3HJOA

Crystal structure of glutathione transferase pi y108v mutant in complex with the glutathione conjugate of ethacrynic acid
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
209
structure length
209
Chain Sequence
PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIVTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase P
publication title Influence of the H-site residue 108 on human glutathione transferase P1-1 ligand binding: structure-thermodynamic relationships and thermal stability.
pubmed doi rcsb
source organism Homo sapiens
total genus 81
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2009-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3hjoA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3hjoA01
5ECMB 1LJRA 2UZ8A 3QFBC 4XRDA 3F63A 5DJLA 2LNTA 4FQUA 1QXHA 4ZB9A 3UAPA 4YAPA 4POBA 4V2LA 3WT1A 2C3TA 5ELAA 2DBCA 2H76A 3M9KA 5C04A 3KP9A 1QQ2A 1XFLA 3GTUB 2IMFA 3QAVA 1X9MB 2JZRA 5LD0A 3HVSA 2YWOA 2JADA 3L78A 3FRCA 2CT6A 1T4YA 3A2XA 3C71A 1ERVA 5JWOB 2O89A 3C8EA 3BJ5A 5IPGA 3ZMLA 2AJQB 3ZIVA 4LA1A 3I43A 5HR1A 2HSMB 5HFIA 2IMEA 3E0UA 5CRWA 1YY7A 5HR3A 1T4ZA 4JR4A 1VF2A 2E2GA 2XBQA 3GL5A 1K0CA 2HRKB 3UARA 3K8NA 4MMMA 4OD7A 2CQ9A 2VLUA 1M2DA 1PX7A 5ECQB 3RDWA 2VCZA 5KN2A 1K0AA 1WWJA 4MJCA 2LRTA 4K7OA 4WEYA 2JU5A 4X0XA 4FH8A 1RQMA 2IIYA 5ECOB 4KF9A 1K3OA 5JWRB 3FEUA 1YKAA 4IGJA 4XS4A 2HZEA 2HYXA 4IBPA 4GRFA 1TRUA 1THXA 2WJUA 1HQOA 1F37A 1FAAA 2AUVA 1GNWA 2EIQA 2P5RA 1ILOA 16GSA 3Q18A 1VF3A 1XWAA 3FW2A 3LYPA 4DSSB 1DSBA 2CX3A 3MDKA 1GTUA 2LJRA 2C0GA 2M80A 2V6OA 5ID2B 2H74A 4RQRA 1PKWA 5EPFA 3D4MA 5HR2A 1XOAA 5J3RA 3ERFA 1AW9A 1Z7PA 2B5EA 3F4TA 3GSTA 2RLIA 4FIWA 4KB3A 3UVTA 3GKMA 5DVBA 4K0GA 2LTKA 4JBBA 4KDYA 2QGVA 3BCKA 4HU7A 2P31A 3HXSA 1XW5A 3IE3A 4MZWA 3J7Yk 3UL3A 2CAQA 1IYIA 2GQLA 2NVLA 1TOFA 2VAFA 3D4TA 5B8AA 3TKSC 4HQZA 2VLVA 5A4UA 4TRXA 3CXGA 4LL4B 2VD0A 3FZAA 3CSJA 3QAWA 3TOTA 2MMOA 1TK5B 1R4WA 3KGKA 3FR3A 1S3DA 1N2AA 4GXZA 2XBIA 3W8SA 3E3EA 3MAKA 5DBQA 1WPIA 1AAZA 4MA9A 1U3IA 3ZFLA 5IOXA 1ZYQB 3GL3A 2KHPA 1KTEA 2H0IA 4GSTA 3C1SA 5LNKe 1YJ6A 2GSTA 6GSSA 5EVOA 3UVHA 3ZMKA 1X5CA 1HNBA 3IRAA 1FHEA 6GSYA 1URMA 3LQ7A 4POKA 4EVMA 3VPQA 2AAWA 2ON7A 1QFNA 3KTLA 4KAEA 4YQMA 1B9YC 3BD2A 5ECLB 3GN3A 5IMCA 1A24A 2FGXA 2OACA 5DAKA 2H71A 3FZ4A 3HVXA 5GAPD 1K0OA 1GSUA 1GL8A 1TDIA 3UEMA 4HI7A 4KDUA 1SK2A 3IC8A 2PPTA 1V98A 3HY2A 3GHAA 1JZDA 4WKWA 3P7XA 2HNLA 1GH2A 4F03A 3KM6A 3TJGA 5GZZB 4TVEA 2P5QA 3UJ1A 4GSNA 4TR4A 1GSSA 3LXZA 1XVQA 2VLTA 3LYKA 4MP4A 3V1WA 4K8MA 4IW9A 1Y6EA 4DVCA 4L5LA 3H1NA 3A2WA 2R4VA 5ECIB 2V2GA 3LEFA 1OKTA 1EZKA 4PTSA 3UBLA 1WRYA 2C0DA 3A5WA 2CV4A 1GSFA 2I81A 3IA1A 1MTCA 1FW1A 1AQXA 2HRFA 1GSYA 2DMMA 5J9CA 3ZL5A 5EY6A 1V57A 4HQSA 3D5JA 1SKSB 2IWTA 1SYXA 1G7OA 3R3EA 2H19A 3PH9A 4BA7A 2AV4A 3NIVA 1XOBA 1FB6A 4HU9A 1MDIA 1ZMAA 3TKRA 2HRNA 4NMUA 1QUWA 1NSWA 3J7Yb 3DWVA 5CREA 1GUMA 4I5QA 4OWYA 4LMWA 2WGRA 3O3TA 3F6FA 5ENUA 2GS3A 3KMOA 4D73B 5IO2A 4GQCA 4WBRD 2YCDA 1M9BA 2F8AA 2ZCTA 2H8LA 3LWAA 4RUVA 1IYHA 2KP1A 4NHWA 5D9XA 1PQNA 2F9SA 2HFDA 4L5OA 4EDZA 2VM2A 2FA4A 2PERA 4Q5QA 3L4NA 5D9VA 2GZYA 4TXOA 2HZFA 4ACSA 4O5RA 4IS0A 2HI7A 4OO4A 1OC3A 2OE0A 5ECSA 2GSRA 2H72A 2VL9A 4WETA 1B9XC 2BMXA 3C1RA 1OAZA 5KN3A 2RM5A 1DE1A 2V1MA 4F9ZA 2GZZA 1A23A 2IL3A 2VUPA 2QC7A 1O81A 3UBKA 4X43A 3FR9A 4O32A 20GSA 1YZXA 13GSA 1GSQA 3O76A 4EE0A 1E2YA 1M2BA 2VCTA 4NXIA 3KTBA 2C8UA 4N11A 3JCML 4BVXA 3DVWA 4J56E 2NDOA 4X1UA 2FUG2 2PGTA 5DQYA 2L57A 2GTUA 3L9UA 1M99A 2CA8A 5AN1A 1SU9A 1O8WA 3TKPA 2E2MA 3CTGA 3GA4A 4AGSA 3RPNA 3DGQA 3DIEA 3TJKA 5D9TA 4N0VA 4EDYA 4JZQA 3DYRA 4XTSA 3U5RE 5DALB 3L0HA 9GSSA 2HXKA 5IMVA 2YZUA 4MPFA 3TUEA 3D21A 4I2TA 1HNAA 5IIZA 1DUGA 4L0UA 3EVIA 5IMFA 5ECHB 2IMIA 1O8XA 3GX0A 3HA9A 5F07A 3ZZXA 2RM6A 3ZIJA 2RUEA 4PNFA 3EINA 4JU5A 3M1GA 2K9FA 2MMAA 3VWWA 2YJHA 2H1GA 4WXTA 4POLA 1GLPA 2GGTA 1GNEA 4MH2A 5H5QA 1TRWA 4GTUA 1KNGA 4MZCA 2J23A 4N30A 4CW9A 1F3BA 5EL8A 1PKZA 3CRTA 3CRUA 2IFQB 5DCHA 4EC0A 5J4UA 1A8YA 4Z7XA 5DCGA 1TKDB 1SK0A 4K9ZA 1YF1A 4LMVA 2GLRA 4NV5A 3PGTA 2DSAA 3GX8A 3IOSA 1EOGA 4ZB6A 4KA0A 2NTOA 1ML6A 2GT6A 1TK8B 2CX4A 1F3AA 1XWKA 1JZOA 3TDGA 1ZGNA 10GSA 1QGVA 3PPUA 3TKQA 1NHOA 2VCXA 1PMTA 4HUAA 2VD1A 3GNJA 2IPAA 4MJBA 3ERGA 3VURA 2MBSA 1ACVA 5G2ZA 1THOA 4F2IA 4V1Ag 4ZIJA 3GKXA 7GSSA 3IAM2 2GQMA 4PGTA 4HDEA 5HR0A 5LCZA 3A3TA 4GWRA 1HYUA 5ELGA 3QDNA 4GF0A 3KZQA 1LU4A 1T8EB 4XS1A 2LQQA 5B6MA 4I97A 4WF5A 2R2JA 1G6YA 3DVXA 3O6TA 1YEPA 1Z6MA 3QFAC 2VCWA 2V32A 4OFTA 5E59A 1RK4A 4OFNA 2K8VA 1FO5A 1M2AA 3TCOA 2JZSA 3IC4A 2LV3A 4KUNA 3GTUA 4MF7A 2B7JA 5ECNB 2O85A 1FB0A 4ZL8A 2Z9SA 2MYGA 1B4QA 3LGCA 4AF2A 3QD9A 5GSTA 2B1KA 3HDCA 3IBHA 4CDOA 3KH9A 6GSTA 1XWCA 5H5RA 1EOHA 2IJYA 4XCSA 5HFKA 4KSMA 5ECRB 4IVFA 3RPPA 2A2RA 3UMAA 3KH7A 3KMNA 3UOMA 2HSYA 3GV1A 1WIKA 2WDUA 2HSMA 1GRXA 1O73A 3C7MA 2L59A 5G1KA 2FA8A 3W6GA 4MJEA 3LSZA 2HSHA 4N0ZA 3HJOA 5ECKB 3GUSA 3L9VA 1Q4JA 3VLNA 4Q5RA 2N5FA 3RBTA 1UC7A 2IN3A 1NW2A 1J0FA 2PU9C 2OE3A 1ERUA 1YQ1A 1BAYA 3UIWA 3OR5A 2K18A 3FZ5A 1R26A 1TRSA 4ML6A 5IO0A 1U6TA 3CYNA 3ZTLA 4G0KA 4ECBA 3D22A 4GQFA 1YF0A 2XC2A 3WT2A 4QL7A 1OC9B 2JSYA 2FWEA 2JZTA 1TRVA 2A2SA 1JZRA 5GSSA 3H79A 3QMXA 5DJMA 3EE2A 3FY7A 2FWHA 3WGXA 5GAND 1TW9A 1EV4A 2ZNMA 1FVJA 3ZVJA 4DSSA 4QL9A 3F0IA 1ON4A 1C72A 4QQ7A 2C3NA 4H86A 2ES7A 3ERWA 1UA5A 4MCUA 3TKSE 5ID2A 4K2DA 1CQHA 1EGOA 1WOUA 2F8FA 3IAS2 4I8BA 4MH3A 5J5NA 4ZBDA 2LS5A 3HVVA 1Z7RA 4MJAA 2X64A 1SL1B 4HOJA 3IK7A 6GSWA 3KIJA 4ZILA 1X9WB 4IQ1A 4HZ2A 1PA3A 1A0RP 5D96A 4DSRA 5KN0A 4PQIA 3F4RA 4WBJA 5KEJA 2H75A 4TKYA 1SD8A 1GUHA 3FYGA 2L5LA 2X8GA 4KH7A 1ZOFA 3N9JA 2HLSA 3RHBA 4EL1A 2CVBA 2OADA 2CAIA 1SKWB 3QAGA 2PN8A 1Z3EA 1BEDA 2AHEA 2PVOC 4IELA 2X8HA 4ISDA 2C1YA 2TRXA 1E6BA 3QCPA 5FWGA 2YJ7A 4O92A 1H4OA 1A2JA 1WJKA 4BWQA 2FNOA 2GSQA 1XW9A 3CTFA 4ZXGA 3F6DA 2DJKA 3EC3A 1Z9HA 3ZITA 4ZL9A 3IV4A 5HQPA 2H70A 2O8VB 1TP9A 3CMIA 1TU8A 3RAZA 3VI7A 3L9SA 1HD2A 1GTAA 3LG6A 1PD21 3N5OA 3DD3A 4G19A 3IHQA 1ZYEA 4HJMA 2YWIA 3IXRA 2VL3A 1M7TA 4ECJA 3VI5A 2E7PA 4AJ6A 1QK8A 3QPMA 4I6XA 4G2EA 1OVNA 3LORA 3VFIA 2X8CA 2H1AA 3A2VA 4IJ3A 1KEBA 2N5AA 2B6MA 2FD3A 2DJ0A 3VWVA 3P8WA 2ON5A 3EU4A 1XZOA 3GKNA 1SJ6A 4BL7A 2EIOA 2C0FA 3DMLA 2V6KA 1SJIA 4YAVA 2WB9A 3ED3A 5F0GA 4G10A 1X0RA 5D93A 4ECCA 1Z6NA 3FR6A 3HJMA 2L5OA 4BVYB 4PUFC 2RIIA 4ULXA 3F3QA 3TGZA 4OO5A 4PX1A 1EEMA 2M46A 4FYBA 1VF4A 3LXTA 2J9HA 1VGLA 4KDXA 5AIXA 2WULA 5B6NA 2ZUPA 1XW6A 1B48A 3H8QA 1N8JA 4O7HA 3GYKA 2TIRA 5A4VA 5B7CA 1JLWA 4AJ8A 1BX9A 3TB2A 1HNCA 4HJ2A 1EV9A 1GWCA 1R5PA 4KGIA 2H1BA 3APOA 3NZNA 4HS1A 2VIMA 4L8EA 12GSA 2M72A 3EMXA 2VL2A 2EC4A 3NOFA 2B5XA 1TTZA 5E4WA 3TJJA 1BQ7A 3G7YA 3R2QA 5IQYA 2KUCA 1EWXA 4ID0A 2LRNA 3IR4A 1TK0B 1EP8A 4ECIA 4K0NA 4USSA 3G7JA 5J41A 4D73A 3Q74A 4PQHA 4PNGA 5B8BA 3BCIA 4LL1B 2BJXA 5CRHA 1A2LA 3ZRDA 4OMVA 2OBKA 4IP1A 3ZREA 4G9HA 1Z5YE 3IPZA 3KD0A 4TR1B 1TJDA 4YQVA 5D9WA 3LJRA 3SWLA 1NHYA 4GCIA 1AQWA 3FHKA 4EUYA 1W89A 1BYEA 1O7UA 1GSDA 2OE1A 2RUFA 2ALBA 2H30A 2DIZA 2HSNB 1TXXA 1R7HA 1SKRB 1R5AA 1UN2A 2LJKA 2HT9A 1GP1A 1Y25A 2L4QA 4TR0A 2BTOT 3ISOA 1SK1A 2REMA 4IN0A 2L6DA 1TI3A 3WYWA 2YP6A 2G2QA 1A0FA 1XPVA 2B5YA 4V2MA 2FHEA 2V41A 4JR6A 1EEJA 3ZLPA 4PQ1A 2E0QA 3Q6OA 3EU3A 4EF0A 2YANA 4IJIA 2CZ3A 4ZBAA 4EKZA 2YV7A 1DE2A 2B3SA 4P3YB 2MMZA 4JEDA 4NAXA 1I5GA 5ECPB 3DEXA 5HFGA 3DKSA 2I4AA 3SBCA 4RI7A 4K6XA 2X99A 2JL4A 1GLQA 1UVZA 2VOCA 4K7IA 3WGDA 2HRAA 1CQGA 2LSTA 1WP0A 2MMNA 2IMKA 3TJBA 5DALA 3QR6A 1AUCA 5G5EA 2DJJA 1PX6A 1J08A 3CSHA 3ZFBA 2CVDA 8GSSA 5JCWA 3FK8A 2DIYA 4OFMA 3IK9A 3IDVA 2P0GA 3GH6A 2A4VA 5L71A 1K0BA 4PXOA 3P2AA 4RQXA 2D2ZA 4XS4B 4NHZA 2GVPA 4V1Ap 2HZEB 5KN1A 5CNWA 1XXUA 5CAXA 3HYPA 3ZYWA 5G30A 3KCMA 22GSA 2L6CA 4OCEA 2WCIA 3APQA 4HZ4A 2IFQA 1U87A 4MK3A 5CYYA 2H6YA 3WGEA 3EURA 1SYRA 1GTIA 4G0IA 1YEXA 4FO5A 5IMAA 4IKHA 2G0FA 4YQUA 3VK9A 4MPGA 3TOUA 1JZWA 3Q19A 2H6ZA 2O87A 1AC1A 6GSVA 2HE3A 4XS6A 1XWGA 2N5BA 1SL0B 5IPHA 19GSA 4MDCA 5FHIA 1V40A 1ERWA 2K8SA 4N10A 2GSSA 3US3A 3F4SA 4Q5FA 4RI6A 4E8EA 3KJYA 3G9BA 2F3MA 4EXJA 2GDRA 3M9JA 1GULA 2H6XA 1I9DA 3GFKA 1FVKA 1GUKA 3APSA 1ZZYA 4YH2A 2JACA 4NV2A 4KCAA 3HD5A 1V58A 5F05A 3MSZA 1AQVA 1B4PA 4MF5A 2HQTA 4I2UA 1USBA 3PINA 5COHA 2DLXA 4AJ7A 4ML1A 4DSQA 2HRKA 5G5FA 5FT3A 4IQAA 3TRPA 2DJ2A 3CSIA 18GSA 1KBNA 4XRAA 2C0EA 4TN8A 2AYTA 1LBKA 1H75A 1SJZA 4ZBBA 2VL2C 1GTBA 1PL2A 3H93A 1F9MA 2EIRA 1X9SB 1OC8A 5C00A 4K7NA 3HZ8A 3F8UA 1PN9A 4OCFA 2YOIA 5DAKB 4GLTA 2PVQA 1TI1A 2LQOA 4WF4A 1WE0A 4NPBA 5D73A 3FKFA 1JLVA 4ZB8A 3VWUA 1XVWA 1J9BA 4KCEA 2C3QA 3D0ZA 5A4WA 2NPBA 2XPEA 2H73A 4Q5NA 3KP8A 1T3BA 1JHBA 4IP6A 5JCGA 1ZCPA 1O6JA 2PWJA 2QKEA 4XIHA 2FLSA 2B1LA 1JFUA 3F3RA 4BPYA 1U3AA 2XPDA 1ERTA 3LFLA 1MD3A 1YDKA 1PSQA 1MD4A 1XBSA 4KW6A 4L0WA 1VRSD 4TW5A 1V2AA 4J2FA 11GSA 4GSSA 3E9JB 1ABAA 5CP1A 1W4VA 3GKKA 2VO4A 2JSZA 1BG5A 2YZHA 3EMPA 2I9HA 4KX4A 2GZPA 4PURA 2DJ3A 1MDKA 4LLRA 4TOPA 3HJPA 3ZVJD 4KE3A 2OBIA 1OC9A 2C4JA 1T1VA 4EO3A 3TJFA 4F0CA 3HKRA 3AY8A 4IHUA 4BL7B 4F82A 1K3YA 1AIUA 3CBUA 1PRXA 2GT5A 3D6IA 4TR3A 3MWHA 2YPMA 3QOUA 3M8NA 4DEJA 1S3AA 3H4KA 1WMJA 2R37A 4CHSA 2AB6A 1BJXA 5F8BA 1VF1A 1ST9A 3RHCA 3ME7A 3PR8A 2VCQA 2R3XA 2FWFA 3WD6A 2OA7A 1B8XA 2YNXA 5INYA 2LRCA 4TXOB 2R6KA 2QSIA 2IMDA 1MEKA 1QMVA 1OYJA 2YWNA 1OE7A 2YN1A 3EYTA 3EWLA 2PUKC 4XHMA 1TU7A 2KOKA 2OJLA 1K0DA 5G1LA 4TXVA 4JRRA 4ZL7A 1EP7A 4WR5A 5CRGA 3BBYA 2GQKA 1RW1A 4MF6A 2TRCP 4FYCA 1ZL9A 2LUSA 4ILFA 4K1FA 1V9WA 5CRDA 5IM9A 2WRTA 2I1UA 3GH9A 1PL1A 2LKUA 4BVXB 2H01A 1A8LA 1F6MC 3KXOA 3VPTA 4MABA 2KLXA 3M0FA 2MBTA 3P90A 2LEGA 1U88A 3GURA 2CVKA 3BOAA 2H66A 2WS2A 2VCVA 5DQSA 4POMA 3DXBA 4KNDA 1GSEA 6GSXA 1SENA 3FZ9A 3M3MA 4J57E 1FG4A 4V2NA 1OKDA 5AIVA 3HCZA 1T00A 1G6WA 4BVYA 2FCHA 3GIXA 4F0BA 1M0UA 5F06A 3GSSA 2O7KA 2FY6A 2C80A 2K6VA 5AISA 4KSOA 3ME8A 5A5KA 3TRXA 3TKSA 5BMUA 5AGYA 2B7KA 1K3LA 5JWQB 2MZCA 2DMLA 4BWSA 2OKAA 3F9UA 1T7PB 2PMTA 3GMFA 2H0GA 1G0TA 2F51A 4FYUA 1A2MA 2WFCA 3HHVA 3KEBA 3TRQA 2R5GA 3HZ4A 1K0NA 4PUAA 1O85A 5IMZA 3G7IA 5D8IA 4MLYA 3I6AA 1Q98A 1FOVA 1M9AA 17GSA 5IMDA 3VWXA 1AXDA 2XHFA 4E8HA 1S3CA 5IOWA 4HEA2 5ABRA 5J9BA 4JE1A 3W8JA 5CO3A 6GSUA 1NM3A 3U6VA 1EGRA 2YV9A 14GSA 2FWGA 2PBJA 2LNSA 1X5EA 1PGTA 1XCCA 2DC5A 2YWMA 5JCUA 2WZ9A 2I3YA 1OE8A 3MNGA 1DBYA 1G7EA 1K0MA 1YKCA 2H0HA 2LJAA 2KP2A 5DDLA 2DJ1A 3DRNA 3S9FA 4MZBA 4G0LA 1XWBA 1XIYA 5G31A 4TR1A 4WR4A 2CZ2A 4NWYA 1SD9A 3GRXA 3I69A 1X5DA 2VM1A 2L4CA 2H1DA 3C73A 5H5SA 1MDJA 1F2EA 2NBSA 3I9V2 1SL2B
