3HJOA

Crystal structure of glutathione transferase pi y108v mutant in complex with the glutathione conjugate of ethacrynic acid
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
209
structure length
209
Chain Sequence
PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIVTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase P
publication title Influence of the H-site residue 108 on human glutathione transferase P1-1 ligand binding: structure-thermodynamic relationships and thermal stability.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 81
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2009-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3hjoA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3hjoA01
2HLSA 3C8EA 2EIQA 3A2WA 2YJ7A 3GX8A 1YJ6A 3VURA 4YH2A 2G2QA 2FUG2 5GSTA 1GL8A 3EURA 4DSQA 1OYJA 2LNTA 4X0XA 2OKAA 4IS0A 6GSSA 1K3OA 5DQSA 5LD0A 4I6XA 1W89A 3E9JB 1SKSB 1IYHA 5B6NA 4MH3A 1SK1A 1PRXA 2CVBA 1AIUA 2IFQB 4F0CA 3ED3A 1Y6EA 2GQLA 2YZUA 4ZBDA 4GSTA 1EV4A 1QUWA 3F4TA 1GRXA 4K2DA 3HJMA 2HSMA 4ILFA 1GTAA 3HY2A 1XPVA 2FCHA 3MNGA 2G0FA 2CZ3A 1BYEA 2DSAA 2PN8A 1JZRA 1FB0A 4FH8A 4N30A 2J23A 2L5OA 1VF3A 5F0GA 3QFAC 1ERUA 1GULA 10GSA 2HFDA 1WE0A 5IMDA 4XRAA 5ECOB 3TKPA 1LBKA 2LV3A 5G5FA 1U3AA 3K8NA 1WIKA 3SBCA 3PINA 3HYPA 3DD3A 2XC2A 1HD2A 4L0UA 3M8NA 2X8GA 2B1KA 2O85A 2B6MA 2HSHA 3UBKA 5J9CA 1H4OA 4OCFA 4XS4B 3A5WA 3TKRA 1SJIA 1V98A 1VF2A 4ZL9A 3M9JA 1QMVA 5A5KA 1GSYA 1MEKA 3KTBA 1SK2A 4QL9A 1PKZA 3LEFA 3TKSC 5JWRB 5LCZA 2GGTA 1FOVA 2VL9A 5G1LA 4HU9A 2CVKA 3I69A 5D9TA 5CNWA 3DGQA 3IHQA 2DMLA 5F07A 3GNJA 3HA9A 3C7MA 3ZIVA 4PXOA 2IPAA 2H8LA 3GX0A 3CSHA 2B5YA 5EY6A 3F4RA 4ML6A 3LYPA 3ZIJA 4TXOB 2C80A 1KTEA 3KMNA 1TJDA 3UJ1A 