5EY6A

Crystal structure of glutathione transferase f2 from populus trichocarpa
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
215
structure length
215
Chain Sequence
PVKVYGPPLSTAVSRVLVTLLEKDVPFQIIPVDMSKGEHKKPDYLKIQPFGQVPAFQDESISLFESRSICRYVCEKYADRGDKGLYGTNPLERASIDQWVEAEGQSFGPSSGALVFQLAFAPRMNIPQDQGVIKQNEEKLGKVLDIYEQRLGESRFLAGDEFTFADLSHLPNGDYLVNATDKGHLFTSRENVGRWWNEISDRESWKKVIEMRKSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Phi class glutathione transferase GSTF2
publication title Structural plasticity among glutathione transferase Phi members: natural combination of catalytic residues confers dual biochemical activities.
pubmed doi rcsb
source organism Populus trichocarpa
total genus 82
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2015-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5ey6A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5ey6A01
5F06A 4HJMA 2O89A 2CAIA 1ERVA 2O87A 1AAZA 2OKAA 1NSWA 1EV4A 4EE0A 2ZNMA 1XVQA 1RW1A 4HOJA 1X5CA 3L78A 3N5OA 2CX4A 1OVNA 3GTUA 3MSZA 1WWJA 5COHA 1BQ7A 2FA4A 4V2NA 4YQUA 2CVBA 3TKQA 1NW2A 4ZL9A 2A4VA 3WGXA 3FR9A 4KA0A 2LRNA 4O92A 4Z7XA 4IQAA 2DJ3A 2C0EA 1HNCA 1R26A 2GSRA 4PQHA 4GLTA 1SYRA 4MDCA 2EIRA 1XWBA 4PURA 2NVLA 3DVWA 4TR1A 1GLPA 3FRCA 5G30A 1F37A 2O8VB 1LJRA 4TXOB 1ZCPA 3UJ1A 2L6CA 2CVDA 2CX3A 3D21A 1XWAA 1YQ1A 2JU5A 3GYKA 4I8BA 3IBHA 5EVOA 1B9YC 3IOSA 6GSVA 5ELGA 3IV4A 3H8QA 1ZOFA 2C3NA 1V98A 3DMLA 3F3RA 2OADA 1EZKA 4G2EA 1G7OA 2L4CA 4NMUA 2LSTA 1YF0A 1Z7PA 4USSA 2HLSA 1SENA 1XZOA 5D93A 1XOBA 1ABAA 3CSHA 1GTAA 2VD1A 5IQYA 3FZ9A 5IMAA 2G0FA 5DDLA 1AC1A 3KTLA 3ERFA 5DBQA 3GMFA 3EU3A 1FAAA 5D9WA 2LQQA 4PNFA 3VURA 4NWYA 2FLSA 4K7OA 1JZWA 5F07A 2HRAA 5C00A 4MJBA 3QOUA 4TW5A 4NHZA 2PGTA 3F0IA 1EGOA 3H79A 1GTBA 1SL1B 1XBSA 3TRPA 2HRKA 3SWLA 1VF4A 2WGRA 3ERWA 3UL3A 1THOA 2YJ7A 4I6XA 1GL8A 4POMA 5A4VA 2OA7A 4L5OA 4ULXA 2YWIA 3IC8A 4OO5A 1TP9A 3GKMA 4ACSA 2RM5A 1R5AA 2FHEA 2OE0A 3QAVA 3TUEA 2DJKA 3TGZA 2HRNA 5DALB 4WXTA 1BX9A 1SYXA 1XVWA 2I1UA 2IMFA 3M3MA 4XTSA 1MDJA 3D4TA 4ZL7A 3M9JA 2DMMA 2PVQA 5IOWA 5ID2A 4Q5QA 1X9SB 3TOTA 2JL4A 4HZ4A 4Q5RA 2O85A 1TK8B 4Q5FA 2GS3A 4F9ZA 1PKZA 2LRCA 3FZ5A 2DJJA 3FR3A 4IN0A 5HFIA 5IO0A 1TDIA 3ZFBA 1XIYA 4BVYB 5HR3A 2JADA 3P7XA 2VCTA 1E2YA 1O8XA 2DMLA 3V1WA 1HNAA 2ZUPA 1GRXA 3ZMKA 2KP1A 2RIIA 3J7Yb 4GWRA 6GSWA 2XPDA 2VCZA 4KX4A 3QPMA 4X1UA 3CSJA 5G5FA 4RQXA 3HYPA 5B8BA 4POKA 1YKCA 4V2MA 4XRDA 3Q19A 1O6JA 1YZXA 4AJ7A 4WR4A 1CQGA 2HSYA 5IOXA 1WIKA 5IMCA 2PUKC 2F3MA 1G7EA 3F4TA 4NHWA 1SK2A 5J9CA 2GT5A 1TJDA 3C1SA 3PR8A 2P0GA 5ECKB 4GTUA 3RAZA 3L4NA 5D9VA 4ZILA 2H1AA 1FW1A 1O73A 4NV2A 4IELA 5ECHB 1SK0A 4TXOA 1UC7A 1XWGA 2C4JA 2OE3A 4OMVA 3CXGA 3WGEA 4HQZA 2PWJA 2IN3A 5D9XA 1PA3A 3CSIA 4KDUA 2GDRA 4O7HA 3UOMA 4L0UA 4KF9A 1THXA 3KH7A 4N0ZA 1R7HA 1AQVA 1O81A 1FVJA 4X43A 2HNLA 4FQUA 1OC9B 8GSSA 3VWXA 3MNGA 2H66A 2H76A 2H1DA 4BPYA 1GUHA 3F8UA 1TRVA 1AQWA 2YJHA 4JE1A 3UBKA 1WRYA 4FO5A 4HI7A 1E6BA 1J0FA 5HQPA 2L5OA 3FZAA 1GUKA 3FHKA 2J9HA 3ZL5A 4IS0A 1KTEA 5JWOB 3ZRDA 3NZNA 1GTUA 2VM2A 2CQ9A 3ZVJA 1PD21 5F8BA 2YANA 4Q5NA 4LA1A 4JZQA 3IHQA 4GXZA 2FGXA 1F3BA 4HUAA 1TU7A 2HFDA 1GUMA 2RUFA 1XW9A 3GKKA 2DIZA 1ON4A 1OKTA 4TVEA 2LKUA 5JCWA 5ECPB 3SBCA 3UIWA 1X5DA 1R5PA 1U88A 1H4OA 3DRNA 1KNGA 5L71A 1GSSA 4X0XA 3ED3A 1A8YA 1M9BA 1DUGA 5ABRA 2ALBA 2IPAA 4JRRA 2MMZA 4HQSA 2PERA 2C0DA 1PL2A 3GH6A 2YNXA 2NDOA 1B8XA 1G0TA 5DVBA 1CQHA 4EVMA 2MMNA 1QUWA 3TRXA 2M80A 1WPIA 2E2GA 5DALA 5A4UA 4ZIJA 5EY6A 2H75A 2M46A 2C0GA 1SJZA 3H93A 4RI7A 2P31A 2C1YA 3IDVA 4KSOA 4WETA 4V1Ag 2E0QA 1V40A 5FT3A 4K1FA 5ECOB 2F8AA 4KDYA 3LQ7A 4CW9A 3DVXA 1DE1A 3HHVA 1GSEA 2LJAA 4F82A 3IK9A 2I81A 1JFUA 4ECCA 5G1KA 4LL1B 3DEXA 4BVYA 2NPBA 5AGYA 4NPBA 2WRTA 3F4RA 3ZFLA 2DJ1A 3CYNA 2NTOA 3QCPA 4K9ZA 1K3OA 3DYRA 1A2MA 1QXHA 2VL2C 2RUEA 3NIVA 3CRTA 1PQNA 3GH9A 3KP8A 3GKXA 2FWEA 3CBUA 3VI5A 1TXXA 1TK5B 2V6KA 2LNTA 2FA8A 4HS1A 2YCDA 4EDZA 4ECBA 3L9UA 5HFKA 2VL9A 1T3BA 3TKSC 2WZ9A 5D9TA 3GSTA 3DKSA 3UMAA 2C80A 3CTGA 5D8IA 1TU8A 2KHPA 4MABA 4EUYA 4GQCA 3VWWA 1VF3A 2H0IA 1HYUA 3IRAA 4V2LA 6GSXA 3L0HA 1WJKA 1ZMAA 1JLVA 5DCHA 1G6YA 4IVFA 1TKDB 2CZ2A 4TR3A 2HSHA 4PX1A 3EU4A 5GAPD 3HDCA 5H5QA 1BYEA 5CO3A 1OC9A 2XBQA 3J7Yk 1PN9A 5D96A 4D73A 2LEGA 4HU9A 3VPTA 4RQRA 1JZRA 2A2SA 4HZ2A 3RHBA 2TRXA 1Y25A 2JZRA 2J23A 3RDWA 1XWCA 1Q98A 2FUG2 2Z9SA 3TJJA 1MD3A 4WKWA 4ECJA 2CV4A 4PQ1A 2LQOA 4G0KA 1Z9HA 4MF6A 4ZB8A 3O76A 3UBLA 2PBJA 3HJOA 4QQ7A 1FB6A 3MAKA 2YN1A 3KEBA 1U6TA 2OBKA 3ERGA 4IP1A 5CNWA 3TJGA 2HSMB 5LCZA 2V2GA 3QR6A 2WFCA 5FHIA 9GSSA 2R2JA 1PMTA 4EDYA 4OWYA 1Z3EA 5DJMA 4ZB9A 2DLXA 1I9DA 3NOFA 5J41A 3IA1A 2RLIA 2X64A 3CMIA 4MJEA 3PPUA 1YEXA 3KXOA 2DJ0A 3U5RE 2H1GA 1T4ZA 3ZIVA 2HZFA 2P5RA 2F51A 2L5LA 5IPHA 4AGSA 2YWMA 2FNOA 4IJIA 1GSDA 1TOFA 3GSSA 1QK8A 4XS1A 2DSAA 5E4WA 1IYHA 4BWSA 1X0RA 5AISA 4V1Ap 2P5QA 3L9VA 3VK9A 4FH8A 1BG5A 5DAKA 1TW9A 3HZ4A 2X8CA 2YZHA 1SU9A 2L57A 3A2VA 3HXSA 1B4PA 2H19A 5AIVA 2QC7A 3HD5A 3TJKA 3I6AA 2WB9A 4MZWA 3HVXA 1SKRB 4YQMA 1SK1A 1J08A 17GSA 2VIMA 1K0DA 1S3CA 3PGTA 4E8EA 3FEUA 4P3YB 5IM9A 3M8NA 2CVKA 3UVTA 2AYTA 3ZITA 1K0OA 2K18A 1A24A 2IMEA 3ZLPA 4PXOA 2CZ3A 2XPEA 1M7TA 1PRXA 3LXZA 4KSMA 4OFNA 2B3SA 3TKPA 3CTFA 4OO4A 3FKFA 5C04A 5ECMB 3TDGA 5IMFA 2WCIA 2H74A 3C1RA 1XWKA 1VGLA 5F05A 3VWVA 2AAWA 1M2DA 3W6GA 2B5EA 2ZCTA 3UVHA 4WBRD 1Z6NA 1RQMA 4TKYA 3PH9A 3G7YA 4OFTA 3LGCA 4F03A 2XBIA 1C72A 5CREA 4DEJA 4KUNA 5JCUA 4ZB6A 2K9FA 3KGKA 4EKZA 3VLNA 3ZIJA 1F3AA 2IL3A 2YPMA 4IW9A 4PNGA 2QKEA 2VO4A 5CP1A 1GNWA 4N30A 1TI3A 1F2EA 2MMOA 3GN3A 1SL0B 2LS5A 1NHOA 3KTBA 4FYCA 1YEPA 4GSSA 3KIJA 2A2RA 2GSTA 5DQSA 4MMMA 1VF2A 3EINA 13GSA 1X9WB 3FYGA 2HT9A 5IMDA 3HVVA 1S3DA 2C3QA 3UARA 1M9AA 1V2AA 4FYUA 2IIYA 3M1GA 2IMKA 4JR4A 4MP4A 1T4YA 1X5EA 2GZYA 1FOVA 3EE2A 5ECRB 2AUVA 3KCMA 3DGQA 5EL8A 2V41A 1U3IA 4POLA 12GSA 2KP2A 1GSFA 1Y6EA 1KEBA 2GQLA 3W8SA 2HZEB 2IWTA 1ACVA 1K0AA 2TRCP 3IE3A 1OAZA 1SD9A 4JU5A 4N0VA 3F4SA 4F0CA 2FY6A 2FWHA 4L8EA 4CHSA 3ME8A 1AXDA 4PTSA 3VPQA 2H6YA 3F63A 20GSA 1TI1A 5JWRB 3GA4A 2X8HA 4K8MA 3G7IA 2LUSA 2GZPA 2C8UA 4H86A 2AJQB 2RM6A 1BJXA 3D4MA 4K0GA 4ZBAA 3TOUA 1SJ6A 1ZYEA 5H5SA 1JHBA 3C8EA 4GF0A 5G5EA 1DSBA 4WR5A 3AY8A 2R5GA 2XHFA 2FCHA 4KAEA 2VCQA 1GSYA 1QFNA 4EL1A 2N5FA 4J57E 3UEMA 3H4KA 3APSA 4EO3A 2VUPA 2CAQA 4DSQA 4O32A 3L9SA 3DD3A 3PINA 2MBTA 2FWFA 1EWXA 2DJ2A 4TOPA 4MF5A 3W8JA 1WOUA 1XPVA 3EWLA 3US3A 4MPFA 4PQIA 5EPFA 3G9BA 3EMXA 3IAM2 1FVKA 3KMNA 1GSQA 3M0FA 4MA9A 3ME7A 2WDUA 1USBA 1JZDA 1G6WA 1UVZA 2BMXA 2GZZA 1O85A 1FO5A 1HQOA 2BTOT 4DSRA 2ON7A 1K0BA 3LYKA 1HNBA 3IPZA 1M0UA 3FW2A 2V32A 1QMVA 2HSNB 1J9BA 2GQKA 1A0FA 3QFAC 4OCFA 3ZYWA 2K8SA 4I5QA 2D2ZA 1EV9A 4XIHA 4EF0A 2AHEA 2VCVA 3C7MA 3IK7A 2JSYA 3EC3A 2YP6A 3I69A 5KN3A 2L6DA 1ERWA 3M9KA 2YWOA 2R3XA 1DE2A 3GL3A 4ML6A 4ISDA 1A0RP 2N5BA 1XOAA 1PKWA 2YZUA 4PGTA 3KP9A 4G0IA 4ZL8A 2N5AA 5HR0A 3F3QA 4LL4B 1BAYA 1SD8A 2HRKB 3HJMA 5JCGA 1FB0A 3GHAA 1Q4JA 3HJPA 3BD2A 4KH7A 2GSSA 5J5NA 1YF1A 2MYGA 5D73A 5BMUA 4K0NA 3HZ8A 1XW6A 4GQFA 2YV9A 3RHCA 3P90A 2X99A 1F9MA 1UN2A 5IO2A 3GUSA 3VWUA 3QMXA 4IJ3A 4WEYA 1TK0B 4MCUA 2IMIA 3E3EA 4XS4B 2VAFA 2H0GA 5CRHA 5J9BA 2QSIA 6GSSA 3R3EA 1JZOA 5INYA 4ZBDA 2B1LA 2I4AA 1A2JA 2CT6A 5KEJA 3F9UA 3P2AA 1T1VA 3QAGA 3D22A 4G19A 4MZBA 4POBA 5H5RA 1ZGNA 1GSUA 4KDXA 3EURA 2B5XA 2C3TA 5JWQB 1UA5A 1PL1A 1T00A 1MTCA 4N11A 3VI7A 1S3AA 1K0NA 2L59A 4OFMA 5CRDA 2V1MA 3P8WA 3LEFA 5KN1A 1Z7RA 4KW6A 2IFQB 3A2WA 2R6KA 5B7CA 2HE3A 3RPPA 5ECSA 2HZEA 4K6XA 1ZL9A 3K8NA 3A3TA 1R4WA 4HEA2 3IR4A 2LTKA 2H6XA 3H1NA 5J3RA 2GSQA 2UZ8A 1U3AA 5CRGA 3LWAA 4BL7B 1WP0A 1BEDA 3F6FA 1MDIA 2HQTA 1GULA 2R4VA 2EIOA 1EOHA 4IKHA 3GURA 1T7PB 2OBIA 3WT1A 4PUFC 4GSTA 1B4QA 5B6MA 1OE7A 4DSSB 2L4QA 3EYTA 3VFIA 3E9JB 5CYYA 3JCML 3ZVJD 4MPGA 3WYWA 1Z6MA 4K7NA 3TKRA 5ECIB 2K6VA 5G1LA 4BVXB 1GH2A 1ERTA 4JEDA 3BCIA 1PX6A 2VOCA 3E0UA 1OYJA 2V6OA 1ILOA 3F6DA 1V57A 3BJ5A 3Q6OA 3FR6A 2VD0A 3O3TA 3DXBA 5ELAA 4L5LA 3HKRA 4WF5A 1EEMA 2I3YA 4TRXA 3D5JA 1LBKA 3ZREA 1ZYQB 4AF2A 1O7UA 4G0LA 1GWCA 2H1BA 3FY7A 4MK3A 3D6IA 1GLQA 1MD4A 2MZCA 2OACA 1JLWA 2WULA 3TB2A 1K3LA 7GSSA 3DIEA 5A4WA 4KCAA 2H8LA 1A2LA 1F6MC 3FK8A 4IHUA 4IQ1A 4MJCA 2PMTA 4XS6A 3LG6A 3LSZA 1PX7A 1SKSB 4ECIA 3DWVA 2AB6A 2H0HA 4ID0A 4KGIA 2GT6A 1QQ2A 3C71A 3GFKA 5ECLB 4ILFA 1OC8A 4J56E 1VF1A 5DQYA 5G2ZA 3CRUA 3BOAA 2XC2A 3OR5A 4QL7A 3TKSE 4XHMA 4JR6A 1M99A 1SL2B 4K2DA 2O7KA 1KBNA 4KCEA 3O6TA 5FWGA 1ML6A 2H01A 4IGJA 2VLUA 3C73A 3D0ZA 2H30A 5ECQB 5CRWA 1B48A 2VCXA 5E59A 5ENUA 1V9WA 2GGTA 2H6ZA 4XS4A 1O8WA 2X8GA 2YOIA 3QAWA 4K7IA 1GP1A 3WD6A 1EP7A 3RPNA 2PU9C 4ML1A 2GLRA 2HYXA 1TRSA 1TRWA 2I9HA 2HRFA 2B7KA 1A8LA 3APOA 1W4VA 1GNEA 1YKAA 3KJYA 2REMA 4BWQA 2LRTA 4PUAA 1NM3A 3Q74A 3TRQA 4HJ2A 4RUVA 3I43A 4MJAA 4AJ8A 2TIRA 4G9HA 5B8AA 2M72A 4EXJA 2H72A 2IJYA 1AQXA 2F8FA 3EMPA 5IIZA 4MZCA 3KD0A 2DBCA 4HDEA 4GRFA 4FYBA 4NAXA 4MLYA 1EGRA 5GAND 2IFQA 1PGTA 1RK4A 1XFLA 1TRUA 3WT2A 2E7PA 2GQMA 2C0FA 5LNKe 3UAPA 2ES7A 5KN2A 3A5WA 3KMOA 3EVIA 2H71A 1FG4A 5DCGA 1PSQA 4I2TA 4KNDA 1N8JA 1A23A 1B9XC 4LLRA 2NBSA 4NXIA 4MH3A 3KM6A 4BL7A 1OE8A 1X9MB 1QGVA 1WMJA 1YY7A 1AIUA 2PPTA 3S9FA 2DC5A 5B6NA 4WF4A 3BCKA 4YAVA 2F9SA 2KOKA 6GSUA 3GX8A 2EIQA 3QD9A 4TR0A 5CAXA 4WBJA 4IBPA 3MWHA 4DSSA 2DIYA 2VL3A 3QFBC 3GTUB 1K0MA 5F0GA 3IC4A 4HU7A 3HCZA 2LNSA 4BVXA 2HSMA 2PVOC 5GZZB 2VCWA 2K8VA 2YV7A 4CDOA 4OCEA 4YH2A 2IMDA 3HA9A 2PN8A 5IMVA 3LFLA 3LORA 4MF7A 1YDKA 2LJKA 5J4UA 2G2QA 1ERUA 2JSZA 2JZSA 2OJLA 16GSA 5AN1A 1OKDA 4TXVA 2AV4A 3KH9A 1SJIA 1V58A 5LD0A 1K3YA 1K0CA 4KE3A 2ON5A 4D73B 3LJRA 4EC0A 3GIXA 3A2XA 4F0BA 2JACA 4TR1B 1N2AA 2EC4A 1EEJA 2VLVA 1DBYA 5DJLA 1T8EB 3ZZXA 1Z5YE 1SKWB 3R2QA 1GTIA 4J2FA 2B7JA 2E2MA 2KLXA 5GSTA 4N10A 2GTUA 2B5YA 1H75A 2KUCA 1HD2A 1ST9A 5HFGA 1AW9A 5GSSA 2JZTA 2HXKA 3LYPA 2QGVA 3TJFA 2OE1A 4LMVA 1OC3A 3IAS2 3Q18A 3U6VA 4JBBA 4XRAA 4L0WA 5HR2A 2R37A 3RBTA 1MDKA 4GCIA 4QL9A 3GNJA 1EP8A 2WS2A 2GVPA 4ZXGA 1EOGA 4TR4A 3ZTLA 3GRXA 2CA8A 3LXTA 2VM1A 5KN0A 1M2BA 5IPGA 18GSA 11GSA 1WE0A 4TN8A 3GX0A 2VLTA 3I9V2 1MEKA 5IMZA 5A5KA 4FIWA 4I2UA 1TTZA 2WJUA 3ZMLA 2B6MA 3IXRA 2VL2A 2MBSA 4ZBBA 3HY2A 1URMA 4G10A 3HVSA 14GSA 1YJ6A 5AIXA 3KZQA 3FZ4A 1XXUA 2LJRA 4YQVA 1M2AA 2BJXA 4XCSA 1W89A 2FD3A 4LMWA 5DAKB 6GSTA 3G7JA 3TJBA 2LV3A 3GKNA 22GSA 2HI7A 4BA7A 4IP6A 2H70A 1VRSD 3TKSA 2H73A 6GSYA 4NV5A 2B1KA 19GSA 1XCCA 1U87A 3WGDA 2YWNA 3APQA 2MMAA 3QDNA 3BBYA 4KB3A 1LU4A 1XW5A 3GV1A 3TCOA 2FWGA 4AJ6A 3GL5A 3MDKA 10GSA 4O5RA 1AUCA 5HR1A 3ISOA 4RI6A 1FHEA 1I5GA 1ZZYA 4E8HA 4I97A 5G31A 1IYIA 4YAPA 4OD7A 1NHYA 3N9JA 4F2IA 4MH2A 4DVCA 5ID2B 5ECNB 4GSNA