chains in the Genus database with same CATH superfamily
5ECMB 1LJRA 2UZ8A 3QFBC 4XRDA 3F63A 5DJLA 2LNTA 4FQUA 1QXHA 4ZB9A 3UAPA 4YAPA 4POBA 4V2LA 3WT1A 2C3TA 5ELAA 2DBCA 2H76A 3M9KA 5C04A 3KP9A 1QQ2A 4AKHA 1XFLA 3GTUB 2IMFA 3QAVA 1X9MB 2JZRA 5LD0A 3HVSA 2YWOA 2JADA 3L78A 3FRCA 2CT6A 1T4YA 3A2XA 2OT3A 1ERVA 3C71A 5JWOB 2O89A 3C8EA 3BJ5A 5IPGA 3ZMLA 2AJQB 3ZIVA 4LA1A 3I43A 5HR1A 2HSMB 5HFIA 2IMEA 3E0UA 5CRWA 1YY7A 5HR3A 1T4ZA 4JR4A 1VF2A 2E2GA 2XBQA 3GL5A 1K0CA 2HRKB 3UARA 3K8NA 4MMMA 4OD7A 2CQ9A 2VLUA 1M2DA 1PX7A 5ECQB 3RDWA 2VCZA 5KN2A 1K0AA 1WWJA 4MJCA 2LRTA 4K7OA 4WEYA 2JU5A 4X0XA 4FH8A 1RQMA 2IIYA 5ECOB 4KF9A 1K3OA 5JWRB 3FEUA 1I1IP 1YKAA 4IGJA 4XS4A 2HZEA 2HYXA 4IBPA 4GRFA 1TRUA 1THXA 2WJUA 1HQOA 1F37A 1FAAA 2AUVA 1GNWA 2EIQA 2P5RA 1ILOA 16GSA 3Q18A 1VF3A 4N3ZA 1XWAA 3FW2A 3LYPA 1TXUA 4DSSB 1DSBA 2CX3A 3MDKA 1GTUA 2LJRA 2C0GA 2M80A 2V6OA 5ID2B 2H74A 4RQRA 1PKWA 5EPFA 3D4MA 5HR2A 1XOAA 3RGBC 5J3RA 3ERFA 1AW9A 1Z7PA 2B5EA 3F4TA 3GSTA 2RLIA 4FIWA 4KB3A 3UVTA 3GKMA 5DVBA 4K0GA 2LTKA 2WW2A 4JBBA 4KDYA 2QGVA 3BCKA 4HU7A 2P31A 3HXSA 1XW5A 3IE3A 4MZWA 3J7Yk 3UL3A 2CAQA 1IYIA 2GQLA 2NVLA 2QA1A 1TOFA 1PN0A 2VAFA 3D4TA 5B8AA 3TKSC 4HQZA 2VLVA 5A4UA 4TRXA 3CXGA 4LL4B 2VD0A 4AKGA 3FZAA 3CSJA 3QAWA 3TOTA 2MMOA 1TK5B 1R4WA 3KGKA 3FR3A 1S3DA 1N2AA 2XBIA 4GXZA 3W8SA 3E3EA 4FXYP 3MAKA 5DBQA 1WPIA 1AAZA 4MA9A 1U3IA 3ZFLA 5IOXA 1ZYQB 4GDFA 3GL3A 2KHPA 1KTEA 2H0IA 4GSTA 3C1SA 5LNKe 1YJ6A 2GSTA 6GSSA 5EVOA 3UVHA 3ZMKA 1X5CA 1HNBA 3IRAA 1FHEA 6GSYA 1URMA 3LQ7A 4POKA 4EVMA 3VPQA 2AAWA 2ON7A 1QFNA 3KTLA 4KAEA 4YQMA 1B9YC 3BD2A 5ECLB 3GN3A 5IMCA 1A24A 2H1LA 2FGXA 2OACA 5DAKA 2H71A 3HVXA 3FZ4A 3HVNA 5GAPD 4K5SA 1K0OA 1BG1A 1GSUA 1GL8A 1TDIA 3UEMA 5A5HB 1PFOA 4HI7A 4KDUA 1SK2A 3IC8A 2PPTA 1V98A 3HY2A 3GHAA 1JZDA 4WKWA 3P7XA 2HNLA 1GH2A 4F03A 3KM6A 3TJGA 5GZZB 4TVEA 2P5QA 3UJ1A 4GSNA 4TR4A 1GSSA 3LXZA 1XVQA 2VLTA 3LYKA 4MP4A 3V1WA 4K8MA 4IW9A 1Y6EA 4DVCA 4L5LA 3H1NA 3A2WA 2R4VA 5ECIB 2V2GA 3LEFA 1OKTA 1EZKA 4PTSA 3UBLA 1WRYA 2C0DA 3A5WA 2CV4A 1GSFA 2I81A 3IA1A 1MTCA 1FW1A 1AQXA 2HRFA 1GSYA 2DMMA 5J9CA 3ZL5A 5EY6A 2O36A 1V57A 4HQSA 3D5JA 1SKSB 5J4YA 2IWTA 1SYXA 1G7OA 3R3EA 2H19A 1ZYPA 3PH9A 4Z2TA 4BA7A 2AV4A 3NIVA 1XOBA 1FB6A 4HU9A 1MDIA 1ZMAA 3TKRA 2HRNA 4NMUA 1QUWA 1NSWA 3J7Yb 3DWVA 5CREA 1GUMA 4I5QA 4OWYA 2WVXA 4LMWA 2WGRA 3O3TA 3F6FA 3CHXC 5ENUA 2GS3A 3KMOA 4D73B 5IO2A 4GQCA 4WBRD 2YCDA 1M9BA 2F8AA 2ZCTA 2H8LA 3LWAA 4RUVA 1IYHA 2KP1A 3MYDA 4NHWA 5D9XA 1PQNA 2F9SA 2HFDA 4L5OA 4EDZA 3HMJG 2VM2A 2FA4A 2PERA 4Q5QA 3L4NA 5D9VA 2GZYA 4TXOA 2HZFA 4ACSA 4O5RA 4IS0A 2HI7A 4OO4A 1OC3A 2OE0A 5ECSA 2GSRA 3TU3B 2H72A 2VL9A 2EFHA 4WETA 1B9XC 2BMXA 3C1RA 1OAZA 5KN3A 2RM5A 1DE1A 2V1MA 4F9ZA 2GZZA 1A23A 2IL3A 2VUPA 2QC7A 1O81A 3UBKA 2O3EA 4X43A 3FR9A 4O32A 20GSA 1YZXA 13GSA 1GSQA 2EFEA 3O76A 4EE0A 1E2YA 1M2BA 2VCTA 4NXIA 3KTBA 2C8UA 4N11A 3JCML 4BVXA 3DVWA 1SVMA 1SVOA 2NDOA 4J56E 4X1UA 2FUG2 2PGTA 5DQYA 2L57A 2GTUA 3L9UA 1M99A 2CA8A 5AN1A 1SU9A 1O8WA 3TKPA 2E2MA 3CTGA 3GA4A 4AI6A 4AGSA 3RPNA 3DGQA 3DIEA 3TJKA 5D9TA 4N0VA 4EDYA 4JZQA 3DYRA 4XTSA 3U5RE 5DALB 3L0HA 9GSSA 2HXKA 5IMVA 2YZUA 4MPFA 3TUEA 3D21A 4I2TA 1HNAA 5IIZA 1DUGA 4L0UA 3EVIA 5IMFA 5ECHB 2IMIA 1O8XA 3GX0A 1M3JA 3HA9A 5F07A 3ZZXA 2RM6A 4PI2C 3ZIJA 2RUEA 4PNFA 3EINA 4JU5A 3M1GA 2K9FA 2MMAA 3VWWA 2YJHA 2H1GA 4WXTA 4POLA 1GLPA 2GGTA 1GNEA 4MH2A 5H5QA 1TRWA 4GTUA 1KNGA 4MZCA 2J23A 4N30A 4CW9A 1F3BA 5EL8A 1PKZA 3CRTA 3CRUA 2IFQB 5DCHA 4EC0A 5J4UA 1A8YA 2EFDA 4Z7XA 5DCGA 1TKDB 1SK0A 4K9ZA 1YF1A 4LMVA 2GLRA 4NV5A 3PGTA 2DSAA 3GX8A 3IOSA 1EOGA 4ZB6A 4KA0A 2NTOA 1ML6A 2GT6A 1TK8B 2CX4A 1XG8A 4HSCX 1F3AA 1XWKA 1JZOA 3TDGA 1ZGNA 10GSA 1QGVA 3PPUA 5A34A 3TKQA 1NHOA 2VCXA 1PMTA 4HUAA 1BF5A 2VD1A 3GNJA 2IPAA 4MJBA 3ERGA 3VURA 2MBSA 1ACVA 5G2ZA 1THOA 4F2IA 4V1Ag 4ZIJA 3GKXA 7GSSA 3IAM2 2GQMA 4PGTA 4HDEA 5HR0A 5LCZA 3A3TA 4GWRA 1HYUA 5ELGA 3QDNA 4GF0A 3KZQA 1LU4A 1T8EB 4XS1A 2LQQA 5B6MA 4I97A 4WF5A 2R2JA 4YKFA 1G6YA 3DVXA 3O6TA 1YEPA 1Z6MA 3QFAC 2VCWA 2V32A 4OFTA 5E59A 1RK4A 1S3RA 4OFNA 5J47A 2K8VA 1FO5A 1M2AA 3TCOA 2JZSA 3IC4A 2LV3A 4KUNA 3CWGA 3GTUA 4MF7A 5ECNB 4AKIA 2B7JA 2O85A 1FB0A 4ZL8A 2Z9SA 2MYGA 1B4QA 3LGCA 4AF2A 3QD9A 5GSTA 2B1KA 3HDCA 3IBHA 4CDOA 3KH9A 6GSTA 1XWCA 5H5RA 1EOHA 2IJYA 5J4VA 4XCSA 5HFKA 4KSMA 5ECRB 4IVFA 3RPPA 2A2RA 3UMAA 3KH7A 3KMNA 3UOMA 2HSYA 3GV1A 1WIKA 2WDUA 2HSMA 1GRXA 1O73A 3C7MA 2L59A 5G1KA 2FA8A 3W6GA 4MJEA 3LSZA 2HSHA 4N0ZA 3HJOA 5ECKB 3GUSA 3L9VA 1Q4JA 3VLNA 4Q5RA 2X4AA 2N5FA 3RBTA 1UC7A 2IN3A 1NW2A 5KOWA 1J0FA 2PU9C 2OE3A 1ERUA 1YQ1A 1BAYA 3UIWA 3OR5A 2K18A 3FZ5A 1R26A 1TRSA 4ML6A 5IO0A 1U6TA 3CYNA 3ZTLA 4G0KA 4ECBA 3D22A 4GQFA 4A5PA 1YF0A 2XC2A 3WT2A 4QL7A 1OC9B 2JSYA 2FWEA 2JZTA 1TRVA 2A2SA 4MNNA 1JZRA 5GSSA 3H79A 3QMXA 5DJMA 3EE2A 3FY7A 4CY8A 2FWHA 3WGXA 5GAND 1TW9A 1EV4A 2ZNMA 1FVJA 3ZVJA 4DSSA 4QL9A 3F0IA 1ON4A 1C72A 4QQ7A 2C3NA 4H86A 2ES7A 3ERWA 1UA5A 4MCUA 3TKSE 5ID2A 4K2DA 1CQHA 1EGOA 1WOUA 2F8FA 3IAS2 4I8BA 4MH3A 5J5NA 4ZBDA 2LS5A 3HVVA 1Z7RA 4MJAA 2X64A 1SL1B 4HOJA 3IK7A 6GSWA 3KIJA 4ZILA 1X9WB 4IQ1A 4HZ2A 1PA3A 4G01A 1A0RP 5D96A 4DSRA 5KN0A 4PQIA 3LW9A 3F4RA 4WBJA 5KEJA 2H75A 4TKYA 1SD8A 1GUHA 3FYGA 2L5LA 2X8GA 4KH7A 1ZOFA 3N9JA 2HLSA 3RHBA 4EL1A 2CVBA 2OADA 2CAIA 1SKWB 3QAGA 4O5QA 2PN8A 1Z3EA 1BEDA 2X49A 2AHEA 2PVOC 2TRXA 2X8HA 4IELA 4ISDA 2C1YA 5A1NA 1E6BA 3QCPA 5FWGA 2YJ7A 4O92A 1H4OA 1A2JA 1WJKA 4BWQA 2FNOA 2GSQA 1XW9A 3CTFA 4ZXGA 3F6DA 2DJKA 3EC3A 1Z9HA 3ZITA 4ZL9A 3IV4A 5HQPA 2H70A 2O8VB 1TP9A 3CMIA 1TU8A 3RAZA 3VI7A 3L9SA 1HD2A 1GTAA 3LG6A 1PD21 4QMKA 3N5OA 3DD3A 4G19A 3IHQA 1ZYEA 2WVXB 4HJMA 2YWIA 3IXRA 2VL3A 1M7TA 4ECJA 3VI5A 2E7PA 4AJ6A 1QK8A 3QPMA 4I6XA 4G2EA 1OVNA 3LORA 3VFIA 2X8CA 2H1AA 3A2VA 4IJ3A 1KEBA 2N5AA 2B6MA 1S4BP 2FD3A 2DJ0A 3VWVA 3P8WA 2ON5A 2A2PA 3EU4A 1XZOA 3GKNA 1SJ6A 5A5HA 4BL7A 2EIOA 2C0FA 3DMLA 2V6KA 1SJIA 4YAVA 2WB9A 3ED3A 5F0GA 4G10A 1X0RA 5D93A 4ECCA 1Z6NA 1SVLA 3FR6A 3HJMA 2L5OA 4BVYB 4PUFC 2RIIA 4ULXA 3F3QA 3TGZA 4OO5A 4PX1A 1EEMA 2M46A 4FYBA 1VF4A 2DKHA 3LXTA 5BMUB 2WVZA 2J9HA 1M3IA 1VGLA 4KDXA 1ZYNA 5AIXA 5BRTA 2WULA 5B6NA 2ZUPA 1XW6A 1B48A 3H8QA 1N8JA 4O7HA 4X4JA 3GYKA 2TIRA 5A4VA 5B7CA 1JLWA 4AJ8A 5KOXA 1BX9A 3TB2A 4W66A 1N25A 1HNCA 4HJ2A 1EV9A 1GWCA 1R5PA 4KGIA 2H1BA 3APOA 3NZNA 4HS1A 2VIMA 4L8EA 12GSA 2M72A 3EMXA 2VL2A 2EC4A 3NOFA 2B5XA 1TTZA 5E4WA 3TJJA 1BQ7A 3G7YA 3R2QA 5IQYA 2KUCA 1EWXA 4ID0A 2LRNA 3IR4A 1TK0B 1EP8A 4ECIA 4K0NA 4USSA 3G7JA 5J41A 4D73A 3Q74A 2R0GA 4PQHA 4PNGA 5B8BA 3BCIA 4LL1B 2BJXA 5CRHA 1A2LA 4E68A 3ZRDA 4OMVA 2OBKA 4IP1A 3ZREA 4G9HA 1Z5YE 3IPZA 3KD0A 4TR1B 1TJDA 4YQVA 5D9WA 3LJRA 3SWLA 1NHYA 4GCIA 1AQWA 3FHKA 4EUYA 1W89A 1BYEA 1O7UA 1GSDA 2OE1A 2R0PA 2RUFA 2ALBA 2H30A 2DIZA 2HSNB 1TXXA 1R7HA 1SKRB 1R5AA 1UN2A 2LJKA 2HT9A 1GP1A 1Y25A 2L4QA 4TR0A 2BTOT 3ISOA 1SK1A 2REMA 4IN0A 2L6DA 1TI3A 3WYWA 2YP6A 2G2QA 1A0FA 1XPVA 2B5YA 4V2MA 2FHEA 2V41A 4JR6A 4EIQA 1EEJA 3ZLPA 4PQ1A 2E0QA 3Q6OA 3EU3A 4EF0A 2YANA 4IJIA 2CZ3A 4ZBAA 4EKZA 1YEWC 2YV7A 1DE2A 2B3SA 4P3YB 2MMZA 4JEDA 4NAXA 1I5GA 5ECPB 3DEXA 5HFGA 3DKSA 2I4AA 3SBCA 4RI7A 4K6XA 2X99A 2JL4A 4EIPA 1GLQA 1UVZA 2VOCA 4K7IA 3WGDA 2HRAA 1CQGA 2LSTA 1WP0A 4AKXB 2MMNA 2IMKA 3TJBA 5DALA 3QR6A 1AUCA 5G5EA 2DJJA 1PX6A 1J08A 4CY6A 3CSHA 3ZFBA 2CVDA 8GSSA 5JCWA 3FK8A 2DIYA 4OFMA 3IK9A 3IDVA 2P0GA 3GH6A 2A4VA 5L71A 1K0BA 4PXOA 3P2AA 4RQXA 2D2ZA 4XS4B 4NHZA 4K5RA 2GVPA 4V1Ap 2HZEB 5KN1A 4PHZC 5CNWA 1XXUA 5CAXA 3HYPA 3ZYWA 5G30A 3KCMA 2WVYA 22GSA 2EFCA 2L6CA 4OCEA 2WCIA 3APQA 4HZ4A 2IFQA 1U87A 4MK3A 5CYYA 2H6YA 3WGEA 3EURA 1SYRA 1GTIA 4G0IA 1YEXA 4FO5A 5IMAA 2WZSA 4IKHA 2G0FA 4YQUA 3VK9A 4MPGA 3TOUA 1JZWA 3Q19A 2H6ZA 2O87A 1AC1A 6GSVA 2HE3A 4XS6A 1XWGA 2N5BA 1SL0B 5IPHA 19GSA 4MDCA 5FHIA 1V40A 1ERWA 2K8SA 4N10A 2GSSA 3US3A 3F4SA 4Q5FA 4RI6A 4Z2RA 4E8EA 3KJYA 3EPTA 3G9BA 2F3MA 4EXJA 2GDRA 3M9JA 2O5VA 1GULA 2H6XA 1I9DA 3GFKA 1FVKA 1GUKA 3APSA 1ZZYA 4YH2A 2JACA 4NV2A 4KCAA 3HD5A 1V58A 5F05A 3MSZA 1AQVA 1B4PA 4MF5A 2HQTA 4I2UA 1USBA 2UV8G 3PINA 5COHA 2DLXA 4AJ7A 4ML1A 4DSQA 2HRKA 5G5FA 5FT3A 4IQAA 3TRPA 2A4HA 2DJ2A 3CSIA 18GSA 1KBNA 4XRAA 2C0EA 4TN8A 2AYTA 1LBKA 1H75A 1SJZA 4ZBBA 2VL2C 1GTBA 1PL2A 3H93A 1F9MA 2DKIA 2EIRA 1X9SB 1OC8A 5C00A 4K7NA 3HZ8A 3F8UA 4YKGA 1Y1UA 1PN9A 4OCFA 2YOIA 5DAKB 4GLTA 2PVQA 1TI1A 2LQOA 4WF4A 1WE0A 4NPBA 5D73A 3FKFA 1JLVA 4ZB8A 3VWUA 1XVWA 1J9BA 4KCEA 2C3QA 3D0ZA 5A4WA 2NPBA 2XPEA 2WW3A 2H73A 4Q5NA 3KP8A 1T3BA 1JHBA 4IP6A 5JCGA 3MIXA 1ZCPA 1O6JA 5A1NB 2PWJA 2QKEA 4XIHA 2FLSA 2B1LA 1JFUA 3F3RA 4BPYA 1U3AA 2XPDA 1ERTA 3LFLA 2QA2A 1MD3A 1YDKA 1PSQA 1MD4A 1XBSA 2VKZG 2R0CA 4KW6A 4L0WA 1VRSD 4TW5A 1FOHA 1V2AA 4J2FA 11GSA 4GSSA 3E9JB 1ABAA 5CP1A 1W4VA 3GKKA 2VO4A 2JSZA 1BG5A 2YZHA 3EMPA 2I9HA 4KX4A 2GZPA 