3HJOA

Crystal structure of glutathione transferase pi y108v mutant in complex with the glutathione conjugate of ethacrynic acid
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
209
structure length
209
Chain Sequence
PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIVTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase P
publication title Influence of the H-site residue 108 on human glutathione transferase P1-1 ligand binding: structure-thermodynamic relationships and thermal stability.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 81
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2009-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3hjoA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3hjoA01
4PQHA 2BTOT 2WFCA 5CP1A 2VL9A 2PVOC 4YQVA 3UOMA 3LXZA 5B8BA 2GZZA 2B3SA 2WZ9A 3D22A 2VCQA 5IO2A 3RPPA 3GRXA 1SJZA 4WETA 2HT9A 3UARA 2LRTA 4IQAA 2B1KA 2PWJA 5DJMA 2YWNA 14GSA 2LJRA 1K3YA 3PR8A 5J9BA 3H8QA 4XRDA 1QGVA 3RDWA 3DKSA 5J41A 5KN2A 3CXGA 4GXZA 2JSYA 1F6MC 3HHVA 1V9WA 3FHKA 2B6MA 1K0BA 3TGZA 4YH2A 1S3CA 5A5KA 1F9MA 2A2RA 2YV7A 2LQQA 4CHSA 2HYXA 1ZYQB 1TK0B 5H5SA 1K0MA 1EWXA 3ZFBA 1VF2A 4I2TA 1U6TA 2V2GA 1W4VA 1B8XA 3VK9A 1LBKA 4G2EA 4WF4A 1ML6A 1F2EA 1JZWA 5IMZA 3LYKA 4KAEA 4DSQA 2B1LA 3ZMLA 2V6KA 1USBA 1ON4A 4RUVA 1DSBA 1Z9HA 1SKWB 1RW1A 3KXOA 4JEDA 4BVYA 3IAM2 4L8EA 5ECIB 2ON7A 4QL7A 3LEFA 2PBJA 5DQYA 3MNGA 4G9HA 2RUEA 1GTAA 1VF3A 2VD0A 5B6MA 4V1Ap 4HJ2A 4XS6A 1JZOA 2CX4A 2IMFA 3ZLPA 4HOJA 2K8VA 1TTZA 1NSWA 4FH8A 3LGCA 1K0DA 3LJRA 2C8UA 1YZXA 1SK1A 1XBSA 22GSA 4FIWA 1HNCA 2PMTA 4GSSA 1MDKA 5CAXA 3UIWA 2OE3A 1QMVA 2GSTA 1OKTA 4HZ4A 4ZB9A 3F9UA 3HJMA 5DJLA 1YKCA 4IELA 2LEGA 2DJ1A 1T7PB 4FO5A 1TK8B 1GH2A 5F07A 1B48A 3UMAA 3RPNA 3UEMA 1X5CA 3EMXA 3M3MA 1TRWA 2L57A 2HSHA 2H66A 1OKDA 1ILOA 1X9WB 4PX1A 3KM6A 2OKAA 2FWGA 2VLUA 1MD3A 2I3YA 2DMLA 1SKSB 3ZMKA 3M1GA 2MBTA 4HQSA 3IE3A 2CX3A 5IPGA 2VAFA 5FT3A 4WF5A 4GSNA 1DUGA 3D5JA 4XTSA 1R7HA 2F9SA 1PN9A 1AUCA 4WR4A 5G5FA 4AJ8A 3LXTA 4KH7A 4BVXB 4JRRA 4KSOA 5COHA 5B8AA 5CREA 4K6XA 3FZ4A 1BG5A 1QUWA 2O8VB 1WIKA 5AN1A 2P31A 2HQTA 3H4KA 4EDYA 3KP8A 3DMLA 2GZPA 1RQMA 1M2AA 4PTSA 1YF1A 1AC1A 3EWLA 3ZVJA 8GSSA 3FYGA 4ML6A 4ECJA 2HI7A 1GTUA 3F6FA 3CYNA 2GS3A 1GSQA 1GSDA 4K1FA 3F4RA 4EUYA 3GUSA 2H8LA 3Q19A 3HZ8A 4K8MA 3HDCA 4WEYA 4HI7A 1K0OA 2H1AA 4XCSA 2H6YA 1K0AA 2X64A 1R4WA 3WGEA 4YAVA 3FK8A 4I2UA 3GH9A 2P5RA 1K3LA 2MMNA 4TXOB 2M46A 1AAZA 1WMJA 3EU3A 1M2BA 3GURA 4IN0A 3K8NA 2FWEA 5IIZA 2NDOA 5E59A 2GT6A 4V2LA 4G10A 3GNJA 4ID0A 4KDXA 3FRCA 3FR9A 2DC5A 3QDNA 3TRPA 1J9BA 1TKDB 1ABAA 1FG4A 2FCHA 1VF4A 2TIRA 4K9ZA 1UN2A 3EU4A 2FHEA 1QXHA 4MH3A 3TOTA 2H30A 3CBUA 2E2MA 1JFUA 3GTUA 2YV9A 2VLVA 4MJBA 1H75A 2XBQA 2DLXA 4XIHA 3Q74A 1F3BA 1FOVA 4TKYA 5JWRB 3VPTA 4TRXA 3W6GA 2HRNA 2C0FA 4PUFC 3IC8A 4NHZA 1R5AA 5D9XA 2N5AA 2QKEA 2VCXA 1M2DA 1QQ2A 3QFAC 4D73A 2FGXA 1ZYEA 2C0EA 3TKSE 2H76A 5ID2B 2K8SA 1A24A 1FAAA 4E8HA 3GA4A 2FD3A 4KDYA 3VWUA 2F8FA 2ALBA 3NIVA 1K3OA 3LFLA 3G7IA 4POMA 5G2ZA 3C1SA 5G31A 2H70A 4F0BA 2YCDA 2IFQB 5ECKB 4MF7A 2V41A 1VF1A 1YDKA 3BJ5A 4MMMA 1IYHA 3LSZA 2EIQA 3ZFLA 3L0HA 4TR4A 3L4NA 3HZ4A 4KE3A 5CRDA 1GUHA 5IMFA 2H71A 2X8HA 4JE1A 3H93A 1NHOA 3ED3A 1KEBA 3NOFA 3US3A 2QSIA 2VCVA 2JU5A 2ZCTA 4Q5FA 3CRTA 4PQ1A 4PXOA 20GSA 4ML1A 3GYKA 4KW6A 3EINA 1OYJA 5ECHB 4KB3A 3TB2A 1V57A 2IWTA 2PERA 3D4MA 1TRUA 3U5RE 5IMAA 1FVJA 3A3TA 4IJ3A 1OAZA 3GL5A 1URMA 5J3RA 1SD9A 3RAZA 5J5NA 3PGTA 1MEKA 1XW5A 1FB0A 5ECPB 1C72A 2H73A 2C0DA 2KLXA 4OD7A 1A0RP 4KCAA 3UBKA 1T4ZA 3M8NA 4KNDA 2X8GA 4QQ7A 3BBYA 3FZAA 4EO3A 4H86A 3F6DA 2H6ZA 3E9JB 1GL8A 3WD6A 4K0GA 2ES7A 4IGJA 4MP4A 1Z3EA 3ERWA 3KJYA 1HD2A 5IM9A 4RQRA 2Z9SA 2WDUA 4EE0A 4BVYB 1V2AA 3IK7A 1SYRA 1GUKA 4GF0A 3E3EA 3CSHA 4HS1A 2PU9C 1XZOA 4LLRA 2H0HA 2N5BA 4MZWA 2JACA 4PURA 1EGRA 4IP1A 4PGTA 5GZZB 2RM6A 6GSYA 2CA8A 1N8JA 1YKAA 2GQKA 2NVLA 3TDGA 1K0NA 4TR3A 3PPUA 1SL2B 2OADA 1TP9A 5D9VA 2WCIA 3QFBC 1MDJA 1SL0B 4X43A 4MPGA 2LJKA 3RBTA 4YQMA 4ZXGA 3TOUA 3D21A 4MLYA 1E2YA 2E7PA 3FR6A 2AJQB 1XWAA 1GSSA 2CAQA 2YWIA 2VO4A 4EXJA 2IN3A 2GTUA 2YJHA 3ZRDA 1TK5B 5DALA 1YQ1A 5DBQA 2PPTA 4JBBA 2AYTA 1BEDA 3F4SA 4KUNA 1ZMAA 2R2JA 1B9XC 5B6NA 1G7OA 4NV2A 5J4UA 5CRGA 4ECIA 5DAKA 2UZ8A 5JWQB 3QPMA 1XIYA 3GIXA 2PN8A 1G0TA 11GSA 1WWJA 5CRWA 1GSUA 2FLSA 4IKHA 1PX6A 1LJRA 3KGKA 1BX9A 1W89A 4MJCA 2VL3A 2YN1A 6GSVA 2GT5A 5IMCA 1PA3A 2JL4A 5AIXA 1DE2A 2FA8A 4WXTA 3EURA 3KCMA 3HVSA 2MZCA 4XHMA 3TRQA 3ZL5A 1SYXA 2HZEB 5DQSA 1QFNA 3WYWA 2HRKA 1BYEA 4GLTA 4V2MA 4GWRA 1M9BA 5ECRB 5GAND 2MBSA 1VGLA 1XWCA 5CYYA 2R4VA 1SL1B 2NPBA 1IYIA 4WBRD 2GSSA 1TI3A 1MTCA 2YNXA 1TRSA 4N11A 4EKZA 2N5FA 1SJIA 3O6TA 1PGTA 2GQLA 5KEJA 2E2GA 4KA0A 1FHEA 4MPFA 1O8XA 4IS0A 3IAS2 1OC9A 2ZNMA 1B4QA 5DVBA 5ECOB 4Q5NA 4RI6A 1U3AA 2H0GA 3KTLA 1T1VA 4DSSA 2VOCA 1EP8A 2C80A 2DSAA 3DEXA 4DVCA 1EZKA 3F3RA 5GAPD 1X5DA 4ULXA 2KHPA 4TR1A 2TRXA 5D9TA 4PQIA 3WT1A 5CRHA 3GKKA 3C7MA 2DJKA 3IOSA 1HNAA 2R37A 3M9JA 1X5EA 2IPAA 2K9FA 4RI7A 3VFIA 1T4YA 2AV4A 4G19A 4XS4B 5IOWA 3APOA 1ACVA 5J9CA 1O73A 3CSIA 1S3AA 2LRNA 3IPZA 1ERUA 3JCML 4HUAA 4XRAA 2LKUA 2YWMA 1XFLA 3F0IA 3EYTA 3IBHA 5IPHA 3H1NA 2V1MA 4F82A 5C04A 2VD1A 2VCWA 4MJEA 3ZIJA 1GNWA 1Q4JA 4EF0A 1SK0A 1O7UA 1UA5A 3TJBA 3UL3A 3DVWA 5HFIA 2HSNB 2G2QA 4FYBA 2YOIA 3ZREA 3EC3A 2LV3A 3TKRA 5JCWA 2K6VA 2LRCA 1ZL9A 1WPIA 4L0WA 3P8WA 5ABRA 4JR6A 2R6KA 2KOKA 1GNEA 2WB9A 5EL8A 3M0FA 2PGTA 9GSSA 3PINA 2H75A 3APQA 1HQOA 3TRXA 2A2SA 3DRNA 2H6XA 5FWGA 2P0GA 1TRVA 4JZQA 3GX0A 1ZGNA 2VL2C 3DVXA 4MF6A 1OC3A 3FY7A 2YP6A 3KZQA 1SJ6A 4LMWA 5EVOA 3RHCA 1A2LA 1KNGA 5AGYA 4FYCA 5AISA 3GSSA 2IMIA 3VWVA 1G6WA 5ECLB 3P90A 1LU4A 3TCOA 1A8LA 1F3AA 4E8EA 18GSA 2V32A 2F51A 2XPDA 2D2ZA 4N30A 1ERWA 2NBSA 1V98A 4EC0A 4KGIA 2REMA 2GLRA 1U88A 3GKXA 2LSTA 3ZIVA 1T3BA 4MJAA 1HNBA 4CW9A 2DJ2A 2L4CA 2L5LA 1XWGA 4NMUA 1NW2A 3R3EA 4NV5A 2I4AA 6GSUA 2E0QA 4X1UA 4WR5A 5L71A 2C4JA 1A23A 1J0FA 1DE1A 4V1Ag 2C1YA 4OCEA 4ZBDA 2HNLA 1J08A 2RUFA 2RM5A 3HY2A 2I81A 4POBA 4DEJA 3EMPA 3WGDA 3CSJA 1M9AA 5ECQB 3L9UA 3F8UA 3LWAA 3WGXA 1A0FA 1XOAA 2GDRA 2I1UA 3IV4A 1JHBA 5G30A 4PNGA 3GV1A 1EV4A 4O92A 1R5PA 2HSMA 4ZIJA 2F3MA 4BVXA 3DIEA 2F8AA 4L5OA 2WULA 4ZB8A 5HR0A 1PMTA 3EE2A 1PL1A 2M72A 2VCZA 1YY7A 4ILFA 1Y6EA 2JSZA 2CVDA 2CQ9A 3FZ5A 3G9BA 2CZ2A 1JZRA 4X0XA 1FO5A 1EOGA 1O6JA 3KD0A 4G0KA 3W8JA 5DALB 2EC4A 3FW2A 2VCTA 2C3TA 4NHWA 1Z7RA 3J7Yb 2HLSA 2WJUA 3UVHA 2OE1A 4Z7XA 1X0RA 2JZRA 3C71A 1EEJA 3S9FA 4AJ6A 3HJOA 2ZUPA 1GULA 4WKWA 3O76A 5D73A 3ISOA 1BJXA 4O7HA 2DIYA 5IQYA 2ON5A 1XVQA 5F0GA 5DAKB 3GL3A 1Z6MA 3IK9A 2L5OA 4TW5A 2XHFA 5ECNB 2CZ3A 3VI7A 4OFTA 1XVWA 4I97A 1O8WA 2LQOA 2FWFA 3WT2A 2DIZA 1THXA 3W8SA 2LNSA 3TKSC 4TVEA 3IRAA 5B7CA 4MCUA 4MF5A 3TKPA 3LYPA 1UVZA 2KP1A 1U87A 3ME7A 2VM1A 1SKRB 3TKQA 5F8BA 1GSYA 3UJ1A 4HZ2A 2RLIA 3KH9A 3IR4A 4BA7A 2H01A 2FY6A 3VWWA 2EIRA 2MYGA 3P7XA 1K0CA 3HVVA 4GQFA 1EGOA 3I6AA 2FUG2 1TDIA 1GLQA 4YQUA 6GSXA 1I9DA 1PD21 2DBCA 4NWYA 1R26A 2B7JA 2OBKA 4NAXA 5CNWA 1XW9A 2CT6A 4IP6A 1OC9B 4FYUA 1B4PA 3SWLA 1ST9A 2IFQA 3I9V2 2V6OA 2H1DA 1GP1A 2CV4A 2IJYA 3A2WA 3H79A 2GSRA 5ELAA 1X9SB 3G7JA 3KTBA 1MDIA 4IHUA 5HR3A 5JWOB 4POKA 3QAVA 3ZYWA 3FZ9A 3IHQA 4BL7A 1B9YC 4TR1B 3I43A 2C3NA 1XWBA 3HJPA 1NM3A 3VI5A 4G0IA 3O3TA 2B5XA 3TJGA 3D0ZA 1TI1A 4LL1B 5ECSA 1AQVA 1AXDA 2X99A 5HR1A 2GGTA 1Q98A 3FKFA 5H5QA 4GRFA 1GTIA 5GSSA 1VRSD 4DSRA 2O7KA 2YPMA 3ZVJD 1GSEA 3GN3A 5F05A 2GQMA 1TJDA 3VPQA 2YZHA 1JLWA 3HCZA 17GSA 4OO4A 1YEPA 4EL1A 2C3QA 2H72A 2IL3A 3F4TA 5ENUA 5IO0A 1PQNA 2YJ7A 3HA9A 5AIVA 2HXKA 4ECCA 3V1WA 1MD4A 3FEUA 1WJKA 6GSTA 4ACSA 1T00A 2IMEA 5ECMB 4YAPA 3HD5A 1OC8A 1M0UA 2J23A 4J57E 1SK2A 1SENA 4EVMA 1Z7PA 2K18A 3CTGA 3UAPA 1DBYA 3UVTA 1BAYA 3KEBA 3J7Yk 1V58A 4K0NA 4AJ7A 3KMNA 3GHAA 4MZCA 2LJAA 2MMOA 1TOFA 3F63A 1A8YA 3Q6OA 4ZL8A 1TXXA 2VIMA 4HJMA 3PH9A 2AHEA 1WOUA 5DCGA 1ZCPA 3BD2A 4J2FA 1O85A 5DCHA 1N2AA 3MDKA 3KH7A 2OJLA 4XS1A 5G1LA 2OBIA 2PVQA 1FB6A 2I9HA 1PKWA 2XBIA 4KDUA 1E6BA 3R2QA 2VUPA 3N5OA 2R5GA 5G1KA 2JADA 4NXIA 2YWOA 5LNKe 4ZL9A 3U6VA 2GZYA 2HSYA 13GSA 3GTUB 5DDLA 2A4VA 2BMXA 4RQXA 5INYA 3IA1A 3SBCA 3ERGA 4ECBA 1BQ7A 1Z5YE 2TRCP 2NTOA 1G6YA 1OE8A 1WE0A 4TN8A 3DXBA 5KN0A 1AQWA 1A2JA 2IMDA 4I6XA 4O5RA 2JZSA 4HEA2 1THOA 3I69A 4D73B 1Z6NA 2RIIA 4N0ZA 4K7IA 1G7EA 3G7YA 1PL2A 1ERTA 4JU5A 2JZTA 1PRXA 2R3XA 3QR6A 4BWSA 10GSA 5FHIA 1A2MA 1WRYA 4F03A 3VURA 1EP7A 4HU7A 3TJJA 5GSTA 1ZZYA 3Q18A 2PUKC 5D93A 2HSMB 1GTBA 4TXVA 1ZOFA 1M99A 1HYUA 3L9VA 1M7TA 3P2AA 2EIOA 4PUAA 4IVFA 3GFKA 4OFNA 4ZB6A 6GSSA 2MMZA 3TUEA 3ME8A 1PKZA 1PX7A 1S3DA 3QOUA 1XWKA 2HRAA 5LCZA 2KUCA 5A4UA 4V2NA 4BWQA 4ZL7A 4IJIA 2BJXA 3L78A 1AIUA 3QCPA 4OO5A 3GSTA 2GVPA 5KN3A 4MABA 4HU9A 3QAGA 3FR3A 2HZEA 5IMVA 4BPYA 2B5EA 4OWYA 1AQXA 2YZUA 2HE3A 3N9JA 4Q5QA 2LTKA 4OMVA 2H74A 1KBNA 2XPEA 5EPFA 1PSQA 1SU9A 1JLVA 2QGVA 3MSZA 3IDVA 4K7OA 5CO3A 3HKRA 3TJFA 7GSSA 2LNTA 4G0LA 4WBJA 1EOHA 4GTUA 2VL2A 3HYPA 1GRXA 2WRTA 1WP0A 1GLPA 4P3YB 5JCGA 4ISDA 1UC7A 2KP2A 2L6CA 5EY6A 1TU8A 1XW6A 1ERVA 1FVKA 5H5RA 3VWXA 4F2IA 3ERFA 4POLA 4GSTA 3GX8A 2YANA 4QL9A 2VM2A 3GMFA 2LUSA 1YF0A 2L4QA 2DMMA 2HFDA 4FQUA 4CDOA 2CVKA 3HXSA 2X8CA 3A2XA 3C8EA 5ELGA 1H4OA 2O87A 1QK8A 12GSA 3QAWA 1XCCA 2H19A 2IMKA 3RHBA 1V40A 4K2DA 3QD9A 3A2VA 1Y25A 4XS4A 4TR0A 1EV9A 2B7KA 1I5GA 3QMXA 2J9HA 4OFMA 3EVIA 1JZDA 3GKNA 1TW9A 2OACA 4USSA 3D6IA 4GQCA 2OA7A 4Q5RA 5HFKA 2H1BA 3L9SA 4OCFA 3BCIA 1YJ6A 1AW9A 4L5LA 2DJ3A 4LL4B 1EEMA 1XPVA 2WS2A 3C1RA 2WGRA 5HR2A 2H0IA 5HFGA 1GUMA 2MMAA 1CQHA 2AAWA 19GSA 3APSA 3M9KA 3CTFA 3LORA 5JCUA 4BL7B 5A4WA 4LMVA 2H1GA 4J56E 2G0FA 1F37A 4LA1A 5D96A 3E0UA 3OR5A 3ZTLA 3KMOA 2O85A 2B5YA 3DYRA 3GKMA 4HDEA 3DGQA 4EDZA 1U3IA 3IXRA 4O32A 2FWHA 4MZBA 2AUVA 1O81A 5KN1A 3HVXA 4NPBA 1YEXA 4AF2A 4ZBBA 4MK3A 1TU7A 4TXOA 6GSWA 5BMUA 3BCKA 4KX4A 2P5QA 2DJ0A 2L59A 5LD0A 2VLTA 3MWHA 2LS5A 5D9WA 4MDCA 4JR4A 2DJJA 5E4WA 16GSA 2HRFA 2C0GA 1FW1A 3CRUA 2XC2A 3ZZXA 4L0UA 2IIYA 4MH2A 3D4TA 1XOBA 5D8IA 4PNFA 4HQZA 3LG6A 1CQGA 3NZNA 3DD3A 3TKSA 4ZBAA 4IQ1A 3AY8A 5IOXA 2CVBA 2L6DA 4IW9A 2CAIA 4TOPA 2GSQA 4F0CA 1SD8A 1NHYA 2HRKB 4KF9A 1XXUA 2FA4A 1RK4A 5HQPA 5IMDA 3MAKA 3A5WA 4I8BA 5C00A 1KTEA 3F3QA 5A4VA 3C73A 3GH6A 1GWCA 2OE0A 2AB6A 4N10A 4IBPA 2QC7A 3UBLA 4I5QA 3BOAA 4KCEA 4F9ZA 5ID2A 4ZILA 4K7NA 3CMIA 1T8EB 4MA9A 1OE7A 4N0VA 1OVNA 4AGSA 3LQ7A 2FNOA 3KP9A 3ZITA 3IC4A 2O89A 4GCIA 4KSMA 3KIJA 3VLNA 4DSSB 3DWVA 1X9MB 1GSFA 5F06A 2M80A 3TJKA 2HZFA 5G5EA
