3HJOA

Crystal structure of glutathione transferase pi y108v mutant in complex with the glutathione conjugate of ethacrynic acid
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
209
structure length
209
Chain Sequence
b'PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIVTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase P
publication title Influence of the H-site residue 108 on human glutathione transferase P1-1 ligand binding: structure-thermodynamic relationships and thermal stability.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 81
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2009-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3hjoA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3hjoA01
3C1SA 1EEJA 3C1RA 3ZITA 1MD4A 5B7CA 2JZRA 5DALA 4XIHA 4MF7A 2C4JA 1Z5YE 2B7JA 1YY7A 3HHVA 4HJMA 1QMVA 3Q74A 2YJHA 5CRWA 2MZCA 3HZ4A 1SKWB 2L6DA 2WS2A 1VF1A 1GUKA 1A23A 2H8LA 1JFUA 1Z9HA 4EVMA 1WE0A 4PUAA 1S3AA 4WKWA 4YQUA 4XS6A 1A2MA 2GSQA 3LFLA 4JZQA 4NXIA 4ECCA 3ZVJD 4NV5A 3WD6A 3F3RA 4J57E 2L4CA 2C0DA 1SU9A 3GUSA 2AUVA 5IIZA 11GSA 4PUFC 4ZL8A 1F3BA 2L5LA 3I6AA 4OD7A 2VIMA 1PMTA 3VWUA 3FR3A 3F6DA 2LUSA 3F4SA 2LQQA 4DSQA 2CQ9A 1RW1A 2HE3A 1JLWA 2K9FA 5CRHA 1YKCA 3GURA 2CV4A 2HZFA 3KP8A 4V2MA 1A8YA 3HY2A 1K0AA 1SYXA 1DSBA 4OCFA 1S3DA 4HQZA 1J0FA 3EWLA 3F8UA 3AY8A 2LV3A 2DBCA 4WF5A 5DAKA 2OJLA 3EU4A 4LMVA 3KEBA 5IQYA 4CDOA 3TKQA 2VUPA 1WP0A 2ZCTA 4I2TA 1PL1A 4K1FA 2A4VA 5HR3A 3DIEA 1V58A 2HSMA 2O89A 2PPTA 3FKFA 3ZIVA 1QGVA 5F07A 1SYRA 2CVDA 1HQOA 5AISA 2VLUA 5JWRB 1F2EA 3L9VA 4NAXA 1SD8A 2PN8A 4KF9A 2DLXA 1BYEA 5B8AA 2FA8A 2HXKA 1AUCA 5ABRA 3Q19A 5JCGA 2DJJA 4MJBA 1MEKA 4NV2A 4F9ZA 1XPVA 1SK2A 2FWEA 2H1AA 5DJLA 1R4WA 1DE2A 1KEBA 1LJRA 1WWJA 3EYTA 4IP6A 18GSA 4JEDA 2FWGA 1WMJA 3GV1A 3IXRA 1LU4A 4EXJA 1J9BA 2DIYA 1EGOA 3A2WA 2B3SA 2LRCA 3L0HA 4BVYA 1G7OA 4GSSA 4OFMA 3IR4A 1TRVA 2I81A 1TU8A 5IMZA 5IPGA 1JZWA 2VLVA 5COHA 2GLRA 3IHQA 3HCZA 4MF6A 1DUGA 1OVNA 5D9XA 2VL9A 5DALB 1B8XA 1MDJA 4PTSA 2YPMA 4KA0A 4HQSA 4ZB8A 2M46A 4IN0A 4V1Ag 4O92A 3R3EA 4BA7A 1YF0A 5CYYA 3EVIA 4JBBA 1FB0A 4ECJA 2OBIA 3EC3A 3F63A 3ZZXA 1G6YA 4V2NA 5D8IA 1TTZA 4F0CA 5HQPA 1Y6EA 4HS1A 2HLSA 1TI1A 2XPEA 5IOXA 2H76A 2L59A 2H72A 3HDCA 1GUMA 1TK5B 1O7UA 3BCIA 2H01A 1OC9A 1BJXA 1MD3A 2N5AA 3FHKA 3FR9A 1THOA 3ZFBA 4IKHA 1ML6A 3CTGA 1F37A 5G5EA 5ECPB 4WXTA 5D93A 2CX4A 1PX7A 2QC7A 2YWOA 1UN2A 5DQYA 1ERVA 4QQ7A 3TOUA 3DD3A 3GKKA 2GSRA 4KDUA 4TN8A 1FOVA 2LEGA 1MDKA 1XW6A 3IPZA 1AQXA 2HFDA 2MMNA 2VLTA 4GQCA 4MABA 1OAZA 5AN1A 1K0CA 3H79A 1N8JA 2JSYA 5B8BA 1VRSD 4RQXA 2GVPA 3UL3A 2C3NA 4JR6A 3IAS2 2QSIA 3D4TA 4IQ1A 3VWWA 1SENA 4BWQA 1VF3A 2H6ZA 2KOKA 3ERGA 5DAKB 4RI7A 1T3BA 1K3LA 1R5AA 2OACA 3CTFA 1F9MA 4KX4A 1GP1A 4BL7A 2NBSA 1V98A 4ZILA 1E6BA 2FHEA 3GL3A 1NM3A 2H6YA 1PX6A 2V1MA 3ME8A 2GTUA 5BMUA 2RLIA 2LJKA 1SD9A 4MMMA 4XS1A 3U5RE 3GX0A 3MAKA 2GT6A 5JWOB 4WR5A 2ON5A 1SK1A 1TOFA 3D4MA 2V2GA 3VWVA 4G2EA 2PVOC 3ZLPA 2O8VB 5L71A 5G2ZA 4TR1A 2L57A 5J5NA 1ZGNA 3GMFA 3EURA 4PQHA 2GGTA 3DGQA 3P7XA 5H5RA 4PX1A 3KH7A 3P90A 1EGRA 4BVYB 4KAEA 3VFIA 3TJKA 1YZXA 3GX8A 3CBUA 2WZ9A 4MJAA 2IMEA 1PA3A 1F6MC 3FR6A 1V9WA 2FCHA 1OYJA 3KXOA 2H70A 3FY7A 1XOAA 1B9XC 5DCGA 2AJQB 3D0ZA 4RI6A 4PNFA 2HNLA 3HJPA 2R3XA 4WEYA 1ERTA 1A0RP 3I43A 2YZUA 3LEFA 3UBLA 2HRFA 2C0GA 2V32A 2NDOA 4BPYA 1THXA 2H71A 5GAND 3F9UA 3VI5A 3US3A 5DCHA 5J3RA 2GZYA 5F05A 3E9JB 4GCIA 1GTAA 2PMTA 1OKTA 1I5GA 2LQOA 5KN1A 4HDEA 2C8UA 1GUHA 4GQFA 1GSSA 1OC9B 5CAXA 3E0UA 1GLPA 2WCIA 3HKRA 4FQUA 4G0LA 4KDXA 2EIOA 2CVBA 1M99A 3APSA 3M8NA 2KLXA 1R7HA 5ID2A 2ON7A 3IOSA 5LNKe 3CRUA 3GSTA 3UEMA 4AF2A 4HZ2A 1GSEA 5JCWA 3O76A 2CZ3A 1HYUA 3VPQA 3ZYWA 1K0BA 1YDKA 2IN3A 4YAVA 2EIRA 1EV9A 4Q5FA 2GSSA 3ZTLA 4ZBBA 6GSSA 2HRKA 1SL1B 4V1Ap 1K0OA 1YJ6A 1YEPA 3SBCA 3ERWA 4GRFA 2PUKC 2LRNA 3DKSA 2YANA 2O85A 5JCUA 5B6NA 1TK8B 3GRXA 5ECNB 4G19A 4BL7B 5HR0A 1A2LA 1OE7A 3GIXA 3IC8A 5DVBA 4X1UA 2E7PA 2OBKA 4I2UA 4E8EA 3LYKA 3DWVA 2MMOA 1SL0B 3BJ5A 3A2XA 2TRCP 1AW9A 1TKDB 5IO0A 1SKRB 1SL2B 2OE0A 2RUFA 3KTLA 1KTEA 3I9V2 2P31A 3KH9A 4TR1B 4EL1A 1TRWA 4ZL9A 1GSFA 3LYPA 3ED3A 2C1YA 4TVEA 3F3QA 1DBYA 1PKZA 5IMAA 2A2RA 5JWQB 3EU3A 2DC5A 9GSSA 4FYUA 3TJBA 2QKEA 2LNSA 4DEJA 4MPGA 2Z9SA 3QOUA 4LLRA 4IS0A 5G1KA 1JZDA 5D96A 3UOMA 4ISDA 2GZPA 1OC3A 4FYBA 4K2DA 4YH2A 2GQLA 1JZRA 1ACVA 2LJRA 4EO3A 3ERFA 1A2JA 2H73A 1TRUA 2JADA 4NMUA 2OKAA 2YN1A 4NPBA 2LKUA 2JZTA 4ML6A 2CT6A 2WJUA 4KB3A 5H5QA 3APQA 4WETA 1ERUA 1WOUA 3QFAC 3F6FA 3C7MA 1EP8A 4PGTA 1TXXA 2VOCA 2B5EA 3ZL5A 5J9CA 1QFNA 2HQTA 2WGRA 4TXOA 3QAGA 16GSA 4TR0A 5J9BA 4IW9A 4FYCA 3O3TA 2I1UA 5CREA 1YEXA 2FY6A 5C00A 1H75A 1M9BA 1F3AA 1X5CA 2F8FA 3GN3A 4HZ4A 2H1DA 3QAVA 7GSSA 5GSSA 2X8HA 1URMA 4KSOA 2O7KA 1SJ6A 3CSIA 5FHIA 3D22A 3GNJA 2QGVA 3GH9A 1XVQA 3UAPA 1BX9A 2EC4A 1Y25A 2IL3A 5GSTA 2B5XA 1FVJA 3MWHA 3LORA 3M0FA 2OADA 4MCUA 2ES7A 3FZ9A 4L5LA 4LMWA 1ON4A 4EUYA 2DSAA 3TCOA 5DJMA 2KHPA 4OCEA 4X0XA 3RPNA 3LGCA 1AQVA 3IA1A 5G1LA 5LCZA 2GS3A 3Q6OA 1B48A 5G31A 2F8AA 1TJDA 1Z7PA 3L9SA 2AAWA 2J9HA 3IE3A 5G30A 2LSTA 3HXSA 4N10A 2HSYA 3F4RA 4X43A 4MJEA 1WIKA 1G0TA 1EZKA 2RM5A 5AIVA 3M9JA 3WGXA 3FK8A 4P3YB 2KP1A 3LJRA 1PN9A 2N5BA 3TKRA 2CVKA 4HEA2 1Q98A 2FGXA 4MLYA 5IMCA 2H30A 4GSNA 1FVKA 2LNTA 3ZREA 1KNGA 3GKXA 3DYRA 3W8SA 4K0GA 4TRXA 2UZ8A 1GRXA 2R6KA 3I69A 3NZNA 2F51A 5D9VA 5ECIB 1Z3EA 1YQ1A 3EINA 1NSWA 2LTKA 5AIXA 4MZWA 4D73A 5GZZB 1EOGA 2P0GA 2MMAA 1GWCA 1SJZA 19GSA 5KN0A 4TKYA 1BG5A 1GL8A 3EMXA 3HVSA 4KCEA 4F0BA 1GSDA 3R2QA 2ALBA 3GH6A 5IMDA 14GSA 3BOAA 1U3AA 3TJGA 4EF0A 3D5JA 5DDLA 1XIYA 1A0FA 2VL2C 4G0KA 1GTBA 3C73A 2X64A 1FW1A 5IM9A 2AV4A 1NHOA 2JACA 2H0HA 3G9BA 4Q5QA 4GLTA 5ECMB 2WRTA 5ELAA 2V41A 2IPAA 2MBSA 3Q18A 4YQVA 4IGJA 5D9TA 5F06A 6GSWA 3C8EA 2GDRA 5KEJA 3LXZA 4TXOB 3RHCA 1PD21 1R26A 1PRXA 1BEDA 4GXZA 1ZMAA 2YWNA 4XCSA 3DXBA 1XWGA 4PURA 2PVQA 2HSMB 1PSQA 3FZ4A 4EKZA 2FLSA 2DJKA 2D2ZA 3GTUA 4EDYA 1AQWA 3NIVA 2R2JA 2FWFA 4L0UA 4K7IA 1FAAA 3IK7A 1EEMA 2NVLA 2CX3A 2KUCA 4LL4B 5ENUA 1U88A 1B4QA 2A2SA 3IV4A 4K8MA 1UA5A 5KN2A 1TU7A 2KP2A 4WBJA 3UVTA 2P5RA 2LJAA 5ECOB 1U87A 1ZYQB 1U3IA 6GSTA 5EY6A 4LA1A 1HD2A 4POBA 4I8BA 2AHEA 2H75A 2FUG2 3LQ7A 4MK3A 1USBA 3HA9A 3TB2A 1ERWA 1QUWA 2EIQA 1Z6NA 1JHBA 4ZL7A 2VO4A 2VL2A 1GNEA 4TW5A 3PH9A 4ILFA 2VCXA 3UIWA 3ME7A 5INYA 2H0GA 3UVHA 2VD0A 5EVOA 4WF4A 5CNWA 2R4VA 2XBQA 1X0RA 1NHYA 4PNGA 3H4KA 2YP6A 3TUEA 4K7NA 5G5FA 1YF1A 2TRXA 1BQ7A 2V6KA 1ILOA 1K3OA 4EC0A 4O5RA 4G10A 5KN3A 4AGSA 3H8QA 2I9HA 2RIIA 3E3EA 3CSHA 3KGKA 5ECKB 3A5WA 1GSQA 4BVXA 3DVWA 4D73B 4IJIA 1O85A 4TR3A 2H66A 2DJ2A 1OKDA 3KZQA 2R37A 4QL7A 4V2LA 2IJYA 1GTUA 5ECSA 1SJIA 3VK9A 5A4VA 5HFKA 2BMXA 1M2DA 2C0FA 1G6WA 1UVZA 5ECHB 5ELGA 1ZCPA 3CRTA 2IMDA 1HNBA 3ZMKA 1PGTA 3RAZA 1B9YC 1XXUA 4MJCA 4KCAA 2HZEA 3UMAA 4ULXA 5F8BA 1TW9A 2WULA 3KIJA 3MNGA 3DEXA 4K0NA 2VD1A 3WYWA 3V1WA 4E8HA 3TOTA 4O7HA 2H1BA 1Z6MA 4IQAA 2TIRA 2NPBA 4J56E 3UJ1A 1O8WA 1XCCA 2C0EA 4I97A 5ECQB 3G7YA 1ZYEA 2ZUPA 3ZFLA 3TKSE 1JZOA 3HD5A 3TKSC 1X9SB 2YV7A 1VGLA 2C3QA 2JSZA 1EP7A 8GSSA 2E2MA 1ZL9A 4IHUA 1J08A 2CA8A 3GTUB 4L5OA 5LD0A 3EMPA 1K0MA 3C71A 4J2FA 1G7EA 1B4PA 4I5QA 3O6TA 2X99A 4PQ1A 2PERA 1M2BA 5IPHA 5ECRB 3PGTA 2CAQA 3QDNA 4PQIA 1T8EB 5IMFA 1M9AA 4WBRD 5FT3A 1OE8A 2DJ1A 3WT2A 4USSA 2REMA 1O8XA 2H19A 4JE1A 5CP1A 2MBTA 5A5KA 1W4VA 3A3TA 2VL3A 4L0WA 4LL1B 5C04A 3UBKA 4YQMA 1LBKA 3SWLA 4XHMA 1XVWA 22GSA 4PXOA 4CHSA 1H4OA 3TRXA 4ZB6A 3GFKA 2XPDA 4ACSA 4MA9A 5IMVA 1XFLA 1A24A 1XW5A 2L5OA 1K3YA 3L4NA 3S9FA 2CZ2A 3M3MA 4ZBDA 1ABAA 5A4WA 6GSUA 3HZ8A 4RUVA 1X9WB 1V40A 2H0IA 2ZNMA 2DJ3A 1U6TA 3GA4A 4KDYA 1TI3A 3D21A 3OR5A 3D6IA 3BBYA 3CXGA 4ZXGA 2J23A 1C72A 5CRGA 1O81A 4ID0A 4DSRA 1Z7RA 3APOA 4XRDA 2GQKA 3NOFA 2PGTA 4OFTA 2B1LA 2IFQA 1A8LA 2I3YA 5F0GA 1WPIA 3TKPA 3J7Yk 5EL8A 4JR4A 3DRNA 2VCTA 4MH3A 2K8SA 3KD0A 5EPFA 5H5SA 4FH8A 1M0UA 4XS4A 2WB9A 1N2AA 4NHWA 4L8EA 1QK8A 4N11A 4BVXB 3CSJA 3QR6A 4MDCA 4IVFA 3H93A 3QD9A 3TKSA 5A4UA 3HVXA 4TR4A 3QCPA 5HR2A 3W6GA 1FO5A 4MH2A 2JL4A 4ECIA 3PINA 4POLA 4F2IA 3P8WA 1GSYA 1O6JA 2XHFA 1EWXA 20GSA 2AB6A 5D73A 2DMLA 2JZSA 5ID2B 3CYNA 2HI7A 2HRNA 3FEUA 4AJ6A 3PR8A 3ZMLA 1E2YA 3F4TA 2HYXA 3GSSA 4ZBAA 2YNXA 5B6MA 4O32A 4BWSA 2HZEB 4GWRA 3BD2A 2K6VA 1AIUA 1GTIA 2HRKB 5DQSA 2GQMA 10GSA 4WR4A 3TRQA 1QQ2A 3LXTA 4ZB9A 3GKNA 1CQGA 3G7IA 4H86A 3FZ5A 3N5OA 3IC4A 4MF5A 5HFIA 2YJ7A 3TJJA 3VWXA 2YOIA 3RHBA 4XRAA 2VCVA 6GSVA 1GLQA 4Q5RA 2RM6A 1RQMA 1XW9A 1Q4JA 4EDZA 4HOJA 2IMKA 4POKA 3VLNA 4EE0A 5E4WA 1FG4A 4MZCA 1GH2A 3BCKA 4F82A 4KH7A 4FIWA 5CRDA 2X8CA 1UC7A 1EOHA 3K8NA 1PL2A 2H1GA 5FWGA 1IYHA 1HNCA 3IBHA 3MDKA 2VM1A 3KM6A 1XWBA 1AC1A 1S3CA 3JCML 4KE3A 3LG6A 3GHAA 1CQHA 3TRPA 2F9SA 4MZBA 2X8GA 2H74A 1V57A 1MDIA 2VCWA 3HJMA 3ZVJA 4HJ2A 2F3MA 4I6XA 1AAZA 4DSSA 3DVXA 2C80A 1X5EA 1GSUA 4OWYA 1VF4A 3GYKA 2R5GA 4IBPA 2I4AA 5J41A 4N30A 1QXHA 4QL9A 2FA4A 2IWTA 2E2GA 2NTOA 2IMFA 1JLVA 4AJ7A 3IAM2 4FO5A 4HU9A 1TDIA 2GT5A 1TP9A 2G2QA 1SKSB 2IMIA 2OE1A 4AJ8A 3LWAA 2L6CA 3ZIJA 2K8VA 2B1KA 2VAFA 2FNOA 3VI7A 2FD3A 4HUAA 1AXDA 2G0FA 4HU7A 3LSZA 3VPTA 1WRYA 2DJ0A 2IFQB 5IOWA 2XBIA 1NW2A 2VCQA 1ZOFA 4OO4A 2MMZA 2M80A 3TDGA 4XS4B 2LRTA 4GSTA 1XBSA 4OFNA 2VCZA 1SK0A 1I9DA 2XC2A 1T7PB 4ZIJA 5E59A 1X9MB 4OO5A 3WT1A 1K0NA 3IK9A 4XTSA 2WDUA 3QFBC 4TOPA 2E0QA 2GSTA 2DIZA 1ST9A 2YCDA 1T4YA 3FZAA 3W8JA 5DBQA 3FYGA 2M72A 2L4QA 13GSA 4JU5A 4Z7XA 4POMA 3HJOA 4OMVA 4NHZA 4MP4A 2HT9A 2K18A 2CAIA 2DMMA 3DMLA 5D9WA 3IDVA 1T1VA 4KW6A 5HR1A 4IELA 2BJXA 1RK4A 3L78A 3L9UA 2MYGA 12GSA 5HFGA 3RBTA 1MTCA 1GULA 3KMNA 4HI7A 4TXVA 4KNDA 2PBJA 3ISOA 6GSYA 5J4UA 2RUEA 3TJFA 2AYTA 3A2VA 1KBNA 3KMOA 3WGEA 3UARA 1XWCA 3KCMA 4Q5NA 1X5DA 3F0IA 1IYIA 3VURA 2HRAA 3FW2A 3GL5A 5CO3A 1XOBA 3RPPA 3KTBA 1M2AA 1DE1A 3EE2A 4ECBA 1EV4A 2HSHA 2OE3A 2C3TA 3H1NA 5IO2A 4F03A 1XZOA 3M1GA 4KGIA 4N0VA 2N5FA 2B5YA 5AGYA 3QAWA 3QPMA 1TRSA 4DSSB 2OA7A 1M7TA 4K7OA 1W89A 4YAPA 1XWAA 3PPUA 3KJYA 2H6XA 3IRAA 2V6OA 2YWIA 1V2AA 3MSZA 2YV9A 4K9ZA 4NWYA 3HYPA 3J7Yb 5GAPD 2GZZA 3FRCA 4GTUA 1BAYA 2FWHA 2YWMA 4DVCA 3KP9A 2P5QA 4RQRA 3RDWA 1GNWA 3QMXA 3U6VA 2YZHA 3CMIA 2PWJA 3P2AA 4KSMA 2O87A 1VF2A 2LS5A 4G9HA 1XWKA 1HNAA 6GSXA 1ZZYA 4GF0A 2B6MA 1TK0B 4IP1A 17GSA 4IJ3A 3GKMA 1R5PA 1T00A 2PU9C 3WGDA 5ECLB 4G0IA 2IIYA 3G7JA 2B7KA 4N0ZA 4ML1A 1T4ZA 4KUNA 3ZRDA 1K0DA 1O73A 3HVVA 1YKAA 2HSNB 4MPFA 1OC8A 4K6XA 1FHEA 4CW9A 4JRRA 1FB6A 2JU5A 2VM2A 2WFCA 2BTOT 1WJKA 3N9JA 1PQNA 3M9KA 1PKWA 3TGZA