4PURA 2DJ3A 1MDKA 4LLRA 4TOPA 3HJPA 3ZVJD 4KE3A 2OBIA 1OC9A 2C4JA 1T1VA 4EO3A 3TJFA 4F0CA 3HKRA 3AY8A 4IHUA 4PI0C 4BL7B 4F82A 1K3YA 1AIUA 3CBUA 1PRXA 2GT5A 3D6IA 4TR3A 3MWHA 4ICYA 2YPMA 3QOUA 3M8NA 4DEJA 1S3AA 3H4KA 1WMJA 2R37A 4CHSA 2AB6A 1BJXA 5F8BA 1VF1A 1ST9A 2WW1A 3RHCA 3ME7A 3PR8A 2VCQA 2R3XA 2FWFA 3WD6A 2OA7A 1YVLA 1B8XA 2YNXA 5INYA 2LRCA 4TXOB 4Z2UA 2R6KA 2QSIA 2IMDA 1MEKA 1QMVA 1OYJA 2YWNA 1OE7A 2YN1A 3EYTA 3EWLA 2PUKC 4XHMA 1TU7A 2KOKA 2OJLA 1K0DA 5G1LA 4TXVA 4JRRA 2WW0A 4ZL7A 1EP7A 4WR5A 5CRGA 3BBYA 2GQKA 1RW1A 4MF6A 2TRCP 4FYCA 1ZL9A 2LUSA 4ILFA 4K1FA 1V9WA 5CRDA 5IM9A 2WRTA 2I1UA 3GH9A 1PL1A 2LKUA 4BVXB 2H01A 1A8LA 1F6MC 3KXOA 3VPTA 4MABA 2KLXA 3M0FA 2MBTA 3P90A 2LEGA 1U88A 3GURA 2CVKA 3BOAA 2H66A 2WS2A 2VCVA 5DQSA 4POMA 3DXBA 4K2XA 4KNDA 1GSEA 4O5UA 6GSXA 1SENA 3RFRC 3FZ9A 3M3MA 4J57E 1FG4A 4V2NA 4ZB7A 1OKDA 5AIVA 3HCZA 1T00A 1G6WA 4BVYA 2FCHA 3GIXA 4F0BA 1M0UA 5F06A 3GSSA 2O7KA 2FY6A 2C80A 2K6VA 5AISA 3A5IA 4KSOA 3ME8A 5A5KA 3TRXA 3TKSA 5BMUA 5AGYA 2B7KA 1K3LA 5JWQB 2MZCA 2DMLA 4BWSA 2OKAA 3F9UA 1T7PB 2PMTA 3GMFA 2H0GA 1G0TA 2F51A 4FYUA 1A2MA 2WFCA 3HHVA 3KEBA 3TRQA 2R5GA 3HZ4A 1K0NA 4PUAA 1O85A 5IMZA 3G7IA 5D8IA 4MLYA 3I6AA 1Q98A 1FOVA 1M9AA 17GSA 5IMDA 3VWXA 1AXDA 2XHFA 4E8HA 1S3CA 5IOWA 4HEA2 5ABRA 5J9BA 3CQFA 5A34B 4JE1A 3W8JA 5CO3A 6GSUA 1NM3A 3U6VA 1EGRA 2YV9A 14GSA 2FWGA 2PBJA 2LNSA 1X5EA 1PGTA 1XCCA 2DC5A 2YWMA 5JCUA 2WZ9A 2I3YA 1OE8A 3MNGA 1DBYA 1G7EA 1K0MA 1YKCA 2H0HA 2LJAA 2KP2A 5DDLA 2DJ1A 3DRNA 3S9FA 3IHGA 4MZBA 4G0LA 4BIKA 3FMWA 1XWBA 1XIYA 5G31A 4TR1A 4WR4A 5J40A 2CZ2A 4NWYA 1SD9A 3GRXA 3I69A 1X5DA 2VM1A 2L4CA 2H1DA 3C73A 5H5SA 1MDJA 1F2EA 2HSNA 2NBSA 3I9V2 1SL2B
chains in the Genus database with same CATH topology
5ECMB 1LJRA 2UZ8A 3QFBC 4XRDA 3F63A 5DJLA 2LNTA 4FQUA 1QXHA 4ZB9A 3UAPA 4YAPA 4POBA 4V2LA 3WT1A 2C3TA 5ELAA 2DBCA 2H76A 3M9KA 5C04A 3KP9A 1QQ2A 4AKHA 1XFLA 3GTUB 2IMFA 3QAVA 1X9MB 2JZRA 5LD0A 3HVSA 2YWOA 2JADA 3L78A 3FRCA 2CT6A 1T4YA 3A2XA 2OT3A 1ERVA 3C71A 5JWOB 2O89A 3C8EA 3BJ5A 5IPGA 3ZMLA 2AJQB 3ZIVA 4LA1A 3I43A 5HR1A 2HSMB 5HFIA 2IMEA 3E0UA 5CRWA 1YY7A 5HR3A 1T4ZA 4JR4A 1VF2A 2E2GA 2XBQA 3GL5A 1K0CA 2HRKB 3UARA 3K8NA 4MMMA 4OD7A 2CQ9A 2VLUA 1M2DA 1PX7A 5ECQB 3RDWA 2VCZA 5KN2A 1K0AA 1WWJA 4MJCA 2LRTA 4K7OA 4WEYA 2JU5A 4X0XA 4FH8A 1RQMA 2IIYA 5ECOB 4KF9A 1K3OA 5JWRB 3FEUA 1YKAA 4IGJA 4XS4A 2HZEA 2HYXA 4IBPA 4GRFA 1TRUA 1THXA 2WJUA 1HQOA 1F37A 1FAAA 2AUVA 1GNWA 2EIQA 2P5RA 1ILOA 16GSA 3Q18A 1VF3A 4N3ZA 1XWAA 3FW2A 3LYPA 1TXUA 4DSSB 1DSBA 2CX3A 3MDKA 1GTUA 2LJRA 2C0GA 2M80A 2V6OA 5ID2B 2H74A 4RQRA 1PKWA 5EPFA 3D4MA 5HR2A 1XOAA 5J3RA 3ERFA 1AW9A 1Z7PA 2B5EA 3F4TA 3GSTA 2RLIA 4FIWA 4KB3A 3UVTA 3GKMA 5DVBA 4K0GA 2LTKA 4JBBA 4KDYA 2QGVA 3BCKA 4HU7A 2P31A 3HXSA 1XW5A 3IE3A 4MZWA 3J7Yk 3UL3A 2CAQA 1IYIA 2GQLA 2NVLA 2QA1A 1TOFA 1PN0A 2VAFA 3D4TA 5B8AA 3TKSC 4HQZA 2VLVA 5A4UA 4TRXA 3CXGA 4LL4B 2VD0A 4AKGA 3FZAA 3CSJA 3QAWA 3TOTA 2MMOA 1TK5B 1R4WA 3KGKA 3FR3A 1S3DA 1N2AA 2XBIA 4GXZA 3W8SA 3E3EA 3MAKA 5DBQA 1WPIA 1AAZA 4MA9A 1U3IA 3ZFLA 5IOXA 1ZYQB 4GDFA 3GL3A 2KHPA 1KTEA 2H0IA 4GSTA 3C1SA 5LNKe 1YJ6A 2GSTA 6GSSA 5EVOA 3UVHA 3ZMKA 1X5CA 1HNBA 3IRAA 1FHEA 6GSYA 1URMA 3LQ7A 4POKA 4EVMA 3VPQA 2AAWA 2ON7A 1QFNA 3KTLA 4KAEA 4YQMA 1B9YC 3BD2A 5ECLB 3GN3A 5IMCA 1A24A 2H1LA 2FGXA 2OACA 5DAKA 2H71A 3FZ4A 3HVXA 5GAPD 4K5SA 1K0OA 1BG1A 1GSUA 1GL8A 1TDIA 3UEMA 5A5HB 4HI7A 4KDUA 1SK2A 3IC8A 2PPTA 1V98A 3HY2A 3GHAA 1JZDA 4WKWA 3P7XA 2HNLA 1GH2A 4F03A 3KM6A 3TJGA 5GZZB 4TVEA 2P5QA 3UJ1A 4GSNA 4TR4A 1GSSA 3LXZA 1XVQA 2VLTA 3LYKA 4MP4A 3V1WA 4K8MA 4IW9A 1Y6EA 4DVCA 4L5LA 3H1NA 3A2WA 2R4VA 5ECIB 2V2GA 3LEFA 1OKTA 1EZKA 4PTSA 3UBLA 1WRYA 2C0DA 3A5WA 2CV4A 1GSFA 2I81A 3IA1A 1MTCA 1FW1A 1AQXA 2HRFA 1GSYA 2DMMA 5J9CA 3ZL5A 5EY6A 1V57A 4HQSA 3D5JA 1SKSB 5J4YA 2IWTA 1SYXA 1G7OA 3R3EA 2H19A 1ZYPA 3PH9A 4Z2TA 4BA7A 2AV4A 3NIVA 1XOBA 1FB6A 4HU9A 1MDIA 1ZMAA 3TKRA 2HRNA 4NMUA 1QUWA 1NSWA 3J7Yb 3DWVA 5CREA 1GUMA 4I5QA 4OWYA 4LMWA 2WGRA 3O3TA 3F6FA 5ENUA 2GS3A 3KMOA 4D73B 5IO2A 4GQCA 4WBRD 2YCDA 1M9BA 2F8AA 2ZCTA 2H8LA 3LWAA 4RUVA 1IYHA 2KP1A 3MYDA 4NHWA 5D9XA 1PQNA 2F9SA 2HFDA 4L5OA 4EDZA 3HMJG 2VM2A 2FA4A 2PERA 4Q5QA 3L4NA 5D9VA 2GZYA 4TXOA 2HZFA 4ACSA 4O5RA 4IS0A 2HI7A 4OO4A 1OC3A 2OE0A 5ECSA 2GSRA 3TU3B 2H72A 2VL9A 2EFHA 4WETA 1B9XC 2BMXA 3C1RA 1OAZA 5KN3A 2RM5A 1DE1A 2V1MA 4F9ZA 2GZZA 1A23A 2IL3A 2VUPA 2QC7A 1O81A 3UBKA 4X43A 3FR9A 4O32A 20GSA 1YZXA 13GSA 1GSQA 2EFEA 3O76A 4EE0A 1E2YA 1M2BA 2VCTA 4NXIA 3KTBA 2C8UA 4N11A 3JCML 4BVXA 3DVWA 1SVMA 1SVOA 2NDOA 4J56E 4X1UA 2FUG2 2PGTA 5DQYA 2L57A 2GTUA 3L9UA 1M99A 2CA8A 5AN1A 1SU9A 1O8WA 3TKPA 2E2MA 3CTGA 3GA4A 4AI6A 4AGSA 3RPNA 3DGQA 3DIEA 3TJKA 5D9TA 4N0VA 4EDYA 4JZQA 3DYRA 4XTSA 3U5RE 5DALB 3L0HA 9GSSA 2HXKA 5IMVA 2YZUA 4MPFA 3TUEA 3D21A 4I2TA 1HNAA 5IIZA 1DUGA 4L0UA 3EVIA 5IMFA 5ECHB 2IMIA 1O8XA 3GX0A 3HA9A 5F07A 3ZZXA 2RM6A 3ZIJA 2RUEA 4PNFA 3EINA 4JU5A 3M1GA 2K9FA 2MMAA 3VWWA 2YJHA 2H1GA 4WXTA 4POLA 1GLPA 2GGTA 1GNEA 4MH2A 5H5QA 1TRWA 4GTUA 1KNGA 4MZCA 2J23A 4N30A 4CW9A 1F3BA 5EL8A 1PKZA 3CRTA 3CRUA 2IFQB 5DCHA 4EC0A 5J4UA 1A8YA 2EFDA 4Z7XA 5DCGA 1TKDB 1SK0A 4K9ZA 1YF1A 4LMVA 2GLRA 4NV5A 3PGTA 2DSAA 3GX8A 3IOSA 1EOGA 4ZB6A 4KA0A 2NTOA 1ML6A 2GT6A 1TK8B 2CX4A 1F3AA 1XWKA 1JZOA 3TDGA 1ZGNA 10GSA 1QGVA 3PPUA 5A34A 3TKQA 1NHOA 2VCXA 1PMTA 4HUAA 1BF5A 2VD1A 3GNJA 2IPAA 4MJBA 3ERGA 3VURA 2MBSA 1ACVA 5G2ZA 1THOA 4F2IA 4V1Ag 4ZIJA 3GKXA 7GSSA 3IAM2 2GQMA 4PGTA 4HDEA 5HR0A 5LCZA 3A3TA 4GWRA 1HYUA 5ELGA 3QDNA 4GF0A 3KZQA 1LU4A 1T8EB 4XS1A 2LQQA 5B6MA 4I97A 4WF5A 2R2JA 4YKFA 1G6YA 3DVXA 3O6TA 1YEPA 1Z6MA 3QFAC 2VCWA 2V32A 4OFTA 5E59A 1RK4A 4OFNA 5J47A 2K8VA 1FO5A 1M2AA 3TCOA 2JZSA 3IC4A 2LV3A 4KUNA 3CWGA 3GTUA 4MF7A 5ECNB 4AKIA 2B7JA 2O85A 1FB0A 4ZL8A 2Z9SA 2MYGA 1B4QA 3LGCA 4AF2A 3QD9A 5GSTA 2B1KA 3HDCA 3IBHA 4CDOA 3KH9A 6GSTA 1XWCA 5H5RA 1EOHA 2IJYA 5J4VA 4XCSA 5HFKA 4KSMA 5ECRB 4IVFA 3RPPA 2A2RA 3UMAA 3KH7A 3KMNA 3UOMA 2HSYA 3GV1A 1WIKA 2WDUA 2HSMA 1GRXA 1O73A 3C7MA 2L59A 5G1KA 2FA8A 3W6GA 4MJEA 3LSZA 2HSHA 4N0ZA 3HJOA 5ECKB 3GUSA 3L9VA 1Q4JA 3VLNA 4Q5RA 2X4AA 2N5FA 3RBTA 1UC7A 2IN3A 1NW2A 5KOWA 1J0FA 2PU9C 2OE3A 1ERUA 1YQ1A 1BAYA 3UIWA 3OR5A 2K18A 3FZ5A 1R26A 1TRSA 4ML6A 5IO0A 1U6TA 3CYNA 3ZTLA 4G0KA 4ECBA 3D22A 4GQFA 4A5PA 1YF0A 2XC2A 3WT2A 4QL7A 1OC9B 2JSYA 2FWEA 2JZTA 1TRVA 2A2SA 4MNNA 1JZRA 5GSSA 3H79A 3QMXA 5DJMA 3EE2A 3FY7A 4CY8A 2FWHA 3WGXA 5GAND 1TW9A 1EV4A 2ZNMA 1FVJA 3ZVJA 4DSSA 4QL9A 3F0IA 1ON4A 1C72A 4QQ7A 2C3NA 4H86A 2ES7A 3ERWA 1UA5A 4MCUA 3TKSE 5ID2A 4K2DA 1CQHA 1EGOA 1WOUA 2F8FA 3IAS2 4I8BA 4MH3A 5J5NA 4ZBDA 2LS5A 3HVVA 1Z7RA 4MJAA 2X64A 1SL1B 4HOJA 3IK7A 6GSWA 3KIJA 4ZILA 1X9WB 4IQ1A 4HZ2A 1PA3A 4G01A 1A0RP 5D96A 4DSRA 5KN0A 4PQIA 3LW9A 3F4RA 4WBJA 5KEJA 2H75A 4TKYA 1SD8A 1GUHA 3FYGA 2L5LA 2X8GA 4KH7A 1ZOFA 3N9JA 2HLSA 3RHBA 4EL1A 2CVBA 2OADA 2CAIA 1SKWB 3QAGA 4O5QA 2PN8A 1Z3EA 1BEDA 2X49A 2AHEA 2PVOC 2TRXA 2X8HA 4IELA 4ISDA 2C1YA 5A1NA 1E6BA 3QCPA 5FWGA 2YJ7A 4O92A 1H4OA 1A2JA 1WJKA 4BWQA 2FNOA 2GSQA 1XW9A 3CTFA 4ZXGA 3F6DA 2DJKA 3EC3A 1Z9HA 3ZITA 4ZL9A 3IV4A 5HQPA 2H70A 2O8VB 1TP9A 3CMIA 1TU8A 3RAZA 3VI7A 3L9SA 1HD2A 1GTAA 3LG6A 1PD21 4QMKA 3N5OA 3DD3A 4G19A 3IHQA 1ZYEA 4HJMA 2YWIA 3IXRA 2VL3A 1M7TA 4ECJA 3VI5A 2E7PA 4AJ6A 1QK8A 3QPMA 4I6XA 4G2EA 1OVNA 3LORA 3VFIA 2X8CA 2H1AA 3A2VA 4IJ3A 1KEBA 2N5AA 2B6MA 2FD3A 2DJ0A 3VWVA 3P8WA 2ON5A 2A2PA 3EU4A 1XZOA 3GKNA 1SJ6A 5A5HA 4BL7A 2EIOA 2C0FA 3DMLA 2V6KA 1SJIA 4YAVA 2WB9A 3ED3A 5F0GA 4G10A 1X0RA 5D93A 4ECCA 1Z6NA 1SVLA 3FR6A 3HJMA 2L5OA 4BVYB 4PUFC 2RIIA 4ULXA 3F3QA 3TGZA 4OO5A 4PX1A 1EEMA 2M46A 4FYBA 1VF4A 2DKHA 3LXTA 5BMUB 2J9HA 1VGLA 4KDXA 1ZYNA 5AIXA 5BRTA 2WULA 5B6NA 2ZUPA 1XW6A 1B48A 3H8QA 1N8JA 4O7HA 4X4JA 3GYKA 2TIRA 5A4VA 5B7CA 1JLWA 4AJ8A 5KOXA 1BX9A 3TB2A 4W66A 1N25A 1HNCA 4HJ2A 1EV9A 1GWCA 1R5PA 4KGIA 2H1BA 3APOA 3NZNA 4HS1A 2VIMA 4L8EA 12GSA 2M72A 3EMXA 2VL2A 2EC4A 3NOFA 2B5XA 1TTZA 5E4WA 3TJJA 1BQ7A 3G7YA 3R2QA 5IQYA 2KUCA 1EWXA 4ID0A 2LRNA 3IR4A 1TK0B 1EP8A 4ECIA 4K0NA 4USSA 3G7JA 5J41A 4D73A 3Q74A 2R0GA 4PQHA 4PNGA 5B8BA 3BCIA 4LL1B 2BJXA 5CRHA 1A2LA 4E68A 3ZRDA 4OMVA 2OBKA 4IP1A 3ZREA 4G9HA 1Z5YE 3IPZA 3KD0A 4TR1B 1TJDA 4YQVA 5D9WA 3LJRA 3SWLA 1NHYA 4GCIA 1AQWA 3FHKA 4EUYA 1W89A 1BYEA 1O7UA 1GSDA 2OE1A 2R0PA 2RUFA 2ALBA 2H30A 2DIZA 2HSNB 1TXXA 1R7HA 1SKRB 1R5AA 1UN2A 2LJKA 2HT9A 1GP1A 1Y25A 2L4QA 4TR0A 2BTOT 3ISOA 1SK1A 2REMA 4IN0A 2L6DA 1TI3A 3WYWA 2YP6A 2G2QA 1A0FA 1XPVA 2B5YA 4V2MA 2FHEA 2V41A 4JR6A 4EIQA 1EEJA 3ZLPA 4PQ1A 2E0QA 3Q6OA 3EU3A 4EF0A 2YANA 4IJIA 2CZ3A 4ZBAA 4EKZA 2YV7A 1DE2A 2B3SA 4P3YB 2MMZA 4JEDA 4NAXA 1I5GA 5ECPB 3DEXA 5HFGA 3DKSA 2I4AA 3SBCA 4RI7A 4K6XA 2X99A 2JL4A 4EIPA 1GLQA 1UVZA 2VOCA 4K7IA 3WGDA 2HRAA 1CQGA 2LSTA 1WP0A 4AKXB 2MMNA 2IMKA 3TJBA 5DALA 3QR6A 1AUCA 5G5EA 2DJJA 1PX6A 1J08A 4CY6A 3CSHA 3ZFBA 2CVDA 8GSSA 5JCWA 3FK8A 2DIYA 4OFMA 3IK9A 3IDVA 2P0GA 3GH6A 2A4VA 5L71A 1K0BA 4PXOA 3P2AA 4RQXA 2D2ZA 4XS4B 4NHZA 4K5RA 2GVPA 4V1Ap 2HZEB 5KN1A 5CNWA 1XXUA 5CAXA 3HYPA 3ZYWA 5G30A 3KCMA 22GSA 2EFCA 2L6CA 4OCEA 2WCIA 3APQA 4HZ4A 2IFQA 1U87A 4MK3A 5CYYA 2H6YA 3WGEA 3EURA 1SYRA 1GTIA 4G0IA 1YEXA 4FO5A 5IMAA 4IKHA 2G0FA 4YQUA 3VK9A 4MPGA 3TOUA 1JZWA 3Q19A 2H6ZA 2O87A 1AC1A 6GSVA 2HE3A 4XS6A 1XWGA 2N5BA 1SL0B 5IPHA 19GSA 4MDCA 5FHIA 1V40A 1ERWA 2K8SA 4N10A 2GSSA 3US3A 3F4SA 4Q5FA 4RI6A 4Z2RA 4E8EA 3KJYA 3EPTA 3G9BA 2F3MA 4EXJA 2GDRA 3M9JA 2O5VA 1GULA 2H6XA 1I9DA 3GFKA 1FVKA 1GUKA 3APSA 1ZZYA 4YH2A 2JACA 4NV2A 4KCAA 3HD5A 1V58A 5F05A 3MSZA 1AQVA 1B4PA 4MF5A 2HQTA 4I2UA 1USBA 2UV8G 3PINA 5COHA 2DLXA 4AJ7A 