4MF5A

Crystal structure of glutathione transferase bgramdraft_1843 from burkholderia graminis, target efi-507289, with traces of one gsh bound
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
238
structure length
238
Chain Sequence
YFQSMTDLSAFPITKKWPAAHPERLQLYSLPTPNGVKVSIMLEETGLPYEPHLVRFDTNDQLTPEFMSLNPNNKIPAIIDPNGPDGKPLPLFESGAILIYLADKTGQLIPQDAAGRYEAIQWVMFQMGGIGPMFGQLGFFHKFAGKEYEDKRPRDRYVAESKRLLGVLEQRLEGREWILGDQYSIADIATFPWVRNLIGFYEAGELVAIQDFPNVQRALAAFVARPAVVRGLDSPKRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase domain
publication title Crystal structure of glutathione transferase BgramDRAFT_1843 from Burkholderia graminis, Target EFI-507289, with traces of one GSH bound
rcsb
source organism Burkholderia graminis
total genus 77
structure length 238
sequence length 238
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2013-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4mf5A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4mf5A01
3F4SA 4IS0A 3W8JA 1TDIA 5A4UA 4TW5A 3VLNA 3D21A 1TJDA 1MD4A 1GSFA 5HFKA 2RIIA 1M2DA 2MBTA 5FHIA 4MF7A 2B7KA 3PGTA 4EKZA 5IMDA 3AY8A 2B5XA 4MPFA 2CX3A 3HVSA 1TK5B 22GSA 1TU8A 3GNJA 1XCCA 1PD21 4EE0A 5AGYA 1WP0A 2K8VA 3HA9A 4FYBA 2X64A 1GWCA 2YZHA 4ZIJA 2VM1A 3GURA 2C0DA 2BMXA 2V1MA 2JACA 4MMMA 3QR6A 5IQYA 2C3NA 3ED3A 4AJ6A 4AJ7A 3P2AA 2IMEA 3ZMKA 3IK7A 3P90A 4KNDA 2L6DA 4L0UA 3WT1A 2QKEA 1YEXA 2RLIA 6GSTA 2WJUA 3ZFLA 4AF2A 3EWLA 1F3BA 1LU4A 1SK0A 4WR5A 3DXBA 4WETA 5F8BA 3ZLPA 3ZVJA 4RQRA 2OADA 2DMMA 1J0FA 1TOFA 1SYRA 1OAZA 1TP9A 2NVLA 1TK8B 1ILOA 4XS4B 2GQMA 5GZZB 2M46A 1J9BA 4KUNA 5ID2A 2JADA 2HZFA 3UARA 4GLTA 4JE1A 2FWHA 2IIYA 2O87A 2P31A 1K3LA 1XZOA 2N5FA 3HKRA 2IWTA 3HZ4A 1DBYA 3R3EA 1USBA 2QC7A 3WT2A 3PR8A 3GH9A 3KP9A 1TRUA 2UZ8A 4EDYA 1TKDB 1B9YC 1X9SB 5IMAA 2IMKA 4WBJA 1OE8A 4OFTA 1AW9A 2XC2A 4USSA 3KD0A 1TK0B 3RDWA 1WPIA 4F2IA 4XS1A 5EVOA 1B8XA 1Z7PA 3F6DA 3M0FA 5EY6A 3F0IA 3DVXA 1RW1A 4XS6A 1V9WA 1C72A 4K0GA 5DJLA 2FUG2 1T00A 2WFCA 4ZB9A 4DEJA 4DSSA 2GLRA 3CTFA 4F9ZA 3C71A 2PU9C 4G0KA 1XBSA 5IPHA 4ECIA 1NW2A 4PGTA 1A2MA 5CYYA 4TR1A 4BVXB 3MDKA 1FG4A 4O92A 3DWVA 4P3YB 4X1UA 2JU5A 1K0DA 3LYKA 4ZB6A 1X5DA 2H8LA 1GTUA 3HJMA 5BMUA 3GKNA 2L59A 3IHQA 2HLSA 4PTSA 4HU9A 2I1UA 2GZPA 4FQUA 5DCHA 3ISOA 2OBIA 1RQMA 1U87A 3APSA 5IMCA 1SKSB 4OCFA 4LL1B 3DRNA 4MABA 1EV4A 4MLYA 3A2VA 2VCXA 1XW9A 4EL1A 1XWCA 5D8IA 2P5QA 3TKRA 5JWOB 1JLVA 6GSVA 2O7KA 1EEJA 1G0TA 3CRUA 4TKYA 3VFIA 1O73A 2R37A 1YDKA 4GSSA 3QDNA 3IOSA 4V2NA 5G2ZA 1EOGA 5ECSA 4ZILA 1PN9A 4I5QA 4EC0A 3MWHA 3FW2A 5B6NA 2M80A 2O89A 1TW9A 5JCWA 2ZCTA 1EV9A 5IOXA 4ILFA 3ZREA 3EINA 3QFAC 4G19A 4GTUA 1U6TA 2PERA 2VLUA 2B5EA 1I5GA 2YCDA 5IO2A 3KTLA 1KTEA 1NSWA 2AB6A 1KBNA 5DVBA 2DJ0A 3KTBA 2R2JA 4Q5NA 4I97A 3H79A 1EP8A 4OMVA 5H5SA 1H75A 1N8JA 5ID2B 3WGXA 2D2ZA 1PL2A 5D9TA 3F4TA 2E0QA 2LKUA 4N11A 2JZSA 3RAZA 1GSYA 4Q5FA 4KCAA 2LEGA 1WRYA 1FB0A 1FHEA 2DLXA 4MF5A 2TRXA 1Y6EA 1OC3A 3VWXA 5CO3A 2PVOC 3EMXA 3FZAA 2CT6A 3RPNA 4GCIA 4HJMA 4KCEA 4MJCA 4RUVA 4DSRA 1SKRB 3W8SA 1LJRA 2VD0A 4XCSA 2JL4A 2H0GA 1MD3A 3HD5A 2K8SA 3UL3A 2LRNA 2A4VA 3APOA 3EURA 1R5AA 5AIVA 4V2MA 4IKHA 3ERGA 4PNFA 2H6ZA 5IMVA 1X5CA 3UMAA 1FVJA 1Z3EA 4TRXA 4F82A 5ECPB 1AQVA 2MMNA 4TVEA 1F2EA 3TJBA 1X9MB 4KE3A 3RPPA 3KP8A 1K0BA 5JCGA 1NM3A 2MMZA 2DJKA 4BWSA 5F07A 4TR0A 4IN0A 3ZTLA 4TN8A 4XS4A 2H0IA 2X8CA 3CTGA 5CNWA 2C0EA 4LLRA 2OE0A 2K9FA 2LQOA 3ERWA 3TKSA 2LS5A 4YQMA 3P8WA 2B5YA 1PSQA 3LG6A 6GSSA 5J9BA 3G9BA 1W4VA 5CAXA 2ON5A 1YF0A 2AAWA 5ABRA 1QK8A 3GN3A 2HXKA 1Z6MA 4KSOA 2H01A 5IOWA 3NOFA 1XW5A 5ENUA 2VL9A 2VCWA 2KUCA 3KM6A 3IC4A 3LXZA 4HQSA 3MAKA 6GSWA 1RK4A 2AUVA 2X8HA 4KDYA 1WE0A 2P5RA 3F3RA 1THOA 3TKPA 4ECBA 2H0HA 3HDCA 3ZFBA 2VAFA 1KEBA 3GSTA 2CQ9A 3F8UA 3C1SA 1YF1A 2HFDA 2H66A 2L4QA 1GH2A 4POKA 2H75A 3LSZA 3F6FA 1UC7A 1SD9A 3LYPA 4MA9A 5IIZA 5G30A 1T7PB 2IMDA 4EXJA 4ZL9A 4IQAA 2K6VA 3LORA 1THXA 2DMLA 3KH9A 2NPBA 4HEA2 2MMOA 4BVXA 1SU9A 1N2AA 1AAZA 3TGZA 5J41A 2H74A 2YWOA 4HS1A 5CRHA 1UVZA 3GX8A 3HZ8A 2AV4A 2FWGA 2NDOA 5EPFA 1MTCA 3FR3A 4WF5A 4GQFA 3LXTA 4IELA 3GL5A 3W6GA 3IK9A 3VPQA 1QUWA 1YQ1A 1GTBA 3BCKA 2V6KA 2NTOA 5G1LA 19GSA 3EU4A 1X9WB 2H6XA 2FWEA 3H93A 4FIWA 2LTKA 4H86A 2VLVA 2HZEB 1QQ2A 4RQXA 1JZDA 1OYJA 3TDGA 2A2RA 2L4CA 1EWXA 5J5NA 2GQLA 1OKTA 1NHYA 2JZRA 4DVCA 3QMXA 2GGTA 4J56E 2MZCA 4CW9A 5ECRB 5INYA 2GSSA 3D0ZA 3VPTA 2N5AA 3TCOA 5ECKB 3HY2A 6GSUA 4JU5A 3HVXA 1G6YA 4NWYA 2RUEA 2G0FA 1ZYQB 4G2EA 2I4AA 5F05A 4N30A 3JCML 3FZ5A 4K7OA 2HRAA 3U5RE 1F3AA 4NXIA 3CSJA 5DALB 4MZCA 2C0GA 5A4VA 4AJ8A 2VUPA 5DAKB 2LNTA 3BBYA 4KB3A 1X0RA 4ID0A 12GSA 2KLXA 3HHVA 5D96A 1VF1A 3D5JA 4NPBA 2OBKA 5DDLA 1FOVA 5JCUA 1O81A 3DMLA 2H1GA 5AISA 4KGIA 1T4YA 2PUKC 4BWQA 2KP2A 1A0FA 2B3SA 3NZNA 2HSNB 2DJ1A 2H71A 2HRKB 4L8EA 4OD7A 2AHEA 5HR2A 2VOCA 3WD6A 3GL3A 2CA8A 1HD2A 4EVMA 3IC8A 5AN1A 2AJQB 4GSTA 3D6IA 2PN8A 4ML1A 1XIYA 4O5RA 1GLPA 2VCZA 3UIWA 5DCGA 1PKWA 3E0UA 3IRAA 1O8WA 3FK8A 1ST9A 1SK2A 4LMWA 4Z7XA 2XPDA 1W89A 1EEMA 2ON7A 1K0AA 1OE7A 1EP7A 2E7PA 3VURA 4G10A 3BD2A 3GKMA 1YKCA 1K0MA 1G7OA 4YQUA 1R5PA 5D9VA 2FNOA 5F06A 5LNKe 3D22A 4BL7B 3DD3A 4WKWA 1V57A 3ZITA 4PX1A 14GSA 5A4WA 4TXOA 3DEXA 3TRPA 3TOTA 3EYTA 3LGCA 3KMOA 4IHUA 1MEKA 3KH7A 4X0XA 2VL2C 4LL4B 4TR3A 4HU7A 3L0HA 6GSXA 4EUYA 5IMFA 2KP1A 2WDUA 2O85A 3C73A 4PQHA 1HQOA 1V2AA 4WBRD 2YNXA 3Q18A 2CVKA 2ZNMA 2CZ3A 3LFLA 5JWRB 2FCHA 5DJMA 2M72A 5J4UA 3SWLA 4IBPA 4PUAA 2YV7A 3KZQA 3PH9A 4KSMA 1AQXA 3KIJA 2VM2A 1XPVA 3ME8A 4ZBBA 1GULA 4V1Ap 3ZYWA 2OE1A 3C1RA 4NHZA 3VK9A 1IYIA 1SJIA 2XHFA 5JWQB 3IAS2 4EF0A 4YQVA 2VLTA 1FO5A 5A5KA 4G0LA 3TJJA 3A3TA 1Z6NA 5HFIA 2C3TA 4CHSA 1QXHA 1OKDA 2WS2A 2GVPA 1M0UA 2WRTA 2B6MA 3ZVJD 13GSA 1JFUA 2N5BA 4O32A 2EIRA 4I2TA 2Z9SA 1A8YA 3P7XA 5KN0A 2J23A 1HYUA 1ZCPA 1MDJA 1UN2A 5B6MA 4E8EA 5IMZA 4RI7A 2CX4A 3UVTA 2VCTA 3F63A 2FWFA 4DSQA 4JZQA 1WMJA 2B7JA 4MZBA 2DIYA 1BEDA 2YN1A 1O7UA 4JRRA 4JR6A 3TJGA 1QMVA 3H8QA 4POBA 3M9KA 1E6BA 3LWAA 3GUSA 2GDRA 1PRXA 3DIEA 1DE1A 1ZOFA 2YOIA 2HT9A 2HZEA 4K7IA 2C8UA 1QFNA 1GNEA 1BAYA 3ZZXA 3UVHA 2PPTA 3KEBA 5GAND 3Q19A 3I43A 2F8AA 1M2AA 1B4PA 1XVWA 2ZUPA 3HCZA 3MNGA 2XBQA 1AQWA 1F6MC 3I6AA 2V2GA 2WZ9A 16GSA 4HOJA 3APQA 1K0NA 3I69A 1OC8A 2H19A 5FWGA 2IFQB 5B8AA 3GIXA 3G7JA 2H70A 4ZB8A 3S9FA 3Q74A 3QPMA 10GSA 4N0VA 1JHBA 1YZXA 3N5OA 5DALA 4POMA 4IQ1A 2GQKA 3FR6A 3G7IA 3DKSA 4KDXA 5DAKA 4V2LA 2CAQA 1GTAA 1SKWB 1U3IA 3VI7A 2OJLA 4L0WA 1B4QA 4PQ1A 4J2FA 4HJ2A 1A24A 4TXOB 3GH6A 1YEPA 3BOAA 5IPGA 3SBCA 4LA1A 1R26A 4XHMA 1T8EB 3FYGA 3FRCA 2HE3A 3L9SA 3ZMLA 3QOUA 2R3XA 3O3TA 1X5EA 2LJKA 3US3A 1PA3A 3L9UA 3EVIA 3I9V2 1Z5YE 2G2QA 2FY6A 1SJ6A 2HRKA 4JBBA 1HNCA 11GSA 1VF3A 1XXUA 3KGKA 3GHAA 1ZYEA 3QCPA 3FR9A 5ECHB 5EL8A 4N10A 4V1Ag 4GWRA 4HQZA 3IV4A 2HSHA 3M3MA 4K2DA 1OC9B 3KJYA 1PMTA 1NHOA 1GRXA 5G1KA 4KAEA 2B1LA 4ACSA 2WGRA 2X99A 2R4VA 2YPMA 1G6WA 5KN2A 3GYKA 5GSSA 3FZ4A 3EE2A 4ECJA 3TRQA 1WJKA 3HJOA 2V6OA 2V41A 2PMTA 2IMIA 3IBHA 4BL7A 4MJAA 1O6JA 1TI1A 4D73B 3UEMA 5CRGA 4BVYA 5B8BA 3IDVA 4FH8A 1XFLA 1V98A 5CREA 1M2BA 1XOAA 4TR4A 2A2SA 3V1WA 4I8BA 3F3QA 3TB2A 2VIMA 1F9MA 2RUFA 3ERFA 5HR3A 1UA5A 17GSA 2QSIA 3QAWA 2WB9A 2FA8A 3CRTA 4HDEA 1E2YA 1A2JA 3OR5A 1XW6A 3KMNA 2CVDA 1MDIA 3N9JA 1F37A 4ZBDA 2CVBA 2LUSA 2GSQA 9GSSA 5CRWA 3UAPA 2HQTA 3GSSA 4OCEA 2C1YA 5LCZA 4HUAA 1XWBA 3D4TA 1Y25A 5COHA 3EC3A 1WWJA 1SL1B 5CP1A 1XWKA 4Q5QA 5ECLB 2ALBA 1B48A 2F8FA 1ERVA 1CQHA 2MMAA 2VL3A 3ME7A 4QQ7A 3WGEA 3G7YA 4OO5A 1U3AA 1ERTA 2XPEA 4PUFC 4ML6A 5CRDA 2R6KA 1A8LA 3ZRDA 3E3EA 1AC1A 2VCVA 3CMIA 5D93A 1JZRA 2IPAA 2VD1A 2E2MA 5FT3A 2YJHA 1A0RP 3RHBA 5IO0A 5DQSA 2HI7A 2EIOA 2GZZA 1EOHA 2GSTA 4GQCA 2WCIA 2LRCA 3GFKA 1ON4A 4XTSA 4KH7A 4MJEA 4ZXGA 4EO3A 1M7TA 2V32A 3Q6OA 4K1FA 4OFMA 2YV9A 4WEYA 2RM6A 2IL3A 2H6YA 2GT6A 4X43A 2YANA 3R2QA 1BYEA 1XWGA 5HFGA 1OVNA 5HR1A 2X8GA 2H1AA 3HYPA 2FA4A 1JZWA 2KOKA 5KN3A 4KF9A 3WGDA 20GSA 4IP1A 2B1KA 3CYNA 2CAIA 4KDUA 4MCUA 3UOMA 1ML6A 3CSIA 5ECQB 1HNBA 2OE3A 3TOUA 4HZ2A 2R5GA 3GTUB 1B9XC 3VWWA 3GMFA 1XOBA 5ECNB 4IP6A 6GSYA 2HYXA 4TOPA 4LMVA 5GSTA 3IAM2 3J7Yk 1ZZYA 4MDCA 2HNLA 2YWNA 1BJXA 1GNWA 1J08A 4XIHA 2F3MA 3TKSE 1SD8A 4YAPA 1ZMAA 4OO4A 2YZUA 1GSUA 4MJBA 5DBQA 2REMA 4NHWA 5ECIB 2YJ7A 3WYWA 3CXGA 1O8XA 1CQGA 3IE3A 2DJ3A 1V40A 1BQ7A 4IVFA 1TRWA 3C8EA 1BX9A 1GSEA 4BPYA 2IFQA 2PBJA 3BCIA 1R4WA 1DE2A 2FGXA 4F03A 5LD0A 1S3AA 5IM9A 2HSMB 1VRSD 4BVYB 2J9HA 5ELAA 5J3RA 1JLWA 4NV2A 4FO5A 4JEDA 3UBLA 1PKZA 2YP6A 5C00A 5HQPA 1PQNA 1SL2B 3QAVA 3M9JA 3KXOA 3TKSC 5G31A 4MF6A 1H4OA 1YJ6A 1AUCA 5DQYA 2I3YA 5D9XA 1K0CA 4MZWA 3O76A 4TXVA 4QL9A 1ACVA 2PGTA 4L5LA 5E59A 3HJPA 1VF4A 4CDOA 4GRFA 3GKKA 1GSQA 2IN3A 2H76A 2TIRA 5C04A 1FAAA 1SJZA 4NV5A 3GV1A 3A5WA 4RI6A 1AXDA 1T3BA 2WULA 2HRFA 2C80A 3ZL5A 2OACA 1OC9A 1Z9HA 1SK1A 2IJYA 4MK3A 4K9ZA 4PQIA 3D4MA 1Q98A 3TJFA 4IW9A 3F4RA 4MH2A 3L4NA 3RHCA 4ZBAA 5KN1A 3DGQA 4JR4A 1TTZA 2LNSA 1TRVA 3GRXA 4NAXA 4ULXA 4OWYA 4D73A 5J9CA 1TRSA 2E2GA 1S3CA 1T4ZA 1FW1A 1T1VA 1FVKA 3J7Yb 4I2UA 2L6CA 5F0GA 1GSSA 5G5FA 4O7HA 3IPZA 4HI7A 2EC4A 7GSSA 4HZ4A 4OFNA 1EZKA 2L57A 3QD9A 2OKAA 1M9BA 1PGTA 5ECOB 4GSNA 2DJ2A 3UJ1A 1PL1A 1BG5A 1WOUA 1K3OA 1SENA 3DVWA 2H1DA 3BJ5A 2O8VB 2P0GA 1ERUA 1U88A 3IXRA 4G0IA 4KW6A 3TJKA 3CBUA 4L5OA 4F0BA 3M1GA 1JZOA 3FZ9A 1DSBA 4IJIA 2L5LA 4E8HA 1V58A 4WF4A 4EDZA 1VGLA 2LRTA 4K0NA 2GT5A 1A2LA 1ERWA 4K7NA 1KNGA 3EMPA 5B7CA 1DUGA 1K0OA 1Z7RA 5G5EA 4Q5RA 1M9AA 4ISDA 3A2WA 1PX7A 3LJRA 4MPGA 2PVQA 2NBSA 4WXTA 2FD3A 5GAPD 3A2XA 1GL8A 18GSA 2IMFA 2F51A 1GUKA 2H72A 1SYXA 5KEJA 3L9VA 4F0CA 2GS3A 3QFBC 4IGJA 1YY7A 3H4KA 3MSZA 2XBIA 2RM5A 8GSSA 2TRCP 1GUMA 3E9JB 2LJAA 1TI3A 1TU7A 1I9DA 3EU3A 1Q4JA 4ZL7A 1A23A 1XWAA 4PURA 3VWVA 4FYUA 5AIXA 3GA4A 2KHPA 1M99A 2H1BA 4DSSB 5H5RA 4G9HA 5E4WA 3FHKA 3VI5A 2K18A 3H1NA 3C7MA 3M8NA 4XRDA 3K8NA 3KCMA 1XVQA 2GSRA 3PPUA 5ELGA 3TKQA 2AYTA 2HRNA 1AIUA 3FKFA 4TR1B 1ZGNA 3LQ7A 2I81A 2YWIA 3HXSA 2CZ2A 1VF2A 2F9SA 4ZL8A 3FY7A 1ZL9A 1K3YA 2LQQA 3GTUA 2DBCA 1S3DA 2DC5A 2PWJA 3FEUA 2C0FA 2JZTA 2GTUA 1G7EA 3O6TA 4N0ZA 1LBKA 1TXXA 1YKAA 3RBTA 2VL2A 5D9WA 2EIQA 4GXZA 5L71A 1EGOA 2OA7A 1SL0B 1GSDA 4ECCA 4NMUA 1GLQA 1QGVA 3PINA 5HR0A 2MBSA 3HVVA 2ES7A 4I6XA 4GF0A 1MDKA 4POLA 2I9HA 1FB6A 5D73A 5H5QA 3TUEA 2LJRA 2VO4A 3CSHA 3L78A 1PX6A 1EGRA 2HSYA 4PNGA 3ZIVA 4IJ3A 3QAGA 2BTOT 2CV4A 1GP1A 4MP4A 2DJJA 4KA0A 3GX0A 4YAVA 3LEFA 2HSMA 2VCQA 1HNAA 4XRAA 3VWUA 1IYHA 2FHEA 4QL7A 2DIZA 3TRXA 2BJXA 2C3QA 2YWMA 1GTIA 2L5OA 1GUHA 1WIKA 4BA7A 4K8MA 5ECMB 2H30A 3ZIJA 4J57E 2JSYA 3UBKA 4YH2A 2MYGA 2QGVA 2FLSA 3GKXA 4AGSA 4MH3A 1O85A 2GZYA 2DSAA 2LV3A 3NIVA 3U6VA 4KX4A 3IA1A 1ABAA 4FYCA 4K6XA 2JSZA 2H73A 3DYRA 4PXOA 1URMA 3IR4A 3F9UA 2LSTA 2C4JA 1R7HA 4WR4A