chains in the Genus database with same CATH superfamily
4PQHA 2BTOT 2WFCA 5CP1A 2VL9A 2PVOC 4YQVA 4EIPA 3UOMA 3LXZA 5B8BA 2GZZA 2B3SA 2WZ9A 3D22A 2VCQA 5IO2A 3RPPA 1BF5A 3GRXA 1SJZA 4WETA 2HT9A 3UARA 2LRTA 4IQAA 2B1KA 2PWJA 5DJMA 2YWNA 14GSA 2LJRA 1K3YA 3PR8A 5J9BA 3H8QA 4XRDA 1QGVA 3RDWA 3DKSA 5J41A 5KN2A 3CXGA 4GXZA 2JSYA 1F6MC 3HHVA 1V9WA 3FHKA 2B6MA 1K0BA 3TGZA 4YH2A 1SVMA 1S3CA 5A5KA 1F9MA 2A2RA 2YV7A 2LQQA 4CHSA 4MNNA 2HYXA 1ZYQB 2O36A 1TK0B 5H5SA 1K0MA 1YEWC 1EWXA 3ZFBA 1VF2A 4I2TA 1U6TA 2V2GA 1W4VA 1B8XA 3VK9A 1LBKA 4G2EA 4WF4A 1ML6A 1F2EA 1JZWA 5IMZA 3LYKA 4KAEA 4DSQA 2B1LA 3ZMLA 2V6KA 1USBA 1ON4A 4RUVA 1DSBA 1Z9HA 1SKWB 1RW1A 3KXOA 4JEDA 4BVYA 3IAM2 4L8EA 1XG8A 5ECIB 4G01A 2ON7A 4QL7A 3LEFA 2PBJA 5DQYA 3MNGA 4G9HA 2RUEA 1GTAA 1VF3A 2VD0A 5B6MA 4V1Ap 4HJ2A 4XS6A 1JZOA 2CX4A 2IMFA 3ZLPA 4HOJA 2K8VA 1TTZA 1NSWA 4FH8A 3LGCA 1K0DA 3LJRA 2C8UA 1YZXA 1SK1A 1XBSA 22GSA 4FIWA 1HNCA 2PMTA 4GSSA 1S3RA 1MDKA 5CAXA 3UIWA 2OE3A 1QMVA 2GSTA 1OKTA 4HZ4A 4ZB9A 3F9UA 4Z2UA 3HJMA 5DJLA 1YKCA 4IELA 2LEGA 2DJ1A 1T7PB 4FO5A 1TK8B 1GH2A 5F07A 1B48A 3UMAA 3RPNA 3UEMA 1X5CA 3EMXA 3M3MA 1TRWA 2L57A 2HSHA 2H66A 1OKDA 1ILOA 1X9WB 4PX1A 3KM6A 2OKAA 5J47A 2FWGA 2VLUA 1MD3A 2I3YA 2DMLA 1SKSB 3ZMKA 3M1GA 2MBTA 4HQSA 3IE3A 2CX3A 5IPGA 2VAFA 5FT3A 2EFCA 4WF5A 4GSNA 1DUGA 3D5JA 4XTSA 1R7HA 2F9SA 1PN9A 1AUCA 4AKGA 4WR4A 5G5FA 4AJ8A 3LXTA 4KH7A 4BVXB 5J4VA 4JRRA 1SVLA 4KSOA 5COHA 5B8AA 5CREA 4K6XA 3FZ4A 1BG5A 1QUWA 2O8VB 1WIKA 5AN1A 2P31A 2HQTA 3H4KA 4EDYA 3KP8A 3DMLA 2GZPA 3MIXA 1RQMA 1M2AA 4PTSA 1YF1A 1AC1A 3EWLA 3ZVJA 8GSSA 3FYGA 4ML6A 4ECJA 2HI7A 1GTUA 3F6FA 3CYNA 2GS3A 1GSQA 1GSDA 4K1FA 3F4RA 4EUYA 3GUSA 2H8LA 3Q19A 3HZ8A 4K8MA 3HDCA 4WEYA 4HI7A 1K0OA 2H1AA 4XCSA 2H6YA 1K0AA 3EPTA 2X64A 1R4WA 3WGEA 4YAVA 3FK8A 4I2UA 2WVXB 3TU3B 1ZYPA 3GH9A 2P5RA 1K3LA 2MMNA 4TXOB 5BMUB 2M46A 1AAZA 1WMJA 3EU3A 1M2BA 3GURA 4IN0A 3K8NA 2FWEA 5IIZA 2NDOA 5E59A 1BG1A 2GT6A 4V2LA 4G10A 3GNJA 4ID0A 4KDXA 3FRCA 3FR9A 2DC5A 3QDNA 3TRPA 1J9BA 4N3ZA 1TKDB 1ABAA 1FG4A 2FCHA 1VF4A 2TIRA 4K9ZA 1UN2A 3EU4A 2FHEA 4Z2RA 1QXHA 4MH3A 3TOTA 2H30A 3CBUA 2E2MA 1JFUA 3GTUA 2YV9A 2VLVA 4MJBA 1H75A 2XBQA 2DLXA 4XIHA 3Q74A 1F3BA 1M3JA 1FOVA 4TKYA 5JWRB 3VPTA 4TRXA 3W6GA 2HRNA 2C0FA 4PUFC 3IC8A 4E68A 4NHZA 1R5AA 5D9XA 2N5AA 2QKEA 2VCXA 1M2DA 1QQ2A 3QFAC 4D73A 2FGXA 1ZYEA 2C0EA 3TKSE 2H76A 5ID2B 5A1NA 2K8SA 1A24A 1FAAA 4E8HA 2EFDA 3GA4A 2FD3A 4KDYA 3VWUA 2F8FA 2ALBA 3NIVA 1K3OA 3LFLA 3G7IA 4POMA 5G2ZA 3C1SA 5G31A 2H70A 4F0BA 3CQFA 2YCDA 2IFQB 5ECKB 4MF7A 2V41A 1VF1A 4CY6A 1YDKA 3BJ5A 4MMMA 1IYHA 3LSZA 2HSNA 2EIQA 3ZFLA 3L0HA 4TR4A 3L4NA 3HZ4A 4KE3A 5CRDA 1GUHA 5IMFA 2H71A 2X8HA 4JE1A 3H93A 1NHOA 3ED3A 1KEBA 3NOFA 4AI6A 3US3A 2QSIA 2VCVA 2UV8G 2JU5A 2ZCTA 4Q5FA 3CRTA 4PQ1A 4PXOA 20GSA 4ML1A 3GYKA 4KW6A 1FOHA 3EINA 2X49A 1OYJA 5ECHB 4KB3A 3TB2A 1V57A 2IWTA 2PERA 3D4MA 1TRUA 3U5RE 5IMAA 1FVJA 3A3TA 4IJ3A 1OAZA 3GL5A 1URMA 5J3RA 1SD9A 4O5UA 3RAZA 5J5NA 3PGTA 1MEKA 3A5IA 1XW5A 1FB0A 5ECPB 1C72A 2H73A 2C0DA 2KLXA 4OD7A 1A0RP 4KCAA 3UBKA 1T4ZA 3M8NA 4KNDA 2X8GA 4QQ7A 3BBYA 3FZAA 4EO3A 4H86A 3F6DA 2H6ZA 5A5HA 3E9JB 1GL8A 3WD6A 4K0GA 2ES7A 4IGJA 4MP4A 1Z3EA 3ERWA 3KJYA 1HD2A 5IM9A 4RQRA 2Z9SA 2WDUA 4EE0A 4BVYB 1V2AA 3IK7A 1SYRA 1GUKA 4GF0A 4HSCX 3E3EA 3CSHA 4HS1A 2PU9C 1XZOA 4LLRA 2H0HA 2N5BA 4MZWA 2R0GA 2JACA 4PURA 1EGRA 4IP1A 4CY8A 4PGTA 5GZZB 2RM6A 6GSYA 2CA8A 1N8JA 1YKAA 2GQKA 2NVLA 3TDGA 1K0NA 4TR3A 3PPUA 1SL2B 2OADA 1TP9A 5D9VA 2WCIA 3QFBC 1MDJA 1SL0B 4X43A 4MPGA 2LJKA 3RBTA 4YQMA 4ZXGA 3TOUA 3D21A 4MLYA 1E2YA 3RGBC 2E7PA 3FR6A 2AJQB 1XWAA 1GSSA 2CAQA 2YWIA 2QA2A 2VO4A 4EXJA 2IN3A 2GTUA 3CHXC 2YJHA 3ZRDA 1TK5B 5DALA 1YQ1A 5DBQA 2PPTA 4JBBA 2AYTA 1BEDA 4YKGA 4AKHA 3F4SA 4KUNA 1ZMAA 1TXUA 2R2JA 1B9XC 4K5RA 5B6NA 1G7OA 4NV2A 5J4UA 5CRGA 4A5PA 4ECIA 2EFEA 5DAKA 2UZ8A 5JWQB 3QPMA 1XIYA 5BRTA 3GIXA 2PN8A 1G0TA 11GSA 1WWJA 5CRWA 1GSUA 2FLSA 4IKHA 1PX6A 1LJRA 4ZB7A 3KGKA 1BX9A 1W89A 4MJCA 2X4AA 2VL3A 2YN1A 6GSVA 2GT5A 1I1IP 5IMCA 1PA3A 2JL4A 5AIXA 1DE2A 2FA8A 4WXTA 3EURA 3KCMA 3HVSA 2MZCA 4XHMA 3TRQA 3ZL5A 1SYXA 4QMKA 2HZEB 5DQSA 1QFNA 3WYWA 2HRKA 1BYEA 4GLTA 4V2MA 4GWRA 1M9BA 5ECRB 5GAND 2MBSA 1VGLA 4PHZC 1XWCA 5CYYA 2R4VA 1SL1B 2NPBA 1IYIA 4WBRD 2VKZG 2GSSA 1TI3A 1MTCA 2YNXA 1TRSA 4N11A 4EKZA 2N5FA 1SJIA 4PI2C 3O6TA 1PGTA 2GQLA 5KEJA 2E2GA 4KA0A 1FHEA 4MPFA 1O8XA 4IS0A 3IAS2 1OC9A 2ZNMA 1B4QA 5DVBA 5ECOB 4Q5NA 2O5VA 4RI6A 1U3AA 2H0GA 3KTLA 1T1VA 4DSSA 5A34A 2VOCA 1EP8A 2C80A 5J40A 2DSAA 3DEXA 4DVCA 1EZKA 3F3RA 5GAPD 1X5DA 4ULXA 2KHPA 4TR1A 2TRXA 5D9TA 1S4BP 4PQIA 3LW9A 3WT1A 5CRHA 3GKKA 3C7MA 2DJKA 3IOSA 1HNAA 2R37A 3M9JA 1X5EA 2IPAA 2K9FA 4RI7A 3VFIA 1T4YA 2AV4A 4G19A 4XS4B 5IOWA 3APOA 1ACVA 5J9CA 1O73A 3CSIA 1S3AA 2LRNA 3IPZA 1ERUA 3JCML 4HUAA 4XRAA 2LKUA 2YWMA 1XFLA 3F0IA 3EYTA 2R0CA 3IBHA 5IPHA 3H1NA 2V1MA 4F82A 5C04A 2VD1A 2VCWA 4MJEA 3ZIJA 1GNWA 1Q4JA 4EF0A 1SK0A 1O7UA 1UA5A 3TJBA 3UL3A 3DVWA 5HFIA 2HSNB 2G2QA 4FYBA 2YOIA 3ZREA 3EC3A 2LV3A 3TKRA 5JCWA 2K6VA 2LRCA 1ZL9A 1WPIA 4L0WA 3P8WA 4X4JA 5ABRA 4JR6A 3CWGA 2R6KA 2KOKA 1GNEA 2WB9A 5EL8A 3M0FA 2PGTA 9GSSA 3PINA 2QA1A 2H75A 3APQA 4AKIA 1YVLA 1HQOA 3TRXA 2A2SA 3DRNA 2H6XA 5FWGA 2P0GA 1TRVA 4JZQA 3GX0A 1ZGNA 2VL2C 3DVXA 5KOWA 4MF6A 1OC3A 3FY7A 2YP6A 3KZQA 1SJ6A 4LMWA 5EVOA 3RHCA 1A2LA 1KNGA 5AGYA 4FYCA 5AISA 3GSSA 2IMIA 3VWVA 1G6WA 5ECLB 3P90A 1LU4A 3TCOA 1A8LA 1F3AA 4E8EA 18GSA 2V32A 2F51A 2XPDA 2D2ZA 4N30A 1ERWA 2NBSA 4EIQA 1V98A 4EC0A 4KGIA 2REMA 2GLRA 1U88A 3GKXA 2LSTA 3ZIVA 1T3BA 4MJAA 2WW0A 1HNBA 4CW9A 2DJ2A 2L4CA 2L5LA 1XWGA 4NMUA 1NW2A 3R3EA 4NV5A 2I4AA 4GDFA 6GSUA 2E0QA 4X1UA 4WR5A 4PI0C 5L71A 2C4JA 1A23A 1J0FA 1DE1A 4V1Ag 2C1YA 4OCEA 4ZBDA 2HNLA 1J08A 2RUFA 2RM5A 3HY2A 2I81A 4POBA 4DEJA 3EMPA 3WGDA 3CSJA 1M9AA 5ECQB 3L9UA 3F8UA 3LWAA 3WGXA 1A0FA 1XOAA 2GDRA 2I1UA 3IV4A 1JHBA 5G30A 2WVZA 4PNGA 3GV1A 1EV4A 4O92A 1R5PA 2HSMA 4ZIJA 2F3MA 4BVXA 3DIEA 2F8AA 4L5OA 2WULA 4ZB8A 4Z2TA 5HR0A 1PMTA 3EE2A 1PL1A 2M72A 2VCZA 1YY7A 4ILFA 1Y6EA 2JSZA 2CVDA 2CQ9A 3FZ5A 3G9BA 2CZ2A 1JZRA 4X0XA 1FO5A 1EOGA 1O6JA 3KD0A 4K5SA 4G0KA 3W8JA 5DALB 2EC4A 3FW2A 2VCTA 2C3TA 4NHWA 1Z7RA 3J7Yb 2HLSA 2WJUA 3UVHA 2OE1A 4Z7XA 1X0RA 2JZRA 3HVNA 3C71A 1EEJA 4BIKA 4FXYP 3S9FA 4AJ6A 3HJOA 2ZUPA 1GULA 4WKWA 3O76A 5D73A 3ISOA 1BJXA 4O7HA 2DIYA 5IQYA 2ON5A 1XVQA 5F0GA 5DAKB 3GL3A 1Z6MA 3IK9A 2L5OA 4TW5A 2XHFA 5ECNB 2CZ3A 3VI7A 4OFTA 1XVWA 4I97A 1O8WA 2LQOA 2FWFA 3WT2A 2DIZA 1THXA 3W8SA 3IHGA 2LNSA 3TKSC 4TVEA 3IRAA 5B7CA 4MCUA 4MF5A 3TKPA 3LYPA 1UVZA 2KP1A 1U87A 3ME7A 2VM1A 2H1LA 1SKRB 3TKQA 5F8BA 1GSYA 3UJ1A 4HZ2A 2RLIA 3KH9A 3IR4A 4BA7A 2H01A 2FY6A 3VWWA 2EIRA 2MYGA 3P7XA 1K0CA 2EFHA 3HVVA 4GQFA 1EGOA 2A2PA 3I6AA 2FUG2 1TDIA 1GLQA 4YQUA 6GSXA 1I9DA 1PD21 2DBCA 4NWYA 1R26A 2B7JA 2OBKA 4NAXA 5CNWA 1XW9A 2CT6A 4IP6A 1OC9B 4FYUA 1B4PA 3SWLA 1ST9A 2IFQA 3I9V2 2V6OA 2H1DA 1GP1A 2CV4A 2IJYA 3A2WA 3H79A 2GSRA 5ELAA 1X9SB 3G7JA 3KTBA 1MDIA 4IHUA 5HR3A 5JWOB 4POKA 3QAVA 3ZYWA 3FZ9A 3IHQA 4BL7A 1B9YC 4TR1B 3I43A 2C3NA 1XWBA 3HJPA 1NM3A 3VI5A 4G0IA 3O3TA 2B5XA 3TJGA 3D0ZA 1TI1A 4LL1B 5ECSA 1AQVA 1AXDA 2X99A 5HR1A 2GGTA 1Q98A 3FKFA 5H5QA 4GRFA 1GTIA 5GSSA 1VRSD 4DSRA 2O7KA 2YPMA 3ZVJD 1GSEA 3GN3A 5F05A 2GQMA 1TJDA 3VPQA 2YZHA 1JLWA 3HCZA 17GSA 4OO4A 1YEPA 4EL1A 2C3QA 2H72A 2IL3A 3F4TA 5ENUA 5IO0A 1PQNA 2YJ7A 3HA9A 5AIVA 2HXKA 4ECCA 3V1WA 1MD4A 3FEUA 1WJKA 6GSTA 4ACSA 1T00A 2IMEA 5ECMB 4YAPA 3HD5A 1OC8A 1M0UA 2J23A 4J57E 1SK2A 1SENA 4EVMA 1Z7PA 2K18A 3CTGA 3UAPA 1DBYA 3UVTA 1BAYA 1ZYNA 3KEBA 3J7Yk 1V58A 4K0NA 4AJ7A 3KMNA 3GHAA 2WW2A 4MZCA 2LJAA 2MMOA 2DKIA 1TOFA 3F63A 1A8YA 3Q6OA 4ZL8A 1TXXA 2VIMA 4HJMA 3HMJG 3PH9A 2AHEA 1WOUA 5DCGA 1ZCPA 3BD2A 4J2FA 1O85A 5DCHA 1N2AA 3MDKA 2A4HA 2OJLA 3KH7A 4XS1A 5G1LA 2OBIA 4W66A 2PVQA 1FB6A 2I9HA 1PKWA 2XBIA 4KDUA 2DKHA 1E6BA 3R2QA 2VUPA 3N5OA 2R5GA 5G1KA 2JADA 4NXIA 2YWOA 5LNKe 4ZL9A 1SVOA 3U6VA 2GZYA 2HSYA 13GSA 3GTUB 5DDLA 2A4VA 2BMXA 4RQXA 5INYA 3IA1A 3SBCA 3ERGA 4ECBA 1BQ7A 1Z5YE 2TRCP 2NTOA 1G6YA 1OE8A 1WE0A 4TN8A 3DXBA 5KN0A 1AQWA 1A2JA 2IMDA 4I6XA 4O5RA 2JZSA 4HEA2 1THOA 3I69A 4D73B 1Z6NA 2RIIA 4N0ZA 5A1NB 4K7IA 1G7EA 3G7YA 1PL2A 1ERTA 4JU5A 2JZTA 1PRXA 1PN0A 2R3XA 3QR6A 4BWSA 10GSA 5FHIA 1A2MA 1WRYA 4F03A 3VURA 1EP7A 4O5QA 4HU7A 3TJJA 5GSTA 1ZZYA 3Q18A 2PUKC 5D93A 2HSMB 1GTBA 4TXVA 1ZOFA 1M99A 1HYUA 3L9VA 1M7TA 3P2AA 2EIOA 4PUAA 4IVFA 3GFKA 4OFNA 4ZB6A 6GSSA 2MMZA 3TUEA 3ME8A 1PKZA 1PX7A 1S3DA 3QOUA 1XWKA 2HRAA 5LCZA 2KUCA 5A4UA 4V2NA 4BWQA 4ZL7A 4IJIA 2BJXA 3L78A 1AIUA 3QCPA 4OO5A 3GSTA 2GVPA 5KN3A 4MABA 4HU9A 3QAGA 4K2XA 3FR3A 2HZEA 5IMVA 4BPYA 2B5EA 4OWYA 1AQXA 2YZUA 2HE3A 3N9JA 4Q5QA 2LTKA 4OMVA 2H74A 1KBNA 2XPEA 2R0PA 5EPFA 1PSQA 1SU9A 1JLVA 2QGVA 3MSZA 3IDVA 4K7OA 4YKFA 5CO3A 3HKRA 