5EY6A

Crystal structure of glutathione transferase f2 from populus trichocarpa
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
215
structure length
215
Chain Sequence
PVKVYGPPLSTAVSRVLVTLLEKDVPFQIIPVDMSKGEHKKPDYLKIQPFGQVPAFQDESISLFESRSICRYVCEKYADRGDKGLYGTNPLERASIDQWVEAEGQSFGPSSGALVFQLAFAPRMNIPQDQGVIKQNEEKLGKVLDIYEQRLGESRFLAGDEFTFADLSHLPNGDYLVNATDKGHLFTSRENVGRWWNEISDRESWKKVIEMRKSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phi class glutathione transferase GSTF2
publication title Structural plasticity among glutathione transferase Phi members: natural combination of catalytic residues confers dual biochemical activities.
pubmed doi rcsb
source organism Populus trichocarpa
molecule tags Transferase
total genus 82
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2015-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5ey6A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5ey6A01
5H5SA 5GZZB 4OO5A 1XW5A 2HLSA 3V1WA 3IBHA 3QCPA 5IPHA 4BWSA 2E7PA 2DJ2A 2FA8A 4ISDA 4O32A 4FYBA 1UN2A 3QD9A 5FWGA 4PNFA 3C8EA 1W4VA 2KLXA 3ZLPA 5ECQB 1XIYA 2KOKA 4ML6A 3CYNA 1GTAA 1U3AA 4ECBA 4GRFA 5DBQA 1T7PB 3FY7A 4MCUA 4KSOA 3APSA 2LSTA 1AQXA 4GQCA 2K18A 4MJEA 4CDOA 2FY6A 2RUFA 5ECIB 1A24A 1GL8A 3M9KA 1A2LA 2H6YA 2CA8A 1NHYA 1OC8A 1WOUA 3DRNA 3D6IA 1M7TA 2FUG2 1Z6MA 1FO5A 2YWOA 2CVBA 4AJ8A 4MF7A 4BA7A 4XS4A 3A5WA 1FVJA 4I5QA 3L0HA 1K3YA 2N5BA 3ZIJA 4F2IA 2LRNA 2YV9A 3VURA 2IWTA 4TXVA 1ZZYA 1GUKA 2P5QA 1JZRA 5BMUA 3IC8A 4IQ1A 2LJAA 2C3NA 3P7XA 5B7CA 2DJ1A 3HVSA 3VI5A 2H19A 4KW6A 2PN8A 4ZB6A 4XCSA 1K0DA 1JZWA 3O6TA 1R26A 3PR8A 4JZQA 5CO3A 1AC1A 3H1NA 3BCIA 2M80A 2VL3A 5L71A 6GSXA 4YQVA 2XHFA 4ZBBA 5IPGA 1ILOA 3O76A 1XW6A 3PPUA 2FHEA 1W89A 3TJFA 4KA0A 3EINA 1LU4A 4N10A 2B1KA 4EXJA 1MD4A 3SWLA 4BL7A 1SJZA 3IPZA 2V1MA 4NAXA 4WF5A 3KIJA 2C0GA 1WJKA 3GKNA 2FNOA 1O7UA 4V2MA 1Y6EA 1O73A 3NIVA 2CZ3A 4TR4A 4ID0A 1A0FA 1RK4A 3RDWA 5ABRA 1USBA 3MDKA 3M0FA 4ULXA 4I6XA 2IMKA 2P0GA 2H66A 2GSQA 1MDIA 2V6KA 1G0TA 3IDVA 3ZL5A 4AJ7A 3GRXA 3QDNA 2VCVA 5ELAA 4N0ZA 4N11A 2YP6A 5JWQB 2WGRA 3A2WA 4V1Ap 4WR5A 1SL2B 4IJIA 1SYXA 4K1FA 2IN3A 2H72A 4HJMA 2CVDA 2AHEA 1B9XC 3M3MA 4KSMA 2K8SA 3VFIA 4V1Ag 2RM5A 1GSUA 3GUSA 3AY8A 4PTSA 1ZGNA 2BJXA 2DSAA 3FR3A 1EP7A 4YQUA 1I5GA 2IMEA 3G9BA 18GSA 3ZFLA 2WB9A 13GSA 4F82A 3LQ7A 3ZMLA 2R37A 1T3BA 4HQZA 2GLRA 1EOGA 4IGJA 4EC0A 5GAPD 4IP6A 3ME7A 5F06A 2H6XA 5F8BA 3GIXA 4WETA 1A23A 2JSYA 3PH9A 1M9AA 4FYCA 4IP1A 4XS1A 3KM6A 1C72A 1A0RP 1GUHA 1BAYA 3MNGA 1SKSB 2WDUA 2LS5A 1K0NA 1EOHA 3HDCA 2IPAA 1MD3A 4EL1A 1WIKA 2YV7A 2X64A 1B48A 2V2GA 1GLQA 3TKSE 2C3TA 4F9ZA 4OFMA 1BJXA 5JCUA 2LQOA 3GV1A 2WS2A 4K9ZA 3L78A 1E6BA 4MJAA 4KF9A 1EP8A 4NXIA 1VF2A 3QMXA 2KHPA 2OE1A 4RUVA 4HU9A 16GSA 3MSZA 4POLA 1PSQA 1M2DA 3GTUA 4POBA 2P31A 4ZB9A 5KN1A 5HFIA 3LWAA 5CP1A 4GWRA 3J7Yb 4OO4A 5B8AA 2E2GA 5G5FA 4BPYA 5AIXA 3CBUA 2IMFA 1NM3A 3TB2A 4PQIA 2CT6A 5D73A 1ON4A 3ZITA 4F0CA 4IELA 8GSSA 6GSTA 3WT1A 2OACA 2VOCA 2IMIA 1GNWA 2VM1A 3H8QA 5HFKA 1PMTA 2PUKC 3D22A 5A4WA 2C80A 5KN2A 1SYRA 3ZVJD 2YOIA 2UZ8A 3HVVA 4IQAA 1SU9A 1LBKA 3GX8A 1ZCPA 4RQXA 1SK0A 5G2ZA 1PX6A 3SBCA 5F05A 2WFCA 1YEPA 5IMCA 1A2JA 4KH7A 1THXA 2HSNB 2X99A 4NPBA 4I8BA 5J4UA 5ECOB 4OFNA 3QFAC 3R3EA 1QMVA 4ZBAA 3EMPA 4JU5A 3DKSA 5ECLB 3UEMA 2GZZA 3QPMA 3F4SA 1OAZA 2HXKA 4TR3A 1DUGA 4WR4A 4TR0A 4KDXA 1T4YA 3BJ5A 4XIHA 1BQ7A 2H30A 3DEXA 3QOUA 4MZWA 1S3CA 4G0KA 3IK9A 3NOFA 3L9UA 3EC3A 2PMTA 2VAFA 1SD9A 2EIRA 2DLXA 4TXOB 1YF1A 5GSSA 2PBJA 2CVKA 3CSJA 4KX4A 1PX7A 2AB6A 3FZAA 3IRAA 3TDGA 1GSYA 1R5AA 4IW9A 1TU7A 1HQOA 1AXDA 3I9V2 2VCWA 4MPFA 5AIVA 2WJUA 2GZYA 2I1UA 1Z5YE 3ERGA 2AJQB 1TXXA 1WRYA 4G0IA 1XOAA 5G30A 5CNWA 3VPTA 3IXRA 2QSIA 3WGEA 1GP1A 3VLNA 2GDRA 4L8EA 4X1UA 4P3YB 2LKUA 3GFKA 1KEBA 4DSQA 2K9FA 2H1AA 3CRUA 4QQ7A 4HZ2A 3N9JA 3IHQA 4RI7A 1HYUA 3OR5A 5AGYA 3P2AA 2VD1A 1XWAA 3LGCA 3MAKA 5ECKB 3KP9A 3EMXA 5ECHB 4OCFA 1ZYQB 1U88A 6GSVA 3TOUA 2KP1A 2FWFA 4GXZA 4WF4A 2I9HA 1YEXA 2DIZA 1B4PA 5ECMB 1G6YA 2VL9A 2HSMB 4Q5FA 4EE0A 1V58A 3GH9A 3F9UA 2L4CA 1G7EA 10GSA 3M8NA 1K0CA 3G7JA 4HZ4A 2YWMA 3ZFBA 3UVTA 4MMMA 5INYA 1O85A 4V2LA 2J9HA 4GSTA 2YJHA 4EKZA 3LXZA 1SK1A 1X5DA 4F03A 3CTFA 3GYKA 1JLVA 1VF4A 2HRKB 1XXUA 2EIQA 5IMVA 4BVYA 5ECNB 1QXHA 4K7NA 2LJKA 1OC9A 3QFBC 2NDOA 5IMFA 1N2AA 4ZIJA 5B8BA 2X8GA 3GA4A 3EU4A 1EV4A 1M2BA 4ECCA 1AIUA 2YANA 2X8CA 14GSA 4KDUA 1EZKA 1NHOA 1S3AA 2WRTA 1TRWA 2GSRA 3HCZA 3E0UA 5J9CA 1GLPA 5A5KA 3ERFA 2XBIA 1F3AA 5E59A 2H76A 2A2SA 1O8XA 2DJ0A 4ECJA 4LL1B 3TJGA 4JR6A 3TCOA 2QGVA 3CTGA 2PVOC 1JHBA 1G7OA 2L6CA 1K0AA 3IK7A 2C0DA 3FKFA 3FR6A 3I43A 2I4AA 2LTKA 2QC7A 4ML1A 3UL3A 2OJLA 4BVXB 1V9WA 2JZTA 3FZ4A 2WULA 3DIEA 4OWYA 1PQNA 3KMOA 4HDEA 3KMNA 3ZZXA 3TOTA 1ERVA 3FRCA 2HRNA 1SJIA 4KE3A 3UVHA 3KGKA 2OBKA 3IC4A 3F3RA 1F3BA 4TR1B 2YZHA 3E3EA 1OC3A 2CX3A 2HZEB 4GSNA 5JWOB 4USSA 3NZNA 2YN1A 4KUNA 3UBLA 1PA3A 4YH2A 2L6DA 4HS1A 2GVPA 1XWKA 5D8IA 1JLWA 4E8EA 1ML6A 2QKEA 1HD2A 3EVIA 1TK0B 5HR0A 1YKCA 3UJ1A 1GSSA 4MJCA 2VL2A 1SKWB 3KTLA 2HZFA 2O87A 3TKRA 1FW1A 3GNJA 1CQGA 1M99A 3LFLA 12GSA 1DSBA 5F07A 2MYGA 4WBRD 3G7YA 4XRAA 1X9MB 4ZL8A 4PQHA 3HXSA 4V2NA 1QUWA 1PL2A 5DAKB 2FWEA 5HR2A 2ALBA 4PUFC 1U6TA 5DVBA 3IOSA 2V32A 2H74A 2O8VB 5DCHA 4YAPA 6GSYA 4TVEA 1H75A 2GT5A 2HYXA 5HR3A 2DC5A 3BCKA 2R3XA 4IHUA 4Q5RA 4L5OA 3F4TA 3HZ8A 3GKXA 2PPTA 3HJPA 3HJMA 1HNBA 2O7KA 1O8WA 3ZREA 3APOA 4L0UA 2ES7A 2X8HA 1V2AA 1AW9A 5HFGA 5ID2A 2A4VA 2BMXA 3LYPA 2GS3A 2B7KA 3C1SA 1QFNA 1XCCA 3MWHA 3GL3A 3KEBA 1T4ZA 1XW9A 1GTBA 2WZ9A 2GZPA 2L59A 4KB3A 3ZYWA 2R6KA 2DJKA 1A2MA 2JL4A 4JRRA 4GLTA 1OE8A 4PQ1A 2PVQA 3ZMKA 4JEDA 4RI6A 4KNDA 3GL5A 2OADA 3HVXA 3C1RA 1K0OA 1TI3A 4OMVA 2V41A 3IV4A 2IFQB 2OBIA 2MMZA 4PGTA 4I2TA 3WT2A 4EVMA 3CXGA 5E4WA 5IO0A 4O5RA 4GSSA 2ON5A 5C04A 4LLRA 3UAPA 2IMDA 3P90A 4BWQA 1B8XA 3VK9A 1GSDA 5DALB 3US3A 1YJ6A 4O7HA 5COHA 3GX0A 1HNCA 1X0RA 1ERWA 3PGTA 4H86A 1A8YA 2KP2A 1SKRB 5IO2A 1ZOFA 4K0NA 3TKQA 4Z7XA 3IAM2 2V6OA 4EF0A 1NW2A 1U3IA 1G6WA 4PNGA 4DSRA 3RPPA 4NMUA 1TTZA 4L5LA 1T8EB 4TW5A 2NPBA 2JSZA 6GSUA 3FR9A 3LSZA 1URMA 1Y25A 4AF2A 4DSSB 4ZBDA 4LA1A 4WEYA 2FWGA 4XS6A 4JR4A 1YKAA 1F6MC 4MLYA 3HY2A 1Z7RA 2HRAA 3GN3A 4D73B 3A2XA 2REMA 2FD3A 1J08A 2G2QA 4E8HA 5LCZA 4HEA2 2FCHA 1Q4JA 4L0WA 2VL2C 5CYYA 2YZUA 3KP8A 2C1YA 1TK8B 1XVQA 6GSSA 1R4WA 2H8LA 1TW9A 3FW2A 3N5OA 1IYIA 5IM9A 1ABAA 20GSA 1F2EA 5FT3A 2GQLA 3BOAA 2B5XA 1WWJA 3LG6A 5DDLA 2XBQA 2LEGA 3VWWA 3EE2A 3KH9A 3GURA 4IVFA 1FAAA 2H73A 5D93A 5HQPA 2JZSA 2H1BA 5H5RA 4OFTA 1J9BA 1OKTA 2MZCA 2A2RA 1OYJA 5IIZA 4KDYA 5HR1A 3QR6A 1TOFA 3HJOA 4J57E 3LYKA 1PN9A 1YF0A 2P5RA 1K3OA 2VO4A 5FHIA 7GSSA 4MZBA 3P8WA 3FZ9A 1GSEA 2LRTA 3W8JA 1S3DA 4AJ6A 5D96A 1YZXA 4MPGA 3WD6A 5D9VA 3GKMA 3UARA 2B6MA 1FG4A 4X43A 4FO5A 5AN1A 3UOMA 3S9FA 2GT6A 2MMAA 3BBYA 2B1LA 4GF0A 2FWHA 1UA5A 3D0ZA 4JBBA 1EEJA 3VPQA 1OE7A 2WCIA 3APQA 2VD0A 4MJBA 1I9DA 3E9JB 4K0GA 2DJJA 4HI7A 3H4KA 3L4NA 4WXTA 5DCGA 1B4QA 5DJMA 4XS4B 2R5GA 2JADA 2D2ZA 2G0FA 2ZNMA 3CRTA 3U6VA 2ZUPA 1DBYA 4XHMA 1OVNA 2C4JA 2CX4A 4EUYA 1SL0B 4N30A 3Q6OA 2B7JA 4ZL9A 4IJ3A 2VUPA 3DMLA 4PUAA 4K7OA 2CAQA 3FK8A 1PRXA 1MDKA 1VGLA 1T00A 1UVZA 2YPMA 2FA4A 2HQTA 4F0BA 3KH7A 2H0GA 1TRUA 1R7HA 2IIYA 1TRSA 3ERWA 1GSFA 5JCWA 1M9BA 1ZMAA 3Q74A 4OD7A 3GH6A 4MF5A 4KCAA 2AAWA 2L5LA 2N5FA 1KTEA 1F37A 5IQYA 3WGXA 1MEKA 4ECIA 1TKDB 2F8FA 19GSA 2VCTA 5B6NA 3W6GA 4YAVA 3UIWA 2HSHA 2HI7A 4MF6A 1M0UA 1EGRA 4BL7B 2MMNA 3C7MA 4MZCA 4Q5QA 1XBSA 2GQMA 3Q18A 2B5YA 5J3RA 1EEMA 2KUCA 5CRWA 4MH2A 2B3SA 2GSSA 1SENA 4MABA 2DJ3A 2E2MA 2XPEA 4ZL7A 1JZDA 4TXOA 1OKDA 1R5PA 4J56E 3UMAA 17GSA 2OE3A 1SL1B 4PURA 2E0QA 4HUAA 4OCEA 3DGQA 3M9JA 5GAND 1WMJA 2L57A 2HE3A 2AV4A 2OKAA 1PKWA 2PU9C 1VF3A 1TRVA 2M72A 3CSIA 2B5EA 2FGXA 3TKSA 1SK2A 1X9SB 3HHVA 4ZILA 2K8VA 1GULA 5DJLA 3EWLA 3ZTLA 5EVOA 1LJRA 4IS0A 2HRFA 1X5EA 5JCGA 1VF1A 3H93A 2TIRA 5KN3A 1GTUA 2MMOA 2H01A 5ID2B 1Z7PA 2F51A 1GH2A 1T1VA 4XTSA 5DQSA 4K8MA 3RPNA 2RUEA 4XRDA 2L5OA 3FEUA 2R4VA 1PL1A 3LXTA 4MA9A 3HA9A 3DVWA 4CW9A 1YQ1A 2HSMA 4POMA 3KTBA 1EGOA 5A4UA 5B6MA 2ZCTA 1N8JA 5EL8A 4JE1A 3F6FA 1TU8A 4K6XA 4GCIA 2CAIA 1PD21 2JACA 5G1LA 1GRXA 4G2EA 5KEJA 1XFLA 3FZ5A 2LRCA 3TRQA 5AISA 1XZOA 1QQ2A 3DD3A 1RQMA 1NSWA 3VWXA 1VRSD 5IMAA 1YY7A 1X9WB 2HRKA 3D4TA 3TJKA 2DBCA 11GSA 2VLTA 3ZRDA 4EDYA 5D9WA 3IA1A 3O3TA 1WPIA 4KCEA 2H71A 2O85A 2HSYA 1V57A 2LNTA 3H79A 2VIMA 1J0FA 2I3YA 3VWUA 4GQFA 4IKHA 1GWCA 4EO3A 3FYGA 3LEFA 3I69A 4FYUA 3C73A 3ED3A 4MK3A 2GTUA 2CQ9A 2H0HA 1ST9A 3GTUB 5A4VA 2H6ZA 5IMDA 1XOBA 1EWXA 1TJDA 2H1GA 2MBSA 2LUSA 4K7IA 1KNGA 2H0IA 3ZVJA 2GSTA 1ZL9A 4X0XA 4YQMA 1GTIA 3RBTA 3W8SA 5D9TA 3R2QA 4POKA 1AAZA 5J41A 3C71A 4O92A 3FHKA 4IN0A 1THOA 2YWIA 3DWVA 4AGSA 1XVWA 3DVXA 4BVXA 3TJJA 1SJ6A 3TJBA 3DYRA 4J2FA 3KCMA 1FB0A 5G31A 3L9SA 5GSTA 3GSTA 5ECSA 2HFDA 1IYHA 2LNSA 2C3QA 5IOXA 1DE1A 2XPDA 5G5EA 3VWVA 1JZOA 1XPVA 4N0VA 1Z6NA 2YWNA 4TR1A 3JCML 1BX9A 5ENUA 3D5JA 4MH3A 1M2AA 2HZEA 1BEDA 1V98A 2NBSA 3D4MA 3TKSC 4HOJA 1WP0A 2H75A 1O81A 3ISOA 2L4QA 3IAS2 1FB6A 3RHBA 5CAXA 2VLVA 2R2JA 1BG5A 1Z9HA 2PERA 1B9YC 2J23A 5EY6A 3G7IA 2YNXA 1K0BA 4KAEA 3K8NA 4MP4A 2OE0A 1MDJA 3HZ4A 4LMVA 1K0MA 3J7Yk 1X5CA 4LMWA 3Q19A 5F0GA 3I6AA 3F3QA 3BD2A 3KXOA 2OA7A 2N5AA 5DAKA 1V40A 2K6VA 3EU3A 1GSQA 4FIWA 5ECPB 3ZIVA 1U87A 3IE3A 3QAGA 6GSWA 2YCDA 4ZXGA 1XWCA 1O6JA 1BYEA 1WE0A 1RW1A 4ACSA 1JFUA 4DEJA 1H4OA 9GSSA 2VLUA 3CSHA 1TDIA 4QL9A 3F4RA 3F63A 4FH8A 3TGZA 2RLIA 3QAWA 2Z9SA 4I97A 4G10A 4PXOA 4HJ2A 3HKRA 4PX1A 2F3MA 3A3TA 4FQUA 5CRGA 5IOWA 4HQSA 1ERUA 3TUEA 3GHAA 3GKKA 2EC4A 5CREA 4I2UA 2I81A 2CZ2A 3PINA 2EIOA 1ZYEA 2VCZA 2DMMA 3F8UA 2CV4A 3DXBA 4QL7A 1SD8A 1Z3EA 4NHZA 5ELGA 2JZRA 2H1DA 2F8AA 3WYWA 2JU5A 3EURA 1QK8A 2AYTA 5DQYA 3CMIA 1K3LA 1XWBA 3LJRA 1DE2A 3GSSA 2LQQA 3LORA 4ZB8A 3TRXA 1AQVA 4WBJA 5KN0A 3RHCA 3TKPA 3GMFA 2XC2A 3F6DA 2IFQA 1XWGA 3QAVA 3L9VA 3U5RE 2YJ7A 2PWJA 4TOPA 3VI7A 2IL3A 3HYPA 2PGTA 5JWRB 4TN8A 5C00A 22GSA 3RAZA 5IMZA 4K2DA 2IJYA 4RQRA 4HU7A 3A2VA 1HNAA 2GQKA 4BVYB 1KBNA 5CRDA 2NTOA 1OC9B 5DALA 2BTOT 2M46A 3HD5A 3UBKA 4LL4B 1UC7A 4IBPA 5D9XA 5G1KA 2LV3A 3ME8A 4TKYA 1AUCA 1AQWA 2VCXA 4G9HA 4CHSA 2FLSA 2RIIA 1PGTA 2C0EA 3WGDA 1F9MA 2C8UA 4WKWA 4NV5A 5J5NA 4NV2A 3KZQA 1EV9A 2VCQA 4TRXA 1TP9A 4NHWA 4MDCA 4DSSA 1PKZA 5LD0A 1TK5B 2AUVA 4G0LA 1ERTA 5CRHA 2F9SA 2DIYA 1YDKA 2MBTA 3IR4A 5J9BA 1FOVA 4D73A 1Q98A 3KJYA 4ILFA 3M1GA 2TRXA 2HT9A 4GTUA 5LNKe 2RM6A 1A8LA 2ON7A 4Q5NA 1FVKA 2H70A 5EPFA 1GUMA 2HNLA 3D21A 4DVCA 2VM2A 5ECRB 1ACVA 1TI1A 2GGTA 2O89A 5H5QA 1CQHA 2TRCP 4NWYA 1E2YA 4EDZA 2C0FA 1QGVA 3EYTA 2DMLA 1FHEA 2LJRA 1MTCA 4KGIA 2NVLA 4G19A 1GNEA 3F0IA 3KD0A 3TRPA
