1A 1WE0A 5D9VA 1A8YA 2V1MA 4Z2TA 4LL4B 2VKZG 3O3TA 5IO0A 3TKSC 1ZOFA 5J4VA 2WDUA 4V2NA 2LQOA 1MDJA 1VF3A 1O85A 4LLRA 1XVQA 1EEMA 1WPIA 2AYTA 3DWVA 5ECPB 3FR3A 2VD1A 3H93A 5JCWA 4GRFA 5KN2A 1J08A 1RQMA 2PVQA 5CRDA 3ED3A 5G1LA 1K0CA 4TXOA 2RM5A 1FOHA 2UV8G 2JSZA 1AUCA 1DUGA 4IELA 3C73A 1VGLA 3KEBA 2J23A 2PBJA 1F6MC 4BA7A 3BBYA 4D73B 3FR9A 1YF0A 4MZWA 5G5EA 3ZZXA 1XWBA 1ZYEA 1GUKA 4IGJA 4WF5A 1GH2A 2C4JA 1KTEA 3EYTA 2YZUA 2WS2A 5ECHB 3PGTA 3J7Yk 2HE3A 2HXKA 3GA4A 3TKQA 3C1SA 2P0GA 4Q5FA 2V32A 4Q5QA 4KX4A 3O76A 3IOSA 5CRHA 3Q19A 3KP9A 2ZNMA 3GRXA 3A2WA 4X4JA 4QL7A 1GWCA 5F05A 1ERTA 3CTGA 4MK3A 2PN8A 1T8EB 1Y25A 1FVKA 4RQXA 5A5HA 4GQFA 2YV9A 3CRTA 2H0HA 3APQA 4A5PA 7GSSA 1OC9B 2FNOA 4KDXA 3HJMA 1XVWA 3DRNA 2L57A 4YH2A 2R0PA 3LG6A 1GULA 5EL8A 2OE0A 3GN3A 2R0CA 2H0GA 1W4VA 4LMWA 1XZOA 4JZQA 4TR0A 4QL9A 5DCGA 2WFCA 3QMXA 3Q74A 3HD5A 4EO3A 1SD9A 3DIEA 3VK9A 5HR1A 1B9XC 2P5QA 2K18A 1BAYA 1CQGA 4K7NA 2R4VA 5IQYA 3FY7A 3C1RA 1OE8A 2FWGA 1RW1A 3F9UA 1PL2A 2VO4A 3Q18A 4IP1A 2O7KA 2JADA 1W89A 2H8LA 2FUG2 2DSAA 1DSBA 2R3XA 5A4WA 4IN0A 2IMEA 2XPDA 4BL7B 2EFDA 1M2AA 1U87A 3LSZA 4HZ4A 1XWAA 5A4VA 1ZCPA 1K0BA 1XIYA 4G19A 4PNFA 3IA1A 2L6CA 4RI6A 11GSA 3ZYWA 1GLQA 5IOXA 1NHYA 1WWJA 3KXOA 2ZCTA 2B1KA 1GSEA 4PNGA 2MMAA 4N0VA 1U6TA 4LA1A 1WIKA 4KSOA 1PQNA 4K2XA 1OVNA 1GTBA 5D9XA 2YPMA 3VFIA 6GSVA 5IMFA 4TVEA 4K7OA 1ST9A 2H30A 3LXZA 3FYGA 2KP1A 4DSQA 5AISA 1UC7A 3DGQA 2VOCA 3D21A 2TRCP 2X99A 1EWXA 1PMTA 4ZL9A 2YCDA 2WB9A 4KE3A 3FZ9A 2YNXA 2DJ3A 2DBCA 1YKCA 2BJXA 2MMZA 2VCVA 2PMTA 1OKTA 4TXOB 5BRTA 4ISDA 3EMXA 1PGTA 4IVFA 5D73A 1YEPA 2YOIA 3F3RA 2E7PA 4TOPA 3IAM2 2IIYA 1TRUA 4ZL8A 3FEUA 2GZZA 5B8AA 1G6WA 5E4WA 2JSYA 3HDCA 1B4QA 3WYWA 2XHFA 3DVWA 4XS4A 2OE3A 5J9CA 2MMNA 4N10A 3TGZA 1XOBA 2C8UA 1X5DA 4TR4A 4HQZA 4IS0A 4X0XA 1ZYQB 2VD0A 3ERGA 4PGTA 2GQLA 2IN3A 3GYKA 1R5PA 3PH9A 4JBBA 1OC3A 3ZL5A 4N0ZA 2R5GA 5B8BA 4HEA2 5GSTA 2IWTA 2C3QA 3RAZA 1XWGA 2QC7A 4TR1A 18GSA 1YDKA 5C04A 3HVXA 5H5QA 3ZFLA 3VURA 3LFLA 5A5HB 2NBSA 4ZILA 5D8IA 1EGRA 3CBUA 2WGRA 3TRXA 3US3A 3M3MA 2E0QA 3HYPA 4IJ3A 2B7JA 3G7YA 2GT6A 4YKFA 4XRDA 1OE7A 1QGVA 2ZUPA 4ID0A 5DJLA 2OADA 3Q6OA 4FYUA 4ULXA 5JWRB 3TKPA 2FD3A 1PRXA 1SL0B 1ABAA 4MF6A 1IYHA 2F9SA 1GP1A 3GKKA 4I6XA 1LBKA 3M8NA 1XW5A 5ECLB 1Q4JA 2YZHA 4NHZA 1V9WA 1B9YC 1AIUA 1JZWA 4ZB8A 3CTFA 4OD7A 2AAWA 1I5GA 4HZ2A 3UAPA 4NHWA 4DSSA 5AGYA 4XS6A 3KH7A 1HYUA 2C0FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GSF A;  3TJB A;  1GTU A;  3FW2 A;  1J9B A;  3WT1 A;  4TRX A;  3EIN A;  3RHB A;  3KH9 A;  1AQX A;  2HFD A;  1FB6 A;  1A2J A;  4KAE A;  2C1Y A;  4ZXG A;  4FYB A;  5ECO B;  3G7J A;  2YV7 A;  1Z6N A;  4ECJ A;  2O87 A;  4ACS A;  4F03 A;  1NW2 A;  3CRU A;  5ECK B;  3IAS 2;  4GF0 A;  1XOA A;  5B6N A;  2R2J A;  1V40 A;  2AB6 A;  4MLY A;  2LQQ A;  3H8Q A;  4TR3 A;  3L9U A;  1THX A;  3F0I A;  5DQY A;  2F51 A;  3QAW A;  5HFG A;  2E2G A;  2V2G A;  2RII A;  2PGT A;  4OFT A;  4PQH A;  2HQT A;  5ENU A;  2JAC A;  16GS A;  3TJJ A;  2OBK A;  1JZR A;  2L5L A;  2M46 A;  3GL5 A;  2IMF A;  2Z9S A;  1A2M A;  1HNC A;  4O5R A;  5J41 A;  4EDY A;  3JCM L;  3P7X A;  5HQP A;  4IW9 A;  1WMJ A;  2H74 A;  4TXV A;  5KN1 A;  2KHP A;  4I2T A;  2DJ1 A;  3M9K A;  4WBJ A;  2VL2 C;  1K0D A;  4NXI A;  4JR4 A;  5HFK A;  6GST A;  5A4U A;  4V1A g;  1Y6E A;  2J9H A;  1QXH A;  2DC5 A;  4O92 A;  4ZB9 A;  4IBP A;  1LU4 A;  3WT2 A;  1ERV A;  3HA9 A;  4XS4 B;  4BWS A;  5IOW A;  6GSX A;  2GGT A;  2GSR A;  2LJK A;  4K0G A;  4XRA A;  2GST A;  4MH3 A;  2VM2 A;  2YWO A;  4WR4 A;  2B3S A;  1ZL9 A;  3DYR A;  3FKF A;  5IMZ A;  2HRA A;  3GMF A;  19GS A;  2VCQ A;  3IC4 A;  3UVT A;  2YWN A;  4MJB A;  5FT3 A;  3QDN A;  4WKW A;  1GSU A;  4ZBA A;  2PWJ A;  1TOF A;  4TR1 B;  3L9V A;  3MNG A;  5B7C A;  3V1W A;  1K0A A;  3GH6 A;  3DEX A;  5H5R A;  3GUS A;  5LNK e;  2XPE A;  2VL3 A;  1GTA A;  5LD0 A;  5ECI B;  4EVM A;  1O7U A;  1URM A;  5E59 A;  1GSS A;  2V6K A;  2YJ7 A;  1O6J A;  3GST A;  3VWU A;  4K9Z A;  2VCT A;  1MDI A;  3MSZ A;  4P3Y B;  1T1V A;  1R26 A;  1VF4 A;  1V58 A;  3VPQ A;  2R37 A;  4BVX A;  2TIR A;  5HFI A;  5ECS A;  4G0I A;  3VLN A;  3CSH A;  3P90 A;  1TI3 A;  3KMN A;  4MH2 A;  1GUH A;  4NV2 A;  3E9J B;  1K3O A;  5D9W A;  3RPN A;  4KH7 A;  4GXZ A;  2WRT A;  1GSD A;  2GLR A;  3F8U A;  2LRC A;  1EGO A;  1PSQ A;  1MD4 A;  5J4U A;  4Q5R A;  2EIQ A;  2MZC A;  4DSS B;  1YY7 A;  5F8B A;  4Z7X A;  1Z5Y E;  4XIH A;  2MBT A;  3RPP A;  1SL1 B;  4F9Z A;  2OA7 A;  4F2I A;  1V2A A;  4K8M A;  3M1G A;  1O73 A;  1H4O A;  2H66 A;  2MMO A;  3TKS A;  4KCE A;  4LMV A;  2O8V B;  5BMU A;  1PD2 1;  1QFN A;  1YJ6 A;  3GKM A;  4GSN A;  3IV4 A;  1Z6M A;  4J2F A;  3KP8 A;  4L8E A;  1UN2 A;  3GUR A;  1AW9 A;  4L5L A;  4J56 E;  5JCG A;  4OO4 A;  5FWG A;  3H1N A;  1ERU A;  4PX1 A;  2CZ3 A;  4ILF A;  1R4W A;  2IPA A;  3LJR A;  4G0K A;  3I9V 2;  3IR4 A;  3LYP A;  2AHE A;  2OAC A;  8GSS A;  3IXR A;  4X1U A;  4MF5 A;  2B1L A;  1PA3 A;  3QAV A;  5F0G A;  5AIV A;  1EEJ A;  5DDL A;  4KW6 A;  3EU4 A;  1SU9 A;  3I69 A;  3ZML A;  1BYE A;  4DEJ A;  2ON7 A;  1T7P B;  1EV9 A;  3QPM A;  2MYG A;  1EZK A;  4EDZ A;  1XXU A;  4TN8 A;  2ALB A;  1B8X A;  4G9H A;  5F06 A;  2I3Y A;  3TRQ A;  1R5A A;  3F4R A;  1CQH A;  2L4Q A;  4POK A;  1H75 A;  3TOU A;  2HSM A;  1A23 A;  4MZC A;  2PVO C;  3L9S A;  5EPF A;  2WJU A;  3GV1 A;  6GSW A;  2WCI A;  2XBI A;  4MA9 A;  2O89 A;  3QOU A;  4FIW A;  2LJA A;  2HRF A;  5J5N A;  1X9M B;  2CVK A;  3FZ4 A;  1SKS B;  5DJM A;  5ABR A;  4BPY A;  2AUV A;  1M2B A;  5ID2 A;  1SL2 B;  4PUF C;  1J0F A;  3BCK A;  1SJZ A;  3R3E A;  4DSR A;  4NV5 A;  4ZBB A;  4HU7 A;  3ZLP A;  1JLV A;  1T3B A;  2OKA A;  3FR6 A;  4N11 A;  5FHI A;  3ZMK A;  2IJY A;  10GS A;  2CX3 A;  3HVV A;  2LV3 A;  2CVD A;  3DXB A;  5DAK A;  2LTK A;  3LEF A;  1U3A A;  4OWY A;  1SK1 A;  2HT9 A;  4OO5 A;  1TK8 B;  2F8F A;  3VWW A;  4KGI A;  4BVX B;  5CP1 A;  3CYN A;  2VCX A;  4L0W A;  1GNW A;  4KF9 A;  3E3E A;  2DJ2 