3TJFA 7GSSA 2LNTA 4G0LA 4WBJA 1EOHA 4GTUA 4ICYA 2VL2A 3HYPA 2O3EA 1GRXA 2WRTA 1WP0A 1GLPA 4P3YB 5JCGA 4ISDA 1UC7A 2KP2A 2L6CA 5EY6A 1TU8A 1XW6A 1ERVA 1FVKA 5H5RA 3VWXA 4F2IA 3ERFA 4POLA 5A5HB 4GSTA 3GX8A 2YANA 4QL9A 2VM2A 3GMFA 1M3IA 2LUSA 1YF0A 2L4QA 2DMMA 2HFDA 4FQUA 4CDOA 2CVKA 3HXSA 2X8CA 3A2XA 3C8EA 5ELGA 1H4OA 2O87A 1QK8A 12GSA 3QAWA 1XCCA 2H19A 2IMKA 3RHBA 2WZSA 1V40A 4K2DA 3QD9A 3A2VA 1Y25A 4XS4A 4TR0A 1EV9A 2B7KA 1I5GA 3QMXA 2J9HA 4OFMA 3EVIA 1JZDA 3GKNA 1TW9A 2OACA 4USSA 3D6IA 2OA7A 4GQCA 4Q5RA 5HFKA 2H1BA 3L9SA 4OCFA 2OT3A 3BCIA 1YJ6A 1AW9A 4L5LA 2DJ3A 4LL4B 1EEMA 1XPVA 2WS2A 3C1RA 2WGRA 5HR2A 2H0IA 5HFGA 1GUMA 2MMAA 1CQHA 1N25A 2AAWA 19GSA 3APSA 3M9KA 3CTFA 3LORA 5JCUA 4BL7B 5A4WA 4LMVA 2H1GA 4J56E 2G0FA 1F37A 4LA1A 5D96A 3E0UA 3OR5A 3RFRC 3ZTLA 3KMOA 2O85A 2B5YA 3DYRA 3GKMA 4HDEA 3DGQA 4EDZA 1U3IA 3IXRA 4O32A 2FWHA 4MZBA 2AUVA 2WW3A 1O81A 5KN1A 3HVXA 4NPBA 1YEXA 2WVXA 4AF2A 4ZBBA 4MK3A 1TU7A 4TXOA 6GSWA 3FMWA 5BMUA 3BCKA 4KX4A 2P5QA 2DJ0A 2L59A 5LD0A 3MYDA 2VLTA 3MWHA 2LS5A 5KOXA 5D9WA 4MDCA 4JR4A 2DJJA 1Y1UA 5E4WA 16GSA 2HRFA 2C0GA 1FW1A 3CRUA 2XC2A 3ZZXA 4L0UA 2IIYA 4MH2A 3D4TA 1XOBA 5D8IA 4PNFA 4HQZA 3LG6A 1CQGA 3NZNA 2WVYA 3DD3A 3TKSA 4ZBAA 5J4YA 4IQ1A 3AY8A 5IOXA 2CVBA 2L6DA 4IW9A 2CAIA 4TOPA 1PFOA 2GSQA 4F0CA 1SD8A 1NHYA 2HRKB 4KF9A 1XXUA 2FA4A 1RK4A 5HQPA 4AKXB 5IMDA 3MAKA 3A5WA 4I8BA 5C00A 1KTEA 3F3QA 5A4VA 3C73A 3GH6A 1GWCA 2OE0A 2AB6A 4N10A 4IBPA 2QC7A 3UBLA 4I5QA 3BOAA 4KCEA 4F9ZA 5ID2A 4ZILA 4K7NA 3CMIA 1T8EB 4MA9A 1OE7A 4N0VA 1OVNA 4AGSA 3LQ7A 2FNOA 3KP9A 3ZITA 3IC4A 2O89A 4GCIA 4KSMA 3KIJA 3VLNA 2WW1A 4DSSB 3DWVA 1X9MB 1GSFA 5A34B 5F06A 2M80A 3TJKA 2HZFA 5G5EA
chains in the Genus database with same CATH topology
4PQHA 2BTOT 2WFCA 5CP1A 2VL9A 2PVOC 4YQVA 4EIPA 3UOMA 3LXZA 5B8BA 2GZZA 2B3SA 2WZ9A 3D22A 2VCQA 5IO2A 3RPPA 1BF5A 3GRXA 1SJZA 4WETA 2HT9A 3UARA 2LRTA 4IQAA 2B1KA 2PWJA 5DJMA 2YWNA 14GSA 2LJRA 1K3YA 3PR8A 5J9BA 3H8QA 4XRDA 1QGVA 3RDWA 3DKSA 5J41A 5KN2A 3CXGA 4GXZA 2JSYA 1F6MC 3HHVA 1V9WA 3FHKA 2B6MA 1K0BA 3TGZA 4YH2A 1SVMA 1S3CA 5A5KA 1F9MA 2A2RA 2YV7A 2LQQA 4CHSA 4MNNA 2HYXA 1ZYQB 1TK0B 5H5SA 1K0MA 1EWXA 3ZFBA 1VF2A 4I2TA 1U6TA 2V2GA 1W4VA 1B8XA 3VK9A 1LBKA 4G2EA 4WF4A 1ML6A 1F2EA 1JZWA 5IMZA 3LYKA 4KAEA 4DSQA 2B1LA 3ZMLA 2V6KA 1USBA 1ON4A 4RUVA 1DSBA 1Z9HA 1SKWB 1RW1A 3KXOA 4JEDA 4BVYA 3IAM2 4L8EA 5ECIB 4G01A 2ON7A 4QL7A 3LEFA 2PBJA 5DQYA 3MNGA 4G9HA 2RUEA 1GTAA 1VF3A 2VD0A 5B6MA 4V1Ap 4HJ2A 4XS6A 1JZOA 2CX4A 2IMFA 3ZLPA 4HOJA 2K8VA 1TTZA 1NSWA 4FH8A 3LGCA 1K0DA 3LJRA 2C8UA 1YZXA 1SK1A 1XBSA 22GSA 4FIWA 1HNCA 2PMTA 4GSSA 1MDKA 5CAXA 3UIWA 2OE3A 1QMVA 2GSTA 1OKTA 4HZ4A 4ZB9A 3F9UA 4Z2UA 3HJMA 5DJLA 1YKCA 4IELA 2LEGA 2DJ1A 1T7PB 4FO5A 1TK8B 1GH2A 5F07A 1B48A 3UMAA 3RPNA 3UEMA 1X5CA 3EMXA 3M3MA 1TRWA 2L57A 2HSHA 2H66A 1OKDA 1ILOA 1X9WB 4PX1A 3KM6A 2OKAA 5J47A 2FWGA 2VLUA 1MD3A 2I3YA 2DMLA 1SKSB 3ZMKA 3M1GA 2MBTA 4HQSA 3IE3A 2CX3A 5IPGA 2VAFA 5FT3A 2EFCA 4WF5A 4GSNA 1DUGA 3D5JA 4XTSA 1R7HA 2F9SA 1PN9A 1AUCA 4AKGA 4WR4A 5G5FA 4AJ8A 3LXTA 4KH7A 4BVXB 5J4VA 4JRRA 1SVLA 4KSOA 5COHA 5B8AA 5CREA 4K6XA 3FZ4A 1BG5A 1QUWA 2O8VB 1WIKA 5AN1A 2P31A 2HQTA 3H4KA 4EDYA 3KP8A 3DMLA 2GZPA 3MIXA 1RQMA 1M2AA 4PTSA 1YF1A 1AC1A 3EWLA 3ZVJA 8GSSA 3FYGA 4ML6A 4ECJA 2HI7A 1GTUA 3F6FA 3CYNA 2GS3A 1GSQA 1GSDA 4K1FA 3F4RA 4EUYA 3GUSA 2H8LA 3Q19A 3HZ8A 4K8MA 3HDCA 4WEYA 4HI7A 1K0OA 2H1AA 4XCSA 2H6YA 1K0AA 3EPTA 2X64A 1R4WA 3WGEA 4YAVA 3FK8A 4I2UA 3TU3B 3GH9A 1ZYPA 2P5RA 1K3LA 2MMNA 4TXOB 5BMUB 2M46A 1AAZA 1WMJA 3EU3A 1M2BA 3GURA 4IN0A 3K8NA 2FWEA 5IIZA 2NDOA 5E59A 1BG1A 2GT6A 4V2LA 4G10A 3GNJA 4ID0A 4KDXA 3FRCA 3FR9A 2DC5A 3QDNA 3TRPA 1J9BA 4N3ZA 1TKDB 1ABAA 1FG4A 2FCHA 1VF4A 2TIRA 4K9ZA 1UN2A 3EU4A 2FHEA 4Z2RA 1QXHA 4MH3A 3TOTA 2H30A 3CBUA 2E2MA 1JFUA 3GTUA 2YV9A 2VLVA 4MJBA 1H75A 2XBQA 2DLXA 4XIHA 3Q74A 1F3BA 1FOVA 4TKYA 5JWRB 3VPTA 4TRXA 3W6GA 2HRNA 2C0FA 4PUFC 3IC8A 4E68A 4NHZA 1R5AA 5D9XA 2N5AA 2QKEA 2VCXA 1M2DA 1QQ2A 3QFAC 4D73A 2FGXA 1ZYEA 2C0EA 3TKSE 2H76A 5ID2B 5A1NA 2K8SA 1A24A 1FAAA 4E8HA 2EFDA 3GA4A 2FD3A 4KDYA 3VWUA 2F8FA 2ALBA 3NIVA 1K3OA 3LFLA 3G7IA 4POMA 5G2ZA 3C1SA 5G31A 2H70A 4F0BA 2YCDA 2IFQB 5ECKB 4MF7A 2V41A 1VF1A 4CY6A 1YDKA 3BJ5A 4MMMA 1IYHA 3LSZA 2HSNA 2EIQA 3ZFLA 3L0HA 4TR4A 3L4NA 3HZ4A 4KE3A 5CRDA 1GUHA 5IMFA 2H71A 2X8HA 4JE1A 3H93A 1NHOA 3ED3A 1KEBA 3NOFA 4AI6A 3US3A 2QSIA 2VCVA 2UV8G 2JU5A 2ZCTA 4Q5FA 3CRTA 4PQ1A 4PXOA 20GSA 4ML1A 3GYKA 4KW6A 1FOHA 3EINA 2X49A 1OYJA 5ECHB 4KB3A 3TB2A 1V57A 2IWTA 2PERA 3D4MA 1TRUA 3U5RE 5IMAA 1FVJA 3A3TA 4IJ3A 1OAZA 3GL5A 1URMA 5J3RA 1SD9A 4O5UA 3RAZA 5J5NA 3PGTA 1MEKA 3A5IA 1XW5A 1FB0A 5ECPB 1C72A 2H73A 2C0DA 2KLXA 4OD7A 1A0RP 4KCAA 3UBKA 1T4ZA 3M8NA 4KNDA 2X8GA 4QQ7A 3BBYA 3FZAA 4EO3A 4H86A 3F6DA 2H6ZA 5A5HA 3E9JB 1GL8A 3WD6A 4K0GA 2ES7A 4IGJA 4MP4A 1Z3EA 3ERWA 3KJYA 1HD2A 5IM9A 4RQRA 2Z9SA 2WDUA 4EE0A 4BVYB 1V2AA 3IK7A 1SYRA 1GUKA 4GF0A 3E3EA 3CSHA 4HS1A 2PU9C 1XZOA 4LLRA 2H0HA 2N5BA 4MZWA 2R0GA 2JACA 4PURA 1EGRA 4IP1A 4CY8A 4PGTA 5GZZB 2RM6A 6GSYA 2CA8A 1N8JA 1YKAA 2GQKA 2NVLA 3TDGA 1K0NA 4TR3A 3PPUA 1SL2B 2OADA 1TP9A 5D9VA 2WCIA 3QFBC 1MDJA 1SL0B 4X43A 4MPGA 2LJKA 3RBTA 4YQMA 4ZXGA 3TOUA 3D21A 4MLYA 1E2YA 2E7PA 3FR6A 2AJQB 1XWAA 1GSSA 2CAQA 2YWIA 2QA2A 2VO4A 4EXJA 2IN3A 2GTUA 2YJHA 3ZRDA 1TK5B 5DALA 1YQ1A 5DBQA 2PPTA 4JBBA 2AYTA 1BEDA 4YKGA 4AKHA 3F4SA 4KUNA 1ZMAA 1TXUA 2R2JA 1B9XC 4K5RA 5B6NA 1G7OA 4NV2A 5J4UA 5CRGA 4A5PA 4ECIA 2EFEA 5DAKA 2UZ8A 5JWQB 3QPMA 1XIYA 5BRTA 3GIXA 2PN8A 1G0TA 11GSA 1WWJA 5CRWA 1GSUA 2FLSA 4IKHA 1PX6A 1LJRA 4ZB7A 3KGKA 1BX9A 1W89A 4MJCA 2X4AA 2VL3A 2YN1A 6GSVA 2GT5A 5IMCA 1PA3A 2JL4A 5AIXA 1DE2A 2FA8A 4WXTA 3EURA 3KCMA 3HVSA 2MZCA 4XHMA 3TRQA 3ZL5A 1SYXA 4QMKA 2HZEB 5DQSA 1QFNA 3WYWA 2HRKA 1BYEA 4GLTA 4V2MA 4GWRA 1M9BA 5ECRB 5GAND 2MBSA 1VGLA 1XWCA 5CYYA 2R4VA 1SL1B 2NPBA 1IYIA 4WBRD 2VKZG 2GSSA 1TI3A 1MTCA 2YNXA 1TRSA 4N11A 4EKZA 2N5FA 1SJIA 3O6TA 1PGTA 2GQLA 5KEJA 2E2GA 4KA0A 1FHEA 4MPFA 1O8XA 4IS0A 3IAS2 1OC9A 2ZNMA 1B4QA 5DVBA 5ECOB 4Q5NA 2O5VA 4RI6A 1U3AA 2H0GA 3KTLA 1T1VA 4DSSA 5A34A 2VOCA 1EP8A 2C80A 5J40A 2DSAA 3DEXA 4DVCA 1EZKA 3F3RA 5GAPD 1X5DA 4ULXA 2KHPA 4TR1A 2TRXA 5D9TA 4PQIA 3LW9A 3WT1A 5CRHA 3GKKA 3C7MA 2DJKA 3IOSA 1HNAA 2R37A 3M9JA 1X5EA 2IPAA 2K9FA 4RI7A 3VFIA 1T4YA 2AV4A 4G19A 4XS4B 5IOWA 3APOA 1ACVA 5J9CA 1O73A 3CSIA 1S3AA 2LRNA 3IPZA 1ERUA 3JCML 4HUAA 4XRAA 2LKUA 2YWMA 1XFLA 3F0IA 3EYTA 2R0CA 3IBHA 5IPHA 3H1NA 2V1MA 4F82A 5C04A 2VD1A 2VCWA 4MJEA 3ZIJA 1GNWA 1Q4JA 4EF0A 1SK0A 1O7UA 1UA5A 3TJBA 3UL3A 3DVWA 5HFIA 2HSNB 2G2QA 4FYBA 2YOIA 3ZREA 3EC3A 2LV3A 3TKRA 5JCWA 2K6VA 2LRCA 1ZL9A 1WPIA 4L0WA 3P8WA 4X4JA 5ABRA 4JR6A 3CWGA 2R6KA 2KOKA 1GNEA 2WB9A 5EL8A 3M0FA 2PGTA 9GSSA 3PINA 2QA1A 2H75A 3APQA 4AKIA 1YVLA 1HQOA 3TRXA 2A2SA 3DRNA 2H6XA 5FWGA 2P0GA 1TRVA 4JZQA 3GX0A 1ZGNA 2VL2C 3DVXA 5KOWA 4MF6A 1OC3A 3FY7A 2YP6A 3KZQA 1SJ6A 4LMWA 5EVOA 3RHCA 1A2LA 1KNGA 5AGYA 4FYCA 5AISA 3GSSA 2IMIA 3VWVA 1G6WA 5ECLB 3P90A 1LU4A 3TCOA 1A8LA 1F3AA 4E8EA 18GSA 2V32A 2F51A 2XPDA 2D2ZA 4N30A 1ERWA 2NBSA 4EIQA 1V98A 4EC0A 4KGIA 2REMA 2GLRA 1U88A 3GKXA 2LSTA 3ZIVA 1T3BA 4MJAA 1HNBA 4CW9A 2DJ2A 2L4CA 2L5LA 1XWGA 4NMUA 1NW2A 3R3EA 4NV5A 2I4AA 4GDFA 6GSUA 2E0QA 4X1UA 4WR5A 5L71A 2C4JA 1A23A 1J0FA 1DE1A 4V1Ag 2C1YA 4OCEA 4ZBDA 2HNLA 1J08A 2RUFA 2RM5A 3HY2A 2I81A 4POBA 4DEJA 3EMPA 3WGDA 3CSJA 1M9AA 5ECQB 3L9UA 3F8UA 3LWAA 3WGXA 1A0FA 1XOAA 2GDRA 2I1UA 3IV4A 1JHBA 5G30A 4PNGA 3GV1A 1EV4A 4O92A 1R5PA 2HSMA 4ZIJA 2F3MA 4BVXA 3DIEA 2F8AA 4L5OA 2WULA 4ZB8A 4Z2TA 5HR0A 1PMTA 3EE2A 1PL1A 2M72A 2VCZA 1YY7A 4ILFA 1Y6EA 2JSZA 2CVDA 2CQ9A 3FZ5A 3G9BA 2CZ2A 1JZRA 4X0XA 1FO5A 1EOGA 1O6JA 3KD0A 4K5SA 4G0KA 3W8JA 5DALB 2EC4A 3FW2A 2VCTA 2C3TA 4NHWA 1Z7RA 3J7Yb 2HLSA 2WJUA 3UVHA 2OE1A 4Z7XA 1X0RA 2JZRA 3C71A 1EEJA 3S9FA 4AJ6A 3HJOA 2ZUPA 1GULA 4WKWA 3O76A 5D73A 3ISOA 1BJXA 4O7HA 2DIYA 5IQYA 2ON5A 1XVQA 5F0GA 5DAKB 3GL3A 1Z6MA 3IK9A 2L5OA 4TW5A 2XHFA 5ECNB 2CZ3A 3VI7A 4OFTA 1XVWA 4I97A 1O8WA 2LQOA 2FWFA 3WT2A 2DIZA 1THXA 3W8SA 3IHGA 2LNSA 3TKSC 4TVEA 3IRAA 5B7CA 4MCUA 4MF5A 3TKPA 3LYPA 1UVZA 2KP1A 1U87A 3ME7A 2VM1A 2H1LA 1SKRB 3TKQA 5F8BA 1GSYA 3UJ1A 4HZ2A 2RLIA 3KH9A 3IR4A 4BA7A 2H01A 2FY6A 3VWWA 2EIRA 2MYGA 3P7XA 1K0CA 2EFHA 3HVVA 4GQFA 1EGOA 2A2PA 3I6AA 2FUG2 1TDIA 1GLQA 4YQUA 6GSXA 1I9DA 1PD21 2DBCA 4NWYA 1R26A 2B7JA 2OBKA 4NAXA 5CNWA 1XW9A 2CT6A 4IP6A 1OC9B 4FYUA 1B4PA 3SWLA 1ST9A 2IFQA 3I9V2 2V6OA 2H1DA 1GP1A 2CV4A 2IJYA 3A2WA 3H79A 2GSRA 5ELAA 1X9SB 3G7JA 3KTBA 1MDIA 4IHUA 5HR3A 5JWOB 4POKA 3QAVA 3ZYWA 3FZ9A 3IHQA 4BL7A 1B9YC 4TR1B 3I43A 2C3NA 1XWBA 3HJPA 1NM3A 3VI5A 4G0IA 3O3TA 2B5XA 3TJGA 3D0ZA 1TI1A 4LL1B 5ECSA 1AQVA 1AXDA 2X99A 5HR1A 2GGTA 1Q98A 3FKFA 5H5QA 4GRFA 1GTIA 5GSSA 1VRSD 4DSRA 2O7KA 2YPMA 3ZVJD 1GSEA 3GN3A 5F05A 2GQMA 1TJDA 3VPQA 2YZHA 1JLWA 3HCZA 17GSA 4OO4A 1YEPA 4EL1A 2C3QA 2H72A 2IL3A 3F4TA 5ENUA 5IO0A 1PQNA 2YJ7A 3HA9A 5AIVA 2HXKA 4ECCA 3V1WA 1MD4A 3FEUA 1WJKA 6GSTA 4ACSA 1T00A 2IMEA 5ECMB 4YAPA 3HD5A 1OC8A 1M0UA 2J23A 4J57E 1SK2A 1SENA 4EVMA 1Z7PA 2K18A 3CTGA 3UAPA 1DBYA 3UVTA 1BAYA 1ZYNA 3KEBA 3J7Yk 1V58A 4K0NA 4AJ7A 3KMNA 3GHAA 4MZCA 2LJAA 2MMOA 2DKIA 1TOFA 3F63A 1A8YA 3Q6OA 4ZL8A 1TXXA 2VIMA 4HJMA 3HMJG 3PH9A 2AHEA 1WOUA 5DCGA 1ZCPA 3BD2A 4J2FA 1O85A 5DCHA 1N2AA 3MDKA 2A4HA 2OJLA 3KH7A 4XS1A 5G1LA 2OBIA 4W66A 2PVQA 1FB6A 2I9HA 1PKWA 2XBIA 4KDUA 2DKHA 1E6BA 3R2QA 2VUPA 3N5OA 2R5GA 5G1KA 2JADA 4NXIA 2YWOA 5LNKe 4ZL9A 1SVOA 3U6VA 2GZYA 2HSYA 13GSA 3GTUB 5DDLA 2A4VA 2BMXA 4RQXA 5INYA 3IA1A 3SBCA 3ERGA 4ECBA 1BQ7A 1Z5YE 2TRCP 2NTOA 1G6YA 1OE8A 1WE0A 4TN8A 