4MF5A

Crystal structure of glutathione transferase bgramdraft_1843 from burkholderia graminis, target efi-507289, with traces of one gsh bound
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
238
structure length
238
Chain Sequence
YFQSMTDLSAFPITKKWPAAHPERLQLYSLPTPNGVKVSIMLEETGLPYEPHLVRFDTNDQLTPEFMSLNPNNKIPAIIDPNGPDGKPLPLFESGAILIYLADKTGQLIPQDAAGRYEAIQWVMFQMGGIGPMFGQLGFFHKFAGKEYEDKRPRDRYVAESKRLLGVLEQRLEGREWILGDQYSIADIATFPWVRNLIGFYEAGELVAIQDFPNVQRALAAFVARPAVVRGLDSPKRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase domain
publication title Crystal structure of glutathione transferase BgramDRAFT_1843 from Burkholderia graminis, Target EFI-507289, with traces of one GSH bound
rcsb
source organism Burkholderia graminis
molecule tags Transferase
total genus 77
structure length 238
sequence length 238
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2013-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4mf5A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4mf5A01
2C0EA 2AHEA 1NW2A 3IK7A 2E0QA 1Y25A 3CXGA 4E8HA 3G7IA 1GUMA 4HI7A 3GHAA 4CHSA 3DMLA 5COHA 2H70A 4OWYA 4K2DA 1TK5B 3CRUA 2RUEA 3ME8A 1GWCA 2NPBA 5KN3A 4HZ4A 2YJ7A 3C1SA 5GSSA 4GWRA 1XW6A 2LNTA 1U88A 5G31A 2VO4A 3GYKA 1K3YA 1M9AA 1GP1A 1B4PA 2G2QA 2H30A 4NWYA 1YF1A 1X9MB 3GRXA 1EV4A 1R5AA 1V98A 3GSTA 4OD7A 2I3YA 1T4YA 4XS4B 4Z7XA 2H76A 4NV2A 2ON7A 3KZQA 2RIIA 3ZREA 3KEBA 2VCZA 2LNSA 3IR4A 1K0BA 4IQ1A 5A5KA 4HS1A 2VUPA 4KSOA 3O6TA 17GSA 4TR3A 1QMVA 3P90A 3ZTLA 2HSNB 2FGXA 4WETA 2I4AA 1XFLA 1SKSB 2GSQA 2DIZA 2YWIA 2F8FA 2YNXA 3F0IA 1GLPA 3KD0A 2J23A 4CW9A 1ON4A 4JEDA 1CQHA 2OADA 3IPZA 4YAPA 2OE3A 1F37A 2X8CA 4PX1A 5G30A 3LSZA 1OAZA 5C00A 4LL1B 2WS2A 4ISDA 1TJDA 4I8BA 4K7IA 4MPFA 3FHKA 2WZ9A 4HU7A 2H73A 3ZMKA 2RM5A 4TR0A 4TR4A 1HD2A 2HNLA 3EMXA 3ZLPA 3D21A 2H1GA 4WKWA 1JZWA 4ZL8A 3L4NA 2PUKC 3FZ4A 3RPNA 3UBLA 3DRNA 3WGEA 3RHCA 5ECOB 4YQVA 1G7OA 5FWGA 4DSRA 1ERTA 1MDKA 3IHQA 3CYNA 4K9ZA 6GSYA 4NAXA 5ABRA 4J56E 5IO0A 2AYTA 1H75A 1O8WA 2HLSA 4EC0A 1DE2A 2H71A 1OYJA 1GSFA 5A4WA 3IC4A 2I81A 4PUAA 1I9DA 4KH7A 1BYEA 1A2MA 1A0RP 2GQMA 1XIYA 5HFKA 5CNWA 3S9FA 3FR9A 4OMVA 2OA7A 1A23A 3Q19A 1O85A 3QOUA 1RK4A 4MJBA 1O6JA 1TK0B 2YWNA 4GSTA 2OACA 3F6DA 2K8VA 1M99A 2LUSA 4IGJA 2WB9A 1MD3A 3HKRA 1EEJA 4PTSA 3GKKA 3CRTA 1DBYA 1TU7A 2PGTA 4EDYA 2V32A 3ZFBA 4XS6A 2M72A 1URMA 4J57E 2REMA 4WF5A 1X9SB 1SL0B 2FY6A 1A2LA 5F0GA 1EOGA 1GRXA 3A2WA 1I5GA 2F8AA 2PPTA 1SK1A 2NVLA 4OFMA 4NV5A 2H0IA 4WXTA 1GSUA 2CVBA 2F9SA 3LYKA 1ST9A 3HVSA 2YZUA 4EL1A 3FRCA 2DJJA 3TJFA 3M0FA 4GXZA 4XCSA 1XWBA 4ZB6A 1WPIA 3LXTA 13GSA 2C3TA 3FW2A 2PU9C 1R5PA 2OBIA 6GSXA 4EO3A 1T1VA 2MZCA 3G9BA 5ECHB 3GKNA 4HQZA 1Z7PA 4ZBAA 3LWAA 2N5AA 4O92A 2I1UA 3GFKA 3RPPA 2C3NA 3F4TA 4MH2A 1AW9A 2C80A 5F05A 2CAQA 2QGVA 2NBSA 6GSVA 1UVZA 3W8JA 1ZYEA 2KOKA 3ZITA 1EV9A 1GSYA 3GX0A 1KEBA 2LRTA 3IA1A 1FO5A 3P8WA 5CRHA 3MDKA 5IQYA 1G6WA 1J08A 1GSSA 3UVHA 4HUAA 4G0LA 2PVOC 5ECPB 3LG6A 3ME7A 4XRDA 3UJ1A 5AIVA 5G2ZA 3VWWA 1XWCA 3APQA 4G9HA 3VFIA 3HJOA 18GSA 1GH2A 2ZUPA 2L4CA 2K8SA 3G7YA 4IKHA 1R7HA 2FLSA 2FWFA 2QKEA 3HYPA 1S3CA 1WMJA 3PINA 2UZ8A 3PPUA 4K7NA 4GTUA 3TKSE 2BJXA 3CSIA 3F8UA 3FK8A 4K0NA 1K3LA 2IMKA 2IL3A 3QFAC 3TB2A 4YAVA 4BVXA 2DJ0A 1GSQA 2ON5A 2RM6A 4MJEA 1K0MA 1F3AA 3A2XA 4PQHA 3VI5A 3LORA 3KXOA 2GT6A 2H0HA 1T8EB 5ELGA 3SBCA 1Z3EA 5HR0A 3N9JA 4ID0A 2WRTA 2IMDA 3EINA 1F9MA 4DSSA 5IO2A 2HYXA 2HI7A 5JCGA 5B6MA 3NZNA 1V40A 4GQFA 1HNCA 3FZ9A 1THXA 3ZIJA 3KMNA 1YEXA 1Z6MA 4TVEA 4QL9A 4QQ7A 1ERVA 5DAKB 3CTGA 1Q98A 4ZB9A 3F63A 2R4VA 1XXUA 2OBKA 1W4VA 2FUG2 4XHMA 1M2AA 5BMUA 2DBCA 5IPHA 2A2RA 2IMEA 1S3DA 2HSYA 2X8HA 3LXZA 1PN9A 2LS5A 3KIJA 3C73A 2YOIA 3EWLA 1USBA 2HZFA 4WEYA 1FB0A 3HVXA 3LYPA 3E3EA 1KBNA 3J7Yb 5E4WA 4O32A 3J7Yk 1PKWA 1EWXA 4MJCA 4FYUA 5HFGA 22GSA 4ZBBA 1PSQA 4OFNA 3H79A 4TN8A 1QXHA 3GUSA 1JZOA 2IWTA 4JE1A 1JZDA 3GX8A 3VWXA 3I6AA 4DSQA 3D4TA 1GTBA 4NHZA 1IYIA 1ZYQB 1GTAA 4MJAA 1U3IA 5CO3A 4HJMA 2H19A 3F3QA 3VWVA 3K8NA 1SK2A 1UC7A 4F2IA 2K9FA 2LQQA 2K6VA 1EP8A 1UA5A 4G10A 5HQPA 3QFBC 3QCPA 1BQ7A 1O8XA 1BJXA 2TRXA 3C8EA 12GSA 5ECSA 2EIRA 1TXXA 2JU5A 2GZYA 4ZL7A 4WF4A 3TKPA 5IMFA 1V9WA 3FZ5A 4JR6A 2DSAA 1GNEA 3LEFA 1S3AA 4TKYA 4K6XA 1TRSA 5B6NA 1TTZA 4MK3A 1F3BA 5ECRB 4ZILA 3F9UA 1OC3A 1MDIA 1K0AA 3HZ4A 3F3RA 4Q5NA 3H8QA 2JZRA 3F4RA 2P0GA 4KE3A 2RLIA 3RDWA 1OC9A 4CDOA 3L9VA 2V6OA 3QD9A 4KX4A 4D73B 5G1LA 1C72A 1FOVA 2AV4A 2FA8A 3TRXA 1QUWA 2P31A 4PNFA 4L5OA 2LSTA 2LEGA 1E6BA 4TXOB 3IE3A 3UOMA 3HA9A 4MZCA 1X5EA 5DVBA 3FR6A 2PN8A 1PX7A 4EE0A 1YEPA 2VLTA 3ZL5A 3FZAA 3TRPA 2P5RA 2EIOA 4NXIA 2CVKA 1VF3A 2HZEB 2GSRA 3MAKA 1VF2A 2GS3A 5HR2A 3IDVA 3QPMA 2AJQB 1YKAA 1HQOA 4HOJA 4FQUA 3BD2A 4RI7A 5HR3A 1XVQA 2I9HA 1NM3A 5AISA 3UIWA 5J4UA 2Z9SA 1YDKA 2H0GA 4ZL9A 3VWUA 3VPTA 2K18A 5IMCA 1ZCPA 3C71A 5DJMA 1SJIA 1ERUA 1HNBA 2XHFA 4F03A 2JZSA 4POKA 5JWQB 2OJLA 3EU4A 1MTCA 3TOUA 3ZVJD 4HQSA 1VF1A 2MMAA 5IMDA 2VD0A 4EDZA 3DKSA 1Z9HA 1MDJA 5LCZA 4EF0A 4POMA 5A4VA 4L5LA 2H01A 2ES7A 4GLTA 1M2BA 1O73A 3KM6A 3U5RE 1GLQA 2WJUA 3U6VA 1SL1B 1TRUA 4XRAA 4V1Ap 4NMUA 2HRFA 3GSSA 16GSA 3US3A 6GSTA 2QSIA 1FVJA 1UN2A 5EVOA 5J9BA 3GN3A 3TUEA 4I97A 4IVFA 1M9BA 2H1AA 1AC1A 2CX4A 4J2FA 1FVKA 3KH7A 4K8MA 2HQTA 5D9TA 4AJ6A 4I2TA 1RW1A 3GKXA 2HRKB 1XBSA 2YJHA 4KUNA 2KLXA 1ZMAA 1T00A 3F4SA 3CMIA 2VL9A 2H1BA 4ECCA 1Q4JA 1PMTA 5HR1A 2MMZA 4MF7A 1OVNA 1YQ1A 3NIVA 1A2JA 3O3TA 5B8BA 3IRAA 10GSA 1X0RA 2O8VB 3GIXA 4GCIA 1SD9A 2R37A 2WFCA 2PERA 2AB6A 3W8SA 3UAPA 2VCTA 1U3AA 6GSUA 1PRXA 1ERWA 2DJ2A 1AUCA 4PURA 4MZWA 4Q5FA 3DD3A 5IMVA 1HYUA 2GZPA 1YF0A 5H5QA 2IMIA 3L9UA 2C8UA 1JZRA 4KF9A 1KNGA 1TKDB 2VD1A 2B6MA 3FKFA 3GL5A 2VL2A 1TRVA 5DCGA 4OCFA 2VCQA 2LJRA 2JACA 2IFQA 1PL2A 4BVYB 4NPBA 4OO5A 14GSA 3RBTA 3BJ5A 2LRNA 4WR4A 3RHBA 1A0FA 5IPGA 4IELA 1GTIA 5D73A 4G0IA 4BWSA 2FWEA 2O89A 3EURA 2OKAA 1JLVA 4PQ1A 1E2YA 2IPAA 4BPYA 2MYGA 5H5RA 1FG4A 3ZIVA 1GL8A 1B48A 3ZVJA 3FYGA 1M7TA 5DALB 4ECIA 2MBTA 3H4KA 2N5FA 2JSZA 1WIKA 2V6KA 1TI1A 2YWMA 1U87A 4KA0A 5B7CA 4RQXA 3ERGA 4I6XA 3HCZA 2DJKA 4G2EA 5KN2A 4TXOA 4OCEA 5ELAA 1T7PB 1R4WA 2YANA 4MP4A 2OE1A 2H8LA 4XS4A 4F0BA 5IM9A 2M46A 3G7JA 2V41A 2HE3A 1XZOA 1VF4A 2JADA 1NHYA 4X1UA 2IMFA 4N10A 5JWOB 4H86A 2HZEA 3IOSA 4KNDA 4V2NA 5G5EA 1XOBA 3LJRA 2FNOA 4IHUA 1LJRA 5KEJA 4OFTA 4MF6A 4N0VA 2CAIA 4MABA 2DIYA 2AAWA 2C0GA 2C1YA 1ILOA 4GSSA 3DEXA 2CV4A 3KGKA 4MCUA 1YJ6A 4AJ8A 2ZNMA 4RI6A 1JHBA 1G7EA 3TKSA 1WOUA 1SKRB 4XS1A 1OKTA 1PL1A 5J5NA 2VL3A 1K0OA 3ERFA 5JWRB 4MDCA 3P2AA 3D22A 5DBQA 2P5QA 3LGCA 3O76A 2F51A 3LFLA 1KTEA 1MD4A 3HY2A 2X99A 3KTBA 3ZYWA 4F0CA 2L59A 1PGTA 5ECMB 1FW1A 5GAPD 2CZ3A 3M9JA 2XBIA 3ERWA 3DGQA 1OKDA 4GRFA 2GVPA 4TR1B 1PA3A 3M1GA 2BMXA 2L6DA 3LQ7A 4DEJA 4ULXA 4RUVA 4TXVA 4L0UA 19GSA 3A5WA 5KN1A 2FWHA 3BOAA 3UARA 1B4QA 1AAZA 2EC4A 3HDCA 4HDEA 1SL2B 4KDUA 4LLRA 3EE2A 4EKZA 1EOHA 3D0ZA 5ECQB 4LMWA 2CQ9A 4G19A 2B1LA 1LBKA 4V2LA 3HD5A 3FY7A 2L4QA 5DCHA 3IC8A 1K0CA 2KP2A 6GSSA 3DYRA 3CBUA 2OE0A 3RAZA 3UBKA 3ZFLA 5JCUA 4XIHA 5D96A 5J3RA 3GTUB 2E2MA 3APOA 2VCWA 1XVWA 3QAVA 5DQSA 2B5EA 4FIWA 3H1NA 4DVCA 1Y6EA 7GSSA 3KMOA 2RUFA 1PD21 1OE7A 5KN0A 5ECIB 1ZOFA 1SJZA 3L9SA 2ALBA 4GF0A 4BL7B 1TDIA 9GSSA 2TIRA 1EEMA 2MMOA 2AUVA 4ZXGA 2CX3A 2GSSA 1WP0A 3MWHA 5LD0A 3E9JB 4QL7A 2VOCA 4O5RA 4WR5A 2FWGA 3GA4A 2IIYA 1QGVA 2H6XA 2H75A 2KP1A 4E8EA 1U6TA 3GNJA 4BVYA 3KTLA 1R26A 3DWVA 2R5GA 2LQOA 4MA9A 2WCIA 2DMLA 2YWOA 1A24A 2B1KA 5AIXA 4PGTA 1J9BA 1QK8A 4IJIA 1XW5A 2NDOA 1GUHA 4IS0A 4IP6A 3QR6A 3PH9A 1WWJA 3ZRDA 2TRCP 3R2QA 3L78A 4AGSA 1V2AA 1T3BA 5LNKe 3MSZA 1Z5YE 3GH6A 1EZKA 1N2AA 3IK9A 5H5SA 2G0FA 2GDRA 3QAWA 1FHEA 5DALA 2LV3A 4PNGA 5CP1A 2DJ1A 4IBPA 4JU5A 3ZZXA 2HFDA 2YCDA 3TJKA 3DVWA 4KSMA 3WT1A 1V57A 3HVVA 3UVTA 2KHPA 5INYA 2PBJA 1YZXA 1W89A 2H66A 2LJKA 2FCHA 5JCWA 1ACVA 4YQUA 4I2UA 1F6MC 2F3MA 3GL3A 3TJGA 2C3QA 3UMAA 1AQVA 5CYYA 2MBSA 3GH9A 1O7UA 3HZ8A 4X0XA 1TOFA 5F07A 1BG5A 2E2GA 3DXBA 1X5DA 4AF2A 4HEA2 2WDUA 2B7KA 2XPEA 4BA7A 3A2VA 3ISOA 3OR5A 2JZTA 1Z6NA 1JLWA 5F06A 2HT9A 5DQYA 2B5YA 4IW9A 1JFUA 3E0UA 2DC5A 2L6CA 2H6YA 5EY6A 4EXJA 5GZZB 4MH3A 3QDNA 4ZBDA 4K1FA 1AIUA 3CSJA 4USSA 4ML1A 5ENUA 1TI3A 3D5JA 1M0UA 2VLUA 1SYXA 3EVIA 5E59A 2VCXA 4BVXB 2JSYA 5F8BA 4POBA 5IOXA 4L0WA 3HJPA 4KAEA 1SK0A 4GQCA 5J41A 2H74A 3HHVA 2XC2A 1A8LA 1DUGA 2J9HA 2B3SA 1ML6A 2GZZA 4K7OA 4ML6A 2DJ3A 2YN1A 1TU8A 1WRYA 3BBYA 1EGOA 2VM1A 4DSSB 1F2EA 1ABAA 2YZHA 5DAKA 3ZMLA 3IXRA 1XOAA 1GUKA 3ED3A 1HNAA 2NTOA 4TR1A 2FA4A 2CVDA 3Q18A 5FHIA 3QAGA 3Q74A 4PQIA 5GAND 5GSTA 1SU9A 5DDLA 1AQWA 2O87A 3FR3A 4KGIA 2FHEA 4TW5A 3EC3A 3BCKA 3APSA 2N5BA 4OO4A 3TOTA 5D93A 4YQMA 1A8YA 4TRXA 2V1MA 2LJAA 5D8IA 3TJBA 1QQ2A 1TRWA 1B8XA 1EP7A 2B5XA 3EYTA 4WBRD 3GTUA 2R3XA 4PUFC 1VGLA 4KCEA 1GNWA 2DMMA 3W6GA 3TJJA 1N8JA 2O7KA 3PGTA 5ID2B 4MPGA 2HXKA 1ZZYA 3A3TA 4N30A 1B9YC 5EPFA 8GSSA 1SYRA 3PR8A 1M2DA 2A2SA 2VCVA 4F82A 4BL7A 4KW6A 2GLRA 6GSWA 4X43A 3KP9A 2LTKA 2HSMB 3GURA 1GSEA 1TK8B 4V2MA 1QFNA 4ECBA 3HJMA 1GTUA 5HFIA 1XWAA 2D2ZA 4HJ2A 3IBHA 4G0KA 2L57A 2H72A 4LMVA 1O81A 3EMPA 3KCMA 4KDYA 5D9XA 1WE0A 2M80A 3QMXA 2L5OA 5A4UA 2GTUA 1GSDA 4IQAA 2R2JA 3N5OA 2HSHA 3TDGA 3UL3A 1SJ6A 4N11A 4MLYA 3H93A 1YKCA 4GSNA 2YP6A 2PMTA 1SENA 3WGDA 2GQLA 2BTOT 4D73A 2C0FA 4XTSA 1Z7RA 4NHWA 2VAFA 2VL2C 4RQRA 1K0DA 2B7JA 2GQKA 5CREA 3VK9A 1OC9B 4O7HA 2L5LA 1XCCA 1BAYA 3TCOA 1FAAA 2PWJA 5EL8A 2A4VA 2GGTA 3JCML 5J9CA 3IV4A 4MMMA 1ZL9A 4FYBA 3C1RA 2FD3A 4K0GA 4FO5A 1XWGA 1XW9A 3MNGA 4ECJA 5G5FA 4JZQA 3VPQA 1B9XC 1FB6A 4FH8A 4I5QA 5ECLB 2MMNA 3DVXA 3FEUA 2X8GA 1XPVA 2EIQA 3IAS2 3WYWA 2LRCA 3GV1A 3VLNA 4P3YB 4FYCA 3BCIA 4ZB8A 3D6IA 4EVMA 4HZ2A 20GSA 1IYHA 3KP8A 5DJLA 2WGRA 5AN1A 2YV7A 4Q5QA 3GKMA 3HXSA 3WT2A 3TKRA 4ACSA 2V2GA 3EU3A 2YV9A 1SD8A 4LL4B 2KUCA 1LU4A 3TRQA 2LKUA 5D9VA 4HU9A 1PQNA 4V1Ag 4BWQA 4JR4A 3C7MA 5B8AA 4ILFA 3M9KA 4L8EA 4KCAA 2HRAA 4JBBA 3I43A 4TOPA 3P7XA 1TP9A 1G6YA 1CQGA 3CTFA 3TKQA 1DSBA 1H4OA 2X64A 1WJKA 3DIEA 4KDXA 4KB3A 3IAM2 4Q5RA 2O85A 2VIMA 1GULA 2CZ2A 2QC7A 1OE8A 2DLXA 1G0TA 5CRWA 3NOFA 2WULA 3V1WA 3SWLA 11GSA 4POLA 3TKSC 1EGRA 2HRKA 5FT3A 1TW9A 1X9WB 3M3MA 4ZIJA 2C0DA 3VI7A 4LA1A 5CRDA 3I69A 1T4ZA 4IJ3A 1RQMA 1BX9A 5AGYA 2CT6A 4WBJA 5ECKB 5IMZA 4IN0A 2C4JA 3L0HA 3D4MA 5CAXA 5G1KA 1OC8A 1ZGNA 4N0ZA 1AXDA 1VRSD 4IP1A 1YY7A 1NHOA 4EUYA 5ID2A 2JL4A 2VLVA 3CSHA 3WD6A 5C04A 1BEDA 1THOA 5IOWA 4PXOA 3AY8A 2GT5A 1X5CA 3KJYA 4F9ZA 3R3EA 3GMFA 2YPMA 2H6ZA 2GSTA 2PVQA 3I9V2 2ZCTA 4YH2A 2IJYA 1K0NA 1V58A 2HSMA 3M8NA 1AQXA 5ECNB 1PX6A 3WGXA 2XPDA 3UEMA 5IIZA 2IN3A 2XBQA 3Q6OA 5CRGA 5L71A 2R6KA 2H1DA 2HRNA 4AJ7A 2VM2A 2IFQB 3VURA 4MZBA 3TGZA 1XWKA 3F6FA 5IMAA 1SKWB 4MF5A 1MEKA 1PKZA 3KH9A 2E7PA 1J0FA 4JRRA 1DE1A 1NSWA 5D9WA 1K3OA 2CA8A