chains in the Genus database with same CATH superfamily
5F06A 4HJMA 2O89A 2CAIA 5J47A 1ERVA 2O87A 1AAZA 2OKAA 1NSWA 1EV4A 4EE0A 2ZNMA 1XVQA 1RW1A 4HOJA 1X5CA 3L78A 3N5OA 2CX4A 1OVNA 3GTUA 3MSZA 1WWJA 5COHA 1BQ7A 2WW3A 2FA4A 4V2NA 1N25A 4YQUA 2CVBA 3TKQA 1NW2A 4ZL9A 2DKIA 2A4VA 2WW1A 3WGXA 3FR9A 4KA0A 2LRNA 4O92A 4Z7XA 4IQAA 2DJ3A 2C0EA 1HNCA 1R26A 2GSRA 4PQHA 4GLTA 1SYRA 4MDCA 2EIRA 5A1NB 1XWBA 4PURA 2NVLA 3DVWA 2EFCA 4TR1A 3TU3B 1GLPA 3FRCA 2O36A 5G30A 1F37A 2O8VB 1LJRA 4TXOB 1ZCPA 3UJ1A 2L6CA 2CVDA 2CX3A 3D21A 1XWAA 1YQ1A 2JU5A 3GYKA 4I8BA 3IBHA 5EVOA 1B9YC 2EFHA 3IOSA 6GSVA 5ELGA 3IV4A 3H8QA 1ZOFA 2C3NA 1V98A 3DMLA 3F3RA 2X4AA 2OADA 1EZKA 4G2EA 1G7OA 2L4CA 1BF5A 4NMUA 2LSTA 1YF0A 1Z7PA 4USSA 2HLSA 1SENA 1XZOA 5D93A 1XOBA 1ABAA 3CSHA 1GTAA 2VD1A 5IQYA 3FZ9A 5IMAA 2G0FA 5DDLA 1AC1A 3KTLA 3ERFA 5DBQA 3GMFA 3EU3A 1FAAA 5D9WA 2LQQA 4PNFA 3VURA 4NWYA 2FLSA 4K7OA 1JZWA 5F07A 2HRAA 5C00A 4MJBA 3QOUA 4TW5A 4NHZA 2PGTA 3F0IA 1EGOA 3H79A 1GTBA 1SL1B 1XBSA 4CY6A 3TRPA 2HRKA 3SWLA 1VF4A 2WGRA 3ERWA 3UL3A 1THOA 2YJ7A 4I6XA 1SVLA 4POMA 1GL8A 5A4VA 4O5UA 2OA7A 4L5OA 4ULXA 2YWIA 2WW2A 3IC8A 4OO5A 1TP9A 3GKMA 4ACSA 2RM5A 1R5AA 2FHEA 2OE0A 3QAVA 3TUEA 2DJKA 3TGZA 2HRNA 5DALB 4WXTA 1BX9A 1SYXA 1XVWA 1YVLA 2I1UA 2IMFA 3M3MA 4XTSA 1MDJA 3D4TA 2O5VA 4ZL7A 3M9JA 2X49A 2DMMA 2PVQA 5IOWA 5ID2A 4ZB7A 4Q5QA 1X9SB 3TOTA 2JL4A 4HZ4A 4Q5RA 2O85A 4N3ZA 1TK8B 4Q5FA 2GS3A 4F9ZA 3LW9A 1PKZA 2LRCA 4YKFA 3FZ5A 2DJJA 3FR3A 5A34B 4IN0A 5HFIA 5IO0A 4PI0C 1TDIA 3ZFBA 1XIYA 4BVYB 5HR3A 2JADA 3P7XA 2VCTA 1E2YA 1O8XA 2DMLA 3V1WA 1HNAA 2ZUPA 3HMJG 4BIKA 1GRXA 3ZMKA 2KP1A 2RIIA 3J7Yb 4GWRA 6GSWA 2XPDA 1I1IP 2VCZA 4KX4A 3QPMA 4X1UA 3CSJA 5G5FA 4RQXA 3HYPA 5B8BA 4POKA 1YKCA 4V2MA 4XRDA 3Q19A 1O6JA 1YZXA 3MYDA 4AJ7A 4WR4A 1CQGA 2HSYA 5IOXA 1WIKA 5IMCA 2PUKC 2F3MA 1G7EA 3F4TA 4NHWA 1SK2A 5J9CA 2GT5A 1TJDA 3C1SA 3PR8A 2P0GA 5ECKB 4GTUA 3RAZA 3L4NA 5D9VA 4ZILA 2H1AA 1FW1A 1O73A 4NV2A 4IELA 5J4YA 5ECHB 1SK0A 4TXOA 1UC7A 1XWGA 2C4JA 2OE3A 4OMVA 3CXGA 4PHZC 3WGEA 4HQZA 2PWJA 2IN3A 5D9XA 1PA3A 3CSIA 4KDUA 2GDRA 4O7HA 3UOMA 4L0UA 4KF9A 1THXA 3KH7A 4N0ZA 1R7HA 1AQVA 1O81A 1FVJA 4X43A 2HNLA 4FQUA 1OC9B 2WVYA 8GSSA 3VWXA 3MNGA 2H66A 2H76A 2H1DA 4BPYA 1GUHA 3F8UA 1TRVA 1AQWA 2YJHA 4JE1A 3UBKA 1WRYA 4FO5A 4HI7A 1E6BA 1J0FA 1ZYPA 4W66A 1BG1A 5HQPA 2L5OA 3FZAA 1GUKA 3FHKA 2J9HA 3ZL5A 4IS0A 1KTEA 5JWOB 3ZRDA 3NZNA 1GTUA 2VM2A 2CQ9A 3ZVJA 1PD21 5F8BA 2YANA 4Q5NA 4LA1A 4JZQA 3IHQA 4GXZA 2FGXA 1F3BA 4HUAA 1PFOA 1TU7A 2HFDA 1GUMA 2RUFA 1XW9A 3GKKA 2DIZA 4ICYA 1ON4A 1OKTA 4TVEA 2LKUA 5JCWA 5ECPB 3SBCA 3UIWA 1X5DA 1R5PA 1U88A 1H4OA 3DRNA 1KNGA 5L71A 1GSSA 4X0XA 3ED3A 1A8YA 1M9BA 1DUGA 5ABRA 2ALBA 2IPAA 4JRRA 2MMZA 4HQSA 2PERA 2C0DA 1PL2A 3GH6A 2YNXA 2NDOA 1B8XA 1G0TA 5DVBA 1CQHA 4EVMA 2MMNA 1QUWA 3TRXA 2M80A 1WPIA 2E2GA 5DALA 5A4UA 4ZIJA 5EY6A 2H75A 2M46A 3RFRC 2C0GA 1SJZA 3H93A 4RI7A 2P31A 1M3JA 2C1YA 3IDVA 4KSOA 4WETA 4V1Ag 2E0QA 1V40A 5FT3A 4K1FA 5ECOB 2F8AA 4KDYA 3LQ7A 4CW9A 3DVXA 1DE1A 3HHVA 1GSEA 2LJAA 4F82A 3IK9A 2I81A 5A34A 4CY8A 1JFUA 4ECCA 5G1KA 4LL1B 3DEXA 4BVYA 2NPBA 5AGYA 4NPBA 2WRTA 3F4RA 3ZFLA 4A5PA 2DJ1A 3CYNA 2NTOA 3QCPA 4K9ZA 1K3OA 3DYRA 1A2MA 2WZSA 1QXHA 2VL2C 2EFEA 2RUEA 3NIVA 3CRTA 1PQNA 3GH9A 3KP8A 3GKXA 2FWEA 3CBUA 3VI5A 1TXXA 1TK5B 2V6KA 2LNTA 2FA8A 4HS1A 2YCDA 4EDZA 4ECBA 4AKHA 3L9UA 4YKGA 5HFKA 2VL9A 1T3BA 3TKSC 2WZ9A 5D9TA 3GSTA 3DKSA 3UMAA 2C80A 3CTGA 5D8IA 1TU8A 2KHPA 4MABA 4EUYA 4GQCA 2O3EA 3VWWA 1VF3A 2H0IA 1HYUA 3IRAA 4V2LA 6GSXA 3L0HA 1WJKA 1TXUA 1ZMAA 1JLVA 5DCHA 1G6YA 1S3RA 4IVFA 1TKDB 2CZ2A 4TR3A 2HSHA 4PX1A 3EU4A 5GAPD 3HDCA 5H5QA 4QMKA 3RGBC 1BYEA 5CO3A 1OC9A 2XBQA 3J7Yk 1PN9A 5D96A 4D73A 3IHGA 5J40A 2LEGA 4HU9A 3VPTA 4RQRA 1JZRA 2A2SA 4HZ2A 3RHBA 2TRXA 1Y25A 2WVZA 2JZRA 2J23A 3RDWA 1XWCA 1Q98A 2FUG2 2Z9SA 3TJJA 1MD3A 4WKWA 4ECJA 2CV4A 4PQ1A 2LQOA 4G0KA 3MIXA 1Z9HA 4MF6A 4ZB8A 3O76A 3UBLA 2PBJA 3HJOA 4QQ7A 1FB6A 3MAKA 2YN1A 3KEBA 1U6TA 2OBKA 3ERGA 4IP1A 5CNWA 3TJGA 2HSMB 5LCZA 2V2GA 3QR6A 2WFCA 5FHIA 9GSSA 2R2JA 1PMTA 4EDYA 4OWYA 1Z3EA 5DJMA 4ZB9A 2DLXA 1I9DA 3NOFA 2UV8G 5J41A 3IA1A 2RLIA 2X64A 3CMIA 4MJEA 3PPUA 1YEXA 3KXOA 2DJ0A 3U5RE 2H1GA 1T4ZA 3ZIVA 2HZFA 2P5RA 2F51A 5J4VA 2L5LA 5IPHA 4AGSA 2YWMA 2FNOA 4IJIA 1GSDA 1TOFA 3GSSA 1QK8A 4XS1A 2DSAA 5E4WA 1IYHA 4BWSA 1X0RA 5AISA 4V1Ap 2P5QA 4Z2TA 3L9VA 3VK9A 4FH8A 2R0PA 4K5SA 1BG5A 5DAKA 1TW9A 3HZ4A 2X8CA 2YZHA 1SU9A 2L57A 3A2VA 3HXSA 1B4PA 2H19A 5AIVA 2QC7A 3HD5A 3TJKA 3I6AA 2WB9A 4MZWA 3HVXA 1SKRB 4YQMA 1SK1A 1J08A 17GSA 2VIMA 1K0DA 1S3CA 3PGTA 4E8EA 3FEUA 4P3YB 5IM9A 3M8NA 2CVKA 3UVTA 2AYTA 3ZITA 1K0OA 2K18A 5KOWA 1A24A 2IMEA 3ZLPA 4PXOA 2CZ3A 2XPEA 1M7TA 1PRXA 3LXZA 4KSMA 4OFNA 1S4BP 2B3SA 3TKPA 3CTFA 4OO4A 3FKFA 5C04A 5ECMB 3TDGA 5IMFA 2WCIA 2H74A 3C1RA 1XWKA 1VGLA 5F05A 3VWVA 2AAWA 1M2DA 3W6GA 2B5EA 2ZCTA 3UVHA 4WBRD 1Z6NA 1RQMA 4TKYA 3PH9A 3G7YA 4OFTA 3LGCA 4F03A 2XBIA 1C72A 3EPTA 5CREA 4DEJA 4KUNA 5JCUA 4ZB6A 4Z2UA 2K9FA 5BMUB 3KGKA 4EKZA 3VLNA 3ZIJA 1F3AA 2IL3A 2YPMA 4IW9A 4PNGA 2QKEA 2VO4A 5CP1A 1GNWA 4N30A 1TI3A 1F2EA 2MMOA 3GN3A 1SL0B 2LS5A 1NHOA 3KTBA 4FYCA 4E68A 1YEPA 4GSSA 3KIJA 2A2RA 2GSTA 5DQSA 4MMMA 1VF2A 3EINA 13GSA 5A1NA 1X9WB 3FYGA 2HT9A 5IMDA 3HVVA 1S3DA 2C3QA 1XG8A 3UARA 1M9AA 1V2AA 4FYUA 2IIYA 3M1GA 2IMKA 4JR4A 4MP4A 1T4YA 1X5EA 2GZYA 1FOVA 3EE2A 5ECRB 2AUVA 3KCMA 3DGQA 5EL8A 2V41A 1U3IA 4POLA 12GSA 2KP2A 1GSFA 1Y6EA 1KEBA 2GQLA 3W8SA 2HZEB 2IWTA 1ACVA 1K0AA 4O5QA 2TRCP 3IE3A 1OAZA 1SD9A 4JU5A 4N0VA 3F4SA 4F0CA 2FY6A 2FWHA 4L8EA 4CHSA 3ME8A 1AXDA 4PTSA 3VPQA 2H6YA 3F63A 20GSA 1TI1A 5JWRB 3GA4A 2X8HA 4K8MA 3G7IA 5A5HB 2LUSA 2GZPA 2C8UA 4H86A 2AJQB 2RM6A 1BJXA 3D4MA 4K0GA 4ZBAA 3TOUA 1SJ6A 1ZYEA 3A5IA 5H5SA 1JHBA 3C8EA 4GF0A 5G5EA 1DSBA 4WR5A 3AY8A 2R5GA 2XHFA 2FCHA 4KAEA 2VCQA 1GSYA 1QFNA 4EL1A 2N5FA 4J57E 3UEMA 3H4KA 3APSA 4EO3A 4FXYP 2VUPA 2CAQA 4DSQA 4O32A 3L9SA 3DD3A 3PINA 2MBTA 2FWFA 1EWXA 2DJ2A 4TOPA 4MF5A 3W8JA 1WOUA 1XPVA 3EWLA 3US3A 4MPFA 4PQIA 5EPFA 3G9BA 3EMXA 3IAM2 1FVKA 3KMNA 1GSQA 3M0FA 4MA9A 3ME7A 2WDUA 1USBA 1JZDA 1G6WA 1UVZA 2BMXA 2GZZA 1O85A 1FO5A 1HQOA 2BTOT 4DSRA 2ON7A 1K0BA 3LYKA 1HNBA 3IPZA 1M0UA 3FW2A 2V32A 1QMVA 2HSNB 1J9BA 2GQKA 1A0FA 3QFAC 4OCFA 3ZYWA 2K8SA 4I5QA 2D2ZA 1EV9A 4XIHA 3CWGA 4EF0A 2AHEA 2VCVA 3C7MA 3IK7A 2JSYA 3EC3A 2YP6A 3I69A 5KN3A 2L6DA 1ERWA 3M9KA 1YEWC 2YWOA 2R3XA 1DE2A 3GL3A 4ML6A 4ISDA 1A0RP 2N5BA 1FOHA 1XOAA 1PKWA 2YZUA 1ZYNA 4PGTA 3KP9A 4G0IA 4ZL8A 4GDFA 2N5AA 5HR0A 3F3QA 4LL4B 1BAYA 1SD8A 2HRKB 3HJMA 5JCGA 1FB0A 3GHAA 1Q4JA 3HJPA 3BD2A 4KH7A 2GSSA 5J5NA 1YF1A 2MYGA 5D73A 5BMUA 4K0NA 3HZ8A 1XW6A 4GQFA 2YV9A 3RHCA 3P90A 2X99A 4EIPA 1F9MA 1UN2A 5IO2A 3GUSA 3VWUA 2A2PA 3QMXA 4IJ3A 4WEYA 4MCUA 1TK0B 2IMIA 3E3EA 4XS4B 2VAFA 2H0GA 5CRHA 5J9BA 2QSIA 6GSSA 3R3EA 1JZOA 1Y1UA 3CHXC 5INYA 4ZBDA 2B1LA 2I4AA 1A2JA 2CT6A 5KEJA 3F9UA 3P2AA 1T1VA 3QAGA 3D22A 4G19A 4MZBA 4POBA 5H5RA 1ZGNA 1GSUA 4KDXA 3EURA 2B5XA 2C3TA 5JWQB 1UA5A 1PL1A 1T00A 1MTCA 4N11A 3VI7A 1S3AA 1K0NA 2L59A 4OFMA 5CRDA 4PI2C 2V1MA 3P8WA 3LEFA 5KN1A 1Z7RA 4KW6A 2IFQB 3A2WA 2R6KA 4AKGA 5B7CA 2HE3A 3RPPA 5ECSA 2HZEA 4K6XA 1ZL9A 3K8NA 3A3TA 1R4WA 4HEA2 3IR4A 2LTKA 2H6XA 3H1NA 5J3RA 2GSQA 2UZ8A 1U3AA 5CRGA 3LWAA 4BL7B 1WP0A 1BEDA 3F6FA 2R0CA 1MDIA 5A5HA 2OT3A 2HQTA 1GULA 2R4VA 2EIOA 1EOHA 4IKHA 3GURA 1T7PB 2OBIA 3WT1A 4PUFC 3HVNA 4GSTA 1B4QA 5B6MA 1OE7A 4DSSB 2L4QA 3EYTA 3VFIA 3E9JB 5CYYA 3JCML 3ZVJD 4MPGA 3WYWA 1Z6MA 4K7NA 3TKRA 5ECIB 2K6VA 5G1LA 4BVXB 1GH2A 1ERTA 4JEDA 3BCIA 1PX6A 2VOCA 3E0UA 1OYJA 2V6OA 1PN0A 4MNNA 2EFDA 1ILOA 3F6DA 1V57A 3BJ5A 3Q6OA 3FR6A 2VD0A 3O3TA 2QA1A 3DXBA 5ELAA 4L5LA 3HKRA 4WF5A 1EEMA 2I3YA 4TRXA 3D5JA 1LBKA 4HSCX 3ZREA 1ZYQB 4AF2A 2WVXB 1O7UA 4G0LA 1GWCA 2H1BA 3CQFA 3FY7A 4MK3A 3D6IA 1GLQA 1MD4A 2MZCA 2OACA 1JLWA 2HSNA 2WULA 3TB2A 1K3LA 7GSSA 3DIEA 5A4WA 4KCAA 2H8LA 1A2LA 1F6MC 3FK8A 4IHUA 4IQ1A 4AI6A 4MJCA 2PMTA 4XS6A 3LG6A 3LSZA 1PX7A 1SKSB 4ECIA 3DWVA 2AB6A 2H0HA 4ID0A 4KGIA 2GT6A 1QQ2A 3C71A 3GFKA 5ECLB 4ILFA 1OC8A 4Z2RA 4J56E 1VF1A 5DQYA 5G2ZA 3CRUA 3BOAA 2XC2A 3OR5A 4QL7A 3TKSE 4XHMA 4JR6A 1M99A 1SL2B 2R0GA 4K2DA 2O7KA 1KBNA 4KCEA 3O6TA 5FWGA 1ML6A 2H01A 4IGJA 2VLUA 3C73A 3D0ZA 2H30A 5ECQB 5CRWA 1B48A 2VCXA 5E59A 5ENUA 1V9WA 2A4HA 2GGTA 2H6ZA 4XS4A 1O8WA 2X8GA 2YOIA 3QAWA 4K7IA 1GP1A 3WD6A 1EP7A 3RPNA 2PU9C 4ML1A 4AKIA 2GLRA 2HYXA 1TRSA 1TRWA 2I9HA 2HRFA 2B7KA 1A8LA 3APOA 1W4VA 1GNEA 1SVOA 1YKAA 3KJYA 2REMA 4K5RA 2LRTA 4BWQA 4PUAA 1NM3A 3Q74A 3TRQA 4HJ2A 4RUVA 3I43A 4MJAA 4AJ8A 2TIRA 4G9HA 5B8AA 2M72A 4EXJA 2H72A 2IJYA 1AQXA 2F8FA 3EMPA 5IIZA 5KOXA 4MZCA 3KD0A 2DBCA 4HDEA 4GRFA 4FYBA 4NAXA 4MLYA 