3DXBA 5KN0A 1AQWA 1A2JA 2IMDA 4I6XA 4O5RA 2JZSA 4HEA2 1THOA 3I69A 4D73B 1Z6NA 2RIIA 4N0ZA 5A1NB 4K7IA 1G7EA 3G7YA 1PL2A 1ERTA 4JU5A 2JZTA 1PRXA 1PN0A 2R3XA 3QR6A 4BWSA 10GSA 5FHIA 1A2MA 1WRYA 4F03A 3VURA 1EP7A 4O5QA 4HU7A 3TJJA 5GSTA 1ZZYA 3Q18A 2PUKC 5D93A 2HSMB 1GTBA 4TXVA 1ZOFA 1M99A 1HYUA 3L9VA 1M7TA 3P2AA 2EIOA 4PUAA 4IVFA 3GFKA 4OFNA 4ZB6A 6GSSA 2MMZA 3TUEA 3ME8A 1PKZA 1PX7A 1S3DA 3QOUA 1XWKA 2HRAA 5LCZA 2KUCA 5A4UA 4V2NA 4BWQA 4ZL7A 4IJIA 2BJXA 3L78A 1AIUA 3QCPA 4OO5A 3GSTA 2GVPA 5KN3A 4MABA 4HU9A 3QAGA 4K2XA 3FR3A 2HZEA 5IMVA 4BPYA 2B5EA 4OWYA 1AQXA 2YZUA 2HE3A 3N9JA 4Q5QA 2LTKA 4OMVA 2H74A 1KBNA 2XPEA 2R0PA 5EPFA 1PSQA 1SU9A 1JLVA 2QGVA 3MSZA 3IDVA 4K7OA 4YKFA 5CO3A 3HKRA 3TJFA 7GSSA 2LNTA 4G0LA 4WBJA 1EOHA 4GTUA 4ICYA 2VL2A 3HYPA 1GRXA 2WRTA 1WP0A 1GLPA 4P3YB 5JCGA 4ISDA 1UC7A 2KP2A 2L6CA 5EY6A 1TU8A 1XW6A 1ERVA 1FVKA 5H5RA 3VWXA 4F2IA 3ERFA 4POLA 5A5HB 4GSTA 3GX8A 2YANA 4QL9A 2VM2A 3GMFA 2LUSA 1YF0A 2L4QA 2DMMA 2HFDA 4FQUA 4CDOA 2CVKA 3HXSA 2X8CA 3A2XA 3C8EA 5ELGA 1H4OA 2O87A 1QK8A 12GSA 3QAWA 1XCCA 2H19A 2IMKA 3RHBA 1V40A 4K2DA 3QD9A 3A2VA 1Y25A 4XS4A 4TR0A 1EV9A 2B7KA 1I5GA 3QMXA 2J9HA 4OFMA 3EVIA 1JZDA 3GKNA 1TW9A 2OACA 4USSA 3D6IA 2OA7A 4GQCA 4Q5RA 5HFKA 2H1BA 3L9SA 4OCFA 2OT3A 3BCIA 1YJ6A 1AW9A 4L5LA 2DJ3A 4LL4B 1EEMA 1XPVA 2WS2A 3C1RA 2WGRA 5HR2A 2H0IA 5HFGA 1GUMA 2MMAA 1CQHA 1N25A 2AAWA 19GSA 3APSA 3M9KA 3CTFA 3LORA 5JCUA 4BL7B 5A4WA 4LMVA 2H1GA 4J56E 2G0FA 1F37A 4LA1A 5D96A 3E0UA 3OR5A 3ZTLA 3KMOA 2O85A 2B5YA 3DYRA 3GKMA 4HDEA 3DGQA 4EDZA 1U3IA 3IXRA 4O32A 2FWHA 4MZBA 2AUVA 1O81A 5KN1A 3HVXA 4NPBA 1YEXA 4AF2A 4ZBBA 4MK3A 1TU7A 4TXOA 6GSWA 3FMWA 5BMUA 3BCKA 4KX4A 2P5QA 2DJ0A 2L59A 5LD0A 3MYDA 2VLTA 3MWHA 2LS5A 5KOXA 5D9WA 4MDCA 4JR4A 2DJJA 1Y1UA 5E4WA 16GSA 2HRFA 2C0GA 1FW1A 3CRUA 2XC2A 3ZZXA 4L0UA 2IIYA 4MH2A 3D4TA 1XOBA 5D8IA 4PNFA 4HQZA 3LG6A 1CQGA 3NZNA 3DD3A 3TKSA 4ZBAA 5J4YA 4IQ1A 3AY8A 5IOXA 2CVBA 2L6DA 4IW9A 2CAIA 4TOPA 2GSQA 4F0CA 1SD8A 1NHYA 2HRKB 4KF9A 1XXUA 2FA4A 1RK4A 5HQPA 4AKXB 5IMDA 3MAKA 3A5WA 4I8BA 5C00A 1KTEA 3F3QA 5A4VA 3C73A 3GH6A 1GWCA 2OE0A 2AB6A 4N10A 4IBPA 2QC7A 3UBLA 4I5QA 3BOAA 4KCEA 4F9ZA 5ID2A 4ZILA 4K7NA 3CMIA 1T8EB 4MA9A 1OE7A 4N0VA 1OVNA 4AGSA 3LQ7A 2FNOA 3KP9A 3ZITA 3IC4A 2O89A 4GCIA 4KSMA 3KIJA 3VLNA 4DSSB 3DWVA 1X9MB 1GSFA 5A34B 5F06A 2M80A 3TJKA 2HZFA 5G5EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PQH A;  2BTO T;  2WFC A;  5CP1 A;  2VL9 A;  2PVO C;  4YQV A;  3UOM A;  3LXZ A;  5B8B A;  2GZZ A;  2B3S A;  2WZ9 A;  3D22 A;  2VCQ A;  5IO2 A;  3RPP A;  3GRX A;  1SJZ A;  4WET A;  2HT9 A;  3UAR A;  2LRT A;  4IQA A;  2B1K A;  2PWJ A;  5DJM A;  2YWN A;  14GS A;  2LJR A;  1K3Y A;  3PR8 A;  5J9B A;  3H8Q A;  4XRD A;  1QGV A;  3RDW A;  3DKS A;  5J41 A;  5KN2 A;  3CXG A;  4GXZ A;  2JSY A;  1F6M C;  3HHV A;  1V9W A;  3FHK A;  2B6M A;  1K0B A;  3TGZ A;  4YH2 A;  1S3C A;  5A5K A;  1F9M A;  2A2R A;  2YV7 A;  2LQQ A;  4CHS A;  2HYX A;  1ZYQ B;  1TK0 B;  5H5S A;  1K0M A;  1EWX A;  3ZFB A;  1VF2 A;  4I2T A;  1U6T A;  2V2G A;  1W4V A;  1B8X A;  3VK9 A;  1LBK A;  4G2E A;  4WF4 A;  1ML6 A;  1F2E A;  1JZW A;  5IMZ A;  3LYK A;  4KAE A;  4DSQ A;  2B1L A;  3ZML A;  2V6K A;  1USB A;  1ON4 A;  4RUV A;  1DSB A;  1Z9H A;  1SKW B;  1RW1 A;  3KXO A;  4JED A;  4BVY A;  3IAM 2;  4L8E A;  5ECI B;  2ON7 A;  4QL7 A;  3LEF A;  2PBJ A;  5DQY A;  3MNG A;  4G9H A;  2RUE A;  1GTA A;  1VF3 A;  2VD0 A;  5B6M A;  4V1A p;  4HJ2 A;  4XS6 A;  1JZO A;  2CX4 A;  2IMF A;  3ZLP A;  4HOJ A;  2K8V A;  1TTZ A;  1NSW A;  4FH8 A;  3LGC A;  1K0D A;  3LJR A;  2C8U A;  1YZX A;  1SK1 A;  1XBS A;  22GS A;  4FIW A;  1HNC A;  2PMT A;  4GSS A;  1MDK A;  5CAX A;  3UIW A;  2OE3 A;  1QMV A;  2GST A;  1OKT A;  4HZ4 A;  4ZB9 A;  3F9U A;  3HJM A;  5DJL A;  1YKC A;  4IEL A;  2LEG A;  2DJ1 A;  1T7P B;  4FO5 A;  1TK8 B;  1GH2 A;  5F07 A;  1B48 A;  3UMA A;  3RPN A;  3UEM A;  1X5C A;  3EMX A;  3M3M A;  1TRW A;  2L57 A;  2HSH A;  2H66 A;  1OKD A;  1ILO A;  1X9W B;  4PX1 A;  3KM6 A;  2OKA A;  2FWG A;  2VLU A;  1MD3 A;  2I3Y A;  2DML A;  1SKS B;  3ZMK A;  3M1G A;  2MBT A;  4HQS A;  3IE3 A;  2CX3 A;  5IPG A;  2VAF A;  5FT3 A;  4WF5 A;  4GSN A;  1DUG A;  3D5J A;  4XTS A;  1R7H A;  2F9S A;  1PN9 A;  1AUC A;  4WR4 A;  5G5F A;  4AJ8 A;  3LXT A;  4KH7 A;  4BVX B;  4JRR A;  4KSO A;  5COH A;  5B8A A;  5CRE A;  4K6X A;  3FZ4 A;  1BG5 A;  1QUW A;  2O8V B;  1WIK A;  5AN1 A;  2P31 A;  2HQT A;  3H4K A;  4EDY A;  3KP8 A;  3DML A;  2GZP A;  1RQM A;  1M2A A;  4PTS A;  1YF1 A;  1AC1 A;  3EWL A;  3ZVJ A;  8GSS A;  3FYG A;  4ML6 A;  4ECJ A;  2HI7 A;  1GTU A;  3F6F A;  3CYN A;  2GS3 A;  1GSQ A;  1GSD A;  4K1F A;  3F4R A;  4EUY A;  3GUS A;  2H8L A;  3Q19 A;  3HZ8 A;  4K8M A;  3HDC A;  4WEY A;  4HI7 A;  1K0O A;  2H1A A;  4XCS A;  2H6Y A;  1K0A A;  2X64 A;  1R4W A;  3WGE A;  4YAV A;  3FK8 A;  4I2U A;  3GH9 A;  2P5R A;  1K3L A;  2MMN A;  4TXO B;  2M46 A;  1AAZ A;  1WMJ A;  3EU3 A;  1M2B A;  3GUR A;  4IN0 A;  3K8N A;  2FWE A;  5IIZ A;  2NDO A;  5E59 A;  2GT6 A;  4V2L A;  4G10 A;  3GNJ A;  4ID0 A;  4KDX A;  3FRC A;  3FR9 A;  2DC5 A;  3QDN A;  3TRP A;  1J9B A;  1TKD B;  1ABA A;  1FG4 A;  2FCH A;  1VF4 A;  2TIR A;  4K9Z A;  1UN2 A;  3EU4 A;  2FHE A;  1QXH A;  4MH3 A;  3TOT A;  2H30 A;  3CBU A;  2E2M A;  1JFU A;  3GTU A;  2YV9 A;  2VLV A;  4MJB A;  1H75 A;  2XBQ A;  2DLX A;  4XIH A;  3Q74 A;  1F3B A;  1FOV A;  4TKY A;  5JWR B;  3VPT A;  4TRX A;  3W6G A;  2HRN A;  2C0F A;  4PUF C;  3IC8 A;  4NHZ A;  1R5A A;  5D9X A;  2N5A A;  2QKE A;  2VCX A;  1M2D A;  1QQ2 A;  3QFA C;  4D73 A;  2FGX A;  1ZYE A;  2C0E A;  3TKS E;  2H76 A;  5ID2 B;  2K8S A;  1A24 A;  1FAA A;  4E8H A;  3GA4 A;  2FD3 A;  4KDY A;  3VWU A;  2F8F A;  2ALB A;  3NIV A;  1K3O A;  3LFL A;  3G7I A;  4POM A;  5G2Z A;  3C1S A;  5G31 A;  2H70 A;  4F0B A;  2YCD A;  2IFQ B;  5ECK B;  4MF7 A;  2V41 A;  1VF1 A;  1YDK A;  3BJ5 A;  4MMM A;  1IYH A;  3LSZ A;  2EIQ A;  3ZFL A;  3L0H A;  4TR4 A;  3L4N A;  3HZ4 A;  4KE3 A;  5CRD A;  1GUH A;  5IMF A;  2H71 A;  2X8H A;  4JE1 A;  3H93 A;  1NHO A;  3ED3 A;  1KEB A;  3NOF A;  3US3 A;  2QSI A;  2VCV A;  2JU5 A;  2ZCT A;  4Q5F A;  3CRT A;  4PQ1 A;  4PXO A;  20GS A;  4ML1 A;  3GYK A;  4KW6 A;  3EIN A;  1OYJ A;  5ECH B;  4KB3 A;  3TB2 A;  1V57 A;  2IWT A;  2PER A;  3D4M A;  1TRU A;  3U5R E;  5IMA A;  1FVJ A;  3A3T A;  4IJ3 A;  1OAZ A;  3GL5 A;  1URM A;  5J3R A;  1SD9 A;  3RAZ A;  5J5N A;  3PGT A;  1MEK A;  1XW5 A;  1FB0 A;  5ECP B;  1C72 A;  2H73 A;  2C0D A;  2KLX A;  4OD7 A;  1A0R P;  4KCA A;  3UBK A;  1T4Z A;  3M8N A;  4KND A;  2X8G A;  4QQ7 A;  3BBY A;  3FZA A;  4EO3 A;  4H86 A;  3F6D A;  2H6Z A;  3E9J B;  1GL8 A;  3WD6 A;  4K0G A;  2ES7 A;  4IGJ A;  4MP4 A;  1Z3E A;  3ERW A;  3KJY A;  1HD2 A;  5IM9 A;  4RQR A;  2Z9S A;  2WDU A;  4EE0 A;  4BVY B;  1V2A A;  3IK7 A;  1SYR A;  1GUK A;  4GF0 A;  3E3E A;  3CSH A;  4HS1 A;  2PU9 C;  1XZO A;  4LLR A;  2H0H A;  2N5B A;  4MZW A;  2JAC A;  4PUR A;  1EGR A;  4IP1 A;  4PGT A;  5GZZ B;  2RM6 A;  6GSY A;  2CA8 A;  1N8J A;  1YKA A;  2GQK A;  2NVL A;  3TDG A;  1K0N A;  4TR3 A;  3PPU A;  1SL2 B;  2OAD A;  1TP9 A;  5D9V A;  2WCI A;  3QFB C;  1MDJ A;  1SL0 B;  4X43 A;  4MPG A;  2LJK A;  3RBT A;  4YQM A;  4ZXG A;  3TOU A;  3D21 A;  4MLY A;  1E2Y A;  2E7P A;  3FR6 A;  2AJQ B;  1XWA A;  1GSS A;  2CAQ A;  2YWI A;  2VO4 A;  4EXJ A;  2IN3 A;  2GTU A;  2YJH A;  3ZRD A;  1TK5 B;  5DAL A;  1YQ1 A;  5DBQ A;  2PPT A;  4JBB A;  2AYT A;  1BED A;  3F4S A;  4KUN A;  1ZMA A;  2R2J A;  1B9X C;  5B6N A;  1G7O A;  4NV2 A;  5J4U A;  5CRG A;  4ECI A;  5DAK A;  2UZ8 A;  5JWQ B;  3QPM A;  1XIY A;  3GIX A;  2PN8 A;  1G0T A;  11GS A;  1WWJ A;  5CRW A;  1GSU A;  2FLS A;  4IKH A;  1PX6 A;  1LJR A;  3KGK A;  1BX9 A;  1W89 A;  4MJC A;  2VL3 A;  2YN1 A;  6GSV A;  2GT5 A;  5IMC A;  1PA3 A;  2JL4 A;  5AIX A;  1DE2 A;  2FA8 A;  4WXT A;  3EUR A;  3KCM A;  3HVS A;  2MZC A;  4XHM A;  3TRQ A;  3ZL5 A;  1SYX A;  2HZE B;  5DQS A;  1QFN A;  3WYW A;  2HRK A;  1BYE A;  4GLT A;  4V2M A;  4GWR A;  1M9B A;  5ECR B;  5GAN D;  2MBS A;  1VGL A;  1XWC A;  5CYY A;  2R4V A;  1SL1 B;  2NPB A;  1IYI A;  4WBR D;  2GSS A;  1TI3 A;  1MTC A;  2YNX A;  1TRS A;  4N11 A;  4EKZ A;  2N5F A;  1SJI A;  3O6T A;  1PGT A;  2GQL A;  5KEJ A;  2E2G A;  4KA0 A;  1FHE A;  4MPF A;  1O8X A;  4IS0 A;  3IAS 2;  1OC9 A;  2ZNM A;  1B4Q A;  5DVB A;  5ECO B;  4Q5N A;  4RI6 A;  1U3A A;  2H0G A;  3KTL A;  1T1V A;  4DSS A;  2VOC A;  1EP8 A;  2C80 A;  2DSA A;  3DEX A;  4DVC A;  1EZK A;  3F3R A;  5GAP D;  1X5D A;  4ULX A;  2KHP A;  4TR1 A;  2TRX A;  5D9T A;  4PQI A;  3WT1 A;  5CRH A;  3GKK A;  3C7M A;  2DJK A;  3IOS A;  1HNA A;  2R37 A;  3M9J A;  1X5E A;  2IPA A;  2K9F A;  4RI7 A;  3VFI A;  1T4Y A;  2AV4 A;  4G19 A;  4XS4 B;  5IOW A;  3APO A;  1ACV A;  5J9C A;  1O73 A;  3CSI A;  1S3A A;  2LRN A;  3IPZ A;  1ERU A;  3JCM L;  4HUA A;  4XRA A;  2LKU A;  2YWM A;  1XFL A;  3F0I A;  3EYT A;  3IBH A;  5IPH A;  3H1N A;  2V1M A;  4F82 A;  5C04 A;  2VD1 A;  2VCW A;  4MJE A;  3ZIJ A;  1GNW A;  1Q4J A;  4EF0 A;  1SK0 A;  1O7U A;  1UA5 A;  3TJB A;  3UL3 A;  3DVW A;  5HFI A;  2HSN B;  2G2Q A;  4FYB A;  2YOI A;  3ZRE A;  3EC3 A;  2LV3 A;  3TKR A;  5JCW A;  2K6V A;  2LRC A;  1ZL9 A;  1WPI A;  4L0W A;  3P8W A;  5ABR A;  4JR6 A;  2R6K A;  2KOK A;  1GNE A;  2WB9 A;  5EL8 A;  3M0F A;  2PGT A;  9GSS A;  3PIN A;  2H75 A;  3APQ A;  1HQO A;  3TRX A;  2A2S A;  3DRN A;  2H6X A;  5FWG A;  2P0G A;  1TRV A;  4JZQ A;  3GX0 A;  1ZGN A;  2VL2 C;  3DVX A;  4MF6 A;  1OC3 A;  3FY7 A;  2YP6 A;  