chains in the Genus database with same CATH superfamily
2C0EA 2AHEA 1NW2A 3IK7A 2E0QA 1Y25A 2X4AA 1S3RA 3CXGA 3CQFA 4E8HA 3G7IA 1GUMA 4HI7A 3GHAA 4CHSA 3DMLA 5COHA 2H70A 4OWYA 4K2DA 1TK5B 3CRUA 2O5VA 2RUEA 3ME8A 1GWCA 2NPBA 5KN3A 4HZ4A 2YJ7A 3C1SA 5GSSA 4GWRA 1XW6A 2LNTA 1U88A 4PHZC 5G31A 2VO4A 3GYKA 1K3YA 1M9AA 1GP1A 1B4PA 2G2QA 2H30A 4NWYA 1YF1A 1X9MB 3GRXA 1EV4A 1R5AA 1V98A 3GSTA 4OD7A 2I3YA 1T4YA 4XS4B 4Z7XA 2H76A 4NV2A 2ON7A 3KZQA 2RIIA 3ZREA 3KEBA 3MIXA 2VCZA 2LNSA 3IR4A 1K0BA 1N25A 4IQ1A 5A5KA 4HS1A 2VUPA 4KSOA 3O6TA 17GSA 4TR3A 1QMVA 3P90A 3ZTLA 2HSNB 2FGXA 4WETA 2I4AA 1XFLA 1SKSB 2GSQA 2DIZA 2YWIA 2F8FA 2YNXA 3F0IA 1GLPA 3KD0A 4PI2C 2J23A 4CW9A 4QMKA 1ON4A 4JEDA 1CQHA 2OADA 3IPZA 4YAPA 2OE3A 1F37A 2X8CA 4PX1A 5G30A 3LSZA 1OAZA 5C00A 4LL1B 2WS2A 4ISDA 1TJDA 3CWGA 4I8BA 4K7IA 4MPFA 3FHKA 2WZ9A 4HU7A 2H73A 3ZMKA 2RM5A 4A5PA 4TR0A 4TR4A 1HD2A 2HNLA 3EMXA 3ZLPA 3D21A 2H1GA 4WKWA 1JZWA 4ZL8A 3L4NA 2PUKC 3FZ4A 3RPNA 3UBLA 5KOXA 3DRNA 3WGEA 3RHCA 5ECOB 4YQVA 1G7OA 5FWGA 4DSRA 1ERTA 1MDKA 3IHQA 3CYNA 4K9ZA 5KOWA 6GSYA 4NAXA 5ABRA 4J56E 3MYDA 5IO0A 2AYTA 1H75A 1O8WA 2HLSA 4EC0A 1DE2A 2H71A 1OYJA 1GSFA 4Z2RA 5A34A 1ZYNA 5A4WA 3IC4A 2I81A 4PUAA 1I9DA 4KH7A 1BYEA 4FXYP 1A2MA 1A0RP 2EFCA 2GQMA 1XIYA 5HFKA 5CNWA 3S9FA 3FR9A 4OMVA 2OA7A 1A23A 3Q19A 1O85A 3QOUA 1RK4A 4MJBA 1O6JA 1TK0B 2YWNA 4GSTA 2OACA 3F6DA 2K8VA 1M99A 2LUSA 4IGJA 2WB9A 4N3ZA 1MD3A 3HKRA 1EEJA 4PTSA 3GKKA 3CRTA 1DBYA 4K2XA 1TU7A 2PGTA 4EDYA 2V32A 4AI6A 3ZFBA 4XS6A 2M72A 1URMA 4J57E 1M3JA 2REMA 4WF5A 1X9SB 1SL0B 2FY6A 1A2LA 5F0GA 1EOGA 1GRXA 3A2WA 1I5GA 2F8AA 2PPTA 1SK1A 2NVLA 4OFMA 3HVNA 4NV5A 2H0IA 4WXTA 1GSUA 2CVBA 2F9SA 3LYKA 1ST9A 3HVSA 2YZUA 4EL1A 3FRCA 2DJJA 3TJFA 3M0FA 4GXZA 4XCSA 1XWBA 4ZB6A 1WPIA 3LXTA 13GSA 2C3TA 3FW2A 2PU9C 1R5PA 2OBIA 6GSXA 4EO3A 1T1VA 2MZCA 3G9BA 5ECHB 3GKNA 4HQZA 1Z7PA 4ZBAA 3LWAA 2N5AA 4O92A 2I1UA 3GFKA 3RPPA 2C3NA 3F4TA 4MH2A 1AW9A 2C80A 5F05A 2CAQA 2QGVA 2NBSA 6GSVA 1UVZA 3LW9A 3W8JA 1ZYEA 2KOKA 3RFRC 3ZITA 4Z2TA 1EV9A 2WW0A 4YKGA 1GSYA 3GX0A 1KEBA 2LRTA 3IA1A 1FO5A 3P8WA 5CRHA 3MDKA 5IQYA 1G6WA 1J08A 1GSSA 3UVHA 4HUAA 4G0LA 2PVOC 5ECPB 3LG6A 3ME7A 4XRDA 3UJ1A 5AIVA 5G2ZA 3VWWA 5J47A 1XWCA 3APQA 4G9HA 3VFIA 3HJOA 18GSA 1GH2A 2ZUPA 2L4CA 2K8SA 3G7YA 4IKHA 1R7HA 2FLSA 2FWFA 2QKEA 3HYPA 1S3CA 1WMJA 3PINA 2UZ8A 3PPUA 4K7NA 4GTUA 3TKSE 3FMWA 2BJXA 3CSIA 3F8UA 3FK8A 4K0NA 1K3LA 1YEWC 2IMKA 2IL3A 3QFAC 3TB2A 4YAVA 2HSNA 4BVXA 3RGBC 2DJ0A 1GSQA 5BRTA 2ON5A 2RM6A 4MJEA 1K0MA 1F3AA 3A2XA 4PQHA 3VI5A 3LORA 3KXOA 2GT6A 2H0HA 1T8EB 4ZB7A 5ELGA 3SBCA 1Z3EA 5HR0A 3N9JA 4ID0A 2A4HA 2WRTA 2IMDA 3EINA 1F9MA 4DSSA 5IO2A 2HYXA 2HI7A 5JCGA 5B6MA 3NZNA 1V40A 4GQFA 1HNCA 3FZ9A 4BIKA 1THXA 3ZIJA 3KMNA 1YEXA 1Z6MA 4TVEA 4QL9A 4QQ7A 1ERVA 5DAKB 3CTGA 1Q98A 4ZB9A 3F63A 2R4VA 1XXUA 2OBKA 2R0PA 1W4VA 2FUG2 4XHMA 1M2AA 5BMUA 2DBCA 5IPHA 2A2RA 2IMEA 1S3DA 2HSYA 2X8HA 3LXZA 1PN9A 2LS5A 3KIJA 3C73A 4ICYA 2YOIA 3EWLA 1USBA 2HZFA 4WEYA 1FB0A 3HVXA 3LYPA 3E3EA 1KBNA 3J7Yb 5E4WA 4O32A 3J7Yk 1PKWA 1EWXA 4MJCA 4FYUA 5HFGA 22GSA 4ZBBA 1PSQA 4OFNA 3H79A 4TN8A 1QXHA 3GUSA 1JZOA 2IWTA 4JE1A 1JZDA 3GX8A 1FOHA 3VWXA 3I6AA 4DSQA 3D4TA 1GTBA 4NHZA 1IYIA 1ZYQB 1GTAA 4MJAA 1U3IA 5CO3A 4HJMA 2H19A 3F3QA 3VWVA 3K8NA 1SK2A 1UC7A 4F2IA 2K9FA 2WW3A 2LQQA 2K6VA 1EP8A 1UA5A 4G10A 5HQPA 3QFBC 3QCPA 1BQ7A 1O8XA 1BF5A 1BJXA 2TRXA 3C8EA 12GSA 5ECSA 2EIRA 1TXXA 2JU5A 2GZYA 4ZL7A 4WF4A 3TKPA 5IMFA 1V9WA 3FZ5A 4JR6A 2DSAA 1GNEA 3LEFA 1S3AA 4TKYA 4K6XA 1TRSA 5B6NA 1TTZA 4MK3A 1F3BA 5ECRB 4ZILA 3F9UA 4HSCX 1OC3A 1MDIA 1K0AA 3HZ4A 3F3RA 4Q5NA 3H8QA 2JZRA 3F4RA 1YVLA 2P0GA 4AKIA 2A2PA 1SVMA 4KE3A 2RLIA 3RDWA 1OC9A 4CDOA 3L9VA 2V6OA 3QD9A 4KX4A 4D73B 5G1LA 1C72A 1FOVA 2AV4A 2FA8A 3TRXA 1QUWA 2P31A 4PNFA 4L5OA 2LSTA 2LEGA 1E6BA 4TXOB 3IE3A 3UOMA 3HA9A 4MZCA 1X5EA 5DVBA 3FR6A 2PN8A 1PX7A 4EE0A 1YEPA 5A5HB 2VLTA 3ZL5A 3FZAA 3TRPA 2P5RA 2EIOA 4AKXB 4NXIA 2CVKA 1VF3A 2HZEB 2WVXB 2GSRA 3MAKA 1VF2A 2GS3A 5HR2A 3IDVA 3QPMA 4MNNA 2AJQB 2WW1A 1YKAA 1HQOA 4HOJA 4FQUA 3BD2A 4RI7A 5HR3A 1XVQA 2I9HA 1NM3A 5AISA 3UIWA 5J4UA 2Z9SA 1YDKA 2H0GA 4ZL9A 3VWUA 3VPTA 2K18A 5IMCA 1ZCPA 3C71A 5DJMA 1SJIA 1ERUA 1HNBA 2XHFA 4F03A 2JZSA 4POKA 5JWQB 2OJLA 3EU4A 1MTCA 3TOUA 3ZVJD 4HQSA 2QA1A 1VF1A 2MMAA 5IMDA 2VD0A 4EDZA 3DKSA 1Z9HA 1MDJA 5LCZA 4EF0A 4POMA 5A4VA 4L5LA 2H01A 2ES7A 4GLTA 1M2BA 1O73A 3KM6A 3U5RE 1GLQA 2WJUA 3U6VA 1SL1B 1TRUA 4XRAA 4V1Ap 4EIQA 4NMUA 2HRFA 3GSSA 16GSA 3US3A 6GSTA 2QSIA 1FVJA 1UN2A 4O5UA 5J4VA 5EVOA 5J9BA 3GN3A 3TUEA 4I97A 4IVFA 1M9BA 2H1AA 1AC1A 2CX4A 4J2FA 1FVKA 3KH7A 4K8MA 2HQTA 5D9TA 4AJ6A 4I2TA 1RW1A 3GKXA 2WVYA 2HRKB 1XBSA 2YJHA 4KUNA 2KLXA 1ZMAA 1T00A 3F4SA 3CMIA 2VL9A 3HMJG 2H1BA 4ECCA 1Q4JA 4O5QA 1PMTA 5HR1A 2MMZA 4MF7A 1OVNA 1YQ1A 3NIVA 1A2JA 3O3TA 5B8BA 3IRAA 10GSA 1X0RA 2O8VB 3GIXA 4GCIA 1SD9A 2R37A 2WFCA 2PERA 2AB6A 3W8SA 3UAPA 2VCTA 1U3AA 6GSUA 1PRXA 1ERWA 2DJ2A 1AUCA 4PURA 4MZWA 4Q5FA 3DD3A 5IMVA 1HYUA 2GZPA 1YF0A 5H5QA 3TU3B 2IMIA 3L9UA 2C8UA 1JZRA 4KF9A 1KNGA 1TKDB 2VD1A 2B6MA 3FKFA 3GL5A 2VL2A 1TRVA 5DCGA 4OCFA 2VCQA 2LJRA 2JACA 2IFQA 1PL2A 4BVYB 4NPBA 4OO5A 14GSA 3RBTA 3A5IA 3BJ5A 4EIPA 2LRNA 4WR4A 3RHBA 1A0FA 5IPGA 4IELA 1GTIA 5D73A 3EPTA 4G0IA 4BWSA 2FWEA 2O89A 3EURA 2OKAA 1JLVA 4PQ1A 1E2YA 2IPAA 4BPYA 2MYGA 5H5RA 1FG4A 3ZIVA 1GL8A 1B48A 3ZVJA 3FYGA 1M7TA 5DALB 2OT3A 4ECIA 2MBTA 3H4KA 2N5FA 2JSZA 1WIKA 2V6KA 1TI1A 2YWMA 1U87A 4KA0A 5B7CA 4RQXA 3ERGA 4I6XA 3HCZA 2DJKA 4G2EA 5KN2A 4TXOA 4OCEA 5ELAA 1T7PB 1R4WA 2YANA 4MP4A 2OE1A 2H8LA 4XS4A 4F0BA 5IM9A 2M46A 3G7JA 2V41A 2HE3A 1XZOA 1VF4A 2JADA 1NHYA 4X1UA 2IMFA 4N10A 5JWOB 4H86A 2R0CA 2HZEA 2WVXA 3IOSA 4KNDA 4V2NA 5G5EA 1XOBA 3LJRA 2FNOA 4IHUA 1LJRA 5KEJA 4OFTA 4MF6A 4N0VA 2CAIA 4MABA 2DIYA 2AAWA 2C0GA 2C1YA 1ILOA 4GSSA 3DEXA 2CV4A 3KGKA 4MCUA 1YJ6A 4AJ8A 4Z2UA 2ZNMA 4RI6A 1JHBA 1G7EA 3TKSA 1WOUA 1SKRB 4XS1A 1OKTA 1PL1A 5J5NA 2VL3A 1K0OA 3ERFA 5JWRB 2O3EA 4MDCA 3P2AA 3D22A 5DBQA 2P5QA 3LGCA 3O76A 2F51A 3LFLA 1KTEA 1MD4A 3HY2A 2X99A 3KTBA 3ZYWA 4F0CA 2L59A 1PGTA 5ECMB 1FW1A 5GAPD 2CZ3A 3M9JA 2XBIA 1SVOA 3ERWA 3DGQA 1OKDA 4GRFA 2GVPA 4TR1B 1PA3A 3M1GA 2BMXA 4K5SA 2L6DA 3LQ7A 4DEJA 4ULXA 1PN0A 4RUVA 4TXVA 4L0UA 19GSA 3A5WA 5KN1A 2FWHA 3BOAA 3UARA 1B4QA 1AAZA 2EC4A 3HDCA 4HDEA 1SL2B 4KDUA 4LLRA 3EE2A 4EKZA 1EOHA 3D0ZA 5ECQB 4LMWA 2CQ9A 4G19A 2B1LA 1LBKA 4V2LA 3HD5A 3FY7A 2L4QA 5DCHA 3IC8A 1K0CA 2KP2A 6GSSA 5A34B 3DYRA 3CBUA 2OE0A 3RAZA 3UBKA 2X49A 3ZFLA 5JCUA 4XIHA 5D96A 5J3RA 3GTUB 2E2MA 3APOA 2VCWA 2EFHA 1XVWA 3QAVA 5DQSA 2B5EA 4FIWA 3H1NA 2WW2A 4DVCA 1Y6EA 7GSSA 3KMOA 2RUFA 1PD21 1OE7A 5KN0A 5ECIB 1ZOFA 1SJZA 3L9SA 2ALBA 4GF0A 4BL7B 1TDIA 9GSSA 2TIRA 1EEMA 2MMOA 2AUVA 4ZXGA 2CX3A 2GSSA 1WP0A 3MWHA 5LD0A 3E9JB 4QL7A 2QA2A 2VOCA 4O5RA 4WR5A 2FWGA 3GA4A 2IIYA 1QGVA 2H6XA 5A1NB 2H75A 2KP1A 4E8EA 1U6TA 3GNJA 4BVYA 3KTLA 1R26A 4X4JA 3DWVA 2R5GA 2LQOA 4MA9A 2WCIA 2DMLA 2YWOA 1A24A 2B1KA 1I1IP 5AIXA 4PGTA 1J9BA 1QK8A 4IJIA 1XW5A 2NDOA 1GUHA 4GDFA 4IS0A 1M3IA 4IP6A 3QR6A 3PH9A 1WWJA 3ZRDA 2TRCP 3R2QA 3L78A 4AGSA 1V2AA 1T3BA 5LNKe 3MSZA 1Z5YE 3GH6A 1EZKA 1N2AA 4PI0C 3IK9A 5H5SA 2G0FA 2GDRA 3QAWA 1FHEA 5DALA 2LV3A 4PNGA 5CP1A 2DJ1A 4IBPA 4JU5A 3ZZXA 2HFDA 2YCDA 3TJKA 3DVWA 4KSMA 3WT1A 1V57A 3HVVA 3UVTA 2KHPA 5INYA 2PBJA 1YZXA 2R0GA 1W89A 2H66A 2LJKA 2FCHA 5JCWA 1ACVA 4YQUA 4I2UA 1F6MC 2F3MA 3GL3A 3TJGA 2C3QA 3UMAA 1AQVA 1ZYPA 5CYYA 2MBSA 3GH9A 1O7UA 3HZ8A 4X0XA 1TOFA 5F07A 1BG5A 2E2GA 3DXBA 1X5DA 4AF2A 4HEA2 2WDUA 2B7KA 2XPEA 4BA7A 3A2VA 3ISOA 3OR5A 2JZTA 1Z6NA 1JLWA 5F06A 2HT9A 5DQYA 2B5YA 4IW9A 1JFUA 3E0UA 2DC5A 2L6CA 2H6YA 5EY6A 4EXJA 5GZZB 4MH3A 3QDNA 4W66A 4ZBDA 4K1FA 1AIUA 3CSJA 4USSA 4ML1A 5ENUA 1TI3A 1Y1UA 3D5JA 1M0UA 2VLUA 1SYXA 3EVIA 5E59A 2VCXA 4BVXB 2JSYA 5F8BA 4POBA 5IOXA 4L0WA 3HJPA 4KAEA 1SK0A 4GQCA 1PFOA 5J41A 2H74A 3HHVA 2XC2A 1A8LA 2WVZA 1DUGA 2J9HA 2B3SA 1ML6A 2GZZA 4K7OA 4ML6A 2DJ3A 2YN1A 1TU8A 1WRYA 3BBYA 1EGOA 2VM1A 4DSSB 1F2EA 5J4YA 1ABAA 2YZHA 4CY6A 5DAKA 3ZMLA 4K5RA 3IXRA 1XOAA 1GUKA 3ED3A 1HNAA 2NTOA 4TR1A 2FA4A 2CVDA 3Q18A 5FHIA 3QAGA 3Q74A 4PQIA 5GAND 5GSTA 5BMUB 1SU9A 2UV8G 5DDLA 1AQWA 2O87A 3FR3A 4KGIA 2FHEA 4TW5A 3EC3A 3BCKA 2EFDA 3APSA 2N5BA 4OO4A 3TOTA 5D93A 4YQMA 1A8YA 4TRXA 2V1MA 2LJAA 5D8IA 3TJBA 1QQ2A 1TRWA 1B8XA 1EP7A 2B5XA 3EYTA 4WBRD 3GTUA 2R3XA 4PUFC 1VGLA 4KCEA 1GNWA 2DMMA 3W6GA 1BG1A 3TJJA 1N8JA 2O7KA 3PGTA 5ID2B 4MPGA 2HXKA 1ZZYA 3A3TA 4N30A 1B9YC 5EPFA 8GSSA 1SYRA 3PR8A 1M2DA 2A2SA 2VCVA 4F82A 4BL7A 4KW6A 2WZSA 2GLRA 4CY8A 3CHXC 6GSWA 4X43A 3KP9A 2LTKA 2HSMB 