chains in the Genus database with same CATH superfamily
3F4SA 4IS0A 3W8JA 1TDIA 5A4UA 4TW5A 3VLNA 3D21A 1TJDA 1MD4A 1GSFA 5HFKA 2RIIA 1M2DA 2MBTA 5FHIA 4MF7A 2B7KA 3PGTA 4EKZA 5IMDA 3AY8A 4PHZC 4MNNA 2B5XA 4MPFA 2CX3A 3HVSA 1TK5B 22GSA 1TU8A 3GNJA 4Z2RA 1XCCA 1PD21 4EE0A 5AGYA 1WP0A 2K8VA 3HA9A 4FYBA 3CHXC 2X64A 1GWCA 2YZHA 4ZIJA 2VM1A 3GURA 2C0DA 2BMXA 2V1MA 2JACA 4MMMA 3QR6A 5IQYA 2C3NA 3ED3A 3LW9A 4AJ6A 4AJ7A 1SVOA 3P2AA 2IMEA 3ZMKA 3IK7A 3P90A 2DKIA 4KNDA 2L6DA 4L0UA 3WT1A 2QKEA 1YEXA 5KOXA 2RLIA 6GSTA 2WJUA 3ZFLA 4AF2A 3EWLA 1F3BA 1LU4A 1SK0A 4WR5A 3DXBA 4WETA 5F8BA 3ZLPA 2WVXA 3ZVJA 4RQRA 2OADA 4ZB7A 2DMMA 1J0FA 1TOFA 1SYRA 1OAZA 1TP9A 2NVLA 1TK8B 1ILOA 4XS4B 2GQMA 5GZZB 2M46A 1J9BA 4KUNA 5ID2A 2JADA 2HZFA 3UARA 4GLTA 4JE1A 2FWHA 2IIYA 2O87A 2P31A 1K3LA 1XZOA 2N5FA 3HKRA 2IWTA 3HZ4A 4HSCX 1DBYA 3R3EA 4G01A 1USBA 2QC7A 3WT2A 3PR8A 3GH9A 3KP9A 1TRUA 2UZ8A 4EDYA 1TKDB 1B9YC 1X9SB 5IMAA 2IMKA 2OT3A 4WBJA 1OE8A 4OFTA 2O5VA 1AW9A 2XC2A 4USSA 3KD0A 1TK0B 3RDWA 1WPIA 4F2IA 4XS1A 5EVOA 1B8XA 1Z7PA 3F6DA 3M0FA 5EY6A 3F0IA 3DVXA 1RW1A 4XS6A 1V9WA 1C72A 4K0GA 5DJLA 2FUG2 1T00A 2WFCA 4ZB9A 4DEJA 4DSSA 2GLRA 3CTFA 4F9ZA 3C71A 2PU9C 4G0KA 1XBSA 4PI2C 4ECIA 5IPHA 1NW2A 4PGTA 1A2MA 5CYYA 4TR1A 4BVXB 3MDKA 1FG4A 4O92A 3DWVA 4P3YB 4X1UA 2JU5A 1K0DA 3LYKA 4ZB6A 1X5DA 2H8LA 1GTUA 3HJMA 4O5UA 5BMUA 3GKNA 2L59A 3IHQA 1TXUA 2HLSA 4PTSA 4HU9A 2I1UA 2GZPA 4FQUA 5DCHA 3ISOA 2OBIA 1RQMA 1U87A 3APSA 5IMCA 4YKFA 1SKSB 4OCFA 4LL1B 5J4VA 3DRNA 4MABA 1EV4A 4MLYA 3A2VA 2VCXA 1XW9A 4EL1A 1XWCA 5D8IA 2P5QA 3TKRA 5JWOB 1JLVA 1S3RA 6GSVA 2O7KA 2A4HA 1EEJA 1G0TA 3CRUA 5KOWA 4TKYA 3VFIA 1O73A 2R37A 1YDKA 4GSSA 3QDNA 3IOSA 4V2NA 5G2ZA 1EOGA 5ECSA 4ZILA 1PN9A 2QA2A 4I5QA 4EC0A 3MWHA 3FW2A 5B6NA 2M80A 2O89A 1TW9A 5JCWA 2ZCTA 1EV9A 5IOXA 4ILFA 3ZREA 1N25A 4BIKA 3EINA 3QFAC 4G19A 4GTUA 1U6TA 2PERA 2VLUA 2B5EA 1I5GA 2YCDA 5IO2A 3KTLA 1KTEA 1NSWA 2AB6A 1KBNA 5DVBA 2DJ0A 3KTBA 2R2JA 1M3JA 4Q5NA 4I97A 3H79A 1EP8A 4OMVA 5H5SA 1H75A 1N8JA 5ID2B 3WGXA 2D2ZA 1PL2A 5D9TA 3F4TA 2E0QA 2LKUA 4N11A 2JZSA 3RAZA 1GSYA 4Q5FA 3FMWA 4KCAA 2LEGA 1WRYA 1FB0A 1FHEA 1Y1UA 2DLXA 4MF5A 2TRXA 1Y6EA 1OC3A 3VWXA 5CO3A 2PVOC 3EMXA 3FZAA 2CT6A 3RPNA 4GCIA 4HJMA 4KCEA 4MJCA 4RUVA 4DSRA 1SKRB 3W8SA 1LJRA 4PI0C 2VD0A 4XCSA 2JL4A 2H0GA 1MD3A 3HD5A 2K8SA 3UL3A 2LRNA 2A4VA 3APOA 4A5PA 3EURA 3CQFA 1R5AA 5AIVA 4V2MA 4EIPA 4IKHA 3ERGA 4PNFA 2H6ZA 5IMVA 1X5CA 3CWGA 3UMAA 2R0CA 1FVJA 1Z3EA 4TRXA 4F82A 5ECPB 1AQVA 2MMNA 4TVEA 1F2EA 3TJBA 1X9MB 4KE3A 3RPPA 3KP8A 1K0BA 4AKIA 5JCGA 1NM3A 2MMZA 2DJKA 4BWSA 5F07A 4TR0A 4IN0A 3ZTLA 4TN8A 4XS4A 2H0IA 2X8CA 3CTGA 5CNWA 2C0EA 4LLRA 2OE0A 2K9FA 2LQOA 3ERWA 3TKSA 2LS5A 4YQMA 3P8WA 2QA1A 2B5YA 1PSQA 3LG6A 6GSSA 5J9BA 2HSNA 3G9BA 1W4VA 5CAXA 2ON5A 4QMKA 1YF0A 2AAWA 2EFCA 5ABRA 3GN3A 1QK8A 2HXKA 1Z6MA 4KSOA 2H01A 5IOWA 3NOFA 1XW5A 5ENUA 2VL9A 1M3IA 2VCWA 2KUCA 3KM6A 3IC4A 5A5HA 3LXZA 4HQSA 3RFRC 3MAKA 6GSWA 1RK4A 2AUVA 2X8HA 4KDYA 1WE0A 2P5RA 3F3RA 1THOA 3TKPA 4ECBA 2H0HA 3HDCA 3ZFBA 2VAFA 1KEBA 3GSTA 2CQ9A 3F8UA 3C1SA 1YF1A 4Z2TA 2HFDA 2H66A 2L4QA 1GH2A 4POKA 2H75A 3LSZA 3F6FA 1UC7A 1SD9A 3LYPA 4MA9A 5IIZA 5G30A 1T7PB 2IMDA 4EXJA 4ZL9A 4IQAA 2K6VA 3LORA 4FXYP 5J40A 1THXA 2H1LA 2DMLA 3KH9A 2NPBA 4HEA2 4ICYA 2MMOA 4BVXA 1SU9A 1N2AA 2A2PA 1AAZA 3TGZA 5J41A 2H74A 2YWOA 4HS1A 5CRHA 1UVZA 3GX8A 3HZ8A 3EPTA 2AV4A 2FWGA 2NDOA 4AKGA 5EPFA 1MTCA 3FR3A 4WF5A 4GQFA 3LXTA 4IELA 3GL5A 3W6GA 3IK9A 3VPQA 1QUWA 1YQ1A 1GTBA 3BCKA 2V6KA 2NTOA 5G1LA 19GSA 3EU4A 1X9WB 2H6XA 2FWEA 3H93A 4FIWA 4N3ZA 2LTKA 4H86A 2VLVA 2HZEB 1QQ2A 4RQXA 1JZDA 1OYJA 3TDGA 2A2RA 2L4CA 1EWXA 5J5NA 2GQLA 1OKTA 1NHYA 2JZRA 4DVCA 3QMXA 2GGTA 4J56E 2MZCA 4CW9A 5ECRB 5INYA 2GSSA 3D0ZA 3VPTA 4GDFA 2N5AA 3TCOA 5ECKB 3HY2A 6GSUA 4JU5A 3HVXA 1G6YA 4NWYA 2RUEA 2G0FA 1ZYQB 4G2EA 2I4AA 5F05A 4N30A 3JCML 3FZ5A 4K7OA 2HRAA 2O3EA 3U5RE 1F3AA 4NXIA 3CSJA 5DALB 4MZCA 2C0GA 5A4VA 4AJ8A 2VUPA 5DAKB 2LNTA 4YKGA 3BBYA 4KB3A 1X0RA 4ID0A 12GSA 2WVZA 2KLXA 3HHVA 5D96A 1VF1A 3D5JA 4NPBA 2OBKA 5DDLA 1FOVA 5JCUA 1O81A 3DMLA 2H1GA 5AISA 4KGIA 1T4YA 2PUKC 4BWQA 2KP2A 1A0FA 2B3SA 3NZNA 2HSNB 2DJ1A 2H71A 2HRKB 4L8EA 4OD7A 2AHEA 5HR2A 2VOCA 3WD6A 3GL3A 2CA8A 1HD2A 4EVMA 3IC8A 5AN1A 2AJQB 4GSTA 3D6IA 2PN8A 4ML1A 1XIYA 3MYDA 4O5RA 1GLPA 2VCZA 3UIWA 5DCGA 1PKWA 5A5HB 3E0UA 3IRAA 1O8WA 3FK8A 1ST9A 1SK2A 4LMWA 4Z7XA 2XPDA 1W89A 1EEMA 2ON7A 1K0AA 1OE7A 1EP7A 2E7PA 3VURA 4G10A 3BD2A 3GKMA 1YKCA 1K0MA 1G7OA 4YQUA 1R5PA 5D9VA 1FOHA 2FNOA 5F06A 5LNKe 3D22A 4BL7B 3DD3A 4WKWA 1V57A 3ZITA 4PX1A 14GSA 5A4WA 4TXOA 3DEXA 3TRPA 3TOTA 3EYTA 3LGCA 3KMOA 4IHUA 2UV8G 1MEKA 3KH7A 4X0XA 2VL2C 4LL4B 3HVNA 4TR3A 4HU7A 3L0HA 6GSXA 4EUYA 5IMFA 2KP1A 2WDUA 2O85A 2VKZG 3C73A 4PQHA 1HQOA 1V2AA 4W66A 4WBRD 2YNXA 3Q18A 2CVKA 2ZNMA 2CZ3A 3LFLA 5JWRB 2FCHA 5DJMA 2M72A 5J4UA 3SWLA 1ZYNA 4IBPA 4PUAA 2YV7A 3KZQA 3PH9A 4KSMA 1AQXA 2EFDA 3KIJA 2VM2A 1XPVA 3ME8A 4ZBBA 3TU3B 1GULA 4V1Ap 3ZYWA 2WVYA 1XG8A 2OE1A 3C1RA 4NHZA 3VK9A 1IYIA 1SJIA 2XHFA 5JWQB 3IAS2 4EF0A 4YQVA 2VLTA 1FO5A 5A5KA 4G0LA 3TJJA 3A3TA 1Z6NA 5HFIA 2C3TA 4CHSA 1QXHA 1OKDA 2WS2A 2GVPA 1M0UA 2WRTA 2B6MA 3ZVJD 13GSA 1JFUA 4K5RA 2N5BA 4O32A 2EIRA 4I2TA 2Z9SA 2WW3A 1S4BP 1A8YA 3P7XA 5KN0A 2J23A 1HYUA 1ZCPA 1MDJA 1UN2A 5B6MA 4E8EA 5IMZA 4RI7A 2CX4A 3UVTA 2VCTA 3F63A 2FWFA 4DSQA 4JZQA 1WMJA 2B7JA 4MZBA 2DIYA 1BEDA 2YN1A 1O7UA 4JRRA 4JR6A 3RGBC 3TJGA 1QMVA 3H8QA 4POBA 2X4AA 3M9KA 1E6BA 3LWAA 3GUSA 2GDRA 1PRXA 3DIEA 1DE1A 1BF5A 1ZOFA 2YOIA 2HT9A 2HZEA 4K7IA 2C8UA 1QFNA 1GNEA 1BAYA 3ZZXA 3UVHA 2PPTA 3KEBA 5GAND 3Q19A 3I43A 2WW0A 2F8AA 1M2AA 1B4PA 1XVWA 2ZUPA 3HCZA 3MNGA 2XBQA 1AQWA 1F6MC 3I6AA 2V2GA 2WZ9A 16GSA 2EFHA 4HOJA 3APQA 1K0NA 3I69A 1OC8A 2H19A 5FWGA 2IFQB 5B8AA 3GIXA 3G7JA 2H70A 4ZB8A 3S9FA 3Q74A 3QPMA 10GSA 4N0VA 1JHBA 1YZXA 3N5OA 5DALA 4POMA 4IQ1A 2GQKA 3FR6A 3G7IA 3DKSA 4KDXA 5DAKA 2EFEA 4V2LA 2CAQA 1GTAA 1SKWB 1U3IA 3VI7A 2OJLA 4L0WA 1B4QA 4PQ1A 4J2FA 4HJ2A 1A24A 4TXOB 3GH6A 1YEPA 3BOAA 5IPGA 3SBCA 4LA1A 4AKHA 1R26A 4XHMA 1T8EB 3FYGA 3FRCA 2HE3A 3L9SA 3ZMLA 3QOUA 2R3XA 3O3TA 1X5EA 2LJKA 3US3A 1SVMA 1PA3A 2DKHA 3L9UA 3EVIA 3I9V2 1Z5YE 2G2QA 2FY6A 1SJ6A 2HRKA 4JBBA 1HNCA 11GSA 1VF3A 1XXUA 3KGKA 3GHAA 1ZYEA 3QCPA 3FR9A 5ECHB 5EL8A 4N10A 4V1Ag 4GWRA 2WW2A 4HQZA 3IV4A 2HSHA 3M3MA 4K2DA 1OC9B 3KJYA 1PMTA 1NHOA 1GRXA 5G1KA 4KAEA 2B1LA 4ACSA 2WGRA 2X99A 2R4VA 2YPMA 1G6WA 5KN2A 3GYKA 5GSSA 3FZ4A 3EE2A 4ECJA 3TRQA 1WJKA 3HJOA 2V6OA 2V41A 2PMTA 2IMIA 3IBHA 4BL7A 4MJAA 1O6JA 1TI1A 4D73B 3UEMA 5CRGA 4BVYA 5B8BA 3IDVA 4FH8A 1XFLA 1V98A 5CREA 1M2BA 1XOAA 4TR4A 2A2SA 3V1WA 4I8BA 3F3QA 3TB2A 2VIMA 1F9MA 2RUFA 3ERFA 5HR3A 1UA5A 17GSA 2QSIA 3QAWA 2WB9A 2FA8A 3CRTA 4HDEA 1E2YA 1A2JA 1XW6A 3OR5A 3KMNA 2CVDA 1MDIA 3N9JA 1F37A 4ZBDA 2CVBA 2LUSA 2GSQA 9GSSA 5CRWA 3UAPA 2HQTA 3GSSA 4OCEA 2C1YA 5LCZA 4HUAA 1XWBA 3D4TA 1Y25A 5COHA 3EC3A 1WWJA 1SL1B 5CP1A 1XWKA 4Q5QA 5ECLB 2ALBA 1B48A 2F8FA 1ERVA 1CQHA 1ZYPA 2MMAA 2VL3A 3ME7A 4QQ7A 3WGEA 3G7YA 4OO5A 1U3AA 1ERTA 2XPEA 4PUFC 4ML6A 5CRDA 2R6KA 1A8LA 3ZRDA 3E3EA 1BG1A 1AC1A 2VCVA 3CMIA 5D93A 1JZRA 2IPAA 1SVLA 2VD1A 2E2MA 5FT3A 2YJHA 1A0RP 3RHBA 5IO0A 2WW1A 5DQSA 2HI7A 2EIOA 2GZZA 1EOHA 2GSTA 4GQCA 2WCIA 2LRCA 3GFKA 1ON4A 4XTSA 4CY8A 4KH7A 4MJEA 4ZXGA 4EO3A 4X4JA 1M7TA 2V32A 3Q6OA 4K1FA 4OFMA 5A34B 2YV9A 4WEYA 2RM6A 2IL3A 2H6YA 2GT6A 4X43A 2YANA 3R2QA 1BYEA 1XWGA 5HFGA 1OVNA 5HR1A 2X8GA 2H1AA 3HYPA 2FA4A 1JZWA 2KOKA 5KN3A 4KF9A 3WGDA 20GSA 4IP1A 2B1KA 3CYNA 2CAIA 4KDUA 4MCUA 3UOMA 1ML6A 3CSIA 5ECQB 1HNBA 2OE3A 3TOUA 4HZ2A 2R5GA 3GTUB 1B9XC 3VWWA 3GMFA 1XOBA 5ECNB 4IP6A 6GSYA 2HYXA 4TOPA 4LMVA 5GSTA 3IAM2 3J7Yk 1ZZYA 4MDCA 2HNLA 2YWNA 1BJXA 1GNWA 1J08A 4XIHA 2F3MA 3TKSE 1YEWC 1SD8A 2O36A 4YAPA 1ZMAA 4OO4A 2YZUA 1GSUA 4MJBA 5DBQA 2REMA 4NHWA 5ECIB 2YJ7A 3WYWA 3CXGA 1O8XA 1CQGA 3IE3A 2DJ3A 1V40A 1BQ7A 4IVFA 1TRWA 3C8EA 1BX9A 1GSEA 4BPYA 2IFQA 2PBJA 3BCIA 1R4WA 1DE2A 2FGXA 4F03A 5LD0A 1S3AA 4EIQA 5IM9A 2HSMB 1VRSD 4BVYB 4Z2UA 2J9HA 5ELAA 5J3RA 1JLWA 4NV2A 4FO5A 4JEDA 3UBLA 1PKZA 2YP6A 5C00A 5HQPA 1PQNA 1SL2B 5J47A 3QAVA 3M9JA 3KXOA 3TKSC 5G31A 4MF6A 1H4OA 1YJ6A 1AUCA 5DQYA 2I3YA 5D9XA 1K0CA 4MZWA 3O76A 4TXVA 4QL9A 1ACVA 2PGTA 4L5LA 5E59A 3HJPA 1VF4A 4CDOA 2R0GA 4GRFA 3GKKA 1GSQA 2IN3A 2H76A 2TIRA 5C04A 1FAAA 1SJZA 4NV5A 3GV1A 3A5WA 4RI6A 3MIXA 1AXDA 1T3BA 4O5QA 2WULA 2HRFA 2C80A 3ZL5A 2OACA 5A1NB 1OC9A 1Z9HA 1SK1A 2IJYA 5BMUB 4E68A 4MK3A 4K9ZA 4PQIA 3D4MA 1Q98A 3TJFA 4IW9A 3F4RA 4MH2A 3L4NA 3RHCA 4ZBAA 5KN1A 3DGQA 4JR4A 1TTZA 2LNSA 1TRVA 3GRXA 4NAXA 4ULXA 4AKXB 4OWYA 4D73A 