1ZMAA 3DRNA 4FO5A 4WXTA 4QQ7A 1XXUA 4MF5A 2PPTA 1Z6NA 1PKWA 4KB3A 2HZFA 2UZ8A 1XW5A 4RQRA 2DJJA 1R26A 1GSDA 2J9HA 1XWGA 4YQMA 3VFIA 2IFQA 4K0GA 3P7XA 1ZGNA 1F9MA 4YAPA 5DQYA 1ZZYA 3GSSA 2H1BA 3IV4A 4I97A 2IMEA 1NW2A 3FRCA 2O87A 3U5RE 4YQVA 4IQAA 2V1MA 2PVQA 3TOUA 4ECIA 3ME7A 2DC5A 2JZSA 3C1SA 5DAKB 4N0ZA 2LJRA 4Q5NA 3IPZA 2CQ9A 1TXXA 5DCGA 2YN1A 5G2ZA 2IMKA 3TOTA 3TRPA 2WDUA 2TIRA 2N5AA 3APOA 1X5EA 5ABRA 5CP1A 2L4CA 1RK4A 3ZREA 6GSXA 3HXSA 4MZBA 3GH9A 2E2MA 2DIZA 4P3YB 4D73A 1U3IA 2LRCA 4TRXA 1B48A 1JZDA 4IVFA 1B8XA 5HR0A 2FLSA 4ZB9A 3UL3A 1R5PA 4EXJA 4POLA 2PMTA 2F8AA 2FA4A 2FD3A 2A2RA 5IMAA 1HNBA 5HFGA 2VCXA 2VCVA 1JLVA 4BA7A 3IBHA 2K9FA 2XBIA 3CTGA 5DJMA 2GDRA 2CX4A 2PGTA 1XZOA 3Q19A 1EEMA 3GHAA 1GTBA 1TK8B 4KE3A 1XOBA 1HYUA 1A2MA 1EOHA 4IGJA 4N10A 4KW6A 3LFLA 4ML1A 3FK8A 3QR6A 2VCZA 1FHEA 1X9SB 4WF4A 2YV9A 5DALB 1TRUA 3IK7A 3I9V2 2VLTA 4LLRA 4PX1A 2B5EA 3KJYA 5H5QA 4MDCA 3GH6A 2XPDA 4HJMA 1F3AA 1TOFA 3GKKA 2D2ZA 4TVEA 2IIYA 1AW9A 4V1Ag 3G7YA 2WJUA 3L4NA 2VLUA 1OE7A 5AISA 2LS5A 5HR1A 3QD9A 4IJIA 2RM5A 2YV7A 5J41A 1G7OA 2VCWA 2LUSA 1R5AA 3TGZA 4NXIA 3H1NA 4LMWA 5BMUA 1GSUA 4I5QA 3FZ5A 4XHMA 4F82A 3IC4A 3WGDA 4WEYA 5G5EA 3VWUA 4HJ2A 4G19A 5AN1A 3U6VA 1YKCA 5CRWA 5D93A 1AUCA 3ZVJD 3IA1A 5KEJA 3M3MA 3ZYWA 5ECLB 5DAKA 2DMMA 3QFBC 2EIRA 3VWXA 3TDGA 3TRXA 3UOMA 4MMMA 1X0RA 3RHCA 1M99A 2V6OA 3GTUB 2LRNA 4ECJA 4EL1A 4XTSA 3D5JA 1T3BA 3FW2A 1X5CA 1F3BA 1TK5B 5J4UA 5B6MA 4ECBA 2C0GA 2MMZA 1EGOA 1TU8A 1GSQA 1R7HA 2JZRA 1U6TA 1PGTA 3CSJA 6GSYA 4PURA 2JSYA 4O92A 3GL5A 4DEJA 3GIXA 3R3EA 1A2JA 1SYRA 1SL2B 5C04A 2WFCA 2HSMB 2L59A 1XVWA 1MTCA 4IN0A 1X9WB 17GSA 2OADA 3LXZA 4BVXA 5A4VA 2REMA 2AYTA 3ZRDA 4KDUA 1Q4JA 2MMAA 5FHIA 2F8FA 1PD21 1YY7A 6GSUA 2WZ9A 1ERTA 