3GURA 1GSEA 1TK8B 4V2MA 1QFNA 4ECBA 5A1NA 3HJMA 1GTUA 5HFIA 1XWAA 2D2ZA 4HJ2A 3IBHA 4G0KA 2L57A 2H72A 4LMVA 1O81A 3EMPA 3KCMA 4KDYA 5D9XA 1WE0A 2M80A 3QMXA 2L5OA 5A4UA 2GTUA 1GSDA 4IQAA 2R2JA 3N5OA 2HSHA 3TDGA 4AKHA 3UL3A 1SJ6A 1XG8A 4N11A 4MLYA 3H93A 1YKCA 4GSNA 2YP6A 2PMTA 1SENA 3WGDA 2GQLA 2BTOT 4D73A 2C0FA 4XTSA 1Z7RA 4NHWA 2VAFA 2VL2C 4RQRA 1K0DA 2B7JA 2GQKA 5CREA 3VK9A 1OC9B 4O7HA 2L5LA 1XCCA 1BAYA 3TCOA 1FAAA 2PWJA 5EL8A 2A4VA 2GGTA 5A5HA 3JCML 5J9CA 3IV4A 4MMMA 1ZL9A 4FYBA 3C1RA 2FD3A 4K0GA 4FO5A 1XWGA 1XW9A 3MNGA 4ECJA 5G5FA 4JZQA 3VPQA 1B9XC 1FB6A 4FH8A 4E68A 4I5QA 5ECLB 2MMNA 3DVXA 3FEUA 2X8GA 1XPVA 2EIQA 3IAS2 3WYWA 2LRCA 3GV1A 3VLNA 4P3YB 4FYCA 3BCIA 4ZB8A 3D6IA 4EVMA 4HZ2A 20GSA 1IYHA 3KP8A 5DJLA 2WGRA 5AN1A 2YV7A 4Q5QA 3GKMA 3HXSA 3WT2A 3TKRA 4ACSA 2V2GA 3EU3A 2YV9A 1SD8A 4LL4B 4YKFA 2KUCA 1LU4A 3TRQA 2LKUA 5D9VA 4HU9A 1PQNA 4V1Ag 4BWQA 4JR4A 3C7MA 5B8AA 4ILFA 4G01A 3M9KA 4L8EA 4KCAA 2HRAA 2O36A 4JBBA 3I43A 4TOPA 3P7XA 1TP9A 1G6YA 1CQGA 3CTFA 3TKQA 1DSBA 1H4OA 2X64A 1TXUA 1WJKA 3DIEA 4KDXA 5J40A 4KB3A 3IAM2 4Q5RA 2O85A 2VIMA 4AKGA 1SVLA 1GULA 2CZ2A 2QC7A 1OE8A 2DKHA 2DLXA 1G0TA 5CRWA 3NOFA 2WULA 3V1WA 3SWLA 11GSA 4POLA 3TKSC 1EGRA 2HRKA 5FT3A 1TW9A 1X9WB 3M3MA 4ZIJA 2C0DA 3VI7A 4LA1A 5CRDA 3I69A 1T4ZA 4IJ3A 2H1LA 1RQMA 1BX9A 5AGYA 2CT6A 2EFEA 4WBJA 5ECKB 5IMZA 4IN0A 2C4JA 3L0HA 3D4MA 5CAXA 5G1KA 1OC8A 1ZGNA 4N0ZA 1AXDA 1VRSD 4IP1A 1YY7A 1NHOA 4EUYA 1S4BP 5ID2A 2JL4A 2VLVA 3CSHA 3WD6A 5C04A 1BEDA 1THOA 5IOWA 4PXOA 3AY8A 2GT5A 1X5CA 3KJYA 4F9ZA 2VKZG 3R3EA 3GMFA 2YPMA 2H6ZA 2GSTA 2PVQA 3I9V2 2ZCTA 4YH2A 2IJYA 1K0NA 1V58A 2HSMA 3M8NA 1AQXA 5ECNB 3IHGA 1PX6A 3WGXA 2XPDA 3UEMA 5IIZA 2DKIA 2IN3A 2XBQA 3Q6OA 5CRGA 5L71A 2R6KA 2H1DA 2HRNA 4AJ7A 2VM2A 2IFQB 3VURA 4MZBA 3TGZA 1XWKA 3F6FA 5IMAA 1SKWB 4MF5A 1MEKA 1PKZA 3KH9A 2E7PA 1J0FA 4JRRA 1DE1A 1NSWA 5D9WA 1K3OA 2CA8A
chains in the Genus database with same CATH topology
2C0EA 2AHEA 1NW2A 3IK7A 2E0QA 1Y25A 2X4AA 3CXGA 4E8HA 3G7IA 1GUMA 4HI7A 3GHAA 4CHSA 3DMLA 5COHA 2H70A 4OWYA 4K2DA 1TK5B 3CRUA 2O5VA 2RUEA 3ME8A 1GWCA 2NPBA 5KN3A 4HZ4A 2YJ7A 3C1SA 5GSSA 4GWRA 1XW6A 2LNTA 1U88A 5G31A 2VO4A 3GYKA 1K3YA 1M9AA 1GP1A 1B4PA 2G2QA 2H30A 4NWYA 1YF1A 1X9MB 3GRXA 1EV4A 1R5AA 1V98A 3GSTA 4OD7A 2I3YA 1T4YA 4XS4B 4Z7XA 2H76A 4NV2A 2ON7A 3KZQA 2RIIA 3ZREA 3KEBA 3MIXA 2VCZA 2LNSA 3IR4A 1K0BA 1N25A 4IQ1A 5A5KA 4HS1A 2VUPA 4KSOA 3O6TA 17GSA 4TR3A 1QMVA 3P90A 3ZTLA 2HSNB 2FGXA 4WETA 2I4AA 1XFLA 1SKSB 2GSQA 2DIZA 2YWIA 2F8FA 2YNXA 3F0IA 1GLPA 3KD0A 2J23A 4CW9A 4QMKA 1ON4A 4JEDA 1CQHA 2OADA 3IPZA 4YAPA 2OE3A 1F37A 2X8CA 4PX1A 5G30A 3LSZA 1OAZA 5C00A 4LL1B 2WS2A 4ISDA 1TJDA 3CWGA 4I8BA 4K7IA 4MPFA 3FHKA 2WZ9A 4HU7A 2H73A 3ZMKA 2RM5A 4A5PA 4TR0A 4TR4A 1HD2A 2HNLA 3EMXA 3ZLPA 3D21A 2H1GA 4WKWA 1JZWA 4ZL8A 3L4NA 2PUKC 3FZ4A 3RPNA 3UBLA 5KOXA 3DRNA 3WGEA 3RHCA 5ECOB 4YQVA 1G7OA 5FWGA 4DSRA 1ERTA 1MDKA 3IHQA 3CYNA 4K9ZA 5KOWA 6GSYA 4NAXA 5ABRA 4J56E 3MYDA 5IO0A 2AYTA 1H75A 1O8WA 2HLSA 4EC0A 1DE2A 2H71A 1OYJA 1GSFA 4Z2RA 5A34A 1ZYNA 5A4WA 3IC4A 2I81A 4PUAA 1I9DA 4KH7A 1BYEA 1A2MA 1A0RP 2EFCA 2GQMA 1XIYA 5HFKA 5CNWA 3S9FA 3FR9A 4OMVA 2OA7A 1A23A 3Q19A 1O85A 3QOUA 1RK4A 4MJBA 1O6JA 1TK0B 2YWNA 4GSTA 2OACA 3F6DA 2K8VA 1M99A 2LUSA 4IGJA 2WB9A 4N3ZA 1MD3A 3HKRA 1EEJA 4PTSA 3GKKA 3CRTA 1DBYA 4K2XA 1TU7A 2PGTA 4EDYA 2V32A 4AI6A 3ZFBA 4XS6A 2M72A 1URMA 4J57E 2REMA 4WF5A 1X9SB 1SL0B 2FY6A 1A2LA 5F0GA 1EOGA 1GRXA 3A2WA 1I5GA 2F8AA 2PPTA 1SK1A 2NVLA 4OFMA 4NV5A 2H0IA 4WXTA 1GSUA 2CVBA 2F9SA 3LYKA 1ST9A 3HVSA 2YZUA 4EL1A 3FRCA 2DJJA 3TJFA 3M0FA 4GXZA 4XCSA 1XWBA 4ZB6A 1WPIA 3LXTA 13GSA 2C3TA 3FW2A 2PU9C 1R5PA 2OBIA 6GSXA 4EO3A 1T1VA 2MZCA 3G9BA 5ECHB 3GKNA 4HQZA 1Z7PA 4ZBAA 3LWAA 2N5AA 4O92A 2I1UA 3GFKA 3RPPA 2C3NA 3F4TA 4MH2A 1AW9A 2C80A 5F05A 2CAQA 2QGVA 2NBSA 6GSVA 1UVZA 3LW9A 3W8JA 1ZYEA 2KOKA 3ZITA 4Z2TA 1EV9A 4YKGA 1GSYA 3GX0A 1KEBA 2LRTA 3IA1A 1FO5A 3P8WA 5CRHA 3MDKA 5IQYA 1G6WA 1J08A 1GSSA 3UVHA 4HUAA 4G0LA 2PVOC 5ECPB 3LG6A 3ME7A 4XRDA 3UJ1A 5AIVA 5G2ZA 3VWWA 5J47A 1XWCA 3APQA 4G9HA 3VFIA 3HJOA 18GSA 1GH2A 2ZUPA 2L4CA 2K8SA 3G7YA 4IKHA 1R7HA 2FLSA 2FWFA 2QKEA 3HYPA 1S3CA 1WMJA 3PINA 2UZ8A 3PPUA 4K7NA 4GTUA 3TKSE 3FMWA 2BJXA 3CSIA 3F8UA 3FK8A 4K0NA 1K3LA 2IMKA 2IL3A 3QFAC 3TB2A 4YAVA 2HSNA 4BVXA 2DJ0A 1GSQA 5BRTA 2ON5A 2RM6A 4MJEA 1K0MA 1F3AA 3A2XA 4PQHA 3VI5A 3LORA 3KXOA 2GT6A 2H0HA 1T8EB 4ZB7A 5ELGA 3SBCA 1Z3EA 5HR0A 3N9JA 4ID0A 2A4HA 2WRTA 2IMDA 3EINA 1F9MA 4DSSA 5IO2A 2HYXA 2HI7A 5JCGA 5B6MA 3NZNA 1V40A 4GQFA 1HNCA 3FZ9A 1THXA 3ZIJA 3KMNA 1YEXA 1Z6MA 4TVEA 4QL9A 4QQ7A 1ERVA 5DAKB 3CTGA 1Q98A 4ZB9A 3F63A 2R4VA 1XXUA 2OBKA 2R0PA 1W4VA 2FUG2 4XHMA 1M2AA 5BMUA 2DBCA 5IPHA 2A2RA 2IMEA 1S3DA 2HSYA 2X8HA 3LXZA 1PN9A 2LS5A 3KIJA 3C73A 4ICYA 2YOIA 3EWLA 1USBA 2HZFA 4WEYA 1FB0A 3HVXA 3LYPA 3E3EA 1KBNA 3J7Yb 5E4WA 4O32A 3J7Yk 1PKWA 1EWXA 4MJCA 4FYUA 5HFGA 22GSA 4ZBBA 1PSQA 4OFNA 3H79A 4TN8A 1QXHA 3GUSA 1JZOA 2IWTA 4JE1A 1JZDA 3GX8A 1FOHA 3VWXA 3I6AA 4DSQA 3D4TA 1GTBA 4NHZA 1IYIA 1ZYQB 1GTAA 4MJAA 1U3IA 5CO3A 4HJMA 2H19A 3F3QA 3VWVA 3K8NA 1SK2A 1UC7A 4F2IA 2K9FA 2LQQA 2K6VA 1EP8A 1UA5A 4G10A 5HQPA 3QFBC 3QCPA 1BQ7A 1O8XA 1BF5A 1BJXA 2TRXA 3C8EA 12GSA 5ECSA 2EIRA 1TXXA 2JU5A 2GZYA 4ZL7A 4WF4A 3TKPA 5IMFA 1V9WA 3FZ5A 4JR6A 2DSAA 1GNEA 3LEFA 1S3AA 4TKYA 4K6XA 1TRSA 5B6NA 1TTZA 4MK3A 1F3BA 5ECRB 4ZILA 3F9UA 1OC3A 1MDIA 1K0AA 3HZ4A 3F3RA 4Q5NA 3H8QA 2JZRA 3F4RA 1YVLA 2P0GA 4AKIA 2A2PA 1SVMA 4KE3A 2RLIA 3RDWA 1OC9A 4CDOA 3L9VA 2V6OA 3QD9A 4KX4A 4D73B 5G1LA 1C72A 1FOVA 2AV4A 2FA8A 3TRXA 1QUWA 2P31A 4PNFA 4L5OA 2LSTA 2LEGA 1E6BA 4TXOB 3IE3A 3UOMA 3HA9A 4MZCA 1X5EA 5DVBA 3FR6A 2PN8A 1PX7A 4EE0A 1YEPA 5A5HB 2VLTA 3ZL5A 3FZAA 3TRPA 2P5RA 2EIOA 4AKXB 4NXIA 2CVKA 1VF3A 2HZEB 2GSRA 3MAKA 1VF2A 2GS3A 5HR2A 3IDVA 3QPMA 4MNNA 2AJQB 1YKAA 1HQOA 4HOJA 4FQUA 3BD2A 4RI7A 5HR3A 1XVQA 2I9HA 1NM3A 5AISA 3UIWA 5J4UA 2Z9SA 1YDKA 2H0GA 4ZL9A 3VWUA 3VPTA 2K18A 5IMCA 1ZCPA 3C71A 5DJMA 1SJIA 1ERUA 1HNBA 2XHFA 4F03A 2JZSA 4POKA 5JWQB 2OJLA 3EU4A 1MTCA 3TOUA 3ZVJD 4HQSA 2QA1A 1VF1A 2MMAA 5IMDA 2VD0A 4EDZA 3DKSA 1Z9HA 1MDJA 5LCZA 4EF0A 4POMA 5A4VA 4L5LA 2H01A 2ES7A 4GLTA 1M2BA 1O73A 3KM6A 3U5RE 1GLQA 2WJUA 3U6VA 1SL1B 1TRUA 4XRAA 4V1Ap 4EIQA 4NMUA 2HRFA 3GSSA 16GSA 3US3A 6GSTA 2QSIA 1FVJA 1UN2A 4O5UA 5J4VA 5EVOA 5J9BA 3GN3A 3TUEA 4I97A 4IVFA 1M9BA 2H1AA 1AC1A 2CX4A 4J2FA 1FVKA 3KH7A 4K8MA 2HQTA 5D9TA 4AJ6A 4I2TA 1RW1A 3GKXA 2HRKB 1XBSA 2YJHA 4KUNA 2KLXA 1ZMAA 1T00A 3F4SA 3CMIA 2VL9A 3HMJG 2H1BA 4ECCA 1Q4JA 4O5QA 1PMTA 5HR1A 2MMZA 4MF7A 1OVNA 1YQ1A 3NIVA 1A2JA 3O3TA 5B8BA 3IRAA 10GSA 1X0RA 2O8VB 3GIXA 4GCIA 1SD9A 2R37A 2WFCA 2PERA 2AB6A 3W8SA 3UAPA 2VCTA 1U3AA 6GSUA 1PRXA 1ERWA 2DJ2A 1AUCA 4PURA 4MZWA 4Q5FA 3DD3A 5IMVA 1HYUA 2GZPA 1YF0A 5H5QA 3TU3B 2IMIA 3L9UA 2C8UA 1JZRA 4KF9A 1KNGA 1TKDB 2VD1A 2B6MA 3FKFA 3GL5A 2VL2A 1TRVA 5DCGA 4OCFA 2VCQA 2LJRA 2JACA 2IFQA 1PL2A 4BVYB 4NPBA 4OO5A 14GSA 3RBTA 3A5IA 3BJ5A 4EIPA 2LRNA 4WR4A 3RHBA 1A0FA 5IPGA 4IELA 1GTIA 5D73A 3EPTA 4G0IA 4BWSA 2FWEA 2O89A 3EURA 2OKAA 1JLVA 4PQ1A 1E2YA 2IPAA 4BPYA 2MYGA 5H5RA 1FG4A 3ZIVA 1GL8A 1B48A 3ZVJA 3FYGA 1M7TA 5DALB 2OT3A 4ECIA 2MBTA 3H4KA 2N5FA 2JSZA 1WIKA 2V6KA 1TI1A 2YWMA 1U87A 4KA0A 5B7CA 4RQXA 3ERGA 4I6XA 3HCZA 2DJKA 4G2EA 5KN2A 4TXOA 4OCEA 5ELAA 1T7PB 1R4WA 2YANA 4MP4A 2OE1A 2H8LA 4XS4A 4F0BA 5IM9A 2M46A 3G7JA 2V41A 2HE3A 1XZOA 1VF4A 2JADA 1NHYA 4X1UA 2IMFA 4N10A 5JWOB 4H86A 2R0CA 2HZEA 3IOSA 4KNDA 4V2NA 5G5EA 1XOBA 3LJRA 2FNOA 4IHUA 1LJRA 5KEJA 4OFTA 4MF6A 4N0VA 2CAIA 4MABA 2DIYA 2AAWA 2C0GA 2C1YA 1ILOA 4GSSA 3DEXA 2CV4A 3KGKA 4MCUA 1YJ6A 4AJ8A 4Z2UA 2ZNMA 4RI6A 1JHBA 1G7EA 3TKSA 1WOUA 1SKRB 4XS1A 1OKTA 1PL1A 5J5NA 2VL3A 1K0OA 3ERFA 5JWRB 4MDCA 3P2AA 3D22A 5DBQA 2P5QA 3LGCA 3O76A 2F51A 3LFLA 1KTEA 1MD4A 3HY2A 2X99A 3KTBA 3ZYWA 4F0CA 2L59A 1PGTA 5ECMB 1FW1A 5GAPD 2CZ3A 3M9JA 2XBIA 1SVOA 3ERWA 3DGQA 1OKDA 4GRFA 2GVPA 4TR1B 1PA3A 3M1GA 2BMXA 4K5SA 2L6DA 3LQ7A 4DEJA 4ULXA 1PN0A 4RUVA 4TXVA 4L0UA 19GSA 3A5WA 5KN1A 2FWHA 3BOAA 3UARA 1B4QA 1AAZA 2EC4A 3HDCA 4HDEA 1SL2B 4KDUA 4LLRA 3EE2A 4EKZA 1EOHA 3D0ZA 5ECQB 4LMWA 2CQ9A 4G19A 2B1LA 1LBKA 4V2LA 3HD5A 3FY7A 2L4QA 5DCHA 3IC8A 1K0CA 2KP2A 6GSSA 5A34B 3DYRA 3CBUA 2OE0A 3RAZA 3UBKA 2X49A 3ZFLA 5JCUA 4XIHA 5D96A 5J3RA 3GTUB 2E2MA 3APOA 2VCWA 2EFHA 1XVWA 3QAVA 5DQSA 2B5EA 4FIWA 3H1NA 4DVCA 1Y6EA 7GSSA 3KMOA 2RUFA 1PD21 1OE7A 5KN0A 5ECIB 1ZOFA 1SJZA 3L9SA 2ALBA 4GF0A 4BL7B 1TDIA 9GSSA 2TIRA 1EEMA 2MMOA 2AUVA 4ZXGA 2CX3A 2GSSA 1WP0A 3MWHA 5LD0A 3E9JB 4QL7A 2QA2A 2VOCA 4O5RA 4WR5A 2FWGA 3GA4A 2IIYA 1QGVA 2H6XA 5A1NB 2H75A 2KP1A 4E8EA 1U6TA 3GNJA 4BVYA 3KTLA 1R26A 4X4JA 3DWVA 2R5GA 2LQOA 4MA9A 2WCIA 2DMLA 2YWOA 1A24A 2B1KA 5AIXA 4PGTA 1J9BA 1QK8A 4IJIA 1XW5A 2NDOA 1GUHA 4GDFA 4IS0A 4IP6A 3QR6A 3PH9A 1WWJA 3ZRDA 2TRCP 3R2QA 3L78A 4AGSA 1V2AA 1T3BA 5LNKe 3MSZA 1Z5YE 3GH6A 1EZKA 1N2AA 3IK9A 5H5SA 2G0FA 2GDRA 3QAWA 1FHEA 5DALA 2LV3A 4PNGA 5CP1A 2DJ1A 4IBPA 4JU5A 3ZZXA 2HFDA 2YCDA 3TJKA 3DVWA 4KSMA 3WT1A 1V57A 3HVVA 3UVTA 2KHPA 5INYA 2PBJA 1YZXA 2R0GA 1W89A 2H66A 2LJKA 2FCHA 5JCWA 1ACVA 4YQUA 4I2UA 1F6MC 2F3MA 3GL3A 3TJGA 2C3QA 3UMAA 1AQVA 1ZYPA 5CYYA 2MBSA 3GH9A 1O7UA 3HZ8A 4X0XA 1TOFA 5F07A 1BG5A 2E2GA 3DXBA 1X5DA 4AF2A 4HEA2 2WDUA 2B7KA 2XPEA 4BA7A 3A2VA 3ISOA 3OR5A 2JZTA 1Z6NA 1JLWA 5F06A 2HT9A 5DQYA 2B5YA 4IW9A 1JFUA 3E0UA 2DC5A 2L6CA 2H6YA 5EY6A 4EXJA 5GZZB 4MH3A 3QDNA 4W66A 4ZBDA 4K1FA 1AIUA 3CSJA 4USSA 4ML1A 5ENUA 1TI3A 1Y1UA 3D5JA 1M0UA 2VLUA 1SYXA 3EVIA 5E59A 2VCXA 4BVXB 2JSYA 5F8BA 4POBA 5IOXA 4L0WA 3HJPA 4KAEA 1SK0A 4GQCA 5J41A 2H74A 3HHVA 2XC2A 1A8LA 1DUGA 2J9HA 2B3SA 1ML6A 