3KZQ A;  1SJ6 A;  4LMW A;  5EVO A;  3RHC A;  1A2L A;  1KNG A;  5AGY A;  4FYC A;  5AIS A;  3GSS A;  2IMI A;  3VWV A;  1G6W A;  5ECL B;  3P90 A;  1LU4 A;  3TCO A;  1A8L A;  1F3A A;  4E8E A;  18GS A;  2V32 A;  2F51 A;  2XPD A;  2D2Z A;  4N30 A;  1ERW A;  2NBS A;  1V98 A;  4EC0 A;  4KGI A;  2REM A;  2GLR A;  1U88 A;  3GKX A;  2LST A;  3ZIV A;  1T3B A;  4MJA A;  1HNB A;  4CW9 A;  2DJ2 A;  2L4C A;  2L5L A;  1XWG A;  4NMU A;  1NW2 A;  3R3E A;  4NV5 A;  2I4A A;  6GSU A;  2E0Q A;  4X1U A;  4WR5 A;  5L71 A;  2C4J A;  1A23 A;  1J0F A;  1DE1 A;  4V1A g;  2C1Y A;  4OCE A;  4ZBD A;  2HNL A;  1J08 A;  2RUF A;  2RM5 A;  3HY2 A;  2I81 A;  4POB A;  4DEJ A;  3EMP A;  3WGD A;  3CSJ A;  1M9A A;  5ECQ B;  3L9U A;  3F8U A;  3LWA A;  3WGX A;  1A0F A;  1XOA A;  2GDR A;  2I1U A;  3IV4 A;  1JHB A;  5G30 A;  4PNG A;  3GV1 A;  1EV4 A;  4O92 A;  1R5P A;  2HSM A;  4ZIJ A;  2F3M A;  4BVX A;  3DIE A;  2F8A A;  4L5O A;  2WUL A;  4ZB8 A;  5HR0 A;  1PMT A;  3EE2 A;  1PL1 A;  2M72 A;  2VCZ A;  1YY7 A;  4ILF A;  1Y6E A;  2JSZ A;  2CVD A;  2CQ9 A;  3FZ5 A;  3G9B A;  2CZ2 A;  1JZR A;  4X0X A;  1FO5 A;  1EOG A;  1O6J A;  3KD0 A;  4G0K A;  3W8J A;  5DAL B;  2EC4 A;  3FW2 A;  2VCT A;  2C3T A;  4NHW A;  1Z7R A;  3J7Y b;  2HLS A;  2WJU A;  3UVH A;  2OE1 A;  4Z7X A;  1X0R A;  2JZR A;  3C71 A;  1EEJ A;  3S9F A;  4AJ6 A;  3HJO A;  2ZUP A;  1GUL A;  4WKW A;  3O76 A;  5D73 A;  3ISO A;  1BJX A;  4O7H A;  2DIY A;  5IQY A;  2ON5 A;  1XVQ A;  5F0G A;  5DAK B;  3GL3 A;  1Z6M A;  3IK9 A;  2L5O A;  4TW5 A;  2XHF A;  5ECN B;  2CZ3 A;  3VI7 A;  4OFT A;  1XVW A;  4I97 A;  1O8W A;  2LQO A;  2FWF A;  3WT2 A;  2DIZ A;  1THX A;  3W8S A;  2LNS A;  3TKS C;  4TVE A;  3IRA A;  5B7C A;  4MCU A;  4MF5 A;  3TKP A;  3LYP A;  1UVZ A;  2KP1 A;  1U87 A;  3ME7 A;  2VM1 A;  1SKR B;  3TKQ A;  5F8B A;  1GSY A;  3UJ1 A;  4HZ2 A;  2RLI A;  3KH9 A;  3IR4 A;  4BA7 A;  2H01 A;  2FY6 A;  3VWW A;  2EIR A;  2MYG A;  3P7X A;  1K0C A;  3HVV A;  4GQF A;  1EGO A;  3I6A A;  2FUG 2;  1TDI A;  1GLQ A;  4YQU A;  6GSX A;  1I9D A;  1PD2 1;  2DBC A;  4NWY A;  1R26 A;  2B7J A;  2OBK A;  4NAX A;  5CNW A;  1XW9 A;  2CT6 A;  4IP6 A;  1OC9 B;  4FYU A;  1B4P A;  3SWL A;  1ST9 A;  2IFQ A;  3I9V 2;  2V6O A;  2H1D A;  1GP1 A;  2CV4 A;  2IJY A;  3A2W A;  3H79 A;  2GSR A;  5ELA A;  1X9S B;  3G7J A;  3KTB A;  1MDI A;  4IHU A;  5HR3 A;  5JWO B;  4POK A;  3QAV A;  3ZYW A;  3FZ9 A;  3IHQ A;  4BL7 A;  1B9Y C;  4TR1 B;  3I43 A;  2C3N A;  1XWB A;  3HJP A;  1NM3 A;  3VI5 A;  4G0I A;  3O3T A;  2B5X A;  3TJG A;  3D0Z A;  1TI1 A;  4LL1 B;  5ECS A;  1AQV A;  1AXD A;  2X99 A;  5HR1 A;  2GGT A;  1Q98 A;  3FKF A;  5H5Q A;  4GRF A;  1GTI A;  5GSS A;  1VRS D;  4DSR A;  2O7K A;  2YPM A;  3ZVJ D;  1GSE A;  3GN3 A;  5F05 A;  2GQM A;  1TJD A;  3VPQ A;  2YZH A;  1JLW A;  3HCZ A;  17GS A;  4OO4 A;  1YEP A;  4EL1 A;  2C3Q A;  2H72 A;  2IL3 A;  3F4T A;  5ENU A;  5IO0 A;  1PQN A;  2YJ7 A;  3HA9 A;  5AIV A;  2HXK A;  4ECC A;  3V1W A;  1MD4 A;  3FEU A;  1WJK A;  6GST A;  4ACS A;  1T00 A;  2IME A;  5ECM B;  4YAP A;  3HD5 A;  1OC8 A;  1M0U A;  2J23 A;  4J57 E;  1SK2 A;  1SEN A;  4EVM A;  1Z7P A;  2K18 A;  3CTG A;  3UAP A;  1DBY A;  3UVT A;  1BAY A;  3KEB A;  3J7Y k;  1V58 A;  4K0N A;  4AJ7 A;  3KMN A;  3GHA A;  4MZC A;  2LJA A;  2MMO A;  1TOF A;  3F63 A;  1A8Y A;  3Q6O A;  4ZL8 A;  1TXX A;  2VIM A;  4HJM A;  3PH9 A;  2AHE A;  1WOU A;  5DCG A;  1ZCP A;  3BD2 A;  4J2F A;  1O85 A;  5DCH A;  1N2A A;  3MDK A;  3KH7 A;  2OJL A;  4XS1 A;  5G1L A;  2OBI A;  2PVQ A;  1FB6 A;  2I9H A;  1PKW A;  2XBI A;  4KDU A;  1E6B A;  3R2Q A;  2VUP A;  3N5O A;  2R5G A;  5G1K A;  2JAD A;  4NXI A;  2YWO A;  5LNK e;  4ZL9 A;  3U6V A;  2GZY A;  2HSY A;  13GS A;  3GTU B;  5DDL A;  2A4V A;  2BMX A;  4RQX A;  5INY A;  3IA1 A;  3SBC A;  3ERG A;  4ECB A;  1BQ7 A;  1Z5Y E;  2TRC P;  2NTO A;  1G6Y A;  1OE8 A;  1WE0 A;  4TN8 A;  3DXB A;  5KN0 A;  1AQW A;  1A2J A;  2IMD A;  4I6X A;  4O5R A;  2JZS A;  4HEA 2;  1THO A;  3I69 A;  4D73 B;  1Z6N A;  2RII A;  4N0Z A;  4K7I A;  1G7E A;  3G7Y A;  1PL2 A;  1ERT A;  4JU5 A;  2JZT A;  1PRX A;  2R3X A;  3QR6 A;  4BWS A;  10GS A;  5FHI A;  1A2M A;  1WRY A;  4F03 A;  3VUR A;  1EP7 A;  4HU7 A;  3TJJ A;  5GST A;  1ZZY A;  3Q18 A;  2PUK C;  5D93 A;  2HSM B;  1GTB A;  4TXV A;  1ZOF A;  1M99 A;  1HYU A;  3L9V A;  1M7T A;  3P2A A;  2EIO A;  4PUA A;  4IVF A;  3GFK A;  4OFN A;  4ZB6 A;  6GSS A;  2MMZ A;  3TUE A;  3ME8 A;  1PKZ A;  1PX7 A;  1S3D A;  3QOU A;  1XWK A;  2HRA A;  5LCZ A;  2KUC A;  5A4U A;  4V2N A;  4BWQ A;  4ZL7 A;  4IJI A;  2BJX A;  3L78 A;  1AIU A;  3QCP A;  4OO5 A;  3GST A;  2GVP A;  5KN3 A;  4MAB A;  4HU9 A;  3QAG A;  3FR3 A;  2HZE A;  5IMV A;  4BPY A;  2B5E A;  4OWY A;  1AQX A;  2YZU A;  2HE3 A;  3N9J A;  4Q5Q A;  2LTK A;  4OMV A;  2H74 A;  1KBN A;  2XPE A;  5EPF A;  1PSQ A;  1SU9 A;  1JLV A;  2QGV A;  3MSZ A;  3IDV A;  4K7O A;  5CO3 A;  3HKR A;  3TJF A;  7GSS A;  2LNT A;  4G0L A;  4WBJ A;  1EOH A;  4GTU A;  2VL2 A;  3HYP A;  1GRX A;  2WRT A;  1WP0 A;  1GLP A;  4P3Y B;  5JCG A;  4ISD A;  1UC7 A;  2KP2 A;  2L6C A;  5EY6 A;  1TU8 A;  1XW6 A;  1ERV A;  1FVK A;  5H5R A;  3VWX A;  4F2I A;  3ERF A;  4POL A;  4GST A;  3GX8 A;  2YAN A;  4QL9 A;  2VM2 A;  3GMF A;  2LUS A;  1YF0 A;  2L4Q A;  2DMM A;  2HFD A;  4FQU A;  4CDO A;  2CVK A;  3HXS A;  2X8C A;  3A2X A;  3C8E A;  5ELG A;  1H4O A;  2O87 A;  1QK8 A;  12GS A;  3QAW A;  1XCC A;  2H19 A;  2IMK A;  3RHB A;  1V40 A;  4K2D A;  3QD9 A;  3A2V A;  1Y25 A;  4XS4 A;  4TR0 A;  1EV9 A;  2B7K A;  1I5G A;  3QMX A;  2J9H A;  4OFM A;  3EVI A;  1JZD A;  3GKN A;  1TW9 A;  2OAC A;  4USS A;  3D6I A;  4GQC A;  2OA7 A;  4Q5R A;  5HFK A;  2H1B A;  3L9S A;  4OCF A;  3BCI A;  1YJ6 A;  1AW9 A;  4L5L A;  2DJ3 A;  4LL4 B;  1EEM A;  1XPV A;  2WS2 A;  3C1R A;  2WGR A;  5HR2 A;  2H0I A;  5HFG A;  1GUM A;  2MMA A;  1CQH A;  2AAW A;  19GS A;  3APS A;  3M9K A;  3CTF A;  3LOR A;  5JCU A;  4BL7 B;  5A4W A;  4LMV A;  2H1G A;  4J56 E;  2G0F A;  1F37 A;  4LA1 A;  5D96 A;  3E0U A;  3OR5 A;  3ZTL A;  3KMO A;  2O85 A;  2B5Y A;  3DYR A;  3GKM A;  4HDE A;  3DGQ A;  4EDZ A;  1U3I A;  3IXR A;  4O32 A;  2FWH A;  4MZB A;  2AUV A;  1O81 A;  5KN1 A;  3HVX A;  4NPB A;  1YEX A;  4AF2 A;  4ZBB A;  4MK3 A;  1TU7 A;  4TXO A;  6GSW A;  5BMU A;  3BCK A;  4KX4 A;  2P5Q A;  2DJ0 A;  2L59 A;  5LD0 A;  2VLT A;  3MWH A;  2LS5 A;  5D9W A;  4MDC A;  4JR4 A;  2DJJ A;  5E4W A;  16GS A;  2HRF A;  2C0G A;  1FW1 A;  3CRU A;  2XC2 A;  3ZZX A;  4L0U A;  2IIY A;  4MH2 A;  3D4T A;  1XOB A;  5D8I A;  4PNF A;  4HQZ A;  3LG6 A;  1CQG A;  3NZN A;  3DD3 A;  3TKS A;  4ZBA A;  4IQ1 A;  3AY8 A;  5IOX A;  2CVB A;  2L6D A;  4IW9 A;  2CAI A;  4TOP A;  2GSQ A;  4F0C A;  1SD8 A;  1NHY A;  2HRK B;  4KF9 A;  1XXU A;  2FA4 A;  1RK4 A;  5HQP A;  5IMD A;  3MAK A;  3A5W A;  4I8B A;  5C00 A;  1KTE A;  3F3Q A;  5A4V A;  3C73 A;  3GH6 A;  1GWC A;  2OE0 A;  2AB6 A;  4N10 A;  4IBP A;  2QC7 A;  3UBL A;  4I5Q A;  3BOA A;  4KCE A;  4F9Z A;  5ID2 A;  4ZIL A;  4K7N A;  3CMI A;  1T8E B;  4MA9 A;  1OE7 A;  4N0V A;  1OVN A;  4AGS A;  3LQ7 A;  2FNO A;  3KP9 A;  3ZIT A;  3IC4 A;  2O89 A;  4GCI A;  4KSM A;  3KIJ A;  3VLN A;  4DSS B;  3DWV A;  1X9M B;  1GSF A;  5F06 A;  2M80 A;  3TJK A;  2HZF A;  5G5E A; 
#chains in the Genus database with same CATH topology
 4PQH A;  2BTO T;  2WFC A;  5CP1 A;  2VL9 A;  2PVO C;  4YQV A;  4EIP A;  3UOM A;  3LXZ A;  5B8B A;  2GZZ A;  2B3S A;  2WZ9 A;  3D22 A;  2VCQ A;  5IO2 A;  3RPP A;  1BF5 A;  3GRX A;  1SJZ A;  4WET A;  2HT9 A;  3UAR A;  2LRT A;  4IQA A;  2B1K A;  2PWJ A;  5DJM A;  2YWN A;  14GS A;  2LJR A;  1K3Y A;  3PR8 A;  5J9B A;  3H8Q A;  4XRD A;  1QGV A;  3RDW A;  3DKS A;  5J41 A;  5KN2 A;  3CXG A;  4GXZ A;  2JSY A;  1F6M C;  3HHV A;  1V9W A;  3FHK A;  2B6M A;  1K0B A;  3TGZ A;  4YH2 A;  1SVM A;  1S3C A;  5A5K A;  1F9M A;  2A2R A;  2YV7 A;  2LQQ A;  4CHS A;  4MNN A;  2HYX A;  1ZYQ B;  2O36 A;  1TK0 B;  5H5S A;  1K0M A;  1YEW C;  1EWX A;  3ZFB A;  1VF2 A;  4I2T A;  1U6T A;  2V2G A;  1W4V A;  1B8X A;  3VK9 A;  1LBK A;  4G2E A;  4WF4 A;  1ML6 A;  1F2E A;  1JZW A;  5IMZ A;  3LYK A;  4KAE A;  4DSQ A;  2B1L A;  3ZML A;  2V6K A;  1USB A;  1ON4 A;  4RUV A;  1DSB A;  1Z9H A;  1SKW B;  1RW1 A;  3KXO A;  4JED A;  4BVY A;  3IAM 2;  4L8E A;  1XG8 A;  5ECI B;  4G01 A;  2ON7 A;  4QL7 A;  3LEF A;  2PBJ A;  5DQY A;  3MNG A;  4G9H A;  2RUE A;  1GTA A;  1VF3 A;  2VD0 A;  5B6M A;  4V1A p;  4HJ2 A;  4XS6 A;  1JZO A;  2CX4 A;  2IMF A;  3ZLP A;  4HOJ A;  2K8V A;  1TTZ A;  1NSW A;  4FH8 A;  3LGC A;  1K0D A;  3LJR A;  2C8U A;  1YZX A;  1SK1 A;  1XBS A;  22GS A;  4FIW A;  1HNC A;  2PMT A;  4GSS A;  1S3R A;  1MDK A;  5CAX A;  3UIW A;  2OE3 A;  1QMV A;  2GST A;  1OKT A;  4HZ4 A;  4ZB9 A;  3F9U A;  4Z2U A;  3HJM A;  5DJL A;  1YKC A;  4IEL A;  2LEG A;  2DJ1 A;  1T7P B;  4FO5 A;  1TK8 B;  1GH2 A;  5F07 A;  1B48 A;  3UMA A;  3RPN A;  3UEM A;  1X5C A;  3EMX A;  3M3M A;  1TRW A;  2L57 A;  2HSH A;  2H66 A;  1OKD A;  1ILO A;  1X9W B;  4PX1 A;  3KM6 A;  2OKA A;  5J47 A;  2FWG A;  2VLU A;  1MD3 A;  2I3Y A;  2DML A;  1SKS B;  3ZMK A;  3M1G A;  2MBT A;  4HQS A;  3IE3 A;  2CX3 A;  5IPG A;  2VAF A;  5FT3 A;  2EFC A;  4WF5 A;  4GSN A;  1DUG A;  3D5J A;  4XTS A;  1R7H A;  2F9S A;  1PN9 A;  1AUC A;  4AKG A;  4WR4 A;  5G5F A;  4AJ8 A;  3LXT A;  4KH7 A;  4BVX B;  5J4V A;  4JRR A;  1SVL A;  4KSO A;  5COH A;  5B8A A;  5CRE A;  4K6X A;  3FZ4 A;  1BG5 A;  1QUW A;  2O8V B;  1WIK A;  5AN1 A;  2P31 A;  2HQT A;  3H4K A;  4EDY A;  3KP8 A;  3DML A;  2GZP A;  