chains in the Genus database with same CATH superfamily
5H5SA 5GZZB 4OO5A 5BRTA 1XW5A 2HLSA 3V1WA 3IBHA 3QCPA 5IPHA 4BWSA 2E7PA 4G01A 2DJ2A 2FA8A 4ISDA 4O32A 4FYBA 1UN2A 3QD9A 5FWGA 4PNFA 5J4VA 3C8EA 1W4VA 2KLXA 3ZLPA 5ECQB 1XIYA 2KOKA 4ML6A 3CYNA 1GTAA 1U3AA 4ECBA 4GRFA 5DBQA 1T7PB 3FY7A 3FMWA 4MCUA 4KSOA 3APSA 2LSTA 1AQXA 4GQCA 2K18A 4MJEA 4CDOA 2FY6A 2RUFA 5ECIB 1A24A 1GL8A 3M9KA 1A2LA 2H6YA 2CA8A 1NHYA 1OC8A 1WOUA 3DRNA 3D6IA 1M7TA 2FUG2 1Z6MA 1FO5A 2YWOA 2CVBA 4AJ8A 4MF7A 4BA7A 4XS4A 3A5WA 1FVJA 4I5QA 3L0HA 5J47A 1K3YA 2N5BA 3ZIJA 4F2IA 2LRNA 2YV9A 3VURA 2IWTA 4TXVA 1ZZYA 3EPTA 1GUKA 2P5QA 1JZRA 5BMUA 3IC8A 4IQ1A 4Z2TA 2LJAA 2C3NA 5B7CA 3P7XA 2DJ1A 3HVSA 3VI5A 2O5VA 2H19A 4KW6A 2PN8A 4ZB6A 4XCSA 1K0DA 1JZWA 2WVXB 3O6TA 1R26A 3PR8A 4JZQA 5CO3A 4CY8A 1AC1A 3H1NA 3BCIA 2M80A 2VL3A 5L71A 6GSXA 4YQVA 2XHFA 4ZBBA 5IPGA 1ILOA 3O76A 1XW6A 3PPUA 2FHEA 1W89A 3TJFA 4KA0A 3EINA 1LU4A 1SVMA 2B1KA 4N10A 1ZYPA 4EXJA 1PFOA 1MD4A 3SWLA 4BL7A 1SJZA 3IPZA 2V1MA 4NAXA 4WF5A 3KIJA 2C0GA 1WJKA 3GKNA 2FNOA 1O7UA 4V2MA 1Y6EA 1O73A 3NIVA 2CZ3A 1M3JA 4TR4A 4ID0A 1A0FA 1RK4A 3RDWA 5ABRA 1USBA 3MDKA 3M0FA 4ULXA 4I6XA 2IMKA 2P0GA 2H66A 2GSQA 1MDIA 2V6KA 1G0TA 3IDVA 3ZL5A 4AJ7A 3GRXA 3QDNA 2VCVA 5ELAA 4N0ZA 4N11A 2YP6A 5JWQB 2WGRA 3A2WA 4V1Ap 4WR5A 4EIPA 1SL2B 4IJIA 1SYXA 3MYDA 4K1FA 2IN3A 2H72A 4HJMA 2CVDA 2AHEA 1B9XC 3M3MA 4KSMA 2K8SA 3VFIA 4V1Ag 2RM5A 1GSUA 3GUSA 3AY8A 4PTSA 1ZGNA 2BJXA 2DSAA 3FR3A 1EP7A 4YQUA 1I5GA 2IMEA 3G9BA 18GSA 3ZFLA 2WB9A 13GSA 4F82A 3LQ7A 3ZMLA 2R37A 1T3BA 4HQZA 2GLRA 1EOGA 4IGJA 4EC0A 1Y1UA 5GAPD 4IP6A 3ME7A 5F06A 2H6XA 5F8BA 3GIXA 4WETA 1A23A 2JSYA 3PH9A 3MIXA 1M9AA 4FYCA 4IP1A 4XS1A 3KM6A 1C72A 1A0RP 1GUHA 1BAYA 3MNGA 1SKSB 2WDUA 2LS5A 1K0NA 1EOHA 3HDCA 2IPAA 1MD3A 4EL1A 4AKHA 1WIKA 5A34A 2YV7A 2X64A 1B48A 2V2GA 1GLQA 3TKSE 2C3TA 4F9ZA 4OFMA 1BJXA 5JCUA 2LQOA 3GV1A 2WS2A 4K9ZA 3L78A 1E6BA 4MJAA 4KF9A 1EP8A 4NXIA 1VF2A 3QMXA 2KHPA 2OE1A 4RUVA 4HU9A 16GSA 3MSZA 4POLA 1PSQA 1M2DA 3GTUA 4POBA 2P31A 2QA1A 4ZB9A 5KN1A 5HFIA 3LWAA 5CP1A 4GWRA 3J7Yb 4OO4A 5B8AA 2E2GA 4QMKA 5G5FA 5AIXA 4BPYA 3CBUA 2IMFA 1NM3A 3TB2A 4PQIA 2CT6A 5D73A 2EFDA 1ON4A 3ZITA 4F0CA 4IELA 8GSSA 6GSTA 3WT1A 2OACA 2VOCA 2IMIA 1GNWA 2VM1A 3H8QA 5HFKA 1PMTA 2PUKC 3D22A 5A4WA 2C80A 5KN2A 1SYRA 3ZVJD 2YOIA 2UZ8A 3HVVA 4IQAA 1SU9A 1LBKA 3GX8A 1ZCPA 4RQXA 1SK0A 5G2ZA 1PX6A 3SBCA 5F05A 2WFCA 4CY6A 1YEPA 5IMCA 1A2JA 4KH7A 1THXA 2HSNB 2X99A 4NPBA 4I8BA 5J4UA 5ECOB 4OFNA 3QFAC 3R3EA 1QMVA 4ZBAA 3EMPA 2A2PA 4JU5A 3DKSA 5ECLB 3UEMA 2GZZA 3QPMA 3F4SA 1OAZA 2HXKA 4TR3A 1DUGA 4WR4A 4TR0A 4KDXA 1T4YA 3BJ5A 4XIHA 1BQ7A 2H30A 3DEXA 3QOUA 4MZWA 1S3CA 4G0KA 3IK9A 3NOFA 3L9UA 3EC3A 2PMTA 2VAFA 1SD9A 2EIRA 2DLXA 4TXOB 1YF1A 5GSSA 2PBJA 2CVKA 3CSJA 4KX4A 1PX7A 2AB6A 3FZAA 3IRAA 3TDGA 1GSYA 1R5AA 4IW9A 1TU7A 1HQOA 1AXDA 3I9V2 2VCWA 4MPFA 5AIVA 2WJUA 2GZYA 2I1UA 1Z5YE 3ERGA 2AJQB 1TXXA 1WRYA 4G0IA 1XOAA 5G30A 5CNWA 3VPTA 3IXRA 2QSIA 3WGEA 1GP1A 3VLNA 2GDRA 4L8EA 4X1UA 4P3YB 2LKUA 3GFKA 1KEBA 4DSQA 2K9FA 1BG1A 3CRUA 2H1AA 4QQ7A 4HZ2A 3N9JA 3IHQA 1YVLA 4RI7A 1HYUA 3OR5A 5AGYA 5BMUB 3P2AA 2VD1A 1XWAA 3LGCA 3MAKA 5ECKB 3KP9A 2WW1A 3EMXA 5ECHB 4OCFA 1ZYQB 1U88A 6GSVA 3TOUA 2O36A 2KP1A 2FWFA 4GXZA 4WF4A 2I9HA 1YEXA 2DIZA 3TU3B 1B4PA 5ECMB 1G6YA 2VL9A 2HSMB 4Q5FA 4EE0A 1V58A 3GH9A 3F9UA 2L4CA 1G7EA 10GSA 3M8NA 1K0CA 3G7JA 2DKIA 4HZ4A 2YWMA 3ZFBA 3UVTA 4MMMA 5INYA 1O85A 4V2LA 2J9HA 5A5HA 4GSTA 2YJHA 4EKZA 3LXZA 1SK1A 1X5DA 4F03A 3CTFA 3GYKA 1JLVA 1VF4A 1TXUA 2HRKB 1XXUA 2EIQA 5IMVA 4BVYA 5ECNB 1QXHA 4K7NA 2LJKA 1OC9A 3QFBC 2NDOA 5IMFA 1N2AA 4ZIJA 5B8BA 2X8GA 3GA4A 2WW3A 1I1IP 3EU4A 1EV4A 1M2BA 4ECCA 1AIUA 2YANA 2QA2A 2X8CA 14GSA 4KDUA 1EZKA 1NHOA 1S3AA 2WRTA 1TRWA 2GSRA 3HCZA 3E0UA 5J9CA 1GLPA 5A5KA 3ERFA 2XBIA 1F3AA 5E59A 2H76A 2A2SA 4W66A 1O8XA 2DJ0A 4ECJA 4LL1B 3TJGA 4JR6A 3TCOA 2QGVA 3CTGA 2OT3A 2PVOC 1JHBA 1G7OA 2L6CA 1K0AA 3IK7A 2C0DA 3FKFA 1YEWC 3FR6A 3I43A 2I4AA 2LTKA 2QC7A 4ML1A 3UL3A 2OJLA 4BVXB 1V9WA 2JZTA 3FZ4A 2WULA 3DIEA 4OWYA 1PQNA 3KMOA 4HDEA 3KMNA 3ZZXA 1ZYNA 3TOTA 1ERVA 3FRCA 2HRNA 4A5PA 1SJIA 4KE3A 3UVHA 3KGKA 2OBKA 3IC4A 3F3RA 1F3BA 4TR1B 2YZHA 3E3EA 5KOWA 1OC3A 2CX3A 2HZEB 4GSNA 5JWOB 4USSA 3NZNA 2YN1A 4KUNA 3UBLA 5A1NB 1PA3A 4YH2A 2L6DA 4HS1A 2GVPA 1XWKA 5D8IA 1JLWA 4E8EA 1ML6A 2QKEA 1HD2A 3EVIA 1TK0B 5HR0A 1YKCA 3UJ1A 1GSSA 4AKGA 4MJCA 2VL2A 1SKWB 3KTLA 2HZFA 2O87A 3TKRA 1FW1A 3GNJA 1CQGA 1M99A 3LFLA 3CQFA 12GSA 1DSBA 5F07A 2MYGA 4WBRD 3G7YA 4XRAA 1X9MB 3HMJG 4ZL8A 4PQHA 3RGBC 3HXSA 4V2NA 1QUWA 1PL2A 5DAKB 2FWEA 5HR2A 2ALBA 4PUFC 1U6TA 5DVBA 3IOSA 2V32A 2H74A 2O8VB 5DCHA 4YAPA 6GSYA 4TVEA 1H75A 2GT5A 2HYXA 5HR3A 2DC5A 3BCKA 2R3XA 1SVOA 4IHUA 4Q5RA 4ICYA 3RFRC 4L5OA 3F4TA 3HZ8A 3GKXA 2PPTA 3HJPA 3HJMA 1HNBA 2WVYA 2O7KA 1O8WA 3ZREA 3APOA 4L0UA 2ES7A 2X8HA 1V2AA 1AW9A 5HFGA 5ID2A 2A4VA 2BMXA 3LYPA 2GS3A 2B7KA 3C1SA 1QFNA 1XCCA 3MWHA 3GL3A 3KEBA 1T4ZA 1XW9A 2WVXA 1GTBA 2WZ9A 2GZPA 2L59A 4KB3A 3ZYWA 2R6KA 2DJKA 1A2MA 4YKFA 2JL4A 4JRRA 4GLTA 1OE8A 4PQ1A 2PVQA 3ZMKA 4JEDA 4RI6A 4KNDA 3GL5A 2OADA 3HVXA 3C1RA 1K0OA 1TI3A 4MNNA 4OMVA 2V41A 3IV4A 4Z2RA 2IFQB 2OBIA 2MMZA 4PGTA 4I2TA 3WT2A 4EVMA 2O3EA 3CXGA 5E4WA 5IO0A 4O5RA 4GSSA 2ON5A 5C04A 4PI2C 4LLRA 3UAPA 2IMDA 3P90A 2H1LA 4BWQA 1B8XA 3VK9A 1GSDA 5DALB 3US3A 1YJ6A 4O7HA 5COHA 3GX0A 1HNCA 1X0RA 1ERWA 3PGTA 4H86A 1A8YA 2KP2A 1SKRB 5IO2A 1ZOFA 4K0NA 3TKQA 4Z7XA 3IAM2 2V6OA 4EF0A 1NW2A 1U3IA 1G6WA 4PNGA 4DSRA 3RPPA 4NMUA 5J40A 1TTZA 4L5LA 1T8EB 4TW5A 2NPBA 4ZB7A 2JSZA 6GSUA 3FR9A 3LSZA 1URMA 4YKGA 1Y25A 4AF2A 4DSSB 4ZBDA 4LA1A 4WEYA 4O5UA 2FWGA 4XS6A 4JR4A 1YKAA 1F6MC 1M3IA 4MLYA 3HY2A 1Z7RA 2HRAA 3GN3A 4D73B 3A2XA 2REMA 1SVLA 2FD3A 1J08A 2G2QA 4E8HA 5LCZA 4HEA2 2FCHA 1Q4JA 4L0WA 2VL2C 5CYYA 2YZUA 3KP8A 2C1YA 1TK8B 1XVQA 6GSSA 1R4WA 2H8LA 4Z2UA 1TW9A 3FW2A 3N5OA 1IYIA 5IM9A 1ABAA 20GSA 1F2EA 5FT3A 2GQLA 3BOAA 2B5XA 1WWJA 3LG6A 5DDLA 2XBQA 2LEGA 3VWWA 3EE2A 3KH9A 3GURA 4IVFA 1FAAA 2WVZA 2H73A 5D93A 5HQPA 2JZSA 2H1BA 5H5RA 4OFTA 1J9BA 1OKTA 2MZCA 2A2RA 1OYJA 5IIZA 4KDYA 5HR1A 3QR6A 1TOFA 3HJOA 4J57E 3LYKA 1PN9A 1YF0A 2P5RA 1K3OA 4BIKA 2VO4A 5FHIA 7GSSA 4MZBA 3P8WA 3FZ9A 1GSEA 2LRTA 3W8JA 1S3DA 4AJ6A 5D96A 1YZXA 4MPGA 3WD6A 2A4HA 5D9VA 3GKMA 3CHXC 3UARA 2B6MA 1FG4A 4X43A 4FO5A 5AN1A 3UOMA 3S9FA 2GT6A 2MMAA 3BBYA 2B1LA 4GF0A 2FWHA 1UA5A 3D0ZA 4JBBA 1EEJA 3VPQA 1OE7A 2WCIA 3APQA 2VD0A 4MJBA 1I9DA 3E9JB 4K0GA 2DJJA 4HI7A 3H4KA 3L4NA 4WXTA 5DCGA 1B4QA 5DJMA 4XS4B 2R0CA 2R5GA 2JADA 2D2ZA 2G0FA 2ZNMA 3CRTA 3U6VA 2ZUPA 1DBYA 4XHMA 1OVNA 2C4JA 2CX4A 4EUYA 1SL0B 4N30A 3Q6OA 2B7JA 4ZL9A 4IJ3A 2VUPA 3DMLA 4PUAA 4K7OA 2CAQA 3FK8A 1PRXA 1MDKA 1VGLA 4GDFA 1T00A 1UVZA 2R0GA 2YPMA 4HSCX 2FA4A 2HQTA 4N3ZA 4F0BA 3KH7A 2H0GA 1TRUA 1R7HA 2IIYA 1TRSA 3ERWA 1GSFA 5JCWA 1M9BA 1ZMAA 3Q74A 4OD7A 3GH6A 4MF5A 4KCAA 2AAWA 2L5LA 2N5FA 1KTEA 1F37A 2HSNA 5IQYA 3WGXA 1MEKA 4ECIA 1TKDB 2F8FA 19GSA 2VCTA 5B6NA 3W6GA 4YAVA 3UIWA 2HSHA 2HI7A 4MF6A 1M0UA 1EGRA 4BL7B 2MMNA 3C7MA 4MZCA 4Q5QA 1XBSA 2GQMA 3Q18A 2B5YA 5J3RA 1EEMA 2KUCA 5CRWA 4MH2A 2B3SA 2GSSA 1SENA 4MABA 1PN0A 2DJ3A 2E2MA 4AKIA 2XPEA 4ZL7A 1JZDA 4TXOA 1OKDA 1R5PA 1S3RA 4J56E 3UMAA 17GSA 2OE3A 1SL1B 4PURA 2E0QA 4HUAA 4OCEA 3DGQA 3M9JA 5GAND 1WMJA 2L57A 2HE3A 2AV4A 2OKAA 1PKWA 2PU9C 1VF3A 1TRVA 2M72A 3CSIA 2B5EA 2FGXA 3TKSA 1SK2A 1X9SB 3HHVA 4ZILA 2K8VA 1GULA 1N25A 5DJLA 3EWLA 3ZTLA 5EVOA 1LJRA 4IS0A 2HRFA 1X5EA 5JCGA 1VF1A 3H93A 2TIRA 5KN3A 1GTUA 2MMOA 2H01A 5ID2B 5KOXA 1Z7PA 2F51A 1GH2A 2DKHA 1T1VA 4XTSA 5DQSA 4K8MA 3RPNA 2RUEA 4XRDA 2L5OA 3FEUA 2R4VA 1PL1A 3LXTA 4MA9A 1XG8A 3HA9A 3DVWA 4CW9A 1YQ1A 2HSMA 4POMA 3KTBA 1EGOA 5A4UA 5B6MA 2ZCTA 1N8JA 1S4BP 5EL8A 4JE1A 3F6FA 1TU8A 4K6XA 4GCIA 2CAIA 1PD21 2JACA 5G1LA 2UV8G 1GRXA 4G2EA 5KEJA 1XFLA 3FZ5A 2LRCA 4AKXB 3TRQA 5AISA 1XZOA 1QQ2A 3DD3A 1RQMA 1NSWA 3VWXA 5A34B 1VRSD 5IMAA 1YY7A 1X9WB 2HRKA 3D4TA 3TJKA 2DBCA 11GSA 2VLTA 3ZRDA 4EDYA 5D9WA 3IA1A 3O3TA 1WPIA 4KCEA 2H71A 2O85A 2HSYA 1V57A 2LNTA 3H79A 2VIMA 1J0FA 2I3YA 3VWUA 4GQFA 4IKHA 1GWCA 4EO3A 3FYGA 3LEFA 3I69A 4FYUA 3C73A 3ED3A 4MK3A 2GTUA 2CQ9A 2H0HA 1ST9A 3GTUB 5A4VA 2H6ZA 2WW2A 5IMDA 2EFCA 1XOBA 1EWXA 1TJDA 2H1GA 2MBSA 2LUSA 4K7IA 1KNGA 2H0IA 3ZVJA 2GSTA 1BF5A 1ZL9A 4X0XA 4YQMA 1GTIA 3RBTA 3W8SA 5D9TA 3R2QA 4POKA 1AAZA 5J41A 3C71A 4O92A 3FHKA 4IN0A 1THOA 2YWIA 3DWVA 4AGSA 1XVWA 3DVXA 4BVXA 3TJJA 1SJ6A 3TJBA 3DYRA 4J2FA 3KCMA 3IHGA 1FB0A 5G31A 3L9SA 5GSTA 3GSTA 5ECSA 2HFDA 1IYHA 2LNSA 2C3QA 5IOXA 1DE1A 4FXYP 2XPDA 5G5EA 3VWVA 1JZOA 1XPVA 4N0VA 1Z6NA 2YWNA 4TR1A 3JCML 1BX9A 5ENUA 3D5JA 4MH3A 2WW0A 1M2AA 2HZEA 1BEDA 4X4JA 