2GZZA 4K7OA 4ML6A 2DJ3A 2YN1A 1TU8A 1WRYA 3BBYA 1EGOA 2VM1A 4DSSB 1F2EA 5J4YA 1ABAA 2YZHA 4CY6A 5DAKA 3ZMLA 4K5RA 3IXRA 1XOAA 1GUKA 3ED3A 1HNAA 2NTOA 4TR1A 2FA4A 2CVDA 3Q18A 5FHIA 3QAGA 3Q74A 4PQIA 5GAND 5GSTA 5BMUB 1SU9A 2UV8G 5DDLA 1AQWA 2O87A 3FR3A 4KGIA 2FHEA 4TW5A 3EC3A 3BCKA 2EFDA 3APSA 2N5BA 4OO4A 3TOTA 5D93A 4YQMA 1A8YA 4TRXA 2V1MA 2LJAA 5D8IA 3TJBA 1QQ2A 1TRWA 1B8XA 1EP7A 2B5XA 3EYTA 4WBRD 3GTUA 2R3XA 4PUFC 1VGLA 4KCEA 1GNWA 2DMMA 3W6GA 1BG1A 3TJJA 1N8JA 2O7KA 3PGTA 5ID2B 4MPGA 2HXKA 1ZZYA 3A3TA 4N30A 1B9YC 5EPFA 8GSSA 1SYRA 3PR8A 1M2DA 2A2SA 2VCVA 4F82A 4BL7A 4KW6A 2GLRA 4CY8A 6GSWA 4X43A 3KP9A 2LTKA 2HSMB 3GURA 1GSEA 1TK8B 4V2MA 1QFNA 4ECBA 5A1NA 3HJMA 1GTUA 5HFIA 1XWAA 2D2ZA 4HJ2A 3IBHA 4G0KA 2L57A 2H72A 4LMVA 1O81A 3EMPA 3KCMA 4KDYA 5D9XA 1WE0A 2M80A 3QMXA 2L5OA 5A4UA 2GTUA 1GSDA 4IQAA 2R2JA 3N5OA 2HSHA 3TDGA 4AKHA 3UL3A 1SJ6A 4N11A 4MLYA 3H93A 1YKCA 4GSNA 2YP6A 2PMTA 1SENA 3WGDA 2GQLA 2BTOT 4D73A 2C0FA 4XTSA 1Z7RA 4NHWA 2VAFA 2VL2C 4RQRA 1K0DA 2B7JA 2GQKA 5CREA 3VK9A 1OC9B 4O7HA 2L5LA 1XCCA 1BAYA 3TCOA 1FAAA 2PWJA 5EL8A 2A4VA 2GGTA 5A5HA 3JCML 5J9CA 3IV4A 4MMMA 1ZL9A 4FYBA 3C1RA 2FD3A 4K0GA 4FO5A 1XWGA 1XW9A 3MNGA 4ECJA 5G5FA 4JZQA 3VPQA 1B9XC 1FB6A 4FH8A 4E68A 4I5QA 5ECLB 2MMNA 3DVXA 3FEUA 2X8GA 1XPVA 2EIQA 3IAS2 3WYWA 2LRCA 3GV1A 3VLNA 4P3YB 4FYCA 3BCIA 4ZB8A 3D6IA 4EVMA 4HZ2A 20GSA 1IYHA 3KP8A 5DJLA 2WGRA 5AN1A 2YV7A 4Q5QA 3GKMA 3HXSA 3WT2A 3TKRA 4ACSA 2V2GA 3EU3A 2YV9A 1SD8A 4LL4B 4YKFA 2KUCA 1LU4A 3TRQA 2LKUA 5D9VA 4HU9A 1PQNA 4V1Ag 4BWQA 4JR4A 3C7MA 5B8AA 4ILFA 4G01A 3M9KA 4L8EA 4KCAA 2HRAA 4JBBA 3I43A 4TOPA 3P7XA 1TP9A 1G6YA 1CQGA 3CTFA 3TKQA 1DSBA 1H4OA 2X64A 1TXUA 1WJKA 3DIEA 4KDXA 5J40A 4KB3A 3IAM2 4Q5RA 2O85A 2VIMA 4AKGA 1SVLA 1GULA 2CZ2A 2QC7A 1OE8A 2DKHA 2DLXA 1G0TA 5CRWA 3NOFA 2WULA 3V1WA 3SWLA 11GSA 4POLA 3TKSC 1EGRA 2HRKA 5FT3A 1TW9A 1X9WB 3M3MA 4ZIJA 2C0DA 3VI7A 4LA1A 5CRDA 3I69A 1T4ZA 4IJ3A 2H1LA 1RQMA 1BX9A 5AGYA 2CT6A 2EFEA 4WBJA 5ECKB 5IMZA 4IN0A 2C4JA 3L0HA 3D4MA 5CAXA 5G1KA 1OC8A 1ZGNA 4N0ZA 1AXDA 1VRSD 4IP1A 1YY7A 1NHOA 4EUYA 5ID2A 2JL4A 2VLVA 3CSHA 3WD6A 5C04A 1BEDA 1THOA 5IOWA 4PXOA 3AY8A 2GT5A 1X5CA 3KJYA 4F9ZA 2VKZG 3R3EA 3GMFA 2YPMA 2H6ZA 2GSTA 2PVQA 3I9V2 2ZCTA 4YH2A 2IJYA 1K0NA 1V58A 2HSMA 3M8NA 1AQXA 5ECNB 3IHGA 1PX6A 3WGXA 2XPDA 3UEMA 5IIZA 2DKIA 2IN3A 2XBQA 3Q6OA 5CRGA 5L71A 2R6KA 2H1DA 2HRNA 4AJ7A 2VM2A 2IFQB 3VURA 4MZBA 3TGZA 1XWKA 3F6FA 5IMAA 1SKWB 4MF5A 1MEKA 1PKZA 3KH9A 2E7PA 1J0FA 4JRRA 1DE1A 1NSWA 5D9WA 1K3OA 2CA8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C0E A;  2AHE A;  1NW2 A;  3IK7 A;  2E0Q A;  1Y25 A;  3CXG A;  4E8H A;  3G7I A;  1GUM A;  4HI7 A;  3GHA A;  4CHS A;  3DML A;  5COH A;  2H70 A;  4OWY A;  4K2D A;  1TK5 B;  3CRU A;  2RUE A;  3ME8 A;  1GWC A;  2NPB A;  5KN3 A;  4HZ4 A;  2YJ7 A;  3C1S A;  5GSS A;  4GWR A;  1XW6 A;  2LNT A;  1U88 A;  5G31 A;  2VO4 A;  3GYK A;  1K3Y A;  1M9A A;  1GP1 A;  1B4P A;  2G2Q A;  2H30 A;  4NWY A;  1YF1 A;  1X9M B;  3GRX A;  1EV4 A;  1R5A A;  1V98 A;  3GST A;  4OD7 A;  2I3Y A;  1T4Y A;  4XS4 B;  4Z7X A;  2H76 A;  4NV2 A;  2ON7 A;  3KZQ A;  2RII A;  3ZRE A;  3KEB A;  2VCZ A;  2LNS A;  3IR4 A;  1K0B A;  4IQ1 A;  5A5K A;  4HS1 A;  2VUP A;  4KSO A;  3O6T A;  17GS A;  4TR3 A;  1QMV A;  3P90 A;  3ZTL A;  2HSN B;  2FGX A;  4WET A;  2I4A A;  1XFL A;  1SKS B;  2GSQ A;  2DIZ A;  2YWI A;  2F8F A;  2YNX A;  3F0I A;  1GLP A;  3KD0 A;  2J23 A;  4CW9 A;  1ON4 A;  4JED A;  1CQH A;  2OAD A;  3IPZ A;  4YAP A;  2OE3 A;  1F37 A;  2X8C A;  4PX1 A;  5G30 A;  3LSZ A;  1OAZ A;  5C00 A;  4LL1 B;  2WS2 A;  4ISD A;  1TJD A;  4I8B A;  4K7I A;  4MPF A;  3FHK A;  2WZ9 A;  4HU7 A;  2H73 A;  3ZMK A;  2RM5 A;  4TR0 A;  4TR4 A;  1HD2 A;  2HNL A;  3EMX A;  3ZLP A;  3D21 A;  2H1G A;  4WKW A;  1JZW A;  4ZL8 A;  3L4N A;  2PUK C;  3FZ4 A;  3RPN A;  3UBL A;  3DRN A;  3WGE A;  3RHC A;  5ECO B;  4YQV A;  1G7O A;  5FWG A;  4DSR A;  1ERT A;  1MDK A;  3IHQ A;  3CYN A;  4K9Z A;  6GSY A;  4NAX A;  5ABR A;  4J56 E;  5IO0 A;  2AYT A;  1H75 A;  1O8W A;  2HLS A;  4EC0 A;  1DE2 A;  2H71 A;  1OYJ A;  1GSF A;  5A4W A;  3IC4 A;  2I81 A;  4PUA A;  1I9D A;  4KH7 A;  1BYE A;  1A2M A;  1A0R P;  2GQM A;  1XIY A;  5HFK A;  5CNW A;  3S9F A;  3FR9 A;  4OMV A;  2OA7 A;  1A23 A;  3Q19 A;  1O85 A;  3QOU A;  1RK4 A;  4MJB A;  1O6J A;  1TK0 B;  2YWN A;  4GST A;  2OAC A;  3F6D A;  2K8V A;  1M99 A;  2LUS A;  4IGJ A;  2WB9 A;  1MD3 A;  3HKR A;  1EEJ A;  4PTS A;  3GKK A;  3CRT A;  1DBY A;  1TU7 A;  2PGT A;  4EDY A;  2V32 A;  3ZFB A;  4XS6 A;  2M72 A;  1URM A;  4J57 E;  2REM A;  4WF5 A;  1X9S B;  1SL0 B;  2FY6 A;  1A2L A;  5F0G A;  1EOG A;  1GRX A;  3A2W A;  1I5G A;  2F8A A;  2PPT A;  1SK1 A;  2NVL A;  4OFM A;  4NV5 A;  2H0I A;  4WXT A;  1GSU A;  2CVB A;  2F9S A;  3LYK A;  1ST9 A;  3HVS A;  2YZU A;  4EL1 A;  3FRC A;  2DJJ A;  3TJF A;  3M0F A;  4GXZ A;  4XCS A;  1XWB A;  4ZB6 A;  1WPI A;  3LXT A;  13GS A;  2C3T A;  3FW2 A;  2PU9 C;  1R5P A;  2OBI A;  6GSX A;  4EO3 A;  1T1V A;  2MZC A;  3G9B A;  5ECH B;  3GKN A;  4HQZ A;  1Z7P A;  4ZBA A;  3LWA A;  2N5A A;  4O92 A;  2I1U A;  3GFK A;  3RPP A;  2C3N A;  3F4T A;  4MH2 A;  1AW9 A;  2C80 A;  5F05 A;  2CAQ A;  2QGV A;  2NBS A;  6GSV A;  1UVZ A;  3W8J A;  1ZYE A;  2KOK A;  3ZIT A;  1EV9 A;  1GSY A;  3GX0 A;  1KEB A;  2LRT A;  3IA1 A;  1FO5 A;  3P8W A;  5CRH A;  3MDK A;  5IQY A;  1G6W A;  1J08 A;  1GSS A;  3UVH A;  4HUA A;  4G0L A;  2PVO C;  5ECP B;  3LG6 A;  3ME7 A;  4XRD A;  3UJ1 A;  5AIV A;  5G2Z A;  3VWW A;  1XWC A;  3APQ A;  4G9H A;  3VFI A;  3HJO A;  18GS A;  1GH2 A;  2ZUP A;  2L4C A;  2K8S A;  3G7Y A;  4IKH A;  1R7H A;  2FLS A;  2FWF A;  2QKE A;  3HYP A;  1S3C A;  1WMJ A;  3PIN A;  2UZ8 A;  3PPU A;  4K7N A;  4GTU A;  3TKS E;  2BJX A;  3CSI A;  3F8U A;  3FK8 A;  4K0N A;  1K3L A;  2IMK A;  2IL3 A;  3QFA C;  3TB2 A;  4YAV A;  4BVX A;  2DJ0 A;  1GSQ A;  2ON5 A;  2RM6 A;  4MJE A;  1K0M A;  1F3A A;  3A2X A;  4PQH A;  3VI5 A;  3LOR A;  3KXO A;  2GT6 A;  2H0H A;  1T8E B;  5ELG A;  3SBC A;  1Z3E A;  5HR0 A;  3N9J A;  4ID0 A;  2WRT A;  2IMD A;  3EIN A;  1F9M A;  4DSS A;  5IO2 A;  2HYX A;  2HI7 A;  5JCG A;  5B6M A;  3NZN A;  1V40 A;  4GQF A;  1HNC A;  3FZ9 A;  1THX A;  3ZIJ A;  3KMN A;  1YEX A;  1Z6M A;  4TVE A;  4QL9 A;  4QQ7 A;  1ERV A;  5DAK B;  3CTG A;  1Q98 A;  4ZB9 A;  3F63 A;  2R4V A;  1XXU A;  2OBK A;  1W4V A;  2FUG 2;  4XHM A;  1M2A A;  5BMU A;  2DBC A;  5IPH A;  2A2R A;  2IME A;  1S3D A;  2HSY A;  2X8H A;  3LXZ A;  1PN9 A;  2LS5 A;  3KIJ A;  3C73 A;  2YOI A;  3EWL A;  1USB A;  2HZF A;  4WEY A;  1FB0 A;  3HVX A;  3LYP A;  3E3E A;  1KBN A;  3J7Y b;  5E4W A;  4O32 A;  3J7Y k;  1PKW A;  1EWX A;  4MJC A;  4FYU A;  5HFG A;  22GS A;  4ZBB A;  1PSQ A;  4OFN A;  3H79 A;  4TN8 A;  1QXH A;  3GUS A;  1JZO A;  2IWT A;  4JE1 A;  1JZD A;  3GX8 A;  3VWX A;  3I6A A;  4DSQ A;  3D4T A;  1GTB A;  4NHZ A;  1IYI A;  1ZYQ B;  1GTA A;  4MJA A;  1U3I A;  5CO3 A;  4HJM A;  2H19 A;  3F3Q A;  3VWV A;  3K8N A;  1SK2 A;  1UC7 A;  4F2I A;  2K9F A;  2LQQ A;  2K6V A;  1EP8 A;  1UA5 A;  4G10 A;  5HQP A;  3QFB C;  3QCP A;  1BQ7 A;  1O8X A;  1BJX A;  2TRX A;  3C8E A;  12GS A;  5ECS A;  2EIR A;  1TXX A;  2JU5 A;  2GZY A;  4ZL7 A;  4WF4 A;  3TKP A;  5IMF A;  1V9W A;  3FZ5 A;  4JR6 A;  2DSA A;  1GNE A;  3LEF A;  1S3A A;  4TKY A;  4K6X A;  1TRS A;  5B6N A;  1TTZ A;  4MK3 A;  1F3B A;  5ECR B;  4ZIL A;  3F9U A;  1OC3 A;  1MDI A;  1K0A A;  3HZ4 A;  3F3R A;  4Q5N A;  3H8Q A;  2JZR A;  3F4R A;  2P0G A;  4KE3 A;  2RLI A;  3RDW A;  1OC9 A;  4CDO A;  3L9V A;  2V6O A;  3QD9 A;  4KX4 A;  4D73 B;  5G1L A;  1C72 A;  1FOV A;  2AV4 A;  2FA8 A;  3TRX A;  1QUW A;  2P31 A;  4PNF A;  4L5O A;  2LST A;  2LEG A;  1E6B A;  4TXO B;  3IE3 A;  3UOM A;  3HA9 A;  4MZC A;  1X5E A;  5DVB A;  3FR6 A;  2PN8 A;  1PX7 A;  4EE0 A;  1YEP A;  2VLT A;  3ZL5 A;  3FZA A;  3TRP A;  2P5R A;  2EIO A;  4NXI A;  2CVK A;  1VF3 A;  2HZE B;  2GSR A;  3MAK A;  1VF2 A;  2GS3 A;  5HR2 A;  3IDV A;  3QPM A;  2AJQ B;  1YKA A;  1HQO A;  4HOJ A;  4FQU A;  3BD2 A;  4RI7 A;  5HR3 A;  1XVQ A;  2I9H A;  1NM3 A;  5AIS A;  3UIW A;  5J4U A;  2Z9S A;  1YDK A;  2H0G A;  4ZL9 A;  3VWU A;  3VPT A;  2K18 A;  5IMC A;  1ZCP A;  3C71 A;  5DJM A;  1SJI A;  1ERU A;  1HNB A;  2XHF A;  4F03 A;  2JZS A;  4POK A;  5JWQ B;  2OJL A;  3EU4 A;  1MTC A;  3TOU A;  3ZVJ D;  4HQS A;  1VF1 A;  2MMA A;  5IMD A;  2VD0 A;  4EDZ A;  3DKS A;  1Z9H A;  1MDJ A;  5LCZ A;  4EF0 A;  4POM A;  5A4V A;  4L5L A;  2H01 A;  2ES7 A;  4GLT A;  1M2B A;  1O73 A;  3KM6 A;  3U5R E;  1GLQ A;  2WJU A;  3U6V A;  1SL1 B;  1TRU A;  4XRA A;  4V1A p;  4NMU A;  2HRF A;  3GSS A;  16GS A;  3US3 A;  6GST A;  2QSI A;  1FVJ A;  1UN2 A;  5EVO A;  5J9B A;  3GN3 A;  3TUE A;  4I97 A;  4IVF A;  1M9B A;  2H1A A;  1AC1 A;  2CX4 A;  4J2F A;  1FVK A;  3KH7 A;  4K8M A;  2HQT A;  5D9T A;  4AJ6 A;  4I2T A;  1RW1 A;  3GKX A;  2HRK B;  1XBS A;  2YJH A;  4KUN A;  2KLX A;  1ZMA A;  1T00 A;  3F4S A;  3CMI A;  2VL9 A;  2H1B A;  4ECC A;  1Q4J A;  1PMT A;  5HR1 A;  2MMZ A;  4MF7 A;  1OVN A;  1YQ1 A;  3NIV A;  1A2J A;  3O3T A;  5B8B A;  3IRA A;  10GS A;  1X0R A;  2O8V B;  3GIX A;  4GCI A;  1SD9 A;  2R37 A;  2WFC A;  2PER A;  2AB6 A;  3W8S A;  3UAP A;  2VCT A;  1U3A A;  6GSU A;  1PRX A;  1ERW A;  2DJ2 A;  1AUC A;  4PUR A;  4MZW A;  4Q5F A;  3DD3 A;  5IMV A;  1HYU A;  2GZP A;  1YF0 A;  5H5Q A;  2IMI A;  3L9U A;  2C8U A;  1JZR A;  4KF9 A;  1KNG A;  1TKD B;  2VD1 A;  2B6M A;  3FKF A;  3GL5 A;  2VL2 A;  1TRV A;  5DCG A;  4OCF A;  2VCQ A;  2LJR A;  2JAC A;  2IFQ A;  1PL2 A;  4BVY B;  4NPB A;  