A;  2GSQ A;  2K6V A;  4OFN A;  1T00 A;  3O6T A;  1YKA A;  2OBI A;  4GQC A;  3D4T A;  3TJG A;  3TJF A;  1I9D A;  2H6Y A;  5GAN D;  1GSQ A;  2VL9 A;  5DBQ A;  2GZY A;  2G0F A;  2OE1 A;  3KGK A;  3DVX A;  3L0H A;  5IPH A;  2GDR A;  4K7I A;  3FK8 A;  1C72 A;  1UVZ A;  1MDK A;  1NM3 A;  1SEN A;  1Z3E A;  5G30 A;  2GTU A;  1E6B A;  3R2Q A;  3D22 A;  3GSS A;  3LOR A;  4GSS A;  4AF2 A;  3I43 A;  4HDE A;  4I2U A;  3J7Y b;  2WUL A;  2BMX A;  1M7T A;  5D93 A;  2H01 A;  4MZB A;  5COH A;  3KTB A;  3EE2 A;  4MAB A;  1K0M A;  4PQ1 A;  2K9F A;  1SKW B;  1FAA A;  1PX7 A;  1EOH A;  2HSH A;  2QSI A;  1F9M A;  1PX6 A;  1QK8 A;  2L5O A;  1E2Y A;  1O8X A;  4XCS A;  1FW1 A;  3D5J A;  4FQU A;  5IM9 A;  2R6K A;  22GS A;  9GSS A;  4IP6 A;  3TDG A;  17GS A;  1ON4 A;  2H71 A;  3UOM A;  3D0Z A;  3K8N A;  3GKX A;  2P5R A;  4CW9 A;  1SK0 A;  4IQA A;  3IK9 A;  3ZIJ A;  1OYJ A;  3IDV A;  1PN9 A;  1BED A;  2HSY A;  3GNJ A;  2DIY A;  3H4K A;  4TKY A;  4F0C A;  1X9W B;  3UVH A;  2IMD A;  4AJ8 A;  1QUW A;  3IRA A;  3VPT A;  3KMO A;  1GL8 A;  2HSM B;  2EC4 A;  2HRN A;  1TJD A;  4O7H A;  20GS A;  3TCO A;  2D2Z A;  2AV4 A;  4OCF A;  5CNW A;  3CSI A;  4E8E A;  2PUK C;  1XBS A;  2CA8 A;  3G7I A;  4KCA A;  5ID2 B;  2C0G A;  1EP8 A;  2H76 A;  3TRP A;  2IMI A;  1EP7 A;  2C0D A;  4IQ1 A;  1S3D A;  3GX8 A;  1TRS A;  1KNG A;  3BJ5 A;  4HU9 A;  3ZIV A;  2FGX A;  1TRV A;  1GRX A;  4V1A p;  2TRX A;  1FOV A;  1S3C A;  3N5O A;  2CAQ A;  2VLV A;  5DAK B;  5A5K A;  3A5W A;  3UMA A;  4G10 A;  3UBL A;  4J57 E;  3I6A A;  3WGX A;  3HVS A;  3G9B A;  1XWK A;  3NIV A;  1OC8 A;  3F63 A;  2RLI A;  1TW9 A;  2M72 A;  3PR8 A;  5CYY A;  3VI5 A;  1QMV A;  4N30 A;  3HHV A;  3ZRD A;  4YQU A;  1M99 A;  1MEK A;  2YWM A;  4MF7 A;  5ECN B;  2GQM A;  2X8G A;  3LGC A;  5D9T A;  3W6G A;  1TKD B;  4HS1 A;  3HCZ A;  4L0U A;  2GZP A;  1X9S B;  1T4Y A;  3IHQ A;  2DLX A;  2DJK A;  2DMM A;  1LJR A;  4EXJ A;  6GSS A;  2FWH A;  3IK7 A;  3M0F A;  1ERW A;  1TTZ A;  2FA8 A;  4PUR A;  4TW5 A;  5IMV A;  1A8L A;  1F3A A;  1G6Y A;  3QD9 A;  5AN1 A;  4KA0 A;  3TJK A;  2GSS A;  2DIZ A;  2X8C A;  4O32 A;  2N5A A;  2NPB A;  2H70 A;  1BQ7 A;  2L4C A;  3M9J A;  2LRN A;  4MPG A;  1SYR A;  3MAK A;  2I1U A;  1ZZY A;  1Z9H A;  2H1B A;  2VL2 A;  3HJP A;  1Z7P A;  1XW6 A;  4YAP A;  3F6D A;  3EU3 A;  2QKE A;  4ML1 A;  1U88 A;  5ECQ B;  2H73 A;  1BJX A;  4XS1 A;  4HOJ A;  2LS5 A;  3CXG A;  4FH8 A;  3C71 A;  4GTU A;  2A2S A;  3ZRE A;  3F4T A;  3VWV A;  1SK2 A;  1JLW A;  1N8J A;  3HZ8 A;  4MJA A;  4EE0 A;  1HNA A;  2IL3 A;  3GTU A;  2GQK A;  2FWE A;  4NMU A;  1B48 A;  1M9B A;  2GS3 A;  5IMD A;  1M0U A;  4ML6 A;  1OAZ A;  4PQI A;  1YZX A;  3H79 A;  2GT5 A;  2E2M A;  1T4Z A;  2FCH A;  4K1F A;  1KBN A;  4L5O A;  1XPV A;  3HKR A;  4USS A;  1TK0 B;  5HR3 A;  3DKS A;  4HI7 A;  3A2X A;  2C3T A;  2LKU A;  1FO5 A;  3RDW A;  2H1A A;  2C0E A;  3HXS A;  3PIN A;  2LST A;  4RQR A;  1VF1 A;  5IMC A;  4G0L A;  1JHB A;  5IIZ A;  1ILO A;  5DVB A;  5INY A;  2FA4 A;  5G31 A;  3D6I A;  3MWH A;  1WRY A;  2L6D A;  5ELA A;  2B6M A;  4F82 A;  1UA5 A;  4KDY A;  3KD0 A;  2DJ0 A;  1ZGN A;  5CRW A;  3FZ5 A;  2CZ2 A;  1M9A A;  1N2A A;  2CQ9 A;  4PXO A;  3F4S A;  3GFK A;  1O81 A;  3SBC A;  4ZL7 A;  2A2R A;  2HZE B;  3ZFB A;  1A2L A;  2FHE A;  3MDK A;  3CSJ A;  5CAX A;  1OKD A;  1JZD A;  3QR6 A;  5ECR B;  1TU8 A;  2HZF A;  3AY8 A;  1NHO A;  4MPF A;  2ES7 A;  3F6F A;  1V57 A;  5EVO A;  1DE1 A;  2PER A;  3VI7 A;  3UAR A;  4G2E A;  3RBT A;  4I97 A;  5EY6 A;  1TXX A;  1ACV A;  1GLP A;  2P31 A;  5DQS A;  5KEJ A;  2CV4 A;  4AJ7 A;  1X5C A;  1HD2 A;  3ZVJ D;  2L59 A;  3BD2 A;  1XW9 A;  1TI1 A;  4ECI A;  1AXD A;  4ZBD A;  4GST A;  6GSU A;  5F07 A;  2YWI A;  4XHM A;  2B5Y A;  2H72 A;  4MP4 A;  5CRE A;  2NDO A;  1GTI A;  4HJ2 A;  2HYX A;  1NSW A;  13GS A;  2DJJ A;  4POM A;  2VLU A;  4KND A;  3P2A A;  2REM A;  4MCU A;  2H6X A;  4IJI A;  4CDO A;  2X64 A;  2IMK A;  2YJH A;  3UEM A;  4NPB A;  1BG5 A;  3TKR A;  3HJO A;  3ERW A;  2VM1 A;  4MJC A;  4MJE A;  1M2D A;  4HQS A;  2JL4 A;  2F8A A;  3FZA A;  1GUM A;  2XC2 A;  2CAI A;  3WD6 A;  1G0T A;  1SYX A;  3C7M A;  3DML A;  2K8S A;  5D96 A;  4EL1 A;  3DD3 A;  2EIO A;  3PPU A;  3EUR A;  2CVB A;  4BVY A;  2A4V A;  1XWC A;  2VIM A;  5G2Z A;  4QQ7 A;  1SD8 A;  5KN3 A;  4YAV A;  2KP2 A;  3IBH A;  5L71 A;  2VCZ A;  1K0O A;  3HY2 A;  4ZB6 A;  1DBY A;  3GTU B;  3GHA A;  4YQV A;  4WBR D;  2KOK A;  3QCP A;  4Q5N A;  5AIX A;  1YEX A;  3IE3 A;  2N5F A;  2JZR A;  2BTO T;  1XFL A;  3A3T A;  2C80 A;  3GH9 A;  1F3B A;  5HR2 A;  2N5B A;  2VAF A;  3ME7 A;  1FVJ A;  2YAN A;  2O85 A;  4JU5 A;  1ML6 A;  4K0N A;  1X5E A;  3TUE A;  2JZS A;  1FG4 A;  4EUY A;  2FWF A;  2H1G A;  5KN0 A;  1AQV A;  3BCI A;  2HSN B;  4POL A;  1JFU A;  1RK4 A;  3ZIT A;  3GX0 A;  3UIW A;  2RUE A;  4V2M A;  3VWX A;  4FYC A;  3GL3 A;  5B6M A;  3U5R E;  3A2V A;  2LEG A;  2GVP A;  3ERF A;  4JED A;  3SWL A;  4E8H A;  2DML A;  2HLS A;  3GKN A;  2B5E A;  1B4P A;  2WZ9 A;  3F3Q A;  4WET A;  1IYI A;  1YF1 A;  2KUC A;  3OR5 A;  1Q98 A;  5G5F A;  3TOT A;  2HRK A;  1X0R A;  4X43 A;  2PPT A;  3QFA C;  4PUA A;  1R7H A;  1A0R P;  2G2Q A;  4DVC A;  6GSY A;  1EOG A;  1G7O A;  4GLT A;  3W8J A;  1MTC A;  4ECC A;  4FO5 A;  1TDI A;  1GSY A;  4RI7 A;  3ZTL A;  3LYK A;  4F0B A;  2UZ8 A;  2IFQ A;  3IC8 A;  3KCM A;  5DAL A;  3FRC A;  4KSM A;  4OCE A;  2LNS A;  3HZ4 A;  4XTS A;  1SKR B;  2LRT A;  5IO2 A;  3UBK A;  1PKZ A;  2B5X A;  4I8B A;  2V6O A;  2OJL A;  3S9F A;  2H75 A;  2FY6 A;  4GWR A;  1FHE A;  1GNE A;  1K3Y A;  1Z7R A;  5C00 A;  4EF0 A;  4LL1 B;  5HR0 A;  3QFB C;  1O8W A;  3U6V A;  2H6Z A;  3EWL A;  4KB3 A;  3QAG A;  1WP0 A;  2NTO A;  2QGV A;  1DE2 A;  1U3I A;  2F3M A;  5GSS A;  3EVI A;  2ON5 A;  2B7K A;  3FHK A;  4D73 A;  3C8E A;  1K3L A;  2X8H A;  2RM6 A;  1FB0 A;  5J3R A;  3CMI A;  2PU9 C;  2CT6 A;  4POB A;  1A24 A;  4WEY A;  2FLS A;  2YN1 A;  1THO A;  4MMM A;  1A0F A;  