chains in the Genus database with same CATH superfamily
3C1SA 1EEJA 3C1RA 3ZITA 1MD4A 5B7CA 3RFRC 2JZRA 5DALA 4XIHA 4MF7A 2C4JA 1Z5YE 2B7JA 1YY7A 3HHVA 4HJMA 1QMVA 3Q74A 2YJHA 5CRWA 2MZCA 3HZ4A 1SKWB 2L6DA 2WS2A 1VF1A 1GUKA 1A23A 2H8LA 1JFUA 1Z9HA 4EVMA 1WE0A 4PUAA 1S3AA 4WKWA 4YQUA 4XS6A 1A2MA 2GSQA 3LFLA 4JZQA 4NXIA 4ECCA 3ZVJD 4NV5A 3WD6A 3F3RA 4J57E 2L4CA 2C0DA 1SU9A 2QA1A 3GUSA 2AUVA 5IIZA 11GSA 4PUFC 4ZL8A 1F3BA 2L5LA 4EIQA 2WW3A 3I6AA 4OD7A 4AI6A 2VIMA 1M3JA 1PMTA 3VWUA 3FR3A 3F6DA 2LUSA 3F4SA 2LQQA 4DSQA 2CQ9A 1RW1A 2HE3A 1JLWA 2K9FA 5CRHA 1YKCA 3GURA 2CV4A 2HZFA 3KP8A 4V2MA 1A8YA 3HY2A 1K0AA 1SYXA 1DSBA 4OCFA 1S3DA 4HQZA 1J0FA 3EWLA 3F8UA 3AY8A 2LV3A 2WVYA 2DBCA 4WF5A 4Z2TA 5DAKA 2OJLA 3EU4A 4LMVA 3KEBA 5IQYA 4CDOA 3TKQA 2VUPA 1WP0A 2ZCTA 4I2TA 1PL1A 3CWGA 2A4VA 4K1FA 5HR3A 3DIEA 1V58A 2HSMA 2O89A 2PPTA 3FKFA 3ZIVA 1QGVA 5F07A 1SYRA 2CVDA 1HQOA 5AISA 2VLUA 5JWRB 1F2EA 3L9VA 4NAXA 1SD8A 2PN8A 4KF9A 2DLXA 1BYEA 5B8AA 2FA8A 2HXKA 1AUCA 5ABRA 3RGBC 3Q19A 5JCGA 2DJJA 4MJBA 1MEKA 4PHZC 4NV2A 4F9ZA 1XPVA 2R0PA 1SK2A 2FWEA 2H1AA 5DJLA 1R4WA 1DE2A 1KEBA 1LJRA 1WWJA 3EYTA 4IP6A 18GSA 4JEDA 2FWGA 1WMJA 3GV1A 3IXRA 1LU4A 4EXJA 1J9BA 2DIYA 1EGOA 3A2WA 2B3SA 2LRCA 3L0HA 4BVYA 1G7OA 4GSSA 4OFMA 3IR4A 4E68A 1TRVA 2I81A 1TU8A 5IMZA 5IPGA 1JZWA 2VLVA 5COHA 2GLRA 3IHQA 3HCZA 4MF6A 1DUGA 1OVNA 5D9XA 2VL9A 5DALB 1B8XA 1MDJA 4PTSA 2YPMA 4KA0A 4HQSA 4ZB8A 2M46A 4IN0A 4V1Ag 4O92A 3R3EA 4BA7A 1YF0A 5CYYA 3EVIA 4JBBA 1FB0A 4ECJA 2OBIA 1XG8A 3EC3A 3F63A 3ZZXA 1G6YA 4V2NA 2WVZA 2A4HA 5D8IA 1TTZA 4F0CA 5HQPA 1Y6EA 4HS1A 2HLSA 1TI1A 2XPEA 5A34A 5IOXA 2H76A 2L59A 2H72A 3HDCA 1GUMA 1TK5B 1O7UA 3BCIA 2H01A 1OC9A 1BJXA 1MD3A 2N5AA 3FHKA 3FR9A 1THOA 3ZFBA 4IKHA 1ML6A 3CTGA 1F37A 5G5EA 5ECPB 4WXTA 5D93A 2CX4A 3FMWA 1PX7A 2QC7A 2YWOA 1UN2A 5DQYA 1ERVA 4QQ7A 3TOUA 3DD3A 3HVNA 3GKKA 2GSRA 4KDUA 4TN8A 1FOVA 2LEGA 1MDKA 1XW6A 3IPZA 1AQXA 2HFDA 2MMNA 2VLTA 4GQCA 4MABA 1OAZA 5AN1A 1K0CA 3H79A 1N8JA 4G01A 2JSYA 5B8BA 1VRSD 4RQXA 2GVPA 3UL3A 2C3NA 4JR6A 3IAS2 2QSIA 3D4TA 4IQ1A 3VWWA 1SENA 4BWQA 1VF3A 2OT3A 2H6ZA 2KOKA 3ERGA 5DAKB 4RI7A 1T3BA 1K3LA 1R5AA 2OACA 3CTFA 1M3IA 1F9MA 4KX4A 1GP1A 2EFDA 4BL7A 2NBSA 1V98A 4ZILA 1E6BA 2FHEA 3GL3A 1NM3A 2H6YA 1PX6A 2V1MA 3ME8A 2GTUA 5BMUA 2RLIA 2LJKA 1SD9A 4MMMA 4XS1A 3U5RE 3GX0A 3MAKA 2GT6A 5JWOB 4WR5A 2ON5A 1SK1A 1TOFA 3D4MA 2V2GA 3VWVA 4G2EA 2PVOC 3ZLPA 2O8VB 5L71A 5G2ZA 4TR1A 2L57A 5J5NA 1ZGNA 3GMFA 3EURA 4PQHA 2GGTA 4ZB7A 3DGQA 3P7XA 5H5RA 4PX1A 3KH7A 3P90A 1EGRA 4BVYB 4KAEA 3VFIA 3TJKA 1YZXA 3GX8A 3CBUA 2WZ9A 4MJAA 2IMEA 1PA3A 5BRTA 1F6MC 3FR6A 1V9WA 2WW1A 2FCHA 1OYJA 3KXOA 2H70A 3FY7A 2EFCA 1XOAA 1B9XC 5DCGA 2AJQB 3D0ZA 2O36A 4RI6A 4PNFA 2HNLA 3HJPA 2R3XA 4WEYA 1Y1UA 1ERTA 1A0RP 3I43A 2YZUA 3LEFA 3UBLA 2HRFA 2C0GA 2V32A 2NDOA 4BPYA 1THXA 2H71A 5GAND 3F9UA 3VI5A 3US3A 5DCHA 5J3RA 2GZYA 5F05A 3E9JB 4GCIA 1GTAA 2PMTA 1OKTA 1I5GA 5A34B 2LQOA 5KN1A 4HDEA 2C8UA 1GUHA 4GQFA 1GSSA 1OC9B 5CAXA 3E0UA 1GLPA 2WCIA 4O5UA 3HKRA 4FQUA 4G0LA 4KDXA 2EIOA 2CVBA 1M99A 3APSA 3M8NA 2DKHA 2KLXA 1R7HA 5ID2A 2ON7A 3IOSA 5LNKe 3CRUA 3GSTA 3UEMA 4AF2A 4HZ2A 1GSEA 5JCWA 3O76A 4YKFA 2CZ3A 1HYUA 3VPQA 3ZYWA 1K0BA 1YDKA 2IN3A 4YAVA 2EIRA 1EV9A 4Q5FA 2GSSA 3ZTLA 4ZBBA 6GSSA 2HRKA 1SL1B 4V1Ap 1K0OA 1YJ6A 1YEPA 3SBCA 4N3ZA 3ERWA 4GRFA 2PUKC 2LRNA 3DKSA 2YANA 2O85A 5JCUA 5B6NA 1TK8B 3GRXA 5ECNB 4G19A 4BL7B 5HR0A 1A2LA 1OE7A 3GIXA 3IC8A 5DVBA 4X1UA 2E7PA 2OBKA 5BMUB 4I2UA 4E8EA 3LYKA 3DWVA 2MMOA 1SL0B 4QMKA 3BJ5A 3A2XA 2TRCP 1AW9A 1TKDB 5IO0A 1SKRB 1SL2B 2OE0A 2RUFA 3KTLA 1KTEA 3I9V2 2P31A 3KH9A 4TR1B 4EL1A 1TRWA 4ZL9A 1GSFA 3LYPA 3ED3A 2C1YA 4TVEA 3F3QA 1DBYA 1PKZA 5IMAA 2A2RA 5JWQB 3EU3A 2DC5A 9GSSA 4FYUA 3TJBA 2QKEA 1BF5A 2LNSA 4DEJA 4MPGA 2Z9SA 3QOUA 4LLRA 4IS0A 5G1KA 1JZDA 5D96A 4BIKA 3UOMA 4ISDA 2GZPA 1OC3A 4FYBA 4K2DA 4YH2A 2GQLA 1JZRA 1ACVA 2LJRA 4EO3A 1ZYNA 3ERFA 1A2JA 2H73A 1TRUA 2JADA 4NMUA 2OKAA 2YN1A 4NPBA 2LKUA 2JZTA 4ML6A 2CT6A 2WJUA 4KB3A 2X49A 5H5QA 3APQA 4WETA 1ERUA 1WOUA 3QFAC 3F6FA 3C7MA 1EP8A 4PGTA 1TXXA 2VOCA 2B5EA 3ZL5A 5J9CA 1PFOA 1QFNA 2HQTA 2WGRA 4TXOA 3QAGA 16GSA 4TR0A 5J9BA 4IW9A 4FYCA 3O3TA 4AKGA 2I1UA 5CREA 1YEXA 2FY6A 5C00A 1H75A 1M9BA 1F3AA 1X5CA 5A1NB 5J40A 4K2XA 2F8FA 3GN3A 4HZ4A 2H1DA 3QAVA 7GSSA 5GSSA 2X8HA 1URMA 3CQFA 4KSOA 2O7KA 1SJ6A 4EIPA 3CSIA 5FHIA 2O3EA 3D22A 3GNJA 2QGVA 3GH9A 1XVQA 3UAPA 1BX9A 2EC4A 1Y25A 2IL3A 5GSTA 2B5XA 1FVJA 3MWHA 3LORA 3M0FA 2OADA 4MCUA 2ES7A 3FZ9A 4L5LA 4LMWA 1ON4A 4EUYA 2DSAA 3TCOA 5DJMA 2KHPA 4CY8A 4OCEA 4X0XA 3RPNA 3LGCA 1AQVA 3IA1A 5G1LA 5LCZA 2GS3A 3Q6OA 1B48A 5G31A 2F8AA 1TJDA 1Z7PA 3L9SA 2AAWA 2J9HA 3IE3A 5G30A 2LSTA 3HXSA 4N10A 2HSYA 3F4RA 4X43A 4MJEA 1WIKA 1G0TA 1EZKA 2RM5A 5AIVA 3M9JA 3WGXA 3FK8A 4P3YB 2KP1A 5KOXA 3LJRA 4HSCX 1PN9A 2N5BA 3TKRA 2CVKA 4HEA2 1Q98A 2FGXA 4MLYA 5IMCA 2H30A 4GSNA 1FVKA 2LNTA 5J4YA 3ZREA 1KNGA 3GKXA 3DYRA 3W8SA 3LW9A 4K0GA 4TRXA 2UZ8A 1GRXA 2R6KA 3I69A 2F51A 5D9VA 3NZNA 5ECIB 1Z3EA 1YQ1A 3EINA 2WVXA 1NSWA 2LTKA 5AIXA 4MZWA 4Z2RA 4D73A 5GZZB 1EOGA 2P0GA 2MMAA 1GWCA 1SJZA 19GSA 5KN0A 4TKYA 1BG5A 2DKIA 1GL8A 3EMXA 3HVSA 4KCEA 4F0BA 1GSDA 3R2QA 2ALBA 3GH6A 5IMDA 14GSA 3BOAA 1U3AA 3TJGA 4AKXB 4EF0A 3D5JA 5DDLA 1XIYA 1A0FA 2VL2C 4G0KA 1GTBA 3C73A 2X64A 1FW1A 5IM9A 2AV4A 1NHOA 2JACA 2H0HA 3G9BA 4Q5QA 4GLTA 5ECMB 1PN0A 2WRTA 5ELAA 2V41A 2IPAA 2MBSA 4CY6A 2EFEA 3Q18A 4YQVA 4IGJA 5D9TA 5F06A 6GSWA 3C8EA 2GDRA 5KEJA 3LXZA 4TXOB 3RHCA 1PD21 1R26A 1PRXA 1BEDA 4GXZA 1ZMAA 2YWNA 4XCSA 3DXBA 1XWGA 4PURA 2PVQA 2HSMB 1PSQA 3FZ4A 4EKZA 3TU3B 2FLSA 2DJKA 2D2ZA 3GTUA 4EDYA 1AQWA 3NIVA 2R2JA 2FWFA 4L0UA 4K7IA 2HSNA 1FAAA 3IK7A 4AKHA 1EEMA 2NVLA 2CX3A 2KUCA 4LL4B 5ENUA 1U88A 4PI0C 1B4QA 2A2SA 2O5VA 2R0CA 3IV4A 4K8MA 1UA5A 5KN2A 1TU7A 2KP2A 4WBJA 3UVTA 2P5RA 2LJAA 5ECOB 1U87A 1ZYQB 1U3IA 6GSTA 5EY6A 4LA1A 1HD2A 4POBA 2AHEA 4I8BA 2H75A 2FUG2 3LQ7A 4MK3A 1USBA 3HA9A 3TB2A 1ERWA 1QUWA 2EIQA 1Z6NA 1JHBA 4ZL7A 2VO4A 2VL2A 1GNEA 4TW5A 3PH9A 4ILFA 2VCXA 3UIWA 3ME7A 5INYA 2H0GA 3UVHA 2VD0A 5EVOA 4WF4A 5CNWA 2R4VA 2XBQA 1X0RA 1NHYA 4PNGA 3H4KA 2YP6A 3TUEA 4K7NA 5G5FA 1YF1A 2TRXA 1BQ7A 2V6KA 1ILOA 1K3OA 4EC0A 4O5RA 4G10A 5KN3A 4AGSA 3H8QA 2I9HA 2RIIA 3E3EA 3CSHA 4YKGA 3KGKA 5ECKB 2WVXB 3A5WA 1GSQA 4BVXA 3DVWA 4D73B 4IJIA 1SVLA 1O85A 4TR3A 2H66A 2DJ2A 1OKDA 3KZQA 1BG1A 2R37A 2R0GA 4QL7A 4V2LA 4W66A 5J47A 2IJYA 1GTUA 5ECSA 1SJIA 3VK9A 5A4VA 5HFKA 1YEWC 2BMXA 1M2DA 2C0FA 1G6WA 1UVZA 5ECHB 5ELGA 1ZCPA 3CRTA 2IMDA 4K5RA 1HNBA 2WW2A 3ZMKA 1PGTA 3RAZA 1B9YC 1XXUA 4MJCA 5A5HA 2HZEA 4KCAA 3UMAA 4ULXA 5F8BA 1TW9A 2WULA 3KIJA 3MNGA 3DEXA 4K0NA 2VD1A 3WYWA 3V1WA 4E8HA 3A5IA 3TOTA 4O7HA 2H1BA 1Z6MA 4IQAA 2TIRA 2NPBA 4J56E 3UJ1A 1O8WA 1XCCA 4A5PA 2C0EA 4I97A 5ECQB 3G7YA 1ZYEA 2ZUPA 3ZFLA 3TKSE 1JZOA 3HD5A 3TKSC 1X9SB 2YV7A 1VGLA 2C3QA 2JSZA 1EP7A 8GSSA 2E2MA 1ZL9A 4IHUA 1J08A 2CA8A 3GTUB 4L5OA 5LD0A 3EMPA 1K0MA 3C71A 4J2FA 3MYDA 1G7EA 1B4PA 4I5QA 3O6TA 2X99A 4PQ1A 2PERA 1M2BA 5IPHA 5ECRB 3PGTA 2CAQA 3QDNA 4Z2UA 4PQIA 1T8EB 5IMFA 1M9AA 4WBRD 5FT3A 2WW0A 1OE8A 3EPTA 2DJ1A 4PI2C 3WT2A 4USSA 2REMA 1O8XA 2H19A 4JE1A 5CP1A 2MBTA 5A5KA 1W4VA 3A3TA 2VL3A 4L0WA 4LL1B 5C04A 3UBKA 4YQMA 1LBKA 3SWLA 4XHMA 1XVWA 22GSA 4PXOA 4CHSA 1H4OA 3TRXA 4ZB6A 3GFKA 4K5SA 2XPDA 4ACSA 4MA9A 5IMVA 1XFLA 1A24A 1XW5A 2L5OA 1K3YA 3L4NA 3S9FA 2CZ2A 3M3MA 4ZBDA 1ABAA 1SVMA 5A4WA 1FOHA 6GSUA 3HZ8A 4RUVA 1X9WB 1V40A 2H0IA 2ZNMA 2DJ3A 1U6TA 3GA4A 4KDYA 1TI3A 3D21A 3OR5A 3D6IA 3BBYA 3CXGA 4ZXGA 2J23A 1C72A 4AKIA 5CRGA 1O81A 4ID0A 4DSRA 1Z7RA 3APOA 4XRDA 2GQKA 3NOFA 2PGTA 4OFTA 2B1LA 2IFQA 1A8LA 2I3YA 5F0GA 1WPIA 3TKPA 3J7Yk 5EL8A 4JR4A 3DRNA 2VCTA 4MH3A 2K8SA 3KD0A 5EPFA 5H5SA 4FH8A 1SVOA 1M0UA 4XS4A 2WB9A 1N2AA 5KOWA 4NHWA 4L8EA 1QK8A 4N11A 4BVXB 3CSJA 3QR6A 4MDCA 4IVFA 3H93A 3QD9A 3TKSA 1TXUA 5A4UA 3HVXA 4TR4A 3QCPA 5HR2A 3W6GA 1FO5A 4MH2A 2JL4A 4ECIA 3PINA 4POLA 4F2IA 3P8WA 1GSYA 1O6JA 2XHFA 1EWXA 20GSA 2AB6A 5D73A 2DMLA 2JZSA 5ID2B 3CYNA 2H1LA 1ZYPA 2HI7A 2HRNA 4MNNA 3FEUA 4AJ6A 3PR8A 3ZMLA 1E2YA 3F4TA 2HYXA 3GSSA 4ZBAA 2YNXA 5B6MA 4O32A 4BWSA 5A5HB 2HZEB 2A2PA 4GWRA 3BD2A 2K6VA 1AIUA 1GTIA 2HRKB 5DQSA 2GQMA 10GSA 4WR4A 3TRQA 1QQ2A 3LXTA 4ZB9A 3GKNA 1CQGA 3G7IA 4H86A 3FZ5A 3N5OA 3IC4A 4MF5A 5HFIA 2EFHA 2YJ7A 3TJJA 3VWXA 2YOIA 3RHBA 4XRAA 2VCVA 6GSVA 1GLQA 4Q5RA 2RM6A 1RQMA 1XW9A 1Q4JA 4EDZA 4HOJA 2IMKA 4POKA 3VLNA 4EE0A 5E4WA 1FG4A 4MZCA 1GH2A 3BCKA 4F82A 4KH7A 4FIWA 5CRDA 2WZSA 2X8CA 1UC7A 1EOHA 3K8NA 1PL2A 2H1GA 5FWGA 1IYHA 1HNCA 3IBHA 3MDKA 2VM1A 1I1IP 3KM6A 1XWBA 1AC1A 1S3CA 2QA2A 3JCML 4KE3A 3LG6A 3CHXC 3GHAA 1CQHA 3TRPA 2F9SA 4MZBA 2X8GA 2H74A 1V57A 1MDIA 2VCWA 1S3RA 4X4JA 3HJMA 3ZVJA 4HJ2A 2F3MA 4I6XA 1AAZA 4DSSA 3DVXA 2C80A 1X5EA 1GSUA 4OWYA 1VF4A 3GYKA 2R5GA 4IBPA 