4OO5 A;  14GS A;  3RBT A;  3BJ5 A;  2LRN A;  4WR4 A;  3RHB A;  1A0F A;  5IPG A;  4IEL A;  1GTI A;  5D73 A;  4G0I A;  4BWS A;  2FWE A;  2O89 A;  3EUR A;  2OKA A;  1JLV A;  4PQ1 A;  1E2Y A;  2IPA A;  4BPY A;  2MYG A;  5H5R A;  1FG4 A;  3ZIV A;  1GL8 A;  1B48 A;  3ZVJ A;  3FYG A;  1M7T A;  5DAL B;  4ECI A;  2MBT A;  3H4K A;  2N5F A;  2JSZ A;  1WIK A;  2V6K A;  1TI1 A;  2YWM A;  1U87 A;  4KA0 A;  5B7C A;  4RQX A;  3ERG A;  4I6X A;  3HCZ A;  2DJK A;  4G2E A;  5KN2 A;  4TXO A;  4OCE A;  5ELA A;  1T7P B;  1R4W A;  2YAN A;  4MP4 A;  2OE1 A;  2H8L A;  4XS4 A;  4F0B A;  5IM9 A;  2M46 A;  3G7J A;  2V41 A;  2HE3 A;  1XZO A;  1VF4 A;  2JAD A;  1NHY A;  4X1U A;  2IMF A;  4N10 A;  5JWO B;  4H86 A;  2HZE A;  3IOS A;  4KND A;  4V2N A;  5G5E A;  1XOB A;  3LJR A;  2FNO A;  4IHU A;  1LJR A;  5KEJ A;  4OFT A;  4MF6 A;  4N0V A;  2CAI A;  4MAB A;  2DIY A;  2AAW A;  2C0G A;  2C1Y A;  1ILO A;  4GSS A;  3DEX A;  2CV4 A;  3KGK A;  4MCU A;  1YJ6 A;  4AJ8 A;  2ZNM A;  4RI6 A;  1JHB A;  1G7E A;  3TKS A;  1WOU A;  1SKR B;  4XS1 A;  1OKT A;  1PL1 A;  5J5N A;  2VL3 A;  1K0O A;  3ERF A;  5JWR B;  4MDC A;  3P2A A;  3D22 A;  5DBQ A;  2P5Q A;  3LGC A;  3O76 A;  2F51 A;  3LFL A;  1KTE A;  1MD4 A;  3HY2 A;  2X99 A;  3KTB A;  3ZYW A;  4F0C A;  2L59 A;  1PGT A;  5ECM B;  1FW1 A;  5GAP D;  2CZ3 A;  3M9J A;  2XBI A;  3ERW A;  3DGQ A;  1OKD A;  4GRF A;  2GVP A;  4TR1 B;  1PA3 A;  3M1G A;  2BMX A;  2L6D A;  3LQ7 A;  4DEJ A;  4ULX A;  4RUV A;  4TXV A;  4L0U A;  19GS A;  3A5W A;  5KN1 A;  2FWH A;  3BOA A;  3UAR A;  1B4Q A;  1AAZ A;  2EC4 A;  3HDC A;  4HDE A;  1SL2 B;  4KDU A;  4LLR A;  3EE2 A;  4EKZ A;  1EOH A;  3D0Z A;  5ECQ B;  4LMW A;  2CQ9 A;  4G19 A;  2B1L A;  1LBK A;  4V2L A;  3HD5 A;  3FY7 A;  2L4Q A;  5DCH A;  3IC8 A;  1K0C A;  2KP2 A;  6GSS A;  3DYR A;  3CBU A;  2OE0 A;  3RAZ A;  3UBK A;  3ZFL A;  5JCU A;  4XIH A;  5D96 A;  5J3R A;  3GTU B;  2E2M A;  3APO A;  2VCW A;  1XVW A;  3QAV A;  5DQS A;  2B5E A;  4FIW A;  3H1N A;  4DVC A;  1Y6E A;  7GSS A;  3KMO A;  2RUF A;  1PD2 1;  1OE7 A;  5KN0 A;  5ECI B;  1ZOF A;  1SJZ A;  3L9S A;  2ALB A;  4GF0 A;  4BL7 B;  1TDI A;  9GSS A;  2TIR A;  1EEM A;  2MMO A;  2AUV A;  4ZXG A;  2CX3 A;  2GSS A;  1WP0 A;  3MWH A;  5LD0 A;  3E9J B;  4QL7 A;  2VOC A;  4O5R A;  4WR5 A;  2FWG A;  3GA4 A;  2IIY A;  1QGV A;  2H6X A;  2H75 A;  2KP1 A;  4E8E A;  1U6T A;  3GNJ A;  4BVY A;  3KTL A;  1R26 A;  3DWV A;  2R5G A;  2LQO A;  4MA9 A;  2WCI A;  2DML A;  2YWO A;  1A24 A;  2B1K A;  5AIX A;  4PGT A;  1J9B A;  1QK8 A;  4IJI A;  1XW5 A;  2NDO A;  1GUH A;  4IS0 A;  4IP6 A;  3QR6 A;  3PH9 A;  1WWJ A;  3ZRD A;  2TRC P;  3R2Q A;  3L78 A;  4AGS A;  1V2A A;  1T3B A;  5LNK e;  3MSZ A;  1Z5Y E;  3GH6 A;  1EZK A;  1N2A A;  3IK9 A;  5H5S A;  2G0F A;  2GDR A;  3QAW A;  1FHE A;  5DAL A;  2LV3 A;  4PNG A;  5CP1 A;  2DJ1 A;  4IBP A;  4JU5 A;  3ZZX A;  2HFD A;  2YCD A;  3TJK A;  3DVW A;  4KSM A;  3WT1 A;  1V57 A;  3HVV A;  3UVT A;  2KHP A;  5INY A;  2PBJ A;  1YZX A;  1W89 A;  2H66 A;  2LJK A;  2FCH A;  5JCW A;  1ACV A;  4YQU A;  4I2U A;  1F6M C;  2F3M A;  3GL3 A;  3TJG A;  2C3Q A;  3UMA A;  1AQV A;  5CYY A;  2MBS A;  3GH9 A;  1O7U A;  3HZ8 A;  4X0X A;  1TOF A;  5F07 A;  1BG5 A;  2E2G A;  3DXB A;  1X5D A;  4AF2 A;  4HEA 2;  2WDU A;  2B7K A;  2XPE A;  4BA7 A;  3A2V A;  3ISO A;  3OR5 A;  2JZT A;  1Z6N A;  1JLW A;  5F06 A;  2HT9 A;  5DQY A;  2B5Y A;  4IW9 A;  1JFU A;  3E0U A;  2DC5 A;  2L6C A;  2H6Y A;  5EY6 A;  4EXJ A;  5GZZ B;  4MH3 A;  3QDN A;  4ZBD A;  4K1F A;  1AIU A;  3CSJ A;  4USS A;  4ML1 A;  5ENU A;  1TI3 A;  3D5J A;  1M0U A;  2VLU A;  1SYX A;  3EVI A;  5E59 A;  2VCX A;  4BVX B;  2JSY A;  5F8B A;  4POB A;  5IOX A;  4L0W A;  3HJP A;  4KAE A;  1SK0 A;  4GQC A;  5J41 A;  2H74 A;  3HHV A;  2XC2 A;  1A8L A;  1DUG A;  2J9H A;  2B3S A;  1ML6 A;  2GZZ A;  4K7O A;  4ML6 A;  2DJ3 A;  2YN1 A;  1TU8 A;  1WRY A;  3BBY A;  1EGO A;  2VM1 A;  4DSS B;  1F2E A;  1ABA A;  2YZH A;  5DAK A;  3ZML A;  3IXR A;  1XOA A;  1GUK A;  3ED3 A;  1HNA A;  2NTO A;  4TR1 A;  2FA4 A;  2CVD A;  3Q18 A;  5FHI A;  3QAG A;  3Q74 A;  4PQI A;  5GAN D;  5GST A;  1SU9 A;  5DDL A;  1AQW A;  2O87 A;  3FR3 A;  4KGI A;  2FHE A;  4TW5 A;  3EC3 A;  3BCK A;  3APS A;  2N5B A;  4OO4 A;  3TOT A;  5D93 A;  4YQM A;  1A8Y A;  4TRX A;  2V1M A;  2LJA A;  5D8I A;  3TJB A;  1QQ2 A;  1TRW A;  1B8X A;  1EP7 A;  2B5X A;  3EYT A;  4WBR D;  3GTU A;  2R3X A;  4PUF C;  1VGL A;  4KCE A;  1GNW A;  2DMM A;  3W6G A;  3TJJ A;  1N8J A;  2O7K A;  3PGT A;  5ID2 B;  4MPG A;  2HXK A;  1ZZY A;  3A3T A;  4N30 A;  1B9Y C;  5EPF A;  8GSS A;  1SYR A;  3PR8 A;  1M2D A;  2A2S A;  2VCV A;  4F82 A;  4BL7 A;  4KW6 A;  2GLR A;  6GSW A;  4X43 A;  3KP9 A;  2LTK A;  2HSM B;  3GUR A;  1GSE A;  1TK8 B;  4V2M A;  1QFN A;  4ECB A;  3HJM A;  1GTU A;  5HFI A;  1XWA A;  2D2Z A;  4HJ2 A;  3IBH A;  4G0K A;  2L57 A;  2H72 A;  4LMV A;  1O81 A;  3EMP A;  3KCM A;  4KDY A;  5D9X A;  1WE0 A;  2M80 A;  3QMX A;  2L5O A;  5A4U A;  2GTU A;  1GSD A;  4IQA A;  2R2J A;  3N5O A;  2HSH A;  3TDG A;  3UL3 A;  1SJ6 A;  4N11 A;  4MLY A;  3H93 A;  1YKC A;  4GSN A;  2YP6 A;  2PMT A;  1SEN A;  3WGD A;  2GQL A;  2BTO T;  4D73 A;  2C0F A;  4XTS A;  1Z7R A;  4NHW A;  2VAF A;  2VL2 C;  4RQR A;  1K0D A;  2B7J A;  2GQK A;  5CRE A;  3VK9 A;  1OC9 B;  4O7H A;  2L5L A;  1XCC A;  1BAY A;  3TCO A;  1FAA A;  2PWJ A;  5EL8 A;  2A4V A;  2GGT A;  3JCM L;  5J9C A;  3IV4 A;  4MMM A;  1ZL9 A;  4FYB A;  3C1R A;  2FD3 A;  4K0G A;  4FO5 A;  1XWG A;  1XW9 A;  3MNG A;  4ECJ A;  5G5F A;  4JZQ A;  3VPQ A;  1B9X C;  1FB6 A;  4FH8 A;  4I5Q A;  5ECL B;  2MMN A;  3DVX A;  3FEU A;  2X8G A;  1XPV A;  2EIQ A;  3IAS 2;  3WYW A;  2LRC A;  3GV1 A;  3VLN A;  4P3Y B;  4FYC A;  3BCI A;  4ZB8 A;  3D6I A;  4EVM A;  4HZ2 A;  20GS A;  1IYH A;  3KP8 A;  5DJL A;  2WGR A;  5AN1 A;  2YV7 A;  4Q5Q A;  3GKM A;  3HXS A;  3WT2 A;  3TKR A;  4ACS A;  2V2G A;  3EU3 A;  2YV9 A;  1SD8 A;  4LL4 B;  2KUC A;  1LU4 A;  3TRQ A;  2LKU A;  5D9V A;  4HU9 A;  1PQN A;  4V1A g;  4BWQ A;  4JR4 A;  3C7M A;  5B8A A;  4ILF A;  3M9K A;  4L8E A;  4KCA A;  2HRA A;  4JBB A;  3I43 A;  4TOP A;  3P7X A;  1TP9 A;  1G6Y A;  1CQG A;  3CTF A;  3TKQ A;  1DSB A;  1H4O A;  2X64 A;  1WJK A;  3DIE A;  4KDX A;  4KB3 A;  3IAM 2;  4Q5R A;  2O85 A;  2VIM A;  1GUL A;  2CZ2 A;  2QC7 A;  1OE8 A;  2DLX A;  1G0T A;  5CRW A;  3NOF A;  2WUL A;  3V1W A;  3SWL A;  11GS A;  4POL A;  3TKS C;  1EGR A;  2HRK A;  5FT3 A;  1TW9 A;  1X9W B;  3M3M A;  4ZIJ A;  2C0D A;  3VI7 A;  4LA1 A;  5CRD A;  3I69 A;  1T4Z A;  4IJ3 A;  1RQM A;  1BX9 A;  5AGY A;  2CT6 A;  4WBJ A;  5ECK B;  5IMZ A;  4IN0 A;  2C4J A;  3L0H A;  3D4M A;  5CAX A;  5G1K A;  1OC8 A;  1ZGN A;  4N0Z A;  1AXD A;  1VRS D;  4IP1 A;  1YY7 A;  1NHO A;  4EUY A;  5ID2 A;  2JL4 A;  2VLV A;  3CSH A;  3WD6 A;  5C04 A;  1BED A;  1THO A;  5IOW A;  4PXO A;  3AY8 A;  2GT5 A;  1X5C A;  3KJY A;  4F9Z A;  3R3E A;  3GMF A;  2YPM A;  2H6Z A;  2GST A;  2PVQ A;  3I9V 2;  2ZCT A;  4YH2 A;  2IJY A;  1K0N A;  1V58 A;  2HSM A;  3M8N A;  1AQX A;  5ECN B;  1PX6 A;  3WGX A;  2XPD A;  3UEM A;  5IIZ A;  2IN3 A;  2XBQ A;  3Q6O A;  5CRG A;  5L71 A;  2R6K A;  2H1D A;  2HRN A;  4AJ7 A;  2VM2 A;  2IFQ B;  3VUR A;  4MZB A;  3TGZ A;  1XWK A;  3F6F A;  5IMA A;  1SKW B;  4MF5 A;  1MEK A;  1PKZ A;  3KH9 A;  2E7P A;  1J0F A;  4JRR A;  1DE1 A;  1NSW A;  5D9W A;  1K3O A;  2CA8 A; 
#chains in the Genus database with same CATH topology
 2C0E A;  2AHE A;  1NW2 A;  3IK7 A;  2E0Q A;  1Y25 A;  2X4A A;  1S3R A;  3CXG A;  3CQF A;  4E8H A;  3G7I A;  1GUM A;  4HI7 A;  3GHA A;  4CHS A;  3DML A;  5COH A;  2H70 A;  4OWY A;  4K2D A;  1TK5 B;  3CRU A;  2O5V A;  2RUE A;  3ME8 A;  1GWC A;  2NPB A;  5KN3 A;  4HZ4 A;  2YJ7 A;  3C1S A;  5GSS A;  4GWR A;  1XW6 A;  2LNT A;  1U88 A;  4PHZ C;  5G31 A;  2VO4 A;  3GYK A;  1K3Y A;  1M9A A;  1GP1 A;  1B4P A;  2G2Q A;  2H30 A;  4NWY A;  1YF1 A;  1X9M B;  3GRX A;  1EV4 A;  1R5A A;  1V98 A;  3GST A;  4OD7 A;  2I3Y A;  1T4Y A;  4XS4 B;  4Z7X A;  2H76 A;  4NV2 A;  2ON7 A;  3KZQ A;  2RII A;  3ZRE A;  3KEB A;  3MIX A;  2VCZ A;  2LNS A;  3IR4 A;  1K0B A;  1N25 A;  4IQ1 A;  5A5K A;  4HS1 A;  2VUP A;  4KSO A;  3O6T A;  17GS A;  4TR3 A;  1QMV A;  3P90 A;  3ZTL A;  2HSN B;  2FGX A;  4WET A;  2I4A A;  1XFL A;  1SKS B;  2GSQ A;  2DIZ A;  2YWI A;  2F8F A;  2YNX A;  3F0I A;  1GLP A;  3KD0 A;  4PI2 C;  2J23 A;  4CW9 A;  4QMK A;  1ON4 A;  4JED A;  1CQH A;  2OAD A;  3IPZ A;  4YAP A;  2OE3 A;  1F37 A;  2X8C A;  4PX1 A;  5G30 A;  3LSZ A;  1OAZ A;  5C00 A;  4LL1 B;  2WS2 A;  4ISD A;  1TJD A;  3CWG A;  4I8B A;  4K7I A;  4MPF A;  3FHK A;  2WZ9 A;  4HU7 A;  2H73 A;  3ZMK A;  2RM5 A;  4A5P A;  4TR0 A;  4TR4 A;  1HD2 A;  2HNL A;  3EMX A;  3ZLP A;  3D21 A;  2H1G A;  4WKW A;  1JZW A;  4ZL8 A;  3L4N A;  2PUK C;  3FZ4 A;  3RPN A;  3UBL A;  5KOX A;  3DRN A;  3WGE A;  3RHC A;  5ECO B;  4YQV A;  1G7O A;  5FWG A;  4DSR A;  1ERT A;  1MDK A;  3IHQ A;  3CYN A;  4K9Z A;  5KOW A;  6GSY A;  4NAX A;  5ABR A;  4J56 E;  3MYD A;  5IO0 A;  2AYT A;  1H75 A;  1O8W A;  2HLS A;  4EC0 A;  1DE2 A;  2H71 A;  1OYJ A;  1GSF A;  4Z2R A;  5A34 A;  1ZYN A;  5A4W A;  3IC4 A;  2I81 A;  4PUA A;  1I9D A;  4KH7 A;  1BYE A;  4FXY P;  1A2M A;  1A0R P;  2EFC A;  2GQM A;  1XIY A;  5HFK A;  5CNW A;  3S9F A;  3FR9 A;  4OMV A;  2OA7 A;  1A23 A;  3Q19 A;  1O85 A;  3QOU A;  1RK4 A;  4MJB A;  1O6J A;  1TK0 B;  2YWN A;  4GST A;  2OAC A;  3F6D A;  2K8V A;  1M99 A;  2LUS A;  4IGJ A;  2WB9 A;  4N3Z A;  1MD3 A;  3HKR A;  1EEJ A;  4PTS A;  3GKK A;  3CRT A;  1DBY A;  4K2X A;  1TU7 