2YP6 A;  1AAZ A;  5IMA A;  5JWQ B;  2VUP A;  1SJ6 A;  1ZMA A;  4MDC A;  4RUV A;  1PKW A;  4JR6 A;  1PL1 A;  2JZT A;  1TP9 A;  1VF2 A;  5DCH A;  4WR5 A;  2HZE A;  4WXT A;  3WGE A;  2KLX A;  1XCC A;  2K8V A;  1EV4 A;  3LWA A;  5ECM B;  4AGS A;  1KEB A;  4EC0 A;  3ISO A;  3KM6 A;  3D4M A;  4IHU A;  4I5Q A;  4BVY B;  1HNB A;  3KZQ A;  4WF4 A;  4YQM A;  3TB2 A;  1OC9 A;  3EC3 A;  4HUA A;  4AJ6 A;  4KUN A;  5IPG A;  2RUF A;  3KJY A;  3L4N A;  1AQW A;  3LQ7 A;  1V98 A;  12GS A;  4PTS A;  4HJM A;  1YQ1 A;  1TU7 A;  3IPZ A;  1TRW A;  1WOU A;  3LXT A;  3BOA A;  3RHC A;  2M80 A;  1VRS D;  2I81 A;  3KTL A;  1SJI A;  4EKZ A;  5JWO B;  14GS A;  2LUS A;  3GIX A;  4CHS A;  2I4A A;  5LCZ A;  1QQ2 A;  2NVL A;  5GZZ B;  4K2D A;  2VCW A;  5JCU A;  3W8S A;  1BX9 A;  1K0N A;  3P8W A;  4NAX A;  2LJR A;  5CRG A;  1F37 A;  3ZVJ A;  3NZN A;  4OMV A;  3APS A;  4ECB A;  3TKS E;  2XBQ A;  2H0I A;  5ELG A;  2HNL A;  4BL7 A;  2I9H A;  3E0U A;  2JU5 A;  3WGD A;  5CO3 A;  1S3A A;  2VLT A;  1JZO A;  5GAP D;  4K6X A;  4GCI A;  3APO A;  2CX4 A;  2MBS A;  1MD3 A;  1G7E A;  4H86 A;  4ZIJ A;  4JRR A;  1HQO A;  2LNT A;  2HRK B;  3N9J A;  5J9B A;  2H19 A;  2V41 A;  5G1K A;  4OFM A;  1TK5 B;  4BWQ A;  1F2E A;  5H5S A;  3EMP A;  3KIJ A;  3NOF A;  2HI7 A;  3UJ1 A;  2AJQ B;  3L78 A;  4IKH A;  4KDU A;  4V2L A;  3ME8 A;  3UL3 A;  1WJK A;  2H1D A;  4NWY A;  2IFQ B;  2C3N A;  5DAL B;  1USB A;  2EIR A;  4JE1 A;  1AC1 A;  1WE0 A;  5D9V A;  1A8Y A;  2V1M A;  4LL4 B;  3O3T A;  5IO0 A;  3TKS C;  1ZOF A;  2WDU A;  4V2N A;  2LQO A;  1MDJ A;  1VF3 A;  1O85 A;  4LLR A;  1XVQ A;  1EEM A;  1WPI A;  2AYT A;  3DWV A;  5ECP B;  3FR3 A;  2VD1 A;  3H93 A;  5JCW A;  4GRF A;  5KN2 A;  1J08 A;  1RQM A;  2PVQ A;  5CRD A;  3ED3 A;  5G1L A;  1K0C A;  4TXO A;  2RM5 A;  2JSZ A;  1AUC A;  1DUG A;  4IEL A;  3C73 A;  1VGL A;  3KEB A;  2J23 A;  2PBJ A;  1F6M C;  4BA7 A;  3BBY A;  4D73 B;  3FR9 A;  1YF0 A;  4MZW A;  5G5E A;  3ZZX A;  1XWB A;  1ZYE A;  1GUK A;  4IGJ A;  4WF5 A;  1GH2 A;  2C4J A;  1KTE A;  3EYT A;  2YZU A;  2WS2 A;  5ECH B;  3PGT A;  3J7Y k;  2HE3 A;  2HXK A;  3GA4 A;  3TKQ A;  3C1S A;  2P0G A;  4Q5F A;  2V32 A;  4Q5Q A;  4KX4 A;  3O76 A;  3IOS A;  5CRH A;  3Q19 A;  3KP9 A;  2ZNM A;  3GRX A;  3A2W A;  4QL7 A;  1GWC A;  5F05 A;  1ERT A;  3CTG A;  4MK3 A;  2PN8 A;  1T8E B;  1Y25 A;  1FVK A;  4RQX A;  4GQF A;  2YV9 A;  3CRT A;  2H0H A;  3APQ A;  7GSS A;  1OC9 B;  2FNO A;  4KDX A;  3HJM A;  1XVW A;  3DRN A;  2L57 A;  4YH2 A;  3LG6 A;  1GUL A;  5EL8 A;  2OE0 A;  3GN3 A;  2H0G A;  1W4V A;  4LMW A;  1XZO A;  4JZQ A;  4TR0 A;  4QL9 A;  5DCG A;  2WFC A;  3QMX A;  3Q74 A;  3HD5 A;  4EO3 A;  1SD9 A;  3DIE A;  3VK9 A;  5HR1 A;  1B9X C;  2P5Q A;  2K18 A;  1BAY A;  1CQG A;  4K7N A;  2R4V A;  5IQY A;  3FY7 A;  3C1R A;  1OE8 A;  2FWG A;  1RW1 A;  3F9U A;  1PL2 A;  2VO4 A;  3Q18 A;  4IP1 A;  2O7K A;  2JAD A;  1W89 A;  2H8L A;  2FUG 2;  2DSA A;  1DSB A;  2R3X A;  5A4W A;  4IN0 A;  2IME A;  2XPD A;  4BL7 B;  1M2A A;  1U87 A;  3LSZ A;  4HZ4 A;  1XWA A;  5A4V A;  1ZCP A;  1K0B A;  1XIY A;  4G19 A;  4PNF A;  3IA1 A;  2L6C A;  4RI6 A;  11GS A;  3ZYW A;  1GLQ A;  5IOX A;  1NHY A;  1WWJ A;  3KXO A;  2ZCT A;  2B1K A;  1GSE A;  4PNG A;  2MMA A;  4N0V A;  1U6T A;  4LA1 A;  1WIK A;  4KSO A;  1PQN A;  1OVN A;  1GTB A;  5D9X A;  2YPM A;  3VFI A;  6GSV A;  5IMF A;  4TVE A;  4K7O A;  1ST9 A;  2H30 A;  3LXZ A;  3FYG A;  2KP1 A;  4DSQ A;  5AIS A;  1UC7 A;  3DGQ A;  2VOC A;  3D21 A;  2TRC P;  2X99 A;  1EWX A;  1PMT A;  4ZL9 A;  2YCD A;  2WB9 A;  4KE3 A;  3FZ9 A;  2YNX A;  2DJ3 A;  2DBC A;  1YKC A;  2BJX A;  2MMZ A;  2VCV A;  2PMT A;  1OKT A;  4TXO B;  4ISD A;  3EMX A;  1PGT A;  4IVF A;  5D73 A;  1YEP A;  2YOI A;  3F3R A;  2E7P A;  4TOP A;  3IAM 2;  2IIY A;  1TRU A;  4ZL8 A;  3FEU A;  2GZZ A;  5B8A A;  1G6W A;  5E4W A;  2JSY A;  3HDC A;  1B4Q A;  3WYW A;  2XHF A;  3DVW A;  4XS4 A;  2OE3 A;  5J9C A;  2MMN A;  4N10 A;  3TGZ A;  1XOB A;  2C8U A;  1X5D A;  4TR4 A;  4HQZ A;  4IS0 A;  4X0X A;  1ZYQ B;  2VD0 A;  3ERG A;  4PGT A;  2GQL A;  2IN3 A;  3GYK A;  1R5P A;  3PH9 A;  4JBB A;  1OC3 A;  3ZL5 A;  4N0Z A;  2R5G A;  5B8B A;  4HEA 2;  5GST A;  2IWT A;  2C3Q A;  3RAZ A;  1XWG A;  2QC7 A;  4TR1 A;  18GS A;  1YDK A;  5C04 A;  3HVX A;  5H5Q A;  3ZFL A;  3VUR A;  3LFL A;  2NBS A;  4ZIL A;  5D8I A;  1EGR A;  3CBU A;  2WGR A;  3TRX A;  3US3 A;  3M3M A;  2E0Q A;  3HYP A;  4IJ3 A;  2B7J A;  3G7Y A;  2GT6 A;  4XRD A;  1OE7 A;  1QGV A;  2ZUP A;  4ID0 A;  5DJL A;  2OAD A;  3Q6O A;  4FYU A;  4ULX A;  5JWR B;  3TKP A;  2FD3 A;  1PRX A;  1SL0 B;  1ABA A;  4MF6 A;  1IYH A;  2F9S A;  1GP1 A;  3GKK A;  4I6X A;  1LBK A;  3M8N A;  1XW5 A;  5ECL B;  1Q4J A;  2YZH A;  4NHZ A;  1V9W A;  1B9Y C;  1AIU A;  1JZW A;  4ZB8 A;  3CTF A;  4OD7 A;  2AAW A;  1I5G A;  4HZ2 A;  3UAP A;  4NHW A;  4DSS A;  5AGY A;  4XS6 A;  3KH7 A;  1HYU A;  2C0F A; 
#chains in the Genus database with same CATH topology
 1GSF A;  3TJB A;  1GTU A;  3FW2 A;  1J9B A;  3WT1 A;  4TRX A;  3EIN A;  3RHB A;  3KH9 A;  1AQX A;  2HFD A;  4GDF A;  1FB6 A;  1A2J A;  4KAE A;  2C1Y A;  4ZXG A;  4EIQ A;  2X4A A;  4FYB A;  2DKI A;  3MYD A;  5ECO B;  3G7J A;  2YV7 A;  1Z6N A;  4ECJ A;  2O87 A;  4ACS A;  4F03 A;  1NW2 A;  3CRU A;  5ECK B;  3IAS 2;  4GF0 A;  1XOA A;  5B6N A;  2R2J A;  1V40 A;  2AB6 A;  4MLY A;  2LQQ A;  1SVO A;  3H8Q A;  4TR3 A;  3L9U A;  1THX A;  3F0I A;  5DQY A;  4G01 A;  2F51 A;  3QAW A;  4ZB7 A;  5HFG A;  2E2G A;  2V2G A;  2RII A;  2PGT A;  4OFT A;  4PQH A;  2HQT A;  5ENU A;  2JAC A;  16GS A;  3TJJ A;  2OBK A;  1JZR A;  2L5L A;  2M46 A;  3GL5 A;  2IMF A;  2Z9S A;  1A2M A;  1HNC A;  4O5R A;  5J41 A;  4EDY A;  3JCM L;  1ZYP A;  3P7X A;  5HQP A;  4IW9 A;  1WMJ A;  2H74 A;  1YVL A;  4TXV A;  5KN1 A;  2KHP A;  4I2T A;  2DJ1 A;  3M9K A;  4WBJ A;  2VL2 C;  1K0D A;  4NXI A;  4JR4 A;  5HFK A;  6GST A;  5A4U A;  1XG8 A;  4V1A g;  1Y6E A;  2J9H A;  1QXH A;  2DC5 A;  