4ML1A 4DSQA 2HRKA 5G5FA 5FT3A 4IQAA 3TRPA 2A4HA 2DJ2A 3CSIA 18GSA 1KBNA 4XRAA 2C0EA 4TN8A 2AYTA 1LBKA 1H75A 1SJZA 4ZBBA 2VL2C 1GTBA 1PL2A 3H93A 1F9MA 2DKIA 2EIRA 1X9SB 1OC8A 5C00A 4K7NA 3HZ8A 3F8UA 4YKGA 1Y1UA 1PN9A 4OCFA 2YOIA 5DAKB 4GLTA 2PVQA 1TI1A 2LQOA 4WF4A 1WE0A 4NPBA 5D73A 3FKFA 1JLVA 4ZB8A 3VWUA 1XVWA 1J9BA 4KCEA 2C3QA 3D0ZA 5A4WA 2NPBA 2XPEA 2H73A 4Q5NA 3KP8A 1T3BA 1JHBA 4IP6A 5JCGA 3MIXA 1ZCPA 1O6JA 5A1NB 2PWJA 2QKEA 4XIHA 2FLSA 2B1LA 1JFUA 3F3RA 4BPYA 1U3AA 2XPDA 1ERTA 3LFLA 2QA2A 1MD3A 1YDKA 1PSQA 1MD4A 1XBSA 2VKZG 2R0CA 4KW6A 4L0WA 1VRSD 4TW5A 1FOHA 1V2AA 4J2FA 11GSA 4GSSA 3E9JB 1ABAA 5CP1A 1W4VA 3GKKA 2VO4A 2JSZA 1BG5A 2YZHA 3EMPA 2I9HA 4KX4A 2GZPA 4PURA 2DJ3A 1MDKA 4LLRA 4TOPA 3HJPA 3ZVJD 4KE3A 2OBIA 1OC9A 2C4JA 1T1VA 4EO3A 3TJFA 4F0CA 3HKRA 3AY8A 4IHUA 4BL7B 4F82A 1K3YA 1AIUA 3CBUA 1PRXA 2GT5A 3D6IA 4TR3A 3MWHA 4ICYA 2YPMA 3QOUA 3M8NA 4DEJA 1S3AA 3H4KA 1WMJA 2R37A 4CHSA 2AB6A 1BJXA 5F8BA 1VF1A 1ST9A 3RHCA 3ME7A 3PR8A 2VCQA 2R3XA 2FWFA 3WD6A 2OA7A 1YVLA 1B8XA 2YNXA 5INYA 2LRCA 4TXOB 4Z2UA 2R6KA 2QSIA 2IMDA 1MEKA 1QMVA 1OYJA 2YWNA 1OE7A 2YN1A 3EYTA 3EWLA 2PUKC 4XHMA 1TU7A 2KOKA 2OJLA 1K0DA 5G1LA 4TXVA 4JRRA 4ZL7A 1EP7A 4WR5A 5CRGA 3BBYA 2GQKA 1RW1A 4MF6A 2TRCP 4FYCA 1ZL9A 2LUSA 4ILFA 4K1FA 1V9WA 5CRDA 5IM9A 2WRTA 2I1UA 3GH9A 1PL1A 2LKUA 4BVXB 2H01A 1A8LA 1F6MC 3KXOA 3VPTA 4MABA 2KLXA 3M0FA 2MBTA 3P90A 2LEGA 1U88A 3GURA 2CVKA 3BOAA 2H66A 2WS2A 2VCVA 5DQSA 4POMA 3DXBA 4K2XA 4KNDA 1GSEA 4O5UA 6GSXA 1SENA 3FZ9A 3M3MA 4J57E 1FG4A 4V2NA 4ZB7A 1OKDA 5AIVA 3HCZA 1T00A 1G6WA 4BVYA 2FCHA 3GIXA 4F0BA 1M0UA 5F06A 3GSSA 2O7KA 2FY6A 2C80A 2K6VA 5AISA 3A5IA 4KSOA 3ME8A 5A5KA 3TRXA 3TKSA 5BMUA 5AGYA 2B7KA 1K3LA 5JWQB 2MZCA 2DMLA 4BWSA 2OKAA 3F9UA 1T7PB 2PMTA 3GMFA 2H0GA 1G0TA 2F51A 4FYUA 1A2MA 2WFCA 3HHVA 3KEBA 3TRQA 2R5GA 3HZ4A 1K0NA 4PUAA 1O85A 5IMZA 3G7IA 5D8IA 4MLYA 3I6AA 1Q98A 1FOVA 1M9AA 17GSA 5IMDA 3VWXA 1AXDA 2XHFA 4E8HA 1S3CA 5IOWA 4HEA2 5ABRA 5J9BA 5A34B 4JE1A 3W8JA 5CO3A 6GSUA 1NM3A 3U6VA 1EGRA 2YV9A 14GSA 2FWGA 2PBJA 2LNSA 1X5EA 1PGTA 1XCCA 2DC5A 2YWMA 5JCUA 2WZ9A 2I3YA 1OE8A 3MNGA 1DBYA 1G7EA 1K0MA 1YKCA 2H0HA 2LJAA 2KP2A 5DDLA 2DJ1A 3DRNA 3S9FA 3IHGA 4MZBA 4G0LA 3FMWA 1XWBA 1XIYA 5G31A 4TR1A 4WR4A 5J40A 2CZ2A 4NWYA 1SD9A 3GRXA 3I69A 1X5DA 2VM1A 2L4CA 2H1DA 3C73A 5H5SA 1MDJA 1F2EA 2HSNA 2NBSA 3I9V2 1SL2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ECM B;  1LJR A;  2UZ8 A;  3QFB C;  4XRD A;  3F63 A;  5DJL A;  2LNT A;  4FQU A;  1QXH A;  4ZB9 A;  3UAP A;  4YAP A;  4POB A;  4V2L A;  3WT1 A;  2C3T A;  5ELA A;  2DBC A;  2H76 A;  3M9K A;  5C04 A;  3KP9 A;  1QQ2 A;  1XFL A;  3GTU B;  2IMF A;  3QAV A;  1X9M B;  2JZR A;  5LD0 A;  3HVS A;  2YWO A;  2JAD A;  3L78 A;  3FRC A;  2CT6 A;  1T4Y A;  3A2X A;  3C71 A;  1ERV A;  5JWO B;  2O89 A;  3C8E A;  3BJ5 A;  5IPG A;  3ZML A;  2AJQ B;  3ZIV A;  4LA1 A;  3I43 A;  5HR1 A;  2HSM B;  5HFI A;  2IME A;  3E0U A;  5CRW A;  1YY7 A;  5HR3 A;  1T4Z A;  4JR4 A;  1VF2 A;  2E2G A;  2XBQ A;  3GL5 A;  1K0C A;  2HRK B;  3UAR A;  3K8N A;  4MMM A;  4OD7 A;  2CQ9 A;  2VLU A;  1M2D A;  1PX7 A;  5ECQ B;  3RDW A;  2VCZ A;  5KN2 A;  1K0A A;  1WWJ A;  4MJC A;  2LRT A;  4K7O A;  4WEY A;  2JU5 A;  4X0X A;  4FH8 A;  1RQM A;  2IIY A;  5ECO B;  4KF9 A;  1K3O A;  5JWR B;  3FEU A;  1YKA A;  4IGJ A;  4XS4 A;  2HZE A;  2HYX A;  4IBP A;  4GRF A;  1TRU A;  1THX A;  2WJU A;  1HQO A;  1F37 A;  1FAA A;  2AUV A;  1GNW A;  2EIQ A;  2P5R A;  1ILO A;  16GS A;  3Q18 A;  1VF3 A;  1XWA A;  3FW2 A;  3LYP A;  4DSS B;  1DSB A;  2CX3 A;  3MDK A;  1GTU A;  2LJR A;  2C0G A;  2M80 A;  2V6O A;  5ID2 B;  2H74 A;  4RQR A;  1PKW A;  5EPF A;  3D4M A;  5HR2 A;  1XOA A;  5J3R A;  3ERF A;  1AW9 A;  1Z7P A;  2B5E A;  3F4T A;  3GST A;  2RLI A;  4FIW A;  4KB3 A;  3UVT A;  3GKM A;  5DVB A;  4K0G A;  2LTK A;  4JBB A;  4KDY A;  2QGV A;  3BCK A;  4HU7 A;  2P31 A;  3HXS A;  1XW5 A;  3IE3 A;  4MZW A;  3J7Y k;  3UL3 A;  2CAQ A;  1IYI A;  2GQL A;  2NVL A;  1TOF A;  2VAF A;  3D4T A;  5B8A A;  3TKS C;  4HQZ A;  2VLV A;  5A4U A;  4TRX A;  3CXG A;  4LL4 B;  2VD0 A;  3FZA A;  3CSJ A;  3QAW A;  3TOT A;  2MMO A;  1TK5 B;  1R4W A;  3KGK A;  3FR3 A;  1S3D A;  1N2A A;  4GXZ A;  2XBI A;  3W8S A;  3E3E A;  3MAK A;  5DBQ A;  1WPI A;  1AAZ A;  4MA9 A;  1U3I A;  3ZFL A;  5IOX A;  1ZYQ B;  3GL3 A;  2KHP A;  1KTE A;  2H0I A;  4GST A;  3C1S A;  5LNK e;  1YJ6 A;  2GST A;  6GSS A;  5EVO A;  3UVH A;  3ZMK A;  1X5C A;  1HNB A;  3IRA A;  1FHE A;  6GSY A;  1URM A;  3LQ7 A;  4POK A;  4EVM A;  3VPQ A;  2AAW A;  2ON7 A;  1QFN A;  3KTL A;  4KAE A;  4YQM A;  1B9Y C;  3BD2 A;  5ECL B;  3GN3 A;  5IMC A;  1A24 A;  2FGX A;  2OAC A;  5DAK A;  2H71 A;  3FZ4 A;  3HVX A;  5GAP D;  1K0O A;  1GSU A;  1GL8 A;  1TDI A;  3UEM A;  4HI7 A;  4KDU A;  1SK2 A;  3IC8 A;  2PPT A;  1V98 A;  3HY2 A;  3GHA A;  1JZD A;  4WKW A;  3P7X A;  2HNL A;  1GH2 A;  4F03 A;  3KM6 A;  3TJG A;  5GZZ B;  4TVE A;  2P5Q A;  3UJ1 A;  4GSN A;  4TR4 A;  1GSS A;  3LXZ A;  1XVQ A;  2VLT A;  3LYK A;  4MP4 A;  3V1W A;  4K8M A;  4IW9 A;  1Y6E A;  4DVC A;  4L5L A;  3H1N A;  3A2W A;  2R4V A;  5ECI B;  2V2G A;  3LEF A;  1OKT A;  1EZK A;  4PTS A;  3UBL A;  1WRY A;  2C0D A;  3A5W A;  2CV4 A;  1GSF A;  2I81 A;  3IA1 A;  1MTC A;  1FW1 A;  1AQX A;  2HRF A;  1GSY A;  2DMM A;  5J9C A;  3ZL5 A;  5EY6 A;  1V57 A;  4HQS A;  3D5J A;  1SKS B;  2IWT A;  1SYX A;  1G7O A;  3R3E A;  2H19 A;  3PH9 A;  4BA7 A;  2AV4 A;  3NIV A;  1XOB A;  1FB6 A;  4HU9 A;  1MDI A;  1ZMA A;  3TKR A;  2HRN A;  4NMU A;  1QUW A;  1NSW A;  3J7Y b;  3DWV A;  5CRE A;  1GUM A;  4I5Q A;  4OWY A;  4LMW A;  2WGR A;  3O3T A;  3F6F A;  5ENU A;  2GS3 A;  3KMO A;  4D73 B;  5IO2 A;  4GQC A;  4WBR D;  2YCD A;  1M9B A;  2F8A A;  2ZCT A;  2H8L A;  3LWA A;  4RUV A;  1IYH A;  2KP1 A;  4NHW A;  5D9X A;  1PQN A;  2F9S A;  2HFD A;  4L5O A;  4EDZ A;  2VM2 A;  2FA4 A;  2PER A;  4Q5Q A;  3L4N A;  5D9V A;  2GZY A;  4TXO A;  2HZF A;  4ACS A;  4O5R A;  4IS0 A;  2HI7 A;  4OO4 A;  1OC3 A;  2OE0 A;  5ECS A;  2GSR A;  2H72 A;  2VL9 A;  4WET A;  1B9X C;  2BMX A;  3C1R A;  1OAZ A;  5KN3 A;  2RM5 A;  1DE1 A;  2V1M A;  4F9Z A;  2GZZ A;  1A23 A;  2IL3 A;  2VUP A;  2QC7 A;  1O81 A;  3UBK A;  4X43 A;  3FR9 A;  4O32 A;  20GS A;  1YZX A;  13GS A;  1GSQ A;  3O76 A;  4EE0 A;  1E2Y A;  1M2B A;  2VCT A;  4NXI A;  3KTB A;  2C8U A;  4N11 A;  3JCM L;  4BVX A;  3DVW A;  4J56 E;  2NDO A;  4X1U A;  2FUG 2;  2PGT A;  5DQY A;  2L57 A;  2GTU A;  3L9U A;  1M99 A;  2CA8 A;  5AN1 A;  1SU9 A;  1O8W A;  3TKP A;  2E2M A;  3CTG A;  3GA4 A;  4AGS A;  3RPN A;  3DGQ A;  3DIE A;  3TJK A;  5D9T A;  4N0V A;  4EDY A;  4JZQ A;  3DYR A;  4XTS A;  3U5R E;  5DAL B;  3L0H A;  9GSS A;  2HXK A;  5IMV A;  2YZU A;  4MPF A;  3TUE A;  3D21 A;  4I2T A;  1HNA A;  5IIZ A;  1DUG A;  4L0U A;  3EVI A;  5IMF A;  5ECH B;  2IMI A;  1O8X A;  3GX0 A;  3HA9 A;  5F07 A;  3ZZX A;  2RM6 A;  3ZIJ A;  2RUE A;  4PNF A;  3EIN A;  4JU5 A;  3M1G A;  2K9F A;  2MMA A;  3VWW A;  2YJH A;  2H1G A;  4WXT A;  4POL A;  1GLP A;  2GGT A;  1GNE A;  4MH2 A;  5H5Q A;  1TRW A;  4GTU A;  1KNG A;  4MZC A;  2J23 A;  4N30 A;  4CW9 A;  1F3B A;  5EL8 A;  1PKZ A;  3CRT A;  3CRU A;  2IFQ B;  5DCH A;  4EC0 A;  5J4U A;  1A8Y A;  4Z7X A;  5DCG A;  1TKD B;  1SK0 A;  4K9Z A;  1YF1 A;  4LMV A;  2GLR A;  4NV5 A;  3PGT A;  2DSA A;  3GX8 A;  3IOS A;  1EOG A;  4ZB6 A;  4KA0 A;  2NTO A;  1ML6 A;  2GT6 A;  1TK8 B;  2CX4 A;  1F3A A;  1XWK A;  1JZO A;  3TDG A;  1ZGN A;  10GS A;  1QGV A;  3PPU A;  3TKQ A;  1NHO A;  2VCX A;  1PMT A;  4HUA A;  2VD1 A;  3GNJ A;  2IPA A;  4MJB A;  3ERG A;  3VUR A;  2MBS A;  1ACV A;  5G2Z A;  1THO A;  4F2I A;  4V1A g;  4ZIJ A;  3GKX A;  7GSS A;  3IAM 2;  2GQM A;  4PGT A;  4HDE A;  5HR0 A;  5LCZ A;  3A3T A;  4GWR A;  1HYU A;  5ELG A;  3QDN A;  4GF0 A;  3KZQ A;  1LU4 A;  1T8E B;  4XS1 A;  2LQQ A;  5B6M A;  4I97 A;  4WF5 A;  2R2J A;  1G6Y A;  3DVX A;  3O6T A;  1YEP A;  1Z6M A;  3QFA C;  2VCW A;  2V32 A;  4OFT A;  5E59 A;  1RK4 A;  4OFN A;  2K8V A;  1FO5 A;  1M2A A;  3TCO A;  2JZS A;  3IC4 A;  2LV3 A;  4KUN A;  3GTU A;  4MF7 A;  2B7J A;  5ECN B;  2O85 A;  1FB0 A;  4ZL8 A;  2Z9S A;  2MYG A;  1B4Q A;  3LGC A;  4AF2 A;  3QD9 A;  5GST A;  2B1K A;  3HDC A;  3IBH A;  4CDO A;  3KH9 A;  6GST A;  1XWC A;  5H5R A;  1EOH A;  2IJY A;  4XCS A;  5HFK A;  4KSM A;  5ECR B;  4IVF A;  3RPP A;  2A2R A;  3UMA A;  3KH7 A;  3KMN A;  3UOM A;  2HSY A;  3GV1 A;  1WIK A;  2WDU A;  2HSM A;  1GRX A;  1O73 A;  3C7M A;  2L59 A;  5G1K A;  2FA8 A;  3W6G A;  4MJE A;  3LSZ A;  2HSH A;  4N0Z A;  3HJO A;  5ECK B;  3GUS A;  3L9V A;  1Q4J A;  3VLN A;  4Q5R A;  2N5F A;  3RBT A;  1UC7 A;  2IN3 A;  1NW2 A;  1J0F A;  2PU9 C;  2OE3 A;  1ERU A;  1YQ1 A;  1BAY A;  3UIW A;  3OR5 A;  2K18 A;  3FZ5 A;  1R26 A;  1TRS A;  4ML6 A;  5IO0 A;  1U6T A;  3CYN A;  3ZTL A;  4G0K A;  4ECB A;  3D22 A;  4GQF A;  1YF0 A;  2XC2 A;  3WT2 A;  4QL7 A;  1OC9 B;  2JSY A;  2FWE A;  2JZT A;  1TRV A;  2A2S A;  1JZR A;  5GSS A;  3H79 A;  3QMX A;  5DJM A;  3EE2 A;  3FY7 A;  2FWH A;  3WGX A;  5GAN D;  1TW9 A;  1EV4 A;  2ZNM A;  1FVJ A;  3ZVJ A;  4DSS A;  4QL9 A;  3F0I A;  1ON4 A;  1C72 A;  4QQ7 A;  2C3N A;  4H86 A;  2ES7 A;  3ERW A;  1UA5 A;  4MCU A;  3TKS E;  5ID2 A;  4K2D A;  1CQH A;  1EGO A;  1WOU A;  2F8F A;  3IAS 2;  4I8B A;  4MH3 A;  5J5N A;  4ZBD A;  2LS5 A;  3HVV A;  1Z7R A;  4MJA A;  2X64 A;  1SL1 B;  4HOJ A;  3IK7 A;  6GSW A;  3KIJ A;  4ZIL A;  1X9W B;  4IQ1 A;  4HZ2 A;  1PA3 A;  1A0R P;  5D96 A;  4DSR A;  5KN0 A;  4PQI A;  3F4R A;  4WBJ A;  5KEJ A;  2H75 A;  