5J9CA 1TRSA 2E2GA 1S3CA 1T4ZA 1FW1A 1T1VA 1FVKA 3J7Yb 4I2UA 2L6CA 5F0GA 1GSSA 5G5FA 4O7HA 3IPZA 4HI7A 2EC4A 7GSSA 4HZ4A 4OFNA 1EZKA 2L57A 3QD9A 2OKAA 1M9BA 1PGTA 5ECOB 4GSNA 2DJ2A 3UJ1A 1PL1A 1BG5A 1WOUA 1K3OA 1SENA 3DVWA 2H1DA 1YVLA 3BJ5A 2O8VB 2P0GA 1ERUA 1U88A 3IXRA 4G0IA 4KW6A 3TJKA 3CBUA 4L5OA 4F0BA 2WVXB 3M1GA 1JZOA 3FZ9A 1DSBA 4IJIA 2L5LA 4E8HA 1V58A 4WF4A 4EDZA 1VGLA 2LRTA 4K0NA 2GT5A 1A2LA 1ERWA 4K7NA 1KNGA 3EMPA 5B7CA 3A5IA 1DUGA 1K0OA 1Z7RA 5G5EA 4Q5RA 1M9AA 4ISDA 3A2WA 1PN0A 1PX7A 3LJRA 4K5SA 4MPGA 2PVQA 2NBSA 4WXTA 2FD3A 5GAPD 3A2XA 1GL8A 18GSA 2IMFA 5J4YA 2F51A 1PFOA 1GUKA 2H72A 1SYXA 5KEJA 3L9VA 4F0CA 2GS3A 3QFBC 4IGJA 1YY7A 3H4KA 3MSZA 2XBIA 2RM5A 8GSSA 2TRCP 1GUMA 3E9JB 2LJAA 4K2XA 1TI3A 1TU7A 1I9DA 3EU3A 1Q4JA 4ZL7A 1A23A 1XWAA 4PURA 5A34A 3VWVA 4FYUA 5AIXA 3GA4A 2KHPA 1M99A 2H1BA 4DSSB 5H5RA 4G9HA 5E4WA 3FHKA 3VI5A 2K18A 3H1NA 3C7MA 3M8NA 4XRDA 3K8NA 3KCMA 1XVQA 2GSRA 3PPUA 5ELGA 3TKQA 2AYTA 2HRNA 1AIUA 3FKFA 4TR1B 1ZGNA 3LQ7A 2I81A 2YWIA 3HXSA 2CZ2A 1VF2A 2F9SA 4ZL8A 3FY7A 1ZL9A 1K3YA 2LQQA 3GTUA 2DBCA 1S3DA 2DC5A 2PWJA 3FEUA 2C0FA 2JZTA 2GTUA 1G7EA 3O6TA 4N0ZA 1LBKA 1TXXA 1YKAA 3RBTA 2VL2A 5D9WA 2EIQA 4GXZA 5BRTA 5L71A 1EGOA 4AI6A 2OA7A 1SL0B 1GSDA 4CY6A 4ECCA 4NMUA 1GLQA 1QGVA 3PINA 5HR0A 2MBSA 3HVVA 2ES7A 4I6XA 4GF0A 1I1IP 2R0PA 1MDKA 4POLA 2WZSA 2I9HA 1FB6A 5D73A 5H5QA 3TUEA 2LJRA 2VO4A 3CSHA 3L78A 1PX6A 1EGRA 2HSYA 2X49A 4PNGA 3ZIVA 4IJ3A 3QAGA 2BTOT 2CV4A 1GP1A 4MP4A 2DJJA 4KA0A 3GX0A 4YAVA 3LEFA 2HSMA 2VCQA 1HNAA 3IHGA 4XRAA 3VWUA 3HMJG 1IYHA 2FHEA 4QL7A 2DIZA 3TRXA 2BJXA 2C3QA 2YWMA 1GTIA 2L5OA 1GUHA 1WIKA 4BA7A 4K8MA 5ECMB 2H30A 3ZIJA 4J57E 2JSYA 3UBKA 4YH2A 2MYGA 2QGVA 2FLSA 3GKXA 4AGSA 4MH3A 1O85A 2GZYA 2DSAA 2LV3A 3NIVA 3U6VA 4KX4A 3IA1A 1ABAA 4FYCA 4K6XA 2JSZA 2H73A 3DYRA 5A1NA 4PXOA 1URMA 3IR4A 3F9UA 2LSTA 2C4JA 1R7HA 4WR4A
chains in the Genus database with same CATH topology
3F4SA 4IS0A 3W8JA 1TDIA 5A4UA 4TW5A 3VLNA 3D21A 1TJDA 1MD4A 1GSFA 5HFKA 2RIIA 1M2DA 2MBTA 5FHIA 4MF7A 2B7KA 3PGTA 4EKZA 5IMDA 3AY8A 4MNNA 2B5XA 4MPFA 2CX3A 3HVSA 1TK5B 22GSA 1TU8A 3GNJA 4Z2RA 1XCCA 1PD21 4EE0A 5AGYA 1WP0A 2K8VA 3HA9A 4FYBA 2X64A 1GWCA 2YZHA 4ZIJA 2VM1A 3GURA 2C0DA 2BMXA 2V1MA 2JACA 4MMMA 3QR6A 5IQYA 2C3NA 3ED3A 3LW9A 4AJ6A 4AJ7A 1SVOA 3P2AA 2IMEA 3ZMKA 3IK7A 3P90A 2DKIA 4KNDA 2L6DA 4L0UA 3WT1A 2QKEA 1YEXA 5KOXA 2RLIA 6GSTA 2WJUA 3ZFLA 4AF2A 3EWLA 1F3BA 1LU4A 1SK0A 4WR5A 3DXBA 4WETA 5F8BA 3ZLPA 3ZVJA 4RQRA 2OADA 4ZB7A 2DMMA 1J0FA 1TOFA 1SYRA 1OAZA 1TP9A 2NVLA 1TK8B 1ILOA 4XS4B 2GQMA 5GZZB 2M46A 1J9BA 4KUNA 5ID2A 2JADA 2HZFA 3UARA 4GLTA 4JE1A 2FWHA 2IIYA 2O87A 2P31A 1K3LA 1XZOA 2N5FA 3HKRA 2IWTA 3HZ4A 1DBYA 3R3EA 4G01A 1USBA 2QC7A 3WT2A 3PR8A 3GH9A 3KP9A 1TRUA 2UZ8A 4EDYA 1TKDB 1B9YC 1X9SB 5IMAA 2IMKA 2OT3A 4WBJA 1OE8A 4OFTA 2O5VA 1AW9A 2XC2A 4USSA 3KD0A 1TK0B 3RDWA 1WPIA 4F2IA 4XS1A 5EVOA 1B8XA 1Z7PA 3F6DA 3M0FA 5EY6A 3F0IA 3DVXA 1RW1A 4XS6A 1V9WA 1C72A 4K0GA 5DJLA 2FUG2 1T00A 2WFCA 4ZB9A 4DEJA 4DSSA 2GLRA 3CTFA 4F9ZA 3C71A 2PU9C 4G0KA 1XBSA 5IPHA 4ECIA 1NW2A 4PGTA 1A2MA 5CYYA 4TR1A 4BVXB 3MDKA 1FG4A 4O92A 3DWVA 4P3YB 4X1UA 2JU5A 1K0DA 3LYKA 4ZB6A 1X5DA 2H8LA 1GTUA 3HJMA 4O5UA 5BMUA 3GKNA 2L59A 3IHQA 1TXUA 2HLSA 4PTSA 4HU9A 2I1UA 2GZPA 4FQUA 5DCHA 3ISOA 2OBIA 1RQMA 1U87A 3APSA 5IMCA 4YKFA 1SKSB 4OCFA 4LL1B 5J4VA 3DRNA 4MABA 1EV4A 4MLYA 3A2VA 2VCXA 1XW9A 4EL1A 1XWCA 5D8IA 2P5QA 3TKRA 5JWOB 1JLVA 6GSVA 2O7KA 2A4HA 1EEJA 1G0TA 3CRUA 5KOWA 4TKYA 3VFIA 1O73A 2R37A 1YDKA 4GSSA 3QDNA 3IOSA 4V2NA 5G2ZA 1EOGA 5ECSA 4ZILA 1PN9A 2QA2A 4I5QA 4EC0A 3MWHA 3FW2A 5B6NA 2M80A 2O89A 1TW9A 5JCWA 2ZCTA 1EV9A 5IOXA 4ILFA 3ZREA 1N25A 3EINA 3QFAC 4G19A 4GTUA 1U6TA 2PERA 2VLUA 2B5EA 1I5GA 2YCDA 5IO2A 3KTLA 1KTEA 1NSWA 2AB6A 1KBNA 5DVBA 2DJ0A 3KTBA 2R2JA 4Q5NA 4I97A 3H79A 1EP8A 4OMVA 5H5SA 1H75A 1N8JA 5ID2B 3WGXA 2D2ZA 1PL2A 5D9TA 3F4TA 2E0QA 2LKUA 4N11A 2JZSA 3RAZA 1GSYA 4Q5FA 3FMWA 4KCAA 2LEGA 1WRYA 1FB0A 1FHEA 1Y1UA 2DLXA 4MF5A 2TRXA 1Y6EA 1OC3A 3VWXA 5CO3A 2PVOC 3EMXA 3FZAA 2CT6A 3RPNA 4GCIA 4HJMA 4KCEA 4MJCA 4RUVA 4DSRA 1SKRB 3W8SA 1LJRA 2VD0A 4XCSA 2JL4A 2H0GA 1MD3A 3HD5A 2K8SA 3UL3A 2LRNA 2A4VA 3APOA 4A5PA 3EURA 1R5AA 5AIVA 4V2MA 4EIPA 4IKHA 3ERGA 4PNFA 2H6ZA 5IMVA 1X5CA 3CWGA 3UMAA 2R0CA 1FVJA 1Z3EA 4TRXA 4F82A 5ECPB 1AQVA 2MMNA 4TVEA 1F2EA 3TJBA 1X9MB 4KE3A 3RPPA 3KP8A 1K0BA 4AKIA 5JCGA 1NM3A 2MMZA 2DJKA 4BWSA 5F07A 4TR0A 4IN0A 3ZTLA 4TN8A 4XS4A 2H0IA 2X8CA 3CTGA 5CNWA 2C0EA 4LLRA 2OE0A 2K9FA 2LQOA 3ERWA 3TKSA 2LS5A 4YQMA 3P8WA 2QA1A 2B5YA 1PSQA 3LG6A 6GSSA 5J9BA 2HSNA 3G9BA 1W4VA 5CAXA 2ON5A 4QMKA 1YF0A 2AAWA 2EFCA 5ABRA 3GN3A 1QK8A 2HXKA 1Z6MA 4KSOA 2H01A 5IOWA 3NOFA 1XW5A 5ENUA 2VL9A 2VCWA 2KUCA 3KM6A 3IC4A 5A5HA 3LXZA 4HQSA 3MAKA 6GSWA 1RK4A 2AUVA 2X8HA 4KDYA 1WE0A 2P5RA 3F3RA 1THOA 3TKPA 4ECBA 2H0HA 3HDCA 3ZFBA 2VAFA 1KEBA 3GSTA 2CQ9A 3F8UA 3C1SA 1YF1A 4Z2TA 2HFDA 2H66A 2L4QA 1GH2A 4POKA 2H75A 3LSZA 3F6FA 1UC7A 1SD9A 3LYPA 4MA9A 5IIZA 5G30A 1T7PB 2IMDA 4EXJA 4ZL9A 4IQAA 2K6VA 3LORA 5J40A 1THXA 2H1LA 2DMLA 3KH9A 2NPBA 4HEA2 4ICYA 2MMOA 4BVXA 1SU9A 1N2AA 2A2PA 1AAZA 3TGZA 5J41A 2H74A 2YWOA 4HS1A 5CRHA 1UVZA 3GX8A 3HZ8A 3EPTA 2AV4A 2FWGA 2NDOA 4AKGA 5EPFA 1MTCA 3FR3A 4WF5A 4GQFA 3LXTA 4IELA 3GL5A 3W6GA 3IK9A 3VPQA 1QUWA 1YQ1A 1GTBA 3BCKA 2V6KA 2NTOA 5G1LA 19GSA 3EU4A 1X9WB 2H6XA 2FWEA 3H93A 4FIWA 4N3ZA 2LTKA 4H86A 2VLVA 2HZEB 1QQ2A 4RQXA 1JZDA 1OYJA 3TDGA 2A2RA 2L4CA 1EWXA 5J5NA 2GQLA 1OKTA 1NHYA 2JZRA 4DVCA 3QMXA 2GGTA 4J56E 2MZCA 4CW9A 5ECRB 5INYA 2GSSA 3D0ZA 3VPTA 4GDFA 2N5AA 3TCOA 5ECKB 3HY2A 6GSUA 4JU5A 3HVXA 1G6YA 4NWYA 2RUEA 2G0FA 1ZYQB 4G2EA 2I4AA 5F05A 4N30A 3JCML 3FZ5A 4K7OA 2HRAA 3U5RE 1F3AA 4NXIA 3CSJA 5DALB 4MZCA 2C0GA 5A4VA 4AJ8A 2VUPA 5DAKB 2LNTA 4YKGA 3BBYA 4KB3A 1X0RA 4ID0A 12GSA 2KLXA 3HHVA 5D96A 1VF1A 3D5JA 4NPBA 2OBKA 5DDLA 1FOVA 5JCUA 1O81A 3DMLA 2H1GA 5AISA 4KGIA 1T4YA 2PUKC 4BWQA 2KP2A 1A0FA 2B3SA 3NZNA 2HSNB 2DJ1A 2H71A 2HRKB 4L8EA 4OD7A 2AHEA 5HR2A 2VOCA 3WD6A 3GL3A 2CA8A 1HD2A 4EVMA 3IC8A 5AN1A 2AJQB 4GSTA 3D6IA 2PN8A 4ML1A 1XIYA 3MYDA 4O5RA 1GLPA 2VCZA 3UIWA 5DCGA 1PKWA 5A5HB 3E0UA 3IRAA 1O8WA 3FK8A 1ST9A 1SK2A 4LMWA 4Z7XA 2XPDA 1W89A 1EEMA 2ON7A 1K0AA 1OE7A 1EP7A 2E7PA 3VURA 4G10A 3BD2A 3GKMA 1YKCA 1K0MA 1G7OA 4YQUA 1R5PA 5D9VA 1FOHA 2FNOA 5F06A 5LNKe 3D22A 4BL7B 3DD3A 4WKWA 1V57A 3ZITA 4PX1A 14GSA 5A4WA 4TXOA 3DEXA 3TRPA 3TOTA 3EYTA 3LGCA 3KMOA 4IHUA 2UV8G 1MEKA 3KH7A 4X0XA 2VL2C 4LL4B 4TR3A 4HU7A 3L0HA 6GSXA 4EUYA 5IMFA 2KP1A 2WDUA 2O85A 2VKZG 3C73A 4PQHA 1HQOA 1V2AA 4W66A 4WBRD 2YNXA 3Q18A 2CVKA 2ZNMA 2CZ3A 3LFLA 5JWRB 2FCHA 5DJMA 2M72A 5J4UA 3SWLA 1ZYNA 4IBPA 4PUAA 2YV7A 3KZQA 3PH9A 4KSMA 1AQXA 2EFDA 3KIJA 2VM2A 1XPVA 3ME8A 4ZBBA 3TU3B 1GULA 4V1Ap 3ZYWA 2OE1A 3C1RA 4NHZA 3VK9A 1IYIA 1SJIA 2XHFA 5JWQB 3IAS2 4EF0A 4YQVA 2VLTA 1FO5A 5A5KA 4G0LA 3TJJA 3A3TA 1Z6NA 5HFIA 2C3TA 4CHSA 1QXHA 1OKDA 2WS2A 2GVPA 1M0UA 2WRTA 2B6MA 3ZVJD 13GSA 1JFUA 4K5RA 2N5BA 4O32A 2EIRA 4I2TA 2Z9SA 1A8YA 3P7XA 5KN0A 2J23A 1HYUA 1ZCPA 1MDJA 1UN2A 5B6MA 4E8EA 5IMZA 4RI7A 2CX4A 3UVTA 2VCTA 3F63A 2FWFA 4DSQA 4JZQA 1WMJA 2B7JA 4MZBA 2DIYA 1BEDA 2YN1A 1O7UA 4JRRA 4JR6A 3TJGA 1QMVA 3H8QA 4POBA 2X4AA 3M9KA 1E6BA 3LWAA 3GUSA 2GDRA 1PRXA 3DIEA 1DE1A 1BF5A 1ZOFA 2YOIA 2HT9A 2HZEA 4K7IA 2C8UA 1QFNA 1GNEA 1BAYA 3ZZXA 3UVHA 2PPTA 3KEBA 5GAND 3Q19A 3I43A 2F8AA 1M2AA 1B4PA 1XVWA 2ZUPA 3HCZA 3MNGA 2XBQA 1AQWA 1F6MC 3I6AA 2V2GA 2WZ9A 16GSA 2EFHA 4HOJA 3APQA 1K0NA 3I69A 1OC8A 2H19A 5FWGA 2IFQB 5B8AA 3GIXA 3G7JA 2H70A 4ZB8A 3S9FA 3Q74A 3QPMA 10GSA 4N0VA 1JHBA 1YZXA 3N5OA 5DALA 4POMA 4IQ1A 2GQKA 3FR6A 3G7IA 3DKSA 4KDXA 5DAKA 2EFEA 4V2LA 2CAQA 1GTAA 1SKWB 1U3IA 3VI7A 2OJLA 4L0WA 1B4QA 4PQ1A 4J2FA 4HJ2A 1A24A 4TXOB 3GH6A 1YEPA 3BOAA 5IPGA 3SBCA 4LA1A 4AKHA 1R26A 4XHMA 1T8EB 3FYGA 3FRCA 2HE3A 3L9SA 3ZMLA 3QOUA 2R3XA 3O3TA 1X5EA 2LJKA 3US3A 1SVMA 1PA3A 2DKHA 3L9UA 3EVIA 3I9V2 1Z5YE 2G2QA 2FY6A 1SJ6A 2HRKA 4JBBA 1HNCA 11GSA 1VF3A 1XXUA 3KGKA 3GHAA 1ZYEA 3QCPA 3FR9A 5ECHB 5EL8A 4N10A 4V1Ag 4GWRA 4HQZA 3IV4A 2HSHA 3M3MA 4K2DA 1OC9B 3KJYA 1PMTA 1NHOA 1GRXA 5G1KA 4KAEA 2B1LA 4ACSA 2WGRA 2X99A 2R4VA 2YPMA 1G6WA 5KN2A 3GYKA 5GSSA 3FZ4A 3EE2A 4ECJA 3TRQA 1WJKA 3HJOA 2V6OA 2V41A 2PMTA 2IMIA 3IBHA 4BL7A 4MJAA 1O6JA 1TI1A 4D73B 3UEMA 5CRGA 4BVYA 5B8BA 3IDVA 4FH8A 1XFLA 1V98A 5CREA 1M2BA 1XOAA 4TR4A 2A2SA 3V1WA 4I8BA 3F3QA 3TB2A 2VIMA 1F9MA 2RUFA 3ERFA 5HR3A 1UA5A 17GSA 2QSIA 3QAWA 2WB9A 2FA8A 3CRTA 4HDEA 1E2YA 1A2JA 1XW6A 3OR5A 3KMNA 2CVDA 1MDIA 3N9JA 1F37A 4ZBDA 2CVBA 2LUSA 2GSQA 9GSSA 5CRWA 3UAPA 2HQTA 3GSSA 4OCEA 2C1YA 5LCZA 4HUAA 1XWBA 3D4TA 1Y25A 5COHA 3EC3A 1WWJA 1SL1B 5CP1A 1XWKA 4Q5QA 5ECLB 2ALBA 1B48A 2F8FA 1ERVA 1CQHA 1ZYPA 2MMAA 2VL3A 3ME7A 4QQ7A 3WGEA 3G7YA 4OO5A 1U3AA 1ERTA 2XPEA 4PUFC 4ML6A 5CRDA 2R6KA 1A8LA 3ZRDA 3E3EA 1BG1A 1AC1A 2VCVA 3CMIA 5D93A 1JZRA 2IPAA 1SVLA 2VD1A 2E2MA 5FT3A 2YJHA 1A0RP 3RHBA 5IO0A 5DQSA 2HI7A 2EIOA 2GZZA 1EOHA 2GSTA 4GQCA 2WCIA 2LRCA 3GFKA 1ON4A 4XTSA 4CY8A 4KH7A 4MJEA 4ZXGA 4EO3A 4X4JA 1M7TA 2V32A 3Q6OA 4K1FA 4OFMA 5A34B 2YV9A 4WEYA 2RM6A 2IL3A 2H6YA 2GT6A 4X43A 2YANA 3R2QA 1BYEA 1XWGA 5HFGA 1OVNA 5HR1A 2X8GA 2H1AA 3HYPA 2FA4A 1JZWA 2KOKA 5KN3A 4KF9A 3WGDA 20GSA 4IP1A 2B1KA 3CYNA 2CAIA 4KDUA 4MCUA 3UOMA 1ML6A 3CSIA 5ECQB 1HNBA 2OE3A 3TOUA 4HZ2A 2R5GA 3GTUB 1B9XC 3VWWA 3GMFA 1XOBA 5ECNB 4IP6A 6GSYA 2HYXA 4TOPA 4LMVA 5GSTA 3IAM2 3J7Yk 1ZZYA 4MDCA 2HNLA 2YWNA 1BJXA 1GNWA 1J08A 4XIHA 2F3MA 3TKSE 1SD8A 4YAPA 1ZMAA 4OO4A 2YZUA 1GSUA 4MJBA 5DBQA 2REMA 4NHWA 5ECIB 2YJ7A 3WYWA 3CXGA 1O8XA 1CQGA 3IE3A 2DJ3A 1V40A 1BQ7A 4IVFA 1TRWA 3C8EA 1BX9A 1GSEA 4BPYA 2IFQA 2PBJA 3BCIA 