5DALA 2YOIA 1XWAA 3PGTA 4F03A 2E0QA 1OAZA 2EC4A 1K0MA 5CRGA 1ILOA 2KUCA 4G9HA 4FYCA 1F6MC 5ELAA 3UVTA 4IP6A 4GXZA 2O89A 4N0VA 3KTLA 3KP9A 2H1DA 3KH7A 4HQZA 1U87A 2M80A 1JHBA 4WF5A 3DVWA 3Q18A 4XS1A 4IP1A 1OC9B 1V40A 2CAIA 5IOXA 1X5DA 1EP7A 3H8QA 2VD0A 4V2MA 3J7Yb 1YZXA 5DCHA 1G6WA 4PQHA 3ZZXA 4ECCA 3HCZA 1GNWA 3ZL5A 2K6VA 1J9BA 1SKRB 2R4VA 3TCOA 3WD6A 3FHKA 3L9VA 4WBJA 2I81A 4HU7A 4EF0A 2RLIA 3GURA 3O3TA 5E4WA 5FWGA 1ZL9A 3RAZA 3RBTA 1DUGA 1VF4A 3GTUA 4TR4A 3WGEA 2H6XA 2NPBA 3TKSA 4F2IA 4ZBAA 2AAWA 2PU9C 5IO0A 1VGLA 3IK9A 3TB2A 3FZ9A 3NOFA 3O6TA 2WS2A 2HRKA 1O7UA 3ZITA 3KMOA 4ZL7A 1M9AA 1VF1A 4V1Ap 2YPMA 4KH7A 1YF1A 3ZMKA 4FQUA 4CW9A 2L4QA 3LGCA 1GTIA 4DVCA 2FNOA 5C00A 1BX9A 1YEXA 3UIWA 2N5FA 4F0BA 2VCTA 2P5QA 3VI5A 4OO4A 2JL4A 3FZ4A 1GUMA 2NTOA 3EWLA 4K6XA 2O7KA 4K7NA 5D9WA 2H19A 1N2AA 1ST9A 2GVPA 4OMVA 2GLRA 1E6BA 1GNEA 2I3YA 3BCIA 4MJCA 4GQCA 2KP2A 2QSIA 3ZMLA 4G10A 2LJKA 2LNSA 3WGXA 4NMUA 4K0NA 4TR1B 1QK8A 1TRVA 1SD9A 3GL3A 4D73B 5DJLA 5HR3A 2H76A 1JLWA 1USBA 2AB6A 4TKYA 4PQIA 3QAWA 3CMIA 4OCEA 4ZB6A 3D4MA 4E8EA 3CXGA 4LL4B 4MF6A 1OC9A 3LQ7A 1AQVA 3WYWA 3GKXA 4H86A 4JU5A 1GSFA 4TR0A 3HHVA 2C0DA 2I9HA 5GAPD 1SENA 2DJ3A 2KP1A 3FZAA 2HZEB 3AY8A 2WGRA 1UA5A 4ULXA 3TJKA 2QKEA 1TI3A 2FWGA 2GSTA 1WOUA 1JZWA 3BOAA 2KLXA 5FT3A 3DIEA 1B4PA 4OD7A 4TR3A 5ECNB 3I43A 1HQOA 4NV5A 4POMA 2HRFA 4EO3A 2R6KA 5G1KA 2OJLA 2BMXA 1QXHA 4I8BA 4KA0A 1TK0B 2GSQA 3RPNA 4Q5FA 4GWRA 4POBA 4XRDA 3EC3A 5CRHA 1OKTA 3FYGA 3WT2A 4HOJA 1ON4A 1I5GA 1THOA 4O5RA 5CRDA 2HSYA 2MBTA 2OA7A 4X43A 4J2FA 3L9SA 1A8LA 2H71A 1PX7A 3ZFBA 1AXDA 3LYKA 1GWCA 1TRSA 3GV1A 1MDKA 2VOCA 4JZQA 3QAGA 4KNDA 4I2TA 4IJ3A 4MJBA 3Q6OA 5KN1A 3Q74A 2GSSA 2JACA 5E59A 4F9ZA 3HZ8A 4G2EA 1K0DA 1DBYA 2GQKA 1TRWA 