4TKY A;  1SD8 A;  1GUH A;  3FYG A;  2L5L A;  2X8G A;  4KH7 A;  1ZOF A;  3N9J A;  2HLS A;  3RHB A;  4EL1 A;  2CVB A;  2OAD A;  2CAI A;  1SKW B;  3QAG A;  2PN8 A;  1Z3E A;  1BED A;  2AHE A;  2PVO C;  4IEL A;  2X8H A;  4ISD A;  2C1Y A;  2TRX A;  1E6B A;  3QCP A;  5FWG A;  2YJ7 A;  4O92 A;  1H4O A;  1A2J A;  1WJK A;  4BWQ A;  2FNO A;  2GSQ A;  1XW9 A;  3CTF A;  4ZXG A;  3F6D A;  2DJK A;  3EC3 A;  1Z9H A;  3ZIT A;  4ZL9 A;  3IV4 A;  5HQP A;  2H70 A;  2O8V B;  1TP9 A;  3CMI A;  1TU8 A;  3RAZ A;  3VI7 A;  3L9S A;  1HD2 A;  1GTA A;  3LG6 A;  1PD2 1;  3N5O A;  3DD3 A;  4G19 A;  3IHQ A;  1ZYE A;  4HJM A;  2YWI A;  3IXR A;  2VL3 A;  1M7T A;  4ECJ A;  3VI5 A;  2E7P A;  4AJ6 A;  1QK8 A;  3QPM A;  4I6X A;  4G2E A;  1OVN A;  3LOR A;  3VFI A;  2X8C A;  2H1A A;  3A2V A;  4IJ3 A;  1KEB A;  2N5A A;  2B6M A;  2FD3 A;  2DJ0 A;  3VWV A;  3P8W A;  2ON5 A;  3EU4 A;  1XZO A;  3GKN A;  1SJ6 A;  4BL7 A;  2EIO A;  2C0F A;  3DML A;  2V6K A;  1SJI A;  4YAV A;  2WB9 A;  3ED3 A;  5F0G A;  4G10 A;  1X0R A;  5D93 A;  4ECC A;  1Z6N A;  3FR6 A;  3HJM A;  2L5O A;  4BVY B;  4PUF C;  2RII A;  4ULX A;  3F3Q A;  3TGZ A;  4OO5 A;  4PX1 A;  1EEM A;  2M46 A;  4FYB A;  1VF4 A;  3LXT A;  2J9H A;  1VGL A;  4KDX A;  5AIX A;  2WUL A;  5B6N A;  2ZUP A;  1XW6 A;  1B48 A;  3H8Q A;  1N8J A;  4O7H A;  3GYK A;  2TIR A;  5A4V A;  5B7C A;  1JLW A;  4AJ8 A;  1BX9 A;  3TB2 A;  1HNC A;  4HJ2 A;  1EV9 A;  1GWC A;  1R5P A;  4KGI A;  2H1B A;  3APO A;  3NZN A;  4HS1 A;  2VIM A;  4L8E A;  12GS A;  2M72 A;  3EMX A;  2VL2 A;  2EC4 A;  3NOF A;  2B5X A;  1TTZ A;  5E4W A;  3TJJ A;  1BQ7 A;  3G7Y A;  3R2Q A;  5IQY A;  2KUC A;  1EWX A;  4ID0 A;  2LRN A;  3IR4 A;  1TK0 B;  1EP8 A;  4ECI A;  4K0N A;  4USS A;  3G7J A;  5J41 A;  4D73 A;  3Q74 A;  4PQH A;  4PNG A;  5B8B A;  3BCI A;  4LL1 B;  2BJX A;  5CRH A;  1A2L A;  3ZRD A;  4OMV A;  2OBK A;  4IP1 A;  3ZRE A;  4G9H A;  1Z5Y E;  3IPZ A;  3KD0 A;  4TR1 B;  1TJD A;  4YQV A;  5D9W A;  3LJR A;  3SWL A;  1NHY A;  4GCI A;  1AQW A;  3FHK A;  4EUY A;  1W89 A;  1BYE A;  1O7U A;  1GSD A;  2OE1 A;  2RUF A;  2ALB A;  2H30 A;  2DIZ A;  2HSN B;  1TXX A;  1R7H A;  1SKR B;  1R5A A;  1UN2 A;  2LJK A;  2HT9 A;  1GP1 A;  1Y25 A;  2L4Q A;  4TR0 A;  2BTO T;  3ISO A;  1SK1 A;  2REM A;  4IN0 A;  2L6D A;  1TI3 A;  3WYW A;  2YP6 A;  2G2Q A;  1A0F A;  1XPV A;  2B5Y A;  4V2M A;  2FHE A;  2V41 A;  4JR6 A;  1EEJ A;  3ZLP A;  4PQ1 A;  2E0Q A;  3Q6O A;  3EU3 A;  4EF0 A;  2YAN A;  4IJI A;  2CZ3 A;  4ZBA A;  4EKZ A;  2YV7 A;  1DE2 A;  2B3S A;  4P3Y B;  2MMZ A;  4JED A;  4NAX A;  1I5G A;  5ECP B;  3DEX A;  5HFG A;  3DKS A;  2I4A A;  3SBC A;  4RI7 A;  4K6X A;  2X99 A;  2JL4 A;  1GLQ A;  1UVZ A;  2VOC A;  4K7I A;  3WGD A;  2HRA A;  1CQG A;  2LST A;  1WP0 A;  2MMN A;  2IMK A;  3TJB A;  5DAL A;  3QR6 A;  1AUC A;  5G5E A;  2DJJ A;  1PX6 A;  1J08 A;  3CSH A;  3ZFB A;  2CVD A;  8GSS A;  5JCW A;  3FK8 A;  2DIY A;  4OFM A;  3IK9 A;  3IDV A;  2P0G A;  3GH6 A;  2A4V A;  5L71 A;  1K0B A;  4PXO A;  3P2A A;  4RQX A;  2D2Z A;  4XS4 B;  4NHZ A;  2GVP A;  4V1A p;  2HZE B;  5KN1 A;  5CNW A;  1XXU A;  5CAX A;  3HYP A;  3ZYW A;  5G30 A;  3KCM A;  22GS A;  2L6C A;  4OCE A;  2WCI A;  3APQ A;  4HZ4 A;  2IFQ A;  1U87 A;  4MK3 A;  5CYY A;  2H6Y A;  3WGE A;  3EUR A;  1SYR A;  1GTI A;  4G0I A;  1YEX A;  4FO5 A;  5IMA A;  4IKH A;  2G0F A;  4YQU A;  3VK9 A;  4MPG A;  3TOU A;  1JZW A;  3Q19 A;  2H6Z A;  2O87 A;  1AC1 A;  6GSV A;  2HE3 A;  4XS6 A;  1XWG A;  2N5B A;  1SL0 B;  5IPH A;  19GS A;  4MDC A;  5FHI A;  1V40 A;  1ERW A;  2K8S A;  4N10 A;  2GSS A;  3US3 A;  3F4S A;  4Q5F A;  4RI6 A;  4E8E A;  3KJY A;  3G9B A;  2F3M A;  4EXJ A;  2GDR A;  3M9J A;  1GUL A;  2H6X A;  1I9D A;  3GFK A;  1FVK A;  1GUK A;  3APS A;  1ZZY A;  4YH2 A;  2JAC A;  4NV2 A;  4KCA A;  3HD5 A;  1V58 A;  5F05 A;  3MSZ A;  1AQV A;  1B4P A;  4MF5 A;  2HQT A;  4I2U A;  1USB A;  3PIN A;  5COH A;  2DLX A;  4AJ7 A;  4ML1 A;  4DSQ A;  2HRK A;  5G5F A;  5FT3 A;  4IQA A;  3TRP A;  2DJ2 A;  3CSI A;  18GS A;  1KBN A;  4XRA A;  2C0E A;  4TN8 A;  2AYT A;  1LBK A;  1H75 A;  1SJZ A;  4ZBB A;  2VL2 C;  1GTB A;  1PL2 A;  3H93 A;  1F9M A;  2EIR A;  1X9S B;  1OC8 A;  5C00 A;  4K7N A;  3HZ8 A;  3F8U A;  1PN9 A;  4OCF A;  2YOI A;  5DAK B;  4GLT A;  2PVQ A;  1TI1 A;  2LQO A;  4WF4 A;  1WE0 A;  4NPB A;  5D73 A;  3FKF A;  1JLV A;  4ZB8 A;  3VWU A;  1XVW A;  1J9B A;  4KCE A;  2C3Q A;  3D0Z A;  5A4W A;  2NPB A;  2XPE A;  2H73 A;  4Q5N A;  3KP8 A;  1T3B A;  1JHB A;  4IP6 A;  5JCG A;  1ZCP A;  1O6J A;  2PWJ A;  2QKE A;  4XIH A;  2FLS A;  2B1L A;  1JFU A;  3F3R A;  4BPY A;  1U3A A;  2XPD A;  1ERT A;  3LFL A;  1MD3 A;  1YDK A;  1PSQ A;  1MD4 A;  1XBS A;  4KW6 A;  4L0W A;  1VRS D;  4TW5 A;  1V2A A;  4J2F A;  11GS A;  4GSS A;  3E9J B;  1ABA A;  5CP1 A;  1W4V A;  3GKK A;  2VO4 A;  2JSZ A;  1BG5 A;  2YZH A;  3EMP A;  2I9H A;  4KX4 A;  2GZP A;  4PUR A;  2DJ3 A;  1MDK A;  4LLR A;  4TOP A;  3HJP A;  3ZVJ D;  4KE3 A;  2OBI A;  1OC9 A;  2C4J A;  1T1V A;  4EO3 A;  3TJF A;  4F0C A;  3HKR A;  3AY8 A;  4IHU A;  4BL7 B;  4F82 A;  1K3Y A;  1AIU A;  3CBU A;  1PRX A;  2GT5 A;  3D6I A;  4TR3 A;  3MWH A;  2YPM A;  3QOU A;  3M8N A;  4DEJ A;  1S3A A;  3H4K A;  1WMJ A;  2R37 A;  4CHS A;  2AB6 A;  1BJX A;  5F8B A;  1VF1 A;  1ST9 A;  3RHC A;  3ME7 A;  3PR8 A;  2VCQ A;  2R3X A;  2FWF A;  3WD6 A;  2OA7 A;  1B8X A;  2YNX A;  5INY A;  2LRC A;  4TXO B;  2R6K A;  2QSI A;  2IMD A;  1MEK A;  1QMV A;  1OYJ A;  2YWN A;  1OE7 A;  2YN1 A;  3EYT A;  3EWL A;  2PUK C;  4XHM A;  1TU7 A;  2KOK A;  2OJL A;  1K0D A;  5G1L A;  4TXV A;  4JRR A;  4ZL7 A;  1EP7 A;  4WR5 A;  5CRG A;  3BBY A;  2GQK A;  1RW1 A;  4MF6 A;  2TRC P;  4FYC A;  1ZL9 A;  2LUS A;  4ILF A;  4K1F A;  1V9W A;  5CRD A;  5IM9 A;  2WRT A;  2I1U A;  3GH9 A;  1PL1 A;  2LKU A;  4BVX B;  2H01 A;  1A8L A;  1F6M C;  3KXO A;  3VPT A;  4MAB A;  2KLX A;  3M0F A;  2MBT A;  3P90 A;  2LEG A;  1U88 A;  3GUR A;  2CVK A;  3BOA A;  2H66 A;  2WS2 A;  2VCV A;  5DQS A;  4POM A;  3DXB A;  4KND A;  1GSE A;  6GSX A;  1SEN A;  3FZ9 A;  3M3M A;  4J57 E;  1FG4 A;  4V2N A;  1OKD A;  5AIV A;  3HCZ A;  1T00 A;  1G6W A;  4BVY A;  2FCH A;  3GIX A;  4F0B A;  1M0U A;  5F06 A;  3GSS A;  2O7K A;  2FY6 A;  2C80 A;  2K6V A;  5AIS A;  4KSO A;  3ME8 A;  5A5K A;  3TRX A;  3TKS A;  5BMU A;  5AGY A;  2B7K A;  1K3L A;  5JWQ B;  2MZC A;  2DML A;  4BWS A;  2OKA A;  3F9U A;  1T7P B;  2PMT A;  3GMF A;  2H0G A;  1G0T A;  2F51 A;  4FYU A;  1A2M A;  2WFC A;  3HHV A;  3KEB A;  3TRQ A;  2R5G A;  3HZ4 A;  1K0N A;  4PUA A;  1O85 A;  5IMZ A;  3G7I A;  5D8I A;  4MLY A;  3I6A A;  1Q98 A;  1FOV A;  1M9A A;  17GS A;  5IMD A;  3VWX A;  1AXD A;  2XHF A;  4E8H A;  1S3C A;  5IOW A;  4HEA 2;  5ABR A;  5J9B A;  4JE1 A;  3W8J A;  5CO3 A;  6GSU A;  1NM3 A;  3U6V A;  1EGR A;  2YV9 A;  14GS A;  2FWG A;  2PBJ A;  2LNS A;  1X5E A;  1PGT A;  1XCC A;  2DC5 A;  2YWM A;  5JCU A;  2WZ9 A;  2I3Y A;  1OE8 A;  3MNG A;  1DBY A;  1G7E A;  1K0M A;  1YKC A;  2H0H A;  2LJA A;  2KP2 A;  5DDL A;  2DJ1 A;  3DRN A;  3S9F A;  4MZB A;  4G0L A;  1XWB A;  1XIY A;  5G31 A;  4TR1 A;  4WR4 A;  2CZ2 A;  4NWY A;  1SD9 A;  3GRX A;  3I69 A;  1X5D A;  2VM1 A;  2L4C A;  2H1D A;  3C73 A;  5H5S A;  1MDJ A;  1F2E A;  2NBS A;  3I9V 2;  1SL2 B; 
#chains in the Genus database with same CATH topology
 5ECM B;  1LJR A;  2UZ8 A;  3QFB C;  4XRD A;  3F63 A;  5DJL A;  2LNT A;  4FQU A;  1QXH A;  4ZB9 A;  3UAP A;  4YAP A;  4POB A;  4V2L A;  3WT1 A;  2C3T A;  5ELA A;  2DBC A;  2H76 A;  3M9K A;  5C04 A;  3KP9 A;  1QQ2 A;  4AKH A;  1XFL A;  3GTU B;  2IMF A;  3QAV A;  1X9M B;  2JZR A;  5LD0 A;  3HVS A;  2YWO A;  2JAD A;  3L78 A;  3FRC A;  2CT6 A;  1T4Y A;  3A2X A;  2OT3 A;  1ERV A;  3C71 A;  5JWO B;  2O89 A;  3C8E A;  3BJ5 A;  5IPG A;  3ZML A;  2AJQ B;  3ZIV A;  4LA1 A;  3I43 A;  5HR1 A;  2HSM B;  5HFI A;  2IME A;  3E0U A;  5CRW A;  1YY7 A;  5HR3 A;  1T4Z A;  4JR4 A;  1VF2 A;  2E2G A;  2XBQ A;  3GL5 A;  1K0C A;  2HRK B;  3UAR A;  3K8N A;  4MMM A;  4OD7 A;  2CQ9 A;  2VLU A;  1M2D A;  1PX7 A;  5ECQ B;  3RDW A;  2VCZ A;  5KN2 A;  1K0A A;  1WWJ A;  4MJC A;  2LRT A;  4K7O A;  4WEY A;  2JU5 A;  4X0X A;  4FH8 A;  1RQM A;  2IIY A;  5ECO B;  4KF9 A;  1K3O A;  5JWR B;  3FEU A;  1I1I P;  1YKA A;  4IGJ A;  4XS4 A;  2HZE A;  2HYX A;  4IBP A;  4GRF A;  1TRU A;  1THX A;  2WJU A;  1HQO A;  1F37 A;  1FAA A;  2AUV A;  1GNW A;  2EIQ A;  2P5R A;  1ILO A;  16GS A;  3Q18 A;  1VF3 A;  4N3Z A;  1XWA A;  3FW2 A;  3LYP A;  1TXU A;  4DSS B;  1DSB A;  2CX3 A;  3MDK A;  1GTU A;  2LJR A;  2C0G A;  2M80 A;  2V6O A;  5ID2 B;  2H74 A;  4RQR A;  1PKW A;  5EPF A;  3D4M A;  5HR2 A;  1XOA A;  3RGB C;  5J3R A;  3ERF A;  1AW9 A;  1Z7P A;  2B5E A;  3F4T A;  3GST A;  2RLI A;  4FIW A;  4KB3 A;  3UVT A;  3GKM A;  5DVB A;  4K0G A;  2LTK A;  2WW2 A;  4JBB A;  4KDY A;  2QGV A;  3BCK A;  4HU7 A;  2P31 A;  3HXS A;  1XW5 A;  3IE3 A;  4MZW A;  3J7Y k;  3UL3 A;  2CAQ A;  1IYI A;  2GQL A;  2NVL A;  2QA1 A;  1TOF A;  1PN0 A;  2VAF A;  3D4T A;  5B8A A;  3TKS C;  4HQZ A;  2VLV A;  5A4U A;  4TRX A;  3CXG A;  4LL4 B;  2VD0 A;  4AKG A;  3FZA A;  3CSJ A;  3QAW A;  3TOT A;  2MMO A;  1TK5 B;  1R4W A;  3KGK A;  3FR3 A;  1S3D A;  1N2A A;  2XBI A;  4GXZ A;  3W8S A;  3E3E A;  4FXY P;  3MAK A;  5DBQ A;  1WPI A;  1AAZ A;  4MA9 A;  1U3I A;  3ZFL A;  5IOX A;  1ZYQ B;  4GDF A;  3GL3 A;  2KHP A;  1KTE A;  2H0I A;  4GST A;  3C1S A;  5LNK e;  1YJ6 A;  2GST A;  6GSS A;  5EVO A;  3UVH A;  3ZMK A;  1X5C A;  1HNB A;  3IRA A;  1FHE A;  6GSY A;  1URM A;  3LQ7 A;  4POK A;  