2I4AA 5J41A 4N30A 1QXHA 4QL9A 2FA4A 2IWTA 2E2GA 2NTOA 2IMFA 1JLVA 4AJ7A 3IAM2 4FO5A 4HU9A 1TDIA 2GT5A 1TP9A 2G2QA 3MIXA 1SKSB 2IMIA 2OE1A 4AJ8A 3LWAA 2L6CA 3ZIJA 2K8VA 2B1KA 2VAFA 2FNOA 3VI7A 2FD3A 4HUAA 1AXDA 2G0FA 4HU7A 3LSZA 3VPTA 1WRYA 2DJ0A 2IFQB 5IOWA 2XBIA 1NW2A 2VCQA 1ZOFA 4OO4A 2MMZA 2M80A 3TDGA 4XS4B 2LRTA 4GSTA 1XBSA 4OFNA 2VCZA 1SK0A 1I9DA 2XC2A 1T7PB 4ZIJA 5E59A 1X9MB 4OO5A 3WT1A 1K0NA 3IK9A 1N25A 4XTSA 2WDUA 3QFBC 1YVLA 4TOPA 2E0QA 2GSTA 4O5QA 2DIZA 1ST9A 2YCDA 1T4YA 3FZAA 3W8JA 5DBQA 3FYGA 2M72A 2L4QA 13GSA 4JU5A 4Z7XA 4POMA 3HJOA 4OMVA 4NHZA 4MP4A 2HT9A 2K18A 2CAIA 2DMMA 3DMLA 5D9WA 3IDVA 3HMJG 1T1VA 4KW6A 5HR1A 4IELA 2BJXA 1RK4A 3L78A 3L9UA 2MYGA 1S4BP 12GSA 5HFGA 3RBTA 1MTCA 2X4AA 1GULA 3KMNA 4ICYA 4HI7A 2UV8G 4TXVA 4KNDA 2PBJA 3ISOA 4FXYP 6GSYA 5J4UA 2RUEA 3TJFA 2AYTA 3A2VA 1KBNA 3KMOA 3WGEA 3UARA 1XWCA 3KCMA 4Q5NA 1X5DA 3F0IA 1IYIA 3VURA 2HRAA 3FW2A 3GL5A 5CO3A 1XOBA 3RPPA 3KTBA 1M2AA 1DE1A 3EE2A 2VKZG 4ECBA 1EV4A 2HSHA 2OE3A 2C3TA 3H1NA 5IO2A 4F03A 1XZOA 3M1GA 4KGIA 4N0VA 2N5FA 2B5YA 5AGYA 3QAWA 3QPMA 1TRSA 4DSSB 5J4VA 2OA7A 1M7TA 4K7OA 1W89A 4YAPA 1XWAA 3PPUA 3IHGA 3KJYA 2H6XA 3IRAA 2V6OA 2YWIA 1V2AA 3MSZA 2YV9A 4K9ZA 4NWYA 5A1NA 3HYPA 3J7Yb 5GAPD 2GZZA 3FRCA 4GTUA 1BAYA 2FWHA 2YWMA 4DVCA 3KP9A 2P5QA 4RQRA 3RDWA 1GNWA 3QMXA 3U6VA 2YZHA 3CMIA 2PWJA 3P2AA 4KSMA 2O87A 1VF2A 2LS5A 4G9HA 1XWKA 1HNAA 6GSXA 1ZZYA 4GF0A 2B6MA 1TK0B 4IP1A 17GSA 4IJ3A 3GKMA 1R5PA 1T00A 2PU9C 3WGDA 5ECLB 4G0IA 2IIYA 3G7JA 2B7KA 4N0ZA 4ML1A 4GDFA 1T4ZA 4KUNA 3ZRDA 1K0DA 1O73A 3HVVA 1YKAA 2HSNB 4MPFA 1OC8A 4K6XA 1FHEA 4CW9A 4JRRA 1FB6A 2JU5A 2VM2A 2WFCA 2BTOT 1WJKA 3N9JA 1PQNA 3M9KA 1PKWA 3TGZA
chains in the Genus database with same CATH topology
3C1SA 1EEJA 3C1RA 3ZITA 1MD4A 5B7CA 2JZRA 5DALA 4XIHA 4MF7A 2C4JA 1Z5YE 2B7JA 1YY7A 3HHVA 4HJMA 1QMVA 3Q74A 2YJHA 5CRWA 2MZCA 3HZ4A 1SKWB 2L6DA 2WS2A 1VF1A 1GUKA 1A23A 2H8LA 1JFUA 1Z9HA 4EVMA 1WE0A 4PUAA 1S3AA 4WKWA 4YQUA 4XS6A 1A2MA 2GSQA 3LFLA 4JZQA 4NXIA 4ECCA 3ZVJD 4NV5A 3WD6A 3F3RA 4J57E 2L4CA 2C0DA 1SU9A 2QA1A 3GUSA 2AUVA 5IIZA 11GSA 4PUFC 4ZL8A 1F3BA 2L5LA 4EIQA 3I6AA 4OD7A 4AI6A 2VIMA 1PMTA 3VWUA 3FR3A 3F6DA 2LUSA 3F4SA 2LQQA 4DSQA 2CQ9A 1RW1A 2HE3A 1JLWA 2K9FA 5CRHA 1YKCA 3GURA 2CV4A 2HZFA 3KP8A 4V2MA 1A8YA 3HY2A 1K0AA 1SYXA 1DSBA 4OCFA 1S3DA 4HQZA 1J0FA 3EWLA 3F8UA 3AY8A 2LV3A 2DBCA 4WF5A 4Z2TA 5DAKA 2OJLA 3EU4A 4LMVA 3KEBA 5IQYA 4CDOA 3TKQA 2VUPA 1WP0A 2ZCTA 4I2TA 1PL1A 3CWGA 2A4VA 4K1FA 5HR3A 3DIEA 1V58A 2HSMA 2O89A 2PPTA 3FKFA 3ZIVA 1QGVA 5F07A 1SYRA 2CVDA 1HQOA 5AISA 2VLUA 5JWRB 1F2EA 3L9VA 4NAXA 1SD8A 2PN8A 4KF9A 2DLXA 1BYEA 5B8AA 2FA8A 2HXKA 1AUCA 5ABRA 3Q19A 5JCGA 2DJJA 4MJBA 1MEKA 4NV2A 4F9ZA 1XPVA 2R0PA 1SK2A 2FWEA 2H1AA 5DJLA 1R4WA 1DE2A 1KEBA 1LJRA 1WWJA 3EYTA 4IP6A 18GSA 4JEDA 2FWGA 1WMJA 3GV1A 3IXRA 1LU4A 4EXJA 1J9BA 2DIYA 1EGOA 3A2WA 2B3SA 2LRCA 3L0HA 4BVYA 1G7OA 4GSSA 4OFMA 3IR4A 4E68A 1TRVA 2I81A 1TU8A 5IMZA 5IPGA 1JZWA 2VLVA 5COHA 2GLRA 3IHQA 3HCZA 4MF6A 1DUGA 1OVNA 5D9XA 2VL9A 5DALB 1B8XA 1MDJA 4PTSA 2YPMA 4KA0A 4HQSA 4ZB8A 2M46A 4IN0A 4V1Ag 4O92A 3R3EA 4BA7A 1YF0A 5CYYA 3EVIA 4JBBA 1FB0A 4ECJA 2OBIA 3EC3A 3F63A 3ZZXA 1G6YA 4V2NA 2A4HA 5D8IA 1TTZA 4F0CA 5HQPA 1Y6EA 4HS1A 2HLSA 1TI1A 2XPEA 5A34A 5IOXA 2H76A 2L59A 2H72A 3HDCA 1GUMA 1TK5B 1O7UA 3BCIA 2H01A 1OC9A 1BJXA 1MD3A 2N5AA 3FHKA 3FR9A 1THOA 3ZFBA 4IKHA 1ML6A 3CTGA 1F37A 5G5EA 5ECPB 4WXTA 5D93A 2CX4A 3FMWA 1PX7A 2QC7A 2YWOA 1UN2A 5DQYA 1ERVA 4QQ7A 3TOUA 3DD3A 3GKKA 2GSRA 4KDUA 4TN8A 1FOVA 2LEGA 1MDKA 1XW6A 3IPZA 1AQXA 2HFDA 2MMNA 2VLTA 4GQCA 4MABA 1OAZA 5AN1A 1K0CA 3H79A 1N8JA 4G01A 2JSYA 5B8BA 1VRSD 4RQXA 2GVPA 3UL3A 2C3NA 4JR6A 3IAS2 2QSIA 3D4TA 4IQ1A 3VWWA 1SENA 4BWQA 1VF3A 2OT3A 2H6ZA 2KOKA 3ERGA 5DAKB 4RI7A 1T3BA 1K3LA 1R5AA 2OACA 3CTFA 1F9MA 4KX4A 1GP1A 2EFDA 4BL7A 2NBSA 1V98A 4ZILA 1E6BA 2FHEA 3GL3A 1NM3A 2H6YA 1PX6A 2V1MA 3ME8A 2GTUA 5BMUA 2RLIA 2LJKA 1SD9A 4MMMA 4XS1A 3U5RE 3GX0A 3MAKA 2GT6A 5JWOB 4WR5A 2ON5A 1SK1A 1TOFA 3D4MA 2V2GA 3VWVA 4G2EA 2PVOC 3ZLPA 2O8VB 5L71A 5G2ZA 4TR1A 2L57A 5J5NA 1ZGNA 3GMFA 3EURA 4PQHA 2GGTA 4ZB7A 3DGQA 3P7XA 5H5RA 4PX1A 3KH7A 3P90A 1EGRA 4BVYB 4KAEA 3VFIA 3TJKA 1YZXA 3GX8A 3CBUA 2WZ9A 4MJAA 2IMEA 1PA3A 5BRTA 1F6MC 3FR6A 1V9WA 2FCHA 1OYJA 3KXOA 2H70A 3FY7A 2EFCA 1XOAA 1B9XC 5DCGA 2AJQB 3D0ZA 4RI6A 4PNFA 2HNLA 3HJPA 2R3XA 4WEYA 1Y1UA 1ERTA 1A0RP 3I43A 2YZUA 3LEFA 3UBLA 2HRFA 2C0GA 2V32A 2NDOA 4BPYA 1THXA 2H71A 5GAND 3F9UA 3VI5A 3US3A 5DCHA 5J3RA 2GZYA 5F05A 3E9JB 4GCIA 1GTAA 2PMTA 1OKTA 1I5GA 5A34B 2LQOA 5KN1A 4HDEA 2C8UA 1GUHA 4GQFA 1GSSA 1OC9B 5CAXA 3E0UA 1GLPA 2WCIA 4O5UA 3HKRA 4FQUA 4G0LA 4KDXA 2EIOA 2CVBA 1M99A 3APSA 3M8NA 2DKHA 2KLXA 1R7HA 5ID2A 2ON7A 3IOSA 5LNKe 3CRUA 3GSTA 3UEMA 4AF2A 4HZ2A 1GSEA 5JCWA 3O76A 4YKFA 2CZ3A 1HYUA 3VPQA 3ZYWA 1K0BA 1YDKA 2IN3A 4YAVA 2EIRA 1EV9A 4Q5FA 2GSSA 3ZTLA 4ZBBA 6GSSA 2HRKA 1SL1B 4V1Ap 1K0OA 1YJ6A 1YEPA 3SBCA 4N3ZA 3ERWA 4GRFA 2PUKC 2LRNA 3DKSA 2YANA 2O85A 5JCUA 5B6NA 1TK8B 3GRXA 5ECNB 4G19A 4BL7B 5HR0A 1A2LA 1OE7A 3GIXA 3IC8A 5DVBA 4X1UA 2E7PA 2OBKA 5BMUB 4I2UA 4E8EA 3LYKA 3DWVA 2MMOA 1SL0B 4QMKA 3BJ5A 3A2XA 2TRCP 1AW9A 1TKDB 5IO0A 1SKRB 1SL2B 2OE0A 2RUFA 3KTLA 1KTEA 3I9V2 2P31A 3KH9A 4TR1B 4EL1A 1TRWA 4ZL9A 1GSFA 3LYPA 3ED3A 2C1YA 4TVEA 3F3QA 1DBYA 1PKZA 5IMAA 2A2RA 5JWQB 3EU3A 2DC5A 9GSSA 4FYUA 3TJBA 2QKEA 1BF5A 2LNSA 4DEJA 4MPGA 2Z9SA 3QOUA 4LLRA 4IS0A 5G1KA 1JZDA 5D96A 3UOMA 4ISDA 2GZPA 1OC3A 4FYBA 4K2DA 4YH2A 2GQLA 1JZRA 1ACVA 2LJRA 4EO3A 1ZYNA 3ERFA 1A2JA 2H73A 1TRUA 2JADA 4NMUA 2OKAA 2YN1A 4NPBA 2LKUA 2JZTA 4ML6A 2CT6A 2WJUA 4KB3A 2X49A 5H5QA 3APQA 4WETA 1ERUA 1WOUA 3QFAC 3F6FA 3C7MA 1EP8A 4PGTA 1TXXA 2VOCA 2B5EA 3ZL5A 5J9CA 1QFNA 2HQTA 2WGRA 4TXOA 3QAGA 16GSA 4TR0A 5J9BA 4IW9A 4FYCA 3O3TA 4AKGA 2I1UA 5CREA 1YEXA 2FY6A 5C00A 1H75A 1M9BA 1F3AA 1X5CA 5A1NB 5J40A 4K2XA 2F8FA 3GN3A 4HZ4A 2H1DA 3QAVA 7GSSA 5GSSA 2X8HA 1URMA 4KSOA 2O7KA 1SJ6A 4EIPA 3CSIA 5FHIA 3D22A 3GNJA 2QGVA 3GH9A 1XVQA 3UAPA 1BX9A 2EC4A 1Y25A 2IL3A 5GSTA 2B5XA 1FVJA 3MWHA 3LORA 3M0FA 2OADA 4MCUA 2ES7A 3FZ9A 4L5LA 4LMWA 1ON4A 4EUYA 2DSAA 3TCOA 5DJMA 2KHPA 4CY8A 4OCEA 4X0XA 3RPNA 3LGCA 1AQVA 3IA1A 5G1LA 5LCZA 2GS3A 3Q6OA 1B48A 5G31A 2F8AA 1TJDA 1Z7PA 3L9SA 2AAWA 2J9HA 3IE3A 5G30A 2LSTA 3HXSA 4N10A 2HSYA 3F4RA 4X43A 4MJEA 1WIKA 1G0TA 1EZKA 2RM5A 5AIVA 3M9JA 3WGXA 3FK8A 4P3YB 2KP1A 5KOXA 3LJRA 1PN9A 2N5BA 3TKRA 2CVKA 4HEA2 1Q98A 2FGXA 4MLYA 5IMCA 2H30A 4GSNA 1FVKA 2LNTA 5J4YA 3ZREA 1KNGA 3GKXA 3DYRA 3W8SA 3LW9A 4K0GA 4TRXA 2UZ8A 1GRXA 2R6KA 3I69A 2F51A 5D9VA 3NZNA 5ECIB 1Z3EA 1YQ1A 3EINA 1NSWA 2LTKA 5AIXA 4MZWA 4Z2RA 4D73A 5GZZB 1EOGA 2P0GA 2MMAA 1GWCA 1SJZA 19GSA 5KN0A 4TKYA 1BG5A 2DKIA 1GL8A 3EMXA 3HVSA 4KCEA 4F0BA 1GSDA 3R2QA 2ALBA 3GH6A 5IMDA 14GSA 3BOAA 1U3AA 3TJGA 4AKXB 4EF0A 3D5JA 5DDLA 1XIYA 1A0FA 2VL2C 4G0KA 1GTBA 3C73A 2X64A 1FW1A 5IM9A 2AV4A 1NHOA 2JACA 2H0HA 3G9BA 4Q5QA 4GLTA 5ECMB 1PN0A 2WRTA 5ELAA 2V41A 2IPAA 2MBSA 4CY6A 2EFEA 3Q18A 4YQVA 4IGJA 5D9TA 5F06A 6GSWA 3C8EA 2GDRA 5KEJA 3LXZA 4TXOB 3RHCA 1PD21 1R26A 1PRXA 1BEDA 4GXZA 1ZMAA 2YWNA 4XCSA 3DXBA 1XWGA 4PURA 2PVQA 2HSMB 1PSQA 3FZ4A 4EKZA 3TU3B 2FLSA 2DJKA 2D2ZA 3GTUA 4EDYA 1AQWA 3NIVA 2R2JA 2FWFA 4L0UA 4K7IA 2HSNA 1FAAA 3IK7A 4AKHA 1EEMA 2NVLA 2CX3A 2KUCA 4LL4B 5ENUA 1U88A 1B4QA 2A2SA 2O5VA 2R0CA 3IV4A 4K8MA 1UA5A 5KN2A 1TU7A 2KP2A 4WBJA 3UVTA 2P5RA 2LJAA 5ECOB 1U87A 1ZYQB 1U3IA 6GSTA 5EY6A 4LA1A 1HD2A 4POBA 2AHEA 4I8BA 2H75A 2FUG2 3LQ7A 4MK3A 1USBA 3HA9A 3TB2A 1ERWA 1QUWA 2EIQA 1Z6NA 1JHBA 4ZL7A 2VO4A 2VL2A 1GNEA 4TW5A 3PH9A 4ILFA 2VCXA 3UIWA 3ME7A 5INYA 2H0GA 3UVHA 2VD0A 5EVOA 4WF4A 5CNWA 2R4VA 2XBQA 1X0RA 1NHYA 4PNGA 3H4KA 2YP6A 3TUEA 4K7NA 5G5FA 1YF1A 2TRXA 1BQ7A 2V6KA 1ILOA 1K3OA 4EC0A 4O5RA 4G10A 5KN3A 4AGSA 3H8QA 2I9HA 2RIIA 3E3EA 3CSHA 4YKGA 3KGKA 5ECKB 3A5WA 1GSQA 4BVXA 3DVWA 4D73B 4IJIA 1SVLA 1O85A 4TR3A 2H66A 2DJ2A 1OKDA 3KZQA 1BG1A 2R37A 2R0GA 4QL7A 4V2LA 4W66A 5J47A 2IJYA 1GTUA 5ECSA 1SJIA 3VK9A 5A4VA 5HFKA 2BMXA 1M2DA 2C0FA 1G6WA 1UVZA 5ECHB 5ELGA 1ZCPA 3CRTA 2IMDA 4K5RA 1HNBA 3ZMKA 1PGTA 3RAZA 1B9YC 1XXUA 4MJCA 5A5HA 2HZEA 4KCAA 3UMAA 4ULXA 5F8BA 1TW9A 2WULA 3KIJA 3MNGA 3DEXA 4K0NA 2VD1A 3WYWA 3V1WA 4E8HA 3A5IA 3TOTA 4O7HA 2H1BA 1Z6MA 4IQAA 2TIRA 2NPBA 4J56E 3UJ1A 1O8WA 1XCCA 4A5PA 2C0EA 4I97A 5ECQB 3G7YA 1ZYEA 2ZUPA 3ZFLA 3TKSE 1JZOA 3HD5A 3TKSC 1X9SB 2YV7A 1VGLA 2C3QA 2JSZA 1EP7A 8GSSA 2E2MA 1ZL9A 4IHUA 1J08A 2CA8A 3GTUB 4L5OA 5LD0A 3EMPA 1K0MA 3C71A 4J2FA 3MYDA 1G7EA 1B4PA 4I5QA 3O6TA 2X99A 4PQ1A 2PERA 1M2BA 5IPHA 5ECRB 3PGTA 2CAQA 3QDNA 4Z2UA 4PQIA 1T8EB 5IMFA 1M9AA 4WBRD 5FT3A 1OE8A 3EPTA 2DJ1A 3WT2A 4USSA 2REMA 1O8XA 2H19A 4JE1A 5CP1A 2MBTA 5A5KA 1W4VA 3A3TA 2VL3A 4L0WA 4LL1B 5C04A 3UBKA 4YQMA 1LBKA 3SWLA 4XHMA 1XVWA 22GSA 4PXOA 4CHSA 1H4OA 3TRXA 4ZB6A 3GFKA 4K5SA 2XPDA 4ACSA 4MA9A 5IMVA 1XFLA 1A24A 1XW5A 2L5OA 1K3YA 3L4NA 3S9FA 2CZ2A 3M3MA 4ZBDA 1ABAA 1SVMA 5A4WA 1FOHA 6GSUA 3HZ8A 4RUVA 1X9WB 1V40A 2H0IA 2ZNMA 2DJ3A 1U6TA 3GA4A 4KDYA 1TI3A 3D21A 3OR5A 3D6IA 3BBYA 3CXGA 4ZXGA 2J23A 1C72A 4AKIA 5CRGA 1O81A 4ID0A 4DSRA 1Z7RA 3APOA 4XRDA 2GQKA 3NOFA 2PGTA 4OFTA 2B1LA 2IFQA 1A8LA 2I3YA 5F0GA 1WPIA 3TKPA 3J7Yk 5EL8A 4JR4A 3DRNA 2VCTA 4MH3A 2K8SA 3KD0A 5EPFA 5H5SA 4FH8A 1SVOA 1M0UA 4XS4A 2WB9A 1N2AA 5KOWA 4NHWA 4L8EA 1QK8A 4N11A 4BVXB 3CSJA 3QR6A 4MDCA 4IVFA 3H93A 3QD9A 3TKSA 1TXUA 5A4UA 3HVXA 4TR4A 3QCPA 5HR2A 3W6GA 1FO5A 4MH2A 2JL4A 4ECIA 3PINA 4POLA 4F2IA 3P8WA 1GSYA 1O6JA 2XHFA 1EWXA 20GSA 2AB6A 5D73A 2DMLA 2JZSA 5ID2B 3CYNA 2H1LA 1ZYPA 2HI7A 2HRNA 4MNNA 3FEUA 4AJ6A 3PR8A 3ZMLA 1E2YA 3F4TA 2HYXA 3GSSA 