1V98A 2NBSA 3D4MA 5A1NA 3TKSC 4HOJA 1WP0A 2H75A 1O81A 3ISOA 2L4QA 3IAS2 4PI0C 1FB6A 3RHBA 5CAXA 2VLVA 2R2JA 1BG5A 1Z9HA 2PERA 1B9YC 2J23A 5EY6A 3G7IA 2YNXA 1K0BA 4KAEA 3K8NA 4MP4A 3HVNA 2OE0A 1MDJA 3HZ4A 4LMVA 1K0MA 3J7Yk 1X5CA 4LMWA 3Q19A 5F0GA 3I6AA 3F3QA 3BD2A 3KXOA 2OA7A 2N5AA 5DAKA 4EIQA 1V40A 2K6VA 3EU3A 1GSQA 4FIWA 5ECPB 3ZIVA 1U87A 3IE3A 3QAGA 6GSWA 2YCDA 4ZXGA 4PHZC 1XWCA 1O6JA 1BYEA 1WE0A 1RW1A 4ACSA 1JFUA 4DEJA 1H4OA 9GSSA 2VLUA 3CSHA 1TDIA 4K2XA 4QL9A 3F4RA 3F63A 4FH8A 3TGZA 2RLIA 3QAWA 2Z9SA 1FOHA 4I97A 4G10A 4PXOA 4HJ2A 3HKRA 4PX1A 2F3MA 3A3TA 4FQUA 5CRGA 5IOWA 4HQSA 1ERUA 3TUEA 2VKZG 3GHAA 3GKKA 2EC4A 4K5SA 5CREA 4I2UA 2I81A 2CZ2A 3PINA 2EIOA 1ZYEA 2VCZA 2DMMA 3F8UA 2CV4A 3DXBA 4QL7A 1SD8A 1Z3EA 4NHZA 5ELGA 2JZRA 2H1DA 2F8AA 5J4YA 3WYWA 2JU5A 3EURA 1QK8A 2AYTA 5DQYA 3CMIA 1K3LA 1XWBA 3LJRA 1DE2A 3A5IA 3GSSA 2LQQA 3LORA 4ZB8A 3TRXA 1AQVA 4WBJA 5KN0A 3RHCA 3TKPA 3GMFA 2XC2A 3F6DA 2IFQA 1XWGA 3QAVA 3L9VA 3LW9A 3U5RE 2EFHA 2YJ7A 2PWJA 4TOPA 3VI7A 2IL3A 5A5HB 3HYPA 2PGTA 5JWRB 2WZSA 4TN8A 5C00A 22GSA 3RAZA 5IMZA 4K2DA 2IJYA 4RQRA 4HU7A 3A2VA 1HNAA 2GQKA 4BVYB 1KBNA 5CRDA 3CWGA 2NTOA 1OC9B 5DALA 2BTOT 2M46A 3HD5A 4K5RA 3UBKA 4LL4B 1UC7A 4IBPA 5D9XA 5G1KA 2LV3A 2X4AA 3ME8A 4TKYA 1AUCA 1AQWA 2VCXA 4G9HA 4CHSA 2FLSA 2RIIA 1PGTA 2C0EA 3WGDA 1F9MA 2C8UA 4WKWA 4NV5A 5J5NA 4NV2A 2X49A 3KZQA 1EV9A 2VCQA 4TRXA 1TP9A 4NHWA 4MDCA 4DSSA 1PKZA 5LD0A 1TK5B 2AUVA 4G0LA 1ERTA 5CRHA 2F9SA 2DIYA 1YDKA 2MBTA 3IR4A 5J9BA 1FOVA 4D73A 1Q98A 3KJYA 4ILFA 4O5QA 3M1GA 4AI6A 2TRXA 2HT9A 4GTUA 5LNKe 2RM6A 1A8LA 2ON7A 4Q5NA 1FVKA 2H70A 5EPFA 1GUMA 2HNLA 3D21A 4E68A 4DVCA 2VM2A 5ECRB 1ACVA 1TI1A 2GGTA 2O89A 5H5QA 1CQHA 2TRCP 4NWYA 1E2YA 4EDZA 2C0FA 1QGVA 3EYTA 2DMLA 1FHEA 2R0PA 2LJRA 1MTCA 4KGIA 2NVLA 4G19A 1GNEA 2EFEA 3F0IA 3KD0A 3TRPA
chains in the Genus database with same CATH topology
5H5SA 5GZZB 4OO5A 5BRTA 1XW5A 2HLSA 3V1WA 3IBHA 3QCPA 5IPHA 4BWSA 2E7PA 4G01A 2DJ2A 2FA8A 4ISDA 4O32A 4FYBA 1UN2A 3QD9A 5FWGA 4PNFA 5J4VA 3C8EA 1W4VA 2KLXA 3ZLPA 5ECQB 1XIYA 2KOKA 4ML6A 3CYNA 1GTAA 1U3AA 4ECBA 4GRFA 5DBQA 1T7PB 3FY7A 3FMWA 4MCUA 4KSOA 3APSA 2LSTA 1AQXA 4GQCA 2K18A 4MJEA 4CDOA 2FY6A 2RUFA 5ECIB 1A24A 1GL8A 3M9KA 1A2LA 2H6YA 2CA8A 1NHYA 1OC8A 1WOUA 3DRNA 3D6IA 1M7TA 2FUG2 1Z6MA 1FO5A 2YWOA 2CVBA 4AJ8A 4MF7A 4BA7A 4XS4A 3A5WA 1FVJA 4I5QA 3L0HA 5J47A 1K3YA 2N5BA 3ZIJA 4F2IA 2LRNA 2YV9A 3VURA 2IWTA 4TXVA 1ZZYA 3EPTA 1GUKA 2P5QA 1JZRA 5BMUA 3IC8A 4IQ1A 4Z2TA 2LJAA 2C3NA 5B7CA 3P7XA 2DJ1A 3HVSA 3VI5A 2O5VA 2H19A 4KW6A 2PN8A 4ZB6A 4XCSA 1K0DA 1JZWA 3O6TA 1R26A 3PR8A 4JZQA 5CO3A 4CY8A 1AC1A 3H1NA 3BCIA 2M80A 2VL3A 5L71A 6GSXA 4YQVA 2XHFA 4ZBBA 5IPGA 1ILOA 3O76A 1XW6A 3PPUA 2FHEA 1W89A 3TJFA 4KA0A 3EINA 1LU4A 1SVMA 2B1KA 4N10A 1ZYPA 4EXJA 1MD4A 3SWLA 4BL7A 1SJZA 3IPZA 2V1MA 4NAXA 4WF5A 3KIJA 2C0GA 1WJKA 3GKNA 2FNOA 1O7UA 4V2MA 1Y6EA 1O73A 3NIVA 2CZ3A 4TR4A 4ID0A 1A0FA 1RK4A 3RDWA 5ABRA 1USBA 3MDKA 3M0FA 4ULXA 4I6XA 2IMKA 2P0GA 2H66A 2GSQA 1MDIA 2V6KA 1G0TA 3IDVA 3ZL5A 4AJ7A 3GRXA 3QDNA 2VCVA 5ELAA 4N0ZA 4N11A 2YP6A 5JWQB 2WGRA 3A2WA 4V1Ap 4WR5A 4EIPA 1SL2B 4IJIA 1SYXA 3MYDA 4K1FA 2IN3A 2H72A 4HJMA 2CVDA 2AHEA 1B9XC 3M3MA 4KSMA 2K8SA 3VFIA 4V1Ag 2RM5A 1GSUA 3GUSA 3AY8A 4PTSA 1ZGNA 2BJXA 2DSAA 3FR3A 1EP7A 4YQUA 1I5GA 2IMEA 3G9BA 18GSA 3ZFLA 2WB9A 13GSA 4F82A 3LQ7A 3ZMLA 2R37A 1T3BA 4HQZA 2GLRA 1EOGA 4IGJA 4EC0A 1Y1UA 5GAPD 4IP6A 3ME7A 5F06A 2H6XA 5F8BA 3GIXA 4WETA 1A23A 2JSYA 3PH9A 3MIXA 1M9AA 4FYCA 4IP1A 4XS1A 3KM6A 1C72A 1A0RP 1GUHA 1BAYA 3MNGA 1SKSB 2WDUA 2LS5A 1K0NA 1EOHA 3HDCA 2IPAA 1MD3A 4EL1A 4AKHA 1WIKA 5A34A 2YV7A 2X64A 1B48A 2V2GA 1GLQA 3TKSE 2C3TA 4F9ZA 4OFMA 1BJXA 5JCUA 2LQOA 3GV1A 2WS2A 4K9ZA 3L78A 1E6BA 4MJAA 4KF9A 1EP8A 4NXIA 1VF2A 3QMXA 2KHPA 2OE1A 4RUVA 4HU9A 16GSA 3MSZA 4POLA 1PSQA 1M2DA 3GTUA 4POBA 2P31A 2QA1A 4ZB9A 5KN1A 5HFIA 3LWAA 5CP1A 4GWRA 3J7Yb 4OO4A 5B8AA 2E2GA 4QMKA 5G5FA 5AIXA 4BPYA 3CBUA 2IMFA 1NM3A 3TB2A 4PQIA 2CT6A 5D73A 2EFDA 1ON4A 3ZITA 4F0CA 4IELA 8GSSA 6GSTA 3WT1A 2OACA 2VOCA 2IMIA 1GNWA 2VM1A 3H8QA 5HFKA 1PMTA 2PUKC 3D22A 5A4WA 2C80A 5KN2A 1SYRA 3ZVJD 2YOIA 2UZ8A 3HVVA 4IQAA 1SU9A 1LBKA 3GX8A 1ZCPA 4RQXA 1SK0A 5G2ZA 1PX6A 3SBCA 5F05A 2WFCA 4CY6A 1YEPA 5IMCA 1A2JA 4KH7A 1THXA 2HSNB 2X99A 4NPBA 4I8BA 5J4UA 5ECOB 4OFNA 3QFAC 3R3EA 1QMVA 4ZBAA 3EMPA 2A2PA 4JU5A 3DKSA 5ECLB 3UEMA 2GZZA 3QPMA 3F4SA 1OAZA 2HXKA 4TR3A 1DUGA 4WR4A 4TR0A 4KDXA 1T4YA 3BJ5A 4XIHA 1BQ7A 2H30A 3DEXA 3QOUA 4MZWA 1S3CA 4G0KA 3IK9A 3NOFA 3L9UA 3EC3A 2PMTA 2VAFA 1SD9A 2EIRA 2DLXA 4TXOB 1YF1A 5GSSA 2PBJA 2CVKA 3CSJA 4KX4A 1PX7A 2AB6A 3FZAA 3IRAA 3TDGA 1GSYA 1R5AA 4IW9A 1TU7A 1HQOA 1AXDA 3I9V2 2VCWA 4MPFA 5AIVA 2WJUA 2GZYA 2I1UA 1Z5YE 3ERGA 2AJQB 1TXXA 1WRYA 4G0IA 1XOAA 5G30A 5CNWA 3VPTA 3IXRA 2QSIA 3WGEA 1GP1A 3VLNA 2GDRA 4L8EA 4X1UA 4P3YB 2LKUA 3GFKA 1KEBA 4DSQA 2K9FA 1BG1A 3CRUA 2H1AA 4QQ7A 4HZ2A 3N9JA 3IHQA 1YVLA 4RI7A 1HYUA 3OR5A 5AGYA 5BMUB 3P2AA 2VD1A 1XWAA 3LGCA 3MAKA 5ECKB 3KP9A 3EMXA 5ECHB 4OCFA 1ZYQB 1U88A 6GSVA 3TOUA 2KP1A 2FWFA 4GXZA 4WF4A 2I9HA 1YEXA 2DIZA 3TU3B 1B4PA 5ECMB 1G6YA 2VL9A 2HSMB 4Q5FA 4EE0A 1V58A 3GH9A 3F9UA 2L4CA 1G7EA 10GSA 3M8NA 1K0CA 3G7JA 2DKIA 4HZ4A 2YWMA 3ZFBA 3UVTA 4MMMA 5INYA 1O85A 4V2LA 2J9HA 5A5HA 4GSTA 2YJHA 4EKZA 3LXZA 1SK1A 1X5DA 4F03A 3CTFA 3GYKA 1JLVA 1VF4A 1TXUA 2HRKB 1XXUA 2EIQA 5IMVA 4BVYA 5ECNB 1QXHA 4K7NA 2LJKA 1OC9A 3QFBC 2NDOA 5IMFA 1N2AA 4ZIJA 5B8BA 2X8GA 3GA4A 3EU4A 1EV4A 1M2BA 4ECCA 1AIUA 2YANA 2QA2A 2X8CA 14GSA 4KDUA 1EZKA 1NHOA 1S3AA 2WRTA 1TRWA 2GSRA 3HCZA 3E0UA 5J9CA 1GLPA 5A5KA 3ERFA 2XBIA 1F3AA 5E59A 2H76A 2A2SA 4W66A 1O8XA 2DJ0A 4ECJA 4LL1B 3TJGA 4JR6A 3TCOA 2QGVA 3CTGA 2OT3A 2PVOC 1JHBA 1G7OA 2L6CA 1K0AA 3IK7A 2C0DA 3FKFA 3FR6A 3I43A 2I4AA 2LTKA 2QC7A 4ML1A 3UL3A 2OJLA 4BVXB 1V9WA 2JZTA 3FZ4A 2WULA 3DIEA 4OWYA 1PQNA 3KMOA 4HDEA 3KMNA 3ZZXA 1ZYNA 3TOTA 1ERVA 3FRCA 2HRNA 4A5PA 1SJIA 4KE3A 3UVHA 3KGKA 2OBKA 3IC4A 3F3RA 1F3BA 4TR1B 2YZHA 3E3EA 5KOWA 1OC3A 2CX3A 2HZEB 4GSNA 5JWOB 4USSA 3NZNA 2YN1A 4KUNA 3UBLA 5A1NB 1PA3A 4YH2A 2L6DA 4HS1A 2GVPA 1XWKA 5D8IA 1JLWA 4E8EA 1ML6A 2QKEA 1HD2A 3EVIA 1TK0B 5HR0A 1YKCA 3UJ1A 1GSSA 4AKGA 4MJCA 2VL2A 1SKWB 3KTLA 2HZFA 2O87A 3TKRA 1FW1A 3GNJA 1CQGA 1M99A 3LFLA 12GSA 1DSBA 5F07A 2MYGA 4WBRD 3G7YA 4XRAA 1X9MB 3HMJG 4ZL8A 4PQHA 3HXSA 4V2NA 1QUWA 1PL2A 5DAKB 2FWEA 5HR2A 2ALBA 4PUFC 1U6TA 5DVBA 3IOSA 2V32A 2H74A 2O8VB 5DCHA 4YAPA 6GSYA 4TVEA 1H75A 2GT5A 2HYXA 5HR3A 2DC5A 3BCKA 2R3XA 1SVOA 4IHUA 4Q5RA 4ICYA 4L5OA 3F4TA 3HZ8A 3GKXA 2PPTA 3HJPA 3HJMA 1HNBA 2O7KA 1O8WA 3ZREA 3APOA 4L0UA 2ES7A 2X8HA 1V2AA 1AW9A 5HFGA 5ID2A 2A4VA 2BMXA 3LYPA 2GS3A 2B7KA 3C1SA 1QFNA 1XCCA 3MWHA 3GL3A 3KEBA 1T4ZA 1XW9A 1GTBA 2WZ9A 2GZPA 2L59A 4KB3A 3ZYWA 2R6KA 2DJKA 1A2MA 4YKFA 2JL4A 4JRRA 4GLTA 1OE8A 4PQ1A 2PVQA 3ZMKA 4JEDA 4RI6A 4KNDA 3GL5A 2OADA 3HVXA 3C1RA 1K0OA 1TI3A 4MNNA 4OMVA 2V41A 3IV4A 4Z2RA 2IFQB 2OBIA 2MMZA 4PGTA 4I2TA 3WT2A 4EVMA 3CXGA 5E4WA 5IO0A 4O5RA 4GSSA 2ON5A 5C04A 4LLRA 3UAPA 2IMDA 3P90A 2H1LA 4BWQA 1B8XA 3VK9A 1GSDA 5DALB 3US3A 1YJ6A 4O7HA 5COHA 3GX0A 1HNCA 1X0RA 1ERWA 3PGTA 4H86A 1A8YA 2KP2A 1SKRB 5IO2A 1ZOFA 4K0NA 3TKQA 4Z7XA 3IAM2 2V6OA 4EF0A 1NW2A 1U3IA 1G6WA 4PNGA 4DSRA 3RPPA 4NMUA 5J40A 1TTZA 4L5LA 1T8EB 4TW5A 2NPBA 4ZB7A 2JSZA 6GSUA 3FR9A 3LSZA 1URMA 4YKGA 1Y25A 4AF2A 4DSSB 4ZBDA 4LA1A 4WEYA 4O5UA 2FWGA 4XS6A 4JR4A 1YKAA 1F6MC 4MLYA 3HY2A 1Z7RA 2HRAA 3GN3A 4D73B 3A2XA 2REMA 1SVLA 2FD3A 1J08A 2G2QA 4E8HA 5LCZA 4HEA2 2FCHA 1Q4JA 4L0WA 2VL2C 5CYYA 2YZUA 3KP8A 2C1YA 1TK8B 1XVQA 6GSSA 1R4WA 2H8LA 4Z2UA 1TW9A 3FW2A 3N5OA 1IYIA 5IM9A 1ABAA 20GSA 1F2EA 5FT3A 2GQLA 3BOAA 2B5XA 1WWJA 3LG6A 5DDLA 2XBQA 2LEGA 3VWWA 3EE2A 3KH9A 3GURA 4IVFA 1FAAA 2H73A 5D93A 5HQPA 2JZSA 2H1BA 5H5RA 4OFTA 1J9BA 1OKTA 2MZCA 2A2RA 1OYJA 5IIZA 4KDYA 5HR1A 3QR6A 1TOFA 3HJOA 4J57E 3LYKA 1PN9A 1YF0A 2P5RA 1K3OA 2VO4A 5FHIA 7GSSA 4MZBA 3P8WA 3FZ9A 1GSEA 2LRTA 3W8JA 1S3DA 4AJ6A 5D96A 1YZXA 4MPGA 3WD6A 2A4HA 5D9VA 3GKMA 3UARA 2B6MA 1FG4A 4X43A 4FO5A 5AN1A 3UOMA 3S9FA 2GT6A 2MMAA 3BBYA 2B1LA 4GF0A 2FWHA 1UA5A 3D0ZA 4JBBA 1EEJA 3VPQA 1OE7A 2WCIA 3APQA 2VD0A 4MJBA 1I9DA 3E9JB 4K0GA 2DJJA 4HI7A 3H4KA 3L4NA 4WXTA 5DCGA 1B4QA 5DJMA 4XS4B 2R0CA 2R5GA 2JADA 2D2ZA 2G0FA 2ZNMA 3CRTA 3U6VA 2ZUPA 1DBYA 4XHMA 1OVNA 2C4JA 2CX4A 4EUYA 1SL0B 4N30A 3Q6OA 2B7JA 4ZL9A 4IJ3A 2VUPA 3DMLA 4PUAA 4K7OA 2CAQA 3FK8A 1PRXA 1MDKA 1VGLA 4GDFA 1T00A 1UVZA 2R0GA 2YPMA 2FA4A 2HQTA 4N3ZA 4F0BA 3KH7A 2H0GA 1TRUA 1R7HA 2IIYA 1TRSA 3ERWA 1GSFA 5JCWA 1M9BA 1ZMAA 3Q74A 4OD7A 3GH6A 4MF5A 4KCAA 2AAWA 2L5LA 2N5FA 1KTEA 1F37A 2HSNA 5IQYA 3WGXA 1MEKA 4ECIA 1TKDB 2F8FA 19GSA 2VCTA 5B6NA 3W6GA 4YAVA 3UIWA 2HSHA 2HI7A 4MF6A 1M0UA 1EGRA 4BL7B 2MMNA 3C7MA 4MZCA 4Q5QA 1XBSA 2GQMA 3Q18A 2B5YA 5J3RA 1EEMA 2KUCA 5CRWA 4MH2A 2B3SA 2GSSA 1SENA 4MABA 1PN0A 2DJ3A 2E2MA 4AKIA 2XPEA 4ZL7A 1JZDA 4TXOA 1OKDA 1R5PA 4J56E 3UMAA 17GSA 2OE3A 1SL1B 4PURA 2E0QA 4HUAA 4OCEA 3DGQA 3M9JA 5GAND 1WMJA 2L57A 2HE3A 2AV4A 2OKAA 1PKWA 2PU9C 1VF3A 1TRVA 2M72A 3CSIA 2B5EA 2FGXA 3TKSA 1SK2A 1X9SB 3HHVA 4ZILA 2K8VA 1GULA 1N25A 5DJLA 3EWLA 3ZTLA 5EVOA 1LJRA 4IS0A 2HRFA 1X5EA 5JCGA 1VF1A 3H93A 2TIRA 5KN3A 1GTUA 2MMOA 2H01A 5ID2B 5KOXA 1Z7PA 2F51A 1GH2A 2DKHA 1T1VA 4XTSA 5DQSA 4K8MA 3RPNA 2RUEA 4XRDA 2L5OA 3FEUA 2R4VA 1PL1A 3LXTA 4MA9A 3HA9A 3DVWA 4CW9A 1YQ1A 2HSMA 4POMA 3KTBA 1EGOA 5A4UA 5B6MA 2ZCTA 1N8JA 5EL8A 4JE1A 3F6FA 1TU8A 4K6XA 4GCIA 2CAIA 1PD21 2JACA 5G1LA 2UV8G 1GRXA 4G2EA 5KEJA 1XFLA 3FZ5A 2LRCA 4AKXB 3TRQA 5AISA 1XZOA 1QQ2A 3DD3A 1RQMA 1NSWA 3VWXA 5A34B 1VRSD 5IMAA 1YY7A 1X9WB 2HRKA 3D4TA 3TJKA 2DBCA 11GSA 2VLTA 3ZRDA 4EDYA 