1EGRA 5BRTA 5GAND 2IFQA 1PGTA 1RK4A 1XFLA 1TRUA 3WT2A 2E7PA 2GQMA 2C0FA 5LNKe 3UAPA 2ES7A 5KN2A 3A5WA 3KMOA 3EVIA 2H71A 1FG4A 5DCGA 4AKXB 1PSQA 4I2TA 4K2XA 4KNDA 1N8JA 2DKHA 1A23A 1B9XC 4LLRA 2NBSA 4NXIA 4MH3A 3KM6A 4BL7A 1OE8A 1X9MB 1QGVA 1WMJA 1YY7A 1AIUA 2PPTA 3S9FA 2DC5A 5B6NA 4WF4A 3BCKA 4YAVA 2F9SA 2KOKA 6GSUA 3GX8A 2EIQA 3QD9A 4TR0A 5CAXA 4WBJA 4IBPA 3MWHA 4DSSA 2DIYA 2VL3A 3QFBC 3GTUB 1K0MA 5F0GA 3IC4A 4HU7A 3HCZA 2LNSA 4BVXA 2HSMA 2PVOC 5GZZB 2VCWA 2WW0A 2K8VA 2YV7A 4CDOA 4OCEA 4YH2A 2IMDA 3HA9A 2PN8A 5IMVA 3LFLA 3LORA 4MF7A 3FMWA 1YDKA 2LJKA 5J4UA 2G2QA 1ERUA 2JSZA 2JZSA 2OJLA 16GSA 5AN1A 1OKDA 4TXVA 4G01A 2AV4A 3KH9A 1SJIA 1V58A 5LD0A 1K3YA 1K0CA 4KE3A 2ON5A 2WVXA 4D73B 3LJRA 4EC0A 3GIXA 3A2XA 4F0BA 2JACA 4TR1B 1N2AA 2EC4A 1EEJA 2VLVA 1DBYA 5DJLA 1T8EB 3ZZXA 1Z5YE 1SKWB 3R2QA 1GTIA 4J2FA 2B7JA 2E2MA 2KLXA 5GSTA 4N10A 2GTUA 2B5YA 1H75A 2KUCA 1HD2A 1ST9A 5HFGA 4X4JA 1AW9A 5GSSA 2JZTA 2HXKA 3LYPA 2QGVA 2H1LA 3TJFA 2OE1A 4LMVA 1OC3A 3IAS2 3Q18A 3U6VA 4JBBA 4XRAA 4L0WA 5HR2A 2R37A 3RBTA 1MDKA 4GCIA 4QL9A 3GNJA 1EP8A 2WS2A 1M3IA 2GVPA 4ZXGA 1EOGA 4TR4A 3ZTLA 3GRXA 2CA8A 4EIQA 3LXTA 2VM1A 5KN0A 1M2BA 5IPGA 18GSA 11GSA 1WE0A 4TN8A 3GX0A 2VLTA 3I9V2 1MEKA 5IMZA 5A5KA 4FIWA 4I2UA 1TTZA 2WJUA 3ZMLA 2B6MA 3IXRA 2VL2A 2MBSA 4ZBBA 1SVMA 3HY2A 1URMA 4G10A 3HVSA 14GSA 1YJ6A 5AIXA 3KZQA 3FZ4A 1XXUA 2LJRA 4YQVA 1M2AA 2BJXA 4XCSA 1W89A 2FD3A 4LMWA 5DAKB 6GSTA 3G7JA 3TJBA 2LV3A 3GKNA 22GSA 2HI7A 4BA7A 4IP6A 2H70A 1VRSD 3TKSA 2H73A 6GSYA 4NV5A 2B1KA 2QA2A 19GSA 1XCCA 1U87A 3WGDA 2YWNA 3APQA 2MMAA 3QDNA 3BBYA 4KB3A 1LU4A 1XW5A 3GV1A 3TCOA 2FWGA 4AJ6A 3GL5A 3MDKA 10GSA 4O5RA 1AUCA 5HR1A 3ISOA 4RI6A 1FHEA 1I5GA 1ZZYA 4E8HA 4I97A 5G31A 1IYIA 4YAPA 4OD7A 1NHYA 3N9JA 4F2IA 4MH2A 4DVCA 5ID2B 5ECNB 4GSNA 2VKZG
chains in the Genus database with same CATH topology
5F06A 4HJMA 2O89A 2CAIA 5J47A 1ERVA 2O87A 1AAZA 2OKAA 1NSWA 1EV4A 4EE0A 2ZNMA 1XVQA 1RW1A 4HOJA 1X5CA 3L78A 3N5OA 2CX4A 1OVNA 3GTUA 3MSZA 1WWJA 5COHA 1BQ7A 2FA4A 4V2NA 1N25A 4YQUA 2CVBA 3TKQA 1NW2A 4ZL9A 2DKIA 2A4VA 3WGXA 3FR9A 4KA0A 2LRNA 4O92A 4Z7XA 4IQAA 2DJ3A 2C0EA 1HNCA 1R26A 2GSRA 4PQHA 4GLTA 1SYRA 4MDCA 2EIRA 5A1NB 1XWBA 4PURA 2NVLA 3DVWA 2EFCA 4TR1A 3TU3B 1GLPA 3FRCA 5G30A 1F37A 2O8VB 1LJRA 4TXOB 1ZCPA 3UJ1A 2L6CA 2CVDA 2CX3A 3D21A 1XWAA 1YQ1A 2JU5A 3GYKA 4I8BA 3IBHA 5EVOA 1B9YC 2EFHA 3IOSA 6GSVA 5ELGA 3IV4A 3H8QA 1ZOFA 2C3NA 1V98A 3DMLA 3F3RA 2X4AA 2OADA 1EZKA 4G2EA 1G7OA 2L4CA 1BF5A 4NMUA 2LSTA 1YF0A 1Z7PA 4USSA 2HLSA 1SENA 1XZOA 5D93A 1XOBA 1ABAA 3CSHA 1GTAA 2VD1A 5IQYA 3FZ9A 5IMAA 2G0FA 5DDLA 1AC1A 3KTLA 3ERFA 5DBQA 3GMFA 3EU3A 1FAAA 5D9WA 2LQQA 4PNFA 3VURA 4NWYA 2FLSA 4K7OA 1JZWA 5F07A 2HRAA 5C00A 4MJBA 3QOUA 4TW5A 4NHZA 2PGTA 3F0IA 1EGOA 3H79A 1GTBA 1SL1B 1XBSA 4CY6A 3TRPA 2HRKA 3SWLA 1VF4A 2WGRA 3ERWA 3UL3A 1THOA 2YJ7A 4I6XA 1SVLA 4POMA 1GL8A 5A4VA 4O5UA 2OA7A 4L5OA 4ULXA 2YWIA 3IC8A 4OO5A 1TP9A 3GKMA 4ACSA 2RM5A 1R5AA 2FHEA 2OE0A 3QAVA 3TUEA 2DJKA 3TGZA 2HRNA 5DALB 4WXTA 1BX9A 1SYXA 1XVWA 1YVLA 2I1UA 2IMFA 3M3MA 4XTSA 1MDJA 3D4TA 2O5VA 4ZL7A 3M9JA 2X49A 2DMMA 2PVQA 5IOWA 5ID2A 4ZB7A 4Q5QA 1X9SB 3TOTA 2JL4A 4HZ4A 4Q5RA 2O85A 4N3ZA 1TK8B 4Q5FA 2GS3A 4F9ZA 3LW9A 1PKZA 2LRCA 4YKFA 3FZ5A 2DJJA 3FR3A 5A34B 4IN0A 5HFIA 5IO0A 1TDIA 3ZFBA 1XIYA 4BVYB 5HR3A 2JADA 3P7XA 2VCTA 1E2YA 1O8XA 2DMLA 3V1WA 1HNAA 2ZUPA 3HMJG 1GRXA 3ZMKA 2KP1A 2RIIA 3J7Yb 4GWRA 6GSWA 2XPDA 2VCZA 4KX4A 3QPMA 4X1UA 3CSJA 5G5FA 4RQXA 3HYPA 5B8BA 4POKA 1YKCA 4V2MA 4XRDA 3Q19A 1O6JA 1YZXA 3MYDA 4AJ7A 4WR4A 1CQGA 2HSYA 5IOXA 1WIKA 5IMCA 2PUKC 2F3MA 1G7EA 3F4TA 4NHWA 1SK2A 5J9CA 2GT5A 1TJDA 3C1SA 3PR8A 2P0GA 5ECKB 4GTUA 3RAZA 3L4NA 5D9VA 4ZILA 2H1AA 1FW1A 1O73A 4NV2A 4IELA 5J4YA 5ECHB 1SK0A 4TXOA 1UC7A 1XWGA 2C4JA 2OE3A 4OMVA 3CXGA 3WGEA 4HQZA 2PWJA 2IN3A 5D9XA 1PA3A 3CSIA 4KDUA 2GDRA 4O7HA 3UOMA 4L0UA 4KF9A 1THXA 3KH7A 4N0ZA 1R7HA 1AQVA 1O81A 1FVJA 4X43A 2HNLA 4FQUA 1OC9B 8GSSA 3VWXA 3MNGA 2H66A 2H76A 2H1DA 4BPYA 1GUHA 3F8UA 1TRVA 1AQWA 2YJHA 4JE1A 3UBKA 1WRYA 4FO5A 4HI7A 1E6BA 1J0FA 1ZYPA 4W66A 1BG1A 5HQPA 2L5OA 3FZAA 1GUKA 3FHKA 2J9HA 3ZL5A 4IS0A 1KTEA 5JWOB 3ZRDA 3NZNA 1GTUA 2VM2A 2CQ9A 3ZVJA 1PD21 5F8BA 2YANA 4Q5NA 4LA1A 4JZQA 3IHQA 4GXZA 2FGXA 1F3BA 4HUAA 1TU7A 2HFDA 1GUMA 2RUFA 1XW9A 3GKKA 2DIZA 4ICYA 1ON4A 1OKTA 4TVEA 2LKUA 5JCWA 5ECPB 3SBCA 3UIWA 1X5DA 1R5PA 1U88A 1H4OA 3DRNA 1KNGA 5L71A 1GSSA 4X0XA 3ED3A 1A8YA 1M9BA 1DUGA 5ABRA 2ALBA 2IPAA 4JRRA 2MMZA 4HQSA 2PERA 2C0DA 1PL2A 3GH6A 2YNXA 2NDOA 1B8XA 1G0TA 5DVBA 1CQHA 4EVMA 2MMNA 1QUWA 3TRXA 2M80A 1WPIA 2E2GA 5DALA 5A4UA 4ZIJA 5EY6A 2H75A 2M46A 2C0GA 1SJZA 3H93A 4RI7A 2P31A 2C1YA 3IDVA 4KSOA 4WETA 4V1Ag 2E0QA 1V40A 5FT3A 4K1FA 5ECOB 2F8AA 4KDYA 3LQ7A 4CW9A 3DVXA 1DE1A 3HHVA 1GSEA 2LJAA 4F82A 3IK9A 2I81A 5A34A 4CY8A 1JFUA 4ECCA 5G1KA 4LL1B 3DEXA 4BVYA 2NPBA 5AGYA 4NPBA 2WRTA 3F4RA 3ZFLA 4A5PA 2DJ1A 3CYNA 2NTOA 3QCPA 4K9ZA 1K3OA 3DYRA 1A2MA 1QXHA 2VL2C 2EFEA 2RUEA 3NIVA 3CRTA 1PQNA 3GH9A 3KP8A 3GKXA 2FWEA 3CBUA 3VI5A 1TXXA 1TK5B 2V6KA 2LNTA 2FA8A 4HS1A 2YCDA 4EDZA 4ECBA 4AKHA 3L9UA 4YKGA 5HFKA 2VL9A 1T3BA 3TKSC 2WZ9A 5D9TA 3GSTA 3DKSA 3UMAA 2C80A 3CTGA 5D8IA 1TU8A 2KHPA 4MABA 4EUYA 4GQCA 3VWWA 1VF3A 2H0IA 1HYUA 3IRAA 4V2LA 6GSXA 3L0HA 1WJKA 1TXUA 1ZMAA 1JLVA 5DCHA 1G6YA 4IVFA 1TKDB 2CZ2A 4TR3A 2HSHA 4PX1A 3EU4A 5GAPD 3HDCA 5H5QA 4QMKA 1BYEA 5CO3A 1OC9A 2XBQA 3J7Yk 1PN9A 5D96A 4D73A 3IHGA 5J40A 2LEGA 4HU9A 3VPTA 4RQRA 1JZRA 2A2SA 4HZ2A 3RHBA 2TRXA 1Y25A 2JZRA 2J23A 3RDWA 1XWCA 1Q98A 2FUG2 2Z9SA 3TJJA 1MD3A 4WKWA 4ECJA 2CV4A 4PQ1A 2LQOA 4G0KA 3MIXA 1Z9HA 4MF6A 4ZB8A 3O76A 3UBLA 2PBJA 3HJOA 4QQ7A 1FB6A 3MAKA 2YN1A 3KEBA 1U6TA 2OBKA 3ERGA 4IP1A 5CNWA 3TJGA 2HSMB 5LCZA 2V2GA 3QR6A 2WFCA 5FHIA 9GSSA 2R2JA 1PMTA 4EDYA 4OWYA 1Z3EA 5DJMA 4ZB9A 2DLXA 1I9DA 3NOFA 2UV8G 5J41A 3IA1A 2RLIA 2X64A 3CMIA 4MJEA 3PPUA 1YEXA 3KXOA 2DJ0A 3U5RE 2H1GA 1T4ZA 3ZIVA 2HZFA 2P5RA 2F51A 5J4VA 2L5LA 5IPHA 4AGSA 2YWMA 2FNOA 4IJIA 1GSDA 1TOFA 3GSSA 1QK8A 4XS1A 2DSAA 5E4WA 1IYHA 4BWSA 1X0RA 5AISA 4V1Ap 2P5QA 4Z2TA 3L9VA 3VK9A 4FH8A 2R0PA 4K5SA 1BG5A 5DAKA 1TW9A 3HZ4A 2X8CA 2YZHA 1SU9A 2L57A 3A2VA 3HXSA 1B4PA 2H19A 5AIVA 2QC7A 3HD5A 3TJKA 3I6AA 2WB9A 4MZWA 3HVXA 1SKRB 4YQMA 1SK1A 1J08A 17GSA 2VIMA 1K0DA 1S3CA 3PGTA 4E8EA 3FEUA 4P3YB 5IM9A 3M8NA 2CVKA 3UVTA 2AYTA 3ZITA 1K0OA 2K18A 5KOWA 1A24A 2IMEA 3ZLPA 4PXOA 2CZ3A 2XPEA 1M7TA 1PRXA 3LXZA 4KSMA 4OFNA 2B3SA 3TKPA 3CTFA 4OO4A 3FKFA 5C04A 5ECMB 3TDGA 5IMFA 2WCIA 2H74A 3C1RA 1XWKA 1VGLA 5F05A 3VWVA 2AAWA 1M2DA 3W6GA 2B5EA 2ZCTA 3UVHA 4WBRD 1Z6NA 1RQMA 4TKYA 3PH9A 3G7YA 4OFTA 3LGCA 4F03A 2XBIA 1C72A 3EPTA 5CREA 4DEJA 4KUNA 5JCUA 4ZB6A 4Z2UA 2K9FA 5BMUB 3KGKA 4EKZA 3VLNA 3ZIJA 1F3AA 2IL3A 2YPMA 4IW9A 4PNGA 2QKEA 2VO4A 5CP1A 1GNWA 4N30A 1TI3A 1F2EA 2MMOA 3GN3A 1SL0B 2LS5A 1NHOA 3KTBA 4FYCA 4E68A 1YEPA 4GSSA 3KIJA 2A2RA 2GSTA 5DQSA 4MMMA 1VF2A 3EINA 13GSA 5A1NA 1X9WB 3FYGA 2HT9A 5IMDA 3HVVA 1S3DA 2C3QA 3UARA 1M9AA 1V2AA 4FYUA 2IIYA 3M1GA 2IMKA 4JR4A 4MP4A 1T4YA 1X5EA 2GZYA 1FOVA 3EE2A 5ECRB 2AUVA 3KCMA 3DGQA 5EL8A 2V41A 1U3IA 4POLA 12GSA 2KP2A 1GSFA 1Y6EA 1KEBA 2GQLA 3W8SA 2HZEB 2IWTA 1ACVA 1K0AA 4O5QA 2TRCP 3IE3A 1OAZA 1SD9A 4JU5A 4N0VA 3F4SA 4F0CA 2FY6A 2FWHA 4L8EA 4CHSA 3ME8A 1AXDA 4PTSA 3VPQA 2H6YA 3F63A 20GSA 1TI1A 5JWRB 3GA4A 2X8HA 4K8MA 3G7IA 5A5HB 2LUSA 2GZPA 2C8UA 4H86A 2AJQB 2RM6A 1BJXA 3D4MA 4K0GA 4ZBAA 3TOUA 1SJ6A 1ZYEA 3A5IA 5H5SA 1JHBA 3C8EA 4GF0A 5G5EA 1DSBA 4WR5A 3AY8A 2R5GA 2XHFA 2FCHA 4KAEA 2VCQA 1GSYA 1QFNA 4EL1A 2N5FA 4J57E 3UEMA 3H4KA 3APSA 4EO3A 2VUPA 2CAQA 4DSQA 4O32A 3L9SA 3DD3A 3PINA 2MBTA 2FWFA 1EWXA 2DJ2A 4TOPA 4MF5A 3W8JA 1WOUA 1XPVA 3EWLA 3US3A 4MPFA 4PQIA 5EPFA 3G9BA 3EMXA 3IAM2 1FVKA 3KMNA 1GSQA 3M0FA 4MA9A 3ME7A 2WDUA 1USBA 1JZDA 1G6WA 1UVZA 2BMXA 2GZZA 1O85A 1FO5A 1HQOA 2BTOT 4DSRA 2ON7A 1K0BA 3LYKA 1HNBA 3IPZA 1M0UA 3FW2A 2V32A 1QMVA 2HSNB 1J9BA 2GQKA 1A0FA 3QFAC 4OCFA 3ZYWA 2K8SA 4I5QA 2D2ZA 1EV9A 4XIHA 3CWGA 4EF0A 2AHEA 2VCVA 3C7MA 3IK7A 2JSYA 3EC3A 2YP6A 3I69A 5KN3A 2L6DA 1ERWA 3M9KA 2YWOA 2R3XA 1DE2A 3GL3A 4ML6A 4ISDA 1A0RP 2N5BA 1FOHA 1XOAA 1PKWA 2YZUA 1ZYNA 4PGTA 3KP9A 4G0IA 4ZL8A 4GDFA 2N5AA 5HR0A 3F3QA 4LL4B 1BAYA 1SD8A 2HRKB 3HJMA 5JCGA 1FB0A 3GHAA 1Q4JA 3HJPA 3BD2A 4KH7A 2GSSA 5J5NA 1YF1A 2MYGA 5D73A 5BMUA 4K0NA 3HZ8A 1XW6A 4GQFA 2YV9A 3RHCA 3P90A 2X99A 4EIPA 1F9MA 1UN2A 5IO2A 3GUSA 3VWUA 2A2PA 3QMXA 4IJ3A 4WEYA 4MCUA 1TK0B 2IMIA 3E3EA 4XS4B 2VAFA 2H0GA 5CRHA 5J9BA 2QSIA 6GSSA 3R3EA 1JZOA 1Y1UA 5INYA 4ZBDA 2B1LA 2I4AA 1A2JA 2CT6A 5KEJA 3F9UA 3P2AA 1T1VA 3QAGA 3D22A 4G19A 4MZBA 4POBA 5H5RA 1ZGNA 1GSUA 4KDXA 3EURA 2B5XA 2C3TA 5JWQB 1UA5A 1PL1A 1T00A 1MTCA 4N11A 3VI7A 1S3AA 1K0NA 2L59A 4OFMA 5CRDA 2V1MA 3P8WA 3LEFA 5KN1A 1Z7RA 4KW6A 2IFQB 3A2WA 2R6KA 4AKGA 5B7CA 2HE3A 3RPPA 5ECSA 2HZEA 4K6XA 1ZL9A 3K8NA 3A3TA 1R4WA 4HEA2 3IR4A 2LTKA 2H6XA 3H1NA 5J3RA 2GSQA 2UZ8A 1U3AA 5CRGA 3LWAA 4BL7B 1WP0A 1BEDA 3F6FA 2R0CA 1MDIA 5A5HA 2OT3A 2HQTA 1GULA 2R4VA 2EIOA 1EOHA 4IKHA 3GURA 1T7PB 2OBIA 3WT1A 4PUFC 4GSTA 1B4QA 5B6MA 1OE7A 4DSSB 2L4QA 3EYTA 3VFIA 3E9JB 5CYYA 3JCML 3ZVJD 4MPGA 3WYWA 1Z6MA 4K7NA 3TKRA 5ECIB 2K6VA 5G1LA 4BVXB 1GH2A 1ERTA 4JEDA 3BCIA 1PX6A 2VOCA 3E0UA 1OYJA 2V6OA 1PN0A 4MNNA 2EFDA 1ILOA 3F6DA 1V57A 3BJ5A 3Q6OA 3FR6A 2VD0A 3O3TA 2QA1A 3DXBA 5ELAA 4L5LA 3HKRA 4WF5A 1EEMA 2I3YA 4TRXA 3D5JA 1LBKA 3ZREA 1ZYQB 4AF2A 1O7UA 4G0LA 1GWCA 2H1BA 3FY7A 4MK3A 3D6IA 1GLQA 1MD4A 2MZCA 2OACA 1JLWA 2HSNA 2WULA 3TB2A 1K3LA 7GSSA 3DIEA 5A4WA 4KCAA 2H8LA 1A2LA 1F6MC 3FK8A 4IHUA 4IQ1A 4AI6A 4MJCA 2PMTA 4XS6A 3LG6A 3LSZA 1PX7A 1SKSB 4ECIA 3DWVA 2AB6A 2H0HA 4ID0A 4KGIA 