4O92 A;  4ZB9 A;  4IBP A;  1LU4 A;  3WT2 A;  1ERV A;  3HA9 A;  4XS4 B;  4BWS A;  5IOW A;  6GSX A;  2GGT A;  2GSR A;  3RGB C;  2LJK A;  4K0G A;  4XRA A;  2GST A;  4MH3 A;  2VM2 A;  2YWO A;  4WR4 A;  2B3S A;  1ZL9 A;  3DYR A;  3FKF A;  5IMZ A;  2HRA A;  3GMF A;  19GS A;  2VCQ A;  3IC4 A;  3UVT A;  2YWN A;  4MJB A;  5FT3 A;  3QDN A;  4WKW A;  1GSU A;  4ZBA A;  2PWJ A;  1TOF A;  4TR1 B;  3L9V A;  3MNG A;  5B7C A;  3V1W A;  1K0A A;  3GH6 A;  3DEX A;  5H5R A;  3GUS A;  5LNK e;  2XPE A;  2VL3 A;  1GTA A;  5LD0 A;  5ECI B;  4EVM A;  1O7U A;  1URM A;  5E59 A;  1GSS A;  2V6K A;  2YJ7 A;  1O6J A;  3GST A;  3VWU A;  4K9Z A;  2VCT A;  1MDI A;  3MSZ A;  4P3Y B;  1T1V A;  1R26 A;  1VF4 A;  1V58 A;  3VPQ A;  2R37 A;  4BVX A;  2TIR A;  5HFI A;  5ECS A;  4G0I A;  3VLN A;  3CSH A;  3P90 A;  1TI3 A;  3KMN A;  4MH2 A;  1GUH A;  4NV2 A;  3E9J B;  1K3O A;  5D9W A;  3RPN A;  4KH7 A;  4GXZ A;  2WRT A;  1GSD A;  2GLR A;  3F8U A;  2LRC A;  1EGO A;  1PSQ A;  1MD4 A;  5J4U A;  4Q5R A;  2EIQ A;  2MZC A;  2WW1 A;  4DSS B;  1YY7 A;  5F8B A;  4Z7X A;  1Z5Y E;  4XIH A;  2MBT A;  3RPP A;  3EPT A;  1SL1 B;  4F9Z A;  2OA7 A;  4F2I A;  1V2A A;  4K8M A;  3M1G A;  1O73 A;  1H4O A;  2H66 A;  2MMO A;  3TKS A;  2EFE A;  4KCE A;  4LMV A;  2O8V B;  5BMU A;  1PD2 1;  1QFN A;  4MNN A;  1YJ6 A;  3GKM A;  4GSN A;  3IV4 A;  1Z6M A;  4J2F A;  3KP8 A;  4L8E A;  1UN2 A;  3GUR A;  1AW9 A;  4L5L A;  4J56 E;  5JCG A;  4OO4 A;  5FWG A;  3H1N A;  1ERU A;  4PX1 A;  2CZ3 A;  4ILF A;  1R4W A;  2IPA A;  1TXU A;  3LJR A;  4G0K A;  3I9V 2;  1I1I P;  3IR4 A;  3LYP A;  2AHE A;  2OAC A;  8GSS A;  2R0G A;  3IXR A;  4X1U A;  5J47 A;  4MF5 A;  2B1L A;  1PA3 A;  3QAV A;  5F0G A;  5AIV A;  1EEJ A;  5DDL A;  4KW6 A;  3EU4 A;  1SU9 A;  3I69 A;  3ZML A;  1BYE A;  4DEJ A;  2ON7 A;  1T7P B;  1EV9 A;  3QPM A;  3RFR C;  2MYG A;  1EZK A;  4PI0 C;  4EDZ A;  1XXU A;  4TN8 A;  2ALB A;  1B8X A;  4G9H A;  5F06 A;  2I3Y A;  3TRQ A;  1R5A A;  3F4R A;  1CQH A;  2L4Q A;  4POK A;  1H75 A;  3TOU A;  2HSM A;  1A23 A;  4HSC X;  4W66 A;  4MZC A;  4AKX B;  2QA1 A;  2PVO C;  3L9S A;  5EPF A;  2WJU A;  3GV1 A;  4QMK A;  6GSW A;  2WCI A;  2QA2 A;  2XBI A;  4MA9 A;  2O89 A;  3QOU A;  4FIW A;  2LJA A;  2HRF A;  5J5N A;  1X9M B;  2CVK A;  3FZ4 A;  1SKS B;  5DJM A;  5ABR A;  4BPY A;  2AUV A;  1M2B A;  5ID2 A;  1SL2 B;  4PUF C;  1J0F A;  3BCK A;  1SJZ A;  3R3E A;  4DSR A;  4NV5 A;  4ZBB A;  4HU7 A;  3ZLP A;  1JLV A;  1T3B A;  2OKA A;  3FR6 A;  4N11 A;  5FHI A;  3ZMK A;  2WW3 A;  2IJY A;  10GS A;  2CX3 A;  3HVV A;  2LV3 A;  2CVD A;  3DXB A;  5DAK A;  1BF5 A;  4K5S A;  2LTK A;  3LEF A;  1U3A A;  4OWY A;  1SK1 A;  2HT9 A;  4OO5 A;  1TK8 B;  2F8F A;  3VWW A;  4KGI A;  4BVX B;  5CP1 A;  3CYN A;  2VCX A;  4L0W A;  1GNW A;  4KF9 A;  3E3E A;  2DJ2 A;  2GSQ A;  2K6V A;  4OFN A;  1T00 A;  3O6T A;  1YKA A;  2OBI A;  4GQC A;  3D4T A;  3TJG A;  3TJF A;  3MIX A;  1I9D A;  2H6Y A;  5GAN D;  1GSQ A;  2VL9 A;  5DBQ A;  2GZY A;  2G0F A;  2OE1 A;  3KGK A;  3DVX A;  3L0H A;  5IPH A;  2GDR A;  4K7I A;  3FK8 A;  1C72 A;  1UVZ A;  1MDK A;  1NM3 A;  1SEN A;  1Z3E A;  5G30 A;  2GTU A;  5KOX A;  1E6B A;  3R2Q A;  3D22 A;  5BMU B;  3GSS A;  3LOR A;  4GSS A;  4AF2 A;  3I43 A;  4HDE A;  4I2U A;  3J7Y b;  2WUL A;  2BMX A;  1M7T A;  5D93 A;  2H01 A;  4MZB A;  5COH A;  3KTB A;  3EE2 A;  4MAB A;  1K0M A;  4PQ1 A;  2K9F A;  1SKW B;  1FAA A;  1PX7 A;  1EOH A;  2HSH A;  2QSI A;  1S4B P;  1F9M A;  1PX6 A;  2O36 A;  1QK8 A;  2L5O A;  1E2Y A;  1O8X A;  4XCS A;  1FW1 A;  3D5J A;  4FQU A;  4CY8 A;  5IM9 A;  2R6K A;  22GS A;  9GSS A;  4IP6 A;  3TDG A;  17GS A;  1ON4 A;  2H71 A;  3UOM A;  3D0Z A;  4AKG A;  3K8N A;  3GKX A;  2P5R A;  4CW9 A;  2WW2 A;  1SK0 A;  4IQA A;  3IK9 A;  3ZIJ A;  1OYJ A;  3IDV A;  1PN9 A;  1BED A;  2HSY A;  3GNJ A;  2DIY A;  3H4K A;  4TKY A;  4F0C A;  1X9W B;  3UVH A;  2IMD A;  4AJ8 A;  1QUW A;  3IRA A;  3VPT A;  3KMO A;  2DKH A;  1GL8 A;  2HSM B;  2EC4 A;  2HRN A;  1TJD A;  4O7H A;  20GS A;  3TCO A;  2D2Z A;  2AV4 A;  4OCF A;  5CNW A;  2O5V A;  3CSI A;  4E8E A;  2PUK C;  1XBS A;  2CA8 A;  3G7I A;  4Z2R A;  4KCA A;  5ID2 B;  2C0G A;  1EP8 A;  2H76 A;  3TRP A;  2IMI A;  1EP7 A;  2C0D A;  4IQ1 A;  1S3D A;  3GX8 A;  1TRS A;  1KNG A;  3BJ5 A;  4HU9 A;  3ZIV A;  2FGX A;  1TRV A;  1GRX A;  4V1A p;  2TRX A;  1FOV A;  3LW9 A;  1S3C A;  3N5O A;  2EFH A;  2CAQ A;  2VLV A;  5DAK B;  5A5K A;  3A5W A;  3UMA A;  4G10 A;  3UBL A;  4J57 E;  3I6A A;  3WGX A;  3HVS A;  4PI2 C;  3G9B A;  3HMJ G;  1XWK A;  3NIV A;  1OC8 A;  3F63 A;  2RLI A;  1TW9 A;  2M72 A;  3PR8 A;  1SVL A;  4K5R A;  5CYY A;  4Z2U A;  3VI5 A;  1QMV A;  4N30 A;  3HHV A;  5J4Y A;  3ZRD A;  4YQU A;  1M99 A;  1MEK A;  2YWM A;  4MF7 A;  5ECN B;  2GQM A;  2X8G A;  3LGC A;  5D9T A;  3W6G A;  1TKD B;  4HS1 A;  3HCZ A;  4L0U A;  2GZP A;  1X9S B;  1T4Y A;  3IHQ A;  1N25 A;  2DLX A;  2DJK A;  2DMM A;  1LJR A;  4EXJ A;  6GSS A;  2FWH A;  3IK7 A;  3M0F A;  1ERW A;  1TTZ A;  2FA8 A;  4PUR A;  4TW5 A;  5IMV A;  1A8L A;  1F3A A;  1G6Y A;  3QD9 A;  5AN1 A;  4KA0 A;  3TJK A;  2GSS A;  2DIZ A;  1Y1U A;  2X8C A;  4O32 A;  2N5A A;  2NPB A;  2H70 A;  1BQ7 A;  2L4C A;  3M9J A;  2LRN A;  4MPG A;  1SYR A;  3MAK A;  2I1U A;  1ZZY A;  1Z9H A;  2H1B A;  2VL2 A;  3HJP A;  1Z7P A;  1XW6 A;  4YAP A;  3F6D A;  3EU3 A;  2QKE A;  4ML1 A;  1U88 A;  5ECQ B;  2H73 A;  1BJX A;  4XS1 A;  4HOJ A;  5J40 A;  1PN0 A;  2LS5 A;  3CXG A;  4FH8 A;  3C71 A;  4GTU A;  2A2S A;  3ZRE A;  3F4T A;  3VWV A;  1SK2 A;  1JLW A;  1N8J A;  3HZ8 A;  1S3R A;  4MJA A;  4BIK A;  4EE0 A;  1HNA A;  2IL3 A;  3GTU A;  2GQK A;  5A34 A;  2FWE A;  4NMU A;  1B48 A;  1M9B A;  2GS3 A;  5IMD A;  1M0U A;  4ML6 A;  1OAZ A;  4PQI A;  1YZX A;  3H79 A;  3IHG A;  3TU3 B;  2GT5 A;  2E2M A;  1T4Z A;  2FCH A;  4K1F A;  1KBN A;  4L5O A;  1XPV A;  3HKR A;  4USS A;  1TK0 B;  5HR3 A;  3DKS A;  4HI7 A;  3A2X A;  2C3T A;  2HSN A;  2LKU A;  1FO5 A;  3RDW A;  2H1A A;  2C0E A;  3HXS A;  3PIN A;  2LST A;  4RQR A;  1VF1 A;  5IMC A;  4G0L A;  1JHB A;  5IIZ A;  1ILO A;  5DVB A;  4AI6 A;  5INY A;  2FA4 A;  5G31 A;  3D6I A;  3MWH A;  1WRY A;  2L6D A;  5ELA A;  2B6M A;  4F82 A;  1UA5 A;  4KDY A;  3KD0 A;  2DJ0 A;  1ZGN A;  5CRW A;  3FZ5 A;  2CZ2 A;  1M9A A;  1N2A A;  2CQ9 A;  4PXO A;  3F4S A;  3GFK A;  4PHZ C;  1O81 A;  3SBC A;  4ZL7 A;  2A2R A;  2HZE B;  3ZFB A;  1A2L A;  2FHE A;  3MDK A;  3CSJ A;  5CAX A;  1OKD A;  1JZD A;  3QR6 A;  5ECR B;  1TU8 A;  2HZF A;  3AY8 A;  1NHO A;  4MPF A;  2ES7 A;  3F6F A;  1V57 A;  5EVO A;  1DE1 A;  2PER A;  3VI7 A;  3UAR A;  4G2E A;  3RBT A;  4I97 A;  5EY6 A;  1TXX A;  1ACV A;  1GLP A;  2P31 A;  5DQS A;  2A2P A;  5KEJ A;  2CV4 A;  4AJ7 A;  1YEW C;  1X5C A;  1HD2 A;  3ZVJ D;  2L59 A;  3BD2 A;  1XW9 A;  1TI1 A;  4ECI A;  1AXD A;  4ZBD A;  4GST A;  6GSU A;  5F07 A;  2YWI A;  4XHM A;  2B5Y A;  2H72 A;  4MP4 A;  5CRE A;  2NDO A;  1GTI A;  4HJ2 A;  2EFC A;  2HYX A;  1NSW A;  13GS A;  2DJJ A;  4POM A;  2VLU A;  3HVN A;  4KND A;  3P2A A;  2REM A;  4MCU A;  2H6X A;  4IJI A;  4CDO A;  2X64 A;  2IMK A;  2YJH A;  3UEM A;  4NPB A;  1BG5 A;  3TKR A;  3HJO A;  3ERW A;  5KOW A;  2VM1 A;  4MJC A;  4MJE A;  1M2D A;  4HQS A;  2JL4 A;  2F8A A;  3FZA A;  2XC2 A;  1GUM A;  2CAI A;  3WD6 A;  1G0T A;  1SYX A;  4E68 A;  3C7M A;  3DML A;  2K8S A;  5D96 A;  4EL1 A;  3DD3 A;  2EIO A;  3PPU A;  1ZYN A;  3EUR A;  2CVB A;  4BVY A;  2A4V A;  1XWC A;  2VIM A;  5G2Z A;  4QQ7 A;  1SD8 A;  5KN3 A;  4YAV A;  2KP2 A;  3IBH A;  5L71 A;  2VCZ A;  1K0O A;  3HY2 A;  4ZB6 A;  1DBY A;  3GTU B;  3GHA A;  5A34 B;  4YQV A;  4WBR D;  2KOK A;  3QCP A;  4Q5N A;  5AIX A;  1YEX A;  3IE3 A;  2N5F A;  2JZR A;  2BTO T;  1XFL A;  5A1N A;  3A3T A;  2C80 A;  3GH9 A;  3CWG A;  1F3B A;  5HR2 A;  2N5B A;  2VAF A;  3ME7 A;  1FVJ A;  2YAN A;  2O85 A;  4JU5 A;  1ML6 A;  4K0N A;  1X5E A;  3TUE A;  2JZS A;  1FG4 A;  4EUY A;  2FWF A;  2H1G A;  5KN0 A;  1AQV A;  3BCI A;  2HSN B;  4POL A;  1JFU A;  1M3I A;  1RK4 A;  3ZIT A;  3GX0 A;  3UIW A;  2RUE A;  4V2M A;  2OT3 A;  3VWX A;  2WVZ A;  4FYC A;  4O5Q A;  3GL3 A;  5B6M A;  2WVY A;  3U5R E;  3A2V A;  2LEG A;  2GVP A;  3ERF A;  4JED A;  3SWL A;  4E8H A;  2DML A;  2HLS A;  3GKN A;  2B5E A;  1B4P A;  2WZ9 A;  3F3Q A;  4WET A;  1IYI A;  1YF1 A;  2KUC A;  3OR5 A;  4AKH A;  1Q98 A;  5G5F A;  3TOT A;  2HRK A;  1X0R A;  4X43 A;  3A5I A;  2PPT A;  3QFA C;  4PUA A;  1R7H A;  1A0R P;  2G2Q A;  4DVC A;  1BG1 A;  6GSY A;  2H1L A;  1EOG A;  1G7O A;  4GLT A;  3W8J A;  1MTC A;  4ECC A;  4FO5 A;  1TDI A;  1GSY A;  4RI7 A;  3ZTL A;  3LYK A;  4F0B A;  2UZ8 A;  2IFQ A;  3IC8 A;  3KCM A;  5DAL A;  3FRC A;  4KSM A;  4OCE A;  2LNS A;  3HZ4 A;  2X49 A;  3FMW A;  4XTS A;  1SKR B;  2LRT A;  5IO2 A;  3UBK A;  1PKZ A;  2B5X A;  4I8B A;  2V6O A;  2OJL A;  3S9F A;  2H75 A;  2FY6 A;  4GWR A;  1FHE A;  1GNE A;  1K3Y A;  1Z7R A;  5C00 A;  4EF0 A;  4LL1 B;  5HR0 A;  3QFB C;  1O8W A;  3U6V A;  2H6Z A;  3EWL A;  4KB3 A;  3QAG A;  1WP0 A;  2NTO A;  2QGV A;  1DE2 A;  1U3I A;  2F3M A;  5GSS A;  3EVI A;  2ON5 A;  4YKG A;  2B7K A;  4ICY A;  3FHK A;  4D73 A;  3C8E A;  1K3L A;  3CQF A;  1SVM A;  2O3E A;  2X8H A;  4CY6 A;  2RM6 A;  1FB0 A;  5J3R A;  3CMI A;  2PU9 C;  2CT6 A;  4POB A;  1A24 A;  4WEY A;  2FLS A;  2YN1 A;  1THO A;  4MMM A;  1A0F A;  2YP6 A;  1AAZ A;  5IMA A;  5JWQ B;  2VUP A;  1SJ6 A;  1ZMA A;  4EIP A;  4MDC A;  4RUV A;  1PKW A;  4JR6 A;  1PL1 A;  2JZT A;  1TP9 A;  1VF2 A;  5DCH A;  4WR5 A;  2HZE A;  4WXT A;  2WZS A;  3WGE A;  2KLX A;  1XCC A;  2K8V A;  1EV4 A;  3LWA A;  5ECM B;  4AGS A;  1KEB A;  4EC0 A;  3ISO A;  3KM6 A;  3D4M A;  4IHU A;  4I5Q A;  4BVY B;  1HNB A;  3KZQ A;  4WF4 A;  4N3Z A;  4YQM A;  3TB2 A;  1OC9 A;  3EC3 A;  4HUA A;  4AJ6 A;  4KUN A;  4O5U A;  5IPG A;  2RUF A;  3KJY A;  3L4N A;  1AQW A;  3LQ7 A;  1V98 A;  12GS A;  4PTS A;  4HJM A;  1YQ1 A;  1TU7 A;  3IPZ A;  1TRW A;  1WOU A;  5A1N B;  3LXT A;  3BOA A;  3RHC A;  2M80 A;  1VRS D;  2I81 A;  3KTL A;  1SJI A;  4EKZ A;  2A4H A;  5JWO B;  14GS A;  2LUS A;  3GIX A;  4CHS A;  2I4A A;  5LCZ A;  1QQ2 A;  2NVL A;  5GZZ B;  4K2D A;  2VCW A;  5JCU A;  3W8S A;  1BX9 A;  1K0N A;  3P8W A;  4NAX A;  2LJR A;  5CRG A;  1F37 A;  3ZVJ A;  3NZN A;  4OMV A;  3APS A;  4ECB A;  3TKS E;  2XBQ A;  2H0I A;  5ELG A;  2HNL A;  4BL7 A;  2I9H A;  3E0U A;  2JU5 A;  3WGD A;  5CO3 A;  1S3A A;  2VLT A;  1JZO A;  5GAP D;  4K6X A;  4GCI A;  3APO A;  2CX4 A;  2MBS A;  1MD3 A;  1G7E A;  4H86 A;  4ZIJ A;  4JRR A;  1HQO A;  2LNT A;  2HRK B;  3N9J A;  5J9B A;  2WVX A;  4AKI A;  2H19 A;  2V41 A;  5G1K A;  4OFM A;  1TK5 B;  4BWQ A;  1F2E A;  5H5S A;  3EMP A;  3KIJ A;  3NOF A;  2HI7 A;  3UJ1 A;  2AJQ B;  3L78 A;  4IKH A;  4KDU A;  4V2L A;  3ME8 A;  3UL3 A;  1WJK A;  2H1D A;  4NWY A;  2IFQ B;  2C3N A;  5DAL B;  1USB A;  2EIR A;  4JE1 A;  1AC1 A;  1WE0 A;  5D9V A;  1A8Y A;  2V1M A;  4Z2T A;  4LL4 B;  2VKZ G;  3O3T A;  5IO0 A;  3TKS C;  1ZOF A;  5J4V A;  2WDU A;  4V2N A;  2LQO A;  1MDJ A;  1VF3 A;  1O85 A;  4LLR A;  1XVQ A;  1EEM A;  1WPI A;  2AYT A;  3DWV A;  5ECP B;  3FR3 A;  2VD1 A;  3H93 A;  5JCW A;  4GRF A;  5KN2 A;  1J08 A;  1RQM A;  2PVQ A;  5CRD A;  3ED3 A;  5G1L A;  1K0C A;  4TXO A;  2RM5 A;  1FOH A;  2UV8 G;  2JSZ A;  1AUC A;  1DUG A;  4IEL A;  3C73 A;  1VGL A;  3KEB A;  2J23 A;  2PBJ A;  1F6M C;  4BA7 A;  3BBY A;  4D73 B;  3FR9 A;  1YF0 A;  4MZW A;  5G5E A;  3ZZX A;  1XWB A;  1ZYE A;  1GUK A;  4IGJ A;  4WF5 A;  1GH2 A;  2C4J A;  1KTE A;  3EYT A;  2YZU A;  2WS2 A;  5ECH B;  3PGT A;  3J7Y k;  2HE3 A;  2HXK A;  3GA4 A;  3TKQ A;  3C1S A;  2P0G A;  4Q5F A;  2V32 A;  4Q5Q A;  4KX4 A;  3O76 A;  3IOS A;  5CRH A;  3Q19 A;  3KP9 A;  2ZNM A;  3GRX A;  3A2W A;  4X4J A;  2WW0 A;  4QL7 A;  1GWC A;  5F05 A;  1ERT A;  3CTG A;  4MK3 A;  2PN8 A;  1T8E B;  1Y25 A;  1FVK A;  4RQX A;  5A5H A;  4GQF A;  2YV9 A;  3CRT A;  2H0H A;  3APQ A;  4A5P A;  7GSS A;  1OC9 B;  2FNO A;  