4ZBAA 2YNXA 5B6MA 4O32A 4BWSA 5A5HB 2HZEB 2A2PA 4GWRA 3BD2A 2K6VA 1AIUA 1GTIA 2HRKB 5DQSA 2GQMA 10GSA 4WR4A 3TRQA 1QQ2A 3LXTA 4ZB9A 3GKNA 1CQGA 3G7IA 4H86A 3FZ5A 3N5OA 3IC4A 4MF5A 5HFIA 2EFHA 2YJ7A 3TJJA 3VWXA 2YOIA 3RHBA 4XRAA 2VCVA 6GSVA 1GLQA 4Q5RA 2RM6A 1RQMA 1XW9A 1Q4JA 4EDZA 4HOJA 2IMKA 4POKA 3VLNA 4EE0A 5E4WA 1FG4A 4MZCA 1GH2A 3BCKA 4F82A 4KH7A 4FIWA 5CRDA 2X8CA 1UC7A 1EOHA 3K8NA 1PL2A 2H1GA 5FWGA 1IYHA 1HNCA 3IBHA 3MDKA 2VM1A 3KM6A 1XWBA 1AC1A 1S3CA 2QA2A 3JCML 4KE3A 3LG6A 3GHAA 1CQHA 3TRPA 2F9SA 4MZBA 2X8GA 2H74A 1V57A 1MDIA 2VCWA 4X4JA 3HJMA 3ZVJA 4HJ2A 2F3MA 4I6XA 1AAZA 4DSSA 3DVXA 2C80A 1X5EA 1GSUA 4OWYA 1VF4A 3GYKA 2R5GA 4IBPA 2I4AA 5J41A 4N30A 1QXHA 4QL9A 2FA4A 2IWTA 2E2GA 2NTOA 2IMFA 1JLVA 4AJ7A 3IAM2 4FO5A 4HU9A 1TDIA 2GT5A 1TP9A 2G2QA 3MIXA 1SKSB 2IMIA 2OE1A 4AJ8A 3LWAA 2L6CA 3ZIJA 2K8VA 2B1KA 2VAFA 2FNOA 3VI7A 2FD3A 4HUAA 1AXDA 2G0FA 4HU7A 3LSZA 3VPTA 1WRYA 2DJ0A 2IFQB 5IOWA 2XBIA 1NW2A 2VCQA 1ZOFA 4OO4A 2MMZA 2M80A 3TDGA 4XS4B 2LRTA 4GSTA 1XBSA 4OFNA 2VCZA 1SK0A 1I9DA 2XC2A 1T7PB 4ZIJA 5E59A 1X9MB 4OO5A 3WT1A 1K0NA 3IK9A 1N25A 4XTSA 2WDUA 3QFBC 1YVLA 4TOPA 2E0QA 2GSTA 4O5QA 2DIZA 1ST9A 2YCDA 1T4YA 3FZAA 3W8JA 5DBQA 3FYGA 2M72A 2L4QA 13GSA 4JU5A 4Z7XA 4POMA 3HJOA 4OMVA 4NHZA 4MP4A 2HT9A 2K18A 2CAIA 2DMMA 3DMLA 5D9WA 3IDVA 3HMJG 1T1VA 4KW6A 5HR1A 4IELA 2BJXA 1RK4A 3L78A 3L9UA 2MYGA 12GSA 5HFGA 3RBTA 1MTCA 2X4AA 1GULA 3KMNA 4ICYA 4HI7A 2UV8G 4TXVA 4KNDA 2PBJA 3ISOA 6GSYA 5J4UA 2RUEA 3TJFA 2AYTA 3A2VA 1KBNA 3KMOA 3WGEA 3UARA 1XWCA 3KCMA 4Q5NA 1X5DA 3F0IA 1IYIA 3VURA 2HRAA 3FW2A 3GL5A 5CO3A 1XOBA 3RPPA 3KTBA 1M2AA 1DE1A 3EE2A 2VKZG 4ECBA 1EV4A 2HSHA 2OE3A 2C3TA 3H1NA 5IO2A 4F03A 1XZOA 3M1GA 4KGIA 4N0VA 2N5FA 2B5YA 5AGYA 3QAWA 3QPMA 1TRSA 4DSSB 5J4VA 2OA7A 1M7TA 4K7OA 1W89A 4YAPA 1XWAA 3PPUA 3IHGA 3KJYA 2H6XA 3IRAA 2V6OA 2YWIA 1V2AA 3MSZA 2YV9A 4K9ZA 4NWYA 5A1NA 3HYPA 3J7Yb 5GAPD 2GZZA 3FRCA 4GTUA 1BAYA 2FWHA 2YWMA 4DVCA 3KP9A 2P5QA 4RQRA 3RDWA 1GNWA 3QMXA 3U6VA 2YZHA 3CMIA 2PWJA 3P2AA 4KSMA 2O87A 1VF2A 2LS5A 4G9HA 1XWKA 1HNAA 6GSXA 1ZZYA 4GF0A 2B6MA 1TK0B 4IP1A 17GSA 4IJ3A 3GKMA 1R5PA 1T00A 2PU9C 3WGDA 5ECLB 4G0IA 2IIYA 3G7JA 2B7KA 4N0ZA 4ML1A 4GDFA 1T4ZA 4KUNA 3ZRDA 1K0DA 1O73A 3HVVA 1YKAA 2HSNB 4MPFA 1OC8A 4K6XA 1FHEA 4CW9A 4JRRA 1FB6A 2JU5A 2VM2A 2WFCA 2BTOT 1WJKA 3N9JA 1PQNA 3M9KA 1PKWA 3TGZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C1S A;  1EEJ A;  3C1R A;  3ZIT A;  1MD4 A;  5B7C A;  2JZR A;  5DAL A;  4XIH A;  4MF7 A;  2C4J A;  1Z5Y E;  2B7J A;  1YY7 A;  3HHV A;  4HJM A;  1QMV A;  3Q74 A;  2YJH A;  5CRW A;  2MZC A;  3HZ4 A;  1SKW B;  2L6D A;  2WS2 A;  1VF1 A;  1GUK A;  1A23 A;  2H8L A;  1JFU A;  1Z9H A;  4EVM A;  1WE0 A;  4PUA A;  1S3A A;  4WKW A;  4YQU A;  4XS6 A;  1A2M A;  2GSQ A;  3LFL A;  4JZQ A;  4NXI A;  4ECC A;  3ZVJ D;  4NV5 A;  3WD6 A;  3F3R A;  4J57 E;  2L4C A;  2C0D A;  1SU9 A;  3GUS A;  2AUV A;  5IIZ A;  11GS A;  4PUF C;  4ZL8 A;  1F3B A;  2L5L A;  3I6A A;  4OD7 A;  2VIM A;  1PMT A;  3VWU A;  3FR3 A;  3F6D A;  2LUS A;  3F4S A;  2LQQ A;  4DSQ A;  2CQ9 A;  1RW1 A;  2HE3 A;  1JLW A;  2K9F A;  5CRH A;  1YKC A;  3GUR A;  2CV4 A;  2HZF A;  3KP8 A;  4V2M A;  1A8Y A;  3HY2 A;  1K0A A;  1SYX A;  1DSB A;  4OCF A;  1S3D A;  4HQZ A;  1J0F A;  3EWL A;  3F8U A;  3AY8 A;  2LV3 A;  2DBC A;  4WF5 A;  5DAK A;  2OJL A;  3EU4 A;  4LMV A;  3KEB A;  5IQY A;  4CDO A;  3TKQ A;  2VUP A;  1WP0 A;  2ZCT A;  4I2T A;  1PL1 A;  4K1F A;  2A4V A;  5HR3 A;  3DIE A;  1V58 A;  2HSM A;  2O89 A;  2PPT A;  3FKF A;  3ZIV A;  1QGV A;  5F07 A;  1SYR A;  2CVD A;  1HQO A;  5AIS A;  2VLU A;  5JWR B;  1F2E A;  3L9V A;  4NAX A;  1SD8 A;  2PN8 A;  4KF9 A;  2DLX A;  1BYE A;  5B8A A;  2FA8 A;  2HXK A;  1AUC A;  5ABR A;  3Q19 A;  5JCG A;  2DJJ A;  4MJB A;  1MEK A;  4NV2 A;  4F9Z A;  1XPV A;  1SK2 A;  2FWE A;  2H1A A;  5DJL A;  1R4W A;  1DE2 A;  1KEB A;  1LJR A;  1WWJ A;  3EYT A;  4IP6 A;  18GS A;  4JED A;  2FWG A;  1WMJ A;  3GV1 A;  3IXR A;  1LU4 A;  4EXJ A;  1J9B A;  2DIY A;  1EGO A;  3A2W A;  2B3S A;  2LRC A;  3L0H A;  4BVY A;  1G7O A;  4GSS A;  4OFM A;  3IR4 A;  1TRV A;  2I81 A;  1TU8 A;  5IMZ A;  5IPG A;  1JZW A;  2VLV A;  5COH A;  2GLR A;  3IHQ A;  3HCZ A;  4MF6 A;  1DUG A;  1OVN A;  5D9X A;  2VL9 A;  5DAL B;  1B8X A;  1MDJ A;  4PTS A;  2YPM A;  4KA0 A;  4HQS A;  4ZB8 A;  2M46 A;  4IN0 A;  4V1A g;  4O92 A;  3R3E A;  4BA7 A;  1YF0 A;  5CYY A;  3EVI A;  4JBB A;  1FB0 A;  4ECJ A;  2OBI A;  3EC3 A;  3F63 A;  3ZZX A;  1G6Y A;  4V2N A;  5D8I A;  1TTZ A;  4F0C A;  5HQP A;  1Y6E A;  4HS1 A;  2HLS A;  1TI1 A;  2XPE A;  5IOX A;  2H76 A;  2L59 A;  2H72 A;  3HDC A;  1GUM A;  1TK5 B;  1O7U A;  3BCI A;  2H01 A;  1OC9 A;  1BJX A;  1MD3 A;  2N5A A;  3FHK A;  3FR9 A;  1THO A;  3ZFB A;  4IKH A;  1ML6 A;  3CTG A;  1F37 A;  5G5E A;  5ECP B;  4WXT A;  5D93 A;  2CX4 A;  1PX7 A;  2QC7 A;  2YWO A;  1UN2 A;  5DQY A;  1ERV A;  4QQ7 A;  3TOU A;  3DD3 A;  3GKK A;  2GSR A;  4KDU A;  4TN8 A;  1FOV A;  2LEG A;  1MDK A;  1XW6 A;  3IPZ A;  1AQX A;  2HFD A;  2MMN A;  2VLT A;  4GQC A;  4MAB A;  1OAZ A;  5AN1 A;  1K0C A;  3H79 A;  1N8J A;  2JSY A;  5B8B A;  1VRS D;  4RQX A;  2GVP A;  3UL3 A;  2C3N A;  4JR6 A;  3IAS 2;  2QSI A;  3D4T A;  4IQ1 A;  3VWW A;  1SEN A;  4BWQ A;  1VF3 A;  2H6Z A;  2KOK A;  3ERG A;  5DAK B;  4RI7 A;  1T3B A;  1K3L A;  1R5A A;  2OAC A;  3CTF A;  1F9M A;  4KX4 A;  1GP1 A;  4BL7 A;  2NBS A;  1V98 A;  4ZIL A;  1E6B A;  2FHE A;  3GL3 A;  1NM3 A;  2H6Y A;  1PX6 A;  2V1M A;  3ME8 A;  2GTU A;  5BMU A;  2RLI A;  2LJK A;  1SD9 A;  4MMM A;  4XS1 A;  3U5R E;  3GX0 A;  3MAK A;  2GT6 A;  5JWO B;  4WR5 A;  2ON5 A;  1SK1 A;  1TOF A;  3D4M A;  2V2G A;  3VWV A;  4G2E A;  2PVO C;  3ZLP A;  2O8V B;  5L71 A;  5G2Z A;  4TR1 A;  2L57 A;  5J5N A;  1ZGN A;  3GMF A;  3EUR A;  4PQH A;  2GGT A;  3DGQ A;  3P7X A;  5H5R A;  4PX1 A;  3KH7 A;  3P90 A;  1EGR A;  4BVY B;  4KAE A;  3VFI A;  3TJK A;  1YZX A;  3GX8 A;  3CBU A;  2WZ9 A;  4MJA A;  2IME A;  1PA3 A;  1F6M C;  3FR6 A;  1V9W A;  2FCH A;  1OYJ A;  3KXO A;  2H70 A;  3FY7 A;  1XOA A;  1B9X C;  5DCG A;  2AJQ B;  3D0Z A;  4RI6 A;  4PNF A;  2HNL A;  3HJP A;  2R3X A;  4WEY A;  1ERT A;  1A0R P;  3I43 A;  2YZU A;  3LEF A;  3UBL A;  2HRF A;  2C0G A;  2V32 A;  2NDO A;  4BPY A;  1THX A;  2H71 A;  5GAN D;  3F9U A;  3VI5 A;  3US3 A;  5DCH A;  5J3R A;  2GZY A;  5F05 A;  3E9J B;  4GCI A;  1GTA A;  2PMT A;  1OKT A;  1I5G A;  2LQO A;  5KN1 A;  4HDE A;  2C8U A;  1GUH A;  4GQF A;  1GSS A;  1OC9 B;  5CAX A;  3E0U A;  1GLP A;  2WCI A;  3HKR A;  4FQU A;  4G0L A;  4KDX A;  2EIO A;  2CVB A;  1M99 A;  3APS A;  3M8N A;  2KLX A;  1R7H A;  5ID2 A;  2ON7 A;  3IOS A;  5LNK e;  3CRU A;  3GST A;  3UEM A;  4AF2 A;  4HZ2 A;  1GSE A;  5JCW A;  3O76 A;  2CZ3 A;  1HYU A;  3VPQ A;  3ZYW A;  1K0B A;  1YDK A;  2IN3 A;  4YAV A;  2EIR A;  1EV9 A;  4Q5F A;  2GSS A;  3ZTL A;  4ZBB A;  6GSS A;  2HRK A;  1SL1 B;  4V1A p;  1K0O A;  1YJ6 A;  1YEP A;  3SBC A;  3ERW A;  4GRF A;  2PUK C;  2LRN A;  3DKS A;  2YAN A;  2O85 A;  5JCU A;  5B6N A;  1TK8 B;  3GRX A;  5ECN B;  4G19 A;  4BL7 B;  5HR0 A;  1A2L A;  1OE7 A;  3GIX A;  3IC8 A;  5DVB A;  4X1U A;  2E7P A;  2OBK A;  4I2U A;  4E8E A;  3LYK A;  3DWV A;  2MMO A;  1SL0 B;  3BJ5 A;  3A2X A;  2TRC P;  1AW9 A;  1TKD B;  5IO0 A;  1SKR B;  1SL2 B;  2OE0 A;  2RUF A;  3KTL A;  1KTE A;  3I9V 2;  2P31 A;  3KH9 A;  4TR1 B;  4EL1 A;  1TRW A;  4ZL9 A;  1GSF A;  3LYP A;  3ED3 A;  2C1Y A;  4TVE A;  3F3Q A;  1DBY A;  1PKZ A;  5IMA A;  2A2R A;  5JWQ B;  3EU3 A;  2DC5 A;  9GSS A;  4FYU A;  3TJB A;  2QKE A;  2LNS A;  4DEJ A;  4MPG A;  2Z9S A;  3QOU A;  4LLR A;  4IS0 A;  5G1K A;  1JZD A;  5D96 A;  3UOM A;  4ISD A;  2GZP A;  1OC3 A;  4FYB A;  4K2D A;  4YH2 A;  2GQL A;  1JZR A;  1ACV A;  2LJR A;  4EO3 A;  3ERF A;  1A2J A;  2H73 A;  1TRU A;  2JAD A;  4NMU A;  2OKA A;  2YN1 A;  4NPB A;  2LKU A;  2JZT A;  4ML6 A;  2CT6 A;  2WJU A;  4KB3 A;  5H5Q A;  3APQ A;  4WET A;  1ERU A;  1WOU A;  3QFA C;  3F6F A;  3C7M A;  1EP8 A;  4PGT A;  1TXX A;  2VOC A;  2B5E A;  3ZL5 A;  5J9C A;  1QFN A;  2HQT A;  2WGR A;  4TXO A;  3QAG A;  16GS A;  4TR0 A;  5J9B A;  4IW9 A;  4FYC A;  3O3T A;  2I1U A;  5CRE A;  1YEX A;  2FY6 A;  5C00 A;  1H75 A;  1M9B A;  1F3A A;  1X5C A;  2F8F A;  3GN3 A;  4HZ4 A;  2H1D A;  3QAV A;  7GSS A;  5GSS A;  2X8H A;  1URM A;  4KSO A;  2O7K A;  1SJ6 A;  3CSI A;  5FHI A;  3D22 A;  3GNJ A;  2QGV A;  3GH9 A;  1XVQ A;  3UAP A;  1BX9 A;  2EC4 A;  1Y25 A;  2IL3 A;  5GST A;  2B5X A;  1FVJ A;  3MWH A;  3LOR A;  3M0F A;  2OAD A;  4MCU A;  2ES7 A;  3FZ9 A;  4L5L A;  4LMW A;  1ON4 A;  4EUY A;  2DSA A;  3TCO A;  5DJM A;  2KHP A;  4OCE A;  4X0X A;  3RPN A;  3LGC A;  1AQV A;  3IA1 A;  5G1L A;  5LCZ A;  2GS3 A;  3Q6O A;  1B48 A;  5G31 A;  2F8A A;  1TJD A;  1Z7P A;  3L9S A;  2AAW A;  2J9H A;  3IE3 A;  5G30 A;  2LST A;  3HXS A;  4N10 A;  2HSY A;  3F4R A;  4X43 A;  4MJE A;  1WIK A;  1G0T A;  1EZK A;  2RM5 A;  5AIV A;  3M9J A;  3WGX A;  3FK8 A;  4P3Y B;  2KP1 A;  3LJR A;  1PN9 A;  2N5B A;  3TKR A;  2CVK A;  4HEA 2;  1Q98 A;  2FGX A;  4MLY A;  5IMC A;  2H30 A;  4GSN A;  1FVK A;  2LNT A;  3ZRE A;  1KNG A;  3GKX A;  3DYR A;  3W8S A;  4K0G A;  4TRX A;  2UZ8 A;  1GRX A;  2R6K A;  3I69 A;  3NZN A;  2F51 A;  5D9V A;  5ECI B;  1Z3E A;  1YQ1 A;  3EIN A;  1NSW A;  2LTK A;  5AIX A;  4MZW A;  4D73 A;  5GZZ B;  1EOG A;  2P0G A;  2MMA A;  1GWC A;  1SJZ A;  19GS A;  5KN0 A;  4TKY A;  1BG5 A;  1GL8 A;  3EMX A;  3HVS A;  4KCE A;  4F0B A;  1GSD A;  3R2Q A;  2ALB A;  3GH6 A;  5IMD A;  14GS A;  3BOA A;  