3MIX A;  1RQM A;  1M2A A;  4PTS A;  1YF1 A;  1AC1 A;  3EWL A;  3ZVJ A;  8GSS A;  3FYG A;  4ML6 A;  4ECJ A;  2HI7 A;  1GTU A;  3F6F A;  3CYN A;  2GS3 A;  1GSQ A;  1GSD A;  4K1F A;  3F4R A;  4EUY A;  3GUS A;  2H8L A;  3Q19 A;  3HZ8 A;  4K8M A;  3HDC A;  4WEY A;  4HI7 A;  1K0O A;  2H1A A;  4XCS A;  2H6Y A;  1K0A A;  3EPT A;  2X64 A;  1R4W A;  3WGE A;  4YAV A;  3FK8 A;  4I2U A;  2WVX B;  3TU3 B;  1ZYP A;  3GH9 A;  2P5R A;  1K3L A;  2MMN A;  4TXO B;  5BMU B;  2M46 A;  1AAZ A;  1WMJ A;  3EU3 A;  1M2B A;  3GUR A;  4IN0 A;  3K8N A;  2FWE A;  5IIZ A;  2NDO A;  5E59 A;  1BG1 A;  2GT6 A;  4V2L A;  4G10 A;  3GNJ A;  4ID0 A;  4KDX A;  3FRC A;  3FR9 A;  2DC5 A;  3QDN A;  3TRP A;  1J9B A;  4N3Z A;  1TKD B;  1ABA A;  1FG4 A;  2FCH A;  1VF4 A;  2TIR A;  4K9Z A;  1UN2 A;  3EU4 A;  2FHE A;  4Z2R A;  1QXH A;  4MH3 A;  3TOT A;  2H30 A;  3CBU A;  2E2M A;  1JFU A;  3GTU A;  2YV9 A;  2VLV A;  4MJB A;  1H75 A;  2XBQ A;  2DLX A;  4XIH A;  3Q74 A;  1F3B A;  1M3J A;  1FOV A;  4TKY A;  5JWR B;  3VPT A;  4TRX A;  3W6G A;  2HRN A;  2C0F A;  4PUF C;  3IC8 A;  4E68 A;  4NHZ A;  1R5A A;  5D9X A;  2N5A A;  2QKE A;  2VCX A;  1M2D A;  1QQ2 A;  3QFA C;  4D73 A;  2FGX A;  1ZYE A;  2C0E A;  3TKS E;  2H76 A;  5ID2 B;  5A1N A;  2K8S A;  1A24 A;  1FAA A;  4E8H A;  2EFD A;  3GA4 A;  2FD3 A;  4KDY A;  3VWU A;  2F8F A;  2ALB A;  3NIV A;  1K3O A;  3LFL A;  3G7I A;  4POM A;  5G2Z A;  3C1S A;  5G31 A;  2H70 A;  4F0B A;  3CQF A;  2YCD A;  2IFQ B;  5ECK B;  4MF7 A;  2V41 A;  1VF1 A;  4CY6 A;  1YDK A;  3BJ5 A;  4MMM A;  1IYH A;  3LSZ A;  2HSN A;  2EIQ A;  3ZFL A;  3L0H A;  4TR4 A;  3L4N A;  3HZ4 A;  4KE3 A;  5CRD A;  1GUH A;  5IMF A;  2H71 A;  2X8H A;  4JE1 A;  3H93 A;  1NHO A;  3ED3 A;  1KEB A;  3NOF A;  4AI6 A;  3US3 A;  2QSI A;  2VCV A;  2UV8 G;  2JU5 A;  2ZCT A;  4Q5F A;  3CRT A;  4PQ1 A;  4PXO A;  20GS A;  4ML1 A;  3GYK A;  4KW6 A;  1FOH A;  3EIN A;  2X49 A;  1OYJ A;  5ECH B;  4KB3 A;  3TB2 A;  1V57 A;  2IWT A;  2PER A;  3D4M A;  1TRU A;  3U5R E;  5IMA A;  1FVJ A;  3A3T A;  4IJ3 A;  1OAZ A;  3GL5 A;  1URM A;  5J3R A;  1SD9 A;  4O5U A;  3RAZ A;  5J5N A;  3PGT A;  1MEK A;  3A5I A;  1XW5 A;  1FB0 A;  5ECP B;  1C72 A;  2H73 A;  2C0D A;  2KLX A;  4OD7 A;  1A0R P;  4KCA A;  3UBK A;  1T4Z A;  3M8N A;  4KND A;  2X8G A;  4QQ7 A;  3BBY A;  3FZA A;  4EO3 A;  4H86 A;  3F6D A;  2H6Z A;  5A5H A;  3E9J B;  1GL8 A;  3WD6 A;  4K0G A;  2ES7 A;  4IGJ A;  4MP4 A;  1Z3E A;  3ERW A;  3KJY A;  1HD2 A;  5IM9 A;  4RQR A;  2Z9S A;  2WDU A;  4EE0 A;  4BVY B;  1V2A A;  3IK7 A;  1SYR A;  1GUK A;  4GF0 A;  4HSC X;  3E3E A;  3CSH A;  4HS1 A;  2PU9 C;  1XZO A;  4LLR A;  2H0H A;  2N5B A;  4MZW A;  2R0G A;  2JAC A;  4PUR A;  1EGR A;  4IP1 A;  4CY8 A;  4PGT A;  5GZZ B;  2RM6 A;  6GSY A;  2CA8 A;  1N8J A;  1YKA A;  2GQK A;  2NVL A;  3TDG A;  1K0N A;  4TR3 A;  3PPU A;  1SL2 B;  2OAD A;  1TP9 A;  5D9V A;  2WCI A;  3QFB C;  1MDJ A;  1SL0 B;  4X43 A;  4MPG A;  2LJK A;  3RBT A;  4YQM A;  4ZXG A;  3TOU A;  3D21 A;  4MLY A;  1E2Y A;  3RGB C;  2E7P A;  3FR6 A;  2AJQ B;  1XWA A;  1GSS A;  2CAQ A;  2YWI A;  2QA2 A;  2VO4 A;  4EXJ A;  2IN3 A;  2GTU A;  3CHX C;  2YJH A;  3ZRD A;  1TK5 B;  5DAL A;  1YQ1 A;  5DBQ A;  2PPT A;  4JBB A;  2AYT A;  1BED A;  4YKG A;  4AKH A;  3F4S A;  4KUN A;  1ZMA A;  1TXU A;  2R2J A;  1B9X C;  4K5R A;  5B6N A;  1G7O A;  4NV2 A;  5J4U A;  5CRG A;  4A5P A;  4ECI A;  2EFE A;  5DAK A;  2UZ8 A;  5JWQ B;  3QPM A;  1XIY A;  5BRT A;  3GIX A;  2PN8 A;  1G0T A;  11GS A;  1WWJ A;  5CRW A;  1GSU A;  2FLS A;  4IKH A;  1PX6 A;  1LJR A;  4ZB7 A;  3KGK A;  1BX9 A;  1W89 A;  4MJC A;  2X4A A;  2VL3 A;  2YN1 A;  6GSV A;  2GT5 A;  1I1I P;  5IMC A;  1PA3 A;  2JL4 A;  5AIX A;  1DE2 A;  2FA8 A;  4WXT A;  3EUR A;  3KCM A;  3HVS A;  2MZC A;  4XHM A;  3TRQ A;  3ZL5 A;  1SYX A;  4QMK A;  2HZE B;  5DQS A;  1QFN A;  3WYW A;  2HRK A;  1BYE A;  4GLT A;  4V2M A;  4GWR A;  1M9B A;  5ECR B;  5GAN D;  2MBS A;  1VGL A;  4PHZ C;  1XWC A;  5CYY A;  2R4V A;  1SL1 B;  2NPB A;  1IYI A;  4WBR D;  2VKZ G;  2GSS A;  1TI3 A;  1MTC A;  2YNX A;  1TRS A;  4N11 A;  4EKZ A;  2N5F A;  1SJI A;  4PI2 C;  3O6T A;  1PGT A;  2GQL A;  5KEJ A;  2E2G A;  4KA0 A;  1FHE A;  4MPF A;  1O8X A;  4IS0 A;  3IAS 2;  1OC9 A;  2ZNM A;  1B4Q A;  5DVB A;  5ECO B;  4Q5N A;  2O5V A;  4RI6 A;  1U3A A;  2H0G A;  3KTL A;  1T1V A;  4DSS A;  5A34 A;  2VOC A;  1EP8 A;  2C80 A;  5J40 A;  2DSA A;  3DEX A;  4DVC A;  1EZK A;  3F3R A;  5GAP D;  1X5D A;  4ULX A;  2KHP A;  4TR1 A;  2TRX A;  5D9T A;  1S4B P;  4PQI A;  3LW9 A;  3WT1 A;  5CRH A;  3GKK A;  3C7M A;  2DJK A;  3IOS A;  1HNA A;  2R37 A;  3M9J A;  1X5E A;  2IPA A;  2K9F A;  4RI7 A;  3VFI A;  1T4Y A;  2AV4 A;  4G19 A;  4XS4 B;  5IOW A;  3APO A;  1ACV A;  5J9C A;  1O73 A;  3CSI A;  1S3A A;  2LRN A;  3IPZ A;  1ERU A;  3JCM L;  4HUA A;  4XRA A;  2LKU A;  2YWM A;  1XFL A;  3F0I A;  3EYT A;  2R0C A;  3IBH A;  5IPH A;  3H1N A;  2V1M A;  4F82 A;  5C04 A;  2VD1 A;  2VCW A;  4MJE A;  3ZIJ A;  1GNW A;  1Q4J A;  4EF0 A;  1SK0 A;  1O7U A;  1UA5 A;  3TJB A;  3UL3 A;  3DVW A;  5HFI A;  2HSN B;  2G2Q A;  4FYB A;  2YOI A;  3ZRE A;  3EC3 A;  2LV3 A;  3TKR A;  5JCW A;  2K6V A;  2LRC A;  1ZL9 A;  1WPI A;  4L0W A;  3P8W A;  4X4J A;  5ABR A;  4JR6 A;  3CWG A;  2R6K A;  2KOK A;  1GNE A;  2WB9 A;  5EL8 A;  3M0F A;  2PGT A;  9GSS A;  3PIN A;  2QA1 A;  2H75 A;  3APQ A;  4AKI A;  1YVL A;  1HQO A;  3TRX A;  2A2S A;  3DRN A;  2H6X A;  5FWG A;  2P0G A;  1TRV A;  4JZQ A;  3GX0 A;  1ZGN A;  2VL2 C;  3DVX A;  5KOW A;  4MF6 A;  1OC3 A;  3FY7 A;  2YP6 A;  3KZQ A;  1SJ6 A;  4LMW A;  5EVO A;  3RHC A;  1A2L A;  1KNG A;  5AGY A;  4FYC A;  5AIS A;  3GSS A;  2IMI A;  3VWV A;  1G6W A;  5ECL B;  3P90 A;  1LU4 A;  3TCO A;  1A8L A;  1F3A A;  4E8E A;  18GS A;  2V32 A;  2F51 A;  2XPD A;  2D2Z A;  4N30 A;  1ERW A;  2NBS A;  4EIQ A;  1V98 A;  4EC0 A;  4KGI A;  2REM A;  2GLR A;  1U88 A;  3GKX A;  2LST A;  3ZIV A;  1T3B A;  4MJA A;  2WW0 A;  1HNB A;  4CW9 A;  2DJ2 A;  2L4C A;  2L5L A;  1XWG A;  4NMU A;  1NW2 A;  3R3E A;  4NV5 A;  2I4A A;  4GDF A;  6GSU A;  2E0Q A;  4X1U A;  4WR5 A;  4PI0 C;  5L71 A;  2C4J A;  1A23 A;  1J0F A;  1DE1 A;  4V1A g;  2C1Y A;  4OCE A;  4ZBD A;  2HNL A;  1J08 A;  2RUF A;  2RM5 A;  3HY2 A;  2I81 A;  4POB A;  4DEJ A;  3EMP A;  3WGD A;  3CSJ A;  1M9A A;  5ECQ B;  3L9U A;  3F8U A;  3LWA A;  3WGX A;  1A0F A;  1XOA A;  2GDR A;  2I1U A;  3IV4 A;  1JHB A;  5G30 A;  2WVZ A;  4PNG A;  3GV1 A;  1EV4 A;  4O92 A;  1R5P A;  2HSM A;  4ZIJ A;  2F3M A;  4BVX A;  3DIE A;  2F8A A;  4L5O A;  2WUL A;  4ZB8 A;  4Z2T A;  5HR0 A;  1PMT A;  3EE2 A;  1PL1 A;  2M72 A;  2VCZ A;  1YY7 A;  4ILF A;  1Y6E A;  2JSZ A;  2CVD A;  2CQ9 A;  3FZ5 A;  3G9B A;  2CZ2 A;  1JZR A;  4X0X A;  1FO5 A;  1EOG A;  1O6J A;  3KD0 A;  4K5S A;  4G0K A;  3W8J A;  5DAL B;  2EC4 A;  3FW2 A;  2VCT A;  2C3T A;  4NHW A;  1Z7R A;  3J7Y b;  2HLS A;  2WJU A;  3UVH A;  2OE1 A;  4Z7X A;  1X0R A;  2JZR A;  3HVN A;  3C71 A;  1EEJ A;  4BIK A;  4FXY P;  3S9F A;  4AJ6 A;  3HJO A;  2ZUP A;  1GUL A;  4WKW A;  3O76 A;  5D73 A;  3ISO A;  1BJX A;  4O7H A;  2DIY A;  5IQY A;  2ON5 A;  1XVQ A;  5F0G A;  5DAK B;  3GL3 A;  1Z6M A;  3IK9 A;  2L5O A;  4TW5 A;  2XHF A;  5ECN B;  2CZ3 A;  3VI7 A;  4OFT A;  1XVW A;  4I97 A;  1O8W A;  2LQO A;  2FWF A;  3WT2 A;  2DIZ A;  1THX A;  3W8S A;  3IHG A;  2LNS A;  3TKS C;  4TVE A;  3IRA A;  5B7C A;  4MCU A;  4MF5 A;  3TKP A;  3LYP A;  1UVZ A;  2KP1 A;  1U87 A;  3ME7 A;  2VM1 A;  2H1L A;  1SKR B;  3TKQ A;  5F8B A;  1GSY A;  3UJ1 A;  4HZ2 A;  2RLI A;  3KH9 A;  3IR4 A;  4BA7 A;  2H01 A;  2FY6 A;  3VWW A;  2EIR A;  2MYG A;  3P7X A;  1K0C A;  2EFH A;  3HVV A;  4GQF A;  1EGO A;  2A2P A;  3I6A A;  2FUG 2;  1TDI A;  1GLQ A;  4YQU A;  6GSX A;  1I9D A;  1PD2 1;  2DBC A;  4NWY A;  1R26 A;  2B7J A;  2OBK A;  4NAX A;  5CNW A;  1XW9 A;  2CT6 A;  4IP6 A;  1OC9 B;  4FYU A;  1B4P A;  3SWL A;  1ST9 A;  2IFQ A;  3I9V 2;  2V6O A;  2H1D A;  1GP1 A;  2CV4 A;  2IJY A;  3A2W A;  3H79 A;  2GSR A;  5ELA A;  1X9S B;  3G7J A;  3KTB A;  1MDI A;  4IHU A;  5HR3 A;  5JWO B;  4POK A;  3QAV A;  3ZYW A;  3FZ9 A;  3IHQ A;  4BL7 A;  1B9Y C;  4TR1 B;  3I43 A;  2C3N A;  1XWB A;  3HJP A;  1NM3 A;  3VI5 A;  4G0I A;  3O3T A;  2B5X A;  3TJG A;  3D0Z A;  1TI1 A;  4LL1 B;  5ECS A;  1AQV A;  1AXD A;  2X99 A;  5HR1 A;  2GGT A;  1Q98 A;  3FKF A;  5H5Q A;  4GRF A;  1GTI A;  5GSS A;  1VRS D;  4DSR A;  2O7K A;  2YPM A;  3ZVJ D;  1GSE A;  3GN3 A;  5F05 A;  2GQM A;  1TJD A;  3VPQ A;  2YZH A;  1JLW A;  3HCZ A;  17GS A;  4OO4 A;  1YEP A;  4EL1 A;  2C3Q A;  2H72 A;  2IL3 A;  3F4T A;  5ENU A;  5IO0 A;  1PQN A;  2YJ7 A;  3HA9 A;  5AIV A;  2HXK A;  4ECC A;  3V1W A;  1MD4 A;  3FEU A;  1WJK A;  6GST A;  4ACS A;  1T00 A;  2IME A;  5ECM B;  4YAP A;  3HD5 A;  1OC8 A;  1M0U A;  2J23 A;  4J57 E;  1SK2 A;  1SEN A;  4EVM A;  1Z7P A;  2K18 A;  3CTG A;  3UAP A;  1DBY A;  3UVT A;  1BAY A;  1ZYN A;  3KEB A;  3J7Y k;  1V58 A;  4K0N A;  4AJ7 A;  3KMN A;  3GHA A;  2WW2 A;  4MZC A;  2LJA A;  2MMO A;  2DKI A;  1TOF A;  3F63 A;  1A8Y A;  3Q6O A;  4ZL8 A;  1TXX A;  2VIM A;  4HJM A;  3HMJ G;  3PH9 A;  2AHE A;  1WOU A;  5DCG A;  1ZCP A;  3BD2 A;  4J2F A;  1O85 A;  5DCH A;  1N2A A;  3MDK A;  2A4H A;  2OJL A;  3KH7 A;  4XS1 A;  5G1L A;  2OBI A;  4W66 A;  2PVQ A;  1FB6 A;  2I9H A;  1PKW A;  2XBI A;  4KDU A;  2DKH A;  1E6B A;  3R2Q A;  2VUP A;  3N5O A;  2R5G A;  5G1K A;  2JAD A;  4NXI A;  2YWO A;  5LNK e;  4ZL9 A;  1SVO A;  3U6V A;  2GZY A;  2HSY A;  13GS A;  3GTU B;  5DDL A;  2A4V A;  2BMX A;  