3RPPA 1Z3EA 3HD5A 1Q98A 2RUEA 3F3QA 3C71A 1GH2A 5AIVA 2VL2A 8GSSA 3IAS2 1PSQA 4EC0A 2WB9A 2BTOT 4IW9A 4Q5QA 3G7IA 3IRAA 3F3RA 4MK3A 1Z7RA 3BCKA 4ZB8A 5HFIA 1MD3A 4E8HA 2AV4A 2VUPA 4TR1A 4G0IA 4HQSA 4ID0A 1F37A 1EZKA 2CV4A 5HR2A 2C8UA 2AUVA 3KH9A 4V2NA 1S3CA 4HDEA 1G7EA 1S3AA 3UBLA 3FKFA 2P0GA 1YEPA 1XWKA 4ZILA 4JR4A 5B7CA 1K3LA 2C3QA 3J7Yk 3UMAA 4G0KA 3MWHA 4IHUA 2HZEA 3G7JA 5ECIB 1YKAA 2ZCTA 4XS6A 3RDWA 2FWEA 3EU4A 4KCEA 3TJFA 3EE2A 1PMTA 2OE1A 5B8AA 2YZHA 22GSA 3QCPA 5KN3A 4BVXB 2GZYA 1EEJA 1FO5A 4MABA 4DSRA 3F4SA 13GSA 2YP6A 4QL7A 1CQHA 3GA4A 1Z9HA 2DJKA 2L6CA 1TW9A 4TOPA 1SD8A 1K0OA 1V58A 3VWWA 3QPMA 2L57A 5H5SA 2H1GA 1NM3A 2H0GA 4JR6A 1GUHA 3FR9A 3IXRA 3W6GA 4PGTA 1NSWA 4PNFA 4EUYA 4NPBA 2GTUA 2HYXA 4X1UA 2FWHA 3OR5A 4GRFA 1BAYA 3QMXA 2XPEA 4IELA 1T7PB 4WETA 2YWMA 3FR3A 3L0HA 3HVSA 3EMXA 2HSNB 1EGRA 2RM6A 3BJ5A 5HQPA 2H01A 2ZNMA 1YQ1A 1Z6MA 5GAND 1O6JA 2H70A 1K3YA 3C73A 3F9UA 9GSSA 1M0UA 1ERVA 1T4ZA 1DE1A 4IQ1A 3DVXA 4K7OA 4HUAA 1B9XC 3UAPA 2JSZA 1FB6A 5KN0A 3IE3A 2R2JA 2CVDA 2HRKB 3H4KA 4MA9A 5CYYA 5F8BA 3PPUA 2R3XA 4EDZA 4I2UA 4J56E 4KCAA 3ZVJA 1CQGA 2IMDA 2WRTA 1FW1A 3TUEA 2MMOA 1J0FA 2LJAA 3KM6A 2Z9SA 11GSA 1T8EB 2IN3A 3TJGA 1A0FA 1H75A 2I1UA 4TXVA 6GSTA 4ZBBA 5ENUA 2HXKA 2VM1A 4OFTA 1T1VA 3N9JA 3KIJA 2K8VA 5G30A 2OBIA 1GUKA 4EKZA 5A4UA 5AIXA 4LA1A 4CDOA 2QC7A 2VL3A 3R2QA 2OE0A 2H6YA 4BVYB 3NZNA 5J9BA 1EP8A 1W4VA 1WRYA 4AJ7A 4KDXA 2LSTA 2FA8A 19GSA 2IWTA 1GLQA 1O8XA 4O7HA 4OFNA 3NIVA 4KX4A 3W8JA 5IOWA 1MDIA 1ZCPA 1SU9A 4L8EA 2F3MA 5D8IA 2GT6A 1JFUA 1TI1A 3GN3A 2JADA 3VLNA 2N5BA 2QGVA 4RI6A 4G0LA 5JCGA 2PVOC 1T4YA 18GSA 2KHPA 1XBSA 5H5RA 4KSOA 4BL7A 3L78A 4KDYA 1M9BA 4PUAA 1GSSA 3E3EA 2XBQA 4BWQA 4L5OA 5ID2B 20GSA 4FYBA 1AAZA 2E7PA 2YJHA 