1U3A A;  3TJG A;  4EF0 A;  3D5J A;  5DDL A;  1XIY A;  1A0F A;  2VL2 C;  4G0K A;  1GTB A;  3C73 A;  2X64 A;  1FW1 A;  5IM9 A;  2AV4 A;  1NHO A;  2JAC A;  2H0H A;  3G9B A;  4Q5Q A;  4GLT A;  5ECM B;  2WRT A;  5ELA A;  2V41 A;  2IPA A;  2MBS A;  3Q18 A;  4YQV A;  4IGJ A;  5D9T A;  5F06 A;  6GSW A;  3C8E A;  2GDR A;  5KEJ A;  3LXZ A;  4TXO B;  3RHC A;  1PD2 1;  1R26 A;  1PRX A;  1BED A;  4GXZ A;  1ZMA A;  2YWN A;  4XCS A;  3DXB A;  1XWG A;  4PUR A;  2PVQ A;  2HSM B;  1PSQ A;  3FZ4 A;  4EKZ A;  2FLS A;  2DJK A;  2D2Z A;  3GTU A;  4EDY A;  1AQW A;  3NIV A;  2R2J A;  2FWF A;  4L0U A;  4K7I A;  1FAA A;  3IK7 A;  1EEM A;  2NVL A;  2CX3 A;  2KUC A;  4LL4 B;  5ENU A;  1U88 A;  1B4Q A;  2A2S A;  3IV4 A;  4K8M A;  1UA5 A;  5KN2 A;  1TU7 A;  2KP2 A;  4WBJ A;  3UVT A;  2P5R A;  2LJA A;  5ECO B;  1U87 A;  1ZYQ B;  1U3I A;  6GST A;  5EY6 A;  4LA1 A;  1HD2 A;  4POB A;  4I8B A;  2AHE A;  2H75 A;  2FUG 2;  3LQ7 A;  4MK3 A;  1USB A;  3HA9 A;  3TB2 A;  1ERW A;  1QUW A;  2EIQ A;  1Z6N A;  1JHB A;  4ZL7 A;  2VO4 A;  2VL2 A;  1GNE A;  4TW5 A;  3PH9 A;  4ILF A;  2VCX A;  3UIW A;  3ME7 A;  5INY A;  2H0G A;  3UVH A;  2VD0 A;  5EVO A;  4WF4 A;  5CNW A;  2R4V A;  2XBQ A;  1X0R A;  1NHY A;  4PNG A;  3H4K A;  2YP6 A;  3TUE A;  4K7N A;  5G5F A;  1YF1 A;  2TRX A;  1BQ7 A;  2V6K A;  1ILO A;  1K3O A;  4EC0 A;  4O5R A;  4G10 A;  5KN3 A;  4AGS A;  3H8Q A;  2I9H A;  2RII A;  3E3E A;  3CSH A;  3KGK A;  5ECK B;  3A5W A;  1GSQ A;  4BVX A;  3DVW A;  4D73 B;  4IJI A;  1O85 A;  4TR3 A;  2H66 A;  2DJ2 A;  1OKD A;  3KZQ A;  2R37 A;  4QL7 A;  4V2L A;  2IJY A;  1GTU A;  5ECS A;  1SJI A;  3VK9 A;  5A4V A;  5HFK A;  2BMX A;  1M2D A;  2C0F A;  1G6W A;  1UVZ A;  5ECH B;  5ELG A;  1ZCP A;  3CRT A;  2IMD A;  1HNB A;  3ZMK A;  1PGT A;  3RAZ A;  1B9Y C;  1XXU A;  4MJC A;  4KCA A;  2HZE A;  3UMA A;  4ULX A;  5F8B A;  1TW9 A;  2WUL A;  3KIJ A;  3MNG A;  3DEX A;  4K0N A;  2VD1 A;  3WYW A;  3V1W A;  4E8H A;  3TOT A;  4O7H A;  2H1B A;  1Z6M A;  4IQA A;  2TIR A;  2NPB A;  4J56 E;  3UJ1 A;  1O8W A;  1XCC A;  2C0E A;  4I97 A;  5ECQ B;  3G7Y A;  1ZYE A;  2ZUP A;  3ZFL A;  3TKS E;  1JZO A;  3HD5 A;  3TKS C;  1X9S B;  2YV7 A;  1VGL A;  2C3Q A;  2JSZ A;  1EP7 A;  8GSS A;  2E2M A;  1ZL9 A;  4IHU A;  1J08 A;  2CA8 A;  3GTU B;  4L5O A;  5LD0 A;  3EMP A;  1K0M A;  3C71 A;  4J2F A;  1G7E A;  1B4P A;  4I5Q A;  3O6T A;  2X99 A;  4PQ1 A;  2PER A;  1M2B A;  5IPH A;  5ECR B;  3PGT A;  2CAQ A;  3QDN A;  4PQI A;  1T8E B;  5IMF A;  1M9A A;  4WBR D;  5FT3 A;  1OE8 A;  2DJ1 A;  3WT2 A;  4USS A;  2REM A;  1O8X A;  2H19 A;  4JE1 A;  5CP1 A;  2MBT A;  5A5K A;  1W4V A;  3A3T A;  2VL3 A;  4L0W A;  4LL1 B;  5C04 A;  3UBK A;  4YQM A;  1LBK A;  3SWL A;  4XHM A;  1XVW A;  22GS A;  4PXO A;  4CHS A;  1H4O A;  3TRX A;  4ZB6 A;  3GFK A;  2XPD A;  4ACS A;  4MA9 A;  5IMV A;  1XFL A;  1A24 A;  1XW5 A;  2L5O A;  1K3Y A;  3L4N A;  3S9F A;  2CZ2 A;  3M3M A;  4ZBD A;  1ABA A;  5A4W A;  6GSU A;  3HZ8 A;  4RUV A;  1X9W B;  1V40 A;  2H0I A;  2ZNM A;  2DJ3 A;  1U6T A;  3GA4 A;  4KDY A;  1TI3 A;  3D21 A;  3OR5 A;  3D6I A;  3BBY A;  3CXG A;  4ZXG A;  2J23 A;  1C72 A;  5CRG A;  1O81 A;  4ID0 A;  4DSR A;  1Z7R A;  3APO A;  4XRD A;  2GQK A;  3NOF A;  2PGT A;  4OFT A;  2B1L A;  2IFQ A;  1A8L A;  2I3Y A;  5F0G A;  1WPI A;  3TKP A;  3J7Y k;  5EL8 A;  4JR4 A;  3DRN A;  2VCT A;  4MH3 A;  2K8S A;  3KD0 A;  5EPF A;  5H5S A;  4FH8 A;  1M0U A;  4XS4 A;  2WB9 A;  1N2A A;  4NHW A;  4L8E A;  1QK8 A;  4N11 A;  4BVX B;  3CSJ A;  3QR6 A;  4MDC A;  4IVF A;  3H93 A;  3QD9 A;  3TKS A;  5A4U A;  3HVX A;  4TR4 A;  3QCP A;  5HR2 A;  3W6G A;  1FO5 A;  4MH2 A;  2JL4 A;  4ECI A;  3PIN A;  4POL A;  4F2I A;  3P8W A;  1GSY A;  1O6J A;  2XHF A;  1EWX A;  20GS A;  2AB6 A;  5D73 A;  2DML A;  2JZS A;  5ID2 B;  3CYN A;  2HI7 A;  2HRN A;  3FEU A;  4AJ6 A;  3PR8 A;  3ZML A;  1E2Y A;  3F4T A;  2HYX A;  3GSS A;  4ZBA A;  2YNX A;  5B6M A;  4O32 A;  4BWS A;  2HZE B;  4GWR A;  3BD2 A;  2K6V A;  1AIU A;  1GTI A;  2HRK B;  5DQS A;  2GQM A;  10GS A;  4WR4 A;  3TRQ A;  1QQ2 A;  3LXT A;  4ZB9 A;  3GKN A;  1CQG A;  3G7I A;  4H86 A;  3FZ5 A;  3N5O A;  3IC4 A;  4MF5 A;  5HFI A;  2YJ7 A;  3TJJ A;  3VWX A;  2YOI A;  3RHB A;  4XRA A;  2VCV A;  6GSV A;  1GLQ A;  4Q5R A;  2RM6 A;  1RQM A;  1XW9 A;  1Q4J A;  4EDZ A;  4HOJ A;  2IMK A;  4POK A;  3VLN A;  4EE0 A;  5E4W A;  1FG4 A;  4MZC A;  1GH2 A;  3BCK A;  4F82 A;  4KH7 A;  4FIW A;  5CRD A;  2X8C A;  1UC7 A;  1EOH A;  3K8N A;  1PL2 A;  2H1G A;  5FWG A;  1IYH A;  1HNC A;  3IBH A;  3MDK A;  2VM1 A;  3KM6 A;  1XWB A;  1AC1 A;  1S3C A;  3JCM L;  4KE3 A;  3LG6 A;  3GHA A;  1CQH A;  3TRP A;  2F9S A;  4MZB A;  2X8G A;  2H74 A;  1V57 A;  1MDI A;  2VCW A;  3HJM A;  3ZVJ A;  4HJ2 A;  2F3M A;  4I6X A;  1AAZ A;  4DSS A;  3DVX A;  2C80 A;  1X5E A;  1GSU A;  4OWY A;  1VF4 A;  3GYK A;  2R5G A;  4IBP A;  2I4A A;  5J41 A;  4N30 A;  1QXH A;  4QL9 A;  2FA4 A;  2IWT A;  2E2G A;  2NTO A;  2IMF A;  1JLV A;  4AJ7 A;  3IAM 2;  4FO5 A;  4HU9 A;  1TDI A;  2GT5 A;  1TP9 A;  2G2Q A;  1SKS B;  2IMI A;  2OE1 A;  4AJ8 A;  3LWA A;  2L6C A;  3ZIJ A;  2K8V A;  2B1K A;  2VAF A;  2FNO A;  3VI7 A;  2FD3 A;  4HUA A;  1AXD A;  2G0F A;  4HU7 A;  3LSZ A;  3VPT A;  1WRY A;  2DJ0 A;  2IFQ B;  5IOW A;  2XBI A;  1NW2 A;  2VCQ A;  1ZOF A;  4OO4 A;  2MMZ A;  2M80 A;  3TDG A;  4XS4 B;  2LRT A;  4GST A;  1XBS A;  4OFN A;  2VCZ A;  1SK0 A;  1I9D A;  2XC2 A;  1T7P B;  4ZIJ A;  5E59 A;  1X9M B;  4OO5 A;  3WT1 A;  1K0N A;  3IK9 A;  4XTS A;  2WDU A;  3QFB C;  4TOP A;  2E0Q A;  2GST A;  2DIZ A;  1ST9 A;  2YCD A;  1T4Y A;  3FZA A;  3W8J A;  5DBQ A;  3FYG A;  2M72 A;  2L4Q A;  13GS A;  4JU5 A;  4Z7X A;  4POM A;  3HJO A;  4OMV A;  4NHZ A;  4MP4 A;  2HT9 A;  2K18 A;  2CAI A;  2DMM A;  3DML A;  5D9W A;  3IDV A;  1T1V A;  4KW6 A;  5HR1 A;  4IEL A;  2BJX A;  1RK4 A;  3L78 A;  3L9U A;  2MYG A;  12GS A;  5HFG A;  3RBT A;  1MTC A;  1GUL A;  3KMN A;  4HI7 A;  4TXV A;  4KND A;  2PBJ A;  3ISO A;  6GSY A;  5J4U A;  2RUE A;  3TJF A;  2AYT A;  3A2V A;  1KBN A;  3KMO A;  3WGE A;  3UAR A;  1XWC A;  3KCM A;  4Q5N A;  1X5D A;  3F0I A;  1IYI A;  3VUR A;  2HRA A;  3FW2 A;  3GL5 A;  5CO3 A;  1XOB A;  3RPP A;  3KTB A;  1M2A A;  1DE1 A;  3EE2 A;  4ECB A;  1EV4 A;  2HSH A;  2OE3 A;  2C3T A;  3H1N A;  5IO2 A;  4F03 A;  1XZO A;  3M1G A;  4KGI A;  4N0V A;  2N5F A;  2B5Y A;  5AGY A;  3QAW A;  3QPM A;  1TRS A;  4DSS B;  2OA7 A;  1M7T A;  4K7O A;  1W89 A;  4YAP A;  1XWA A;  3PPU A;  3KJY A;  2H6X A;  3IRA A;  2V6O A;  2YWI A;  1V2A A;  3MSZ A;  2YV9 A;  4K9Z A;  4NWY A;  3HYP A;  3J7Y b;  5GAP D;  2GZZ A;  3FRC A;  4GTU A;  1BAY A;  2FWH A;  2YWM A;  4DVC A;  3KP9 A;  2P5Q A;  4RQR A;  3RDW A;  1GNW A;  3QMX A;  3U6V A;  2YZH A;  3CMI A;  2PWJ A;  3P2A A;  4KSM A;  2O87 A;  1VF2 A;  2LS5 A;  4G9H A;  1XWK A;  1HNA A;  6GSX A;  1ZZY A;  4GF0 A;  2B6M A;  1TK0 B;  4IP1 A;  17GS A;  4IJ3 A;  3GKM A;  1R5P A;  1T00 A;  2PU9 C;  3WGD A;  5ECL B;  4G0I A;  2IIY A;  3G7J A;  2B7K A;  4N0Z A;  4ML1 A;  1T4Z A;  4KUN A;  3ZRD A;  1K0D A;  1O73 A;  3HVV A;  1YKA A;  2HSN B;  4MPF A;  1OC8 A;  4K6X A;  1FHE A;  4CW9 A;  4JRR A;  1FB6 A;  2JU5 A;  2VM2 A;  2WFC A;  2BTO T;  1WJK A;  3N9J A;  1PQN A;  3M9K A;  1PKW A;  3TGZ A; 
#chains in the Genus database with same CATH topology
 3C1S A;  1EEJ A;  3C1R A;  3ZIT A;  1MD4 A;  5B7C A;  3RFR C;  2JZR A;  5DAL A;  4XIH A;  4MF7 A;  2C4J A;  1Z5Y E;  2B7J A;  1YY7 A;  3HHV A;  4HJM A;  1QMV A;  3Q74 A;  2YJH A;  5CRW A;  2MZC A;  3HZ4 A;  1SKW B;  2L6D A;  2WS2 A;  1VF1 A;  1GUK A;  1A23 A;  2H8L A;  1JFU A;  1Z9H A;  4EVM A;  1WE0 A;  4PUA A;  1S3A A;  4WKW A;  4YQU A;  4XS6 A;  1A2M A;  2GSQ A;  3LFL A;  4JZQ A;  4NXI A;  4ECC A;  3ZVJ D;  4NV5 A;  3WD6 A;  3F3R A;  4J57 E;  2L4C A;  2C0D A;  1SU9 A;  2QA1 A;  3GUS A;  2AUV A;  5IIZ A;  11GS A;  4PUF C;  4ZL8 A;  1F3B A;  2L5L A;  4EIQ A;  2WW3 A;  3I6A A;  4OD7 A;  4AI6 A;  2VIM A;  1M3J A;  1PMT A;  3VWU A;  3FR3 A;  3F6D A;  2LUS A;  3F4S A;  2LQQ A;  4DSQ A;  2CQ9 A;  1RW1 A;  2HE3 A;  1JLW A;  2K9F A;  5CRH A;  1YKC A;  3GUR A;  2CV4 A;  2HZF A;  3KP8 A;  4V2M A;  1A8Y A;  3HY2 A;  1K0A A;  1SYX A;  1DSB A;  4OCF A;  1S3D A;  4HQZ A;  1J0F A;  3EWL A;  3F8U A;  3AY8 A;  2LV3 A;  2WVY A;  2DBC A;  4WF5 A;  4Z2T A;  5DAK A;  2OJL A;  3EU4 A;  4LMV A;  3KEB A;  5IQY A;  4CDO A;  3TKQ A;  2VUP A;  1WP0 A;  2ZCT A;  4I2T A;  1PL1 A;  3CWG A;  2A4V A;  4K1F A;  5HR3 A;  3DIE A;  1V58 A;  2HSM A;  2O89 A;  2PPT A;  3FKF A;  3ZIV A;  1QGV A;  5F07 A;  1SYR A;  2CVD A;  1HQO A;  5AIS A;  2VLU A;  5JWR B;  1F2E A;  3L9V A;  4NAX A;  1SD8 A;  2PN8 A;  4KF9 A;  2DLX A;  1BYE A;  5B8A A;  2FA8 A;  2HXK A;  1AUC A;  5ABR A;  3RGB C;  3Q19 A;  5JCG A;  2DJJ A;  4MJB A;  1MEK A;  4PHZ C;  4NV2 A;  4F9Z A;  1XPV A;  2R0P A;  1SK2 A;  2FWE A;  2H1A A;  5DJL A;  1R4W A;  1DE2 A;  1KEB A;  1LJR A;  1WWJ A;  3EYT A;  4IP6 A;  18GS A;  4JED A;  2FWG A;  1WMJ A;  3GV1 A;  3IXR A;  1LU4 A;  4EXJ A;  1J9B A;  2DIY A;  1EGO A;  3A2W A;  2B3S A;  2LRC A;  3L0H A;  4BVY A;  1G7O A;  4GSS A;  4OFM A;  3IR4 A;  4E68 A;  1TRV A;  2I81 A;  1TU8 A;  5IMZ A;  5IPG A;  1JZW A;  2VLV A;  5COH A;  2GLR A;  3IHQ A;  3HCZ A;  4MF6 A;  1DUG A;  1OVN A;  5D9X A;  2VL9 A;  5DAL B;  1B8X A;  1MDJ A;  4PTS A;  2YPM A;  4KA0 A;  4HQS A;  4ZB8 A;  2M46 A;  4IN0 A;  4V1A g;  4O92 A;  3R3E A;  4BA7 A;  1YF0 A;  5CYY A;  3EVI A;  4JBB A;  1FB0 A;  4ECJ A;  2OBI A;  1XG8 A;  3EC3 A;  3F63 A;  3ZZX A;  1G6Y A;  