1R4WA 1DE2A 2FGXA 4F03A 5LD0A 1S3AA 4EIQA 5IM9A 2HSMB 1VRSD 4BVYB 4Z2UA 2J9HA 5ELAA 5J3RA 1JLWA 4NV2A 4FO5A 4JEDA 3UBLA 1PKZA 2YP6A 5C00A 5HQPA 1PQNA 1SL2B 5J47A 3QAVA 3M9JA 3KXOA 3TKSC 5G31A 4MF6A 1H4OA 1YJ6A 1AUCA 5DQYA 2I3YA 5D9XA 1K0CA 4MZWA 3O76A 4TXVA 4QL9A 1ACVA 2PGTA 4L5LA 5E59A 3HJPA 1VF4A 4CDOA 2R0GA 4GRFA 3GKKA 1GSQA 2IN3A 2H76A 2TIRA 5C04A 1FAAA 1SJZA 4NV5A 3GV1A 3A5WA 4RI6A 3MIXA 1AXDA 1T3BA 4O5QA 2WULA 2HRFA 2C80A 3ZL5A 2OACA 5A1NB 1OC9A 1Z9HA 1SK1A 2IJYA 5BMUB 4E68A 4MK3A 4K9ZA 4PQIA 3D4MA 1Q98A 3TJFA 4IW9A 3F4RA 4MH2A 3L4NA 3RHCA 4ZBAA 5KN1A 3DGQA 4JR4A 1TTZA 2LNSA 1TRVA 3GRXA 4NAXA 4ULXA 4AKXB 4OWYA 4D73A 5J9CA 1TRSA 2E2GA 1S3CA 1T4ZA 1FW1A 1T1VA 1FVKA 3J7Yb 4I2UA 2L6CA 5F0GA 1GSSA 5G5FA 4O7HA 3IPZA 4HI7A 2EC4A 7GSSA 4HZ4A 4OFNA 1EZKA 2L57A 3QD9A 2OKAA 1M9BA 1PGTA 5ECOB 4GSNA 2DJ2A 3UJ1A 1PL1A 1BG5A 1WOUA 1K3OA 1SENA 3DVWA 2H1DA 1YVLA 3BJ5A 2O8VB 2P0GA 1ERUA 1U88A 3IXRA 4G0IA 4KW6A 3TJKA 3CBUA 4L5OA 4F0BA 3M1GA 1JZOA 3FZ9A 1DSBA 4IJIA 2L5LA 4E8HA 1V58A 4WF4A 4EDZA 1VGLA 2LRTA 4K0NA 2GT5A 1A2LA 1ERWA 4K7NA 1KNGA 3EMPA 5B7CA 3A5IA 1DUGA 1K0OA 1Z7RA 5G5EA 4Q5RA 1M9AA 4ISDA 3A2WA 1PN0A 1PX7A 3LJRA 4K5SA 4MPGA 2PVQA 2NBSA 4WXTA 2FD3A 5GAPD 3A2XA 1GL8A 18GSA 2IMFA 5J4YA 2F51A 1GUKA 2H72A 1SYXA 5KEJA 3L9VA 4F0CA 2GS3A 3QFBC 4IGJA 1YY7A 3H4KA 3MSZA 2XBIA 2RM5A 8GSSA 2TRCP 1GUMA 3E9JB 2LJAA 4K2XA 1TI3A 1TU7A 1I9DA 3EU3A 1Q4JA 4ZL7A 1A23A 1XWAA 4PURA 5A34A 3VWVA 4FYUA 5AIXA 3GA4A 2KHPA 1M99A 2H1BA 4DSSB 5H5RA 4G9HA 5E4WA 3FHKA 3VI5A 2K18A 3H1NA 3C7MA 3M8NA 4XRDA 3K8NA 3KCMA 1XVQA 2GSRA 3PPUA 5ELGA 3TKQA 2AYTA 2HRNA 1AIUA 3FKFA 4TR1B 1ZGNA 3LQ7A 2I81A 2YWIA 3HXSA 2CZ2A 1VF2A 2F9SA 4ZL8A 3FY7A 1ZL9A 1K3YA 2LQQA 3GTUA 2DBCA 1S3DA 2DC5A 2PWJA 3FEUA 2C0FA 2JZTA 2GTUA 1G7EA 3O6TA 4N0ZA 1LBKA 1TXXA 1YKAA 3RBTA 2VL2A 5D9WA 2EIQA 4GXZA 5BRTA 5L71A 1EGOA 4AI6A 2OA7A 1SL0B 1GSDA 4CY6A 4ECCA 4NMUA 1GLQA 1QGVA 3PINA 5HR0A 2MBSA 3HVVA 2ES7A 4I6XA 4GF0A 2R0PA 1MDKA 4POLA 2I9HA 1FB6A 5D73A 5H5QA 3TUEA 2LJRA 2VO4A 3CSHA 3L78A 1PX6A 1EGRA 2HSYA 2X49A 4PNGA 3ZIVA 4IJ3A 3QAGA 2BTOT 2CV4A 1GP1A 4MP4A 2DJJA 4KA0A 3GX0A 4YAVA 3LEFA 2HSMA 2VCQA 1HNAA 3IHGA 4XRAA 3VWUA 3HMJG 1IYHA 2FHEA 4QL7A 2DIZA 3TRXA 2BJXA 2C3QA 2YWMA 1GTIA 2L5OA 1GUHA 1WIKA 4BA7A 4K8MA 5ECMB 2H30A 3ZIJA 4J57E 2JSYA 3UBKA 4YH2A 2MYGA 2QGVA 2FLSA 3GKXA 4AGSA 4MH3A 1O85A 2GZYA 2DSAA 2LV3A 3NIVA 3U6VA 4KX4A 3IA1A 1ABAA 4FYCA 4K6XA 2JSZA 2H73A 3DYRA 5A1NA 4PXOA 1URMA 3IR4A 3F9UA 2LSTA 2C4JA 1R7HA 4WR4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F4S A;  4IS0 A;  3W8J A;  1TDI A;  5A4U A;  4TW5 A;  3VLN A;  3D21 A;  1TJD A;  1MD4 A;  1GSF A;  5HFK A;  2RII A;  1M2D A;  2MBT A;  5FHI A;  4MF7 A;  2B7K A;  3PGT A;  4EKZ A;  5IMD A;  3AY8 A;  2B5X A;  4MPF A;  2CX3 A;  3HVS A;  1TK5 B;  22GS A;  1TU8 A;  3GNJ A;  1XCC A;  1PD2 1;  4EE0 A;  5AGY A;  1WP0 A;  2K8V A;  3HA9 A;  4FYB A;  2X64 A;  1GWC A;  2YZH A;  4ZIJ A;  2VM1 A;  3GUR A;  2C0D A;  2BMX A;  2V1M A;  2JAC A;  4MMM A;  3QR6 A;  5IQY A;  2C3N A;  3ED3 A;  4AJ6 A;  4AJ7 A;  3P2A A;  2IME A;  3ZMK A;  3IK7 A;  3P90 A;  4KND A;  2L6D A;  4L0U A;  3WT1 A;  2QKE A;  1YEX A;  2RLI A;  6GST A;  2WJU A;  3ZFL A;  4AF2 A;  3EWL A;  1F3B A;  1LU4 A;  1SK0 A;  4WR5 A;  3DXB A;  4WET A;  5F8B A;  3ZLP A;  3ZVJ A;  4RQR A;  2OAD A;  2DMM A;  1J0F A;  1TOF A;  1SYR A;  1OAZ A;  1TP9 A;  2NVL A;  1TK8 B;  1ILO A;  4XS4 B;  2GQM A;  5GZZ B;  2M46 A;  1J9B A;  4KUN A;  5ID2 A;  2JAD A;  2HZF A;  3UAR A;  4GLT A;  4JE1 A;  2FWH A;  2IIY A;  2O87 A;  2P31 A;  1K3L A;  1XZO A;  2N5F A;  3HKR A;  2IWT A;  3HZ4 A;  1DBY A;  3R3E A;  1USB A;  2QC7 A;  3WT2 A;  3PR8 A;  3GH9 A;  3KP9 A;  1TRU A;  2UZ8 A;  4EDY A;  1TKD B;  1B9Y C;  1X9S B;  5IMA A;  2IMK A;  4WBJ A;  1OE8 A;  4OFT A;  1AW9 A;  2XC2 A;  4USS A;  3KD0 A;  1TK0 B;  3RDW A;  1WPI A;  4F2I A;  4XS1 A;  5EVO A;  1B8X A;  1Z7P A;  3F6D A;  3M0F A;  5EY6 A;  3F0I A;  3DVX A;  1RW1 A;  4XS6 A;  1V9W A;  1C72 A;  4K0G A;  5DJL A;  2FUG 2;  1T00 A;  2WFC A;  4ZB9 A;  4DEJ A;  4DSS A;  2GLR A;  3CTF A;  4F9Z A;  3C71 A;  2PU9 C;  4G0K A;  1XBS A;  5IPH A;  4ECI A;  1NW2 A;  4PGT A;  1A2M A;  5CYY A;  4TR1 A;  4BVX B;  3MDK A;  1FG4 A;  4O92 A;  3DWV A;  4P3Y B;  4X1U A;  2JU5 A;  1K0D A;  3LYK A;  4ZB6 A;  1X5D A;  2H8L A;  1GTU A;  3HJM A;  5BMU A;  3GKN A;  2L59 A;  3IHQ A;  2HLS A;  4PTS A;  4HU9 A;  2I1U A;  2GZP A;  4FQU A;  5DCH A;  3ISO A;  2OBI A;  1RQM A;  1U87 A;  3APS A;  5IMC A;  1SKS B;  4OCF A;  4LL1 B;  3DRN A;  4MAB A;  1EV4 A;  4MLY A;  3A2V A;  2VCX A;  1XW9 A;  4EL1 A;  1XWC A;  5D8I A;  2P5Q A;  3TKR A;  5JWO B;  1JLV A;  6GSV A;  2O7K A;  1EEJ A;  1G0T A;  3CRU A;  4TKY A;  3VFI A;  1O73 A;  2R37 A;  1YDK A;  4GSS A;  3QDN A;  3IOS A;  4V2N A;  5G2Z A;  1EOG A;  5ECS A;  4ZIL A;  1PN9 A;  4I5Q A;  4EC0 A;  3MWH A;  3FW2 A;  5B6N A;  2M80 A;  2O89 A;  1TW9 A;  5JCW A;  2ZCT A;  1EV9 A;  5IOX A;  4ILF A;  3ZRE A;  3EIN A;  3QFA C;  4G19 A;  4GTU A;  1U6T A;  2PER A;  2VLU A;  2B5E A;  1I5G A;  2YCD A;  5IO2 A;  3KTL A;  1KTE A;  1NSW A;  2AB6 A;  1KBN A;  5DVB A;  2DJ0 A;  3KTB A;  2R2J A;  4Q5N A;  4I97 A;  3H79 A;  1EP8 A;  4OMV A;  5H5S A;  1H75 A;  1N8J A;  5ID2 B;  3WGX A;  2D2Z A;  1PL2 A;  5D9T A;  3F4T A;  2E0Q A;  2LKU A;  4N11 A;  2JZS A;  3RAZ A;  1GSY A;  4Q5F A;  4KCA A;  2LEG A;  1WRY A;  1FB0 A;  1FHE A;  2DLX A;  4MF5 A;  2TRX A;  1Y6E A;  1OC3 A;  3VWX A;  5CO3 A;  2PVO C;  3EMX A;  3FZA A;  2CT6 A;  3RPN A;  4GCI A;  4HJM A;  4KCE A;  4MJC A;  4RUV A;  4DSR A;  1SKR B;  3W8S A;  1LJR A;  2VD0 A;  4XCS A;  2JL4 A;  2H0G A;  1MD3 A;  3HD5 A;  2K8S A;  3UL3 A;  2LRN A;  2A4V A;  3APO A;  3EUR A;  1R5A A;  5AIV A;  4V2M A;  4IKH A;  3ERG A;  4PNF A;  2H6Z A;  5IMV A;  1X5C A;  3UMA A;  1FVJ A;  1Z3E A;  4TRX A;  4F82 A;  5ECP B;  1AQV A;  2MMN A;  4TVE A;  1F2E A;  3TJB A;  1X9M B;  4KE3 A;  3RPP A;  3KP8 A;  1K0B A;  5JCG A;  1NM3 A;  2MMZ A;  2DJK A;  4BWS A;  5F07 A;  4TR0 A;  4IN0 A;  3ZTL A;  4TN8 A;  4XS4 A;  2H0I A;  2X8C A;  3CTG A;  5CNW A;  2C0E A;  4LLR A;  2OE0 A;  2K9F A;  2LQO A;  3ERW A;  3TKS A;  2LS5 A;  4YQM A;  3P8W A;  2B5Y A;  1PSQ A;  3LG6 A;  6GSS A;  5J9B A;  3G9B A;  1W4V A;  5CAX A;  2ON5 A;  1YF0 A;  2AAW A;  5ABR A;  1QK8 A;  3GN3 A;  2HXK A;  1Z6M A;  4KSO A;  2H01 A;  5IOW A;  3NOF A;  1XW5 A;  5ENU A;  2VL9 A;  2VCW A;  2KUC A;  3KM6 A;  3IC4 A;  3LXZ A;  4HQS A;  3MAK A;  6GSW A;  1RK4 A;  2AUV A;  2X8H A;  4KDY A;  1WE0 A;  2P5R A;  3F3R A;  1THO A;  3TKP A;  4ECB A;  2H0H A;  3HDC A;  3ZFB A;  2VAF A;  1KEB A;  3GST A;  2CQ9 A;  3F8U A;  3C1S A;  1YF1 A;  2HFD A;  2H66 A;  2L4Q A;  1GH2 A;  4POK A;  2H75 A;  3LSZ A;  3F6F A;  1UC7 A;  1SD9 A;  3LYP A;  4MA9 A;  5IIZ A;  5G30 A;  1T7P B;  2IMD A;  4EXJ A;  4ZL9 A;  4IQA A;  2K6V A;  3LOR A;  1THX A;  2DML A;  3KH9 A;  2NPB A;  4HEA 2;  2MMO A;  4BVX A;  1SU9 A;  1N2A A;  1AAZ A;  3TGZ A;  5J41 A;  2H74 A;  2YWO A;  4HS1 A;  5CRH A;  1UVZ A;  3GX8 A;  3HZ8 A;  2AV4 A;  2FWG A;  2NDO A;  5EPF A;  1MTC A;  3FR3 A;  4WF5 A;  4GQF A;  3LXT A;  4IEL A;  3GL5 A;  3W6G A;  3IK9 A;  3VPQ A;  1QUW A;  1YQ1 A;  1GTB A;  3BCK A;  2V6K A;  2NTO A;  5G1L A;  19GS A;  3EU4 A;  1X9W B;  2H6X A;  2FWE A;  3H93 A;  4FIW A;  2LTK A;  4H86 A;  2VLV A;  2HZE B;  1QQ2 A;  4RQX A;  1JZD A;  1OYJ A;  3TDG A;  2A2R A;  2L4C A;  1EWX A;  5J5N A;  2GQL A;  1OKT A;  1NHY A;  2JZR A;  4DVC A;  3QMX A;  2GGT A;  4J56 E;  2MZC A;  4CW9 A;  5ECR B;  5INY A;  2GSS A;  3D0Z A;  3VPT A;  2N5A A;  3TCO A;  5ECK B;  3HY2 A;  6GSU A;  4JU5 A;  3HVX A;  1G6Y A;  4NWY A;  2RUE A;  2G0F A;  1ZYQ B;  4G2E A;  2I4A A;  5F05 A;  4N30 A;  3JCM L;  3FZ5 A;  4K7O A;  2HRA A;  3U5R E;  1F3A A;  4NXI A;  3CSJ A;  5DAL B;  4MZC A;  2C0G A;  5A4V A;  4AJ8 A;  2VUP A;  5DAK B;  2LNT A;  3BBY A;  4KB3 A;  1X0R A;  4ID0 A;  12GS A;  2KLX A;  3HHV A;  5D96 A;  1VF1 A;  3D5J A;  4NPB A;  2OBK A;  5DDL A;  1FOV A;  5JCU A;  1O81 A;  3DML A;  2H1G A;  5AIS A;  4KGI A;  1T4Y A;  2PUK C;  4BWQ A;  2KP2 A;  1A0F A;  2B3S A;  3NZN A;  2HSN B;  2DJ1 A;  2H71 A;  2HRK B;  4L8E A;  4OD7 A;  2AHE A;  5HR2 A;  2VOC A;  3WD6 A;  3GL3 A;  2CA8 A;  1HD2 A;  4EVM A;  3IC8 A;  5AN1 A;  2AJQ B;  4GST A;  3D6I A;  2PN8 A;  4ML1 A;  1XIY A;  4O5R A;  1GLP A;  2VCZ A;  3UIW A;  5DCG A;  1PKW A;  3E0U A;  3IRA A;  1O8W A;  3FK8 A;  1ST9 A;  1SK2 A;  4LMW A;  4Z7X A;  2XPD A;  1W89 A;  1EEM A;  2ON7 A;  1K0A A;  1OE7 A;  1EP7 A;  2E7P A;  3VUR A;  4G10 A;  3BD2 A;  3GKM A;  1YKC A;  1K0M A;  1G7O A;  4YQU A;  1R5P A;  5D9V A;  2FNO A;  5F06 A;  5LNK e;  3D22 A;  4BL7 B;  3DD3 A;  4WKW A;  1V57 A;  3ZIT A;  4PX1 A;  14GS A;  5A4W A;  4TXO A;  3DEX A;  3TRP A;  3TOT A;  3EYT A;  3LGC A;  3KMO A;  4IHU A;  1MEK A;  3KH7 A;  4X0X A;  2VL2 C;  4LL4 B;  4TR3 A;  4HU7 A;  3L0H A;  6GSX A;  4EUY A;  5IMF A;  2KP1 A;  2WDU A;  2O85 A;  3C73 A;  4PQH A;  1HQO A;  1V2A A;  4WBR D;  2YNX A;  3Q18 A;  2CVK A;  2ZNM A;  2CZ3 A;  3LFL A;  5JWR B;  2FCH A;  5DJM A;  2M72 A;  5J4U A;  3SWL A;  4IBP A;  4PUA A;  2YV7 A;  3KZQ A;  3PH9 A;  4KSM A;  1AQX A;  3KIJ A;  2VM2 A;  1XPV A;  3ME8 A;  4ZBB A;  1GUL A;  4V1A p;  3ZYW A;  2OE1 A;  3C1R A;  4NHZ A;  3VK9 A;  1IYI A;  1SJI A;  2XHF A;  5JWQ B;  3IAS 2;  4EF0 A;  4YQV A;  2VLT A;  1FO5 A;  5A5K A;  4G0L A;  3TJJ A;  3A3T A;  1Z6N A;  5HFI A;  2C3T A;  4CHS A;  1QXH A;  1OKD A;  2WS2 A;  2GVP A;  1M0U A;  2WRT A;  2B6M A;  3ZVJ D;  13GS A;  1JFU A;  2N5B A;  4O32 