1TDIA 2C0FA 4L0WA 3D21A 2HRAA 2WULA 3KZQA 1AQXA 3TJJA 3I6AA 4JEDA 3FY7A 2BJXA 5D96A 3GRXA 3IR4A 4MCUA 2TRXA 3N5OA 3CYNA 3PH9A 1DE2A 3F6FA 3TRQA 2PBJA 4AJ6A 2LTKA 4MJAA 3VK9A 1A23A 4MH2A 1O73A 1KEBA 5INYA 3W8SA 2LQQA 4GQFA 3A3TA 2ZUPA 4WBRD 4KUNA 4GSSA 3IC8A 5J3RA 4K8MA 5COHA 5F06A 3EVIA 1J08A 3EU3A 1PL1A 1XCCA 1XWBA 5JCWA 2OACA 3L9UA 3H79A 4DSSB 1PA3A 2H66A 4JRRA 2DLXA 1K0BA 2C0EA 3P8WA 3KCMA 2F51A 1C72A 2C4JA 1V57A 4GCIA 16GSA 2HQTA 2MMNA 1ML6A 3IDVA 4EVMA 4BVYA 1WMJA 5A4WA 2VAFA 1MD4A 4PQ1A 5G31A 4PTSA 1K0AA 3KEBA 2DIYA 3HDCA 4L5LA 3IAM2 3HZ4A 5ECHB 1BEDA 2CX3A 2NVLA 3O76A 2HNLA 3LWAA 4BPYA 4TW5A 2IMFA 3GKMA 1YDKA 4HZ4A 3ZLPA 5JWOB 2EIOA 4PNGA 3HJPA 1M2AA 4FYUA 1HNCA 3VI7A 2NBSA 4ZIJA 1S3DA 1UN2A 2CT6A 2MZCA 2KOKA 2M46A 4WR5A 3M9KA 2YWOA 3CRUA 1OC3A 1OVNA 2YANA 1ABAA 1FVKA 5ID2A 1UVZA 2GT5A 4XIHA 5ECKB 3DEXA 2FWFA 3TJBA 2VD1A 2X99A 1RQMA 3IOSA 4KF9A 3ME8A 1GSEA 1Z5YE 5D73A 1A0RP 1B4QA 3TKQA 4GSNA 1TP9A 5CO3A 4MLYA 1UC7A 1XW9A 1G0TA 2B3SA 4RQXA 3A2VA 1WPIA 2DJ1A 5IPGA 6GSWA 4O32A 2GZZA 2YCDA 4RI7A 3UARA 4PUFC 5IMZA 3VWVA 4OO5A 4WKWA 1XVQA 1XFLA 3DYRA 2B7JA 3F6DA 2H72A 2YWIA 5B8BA 4EDYA 4MPGA 2FHEA 3FR6A 1SL0B 1EWXA 2H0IA 2MBSA 4DSSA 1G6YA 3VPQA 3HJOA 3M0FA 4KSMA 2H0HA 1SL1B 2B5XA 1OE8A 2LRTA 4HS1A 1IYIA 2JZTA 1A24A 3HKRA 5D9XA 4AF2A 5IPHA 2IL3A 2CA8A 4KGIA 5IMVA 3V1WA 4GF0A 2VM2A 2X8CA 5F05A 1I9DA 3APSA 3DXBA 1MDJA 1E2YA 2VIMA 4MP4A 2DJ2A 4MZCA 2B1LA 2HT9A 1AC1A 3A2XA 2H1AA 2OE3A 2CZ2A 1DSBA 1TU7A 2HI7A 1F2EA 5JWQB 1O81A 2R5GA 1BJXA 3LJRA 3C1RA 2H30A 3GFKA 1QGVA 5IQYA 3KP8A 4RUVA 5IM9A 2JU5A 4AGSA 1U88A 6GSVA 5DDLA 14GSA 1N8JA 5EL8A 1GP1A 5IIZA 1SJ6A 4FIWA 3H93A 2YWNA 5EPFA 3EYTA 3MAKA 3QAVA 1R4WA 2F9SA 3US3A 1ZYEA 2FGXA 1X9MB 5ECSA 2L5LA 2K18A 