4RQX A;  5INY A;  3IA1 A;  3SBC A;  3ERG A;  4ECB A;  1BQ7 A;  1Z5Y E;  2TRC P;  2NTO A;  1G6Y A;  1OE8 A;  1WE0 A;  4TN8 A;  3DXB A;  5KN0 A;  1AQW A;  1A2J A;  2IMD A;  4I6X A;  4O5R A;  2JZS A;  4HEA 2;  1THO A;  3I69 A;  4D73 B;  1Z6N A;  2RII A;  4N0Z A;  5A1N B;  4K7I A;  1G7E A;  3G7Y A;  1PL2 A;  1ERT A;  4JU5 A;  2JZT A;  1PRX A;  1PN0 A;  2R3X A;  3QR6 A;  4BWS A;  10GS A;  5FHI A;  1A2M A;  1WRY A;  4F03 A;  3VUR A;  1EP7 A;  4O5Q A;  4HU7 A;  3TJJ A;  5GST A;  1ZZY A;  3Q18 A;  2PUK C;  5D93 A;  2HSM B;  1GTB A;  4TXV A;  1ZOF A;  1M99 A;  1HYU A;  3L9V A;  1M7T A;  3P2A A;  2EIO A;  4PUA A;  4IVF A;  3GFK A;  4OFN A;  4ZB6 A;  6GSS A;  2MMZ A;  3TUE A;  3ME8 A;  1PKZ A;  1PX7 A;  1S3D A;  3QOU A;  1XWK A;  2HRA A;  5LCZ A;  2KUC A;  5A4U A;  4V2N A;  4BWQ A;  4ZL7 A;  4IJI A;  2BJX A;  3L78 A;  1AIU A;  3QCP A;  4OO5 A;  3GST A;  2GVP A;  5KN3 A;  4MAB A;  4HU9 A;  3QAG A;  4K2X A;  3FR3 A;  2HZE A;  5IMV A;  4BPY A;  2B5E A;  4OWY A;  1AQX A;  2YZU A;  2HE3 A;  3N9J A;  4Q5Q A;  2LTK A;  4OMV A;  2H74 A;  1KBN A;  2XPE A;  2R0P A;  5EPF A;  1PSQ A;  1SU9 A;  1JLV A;  2QGV A;  3MSZ A;  3IDV A;  4K7O A;  4YKF A;  5CO3 A;  3HKR A;  3TJF A;  7GSS A;  2LNT A;  4G0L A;  4WBJ A;  1EOH A;  4GTU A;  4ICY A;  2VL2 A;  3HYP A;  2O3E A;  1GRX A;  2WRT A;  1WP0 A;  1GLP A;  4P3Y B;  5JCG A;  4ISD A;  1UC7 A;  2KP2 A;  2L6C A;  5EY6 A;  1TU8 A;  1XW6 A;  1ERV A;  1FVK A;  5H5R A;  3VWX A;  4F2I A;  3ERF A;  4POL A;  5A5H B;  4GST A;  3GX8 A;  2YAN A;  4QL9 A;  2VM2 A;  3GMF A;  1M3I A;  2LUS A;  1YF0 A;  2L4Q A;  2DMM A;  2HFD A;  4FQU A;  4CDO A;  2CVK A;  3HXS A;  2X8C A;  3A2X A;  3C8E A;  5ELG A;  1H4O A;  2O87 A;  1QK8 A;  12GS A;  3QAW A;  1XCC A;  2H19 A;  2IMK A;  3RHB A;  2WZS A;  1V40 A;  4K2D A;  3QD9 A;  3A2V A;  1Y25 A;  4XS4 A;  4TR0 A;  1EV9 A;  2B7K A;  1I5G A;  3QMX A;  2J9H A;  4OFM A;  3EVI A;  1JZD A;  3GKN A;  1TW9 A;  2OAC A;  4USS A;  3D6I A;  2OA7 A;  4GQC A;  4Q5R A;  5HFK A;  2H1B A;  3L9S A;  4OCF A;  2OT3 A;  3BCI A;  1YJ6 A;  1AW9 A;  4L5L A;  2DJ3 A;  4LL4 B;  1EEM A;  1XPV A;  2WS2 A;  3C1R A;  2WGR A;  5HR2 A;  2H0I A;  5HFG A;  1GUM A;  2MMA A;  1CQH A;  1N25 A;  2AAW A;  19GS A;  3APS A;  3M9K A;  3CTF A;  3LOR A;  5JCU A;  4BL7 B;  5A4W A;  4LMV A;  2H1G A;  4J56 E;  2G0F A;  1F37 A;  4LA1 A;  5D96 A;  3E0U A;  3OR5 A;  3RFR C;  3ZTL A;  3KMO A;  2O85 A;  2B5Y A;  3DYR A;  3GKM A;  4HDE A;  3DGQ A;  4EDZ A;  1U3I A;  3IXR A;  4O32 A;  2FWH A;  4MZB A;  2AUV A;  2WW3 A;  1O81 A;  5KN1 A;  3HVX A;  4NPB A;  1YEX A;  2WVX A;  4AF2 A;  4ZBB A;  4MK3 A;  1TU7 A;  4TXO A;  6GSW A;  3FMW A;  5BMU A;  3BCK A;  4KX4 A;  2P5Q A;  2DJ0 A;  2L59 A;  5LD0 A;  3MYD A;  2VLT A;  3MWH A;  2LS5 A;  5KOX A;  5D9W A;  4MDC A;  4JR4 A;  2DJJ A;  1Y1U A;  5E4W A;  16GS A;  2HRF A;  2C0G A;  1FW1 A;  3CRU A;  2XC2 A;  3ZZX A;  4L0U A;  2IIY A;  4MH2 A;  3D4T A;  1XOB A;  5D8I A;  4PNF A;  4HQZ A;  3LG6 A;  1CQG A;  3NZN A;  2WVY A;  3DD3 A;  3TKS A;  4ZBA A;  5J4Y A;  4IQ1 A;  3AY8 A;  5IOX A;  2CVB A;  2L6D A;  4IW9 A;  2CAI A;  4TOP A;  1PFO A;  2GSQ A;  4F0C A;  1SD8 A;  1NHY A;  2HRK B;  4KF9 A;  1XXU A;  2FA4 A;  1RK4 A;  5HQP A;  4AKX B;  5IMD A;  3MAK A;  3A5W A;  4I8B A;  5C00 A;  1KTE A;  3F3Q A;  5A4V A;  3C73 A;  3GH6 A;  1GWC A;  2OE0 A;  2AB6 A;  4N10 A;  4IBP A;  2QC7 A;  3UBL A;  4I5Q A;  3BOA A;  4KCE A;  4F9Z A;  5ID2 A;  4ZIL A;  4K7N A;  3CMI A;  1T8E B;  4MA9 A;  1OE7 A;  4N0V A;  1OVN A;  4AGS A;  3LQ7 A;  2FNO A;  3KP9 A;  3ZIT A;  3IC4 A;  2O89 A;  4GCI A;  4KSM A;  3KIJ A;  3VLN A;  2WW1 A;  4DSS B;  3DWV A;  1X9M B;  1GSF A;  5A34 B;  5F06 A;  2M80 A;  3TJK A;  2HZF A;  5G5E A; 
#chains in the Genus database with same CATH homology
 4PQH A;  2BTO T;  2WFC A;  5CP1 A;  2VL9 A;  2PVO C;  4YQV A;  4EIP A;  3UOM A;  3LXZ A;  5B8B A;  2GZZ A;  2B3S A;  2WZ9 A;  3D22 A;  2VCQ A;  5IO2 A;  3RPP A;  1BF5 A;  3GRX A;  1SJZ A;  4WET A;  2HT9 A;  3UAR A;  2LRT A;  4IQA A;  2B1K A;  2PWJ A;  5DJM A;  2YWN A;  14GS A;  2LJR A;  1K3Y A;  3PR8 A;  5J9B A;  3H8Q A;  4XRD A;  1QGV A;  3RDW A;  3DKS A;  5J41 A;  5KN2 A;  3CXG A;  4GXZ A;  2JSY A;  1F6M C;  3HHV A;  1V9W A;  3FHK A;  2B6M A;  1K0B A;  3TGZ A;  4YH2 A;  1SVM A;  1S3C A;  5A5K A;  1F9M A;  2A2R A;  2YV7 A;  2LQQ A;  4CHS A;  4MNN A;  2HYX A;  1ZYQ B;  1TK0 B;  5H5S A;  1K0M A;  1EWX A;  3ZFB A;  1VF2 A;  4I2T A;  1U6T A;  2V2G A;  1W4V A;  1B8X A;  3VK9 A;  1LBK A;  4G2E A;  4WF4 A;  1ML6 A;  1F2E A;  1JZW A;  5IMZ A;  3LYK A;  4KAE A;  4DSQ A;  2B1L A;  3ZML A;  2V6K A;  1USB A;  1ON4 A;  4RUV A;  1DSB A;  1Z9H A;  1SKW B;  1RW1 A;  3KXO A;  4JED A;  4BVY A;  3IAM 2;  4L8E A;  5ECI B;  4G01 A;  2ON7 A;  4QL7 A;  3LEF A;  2PBJ A;  5DQY A;  3MNG A;  4G9H A;  2RUE A;  1GTA A;  1VF3 A;  2VD0 A;  5B6M A;  4V1A p;  4HJ2 A;  4XS6 A;  1JZO A;  2CX4 A;  2IMF A;  3ZLP A;  4HOJ A;  2K8V A;  1TTZ A;  1NSW A;  4FH8 A;  3LGC A;  1K0D A;  3LJR A;  2C8U A;  1YZX A;  1SK1 A;  1XBS A;  22GS A;  4FIW A;  1HNC A;  2PMT A;  4GSS A;  1MDK A;  5CAX A;  3UIW A;  2OE3 A;  1QMV A;  2GST A;  1OKT A;  4HZ4 A;  4ZB9 A;  3F9U A;  4Z2U A;  3HJM A;  5DJL A;  1YKC A;  4IEL A;  2LEG A;  2DJ1 A;  1T7P B;  4FO5 A;  1TK8 B;  1GH2 A;  5F07 A;  1B48 A;  3UMA A;  3RPN A;  3UEM A;  1X5C A;  3EMX A;  3M3M A;  1TRW A;  2L57 A;  2HSH A;  2H66 A;  1OKD A;  1ILO A;  1X9W B;  4PX1 A;  3KM6 A;  2OKA A;  5J47 A;  2FWG A;  2VLU A;  1MD3 A;  2I3Y A;  2DML A;  1SKS B;  3ZMK A;  3M1G A;  2MBT A;  4HQS A;  3IE3 A;  2CX3 A;  5IPG A;  2VAF A;  5FT3 A;  2EFC A;  4WF5 A;  4GSN A;  1DUG A;  3D5J A;  4XTS A;  1R7H A;  2F9S A;  1PN9 A;  1AUC A;  4AKG A;  4WR4 A;  5G5F A;  4AJ8 A;  3LXT A;  4KH7 A;  4BVX B;  5J4V A;  4JRR A;  1SVL A;  4KSO A;  5COH A;  5B8A A;  5CRE A;  4K6X A;  3FZ4 A;  1BG5 A;  1QUW A;  2O8V B;  1WIK A;  5AN1 A;  2P31 A;  2HQT A;  3H4K A;  4EDY A;  3KP8 A;  3DML A;  2GZP A;  3MIX A;  1RQM A;  1M2A A;  4PTS A;  1YF1 A;  1AC1 A;  3EWL A;  3ZVJ A;  8GSS A;  3FYG A;  4ML6 A;  4ECJ A;  2HI7 A;  1GTU A;  3F6F A;  3CYN A;  2GS3 A;  1GSQ A;  1GSD A;  4K1F A;  3F4R A;  4EUY A;  3GUS A;  2H8L A;  3Q19 A;  3HZ8 A;  4K8M A;  3HDC A;  4WEY A;  4HI7 A;  1K0O A;  2H1A A;  4XCS A;  2H6Y A;  1K0A A;  3EPT A;  2X64 A;  1R4W A;  3WGE A;  4YAV A;  3FK8 A;  4I2U A;  3TU3 B;  3GH9 A;  1ZYP A;  2P5R A;  1K3L A;  2MMN A;  4TXO B;  5BMU B;  2M46 A;  1AAZ A;  1WMJ A;  3EU3 A;  1M2B A;  3GUR A;  4IN0 A;  3K8N A;  2FWE A;  5IIZ A;  2NDO A;  5E59 A;  1BG1 A;  2GT6 A;  4V2L A;  4G10 A;  3GNJ A;  4ID0 A;  4KDX A;  3FRC A;  3FR9 A;  2DC5 A;  3QDN A;  3TRP A;  1J9B A;  4N3Z A;  1TKD B;  1ABA A;  1FG4 A;  2FCH A;  1VF4 A;  2TIR A;  4K9Z A;  1UN2 A;  3EU4 A;  2FHE A;  4Z2R A;  1QXH A;  4MH3 A;  3TOT A;  2H30 A;  3CBU A;  2E2M A;  1JFU A;  3GTU A;  2YV9 A;  2VLV A;  4MJB A;  1H75 A;  2XBQ A;  2DLX A;  4XIH A;  3Q74 A;  1F3B A;  1FOV A;  4TKY A;  5JWR B;  3VPT A;  4TRX A;  3W6G A;  2HRN A;  2C0F A;  4PUF C;  3IC8 A;  4E68 A;  4NHZ A;  1R5A A;  5D9X A;  2N5A A;  2QKE A;  2VCX A;  1M2D A;  1QQ2 A;  3QFA C;  4D73 A;  2FGX A;  1ZYE A;  2C0E A;  3TKS E;  2H76 A;  5ID2 B;  5A1N A;  2K8S A;  1A24 A;  1FAA A;  4E8H A;  2EFD A;  3GA4 A;  2FD3 A;  4KDY A;  3VWU A;  2F8F A;  2ALB A;  3NIV A;  1K3O A;  3LFL A;  3G7I A;  4POM A;  5G2Z A;  3C1S A;  5G31 A;  2H70 A;  4F0B A;  2YCD A;  2IFQ B;  5ECK B;  4MF7 A;  2V41 A;  1VF1 A;  4CY6 A;  1YDK A;  3BJ5 A;  4MMM A;  1IYH A;  3LSZ A;  2HSN A;  2EIQ A;  3ZFL A;  3L0H A;  4TR4 A;  3L4N A;  3HZ4 A;  4KE3 A;  5CRD A;  1GUH A;  5IMF A;  2H71 A;  2X8H A;  4JE1 A;  3H93 A;  1NHO A;  3ED3 A;  1KEB A;  3NOF A;  4AI6 A;  3US3 A;  2QSI A;  2VCV A;  2UV8 G;  2JU5 A;  2ZCT A;  4Q5F A;  3CRT A;  4PQ1 A;  4PXO A;  20GS A;  4ML1 A;  3GYK A;  4KW6 A;  1FOH A;  3EIN A;  2X49 A;  1OYJ A;  5ECH B;  4KB3 A;  3TB2 A;  1V57 A;  2IWT A;  2PER A;  3D4M A;  1TRU A;  3U5R E;  5IMA A;  1FVJ A;  3A3T A;  4IJ3 A;  1OAZ A;  3GL5 A;  1URM A;  5J3R A;  1SD9 A;  4O5U A;  3RAZ A;  5J5N A;  3PGT A;  1MEK A;  3A5I A;  1XW5 A;  1FB0 A;  5ECP B;  1C72 A;  2H73 A;  2C0D A;  2KLX A;  4OD7 A;  1A0R P;  4KCA A;  3UBK A;  1T4Z A;  3M8N A;  4KND A;  2X8G A;  4QQ7 A;  3BBY A;  3FZA A;  4EO3 A;  4H86 A;  3F6D A;  2H6Z A;  5A5H A;  3E9J B;  1GL8 A;  3WD6 A;  4K0G A;  2ES7 A;  4IGJ A;  4MP4 A;  1Z3E A;  3ERW A;  3KJY A;  1HD2 A;  5IM9 A;  4RQR A;  2Z9S A;  2WDU A;  4EE0 A;  4BVY B;  1V2A A;  3IK7 A;  1SYR A;  1GUK A;  4GF0 A;  3E3E A;  3CSH A;  4HS1 A;  2PU9 C;  1XZO A;  4LLR A;  2H0H A;  2N5B A;  4MZW A;  2R0G A;  2JAC A;  4PUR A;  1EGR A;  4IP1 A;  4CY8 A;  4PGT A;  5GZZ B;  2RM6 A;  6GSY A;  2CA8 A;  1N8J A;  1YKA A;  2GQK A;  2NVL A;  3TDG A;  1K0N A;  4TR3 A;  3PPU A;  1SL2 B;  2OAD A;  1TP9 A;  5D9V A;  2WCI A;  3QFB C;  1MDJ A;  1SL0 B;  4X43 A;  4MPG A;  2LJK A;  3RBT A;  4YQM A;  4ZXG A;  3TOU A;  3D21 A;  4MLY A;  1E2Y A;  2E7P A;  3FR6 A;  2AJQ B;  1XWA A;  1GSS A;  2CAQ A;  2YWI A;  2QA2 A;  2VO4 A;  4EXJ A;  2IN3 A;  2GTU A;  2YJH A;  3ZRD A;  1TK5 B;  5DAL A;  1YQ1 A;  5DBQ A;  2PPT A;  4JBB A;  2AYT A;  1BED A;  4YKG A;  4AKH A;  3F4S A;  4KUN A;  1ZMA A;  1TXU A;  2R2J A;  1B9X C;  4K5R A;  5B6N A;  1G7O A;  4NV2 A;  5J4U A;  5CRG A;  4A5P A;  4ECI A;  2EFE A;  5DAK A;  2UZ8 A;  5JWQ B;  3QPM A;  1XIY A;  5BRT A;  3GIX A;  2PN8 A;  1G0T A;  11GS A;  1WWJ A;  5CRW A;  1GSU A;  2FLS A;  4IKH A;  1PX6 A;  1LJR A;  4ZB7 A;  3KGK A;  1BX9 A;  1W89 