2GT6A 1QQ2A 3C71A 3GFKA 5ECLB 4ILFA 1OC8A 4Z2RA 4J56E 1VF1A 5DQYA 5G2ZA 3CRUA 3BOAA 2XC2A 3OR5A 4QL7A 3TKSE 4XHMA 4JR6A 1M99A 1SL2B 2R0GA 4K2DA 2O7KA 1KBNA 4KCEA 3O6TA 5FWGA 1ML6A 2H01A 4IGJA 2VLUA 3C73A 3D0ZA 2H30A 5ECQB 5CRWA 1B48A 2VCXA 5E59A 5ENUA 1V9WA 2A4HA 2GGTA 2H6ZA 4XS4A 1O8WA 2X8GA 2YOIA 3QAWA 4K7IA 1GP1A 3WD6A 1EP7A 3RPNA 2PU9C 4ML1A 4AKIA 2GLRA 2HYXA 1TRSA 1TRWA 2I9HA 2HRFA 2B7KA 1A8LA 3APOA 1W4VA 1GNEA 1SVOA 1YKAA 3KJYA 2REMA 4K5RA 2LRTA 4BWQA 4PUAA 1NM3A 3Q74A 3TRQA 4HJ2A 4RUVA 3I43A 4MJAA 4AJ8A 2TIRA 4G9HA 5B8AA 2M72A 4EXJA 2H72A 2IJYA 1AQXA 2F8FA 3EMPA 5IIZA 5KOXA 4MZCA 3KD0A 2DBCA 4HDEA 4GRFA 4FYBA 4NAXA 4MLYA 1EGRA 5BRTA 5GAND 2IFQA 1PGTA 1RK4A 1XFLA 1TRUA 3WT2A 2E7PA 2GQMA 2C0FA 5LNKe 3UAPA 2ES7A 5KN2A 3A5WA 3KMOA 3EVIA 2H71A 1FG4A 5DCGA 4AKXB 1PSQA 4I2TA 4K2XA 4KNDA 1N8JA 2DKHA 1A23A 1B9XC 4LLRA 2NBSA 4NXIA 4MH3A 3KM6A 4BL7A 1OE8A 1X9MB 1QGVA 1WMJA 1YY7A 1AIUA 2PPTA 3S9FA 2DC5A 5B6NA 4WF4A 3BCKA 4YAVA 2F9SA 2KOKA 6GSUA 3GX8A 2EIQA 3QD9A 4TR0A 5CAXA 4WBJA 4IBPA 3MWHA 4DSSA 2DIYA 2VL3A 3QFBC 3GTUB 1K0MA 5F0GA 3IC4A 4HU7A 3HCZA 2LNSA 4BVXA 2HSMA 2PVOC 5GZZB 2VCWA 2K8VA 2YV7A 4CDOA 4OCEA 4YH2A 2IMDA 3HA9A 2PN8A 5IMVA 3LFLA 3LORA 4MF7A 3FMWA 1YDKA 2LJKA 5J4UA 2G2QA 1ERUA 2JSZA 2JZSA 2OJLA 16GSA 5AN1A 1OKDA 4TXVA 4G01A 2AV4A 3KH9A 1SJIA 1V58A 5LD0A 1K3YA 1K0CA 4KE3A 2ON5A 4D73B 3LJRA 4EC0A 3GIXA 3A2XA 4F0BA 2JACA 4TR1B 1N2AA 2EC4A 1EEJA 2VLVA 1DBYA 5DJLA 1T8EB 3ZZXA 1Z5YE 1SKWB 3R2QA 1GTIA 4J2FA 2B7JA 2E2MA 2KLXA 5GSTA 4N10A 2GTUA 2B5YA 1H75A 2KUCA 1HD2A 1ST9A 5HFGA 4X4JA 1AW9A 5GSSA 2JZTA 2HXKA 3LYPA 2QGVA 2H1LA 3TJFA 2OE1A 4LMVA 1OC3A 3IAS2 3Q18A 3U6VA 4JBBA 4XRAA 4L0WA 5HR2A 2R37A 3RBTA 1MDKA 4GCIA 4QL9A 3GNJA 1EP8A 2WS2A 2GVPA 4ZXGA 1EOGA 4TR4A 3ZTLA 3GRXA 2CA8A 4EIQA 3LXTA 2VM1A 5KN0A 1M2BA 5IPGA 18GSA 11GSA 1WE0A 4TN8A 3GX0A 2VLTA 3I9V2 1MEKA 5IMZA 5A5KA 4FIWA 4I2UA 1TTZA 2WJUA 3ZMLA 2B6MA 3IXRA 2VL2A 2MBSA 4ZBBA 1SVMA 3HY2A 1URMA 4G10A 3HVSA 14GSA 1YJ6A 5AIXA 3KZQA 3FZ4A 1XXUA 2LJRA 4YQVA 1M2AA 2BJXA 4XCSA 1W89A 2FD3A 4LMWA 5DAKB 6GSTA 3G7JA 3TJBA 2LV3A 3GKNA 22GSA 2HI7A 4BA7A 4IP6A 2H70A 1VRSD 3TKSA 2H73A 6GSYA 4NV5A 2B1KA 2QA2A 19GSA 1XCCA 1U87A 3WGDA 2YWNA 3APQA 2MMAA 3QDNA 3BBYA 4KB3A 1LU4A 1XW5A 3GV1A 3TCOA 2FWGA 4AJ6A 3GL5A 3MDKA 10GSA 4O5RA 1AUCA 5HR1A 3ISOA 4RI6A 1FHEA 1I5GA 1ZZYA 4E8HA 4I97A 5G31A 1IYIA 4YAPA 4OD7A 1NHYA 3N9JA 4F2IA 4MH2A 4DVCA 5ID2B 5ECNB 4GSNA 2VKZG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F06 A;  4HJM A;  2O89 A;  2CAI A;  1ERV A;  2O87 A;  1AAZ A;  2OKA A;  1NSW A;  1EV4 A;  4EE0 A;  2ZNM A;  1XVQ A;  1RW1 A;  4HOJ A;  1X5C A;  3L78 A;  3N5O A;  2CX4 A;  1OVN A;  3GTU A;  3MSZ A;  1WWJ A;  5COH A;  1BQ7 A;  2FA4 A;  4V2N A;  4YQU A;  2CVB A;  3TKQ A;  1NW2 A;  4ZL9 A;  2A4V A;  3WGX A;  3FR9 A;  4KA0 A;  2LRN A;  4O92 A;  4Z7X A;  4IQA A;  2DJ3 A;  2C0E A;  1HNC A;  1R26 A;  2GSR A;  4PQH A;  4GLT A;  1SYR A;  4MDC A;  2EIR A;  1XWB A;  4PUR A;  2NVL A;  3DVW A;  4TR1 A;  1GLP A;  3FRC A;  5G30 A;  1F37 A;  2O8V B;  1LJR A;  4TXO B;  1ZCP A;  3UJ1 A;  2L6C A;  2CVD A;  2CX3 A;  3D21 A;  1XWA A;  1YQ1 A;  2JU5 A;  3GYK A;  4I8B A;  3IBH A;  5EVO A;  1B9Y C;  3IOS A;  6GSV A;  5ELG A;  3IV4 A;  3H8Q A;  1ZOF A;  2C3N A;  1V98 A;  3DML A;  3F3R A;  2OAD A;  1EZK A;  4G2E A;  1G7O A;  2L4C A;  4NMU A;  2LST A;  1YF0 A;  1Z7P A;  4USS A;  2HLS A;  1SEN A;  1XZO A;  5D93 A;  1XOB A;  1ABA A;  3CSH A;  1GTA A;  2VD1 A;  5IQY A;  3FZ9 A;  5IMA A;  2G0F A;  5DDL A;  1AC1 A;  3KTL A;  3ERF A;  5DBQ A;  3GMF A;  3EU3 A;  1FAA A;  5D9W A;  2LQQ A;  4PNF A;  3VUR A;  4NWY A;  2FLS A;  4K7O A;  1JZW A;  5F07 A;  2HRA A;  5C00 A;  4MJB A;  3QOU A;  4TW5 A;  4NHZ A;  2PGT A;  3F0I A;  1EGO A;  3H79 A;  1GTB A;  1SL1 B;  1XBS A;  3TRP A;  2HRK A;  3SWL A;  1VF4 A;  2WGR A;  3ERW A;  3UL3 A;  1THO A;  2YJ7 A;  4I6X A;  1GL8 A;  4POM A;  5A4V A;  2OA7 A;  4L5O A;  4ULX A;  2YWI A;  3IC8 A;  4OO5 A;  1TP9 A;  3GKM A;  4ACS A;  2RM5 A;  1R5A A;  2FHE A;  2OE0 A;  3QAV A;  3TUE A;  2DJK A;  3TGZ A;  2HRN A;  5DAL B;  4WXT A;  1BX9 A;  1SYX A;  1XVW A;  2I1U A;  2IMF A;  3M3M A;  4XTS A;  1MDJ A;  3D4T A;  4ZL7 A;  3M9J A;  2DMM A;  2PVQ A;  5IOW A;  5ID2 A;  4Q5Q A;  1X9S B;  3TOT A;  2JL4 A;  4HZ4 A;  4Q5R A;  2O85 A;  1TK8 B;  4Q5F A;  2GS3 A;  4F9Z A;  1PKZ A;  2LRC A;  3FZ5 A;  2DJJ A;  3FR3 A;  4IN0 A;  5HFI A;  5IO0 A;  1TDI A;  3ZFB A;  1XIY A;  4BVY B;  5HR3 A;  2JAD A;  3P7X A;  2VCT A;  1E2Y A;  1O8X A;  2DML A;  3V1W A;  1HNA A;  2ZUP A;  1GRX A;  3ZMK A;  2KP1 A;  2RII A;  3J7Y b;  4GWR A;  6GSW A;  2XPD A;  2VCZ A;  4KX4 A;  3QPM A;  4X1U A;  3CSJ A;  5G5F A;  4RQX A;  3HYP A;  5B8B A;  4POK A;  1YKC A;  4V2M A;  4XRD A;  3Q19 A;  1O6J A;  1YZX A;  4AJ7 A;  4WR4 A;  1CQG A;  2HSY A;  5IOX A;  1WIK A;  5IMC A;  2PUK C;  2F3M A;  1G7E A;  3F4T A;  4NHW A;  1SK2 A;  5J9C A;  2GT5 A;  1TJD A;  3C1S A;  3PR8 A;  2P0G A;  5ECK B;  4GTU A;  3RAZ A;  3L4N A;  5D9V A;  4ZIL A;  2H1A A;  1FW1 A;  1O73 A;  4NV2 A;  4IEL A;  5ECH B;  1SK0 A;  4TXO A;  1UC7 A;  1XWG A;  2C4J A;  2OE3 A;  4OMV A;  3CXG A;  3WGE A;  4HQZ A;  2PWJ A;  2IN3 A;  5D9X A;  1PA3 A;  3CSI A;  4KDU A;  2GDR A;  4O7H A;  3UOM A;  4L0U A;  4KF9 A;  1THX A;  3KH7 A;  4N0Z A;  1R7H A;  1AQV A;  1O81 A;  1FVJ A;  4X43 A;  2HNL A;  4FQU A;  1OC9 B;  8GSS A;  3VWX A;  3MNG A;  2H66 A;  2H76 A;  2H1D A;  4BPY A;  1GUH A;  3F8U A;  1TRV A;  1AQW A;  2YJH A;  4JE1 A;  3UBK A;  1WRY A;  4FO5 A;  4HI7 A;  1E6B A;  1J0F A;  5HQP A;  2L5O A;  3FZA A;  1GUK A;  3FHK A;  2J9H A;  3ZL5 A;  4IS0 A;  1KTE A;  5JWO B;  3ZRD A;  3NZN A;  1GTU A;  2VM2 A;  2CQ9 A;  3ZVJ A;  1PD2 1;  5F8B A;  2YAN A;  4Q5N A;  4LA1 A;  4JZQ A;  3IHQ A;  4GXZ A;  2FGX A;  1F3B A;  4HUA A;  1TU7 A;  2HFD A;  1GUM A;  2RUF A;  1XW9 A;  3GKK A;  2DIZ A;  1ON4 A;  1OKT A;  4TVE A;  2LKU A;  5JCW A;  5ECP B;  3SBC A;  3UIW A;  1X5D A;  1R5P A;  1U88 A;  1H4O A;  3DRN A;  1KNG A;  5L71 A;  1GSS A;  4X0X A;  3ED3 A;  1A8Y A;  1M9B A;  1DUG A;  5ABR A;  2ALB A;  2IPA A;  4JRR A;  2MMZ A;  4HQS A;  2PER A;  2C0D A;  1PL2 A;  3GH6 A;  2YNX A;  2NDO A;  1B8X A;  1G0T A;  5DVB A;  1CQH A;  4EVM A;  2MMN A;  1QUW A;  3TRX A;  2M80 A;  1WPI A;  2E2G A;  5DAL A;  5A4U A;  4ZIJ A;  5EY6 A;  2H75 A;  2M46 A;  2C0G A;  1SJZ A;  3H93 A;  4RI7 A;  2P31 A;  2C1Y A;  3IDV A;  4KSO A;  4WET A;  4V1A g;  2E0Q A;  1V40 A;  5FT3 A;  4K1F A;  5ECO B;  2F8A A;  4KDY A;  3LQ7 A;  4CW9 A;  3DVX A;  1DE1 A;  3HHV A;  1GSE A;  2LJA A;  4F82 A;  3IK9 A;  2I81 A;  1JFU A;  4ECC A;  5G1K A;  4LL1 B;  3DEX A;  4BVY A;  2NPB A;  5AGY A;  4NPB A;  2WRT A;  3F4R A;  3ZFL A;  2DJ1 A;  3CYN A;  2NTO A;  3QCP A;  4K9Z A;  1K3O A;  3DYR A;  1A2M A;  1QXH A;  2VL2 C;  2RUE A;  3NIV A;  3CRT A;  1PQN A;  3GH9 A;  3KP8 A;  3GKX A;  2FWE A;  3CBU A;  3VI5 A;  1TXX A;  1TK5 B;  2V6K A;  2LNT A;  2FA8 A;  4HS1 A;  2YCD A;  4EDZ A;  4ECB A;  3L9U A;  5HFK A;  2VL9 A;  1T3B A;  3TKS C;  2WZ9 A;  5D9T A;  3GST A;  3DKS A;  3UMA A;  2C80 A;  3CTG A;  5D8I A;  1TU8 A;  2KHP A;  4MAB A;  4EUY A;  4GQC A;  3VWW A;  1VF3 A;  2H0I A;  1HYU A;  3IRA A;  4V2L A;  6GSX A;  3L0H A;  1WJK A;  1ZMA A;  1JLV A;  5DCH A;  1G6Y A;  4IVF A;  1TKD B;  2CZ2 A;  4TR3 A;  2HSH A;  4PX1 A;  3EU4 A;  5GAP D;  3HDC A;  5H5Q A;  1BYE A;  5CO3 A;  1OC9 A;  2XBQ A;  3J7Y k;  1PN9 A;  5D96 A;  4D73 A;  2LEG A;  4HU9 A;  3VPT A;  4RQR A;  1JZR A;  2A2S A;  4HZ2 A;  3RHB A;  2TRX A;  1Y25 A;  2JZR A;  2J23 A;  3RDW A;  1XWC A;  1Q98 A;  2FUG 2;  2Z9S A;  3TJJ A;  1MD3 A;  4WKW A;  4ECJ A;  2CV4 A;  4PQ1 A;  2LQO A;  4G0K A;  1Z9H A;  4MF6 A;  4ZB8 A;  3O76 A;  3UBL A;  2PBJ A;  3HJO A;  4QQ7 A;  1FB6 A;  3MAK A;  2YN1 A;  3KEB A;  1U6T A;  2OBK A;  3ERG A;  4IP1 A;  5CNW A;  3TJG A;  2HSM B;  5LCZ A;  2V2G A;  3QR6 A;  2WFC A;  5FHI A;  9GSS A;  2R2J A;  1PMT A;  4EDY A;  4OWY A;  1Z3E A;  5DJM A;  4ZB9 A;  2DLX A;  1I9D A;  3NOF A;  5J41 A;  3IA1 A;  2RLI A;  2X64 A;  3CMI A;  4MJE A;  3PPU A;  1YEX A;  3KXO A;  2DJ0 A;  3U5R E;  2H1G A;  1T4Z A;  3ZIV A;  2HZF A;  2P5R A;  2F51 A;  2L5L A;  5IPH A;  4AGS A;  2YWM A;  2FNO A;  4IJI A;  1GSD A;  1TOF A;  3GSS A;  1QK8 A;  4XS1 A;  2DSA A;  5E4W A;  1IYH A;  4BWS A;  1X0R A;  5AIS A;  4V1A p;  2P5Q A;  3L9V A;  3VK9 A;  4FH8 A;  1BG5 A;  5DAK A;  1TW9 A;  3HZ4 A;  2X8C A;  2YZH A;  1SU9 A;  2L57 A;  3A2V A;  3HXS A;  1B4P A;  2H19 A;  5AIV A;  2QC7 A;  3HD5 A;  3TJK A;  3I6A A;  2WB9 A;  4MZW A;  3HVX A;  1SKR B;  4YQM A;  1SK1 A;  1J08 A;  17GS A;  2VIM A;  1K0D A;  1S3C A;  3PGT A;  4E8E A;  3FEU A;  4P3Y B;  5IM9 A;  3M8N A;  2CVK A;  3UVT A;  2AYT A;  3ZIT A;  1K0O A;  2K18 A;  1A24 A;  2IME A;  3ZLP A;  4PXO A;  2CZ3 A;  2XPE A;  1M7T A;  1PRX A;  3LXZ A;  4KSM A;  4OFN A;  2B3S A;  3TKP A;  3CTF A;  4OO4 A;  3FKF A;  5C04 A;  5ECM B;  3TDG A;  5IMF A;  2WCI A;  2H74 A;  3C1R A;  1XWK A;  1VGL A;  5F05 A;  3VWV A;  2AAW A;  1M2D A;  3W6G A;  2B5E A;  2ZCT A;  3UVH A;  4WBR D;  1Z6N A;  1RQM A;  4TKY A;  3PH9 A;  3G7Y A;  4OFT A;  3LGC A;  4F03 A;  2XBI A;  1C72 A;  5CRE A;  4DEJ A;  4KUN A;  5JCU A;  4ZB6 A;  2K9F A;  3KGK A;  4EKZ A;  3VLN A;  3ZIJ A;  1F3A A;  2IL3 A;  2YPM A;  4IW9 A;  4PNG A;  2QKE A;  2VO4 A;  5CP1 A;  1GNW A;  4N30 A;  1TI3 A;  1F2E A;  2MMO A;  3GN3 A;  1SL0 B;  2LS5 A;  1NHO A;  3KTB A;  4FYC A;  1YEP A;  4GSS A;  3KIJ A;  2A2R A;  2GST A;  5DQS A;  4MMM A;  1VF2 A;  3EIN A;  13GS A;  1X9W B;  