4KDX A;  3HJM A;  1XVW A;  3DRN A;  2L57 A;  4YH2 A;  2R0P A;  3LG6 A;  1GUL A;  5EL8 A;  2OE0 A;  1M3J A;  3GN3 A;  2R0C A;  2H0G A;  1W4V A;  4LMW A;  1XZO A;  4JZQ A;  4TR0 A;  4QL9 A;  5DCG A;  2WFC A;  3QMX A;  3Q74 A;  3HD5 A;  4EO3 A;  1SD9 A;  3DIE A;  3VK9 A;  5HR1 A;  1B9X C;  2P5Q A;  2K18 A;  1BAY A;  1CQG A;  4K7N A;  2R4V A;  5IQY A;  3FY7 A;  3C1R A;  1OE8 A;  2FWG A;  1RW1 A;  3F9U A;  1PL2 A;  2VO4 A;  3Q18 A;  4IP1 A;  2O7K A;  2JAD A;  1W89 A;  2H8L A;  2FUG 2;  2DSA A;  1DSB A;  2R3X A;  5A4W A;  4IN0 A;  2IME A;  2XPD A;  4BL7 B;  2EFD A;  1M2A A;  1U87 A;  3LSZ A;  4HZ4 A;  1XWA A;  5A4V A;  1ZCP A;  1K0B A;  1XIY A;  4G19 A;  4PNF A;  3IA1 A;  2L6C A;  4RI6 A;  11GS A;  3ZYW A;  1GLQ A;  5IOX A;  1NHY A;  1WWJ A;  2WVX B;  3KXO A;  2ZCT A;  2B1K A;  1GSE A;  4PNG A;  2MMA A;  4N0V A;  1U6T A;  4LA1 A;  1WIK A;  4KSO A;  1PQN A;  4K2X A;  1OVN A;  1GTB A;  5D9X A;  2YPM A;  3VFI A;  6GSV A;  5IMF A;  4TVE A;  4K7O A;  1ST9 A;  2H30 A;  3LXZ A;  3FYG A;  2KP1 A;  4DSQ A;  5AIS A;  1UC7 A;  3DGQ A;  2VOC A;  3D21 A;  2TRC P;  2X99 A;  1EWX A;  1PMT A;  4ZL9 A;  2YCD A;  2WB9 A;  4KE3 A;  3FZ9 A;  2YNX A;  2DJ3 A;  2DBC A;  1YKC A;  2BJX A;  2MMZ A;  2VCV A;  2PMT A;  1PFO A;  1OKT A;  4TXO B;  5BRT A;  4ISD A;  3EMX A;  1PGT A;  4IVF A;  5D73 A;  1YEP A;  2YOI A;  3F3R A;  2E7P A;  4TOP A;  3IAM 2;  2IIY A;  1TRU A;  4ZL8 A;  3FEU A;  2GZZ A;  5B8A A;  1G6W A;  5E4W A;  2JSY A;  3HDC A;  1B4Q A;  3WYW A;  2XHF A;  3DVW A;  4XS4 A;  2OE3 A;  5J9C A;  2MMN A;  4N10 A;  3TGZ A;  1XOB A;  2C8U A;  1X5D A;  4TR4 A;  4HQZ A;  4IS0 A;  4X0X A;  1ZYQ B;  2VD0 A;  3ERG A;  4PGT A;  2GQL A;  2IN3 A;  3GYK A;  1R5P A;  3PH9 A;  4JBB A;  1OC3 A;  3ZL5 A;  4N0Z A;  2R5G A;  5B8B A;  4HEA 2;  5GST A;  2IWT A;  2C3Q A;  3RAZ A;  1XWG A;  2QC7 A;  4TR1 A;  18GS A;  1YDK A;  5C04 A;  3HVX A;  5H5Q A;  3ZFL A;  3VUR A;  3LFL A;  5A5H B;  2NBS A;  3CHX C;  4ZIL A;  5D8I A;  1EGR A;  3CBU A;  2WGR A;  3TRX A;  3US3 A;  3M3M A;  2E0Q A;  3HYP A;  4IJ3 A;  2B7J A;  3G7Y A;  2GT6 A;  4YKF A;  4XRD A;  1OE7 A;  1QGV A;  2ZUP A;  4ID0 A;  5DJL A;  2OAD A;  3Q6O A;  4FYU A;  4ULX A;  5JWR B;  3TKP A;  2FD3 A;  1PRX A;  1SL0 B;  1ABA A;  4MF6 A;  1IYH A;  4FXY P;  2F9S A;  1GP1 A;  3GKK A;  4I6X A;  1LBK A;  3M8N A;  1XW5 A;  5ECL B;  1Q4J A;  2YZH A;  4NHZ A;  1V9W A;  1B9Y C;  1AIU A;  1JZW A;  4ZB8 A;  3CTF A;  4OD7 A;  2AAW A;  1I5G A;  4HZ2 A;  3UAP A;  4NHW A;  4DSS A;  5AGY A;  4XS6 A;  3KH7 A;  1HYU A;  2C0F A; 
#chains in the Genus database with same CATH homology
 1GSF A;  3TJB A;  1GTU A;  3FW2 A;  1J9B A;  3WT1 A;  4TRX A;  3EIN A;  3RHB A;  3KH9 A;  1AQX A;  2HFD A;  4GDF A;  1FB6 A;  1A2J A;  4KAE A;  2C1Y A;  4ZXG A;  4EIQ A;  2X4A A;  4FYB A;  2DKI A;  3MYD A;  5ECO B;  3G7J A;  2YV7 A;  1Z6N A;  4ECJ A;  2O87 A;  4ACS A;  4F03 A;  1NW2 A;  3CRU A;  5ECK B;  3IAS 2;  4GF0 A;  1XOA A;  5B6N A;  2R2J A;  1V40 A;  2AB6 A;  4MLY A;  2LQQ A;  1SVO A;  3H8Q A;  4TR3 A;  3L9U A;  1THX A;  3F0I A;  5DQY A;  4G01 A;  2F51 A;  3QAW A;  4ZB7 A;  5HFG A;  2E2G A;  2V2G A;  2RII A;  2PGT A;  4OFT A;  4PQH A;  2HQT A;  5ENU A;  2JAC A;  16GS A;  3TJJ A;  2OBK A;  1JZR A;  2L5L A;  2M46 A;  3GL5 A;  2IMF A;  2Z9S A;  1A2M A;  1HNC A;  4O5R A;  5J41 A;  4EDY A;  3JCM L;  1ZYP A;  3P7X A;  5HQP A;  4IW9 A;  1WMJ A;  2H74 A;  1YVL A;  4TXV A;  5KN1 A;  2KHP A;  4I2T A;  2DJ1 A;  3M9K A;  4WBJ A;  2VL2 C;  1K0D A;  4NXI A;  4JR4 A;  5HFK A;  6GST A;  5A4U A;  4V1A g;  1Y6E A;  2J9H A;  1QXH A;  2DC5 A;  4O92 A;  4ZB9 A;  4IBP A;  1LU4 A;  3WT2 A;  1ERV A;  3HA9 A;  4XS4 B;  4BWS A;  5IOW A;  6GSX A;  2GGT A;  2GSR A;  2LJK A;  4K0G A;  4XRA A;  2GST A;  4MH3 A;  2VM2 A;  2YWO A;  4WR4 A;  2B3S A;  1ZL9 A;  3DYR A;  3FKF A;  5IMZ A;  2HRA A;  3GMF A;  19GS A;  2VCQ A;  3IC4 A;  3UVT A;  2YWN A;  4MJB A;  5FT3 A;  3QDN A;  4WKW A;  1GSU A;  4ZBA A;  2PWJ A;  1TOF A;  4TR1 B;  3L9V A;  3MNG A;  5B7C A;  3V1W A;  1K0A A;  3GH6 A;  3DEX A;  5H5R A;  3GUS A;  5LNK e;  2XPE A;  2VL3 A;  1GTA A;  5LD0 A;  5ECI B;  4EVM A;  1O7U A;  1URM A;  5E59 A;  1GSS A;  2V6K A;  2YJ7 A;  1O6J A;  3GST A;  3VWU A;  4K9Z A;  2VCT A;  1MDI A;  3MSZ A;  4P3Y B;  1T1V A;  1R26 A;  1VF4 A;  1V58 A;  3VPQ A;  2R37 A;  4BVX A;  2TIR A;  5HFI A;  5ECS A;  4G0I A;  3VLN A;  3CSH A;  3P90 A;  1TI3 A;  3KMN A;  4MH2 A;  1GUH A;  4NV2 A;  3E9J B;  1K3O A;  5D9W A;  3RPN A;  4KH7 A;  4GXZ A;  2WRT A;  1GSD A;  2GLR A;  3F8U A;  2LRC A;  1EGO A;  1PSQ A;  1MD4 A;  5J4U A;  4Q5R A;  2EIQ A;  2MZC A;  4DSS B;  1YY7 A;  5F8B A;  4Z7X A;  1Z5Y E;  4XIH A;  2MBT A;  3RPP A;  3EPT A;  1SL1 B;  4F9Z A;  2OA7 A;  4F2I A;  1V2A A;  4K8M A;  3M1G A;  1O73 A;  1H4O A;  2H66 A;  2MMO A;  3TKS A;  2EFE A;  4KCE A;  4LMV A;  2O8V B;  5BMU A;  1PD2 1;  1QFN A;  4MNN A;  1YJ6 A;  3GKM A;  4GSN A;  3IV4 A;  1Z6M A;  4J2F A;  3KP8 A;  4L8E A;  1UN2 A;  3GUR A;  1AW9 A;  4L5L A;  4J56 E;  5JCG A;  4OO4 A;  5FWG A;  3H1N A;  1ERU A;  4PX1 A;  2CZ3 A;  4ILF A;  1R4W A;  2IPA A;  1TXU A;  3LJR A;  4G0K A;  3I9V 2;  3IR4 A;  3LYP A;  2AHE A;  2OAC A;  8GSS A;  2R0G A;  3IXR A;  4X1U A;  5J47 A;  4MF5 A;  2B1L A;  1PA3 A;  3QAV A;  5F0G A;  5AIV A;  1EEJ A;  5DDL A;  4KW6 A;  3EU4 A;  1SU9 A;  3I69 A;  3ZML A;  1BYE A;  4DEJ A;  2ON7 A;  1T7P B;  1EV9 A;  3QPM A;  2MYG A;  1EZK A;  4EDZ A;  1XXU A;  4TN8 A;  2ALB A;  1B8X A;  4G9H A;  5F06 A;  2I3Y A;  3TRQ A;  1R5A A;  3F4R A;  1CQH A;  2L4Q A;  4POK A;  1H75 A;  3TOU A;  2HSM A;  1A23 A;  4W66 A;  4MZC A;  4AKX B;  2QA1 A;  2PVO C;  3L9S A;  5EPF A;  2WJU A;  3GV1 A;  4QMK A;  6GSW A;  2WCI A;  2QA2 A;  2XBI A;  4MA9 A;  2O89 A;  3QOU A;  4FIW A;  2LJA A;  2HRF A;  5J5N A;  1X9M B;  2CVK A;  3FZ4 A;  1SKS B;  5DJM A;  5ABR A;  4BPY A;  2AUV A;  1M2B A;  5ID2 A;  1SL2 B;  4PUF C;  1J0F A;  3BCK A;  1SJZ A;  3R3E A;  