4V2N A;  2WVZ A;  2A4H A;  5D8I A;  1TTZ A;  4F0C A;  5HQP A;  1Y6E A;  4HS1 A;  2HLS A;  1TI1 A;  2XPE A;  5A34 A;  5IOX A;  2H76 A;  2L59 A;  2H72 A;  3HDC A;  1GUM A;  1TK5 B;  1O7U A;  3BCI A;  2H01 A;  1OC9 A;  1BJX A;  1MD3 A;  2N5A A;  3FHK A;  3FR9 A;  1THO A;  3ZFB A;  4IKH A;  1ML6 A;  3CTG A;  1F37 A;  5G5E A;  5ECP B;  4WXT A;  5D93 A;  2CX4 A;  3FMW A;  1PX7 A;  2QC7 A;  2YWO A;  1UN2 A;  5DQY A;  1ERV A;  4QQ7 A;  3TOU A;  3DD3 A;  3HVN A;  3GKK A;  2GSR A;  4KDU A;  4TN8 A;  1FOV A;  2LEG A;  1MDK A;  1XW6 A;  3IPZ A;  1AQX A;  2HFD A;  2MMN A;  2VLT A;  4GQC A;  4MAB A;  1OAZ A;  5AN1 A;  1K0C A;  3H79 A;  1N8J A;  4G01 A;  2JSY A;  5B8B A;  1VRS D;  4RQX A;  2GVP A;  3UL3 A;  2C3N A;  4JR6 A;  3IAS 2;  2QSI A;  3D4T A;  4IQ1 A;  3VWW A;  1SEN A;  4BWQ A;  1VF3 A;  2OT3 A;  2H6Z A;  2KOK A;  3ERG A;  5DAK B;  4RI7 A;  1T3B A;  1K3L A;  1R5A A;  2OAC A;  3CTF A;  1M3I A;  1F9M A;  4KX4 A;  1GP1 A;  2EFD A;  4BL7 A;  2NBS A;  1V98 A;  4ZIL A;  1E6B A;  2FHE A;  3GL3 A;  1NM3 A;  2H6Y A;  1PX6 A;  2V1M A;  3ME8 A;  2GTU A;  5BMU A;  2RLI A;  2LJK A;  1SD9 A;  4MMM A;  4XS1 A;  3U5R E;  3GX0 A;  3MAK A;  2GT6 A;  5JWO B;  4WR5 A;  2ON5 A;  1SK1 A;  1TOF A;  3D4M A;  2V2G A;  3VWV A;  4G2E A;  2PVO C;  3ZLP A;  2O8V B;  5L71 A;  5G2Z A;  4TR1 A;  2L57 A;  5J5N A;  1ZGN A;  3GMF A;  3EUR A;  4PQH A;  2GGT A;  4ZB7 A;  3DGQ A;  3P7X A;  5H5R A;  4PX1 A;  3KH7 A;  3P90 A;  1EGR A;  4BVY B;  4KAE A;  3VFI A;  3TJK A;  1YZX A;  3GX8 A;  3CBU A;  2WZ9 A;  4MJA A;  2IME A;  1PA3 A;  5BRT A;  1F6M C;  3FR6 A;  1V9W A;  2WW1 A;  2FCH A;  1OYJ A;  3KXO A;  2H70 A;  3FY7 A;  2EFC A;  1XOA A;  1B9X C;  5DCG A;  2AJQ B;  3D0Z A;  2O36 A;  4RI6 A;  4PNF A;  2HNL A;  3HJP A;  2R3X A;  4WEY A;  1Y1U A;  1ERT A;  1A0R P;  3I43 A;  2YZU A;  3LEF A;  3UBL A;  2HRF A;  2C0G A;  2V32 A;  2NDO A;  4BPY A;  1THX A;  2H71 A;  5GAN D;  3F9U A;  3VI5 A;  3US3 A;  5DCH A;  5J3R A;  2GZY A;  5F05 A;  3E9J B;  4GCI A;  1GTA A;  2PMT A;  1OKT A;  1I5G A;  5A34 B;  2LQO A;  5KN1 A;  4HDE A;  2C8U A;  1GUH A;  4GQF A;  1GSS A;  1OC9 B;  5CAX A;  3E0U A;  1GLP A;  2WCI A;  4O5U A;  3HKR A;  4FQU A;  4G0L A;  4KDX A;  2EIO A;  2CVB A;  1M99 A;  3APS A;  3M8N A;  2DKH A;  2KLX A;  1R7H A;  5ID2 A;  2ON7 A;  3IOS A;  5LNK e;  3CRU A;  3GST A;  3UEM A;  4AF2 A;  4HZ2 A;  1GSE A;  5JCW A;  3O76 A;  4YKF A;  2CZ3 A;  1HYU A;  3VPQ A;  3ZYW A;  1K0B A;  1YDK A;  2IN3 A;  4YAV A;  2EIR A;  1EV9 A;  4Q5F A;  2GSS A;  3ZTL A;  4ZBB A;  6GSS A;  2HRK A;  1SL1 B;  4V1A p;  1K0O A;  1YJ6 A;  1YEP A;  3SBC A;  4N3Z A;  3ERW A;  4GRF A;  2PUK C;  2LRN A;  3DKS A;  2YAN A;  2O85 A;  5JCU A;  5B6N A;  1TK8 B;  3GRX A;  5ECN B;  4G19 A;  4BL7 B;  5HR0 A;  1A2L A;  1OE7 A;  3GIX A;  3IC8 A;  5DVB A;  4X1U A;  2E7P A;  2OBK A;  5BMU B;  4I2U A;  4E8E A;  3LYK A;  3DWV A;  2MMO A;  1SL0 B;  4QMK A;  3BJ5 A;  3A2X A;  2TRC P;  1AW9 A;  1TKD B;  5IO0 A;  1SKR B;  1SL2 B;  2OE0 A;  2RUF A;  3KTL A;  1KTE A;  3I9V 2;  2P31 A;  3KH9 A;  4TR1 B;  4EL1 A;  1TRW A;  4ZL9 A;  1GSF A;  3LYP A;  3ED3 A;  2C1Y A;  4TVE A;  3F3Q A;  1DBY A;  1PKZ A;  5IMA A;  2A2R A;  5JWQ B;  3EU3 A;  2DC5 A;  9GSS A;  4FYU A;  3TJB A;  2QKE A;  1BF5 A;  2LNS A;  4DEJ A;  4MPG A;  2Z9S A;  3QOU A;  4LLR A;  4IS0 A;  5G1K A;  1JZD A;  5D96 A;  4BIK A;  3UOM A;  4ISD A;  2GZP A;  1OC3 A;  4FYB A;  4K2D A;  4YH2 A;  2GQL A;  1JZR A;  1ACV A;  2LJR A;  4EO3 A;  1ZYN A;  3ERF A;  1A2J A;  2H73 A;  1TRU A;  2JAD A;  4NMU A;  2OKA A;  2YN1 A;  4NPB A;  2LKU A;  2JZT A;  4ML6 A;  2CT6 A;  2WJU A;  4KB3 A;  2X49 A;  5H5Q A;  3APQ A;  4WET A;  1ERU A;  1WOU A;  3QFA C;  3F6F A;  3C7M A;  1EP8 A;  4PGT A;  1TXX A;  2VOC A;  2B5E A;  3ZL5 A;  5J9C A;  1PFO A;  1QFN A;  2HQT A;  2WGR A;  4TXO A;  3QAG A;  16GS A;  4TR0 A;  5J9B A;  4IW9 A;  4FYC A;  3O3T A;  4AKG A;  2I1U A;  5CRE A;  1YEX A;  2FY6 A;  5C00 A;  1H75 A;  1M9B A;  1F3A A;  1X5C A;  5A1N B;  5J40 A;  4K2X A;  2F8F A;  3GN3 A;  4HZ4 A;  2H1D A;  3QAV A;  7GSS A;  5GSS A;  2X8H A;  1URM A;  3CQF A;  4KSO A;  2O7K A;  1SJ6 A;  4EIP A;  3CSI A;  5FHI A;  2O3E A;  3D22 A;  3GNJ A;  2QGV A;  3GH9 A;  1XVQ A;  3UAP A;  1BX9 A;  2EC4 A;  1Y25 A;  2IL3 A;  5GST A;  2B5X A;  1FVJ A;  3MWH A;  3LOR A;  3M0F A;  2OAD A;  4MCU A;  2ES7 A;  3FZ9 A;  4L5L A;  4LMW A;  1ON4 A;  4EUY A;  2DSA A;  3TCO A;  5DJM A;  2KHP A;  4CY8 A;  4OCE A;  4X0X A;  3RPN A;  3LGC A;  1AQV A;  3IA1 A;  5G1L A;  5LCZ A;  2GS3 A;  3Q6O A;  1B48 A;  5G31 A;  2F8A A;  1TJD A;  1Z7P A;  3L9S A;  2AAW A;  2J9H A;  3IE3 A;  5G30 A;  2LST A;  3HXS A;  4N10 A;  2HSY A;  3F4R A;  4X43 A;  4MJE A;  1WIK A;  1G0T A;  1EZK A;  2RM5 A;  5AIV A;  3M9J A;  3WGX A;  3FK8 A;  4P3Y B;  2KP1 A;  5KOX A;  3LJR A;  4HSC X;  1PN9 A;  2N5B A;  3TKR A;  2CVK A;  4HEA 2;  1Q98 A;  2FGX A;  4MLY A;  5IMC A;  2H30 A;  4GSN A;  1FVK A;  2LNT A;  5J4Y A;  3ZRE A;  1KNG A;  3GKX A;  3DYR A;  3W8S A;  3LW9 A;  4K0G A;  4TRX A;  2UZ8 A;  1GRX A;  2R6K A;  3I69 A;  2F51 A;  5D9V A;  3NZN A;  5ECI B;  1Z3E A;  1YQ1 A;  3EIN A;  2WVX A;  1NSW A;  2LTK A;  5AIX A;  4MZW A;  4Z2R A;  4D73 A;  5GZZ B;  1EOG A;  2P0G A;  2MMA A;  1GWC A;  1SJZ A;  19GS A;  5KN0 A;  4TKY A;  1BG5 A;  2DKI A;  1GL8 A;  3EMX A;  3HVS A;  4KCE A;  4F0B A;  1GSD A;  3R2Q A;  2ALB A;  3GH6 A;  5IMD A;  14GS A;  3BOA A;  1U3A A;  3TJG A;  4AKX B;  4EF0 A;  3D5J A;  5DDL A;  1XIY A;  1A0F A;  2VL2 C;  4G0K A;  1GTB A;  3C73 A;  2X64 A;  1FW1 A;  5IM9 A;  2AV4 A;  1NHO A;  2JAC A;  2H0H A;  3G9B A;  4Q5Q A;  4GLT A;  5ECM B;  1PN0 A;  2WRT A;  5ELA A;  2V41 A;  2IPA A;  2MBS A;  4CY6 A;  2EFE A;  3Q18 A;  4YQV A;  4IGJ A;  5D9T A;  5F06 A;  6GSW A;  3C8E A;  2GDR A;  5KEJ A;  3LXZ A;  4TXO B;  3RHC A;  1PD2 1;  1R26 A;  1PRX A;  1BED A;  4GXZ A;  1ZMA A;  2YWN A;  4XCS A;  3DXB A;  1XWG A;  4PUR A;  2PVQ A;  2HSM B;  1PSQ A;  3FZ4 A;  4EKZ A;  3TU3 B;  2FLS A;  2DJK A;  2D2Z A;  3GTU A;  4EDY A;  1AQW A;  3NIV A;  2R2J A;  2FWF A;  4L0U A;  4K7I A;  2HSN A;  1FAA A;  3IK7 A;  4AKH A;  1EEM A;  2NVL A;  2CX3 A;  2KUC A;  4LL4 B;  5ENU A;  1U88 A;  4PI0 C;  1B4Q A;  2A2S A;  2O5V A;  2R0C A;  3IV4 A;  4K8M A;  1UA5 A;  5KN2 A;  1TU7 A;  2KP2 A;  4WBJ A;  3UVT A;  2P5R A;  2LJA A;  5ECO B;  1U87 A;  1ZYQ B;  1U3I A;  6GST A;  5EY6 A;  4LA1 A;  1HD2 A;  4POB A;  2AHE A;  4I8B A;  2H75 A;  2FUG 2;  3LQ7 A;  4MK3 A;  1USB A;  3HA9 A;  3TB2 A;  1ERW A;  1QUW A;  2EIQ A;  1Z6N A;  1JHB A;  4ZL7 A;  2VO4 A;  2VL2 A;  1GNE A;  4TW5 A;  3PH9 A;  4ILF A;  2VCX A;  3UIW A;  3ME7 A;  5INY A;  2H0G A;  3UVH A;  2VD0 A;  5EVO A;  4WF4 A;  5CNW A;  2R4V A;  2XBQ A;  1X0R A;  1NHY A;  4PNG A;  3H4K A;  2YP6 A;  3TUE A;  4K7N A;  5G5F A;  1YF1 A;  2TRX A;  1BQ7 A;  2V6K A;  1ILO A;  1K3O A;  4EC0 A;  4O5R A;  4G10 A;  5KN3 A;  4AGS A;  3H8Q A;  2I9H A;  2RII A;  3E3E A;  3CSH A;  4YKG A;  3KGK A;  5ECK B;  2WVX B;  3A5W A;  1GSQ A;  4BVX A;  3DVW A;  4D73 B;  4IJI A;  1SVL A;  1O85 A;  4TR3 A;  2H66 A;  2DJ2 A;  1OKD A;  3KZQ A;  1BG1 A;  2R37 A;  2R0G A;  4QL7 A;  4V2L A;  4W66 A;  5J47 A;  2IJY A;  1GTU A;  5ECS A;  1SJI A;  3VK9 A;  5A4V A;  5HFK A;  1YEW C;  2BMX A;  1M2D A;  2C0F A;  1G6W A;  1UVZ A;  5ECH B;  5ELG A;  1ZCP A;  3CRT A;  2IMD A;  4K5R A;  1HNB A;  2WW2 A;  3ZMK A;  1PGT A;  3RAZ A;  1B9Y C;  1XXU A;  4MJC A;  5A5H A;  2HZE A;  4KCA A;  3UMA A;  4ULX A;  5F8B A;  1TW9 A;  2WUL A;  3KIJ A;  3MNG A;  3DEX A;  4K0N A;  2VD1 A;  3WYW A;  3V1W A;  4E8H A;  3A5I A;  3TOT A;  4O7H A;  2H1B A;  1Z6M A;  4IQA A;  2TIR A;  2NPB A;  4J56 E;  3UJ1 A;  1O8W A;  1XCC A;  4A5P A;  2C0E A;  4I97 A;  5ECQ B;  3G7Y A;  1ZYE A;  2ZUP A;  3ZFL A;  3TKS E;  1JZO A;  3HD5 A;  3TKS C;  1X9S B;  2YV7 A;  1VGL A;  2C3Q A;  2JSZ A;  1EP7 A;  8GSS A;  2E2M A;  1ZL9 A;  4IHU A;  1J08 A;  2CA8 A;  3GTU B;  4L5O A;  5LD0 A;  3EMP A;  1K0M A;  3C71 A;  4J2F A;  3MYD A;  1G7E A;  1B4P A;  4I5Q A;  3O6T A;  2X99 A;  4PQ1 A;  2PER A;  1M2B A;  5IPH A;  5ECR B;  3PGT A;  2CAQ A;  3QDN A;  4Z2U A;  4PQI A;  1T8E B;  5IMF A;  1M9A A;  4WBR D;  5FT3 A;  2WW0 A;  1OE8 A;  3EPT A;  2DJ1 A;  4PI2 C;  3WT2 A;  4USS A;  2REM A;  1O8X A;  2H19 A;  4JE1 A;  5CP1 A;  2MBT A;  5A5K A;  1W4V A;  3A3T A;  2VL3 A;  4L0W A;  4LL1 B;  5C04 A;  3UBK A;  4YQM A;  1LBK A;  3SWL A;  4XHM A;  1XVW A;  22GS A;  4PXO A;  4CHS A;  1H4O A;  3TRX A;  4ZB6 A;  3GFK A;  4K5S A;  2XPD A;  4ACS A;  4MA9 A;  5IMV A;  1XFL A;  1A24 A;  1XW5 A;  2L5O A;  1K3Y A;  3L4N A;  3S9F A;  2CZ2 A;  3M3M A;  4ZBD A;  1ABA A;  1SVM A;  5A4W A;  1FOH A;  6GSU A;  3HZ8 A;  4RUV A;  1X9W B;  1V40 A;  2H0I A;  2ZNM A;  2DJ3 A;  1U6T A;  3GA4 A;  4KDY A;  1TI3 A;  3D21 A;  3OR5 A;  3D6I A;  3BBY A;  3CXG A;  4ZXG A;  2J23 A;  1C72 A;  4AKI A;  5CRG A;  1O81 A;  4ID0 A;  4DSR A;  1Z7R A;  3APO A;  4XRD A;  2GQK A;  3NOF A;  2PGT A;  4OFT A;  2B1L A;  2IFQ A;  1A8L A;  2I3Y A;  5F0G A;  1WPI A;  3TKP A;  3J7Y k;  5EL8 A;  4JR4 A;  3DRN A;  2VCT A;  4MH3 A;  2K8S A;  3KD0 A;  5EPF A;  5H5S A;  4FH8 A;  1SVO A;  1M0U A;  4XS4 A;  2WB9 A;  1N2A A;  5KOW A;  4NHW A;  4L8E A;  1QK8 A;  4N11 A;  4BVX B;  3CSJ A;  3QR6 A;  4MDC A;  4IVF A;  3H93 A;  3QD9 A;  3TKS A;  1TXU A;  5A4U A;  3HVX A;  4TR4 A;  3QCP A;  5HR2 A;  3W6G A;  1FO5 A;  4MH2 A;  2JL4 A;  4ECI A;  3PIN A;  4POL A;  4F2I A;  3P8W A;  1GSY A;  1O6J A;  2XHF A;  1EWX A;  20GS A;  2AB6 A;  5D73 A;  