4EVM A;  3VPQ A;  2AAW A;  2ON7 A;  1QFN A;  3KTL A;  4KAE A;  4YQM A;  1B9Y C;  3BD2 A;  5ECL B;  3GN3 A;  5IMC A;  1A24 A;  2H1L A;  2FGX A;  2OAC A;  5DAK A;  2H71 A;  3HVX A;  3FZ4 A;  3HVN A;  5GAP D;  4K5S A;  1K0O A;  1BG1 A;  1GSU A;  1GL8 A;  1TDI A;  3UEM A;  5A5H B;  1PFO A;  4HI7 A;  4KDU A;  1SK2 A;  3IC8 A;  2PPT A;  1V98 A;  3HY2 A;  3GHA A;  1JZD A;  4WKW A;  3P7X A;  2HNL A;  1GH2 A;  4F03 A;  3KM6 A;  3TJG A;  5GZZ B;  4TVE A;  2P5Q A;  3UJ1 A;  4GSN A;  4TR4 A;  1GSS A;  3LXZ A;  1XVQ A;  2VLT A;  3LYK A;  4MP4 A;  3V1W A;  4K8M A;  4IW9 A;  1Y6E A;  4DVC A;  4L5L A;  3H1N A;  3A2W A;  2R4V A;  5ECI B;  2V2G A;  3LEF A;  1OKT A;  1EZK A;  4PTS A;  3UBL A;  1WRY A;  2C0D A;  3A5W A;  2CV4 A;  1GSF A;  2I81 A;  3IA1 A;  1MTC A;  1FW1 A;  1AQX A;  2HRF A;  1GSY A;  2DMM A;  5J9C A;  3ZL5 A;  5EY6 A;  2O36 A;  1V57 A;  4HQS A;  3D5J A;  1SKS B;  5J4Y A;  2IWT A;  1SYX A;  1G7O A;  3R3E A;  2H19 A;  1ZYP A;  3PH9 A;  4Z2T A;  4BA7 A;  2AV4 A;  3NIV A;  1XOB A;  1FB6 A;  4HU9 A;  1MDI A;  1ZMA A;  3TKR A;  2HRN A;  4NMU A;  1QUW A;  1NSW A;  3J7Y b;  3DWV A;  5CRE A;  1GUM A;  4I5Q A;  4OWY A;  2WVX A;  4LMW A;  2WGR A;  3O3T A;  3F6F A;  3CHX C;  5ENU A;  2GS3 A;  3KMO A;  4D73 B;  5IO2 A;  4GQC A;  4WBR D;  2YCD A;  1M9B A;  2F8A A;  2ZCT A;  2H8L A;  3LWA A;  4RUV A;  1IYH A;  2KP1 A;  3MYD A;  4NHW A;  5D9X A;  1PQN A;  2F9S A;  2HFD A;  4L5O A;  4EDZ A;  3HMJ G;  2VM2 A;  2FA4 A;  2PER A;  4Q5Q A;  3L4N A;  5D9V A;  2GZY A;  4TXO A;  2HZF A;  4ACS A;  4O5R A;  4IS0 A;  2HI7 A;  4OO4 A;  1OC3 A;  2OE0 A;  5ECS A;  2GSR A;  3TU3 B;  2H72 A;  2VL9 A;  2EFH A;  4WET A;  1B9X C;  2BMX A;  3C1R A;  1OAZ A;  5KN3 A;  2RM5 A;  1DE1 A;  2V1M A;  4F9Z A;  2GZZ A;  1A23 A;  2IL3 A;  2VUP A;  2QC7 A;  1O81 A;  3UBK A;  2O3E A;  4X43 A;  3FR9 A;  4O32 A;  20GS A;  1YZX A;  13GS A;  1GSQ A;  2EFE A;  3O76 A;  4EE0 A;  1E2Y A;  1M2B A;  2VCT A;  4NXI A;  3KTB A;  2C8U A;  4N11 A;  3JCM L;  4BVX A;  3DVW A;  1SVM A;  1SVO A;  2NDO A;  4J56 E;  4X1U A;  2FUG 2;  2PGT A;  5DQY A;  2L57 A;  2GTU A;  3L9U A;  1M99 A;  2CA8 A;  5AN1 A;  1SU9 A;  1O8W A;  3TKP A;  2E2M A;  3CTG A;  3GA4 A;  4AI6 A;  4AGS A;  3RPN A;  3DGQ A;  3DIE A;  3TJK A;  5D9T A;  4N0V A;  4EDY A;  4JZQ A;  3DYR A;  4XTS A;  3U5R E;  5DAL B;  3L0H A;  9GSS A;  2HXK A;  5IMV A;  2YZU A;  4MPF A;  3TUE A;  3D21 A;  4I2T A;  1HNA A;  5IIZ A;  1DUG A;  4L0U A;  3EVI A;  5IMF A;  5ECH B;  2IMI A;  1O8X A;  3GX0 A;  1M3J A;  3HA9 A;  5F07 A;  3ZZX A;  2RM6 A;  4PI2 C;  3ZIJ A;  2RUE A;  4PNF A;  3EIN A;  4JU5 A;  3M1G A;  2K9F A;  2MMA A;  3VWW A;  2YJH A;  2H1G A;  4WXT A;  4POL A;  1GLP A;  2GGT A;  1GNE A;  4MH2 A;  5H5Q A;  1TRW A;  4GTU A;  1KNG A;  4MZC A;  2J23 A;  4N30 A;  4CW9 A;  1F3B A;  5EL8 A;  1PKZ A;  3CRT A;  3CRU A;  2IFQ B;  5DCH A;  4EC0 A;  5J4U A;  1A8Y A;  2EFD A;  4Z7X A;  5DCG A;  1TKD B;  1SK0 A;  4K9Z A;  1YF1 A;  4LMV A;  2GLR A;  4NV5 A;  3PGT A;  2DSA A;  3GX8 A;  3IOS A;  1EOG A;  4ZB6 A;  4KA0 A;  2NTO A;  1ML6 A;  2GT6 A;  1TK8 B;  2CX4 A;  1XG8 A;  4HSC X;  1F3A A;  1XWK A;  1JZO A;  3TDG A;  1ZGN A;  10GS A;  1QGV A;  3PPU A;  5A34 A;  3TKQ A;  1NHO A;  2VCX A;  1PMT A;  4HUA A;  1BF5 A;  2VD1 A;  3GNJ A;  2IPA A;  4MJB A;  3ERG A;  3VUR A;  2MBS A;  1ACV A;  5G2Z A;  1THO A;  4F2I A;  4V1A g;  4ZIJ A;  3GKX A;  7GSS A;  3IAM 2;  2GQM A;  4PGT A;  4HDE A;  5HR0 A;  5LCZ A;  3A3T A;  4GWR A;  1HYU A;  5ELG A;  3QDN A;  4GF0 A;  3KZQ A;  1LU4 A;  1T8E B;  4XS1 A;  2LQQ A;  5B6M A;  4I97 A;  4WF5 A;  2R2J A;  4YKF A;  1G6Y A;  3DVX A;  3O6T A;  1YEP A;  1Z6M A;  3QFA C;  2VCW A;  2V32 A;  4OFT A;  5E59 A;  1RK4 A;  1S3R A;  4OFN A;  5J47 A;  2K8V A;  1FO5 A;  1M2A A;  3TCO A;  2JZS A;  3IC4 A;  2LV3 A;  4KUN A;  3CWG A;  3GTU A;  4MF7 A;  5ECN B;  4AKI A;  2B7J A;  2O85 A;  1FB0 A;  4ZL8 A;  2Z9S A;  2MYG A;  1B4Q A;  3LGC A;  4AF2 A;  3QD9 A;  5GST A;  2B1K A;  3HDC A;  3IBH A;  4CDO A;  3KH9 A;  6GST A;  1XWC A;  5H5R A;  1EOH A;  2IJY A;  5J4V A;  4XCS A;  5HFK A;  4KSM A;  5ECR B;  4IVF A;  3RPP A;  2A2R A;  3UMA A;  3KH7 A;  3KMN A;  3UOM A;  2HSY A;  3GV1 A;  1WIK A;  2WDU A;  2HSM A;  1GRX A;  1O73 A;  3C7M A;  2L59 A;  5G1K A;  2FA8 A;  3W6G A;  4MJE A;  3LSZ A;  2HSH A;  4N0Z A;  3HJO A;  5ECK B;  3GUS A;  3L9V A;  1Q4J A;  3VLN A;  4Q5R A;  2X4A A;  2N5F A;  3RBT A;  1UC7 A;  2IN3 A;  1NW2 A;  5KOW A;  1J0F A;  2PU9 C;  2OE3 A;  1ERU A;  1YQ1 A;  1BAY A;  3UIW A;  3OR5 A;  2K18 A;  3FZ5 A;  1R26 A;  1TRS A;  4ML6 A;  5IO0 A;  1U6T A;  3CYN A;  3ZTL A;  4G0K A;  4ECB A;  3D22 A;  4GQF A;  4A5P A;  1YF0 A;  2XC2 A;  3WT2 A;  4QL7 A;  1OC9 B;  2JSY A;  2FWE A;  2JZT A;  1TRV A;  2A2S A;  4MNN A;  1JZR A;  5GSS A;  3H79 A;  3QMX A;  5DJM A;  3EE2 A;  3FY7 A;  4CY8 A;  2FWH A;  3WGX A;  5GAN D;  1TW9 A;  1EV4 A;  2ZNM A;  1FVJ A;  3ZVJ A;  4DSS A;  4QL9 A;  3F0I A;  1ON4 A;  1C72 A;  4QQ7 A;  2C3N A;  4H86 A;  2ES7 A;  3ERW A;  1UA5 A;  4MCU A;  3TKS E;  5ID2 A;  4K2D A;  1CQH A;  1EGO A;  1WOU A;  2F8F A;  3IAS 2;  4I8B A;  4MH3 A;  5J5N A;  4ZBD A;  2LS5 A;  3HVV A;  1Z7R A;  4MJA A;  2X64 A;  1SL1 B;  4HOJ A;  3IK7 A;  6GSW A;  3KIJ A;  4ZIL A;  1X9W B;  4IQ1 A;  4HZ2 A;  1PA3 A;  4G01 A;  1A0R P;  5D96 A;  4DSR A;  5KN0 A;  4PQI A;  3LW9 A;  3F4R A;  4WBJ A;  5KEJ A;  2H75 A;  4TKY A;  1SD8 A;  1GUH A;  3FYG A;  2L5L A;  2X8G A;  4KH7 A;  1ZOF A;  3N9J A;  2HLS A;  3RHB A;  4EL1 A;  2CVB A;  2OAD A;  2CAI A;  1SKW B;  3QAG A;  4O5Q A;  2PN8 A;  1Z3E A;  1BED A;  2X49 A;  2AHE A;  2PVO C;  2TRX A;  2X8H A;  4IEL A;  4ISD A;  2C1Y A;  5A1N A;  1E6B A;  3QCP A;  5FWG A;  2YJ7 A;  4O92 A;  1H4O A;  1A2J A;  1WJK A;  4BWQ A;  2FNO A;  2GSQ A;  1XW9 A;  3CTF A;  4ZXG A;  3F6D A;  2DJK A;  3EC3 A;  1Z9H A;  3ZIT A;  4ZL9 A;  3IV4 A;  5HQP A;  2H70 A;  2O8V B;  1TP9 A;  3CMI A;  1TU8 A;  3RAZ A;  3VI7 A;  3L9S A;  1HD2 A;  1GTA A;  3LG6 A;  1PD2 1;  4QMK A;  3N5O A;  3DD3 A;  4G19 A;  3IHQ A;  1ZYE A;  2WVX B;  4HJM A;  2YWI A;  3IXR A;  2VL3 A;  1M7T A;  4ECJ A;  3VI5 A;  2E7P A;  4AJ6 A;  1QK8 A;  3QPM A;  4I6X A;  4G2E A;  1OVN A;  3LOR A;  3VFI A;  2X8C A;  2H1A A;  3A2V A;  4IJ3 A;  1KEB A;  2N5A A;  2B6M A;  1S4B P;  2FD3 A;  2DJ0 A;  3VWV A;  3P8W A;  2ON5 A;  2A2P A;  3EU4 A;  1XZO A;  3GKN A;  1SJ6 A;  5A5H A;  4BL7 A;  2EIO A;  2C0F A;  3DML A;  2V6K A;  1SJI A;  4YAV A;  2WB9 A;  3ED3 A;  5F0G A;  4G10 A;  1X0R A;  5D93 A;  4ECC A;  1Z6N A;  1SVL A;  3FR6 A;  3HJM A;  2L5O A;  4BVY B;  4PUF C;  2RII A;  4ULX A;  3F3Q A;  3TGZ A;  4OO5 A;  4PX1 A;  1EEM A;  2M46 A;  4FYB A;  1VF4 A;  2DKH A;  3LXT A;  5BMU B;  2WVZ A;  2J9H A;  1M3I A;  1VGL A;  4KDX A;  1ZYN A;  5AIX A;  5BRT A;  2WUL A;  5B6N A;  2ZUP A;  1XW6 A;  1B48 A;  3H8Q A;  1N8J A;  4O7H A;  4X4J A;  3GYK A;  2TIR A;  5A4V A;  5B7C A;  1JLW A;  4AJ8 A;  5KOX A;  1BX9 A;  3TB2 A;  4W66 A;  1N25 A;  1HNC A;  4HJ2 A;  1EV9 A;  1GWC A;  1R5P A;  4KGI A;  2H1B A;  3APO A;  3NZN A;  4HS1 A;  2VIM A;  4L8E A;  12GS A;  2M72 A;  3EMX A;  2VL2 A;  2EC4 A;  3NOF A;  2B5X A;  1TTZ A;  5E4W A;  3TJJ A;  1BQ7 A;  3G7Y A;  3R2Q A;  5IQY A;  2KUC A;  1EWX A;  4ID0 A;  2LRN A;  3IR4 A;  1TK0 B;  1EP8 A;  4ECI A;  4K0N A;  4USS A;  3G7J A;  5J41 A;  4D73 A;  3Q74 A;  2R0G A;  4PQH A;  4PNG A;  5B8B A;  3BCI A;  4LL1 B;  2BJX A;  5CRH A;  1A2L A;  4E68 A;  3ZRD A;  4OMV A;  2OBK A;  4IP1 A;  3ZRE A;  4G9H A;  1Z5Y E;  3IPZ A;  3KD0 A;  4TR1 B;  1TJD A;  4YQV A;  5D9W A;  3LJR A;  3SWL A;  1NHY A;  4GCI A;  1AQW A;  3FHK A;  4EUY A;  1W89 A;  1BYE A;  1O7U A;  1GSD A;  2OE1 A;  2R0P A;  2RUF A;  2ALB A;  2H30 A;  2DIZ A;  2HSN B;  1TXX A;  1R7H A;  1SKR B;  1R5A A;  1UN2 A;  2LJK A;  2HT9 A;  1GP1 A;  1Y25 A;  2L4Q A;  4TR0 A;  2BTO T;  3ISO A;  1SK1 A;  2REM A;  4IN0 A;  2L6D A;  1TI3 A;  3WYW A;  2YP6 A;  2G2Q A;  1A0F A;  1XPV A;  2B5Y A;  4V2M A;  2FHE A;  2V41 A;  4JR6 A;  4EIQ A;  1EEJ A;  3ZLP A;  4PQ1 A;  2E0Q A;  3Q6O A;  3EU3 A;  4EF0 A;  2YAN A;  4IJI A;  2CZ3 A;  4ZBA A;  4EKZ A;  1YEW C;  2YV7 A;  1DE2 A;  2B3S A;  4P3Y B;  2MMZ A;  4JED A;  4NAX A;  1I5G A;  5ECP B;  3DEX A;  5HFG A;  3DKS A;  2I4A A;  3SBC A;  4RI7 A;  4K6X A;  2X99 A;  2JL4 A;  4EIP A;  1GLQ A;  1UVZ A;  2VOC A;  4K7I A;  3WGD A;  2HRA A;  1CQG A;  2LST A;  1WP0 A;  4AKX B;  2MMN A;  2IMK A;  3TJB A;  5DAL A;  3QR6 A;  1AUC A;  5G5E A;  2DJJ A;  1PX6 A;  1J08 A;  4CY6 A;  3CSH A;  3ZFB A;  2CVD A;  8GSS A;  5JCW A;  3FK8 A;  2DIY A;  4OFM A;  3IK9 A;  3IDV A;  2P0G A;  3GH6 A;  2A4V A;  5L71 A;  1K0B A;  4PXO A;  3P2A A;  4RQX A;  2D2Z A;  4XS4 B;  4NHZ A;  4K5R A;  2GVP A;  4V1A p;  2HZE B;  5KN1 A;  4PHZ C;  5CNW A;  1XXU A;  5CAX A;  3HYP A;  3ZYW A;  5G30 A;  3KCM A;  2WVY A;  22GS A;  2EFC A;  2L6C A;  4OCE A;  2WCI A;  3APQ A;  4HZ4 A;  2IFQ A;  1U87 A;  4MK3 A;  5CYY A;  2H6Y A;  3WGE A;  3EUR A;  1SYR A;  1GTI A;  4G0I A;  1YEX A;  4FO5 A;  5IMA A;  2WZS A;  4IKH A;  2G0F A;  4YQU A;  3VK9 A;  4MPG A;  3TOU A;  1JZW A;  3Q19 A;  2H6Z A;  2O87 A;  1AC1 A;  6GSV A;  2HE3 A;  4XS6 A;  1XWG A;  2N5B A;  1SL0 B;  5IPH A;  19GS A;  4MDC A;  5FHI A;  1V40 A;  1ERW A;  2K8S A;  4N10 A;  2GSS A;  3US3 A;  3F4S A;  4Q5F A;  4RI6 A;  4Z2R A;  4E8E A;  3KJY A;  3EPT A;  3G9B A;  2F3M A;  4EXJ A;  2GDR A;  3M9J A;  2O5V A;  1GUL A;  2H6X A;  1I9D A;  3GFK A;  1FVK A;  1GUK A;  3APS A;  1ZZY A;  4YH2 A;  2JAC A;  4NV2 A;  4KCA A;  