5D9WA 3IA1A 3O3TA 1WPIA 4KCEA 2H71A 2O85A 2HSYA 1V57A 2LNTA 3H79A 2VIMA 1J0FA 2I3YA 3VWUA 4GQFA 4IKHA 1GWCA 4EO3A 3FYGA 3LEFA 3I69A 4FYUA 3C73A 3ED3A 4MK3A 2GTUA 2CQ9A 2H0HA 1ST9A 3GTUB 5A4VA 2H6ZA 5IMDA 2EFCA 1XOBA 1EWXA 1TJDA 2H1GA 2MBSA 2LUSA 4K7IA 1KNGA 2H0IA 3ZVJA 2GSTA 1BF5A 1ZL9A 4X0XA 4YQMA 1GTIA 3RBTA 3W8SA 5D9TA 3R2QA 4POKA 1AAZA 5J41A 3C71A 4O92A 3FHKA 4IN0A 1THOA 2YWIA 3DWVA 4AGSA 1XVWA 3DVXA 4BVXA 3TJJA 1SJ6A 3TJBA 3DYRA 4J2FA 3KCMA 3IHGA 1FB0A 5G31A 3L9SA 5GSTA 3GSTA 5ECSA 2HFDA 1IYHA 2LNSA 2C3QA 5IOXA 1DE1A 2XPDA 5G5EA 3VWVA 1JZOA 1XPVA 4N0VA 1Z6NA 2YWNA 4TR1A 3JCML 1BX9A 5ENUA 3D5JA 4MH3A 1M2AA 2HZEA 1BEDA 4X4JA 1V98A 2NBSA 3D4MA 5A1NA 3TKSC 4HOJA 1WP0A 2H75A 1O81A 3ISOA 2L4QA 3IAS2 1FB6A 3RHBA 5CAXA 2VLVA 2R2JA 1BG5A 1Z9HA 2PERA 1B9YC 2J23A 5EY6A 3G7IA 2YNXA 1K0BA 4KAEA 3K8NA 4MP4A 2OE0A 1MDJA 3HZ4A 4LMVA 1K0MA 3J7Yk 1X5CA 4LMWA 3Q19A 5F0GA 3I6AA 3F3QA 3BD2A 3KXOA 2OA7A 2N5AA 5DAKA 4EIQA 1V40A 2K6VA 3EU3A 1GSQA 4FIWA 5ECPB 3ZIVA 1U87A 3IE3A 3QAGA 6GSWA 2YCDA 4ZXGA 1XWCA 1O6JA 1BYEA 1WE0A 1RW1A 4ACSA 1JFUA 4DEJA 1H4OA 9GSSA 2VLUA 3CSHA 1TDIA 4K2XA 4QL9A 3F4RA 3F63A 4FH8A 3TGZA 2RLIA 3QAWA 2Z9SA 1FOHA 4I97A 4G10A 4PXOA 4HJ2A 3HKRA 4PX1A 2F3MA 3A3TA 4FQUA 5CRGA 5IOWA 4HQSA 1ERUA 3TUEA 2VKZG 3GHAA 3GKKA 2EC4A 4K5SA 5CREA 4I2UA 2I81A 2CZ2A 3PINA 2EIOA 1ZYEA 2VCZA 2DMMA 3F8UA 2CV4A 3DXBA 4QL7A 1SD8A 1Z3EA 4NHZA 5ELGA 2JZRA 2H1DA 2F8AA 5J4YA 3WYWA 2JU5A 3EURA 1QK8A 2AYTA 5DQYA 3CMIA 1K3LA 1XWBA 3LJRA 1DE2A 3A5IA 3GSSA 2LQQA 3LORA 4ZB8A 3TRXA 1AQVA 4WBJA 5KN0A 3RHCA 3TKPA 3GMFA 2XC2A 3F6DA 2IFQA 1XWGA 3QAVA 3L9VA 3LW9A 3U5RE 2EFHA 2YJ7A 2PWJA 4TOPA 3VI7A 2IL3A 5A5HB 3HYPA 2PGTA 5JWRB 4TN8A 5C00A 22GSA 3RAZA 5IMZA 4K2DA 2IJYA 4RQRA 4HU7A 3A2VA 1HNAA 2GQKA 4BVYB 1KBNA 5CRDA 3CWGA 2NTOA 1OC9B 5DALA 2BTOT 2M46A 3HD5A 4K5RA 3UBKA 4LL4B 1UC7A 4IBPA 5D9XA 5G1KA 2LV3A 2X4AA 3ME8A 4TKYA 1AUCA 1AQWA 2VCXA 4G9HA 4CHSA 2FLSA 2RIIA 1PGTA 2C0EA 3WGDA 1F9MA 2C8UA 4WKWA 4NV5A 5J5NA 4NV2A 2X49A 3KZQA 1EV9A 2VCQA 4TRXA 1TP9A 4NHWA 4MDCA 4DSSA 1PKZA 5LD0A 1TK5B 2AUVA 4G0LA 1ERTA 5CRHA 2F9SA 2DIYA 1YDKA 2MBTA 3IR4A 5J9BA 1FOVA 4D73A 1Q98A 3KJYA 4ILFA 4O5QA 3M1GA 4AI6A 2TRXA 2HT9A 4GTUA 5LNKe 2RM6A 1A8LA 2ON7A 4Q5NA 1FVKA 2H70A 5EPFA 1GUMA 2HNLA 3D21A 4E68A 4DVCA 2VM2A 5ECRB 1ACVA 1TI1A 2GGTA 2O89A 5H5QA 1CQHA 2TRCP 4NWYA 1E2YA 4EDZA 2C0FA 1QGVA 3EYTA 2DMLA 1FHEA 2R0PA 2LJRA 1MTCA 4KGIA 2NVLA 4G19A 1GNEA 2EFEA 3F0IA 3KD0A 3TRPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H5S A;  5GZZ B;  4OO5 A;  1XW5 A;  2HLS A;  3V1W A;  3IBH A;  3QCP A;  5IPH A;  4BWS A;  2E7P A;  2DJ2 A;  2FA8 A;  4ISD A;  4O32 A;  4FYB A;  1UN2 A;  3QD9 A;  5FWG A;  4PNF A;  3C8E A;  1W4V A;  2KLX A;  3ZLP A;  5ECQ B;  1XIY A;  2KOK A;  4ML6 A;  3CYN A;  1GTA A;  1U3A A;  4ECB A;  4GRF A;  5DBQ A;  1T7P B;  3FY7 A;  4MCU A;  4KSO A;  3APS A;  2LST A;  1AQX A;  4GQC A;  2K18 A;  4MJE A;  4CDO A;  2FY6 A;  2RUF A;  5ECI B;  1A24 A;  1GL8 A;  3M9K A;  1A2L A;  2H6Y A;  2CA8 A;  1NHY A;  1OC8 A;  1WOU A;  3DRN A;  3D6I A;  1M7T A;  2FUG 2;  1Z6M A;  1FO5 A;  2YWO A;  2CVB A;  4AJ8 A;  4MF7 A;  4BA7 A;  4XS4 A;  3A5W A;  1FVJ A;  4I5Q A;  3L0H A;  1K3Y A;  2N5B A;  3ZIJ A;  4F2I A;  2LRN A;  2YV9 A;  3VUR A;  2IWT A;  4TXV A;  1ZZY A;  1GUK A;  2P5Q A;  1JZR A;  5BMU A;  3IC8 A;  4IQ1 A;  2LJA A;  2C3N A;  3P7X A;  5B7C A;  2DJ1 A;  3HVS A;  3VI5 A;  2H19 A;  4KW6 A;  2PN8 A;  4ZB6 A;  4XCS A;  1K0D A;  1JZW A;  3O6T A;  1R26 A;  3PR8 A;  4JZQ A;  5CO3 A;  1AC1 A;  3H1N A;  3BCI A;  2M80 A;  2VL3 A;  5L71 A;  6GSX A;  4YQV A;  2XHF A;  4ZBB A;  5IPG A;  1ILO A;  3O76 A;  1XW6 A;  3PPU A;  2FHE A;  1W89 A;  3TJF A;  4KA0 A;  3EIN A;  1LU4 A;  4N10 A;  2B1K A;  4EXJ A;  1MD4 A;  3SWL A;  4BL7 A;  1SJZ A;  3IPZ A;  2V1M A;  4NAX A;  4WF5 A;  3KIJ A;  2C0G A;  1WJK A;  3GKN A;  2FNO A;  1O7U A;  4V2M A;  1Y6E A;  1O73 A;  3NIV A;  2CZ3 A;  4TR4 A;  4ID0 A;  1A0F A;  1RK4 A;  3RDW A;  5ABR A;  1USB A;  3MDK A;  3M0F A;  4ULX A;  4I6X A;  2IMK A;  2P0G A;  2H66 A;  2GSQ A;  1MDI A;  2V6K A;  1G0T A;  3IDV A;  3ZL5 A;  4AJ7 A;  3GRX A;  3QDN A;  2VCV A;  5ELA A;  4N0Z A;  4N11 A;  2YP6 A;  5JWQ B;  2WGR A;  3A2W A;  4V1A p;  4WR5 A;  1SL2 B;  4IJI A;  1SYX A;  4K1F A;  2IN3 A;  2H72 A;  4HJM A;  2CVD A;  2AHE A;  1B9X C;  3M3M A;  4KSM A;  2K8S A;  3VFI A;  4V1A g;  2RM5 A;  1GSU A;  3GUS A;  3AY8 A;  4PTS A;  1ZGN A;  2BJX A;  2DSA A;  3FR3 A;  1EP7 A;  4YQU A;  1I5G A;  2IME A;  3G9B A;  18GS A;  3ZFL A;  2WB9 A;  13GS A;  4F82 A;  3LQ7 A;  3ZML A;  2R37 A;  1T3B A;  4HQZ A;  2GLR A;  1EOG A;  4IGJ A;  4EC0 A;  5GAP D;  4IP6 A;  3ME7 A;  5F06 A;  2H6X A;  5F8B A;  3GIX A;  4WET A;  1A23 A;  2JSY A;  3PH9 A;  1M9A A;  4FYC A;  4IP1 A;  4XS1 A;  3KM6 A;  1C72 A;  1A0R P;  1GUH A;  1BAY A;  3MNG A;  1SKS B;  2WDU A;  2LS5 A;  1K0N A;  1EOH A;  3HDC A;  2IPA A;  1MD3 A;  4EL1 A;  1WIK A;  2YV7 A;  2X64 A;  1B48 A;  2V2G A;  1GLQ A;  3TKS E;  2C3T A;  4F9Z A;  4OFM A;  1BJX A;  5JCU A;  2LQO A;  3GV1 A;  2WS2 A;  4K9Z A;  3L78 A;  1E6B A;  4MJA A;  4KF9 A;  1EP8 A;  4NXI A;  1VF2 A;  3QMX A;  2KHP A;  2OE1 A;  4RUV A;  4HU9 A;  16GS A;  3MSZ A;  4POL A;  1PSQ A;  1M2D A;  3GTU A;  4POB A;  2P31 A;  4ZB9 A;  5KN1 A;  5HFI A;  3LWA A;  5CP1 A;  4GWR A;  3J7Y b;  4OO4 A;  5B8A A;  2E2G A;  5G5F A;  4BPY A;  5AIX A;  3CBU A;  2IMF A;  1NM3 A;  3TB2 A;  4PQI A;  2CT6 A;  5D73 A;  1ON4 A;  3ZIT A;  4F0C A;  4IEL A;  8GSS A;  6GST A;  3WT1 A;  2OAC A;  2VOC A;  2IMI A;  1GNW A;  2VM1 A;  3H8Q A;  5HFK A;  1PMT A;  2PUK C;  3D22 A;  5A4W A;  2C80 A;  5KN2 A;  1SYR A;  3ZVJ D;  2YOI A;  2UZ8 A;  3HVV A;  4IQA A;  1SU9 A;  1LBK A;  3GX8 A;  1ZCP A;  4RQX A;  1SK0 A;  5G2Z A;  1PX6 A;  3SBC A;  5F05 A;  2WFC A;  1YEP A;  5IMC A;  1A2J A;  4KH7 A;  1THX A;  2HSN B;  2X99 A;  4NPB A;  4I8B A;  5J4U A;  5ECO B;  4OFN A;  3QFA C;  3R3E A;  1QMV A;  4ZBA A;  3EMP A;  4JU5 A;  3DKS A;  5ECL B;  3UEM A;  2GZZ A;  3QPM A;  3F4S A;  1OAZ A;  2HXK A;  4TR3 A;  1DUG A;  4WR4 A;  4TR0 A;  4KDX A;  1T4Y A;  3BJ5 A;  4XIH A;  1BQ7 A;  2H30 A;  3DEX A;  3QOU A;  4MZW A;  1S3C A;  4G0K A;  3IK9 A;  3NOF A;  3L9U A;  3EC3 A;  2PMT A;  2VAF A;  1SD9 A;  2EIR A;  2DLX A;  4TXO B;  1YF1 A;  5GSS A;  2PBJ A;  2CVK A;  3CSJ A;  4KX4 A;  1PX7 A;  2AB6 A;  3FZA A;  3IRA A;  3TDG A;  1GSY A;  1R5A A;  4IW9 A;  1TU7 A;  1HQO A;  1AXD A;  3I9V 2;  2VCW A;  4MPF A;  5AIV A;  2WJU A;  2GZY A;  2I1U A;  1Z5Y E;  3ERG A;  2AJQ B;  1TXX A;  1WRY A;  4G0I A;  1XOA A;  5G30 A;  5CNW A;  3VPT A;  3IXR A;  2QSI A;  3WGE A;  1GP1 A;  3VLN A;  2GDR A;  4L8E A;  4X1U A;  4P3Y B;  2LKU A;  3GFK A;  1KEB A;  4DSQ A;  2K9F A;  2H1A A;  3CRU A;  4QQ7 A;  4HZ2 A;  3N9J A;  3IHQ A;  4RI7 A;  1HYU A;  3OR5 A;  5AGY A;  3P2A A;  2VD1 A;  1XWA A;  3LGC A;  3MAK A;  5ECK B;  3KP9 A;  3EMX A;  5ECH B;  4OCF A;  1ZYQ B;  1U88 A;  6GSV A;  3TOU A;  2KP1 A;  2FWF A;  4GXZ A;  4WF4 A;  2I9H A;  1YEX A;  2DIZ A;  1B4P A;  5ECM B;  1G6Y A;  2VL9 A;  2HSM B;  4Q5F A;  4EE0 A;  1V58 A;  3GH9 A;  3F9U A;  2L4C A;  1G7E A;  10GS A;  3M8N A;  1K0C A;  3G7J A;  4HZ4 A;  2YWM A;  3ZFB A;  3UVT A;  4MMM A;  5INY A;  1O85 A;  4V2L A;  2J9H A;  4GST A;  2YJH A;  4EKZ A;  3LXZ A;  1SK1 A;  1X5D A;  4F03 A;  3CTF A;  3GYK A;  1JLV A;  1VF4 A;  2HRK B;  1XXU A;  2EIQ A;  5IMV A;  4BVY A;  5ECN B;  1QXH A;  4K7N A;  2LJK A;  1OC9 A;  3QFB C;  2NDO A;  5IMF A;  1N2A A;  4ZIJ A;  5B8B A;  2X8G A;  3GA4 A;  3EU4 A;  1EV4 A;  1M2B A;  4ECC A;  1AIU A;  2YAN A;  2X8C A;  14GS A;  4KDU A;  1EZK A;  1NHO A;  1S3A A;  2WRT A;  1TRW A;  2GSR A;  3HCZ A;  3E0U A;  5J9C A;  1GLP A;  5A5K A;  3ERF A;  2XBI A;  1F3A A;  5E59 A;  2H76 A;  2A2S A;  1O8X A;  2DJ0 A;  4ECJ A;  4LL1 B;  3TJG A;  4JR6 A;  3TCO A;  2QGV A;  3CTG A;  2PVO C;  1JHB A;  1G7O A;  2L6C A;  1K0A A;  3IK7 A;  2C0D A;  3FKF A;  3FR6 A;  3I43 A;  2I4A A;  2LTK A;  2QC7 A;  4ML1 A;  3UL3 A;  2OJL A;  4BVX B;  1V9W A;  2JZT A;  3FZ4 A;  2WUL A;  3DIE A;  4OWY A;  1PQN A;  3KMO A;  4HDE A;  3KMN A;  3ZZX A;  3TOT A;  1ERV A;  3FRC A;  2HRN A;  1SJI A;  4KE3 A;  3UVH A;  3KGK A;  2OBK A;  3IC4 A;  3F3R A;  1F3B A;  4TR1 B;  2YZH A;  3E3E A;  1OC3 A;  2CX3 A;  2HZE B;  4GSN A;  5JWO B;  4USS A;  3NZN A;  2YN1 A;  4KUN A;  3UBL A;  1PA3 A;  4YH2 A;  2L6D A;  4HS1 A;  2GVP A;  1XWK A;  5D8I A;  1JLW A;  4E8E A;  1ML6 A;  2QKE A;  1HD2 A;  3EVI A;  1TK0 B;  5HR0 A;  1YKC A;  3UJ1 A;  1GSS A;  4MJC A;  2VL2 A;  1SKW B;  3KTL A;  2HZF A;  2O87 A;  3TKR A;  1FW1 A;  3GNJ A;  1CQG A;  1M99 A;  3LFL A;  12GS A;  1DSB A;  5F07 A;  2MYG A;  4WBR D;  3G7Y A;  4XRA A;  1X9M B;  4ZL8 A;  4PQH A;  3HXS A;  4V2N A;  1QUW A;  1PL2 A;  5DAK B;  2FWE A;  5HR2 A;  2ALB A;  4PUF C;  1U6T A;  5DVB A;  3IOS A;  2V32 A;  2H74 A;  2O8V B;  5DCH A;  4YAP A;  6GSY A;  4TVE A;  1H75 A;  2GT5 A;  2HYX A;  5HR3 A;  2DC5 A;  3BCK A;  2R3X A;  4IHU A;  4Q5R A;  4L5O A;  3F4T A;  3HZ8 A;  3GKX A;  2PPT A;  3HJP A;  3HJM A;  1HNB A;  2O7K A;  1O8W A;  3ZRE A;  3APO A;  4L0U A;  2ES7 A;  2X8H A;  1V2A A;  1AW9 A;  5HFG A;  5ID2 A;  2A4V A;  2BMX A;  3LYP A;  2GS3 A;  2B7K A;  3C1S A;  1QFN A;  1XCC A;  3MWH A;  3GL3 A;  3KEB A;  1T4Z A;  1XW9 A;  1GTB A;  2WZ9 A;  2GZP A;  2L59 A;  4KB3 A;  3ZYW A;  2R6K A;  2DJK A;  1A2M A;  2JL4 A;  4JRR A;  4GLT A;  1OE8 A;  4PQ1 A;  2PVQ A;  3ZMK A;  4JED A;  4RI6 A;  4KND A;  3GL5 A;  2OAD A;  3HVX A;  3C1R A;  1K0O A;  1TI3 A;  4OMV A;  2V41 