3FYG A;  2HT9 A;  5IMD A;  3HVV A;  1S3D A;  2C3Q A;  3UAR A;  1M9A A;  1V2A A;  4FYU A;  2IIY A;  3M1G A;  2IMK A;  4JR4 A;  4MP4 A;  1T4Y A;  1X5E A;  2GZY A;  1FOV A;  3EE2 A;  5ECR B;  2AUV A;  3KCM A;  3DGQ A;  5EL8 A;  2V41 A;  1U3I A;  4POL A;  12GS A;  2KP2 A;  1GSF A;  1Y6E A;  1KEB A;  2GQL A;  3W8S A;  2HZE B;  2IWT A;  1ACV A;  1K0A A;  2TRC P;  3IE3 A;  1OAZ A;  1SD9 A;  4JU5 A;  4N0V A;  3F4S A;  4F0C A;  2FY6 A;  2FWH A;  4L8E A;  4CHS A;  3ME8 A;  1AXD A;  4PTS A;  3VPQ A;  2H6Y A;  3F63 A;  20GS A;  1TI1 A;  5JWR B;  3GA4 A;  2X8H A;  4K8M A;  3G7I A;  2LUS A;  2GZP A;  2C8U A;  4H86 A;  2AJQ B;  2RM6 A;  1BJX A;  3D4M A;  4K0G A;  4ZBA A;  3TOU A;  1SJ6 A;  1ZYE A;  5H5S A;  1JHB A;  3C8E A;  4GF0 A;  5G5E A;  1DSB A;  4WR5 A;  3AY8 A;  2R5G A;  2XHF A;  2FCH A;  4KAE A;  2VCQ A;  1GSY A;  1QFN A;  4EL1 A;  2N5F A;  4J57 E;  3UEM A;  3H4K A;  3APS A;  4EO3 A;  2VUP A;  2CAQ A;  4DSQ A;  4O32 A;  3L9S A;  3DD3 A;  3PIN A;  2MBT A;  2FWF A;  1EWX A;  2DJ2 A;  4TOP A;  4MF5 A;  3W8J A;  1WOU A;  1XPV A;  3EWL A;  3US3 A;  4MPF A;  4PQI A;  5EPF A;  3G9B A;  3EMX A;  3IAM 2;  1FVK A;  3KMN A;  1GSQ A;  3M0F A;  4MA9 A;  3ME7 A;  2WDU A;  1USB A;  1JZD A;  1G6W A;  1UVZ A;  2BMX A;  2GZZ A;  1O85 A;  1FO5 A;  1HQO A;  2BTO T;  4DSR A;  2ON7 A;  1K0B A;  3LYK A;  1HNB A;  3IPZ A;  1M0U A;  3FW2 A;  2V32 A;  1QMV A;  2HSN B;  1J9B A;  2GQK A;  1A0F A;  3QFA C;  4OCF A;  3ZYW A;  2K8S A;  4I5Q A;  2D2Z A;  1EV9 A;  4XIH A;  4EF0 A;  2AHE A;  2VCV A;  3C7M A;  3IK7 A;  2JSY A;  3EC3 A;  2YP6 A;  3I69 A;  5KN3 A;  2L6D A;  1ERW A;  3M9K A;  2YWO A;  2R3X A;  1DE2 A;  3GL3 A;  4ML6 A;  4ISD A;  1A0R P;  2N5B A;  1XOA A;  1PKW A;  2YZU A;  4PGT A;  3KP9 A;  4G0I A;  4ZL8 A;  2N5A A;  5HR0 A;  3F3Q A;  4LL4 B;  1BAY A;  1SD8 A;  2HRK B;  3HJM A;  5JCG A;  1FB0 A;  3GHA A;  1Q4J A;  3HJP A;  3BD2 A;  4KH7 A;  2GSS A;  5J5N A;  1YF1 A;  2MYG A;  5D73 A;  5BMU A;  4K0N A;  3HZ8 A;  1XW6 A;  4GQF A;  2YV9 A;  3RHC A;  3P90 A;  2X99 A;  1F9M A;  1UN2 A;  5IO2 A;  3GUS A;  3VWU A;  3QMX A;  4IJ3 A;  4WEY A;  1TK0 B;  4MCU A;  2IMI A;  3E3E A;  4XS4 B;  2VAF A;  2H0G A;  5CRH A;  5J9B A;  2QSI A;  6GSS A;  3R3E A;  1JZO A;  5INY A;  4ZBD A;  2B1L A;  2I4A A;  1A2J A;  2CT6 A;  5KEJ A;  3F9U A;  3P2A A;  1T1V A;  3QAG A;  3D22 A;  4G19 A;  4MZB A;  4POB A;  5H5R A;  1ZGN A;  1GSU A;  4KDX A;  3EUR A;  2B5X A;  2C3T A;  5JWQ B;  1UA5 A;  1PL1 A;  1T00 A;  1MTC A;  4N11 A;  3VI7 A;  1S3A A;  1K0N A;  2L59 A;  4OFM A;  5CRD A;  2V1M A;  3P8W A;  3LEF A;  5KN1 A;  1Z7R A;  4KW6 A;  2IFQ B;  3A2W A;  2R6K A;  5B7C A;  2HE3 A;  3RPP A;  5ECS A;  2HZE A;  4K6X A;  1ZL9 A;  3K8N A;  3A3T A;  1R4W A;  4HEA 2;  3IR4 A;  2LTK A;  2H6X A;  3H1N A;  5J3R A;  2GSQ A;  2UZ8 A;  1U3A A;  5CRG A;  3LWA A;  4BL7 B;  1WP0 A;  1BED A;  3F6F A;  1MDI A;  2HQT A;  1GUL A;  2R4V A;  2EIO A;  1EOH A;  4IKH A;  3GUR A;  1T7P B;  2OBI A;  3WT1 A;  4PUF C;  4GST A;  1B4Q A;  5B6M A;  1OE7 A;  4DSS B;  2L4Q A;  3EYT A;  3VFI A;  3E9J B;  5CYY A;  3JCM L;  3ZVJ D;  4MPG A;  3WYW A;  1Z6M A;  4K7N A;  3TKR A;  5ECI B;  2K6V A;  5G1L A;  4BVX B;  1GH2 A;  1ERT A;  4JED A;  3BCI A;  1PX6 A;  2VOC A;  3E0U A;  1OYJ A;  2V6O A;  1ILO A;  3F6D A;  1V57 A;  3BJ5 A;  3Q6O A;  3FR6 A;  2VD0 A;  3O3T A;  3DXB A;  5ELA A;  4L5L A;  3HKR A;  4WF5 A;  1EEM A;  2I3Y A;  4TRX A;  3D5J A;  1LBK A;  3ZRE A;  1ZYQ B;  4AF2 A;  1O7U A;  4G0L A;  1GWC A;  2H1B A;  3FY7 A;  4MK3 A;  3D6I A;  1GLQ A;  1MD4 A;  2MZC A;  2OAC A;  1JLW A;  2WUL A;  3TB2 A;  1K3L A;  7GSS A;  3DIE A;  5A4W A;  4KCA A;  2H8L A;  1A2L A;  1F6M C;  3FK8 A;  4IHU A;  4IQ1 A;  4MJC A;  2PMT A;  4XS6 A;  3LG6 A;  3LSZ A;  1PX7 A;  1SKS B;  4ECI A;  3DWV A;  2AB6 A;  2H0H A;  4ID0 A;  4KGI A;  2GT6 A;  1QQ2 A;  3C71 A;  3GFK A;  5ECL B;  4ILF A;  1OC8 A;  4J56 E;  1VF1 A;  5DQY A;  5G2Z A;  3CRU A;  3BOA A;  2XC2 A;  3OR5 A;  4QL7 A;  3TKS E;  4XHM A;  4JR6 A;  1M99 A;  1SL2 B;  4K2D A;  2O7K A;  1KBN A;  4KCE A;  3O6T A;  5FWG A;  1ML6 A;  2H01 A;  4IGJ A;  2VLU A;  3C73 A;  3D0Z A;  2H30 A;  5ECQ B;  5CRW A;  1B48 A;  2VCX A;  5E59 A;  5ENU A;  1V9W A;  2GGT A;  2H6Z A;  4XS4 A;  1O8W A;  2X8G A;  2YOI A;  3QAW A;  4K7I A;  1GP1 A;  3WD6 A;  1EP7 A;  3RPN A;  2PU9 C;  4ML1 A;  2GLR A;  2HYX A;  1TRS A;  1TRW A;  2I9H A;  2HRF A;  2B7K A;  1A8L A;  3APO A;  1W4V A;  1GNE A;  1YKA A;  3KJY A;  2REM A;  4BWQ A;  2LRT A;  4PUA A;  1NM3 A;  3Q74 A;  3TRQ A;  4HJ2 A;  4RUV A;  3I43 A;  4MJA A;  4AJ8 A;  2TIR A;  4G9H A;  5B8A A;  2M72 A;  4EXJ A;  2H72 A;  2IJY A;  1AQX A;  2F8F A;  3EMP A;  5IIZ A;  4MZC A;  3KD0 A;  2DBC A;  4HDE A;  4GRF A;  4FYB A;  4NAX A;  4MLY A;  1EGR A;  5GAN D;  2IFQ A;  1PGT A;  1RK4 A;  1XFL A;  1TRU A;  3WT2 A;  2E7P A;  2GQM A;  2C0F A;  5LNK e;  3UAP A;  2ES7 A;  5KN2 A;  3A5W A;  3KMO A;  3EVI A;  2H71 A;  1FG4 A;  5DCG A;  1PSQ A;  4I2T A;  4KND A;  1N8J A;  1A23 A;  1B9X C;  4LLR A;  2NBS A;  4NXI A;  4MH3 A;  3KM6 A;  4BL7 A;  1OE8 A;  1X9M B;  1QGV A;  1WMJ A;  1YY7 A;  1AIU A;  2PPT A;  3S9F A;  2DC5 A;  5B6N A;  4WF4 A;  3BCK A;  4YAV A;  2F9S A;  2KOK A;  6GSU A;  3GX8 A;  2EIQ A;  3QD9 A;  4TR0 A;  5CAX A;  4WBJ A;  4IBP A;  3MWH A;  4DSS A;  2DIY A;  2VL3 A;  3QFB C;  3GTU B;  1K0M A;  5F0G A;  3IC4 A;  4HU7 A;  3HCZ A;  2LNS A;  4BVX A;  2HSM A;  2PVO C;  5GZZ B;  2VCW A;  2K8V A;  2YV7 A;  4CDO A;  4OCE A;  4YH2 A;  2IMD A;  3HA9 A;  2PN8 A;  5IMV A;  3LFL A;  3LOR A;  4MF7 A;  1YDK A;  2LJK A;  5J4U A;  2G2Q A;  1ERU A;  2JSZ A;  2JZS A;  2OJL A;  16GS A;  5AN1 A;  1OKD A;  4TXV A;  2AV4 A;  3KH9 A;  1SJI A;  1V58 A;  5LD0 A;  1K3Y A;  1K0C A;  4KE3 A;  2ON5 A;  4D73 B;  3LJR A;  4EC0 A;  3GIX A;  3A2X A;  4F0B A;  2JAC A;  4TR1 B;  1N2A A;  2EC4 A;  1EEJ A;  2VLV A;  1DBY A;  5DJL A;  1T8E B;  3ZZX A;  1Z5Y E;  1SKW B;  3R2Q A;  1GTI A;  4J2F A;  2B7J A;  2E2M A;  2KLX A;  5GST A;  4N10 A;  2GTU A;  2B5Y A;  1H75 A;  2KUC A;  1HD2 A;  1ST9 A;  5HFG A;  1AW9 A;  5GSS A;  2JZT A;  2HXK A;  3LYP A;  2QGV A;  3TJF A;  2OE1 A;  4LMV A;  1OC3 A;  3IAS 2;  3Q18 A;  3U6V A;  4JBB A;  4XRA A;  4L0W A;  5HR2 A;  2R37 A;  3RBT A;  1MDK A;  4GCI A;  4QL9 A;  3GNJ A;  1EP8 A;  2WS2 A;  2GVP A;  4ZXG A;  1EOG A;  4TR4 A;  3ZTL A;  3GRX A;  2CA8 A;  3LXT A;  2VM1 A;  5KN0 A;  1M2B A;  5IPG A;  18GS A;  11GS A;  1WE0 A;  4TN8 A;  3GX0 A;  2VLT A;  3I9V 2;  1MEK A;  5IMZ A;  5A5K A;  4FIW A;  4I2U A;  1TTZ A;  2WJU A;  3ZML A;  2B6M A;  3IXR A;  2VL2 A;  2MBS A;  4ZBB A;  3HY2 A;  1URM A;  4G10 A;  3HVS A;  14GS A;  1YJ6 A;  5AIX A;  3KZQ A;  3FZ4 A;  1XXU A;  2LJR A;  4YQV A;  1M2A A;  2BJX A;  4XCS A;  1W89 A;  2FD3 A;  4LMW A;  5DAK B;  6GST A;  3G7J A;  3TJB A;  2LV3 A;  3GKN A;  22GS A;  2HI7 A;  4BA7 A;  4IP6 A;  2H70 A;  1VRS D;  3TKS A;  2H73 A;  6GSY A;  4NV5 A;  2B1K A;  19GS A;  1XCC A;  1U87 A;  3WGD A;  2YWN A;  3APQ A;  2MMA A;  3QDN A;  3BBY A;  4KB3 A;  1LU4 A;  1XW5 A;  3GV1 A;  3TCO A;  2FWG A;  4AJ6 A;  3GL5 A;  3MDK A;  10GS A;  4O5R A;  1AUC A;  5HR1 A;  3ISO A;  4RI6 A;  1FHE A;  1I5G A;  1ZZY A;  4E8H A;  4I97 A;  5G31 A;  1IYI A;  4YAP A;  4OD7 A;  1NHY A;  3N9J A;  4F2I A;  4MH2 A;  4DVC A;  5ID2 B;  5ECN B;  4GSN A; 
#chains in the Genus database with same CATH topology
 5F06 A;  4HJM A;  2O89 A;  2CAI A;  5J47 A;  1ERV A;  2O87 A;  1AAZ A;  2OKA A;  1NSW A;  1EV4 A;  4EE0 A;  2ZNM A;  1XVQ A;  1RW1 A;  4HOJ A;  1X5C A;  3L78 A;  3N5O A;  2CX4 A;  1OVN A;  3GTU A;  3MSZ A;  1WWJ A;  5COH A;  1BQ7 A;  2WW3 A;  2FA4 A;  4V2N A;  1N25 A;  4YQU A;  2CVB A;  3TKQ A;  1NW2 A;  4ZL9 A;  2DKI A;  2A4V A;  2WW1 A;  3WGX A;  3FR9 A;  4KA0 A;  2LRN A;  4O92 A;  4Z7X A;  4IQA A;  2DJ3 A;  2C0E A;  1HNC A;  1R26 A;  2GSR A;  4PQH A;  4GLT A;  1SYR A;  4MDC A;  2EIR A;  5A1N B;  1XWB A;  4PUR A;  2NVL A;  3DVW A;  2EFC A;  4TR1 A;  3TU3 B;  1GLP A;  3FRC A;  2O36 A;  5G30 A;  1F37 A;  2O8V B;  1LJR A;  4TXO B;  1ZCP A;  3UJ1 A;  2L6C A;  2CVD A;  2CX3 A;  3D21 A;  1XWA A;  1YQ1 A;  2JU5 A;  3GYK A;  4I8B A;  3IBH A;  5EVO A;  1B9Y C;  2EFH A;  3IOS A;  6GSV A;  5ELG A;  3IV4 A;  3H8Q A;  1ZOF A;  2C3N A;  1V98 A;  3DML A;  3F3R A;  2X4A A;  2OAD A;  1EZK A;  4G2E A;  1G7O A;  2L4C A;  1BF5 A;  4NMU A;  2LST A;  1YF0 A;  1Z7P A;  4USS A;  2HLS A;  1SEN A;  1XZO A;  5D93 A;  1XOB A;  1ABA A;  3CSH A;  1GTA A;  2VD1 A;  5IQY A;  3FZ9 A;  5IMA A;  2G0F A;  5DDL A;  1AC1 A;  3KTL A;  3ERF A;  5DBQ A;  3GMF A;  3EU3 A;  1FAA A;  5D9W A;  2LQQ A;  4PNF A;  3VUR A;  4NWY A;  2FLS A;  4K7O A;  1JZW A;  5F07 A;  2HRA A;  5C00 A;  4MJB A;  3QOU A;  4TW5 A;  4NHZ A;  2PGT A;  3F0I A;  1EGO A;  3H79 A;  1GTB A;  1SL1 B;  1XBS A;  4CY6 A;  3TRP A;  2HRK A;  3SWL A;  1VF4 A;  2WGR A;  3ERW A;  3UL3 A;  1THO A;  2YJ7 A;  4I6X A;  1SVL A;  4POM A;  1GL8 A;  5A4V A;  4O5U A;  2OA7 A;  4L5O A;  4ULX A;  2YWI A;  2WW2 A;  3IC8 A;  4OO5 A;  1TP9 A;  3GKM A;  4ACS A;  2RM5 A;  1R5A A;  2FHE A;  2OE0 A;  3QAV A;  3TUE A;  2DJK A;  3TGZ A;  2HRN A;  5DAL B;  4WXT A;  1BX9 A;  1SYX A;  1XVW A;  1YVL A;  2I1U A;  2IMF A;  3M3M A;  4XTS A;  1MDJ A;  3D4T A;  2O5V A;  4ZL7 A;  3M9J A;  2X49 A;  2DMM A;  2PVQ A;  5IOW A;  5ID2 A;  4ZB7 A;  4Q5Q A;  1X9S B;  3TOT A;  2JL4 A;  4HZ4 A;  4Q5R A;  2O85 A;  4N3Z A;  1TK8 B;  4Q5F A;  2GS3 A;  4F9Z A;  3LW9 A;  1PKZ A;  2LRC A;  4YKF A;  3FZ5 A;  2DJJ A;  3FR3 A;  5A34 B;  4IN0 A;  5HFI A;  5IO0 A;  