2X8HA 3E0UA 3LXTA 3LG6A 3KD0A 2RUFA 1A8YA 4XS4A 3D4TA 4POKA 4YQUA 1XIYA 1RW1A 2PUKC 1M2BA 5DVBA 4N11A 3QDNA 2CAQA 4YAVA 2RIIA 3S9FA 1B9YC 3P2AA 3MDKA 4ZL8A 4IBPA 4HZ2A 3G9BA 2P5RA 1O8WA 3BD2A 4NHZA 3BBYA 4MF7A 2K8SA 5IMCA 2ON7A 1YF0A 1LJRA 4KAEA 1URMA 4NHWA 5EVOA 3APQA 3DMLA 3GSTA 4EE0A 2ES7A 3SWLA 1SJZA 2GZPA 2AHEA 4WR4A 4OWYA 5GZZB 2OBKA 2C3TA 3D0ZA 3F63A 1Y25A 4TXOA 2VCQA 5ELGA 2IJYA 4BL7B 2NDOA 3ZFLA 3ERFA 4GTUA 4ACSA 1V2AA 5ECQB 3ISOA 2AJQB 2GS3A 4MZWA 3F0IA 4MPFA 4Z7XA 4J57E 4MJEA 1KBNA 1Z7PA 2LKUA 1BQ7A 5KN2A 4USSA 4ISDA 2VL2C 3CSIA 2ALBA 3D6IA 3KGKA 4K9ZA 3LSZA 4ZXGA 2B7KA 2GSRA 3PR8A 3JCML 1HNAA 4LMVA 5IMFA 4OFMA 4IKHA 2E2GA 5J5NA 2X64A 2PWJA 4TN8A 1GTUA 3DKSA 2TRCP 2L6DA 1OKDA 2LQOA 3RHBA 4HEA2 4XCSA 2WCIA 1LU4A 5CREA 3HVXA 1K0NA 1WP0A 3LORA 7GSSA 3GYKA 5HFKA 3ERGA 4K7IA 2H6ZA 2XHFA 3GKNA 1FG4A 2H75A 2H73A 1ACVA 4Q5RA 5ECMB 3CRTA 3EINA 3MSZA 5LNKe 1SYXA 3TKSE 4BWSA 1QFNA 5IO2A 3FEUA 1PN9A 3VPTA 1JZOA 2LEGA 1NHYA 2M72A 1GLPA 1XWCA 2V32A 2HRNA 4NAXA 5ECPB 4GLTA 4CHSA 2V2GA 5AGYA 1EV9A 2YNXA 1K0CA 2A2SA 3M1GA 1M7TA 1AQWA 1NHOA 12GSA 3QOUA 4K1FA 1SK0A 4JE1A 3ZTLA 1BG5A 2V41A 1PQNA 2IMIA 1OC8A 3F8UA 4JBBA 4V2LA 1ZYQB 5L71A 2C1YA 1VRSD 3GUSA 2P31A 3UVHA 3KXOA 4HI7A 1A2LA 2H74A 2ON5A 1ZOFA 3P90A 2DJ0A 5D9VA 1O85A 3CBUA 3DWVA 2MYGA 3CTFA 1T00A 1V9WA 1ERWA 1PL2A 1XW6A 5DBQA 1KNGA 2C3NA 1TTZA 1PX6A 1FVJA 2GQMA 1QQ2A 2HE3A 2VO4A 5JCUA 2DBCA 2PERA 2FY6A 4LL1B 4AJ8A 1M2DA 4NV2A 3UEMA 2R37A 3D22A 2VLVA 3GMFA 3HVVA 2O8VB 1TKDB 3EMPA 1WJKA 1EOGA 3WT1A 2A4VA 2V6KA 1THXA 2I4AA 5GSSA 1XOAA 5ECRB 3ERWA 1WWJA 4NWYA 1FAAA 1SKWB 5CAXA
chains in the Genus database with same CATH superfamily