A;  2EIR A;  4I2T A;  2Z9S A;  1A8Y A;  3P7X A;  5KN0 A;  2J23 A;  1HYU A;  1ZCP A;  1MDJ A;  1UN2 A;  5B6M A;  4E8E A;  5IMZ A;  4RI7 A;  2CX4 A;  3UVT A;  2VCT A;  3F63 A;  2FWF A;  4DSQ A;  4JZQ A;  1WMJ A;  2B7J A;  4MZB A;  2DIY A;  1BED A;  2YN1 A;  1O7U A;  4JRR A;  4JR6 A;  3TJG A;  1QMV A;  3H8Q A;  4POB A;  3M9K A;  1E6B A;  3LWA A;  3GUS A;  2GDR A;  1PRX A;  3DIE A;  1DE1 A;  1ZOF A;  2YOI A;  2HT9 A;  2HZE A;  4K7I A;  2C8U A;  1QFN A;  1GNE A;  1BAY A;  3ZZX A;  3UVH A;  2PPT A;  3KEB A;  5GAN D;  3Q19 A;  3I43 A;  2F8A A;  1M2A A;  1B4P A;  1XVW A;  2ZUP A;  3HCZ A;  3MNG A;  2XBQ A;  1AQW A;  1F6M C;  3I6A A;  2V2G A;  2WZ9 A;  16GS A;  4HOJ A;  3APQ A;  1K0N A;  3I69 A;  1OC8 A;  2H19 A;  5FWG A;  2IFQ B;  5B8A A;  3GIX A;  3G7J A;  2H70 A;  4ZB8 A;  3S9F A;  3Q74 A;  3QPM A;  10GS A;  4N0V A;  1JHB A;  1YZX A;  3N5O A;  5DAL A;  4POM A;  4IQ1 A;  2GQK A;  3FR6 A;  3G7I A;  3DKS A;  4KDX A;  5DAK A;  4V2L A;  2CAQ A;  1GTA A;  1SKW B;  1U3I A;  3VI7 A;  2OJL A;  4L0W A;  1B4Q A;  4PQ1 A;  4J2F A;  4HJ2 A;  1A24 A;  4TXO B;  3GH6 A;  1YEP A;  3BOA A;  5IPG A;  3SBC A;  4LA1 A;  1R26 A;  4XHM A;  1T8E B;  3FYG A;  3FRC A;  2HE3 A;  3L9S A;  3ZML A;  3QOU A;  2R3X A;  3O3T A;  1X5E A;  2LJK A;  3US3 A;  1PA3 A;  3L9U A;  3EVI A;  3I9V 2;  1Z5Y E;  2G2Q A;  2FY6 A;  1SJ6 A;  2HRK A;  4JBB A;  1HNC A;  11GS A;  1VF3 A;  1XXU A;  3KGK A;  3GHA A;  1ZYE A;  3QCP A;  3FR9 A;  5ECH B;  5EL8 A;  4N10 A;  4V1A g;  4GWR A;  4HQZ A;  3IV4 A;  2HSH A;  3M3M A;  4K2D A;  1OC9 B;  3KJY A;  1PMT A;  1NHO A;  1GRX A;  5G1K A;  4KAE A;  2B1L A;  4ACS A;  2WGR A;  2X99 A;  2R4V A;  2YPM A;  1G6W A;  5KN2 A;  3GYK A;  5GSS A;  3FZ4 A;  3EE2 A;  4ECJ A;  3TRQ A;  1WJK A;  3HJO A;  2V6O A;  2V41 A;  2PMT A;  2IMI A;  3IBH A;  4BL7 A;  4MJA A;  1O6J A;  1TI1 A;  4D73 B;  3UEM A;  5CRG A;  4BVY A;  5B8B A;  3IDV A;  4FH8 A;  1XFL A;  1V98 A;  5CRE A;  1M2B A;  1XOA A;  4TR4 A;  2A2S A;  3V1W A;  4I8B A;  3F3Q A;  3TB2 A;  2VIM A;  1F9M A;  2RUF A;  3ERF A;  5HR3 A;  1UA5 A;  17GS A;  2QSI A;  3QAW A;  2WB9 A;  2FA8 A;  3CRT A;  4HDE A;  1E2Y A;  1A2J A;  3OR5 A;  1XW6 A;  3KMN A;  2CVD A;  1MDI A;  3N9J A;  1F37 A;  4ZBD A;  2CVB A;  2LUS A;  2GSQ A;  9GSS A;  5CRW A;  3UAP A;  2HQT A;  3GSS A;  4OCE A;  2C1Y A;  5LCZ A;  4HUA A;  1XWB A;  3D4T A;  1Y25 A;  5COH A;  3EC3 A;  1WWJ A;  1SL1 B;  5CP1 A;  1XWK A;  4Q5Q A;  5ECL B;  2ALB A;  1B48 A;  2F8F A;  1ERV A;  1CQH A;  2MMA A;  2VL3 A;  3ME7 A;  4QQ7 A;  3WGE A;  3G7Y A;  4OO5 A;  1U3A A;  1ERT A;  2XPE A;  4PUF C;  4ML6 A;  5CRD A;  2R6K A;  1A8L A;  3ZRD A;  3E3E A;  1AC1 A;  2VCV A;  3CMI A;  5D93 A;  1JZR A;  2IPA A;  2VD1 A;  2E2M A;  5FT3 A;  2YJH A;  1A0R P;  3RHB A;  5IO0 A;  5DQS A;  2HI7 A;  2EIO A;  2GZZ A;  1EOH A;  2GST A;  4GQC A;  2WCI A;  2LRC A;  3GFK A;  1ON4 A;  4XTS A;  4KH7 A;  4MJE A;  4ZXG A;  4EO3 A;  1M7T A;  2V32 A;  3Q6O A;  4K1F A;  4OFM A;  2YV9 A;  4WEY A;  2RM6 A;  2IL3 A;  2H6Y A;  2GT6 A;  4X43 A;  2YAN A;  3R2Q A;  1BYE A;  1XWG A;  5HFG A;  1OVN A;  5HR1 A;  2X8G A;  2H1A A;  3HYP A;  2FA4 A;  1JZW A;  2KOK A;  5KN3 A;  4KF9 A;  3WGD A;  20GS A;  4IP1 A;  2B1K A;  3CYN A;  2CAI A;  4KDU A;  4MCU A;  3UOM A;  1ML6 A;  3CSI A;  5ECQ B;  1HNB A;  2OE3 A;  3TOU A;  4HZ2 A;  2R5G A;  3GTU B;  1B9X C;  3VWW A;  3GMF A;  1XOB A;  5ECN B;  4IP6 A;  6GSY A;  2HYX A;  4TOP A;  4LMV A;  5GST A;  3IAM 2;  3J7Y k;  1ZZY A;  4MDC A;  2HNL A;  2YWN A;  1BJX A;  1GNW A;  1J08 A;  4XIH A;  2F3M A;  3TKS E;  1SD8 A;  4YAP A;  1ZMA A;  4OO4 A;  2YZU A;  1GSU A;  4MJB A;  5DBQ A;  2REM A;  4NHW A;  5ECI B;  2YJ7 A;  3WYW A;  3CXG A;  1O8X A;  1CQG A;  3IE3 A;  2DJ3 A;  1V40 A;  1BQ7 A;  4IVF A;  1TRW A;  3C8E A;  1BX9 A;  1GSE A;  4BPY A;  2IFQ A;  2PBJ A;  3BCI A;  1R4W A;  1DE2 A;  2FGX A;  4F03 A;  5LD0 A;  1S3A A;  5IM9 A;  2HSM B;  1VRS D;  4BVY B;  2J9H A;  5ELA A;  5J3R A;  1JLW A;  4NV2 A;  4FO5 A;  4JED A;  3UBL A;  1PKZ A;  2YP6 A;  5C00 A;  5HQP A;  1PQN A;  1SL2 B;  3QAV A;  3M9J A;  3KXO A;  3TKS C;  5G31 A;  4MF6 A;  1H4O A;  1YJ6 A;  1AUC A;  5DQY A;  2I3Y A;  5D9X A;  1K0C A;  4MZW A;  3O76 A;  4TXV A;  4QL9 A;  1ACV A;  2PGT A;  4L5L A;  5E59 A;  3HJP A;  1VF4 A;  4CDO A;  4GRF A;  3GKK A;  1GSQ A;  2IN3 A;  2H76 A;  2TIR A;  5C04 A;  1FAA A;  1SJZ A;  4NV5 A;  3GV1 A;  3A5W A;  4RI6 A;  1AXD A;  1T3B A;  2WUL A;  2HRF A;  2C80 A;  3ZL5 A;  2OAC A;  1OC9 A;  1Z9H A;  1SK1 A;  2IJY A;  4MK3 A;  4K9Z A;  4PQI A;  3D4M A;  1Q98 A;  3TJF A;  4IW9 A;  3F4R A;  4MH2 A;  3L4N A;  3RHC A;  4ZBA A;  5KN1 A;  3DGQ A;  4JR4 A;  1TTZ A;  2LNS A;  1TRV A;  3GRX A;  4NAX A;  4ULX A;  4OWY A;  4D73 A;  5J9C A;  1TRS A;  2E2G A;  1S3C A;  1T4Z A;  1FW1 A;  1T1V A;  1FVK A;  3J7Y b;  4I2U A;  2L6C A;  5F0G A;  1GSS A;  5G5F A;  4O7H A;  3IPZ A;  4HI7 A;  2EC4 A;  7GSS A;  4HZ4 A;  4OFN A;  1EZK A;  2L57 A;  3QD9 A;  2OKA A;  1M9B A;  1PGT A;  5ECO B;  4GSN A;  2DJ2 A;  3UJ1 A;  1PL1 A;  1BG5 A;  1WOU A;  1K3O A;  1SEN A;  3DVW A;  2H1D A;  3BJ5 A;  2O8V B;  2P0G A;  1ERU A;  1U88 A;  3IXR A;  4G0I A;  4KW6 A;  3TJK A;  3CBU A;  4L5O A;  4F0B A;  3M1G A;  1JZO A;  3FZ9 A;  1DSB A;  4IJI A;  2L5L A;  4E8H A;  1V58 A;  4WF4 A;  4EDZ A;  1VGL A;  2LRT A;  4K0N A;  2GT5 A;  1A2L A;  1ERW A;  4K7N A;  1KNG A;  3EMP A;  5B7C A;  1DUG A;  1K0O A;  1Z7R A;  5G5E A;  4Q5R A;  1M9A A;  4ISD A;  3A2W A;  1PX7 A;  3LJR A;  4MPG A;  2PVQ A;  2NBS A;  4WXT A;  2FD3 A;  5GAP D;  3A2X A;  1GL8 A;  18GS A;  2IMF A;  2F51 A;  1GUK A;  2H72 A;  1SYX A;  5KEJ A;  3L9V A;  4F0C A;  2GS3 A;  3QFB C;  4IGJ A;  1YY7 A;  3H4K A;  3MSZ A;  2XBI A;  2RM5 A;  8GSS A;  2TRC P;  1GUM A;  3E9J B;  2LJA A;  1TI3 A;  1TU7 A;  1I9D A;  3EU3 A;  1Q4J A;  4ZL7 A;  1A23 A;  1XWA A;  4PUR A;  3VWV A;  4FYU A;  5AIX A;  3GA4 A;  2KHP A;  1M99 A;  2H1B A;  4DSS B;  5H5R A;  4G9H A;  5E4W A;  3FHK A;  3VI5 A;  2K18 A;  3H1N A;  3C7M A;  3M8N A;  4XRD A;  3K8N A;  3KCM A;  1XVQ A;  2GSR A;  3PPU A;  5ELG A;  3TKQ A;  2AYT A;  2HRN A;  1AIU A;  3FKF A;  4TR1 B;  1ZGN A;  3LQ7 A;  2I81 A;  2YWI A;  3HXS A;  2CZ2 A;  1VF2 A;  2F9S A;  4ZL8 A;  3FY7 A;  1ZL9 A;  1K3Y A;  2LQQ A;  3GTU A;  2DBC A;  1S3D A;  2DC5 A;  2PWJ A;  3FEU A;  2C0F A;  2JZT A;  2GTU A;  1G7E A;  3O6T A;  4N0Z A;  1LBK A;  1TXX A;  1YKA A;  3RBT A;  2VL2 A;  5D9W A;  2EIQ A;  4GXZ A;  5L71 A;  1EGO A;  2OA7 A;  1SL0 B;  1GSD A;  4ECC A;  4NMU A;  1GLQ A;  1QGV A;  3PIN A;  5HR0 A;  2MBS A;  3HVV A;  2ES7 A;  4I6X A;  4GF0 A;  1MDK A;  4POL A;  2I9H A;  1FB6 A;  5D73 A;  5H5Q A;  3TUE A;  2LJR A;  2VO4 A;  3CSH A;  3L78 A;  1PX6 A;  1EGR A;  2HSY A;  4PNG A;  3ZIV A;  4IJ3 A;  3QAG A;  2BTO T;  2CV4 A;  1GP1 A;  4MP4 A;  2DJJ A;  4KA0 A;  3GX0 A;  4YAV A;  3LEF A;  2HSM A;  2VCQ A;  1HNA A;  4XRA A;  3VWU A;  1IYH A;  2FHE A;  4QL7 A;  2DIZ A;  3TRX A;  2BJX A;  2C3Q A;  2YWM A;  1GTI A;  2L5O A;  1GUH A;  1WIK A;  4BA7 A;  4K8M A;  5ECM B;  2H30 A;  3ZIJ A;  4J57 E;  2JSY A;  3UBK A;  4YH2 A;  2MYG A;  2QGV A;  2FLS A;  3GKX A;  4AGS A;  4MH3 A;  1O85 A;  2GZY A;  2DSA A;  2LV3 A;  3NIV A;  3U6V A;  4KX4 A;  3IA1 A;  1ABA A;  4FYC A;  4K6X A;  2JSZ A;  2H73 A;  3DYR A;  4PXO A;  1URM A;  3IR4 A;  3F9U A;  2LST A;  2C4J A;  1R7H A;  4WR4 A; 
#chains in the Genus database with same CATH topology
 3F4S A;  4IS0 A;  3W8J A;  1TDI A;  5A4U A;  4TW5 A;  3VLN A;  3D21 A;  1TJD A;  1MD4 A;  1GSF A;  5HFK A;  2RII A;  1M2D A;  2MBT A;  5FHI A;  4MF7 A;  2B7K A;  3PGT A;  4EKZ A;  5IMD A;  3AY8 A;  4PHZ C;  4MNN A;  2B5X A;  4MPF A;  2CX3 A;  3HVS A;  1TK5 B;  22GS A;  1TU8 A;  3GNJ A;  4Z2R A;  1XCC A;  1PD2 1;  4EE0 A;  5AGY A;  1WP0 A;  2K8V A;  3HA9 A;  4FYB A;  3CHX C;  2X64 A;  1GWC A;  2YZH A;  4ZIJ A;  2VM1 A;  3GUR A;  2C0D A;  2BMX A;  2V1M A;  2JAC A;  4MMM A;  3QR6 A;  5IQY A;  2C3N A;  3ED3 A;  3LW9 A;  4AJ6 A;  4AJ7 A;  1SVO A;  3P2A A;  2IME A;  3ZMK A;  3IK7 A;  3P90 A;  2DKI A;  4KND A;  2L6D A;  4L0U A;  3WT1 A;  2QKE A;  1YEX A;  5KOX A;  2RLI A;  6GST A;  2WJU A;  3ZFL A;  4AF2 A;  3EWL A;  1F3B A;  1LU4 A;  1SK0 A;  4WR5 A;  3DXB A;  4WET A;  5F8B A;  3ZLP A;  2WVX A;  3ZVJ A;  4RQR A;  2OAD A;  4ZB7 A;  2DMM A;  1J0F A;  1TOF A;  1SYR A;  1OAZ A;  1TP9 A;  2NVL A;  1TK8 B;  1ILO A;  4XS4 B;  2GQM A;  5GZZ B;  2M46 A;  1J9B A;  4KUN A;  5ID2 A;  2JAD A;  2HZF A;  3UAR A;  4GLT A;  4JE1 A;  2FWH A;  2IIY A;  2O87 A;  2P31 A;  1K3L A;  1XZO A;  2N5F A;  3HKR A;  2IWT A;  3HZ4 A;  4HSC X;  1DBY A;  3R3E A;  4G01 A;  1USB A;  2QC7 A;  3WT2 A;  3PR8 A;  3GH9 A;  3KP9 A;  1TRU A;  2UZ8 A;  4EDY A;  1TKD B;  1B9Y C;  1X9S B;  5IMA A;  2IMK A;  2OT3 A;  4WBJ A;  1OE8 A;  4OFT A;  2O5V A;  1AW9 A;  2XC2 A;  4USS A;  3KD0 A;  1TK0 B;  3RDW A;  1WPI A;  4F2I A;  4XS1 A;  5EVO A;  1B8X A;  1Z7P A;  3F6D A;  3M0F A;  5EY6 A;  3F0I A;  3DVX A;  1RW1 A;  4XS6 A;  1V9W A;  1C72 A;  4K0G A;  5DJL A;  2FUG 2;  1T00 A;  2WFC A;  4ZB9 A;  4DEJ A;  4DSS A;  2GLR A;  3CTF A;  4F9Z A;  3C71 A;  2PU9 C;  4G0K A;  1XBS A;  4PI2 C;  4ECI A;  5IPH A;  1NW2 A;  4PGT A;  1A2M A;  5CYY A;  4TR1 A;  4BVX B;  3MDK A;  1FG4 A;  4O92 A;  3DWV A;  4P3Y B;  4X1U A;  2JU5 A;  1K0D A;  3LYK A;  4ZB6 A;  1X5D A;  2H8L A;  1GTU A;  3HJM A;  4O5U A;  5BMU A;  3GKN A;  2L59 A;  3IHQ A;  1TXU A;  2HLS A;  4PTS A;  4HU9 A;  2I1U A;  2GZP A;  4FQU A;  5DCH A;  3ISO A;  2OBI A;  1RQM A;  1U87 A;  3APS A;  5IMC A;  4YKF A;  1SKS