4PI0 C;  1TDI A;  3ZFB A;  1XIY A;  4BVY B;  5HR3 A;  2JAD A;  3P7X A;  2VCT A;  1E2Y A;  1O8X A;  2DML A;  3V1W A;  1HNA A;  2ZUP A;  3HMJ G;  4BIK A;  1GRX A;  3ZMK A;  2KP1 A;  2RII A;  3J7Y b;  4GWR A;  6GSW A;  2XPD A;  1I1I P;  2VCZ A;  4KX4 A;  3QPM A;  4X1U A;  3CSJ A;  5G5F A;  4RQX A;  3HYP A;  5B8B A;  4POK A;  1YKC A;  4V2M A;  4XRD A;  3Q19 A;  1O6J A;  1YZX A;  3MYD A;  4AJ7 A;  4WR4 A;  1CQG A;  2HSY A;  5IOX A;  1WIK A;  5IMC A;  2PUK C;  2F3M A;  1G7E A;  3F4T A;  4NHW A;  1SK2 A;  5J9C A;  2GT5 A;  1TJD A;  3C1S A;  3PR8 A;  2P0G A;  5ECK B;  4GTU A;  3RAZ A;  3L4N A;  5D9V A;  4ZIL A;  2H1A A;  1FW1 A;  1O73 A;  4NV2 A;  4IEL A;  5J4Y A;  5ECH B;  1SK0 A;  4TXO A;  1UC7 A;  1XWG A;  2C4J A;  2OE3 A;  4OMV A;  3CXG A;  4PHZ C;  3WGE A;  4HQZ A;  2PWJ A;  2IN3 A;  5D9X A;  1PA3 A;  3CSI A;  4KDU A;  2GDR A;  4O7H A;  3UOM A;  4L0U A;  4KF9 A;  1THX A;  3KH7 A;  4N0Z A;  1R7H A;  1AQV A;  1O81 A;  1FVJ A;  4X43 A;  2HNL A;  4FQU A;  1OC9 B;  2WVY A;  8GSS A;  3VWX A;  3MNG A;  2H66 A;  2H76 A;  2H1D A;  4BPY A;  1GUH A;  3F8U A;  1TRV A;  1AQW A;  2YJH A;  4JE1 A;  3UBK A;  1WRY A;  4FO5 A;  4HI7 A;  1E6B A;  1J0F A;  1ZYP A;  4W66 A;  1BG1 A;  5HQP A;  2L5O A;  3FZA A;  1GUK A;  3FHK A;  2J9H A;  3ZL5 A;  4IS0 A;  1KTE A;  5JWO B;  3ZRD A;  3NZN A;  1GTU A;  2VM2 A;  2CQ9 A;  3ZVJ A;  1PD2 1;  5F8B A;  2YAN A;  4Q5N A;  4LA1 A;  4JZQ A;  3IHQ A;  4GXZ A;  2FGX A;  1F3B A;  4HUA A;  1PFO A;  1TU7 A;  2HFD A;  1GUM A;  2RUF A;  1XW9 A;  3GKK A;  2DIZ A;  4ICY A;  1ON4 A;  1OKT A;  4TVE A;  2LKU A;  5JCW A;  5ECP B;  3SBC A;  3UIW A;  1X5D A;  1R5P A;  1U88 A;  1H4O A;  3DRN A;  1KNG A;  5L71 A;  1GSS A;  4X0X A;  3ED3 A;  1A8Y A;  1M9B A;  1DUG A;  5ABR A;  2ALB A;  2IPA A;  4JRR A;  2MMZ A;  4HQS A;  2PER A;  2C0D A;  1PL2 A;  3GH6 A;  2YNX A;  2NDO A;  1B8X A;  1G0T A;  5DVB A;  1CQH A;  4EVM A;  2MMN A;  1QUW A;  3TRX A;  2M80 A;  1WPI A;  2E2G A;  5DAL A;  5A4U A;  4ZIJ A;  5EY6 A;  2H75 A;  2M46 A;  3RFR C;  2C0G A;  1SJZ A;  3H93 A;  4RI7 A;  2P31 A;  1M3J A;  2C1Y A;  3IDV A;  4KSO A;  4WET A;  4V1A g;  2E0Q A;  1V40 A;  5FT3 A;  4K1F A;  5ECO B;  2F8A A;  4KDY A;  3LQ7 A;  4CW9 A;  3DVX A;  1DE1 A;  3HHV A;  1GSE A;  2LJA A;  4F82 A;  3IK9 A;  2I81 A;  5A34 A;  4CY8 A;  1JFU A;  4ECC A;  5G1K A;  4LL1 B;  3DEX A;  4BVY A;  2NPB A;  5AGY A;  4NPB A;  2WRT A;  3F4R A;  3ZFL A;  4A5P A;  2DJ1 A;  3CYN A;  2NTO A;  3QCP A;  4K9Z A;  1K3O A;  3DYR A;  1A2M A;  2WZS A;  1QXH A;  2VL2 C;  2EFE A;  2RUE A;  3NIV A;  3CRT A;  1PQN A;  3GH9 A;  3KP8 A;  3GKX A;  2FWE A;  3CBU A;  3VI5 A;  1TXX A;  1TK5 B;  2V6K A;  2LNT A;  2FA8 A;  4HS1 A;  2YCD A;  4EDZ A;  4ECB A;  4AKH A;  3L9U A;  4YKG A;  5HFK A;  2VL9 A;  1T3B A;  3TKS C;  2WZ9 A;  5D9T A;  3GST A;  3DKS A;  3UMA A;  2C80 A;  3CTG A;  5D8I A;  1TU8 A;  2KHP A;  4MAB A;  4EUY A;  4GQC A;  2O3E A;  3VWW A;  1VF3 A;  2H0I A;  1HYU A;  3IRA A;  4V2L A;  6GSX A;  3L0H A;  1WJK A;  1TXU A;  1ZMA A;  1JLV A;  5DCH A;  1G6Y A;  1S3R A;  4IVF A;  1TKD B;  2CZ2 A;  4TR3 A;  2HSH A;  4PX1 A;  3EU4 A;  5GAP D;  3HDC A;  5H5Q A;  4QMK A;  3RGB C;  1BYE A;  5CO3 A;  1OC9 A;  2XBQ A;  3J7Y k;  1PN9 A;  5D96 A;  4D73 A;  3IHG A;  5J40 A;  2LEG A;  4HU9 A;  3VPT A;  4RQR A;  1JZR A;  2A2S A;  4HZ2 A;  3RHB A;  2TRX A;  1Y25 A;  2WVZ A;  2JZR A;  2J23 A;  3RDW A;  1XWC A;  1Q98 A;  2FUG 2;  2Z9S A;  3TJJ A;  1MD3 A;  4WKW A;  4ECJ A;  2CV4 A;  4PQ1 A;  2LQO A;  4G0K A;  3MIX A;  1Z9H A;  4MF6 A;  4ZB8 A;  3O76 A;  3UBL A;  2PBJ A;  3HJO A;  4QQ7 A;  1FB6 A;  3MAK A;  2YN1 A;  3KEB A;  1U6T A;  2OBK A;  3ERG A;  4IP1 A;  5CNW A;  3TJG A;  2HSM B;  5LCZ A;  2V2G A;  3QR6 A;  2WFC A;  5FHI A;  9GSS A;  2R2J A;  1PMT A;  4EDY A;  4OWY A;  1Z3E A;  5DJM A;  4ZB9 A;  2DLX A;  1I9D A;  3NOF A;  2UV8 G;  5J41 A;  3IA1 A;  2RLI A;  2X64 A;  3CMI A;  4MJE A;  3PPU A;  1YEX A;  3KXO A;  2DJ0 A;  3U5R E;  2H1G A;  1T4Z A;  3ZIV A;  2HZF A;  2P5R A;  2F51 A;  5J4V A;  2L5L A;  5IPH A;  4AGS A;  2YWM A;  2FNO A;  4IJI A;  1GSD A;  1TOF A;  3GSS A;  1QK8 A;  4XS1 A;  2DSA A;  5E4W A;  1IYH A;  4BWS A;  1X0R A;  5AIS A;  4V1A p;  2P5Q A;  4Z2T A;  3L9V A;  3VK9 A;  4FH8 A;  2R0P A;  4K5S A;  1BG5 A;  5DAK A;  1TW9 A;  3HZ4 A;  2X8C A;  2YZH A;  1SU9 A;  2L57 A;  3A2V A;  3HXS A;  1B4P A;  2H19 A;  5AIV A;  2QC7 A;  3HD5 A;  3TJK A;  3I6A A;  2WB9 A;  4MZW A;  3HVX A;  1SKR B;  4YQM A;  1SK1 A;  1J08 A;  17GS A;  2VIM A;  1K0D A;  1S3C A;  3PGT A;  4E8E A;  3FEU A;  4P3Y B;  5IM9 A;  3M8N A;  2CVK A;  3UVT A;  2AYT A;  3ZIT A;  1K0O A;  2K18 A;  5KOW A;  1A24 A;  2IME A;  3ZLP A;  4PXO A;  2CZ3 A;  2XPE A;  1M7T A;  1PRX A;  3LXZ A;  4KSM A;  4OFN A;  1S4B P;  2B3S A;  3TKP A;  3CTF A;  4OO4 A;  3FKF A;  5C04 A;  5ECM B;  3TDG A;  5IMF A;  2WCI A;  2H74 A;  3C1R A;  1XWK A;  1VGL A;  5F05 A;  3VWV A;  2AAW A;  1M2D A;  3W6G A;  2B5E A;  2ZCT A;  3UVH A;  4WBR D;  1Z6N A;  1RQM A;  4TKY A;  3PH9 A;  3G7Y A;  4OFT A;  3LGC A;  4F03 A;  2XBI A;  1C72 A;  3EPT A;  5CRE A;  4DEJ A;  4KUN A;  5JCU A;  4ZB6 A;  4Z2U A;  2K9F A;  5BMU B;  3KGK A;  4EKZ A;  3VLN A;  3ZIJ A;  1F3A A;  2IL3 A;  2YPM A;  4IW9 A;  4PNG A;  2QKE A;  2VO4 A;  5CP1 A;  1GNW A;  4N30 A;  1TI3 A;  1F2E A;  2MMO A;  3GN3 A;  1SL0 B;  2LS5 A;  1NHO A;  3KTB A;  4FYC A;  4E68 A;  1YEP A;  4GSS A;  3KIJ A;  2A2R A;  2GST A;  5DQS A;  4MMM A;  1VF2 A;  3EIN A;  13GS A;  5A1N A;  1X9W B;  3FYG A;  2HT9 A;  5IMD A;  3HVV A;  1S3D A;  2C3Q A;  1XG8 A;  3UAR A;  1M9A A;  1V2A A;  4FYU A;  2IIY A;  3M1G A;  2IMK A;  4JR4 A;  4MP4 A;  1T4Y A;  1X5E A;  2GZY A;  1FOV A;  3EE2 A;  5ECR B;  2AUV A;  3KCM A;  3DGQ A;  5EL8 A;  2V41 A;  1U3I A;  4POL A;  12GS A;  2KP2 A;  1GSF A;  1Y6E A;  1KEB A;  2GQL A;  3W8S A;  2HZE B;  2IWT A;  1ACV A;  1K0A A;  4O5Q A;  2TRC P;  3IE3 A;  1OAZ A;  1SD9 A;  4JU5 A;  4N0V A;  3F4S A;  4F0C A;  2FY6 A;  2FWH A;  4L8E A;  4CHS A;  3ME8 A;  1AXD A;  4PTS A;  3VPQ A;  2H6Y A;  3F63 A;  20GS A;  1TI1 A;  5JWR B;  3GA4 A;  2X8H A;  4K8M A;  3G7I A;  5A5H B;  2LUS A;  2GZP A;  2C8U A;  4H86 A;  2AJQ B;  2RM6 A;  1BJX A;  3D4M A;  4K0G A;  4ZBA A;  3TOU A;  1SJ6 A;  1ZYE A;  3A5I A;  5H5S A;  1JHB A;  3C8E A;  4GF0 A;  5G5E A;  1DSB A;  4WR5 A;  3AY8 A;  2R5G A;  2XHF A;  2FCH A;  4KAE A;  2VCQ A;  1GSY A;  1QFN A;  4EL1 A;  2N5F A;  4J57 E;  3UEM A;  3H4K A;  3APS A;  4EO3 A;  4FXY P;  2VUP A;  2CAQ A;  4DSQ A;  4O32 A;  3L9S A;  3DD3 A;  3PIN A;  2MBT A;  2FWF A;  1EWX A;  2DJ2 A;  4TOP A;  4MF5 A;  3W8J A;  1WOU A;  1XPV A;  3EWL A;  3US3 A;  4MPF A;  4PQI A;  5EPF A;  3G9B A;  3EMX A;  3IAM 2;  1FVK A;  3KMN A;  1GSQ A;  3M0F A;  4MA9 A;  3ME7 A;  2WDU A;  1USB A;  1JZD A;  1G6W A;  1UVZ A;  2BMX A;  2GZZ A;  1O85 A;  1FO5 A;  1HQO A;  2BTO T;  4DSR A;  2ON7 A;  1K0B A;  3LYK A;  1HNB A;  3IPZ A;  1M0U A;  3FW2 A;  2V32 A;  1QMV A;  2HSN B;  1J9B A;  2GQK A;  1A0F A;  3QFA C;  4OCF A;  3ZYW A;  2K8S A;  4I5Q A;  2D2Z A;  1EV9 A;  4XIH A;  3CWG A;  4EF0 A;  2AHE A;  2VCV A;  3C7M A;  3IK7 A;  2JSY A;  3EC3 A;  2YP6 A;  3I69 A;  5KN3 A;  2L6D A;  1ERW A;  3M9K A;  1YEW C;  2YWO A;  2R3X A;  1DE2 A;  3GL3 A;  4ML6 A;  4ISD A;  1A0R P;  2N5B A;  1FOH A;  1XOA A;  1PKW A;  2YZU A;  1ZYN A;  4PGT A;  3KP9 A;  4G0I A;  4ZL8 A;  4GDF A;  2N5A A;  5HR0 A;  3F3Q A;  4LL4 B;  1BAY A;  1SD8 A;  2HRK B;  3HJM A;  5JCG A;  1FB0 A;  3GHA A;  1Q4J A;  3HJP A;  3BD2 A;  4KH7 A;  2GSS A;  5J5N A;  1YF1 A;  2MYG A;  5D73 A;  5BMU A;  4K0N A;  3HZ8 A;  1XW6 A;  4GQF A;  2YV9 A;  3RHC A;  3P90 A;  2X99 A;  4EIP A;  1F9M A;  1UN2 A;  5IO2 A;  3GUS A;  3VWU A;  2A2P A;  3QMX A;  4IJ3 A;  4WEY A;  4MCU A;  1TK0 B;  2IMI A;  3E3E A;  4XS4 B;  2VAF A;  2H0G A;  5CRH A;  5J9B A;  2QSI A;  6GSS A;  3R3E A;  1JZO A;  1Y1U A;  3CHX C;  5INY A;  4ZBD A;  2B1L A;  2I4A A;  1A2J A;  2CT6 A;  5KEJ A;  3F9U A;  3P2A A;  1T1V A;  3QAG A;  3D22 A;  4G19 A;  4MZB A;  4POB A;  5H5R A;  1ZGN A;  1GSU A;  4KDX A;  3EUR A;  2B5X A;  2C3T A;  5JWQ B;  1UA5 A;  1PL1 A;  1T00 A;  1MTC A;  4N11 A;  3VI7 A;  1S3A A;  1K0N A;  2L59 A;  4OFM A;  5CRD A;  4PI2 C;  2V1M A;  3P8W A;  3LEF A;  5KN1 A;  1Z7R A;  4KW6 A;  2IFQ B;  3A2W A;  2R6K A;  4AKG A;  5B7C A;  2HE3 A;  3RPP A;  5ECS A;  2HZE A;  4K6X A;  1ZL9 A;  3K8N A;  3A3T A;  1R4W A;  4HEA 2;  3IR4 A;  2LTK A;  2H6X A;  3H1N A;  5J3R A;  2GSQ A;  2UZ8 A;  1U3A A;  5CRG A;  3LWA A;  4BL7 B;  1WP0 A;  1BED A;  3F6F A;  2R0C A;  1MDI A;  5A5H A;  2OT3 A;  2HQT A;  1GUL A;  2R4V A;  2EIO A;  1EOH A;  4IKH A;  3GUR A;  1T7P B;  2OBI A;  3WT1 A;  4PUF C;  3HVN A;  4GST A;  1B4Q A;  5B6M A;  1OE7 A;  4DSS B;  2L4Q A;  3EYT A;  3VFI A;  3E9J B;  5CYY A;  3JCM L;  3ZVJ D;  4MPG A;  3WYW A;  1Z6M A;  4K7N A;  3TKR A;  5ECI B;  2K6V A;  5G1L A;  4BVX B;  1GH2 A;  1ERT A;  4JED A;  3BCI A;  1PX6 A;  2VOC A;  3E0U A;  1OYJ A;  2V6O A;  1PN0 A;  4MNN A;  2EFD A;  1ILO A;  3F6D A;  1V57 A;  3BJ5 A;  3Q6O A;  3FR6 A;  2VD0 A;  3O3T A;  2QA1 A;  3DXB A;  5ELA A;  4L5L A;  3HKR A;  4WF5 A;  1EEM A;  2I3Y A;  4TRX A;  3D5J A;  1LBK A;  4HSC X;  3ZRE A;  1ZYQ B;  4AF2 A;  2WVX B;  1O7U A;  4G0L A;  1GWC A;  2H1B A;  3CQF A;  3FY7 A;  4MK3 A;  3D6I A;  1GLQ A;  1MD4 A;  2MZC A;  2OAC A;  1JLW A;  2HSN A;  2WUL A;  3TB2 A;  1K3L A;  7GSS A;  3DIE A;  5A4W A;  4KCA A;  2H8L A;  1A2L A;  1F6M C;  3FK8 A;  4IHU A;  4IQ1 A;  4AI6 A;  4MJC A;  2PMT A;  4XS6 A;  3LG6 A;  