A;  4MJC A;  2X4A A;  2VL3 A;  2YN1 A;  6GSV A;  2GT5 A;  5IMC A;  1PA3 A;  2JL4 A;  5AIX A;  1DE2 A;  2FA8 A;  4WXT A;  3EUR A;  3KCM A;  3HVS A;  2MZC A;  4XHM A;  3TRQ A;  3ZL5 A;  1SYX A;  4QMK A;  2HZE B;  5DQS A;  1QFN A;  3WYW A;  2HRK A;  1BYE A;  4GLT A;  4V2M A;  4GWR A;  1M9B A;  5ECR B;  5GAN D;  2MBS A;  1VGL A;  1XWC A;  5CYY A;  2R4V A;  1SL1 B;  2NPB A;  1IYI A;  4WBR D;  2VKZ G;  2GSS A;  1TI3 A;  1MTC A;  2YNX A;  1TRS A;  4N11 A;  4EKZ A;  2N5F A;  1SJI A;  3O6T A;  1PGT A;  2GQL A;  5KEJ A;  2E2G A;  4KA0 A;  1FHE A;  4MPF A;  1O8X A;  4IS0 A;  3IAS 2;  1OC9 A;  2ZNM A;  1B4Q A;  5DVB A;  5ECO B;  4Q5N A;  2O5V A;  4RI6 A;  1U3A A;  2H0G A;  3KTL A;  1T1V A;  4DSS A;  5A34 A;  2VOC A;  1EP8 A;  2C80 A;  5J40 A;  2DSA A;  3DEX A;  4DVC A;  1EZK A;  3F3R A;  5GAP D;  1X5D A;  4ULX A;  2KHP A;  4TR1 A;  2TRX A;  5D9T A;  4PQI A;  3LW9 A;  3WT1 A;  5CRH A;  3GKK A;  3C7M A;  2DJK A;  3IOS A;  1HNA A;  2R37 A;  3M9J A;  1X5E A;  2IPA A;  2K9F A;  4RI7 A;  3VFI A;  1T4Y A;  2AV4 A;  4G19 A;  4XS4 B;  5IOW A;  3APO A;  1ACV A;  5J9C A;  1O73 A;  3CSI A;  1S3A A;  2LRN A;  3IPZ A;  1ERU A;  3JCM L;  4HUA A;  4XRA A;  2LKU A;  2YWM A;  1XFL A;  3F0I A;  3EYT A;  2R0C A;  3IBH A;  5IPH A;  3H1N A;  2V1M A;  4F82 A;  5C04 A;  2VD1 A;  2VCW A;  4MJE A;  3ZIJ A;  1GNW A;  1Q4J A;  4EF0 A;  1SK0 A;  1O7U A;  1UA5 A;  3TJB A;  3UL3 A;  3DVW A;  5HFI A;  2HSN B;  2G2Q A;  4FYB A;  2YOI A;  3ZRE A;  3EC3 A;  2LV3 A;  3TKR A;  5JCW A;  2K6V A;  2LRC A;  1ZL9 A;  1WPI A;  4L0W A;  3P8W A;  4X4J A;  5ABR A;  4JR6 A;  3CWG A;  2R6K A;  2KOK A;  1GNE A;  2WB9 A;  5EL8 A;  3M0F A;  2PGT A;  9GSS A;  3PIN A;  2QA1 A;  2H75 A;  3APQ A;  4AKI A;  1YVL A;  1HQO A;  3TRX A;  2A2S A;  3DRN A;  2H6X A;  5FWG A;  2P0G A;  1TRV A;  4JZQ A;  3GX0 A;  1ZGN A;  2VL2 C;  3DVX A;  5KOW A;  4MF6 A;  1OC3 A;  3FY7 A;  2YP6 A;  3KZQ A;  1SJ6 A;  4LMW A;  5EVO A;  3RHC A;  1A2L A;  1KNG A;  5AGY A;  4FYC A;  5AIS A;  3GSS A;  2IMI A;  3VWV A;  1G6W A;  5ECL B;  3P90 A;  1LU4 A;  3TCO A;  1A8L A;  1F3A A;  4E8E A;  18GS A;  2V32 A;  2F51 A;  2XPD A;  2D2Z A;  4N30 A;  1ERW A;  2NBS A;  4EIQ A;  1V98 A;  4EC0 A;  4KGI A;  2REM A;  2GLR A;  1U88 A;  3GKX A;  2LST A;  3ZIV A;  1T3B A;  4MJA A;  1HNB A;  4CW9 A;  2DJ2 A;  2L4C A;  2L5L A;  1XWG A;  4NMU A;  1NW2 A;  3R3E A;  4NV5 A;  2I4A A;  4GDF A;  6GSU A;  2E0Q A;  4X1U A;  4WR5 A;  5L71 A;  2C4J A;  1A23 A;  1J0F A;  1DE1 A;  4V1A g;  2C1Y A;  4OCE A;  4ZBD A;  2HNL A;  1J08 A;  2RUF A;  2RM5 A;  3HY2 A;  2I81 A;  4POB A;  4DEJ A;  3EMP A;  3WGD A;  3CSJ A;  1M9A A;  5ECQ B;  3L9U A;  3F8U A;  3LWA A;  3WGX A;  1A0F A;  1XOA A;  2GDR A;  2I1U A;  3IV4 A;  1JHB A;  5G30 A;  4PNG A;  3GV1 A;  1EV4 A;  4O92 A;  1R5P A;  2HSM A;  4ZIJ A;  2F3M A;  4BVX A;  3DIE A;  2F8A A;  4L5O A;  2WUL A;  4ZB8 A;  4Z2T A;  5HR0 A;  1PMT A;  3EE2 A;  1PL1 A;  2M72 A;  2VCZ A;  1YY7 A;  4ILF A;  1Y6E A;  2JSZ A;  2CVD A;  2CQ9 A;  3FZ5 A;  3G9B A;  2CZ2 A;  1JZR A;  4X0X A;  1FO5 A;  1EOG A;  1O6J A;  3KD0 A;  4K5S A;  4G0K A;  3W8J A;  5DAL B;  2EC4 A;  3FW2 A;  2VCT A;  2C3T A;  4NHW A;  1Z7R A;  3J7Y b;  2HLS A;  2WJU A;  3UVH A;  2OE1 A;  4Z7X A;  1X0R A;  2JZR A;  3C71 A;  1EEJ A;  3S9F A;  4AJ6 A;  3HJO A;  2ZUP A;  1GUL A;  4WKW A;  3O76 A;  5D73 A;  3ISO A;  1BJX A;  4O7H A;  2DIY A;  5IQY A;  2ON5 A;  1XVQ A;  5F0G A;  5DAK B;  3GL3 A;  1Z6M A;  3IK9 A;  2L5O A;  4TW5 A;  2XHF A;  5ECN B;  2CZ3 A;  3VI7 A;  4OFT A;  1XVW A;  4I97 A;  1O8W A;  2LQO A;  2FWF A;  3WT2 A;  2DIZ A;  1THX A;  3W8S A;  3IHG A;  2LNS A;  3TKS C;  4TVE A;  3IRA A;  5B7C A;  4MCU A;  4MF5 A;  3TKP A;  3LYP A;  1UVZ A;  2KP1 A;  1U87 A;  3ME7 A;  2VM1 A;  2H1L A;  1SKR B;  3TKQ A;  5F8B A;  1GSY A;  3UJ1 A;  4HZ2 A;  2RLI A;  3KH9 A;  3IR4 A;  4BA7 A;  2H01 A;  2FY6 A;  3VWW A;  2EIR A;  2MYG A;  3P7X A;  1K0C A;  2EFH A;  3HVV A;  4GQF A;  1EGO A;  2A2P A;  3I6A A;  2FUG 2;  1TDI A;  1GLQ A;  4YQU A;  6GSX A;  1I9D A;  1PD2 1;  2DBC A;  4NWY A;  1R26 A;  2B7J A;  2OBK A;  4NAX A;  5CNW A;  1XW9 A;  2CT6 A;  4IP6 A;  1OC9 B;  4FYU A;  1B4P A;  3SWL A;  1ST9 A;  2IFQ A;  3I9V 2;  2V6O A;  2H1D A;  1GP1 A;  2CV4 A;  2IJY A;  3A2W A;  3H79 A;  2GSR A;  5ELA A;  1X9S B;  3G7J A;  3KTB A;  1MDI A;  4IHU A;  5HR3 A;  5JWO B;  4POK A;  3QAV A;  3ZYW A;  3FZ9 A;  3IHQ A;  4BL7 A;  1B9Y C;  4TR1 B;  3I43 A;  2C3N A;  1XWB A;  3HJP A;  1NM3 A;  3VI5 A;  4G0I A;  3O3T A;  2B5X A;  3TJG A;  3D0Z A;  1TI1 A;  4LL1 B;  5ECS A;  1AQV A;  1AXD A;  2X99 A;  5HR1 A;  2GGT A;  1Q98 A;  3FKF A;  5H5Q A;  4GRF A;  1GTI A;  5GSS A;  1VRS D;  4DSR A;  2O7K A;  2YPM A;  3ZVJ D;  1GSE A;  3GN3 A;  5F05 A;  2GQM A;  1TJD A;  3VPQ A;  2YZH A;  1JLW A;  3HCZ A;  17GS A;  4OO4 A;  1YEP A;  4EL1 A;  2C3Q A;  2H72 A;  2IL3 A;  3F4T A;  5ENU A;  5IO0 A;  1PQN A;  2YJ7 A;  3HA9 A;  5AIV A;  2HXK A;  4ECC A;  3V1W A;  1MD4 A;  3FEU A;  1WJK A;  6GST A;  4ACS A;  1T00 A;  2IME A;  5ECM B;  4YAP A;  3HD5 A;  1OC8 A;  1M0U A;  2J23 A;  4J57 E;  1SK2 A;  1SEN A;  4EVM A;  1Z7P A;  2K18 A;  3CTG A;  3UAP A;  1DBY A;  3UVT A;  1BAY A;  1ZYN A;  3KEB A;  3J7Y k;  1V58 A;  4K0N A;  4AJ7 A;  3KMN A;  3GHA A;  4MZC A;  2LJA A;  2MMO A;  2DKI A;  1TOF A;  3F63 A;  1A8Y A;  3Q6O A;  4ZL8 A;  1TXX A;  2VIM A;  4HJM A;  3HMJ G;  3PH9 A;  2AHE A;  1WOU A;  5DCG A;  1ZCP A;  3BD2 A;  4J2F A;  1O85 A;  5DCH A;  1N2A A;  3MDK A;  2A4H A;  2OJL A;  3KH7 A;  4XS1 A;  5G1L A;  2OBI A;  4W66 A;  2PVQ A;  1FB6 A;  2I9H A;  1PKW A;  2XBI A;  4KDU A;  2DKH A;  1E6B A;  3R2Q A;  2VUP A;  3N5O A;  2R5G A;  5G1K A;  2JAD A;  4NXI A;  2YWO A;  5LNK e;  4ZL9 A;  1SVO A;  3U6V A;  2GZY A;  2HSY A;  13GS A;  3GTU B;  5DDL A;  2A4V A;  2BMX A;  4RQX A;  5INY A;  3IA1 A;  3SBC A;  3ERG A;  4ECB A;  1BQ7 A;  1Z5Y E;  2TRC P;  2NTO A;  1G6Y A;  1OE8 A;  1WE0 A;  4TN8 A;  3DXB A;  5KN0 A;  1AQW A;  1A2J A;  2IMD A;  4I6X A;  4O5R A;  2JZS A;  4HEA 2;  1THO A;  3I69 A;  4D73 B;  1Z6N A;  2RII A;  4N0Z A;  5A1N B;  4K7I A;  1G7E A;  3G7Y A;  1PL2 A;  1ERT A;  4JU5 A;  2JZT A;  1PRX A;  1PN0 A;  2R3X A;  3QR6 A;  4BWS A;  10GS A;  5FHI A;  1A2M A;  1WRY A;  4F03 A;  3VUR A;  1EP7 A;  4O5Q A;  4HU7 A;  3TJJ A;  5GST A;  1ZZY A;  3Q18 A;  2PUK C;  5D93 A;  2HSM B;  1GTB A;  4TXV A;  1ZOF A;  1M99 A;  1HYU A;  3L9V A;  1M7T A;  3P2A A;  2EIO A;  4PUA A;  4IVF A;  3GFK A;  4OFN A;  4ZB6 A;  6GSS A;  2MMZ A;  3TUE A;  3ME8 A;  1PKZ A;  1PX7 A;  1S3D A;  3QOU A;  1XWK A;  2HRA A;  5LCZ A;  2KUC A;  5A4U A;  4V2N A;  4BWQ A;  4ZL7 A;  4IJI A;  2BJX A;  3L78 A;  1AIU A;  3QCP A;  4OO5 A;  3GST A;  2GVP A;  5KN3 A;  4MAB A;  4HU9 A;  3QAG A;  4K2X A;  3FR3 A;  2HZE A;  5IMV A;  4BPY A;  2B5E A;  4OWY A;  1AQX A;  2YZU A;  2HE3 A;  3N9J A;  4Q5Q A;  2LTK A;  4OMV A;  2H74 A;  1KBN A;  2XPE A;  2R0P A;  5EPF A;  1PSQ A;  1SU9 A;  1JLV A;  2QGV A;  3MSZ A;  3IDV A;  4K7O A;  4YKF A;  5CO3 A;  3HKR A;  3TJF A;  7GSS A;  2LNT A;  4G0L A;  4WBJ A;  1EOH A;  4GTU A;  4ICY A;  2VL2 A;  3HYP A;  1GRX A;  2WRT A;  1WP0 A;  1GLP A;  4P3Y B;  5JCG A;  4ISD A;  1UC7 A;  2KP2 A;  2L6C A;  5EY6 A;  1TU8 A;  1XW6 A;  1ERV A;  1FVK A;  5H5R A;  3VWX A;  4F2I A;  3ERF A;  4POL A;  5A5H B;  4GST A;  3GX8 A;  2YAN A;  4QL9 A;  2VM2 A;  3GMF A;  2LUS A;  1YF0 A;  2L4Q A;  2DMM A;  2HFD A;  4FQU A;  4CDO A;  2CVK A;  3HXS A;  2X8C A;  3A2X A;  3C8E A;  5ELG A;  1H4O A;  2O87 A;  1QK8 A;  12GS A;  3QAW A;  1XCC A;  2H19 A;  2IMK A;  3RHB A;  1V40 A;  4K2D A;  3QD9 A;  3A2V A;  1Y25 A;  4XS4 A;  4TR0 A;  1EV9 A;  2B7K A;  1I5G A;  3QMX A;  2J9H A;  4OFM A;  3EVI A;  1JZD A;  3GKN A;  1TW9 A;  2OAC A;  4USS A;  3D6I A;  2OA7 A;  4GQC A;  4Q5R A;  5HFK A;  2H1B A;  3L9S A;  4OCF A;  2OT3 A;  3BCI A;  1YJ6 A;  1AW9 A;  4L5L A;  2DJ3 A;  4LL4 B;  1EEM A;  1XPV A;  2WS2 A;  3C1R A;  2WGR A;  5HR2 A;  2H0I A;  5HFG A;  1GUM A;  2MMA A;  1CQH A;  1N25 A;  2AAW A;  19GS A;  3APS A;  3M9K A;  3CTF A;  3LOR A;  5JCU A;  4BL7 B;  5A4W A;  4LMV A;  2H1G A;  4J56 E;  2G0F A;  1F37 A;  4LA1 A;  5D96 A;  3E0U A;  3OR5 A;  3ZTL A;  3KMO A;  2O85 A;  2B5Y A;  3DYR A;  3GKM A;  4HDE A;  3DGQ A;  4EDZ A;  1U3I A;  3IXR A;  4O32 A;  2FWH A;  4MZB A;  2AUV A;  1O81 A;  5KN1 A;  3HVX A;  4NPB A;  1YEX A;  4AF2 A;  4ZBB A;  4MK3 A;  1TU7 A;  4TXO A;  6GSW A;  3FMW A;  5BMU A;  3BCK A;  4KX4 A;  2P5Q A;  2DJ0 A;  2L59 A;  5LD0 A;  3MYD A;  2VLT A;  3MWH A;  2LS5 A;  5KOX A;  5D9W A;  4MDC A;  4JR4 A;  2DJJ A;  1Y1U A;  5E4W A;  16GS A;  2HRF A;  2C0G A;  1FW1 A;  3CRU A;  2XC2 A;  3ZZX A;  4L0U A;  2IIY A;  4MH2 A;  3D4T A;  1XOB A;  5D8I A;  4PNF A;  4HQZ A;  3LG6 A;  1CQG A;  3NZN A;  3DD3 A;  3TKS A;  4ZBA A;  5J4Y A;  4IQ1 A;  3AY8 A;  5IOX A;  2CVB A;  2L6D A;  4IW9 A;  2CAI A;  4TOP A;  2GSQ A;  4F0C A;  1SD8 A;  1NHY A;  2HRK B;  4KF9 A;  1XXU A;  2FA4 A;  1RK4 A;  5HQP A;  4AKX B;  5IMD A;  3MAK A;  3A5W A;  4I8B A;  5C00 A;  1KTE A;  3F3Q A;  5A4V A;  3C73 A;  3GH6 A;  1GWC A;  2OE0 A;  2AB6 A;  4N10 A;  4IBP A;  2QC7 A;  3UBL A;  4I5Q A;  3BOA A;  4KCE A;  4F9Z A;  5ID2 A;  4ZIL A;  4K7N A;  3CMI A;  1T8E B;  4MA9 A;  1OE7 A;  4N0V A;  1OVN A;  4AGS A;  3LQ7 A;  2FNO A;  3KP9 A;  3ZIT A;  3IC4 A;  2O89 A;  4GCI A;  4KSM A;  3KIJ A;  3VLN A;  4DSS B;  3DWV A;  1X9M B;  1GSF A;  5A34 B;  5F06 A;  2M80 A;  3TJK A;  2HZF A;  5G5E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...