3HD5 A;  1V58 A;  5F05 A;  3MSZ A;  1AQV A;  1B4P A;  4MF5 A;  2HQT A;  4I2U A;  1USB A;  2UV8 G;  3PIN A;  5COH A;  2DLX A;  4AJ7 A;  4ML1 A;  4DSQ A;  2HRK A;  5G5F A;  5FT3 A;  4IQA A;  3TRP A;  2A4H A;  2DJ2 A;  3CSI A;  18GS A;  1KBN A;  4XRA A;  2C0E A;  4TN8 A;  2AYT A;  1LBK A;  1H75 A;  1SJZ A;  4ZBB A;  2VL2 C;  1GTB A;  1PL2 A;  3H93 A;  1F9M A;  2DKI A;  2EIR A;  1X9S B;  1OC8 A;  5C00 A;  4K7N A;  3HZ8 A;  3F8U A;  4YKG A;  1Y1U A;  1PN9 A;  4OCF A;  2YOI A;  5DAK B;  4GLT A;  2PVQ A;  1TI1 A;  2LQO A;  4WF4 A;  1WE0 A;  4NPB A;  5D73 A;  3FKF A;  1JLV A;  4ZB8 A;  3VWU A;  1XVW A;  1J9B A;  4KCE A;  2C3Q A;  3D0Z A;  5A4W A;  2NPB A;  2XPE A;  2WW3 A;  2H73 A;  4Q5N A;  3KP8 A;  1T3B A;  1JHB A;  4IP6 A;  5JCG A;  3MIX A;  1ZCP A;  1O6J A;  5A1N B;  2PWJ A;  2QKE A;  4XIH A;  2FLS A;  2B1L A;  1JFU A;  3F3R A;  4BPY A;  1U3A A;  2XPD A;  1ERT A;  3LFL A;  2QA2 A;  1MD3 A;  1YDK A;  1PSQ A;  1MD4 A;  1XBS A;  2VKZ G;  2R0C A;  4KW6 A;  4L0W A;  1VRS D;  4TW5 A;  1FOH A;  1V2A A;  4J2F A;  11GS A;  4GSS A;  3E9J B;  1ABA A;  5CP1 A;  1W4V A;  3GKK A;  2VO4 A;  2JSZ A;  1BG5 A;  2YZH A;  3EMP A;  2I9H A;  4KX4 A;  2GZP A;  4PUR A;  2DJ3 A;  1MDK A;  4LLR A;  4TOP A;  3HJP A;  3ZVJ D;  4KE3 A;  2OBI A;  1OC9 A;  2C4J A;  1T1V A;  4EO3 A;  3TJF A;  4F0C A;  3HKR A;  3AY8 A;  4IHU A;  4PI0 C;  4BL7 B;  4F82 A;  1K3Y A;  1AIU A;  3CBU A;  1PRX A;  2GT5 A;  3D6I A;  4TR3 A;  3MWH A;  4ICY A;  2YPM A;  3QOU A;  3M8N A;  4DEJ A;  1S3A A;  3H4K A;  1WMJ A;  2R37 A;  4CHS A;  2AB6 A;  1BJX A;  5F8B A;  1VF1 A;  1ST9 A;  2WW1 A;  3RHC A;  3ME7 A;  3PR8 A;  2VCQ A;  2R3X A;  2FWF A;  3WD6 A;  2OA7 A;  1YVL A;  1B8X A;  2YNX A;  5INY A;  2LRC A;  4TXO B;  4Z2U A;  2R6K A;  2QSI A;  2IMD A;  1MEK A;  1QMV A;  1OYJ A;  2YWN A;  1OE7 A;  2YN1 A;  3EYT A;  3EWL A;  2PUK C;  4XHM A;  1TU7 A;  2KOK A;  2OJL A;  1K0D A;  5G1L A;  4TXV A;  4JRR A;  2WW0 A;  4ZL7 A;  1EP7 A;  4WR5 A;  5CRG A;  3BBY A;  2GQK A;  1RW1 A;  4MF6 A;  2TRC P;  4FYC A;  1ZL9 A;  2LUS A;  4ILF A;  4K1F A;  1V9W A;  5CRD A;  5IM9 A;  2WRT A;  2I1U A;  3GH9 A;  1PL1 A;  2LKU A;  4BVX B;  2H01 A;  1A8L A;  1F6M C;  3KXO A;  3VPT A;  4MAB A;  2KLX A;  3M0F A;  2MBT A;  3P90 A;  2LEG A;  1U88 A;  3GUR A;  2CVK A;  3BOA A;  2H66 A;  2WS2 A;  2VCV A;  5DQS A;  4POM A;  3DXB A;  4K2X A;  4KND A;  1GSE A;  4O5U A;  6GSX A;  1SEN A;  3RFR C;  3FZ9 A;  3M3M A;  4J57 E;  1FG4 A;  4V2N A;  4ZB7 A;  1OKD A;  5AIV A;  3HCZ A;  1T00 A;  1G6W A;  4BVY A;  2FCH A;  3GIX A;  4F0B A;  1M0U A;  5F06 A;  3GSS A;  2O7K A;  2FY6 A;  2C80 A;  2K6V A;  5AIS A;  3A5I A;  4KSO A;  3ME8 A;  5A5K A;  3TRX A;  3TKS A;  5BMU A;  5AGY A;  2B7K A;  1K3L A;  5JWQ B;  2MZC A;  2DML A;  4BWS A;  2OKA A;  3F9U A;  1T7P B;  2PMT A;  3GMF A;  2H0G A;  1G0T A;  2F51 A;  4FYU A;  1A2M A;  2WFC A;  3HHV A;  3KEB A;  3TRQ A;  2R5G A;  3HZ4 A;  1K0N A;  4PUA A;  1O85 A;  5IMZ A;  3G7I A;  5D8I A;  4MLY A;  3I6A A;  1Q98 A;  1FOV A;  1M9A A;  17GS A;  5IMD A;  3VWX A;  1AXD A;  2XHF A;  4E8H A;  1S3C A;  5IOW A;  4HEA 2;  5ABR A;  5J9B A;  3CQF A;  5A34 B;  4JE1 A;  3W8J A;  5CO3 A;  6GSU A;  1NM3 A;  3U6V A;  1EGR A;  2YV9 A;  14GS A;  2FWG A;  2PBJ A;  2LNS A;  1X5E A;  1PGT A;  1XCC A;  2DC5 A;  2YWM A;  5JCU A;  2WZ9 A;  2I3Y A;  1OE8 A;  3MNG A;  1DBY A;  1G7E A;  1K0M A;  1YKC A;  2H0H A;  2LJA A;  2KP2 A;  5DDL A;  2DJ1 A;  3DRN A;  3S9F A;  3IHG A;  4MZB A;  4G0L A;  4BIK A;  3FMW A;  1XWB A;  1XIY A;  5G31 A;  4TR1 A;  4WR4 A;  5J40 A;  2CZ2 A;  4NWY A;  1SD9 A;  3GRX A;  3I69 A;  1X5D A;  2VM1 A;  2L4C A;  2H1D A;  3C73 A;  5H5S A;  1MDJ A;  1F2E A;  2HSN A;  2NBS A;  3I9V 2;  1SL2 B; 
#chains in the Genus database with same CATH homology
 5ECM B;  1LJR A;  2UZ8 A;  3QFB C;  4XRD A;  3F63 A;  5DJL A;  2LNT A;  4FQU A;  1QXH A;  4ZB9 A;  3UAP A;  4YAP A;  4POB A;  4V2L A;  3WT1 A;  2C3T A;  5ELA A;  2DBC A;  2H76 A;  3M9K A;  5C04 A;  3KP9 A;  1QQ2 A;  4AKH A;  1XFL A;  3GTU B;  2IMF A;  3QAV A;  1X9M B;  2JZR A;  5LD0 A;  3HVS A;  2YWO A;  2JAD A;  3L78 A;  3FRC A;  2CT6 A;  1T4Y A;  3A2X A;  2OT3 A;  1ERV A;  3C71 A;  5JWO B;  2O89 A;  3C8E A;  3BJ5 A;  5IPG A;  3ZML A;  2AJQ B;  3ZIV A;  4LA1 A;  3I43 A;  5HR1 A;  2HSM B;  5HFI A;  2IME A;  3E0U A;  5CRW A;  1YY7 A;  5HR3 A;  1T4Z A;  4JR4 A;  1VF2 A;  2E2G A;  2XBQ A;  3GL5 A;  1K0C A;  2HRK B;  3UAR A;  3K8N A;  4MMM A;  4OD7 A;  2CQ9 A;  2VLU A;  1M2D A;  1PX7 A;  5ECQ B;  3RDW A;  2VCZ A;  5KN2 A;  1K0A A;  1WWJ A;  4MJC A;  2LRT A;  4K7O A;  4WEY A;  2JU5 A;  4X0X A;  4FH8 A;  1RQM A;  2IIY A;  5ECO B;  4KF9 A;  1K3O A;  5JWR B;  3FEU A;  1YKA A;  4IGJ A;  4XS4 A;  2HZE A;  2HYX A;  4IBP A;  4GRF A;  1TRU A;  1THX A;  2WJU A;  1HQO A;  1F37 A;  1FAA A;  2AUV A;  1GNW A;  2EIQ A;  2P5R A;  1ILO A;  16GS A;  3Q18 A;  1VF3 A;  4N3Z A;  1XWA A;  3FW2 A;  3LYP A;  1TXU A;  4DSS B;  1DSB A;  2CX3 A;  3MDK A;  1GTU A;  2LJR A;  2C0G A;  2M80 A;  2V6O A;  5ID2 B;  2H74 A;  4RQR A;  1PKW A;  5EPF A;  3D4M A;  5HR2 A;  1XOA A;  5J3R A;  3ERF A;  1AW9 A;  1Z7P A;  2B5E A;  3F4T A;  3GST A;  2RLI A;  4FIW A;  4KB3 A;  3UVT A;  3GKM A;  5DVB A;  4K0G A;  2LTK A;  4JBB A;  4KDY A;  2QGV A;  3BCK A;  4HU7 A;  2P31 A;  3HXS A;  1XW5 A;  3IE3 A;  4MZW A;  3J7Y k;  3UL3 A;  2CAQ A;  1IYI A;  2GQL A;  2NVL A;  2QA1 A;  1TOF A;  1PN0 A;  2VAF A;  3D4T A;  5B8A A;  3TKS C;  4HQZ A;  2VLV A;  5A4U A;  4TRX A;  3CXG A;  4LL4 B;  2VD0 A;  4AKG A;  3FZA A;  3CSJ A;  3QAW A;  3TOT A;  2MMO A;  1TK5 B;  1R4W A;  3KGK A;  3FR3 A;  1S3D A;  1N2A A;  2XBI A;  4GXZ A;  3W8S A;  3E3E A;  3MAK A;  5DBQ A;  1WPI A;  1AAZ A;  4MA9 A;  1U3I A;  3ZFL A;  5IOX A;  1ZYQ B;  4GDF A;  3GL3 A;  2KHP A;  1KTE A;  2H0I A;  4GST A;  3C1S A;  5LNK e;  1YJ6 A;  2GST A;  6GSS A;  5EVO A;  3UVH A;  3ZMK A;  1X5C A;  1HNB A;  3IRA A;  1FHE A;  6GSY A;  1URM A;  3LQ7 A;  4POK A;  4EVM A;  3VPQ A;  2AAW A;  2ON7 A;  1QFN A;  3KTL A;  4KAE A;  4YQM A;  1B9Y C;  3BD2 A;  5ECL B;  3GN3 A;  5IMC A;  1A24 A;  2H1L A;  2FGX A;  2OAC A;  5DAK A;  2H71 A;  3FZ4 A;  3HVX A;  5GAP D;  4K5S A;  1K0O A;  1BG1 A;  1GSU A;  1GL8 A;  1TDI A;  3UEM A;  5A5H B;  4HI7 A;  4KDU A;  1SK2 A;  3IC8 A;  2PPT A;  1V98 A;  3HY2 A;  3GHA A;  1JZD A;  4WKW A;  3P7X A;  2HNL A;  1GH2 A;  4F03 A;  3KM6 A;  3TJG A;  5GZZ B;  4TVE A;  2P5Q A;  3UJ1 A;  4GSN A;  4TR4 A;  1GSS A;  3LXZ A;  1XVQ A;  2VLT A;  3LYK A;  4MP4 A;  3V1W A;  4K8M A;  4IW9 A;  1Y6E A;  4DVC A;  4L5L A;  3H1N A;  3A2W A;  2R4V A;  5ECI B;  2V2G A;  3LEF A;  1OKT A;  1EZK A;  4PTS A;  3UBL A;  1WRY A;  2C0D A;  3A5W A;  2CV4 A;  1GSF A;  2I81 A;  3IA1 A;  1MTC A;  1FW1 A;  1AQX A;  2HRF A;  1GSY A;  2DMM A;  5J9C A;  3ZL5 A;  5EY6 A;  1V57 A;  4HQS A;  3D5J A;  1SKS B;  5J4Y A;  2IWT A;  1SYX A;  1G7O A;  3R3E A;  2H19 A;  1ZYP A;  3PH9 A;  4Z2T A;  4BA7 A;  2AV4 A;  3NIV A;  1XOB A;  1FB6 A;  4HU9 A;  1MDI A;  1ZMA A;  3TKR A;  2HRN A;  4NMU A;  1QUW A;  1NSW A;  3J7Y b;  3DWV A;  5CRE A;  1GUM A;  4I5Q A;  4OWY A;  4LMW A;  2WGR A;  3O3T A;  3F6F A;  5ENU A;  2GS3 A;  3KMO A;  4D73 B;  5IO2 A;  4GQC A;  4WBR D;  2YCD A;  1M9B A;  2F8A A;  2ZCT A;  2H8L A;  3LWA A;  4RUV A;  1IYH A;  2KP1 A;  3MYD A;  4NHW A;  5D9X A;  1PQN A;  2F9S A;  2HFD A;  4L5O A;  4EDZ A;  3HMJ G;  2VM2 A;  2FA4 A;  2PER A;  4Q5Q A;  3L4N A;  5D9V A;  2GZY A;  4TXO A;  2HZF A;  4ACS A;  4O5R A;  4IS0 A;  2HI7 A;  4OO4 A;  1OC3 A;  2OE0 A;  5ECS A;  2GSR A;  3TU3 B;  2H72 A;  2VL9 A;  2EFH A;  4WET A;  1B9X C;  2BMX A;  3C1R A;  1OAZ A;  5KN3 A;  2RM5 A;  1DE1 A;  2V1M A;  4F9Z A;  2GZZ A;  1A23 A;  2IL3 A;  2VUP A;  2QC7 A;  1O81 A;  3UBK A;  4X43 A;  3FR9 A;  4O32 A;  20GS A;  1YZX A;  13GS A;  1GSQ A;  2EFE A;  3O76 A;  4EE0 A;  1E2Y A;  1M2B A;  2VCT A;  4NXI A;  3KTB A;  2C8U A;  4N11 A;  3JCM L;  4BVX A;  3DVW A;  1SVM A;  1SVO A;  2NDO A;  4J56 E;  4X1U A;  2FUG 2;  2PGT A;  5DQY A;  2L57 A;  2GTU A;  3L9U A;  1M99 A;  2CA8 A;  5AN1 A;  1SU9 A;  1O8W A;  3TKP A;  2E2M A;  3CTG A;  3GA4 A;  4AI6 A;  4AGS A;  3RPN A;  3DGQ A;  3DIE A;  3TJK A;  5D9T A;  4N0V A;  4EDY A;  4JZQ A;  3DYR A;  4XTS A;  3U5R E;  5DAL B;  3L0H A;  9GSS A;  2HXK A;  5IMV A;  2YZU A;  4MPF A;  3TUE A;  3D21 A;  4I2T A;  1HNA A;  5IIZ A;  1DUG A;  4L0U A;  3EVI A;  5IMF A;  5ECH B;  2IMI A;  1O8X A;  3GX0 A;  3HA9 A;  5F07 A;  3ZZX A;  2RM6 A;  3ZIJ A;  2RUE A;  4PNF A;  3EIN A;  4JU5 A;  3M1G A;  2K9F A;  2MMA A;  3VWW A;  2YJH A;  2H1G A;  4WXT A;  4POL A;  1GLP A;  2GGT A;  1GNE A;  4MH2 A;  5H5Q A;  1TRW A;  4GTU A;  1KNG A;  4MZC A;  2J23 A;  4N30 A;  4CW9 A;  1F3B A;  5EL8 A;  1PKZ A;  3CRT A;  3CRU A;  2IFQ B;  5DCH A;  4EC0 A;  5J4U A;  1A8Y A;  2EFD A;  4Z7X A;  5DCG A;  1TKD B;  1SK0 A;  4K9Z A;  1YF1 A;  4LMV A;  2GLR A;  4NV5 A;  3PGT A;  2DSA A;  3GX8 A;  3IOS A;  1EOG A;  4ZB6 A;  4KA0 A;  2NTO A;  1ML6 A;  2GT6 A;  1TK8 B;  2CX4 A;  1F3A A;  1XWK A;  1JZO A;  3TDG A;  1ZGN A;  10GS A;  1QGV A;  3PPU A;  5A34 A;  3TKQ A;  1NHO A;  2VCX A;  1PMT A;  4HUA A;  1BF5 A;  2VD1 A;  3GNJ A;  2IPA A;  4MJB A;  3ERG A;  3VUR A;  2MBS A;  1ACV A;  5G2Z A;  1THO A;  4F2I A;  4V1A g;  4ZIJ A;  3GKX A;  7GSS A;  3IAM 2;  2GQM A;  4PGT A;  4HDE A;  5HR0 A;  5LCZ A;  3A3T A;  4GWR A;  1HYU A;  5ELG A;  3QDN A;  4GF0 A;  3KZQ A;  1LU4 A;  1T8E B;  4XS1 A;  2LQQ A;  5B6M A;  4I97 A;  4WF5 A;  2R2J A;  4YKF A;  1G6Y A;  3DVX