2DML A;  2JZS A;  5ID2 B;  3CYN A;  2H1L A;  1ZYP A;  2HI7 A;  2HRN A;  4MNN A;  3FEU A;  4AJ6 A;  3PR8 A;  3ZML A;  1E2Y A;  3F4T A;  2HYX A;  3GSS A;  4ZBA A;  2YNX A;  5B6M A;  4O32 A;  4BWS A;  5A5H B;  2HZE B;  2A2P A;  4GWR A;  3BD2 A;  2K6V A;  1AIU A;  1GTI A;  2HRK B;  5DQS A;  2GQM A;  10GS A;  4WR4 A;  3TRQ A;  1QQ2 A;  3LXT A;  4ZB9 A;  3GKN A;  1CQG A;  3G7I A;  4H86 A;  3FZ5 A;  3N5O A;  3IC4 A;  4MF5 A;  5HFI A;  2EFH A;  2YJ7 A;  3TJJ A;  3VWX A;  2YOI A;  3RHB A;  4XRA A;  2VCV A;  6GSV A;  1GLQ A;  4Q5R A;  2RM6 A;  1RQM A;  1XW9 A;  1Q4J A;  4EDZ A;  4HOJ A;  2IMK A;  4POK A;  3VLN A;  4EE0 A;  5E4W A;  1FG4 A;  4MZC A;  1GH2 A;  3BCK A;  4F82 A;  4KH7 A;  4FIW A;  5CRD A;  2WZS A;  2X8C A;  1UC7 A;  1EOH A;  3K8N A;  1PL2 A;  2H1G A;  5FWG A;  1IYH A;  1HNC A;  3IBH A;  3MDK A;  2VM1 A;  1I1I P;  3KM6 A;  1XWB A;  1AC1 A;  1S3C A;  2QA2 A;  3JCM L;  4KE3 A;  3LG6 A;  3CHX C;  3GHA A;  1CQH A;  3TRP A;  2F9S A;  4MZB A;  2X8G A;  2H74 A;  1V57 A;  1MDI A;  2VCW A;  1S3R A;  4X4J A;  3HJM A;  3ZVJ A;  4HJ2 A;  2F3M A;  4I6X A;  1AAZ A;  4DSS A;  3DVX A;  2C80 A;  1X5E A;  1GSU A;  4OWY A;  1VF4 A;  3GYK A;  2R5G A;  4IBP A;  2I4A A;  5J41 A;  4N30 A;  1QXH A;  4QL9 A;  2FA4 A;  2IWT A;  2E2G A;  2NTO A;  2IMF A;  1JLV A;  4AJ7 A;  3IAM 2;  4FO5 A;  4HU9 A;  1TDI A;  2GT5 A;  1TP9 A;  2G2Q A;  3MIX A;  1SKS B;  2IMI A;  2OE1 A;  4AJ8 A;  3LWA A;  2L6C A;  3ZIJ A;  2K8V A;  2B1K A;  2VAF A;  2FNO A;  3VI7 A;  2FD3 A;  4HUA A;  1AXD A;  2G0F A;  4HU7 A;  3LSZ A;  3VPT A;  1WRY A;  2DJ0 A;  2IFQ B;  5IOW A;  2XBI A;  1NW2 A;  2VCQ A;  1ZOF A;  4OO4 A;  2MMZ A;  2M80 A;  3TDG A;  4XS4 B;  2LRT A;  4GST A;  1XBS A;  4OFN A;  2VCZ A;  1SK0 A;  1I9D A;  2XC2 A;  1T7P B;  4ZIJ A;  5E59 A;  1X9M B;  4OO5 A;  3WT1 A;  1K0N A;  3IK9 A;  1N25 A;  4XTS A;  2WDU A;  3QFB C;  1YVL A;  4TOP A;  2E0Q A;  2GST A;  4O5Q A;  2DIZ A;  1ST9 A;  2YCD A;  1T4Y A;  3FZA A;  3W8J A;  5DBQ A;  3FYG A;  2M72 A;  2L4Q A;  13GS A;  4JU5 A;  4Z7X A;  4POM A;  3HJO A;  4OMV A;  4NHZ A;  4MP4 A;  2HT9 A;  2K18 A;  2CAI A;  2DMM A;  3DML A;  5D9W A;  3IDV A;  3HMJ G;  1T1V A;  4KW6 A;  5HR1 A;  4IEL A;  2BJX A;  1RK4 A;  3L78 A;  3L9U A;  2MYG A;  1S4B P;  12GS A;  5HFG A;  3RBT A;  1MTC A;  2X4A A;  1GUL A;  3KMN A;  4ICY A;  4HI7 A;  2UV8 G;  4TXV A;  4KND A;  2PBJ A;  3ISO A;  4FXY P;  6GSY A;  5J4U A;  2RUE A;  3TJF A;  2AYT A;  3A2V A;  1KBN A;  3KMO A;  3WGE A;  3UAR A;  1XWC A;  3KCM A;  4Q5N A;  1X5D A;  3F0I A;  1IYI A;  3VUR A;  2HRA A;  3FW2 A;  3GL5 A;  5CO3 A;  1XOB A;  3RPP A;  3KTB A;  1M2A A;  1DE1 A;  3EE2 A;  2VKZ G;  4ECB A;  1EV4 A;  2HSH A;  2OE3 A;  2C3T A;  3H1N A;  5IO2 A;  4F03 A;  1XZO A;  3M1G A;  4KGI A;  4N0V A;  2N5F A;  2B5Y A;  5AGY A;  3QAW A;  3QPM A;  1TRS A;  4DSS B;  5J4V A;  2OA7 A;  1M7T A;  4K7O A;  1W89 A;  4YAP A;  1XWA A;  3PPU A;  3IHG A;  3KJY A;  2H6X A;  3IRA A;  2V6O A;  2YWI A;  1V2A A;  3MSZ A;  2YV9 A;  4K9Z A;  4NWY A;  5A1N A;  3HYP A;  3J7Y b;  5GAP D;  2GZZ A;  3FRC A;  4GTU A;  1BAY A;  2FWH A;  2YWM A;  4DVC A;  3KP9 A;  2P5Q A;  4RQR A;  3RDW A;  1GNW A;  3QMX A;  3U6V A;  2YZH A;  3CMI A;  2PWJ A;  3P2A A;  4KSM A;  2O87 A;  1VF2 A;  2LS5 A;  4G9H A;  1XWK A;  1HNA A;  6GSX A;  1ZZY A;  4GF0 A;  2B6M A;  1TK0 B;  4IP1 A;  17GS A;  4IJ3 A;  3GKM A;  1R5P A;  1T00 A;  2PU9 C;  3WGD A;  5ECL B;  4G0I A;  2IIY A;  3G7J A;  2B7K A;  4N0Z A;  4ML1 A;  4GDF A;  1T4Z A;  4KUN A;  3ZRD A;  1K0D A;  1O73 A;  3HVV A;  1YKA A;  2HSN B;  4MPF A;  1OC8 A;  4K6X A;  1FHE A;  4CW9 A;  4JRR A;  1FB6 A;  2JU5 A;  2VM2 A;  2WFC A;  2BTO T;  1WJK A;  3N9J A;  1PQN A;  3M9K A;  1PKW A;  3TGZ A; 
#chains in the Genus database with same CATH homology
 3C1S A;  1EEJ A;  3C1R A;  3ZIT A;  1MD4 A;  5B7C A;  2JZR A;  5DAL A;  4XIH A;  4MF7 A;  2C4J A;  1Z5Y E;  2B7J A;  1YY7 A;  3HHV A;  4HJM A;  1QMV A;  3Q74 A;  2YJH A;  5CRW A;  2MZC A;  3HZ4 A;  1SKW B;  2L6D A;  2WS2 A;  1VF1 A;  1GUK A;  1A23 A;  2H8L A;  1JFU A;  1Z9H A;  4EVM A;  1WE0 A;  4PUA A;  1S3A A;  4WKW A;  4YQU A;  4XS6 A;  1A2M A;  2GSQ A;  3LFL A;  4JZQ A;  4NXI A;  4ECC A;  3ZVJ D;  4NV5 A;  3WD6 A;  3F3R A;  4J57 E;  2L4C A;  2C0D A;  1SU9 A;  2QA1 A;  3GUS A;  2AUV A;  5IIZ A;  11GS A;  4PUF C;  4ZL8 A;  1F3B A;  2L5L A;  4EIQ A;  3I6A A;  4OD7 A;  4AI6 A;  2VIM A;  1PMT A;  3VWU A;  3FR3 A;  3F6D A;  2LUS A;  3F4S A;  2LQQ A;  4DSQ A;  2CQ9 A;  1RW1 A;  2HE3 A;  1JLW A;  2K9F A;  5CRH A;  1YKC A;  3GUR A;  2CV4 A;  2HZF A;  3KP8 A;  4V2M A;  1A8Y A;  3HY2 A;  1K0A A;  1SYX A;  1DSB A;  4OCF A;  1S3D A;  4HQZ A;  1J0F A;  3EWL A;  3F8U A;  3AY8 A;  2LV3 A;  2DBC A;  4WF5 A;  4Z2T A;  5DAK A;  2OJL A;  3EU4 A;  4LMV A;  3KEB A;  5IQY A;  4CDO A;  3TKQ A;  2VUP A;  1WP0 A;  2ZCT A;  4I2T A;  1PL1 A;  3CWG A;  2A4V A;  4K1F A;  5HR3 A;  3DIE A;  1V58 A;  2HSM A;  2O89 A;  2PPT A;  3FKF A;  3ZIV A;  1QGV A;  5F07 A;  1SYR A;  2CVD A;  1HQO A;  5AIS A;  2VLU A;  5JWR B;  1F2E A;  3L9V A;  4NAX A;  1SD8 A;  2PN8 A;  4KF9 A;  2DLX A;  1BYE A;  5B8A A;  2FA8 A;  2HXK A;  1AUC A;  5ABR A;  3Q19 A;  5JCG A;  2DJJ A;  4MJB A;  1MEK A;  4NV2 A;  4F9Z A;  1XPV A;  2R0P A;  1SK2 A;  2FWE A;  2H1A A;  5DJL A;  1R4W A;  1DE2 A;  1KEB A;  1LJR A;  1WWJ A;  3EYT A;  4IP6 A;  18GS A;  4JED A;  2FWG A;  1WMJ A;  3GV1 A;  3IXR A;  1LU4 A;  4EXJ A;  1J9B A;  2DIY A;  1EGO A;  3A2W A;  2B3S A;  2LRC A;  3L0H A;  4BVY A;  1G7O A;  4GSS A;  4OFM A;  3IR4 A;  4E68 A;  1TRV A;  2I81 A;  1TU8 A;  5IMZ A;  5IPG A;  1JZW A;  2VLV A;  5COH A;  2GLR A;  3IHQ A;  3HCZ A;  4MF6 A;  1DUG A;  1OVN A;  5D9X A;  2VL9 A;  5DAL B;  1B8X A;  1MDJ A;  4PTS A;  2YPM A;  4KA0 A;  4HQS A;  4ZB8 A;  2M46 A;  4IN0 A;  4V1A g;  4O92 A;  3R3E A;  4BA7 A;  1YF0 A;  5CYY A;  3EVI A;  4JBB A;  1FB0 A;  4ECJ A;  2OBI A;  3EC3 A;  3F63 A;  3ZZX A;  1G6Y A;  4V2N A;  2A4H A;  5D8I A;  1TTZ A;  4F0C A;  5HQP A;  1Y6E A;  4HS1 A;  2HLS A;  1TI1 A;  2XPE A;  5A34 A;  5IOX A;  2H76 A;  2L59 A;  2H72 A;  3HDC A;  1GUM A;  1TK5 B;  1O7U A;  3BCI A;  2H01 A;  1OC9 A;  1BJX A;  1MD3 A;  2N5A A;  3FHK A;  3FR9 A;  1THO A;  3ZFB A;  4IKH A;  1ML6 A;  3CTG A;  1F37 A;  5G5E A;  5ECP B;  4WXT A;  5D93 A;  2CX4 A;  3FMW A;  1PX7 A;  2QC7 A;  2YWO A;  1UN2 A;  5DQY A;  1ERV A;  4QQ7 A;  3TOU A;  3DD3 A;  3GKK A;  2GSR A;  4KDU A;  4TN8 A;  1FOV A;  2LEG A;  1MDK A;  1XW6 A;  3IPZ A;  1AQX A;  2HFD A;  2MMN A;  2VLT A;  4GQC A;  4MAB A;  1OAZ A;  5AN1 A;  1K0C A;  3H79 A;  1N8J A;  4G01 A;  2JSY A;  5B8B A;  1VRS D;  4RQX A;  2GVP A;  3UL3 A;  2C3N A;  4JR6 A;  3IAS 2;  2QSI A;  3D4T A;  4IQ1 A;  3VWW A;  1SEN A;  4BWQ A;  1VF3 A;  2OT3 A;  2H6Z A;  2KOK A;  3ERG A;  5DAK B;  4RI7 A;  1T3B A;  1K3L A;  1R5A A;  2OAC A;  3CTF A;  1F9M A;  4KX4 A;  1GP1 A;  2EFD A;  4BL7 A;  2NBS A;  1V98 A;  4ZIL A;  1E6B A;  2FHE A;  3GL3 A;  1NM3 A;  2H6Y A;  1PX6 A;  2V1M A;  3ME8 A;  2GTU A;  5BMU A;  2RLI A;  2LJK A;  1SD9 A;  4MMM A;  4XS1 A;  3U5R E;  3GX0 A;  3MAK A;  2GT6 A;  5JWO B;  4WR5 A;  2ON5 A;  1SK1 A;  1TOF A;  3D4M A;  2V2G A;  3VWV A;  4G2E A;  2PVO C;  3ZLP A;  2O8V B;  5L71 A;  5G2Z A;  4TR1 A;  2L57 A;  5J5N A;  1ZGN A;  3GMF A;  3EUR A;  4PQH A;  2GGT A;  4ZB7 A;  3DGQ A;  3P7X A;  5H5R A;  4PX1 A;  3KH7 A;  3P90 A;  1EGR A;  4BVY B;  4KAE A;  3VFI A;  3TJK A;  1YZX A;  3GX8 A;  3CBU A;  2WZ9 A;  4MJA A;  2IME A;  1PA3 A;  5BRT A;  1F6M C;  3FR6 A;  1V9W A;  2FCH A;  1OYJ A;  3KXO A;  2H70 A;  3FY7 A;  2EFC A;  1XOA A;  1B9X C;  5DCG A;  2AJQ B;  3D0Z A;  4RI6 A;  4PNF A;  2HNL A;  3HJP A;  2R3X A;  4WEY A;  1Y1U A;  1ERT A;  1A0R P;  3I43 A;  2YZU A;  3LEF A;  3UBL A;  2HRF A;  2C0G A;  2V32 A;  2NDO A;  4BPY A;  1THX A;  2H71 A;  5GAN D;  3F9U A;  3VI5 A;  3US3 A;  5DCH A;  5J3R A;  2GZY A;  5F05 A;  3E9J B;  4GCI A;  1GTA A;  2PMT A;  1OKT A;  1I5G A;  5A34 B;  2LQO A;  5KN1 A;  4HDE A;  2C8U A;  1GUH A;  4GQF A;  1GSS A;  1OC9 B;  5CAX A;  3E0U A;  1GLP A;  2WCI A;  4O5U A;  3HKR A;  4FQU A;  4G0L A;  4KDX A;  2EIO A;  2CVB A;  1M99 A;  3APS A;  3M8N A;  2DKH A;  2KLX A;  1R7H A;  5ID2 A;  2ON7 A;  3IOS A;  5LNK e;  3CRU A;  3GST A;  3UEM A;  4AF2 A;  4HZ2 A;  1GSE A;  5JCW A;  3O76 A;  4YKF A;  2CZ3 A;  1HYU A;  3VPQ A;  3ZYW A;  1K0B A;  1YDK A;  2IN3 A;  4YAV A;  2EIR A;  1EV9 A;  4Q5F A;  2GSS A;  3ZTL A;  4ZBB A;  6GSS A;  2HRK A;  1SL1 B;  4V1A p;  1K0O A;  1YJ6 A;  1YEP A;  3SBC A;  4N3Z A;  3ERW A;  4GRF A;  2PUK C;  2LRN A;  3DKS A;  2YAN A;  2O85 A;  5JCU A;  5B6N A;  1TK8 B;  3GRX A;  5ECN B;  4G19 A;  4BL7 B;  5HR0 A;  1A2L A;  1OE7 A;  3GIX A;  3IC8 A;  5DVB A;  4X1U A;  2E7P A;  2OBK A;  5BMU B;  4I2U A;  4E8E A;  3LYK A;  3DWV A;  2MMO A;  1SL0 B;  4QMK A;  3BJ5 A;  3A2X A;  2TRC P;  1AW9 A;  1TKD B;  5IO0 A;  1SKR B;  1SL2 B;  2OE0 A;  2RUF A;  3KTL A;  1KTE A;  3I9V 2;  2P31 A;  3KH9 A;  4TR1 B;  4EL1 A;  1TRW A;  4ZL9 A;  1GSF A;  3LYP A;  3ED3 A;  2C1Y A;  4TVE A;  3F3Q A;  1DBY A;  1PKZ A;  5IMA A;  2A2R A;  5JWQ B;  3EU3 A;  2DC5 A;  9GSS A;  4FYU A;  3TJB A;  2QKE A;  1BF5 A;  2LNS A;  4DEJ A;  4MPG A;  2Z9S A;  3QOU A;  4LLR A;  4IS0 A;  5G1K A;  1JZD A;  5D96 A;  3UOM A;  4ISD A;  2GZP A;  1OC3 A;  4FYB A;  4K2D A;  4YH2 A;  2GQL A;  1JZR A;  1ACV A;  2LJR A;  4EO3 A;  1ZYN A;  3ERF A;  1A2J A;  2H73 A;  1TRU A;  2JAD A;  4NMU A;  2OKA A;  2YN1 A;  4NPB A;  2LKU A;  2JZT A;  4ML6 A;  2CT6 A;  2WJU