A;  3IV4 A;  2IFQ B;  2OBI A;  2MMZ A;  4PGT A;  4I2T A;  3WT2 A;  4EVM A;  3CXG A;  5E4W A;  5IO0 A;  4O5R A;  4GSS A;  2ON5 A;  5C04 A;  4LLR A;  3UAP A;  2IMD A;  3P90 A;  4BWQ A;  1B8X A;  3VK9 A;  1GSD A;  5DAL B;  3US3 A;  1YJ6 A;  4O7H A;  5COH A;  3GX0 A;  1HNC A;  1X0R A;  1ERW A;  3PGT A;  4H86 A;  1A8Y A;  2KP2 A;  1SKR B;  5IO2 A;  1ZOF A;  4K0N A;  3TKQ A;  4Z7X A;  3IAM 2;  2V6O A;  4EF0 A;  1NW2 A;  1U3I A;  1G6W A;  4PNG A;  4DSR A;  3RPP A;  4NMU A;  1TTZ A;  4L5L A;  1T8E B;  4TW5 A;  2NPB A;  2JSZ A;  6GSU A;  3FR9 A;  3LSZ A;  1URM A;  1Y25 A;  4AF2 A;  4DSS B;  4ZBD A;  4LA1 A;  4WEY A;  2FWG A;  4XS6 A;  4JR4 A;  1YKA A;  1F6M C;  4MLY A;  3HY2 A;  1Z7R A;  2HRA A;  3GN3 A;  4D73 B;  3A2X A;  2REM A;  2FD3 A;  1J08 A;  2G2Q A;  4E8H A;  5LCZ A;  4HEA 2;  2FCH A;  1Q4J A;  4L0W A;  2VL2 C;  5CYY A;  2YZU A;  3KP8 A;  2C1Y A;  1TK8 B;  1XVQ A;  6GSS A;  1R4W A;  2H8L A;  1TW9 A;  3FW2 A;  3N5O A;  1IYI A;  5IM9 A;  1ABA A;  20GS A;  1F2E A;  5FT3 A;  2GQL A;  3BOA A;  2B5X A;  1WWJ A;  3LG6 A;  5DDL A;  2XBQ A;  2LEG A;  3VWW A;  3EE2 A;  3KH9 A;  3GUR A;  4IVF A;  1FAA A;  2H73 A;  5D93 A;  5HQP A;  2JZS A;  2H1B A;  5H5R A;  4OFT A;  1J9B A;  1OKT A;  2MZC A;  2A2R A;  1OYJ A;  5IIZ A;  4KDY A;  5HR1 A;  3QR6 A;  1TOF A;  3HJO A;  4J57 E;  3LYK A;  1PN9 A;  1YF0 A;  2P5R A;  1K3O A;  2VO4 A;  5FHI A;  7GSS A;  4MZB A;  3P8W A;  3FZ9 A;  1GSE A;  2LRT A;  3W8J A;  1S3D A;  4AJ6 A;  5D96 A;  1YZX A;  4MPG A;  3WD6 A;  5D9V A;  3GKM A;  3UAR A;  2B6M A;  1FG4 A;  4X43 A;  4FO5 A;  5AN1 A;  3UOM A;  3S9F A;  2GT6 A;  2MMA A;  3BBY A;  2B1L A;  4GF0 A;  2FWH A;  1UA5 A;  3D0Z A;  4JBB A;  1EEJ A;  3VPQ A;  1OE7 A;  2WCI A;  3APQ A;  2VD0 A;  4MJB A;  1I9D A;  3E9J B;  4K0G A;  2DJJ A;  4HI7 A;  3H4K A;  3L4N A;  4WXT A;  5DCG A;  1B4Q A;  5DJM A;  4XS4 B;  2R5G A;  2JAD A;  2D2Z A;  2G0F A;  2ZNM A;  3CRT A;  3U6V A;  2ZUP A;  1DBY A;  4XHM A;  1OVN A;  2C4J A;  2CX4 A;  4EUY A;  1SL0 B;  4N30 A;  3Q6O A;  2B7J A;  4ZL9 A;  4IJ3 A;  2VUP A;  3DML A;  4PUA A;  4K7O A;  2CAQ A;  3FK8 A;  1PRX A;  1MDK A;  1VGL A;  1T00 A;  1UVZ A;  2YPM A;  2FA4 A;  2HQT A;  4F0B A;  3KH7 A;  2H0G A;  1TRU A;  1R7H A;  2IIY A;  1TRS A;  3ERW A;  1GSF A;  5JCW A;  1M9B A;  1ZMA A;  3Q74 A;  4OD7 A;  3GH6 A;  4MF5 A;  4KCA A;  2AAW A;  2L5L A;  2N5F A;  1KTE A;  1F37 A;  5IQY A;  3WGX A;  1MEK A;  4ECI A;  1TKD B;  2F8F A;  19GS A;  2VCT A;  5B6N A;  3W6G A;  4YAV A;  3UIW A;  2HSH A;  2HI7 A;  4MF6 A;  1M0U A;  1EGR A;  4BL7 B;  2MMN A;  3C7M A;  4MZC A;  4Q5Q A;  1XBS A;  2GQM A;  3Q18 A;  2B5Y A;  5J3R A;  1EEM A;  2KUC A;  5CRW A;  4MH2 A;  2B3S A;  2GSS A;  1SEN A;  4MAB A;  2DJ3 A;  2E2M A;  2XPE A;  4ZL7 A;  1JZD A;  4TXO A;  1OKD A;  1R5P A;  4J56 E;  3UMA A;  17GS A;  2OE3 A;  1SL1 B;  4PUR A;  2E0Q A;  4HUA A;  4OCE A;  3DGQ A;  3M9J A;  5GAN D;  1WMJ A;  2L57 A;  2HE3 A;  2AV4 A;  2OKA A;  1PKW A;  2PU9 C;  1VF3 A;  1TRV A;  2M72 A;  3CSI A;  2B5E A;  2FGX A;  3TKS A;  1SK2 A;  1X9S B;  3HHV A;  4ZIL A;  2K8V A;  1GUL A;  5DJL A;  3EWL A;  3ZTL A;  5EVO A;  1LJR A;  4IS0 A;  2HRF A;  1X5E A;  5JCG A;  1VF1 A;  3H93 A;  2TIR A;  5KN3 A;  1GTU A;  2MMO A;  2H01 A;  5ID2 B;  1Z7P A;  2F51 A;  1GH2 A;  1T1V A;  4XTS A;  5DQS A;  4K8M A;  3RPN A;  2RUE A;  4XRD A;  2L5O A;  3FEU A;  2R4V A;  1PL1 A;  3LXT A;  4MA9 A;  3HA9 A;  3DVW A;  4CW9 A;  1YQ1 A;  2HSM A;  4POM A;  3KTB A;  1EGO A;  5A4U A;  5B6M A;  2ZCT A;  1N8J A;  5EL8 A;  4JE1 A;  3F6F A;  1TU8 A;  4K6X A;  4GCI A;  2CAI A;  1PD2 1;  2JAC A;  5G1L A;  1GRX A;  4G2E A;  5KEJ A;  1XFL A;  3FZ5 A;  2LRC A;  3TRQ A;  5AIS A;  1XZO A;  1QQ2 A;  3DD3 A;  1RQM A;  1NSW A;  3VWX A;  1VRS D;  5IMA A;  1YY7 A;  1X9W B;  2HRK A;  3D4T A;  3TJK A;  2DBC A;  11GS A;  2VLT A;  3ZRD A;  4EDY A;  5D9W A;  3IA1 A;  3O3T A;  1WPI A;  4KCE A;  2H71 A;  2O85 A;  2HSY A;  1V57 A;  2LNT A;  3H79 A;  2VIM A;  1J0F A;  2I3Y A;  3VWU A;  4GQF A;  4IKH A;  1GWC A;  4EO3 A;  3FYG A;  3LEF A;  3I69 A;  4FYU A;  3C73 A;  3ED3 A;  4MK3 A;  2GTU A;  2CQ9 A;  2H0H A;  1ST9 A;  3GTU B;  5A4V A;  2H6Z A;  5IMD A;  1XOB A;  1EWX A;  1TJD A;  2H1G A;  2MBS A;  2LUS A;  4K7I A;  1KNG A;  2H0I A;  3ZVJ A;  2GST A;  1ZL9 A;  4X0X A;  4YQM A;  1GTI A;  3RBT A;  3W8S A;  5D9T A;  3R2Q A;  4POK A;  1AAZ A;  5J41 A;  3C71 A;  4O92 A;  3FHK A;  4IN0 A;  1THO A;  2YWI A;  3DWV A;  4AGS A;  1XVW A;  3DVX A;  4BVX A;  3TJJ A;  1SJ6 A;  3TJB A;  3DYR A;  4J2F A;  3KCM A;  1FB0 A;  5G31 A;  3L9S A;  5GST A;  3GST A;  5ECS A;  2HFD A;  1IYH A;  2LNS A;  2C3Q A;  5IOX A;  1DE1 A;  2XPD A;  5G5E A;  3VWV A;  1JZO A;  1XPV A;  4N0V A;  1Z6N A;  2YWN A;  4TR1 A;  3JCM L;  1BX9 A;  5ENU A;  3D5J A;  4MH3 A;  1M2A A;  2HZE A;  1BED A;  1V98 A;  2NBS A;  3D4M A;  3TKS C;  4HOJ A;  1WP0 A;  2H75 A;  1O81 A;  3ISO A;  2L4Q A;  3IAS 2;  1FB6 A;  3RHB A;  5CAX A;  2VLV A;  2R2J A;  1BG5 A;  1Z9H A;  2PER A;  1B9Y C;  2J23 A;  5EY6 A;  3G7I A;  2YNX A;  1K0B A;  4KAE A;  3K8N A;  4MP4 A;  2OE0 A;  1MDJ A;  3HZ4 A;  4LMV A;  1K0M A;  3J7Y k;  1X5C A;  4LMW A;  3Q19 A;  5F0G A;  3I6A A;  3F3Q A;  3BD2 A;  3KXO A;  2OA7 A;  2N5A A;  5DAK A;  1V40 A;  2K6V A;  3EU3 A;  1GSQ A;  4FIW A;  5ECP B;  3ZIV A;  1U87 A;  3IE3 A;  3QAG A;  6GSW A;  2YCD A;  4ZXG A;  1XWC A;  1O6J A;  1BYE A;  1WE0 A;  1RW1 A;  4ACS A;  1JFU A;  4DEJ A;  1H4O A;  9GSS A;  2VLU A;  3CSH A;  1TDI A;  4QL9 A;  3F4R A;  3F63 A;  4FH8 A;  3TGZ A;  2RLI A;  3QAW A;  2Z9S A;  4I97 A;  4G10 A;  4PXO A;  4HJ2 A;  3HKR A;  4PX1 A;  2F3M A;  3A3T A;  4FQU A;  5CRG A;  5IOW A;  4HQS A;  1ERU A;  3TUE A;  3GHA A;  3GKK A;  2EC4 A;  5CRE A;  4I2U A;  2I81 A;  2CZ2 A;  3PIN A;  2EIO A;  1ZYE A;  2VCZ A;  2DMM A;  3F8U A;  2CV4 A;  3DXB A;  4QL7 A;  1SD8 A;  1Z3E A;  4NHZ A;  5ELG A;  2JZR A;  2H1D A;  2F8A A;  3WYW A;  2JU5 A;  3EUR A;  1QK8 A;  2AYT A;  5DQY A;  3CMI A;  1K3L A;  1XWB A;  3LJR A;  1DE2 A;  3GSS A;  2LQQ A;  3LOR A;  4ZB8 A;  3TRX A;  1AQV A;  4WBJ A;  5KN0 A;  3RHC A;  3TKP A;  3GMF A;  2XC2 A;  3F6D A;  2IFQ A;  1XWG A;  3QAV A;  3L9V A;  3U5R E;  2YJ7 A;  2PWJ A;  4TOP A;  3VI7 A;  2IL3 A;  3HYP A;  2PGT A;  5JWR B;  4TN8 A;  5C00 A;  22GS A;  3RAZ A;  5IMZ A;  4K2D A;  2IJY A;  4RQR A;  4HU7 A;  3A2V A;  1HNA A;  2GQK A;  4BVY B;  1KBN A;  5CRD A;  2NTO A;  1OC9 B;  5DAL A;  2BTO T;  2M46 A;  3HD5 A;  3UBK A;  4LL4 B;  1UC7 A;  4IBP A;  5D9X A;  5G1K A;  2LV3 A;  3ME8 A;  4TKY A;  1AUC A;  1AQW A;  2VCX A;  4G9H A;  4CHS A;  2FLS A;  2RII A;  1PGT A;  2C0E A;  3WGD A;  1F9M A;  2C8U A;  4WKW A;  4NV5 A;  5J5N A;  4NV2 A;  3KZQ A;  1EV9 A;  2VCQ A;  4TRX A;  1TP9 A;  4NHW A;  4MDC A;  4DSS A;  1PKZ A;  5LD0 A;  1TK5 B;  2AUV A;  4G0L A;  1ERT A;  5CRH A;  2F9S A;  2DIY A;  1YDK A;  2MBT A;  3IR4 A;  5J9B A;  1FOV A;  4D73 A;  1Q98 A;  3KJY A;  4ILF A;  3M1G A;  2TRX A;  2HT9 A;  4GTU A;  5LNK e;  2RM6 A;  1A8L A;  2ON7 A;  4Q5N A;  1FVK A;  2H70 A;  5EPF A;  1GUM A;  2HNL A;  3D21 A;  4DVC A;  2VM2 A;  5ECR B;  1ACV A;  1TI1 A;  2GGT A;  2O89 A;  5H5Q A;  1CQH A;  2TRC P;  4NWY A;  1E2Y A;  4EDZ A;  2C0F A;  1QGV A;  3EYT A;  2DML A;  1FHE A;  2LJR A;  1MTC A;  4KGI A;  2NVL A;  4G19 A;  1GNE A;  3F0I A;  3KD0 A;  3TRP A; 
#chains in the Genus database with same CATH topology
 5H5S A;  5GZZ B;  4OO5 A;  5BRT A;  1XW5 A;  2HLS A;  3V1W A;  3IBH A;  3QCP A;  5IPH A;  4BWS A;  2E7P A;  4G01 A;  2DJ2 A;  2FA8 A;  4ISD A;  4O32 A;  4FYB A;  1UN2 A;  3QD9 A;  5FWG A;  4PNF A;  5J4V A;  3C8E A;  1W4V A;  2KLX A;  3ZLP A;  5ECQ B;  1XIY A;  2KOK A;  4ML6 A;  3CYN A;  1GTA A;  1U3A A;  4ECB A;  4GRF A;  5DBQ A;  1T7P B;  3FY7 A;  3FMW A;  4MCU A;  4KSO A;  3APS A;  2LST A;  1AQX A;  4GQC A;  2K18 A;  4MJE A;  4CDO A;  2FY6 A;  2RUF A;  5ECI B;  1A24 A;  1GL8 A;  3M9K A;  1A2L A;  2H6Y A;  2CA8 A;  1NHY A;  1OC8 A;  1WOU A;  3DRN A;  3D6I A;  1M7T A;  2FUG 2;  1Z6M A;  1FO5 A;  2YWO A;  2CVB A;  4AJ8 A;  4MF7 A;  4BA7 A;  4XS4 A;  3A5W A;  1FVJ A;  4I5Q A;  3L0H A;  5J47 A;  1K3Y A;  2N5B A;  3ZIJ A;  4F2I A;  2LRN A;  2YV9 A;  3VUR A;  2IWT A;  4TXV A;  1ZZY A;  3EPT A;  1GUK A;  2P5Q A;  1JZR A;  5BMU A;  3IC8 A;  4IQ1 A;  4Z2T A;  2LJA A;  2C3N A;  5B7C A;  3P7X A;  2DJ1 A;  3HVS A;  3VI5 A;  2O5V A;  2H19 A;  4KW6 A;  2PN8 A;  4ZB6 A;  4XCS A;  1K0D A;  1JZW A;  2WVX B;  3O6T A;  1R26 A;  3PR8 A;  4JZQ A;  5CO3 A;  4CY8 A;  1AC1 A;  3H1N A;  3BCI A;  2M80 A;  2VL3 A;  5L71 A;  6GSX A;  4YQV A;  2XHF A;  4ZBB A;  5IPG A;  1ILO A;  3O76 A;  1XW6 A;  3PPU A;  2FHE A;  1W89 A;  3TJF A;  4KA0 A;  3EIN A;  1LU4 A;  1SVM A;  2B1K A;  4N10 A;  1ZYP A;  4EXJ A;  1PFO A;  1MD4 A;  3SWL A;  4BL7 A;  1SJZ A;  3IPZ A;  2V1M A;  4NAX A;  4WF5 A;  3KIJ A;  2C0G A;  1WJK A;  3GKN A;  2FNO A;  1O7U A;  4V2M A;  1Y6E A;  1O73 A;  3NIV A;  2CZ3 A;  1M3J A;  4TR4 A;  4ID0 A;  1A0F A;  1RK4 A;  3RDW A;  5ABR A;  1USB A;  3MDK A;  3M0F A;  4ULX A;  4I6X A;  2IMK A;  2P0G A;  2H66 A;  2GSQ A;  1MDI A;  2V6K A;  1G0T A;  3IDV A;  3ZL5 A;  4AJ7 A;  3GRX A;  3QDN A;  2VCV A;  5ELA A;  4N0Z A;  4N11 A;  2YP6 A;  5JWQ B;  2WGR A;  3A2W A;  4V1A p;  4WR5 A;  4EIP A;  1SL2 B;  4IJI A;  1SYX A;  3MYD A;  4K1F A;  2IN3 A;  2H72 A;  4HJM A;  2CVD A;  2AHE A;  1B9X C;  3M3M A;  4KSM A;  2K8S A;  3VFI A;  4V1A g;  2RM5 A;  1GSU A;  3GUS A;  3AY8 A;  4PTS A;  1ZGN A;  2BJX A;  2DSA A;  3FR3 A;  1EP7 A;  4YQU A;  1I5G A;  2IME A;  3G9B A;  