A;  2PGT A;  4EDY A;  2V32 A;  4AI6 A;  3ZFB A;  4XS6 A;  2M72 A;  1URM A;  4J57 E;  1M3J A;  2REM A;  4WF5 A;  1X9S B;  1SL0 B;  2FY6 A;  1A2L A;  5F0G A;  1EOG A;  1GRX A;  3A2W A;  1I5G A;  2F8A A;  2PPT A;  1SK1 A;  2NVL A;  4OFM A;  3HVN A;  4NV5 A;  2H0I A;  4WXT A;  1GSU A;  2CVB A;  2F9S A;  3LYK A;  1ST9 A;  3HVS A;  2YZU A;  4EL1 A;  3FRC A;  2DJJ A;  3TJF A;  3M0F A;  4GXZ A;  4XCS A;  1XWB A;  4ZB6 A;  1WPI A;  3LXT A;  13GS A;  2C3T A;  3FW2 A;  2PU9 C;  1R5P A;  2OBI A;  6GSX A;  4EO3 A;  1T1V A;  2MZC A;  3G9B A;  5ECH B;  3GKN A;  4HQZ A;  1Z7P A;  4ZBA A;  3LWA A;  2N5A A;  4O92 A;  2I1U A;  3GFK A;  3RPP A;  2C3N A;  3F4T A;  4MH2 A;  1AW9 A;  2C80 A;  5F05 A;  2CAQ A;  2QGV A;  2NBS A;  6GSV A;  1UVZ A;  3LW9 A;  3W8J A;  1ZYE A;  2KOK A;  3RFR C;  3ZIT A;  4Z2T A;  1EV9 A;  2WW0 A;  4YKG A;  1GSY A;  3GX0 A;  1KEB A;  2LRT A;  3IA1 A;  1FO5 A;  3P8W A;  5CRH A;  3MDK A;  5IQY A;  1G6W A;  1J08 A;  1GSS A;  3UVH A;  4HUA A;  4G0L A;  2PVO C;  5ECP B;  3LG6 A;  3ME7 A;  4XRD A;  3UJ1 A;  5AIV A;  5G2Z A;  3VWW A;  5J47 A;  1XWC A;  3APQ A;  4G9H A;  3VFI A;  3HJO A;  18GS A;  1GH2 A;  2ZUP A;  2L4C A;  2K8S A;  3G7Y A;  4IKH A;  1R7H A;  2FLS A;  2FWF A;  2QKE A;  3HYP A;  1S3C A;  1WMJ A;  3PIN A;  2UZ8 A;  3PPU A;  4K7N A;  4GTU A;  3TKS E;  3FMW A;  2BJX A;  3CSI A;  3F8U A;  3FK8 A;  4K0N A;  1K3L A;  1YEW C;  2IMK A;  2IL3 A;  3QFA C;  3TB2 A;  4YAV A;  2HSN A;  4BVX A;  3RGB C;  2DJ0 A;  1GSQ A;  5BRT A;  2ON5 A;  2RM6 A;  4MJE A;  1K0M A;  1F3A A;  3A2X A;  4PQH A;  3VI5 A;  3LOR A;  3KXO A;  2GT6 A;  2H0H A;  1T8E B;  4ZB7 A;  5ELG A;  3SBC A;  1Z3E A;  5HR0 A;  3N9J A;  4ID0 A;  2A4H A;  2WRT A;  2IMD A;  3EIN A;  1F9M A;  4DSS A;  5IO2 A;  2HYX A;  2HI7 A;  5JCG A;  5B6M A;  3NZN A;  1V40 A;  4GQF A;  1HNC A;  3FZ9 A;  4BIK A;  1THX A;  3ZIJ A;  3KMN A;  1YEX A;  1Z6M A;  4TVE A;  4QL9 A;  4QQ7 A;  1ERV A;  5DAK B;  3CTG A;  1Q98 A;  4ZB9 A;  3F63 A;  2R4V A;  1XXU A;  2OBK A;  2R0P A;  1W4V A;  2FUG 2;  4XHM A;  1M2A A;  5BMU A;  2DBC A;  5IPH A;  2A2R A;  2IME A;  1S3D A;  2HSY A;  2X8H A;  3LXZ A;  1PN9 A;  2LS5 A;  3KIJ A;  3C73 A;  4ICY A;  2YOI A;  3EWL A;  1USB A;  2HZF A;  4WEY A;  1FB0 A;  3HVX A;  3LYP A;  3E3E A;  1KBN A;  3J7Y b;  5E4W A;  4O32 A;  3J7Y k;  1PKW A;  1EWX A;  4MJC A;  4FYU A;  5HFG A;  22GS A;  4ZBB A;  1PSQ A;  4OFN A;  3H79 A;  4TN8 A;  1QXH A;  3GUS A;  1JZO A;  2IWT A;  4JE1 A;  1JZD A;  3GX8 A;  1FOH A;  3VWX A;  3I6A A;  4DSQ A;  3D4T A;  1GTB A;  4NHZ A;  1IYI A;  1ZYQ B;  1GTA A;  4MJA A;  1U3I A;  5CO3 A;  4HJM A;  2H19 A;  3F3Q A;  3VWV A;  3K8N A;  1SK2 A;  1UC7 A;  4F2I A;  2K9F A;  2WW3 A;  2LQQ A;  2K6V A;  1EP8 A;  1UA5 A;  4G10 A;  5HQP A;  3QFB C;  3QCP A;  1BQ7 A;  1O8X A;  1BF5 A;  1BJX A;  2TRX A;  3C8E A;  12GS A;  5ECS A;  2EIR A;  1TXX A;  2JU5 A;  2GZY A;  4ZL7 A;  4WF4 A;  3TKP A;  5IMF A;  1V9W A;  3FZ5 A;  4JR6 A;  2DSA A;  1GNE A;  3LEF A;  1S3A A;  4TKY A;  4K6X A;  1TRS A;  5B6N A;  1TTZ A;  4MK3 A;  1F3B A;  5ECR B;  4ZIL A;  3F9U A;  4HSC X;  1OC3 A;  1MDI A;  1K0A A;  3HZ4 A;  3F3R A;  4Q5N A;  3H8Q A;  2JZR A;  3F4R A;  1YVL A;  2P0G A;  4AKI A;  2A2P A;  1SVM A;  4KE3 A;  2RLI A;  3RDW A;  1OC9 A;  4CDO A;  3L9V A;  2V6O A;  3QD9 A;  4KX4 A;  4D73 B;  5G1L A;  1C72 A;  1FOV A;  2AV4 A;  2FA8 A;  3TRX A;  1QUW A;  2P31 A;  4PNF A;  4L5O A;  2LST A;  2LEG A;  1E6B A;  4TXO B;  3IE3 A;  3UOM A;  3HA9 A;  4MZC A;  1X5E A;  5DVB A;  3FR6 A;  2PN8 A;  1PX7 A;  4EE0 A;  1YEP A;  5A5H B;  2VLT A;  3ZL5 A;  3FZA A;  3TRP A;  2P5R A;  2EIO A;  4AKX B;  4NXI A;  2CVK A;  1VF3 A;  2HZE B;  2WVX B;  2GSR A;  3MAK A;  1VF2 A;  2GS3 A;  5HR2 A;  3IDV A;  3QPM A;  4MNN A;  2AJQ B;  2WW1 A;  1YKA A;  1HQO A;  4HOJ A;  4FQU A;  3BD2 A;  4RI7 A;  5HR3 A;  1XVQ A;  2I9H A;  1NM3 A;  5AIS A;  3UIW A;  5J4U A;  2Z9S A;  1YDK A;  2H0G A;  4ZL9 A;  3VWU A;  3VPT A;  2K18 A;  5IMC A;  1ZCP A;  3C71 A;  5DJM A;  1SJI A;  1ERU A;  1HNB A;  2XHF A;  4F03 A;  2JZS A;  4POK A;  5JWQ B;  2OJL A;  3EU4 A;  1MTC A;  3TOU A;  3ZVJ D;  4HQS A;  2QA1 A;  1VF1 A;  2MMA A;  5IMD A;  2VD0 A;  4EDZ A;  3DKS A;  1Z9H A;  1MDJ A;  5LCZ A;  4EF0 A;  4POM A;  5A4V A;  4L5L A;  2H01 A;  2ES7 A;  4GLT A;  1M2B A;  1O73 A;  3KM6 A;  3U5R E;  1GLQ A;  2WJU A;  3U6V A;  1SL1 B;  1TRU A;  4XRA A;  4V1A p;  4EIQ A;  4NMU A;  2HRF A;  3GSS A;  16GS A;  3US3 A;  6GST A;  2QSI A;  1FVJ A;  1UN2 A;  4O5U A;  5J4V A;  5EVO A;  5J9B A;  3GN3 A;  3TUE A;  4I97 A;  4IVF A;  1M9B A;  2H1A A;  1AC1 A;  2CX4 A;  4J2F A;  1FVK A;  3KH7 A;  4K8M A;  2HQT A;  5D9T A;  4AJ6 A;  4I2T A;  1RW1 A;  3GKX A;  2WVY A;  2HRK B;  1XBS A;  2YJH A;  4KUN A;  2KLX A;  1ZMA A;  1T00 A;  3F4S A;  3CMI A;  2VL9 A;  3HMJ G;  2H1B A;  4ECC A;  1Q4J A;  4O5Q A;  1PMT A;  5HR1 A;  2MMZ A;  4MF7 A;  1OVN A;  1YQ1 A;  3NIV A;  1A2J A;  3O3T A;  5B8B A;  3IRA A;  10GS A;  1X0R A;  2O8V B;  3GIX A;  4GCI A;  1SD9 A;  2R37 A;  2WFC A;  2PER A;  2AB6 A;  3W8S A;  3UAP A;  2VCT A;  1U3A A;  6GSU A;  1PRX A;  1ERW A;  2DJ2 A;  1AUC A;  4PUR A;  4MZW A;  4Q5F A;  3DD3 A;  5IMV A;  1HYU A;  2GZP A;  1YF0 A;  5H5Q A;  3TU3 B;  2IMI A;  3L9U A;  2C8U A;  1JZR A;  4KF9 A;  1KNG A;  1TKD B;  2VD1 A;  2B6M A;  3FKF A;  3GL5 A;  2VL2 A;  1TRV A;  5DCG A;  4OCF A;  2VCQ A;  2LJR A;  2JAC A;  2IFQ A;  1PL2 A;  4BVY B;  4NPB A;  4OO5 A;  14GS A;  3RBT A;  3A5I A;  3BJ5 A;  4EIP A;  2LRN A;  4WR4 A;  3RHB A;  1A0F A;  5IPG A;  4IEL A;  1GTI A;  5D73 A;  3EPT A;  4G0I A;  4BWS A;  2FWE A;  2O89 A;  3EUR A;  2OKA A;  1JLV A;  4PQ1 A;  1E2Y A;  2IPA A;  4BPY A;  2MYG A;  5H5R A;  1FG4 A;  3ZIV A;  1GL8 A;  1B48 A;  3ZVJ A;  3FYG A;  1M7T A;  5DAL B;  2OT3 A;  4ECI A;  2MBT A;  3H4K A;  2N5F A;  2JSZ A;  1WIK A;  2V6K A;  1TI1 A;  2YWM A;  1U87 A;  4KA0 A;  5B7C A;  4RQX A;  3ERG A;  4I6X A;  3HCZ A;  2DJK A;  4G2E A;  5KN2 A;  4TXO A;  4OCE A;  5ELA A;  1T7P B;  1R4W A;  2YAN A;  4MP4 A;  2OE1 A;  2H8L A;  4XS4 A;  4F0B A;  5IM9 A;  2M46 A;  3G7J A;  2V41 A;  2HE3 A;  1XZO A;  1VF4 A;  2JAD A;  1NHY A;  4X1U A;  2IMF A;  4N10 A;  5JWO B;  4H86 A;  2R0C A;  2HZE A;  2WVX A;  3IOS A;  4KND A;  4V2N A;  5G5E A;  1XOB A;  3LJR A;  2FNO A;  4IHU A;  1LJR A;  5KEJ A;  4OFT A;  4MF6 A;  4N0V A;  2CAI A;  4MAB A;  2DIY A;  2AAW A;  2C0G A;  2C1Y A;  1ILO A;  4GSS A;  3DEX A;  2CV4 A;  3KGK A;  4MCU A;  1YJ6 A;  4AJ8 A;  4Z2U A;  2ZNM A;  4RI6 A;  1JHB A;  1G7E A;  3TKS A;  1WOU A;  1SKR B;  4XS1 A;  1OKT A;  1PL1 A;  5J5N A;  2VL3 A;  1K0O A;  3ERF A;  5JWR B;  2O3E A;  4MDC A;  3P2A A;  3D22 A;  5DBQ A;  2P5Q A;  3LGC A;  3O76 A;  2F51 A;  3LFL A;  1KTE A;  1MD4 A;  3HY2 A;  2X99 A;  3KTB A;  3ZYW A;  4F0C A;  2L59 A;  1PGT A;  5ECM B;  1FW1 A;  5GAP D;  2CZ3 A;  3M9J A;  2XBI A;  1SVO A;  3ERW A;  3DGQ A;  1OKD A;  4GRF A;  2GVP A;  4TR1 B;  1PA3 A;  3M1G A;  2BMX A;  4K5S A;  2L6D A;  3LQ7 A;  4DEJ A;  4ULX A;  1PN0 A;  4RUV A;  4TXV A;  4L0U A;  19GS A;  3A5W A;  5KN1 A;  2FWH A;  3BOA A;  3UAR A;  1B4Q A;  1AAZ A;  2EC4 A;  3HDC A;  4HDE A;  1SL2 B;  4KDU A;  4LLR A;  3EE2 A;  4EKZ A;  1EOH A;  3D0Z A;  5ECQ B;  4LMW A;  2CQ9 A;  4G19 A;  2B1L A;  1LBK A;  4V2L A;  3HD5 A;  3FY7 A;  2L4Q A;  5DCH A;  3IC8 A;  1K0C A;  2KP2 A;  6GSS A;  5A34 B;  3DYR A;  3CBU A;  2OE0 A;  3RAZ A;  3UBK A;  2X49 A;  3ZFL A;  5JCU A;  4XIH A;  5D96 A;  5J3R A;  3GTU B;  2E2M A;  3APO A;  2VCW A;  2EFH A;  1XVW A;  3QAV A;  5DQS A;  2B5E A;  4FIW A;  3H1N A;  2WW2 A;  4DVC A;  1Y6E A;  7GSS A;  3KMO A;  2RUF A;  1PD2 1;  1OE7 A;  5KN0 A;  5ECI B;  1ZOF A;  1SJZ A;  3L9S A;  2ALB A;  4GF0 A;  4BL7 B;  1TDI A;  9GSS A;  2TIR A;  1EEM A;  2MMO A;  2AUV A;  4ZXG A;  2CX3 A;  2GSS A;  1WP0 A;  3MWH A;  5LD0 A;  3E9J B;  4QL7 A;  2QA2 A;  2VOC A;  4O5R A;  4WR5 A;  2FWG A;  3GA4 A;  2IIY A;  1QGV A;  2H6X A;  5A1N B;  2H75 A;  2KP1 A;  4E8E A;  1U6T A;  3GNJ A;  4BVY A;  3KTL A;  1R26 A;  4X4J A;  3DWV A;  2R5G A;  2LQO A;  4MA9 A;  2WCI A;  2DML A;  2YWO A;  1A24 A;  2B1K A;  1I1I P;  5AIX A;  4PGT A;  1J9B A;  1QK8 A;  4IJI A;  1XW5 A;  2NDO A;  1GUH A;  4GDF A;  4IS0 A;  1M3I A;  4IP6 A;  3QR6 A;  3PH9 A;  1WWJ A;  3ZRD A;  2TRC P;  3R2Q A;  3L78 A;  4AGS A;  1V2A A;  1T3B A;  5LNK e;  3MSZ A;  1Z5Y E;  3GH6 A;  1EZK A;  1N2A A;  4PI0 C;  3IK9 A;  5H5S A;  2G0F A;  2GDR A;  3QAW A;  1FHE A;  5DAL A;  2LV3 A;  4PNG A;  5CP1 A;  2DJ1 A;  4IBP A;  4JU5 A;  3ZZX A;  2HFD A;  2YCD A;  3TJK A;  3DVW A;  4KSM A;  3WT1 A;  1V57 A;  3HVV A;  3UVT A;  2KHP A;  5INY A;  2PBJ A;  1YZX A;  2R0G A;  1W89 A;  2H66 A;  2LJK A;  2FCH A;  5JCW A;  1ACV A;  4YQU A;  4I2U A;  1F6M C;  2F3M A;  3GL3 A;  3TJG A;  2C3Q A;  3UMA A;  1AQV A;  1ZYP A;  5CYY A;  2MBS A;  3GH9 A;  1O7U A;  3HZ8 A;  4X0X A;  1TOF A;  5F07 A;  1BG5 A;  2E2G A;  3DXB A;  1X5D A;  4AF2 A;  4HEA 2;  2WDU A;  2B7K A;  2XPE A;  4BA7 A;  3A2V A;  3ISO A;  3OR5 A;  2JZT A;  1Z6N A;  1JLW A;  5F06 A;  2HT9 A;  5DQY A;  2B5Y A;  4IW9 A;  1JFU A;  3E0U A;  2DC5 A;  2L6C A;  2H6Y A;  5EY6 A;  4EXJ A;  5GZZ B;  4MH3 A;  3QDN A;  4W66 A;  4ZBD A;  4K1F A;  1AIU A;  3CSJ A;  4USS A;  4ML1 A;  5ENU A;  1TI3 A;  1Y1U A;  3D5J A;  1M0U A;  2VLU A;  1SYX A;  3EVI A;  5E59 A;  2VCX A;  4BVX B;  2JSY A;  5F8B A;  4POB A;  5IOX A;  4L0W A;  3HJP A;  4KAE A;  1SK0 A;  4GQC A;  1PFO A;  5J41 A;  2H74 A;  3HHV A;  2XC2 A;  1A8L A;  2WVZ A;  1DUG A;  2J9H A;  2B3S A;  1ML6 A;  2GZZ A;  4K7O A;  