4DSR A;  4NV5 A;  4ZBB A;  4HU7 A;  3ZLP A;  1JLV A;  1T3B A;  2OKA A;  3FR6 A;  4N11 A;  5FHI A;  3ZMK A;  2IJY A;  10GS A;  2CX3 A;  3HVV A;  2LV3 A;  2CVD A;  3DXB A;  5DAK A;  1BF5 A;  4K5S A;  2LTK A;  3LEF A;  1U3A A;  4OWY A;  1SK1 A;  2HT9 A;  4OO5 A;  1TK8 B;  2F8F A;  3VWW A;  4KGI A;  4BVX B;  5CP1 A;  3CYN A;  2VCX A;  4L0W A;  1GNW A;  4KF9 A;  3E3E A;  2DJ2 A;  2GSQ A;  2K6V A;  4OFN A;  1T00 A;  3O6T A;  1YKA A;  2OBI A;  4GQC A;  3D4T A;  3TJG A;  3TJF A;  3MIX A;  1I9D A;  2H6Y A;  5GAN D;  1GSQ A;  2VL9 A;  5DBQ A;  2GZY A;  2G0F A;  2OE1 A;  3KGK A;  3DVX A;  3L0H A;  5IPH A;  2GDR A;  4K7I A;  3FK8 A;  1C72 A;  1UVZ A;  1MDK A;  1NM3 A;  1SEN A;  1Z3E A;  5G30 A;  2GTU A;  5KOX A;  1E6B A;  3R2Q A;  3D22 A;  5BMU B;  3GSS A;  3LOR A;  4GSS A;  4AF2 A;  3I43 A;  4HDE A;  4I2U A;  3J7Y b;  2WUL A;  2BMX A;  1M7T A;  5D93 A;  2H01 A;  4MZB A;  5COH A;  3KTB A;  3EE2 A;  4MAB A;  1K0M A;  4PQ1 A;  2K9F A;  1SKW B;  1FAA A;  1PX7 A;  1EOH A;  2HSH A;  2QSI A;  1F9M A;  1PX6 A;  1QK8 A;  2L5O A;  1E2Y A;  1O8X A;  4XCS A;  1FW1 A;  3D5J A;  4FQU A;  4CY8 A;  5IM9 A;  2R6K A;  22GS A;  9GSS A;  4IP6 A;  3TDG A;  17GS A;  1ON4 A;  2H71 A;  3UOM A;  3D0Z A;  4AKG A;  3K8N A;  3GKX A;  2P5R A;  4CW9 A;  1SK0 A;  4IQA A;  3IK9 A;  3ZIJ A;  1OYJ A;  3IDV A;  1PN9 A;  1BED A;  2HSY A;  3GNJ A;  2DIY A;  3H4K A;  4TKY A;  4F0C A;  1X9W B;  3UVH A;  2IMD A;  4AJ8 A;  1QUW A;  3IRA A;  3VPT A;  3KMO A;  2DKH A;  1GL8 A;  2HSM B;  2EC4 A;  2HRN A;  1TJD A;  4O7H A;  20GS A;  3TCO A;  2D2Z A;  2AV4 A;  4OCF A;  5CNW A;  2O5V A;  3CSI A;  4E8E A;  2PUK C;  1XBS A;  2CA8 A;  3G7I A;  4Z2R A;  4KCA A;  5ID2 B;  2C0G A;  1EP8 A;  2H76 A;  3TRP A;  2IMI A;  1EP7 A;  2C0D A;  4IQ1 A;  1S3D A;  3GX8 A;  1TRS A;  1KNG A;  3BJ5 A;  4HU9 A;  3ZIV A;  2FGX A;  1TRV A;  1GRX A;  4V1A p;  2TRX A;  1FOV A;  3LW9 A;  1S3C A;  3N5O A;  2EFH A;  2CAQ A;  2VLV A;  5DAK B;  5A5K A;  3A5W A;  3UMA A;  4G10 A;  3UBL A;  4J57 E;  3I6A A;  3WGX A;  3HVS A;  3G9B A;  3HMJ G;  1XWK A;  3NIV A;  1OC8 A;  3F63 A;  2RLI A;  1TW9 A;  2M72 A;  3PR8 A;  1SVL A;  4K5R A;  5CYY A;  4Z2U A;  3VI5 A;  1QMV A;  4N30 A;  3HHV A;  5J4Y A;  3ZRD A;  4YQU A;  1M99 A;  1MEK A;  2YWM A;  4MF7 A;  5ECN B;  2GQM A;  2X8G A;  3LGC A;  5D9T A;  3W6G A;  1TKD B;  4HS1 A;  3HCZ A;  4L0U A;  2GZP A;  1X9S B;  1T4Y A;  3IHQ A;  1N25 A;  2DLX A;  2DJK A;  2DMM A;  1LJR A;  4EXJ A;  6GSS A;  2FWH A;  3IK7 A;  3M0F A;  1ERW A;  1TTZ A;  2FA8 A;  4PUR A;  4TW5 A;  5IMV A;  1A8L A;  1F3A A;  1G6Y A;  3QD9 A;  5AN1 A;  4KA0 A;  3TJK A;  2GSS A;  2DIZ A;  1Y1U A;  2X8C A;  4O32 A;  2N5A A;  2NPB A;  2H70 A;  1BQ7 A;  2L4C A;  3M9J A;  2LRN A;  4MPG A;  1SYR A;  3MAK A;  2I1U A;  1ZZY A;  1Z9H A;  2H1B A;  2VL2 A;  3HJP A;  1Z7P A;  1XW6 A;  4YAP A;  3F6D A;  3EU3 A;  2QKE A;  4ML1 A;  1U88 A;  5ECQ B;  2H73 A;  1BJX A;  4XS1 A;  4HOJ A;  5J40 A;  1PN0 A;  2LS5 A;  3CXG A;  4FH8 A;  3C71 A;  4GTU A;  2A2S A;  3ZRE A;  3F4T A;  3VWV A;  1SK2 A;  1JLW A;  1N8J A;  3HZ8 A;  4MJA A;  4EE0 A;  1HNA A;  2IL3 A;  3GTU A;  2GQK A;  5A34 A;  2FWE A;  4NMU A;  1B48 A;  1M9B A;  2GS3 A;  5IMD A;  1M0U A;  4ML6 A;  1OAZ A;  4PQI A;  1YZX A;  3H79 A;  3IHG A;  3TU3 B;  2GT5 A;  2E2M A;  1T4Z A;  2FCH A;  4K1F A;  1KBN A;  4L5O A;  1XPV A;  3HKR A;  4USS A;  1TK0 B;  5HR3 A;  3DKS A;  4HI7 A;  3A2X A;  2C3T A;  2HSN A;  2LKU A;  1FO5 A;  3RDW A;  2H1A A;  2C0E A;  3HXS A;  3PIN A;  2LST A;  4RQR A;  1VF1 A;  5IMC A;  4G0L A;  1JHB A;  5IIZ A;  1ILO A;  5DVB A;  4AI6 A;  5INY A;  2FA4 A;  5G31 A;  3D6I A;  3MWH A;  1WRY A;  2L6D A;  5ELA A;  2B6M A;  4F82 A;  1UA5 A;  4KDY A;  3KD0 A;  2DJ0 A;  1ZGN A;  5CRW A;  3FZ5 A;  2CZ2 A;  1M9A A;  1N2A A;  2CQ9 A;  4PXO A;  3F4S A;  3GFK A;  1O81 A;  3SBC A;  4ZL7 A;  2A2R A;  2HZE B;  3ZFB A;  1A2L A;  2FHE A;  3MDK A;  3CSJ A;  5CAX A;  1OKD A;  1JZD A;  3QR6 A;  5ECR B;  1TU8 A;  2HZF A;  3AY8 A;  1NHO A;  4MPF A;  2ES7 A;  3F6F A;  1V57 A;  5EVO A;  1DE1 A;  2PER A;  3VI7 A;  3UAR A;  4G2E A;  3RBT A;  4I97 A;  5EY6 A;  1TXX A;  1ACV A;  1GLP A;  2P31 A;  5DQS A;  2A2P A;  5KEJ A;  2CV4 A;  4AJ7 A;  1X5C A;  1HD2 A;  3ZVJ D;  2L59 A;  3BD2 A;  1XW9 A;  1TI1 A;  4ECI A;  1AXD A;  4ZBD A;  4GST A;  6GSU A;  5F07 A;  2YWI A;  4XHM A;  2B5Y A;  2H72 A;  4MP4 A;  5CRE A;  2NDO A;  1GTI A;  4HJ2 A;  2EFC A;  2HYX A;  1NSW A;  13GS A;  2DJJ A;  4POM A;  2VLU A;  4KND A;  3P2A A;  2REM A;  4MCU A;  2H6X A;  4IJI A;  4CDO A;  2X64 A;  2IMK A;  2YJH A;  3UEM A;  4NPB A;  1BG5 A;  3TKR A;  3HJO A;  3ERW A;  5KOW A;  2VM1 A;  4MJC A;  4MJE A;  1M2D A;  4HQS A;  2JL4 A;  2F8A A;  3FZA A;  2XC2 A;  1GUM A;  2CAI A;  3WD6 A;  1G0T A;  1SYX A;  4E68 A;  3C7M A;  3DML A;  2K8S A;  5D96 A;  4EL1 A;  3DD3 A;  2EIO A;  3PPU A;  1ZYN A;  3EUR A;  2CVB A;  4BVY A;  2A4V A;  1XWC A;  2VIM A;  5G2Z A;  4QQ7 A;  1SD8 A;  5KN3 A;  4YAV A;  2KP2 A;  3IBH A;  5L71 A;  2VCZ A;  1K0O A;  3HY2 A;  4ZB6 A;  1DBY A;  3GTU B;  3GHA A;  5A34 B;  4YQV A;  4WBR D;  2KOK A;  3QCP A;  4Q5N A;  5AIX A;  1YEX A;  3IE3 A;  2N5F A;  2JZR A;  2BTO T;  1XFL A;  5A1N A;  3A3T A;  2C80 A;  3GH9 A;  3CWG A;  1F3B A;  5HR2 A;  2N5B A;  2VAF A;  3ME7 A;  1FVJ A;  2YAN A;  2O85 A;  4JU5 A;  1ML6 A;  4K0N A;  1X5E A;  3TUE A;  2JZS A;  1FG4 A;  4EUY A;  2FWF A;  2H1G A;  5KN0 A;  1AQV A;  3BCI A;  2HSN B;  4POL A;  1JFU A;  1RK4 A;  3ZIT A;  3GX0 A;  3UIW A;  2RUE A;  4V2M A;  2OT3 A;  3VWX A;  4FYC A;  4O5Q A;  3GL3 A;  5B6M A;  3U5R E;  3A2V A;  2LEG A;  2GVP A;  3ERF A;  4JED A;  3SWL A;  4E8H A;  2DML A;  2HLS A;  3GKN A;  2B5E A;  1B4P A;  2WZ9 A;  3F3Q A;  4WET A;  1IYI A;  1YF1 A;  2KUC A;  3OR5 A;  4AKH A;  1Q98 A;  5G5F A;  3TOT A;  2HRK A;  1X0R A;  4X43 A;  3A5I A;  2PPT A;  3QFA C;  4PUA A;  1R7H A;  1A0R P;  2G2Q A;  4DVC A;  1BG1 A;  6GSY A;  2H1L A;  1EOG A;  1G7O