18GS A;  3ZFL A;  2WB9 A;  13GS A;  4F82 A;  3LQ7 A;  3ZML A;  2R37 A;  1T3B A;  4HQZ A;  2GLR A;  1EOG A;  4IGJ A;  4EC0 A;  1Y1U A;  5GAP D;  4IP6 A;  3ME7 A;  5F06 A;  2H6X A;  5F8B A;  3GIX A;  4WET A;  1A23 A;  2JSY A;  3PH9 A;  3MIX A;  1M9A A;  4FYC A;  4IP1 A;  4XS1 A;  3KM6 A;  1C72 A;  1A0R P;  1GUH A;  1BAY A;  3MNG A;  1SKS B;  2WDU A;  2LS5 A;  1K0N A;  1EOH A;  3HDC A;  2IPA A;  1MD3 A;  4EL1 A;  4AKH A;  1WIK A;  5A34 A;  2YV7 A;  2X64 A;  1B48 A;  2V2G A;  1GLQ A;  3TKS E;  2C3T A;  4F9Z A;  4OFM A;  1BJX A;  5JCU A;  2LQO A;  3GV1 A;  2WS2 A;  4K9Z A;  3L78 A;  1E6B A;  4MJA A;  4KF9 A;  1EP8 A;  4NXI A;  1VF2 A;  3QMX A;  2KHP A;  2OE1 A;  4RUV A;  4HU9 A;  16GS A;  3MSZ A;  4POL A;  1PSQ A;  1M2D A;  3GTU A;  4POB A;  2P31 A;  2QA1 A;  4ZB9 A;  5KN1 A;  5HFI A;  3LWA A;  5CP1 A;  4GWR A;  3J7Y b;  4OO4 A;  5B8A A;  2E2G A;  4QMK A;  5G5F A;  5AIX A;  4BPY A;  3CBU A;  2IMF A;  1NM3 A;  3TB2 A;  4PQI A;  2CT6 A;  5D73 A;  2EFD A;  1ON4 A;  3ZIT A;  4F0C A;  4IEL A;  8GSS A;  6GST A;  3WT1 A;  2OAC A;  2VOC A;  2IMI A;  1GNW A;  2VM1 A;  3H8Q A;  5HFK A;  1PMT A;  2PUK C;  3D22 A;  5A4W A;  2C80 A;  5KN2 A;  1SYR A;  3ZVJ D;  2YOI A;  2UZ8 A;  3HVV A;  4IQA A;  1SU9 A;  1LBK A;  3GX8 A;  1ZCP A;  4RQX A;  1SK0 A;  5G2Z A;  1PX6 A;  3SBC A;  5F05 A;  2WFC A;  4CY6 A;  1YEP A;  5IMC A;  1A2J A;  4KH7 A;  1THX A;  2HSN B;  2X99 A;  4NPB A;  4I8B A;  5J4U A;  5ECO B;  4OFN A;  3QFA C;  3R3E A;  1QMV A;  4ZBA A;  3EMP A;  2A2P A;  4JU5 A;  3DKS A;  5ECL B;  3UEM A;  2GZZ A;  3QPM A;  3F4S A;  1OAZ A;  2HXK A;  4TR3 A;  1DUG A;  4WR4 A;  4TR0 A;  4KDX A;  1T4Y A;  3BJ5 A;  4XIH A;  1BQ7 A;  2H30 A;  3DEX A;  3QOU A;  4MZW A;  1S3C A;  4G0K A;  3IK9 A;  3NOF A;  3L9U A;  3EC3 A;  2PMT A;  2VAF A;  1SD9 A;  2EIR A;  2DLX A;  4TXO B;  1YF1 A;  5GSS A;  2PBJ A;  2CVK A;  3CSJ A;  4KX4 A;  1PX7 A;  2AB6 A;  3FZA A;  3IRA A;  3TDG A;  1GSY A;  1R5A A;  4IW9 A;  1TU7 A;  1HQO A;  1AXD A;  3I9V 2;  2VCW A;  4MPF A;  5AIV A;  2WJU A;  2GZY A;  2I1U A;  1Z5Y E;  3ERG A;  2AJQ B;  1TXX A;  1WRY A;  4G0I A;  1XOA A;  5G30 A;  5CNW A;  3VPT A;  3IXR A;  2QSI A;  3WGE A;  1GP1 A;  3VLN A;  2GDR A;  4L8E A;  4X1U A;  4P3Y B;  2LKU A;  3GFK A;  1KEB A;  4DSQ A;  2K9F A;  1BG1 A;  3CRU A;  2H1A A;  4QQ7 A;  4HZ2 A;  3N9J A;  3IHQ A;  1YVL A;  4RI7 A;  1HYU A;  3OR5 A;  5AGY A;  5BMU B;  3P2A A;  2VD1 A;  1XWA A;  3LGC A;  3MAK A;  5ECK B;  3KP9 A;  2WW1 A;  3EMX A;  5ECH B;  4OCF A;  1ZYQ B;  1U88 A;  6GSV A;  3TOU A;  2O36 A;  2KP1 A;  2FWF A;  4GXZ A;  4WF4 A;  2I9H A;  1YEX A;  2DIZ A;  3TU3 B;  1B4P A;  5ECM B;  1G6Y A;  2VL9 A;  2HSM B;  4Q5F A;  4EE0 A;  1V58 A;  3GH9 A;  3F9U A;  2L4C A;  1G7E A;  10GS A;  3M8N A;  1K0C A;  3G7J A;  2DKI A;  4HZ4 A;  2YWM A;  3ZFB A;  3UVT A;  4MMM A;  5INY A;  1O85 A;  4V2L A;  2J9H A;  5A5H A;  4GST A;  2YJH A;  4EKZ A;  3LXZ A;  1SK1 A;  1X5D A;  4F03 A;  3CTF A;  3GYK A;  1JLV A;  1VF4 A;  1TXU A;  2HRK B;  1XXU A;  2EIQ A;  5IMV A;  4BVY A;  5ECN B;  1QXH A;  4K7N A;  2LJK A;  1OC9 A;  3QFB C;  2NDO A;  5IMF A;  1N2A A;  4ZIJ A;  5B8B A;  2X8G A;  3GA4 A;  2WW3 A;  1I1I P;  3EU4 A;  1EV4 A;  1M2B A;  4ECC A;  1AIU A;  2YAN A;  2QA2 A;  2X8C A;  14GS A;  4KDU A;  1EZK A;  1NHO A;  1S3A A;  2WRT A;  1TRW A;  2GSR A;  3HCZ A;  3E0U A;  5J9C A;  1GLP A;  5A5K A;  3ERF A;  2XBI A;  1F3A A;  5E59 A;  2H76 A;  2A2S A;  4W66 A;  1O8X A;  2DJ0 A;  4ECJ A;  4LL1 B;  3TJG A;  4JR6 A;  3TCO A;  2QGV A;  3CTG A;  2OT3 A;  2PVO C;  1JHB A;  1G7O A;  2L6C A;  1K0A A;  3IK7 A;  2C0D A;  3FKF A;  1YEW C;  3FR6 A;  3I43 A;  2I4A A;  2LTK A;  2QC7 A;  4ML1 A;  3UL3 A;  2OJL A;  4BVX B;  1V9W A;  2JZT A;  3FZ4 A;  2WUL A;  3DIE A;  4OWY A;  1PQN A;  3KMO A;  4HDE A;  3KMN A;  3ZZX A;  1ZYN A;  3TOT A;  1ERV A;  3FRC A;  2HRN A;  4A5P A;  1SJI A;  4KE3 A;  3UVH A;  3KGK A;  2OBK A;  3IC4 A;  3F3R A;  1F3B A;  4TR1 B;  2YZH A;  3E3E A;  5KOW A;  1OC3 A;  2CX3 A;  2HZE B;  4GSN A;  5JWO B;  4USS A;  3NZN A;  2YN1 A;  4KUN A;  3UBL A;  5A1N B;  1PA3 A;  4YH2 A;  2L6D A;  4HS1 A;  2GVP A;  1XWK A;  5D8I A;  1JLW A;  4E8E A;  1ML6 A;  2QKE A;  1HD2 A;  3EVI A;  1TK0 B;  5HR0 A;  1YKC A;  3UJ1 A;  1GSS A;  4AKG A;  4MJC A;  2VL2 A;  1SKW B;  3KTL A;  2HZF A;  2O87 A;  3TKR A;  1FW1 A;  3GNJ A;  1CQG A;  1M99 A;  3LFL A;  3CQF A;  12GS A;  1DSB A;  5F07 A;  2MYG A;  4WBR D;  3G7Y A;  4XRA A;  1X9M B;  3HMJ G;  4ZL8 A;  4PQH A;  3RGB C;  3HXS A;  4V2N A;  1QUW A;  1PL2 A;  5DAK B;  2FWE A;  5HR2 A;  2ALB A;  4PUF C;  1U6T A;  5DVB A;  3IOS A;  2V32 A;  2H74 A;  2O8V B;  5DCH A;  4YAP A;  6GSY A;  4TVE A;  1H75 A;  2GT5 A;  2HYX A;  5HR3 A;  2DC5 A;  3BCK A;  2R3X A;  1SVO A;  4IHU A;  4Q5R A;  4ICY A;  3RFR C;  4L5O A;  3F4T A;  3HZ8 A;  3GKX A;  2PPT A;  3HJP A;  3HJM A;  1HNB A;  2WVY A;  2O7K A;  1O8W A;  3ZRE A;  3APO A;  4L0U A;  2ES7 A;  2X8H A;  1V2A A;  1AW9 A;  5HFG A;  5ID2 A;  2A4V A;  2BMX A;  3LYP A;  2GS3 A;  2B7K A;  3C1S A;  1QFN A;  1XCC A;  3MWH A;  3GL3 A;  3KEB A;  1T4Z A;  1XW9 A;  2WVX A;  1GTB A;  2WZ9 A;  2GZP A;  2L59 A;  4KB3 A;  3ZYW A;  2R6K A;  2DJK A;  1A2M A;  4YKF A;  2JL4 A;  4JRR A;  4GLT A;  1OE8 A;  4PQ1 A;  2PVQ A;  3ZMK A;  4JED A;  4RI6 A;  4KND A;  3GL5 A;  2OAD A;  3HVX A;  3C1R A;  1K0O A;  1TI3 A;  4MNN A;  4OMV A;  2V41 A;  3IV4 A;  4Z2R A;  2IFQ B;  2OBI A;  2MMZ A;  4PGT A;  4I2T A;  3WT2 A;  4EVM A;  2O3E A;  3CXG A;  5E4W A;  5IO0 A;  4O5R A;  4GSS A;  2ON5 A;  5C04 A;  4PI2 C;  4LLR A;  3UAP A;  2IMD A;  3P90 A;  2H1L A;  4BWQ A;  1B8X A;  3VK9 A;  1GSD A;  5DAL B;  3US3 A;  1YJ6 A;  4O7H A;  5COH A;  3GX0 A;  1HNC A;  1X0R A;  1ERW A;  3PGT A;  4H86 A;  1A8Y A;  2KP2 A;  1SKR B;  5IO2 A;  1ZOF A;  4K0N A;  3TKQ A;  4Z7X A;  3IAM 2;  2V6O A;  4EF0 A;  1NW2 A;  1U3I A;  1G6W A;  4PNG A;  4DSR A;  3RPP A;  4NMU A;  5J40 A;  1TTZ A;  4L5L A;  1T8E B;  4TW5 A;  2NPB A;  4ZB7 A;  2JSZ A;  6GSU A;  3FR9 A;  3LSZ A;  1URM A;  4YKG A;  1Y25 A;  4AF2 A;  4DSS B;  4ZBD A;  4LA1 A;  4WEY A;  4O5U A;  2FWG A;  4XS6 A;  4JR4 A;  1YKA A;  1F6M C;  1M3I A;  4MLY A;  3HY2 A;  1Z7R A;  2HRA A;  3GN3 A;  4D73 B;  3A2X A;  2REM A;  1SVL A;  2FD3 A;  1J08 A;  2G2Q A;  4E8H A;  5LCZ A;  4HEA 2;  2FCH A;  1Q4J A;  4L0W A;  2VL2 C;  5CYY A;  2YZU A;  3KP8 A;  2C1Y A;  1TK8 B;  1XVQ A;  6GSS A;  1R4W A;  2H8L A;  4Z2U A;  1TW9 A;  3FW2 A;  3N5O A;  1IYI A;  5IM9 A;  1ABA A;  20GS A;  1F2E A;  5FT3 A;  2GQL A;  3BOA A;  2B5X A;  1WWJ A;  3LG6 A;  5DDL A;  2XBQ A;  2LEG A;  3VWW A;  3EE2 A;  3KH9 A;  3GUR A;  4IVF A;  1FAA A;  2WVZ A;  2H73 A;  5D93 A;  5HQP A;  2JZS A;  2H1B A;  5H5R A;  4OFT A;  1J9B A;  1OKT A;  2MZC A;  2A2R A;  1OYJ A;  5IIZ A;  4KDY A;  5HR1 A;  3QR6 A;  1TOF A;  3HJO A;  4J57 E;  3LYK A;  1PN9 A;  1YF0 A;  2P5R A;  1K3O A;  4BIK A;  2VO4 A;  5FHI A;  7GSS A;  4MZB A;  3P8W A;  3FZ9 A;  1GSE A;  2LRT A;  3W8J A;  1S3D A;  4AJ6 A;  5D96 A;  1YZX A;  4MPG A;  3WD6 A;  2A4H A;  5D9V A;  3GKM A;  3CHX C;  3UAR A;  2B6M A;  1FG4 A;  4X43 A;  4FO5 A;  5AN1 A;  3UOM A;  3S9F A;  2GT6 A;  2MMA A;  3BBY A;  2B1L A;  4GF0 A;  2FWH A;  1UA5 A;  3D0Z A;  4JBB A;  1EEJ A;  3VPQ A;  1OE7 A;  2WCI A;  3APQ A;  2VD0 A;  4MJB A;  1I9D A;  3E9J B;  4K0G A;  2DJJ A;  4HI7 A;  3H4K A;  3L4N A;  4WXT A;  5DCG A;  1B4Q A;  5DJM A;  4XS4 B;  2R0C A;  2R5G A;  2JAD A;  2D2Z A;  2G0F A;  2ZNM A;  3CRT A;  3U6V A;  2ZUP A;  1DBY A;  4XHM A;  1OVN A;  2C4J A;  2CX4 A;  4EUY A;  1SL0 B;  4N30 A;  3Q6O A;  2B7J A;  4ZL9 A;  4IJ3 A;  2VUP A;  3DML A;  4PUA A;  4K7O A;  2CAQ A;  3FK8 A;  1PRX A;  1MDK A;  1VGL A;  4GDF A;  1T00 A;  1UVZ A;  2R0G A;  2YPM A;  4HSC X;  2FA4 A;  2HQT A;  4N3Z A;  4F0B A;  3KH7 A;  2H0G A;  1TRU A;  1R7H A;  2IIY A;  1TRS A;  3ERW A;  1GSF A;  5JCW A;  1M9B A;  1ZMA A;  3Q74 A;  4OD7 A;  3GH6 A;  4MF5 A;  4KCA A;  2AAW A;  2L5L A;  2N5F A;  1KTE A;  1F37 A;  2HSN A;  5IQY A;  3WGX A;  1MEK A;  4ECI A;  1TKD B;  2F8F A;  19GS A;  2VCT A;  5B6N A;  3W6G A;  4YAV A;  3UIW A;  2HSH A;  2HI7 A;  4MF6 A;  1M0U A;  1EGR A;  4BL7 B;  2MMN A;  3C7M A;  4MZC A;  4Q5Q A;  1XBS A;  2GQM A;  3Q18 A;  2B5Y A;  5J3R A;  1EEM A;  2KUC A;  5CRW A;  4MH2 A;  2B3S A;  2GSS A;  1SEN A;  4MAB A;  1PN0 A;  2DJ3 A;  2E2M A;  4AKI A;  2XPE A;  4ZL7 A;  1JZD A;  4TXO A;  1OKD A;  1R5P A;  1S3R A;  4J56 E;  3UMA A;  17GS A;  2OE3 A;  1SL1 B;  4PUR A;  2E0Q A;  4HUA A;  4OCE A;  3DGQ A;  3M9J A;  5GAN D;  1WMJ A;  2L57 A;  2HE3 A;  2AV4 A;  2OKA A;  1PKW A;  2PU9 C;  1VF3 A;  1TRV A;  2M72 A;  3CSI A;  2B5E A;  2FGX A;  3TKS A;  1SK2 A;  1X9S B;  3HHV A;  4ZIL A;  2K8V A;  1GUL A;  1N25 A;  5DJL A;  3EWL A;  3ZTL A;  5EVO A;  1LJR A;  4IS0 A;  2HRF A;  1X5E A;  5JCG A;  1VF1 A;  3H93 A;  2TIR A;  5KN3 A;  1GTU A;  2MMO A;  2H01 A;  5ID2 B;  5KOX A;  1Z7P A;  2F51 A;  1GH2 A;  2DKH A;  1T1V A;  4XTS A;  5DQS A;  4K8M A;  3RPN A;  2RUE A;  4XRD A;  2L5O A;  3FEU A;  2R4V A;  1PL1 A;  3LXT A;  4MA9 A;  1XG8 A;  3HA9 A;  3DVW A;  4CW9 A;  1YQ1 A;  2HSM A;  4POM A;  3KTB A;  1EGO A;  5A4U A;  5B6M A;  2ZCT A;  1N8J A;  1S4B P;  5EL8 A;  4JE1 A;  3F6F A;  1TU8 A;  4K6X A;  4GCI A;  2CAI A;  1PD2 1;  2JAC A;  5G1L A;  2UV8 G;  1GRX A;  4G2E A;  5KEJ A;  1XFL A;  3FZ5 A;  2LRC A;  4AKX B;  3TRQ A;  5AIS A;  1XZO A;  1QQ2 A;  3DD3 A;  1RQM A;  1NSW A;  3VWX A;  5A34 B;  1VRS D;  5IMA A;  1YY7 A;  1X9W B;  2HRK A;  3D4T A;  3TJK A;  2DBC A;  11GS A;  