3LSZ A;  1PX7 A;  1SKS B;  4ECI A;  3DWV A;  2AB6 A;  2H0H A;  4ID0 A;  4KGI A;  2GT6 A;  1QQ2 A;  3C71 A;  3GFK A;  5ECL B;  4ILF A;  1OC8 A;  4Z2R A;  4J56 E;  1VF1 A;  5DQY A;  5G2Z A;  3CRU A;  3BOA A;  2XC2 A;  3OR5 A;  4QL7 A;  3TKS E;  4XHM A;  4JR6 A;  1M99 A;  1SL2 B;  2R0G A;  4K2D A;  2O7K A;  1KBN A;  4KCE A;  3O6T A;  5FWG A;  1ML6 A;  2H01 A;  4IGJ A;  2VLU A;  3C73 A;  3D0Z A;  2H30 A;  5ECQ B;  5CRW A;  1B48 A;  2VCX A;  5E59 A;  5ENU A;  1V9W A;  2A4H A;  2GGT A;  2H6Z A;  4XS4 A;  1O8W A;  2X8G A;  2YOI A;  3QAW A;  4K7I A;  1GP1 A;  3WD6 A;  1EP7 A;  3RPN A;  2PU9 C;  4ML1 A;  4AKI A;  2GLR A;  2HYX A;  1TRS A;  1TRW A;  2I9H A;  2HRF A;  2B7K A;  1A8L A;  3APO A;  1W4V A;  1GNE A;  1SVO A;  1YKA A;  3KJY A;  2REM A;  4K5R A;  2LRT A;  4BWQ A;  4PUA A;  1NM3 A;  3Q74 A;  3TRQ A;  4HJ2 A;  4RUV A;  3I43 A;  4MJA A;  4AJ8 A;  2TIR A;  4G9H A;  5B8A A;  2M72 A;  4EXJ A;  2H72 A;  2IJY A;  1AQX A;  2F8F A;  3EMP A;  5IIZ A;  5KOX A;  4MZC A;  3KD0 A;  2DBC A;  4HDE A;  4GRF A;  4FYB A;  4NAX A;  4MLY A;  1EGR A;  5BRT A;  5GAN D;  2IFQ A;  1PGT A;  1RK4 A;  1XFL A;  1TRU A;  3WT2 A;  2E7P A;  2GQM A;  2C0F A;  5LNK e;  3UAP A;  2ES7 A;  5KN2 A;  3A5W A;  3KMO A;  3EVI A;  2H71 A;  1FG4 A;  5DCG A;  4AKX B;  1PSQ A;  4I2T A;  4K2X A;  4KND A;  1N8J A;  2DKH A;  1A23 A;  1B9X C;  4LLR A;  2NBS A;  4NXI A;  4MH3 A;  3KM6 A;  4BL7 A;  1OE8 A;  1X9M B;  1QGV A;  1WMJ A;  1YY7 A;  1AIU A;  2PPT A;  3S9F A;  2DC5 A;  5B6N A;  4WF4 A;  3BCK A;  4YAV A;  2F9S A;  2KOK A;  6GSU A;  3GX8 A;  2EIQ A;  3QD9 A;  4TR0 A;  5CAX A;  4WBJ A;  4IBP A;  3MWH A;  4DSS A;  2DIY A;  2VL3 A;  3QFB C;  3GTU B;  1K0M A;  5F0G A;  3IC4 A;  4HU7 A;  3HCZ A;  2LNS A;  4BVX A;  2HSM A;  2PVO C;  5GZZ B;  2VCW A;  2WW0 A;  2K8V A;  2YV7 A;  4CDO A;  4OCE A;  4YH2 A;  2IMD A;  3HA9 A;  2PN8 A;  5IMV A;  3LFL A;  3LOR A;  4MF7 A;  3FMW A;  1YDK A;  2LJK A;  5J4U A;  2G2Q A;  1ERU A;  2JSZ A;  2JZS A;  2OJL A;  16GS A;  5AN1 A;  1OKD A;  4TXV A;  4G01 A;  2AV4 A;  3KH9 A;  1SJI A;  1V58 A;  5LD0 A;  1K3Y A;  1K0C A;  4KE3 A;  2ON5 A;  2WVX A;  4D73 B;  3LJR A;  4EC0 A;  3GIX A;  3A2X A;  4F0B A;  2JAC A;  4TR1 B;  1N2A A;  2EC4 A;  1EEJ A;  2VLV A;  1DBY A;  5DJL A;  1T8E B;  3ZZX A;  1Z5Y E;  1SKW B;  3R2Q A;  1GTI A;  4J2F A;  2B7J A;  2E2M A;  2KLX A;  5GST A;  4N10 A;  2GTU A;  2B5Y A;  1H75 A;  2KUC A;  1HD2 A;  1ST9 A;  5HFG A;  4X4J A;  1AW9 A;  5GSS A;  2JZT A;  2HXK A;  3LYP A;  2QGV A;  2H1L A;  3TJF A;  2OE1 A;  4LMV A;  1OC3 A;  3IAS 2;  3Q18 A;  3U6V A;  4JBB A;  4XRA A;  4L0W A;  5HR2 A;  2R37 A;  3RBT A;  1MDK A;  4GCI A;  4QL9 A;  3GNJ A;  1EP8 A;  2WS2 A;  1M3I A;  2GVP A;  4ZXG A;  1EOG A;  4TR4 A;  3ZTL A;  3GRX A;  2CA8 A;  4EIQ A;  3LXT A;  2VM1 A;  5KN0 A;  1M2B A;  5IPG A;  18GS A;  11GS A;  1WE0 A;  4TN8 A;  3GX0 A;  2VLT A;  3I9V 2;  1MEK A;  5IMZ A;  5A5K A;  4FIW A;  4I2U A;  1TTZ A;  2WJU A;  3ZML A;  2B6M A;  3IXR A;  2VL2 A;  2MBS A;  4ZBB A;  1SVM A;  3HY2 A;  1URM A;  4G10 A;  3HVS A;  14GS A;  1YJ6 A;  5AIX A;  3KZQ A;  3FZ4 A;  1XXU A;  2LJR A;  4YQV A;  1M2A A;  2BJX A;  4XCS A;  1W89 A;  2FD3 A;  4LMW A;  5DAK B;  6GST A;  3G7J A;  3TJB A;  2LV3 A;  3GKN A;  22GS A;  2HI7 A;  4BA7 A;  4IP6 A;  2H70 A;  1VRS D;  3TKS A;  2H73 A;  6GSY A;  4NV5 A;  2B1K A;  2QA2 A;  19GS A;  1XCC A;  1U87 A;  3WGD A;  2YWN A;  3APQ A;  2MMA A;  3QDN A;  3BBY A;  4KB3 A;  1LU4 A;  1XW5 A;  3GV1 A;  3TCO A;  2FWG A;  4AJ6 A;  3GL5 A;  3MDK A;  10GS A;  4O5R A;  1AUC A;  5HR1 A;  3ISO A;  4RI6 A;  1FHE A;  1I5G A;  1ZZY A;  4E8H A;  4I97 A;  5G31 A;  1IYI A;  4YAP A;  4OD7 A;  1NHY A;  3N9J A;  4F2I A;  4MH2 A;  4DVC A;  5ID2 B;  5ECN B;  4GSN A;  2VKZ G; 
#chains in the Genus database with same CATH homology
 5F06 A;  4HJM A;  2O89 A;  2CAI A;  5J47 A;  1ERV A;  2O87 A;  1AAZ A;  2OKA A;  1NSW A;  1EV4 A;  4EE0 A;  2ZNM A;  1XVQ A;  1RW1 A;  4HOJ A;  1X5C A;  3L78 A;  3N5O A;  2CX4 A;  1OVN A;  3GTU A;  3MSZ A;  1WWJ A;  5COH A;  1BQ7 A;  2FA4 A;  4V2N A;  1N25 A;  4YQU A;  2CVB A;  3TKQ A;  1NW2 A;  4ZL9 A;  2DKI A;  2A4V A;  3WGX A;  3FR9 A;  4KA0 A;  2LRN A;  4O92 A;  4Z7X A;  4IQA A;  2DJ3 A;  2C0E A;  1HNC A;  1R26 A;  2GSR A;  4PQH A;  4GLT A;  1SYR A;  4MDC A;  2EIR A;  5A1N B;  1XWB A;  4PUR A;  2NVL A;  3DVW A;  2EFC A;  4TR1 A;  3TU3 B;  1GLP A;  3FRC A;  5G30 A;  1F37 A;  2O8V B;  1LJR A;  4TXO B;  1ZCP A;  3UJ1 A;  2L6C A;  2CVD A;  2CX3 A;  3D21 A;  1XWA A;  1YQ1 A;  2JU5 A;  3GYK A;  4I8B A;  3IBH A;  5EVO A;  1B9Y C;  2EFH A;  3IOS A;  6GSV A;  5ELG A;  3IV4 A;  3H8Q A;  1ZOF A;  2C3N A;  1V98 A;  3DML A;  3F3R A;  2X4A A;  2OAD A;  1EZK A;  4G2E A;  1G7O A;  2L4C A;  1BF5 A;  4NMU A;  2LST A;  1YF0 A;  1Z7P A;  4USS A;  2HLS A;  1SEN A;  1XZO A;  5D93 A;  1XOB A;  1ABA A;  3CSH A;  1GTA A;  2VD1 A;  5IQY A;  3FZ9 A;  5IMA A;  2G0F A;  5DDL A;  1AC1 A;  3KTL A;  3ERF A;  5DBQ A;  3GMF A;  3EU3 A;  1FAA A;  5D9W A;  2LQQ A;  4PNF A;  3VUR A;  4NWY A;  2FLS A;  4K7O A;  1JZW A;  5F07 A;  2HRA A;  5C00 A;  4MJB A;  3QOU A;  4TW5 A;  4NHZ A;  2PGT A;  3F0I A;  1EGO A;  3H79 A;  1GTB A;  1SL1 B;  1XBS A;  4CY6 A;  3TRP A;  2HRK A;  3SWL A;  1VF4 A;  2WGR A;  3ERW A;  3UL3 A;  1THO A;  2YJ7 A;  4I6X A;  1SVL A;  4POM A;  1GL8 A;  5A4V A;  4O5U A;  2OA7 A;  4L5O A;  4ULX A;  2YWI A;  3IC8 A;  4OO5 A;  1TP9 A;  3GKM A;  4ACS A;  2RM5 A;  1R5A A;  2FHE A;  2OE0 A;  3QAV A;  3TUE A;  2DJK A;  3TGZ A;  2HRN A;  5DAL B;  4WXT A;  1BX9 A;  1SYX A;  1XVW A;  1YVL A;  2I1U A;  2IMF A;  3M3M A;  4XTS A;  1MDJ A;  3D4T A;  2O5V A;  4ZL7 A;  3M9J A;  2X49 A;  2DMM A;  2PVQ A;  5IOW A;  5ID2 A;  4ZB7 A;  4Q5Q A;  1X9S B;  3TOT A;  2JL4 A;  4HZ4 A;  4Q5R A;  2O85 A;  4N3Z A;  1TK8 B;  4Q5F A;  2GS3 A;  4F9Z A;  3LW9 A;  1PKZ A;  2LRC A;  4YKF A;  3FZ5 A;  2DJJ A;  3FR3 A;  5A34 B;  4IN0 A;  5HFI A;  5IO0 A;  1TDI A;  3ZFB A;  1XIY A;  4BVY B;  5HR3 A;  2JAD A;  3P7X A;  2VCT A;  1E2Y A;  1O8X A;  2DML A;  3V1W A;  1HNA A;  2ZUP A;  3HMJ G;  1GRX A;  3ZMK A;  2KP1 A;  2RII A;  3J7Y b;  4GWR A;  6GSW A;  2XPD A;  2VCZ A;  4KX4 A;  3QPM A;  4X1U A;  3CSJ A;  5G5F A;  4RQX A;  3HYP A;  5B8B A;  4POK A;  1YKC A;  4V2M A;  4XRD A;  3Q19 A;  1O6J A;  1YZX A;  3MYD A;  4AJ7 A;  4WR4 A;  1CQG A;  2HSY A;  5IOX A;  1WIK A;  5IMC A;  2PUK C;  2F3M A;  1G7E A;  3F4T A;  4NHW A;  1SK2 A;  5J9C A;  2GT5 A;  1TJD A;  3C1S A;  3PR8 A;  2P0G A;  5ECK B;  4GTU A;  3RAZ A;  3L4N A;  5D9V A;  4ZIL A;  2H1A A;  1FW1 A;  1O73 A;  4NV2 A;  4IEL A;  5J4Y A;  5ECH B;  1SK0 A;  4TXO A;  1UC7 A;  1XWG A;  2C4J A;  2OE3 A;  4OMV A;  3CXG A;  3WGE A;  4HQZ A;  2PWJ A;  2IN3 A;  5D9X A;  1PA3 A;  3CSI A;  4KDU A;  2GDR A;  4O7H A;  3UOM A;  4L0U A;  4KF9 A;  1THX A;  3KH7 A;  4N0Z A;  1R7H A;  1AQV A;  1O81 A;  1FVJ A;  4X43 A;  2HNL A;  4FQU A;  1OC9 B;  8GSS A;  3VWX A;  3MNG A;  2H66 A;  2H76 A;  2H1D A;  4BPY A;  1GUH A;  3F8U A;  1TRV A;  1AQW A;  2YJH A;  4JE1 A;  3UBK A;  1WRY A;  4FO5 A;  4HI7 A;  1E6B A;  1J0F A;  1ZYP A;  4W66 A;  1BG1 A;  5HQP A;  2L5O A;  3FZA A;  1GUK A;  3FHK A;  2J9H A;  3ZL5 A;  4IS0 A;  1KTE A;  5JWO B;  3ZRD A;  3NZN A;  1GTU A;  2VM2 A;  2CQ9 A;  3ZVJ A;  1PD2 1;  5F8B A;  2YAN A;  4Q5N A;  4LA1 A;  4JZQ A;  3IHQ A;  4GXZ A;  2FGX A;  1F3B A;  4HUA A;  1TU7 A;  2HFD A;  1GUM A;  2RUF A;  1XW9 A;  3GKK A;  2DIZ A;  4ICY A;  1ON4 A;  1OKT A;  4TVE A;  2LKU A;  5JCW A;  5ECP B;  3SBC A;  3UIW A;  1X5D A;  1R5P A;  1U88 A;  1H4O A;  3DRN A;  1KNG A;  5L71 A;  1GSS A;  4X0X A;  3ED3 A;  1A8Y A;  1M9B A;  1DUG A;  5ABR A;  2ALB A;  2IPA A;  4JRR A;  2MMZ A;  4HQS A;  2PER A;  2C0D A;  1PL2 A;  3GH6 A;  2YNX A;  2NDO A;  1B8X A;  1G0T A;  5DVB A;  1CQH A;  4EVM A;  2MMN A;  1QUW A;  3TRX A;  2M80 A;  1WPI A;  2E2G A;  5DAL A;  5A4U A;  4ZIJ A;  5EY6 A;  2H75 A;  2M46 A;  2C0G A;  1SJZ A;  3H93 A;  4RI7 A;  2P31 A;  2C1Y A;  3IDV A;  4KSO A;  4WET A;  4V1A g;  2E0Q A;  1V40 A;  5FT3 A;  4K1F A;  5ECO B;  2F8A A;  4KDY A;  3LQ7 A;  4CW9 A;  3DVX A;  1DE1 A;  3HHV A;  1GSE A;  2LJA A;  4F82 A;  3IK9 A;  2I81 A;  5A34 A;  4CY8 A;  1JFU A;  4ECC A;  5G1K A;  4LL1 B;  3DEX A;  4BVY A;  2NPB A;  5AGY A;  4NPB A;  2WRT A;  3F4R A;  3ZFL A;  4A5P A;  2DJ1 A;  3CYN A;  2NTO A;  3QCP A;  4K9Z A;  1K3O A;  3DYR A;  1A2M A;  1QXH A;  2VL2 C;  2EFE A;  2RUE A;  3NIV A;  3CRT A;  1PQN A;  3GH9 A;  3KP8 A;  3GKX A;  2FWE A;  3CBU A;  3VI5 A;  1TXX A;  1TK5 B;  2V6K A;  2LNT A;  2FA8 A;  4HS1 A;  2YCD A;  4EDZ A;  4ECB A;  4AKH A;  3L9U A;  4YKG A;  5HFK A;  2VL9 A;  1T3B A;  3TKS C;  2WZ9 A;  5D9T A;  3GST A;  3DKS A;  3UMA A;  2C80 A;  3CTG A;  5D8I A;  1TU8 A;  2KHP A;  4MAB A;  4EUY A;  4GQC A;  3VWW A;  1VF3 A;  2H0I A;  1HYU A;  3IRA A;  4V2L A;  6GSX A;  3L0H A;  1WJK A;  1TXU A;  1ZMA A;  1JLV A;  5DCH A;  1G6Y A;  4IVF A;  1TKD B;  2CZ2 A;  4TR3 A;  2HSH A;  4PX1 A;  3EU4 A;  5GAP D;  3HDC A;  5H5Q A;  4QMK A;  1BYE A;  5CO3 A;  1OC9 A;  2XBQ A;  3J7Y k;  1PN9 A;  5D96 A;  4D73 A;  3IHG A;  5J40 A;  2LEG A;  4HU9 A;  3VPT A;  4RQR A;  1JZR A;  2A2S A;  4HZ2 A;  3RHB A;  2TRX A;  1Y25 A;  2JZR A;  2J23 A;  3RDW A;  1XWC A;  1Q98 A;  2FUG 2;  2Z9S A;  3TJJ A;  1MD3 A;  4WKW A;  4ECJ A;  2CV4 A;  4PQ1 A;  2LQO A;  4G0K A;  3MIX A;  1Z9H A;  4MF6 A;  4ZB8 A;  3O76 A;  3UBL A;  2PBJ A;  3HJO A;  4QQ7 A;  1FB6 A;  3MAK A;  2YN1 A;  3KEB A;  1U6T A;  2OBK A;  3ERG A;  4IP1 A;  5CNW A;  3TJG A;  