A;  3O6T A;  1YEP A;  1Z6M A;  3QFA C;  2VCW A;  2V32 A;  4OFT A;  5E59 A;  1RK4 A;  4OFN A;  5J47 A;  2K8V A;  1FO5 A;  1M2A A;  3TCO A;  2JZS A;  3IC4 A;  2LV3 A;  4KUN A;  3CWG A;  3GTU A;  4MF7 A;  5ECN B;  4AKI A;  2B7J A;  2O85 A;  1FB0 A;  4ZL8 A;  2Z9S A;  2MYG A;  1B4Q A;  3LGC A;  4AF2 A;  3QD9 A;  5GST A;  2B1K A;  3HDC A;  3IBH A;  4CDO A;  3KH9 A;  6GST A;  1XWC A;  5H5R A;  1EOH A;  2IJY A;  5J4V A;  4XCS A;  5HFK A;  4KSM A;  5ECR B;  4IVF A;  3RPP A;  2A2R A;  3UMA A;  3KH7 A;  3KMN A;  3UOM A;  2HSY A;  3GV1 A;  1WIK A;  2WDU A;  2HSM A;  1GRX A;  1O73 A;  3C7M A;  2L59 A;  5G1K A;  2FA8 A;  3W6G A;  4MJE A;  3LSZ A;  2HSH A;  4N0Z A;  3HJO A;  5ECK B;  3GUS A;  3L9V A;  1Q4J A;  3VLN A;  4Q5R A;  2X4A A;  2N5F A;  3RBT A;  1UC7 A;  2IN3 A;  1NW2 A;  5KOW A;  1J0F A;  2PU9 C;  2OE3 A;  1ERU A;  1YQ1 A;  1BAY A;  3UIW A;  3OR5 A;  2K18 A;  3FZ5 A;  1R26 A;  1TRS A;  4ML6 A;  5IO0 A;  1U6T A;  3CYN A;  3ZTL A;  4G0K A;  4ECB A;  3D22 A;  4GQF A;  4A5P A;  1YF0 A;  2XC2 A;  3WT2 A;  4QL7 A;  1OC9 B;  2JSY A;  2FWE A;  2JZT A;  1TRV A;  2A2S A;  4MNN A;  1JZR A;  5GSS A;  3H79 A;  3QMX A;  5DJM A;  3EE2 A;  3FY7 A;  4CY8 A;  2FWH A;  3WGX A;  5GAN D;  1TW9 A;  1EV4 A;  2ZNM A;  1FVJ A;  3ZVJ A;  4DSS A;  4QL9 A;  3F0I A;  1ON4 A;  1C72 A;  4QQ7 A;  2C3N A;  4H86 A;  2ES7 A;  3ERW A;  1UA5 A;  4MCU A;  3TKS E;  5ID2 A;  4K2D A;  1CQH A;  1EGO A;  1WOU A;  2F8F A;  3IAS 2;  4I8B A;  4MH3 A;  5J5N A;  4ZBD A;  2LS5 A;  3HVV A;  1Z7R A;  4MJA A;  2X64 A;  1SL1 B;  4HOJ A;  3IK7 A;  6GSW A;  3KIJ A;  4ZIL A;  1X9W B;  4IQ1 A;  4HZ2 A;  1PA3 A;  4G01 A;  1A0R P;  5D96 A;  4DSR A;  5KN0 A;  4PQI A;  3LW9 A;  3F4R A;  4WBJ A;  5KEJ A;  2H75 A;  4TKY A;  1SD8 A;  1GUH A;  3FYG A;  2L5L A;  2X8G A;  4KH7 A;  1ZOF A;  3N9J A;  2HLS A;  3RHB A;  4EL1 A;  2CVB A;  2OAD A;  2CAI A;  1SKW B;  3QAG A;  4O5Q A;  2PN8 A;  1Z3E A;  1BED A;  2X49 A;  2AHE A;  2PVO C;  2TRX A;  2X8H A;  4IEL A;  4ISD A;  2C1Y A;  5A1N A;  1E6B A;  3QCP A;  5FWG A;  2YJ7 A;  4O92 A;  1H4O A;  1A2J A;  1WJK A;  4BWQ A;  2FNO A;  2GSQ A;  1XW9 A;  3CTF A;  4ZXG A;  3F6D A;  2DJK A;  3EC3 A;  1Z9H A;  3ZIT A;  4ZL9 A;  3IV4 A;  5HQP A;  2H70 A;  2O8V B;  1TP9 A;  3CMI A;  1TU8 A;  3RAZ A;  3VI7 A;  3L9S A;  1HD2 A;  1GTA A;  3LG6 A;  1PD2 1;  4QMK A;  3N5O A;  3DD3 A;  4G19 A;  3IHQ A;  1ZYE A;  4HJM A;  2YWI A;  3IXR A;  2VL3 A;  1M7T A;  4ECJ A;  3VI5 A;  2E7P A;  4AJ6 A;  1QK8 A;  3QPM A;  4I6X A;  4G2E A;  1OVN A;  3LOR A;  3VFI A;  2X8C A;  2H1A A;  3A2V A;  4IJ3 A;  1KEB A;  2N5A A;  2B6M A;  2FD3 A;  2DJ0 A;  3VWV A;  3P8W A;  2ON5 A;  2A2P A;  3EU4 A;  1XZO A;  3GKN A;  1SJ6 A;  5A5H A;  4BL7 A;  2EIO A;  2C0F A;  3DML A;  2V6K A;  1SJI A;  4YAV A;  2WB9 A;  3ED3 A;  5F0G A;  4G10 A;  1X0R A;  5D93 A;  4ECC A;  1Z6N A;  1SVL A;  3FR6 A;  3HJM A;  2L5O A;  4BVY B;  4PUF C;  2RII A;  4ULX A;  3F3Q A;  3TGZ A;  4OO5 A;  4PX1 A;  1EEM A;  2M46 A;  4FYB A;  1VF4 A;  2DKH A;  3LXT A;  5BMU B;  2J9H A;  1VGL A;  4KDX A;  1ZYN A;  5AIX A;  5BRT A;  2WUL A;  5B6N A;  2ZUP A;  1XW6 A;  1B48 A;  3H8Q A;  1N8J A;  4O7H A;  4X4J A;  3GYK A;  2TIR A;  5A4V A;  5B7C A;  1JLW A;  4AJ8 A;  5KOX A;  1BX9 A;  3TB2 A;  4W66 A;  1N25 A;  1HNC A;  4HJ2 A;  1EV9 A;  1GWC A;  1R5P A;  4KGI A;  2H1B A;  3APO A;  3NZN A;  4HS1 A;  2VIM A;  4L8E A;  12GS A;  2M72 A;  3EMX A;  2VL2 A;  2EC4 A;  3NOF A;  2B5X A;  1TTZ A;  5E4W A;  3TJJ A;  1BQ7 A;  3G7Y A;  3R2Q A;  5IQY A;  2KUC A;  1EWX A;  4ID0 A;  2LRN A;  3IR4 A;  1TK0 B;  1EP8 A;  4ECI A;  4K0N A;  4USS A;  3G7J A;  5J41 A;  4D73 A;  3Q74 A;  2R0G A;  4PQH A;  4PNG A;  5B8B A;  3BCI A;  4LL1 B;  2BJX A;  5CRH A;  1A2L A;  4E68 A;  3ZRD A;  4OMV A;  2OBK A;  4IP1 A;  3ZRE A;  4G9H A;  1Z5Y E;  3IPZ A;  3KD0 A;  4TR1 B;  1TJD A;  4YQV A;  5D9W A;  3LJR A;  3SWL A;  1NHY A;  4GCI A;  1AQW A;  3FHK A;  4EUY A;  1W89 A;  1BYE A;  1O7U A;  1GSD A;  2OE1 A;  2R0P A;  2RUF A;  2ALB A;  2H30 A;  2DIZ A;  2HSN B;  1TXX A;  1R7H A;  1SKR B;  1R5A A;  1UN2 A;  2LJK A;  2HT9 A;  1GP1 A;  1Y25 A;  2L4Q A;  4TR0 A;  2BTO T;  3ISO A;  1SK1 A;  2REM A;  4IN0 A;  2L6D A;  1TI3 A;  3WYW A;  2YP6 A;  2G2Q A;  1A0F A;  1XPV A;  2B5Y A;  4V2M A;  2FHE A;  2V41 A;  4JR6 A;  4EIQ A;  1EEJ A;  3ZLP A;  4PQ1 A;  2E0Q A;  3Q6O A;  3EU3 A;  4EF0 A;  2YAN A;  4IJI A;  2CZ3 A;  4ZBA A;  4EKZ A;  2YV7 A;  1DE2 A;  2B3S A;  4P3Y B;  2MMZ A;  4JED A;  4NAX A;  1I5G A;  5ECP B;  3DEX A;  5HFG A;  3DKS A;  2I4A A;  3SBC A;  4RI7 A;  4K6X A;  2X99 A;  2JL4 A;  4EIP A;  1GLQ A;  1UVZ A;  2VOC A;  4K7I A;  3WGD A;  2HRA A;  1CQG A;  2LST A;  1WP0 A;  4AKX B;  2MMN A;  2IMK A;  3TJB A;  5DAL A;  3QR6 A;  1AUC A;  5G5E A;  2DJJ A;  1PX6 A;  1J08 A;  4CY6 A;  3CSH A;  3ZFB A;  2CVD A;  8GSS A;  5JCW A;  3FK8 A;  2DIY A;  4OFM A;  3IK9 A;  3IDV A;  2P0G A;  3GH6 A;  2A4V A;  5L71 A;  1K0B A;  4PXO A;  3P2A A;  4RQX A;  2D2Z A;  4XS4 B;  4NHZ A;  4K5R A;  2GVP A;  4V1A p;  2HZE B;  5KN1 A;  5CNW A;  1XXU A;  5CAX A;  3HYP A;  3ZYW A;  5G30 A;  3KCM A;  22GS A;  2EFC A;  2L6C A;  4OCE A;  2WCI A;  3APQ A;  4HZ4 A;  2IFQ A;  1U87 A;  4MK3 A;  5CYY A;  2H6Y A;  3WGE A;  3EUR A;  1SYR A;  1GTI A;  4G0I A;  1YEX A;  4FO5 A;  5IMA A;  4IKH A;  2G0F A;  4YQU A;  3VK9 A;  4MPG A;  3TOU A;  1JZW A;  3Q19 A;  2H6Z A;  2O87 A;  1AC1 A;  6GSV A;  2HE3 A;  4XS6 A;  1XWG A;  2N5B A;  1SL0 B;  5IPH A;  19GS A;  4MDC A;  5FHI A;  1V40 A;  1ERW A;  2K8S A;  4N10 A;  2GSS A;  3US3 A;  3F4S A;  4Q5F A;  4RI6 A;  4Z2R A;  4E8E A;  3KJY A;  3EPT A;  3G9B A;  2F3M A;  4EXJ A;  2GDR A;  3M9J A;  2O5V A;  1GUL A;  2H6X A;  1I9D A;  3GFK A;  1FVK A;  1GUK A;  3APS A;  1ZZY A;  4YH2 A;  2JAC A;  4NV2 A;  4KCA A;  3HD5 A;  1V58 A;  5F05 A;  3MSZ A;  1AQV A;  1B4P A;  4MF5 A;  2HQT A;  4I2U A;  1USB A;  2UV8 G;  3PIN A;  5COH A;  2DLX A;  4AJ7 A;  4ML1 A;  4DSQ A;  2HRK A;  5G5F A;  5FT3 A;  4IQA A;  3TRP A;  2A4H A;  2DJ2 A;  3CSI A;  18GS A;  1KBN A;  4XRA A;  2C0E A;  4TN8 A;  2AYT A;  1LBK A;  1H75 A;  1SJZ A;  4ZBB A;  2VL2 C;  1GTB A;  1PL2 A;  3H93 A;  1F9M A;  2DKI A;  2EIR A;  1X9S B;  1OC8 A;  5C00 A;  4K7N A;  3HZ8 A;  3F8U A;  4YKG A;  1Y1U A;  1PN9 A;  4OCF A;  2YOI A;  5DAK B;  4GLT A;  2PVQ A;  1TI1 A;  2LQO A;  4WF4 A;  1WE0 A;  4NPB A;  5D73 A;  3FKF A;  1JLV A;  4ZB8 A;  3VWU A;  1XVW A;  1J9B A;  4KCE A;  2C3Q A;  3D0Z A;  5A4W A;  2NPB A;  2XPE A;  2H73 A;  4Q5N A;  3KP8 A;  1T3B A;  1JHB A;  4IP6 A;  5JCG A;  3MIX A;  1ZCP A;  1O6J A;  5A1N B;  2PWJ A;  2QKE A;  4XIH A;  2FLS A;  2B1L A;  1JFU A;  3F3R A;  4BPY A;  1U3A A;  2XPD A;  1ERT A;  3LFL A;  2QA2 A;  1MD3 A;  1YDK A;  1PSQ A;  1MD4 A;  1XBS A;  2VKZ G;  2R0C A;  4KW6 A;  4L0W A;  1VRS D;  4TW5 A;  1FOH A;  1V2A A;  4J2F A;  11GS A;  4GSS A;  3E9J B;  1ABA A;  5CP1 A;  1W4V A;  3GKK A;  2VO4 A;  2JSZ A;  1BG5 A;  2YZH A;  3EMP A;  2I9H A;  4KX4 A;  2GZP A;  4PUR A;  2DJ3 A;  1MDK A;  4LLR A;  4TOP A;  3HJP A;  3ZVJ D;  4KE3 A;  2OBI A;  1OC9 A;  2C4J A;  1T1V A;  4EO3 A;  3TJF A;  4F0C A;  3HKR A;  3AY8 A;  4IHU A;  4BL7 B;  4F82 A;  1K3Y A;  1AIU A;  3CBU A;  1PRX A;  2GT5 A;  3D6I A;  4TR3 A;  3MWH A;  4ICY A;  2YPM A;  3QOU A;  3M8N A;  4DEJ A;  1S3A A;  3H4K A;  1WMJ A;  2R37 A;  4CHS A;  2AB6 A;  1BJX A;  5F8B A;  1VF1 A;  1ST9 A;  3RHC A;  3ME7 A;  3PR8 A;  2VCQ A;  2R3X A;  2FWF A;  3WD6 A;  2OA7 A;  1YVL A;  1B8X A;  2YNX A;  5INY A;  2LRC A;  4TXO B;  4Z2U A;  2R6K A;  2QSI A;  2IMD A;  1MEK A;  1QMV A;  1OYJ A;  2YWN A;  1OE7 A;  2YN1 A;  3EYT A;  3EWL A;  2PUK C;  4XHM A;  1TU7 A;  2KOK A;  2OJL A;  1K0D A;  5G1L A;  4TXV A;  4JRR A;  4ZL7 A;  1EP7 A;  4WR5 A;  5CRG A;  3BBY A;  2GQK A;  1RW1 A;  4MF6 A;  2TRC P;  4FYC A;  1ZL9 A;  2LUS A;  4ILF A;  4K1F A;  1V9W A;  5CRD A;  5IM9 A;  2WRT A;  2I1U A;  3GH9 A;  1PL1 A;  2LKU A;  4BVX B;  2H01 A;  1A8L A;  1F6M C;  3KXO A;  3VPT A;  4MAB A;  2KLX A;  3M0F A;  2MBT A;  3P90 A;  2LEG A;  1U88 A;  3GUR A;  2CVK A;  3BOA A;  2H66 A;  2WS2 A;  2VCV A;  5DQS A;  4POM A;  3DXB A;  4K2X A;  4KND A;  1GSE A;  4O5U A;  6GSX A;  1SEN A;  3FZ9 A;  3M3M A;  4J57 E;  1FG4 A;  4V2N A;  4ZB7 A;  1OKD A;  5AIV A;  3HCZ A;  1T00 A;  1G6W A;  4BVY A;  2FCH A;  3GIX A;  4F0B A;  1M0U A;  5F06 A;  3GSS A;  2O7K A;  2FY6 A;  2C80 A;  2K6V A;  5AIS A;  3A5I A;  4KSO A;  3ME8 A;  5A5K A;  3TRX A;  3TKS A;  5BMU A;  5AGY A;  2B7K A;  1K3L A;  5JWQ B;  2MZC A;  2DML A;  4BWS A;  2OKA A;  3F9U A;  1T7P B;  2PMT A;  3GMF A;  2H0G A;  1G0T A;  2F51 A;  4FYU A;  1A2M A;  2WFC A;  3HHV A;  3KEB A;  3TRQ A;  2R5G A;  3HZ4 A;  1K0N A;  4PUA A;  1O85 A;  5IMZ A;  3G7I A;  5D8I A;  4MLY A;  3I6A A;  1Q98 A;  1FOV A;  1M9A A;  17GS A;  5IMD A;  3VWX A;  1AXD A;  2XHF A;  4E8H A;  1S3C A;  5IOW A;  4HEA 2;  5ABR A;  5J9B A;  5A34 B;  4JE1 A;  3W8J A;  5CO3 A;  6GSU A;  1NM3 A;  3U6V A;  1EGR A;  2YV9 A;  14GS A;  2FWG A;  2PBJ A;  2LNS A;  1X5E A;  1PGT A;  1XCC A;  2DC5 A;  2YWM A;  5JCU A;  2WZ9 A;  2I3Y A;  1OE8 A;  3MNG A;  1DBY A;  1G7E A;  1K0M A;  1YKC A;  2H0H A;  2LJA A;  2KP2 A;  5DDL A;  2DJ1 A;  3DRN A;  3S9F A;  3IHG A;  4MZB A;  4G0L A;  3FMW A;  1XWB A;  1XIY A;  5G31 A;  4TR1 A;  4WR4 A;  5J40 A;  2CZ2 A;  4NWY A;  1SD9 A;  3GRX A;  3I69 A;  1X5D A;  2VM1 A;  2L4C A;  2H1D A;  3C73 A;  5H5S A;  1MDJ A;  1F2E A;  2HSN A;  2NBS A;  3I9V 2;  1SL2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...