2VLT A;  3ZRD A;  4EDY A;  5D9W A;  3IA1 A;  3O3T A;  1WPI A;  4KCE A;  2H71 A;  2O85 A;  2HSY A;  1V57 A;  2LNT A;  3H79 A;  2VIM A;  1J0F A;  2I3Y A;  3VWU A;  4GQF A;  4IKH A;  1GWC A;  4EO3 A;  3FYG A;  3LEF A;  3I69 A;  4FYU A;  3C73 A;  3ED3 A;  4MK3 A;  2GTU A;  2CQ9 A;  2H0H A;  1ST9 A;  3GTU B;  5A4V A;  2H6Z A;  2WW2 A;  5IMD A;  2EFC A;  1XOB A;  1EWX A;  1TJD A;  2H1G A;  2MBS A;  2LUS A;  4K7I A;  1KNG A;  2H0I A;  3ZVJ A;  2GST A;  1BF5 A;  1ZL9 A;  4X0X A;  4YQM A;  1GTI A;  3RBT A;  3W8S A;  5D9T A;  3R2Q A;  4POK A;  1AAZ A;  5J41 A;  3C71 A;  4O92 A;  3FHK A;  4IN0 A;  1THO A;  2YWI A;  3DWV A;  4AGS A;  1XVW A;  3DVX A;  4BVX A;  3TJJ A;  1SJ6 A;  3TJB A;  3DYR A;  4J2F A;  3KCM A;  3IHG A;  1FB0 A;  5G31 A;  3L9S A;  5GST A;  3GST A;  5ECS A;  2HFD A;  1IYH A;  2LNS A;  2C3Q A;  5IOX A;  1DE1 A;  4FXY P;  2XPD A;  5G5E A;  3VWV A;  1JZO A;  1XPV A;  4N0V A;  1Z6N A;  2YWN A;  4TR1 A;  3JCM L;  1BX9 A;  5ENU A;  3D5J A;  4MH3 A;  2WW0 A;  1M2A A;  2HZE A;  1BED A;  4X4J A;  1V98 A;  2NBS A;  3D4M A;  5A1N A;  3TKS C;  4HOJ A;  1WP0 A;  2H75 A;  1O81 A;  3ISO A;  2L4Q A;  3IAS 2;  4PI0 C;  1FB6 A;  3RHB A;  5CAX A;  2VLV A;  2R2J A;  1BG5 A;  1Z9H A;  2PER A;  1B9Y C;  2J23 A;  5EY6 A;  3G7I A;  2YNX A;  1K0B A;  4KAE A;  3K8N A;  4MP4 A;  3HVN A;  2OE0 A;  1MDJ A;  3HZ4 A;  4LMV A;  1K0M A;  3J7Y k;  1X5C A;  4LMW A;  3Q19 A;  5F0G A;  3I6A A;  3F3Q A;  3BD2 A;  3KXO A;  2OA7 A;  2N5A A;  5DAK A;  4EIQ A;  1V40 A;  2K6V A;  3EU3 A;  1GSQ A;  4FIW A;  5ECP B;  3ZIV A;  1U87 A;  3IE3 A;  3QAG A;  6GSW A;  2YCD A;  4ZXG A;  4PHZ C;  1XWC A;  1O6J A;  1BYE A;  1WE0 A;  1RW1 A;  4ACS A;  1JFU A;  4DEJ A;  1H4O A;  9GSS A;  2VLU A;  3CSH A;  1TDI A;  4K2X A;  4QL9 A;  3F4R A;  3F63 A;  4FH8 A;  3TGZ A;  2RLI A;  3QAW A;  2Z9S A;  1FOH A;  4I97 A;  4G10 A;  4PXO A;  4HJ2 A;  3HKR A;  4PX1 A;  2F3M A;  3A3T A;  4FQU A;  5CRG A;  5IOW A;  4HQS A;  1ERU A;  3TUE A;  2VKZ G;  3GHA A;  3GKK A;  2EC4 A;  4K5S A;  5CRE A;  4I2U A;  2I81 A;  2CZ2 A;  3PIN A;  2EIO A;  1ZYE A;  2VCZ A;  2DMM A;  3F8U A;  2CV4 A;  3DXB A;  4QL7 A;  1SD8 A;  1Z3E A;  4NHZ A;  5ELG A;  2JZR A;  2H1D A;  2F8A A;  5J4Y A;  3WYW A;  2JU5 A;  3EUR A;  1QK8 A;  2AYT A;  5DQY A;  3CMI A;  1K3L A;  1XWB A;  3LJR A;  1DE2 A;  3A5I A;  3GSS A;  2LQQ A;  3LOR A;  4ZB8 A;  3TRX A;  1AQV A;  4WBJ A;  5KN0 A;  3RHC A;  3TKP A;  3GMF A;  2XC2 A;  3F6D A;  2IFQ A;  1XWG A;  3QAV A;  3L9V A;  3LW9 A;  3U5R E;  2EFH A;  2YJ7 A;  2PWJ A;  4TOP A;  3VI7 A;  2IL3 A;  5A5H B;  3HYP A;  2PGT A;  5JWR B;  2WZS A;  4TN8 A;  5C00 A;  22GS A;  3RAZ A;  5IMZ A;  4K2D A;  2IJY A;  4RQR A;  4HU7 A;  3A2V A;  1HNA A;  2GQK A;  4BVY B;  1KBN A;  5CRD A;  3CWG A;  2NTO A;  1OC9 B;  5DAL A;  2BTO T;  2M46 A;  3HD5 A;  4K5R A;  3UBK A;  4LL4 B;  1UC7 A;  4IBP A;  5D9X A;  5G1K A;  2LV3 A;  2X4A A;  3ME8 A;  4TKY A;  1AUC A;  1AQW A;  2VCX A;  4G9H A;  4CHS A;  2FLS A;  2RII A;  1PGT A;  2C0E A;  3WGD A;  1F9M A;  2C8U A;  4WKW A;  4NV5 A;  5J5N A;  4NV2 A;  2X49 A;  3KZQ A;  1EV9 A;  2VCQ A;  4TRX A;  1TP9 A;  4NHW A;  4MDC A;  4DSS A;  1PKZ A;  5LD0 A;  1TK5 B;  2AUV A;  4G0L A;  1ERT A;  5CRH A;  2F9S A;  2DIY A;  1YDK A;  2MBT A;  3IR4 A;  5J9B A;  1FOV A;  4D73 A;  1Q98 A;  3KJY A;  4ILF A;  4O5Q A;  3M1G A;  4AI6 A;  2TRX A;  2HT9 A;  4GTU A;  5LNK e;  2RM6 A;  1A8L A;  2ON7 A;  4Q5N A;  1FVK A;  2H70 A;  5EPF A;  1GUM A;  2HNL A;  3D21 A;  4E68 A;  4DVC A;  2VM2 A;  5ECR B;  1ACV A;  1TI1 A;  2GGT A;  2O89 A;  5H5Q A;  1CQH A;  2TRC P;  4NWY A;  1E2Y A;  4EDZ A;  2C0F A;  1QGV A;  3EYT A;  2DML A;  1FHE A;  2R0P A;  2LJR A;  1MTC A;  4KGI A;  2NVL A;  4G19 A;  1GNE A;  2EFE A;  3F0I A;  3KD0 A;  3TRP A; 
#chains in the Genus database with same CATH homology
 5H5S A;  5GZZ B;  4OO5 A;  5BRT A;  1XW5 A;  2HLS A;  3V1W A;  3IBH A;  3QCP A;  5IPH A;  4BWS A;  2E7P A;  4G01 A;  2DJ2 A;  2FA8 A;  4ISD A;  4O32 A;  4FYB A;  1UN2 A;  3QD9 A;  5FWG A;  4PNF A;  5J4V A;  3C8E A;  1W4V A;  2KLX A;  3ZLP A;  5ECQ B;  1XIY A;  2KOK A;  4ML6 A;  3CYN A;  1GTA A;  1U3A A;  4ECB A;  4GRF A;  5DBQ A;  1T7P B;  3FY7 A;  3FMW A;  4MCU A;  4KSO A;  3APS A;  2LST A;  1AQX A;  4GQC A;  2K18 A;  4MJE A;  4CDO A;  2FY6 A;  2RUF A;  5ECI B;  1A24 A;  1GL8 A;  3M9K A;  1A2L A;  2H6Y A;  2CA8 A;  1NHY A;  1OC8 A;  1WOU A;  3DRN A;  3D6I A;  1M7T A;  2FUG 2;  1Z6M A;  1FO5 A;  2YWO A;  2CVB A;  4AJ8 A;  4MF7 A;  4BA7 A;  4XS4 A;  3A5W A;  1FVJ A;  4I5Q A;  3L0H A;  5J47 A;  1K3Y A;  2N5B A;  3ZIJ A;  4F2I A;  2LRN A;  2YV9 A;  3VUR A;  2IWT A;  4TXV A;  1ZZY A;  3EPT A;  1GUK A;  2P5Q A;  1JZR A;  5BMU A;  3IC8 A;  4IQ1 A;  4Z2T A;  2LJA A;  2C3N A;  5B7C A;  3P7X A;  2DJ1 A;  3HVS A;  3VI5 A;  2O5V A;  2H19 A;  4KW6 A;  2PN8 A;  4ZB6 A;  4XCS A;  1K0D A;  1JZW A;  3O6T A;  1R26 A;  3PR8 A;  4JZQ A;  5CO3 A;  4CY8 A;  1AC1 A;  3H1N A;  3BCI A;  2M80 A;  2VL3 A;  5L71 A;  6GSX A;  4YQV A;  2XHF A;  4ZBB A;  5IPG A;  1ILO A;  3O76 A;  1XW6 A;  3PPU A;  2FHE A;  1W89 A;  3TJF A;  4KA0 A;  3EIN A;  1LU4 A;  1SVM A;  2B1K A;  4N10 A;  1ZYP A;  4EXJ A;  1MD4 A;  3SWL A;  4BL7 A;  1SJZ A;  3IPZ A;  2V1M A;  4NAX A;  4WF5 A;  3KIJ A;  2C0G A;  1WJK A;  3GKN A;  2FNO A;  1O7U A;  4V2M A;  1Y6E A;  1O73 A;  3NIV A;  2CZ3 A;  4TR4 A;  4ID0 A;  1A0F A;  1RK4 A;  3RDW A;  5ABR A;  1USB A;  3MDK A;  3M0F A;  4ULX A;  4I6X A;  2IMK A;  2P0G A;  2H66 A;  2GSQ A;  1MDI A;  2V6K A;  1G0T A;  3IDV A;  3ZL5 A;  4AJ7 A;  3GRX A;  3QDN A;  2VCV A;  5ELA A;  4N0Z A;  4N11 A;  2YP6 A;  5JWQ B;  2WGR A;  3A2W A;  4V1A p;  4WR5 A;  4EIP A;  1SL2 B;  4IJI A;  1SYX A;  3MYD A;  4K1F A;  2IN3 A;  2H72 A;  4HJM A;  2CVD A;  2AHE A;  1B9X C;  3M3M A;  4KSM A;  2K8S A;  3VFI A;  4V1A g;  2RM5 A;  1GSU A;  3GUS A;  3AY8 A;  4PTS A;  1ZGN A;  2BJX A;  2DSA A;  3FR3 A;  1EP7 A;  4YQU A;  1I5G A;  2IME A;  3G9B A;  18GS A;  3ZFL A;  2WB9 A;  13GS A;  4F82 A;  3LQ7 A;  3ZML A;  2R37 A;  1T3B A;  4HQZ A;  2GLR A;  1EOG A;  4IGJ A;  4EC0 A;  1Y1U A;  5GAP D;  4IP6 A;  3ME7 A;  5F06 A;  2H6X A;  5F8B A;  3GIX A;  4WET A;  1A23 A;  2JSY A;  3PH9 A;  3MIX A;  1M9A A;  4FYC A;  4IP1 A;  4XS1 A;  3KM6 A;  1C72 A;  1A0R P;  1GUH A;  1BAY A;  3MNG A;  1SKS B;  2WDU A;  2LS5 A;  1K0N A;  1EOH A;  3HDC A;  2IPA A;  1MD3 A;  4EL1 A;  4AKH A;  1WIK A;  5A34 A;  2YV7 A;  2X64 A;  1B48 A;  2V2G A;  1GLQ A;  3TKS E;  2C3T A;  4F9Z A;  4OFM A;  1BJX A;  5JCU A;  2LQO A;  3GV1 A;  2WS2 A;  4K9Z A;  3L78 A;  1E6B A;  4MJA A;  4KF9 A;  1EP8 A;  4NXI A;  1VF2 A;  3QMX A;  2KHP A;  2OE1 A;  4RUV A;  4HU9 A;  16GS A;  3MSZ A;  4POL A;  1PSQ A;  1M2D A;  3GTU A;  4POB A;  2P31 A;  2QA1 A;  4ZB9 A;  5KN1 A;  5HFI A;  3LWA A;  5CP1 A;  4GWR A;  3J7Y b;  4OO4 A;  5B8A A;  2E2G A;  4QMK A;  5G5F A;  5AIX A;  4BPY A;  3CBU A;  2IMF A;  1NM3 A;  3TB2 A;  4PQI A;  2CT6 A;  5D73 A;  2EFD A;  1ON4 A;  3ZIT A;  4F0C A;  4IEL A;  8GSS A;  6GST A;  3WT1 A;  2OAC A;  2VOC A;  2IMI A;  1GNW A;  2VM1 A;  3H8Q A;  5HFK A;  1PMT A;  2PUK C;  3D22 A;  5A4W A;  2C80 A;  5KN2 A;  1SYR A;  3ZVJ D;  2YOI A;  2UZ8 A;  3HVV A;  4IQA A;  1SU9 A;  1LBK A;  3GX8 A;  1ZCP A;  4RQX A;  1SK0 A;  5G2Z A;  1PX6 A;  3SBC A;  5F05 A;  2WFC A;  4CY6 A;  1YEP A;  5IMC A;  1A2J A;  4KH7 A;  1THX A;  2HSN B;  2X99 A;  4NPB A;  4I8B A;  5J4U A;  5ECO B;  4OFN A;  3QFA C;  3R3E A;  1QMV A;  4ZBA A;  3EMP A;  2A2P A;  4JU5 A;  3DKS A;  5ECL B;  3UEM A;  2GZZ A;  3QPM A;  3F4S A;  1OAZ A;  2HXK A;  4TR3 A;  1DUG A;  4WR4 A;  4TR0 A;  4KDX A;  1T4Y A;  3BJ5 A;  4XIH A;  1BQ7 A;  2H30 A;  3DEX A;  3QOU A;  4MZW A;  1S3C A;  4G0K A;  3IK9 A;  3NOF A;  3L9U A;  3EC3 A;  2PMT A;  2VAF A;  1SD9 A;  2EIR A;  2DLX A;  4TXO B;  1YF1 A;  5GSS A;  2PBJ A;  2CVK A;  3CSJ A;  4KX4 A;  1PX7 A;  2AB6 A;  3FZA A;  3IRA A;  3TDG A;  1GSY A;  1R5A A;  4IW9 A;  1TU7 A;  1HQO A;  1AXD A;  3I9V 2;  2VCW A;  4MPF A;  5AIV A;  2WJU A;  2GZY A;  2I1U A;  1Z5Y E;  3ERG A;  2AJQ B;  1TXX A;  1WRY A;  4G0I A;  1XOA A;  5G30 A;  5CNW A;  3VPT A;  3IXR A;  2QSI A;  3WGE A;  1GP1 A;  3VLN A;  2GDR A;  4L8E A;  4X1U A;  4P3Y B;  2LKU A;  3GFK A;  1KEB A;  4DSQ A;  2K9F A;  1BG1 A;  3CRU A;  2H1A A;  4QQ7 A;  4HZ2 A;  3N9J A;  3IHQ A;  1YVL A;  4RI7 A;  1HYU A;  3OR5 A;  5AGY A;  5BMU B;  3P2A A;  2VD1 A;  1XWA A;  3LGC A;  3MAK A;  5ECK B;  3KP9 A;  3EMX A;  5ECH B;  4OCF A;  1ZYQ B;  1U88 A;  6GSV A;  3TOU A;  2KP1 A;  2FWF A;  4GXZ A;  4WF4 A;  2I9H A;  1YEX A;  2DIZ A;  3TU3 B;  1B4P A;  5ECM B;  1G6Y A;  2VL9 A;  2HSM B;  4Q5F A;  4EE0 A;  1V58 A;  3GH9 A;  3F9U A;  2L4C A;  1G7E A;  10GS A;  3M8N A;  1K0C A;  3G7J A;  2DKI A;  4HZ4 A;  2YWM A;  3ZFB A;  3UVT A;  4MMM A;  5INY A;  1O85 A;  4V2L A;  2J9H A;  5A5H A;  4GST A;  2YJH A;  4EKZ A;  3LXZ A;  1SK1 A;  1X5D A;  4F03 A;  3CTF A;  3GYK A;  1JLV A;  1VF4 A;  1TXU A;  2HRK B;  1XXU A;  2EIQ A;  5IMV A;  4BVY A;  5ECN B;  1QXH A;  4K7N A;  2LJK A;  1OC9 A;  3QFB C;  2NDO A;  5IMF A;  1N2A A;  4ZIJ A;  5B8B A;  2X8G A;  3GA4 A;  3EU4 A;  1EV4 A;  1M2B A;  4ECC A;  1AIU A;  2YAN A;  2QA2 A;  2X8C A;  14GS A;  4KDU A;  1EZK A;  1NHO A;  1S3A A;  2WRT A;  1TRW A;  2GSR A;  3HCZ A;  3E0U A;  5J9C A;  1GLP A;  5A5K A;  3ERF A;  2XBI A;  1F3A A;  5E59 A;  2H76 A;  2A2S A;  4W66 A;  1O8X A;  2DJ0 A;  4ECJ A;  4LL1 B;  3TJG A;  4JR6 A;  3TCO A;  2QGV A;  3CTG A;  2OT3 A;  2PVO C;  1JHB A;  1G7O A;  2L6C A;  1K0A A;  3IK7 A;  2C0D