2HSM B;  5LCZ A;  2V2G A;  3QR6 A;  2WFC A;  5FHI A;  9GSS A;  2R2J A;  1PMT A;  4EDY A;  4OWY A;  1Z3E A;  5DJM A;  4ZB9 A;  2DLX A;  1I9D A;  3NOF A;  2UV8 G;  5J41 A;  3IA1 A;  2RLI A;  2X64 A;  3CMI A;  4MJE A;  3PPU A;  1YEX A;  3KXO A;  2DJ0 A;  3U5R E;  2H1G A;  1T4Z A;  3ZIV A;  2HZF A;  2P5R A;  2F51 A;  5J4V A;  2L5L A;  5IPH A;  4AGS A;  2YWM A;  2FNO A;  4IJI A;  1GSD A;  1TOF A;  3GSS A;  1QK8 A;  4XS1 A;  2DSA A;  5E4W A;  1IYH A;  4BWS A;  1X0R A;  5AIS A;  4V1A p;  2P5Q A;  4Z2T A;  3L9V A;  3VK9 A;  4FH8 A;  2R0P A;  4K5S A;  1BG5 A;  5DAK A;  1TW9 A;  3HZ4 A;  2X8C A;  2YZH A;  1SU9 A;  2L57 A;  3A2V A;  3HXS A;  1B4P A;  2H19 A;  5AIV A;  2QC7 A;  3HD5 A;  3TJK A;  3I6A A;  2WB9 A;  4MZW A;  3HVX A;  1SKR B;  4YQM A;  1SK1 A;  1J08 A;  17GS A;  2VIM A;  1K0D A;  1S3C A;  3PGT A;  4E8E A;  3FEU A;  4P3Y B;  5IM9 A;  3M8N A;  2CVK A;  3UVT A;  2AYT A;  3ZIT A;  1K0O A;  2K18 A;  5KOW A;  1A24 A;  2IME A;  3ZLP A;  4PXO A;  2CZ3 A;  2XPE A;  1M7T A;  1PRX A;  3LXZ A;  4KSM A;  4OFN A;  2B3S A;  3TKP A;  3CTF A;  4OO4 A;  3FKF A;  5C04 A;  5ECM B;  3TDG A;  5IMF A;  2WCI A;  2H74 A;  3C1R A;  1XWK A;  1VGL A;  5F05 A;  3VWV A;  2AAW A;  1M2D A;  3W6G A;  2B5E A;  2ZCT A;  3UVH A;  4WBR D;  1Z6N A;  1RQM A;  4TKY A;  3PH9 A;  3G7Y A;  4OFT A;  3LGC A;  4F03 A;  2XBI A;  1C72 A;  3EPT A;  5CRE A;  4DEJ A;  4KUN A;  5JCU A;  4ZB6 A;  4Z2U A;  2K9F A;  5BMU B;  3KGK A;  4EKZ A;  3VLN A;  3ZIJ A;  1F3A A;  2IL3 A;  2YPM A;  4IW9 A;  4PNG A;  2QKE A;  2VO4 A;  5CP1 A;  1GNW A;  4N30 A;  1TI3 A;  1F2E A;  2MMO A;  3GN3 A;  1SL0 B;  2LS5 A;  1NHO A;  3KTB A;  4FYC A;  4E68 A;  1YEP A;  4GSS A;  3KIJ A;  2A2R A;  2GST A;  5DQS A;  4MMM A;  1VF2 A;  3EIN A;  13GS A;  5A1N A;  1X9W B;  3FYG A;  2HT9 A;  5IMD A;  3HVV A;  1S3D A;  2C3Q A;  3UAR A;  1M9A A;  1V2A A;  4FYU A;  2IIY A;  3M1G A;  2IMK A;  4JR4 A;  4MP4 A;  1T4Y A;  1X5E A;  2GZY A;  1FOV A;  3EE2 A;  5ECR B;  2AUV A;  3KCM A;  3DGQ A;  5EL8 A;  2V41 A;  1U3I A;  4POL A;  12GS A;  2KP2 A;  1GSF A;  1Y6E A;  1KEB A;  2GQL A;  3W8S A;  2HZE B;  2IWT A;  1ACV A;  1K0A A;  4O5Q A;  2TRC P;  3IE3 A;  1OAZ A;  1SD9 A;  4JU5 A;  4N0V A;  3F4S A;  4F0C A;  2FY6 A;  2FWH A;  4L8E A;  4CHS A;  3ME8 A;  1AXD A;  4PTS A;  3VPQ A;  2H6Y A;  3F63 A;  20GS A;  1TI1 A;  5JWR B;  3GA4 A;  2X8H A;  4K8M A;  3G7I A;  5A5H B;  2LUS A;  2GZP A;  2C8U A;  4H86 A;  2AJQ B;  2RM6 A;  1BJX A;  3D4M A;  4K0G A;  4ZBA A;  3TOU A;  1SJ6 A;  1ZYE A;  3A5I A;  5H5S A;  1JHB A;  3C8E A;  4GF0 A;  5G5E A;  1DSB A;  4WR5 A;  3AY8 A;  2R5G A;  2XHF A;  2FCH A;  4KAE A;  2VCQ A;  1GSY A;  1QFN A;  4EL1 A;  2N5F A;  4J57 E;  3UEM A;  3H4K A;  3APS A;  4EO3 A;  2VUP A;  2CAQ A;  4DSQ A;  4O32 A;  3L9S A;  3DD3 A;  3PIN A;  2MBT A;  2FWF A;  1EWX A;  2DJ2 A;  4TOP A;  4MF5 A;  3W8J A;  1WOU A;  1XPV A;  3EWL A;  3US3 A;  4MPF A;  4PQI A;  5EPF A;  3G9B A;  3EMX A;  3IAM 2;  1FVK A;  3KMN A;  1GSQ A;  3M0F A;  4MA9 A;  3ME7 A;  2WDU A;  1USB A;  1JZD A;  1G6W A;  1UVZ A;  2BMX A;  2GZZ A;  1O85 A;  1FO5 A;  1HQO A;  2BTO T;  4DSR A;  2ON7 A;  1K0B A;  3LYK A;  1HNB A;  3IPZ A;  1M0U A;  3FW2 A;  2V32 A;  1QMV A;  2HSN B;  1J9B A;  2GQK A;  1A0F A;  3QFA C;  4OCF A;  3ZYW A;  2K8S A;  4I5Q A;  2D2Z A;  1EV9 A;  4XIH A;  3CWG A;  4EF0 A;  2AHE A;  2VCV A;  3C7M A;  3IK7 A;  2JSY A;  3EC3 A;  2YP6 A;  3I69 A;  5KN3 A;  2L6D A;  1ERW A;  3M9K A;  2YWO A;  2R3X A;  1DE2 A;  3GL3 A;  4ML6 A;  4ISD A;  1A0R P;  2N5B A;  1FOH A;  1XOA A;  1PKW A;  2YZU A;  1ZYN A;  4PGT A;  3KP9 A;  4G0I A;  4ZL8 A;  4GDF A;  2N5A A;  5HR0 A;  3F3Q A;  4LL4 B;  1BAY A;  1SD8 A;  2HRK B;  3HJM A;  5JCG A;  1FB0 A;  3GHA A;  1Q4J A;  3HJP A;  3BD2 A;  4KH7 A;  2GSS A;  5J5N A;  1YF1 A;  2MYG A;  5D73 A;  5BMU A;  4K0N A;  3HZ8 A;  1XW6 A;  4GQF A;  2YV9 A;  3RHC A;  3P90 A;  2X99 A;  4EIP A;  1F9M A;  1UN2 A;  5IO2 A;  3GUS A;  3VWU A;  2A2P A;  3QMX A;  4IJ3 A;  4WEY A;  4MCU A;  1TK0 B;  2IMI A;  3E3E A;  4XS4 B;  2VAF A;  2H0G A;  5CRH A;  5J9B A;  2QSI A;  6GSS A;  3R3E A;  1JZO A;  1Y1U A;  5INY A;  4ZBD A;  2B1L A;  2I4A A;  1A2J A;  2CT6 A;  5KEJ A;  3F9U A;  3P2A A;  1T1V A;  3QAG A;  3D22 A;  4G19 A;  4MZB A;  4POB A;  5H5R A;  1ZGN A;  1GSU A;  4KDX A;  3EUR A;  2B5X A;  2C3T A;  5JWQ B;  1UA5 A;  1PL1 A;  1T00 A;  1MTC A;  4N11 A;  3VI7 A;  1S3A A;  1K0N A;  2L59 A;  4OFM A;  5CRD A;  2V1M A;  3P8W A;  3LEF A;  5KN1 A;  1Z7R A;  4KW6 A;  2IFQ B;  3A2W A;  2R6K A;  4AKG A;  5B7C A;  2HE3 A;  3RPP A;  5ECS A;  2HZE A;  4K6X A;  1ZL9 A;  3K8N A;  3A3T A;  1R4W A;  4HEA 2;  3IR4 A;  2LTK A;  2H6X A;  3H1N A;  5J3R A;  2GSQ A;  2UZ8 A;  1U3A A;  5CRG A;  3LWA A;  4BL7 B;  1WP0 A;  1BED A;  3F6F A;  2R0C A;  1MDI A;  5A5H A;  2OT3 A;  2HQT A;  1GUL A;  2R4V A;  2EIO A;  1EOH A;  4IKH A;  3GUR A;  1T7P B;  2OBI A;  3WT1 A;  4PUF C;  4GST A;  1B4Q A;  5B6M A;  1OE7 A;  4DSS B;  2L4Q A;  3EYT A;  3VFI A;  3E9J B;  5CYY A;  3JCM L;  3ZVJ D;  4MPG A;  3WYW A;  1Z6M A;  4K7N A;  3TKR A;  5ECI B;  2K6V A;  5G1L A;  4BVX B;  1GH2 A;  1ERT A;  4JED A;  3BCI A;  1PX6 A;  2VOC A;  3E0U A;  1OYJ A;  2V6O A;  1PN0 A;  4MNN A;  2EFD A;  1ILO A;  3F6D A;  1V57 A;  3BJ5 A;  3Q6O A;  3FR6 A;  2VD0 A;  3O3T A;  2QA1 A;  3DXB A;  5ELA A;  4L5L A;  3HKR A;  4WF5 A;  1EEM A;  2I3Y A;  4TRX A;  3D5J A;  1LBK A;  3ZRE A;  1ZYQ B;  4AF2 A;  1O7U A;  4G0L A;  1GWC A;  2H1B A;  3FY7 A;  4MK3 A;  3D6I A;  1GLQ A;  1MD4 A;  2MZC A;  2OAC A;  1JLW A;  2HSN A;  2WUL A;  3TB2 A;  1K3L A;  7GSS A;  3DIE A;  5A4W A;  4KCA A;  2H8L A;  1A2L A;  1F6M C;  3FK8 A;  4IHU A;  4IQ1 A;  4AI6 A;  4MJC A;  2PMT A;  4XS6 A;  3LG6 A;  3LSZ A;  1PX7 A;  1SKS B;  4ECI A;  3DWV A;  2AB6 A;  2H0H A;  4ID0 A;  4KGI A;  2GT6 A;  1QQ2 A;  3C71 A;  3GFK A;  5ECL B;  4ILF A;  1OC8 A;  4Z2R A;  4J56 E;  1VF1 A;  5DQY A;  5G2Z A;  3CRU A;  3BOA A;  2XC2 A;  3OR5 A;  4QL7 A;  3TKS E;  4XHM A;  4JR6 A;  1M99 A;  1SL2 B;  2R0G A;  4K2D A;  2O7K A;  1KBN A;  4KCE A;  3O6T A;  5FWG A;  1ML6 A;  2H01 A;  4IGJ A;  2VLU A;  3C73 A;  3D0Z A;  2H30 A;  5ECQ B;  5CRW A;  1B48 A;  2VCX A;  5E59 A;  5ENU A;  1V9W A;  2A4H A;  2GGT A;  2H6Z A;  4XS4 A;  1O8W A;  2X8G A;  2YOI A;  3QAW A;  4K7I A;  1GP1 A;  3WD6 A;  1EP7 A;  3RPN A;  2PU9 C;  4ML1 A;  4AKI A;  2GLR A;  2HYX A;  1TRS A;  1TRW A;  2I9H A;  2HRF A;  2B7K A;  1A8L A;  3APO A;  1W4V A;  1GNE A;  1SVO A;  1YKA A;  3KJY A;  2REM A;  4K5R A;  2LRT A;  4BWQ A;  4PUA A;  1NM3 A;  3Q74 A;  3TRQ A;  4HJ2 A;  4RUV A;  3I43 A;  4MJA A;  4AJ8 A;  2TIR A;  4G9H A;  5B8A A;  2M72 A;  4EXJ A;  2H72 A;  2IJY A;  1AQX A;  2F8F A;  3EMP A;  5IIZ A;  5KOX A;  4MZC A;  3KD0 A;  2DBC A;  4HDE A;  4GRF A;  4FYB A;  4NAX A;  4MLY A;  1EGR A;  5BRT A;  5GAN D;  2IFQ A;  1PGT A;  1RK4 A;  1XFL A;  1TRU A;  3WT2 A;  2E7P A;  2GQM A;  2C0F A;  5LNK e;  3UAP A;  2ES7 A;  5KN2 A;  3A5W A;  3KMO A;  3EVI A;  2H71 A;  1FG4 A;  5DCG A;  4AKX B;  1PSQ A;  4I2T A;  4K2X A;  4KND A;  1N8J A;  2DKH A;  1A23 A;  1B9X C;  4LLR A;  2NBS A;  4NXI A;  4MH3 A;  3KM6 A;  4BL7 A;  1OE8 A;  1X9M B;  1QGV A;  1WMJ A;  1YY7 A;  1AIU A;  2PPT A;  3S9F A;  2DC5 A;  5B6N A;  4WF4 A;  3BCK A;  4YAV A;  2F9S A;  2KOK A;  6GSU A;  3GX8 A;  2EIQ A;  3QD9 A;  4TR0 A;  5CAX A;  4WBJ A;  4IBP A;  3MWH A;  4DSS A;  2DIY A;  2VL3 A;  3QFB C;  3GTU B;  1K0M A;  5F0G A;  3IC4 A;  4HU7 A;  3HCZ A;  2LNS A;  4BVX A;  2HSM A;  2PVO C;  5GZZ B;  2VCW A;  2K8V A;  2YV7 A;  4CDO A;  4OCE A;  4YH2 A;  2IMD A;  3HA9 A;  2PN8 A;  5IMV A;  3LFL A;  3LOR A;  4MF7 A;  3FMW A;  1YDK A;  2LJK A;  5J4U A;  2G2Q A;  1ERU A;  2JSZ A;  2JZS A;  2OJL A;  16GS A;  5AN1 A;  1OKD A;  4TXV A;  4G01 A;  2AV4 A;  3KH9 A;  1SJI A;  1V58 A;  5LD0 A;  1K3Y A;  1K0C A;  4KE3 A;  2ON5 A;  4D73 B;  3LJR A;  4EC0 A;  3GIX A;  3A2X A;  4F0B A;  2JAC A;  4TR1 B;  1N2A A;  2EC4 A;  1EEJ A;  2VLV A;  1DBY A;  5DJL A;  1T8E B;  3ZZX A;  1Z5Y E;  1SKW B;  3R2Q A;  1GTI A;  4J2F A;  2B7J A;  2E2M A;  2KLX A;  5GST A;  4N10 A;  2GTU A;  2B5Y A;  1H75 A;  2KUC A;  1HD2 A;  1ST9 A;  5HFG A;  4X4J A;  1AW9 A;  5GSS A;  2JZT A;  2HXK A;  3LYP A;  2QGV A;  2H1L A;  3TJF A;  2OE1 A;  4LMV A;  1OC3 A;  3IAS 2;  3Q18 A;  3U6V A;  4JBB A;  4XRA A;  4L0W A;  5HR2 A;  2R37 A;  3RBT A;  1MDK A;  4GCI A;  4QL9 A;  3GNJ A;  1EP8 A;  2WS2 A;  2GVP A;  4ZXG A;  1EOG A;  4TR4 A;  3ZTL A;  3GRX A;  2CA8 A;  4EIQ A;  3LXT A;  2VM1 A;  5KN0 A;  1M2B A;  5IPG A;  18GS A;  11GS A;  1WE0 A;  4TN8 A;  3GX0 A;  2VLT A;  3I9V 2;  1MEK A;  5IMZ A;  5A5K A;  4FIW A;  4I2U A;  1TTZ A;  2WJU A;  3ZML A;  2B6M A;  3IXR A;  2VL2 A;  2MBS A;  4ZBB A;  1SVM A;  3HY2 A;  1URM A;  4G10 A;  3HVS A;  14GS A;  1YJ6 A;  5AIX A;  3KZQ A;  3FZ4 A;  1XXU A;  2LJR A;  4YQV A;  1M2A A;  2BJX A;  4XCS A;  1W89 A;  2FD3 A;  4LMW A;  5DAK B;  6GST A;  3G7J A;  3TJB A;  2LV3 A;  3GKN A;  22GS A;  2HI7 A;  4BA7 A;  4IP6 A;  2H70 A;  1VRS D;  3TKS A;  2H73 A;  6GSY A;  4NV5 A;  2B1K A;  2QA2 A;  19GS A;  1XCC A;  1U87 A;  3WGD A;  2YWN A;  3APQ A;  2MMA A;  3QDN A;  3BBY A;  4KB3 A;  1LU4 A;  1XW5 A;  3GV1 A;  3TCO A;  2FWG A;  4AJ6 A;  3GL5 A;  3MDK A;  10GS A;  4O5R A;  1AUC A;  5HR1 A;  3ISO A;  4RI6 A;  1FHE A;  1I5G A;  1ZZY A;  4E8H A;  4I97 A;  5G31 A;  1IYI A;  4YAP A;  4OD7 A;  1NHY A;  3N9J A;  4F2I A;  4MH2 A;  4DVC A;  5ID2 B;  5ECN B;  4GSN A;  2VKZ G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...