A;  4KB3 A;  2X49 A;  5H5Q A;  3APQ A;  4WET A;  1ERU A;  1WOU A;  3QFA C;  3F6F A;  3C7M A;  1EP8 A;  4PGT A;  1TXX A;  2VOC A;  2B5E A;  3ZL5 A;  5J9C A;  1QFN A;  2HQT A;  2WGR A;  4TXO A;  3QAG A;  16GS A;  4TR0 A;  5J9B A;  4IW9 A;  4FYC A;  3O3T A;  4AKG A;  2I1U A;  5CRE A;  1YEX A;  2FY6 A;  5C00 A;  1H75 A;  1M9B A;  1F3A A;  1X5C A;  5A1N B;  5J40 A;  4K2X A;  2F8F A;  3GN3 A;  4HZ4 A;  2H1D A;  3QAV A;  7GSS A;  5GSS A;  2X8H A;  1URM A;  4KSO A;  2O7K A;  1SJ6 A;  4EIP A;  3CSI A;  5FHI A;  3D22 A;  3GNJ A;  2QGV A;  3GH9 A;  1XVQ A;  3UAP A;  1BX9 A;  2EC4 A;  1Y25 A;  2IL3 A;  5GST A;  2B5X A;  1FVJ A;  3MWH A;  3LOR A;  3M0F A;  2OAD A;  4MCU A;  2ES7 A;  3FZ9 A;  4L5L A;  4LMW A;  1ON4 A;  4EUY A;  2DSA A;  3TCO A;  5DJM A;  2KHP A;  4CY8 A;  4OCE A;  4X0X A;  3RPN A;  3LGC A;  1AQV A;  3IA1 A;  5G1L A;  5LCZ A;  2GS3 A;  3Q6O A;  1B48 A;  5G31 A;  2F8A A;  1TJD A;  1Z7P A;  3L9S A;  2AAW A;  2J9H A;  3IE3 A;  5G30 A;  2LST A;  3HXS A;  4N10 A;  2HSY A;  3F4R A;  4X43 A;  4MJE A;  1WIK A;  1G0T A;  1EZK A;  2RM5 A;  5AIV A;  3M9J A;  3WGX A;  3FK8 A;  4P3Y B;  2KP1 A;  5KOX A;  3LJR A;  1PN9 A;  2N5B A;  3TKR A;  2CVK A;  4HEA 2;  1Q98 A;  2FGX A;  4MLY A;  5IMC A;  2H30 A;  4GSN A;  1FVK A;  2LNT A;  5J4Y A;  3ZRE A;  1KNG A;  3GKX A;  3DYR A;  3W8S A;  3LW9 A;  4K0G A;  4TRX A;  2UZ8 A;  1GRX A;  2R6K A;  3I69 A;  2F51 A;  5D9V A;  3NZN A;  5ECI B;  1Z3E A;  1YQ1 A;  3EIN A;  1NSW A;  2LTK A;  5AIX A;  4MZW A;  4Z2R A;  4D73 A;  5GZZ B;  1EOG A;  2P0G A;  2MMA A;  1GWC A;  1SJZ A;  19GS A;  5KN0 A;  4TKY A;  1BG5 A;  2DKI A;  1GL8 A;  3EMX A;  3HVS A;  4KCE A;  4F0B A;  1GSD A;  3R2Q A;  2ALB A;  3GH6 A;  5IMD A;  14GS A;  3BOA A;  1U3A A;  3TJG A;  4AKX B;  4EF0 A;  3D5J A;  5DDL A;  1XIY A;  1A0F A;  2VL2 C;  4G0K A;  1GTB A;  3C73 A;  2X64 A;  1FW1 A;  5IM9 A;  2AV4 A;  1NHO A;  2JAC A;  2H0H A;  3G9B A;  4Q5Q A;  4GLT A;  5ECM B;  1PN0 A;  2WRT A;  5ELA A;  2V41 A;  2IPA A;  2MBS A;  4CY6 A;  2EFE A;  3Q18 A;  4YQV A;  4IGJ A;  5D9T A;  5F06 A;  6GSW A;  3C8E A;  2GDR A;  5KEJ A;  3LXZ A;  4TXO B;  3RHC A;  1PD2 1;  1R26 A;  1PRX A;  1BED A;  4GXZ A;  1ZMA A;  2YWN A;  4XCS A;  3DXB A;  1XWG A;  4PUR A;  2PVQ A;  2HSM B;  1PSQ A;  3FZ4 A;  4EKZ A;  3TU3 B;  2FLS A;  2DJK A;  2D2Z A;  3GTU A;  4EDY A;  1AQW A;  3NIV A;  2R2J A;  2FWF A;  4L0U A;  4K7I A;  2HSN A;  1FAA A;  3IK7 A;  4AKH A;  1EEM A;  2NVL A;  2CX3 A;  2KUC A;  4LL4 B;  5ENU A;  1U88 A;  1B4Q A;  2A2S A;  2O5V A;  2R0C A;  3IV4 A;  4K8M A;  1UA5 A;  5KN2 A;  1TU7 A;  2KP2 A;  4WBJ A;  3UVT A;  2P5R A;  2LJA A;  5ECO B;  1U87 A;  1ZYQ B;  1U3I A;  6GST A;  5EY6 A;  4LA1 A;  1HD2 A;  4POB A;  2AHE A;  4I8B A;  2H75 A;  2FUG 2;  3LQ7 A;  4MK3 A;  1USB A;  3HA9 A;  3TB2 A;  1ERW A;  1QUW A;  2EIQ A;  1Z6N A;  1JHB A;  4ZL7 A;  2VO4 A;  2VL2 A;  1GNE A;  4TW5 A;  3PH9 A;  4ILF A;  2VCX A;  3UIW A;  3ME7 A;  5INY A;  2H0G A;  3UVH A;  2VD0 A;  5EVO A;  4WF4 A;  5CNW A;  2R4V A;  2XBQ A;  1X0R A;  1NHY A;  4PNG A;  3H4K A;  2YP6 A;  3TUE A;  4K7N A;  5G5F A;  1YF1 A;  2TRX A;  1BQ7 A;  2V6K A;  1ILO A;  1K3O A;  4EC0 A;  4O5R A;  4G10 A;  5KN3 A;  4AGS A;  3H8Q A;  2I9H A;  2RII A;  3E3E A;  3CSH A;  4YKG A;  3KGK A;  5ECK B;  3A5W A;  1GSQ A;  4BVX A;  3DVW A;  4D73 B;  4IJI A;  1SVL A;  1O85 A;  4TR3 A;  2H66 A;  2DJ2 A;  1OKD A;  3KZQ A;  1BG1 A;  2R37 A;  2R0G A;  4QL7 A;  4V2L A;  4W66 A;  5J47 A;  2IJY A;  1GTU A;  5ECS A;  1SJI A;  3VK9 A;  5A4V A;  5HFK A;  2BMX A;  1M2D A;  2C0F A;  1G6W A;  1UVZ A;  5ECH B;  5ELG A;  1ZCP A;  3CRT A;  2IMD A;  4K5R A;  1HNB A;  3ZMK A;  1PGT A;  3RAZ A;  1B9Y C;  1XXU A;  4MJC A;  5A5H A;  2HZE A;  4KCA A;  3UMA A;  4ULX A;  5F8B A;  1TW9 A;  2WUL A;  3KIJ A;  3MNG A;  3DEX A;  4K0N A;  2VD1 A;  3WYW A;  3V1W A;  4E8H A;  3A5I A;  3TOT A;  4O7H A;  2H1B A;  1Z6M A;  4IQA A;  2TIR A;  2NPB A;  4J56 E;  3UJ1 A;  1O8W A;  1XCC A;  4A5P A;  2C0E A;  4I97 A;  5ECQ B;  3G7Y A;  1ZYE A;  2ZUP A;  3ZFL A;  3TKS E;  1JZO A;  3HD5 A;  3TKS C;  1X9S B;  2YV7 A;  1VGL A;  2C3Q A;  2JSZ A;  1EP7 A;  8GSS A;  2E2M A;  1ZL9 A;  4IHU A;  1J08 A;  2CA8 A;  3GTU B;  4L5O A;  5LD0 A;  3EMP A;  1K0M A;  3C71 A;  4J2F A;  3MYD A;  1G7E A;  1B4P A;  4I5Q A;  3O6T A;  2X99 A;  4PQ1 A;  2PER A;  1M2B A;  5IPH A;  5ECR B;  3PGT A;  2CAQ A;  3QDN A;  4Z2U A;  4PQI A;  1T8E B;  5IMF A;  1M9A A;  4WBR D;  5FT3 A;  1OE8 A;  3EPT A;  2DJ1 A;  3WT2 A;  4USS A;  2REM A;  1O8X A;  2H19 A;  4JE1 A;  5CP1 A;  2MBT A;  5A5K A;  1W4V A;  3A3T A;  2VL3 A;  4L0W A;  4LL1 B;  5C04 A;  3UBK A;  4YQM A;  1LBK A;  3SWL A;  4XHM A;  1XVW A;  22GS A;  4PXO A;  4CHS A;  1H4O A;  3TRX A;  4ZB6 A;  3GFK A;  4K5S A;  2XPD A;  4ACS A;  4MA9 A;  5IMV A;  1XFL A;  1A24 A;  1XW5 A;  2L5O A;  1K3Y A;  3L4N A;  3S9F A;  2CZ2 A;  3M3M A;  4ZBD A;  1ABA A;  1SVM A;  5A4W A;  1FOH A;  6GSU A;  3HZ8 A;  4RUV A;  1X9W B;  1V40 A;  2H0I A;  2ZNM A;  2DJ3 A;  1U6T A;  3GA4 A;  4KDY A;  1TI3 A;  3D21 A;  3OR5 A;  3D6I A;  3BBY A;  3CXG A;  4ZXG A;  2J23 A;  1C72 A;  4AKI A;  5CRG A;  1O81 A;  4ID0 A;  4DSR A;  1Z7R A;  3APO A;  4XRD A;  2GQK A;  3NOF A;  2PGT A;  4OFT A;  2B1L A;  2IFQ A;  1A8L A;  2I3Y A;  5F0G A;  1WPI A;  3TKP A;  3J7Y k;  5EL8 A;  4JR4 A;  3DRN A;  2VCT A;  4MH3 A;  2K8S A;  3KD0 A;  5EPF A;  5H5S A;  4FH8 A;  1SVO A;  1M0U A;  4XS4 A;  2WB9 A;  1N2A A;  5KOW A;  4NHW A;  4L8E A;  1QK8 A;  4N11 A;  4BVX B;  3CSJ A;  3QR6 A;  4MDC A;  4IVF A;  3H93 A;  3QD9 A;  3TKS A;  1TXU A;  5A4U A;  3HVX A;  4TR4 A;  3QCP A;  5HR2 A;  3W6G A;  1FO5 A;  4MH2 A;  2JL4 A;  4ECI A;  3PIN A;  4POL A;  4F2I A;  3P8W A;  1GSY A;  1O6J A;  2XHF A;  1EWX A;  20GS A;  2AB6 A;  5D73 A;  2DML A;  2JZS A;  5ID2 B;  3CYN A;  2H1L A;  1ZYP A;  2HI7 A;  2HRN A;  4MNN A;  3FEU A;  4AJ6 A;  3PR8 A;  3ZML A;  1E2Y A;  3F4T A;  2HYX A;  3GSS A;  4ZBA A;  2YNX A;  5B6M A;  4O32 A;  4BWS A;  5A5H B;  2HZE B;  2A2P A;  4GWR A;  3BD2 A;  2K6V A;  1AIU A;  1GTI A;  2HRK B;  5DQS A;  2GQM A;  10GS A;  4WR4 A;  3TRQ A;  1QQ2 A;  3LXT A;  4ZB9 A;  3GKN A;  1CQG A;  3G7I A;  4H86 A;  3FZ5 A;  3N5O A;  3IC4 A;  4MF5 A;  5HFI A;  2EFH A;  2YJ7 A;  3TJJ A;  3VWX A;  2YOI A;  3RHB A;  4XRA A;  2VCV A;  6GSV A;  1GLQ A;  4Q5R A;  2RM6 A;  1RQM A;  1XW9 A;  1Q4J A;  4EDZ A;  4HOJ A;  2IMK A;  4POK A;  3VLN A;  4EE0 A;  5E4W A;  1FG4 A;  4MZC A;  1GH2 A;  3BCK A;  4F82 A;  4KH7 A;  4FIW A;  5CRD A;  2X8C A;  1UC7 A;  1EOH A;  3K8N A;  1PL2 A;  2H1G A;  5FWG A;  1IYH A;  1HNC A;  3IBH A;  3MDK A;  2VM1 A;  3KM6 A;  1XWB A;  1AC1 A;  1S3C A;  2QA2 A;  3JCM L;  4KE3 A;  3LG6 A;  3GHA A;  1CQH A;  3TRP A;  2F9S A;  4MZB A;  2X8G A;  2H74 A;  1V57 A;  1MDI A;  2VCW A;  4X4J A;  3HJM A;  3ZVJ A;  4HJ2 A;  2F3M A;  4I6X A;  1AAZ A;  4DSS A;  3DVX A;  2C80 A;  1X5E A;  1GSU A;  4OWY A;  1VF4 A;  3GYK A;  2R5G A;  4IBP A;  2I4A A;  5J41 A;  4N30 A;  1QXH A;  4QL9 A;  2FA4 A;  2IWT A;  2E2G A;  2NTO A;  2IMF A;  1JLV A;  4AJ7 A;  3IAM 2;  4FO5 A;  4HU9 A;  1TDI A;  2GT5 A;  1TP9 A;  2G2Q A;  3MIX A;  1SKS B;  2IMI A;  2OE1 A;  4AJ8 A;  3LWA A;  2L6C A;  3ZIJ A;  2K8V A;  2B1K A;  2VAF A;  2FNO A;  3VI7 A;  2FD3 A;  4HUA A;  1AXD A;  2G0F A;  4HU7 A;  3LSZ A;  3VPT A;  1WRY A;  2DJ0 A;  2IFQ B;  5IOW A;  2XBI A;  1NW2 A;  2VCQ A;  1ZOF A;  4OO4 A;  2MMZ A;  2M80 A;  3TDG A;  4XS4 B;  2LRT A;  4GST A;  1XBS A;  4OFN A;  2VCZ A;  1SK0 A;  1I9D A;  2XC2 A;  1T7P B;  4ZIJ A;  5E59 A;  1X9M B;  4OO5 A;  3WT1 A;  1K0N A;  3IK9 A;  1N25 A;  4XTS A;  2WDU A;  3QFB C;  1YVL A;  4TOP A;  2E0Q A;  2GST A;  4O5Q A;  2DIZ A;  1ST9 A;  2YCD A;  1T4Y A;  3FZA A;  3W8J A;  5DBQ A;  3FYG A;  2M72 A;  2L4Q A;  13GS A;  4JU5 A;  4Z7X A;  4POM A;  3HJO A;  4OMV A;  4NHZ A;  4MP4 A;  2HT9 A;  2K18 A;  2CAI A;  2DMM A;  3DML A;  5D9W A;  3IDV A;  3HMJ G;  1T1V A;  4KW6 A;  5HR1 A;  4IEL A;  2BJX A;  1RK4 A;  3L78 A;  3L9U A;  2MYG A;  12GS A;  5HFG A;  3RBT A;  1MTC A;  2X4A A;  1GUL A;  3KMN A;  4ICY A;  4HI7 A;  2UV8 G;  4TXV A;  4KND A;  2PBJ A;  3ISO A;  6GSY A;  5J4U A;  2RUE A;  3TJF A;  2AYT A;  3A2V A;  1KBN A;  3KMO A;  3WGE A;  3UAR A;  1XWC A;  3KCM A;  4Q5N A;  1X5D A;  3F0I A;  1IYI A;  3VUR A;  2HRA A;  3FW2 A;  3GL5 A;  5CO3 A;  1XOB A;  3RPP A;  3KTB A;  1M2A A;  1DE1 A;  3EE2 A;  2VKZ G;  4ECB A;  1EV4 A;  2HSH A;  2OE3 A;  2C3T A;  3H1N A;  5IO2 A;  4F03 A;  1XZO A;  3M1G A;  4KGI A;  4N0V A;  2N5F A;  2B5Y A;  5AGY A;  3QAW A;  3QPM A;  1TRS A;  4DSS B;  5J4V A;  2OA7 A;  1M7T A;  4K7O A;  1W89 A;  4YAP A;  1XWA A;  3PPU A;  3IHG A;  3KJY A;  2H6X A;  3IRA A;  2V6O A;  2YWI A;  1V2A A;  3MSZ A;  2YV9 A;  4K9Z A;  4NWY A;  5A1N A;  3HYP A;  3J7Y b;  5GAP D;  2GZZ A;  3FRC A;  4GTU A;  1BAY A;  2FWH A;  2YWM A;  4DVC A;  3KP9 A;  2P5Q A;  4RQR A;  3RDW A;  1GNW A;  3QMX A;  3U6V A;  2YZH A;  3CMI A;  2PWJ A;  3P2A A;  4KSM A;  2O87 A;  1VF2 A;  2LS5 A;  4G9H A;  1XWK A;  1HNA A;  6GSX A;  1ZZY A;  4GF0 A;  2B6M A;  1TK0 B;  4IP1 A;  17GS A;  4IJ3 A;  3GKM A;  1R5P A;  1T00 A;  2PU9 C;  3WGD A;  5ECL B;  4G0I A;  2IIY A;  3G7J A;  2B7K A;  4N0Z A;  4ML1 A;  4GDF A;  1T4Z A;  4KUN A;  3ZRD A;  1K0D A;  1O73 A;  3HVV A;  1YKA A;  2HSN B;  4MPF A;  1OC8 A;  4K6X A;  1FHE A;  4CW9 A;  4JRR A;  1FB6 A;  2JU5 A;  2VM2 A;  2WFC A;  2BTO T;  1WJK A;  3N9J A;  1PQN A;  3M9K A;  1PKW A;  3TGZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...