A;  4GLT A;  3W8J A;  1MTC A;  4ECC A;  4FO5 A;  1TDI A;  1GSY A;  4RI7 A;  3ZTL A;  3LYK A;  4F0B A;  2UZ8 A;  2IFQ A;  3IC8 A;  3KCM A;  5DAL A;  3FRC A;  4KSM A;  4OCE A;  2LNS A;  3HZ4 A;  2X49 A;  3FMW A;  4XTS A;  1SKR B;  2LRT A;  5IO2 A;  3UBK A;  1PKZ A;  2B5X A;  4I8B A;  2V6O A;  2OJL A;  3S9F A;  2H75 A;  2FY6 A;  4GWR A;  1FHE A;  1GNE A;  1K3Y A;  1Z7R A;  5C00 A;  4EF0 A;  4LL1 B;  5HR0 A;  3QFB C;  1O8W A;  3U6V A;  2H6Z A;  3EWL A;  4KB3 A;  3QAG A;  1WP0 A;  2NTO A;  2QGV A;  1DE2 A;  1U3I A;  2F3M A;  5GSS A;  3EVI A;  2ON5 A;  4YKG A;  2B7K A;  4ICY A;  3FHK A;  4D73 A;  3C8E A;  1K3L A;  1SVM A;  4CY6 A;  2X8H A;  2RM6 A;  1FB0 A;  5J3R A;  3CMI A;  2PU9 C;  2CT6 A;  4POB A;  1A24 A;  4WEY A;  2FLS A;  2YN1 A;  1THO A;  4MMM A;  1A0F A;  2YP6 A;  1AAZ A;  5IMA A;  5JWQ B;  2VUP A;  1SJ6 A;  1ZMA A;  4EIP A;  4MDC A;  4RUV A;  1PKW A;  4JR6 A;  1PL1 A;  2JZT A;  1TP9 A;  1VF2 A;  5DCH A;  4WR5 A;  2HZE A;  4WXT A;  3WGE A;  2KLX A;  1XCC A;  2K8V A;  1EV4 A;  3LWA A;  5ECM B;  4AGS A;  1KEB A;  4EC0 A;  3ISO A;  3KM6 A;  3D4M A;  4IHU A;  4I5Q A;  4BVY B;  1HNB A;  3KZQ A;  4WF4 A;  4N3Z A;  4YQM A;  3TB2 A;  1OC9 A;  3EC3 A;  4HUA A;  4AJ6 A;  4KUN A;  4O5U A;  5IPG A;  2RUF A;  3KJY A;  3L4N A;  1AQW A;  3LQ7 A;  1V98 A;  12GS A;  4PTS A;  4HJM A;  1YQ1 A;  1TU7 A;  3IPZ A;  1TRW A;  1WOU A;  5A1N B;  3LXT A;  3BOA A;  3RHC A;  2M80 A;  1VRS D;  2I81 A;  3KTL A;  1SJI A;  4EKZ A;  2A4H A;  5JWO B;  14GS A;  2LUS A;  3GIX A;  4CHS A;  2I4A A;  5LCZ A;  1QQ2 A;  2NVL A;  5GZZ B;  4K2D A;  2VCW A;  5JCU A;  3W8S A;  1BX9 A;  1K0N A;  3P8W A;  4NAX A;  2LJR A;  5CRG A;  1F37 A;  3ZVJ A;  3NZN A;  4OMV A;  3APS A;  4ECB A;  3TKS E;  2XBQ A;  2H0I A;  5ELG A;  2HNL A;  4BL7 A;  2I9H A;  3E0U A;  2JU5 A;  3WGD A;  5CO3 A;  1S3A A;  2VLT A;  1JZO A;  5GAP D;  4K6X A;  4GCI A;  3APO A;  2CX4 A;  2MBS A;  1MD3 A;  1G7E A;  4H86 A;  4ZIJ A;  4JRR A;  1HQO A;  2LNT A;  2HRK B;  3N9J A;  5J9B A;  4AKI A;  2H19 A;  2V41 A;  5G1K A;  4OFM A;  1TK5 B;  4BWQ A;  1F2E A;  5H5S A;  3EMP A;  3KIJ A;  3NOF A;  2HI7 A;  3UJ1 A;  2AJQ B;  3L78 A;  4IKH A;  4KDU A;  4V2L A;  3ME8 A;  3UL3 A;  1WJK A;  2H1D A;  4NWY A;  2IFQ B;  2C3N A;  5DAL B;  1USB A;  2EIR A;  4JE1 A;  1AC1 A;  1WE0 A;  5D9V A;  1A8Y A;  2V1M A;  4Z2T A;  4LL4 B;  2VKZ G;  3O3T A;  5IO0 A;  3TKS C;  1ZOF A;  5J4V A;  2WDU A;  4V2N A;  2LQO A;  1MDJ A;  1VF3 A;  1O85 A;  4LLR A;  1XVQ A;  1EEM A;  1WPI A;  2AYT A;  3DWV A;  5ECP B;  3FR3 A;  2VD1 A;  3H93 A;  5JCW A;  4GRF A;  5KN2 A;  1J08 A;  1RQM A;  2PVQ A;  5CRD A;  3ED3 A;  5G1L A;  1K0C A;  4TXO A;  2RM5 A;  1FOH A;  2UV8 G;  2JSZ A;  1AUC A;  1DUG A;  4IEL A;  3C73 A;  1VGL A;  3KEB A;  2J23 A;  2PBJ A;  1F6M C;  4BA7 A;  3BBY A;  4D73 B;  3FR9 A;  1YF0 A;  4MZW A;  5G5E A;  3ZZX A;  1XWB A;  1ZYE A;  1GUK A;  4IGJ A;  4WF5 A;  1GH2 A;  2C4J A;  1KTE A;  3EYT A;  2YZU A;  2WS2 A;  5ECH B;  3PGT A;  3J7Y k;  2HE3 A;  2HXK A;  3GA4 A;  3TKQ A;  3C1S A;  2P0G A;  4Q5F A;  2V32 A;  4Q5Q A;  4KX4 A;  3O76 A;  3IOS A;  5CRH A;  3Q19 A;  3KP9 A;  2ZNM A;  3GRX A;  3A2W A;  4X4J A;  4QL7 A;  1GWC A;  5F05 A;  1ERT A;  3CTG A;  4MK3 A;  2PN8 A;  1T8E B;  1Y25 A;  1FVK A;  4RQX A;  5A5H A;  4GQF A;  2YV9 A;  3CRT A;  2H0H A;  3APQ A;  4A5P A;  7GSS A;  1OC9 B;  2FNO A;  4KDX A;  3HJM A;  1XVW A;  3DRN A;  2L57 A;  4YH2 A;  2R0P A;  3LG6 A;  1GUL A;  5EL8 A;  2OE0 A;  3GN3 A;  2R0C A;  2H0G A;  1W4V A;  4LMW A;  1XZO A;  4JZQ A;  4TR0 A;  4QL9 A;  5DCG A;  2WFC A;  3QMX A;  3Q74 A;  3HD5 A;  4EO3 A;  1SD9 A;  3DIE A;  3VK9 A;  5HR1 A;  1B9X C;  2P5Q A;  2K18 A;  1BAY A;  1CQG A;  4K7N A;  2R4V A;  5IQY A;  3FY7 A;  3C1R A;  1OE8 A;  2FWG A;  1RW1 A;  3F9U A;  1PL2 A;  2VO4 A;  3Q18 A;  4IP1 A;  2O7K A;  2JAD A;  1W89 A;  2H8L A;  2FUG 2;  2DSA A;  1DSB A;  2R3X A;  5A4W A;  4IN0 A;  2IME A;  2XPD A;  4BL7 B;  2EFD A;  1M2A A;  1U87 A;  3LSZ A;  4HZ4 A;  1XWA A;  5A4V A;  1ZCP A;  1K0B A;  1XIY A;  4G19 A;  4PNF A;  3IA1 A;  2L6C A;  4RI6 A;  11GS A;  3ZYW A;  1GLQ A;  5IOX A;  1NHY A;  1WWJ A;  3KXO A;  2ZCT A;  2B1K A;  1GSE A;  4PNG A;  2MMA A;  4N0V A;  1U6T A;  4LA1 A;  1WIK A;  4KSO A;  1PQN A;  4K2X A;  1OVN A;  1GTB A;  5D9X A;  2YPM A;  3VFI A;  6GSV A;  5IMF A;  4TVE A;  4K7O A;  1ST9 A;  2H30 A;  3LXZ A;  3FYG A;  2KP1 A;  4DSQ A;  5AIS A;  1UC7 A;  3DGQ A;  2VOC A;  3D21 A;  2TRC P;  2X99 A;  1EWX A;  1PMT A;  4ZL9 A;  2YCD A;  2WB9 A;  4KE3 A;  3FZ9 A;  2YNX A;  2DJ3 A;  2DBC A;  1YKC A;  2BJX A;  2MMZ A;  2VCV A;  2PMT A;  1OKT A;  4TXO B;  5BRT A;  4ISD A;  3EMX A;  1PGT A;  4IVF A;  5D73 A;  1YEP A;  2YOI A;  3F3R A;  2E7P A;  4TOP A;  3IAM 2;  2IIY A;  1TRU A;  4ZL8 A;  3FEU A;  2GZZ A;  5B8A A;  1G6W A;  5E4W A;  2JSY A;  3HDC A;  1B4Q A;  3WYW A;  2XHF A;  3DVW A;  4XS4 A;  2OE3 A;  5J9C A;  2MMN A;  4N10 A;  3TGZ A;  1XOB A;  2C8U A;  1X5D A;  4TR4 A;  4HQZ A;  4IS0 A;  4X0X A;  1ZYQ B;  2VD0 A;  3ERG A;  4PGT A;  2GQL A;  2IN3 A;  3GYK A;  1R5P A;  3PH9 A;  4JBB A;  1OC3 A;  3ZL5 A;  4N0Z A;  2R5G A;  5B8B A;  4HEA 2;  5GST A;  2IWT A;  2C3Q A;  3RAZ A;  1XWG A;  2QC7 A;  4TR1 A;  18GS A;  1YDK A;  5C04 A;  3HVX A;  5H5Q A;  3ZFL A;  3VUR A;  3LFL A;  5A5H B;  2NBS A;  4ZIL A;  5D8I A;  1EGR A;  3CBU A;  2WGR A;  3TRX A;  3US3 A;  3M3M A;  2E0Q A;  3HYP A;  4IJ3 A;  2B7J A;  3G7Y A;  2GT6 A;  4YKF A;  4XRD A;  1OE7 A;  1QGV A;  2ZUP A;  4ID0 A;  5DJL A;  2OAD A;  3Q6O A;  4FYU A;  4ULX A;  5JWR B;  3TKP A;  2FD3 A;  1PRX A;  1SL0 B;  1ABA A;  4MF6 A;  1IYH A;  2F9S A;  1GP1 A;  3GKK A;  4I6X A;  1LBK A;  3M8N A;  1XW5 A;  5ECL B;  1Q4J A;  2YZH A;  4NHZ A;  1V9W A;  1B9Y C;  1AIU A;  1JZW A;  4ZB8 A;  3CTF A;  4OD7 A;  2AAW A;  1I5G A;  4HZ2 A;  3UAP A;  4NHW A;  4DSS A;  5AGY A;  4XS6 A;  3KH7 A;  1HYU A;  2C0F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...