A;  3FKF A;  3FR6 A;  3I43 A;  2I4A A;  2LTK A;  2QC7 A;  4ML1 A;  3UL3 A;  2OJL A;  4BVX B;  1V9W A;  2JZT A;  3FZ4 A;  2WUL A;  3DIE A;  4OWY A;  1PQN A;  3KMO A;  4HDE A;  3KMN A;  3ZZX A;  1ZYN A;  3TOT A;  1ERV A;  3FRC A;  2HRN A;  4A5P A;  1SJI A;  4KE3 A;  3UVH A;  3KGK A;  2OBK A;  3IC4 A;  3F3R A;  1F3B A;  4TR1 B;  2YZH A;  3E3E A;  5KOW A;  1OC3 A;  2CX3 A;  2HZE B;  4GSN A;  5JWO B;  4USS A;  3NZN A;  2YN1 A;  4KUN A;  3UBL A;  5A1N B;  1PA3 A;  4YH2 A;  2L6D A;  4HS1 A;  2GVP A;  1XWK A;  5D8I A;  1JLW A;  4E8E A;  1ML6 A;  2QKE A;  1HD2 A;  3EVI A;  1TK0 B;  5HR0 A;  1YKC A;  3UJ1 A;  1GSS A;  4AKG A;  4MJC A;  2VL2 A;  1SKW B;  3KTL A;  2HZF A;  2O87 A;  3TKR A;  1FW1 A;  3GNJ A;  1CQG A;  1M99 A;  3LFL A;  12GS A;  1DSB A;  5F07 A;  2MYG A;  4WBR D;  3G7Y A;  4XRA A;  1X9M B;  3HMJ G;  4ZL8 A;  4PQH A;  3HXS A;  4V2N A;  1QUW A;  1PL2 A;  5DAK B;  2FWE A;  5HR2 A;  2ALB A;  4PUF C;  1U6T A;  5DVB A;  3IOS A;  2V32 A;  2H74 A;  2O8V B;  5DCH A;  4YAP A;  6GSY A;  4TVE A;  1H75 A;  2GT5 A;  2HYX A;  5HR3 A;  2DC5 A;  3BCK A;  2R3X A;  1SVO A;  4IHU A;  4Q5R A;  4ICY A;  4L5O A;  3F4T A;  3HZ8 A;  3GKX A;  2PPT A;  3HJP A;  3HJM A;  1HNB A;  2O7K A;  1O8W A;  3ZRE A;  3APO A;  4L0U A;  2ES7 A;  2X8H A;  1V2A A;  1AW9 A;  5HFG A;  5ID2 A;  2A4V A;  2BMX A;  3LYP A;  2GS3 A;  2B7K A;  3C1S A;  1QFN A;  1XCC A;  3MWH A;  3GL3 A;  3KEB A;  1T4Z A;  1XW9 A;  1GTB A;  2WZ9 A;  2GZP A;  2L59 A;  4KB3 A;  3ZYW A;  2R6K A;  2DJK A;  1A2M A;  4YKF A;  2JL4 A;  4JRR A;  4GLT A;  1OE8 A;  4PQ1 A;  2PVQ A;  3ZMK A;  4JED A;  4RI6 A;  4KND A;  3GL5 A;  2OAD A;  3HVX A;  3C1R A;  1K0O A;  1TI3 A;  4MNN A;  4OMV A;  2V41 A;  3IV4 A;  4Z2R A;  2IFQ B;  2OBI A;  2MMZ A;  4PGT A;  4I2T A;  3WT2 A;  4EVM A;  3CXG A;  5E4W A;  5IO0 A;  4O5R A;  4GSS A;  2ON5 A;  5C04 A;  4LLR A;  3UAP A;  2IMD A;  3P90 A;  2H1L A;  4BWQ A;  1B8X A;  3VK9 A;  1GSD A;  5DAL B;  3US3 A;  1YJ6 A;  4O7H A;  5COH A;  3GX0 A;  1HNC A;  1X0R A;  1ERW A;  3PGT A;  4H86 A;  1A8Y A;  2KP2 A;  1SKR B;  5IO2 A;  1ZOF A;  4K0N A;  3TKQ A;  4Z7X A;  3IAM 2;  2V6O A;  4EF0 A;  1NW2 A;  1U3I A;  1G6W A;  4PNG A;  4DSR A;  3RPP A;  4NMU A;  5J40 A;  1TTZ A;  4L5L A;  1T8E B;  4TW5 A;  2NPB A;  4ZB7 A;  2JSZ A;  6GSU A;  3FR9 A;  3LSZ A;  1URM A;  4YKG A;  1Y25 A;  4AF2 A;  4DSS B;  4ZBD A;  4LA1 A;  4WEY A;  4O5U A;  2FWG A;  4XS6 A;  4JR4 A;  1YKA A;  1F6M C;  4MLY A;  3HY2 A;  1Z7R A;  2HRA A;  3GN3 A;  4D73 B;  3A2X A;  2REM A;  1SVL A;  2FD3 A;  1J08 A;  2G2Q A;  4E8H A;  5LCZ A;  4HEA 2;  2FCH A;  1Q4J A;  4L0W A;  2VL2 C;  5CYY A;  2YZU A;  3KP8 A;  2C1Y A;  1TK8 B;  1XVQ A;  6GSS A;  1R4W A;  2H8L A;  4Z2U A;  1TW9 A;  3FW2 A;  3N5O A;  1IYI A;  5IM9 A;  1ABA A;  20GS A;  1F2E A;  5FT3 A;  2GQL A;  3BOA A;  2B5X A;  1WWJ A;  3LG6 A;  5DDL A;  2XBQ A;  2LEG A;  3VWW A;  3EE2 A;  3KH9 A;  3GUR A;  4IVF A;  1FAA A;  2H73 A;  5D93 A;  5HQP A;  2JZS A;  2H1B A;  5H5R A;  4OFT A;  1J9B A;  1OKT A;  2MZC A;  2A2R A;  1OYJ A;  5IIZ A;  4KDY A;  5HR1 A;  3QR6 A;  1TOF A;  3HJO A;  4J57 E;  3LYK A;  1PN9 A;  1YF0 A;  2P5R A;  1K3O A;  2VO4 A;  5FHI A;  7GSS A;  4MZB A;  3P8W A;  3FZ9 A;  1GSE A;  2LRT A;  3W8J A;  1S3D A;  4AJ6 A;  5D96 A;  1YZX A;  4MPG A;  3WD6 A;  2A4H A;  5D9V A;  3GKM A;  3UAR A;  2B6M A;  1FG4 A;  4X43 A;  4FO5 A;  5AN1 A;  3UOM A;  3S9F A;  2GT6 A;  2MMA A;  3BBY A;  2B1L A;  4GF0 A;  2FWH A;  1UA5 A;  3D0Z A;  4JBB A;  1EEJ A;  3VPQ A;  1OE7 A;  2WCI A;  3APQ A;  2VD0 A;  4MJB A;  1I9D A;  3E9J B;  4K0G A;  2DJJ A;  4HI7 A;  3H4K A;  3L4N A;  4WXT A;  5DCG A;  1B4Q A;  5DJM A;  4XS4 B;  2R0C A;  2R5G A;  2JAD A;  2D2Z A;  2G0F A;  2ZNM A;  3CRT A;  3U6V A;  2ZUP A;  1DBY A;  4XHM A;  1OVN A;  2C4J A;  2CX4 A;  4EUY A;  1SL0 B;  4N30 A;  3Q6O A;  2B7J A;  4ZL9 A;  4IJ3 A;  2VUP A;  3DML A;  4PUA A;  4K7O A;  2CAQ A;  3FK8 A;  1PRX A;  1MDK A;  1VGL A;  4GDF A;  1T00 A;  1UVZ A;  2R0G A;  2YPM A;  2FA4 A;  2HQT A;  4N3Z A;  4F0B A;  3KH7 A;  2H0G A;  1TRU A;  1R7H A;  2IIY A;  1TRS A;  3ERW A;  1GSF A;  5JCW A;  1M9B A;  1ZMA A;  3Q74 A;  4OD7 A;  3GH6 A;  4MF5 A;  4KCA A;  2AAW A;  2L5L A;  2N5F A;  1KTE A;  1F37 A;  2HSN A;  5IQY A;  3WGX A;  1MEK A;  4ECI A;  1TKD B;  2F8F A;  19GS A;  2VCT A;  5B6N A;  3W6G A;  4YAV A;  3UIW A;  2HSH A;  2HI7 A;  4MF6 A;  1M0U A;  1EGR A;  4BL7 B;  2MMN A;  3C7M A;  4MZC A;  4Q5Q A;  1XBS A;  2GQM A;  3Q18 A;  2B5Y A;  5J3R A;  1EEM A;  2KUC A;  5CRW A;  4MH2 A;  2B3S A;  2GSS A;  1SEN A;  4MAB A;  1PN0 A;  2DJ3 A;  2E2M A;  4AKI A;  2XPE A;  4ZL7 A;  1JZD A;  4TXO A;  1OKD A;  1R5P A;  4J56 E;  3UMA A;  17GS A;  2OE3 A;  1SL1 B;  4PUR A;  2E0Q A;  4HUA A;  4OCE A;  3DGQ A;  3M9J A;  5GAN D;  1WMJ A;  2L57 A;  2HE3 A;  2AV4 A;  2OKA A;  1PKW A;  2PU9 C;  1VF3 A;  1TRV A;  2M72 A;  3CSI A;  2B5E A;  2FGX A;  3TKS A;  1SK2 A;  1X9S B;  3HHV A;  4ZIL A;  2K8V A;  1GUL A;  1N25 A;  5DJL A;  3EWL A;  3ZTL A;  5EVO A;  1LJR A;  4IS0 A;  2HRF A;  1X5E A;  5JCG A;  1VF1 A;  3H93 A;  2TIR A;  5KN3 A;  1GTU A;  2MMO A;  2H01 A;  5ID2 B;  5KOX A;  1Z7P A;  2F51 A;  1GH2 A;  2DKH A;  1T1V A;  4XTS A;  5DQS A;  4K8M A;  3RPN A;  2RUE A;  4XRD A;  2L5O A;  3FEU A;  2R4V A;  1PL1 A;  3LXT A;  4MA9 A;  3HA9 A;  3DVW A;  4CW9 A;  1YQ1 A;  2HSM A;  4POM A;  3KTB A;  1EGO A;  5A4U A;  5B6M A;  2ZCT A;  1N8J A;  5EL8 A;  4JE1 A;  3F6F A;  1TU8 A;  4K6X A;  4GCI A;  2CAI A;  1PD2 1;  2JAC A;  5G1L A;  2UV8 G;  1GRX A;  4G2E A;  5KEJ A;  1XFL A;  3FZ5 A;  2LRC A;  4AKX B;  3TRQ A;  5AIS A;  1XZO A;  1QQ2 A;  3DD3 A;  1RQM A;  1NSW A;  3VWX A;  5A34 B;  1VRS D;  5IMA A;  1YY7 A;  1X9W B;  2HRK A;  3D4T A;  3TJK A;  2DBC A;  11GS A;  2VLT A;  3ZRD A;  4EDY A;  5D9W A;  3IA1 A;  3O3T A;  1WPI A;  4KCE A;  2H71 A;  2O85 A;  2HSY A;  1V57 A;  2LNT A;  3H79 A;  2VIM A;  1J0F A;  2I3Y A;  3VWU A;  4GQF A;  4IKH A;  1GWC A;  4EO3 A;  3FYG A;  3LEF A;  3I69 A;  4FYU A;  3C73 A;  3ED3 A;  4MK3 A;  2GTU A;  2CQ9 A;  2H0H A;  1ST9 A;  3GTU B;  5A4V A;  2H6Z A;  5IMD A;  2EFC A;  1XOB A;  1EWX A;  1TJD A;  2H1G A;  2MBS A;  2LUS A;  4K7I A;  1KNG A;  2H0I A;  3ZVJ A;  2GST A;  1BF5 A;  1ZL9 A;  4X0X A;  4YQM A;  1GTI A;  3RBT A;  3W8S A;  5D9T A;  3R2Q A;  4POK A;  1AAZ A;  5J41 A;  3C71 A;  4O92 A;  3FHK A;  4IN0 A;  1THO A;  2YWI A;  3DWV A;  4AGS A;  1XVW A;  3DVX A;  4BVX A;  3TJJ A;  1SJ6 A;  3TJB A;  3DYR A;  4J2F A;  3KCM A;  3IHG A;  1FB0 A;  5G31 A;  3L9S A;  5GST A;  3GST A;  5ECS A;  2HFD A;  1IYH A;  2LNS A;  2C3Q A;  5IOX A;  1DE1 A;  2XPD A;  5G5E A;  3VWV A;  1JZO A;  1XPV A;  4N0V A;  1Z6N A;  2YWN A;  4TR1 A;  3JCM L;  1BX9 A;  5ENU A;  3D5J A;  4MH3 A;  1M2A A;  2HZE A;  1BED A;  4X4J A;  1V98 A;  2NBS A;  3D4M A;  5A1N A;  3TKS C;  4HOJ A;  1WP0 A;  2H75 A;  1O81 A;  3ISO A;  2L4Q A;  3IAS 2;  1FB6 A;  3RHB A;  5CAX A;  2VLV A;  2R2J A;  1BG5 A;  1Z9H A;  2PER A;  1B9Y C;  2J23 A;  5EY6 A;  3G7I A;  2YNX A;  1K0B A;  4KAE A;  3K8N A;  4MP4 A;  2OE0 A;  1MDJ A;  3HZ4 A;  4LMV A;  1K0M A;  3J7Y k;  1X5C A;  4LMW A;  3Q19 A;  5F0G A;  3I6A A;  3F3Q A;  3BD2 A;  3KXO A;  2OA7 A;  2N5A A;  5DAK A;  4EIQ A;  1V40 A;  2K6V A;  3EU3 A;  1GSQ A;  4FIW A;  5ECP B;  3ZIV A;  1U87 A;  3IE3 A;  3QAG A;  6GSW A;  2YCD A;  4ZXG A;  1XWC A;  1O6J A;  1BYE A;  1WE0 A;  1RW1 A;  4ACS A;  1JFU A;  4DEJ A;  1H4O A;  9GSS A;  2VLU A;  3CSH A;  1TDI A;  4K2X A;  4QL9 A;  3F4R A;  3F63 A;  4FH8 A;  3TGZ A;  2RLI A;  3QAW A;  2Z9S A;  1FOH A;  4I97 A;  4G10 A;  4PXO A;  4HJ2 A;  3HKR A;  4PX1 A;  2F3M A;  3A3T A;  4FQU A;  5CRG A;  5IOW A;  4HQS A;  1ERU A;  3TUE A;  2VKZ G;  3GHA A;  3GKK A;  2EC4 A;  4K5S A;  5CRE A;  4I2U A;  2I81 A;  2CZ2 A;  3PIN A;  2EIO A;  1ZYE A;  2VCZ A;  2DMM A;  3F8U A;  2CV4 A;  3DXB A;  4QL7 A;  1SD8 A;  1Z3E A;  4NHZ A;  5ELG A;  2JZR A;  2H1D A;  2F8A A;  5J4Y A;  3WYW A;  2JU5 A;  3EUR A;  1QK8 A;  2AYT A;  5DQY A;  3CMI A;  1K3L A;  1XWB A;  3LJR A;  1DE2 A;  3A5I A;  3GSS A;  2LQQ A;  3LOR A;  4ZB8 A;  3TRX A;  1AQV A;  4WBJ A;  5KN0 A;  3RHC A;  3TKP A;  3GMF A;  2XC2 A;  3F6D A;  2IFQ A;  1XWG A;  3QAV A;  3L9V A;  3LW9 A;  3U5R E;  2EFH A;  2YJ7 A;  2PWJ A;  4TOP A;  3VI7 A;  2IL3 A;  5A5H B;  3HYP A;  2PGT A;  5JWR B;  4TN8 A;  5C00 A;  22GS A;  3RAZ A;  5IMZ A;  4K2D A;  2IJY A;  4RQR A;  4HU7 A;  3A2V A;  1HNA A;  2GQK A;  4BVY B;  1KBN A;  5CRD A;  3CWG A;  2NTO A;  1OC9 B;  5DAL A;  2BTO T;  2M46 A;  3HD5 A;  4K5R A;  3UBK A;  4LL4 B;  1UC7 A;  4IBP A;  5D9X A;  5G1K A;  2LV3 A;  2X4A A;  3ME8 A;  4TKY A;  1AUC A;  1AQW A;  2VCX A;  4G9H A;  4CHS A;  2FLS A;  2RII A;  1PGT A;  2C0E A;  3WGD A;  1F9M A;  2C8U A;  4WKW A;  4NV5 A;  5J5N A;  4NV2 A;  2X49 A;  3KZQ A;  1EV9 A;  2VCQ A;  4TRX A;  1TP9 A;  4NHW A;  4MDC A;  4DSS A;  1PKZ A;  5LD0 A;  1TK5 B;  2AUV A;  4G0L A;  1ERT A;  5CRH A;  2F9S A;  2DIY A;  1YDK A;  2MBT A;  3IR4 A;  5J9B A;  1FOV A;  4D73 A;  1Q98 A;  3KJY A;  4ILF A;  4O5Q A;  3M1G A;  4AI6 A;  2TRX A;  2HT9 A;  4GTU A;  5LNK e;  2RM6 A;  1A8L A;  2ON7 A;  4Q5N A;  1FVK A;  2H70 A;  5EPF A;  1GUM A;  2HNL A;  3D21 A;  4E68 A;  4DVC A;  2VM2 A;  5ECR B;  1ACV A;  1TI1 A;  2GGT A;  2O89 A;  5H5Q A;  1CQH A;  2TRC P;  4NWY A;  1E2Y A;  4EDZ A;  2C0F A;  1QGV A;  3EYT A;  2DML A;  1FHE A;  2R0P A;  2LJR A;  1MTC A;  4KGI A;  2NVL A;  4G19 A;  1GNE A;  2EFE A;  3F0I A;  3KD0 A;  3TRP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...