B;  4OCF A;  4LL1 B;  5J4V A;  3DRN A;  4MAB A;  1EV4 A;  4MLY A;  3A2V A;  2VCX A;  1XW9 A;  4EL1 A;  1XWC A;  5D8I A;  2P5Q A;  3TKR A;  5JWO B;  1JLV A;  1S3R A;  6GSV A;  2O7K A;  2A4H A;  1EEJ A;  1G0T A;  3CRU A;  5KOW A;  4TKY A;  3VFI A;  1O73 A;  2R37 A;  1YDK A;  4GSS A;  3QDN A;  3IOS A;  4V2N A;  5G2Z A;  1EOG A;  5ECS A;  4ZIL A;  1PN9 A;  2QA2 A;  4I5Q A;  4EC0 A;  3MWH A;  3FW2 A;  5B6N A;  2M80 A;  2O89 A;  1TW9 A;  5JCW A;  2ZCT A;  1EV9 A;  5IOX A;  4ILF A;  3ZRE A;  1N25 A;  4BIK A;  3EIN A;  3QFA C;  4G19 A;  4GTU A;  1U6T A;  2PER A;  2VLU A;  2B5E A;  1I5G A;  2YCD A;  5IO2 A;  3KTL A;  1KTE A;  1NSW A;  2AB6 A;  1KBN A;  5DVB A;  2DJ0 A;  3KTB A;  2R2J A;  1M3J A;  4Q5N A;  4I97 A;  3H79 A;  1EP8 A;  4OMV A;  5H5S A;  1H75 A;  1N8J A;  5ID2 B;  3WGX A;  2D2Z A;  1PL2 A;  5D9T A;  3F4T A;  2E0Q A;  2LKU A;  4N11 A;  2JZS A;  3RAZ A;  1GSY A;  4Q5F A;  3FMW A;  4KCA A;  2LEG A;  1WRY A;  1FB0 A;  1FHE A;  1Y1U A;  2DLX A;  4MF5 A;  2TRX A;  1Y6E A;  1OC3 A;  3VWX A;  5CO3 A;  2PVO C;  3EMX A;  3FZA A;  2CT6 A;  3RPN A;  4GCI A;  4HJM A;  4KCE A;  4MJC A;  4RUV A;  4DSR A;  1SKR B;  3W8S A;  1LJR A;  4PI0 C;  2VD0 A;  4XCS A;  2JL4 A;  2H0G A;  1MD3 A;  3HD5 A;  2K8S A;  3UL3 A;  2LRN A;  2A4V A;  3APO A;  4A5P A;  3EUR A;  3CQF A;  1R5A A;  5AIV A;  4V2M A;  4EIP A;  4IKH A;  3ERG A;  4PNF A;  2H6Z A;  5IMV A;  1X5C A;  3CWG A;  3UMA A;  2R0C A;  1FVJ A;  1Z3E A;  4TRX A;  4F82 A;  5ECP B;  1AQV A;  2MMN A;  4TVE A;  1F2E A;  3TJB A;  1X9M B;  4KE3 A;  3RPP A;  3KP8 A;  1K0B A;  4AKI A;  5JCG A;  1NM3 A;  2MMZ A;  2DJK A;  4BWS A;  5F07 A;  4TR0 A;  4IN0 A;  3ZTL A;  4TN8 A;  4XS4 A;  2H0I A;  2X8C A;  3CTG A;  5CNW A;  2C0E A;  4LLR A;  2OE0 A;  2K9F A;  2LQO A;  3ERW A;  3TKS A;  2LS5 A;  4YQM A;  3P8W A;  2QA1 A;  2B5Y A;  1PSQ A;  3LG6 A;  6GSS A;  5J9B A;  2HSN A;  3G9B A;  1W4V A;  5CAX A;  2ON5 A;  4QMK A;  1YF0 A;  2AAW A;  2EFC A;  5ABR A;  3GN3 A;  1QK8 A;  2HXK A;  1Z6M A;  4KSO A;  2H01 A;  5IOW A;  3NOF A;  1XW5 A;  5ENU A;  2VL9 A;  1M3I A;  2VCW A;  2KUC A;  3KM6 A;  3IC4 A;  5A5H A;  3LXZ A;  4HQS A;  3RFR C;  3MAK A;  6GSW A;  1RK4 A;  2AUV A;  2X8H A;  4KDY A;  1WE0 A;  2P5R A;  3F3R A;  1THO A;  3TKP A;  4ECB A;  2H0H A;  3HDC A;  3ZFB A;  2VAF A;  1KEB A;  3GST A;  2CQ9 A;  3F8U A;  3C1S A;  1YF1 A;  4Z2T A;  2HFD A;  2H66 A;  2L4Q A;  1GH2 A;  4POK A;  2H75 A;  3LSZ A;  3F6F A;  1UC7 A;  1SD9 A;  3LYP A;  4MA9 A;  5IIZ A;  5G30 A;  1T7P B;  2IMD A;  4EXJ A;  4ZL9 A;  4IQA A;  2K6V A;  3LOR A;  4FXY P;  5J40 A;  1THX A;  2H1L A;  2DML A;  3KH9 A;  2NPB A;  4HEA 2;  4ICY A;  2MMO A;  4BVX A;  1SU9 A;  1N2A A;  2A2P A;  1AAZ A;  3TGZ A;  5J41 A;  2H74 A;  2YWO A;  4HS1 A;  5CRH A;  1UVZ A;  3GX8 A;  3HZ8 A;  3EPT A;  2AV4 A;  2FWG A;  2NDO A;  4AKG A;  5EPF A;  1MTC A;  3FR3 A;  4WF5 A;  4GQF A;  3LXT A;  4IEL A;  3GL5 A;  3W6G A;  3IK9 A;  3VPQ A;  1QUW A;  1YQ1 A;  1GTB A;  3BCK A;  2V6K A;  2NTO A;  5G1L A;  19GS A;  3EU4 A;  1X9W B;  2H6X A;  2FWE A;  3H93 A;  4FIW A;  4N3Z A;  2LTK A;  4H86 A;  2VLV A;  2HZE B;  1QQ2 A;  4RQX A;  1JZD A;  1OYJ A;  3TDG A;  2A2R A;  2L4C A;  1EWX A;  5J5N A;  2GQL A;  1OKT A;  1NHY A;  2JZR A;  4DVC A;  3QMX A;  2GGT A;  4J56 E;  2MZC A;  4CW9 A;  5ECR B;  5INY A;  2GSS A;  3D0Z A;  3VPT A;  4GDF A;  2N5A A;  3TCO A;  5ECK B;  3HY2 A;  6GSU A;  4JU5 A;  3HVX A;  1G6Y A;  4NWY A;  2RUE A;  2G0F A;  1ZYQ B;  4G2E A;  2I4A A;  5F05 A;  4N30 A;  3JCM L;  3FZ5 A;  4K7O A;  2HRA A;  2O3E A;  3U5R E;  1F3A A;  4NXI A;  3CSJ A;  5DAL B;  4MZC A;  2C0G A;  5A4V A;  4AJ8 A;  2VUP A;  5DAK B;  2LNT A;  4YKG A;  3BBY A;  4KB3 A;  1X0R A;  4ID0 A;  12GS A;  2WVZ A;  2KLX A;  3HHV A;  5D96 A;  1VF1 A;  3D5J A;  4NPB A;  2OBK A;  5DDL A;  1FOV A;  5JCU A;  1O81 A;  3DML A;  2H1G A;  5AIS A;  4KGI A;  1T4Y A;  2PUK C;  4BWQ A;  2KP2 A;  1A0F A;  2B3S A;  3NZN A;  2HSN B;  2DJ1 A;  2H71 A;  2HRK B;  4L8E A;  4OD7 A;  2AHE A;  5HR2 A;  2VOC A;  3WD6 A;  3GL3 A;  2CA8 A;  1HD2 A;  4EVM A;  3IC8 A;  5AN1 A;  2AJQ B;  4GST A;  3D6I A;  2PN8 A;  4ML1 A;  1XIY A;  3MYD A;  4O5R A;  1GLP A;  2VCZ A;  3UIW A;  5DCG A;  1PKW A;  5A5H B;  3E0U A;  3IRA A;  1O8W A;  3FK8 A;  1ST9 A;  1SK2 A;  4LMW A;  4Z7X A;  2XPD A;  1W89 A;  1EEM A;  2ON7 A;  1K0A A;  1OE7 A;  1EP7 A;  2E7P A;  3VUR A;  4G10 A;  3BD2 A;  3GKM A;  1YKC A;  1K0M A;  1G7O A;  4YQU A;  1R5P A;  5D9V A;  1FOH A;  2FNO A;  5F06 A;  5LNK e;  3D22 A;  4BL7 B;  3DD3 A;  4WKW A;  1V57 A;  3ZIT A;  4PX1 A;  14GS A;  5A4W A;  4TXO A;  3DEX A;  3TRP A;  3TOT A;  3EYT A;  3LGC A;  3KMO A;  4IHU A;  2UV8 G;  1MEK A;  3KH7 A;  4X0X A;  2VL2 C;  4LL4 B;  3HVN A;  4TR3 A;  4HU7 A;  3L0H A;  6GSX A;  4EUY A;  5IMF A;  2KP1 A;  2WDU A;  2O85 A;  2VKZ G;  3C73 A;  4PQH A;  1HQO A;  1V2A A;  4W66 A;  4WBR D;  2YNX A;  3Q18 A;  2CVK A;  2ZNM A;  2CZ3 A;  3LFL A;  5JWR B;  2FCH A;  5DJM A;  2M72 A;  5J4U A;  3SWL A;  1ZYN A;  4IBP A;  4PUA A;  2YV7 A;  3KZQ A;  3PH9 A;  4KSM A;  1AQX A;  2EFD A;  3KIJ A;  2VM2 A;  1XPV A;  3ME8 A;  4ZBB A;  3TU3 B;  1GUL A;  4V1A p;  3ZYW A;  2WVY A;  1XG8 A;  2OE1 A;  3C1R A;  4NHZ A;  3VK9 A;  1IYI A;  1SJI A;  2XHF A;  5JWQ B;  3IAS 2;  4EF0 A;  4YQV A;  2VLT A;  1FO5 A;  5A5K A;  4G0L A;  3TJJ A;  3A3T A;  1Z6N A;  5HFI A;  2C3T A;  4CHS A;  1QXH A;  1OKD A;  2WS2 A;  2GVP A;  1M0U A;  2WRT A;  2B6M A;  3ZVJ D;  13GS A;  1JFU A;  4K5R A;  2N5B A;  4O32 A;  2EIR A;  4I2T A;  2Z9S A;  2WW3 A;  1S4B P;  1A8Y A;  3P7X A;  5KN0 A;  2J23 A;  1HYU A;  1ZCP A;  1MDJ A;  1UN2 A;  5B6M A;  4E8E A;  5IMZ A;  4RI7 A;  2CX4 A;  3UVT A;  2VCT A;  3F63 A;  2FWF A;  4DSQ A;  4JZQ A;  1WMJ A;  2B7J A;  4MZB A;  2DIY A;  1BED A;  2YN1 A;  1O7U A;  4JRR A;  4JR6 A;  3RGB C;  3TJG A;  1QMV A;  3H8Q A;  4POB A;  2X4A A;  3M9K A;  1E6B A;  3LWA A;  3GUS A;  2GDR A;  1PRX A;  3DIE A;  1DE1 A;  1BF5 A;  1ZOF A;  2YOI A;  2HT9 A;  2HZE A;  4K7I A;  2C8U A;  1QFN A;  1GNE A;  1BAY A;  3ZZX A;  3UVH A;  2PPT A;  3KEB A;  5GAN D;  3Q19 A;  3I43 A;  2WW0 A;  2F8A A;  1M2A A;  1B4P A;  1XVW A;  2ZUP A;  3HCZ A;  3MNG A;  2XBQ A;  1AQW A;  1F6M C;  3I6A A;  2V2G A;  2WZ9 A;  16GS A;  2EFH A;  4HOJ A;  3APQ A;  1K0N A;  3I69 A;  1OC8 A;  2H19 A;  5FWG A;  2IFQ B;  5B8A A;  3GIX A;  3G7J A;  2H70 A;  4ZB8 A;  3S9F A;  3Q74 A;  3QPM A;  10GS A;  4N0V A;  1JHB A;  1YZX A;  3N5O A;  5DAL A;  4POM A;  4IQ1 A;  2GQK A;  3FR6 A;  3G7I A;  3DKS A;  4KDX A;  5DAK A;  2EFE A;  4V2L A;  2CAQ A;  1GTA A;  1SKW B;  1U3I A;  3VI7 A;  2OJL A;  4L0W A;  1B4Q A;  4PQ1 A;  4J2F A;  4HJ2 A;  1A24 A;  4TXO B;  3GH6 A;  1YEP A;  3BOA A;  5IPG A;  3SBC A;  4LA1 A;  4AKH A;  1R26 A;  4XHM A;  1T8E B;  3FYG A;  3FRC A;  2HE3 A;  3L9S A;  3ZML A;  3QOU A;  2R3X A;  3O3T A;  1X5E A;  2LJK A;  3US3 A;  1SVM A;  1PA3 A;  2DKH A;  3L9U A;  3EVI A;  3I9V 2;  1Z5Y E;  2G2Q A;  2FY6 A;  1SJ6 A;  2HRK A;  4JBB A;  1HNC A;  11GS A;  1VF3 A;  1XXU A;  3KGK A;  3GHA A;  1ZYE A;  3QCP A;  3FR9 A;  5ECH B;  5EL8 A;  4N10 A;  4V1A g;  4GWR A;  2WW2 A;  4HQZ A;  3IV4 A;  2HSH A;  3M3M A;  4K2D A;  1OC9 B;  3KJY A;  1PMT A;  1NHO A;  1GRX A;  5G1K A;  4KAE A;  2B1L A;  4ACS A;  2WGR A;  2X99 A;  2R4V A;  2YPM A;  1G6W A;  5KN2 A;  3GYK A;  5GSS A;  3FZ4 A;  3EE2 A;  4ECJ A;  3TRQ A;  1WJK A;  3HJO A;  2V6O A;  2V41 A;  2PMT A;  2IMI A;  3IBH A;  4BL7 A;  4MJA A;  1O6J A;  1TI1 A;  4D73 B;  3UEM A;  5CRG A;  4BVY A;  5B8B A;  3IDV A;  4FH8 A;  1XFL A;  1V98 A;  5CRE A;  1M2B A;  1XOA A;  4TR4 A;  2A2S A;  3V1W A;  4I8B A;  3F3Q A;  3TB2 A;  2VIM A;  1F9M A;  2RUF A;  3ERF A;  5HR3 A;  1UA5 A;  17GS A;  2QSI A;  3QAW A;  2WB9 A;  2FA8 A;  3CRT A;  4HDE A;  1E2Y A;  1A2J A;  1XW6 A;  3OR5 A;  3KMN A;  2CVD A;  1MDI A;  3N9J A;  1F37 A;  4ZBD A;  2CVB A;  2LUS A;  2GSQ A;  9GSS A;  5CRW A;  3UAP A;  2HQT A;  3GSS A;  4OCE A;  2C1Y A;  5LCZ A;  4HUA A;  1XWB A;  3D4T A;  1Y25 A;  5COH A;  3EC3 A;  1WWJ A;  1SL1 B;  5CP1 A;  1XWK A;  4Q5Q A;  5ECL B;  2ALB A;  1B48 A;  2F8F A;  1ERV A;  1CQH A;  1ZYP A;  2MMA A;  2VL3 A;  3ME7 A;  4QQ7 A;  3WGE A;  3G7Y A;  4OO5 A;  1U3A A;  1ERT A;  2XPE A;  4PUF C;  4ML6 A;  5CRD A;  2R6K A;  1A8L A;  3ZRD A;  3E3E A;  1BG1 A;  1AC1 A;  2VCV A;  3CMI A;  5D93 A;  1JZR A;  2IPA A;  1SVL A;  2VD1 A;  2E2M A;  5FT3 A;  2YJH A;  1A0R P;  3RHB A;  5IO0 A;  2WW1 A;  5DQS A;  2HI7 A;  2EIO A;  2GZZ A;  1EOH A;  2GST A;  4GQC A;  2WCI A;  2LRC A;  3GFK A;  1ON4 A;  4XTS A;  4CY8 A;  4KH7 A;  4MJE A;  4ZXG A;  4EO3 A;  4X4J A;  1M7T A;  2V32 A;  3Q6O A;  4K1F A;  4OFM A;  5A34 B;  2YV9 A;  4WEY A;  2RM6 A;  2IL3 A;  2H6Y A;  2GT6 A;  4X43 A;  2YAN A;  3R2Q A;  1BYE A;  1XWG A;  5HFG A;  1OVN A;  5HR1 A;  2X8G A;  2H1A A;  3HYP A;  2FA4 A;  1JZW A;  2KOK A;  5KN3 A;  4KF9 A;  3WGD A;  20GS A;  4IP1 A;  2B1K A;  3CYN A;  2CAI A;  4KDU A;  4MCU A;  3UOM A;  1ML6 A;  3CSI A;  5ECQ B;  1HNB A;  2OE3 A;  3TOU A;  4HZ2 A;  2R5G A;  3GTU B;  1B9X C;  3VWW A;  3GMF A;  1XOB A;  5ECN B;  4IP6 A;  6GSY A;  2HYX A;  4TOP A;  4LMV A;  5GST A;  3IAM 2;  3J7Y k;  1ZZY A;  4MDC A;  2HNL A;  2YWN A;  1BJX A;  1GNW A;  1J08 A;  4XIH A;  2F3M A;  3TKS E;  1YEW C;  1SD8 A;  2O36 A;  4YAP A;  1ZMA A;  4OO4 A;  2YZU A;  1GSU A;  4MJB A;  5DBQ A;  2REM A;  4NHW A;  5ECI B;  2YJ7 A;  3WYW A;  3CXG A;  1O8X A;  1CQG A;  3IE3 A;  2DJ3 A;  1V40 A;  1BQ7 A;  4IVF A;  1TRW A;  3C8E A;  1BX9 A;  1GSE A;  4BPY A;  2IFQ A;  2PBJ A;  3BCI A;  1R4W A;  1DE2 A;  2FGX A;  4F03 A;  5LD0 A;  1S3A A;  4EIQ A;  5IM9 A;  2HSM B;  1VRS D;  4BVY B;  4Z2U A;  2J9H A;  5ELA A;  5J3R A;  1JLW A;  4NV2 A;  4FO5 A;  4JED A;  3UBL A;  1PKZ A;  2YP6 A;  5C00 A;  5HQP A;  1PQN A;  1SL2 B;  5J47 A;  3QAV A;  3M9J A;  3KXO A;  3TKS C;  5G31 A;  4MF6 A;  1H4O A;  1YJ6 A;  1AUC A;  5DQY A;  2I3Y A;  5D9X A;  1K0C A;  4MZW A;  3O76 A;  4TXV A;  4QL9 A;  1ACV A;  2PGT A;  4L5L A;  5E59 A;  3HJP A;  1VF4 A;  4CDO A;  2R0G A;  4GRF A;  3GKK A;  1GSQ A;  2IN3 A;  2H76 A;  2TIR A;  5C04 A;  1FAA A;  1SJZ A;  4NV5 A;  3GV1 A;  3A5W A;  4RI6 A;  3MIX A;  1AXD A;  1T3B A;  4O5Q A;  2WUL A;  2HRF A;  2C80 A;  3ZL5 A;  2OAC A;  5A1N B;  1OC9 A;  1Z9H A;  1SK1 A;  2IJY A;  5BMU B;  4E68 A;  4MK3 A;  4K9Z A;  4PQI A;  3D4M A;  1Q98 A;  3TJF A;  4IW9 A;  3F4R A;  4MH2 A;  3L4N A;  3RHC A;  4ZBA A;  5KN1 A;  3DGQ A;  4JR4 A;  1TTZ A;  2LNS A;  1TRV A;  3GRX A;  4NAX A;  4ULX A;  4AKX B;  4OWY A;  4D73 A;  5J9C A;  1TRS A;  2E2G A;  1S3C A;  1T4Z A;  1FW1 A;  1T1V A;  1FVK A;  3J7Y b;  4I2U A;  2L6C A;  5F0G A;  1GSS A;  5G5F A;  4O7H A;  3IPZ A;  4HI7 A;  2EC4 A;  7GSS A;  4HZ4 A;  4OFN A;  1EZK A;  2L57 A;  3QD9 A;  2OKA A;  1M9B A;  1PGT A;  5ECO B;  4GSN A;  2DJ2 A;  3UJ1 A;  1PL1 A;  1BG5 A;  1WOU A;  1K3O A;  1SEN A;  3DVW A;  2H1D A;  1YVL A;  3BJ5 A;  2O8V B;  2P0G A;  1ERU A;  1U88 A;  3IXR A;  4G0I A;  4KW6 A;  3TJK A;  3CBU A;  4L5O A;  4F0B A;  2WVX B;  3M1G A;  1JZO A;  3FZ9 A;  1DSB A;  4IJI A;  2L5L A;  4E8H A;  1V58 A;  4WF4 A;  4EDZ A;  1VGL A;  2LRT A;  4K0N A;  2GT5 A;  1A2L A;  1ERW A;  4K7N A;  1KNG A;  3EMP A;  5B7C A;  3A5I A;  1DUG A;  1K0O A;  1Z7R A;  5G5E A;  4Q5R A;  1M9A A;  4ISD A;  3A2W A;  1PN0 A;  1PX7 A;  3LJR A;  4K5S A;  4MPG A;  2PVQ A;  2NBS A;  4WXT A;  2FD3 A;  5GAP D;  3A2X A;  1GL8 A;  18GS A;  2IMF A;  5J4Y A;  2F51 A;  1PFO A;  1GUK A;  2H72 A;  1SYX A;  5KEJ A;  3L9V A;  4F0C A;  2GS3 A;  3QFB C;  4IGJ A;  1YY7 A;  3H4K A;  3MSZ A;  2XBI A;  2RM5 A;  8GSS A;  2TRC P;  1GUM A;  3E9J B;  2LJA A;  4K2X A;  1TI3 A;  1TU7 A;  1I9D A;  3EU3 A;  1Q4J A;  4ZL7 A;  1A23 A;  1XWA A;  4PUR A;  5A34 A;  3VWV A;  4FYU A;  5AIX A;  3GA4 A;  2KHP A;  1M99 A;  2H1B A;  4DSS B;  5H5R A;  4G9H A;  5E4W A;  3FHK A;  3VI5 A;  2K18 A;  3H1N A;  3C7M A;  3M8N A;  4XRD A;  3K8N A;  3KCM A;  1XVQ A;  2GSR A;  3PPU A;  5ELG A;  3TKQ A;  2AYT A;  2HRN A;  1AIU A;  3FKF A;  4TR1 B;  1ZGN A;  3LQ7 A;  2I81 A;  2YWI A;  3HXS A;  2CZ2 A;  1VF2 A;  2F9S A;  4ZL8 A;  3FY7 A;  1ZL9 A;  1K3Y A;  2LQQ A;  3GTU A;  2DBC A;  1S3D A;  2DC5 A;  2PWJ A;  3FEU A;  2C0F A;  2JZT A;  2GTU A;  1G7E A;  3O6T A;  4N0Z A;  1LBK A;  1TXX A;  1YKA A;  3RBT A;  2VL2 A;  5D9W A;  2EIQ A;  4GXZ A;  5BRT A;  5L71 A;  1EGO A;  4AI6 A;  2OA7 A;  1SL0 B;  1GSD A;  4CY6 A;  4ECC A;  4NMU A;  1GLQ A;  1QGV A;  3PIN A;  5HR0 A;  2MBS A;  3HVV A;  2ES7 A;  4I6X A;  4GF0 A;  1I1I P;  2R0P A;  1MDK A;  4POL A;  2WZS A;  2I9H A;  1FB6 A;  5D73 A;  5H5Q A;  3TUE A;  2LJR A;  2VO4 A;  3CSH A;  3L78 A;  1PX6 A;  1EGR A;  2HSY A;  2X49 A;  4PNG A;  3ZIV A;  4IJ3 A;  3QAG A;  2BTO T;  2CV4 A;  1GP1 A;  4MP4 A;  2DJJ A;  4KA0 A;  3GX0 A;  4YAV A;  3LEF A;  2HSM A;  2VCQ A;  1HNA A;  3IHG A;  4XRA A;  3VWU A;  3HMJ G;  1IYH A;  2FHE A;  4QL7 A;  2DIZ A;  3TRX A;  2BJX A;  2C3Q A;  2YWM A;  1GTI A;  2L5O A;  1GUH A;  1WIK A;  4BA7 A;  4K8M A;  5ECM B;  2H30 A;  3ZIJ A;  4J57 E;  2JSY A;  3UBK A;  4YH2 A;  2MYG A;  2QGV A;  2FLS A;  3GKX A;  4AGS A;  4MH3 A;  1O85 A;  2GZY A;  2DSA A;  2LV3 A;  3NIV A;  3U6V A;  4KX4 A;  3IA1 A;  1ABA A;  4FYC A;  4K6X A;  2JSZ A;  2H73 A;  3DYR A;  5A1N A;  4PXO A;  1URM A;  3IR4 A;  3F9U A;  2LST A;  2C4J A;  1R7H A;  4WR4 A; 
#chains in the Genus database with same CATH homology
 3F4S A;  4IS0 A;  3W8J A;  1TDI A;  5A4U A;  4TW5 A;  3VLN A;  3D21 A;  1TJD A;  1MD4 A;  1GSF A;  5HFK A;  2RII A;  1M2D A;  2MBT A;  5FHI A;  4MF7 A;  2B7K A;  3PGT A;  4EKZ A;  5IMD A;  3AY8 A;  4MNN A;  2B5X A;  4MPF A;  2CX3 A;  3HVS A;  1TK5 B;  22GS A;  1TU8 A;  3GNJ A;  4Z2R A;  1XCC A;  1PD2 1;  4EE0 A;  5AGY A;  1WP0 A;  2K8V A;  3HA9 A;  4FYB A;  2X64 A;  1GWC A;  2YZH A;  4ZIJ A;  2VM1 A;  3GUR A;  2C0D A;  2BMX A;  2V1M A;  2JAC A;  4MMM A;  3QR6 A;  5IQY A;  2C3N A;  3ED3 A;  3LW9 A;  4AJ6 A;  4AJ7 A;  1SVO A;  3P2A A;  2IME A;  3ZMK A;  3IK7 A;  3P90 A;  2DKI A;  4KND A;  2L6D A;  4L0U A;  3WT1 A;  2QKE A;  1YEX A;  5KOX A;  2RLI A;  6GST A;  2WJU A;  3ZFL A;  4AF2 A;  3EWL A;  1F3B A;  1LU4 A;  1SK0 A;  4WR5 A;  3DXB A;  4WET A;  5F8B A;  3ZLP A;  3ZVJ A;  4RQR A;  2OAD A;  4ZB7 A;  2DMM A;  1J0F A;  1TOF A;  1SYR A;  1OAZ A;  1TP9 A;  2NVL A;  1TK8 B;  1ILO A;  4XS4 B;  2GQM A;  5GZZ B;  2M46 A;  1J9B A;  4KUN A;  5ID2 A;  2JAD A;  2HZF A;  3UAR A;  4GLT A;  4JE1 A;  2FWH A;  2IIY A;  2O87 A;  2P31 A;  1K3L A;  1XZO A;  2N5F A;  3HKR A;  2IWT A;  3HZ4 A;  1DBY A;  3R3E A;  4G01 A;  1USB A;  2QC7 A;  3WT2 A;  3PR8 A;  3GH9 A;  3KP9 A;  1TRU A;  2UZ8 A;  4EDY A;  1TKD B;  1B9Y C;  1X9S B;  5IMA A;  2IMK A;  2OT3 A;  4WBJ A;  1OE8 A;  4OFT A;  2O5V A;  1AW9 A;  2XC2 A;  4USS A;  3KD0 A;  1TK0 B;  3RDW A;  1WPI A;  4F2I A;  4XS1 A;  5EVO A;  1B8X A;  1Z7P A;  3F6D A;  3M0F A;  5EY6 A;  3F0I A;  3DVX A;  1RW1 A;  4XS6 A;  1V9W A;  1C72 A;  4K0G A;  5DJL A;  2FUG 2;  1T00 A;  2WFC A;  4ZB9 A;  4DEJ A;  4DSS A;  2GLR A;  3CTF A;  4F9Z A;  3C71 A;  2PU9 C;  4G0K A;  1XBS A;  5IPH A;  4ECI A;  1NW2 A;  4PGT A;  1A2M A;  5CYY A;  4TR1 A;  4BVX B;  3MDK A;  1FG4 A;  4O92 A;  3DWV A;  4P3Y B;  4X1U A;  2JU5 A;  1K0D A;  3LYK A;  4ZB6 A;  1X5D A;  2H8L A;  1GTU A;  3HJM A;  4O5U A;  5BMU A;  3GKN A;  2L59 A;  3IHQ A;  1TXU A;  2HLS A;  4PTS A;  4HU9 A;  2I1U A;  2GZP A;  4FQU A;  5DCH A;  3ISO A;  2OBI A;  1RQM A;  1U87 A;  3APS A;  5IMC A;  4YKF A;  1SKS B;  4OCF A;  4LL1 B;  5J4V A;  3DRN A;  4MAB A;  1EV4 A;  4MLY A;  3A2V A;  2VCX A;  1XW9 A;  4EL1 A;  1XWC A;  5D8I A;  2P5Q A;  3TKR A;  5JWO B;  1JLV A;  6GSV A;  2O7K A;  2A4H A;  1EEJ A;  1G0T A;  3CRU A;  5KOW A;  4TKY A;  3VFI A;  1O73 A;  2R37 A;  1YDK A;  4GSS A;  3QDN A;  3IOS A;  4V2N A;  5G2Z A;  1EOG A;  5ECS A;  4ZIL A;  1PN9 A;  2QA2 A;  4I5Q A;  4EC0 A;  3MWH A;  3FW2 A;  5B6N A;  2M80 A;  2O89 A;  1TW9 A;  5JCW A;  2ZCT A;  1EV9 A;  5IOX A;  4ILF A;  3ZRE A;  1N25 A;  3EIN A;  3QFA C;  4G19 A;  4GTU A;  1U6T A;  2PER A;  2VLU A;  2B5E A;  1I5G A;  2YCD A;  5IO2 A;  3KTL A;  1KTE A;  1NSW A;  2AB6 A;  1KBN A;  5DVB A;  2DJ0 A;  3KTB A;  2R2J A;  4Q5N A;  4I97 A;  3H79 A;  1EP8 A;  4OMV A;  5H5S A;  1H75 A;  1N8J A;  5ID2 B;  3WGX A;  2D2Z A;  1PL2 A;  5D9T A;  3F4T A;  2E0Q A;  2LKU A;  4N11 A;  2JZS A;  3RAZ A;  1GSY A;  4Q5F A;  3FMW A;  4KCA A;  2LEG A;  1WRY A;  1FB0 A;  1FHE A;  1Y1U A;  2DLX A;  4MF5 A;  2TRX A;  1Y6E A;  1OC3 A;  3VWX A;  5CO3 A;  2PVO C;  3EMX A;  3FZA A;  2CT6 A;  3RPN A;  4GCI A;  4HJM A;  4KCE A;  4MJC A;  4RUV A;  4DSR A;  1SKR B;  3W8S A;  1LJR A;  2VD0 A;  4XCS A;  2JL4 A;  2H0G A;  1MD3 A;  3HD5 A;  2K8S A;  3UL3 A;  2LRN A;  2A4V A;  3APO A;  4A5P A;  3EUR A;  1R5A A;  5AIV A;  4V2M A;  4EIP A;  4IKH A;  3ERG A;  4PNF A;  2H6Z A;  5IMV A;  1X5C A;  3CWG A;  3UMA A;  2R0C A;  1FVJ A;  1Z3E A;  4TRX A;  4F82 A;  5ECP B;  1AQV A;  2MMN A;  4TVE A;  1F2E A;  3TJB A;  1X9M B;  4KE3 A;  3RPP A;  3KP8 A;  1K0B A;  4AKI A;  5JCG A;  1NM3 A;  2MMZ A;  2DJK A;  4BWS A;  5F07 A;  4TR0 A;  4IN0 A;  3ZTL A;  4TN8 A;  4XS4 A;  2H0I A;  2X8C A;  3CTG A;  5CNW A;  2C0E A;  4LLR A;  2OE0 A;  2K9F A;  2LQO A;  3ERW A;  3TKS A;  2LS5 A;  4YQM A;  3P8W A;  2QA1 A;  2B5Y A;  1PSQ A;  3LG6 A;  6GSS A;  5J9B A;  2HSN A;  3G9B A;  1W4V A;  5CAX A;  2ON5 A;  4QMK A;  1YF0 A;  2AAW A;  2EFC A;  5ABR A;  3GN3 A;  1QK8 A;  2HXK A;  1Z6M A;  4KSO A;  2H01 A;  5IOW A;  3NOF A;  1XW5 A;  5ENU A;  2VL9 A;  2VCW A;  2KUC A;  3KM6 A;  3IC4 A;  5A5H A;  3LXZ A;  4HQS A;  3MAK A;  6GSW A;  1RK4 A;  2AUV A;  2X8H A;  4KDY A;  1WE0 A;  2P5R A;  3F3R A;  1THO A;  3TKP A;  4ECB A;  2H0H A;  3HDC A;  3ZFB A;  2VAF A;  1KEB A;  3GST A;  2CQ9 A;  3F8U A;  3C1S A;  1YF1 A;  4Z2T A;  2HFD A;  2H66 A;  2L4Q A;  1GH2 A;  4POK A;  2H75 A;  3LSZ A;  3F6F A;  1UC7 A;  1SD9 A;  3LYP A;  4MA9 A;  5IIZ A;  5G30 A;  1T7P B;  2IMD A;  4EXJ A;  4ZL9 A;  4IQA A;  2K6V A;  3LOR A;  5J40 A;  1THX A;  2H1L A;  2DML A;  3KH9 A;  2NPB A;  4HEA 2;  4ICY A;  2MMO A;  4BVX A;  1SU9 A;  1N2A A;  2A2P A;  1AAZ A;  3TGZ A;  5J41 A;  2H74 A;  2YWO A;  4HS1 A;  5CRH A;  1UVZ A;  3GX8 A;  3HZ8 A;  3EPT A;  2AV4 A;  2FWG A;  2NDO A;  4AKG A;  5EPF A;  1MTC A;  3FR3 A;  4WF5 A;  4GQF A;  3LXT A;  4IEL A;  3GL5 A;  3W6G A;  3IK9 A;  3VPQ A;  1QUW A;  1YQ1 A;  1GTB A;  3BCK A;  2V6K A;  2NTO A;  5G1L A;  19GS A;  3EU4 A;  1X9W B;  2H6X A;  2FWE A;  3H93 A;  4FIW A;  4N3Z A;  2LTK A;  4H86 A;  2VLV A;  2HZE B;  1QQ2 A;  4RQX A;  1JZD A;  1OYJ A;  3TDG A;  2A2R A;  2L4C A;  1EWX A;  5J5N A;  2GQL A;  1OKT A;  1NHY A;  2JZR A;  4DVC A;  3QMX A;  2GGT A;  4J56 E;  2MZC A;  4CW9 A;  5ECR B;  5INY A;  2GSS A;  3D0Z A;  3VPT A;  4GDF A;  2N5A A;  3TCO A;  5ECK B;  3HY2 A;  6GSU A;  4JU5 A;  3HVX A;  1G6Y A;  4NWY A;  2RUE A;  2G0F A;  1ZYQ B;  4G2E A;  2I4A A;  5F05 A;  4N30 A;  3JCM L;  3FZ5 A;  4K7O A;  2HRA A;  3U5R E;  1F3A A;  4NXI A;  3CSJ A;  5DAL B;  4MZC A;  2C0G A;  5A4V A;  4AJ8 A;  2VUP A;  5DAK B;  2LNT A;  4YKG A;  3BBY