4ML6 A;  2DJ3 A;  2YN1 A;  1TU8 A;  1WRY A;  3BBY A;  1EGO A;  2VM1 A;  4DSS B;  1F2E A;  5J4Y A;  1ABA A;  2YZH A;  4CY6 A;  5DAK A;  3ZML A;  4K5R A;  3IXR A;  1XOA A;  1GUK A;  3ED3 A;  1HNA A;  2NTO A;  4TR1 A;  2FA4 A;  2CVD A;  3Q18 A;  5FHI A;  3QAG A;  3Q74 A;  4PQI A;  5GAN D;  5GST A;  5BMU B;  1SU9 A;  2UV8 G;  5DDL A;  1AQW A;  2O87 A;  3FR3 A;  4KGI A;  2FHE A;  4TW5 A;  3EC3 A;  3BCK A;  2EFD A;  3APS A;  2N5B A;  4OO4 A;  3TOT A;  5D93 A;  4YQM A;  1A8Y A;  4TRX A;  2V1M A;  2LJA A;  5D8I A;  3TJB A;  1QQ2 A;  1TRW A;  1B8X A;  1EP7 A;  2B5X A;  3EYT A;  4WBR D;  3GTU A;  2R3X A;  4PUF C;  1VGL A;  4KCE A;  1GNW A;  2DMM A;  3W6G A;  1BG1 A;  3TJJ A;  1N8J A;  2O7K A;  3PGT A;  5ID2 B;  4MPG A;  2HXK A;  1ZZY A;  3A3T A;  4N30 A;  1B9Y C;  5EPF A;  8GSS A;  1SYR A;  3PR8 A;  1M2D A;  2A2S A;  2VCV A;  4F82 A;  4BL7 A;  4KW6 A;  2WZS A;  2GLR A;  4CY8 A;  3CHX C;  6GSW A;  4X43 A;  3KP9 A;  2LTK A;  2HSM B;  3GUR A;  1GSE A;  1TK8 B;  4V2M A;  1QFN A;  4ECB A;  5A1N A;  3HJM A;  1GTU A;  5HFI A;  1XWA A;  2D2Z A;  4HJ2 A;  3IBH A;  4G0K A;  2L57 A;  2H72 A;  4LMV A;  1O81 A;  3EMP A;  3KCM A;  4KDY A;  5D9X A;  1WE0 A;  2M80 A;  3QMX A;  2L5O A;  5A4U A;  2GTU A;  1GSD A;  4IQA A;  2R2J A;  3N5O A;  2HSH A;  3TDG A;  4AKH A;  3UL3 A;  1SJ6 A;  1XG8 A;  4N11 A;  4MLY A;  3H93 A;  1YKC A;  4GSN A;  2YP6 A;  2PMT A;  1SEN A;  3WGD A;  2GQL A;  2BTO T;  4D73 A;  2C0F A;  4XTS A;  1Z7R A;  4NHW A;  2VAF A;  2VL2 C;  4RQR A;  1K0D A;  2B7J A;  2GQK A;  5CRE A;  3VK9 A;  1OC9 B;  4O7H A;  2L5L A;  1XCC A;  1BAY A;  3TCO A;  1FAA A;  2PWJ A;  5EL8 A;  2A4V A;  2GGT A;  5A5H A;  3JCM L;  5J9C A;  3IV4 A;  4MMM A;  1ZL9 A;  4FYB A;  3C1R A;  2FD3 A;  4K0G A;  4FO5 A;  1XWG A;  1XW9 A;  3MNG A;  4ECJ A;  5G5F A;  4JZQ A;  3VPQ A;  1B9X C;  1FB6 A;  4FH8 A;  4E68 A;  4I5Q A;  5ECL B;  2MMN A;  3DVX A;  3FEU A;  2X8G A;  1XPV A;  2EIQ A;  3IAS 2;  3WYW A;  2LRC A;  3GV1 A;  3VLN A;  4P3Y B;  4FYC A;  3BCI A;  4ZB8 A;  3D6I A;  4EVM A;  4HZ2 A;  20GS A;  1IYH A;  3KP8 A;  5DJL A;  2WGR A;  5AN1 A;  2YV7 A;  4Q5Q A;  3GKM A;  3HXS A;  3WT2 A;  3TKR A;  4ACS A;  2V2G A;  3EU3 A;  2YV9 A;  1SD8 A;  4LL4 B;  4YKF A;  2KUC A;  1LU4 A;  3TRQ A;  2LKU A;  5D9V A;  4HU9 A;  1PQN A;  4V1A g;  4BWQ A;  4JR4 A;  3C7M A;  5B8A A;  4ILF A;  4G01 A;  3M9K A;  4L8E A;  4KCA A;  2HRA A;  2O36 A;  4JBB A;  3I43 A;  4TOP A;  3P7X A;  1TP9 A;  1G6Y A;  1CQG A;  3CTF A;  3TKQ A;  1DSB A;  1H4O A;  2X64 A;  1TXU A;  1WJK A;  3DIE A;  4KDX A;  5J40 A;  4KB3 A;  3IAM 2;  4Q5R A;  2O85 A;  2VIM A;  4AKG A;  1SVL A;  1GUL A;  2CZ2 A;  2QC7 A;  1OE8 A;  2DKH A;  2DLX A;  1G0T A;  5CRW A;  3NOF A;  2WUL A;  3V1W A;  3SWL A;  11GS A;  4POL A;  3TKS C;  1EGR A;  2HRK A;  5FT3 A;  1TW9 A;  1X9W B;  3M3M A;  4ZIJ A;  2C0D A;  3VI7 A;  4LA1 A;  5CRD A;  3I69 A;  1T4Z A;  4IJ3 A;  2H1L A;  1RQM A;  1BX9 A;  5AGY A;  2CT6 A;  2EFE A;  4WBJ A;  5ECK B;  5IMZ A;  4IN0 A;  2C4J A;  3L0H A;  3D4M A;  5CAX A;  5G1K A;  1OC8 A;  1ZGN A;  4N0Z A;  1AXD A;  1VRS D;  4IP1 A;  1YY7 A;  1NHO A;  4EUY A;  1S4B P;  5ID2 A;  2JL4 A;  2VLV A;  3CSH A;  3WD6 A;  5C04 A;  1BED A;  1THO A;  5IOW A;  4PXO A;  3AY8 A;  2GT5 A;  1X5C A;  3KJY A;  4F9Z A;  2VKZ G;  3R3E A;  3GMF A;  2YPM A;  2H6Z A;  2GST A;  2PVQ A;  3I9V 2;  2ZCT A;  4YH2 A;  2IJY A;  1K0N A;  1V58 A;  2HSM A;  3M8N A;  1AQX A;  5ECN B;  3IHG A;  1PX6 A;  3WGX A;  2XPD A;  3UEM A;  5IIZ A;  2DKI A;  2IN3 A;  2XBQ A;  3Q6O A;  5CRG A;  5L71 A;  2R6K A;  2H1D A;  2HRN A;  4AJ7 A;  2VM2 A;  2IFQ B;  3VUR A;  4MZB A;  3TGZ A;  1XWK A;  3F6F A;  5IMA A;  1SKW B;  4MF5 A;  1MEK A;  1PKZ A;  3KH9 A;  2E7P A;  1J0F A;  4JRR A;  1DE1 A;  1NSW A;  5D9W A;  1K3O A;  2CA8 A; 
#chains in the Genus database with same CATH homology
 2C0E A;  2AHE A;  1NW2 A;  3IK7 A;  2E0Q A;  1Y25 A;  2X4A A;  3CXG A;  4E8H A;  3G7I A;  1GUM A;  4HI7 A;  3GHA A;  4CHS A;  3DML A;  5COH A;  2H70 A;  4OWY A;  4K2D A;  1TK5 B;  3CRU A;  2O5V A;  2RUE A;  3ME8 A;  1GWC A;  2NPB A;  5KN3 A;  4HZ4 A;  2YJ7 A;  3C1S A;  5GSS A;  4GWR A;  1XW6 A;  2LNT A;  1U88 A;  5G31 A;  2VO4 A;  3GYK A;  1K3Y A;  1M9A A;  1GP1 A;  1B4P A;  2G2Q A;  2H30 A;  4NWY A;  1YF1 A;  1X9M B;  3GRX A;  1EV4 A;  1R5A A;  1V98 A;  3GST A;  4OD7 A;  2I3Y A;  1T4Y A;  4XS4 B;  4Z7X A;  2H76 A;  4NV2 A;  2ON7 A;  3KZQ A;  2RII A;  3ZRE A;  3KEB A;  3MIX A;  2VCZ A;  2LNS A;  3IR4 A;  1K0B A;  1N25 A;  4IQ1 A;  5A5K A;  4HS1 A;  2VUP A;  4KSO A;  3O6T A;  17GS A;  4TR3 A;  1QMV A;  3P90 A;  3ZTL A;  2HSN B;  2FGX A;  4WET A;  2I4A A;  1XFL A;  1SKS B;  2GSQ A;  2DIZ A;  2YWI A;  2F8F A;  2YNX A;  3F0I A;  1GLP A;  3KD0 A;  2J23 A;  4CW9 A;  4QMK A;  1ON4 A;  4JED A;  1CQH A;  2OAD A;  3IPZ A;  4YAP A;  2OE3 A;  1F37 A;  2X8C A;  4PX1 A;  5G30 A;  3LSZ A;  1OAZ A;  5C00 A;  4LL1 B;  2WS2 A;  4ISD A;  1TJD A;  3CWG A;  4I8B A;  4K7I A;  4MPF A;  3FHK A;  2WZ9 A;  4HU7 A;  2H73 A;  3ZMK A;  2RM5 A;  4A5P A;  4TR0 A;  4TR4 A;  1HD2 A;  2HNL A;  3EMX A;  3ZLP A;  3D21 A;  2H1G A;  4WKW A;  1JZW A;  4ZL8 A;  3L4N A;  2PUK C;  3FZ4 A;  3RPN A;  3UBL A;  5KOX A;  3DRN A;  3WGE A;  3RHC A;  5ECO B;  4YQV A;  1G7O A;  5FWG A;  4DSR A;  1ERT A;  1MDK A;  3IHQ A;  3CYN A;  4K9Z A;  5KOW A;  6GSY A;  4NAX A;  5ABR A;  4J56 E;  3MYD A;  5IO0 A;  2AYT A;  1H75 A;  1O8W A;  2HLS A;  4EC0 A;  1DE2 A;  2H71 A;  1OYJ A;  1GSF A;  4Z2R A;  5A34 A;  1ZYN A;  5A4W A;  3IC4 A;  2I81 A;  4PUA A;  1I9D A;  4KH7 A;  1BYE A;  1A2M A;  1A0R P;  2EFC A;  2GQM A;  1XIY A;  5HFK A;  5CNW A;  3S9F A;  3FR9 A;  4OMV A;  2OA7 A;  1A23 A;  3Q19 A;  1O85 A;  3QOU A;  1RK4 A;  4MJB A;  1O6J A;  1TK0 B;  2YWN A;  4GST A;  2OAC A;  3F6D A;  2K8V A;  1M99 A;  2LUS A;  4IGJ A;  2WB9 A;  4N3Z A;  1MD3 A;  3HKR A;  1EEJ A;  4PTS A;  3GKK A;  3CRT A;  1DBY A;  4K2X A;  1TU7 A;  2PGT A;  4EDY A;  2V32 A;  4AI6 A;  3ZFB A;  4XS6 A;  2M72 A;  1URM A;  4J57 E;  2REM A;  4WF5 A;  1X9S B;  1SL0 B;  2FY6 A;  1A2L A;  5F0G A;  1EOG A;  1GRX A;  3A2W A;  1I5G A;  2F8A A;  2PPT A;  1SK1 A;  2NVL A;  4OFM A;  4NV5 A;  2H0I A;  4WXT A;  1GSU A;  2CVB A;  2F9S A;  3LYK A;  1ST9 A;  3HVS A;  2YZU A;  4EL1 A;  3FRC A;  2DJJ A;  3TJF A;  3M0F A;  4GXZ A;  4XCS A;  1XWB A;  4ZB6 A;  1WPI A;  3LXT A;  13GS A;  2C3T A;  3FW2 A;  2PU9 C;  1R5P A;  2OBI A;  6GSX A;  4EO3 A;  1T1V A;  2MZC A;  3G9B A;  5ECH B;  3GKN A;  4HQZ A;  1Z7P A;  4ZBA A;  3LWA A;  2N5A A;  4O92 A;  2I1U A;  3GFK A;  3RPP A;  2C3N A;  3F4T A;  4MH2 A;  1AW9 A;  2C80 A;  5F05 A;  2CAQ A;  2QGV A;  2NBS A;  6GSV A;  1UVZ A;  3LW9 A;  3W8J A;  1ZYE A;  2KOK A;  3ZIT A;  4Z2T A;  1EV9 A;  4YKG A;  1GSY A;  3GX0 A;  1KEB A;  2LRT A;  3IA1 A;  1FO5 A;  3P8W A;  5CRH A;  3MDK A;  5IQY A;  1G6W A;  1J08 A;  1GSS A;  3UVH A;  4HUA A;  4G0L A;  2PVO C;  5ECP B;  3LG6 A;  3ME7 A;  4XRD A;  3UJ1 A;  5AIV A;  5G2Z A;  3VWW A;  5J47 A;  1XWC A;  3APQ A;  4G9H A;  3VFI A;  3HJO A;  18GS A;  1GH2 A;  2ZUP A;  2L4C A;  2K8S A;  3G7Y A;  4IKH A;  1R7H A;  2FLS A;  2FWF A;  2QKE A;  3HYP A;  1S3C A;  1WMJ A;  3PIN A;  2UZ8 A;  3PPU A;  4K7N A;  4GTU A;  3TKS E;  3FMW A;  2BJX A;  3CSI A;  3F8U A;  3FK8 A;  4K0N A;  1K3L A;  2IMK A;  2IL3 A;  3QFA C;  3TB2 A;  4YAV A;  2HSN A;  4BVX A;  2DJ0 A;  1GSQ A;  5BRT A;  2ON5 A;  2RM6 A;  4MJE A;  1K0M A;  1F3A A;  3A2X A;  4PQH A;  3VI5 A;  3LOR A;  3KXO A;  2GT6 A;  2H0H A;  1T8E B;  4ZB7 A;  5ELG A;  3SBC A;  1Z3E A;  5HR0 A;  3N9J A;  4ID0 A;  2A4H A;  2WRT A;  2IMD A;  3EIN A;  1F9M A;  4DSS A;  5IO2 A;  2HYX A;  2HI7 A;  5JCG A;  5B6M A;  3NZN A;  1V40 A;  4GQF A;  1HNC A;  3FZ9 A;  1THX A;  3ZIJ A;  3KMN A;  1YEX A;  1Z6M A;  4TVE A;  4QL9 A;  4QQ7 A;  1ERV A;  5DAK B;  3CTG A;  1Q98 A;  4ZB9 A;  3F63 A;  2R4V A;  1XXU A;  2OBK A;  2R0P A;  1W4V A;  2FUG 2;  4XHM A;  1M2A A;  5BMU A;  2DBC A;  5IPH A;  2A2R A;  2IME A;  1S3D A;  2HSY A;  2X8H A;  3LXZ A;  1PN9 A;  2LS5 A;  3KIJ A;  3C73 A;  4ICY A;  2YOI A;  3EWL A;  1USB A;  2HZF A;  4WEY A;  1FB0 A;  3HVX A;  3LYP A;  3E3E A;  1KBN A;  3J7Y b;  5E4W A;  4O32 A;  3J7Y k;  1PKW A;  1EWX A;  4MJC A;  4FYU A;  5HFG A;  22GS A;  4ZBB A;  1PSQ A;  4OFN A;  3H79 A;  4TN8 A;  1QXH A;  3GUS A;  1JZO A;  2IWT A;  4JE1 A;  1JZD A;  3GX8 A;  1FOH A;  3VWX A;  3I6A A;  4DSQ A;  3D4T A;  1GTB A;  4NHZ A;  1IYI A;  1ZYQ B;  1GTA A;  4MJA A;  1U3I A;  5CO3 A;  4HJM A;  2H19 A;  3F3Q A;  3VWV A;  3K8N A;  1SK2 A;  1UC7 A;  4F2I A;  2K9F A;  2LQQ A;  2K6V A;  1EP8 A;  1UA5 A;  4G10 A;  5HQP A;  3QFB C;  3QCP A;  1BQ7 A;  1O8X A;  1BF5 A;  1BJX A;  2TRX A;  3C8E A;  12GS A;  5ECS A;  2EIR A;  1TXX A;  2JU5 A;  2GZY A;  4ZL7 A;  4WF4 A;  3TKP A;  5IMF A;  1V9W A;  3FZ5 A;  4JR6 A;  2DSA A;  1GNE A;  3LEF A;  1S3A A;  4TKY A;  4K6X A;  1TRS A;  5B6N A;  1TTZ A;  4MK3 A;  1F3B A;  5ECR B;  4ZIL A;  3F9U A;  1OC3 A;  1MDI A;  1K0A A;  3HZ4 A;  3F3R A;  4Q5N A;  3H8Q A;  2JZR A;  3F4R A;  1YVL A;  2P0G A;  4AKI A;  2A2P A;  1SVM A;  4KE3 A;  2RLI A;  3RDW A;  1OC9 A;  4CDO A;  3L9V A;  2V6O A;  3QD9 A;  4KX4 A;  4D73 B;  5G1L A;  1C72 A;  1FOV A;  2AV4 A;  2FA8 A;  3TRX A;  1QUW A;  2P31 A;  4PNF A;  4L5O A;  2LST A;  2LEG A;  1E6B A;  4TXO B;  3IE3 A;  3UOM A;  3HA9 A;  4MZC A;  1X5E A;  5DVB A;  3FR6 A;  2PN8 A;  1PX7 A;  4EE0 A;  1YEP A;  5A5H B;  2VLT A;  3ZL5 A;  3FZA A;  3TRP A;  2P5R A;  2EIO A;  4AKX B;  4NXI A;  2CVK A;  1VF3 A;  2HZE B;  2GSR A;  3MAK A;  