A;  4KB3 A;  1X0R A;  4ID0 A;  12GS A;  2KLX A;  3HHV A;  5D96 A;  1VF1 A;  3D5J A;  4NPB A;  2OBK A;  5DDL A;  1FOV A;  5JCU A;  1O81 A;  3DML A;  2H1G A;  5AIS A;  4KGI A;  1T4Y A;  2PUK C;  4BWQ A;  2KP2 A;  1A0F A;  2B3S A;  3NZN A;  2HSN B;  2DJ1 A;  2H71 A;  2HRK B;  4L8E A;  4OD7 A;  2AHE A;  5HR2 A;  2VOC A;  3WD6 A;  3GL3 A;  2CA8 A;  1HD2 A;  4EVM A;  3IC8 A;  5AN1 A;  2AJQ B;  4GST A;  3D6I A;  2PN8 A;  4ML1 A;  1XIY A;  3MYD A;  4O5R A;  1GLP A;  2VCZ A;  3UIW A;  5DCG A;  1PKW A;  5A5H B;  3E0U A;  3IRA A;  1O8W A;  3FK8 A;  1ST9 A;  1SK2 A;  4LMW A;  4Z7X A;  2XPD A;  1W89 A;  1EEM A;  2ON7 A;  1K0A A;  1OE7 A;  1EP7 A;  2E7P A;  3VUR A;  4G10 A;  3BD2 A;  3GKM A;  1YKC A;  1K0M A;  1G7O A;  4YQU A;  1R5P A;  5D9V A;  1FOH A;  2FNO A;  5F06 A;  5LNK e;  3D22 A;  4BL7 B;  3DD3 A;  4WKW A;  1V57 A;  3ZIT A;  4PX1 A;  14GS A;  5A4W A;  4TXO A;  3DEX A;  3TRP A;  3TOT A;  3EYT A;  3LGC A;  3KMO A;  4IHU A;  2UV8 G;  1MEK A;  3KH7 A;  4X0X A;  2VL2 C;  4LL4 B;  4TR3 A;  4HU7 A;  3L0H A;  6GSX A;  4EUY A;  5IMF A;  2KP1 A;  2WDU A;  2O85 A;  2VKZ G;  3C73 A;  4PQH A;  1HQO A;  1V2A A;  4W66 A;  4WBR D;  2YNX A;  3Q18 A;  2CVK A;  2ZNM A;  2CZ3 A;  3LFL A;  5JWR B;  2FCH A;  5DJM A;  2M72 A;  5J4U A;  3SWL A;  1ZYN A;  4IBP A;  4PUA A;  2YV7 A;  3KZQ A;  3PH9 A;  4KSM A;  1AQX A;  2EFD A;  3KIJ A;  2VM2 A;  1XPV A;  3ME8 A;  4ZBB A;  3TU3 B;  1GUL A;  4V1A p;  3ZYW A;  2OE1 A;  3C1R A;  4NHZ A;  3VK9 A;  1IYI A;  1SJI A;  2XHF A;  5JWQ B;  3IAS 2;  4EF0 A;  4YQV A;  2VLT A;  1FO5 A;  5A5K A;  4G0L A;  3TJJ A;  3A3T A;  1Z6N A;  5HFI A;  2C3T A;  4CHS A;  1QXH A;  1OKD A;  2WS2 A;  2GVP A;  1M0U A;  2WRT A;  2B6M A;  3ZVJ D;  13GS A;  1JFU A;  4K5R A;  2N5B A;  4O32 A;  2EIR A;  4I2T A;  2Z9S A;  1A8Y A;  3P7X A;  5KN0 A;  2J23 A;  1HYU A;  1ZCP A;  1MDJ A;  1UN2 A;  5B6M A;  4E8E A;  5IMZ A;  4RI7 A;  2CX4 A;  3UVT A;  2VCT A;  3F63 A;  2FWF A;  4DSQ A;  4JZQ A;  1WMJ A;  2B7J A;  4MZB A;  2DIY A;  1BED A;  2YN1 A;  1O7U A;  4JRR A;  4JR6 A;  3TJG A;  1QMV A;  3H8Q A;  4POB A;  2X4A A;  3M9K A;  1E6B A;  3LWA A;  3GUS A;  2GDR A;  1PRX A;  3DIE A;  1DE1 A;  1BF5 A;  1ZOF A;  2YOI A;  2HT9 A;  2HZE A;  4K7I A;  2C8U A;  1QFN A;  1GNE A;  1BAY A;  3ZZX A;  3UVH A;  2PPT A;  3KEB A;  5GAN D;  3Q19 A;  3I43 A;  2F8A A;  1M2A A;  1B4P A;  1XVW A;  2ZUP A;  3HCZ A;  3MNG A;  2XBQ A;  1AQW A;  1F6M C;  3I6A A;  2V2G A;  2WZ9 A;  16GS A;  2EFH A;  4HOJ A;  3APQ A;  1K0N A;  3I69 A;  1OC8 A;  2H19 A;  5FWG A;  2IFQ B;  5B8A A;  3GIX A;  3G7J A;  2H70 A;  4ZB8 A;  3S9F A;  3Q74 A;  3QPM A;  10GS A;  4N0V A;  1JHB A;  1YZX A;  3N5O A;  5DAL A;  4POM A;  4IQ1 A;  2GQK A;  3FR6 A;  3G7I A;  3DKS A;  4KDX A;  5DAK A;  2EFE A;  4V2L A;  2CAQ A;  1GTA A;  1SKW B;  1U3I A;  3VI7 A;  2OJL A;  4L0W A;  1B4Q A;  4PQ1 A;  4J2F A;  4HJ2 A;  1A24 A;  4TXO B;  3GH6 A;  1YEP A;  3BOA A;  5IPG A;  3SBC A;  4LA1 A;  4AKH A;  1R26 A;  4XHM A;  1T8E B;  3FYG A;  3FRC A;  2HE3 A;  3L9S A;  3ZML A;  3QOU A;  2R3X A;  3O3T A;  1X5E A;  2LJK A;  3US3 A;  1SVM A;  1PA3 A;  2DKH A;  3L9U A;  3EVI A;  3I9V 2;  1Z5Y E;  2G2Q A;  2FY6 A;  1SJ6 A;  2HRK A;  4JBB A;  1HNC A;  11GS A;  1VF3 A;  1XXU A;  3KGK A;  3GHA A;  1ZYE A;  3QCP A;  3FR9 A;  5ECH B;  5EL8 A;  4N10 A;  4V1A g;  4GWR A;  4HQZ A;  3IV4 A;  2HSH A;  3M3M A;  4K2D A;  1OC9 B;  3KJY A;  1PMT A;  1NHO A;  1GRX A;  5G1K A;  4KAE A;  2B1L A;  4ACS A;  2WGR A;  2X99 A;  2R4V A;  2YPM A;  1G6W A;  5KN2 A;  3GYK A;  5GSS A;  3FZ4 A;  3EE2 A;  4ECJ A;  3TRQ A;  1WJK A;  3HJO A;  2V6O A;  2V41 A;  2PMT A;  2IMI A;  3IBH A;  4BL7 A;  4MJA A;  1O6J A;  1TI1 A;  4D73 B;  3UEM A;  5CRG A;  4BVY A;  5B8B A;  3IDV A;  4FH8 A;  1XFL A;  1V98 A;  5CRE A;  1M2B A;  1XOA A;  4TR4 A;  2A2S A;  3V1W A;  4I8B A;  3F3Q A;  3TB2 A;  2VIM A;  1F9M A;  2RUF A;  3ERF A;  5HR3 A;  1UA5 A;  17GS A;  2QSI A;  3QAW A;  2WB9 A;  2FA8 A;  3CRT A;  4HDE A;  1E2Y A;  1A2J A;  1XW6 A;  3OR5 A;  3KMN A;  2CVD A;  1MDI A;  3N9J A;  1F37 A;  4ZBD A;  2CVB A;  2LUS A;  2GSQ A;  9GSS A;  5CRW A;  3UAP A;  2HQT A;  3GSS A;  4OCE A;  2C1Y A;  5LCZ A;  4HUA A;  1XWB A;  3D4T A;  1Y25 A;  5COH A;  3EC3 A;  1WWJ A;  1SL1 B;  5CP1 A;  1XWK A;  4Q5Q A;  5ECL B;  2ALB A;  1B48 A;  2F8F A;  1ERV A;  1CQH A;  1ZYP A;  2MMA A;  2VL3 A;  3ME7 A;  4QQ7 A;  3WGE A;  3G7Y A;  4OO5 A;  1U3A A;  1ERT A;  2XPE A;  4PUF C;  4ML6 A;  5CRD A;  2R6K A;  1A8L A;  3ZRD A;  3E3E A;  1BG1 A;  1AC1 A;  2VCV A;  3CMI A;  5D93 A;  1JZR A;  2IPA A;  1SVL A;  2VD1 A;  2E2M A;  5FT3 A;  2YJH A;  1A0R P;  3RHB A;  5IO0 A;  5DQS A;  2HI7 A;  2EIO A;  2GZZ A;  1EOH A;  2GST A;  4GQC A;  2WCI A;  2LRC A;  3GFK A;  1ON4 A;  4XTS A;  4CY8 A;  4KH7 A;  4MJE A;  4ZXG A;  4EO3 A;  4X4J A;  1M7T A;  2V32 A;  3Q6O A;  4K1F A;  4OFM A;  5A34 B;  2YV9 A;  4WEY A;  2RM6 A;  2IL3 A;  2H6Y A;  2GT6 A;  4X43 A;  2YAN A;  3R2Q A;  1BYE A;  1XWG A;  5HFG A;  1OVN A;  5HR1 A;  2X8G A;  2H1A A;  3HYP A;  2FA4 A;  1JZW A;  2KOK A;  5KN3 A;  4KF9 A;  3WGD A;  20GS A;  4IP1 A;  2B1K A;  3CYN A;  2CAI A;  4KDU A;  4MCU A;  3UOM A;  1ML6 A;  3CSI A;  5ECQ B;  1HNB A;  2OE3 A;  3TOU A;  4HZ2 A;  2R5G A;  3GTU B;  1B9X C;  3VWW A;  3GMF A;  1XOB A;  5ECN B;  4IP6 A;  6GSY A;  2HYX A;  4TOP A;  4LMV A;  5GST A;  3IAM 2;  3J7Y k;  1ZZY A;  4MDC A;  2HNL A;  2YWN A;  1BJX A;  1GNW A;  1J08 A;  4XIH A;  2F3M A;  3TKS E;  1SD8 A;  4YAP A;  1ZMA A;  4OO4 A;  2YZU A;  1GSU A;  4MJB A;  5DBQ A;  2REM A;  4NHW A;  5ECI B;  2YJ7 A;  3WYW A;  3CXG A;  1O8X A;  1CQG A;  3IE3 A;  2DJ3 A;  1V40 A;  1BQ7 A;  4IVF A;  1TRW A;  3C8E A;  1BX9 A;  1GSE A;  4BPY A;  2IFQ A;  2PBJ A;  3BCI A;  1R4W A;  1DE2 A;  2FGX A;  4F03 A;  5LD0 A;  1S3A A;  4EIQ A;  5IM9 A;  2HSM B;  1VRS D;  4BVY B;  4Z2U A;  2J9H A;  5ELA A;  5J3R A;  1JLW A;  4NV2 A;  4FO5 A;  4JED A;  3UBL A;  1PKZ A;  2YP6 A;  5C00 A;  5HQP A;  1PQN A;  1SL2 B;  5J47 A;  3QAV A;  3M9J A;  3KXO A;  3TKS C;  5G31 A;  4MF6 A;  1H4O A;  1YJ6 A;  1AUC A;  5DQY A;  2I3Y A;  5D9X A;  1K0C A;  4MZW A;  3O76 A;  4TXV A;  4QL9 A;  1ACV A;  2PGT A;  4L5L A;  5E59 A;  3HJP A;  1VF4 A;  4CDO A;  2R0G A;  4GRF A;  3GKK A;  1GSQ A;  2IN3 A;  2H76 A;  2TIR A;  5C04 A;  1FAA A;  1SJZ A;  4NV5 A;  3GV1 A;  3A5W A;  4RI6 A;  3MIX A;  1AXD A;  1T3B A;  4O5Q A;  2WUL A;  2HRF A;  2C80 A;  3ZL5 A;  2OAC A;  5A1N B;  1OC9 A;  1Z9H A;  1SK1 A;  2IJY A;  5BMU B;  4E68 A;  4MK3 A;  4K9Z A;  4PQI A;  3D4M A;  1Q98 A;  3TJF A;  4IW9 A;  3F4R A;  4MH2 A;  3L4N A;  3RHC A;  4ZBA A;  5KN1 A;  3DGQ A;  4JR4 A;  1TTZ A;  2LNS A;  1TRV A;  3GRX A;  4NAX A;  4ULX A;  4AKX B;  4OWY A;  4D73 A;  5J9C A;  1TRS A;  2E2G A;  1S3C A;  1T4Z A;  1FW1 A;  1T1V A;  1FVK A;  3J7Y b;  4I2U A;  2L6C A;  5F0G A;  1GSS A;  5G5F A;  4O7H A;  3IPZ A;  4HI7 A;  2EC4 A;  7GSS A;  4HZ4 A;  4OFN A;  1EZK A;  2L57 A;  3QD9 A;  2OKA A;  1M9B A;  1PGT A;  5ECO B;  4GSN A;  2DJ2 A;  3UJ1 A;  1PL1 A;  1BG5 A;  1WOU A;  1K3O A;  1SEN A;  3DVW A;  2H1D A;  1YVL A;  3BJ5 A;  2O8V B;  2P0G A;  1ERU A;  1U88 A;  3IXR A;  4G0I A;  4KW6 A;  3TJK A;  3CBU A;  4L5O A;  4F0B A;  3M1G A;  1JZO A;  3FZ9 A;  1DSB A;  4IJI A;  2L5L A;  4E8H A;  1V58 A;  4WF4 A;  4EDZ A;  1VGL A;  2LRT A;  4K0N A;  2GT5 A;  1A2L A;  1ERW A;  4K7N A;  1KNG A;  3EMP A;  5B7C A;  3A5I A;  1DUG A;  1K0O A;  1Z7R A;  5G5E A;  4Q5R A;  1M9A A;  4ISD A;  3A2W A;  1PN0 A;  1PX7 A;  3LJR A;  4K5S A;  4MPG A;  2PVQ A;  2NBS A;  4WXT A;  2FD3 A;  5GAP D;  3A2X A;  1GL8 A;  18GS A;  2IMF A;  5J4Y A;  2F51 A;  1GUK A;  2H72 A;  1SYX A;  5KEJ A;  3L9V A;  4F0C A;  2GS3 A;  3QFB C;  4IGJ A;  1YY7 A;  3H4K A;  3MSZ A;  2XBI A;  2RM5 A;  8GSS A;  2TRC P;  1GUM A;  3E9J B;  2LJA A;  4K2X A;  1TI3 A;  1TU7 A;  1I9D A;  3EU3 A;  1Q4J A;  4ZL7 A;  1A23 A;  1XWA A;  4PUR A;  5A34 A;  3VWV A;  4FYU A;  5AIX A;  3GA4 A;  2KHP A;  1M99 A;  2H1B A;  4DSS B;  5H5R A;  4G9H A;  5E4W A;  3FHK A;  3VI5 A;  2K18 A;  3H1N A;  3C7M A;  3M8N A;  4XRD A;  3K8N A;  3KCM A;  1XVQ A;  2GSR A;  3PPU A;  5ELG A;  3TKQ A;  2AYT A;  2HRN A;  1AIU A;  3FKF A;  4TR1 B;  1ZGN A;  3LQ7 A;  2I81 A;  2YWI A;  3HXS A;  2CZ2 A;  1VF2 A;  2F9S A;  4ZL8 A;  3FY7 A;  1ZL9 A;  1K3Y A;  2LQQ A;  3GTU A;  2DBC A;  1S3D A;  2DC5 A;  2PWJ A;  3FEU A;  2C0F A;  2JZT A;  2GTU A;  1G7E A;  3O6T A;  4N0Z A;  1LBK A;  1TXX A;  1YKA A;  3RBT A;  2VL2 A;  5D9W A;  2EIQ A;  4GXZ A;  5BRT A;  5L71 A;  1EGO A;  4AI6 A;  2OA7 A;  1SL0 B;  1GSD A;  4CY6 A;  4ECC A;  4NMU A;  1GLQ A;  1QGV A;  3PIN A;  5HR0 A;  2MBS A;  3HVV A;  2ES7 A;  4I6X A;  4GF0 A;  2R0P A;  1MDK A;  4POL A;  2I9H A;  1FB6 A;  5D73 A;  5H5Q A;  3TUE A;  2LJR A;  2VO4 A;  3CSH A;  3L78 A;  1PX6 A;  1EGR A;  2HSY A;  2X49 A;  4PNG A;  3ZIV A;  4IJ3 A;  3QAG A;  2BTO T;  2CV4 A;  1GP1 A;  4MP4 A;  2DJJ A;  4KA0 A;  3GX0 A;  4YAV A;  3LEF A;  2HSM A;  2VCQ A;  1HNA A;  3IHG A;  4XRA A;  3VWU A;  3HMJ G;  1IYH A;  2FHE A;  4QL7 A;  2DIZ A;  3TRX A;  2BJX A;  2C3Q A;  2YWM A;  1GTI A;  2L5O A;  1GUH A;  1WIK A;  4BA7 A;  4K8M A;  5ECM B;  2H30 A;  3ZIJ A;  4J57 E;  2JSY A;  3UBK A;  4YH2 A;  2MYG A;  2QGV A;  2FLS A;  3GKX A;  4AGS A;  4MH3 A;  1O85 A;  2GZY A;  2DSA A;  2LV3 A;  3NIV A;  3U6V A;  4KX4 A;  3IA1 A;  1ABA A;  4FYC A;  4K6X A;  2JSZ A;  2H73 A;  3DYR A;  5A1N A;  4PXO A;  1URM A;  3IR4 A;  3F9U A;  2LST A;  2C4J A;  1R7H A;  4WR4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...