1VF2 A;  2GS3 A;  5HR2 A;  3IDV A;  3QPM A;  4MNN A;  2AJQ B;  1YKA A;  1HQO A;  4HOJ A;  4FQU A;  3BD2 A;  4RI7 A;  5HR3 A;  1XVQ A;  2I9H A;  1NM3 A;  5AIS A;  3UIW A;  5J4U A;  2Z9S A;  1YDK A;  2H0G A;  4ZL9 A;  3VWU A;  3VPT A;  2K18 A;  5IMC A;  1ZCP A;  3C71 A;  5DJM A;  1SJI A;  1ERU A;  1HNB A;  2XHF A;  4F03 A;  2JZS A;  4POK A;  5JWQ B;  2OJL A;  3EU4 A;  1MTC A;  3TOU A;  3ZVJ D;  4HQS A;  2QA1 A;  1VF1 A;  2MMA A;  5IMD A;  2VD0 A;  4EDZ A;  3DKS A;  1Z9H A;  1MDJ A;  5LCZ A;  4EF0 A;  4POM A;  5A4V A;  4L5L A;  2H01 A;  2ES7 A;  4GLT A;  1M2B A;  1O73 A;  3KM6 A;  3U5R E;  1GLQ A;  2WJU A;  3U6V A;  1SL1 B;  1TRU A;  4XRA A;  4V1A p;  4EIQ A;  4NMU A;  2HRF A;  3GSS A;  16GS A;  3US3 A;  6GST A;  2QSI A;  1FVJ A;  1UN2 A;  4O5U A;  5J4V A;  5EVO A;  5J9B A;  3GN3 A;  3TUE A;  4I97 A;  4IVF A;  1M9B A;  2H1A A;  1AC1 A;  2CX4 A;  4J2F A;  1FVK A;  3KH7 A;  4K8M A;  2HQT A;  5D9T A;  4AJ6 A;  4I2T A;  1RW1 A;  3GKX A;  2HRK B;  1XBS A;  2YJH A;  4KUN A;  2KLX A;  1ZMA A;  1T00 A;  3F4S A;  3CMI A;  2VL9 A;  3HMJ G;  2H1B A;  4ECC A;  1Q4J A;  4O5Q A;  1PMT A;  5HR1 A;  2MMZ A;  4MF7 A;  1OVN A;  1YQ1 A;  3NIV A;  1A2J A;  3O3T A;  5B8B A;  3IRA A;  10GS A;  1X0R A;  2O8V B;  3GIX A;  4GCI A;  1SD9 A;  2R37 A;  2WFC A;  2PER A;  2AB6 A;  3W8S A;  3UAP A;  2VCT A;  1U3A A;  6GSU A;  1PRX A;  1ERW A;  2DJ2 A;  1AUC A;  4PUR A;  4MZW A;  4Q5F A;  3DD3 A;  5IMV A;  1HYU A;  2GZP A;  1YF0 A;  5H5Q A;  3TU3 B;  2IMI A;  3L9U A;  2C8U A;  1JZR A;  4KF9 A;  1KNG A;  1TKD B;  2VD1 A;  2B6M A;  3FKF A;  3GL5 A;  2VL2 A;  1TRV A;  5DCG A;  4OCF A;  2VCQ A;  2LJR A;  2JAC A;  2IFQ A;  1PL2 A;  4BVY B;  4NPB A;  4OO5 A;  14GS A;  3RBT A;  3A5I A;  3BJ5 A;  4EIP A;  2LRN A;  4WR4 A;  3RHB A;  1A0F A;  5IPG A;  4IEL A;  1GTI A;  5D73 A;  3EPT A;  4G0I A;  4BWS A;  2FWE A;  2O89 A;  3EUR A;  2OKA A;  1JLV A;  4PQ1 A;  1E2Y A;  2IPA A;  4BPY A;  2MYG A;  5H5R A;  1FG4 A;  3ZIV A;  1GL8 A;  1B48 A;  3ZVJ A;  3FYG A;  1M7T A;  5DAL B;  2OT3 A;  4ECI A;  2MBT A;  3H4K A;  2N5F A;  2JSZ A;  1WIK A;  2V6K A;  1TI1 A;  2YWM A;  1U87 A;  4KA0 A;  5B7C A;  4RQX A;  3ERG A;  4I6X A;  3HCZ A;  2DJK A;  4G2E A;  5KN2 A;  4TXO A;  4OCE A;  5ELA A;  1T7P B;  1R4W A;  2YAN A;  4MP4 A;  2OE1 A;  2H8L A;  4XS4 A;  4F0B A;  5IM9 A;  2M46 A;  3G7J A;  2V41 A;  2HE3 A;  1XZO A;  1VF4 A;  2JAD A;  1NHY A;  4X1U A;  2IMF A;  4N10 A;  5JWO B;  4H86 A;  2R0C A;  2HZE A;  3IOS A;  4KND A;  4V2N A;  5G5E A;  1XOB A;  3LJR A;  2FNO A;  4IHU A;  1LJR A;  5KEJ A;  4OFT A;  4MF6 A;  4N0V A;  2CAI A;  4MAB A;  2DIY A;  2AAW A;  2C0G A;  2C1Y A;  1ILO A;  4GSS A;  3DEX A;  2CV4 A;  3KGK A;  4MCU A;  1YJ6 A;  4AJ8 A;  4Z2U A;  2ZNM A;  4RI6 A;  1JHB A;  1G7E A;  3TKS A;  1WOU A;  1SKR B;  4XS1 A;  1OKT A;  1PL1 A;  5J5N A;  2VL3 A;  1K0O A;  3ERF A;  5JWR B;  4MDC A;  3P2A A;  3D22 A;  5DBQ A;  2P5Q A;  3LGC A;  3O76 A;  2F51 A;  3LFL A;  1KTE A;  1MD4 A;  3HY2 A;  2X99 A;  3KTB A;  3ZYW A;  4F0C A;  2L59 A;  1PGT A;  5ECM B;  1FW1 A;  5GAP D;  2CZ3 A;  3M9J A;  2XBI A;  1SVO A;  3ERW A;  3DGQ A;  1OKD A;  4GRF A;  2GVP A;  4TR1 B;  1PA3 A;  3M1G A;  2BMX A;  4K5S A;  2L6D A;  3LQ7 A;  4DEJ A;  4ULX A;  1PN0 A;  4RUV A;  4TXV A;  4L0U A;  19GS A;  3A5W A;  5KN1 A;  2FWH A;  3BOA A;  3UAR A;  1B4Q A;  1AAZ A;  2EC4 A;  3HDC A;  4HDE A;  1SL2 B;  4KDU A;  4LLR A;  3EE2 A;  4EKZ A;  1EOH A;  3D0Z A;  5ECQ B;  4LMW A;  2CQ9 A;  4G19 A;  2B1L A;  1LBK A;  4V2L A;  3HD5 A;  3FY7 A;  2L4Q A;  5DCH A;  3IC8 A;  1K0C A;  2KP2 A;  6GSS A;  5A34 B;  3DYR A;  3CBU A;  2OE0 A;  3RAZ A;  3UBK A;  2X49 A;  3ZFL A;  5JCU A;  4XIH A;  5D96 A;  5J3R A;  3GTU B;  2E2M A;  3APO A;  2VCW A;  2EFH A;  1XVW A;  3QAV A;  5DQS A;  2B5E A;  4FIW A;  3H1N A;  4DVC A;  1Y6E A;  7GSS A;  3KMO A;  2RUF A;  1PD2 1;  1OE7 A;  5KN0 A;  5ECI B;  1ZOF A;  1SJZ A;  3L9S A;  2ALB A;  4GF0 A;  4BL7 B;  1TDI A;  9GSS A;  2TIR A;  1EEM A;  2MMO A;  2AUV A;  4ZXG A;  2CX3 A;  2GSS A;  1WP0 A;  3MWH A;  5LD0 A;  3E9J B;  4QL7 A;  2QA2 A;  2VOC A;  4O5R A;  4WR5 A;  2FWG A;  3GA4 A;  2IIY A;  1QGV A;  2H6X A;  5A1N B;  2H75 A;  2KP1 A;  4E8E A;  1U6T A;  3GNJ A;  4BVY A;  3KTL A;  1R26 A;  4X4J A;  3DWV A;  2R5G A;  2LQO A;  4MA9 A;  2WCI A;  2DML A;  2YWO A;  1A24 A;  2B1K A;  5AIX A;  4PGT A;  1J9B A;  1QK8 A;  4IJI A;  1XW5 A;  2NDO A;  1GUH A;  4GDF A;  4IS0 A;  4IP6 A;  3QR6 A;  3PH9 A;  1WWJ A;  3ZRD A;  2TRC P;  3R2Q A;  3L78 A;  4AGS A;  1V2A A;  1T3B A;  5LNK e;  3MSZ A;  1Z5Y E;  3GH6 A;  1EZK A;  1N2A A;  3IK9 A;  5H5S A;  2G0F A;  2GDR A;  3QAW A;  1FHE A;  5DAL A;  2LV3 A;  4PNG A;  5CP1 A;  2DJ1 A;  4IBP A;  4JU5 A;  3ZZX A;  2HFD A;  2YCD A;  3TJK A;  3DVW A;  4KSM A;  3WT1 A;  1V57 A;  3HVV A;  3UVT A;  2KHP A;  5INY A;  2PBJ A;  1YZX A;  2R0G A;  1W89 A;  2H66 A;  2LJK A;  2FCH A;  5JCW A;  1ACV A;  4YQU A;  4I2U A;  1F6M C;  2F3M A;  3GL3 A;  3TJG A;  2C3Q A;  3UMA A;  1AQV A;  1ZYP A;  5CYY A;  2MBS A;  3GH9 A;  1O7U A;  3HZ8 A;  4X0X A;  1TOF A;  5F07 A;  1BG5 A;  2E2G A;  3DXB A;  1X5D A;  4AF2 A;  4HEA 2;  2WDU A;  2B7K A;  2XPE A;  4BA7 A;  3A2V A;  3ISO A;  3OR5 A;  2JZT A;  1Z6N A;  1JLW A;  5F06 A;  2HT9 A;  5DQY A;  2B5Y A;  4IW9 A;  1JFU A;  3E0U A;  2DC5 A;  2L6C A;  2H6Y A;  5EY6 A;  4EXJ A;  5GZZ B;  4MH3 A;  3QDN A;  4W66 A;  4ZBD A;  4K1F A;  1AIU A;  3CSJ A;  4USS A;  4ML1 A;  5ENU A;  1TI3 A;  1Y1U A;  3D5J A;  1M0U A;  2VLU A;  1SYX A;  3EVI A;  5E59 A;  2VCX A;  4BVX B;  2JSY A;  5F8B A;  4POB A;  5IOX A;  4L0W A;  3HJP A;  4KAE A;  1SK0 A;  4GQC A;  5J41 A;  2H74 A;  3HHV A;  2XC2 A;  1A8L A;  1DUG A;  2J9H A;  2B3S A;  1ML6 A;  2GZZ A;  4K7O A;  4ML6 A;  2DJ3 A;  2YN1 A;  1TU8 A;  1WRY A;  3BBY A;  1EGO A;  2VM1 A;  4DSS B;  1F2E A;  5J4Y A;  1ABA A;  2YZH A;  4CY6 A;  5DAK A;  3ZML A;  4K5R A;  3IXR A;  1XOA A;  1GUK A;  3ED3 A;  1HNA A;  2NTO A;  4TR1 A;  2FA4 A;  2CVD A;  3Q18 A;  5FHI A;  3QAG A;  3Q74 A;  4PQI A;  5GAN D;  5GST A;  5BMU B;  1SU9 A;  2UV8 G;  5DDL A;  1AQW A;  2O87 A;  3FR3 A;  4KGI A;  2FHE A;  4TW5 A;  3EC3 A;  3BCK A;  2EFD A;  3APS A;  2N5B A;  4OO4 A;  3TOT A;  5D93 A;  4YQM A;  1A8Y A;  4TRX A;  2V1M A;  2LJA A;  5D8I A;  3TJB A;  1QQ2 A;  1TRW A;  1B8X A;  1EP7 A;  2B5X A;  3EYT A;  4WBR D;  3GTU A;  2R3X A;  4PUF C;  1VGL A;  4KCE A;  1GNW A;  2DMM A;  3W6G A;  1BG1 A;  3TJJ A;  1N8J A;  2O7K A;  3PGT A;  5ID2 B;  4MPG A;  2HXK A;  1ZZY A;  3A3T A;  4N30 A;  1B9Y C;  5EPF A;  8GSS A;  1SYR A;  3PR8 A;  1M2D A;  2A2S A;  2VCV A;  4F82 A;  4BL7 A;  4KW6 A;  2GLR A;  4CY8 A;  6GSW A;  4X43 A;  3KP9 A;  2LTK A;  2HSM B;  3GUR A;  1GSE A;  1TK8 B;  4V2M A;  1QFN A;  4ECB A;  5A1N A;  3HJM A;  1GTU A;  5HFI A;  1XWA A;  2D2Z A;  4HJ2 A;  3IBH A;  4G0K A;  2L57 A;  2H72 A;  4LMV A;  1O81 A;  3EMP A;  3KCM A;  4KDY A;  5D9X A;  1WE0 A;  2M80 A;  3QMX A;  2L5O A;  5A4U A;  2GTU A;  1GSD A;  4IQA A;  2R2J A;  3N5O A;  2HSH A;  3TDG A;  4AKH A;  3UL3 A;  1SJ6 A;  4N11 A;  4MLY A;  3H93 A;  1YKC A;  4GSN A;  2YP6 A;  2PMT A;  1SEN A;  3WGD A;  2GQL A;  2BTO T;  4D73 A;  2C0F A;  4XTS A;  1Z7R A;  4NHW A;  2VAF A;  2VL2 C;  4RQR A;  1K0D A;  2B7J A;  2GQK A;  5CRE A;  3VK9 A;  1OC9 B;  4O7H A;  2L5L A;  1XCC A;  1BAY A;  3TCO A;  1FAA A;  2PWJ A;  5EL8 A;  2A4V A;  2GGT A;  5A5H A;  3JCM L;  5J9C A;  3IV4 A;  4MMM A;  1ZL9 A;  4FYB A;  3C1R A;  2FD3 A;  4K0G A;  4FO5 A;  1XWG A;  1XW9 A;  3MNG A;  4ECJ A;  5G5F A;  4JZQ A;  3VPQ A;  1B9X C;  1FB6 A;  4FH8 A;  4E68 A;  4I5Q A;  5ECL B;  2MMN A;  3DVX A;  3FEU A;  2X8G A;  1XPV A;  2EIQ A;  3IAS 2;  3WYW A;  2LRC A;  3GV1 A;  3VLN A;  4P3Y B;  4FYC A;  3BCI A;  4ZB8 A;  3D6I A;  4EVM A;  4HZ2 A;  20GS A;  1IYH A;  3KP8 A;  5DJL A;  2WGR A;  5AN1 A;  2YV7 A;  4Q5Q A;  3GKM A;  3HXS A;  3WT2 A;  3TKR A;  4ACS A;  2V2G A;  3EU3 A;  2YV9 A;  1SD8 A;  4LL4 B;  4YKF A;  2KUC A;  1LU4 A;  3TRQ A;  2LKU A;  5D9V A;  4HU9 A;  1PQN A;  4V1A g;  4BWQ A;  4JR4 A;  3C7M A;  5B8A A;  4ILF A;  4G01 A;  3M9K A;  4L8E A;  4KCA A;  2HRA A;  4JBB A;  3I43 A;  4TOP A;  3P7X A;  1TP9 A;  1G6Y A;  1CQG A;  3CTF A;  3TKQ A;  1DSB A;  1H4O A;  2X64 A;  1TXU A;  1WJK A;  3DIE A;  4KDX A;  5J40 A;  4KB3 A;  3IAM 2;  4Q5R A;  2O85 A;  2VIM A;  4AKG A;  1SVL A;  1GUL A;  2CZ2 A;  2QC7 A;  1OE8 A;  2DKH A;  2DLX A;  1G0T A;  5CRW A;  3NOF A;  2WUL A;  3V1W A;  3SWL A;  11GS A;  4POL A;  3TKS C;  1EGR A;  2HRK A;  5FT3 A;  1TW9 A;  1X9W B;  3M3M A;  4ZIJ A;  2C0D A;  3VI7 A;  4LA1 A;  5CRD A;  3I69 A;  1T4Z A;  4IJ3 A;  2H1L A;  1RQM A;  1BX9 A;  5AGY A;  2CT6 A;  2EFE A;  4WBJ A;  5ECK B;  5IMZ A;  4IN0 A;  2C4J A;  3L0H A;  3D4M A;  5CAX A;  5G1K A;  1OC8 A;  1ZGN A;  4N0Z A;  1AXD A;  1VRS D;  4IP1 A;  1YY7 A;  1NHO A;  4EUY A;  5ID2 A;  2JL4 A;  2VLV A;  3CSH A;  3WD6 A;  5C04 A;  1BED A;  1THO A;  5IOW A;  4PXO A;  3AY8 A;  2GT5 A;  1X5C A;  3KJY A;  4F9Z A;  2VKZ G;  3R3E A;  3GMF A;  2YPM A;  2H6Z A;  2GST A;  2PVQ A;  3I9V 2;  2ZCT A;  4YH2 A;  2IJY A;  1K0N A;  1V58 A;  2HSM A;  3M8N A;  1AQX A;  5ECN B;  3IHG A;  1PX6 A;  3WGX A;  2XPD A;  3UEM A;  5IIZ A;  2DKI A;  2IN3 A;  2XBQ A;  3Q6O A;  5CRG A;  5L71 A;  2R6K A;  2H1D A;  2HRN A;  4AJ7 A;  2VM2 A;  2IFQ B;  3VUR A;  4MZB A;  3TGZ A;  1XWK A;  3F6F A;  5IMA A;  1SKW B;  4MF5 A;  1MEK A;  1PKZ A;  3KH9 A;  2E7P A;  1J0F A;  4JRR A;  1DE1 A;  1NSW A;  5D9W A;  1K3O A;  2CA8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...