2HLSA 3C8EA 2EIQA 3A2WA 2YJ7A 3GX8A 1YJ6A 3VURA 4YH2A 3LW9A 2G2QA 2FUG2 5GSTA 1GL8A 3EURA 4DSQA 1OYJA 2LNTA 4X0XA 2OKAA 4IS0A 6GSSA 1K3OA 5DQSA 5LD0A 4I6XA 4CY8A 1W89A 2O36A 3E9JB 1SKSB 1IYHA 5B6NA 4MH3A 1SK1A 1PRXA 2CVBA 1AIUA 2IFQB 4F0CA 3ED3A 1Y6EA 2GQLA 2YZUA 4ZBDA 4GSTA 1EV4A 1QUWA 3F4TA 1GRXA 4K2DA 3HJMA 2HSMA 4ILFA 1GTAA 3HY2A 1XPVA 2FCHA 3MNGA 2G0FA 2CZ3A 1BYEA 2DSAA 2PN8A 1JZRA 1FB0A 4FH8A 4N30A 2J23A 2L5OA 1VF3A 5F0GA 3QFAC 1ERUA 1GULA 10GSA 2HFDA 1WE0A 5IMDA 4XRAA 5ECOB 3TKPA 1LBKA 2LV3A 5G5FA 1U3AA 3K8NA 1WIKA 3SBCA 3PINA 3HYPA 3MIXA 3DD3A 2XC2A 1HD2A 5J4VA 4L0UA 3M8NA 2X8GA 2B1KA 2O85A 2B6MA 2HSHA 3UBKA 5J9CA 1H4OA 4OCFA 4XS4B 3A5WA 3TKRA 1SJIA 1V98A 1VF2A 4ZL9A 3M9JA 1QMVA 5A5KA 1GSYA 1MEKA 3KTBA 1SK2A 4QL9A 1PKZA 3LEFA 3TKSC 5JWRB 5LCZA 2GGTA 1FOVA 2VL9A 5G1LA 4HU9A 2CVKA 3I69A 5D9TA 5CNWA 3DGQA 3IHQA 2DMLA 5F07A 3GNJA 3HA9A 3C7MA 3ZIVA 4PXOA 2IPAA 2H8LA 3GX0A 3CSHA 2B5YA 5EY6A 3F4RA 4ML6A 3LYPA 4O5UA 3ZIJA 4TXOB 2C80A 1KTEA 3KMNA 1TJDA 3UJ1A 1ZMAA 3DRNA 4FO5A 4WXTA 4QQ7A 1XXUA 2WVYA 4MF5A 2PPTA 2UV8G 1Z6NA 1PKWA 4KB3A 5J40A 2HZFA 2UZ8A 1XW5A 4RQRA 2DJJA 1R26A 1GSDA 2J9HA 1XWGA 4YQMA 5BMUB 3VFIA 2IFQA 4K0GA 3P7XA 1ZGNA 1F9MA 4YAPA 5DQYA 1ZZYA 3GSSA 2H1BA 3IV4A 4I97A 2IMEA 1NW2A 3FRCA 2O87A 3U5RE 4YQVA 4IQAA 2V1MA 2PVQA 3TOUA 4ECIA 3ME7A 2DC5A 2JZSA 3C1SA 5DAKB 4N0ZA 2LJRA 4Q5NA 3IPZA 2CQ9A 1TXXA 5DCGA 2YN1A 5G2ZA 2IMKA 3TOTA 2X4AA 3TRPA 2WDUA 2TIRA 2N5AA 3APOA 1X5EA 5ABRA 5CP1A 2L4CA 1RK4A 3ZREA 6GSXA 3HXSA 4MZBA 3GH9A 2E2MA 2DIZA 4P3YB 4D73A 3FMWA 1U3IA 2LRCA 4TRXA 1B48A 1JZDA 4IVFA 1B8XA 5HR0A 2FLSA 4ZB9A 3UL3A 1R5PA 1YEWC 4EXJA 4POLA 2A4HA 2PMTA 2F8AA 2FA4A 2FD3A 2A2RA 5IMAA 1HNBA 5HFGA 2VCXA 2VCVA 1JLVA 4BA7A 3IBHA 2K9FA 2XBIA 3CTGA 5DJMA 2GDRA 2CX4A 2PGTA 1XZOA 3Q19A 1EEMA 2EFDA 3GHAA 1GTBA 1TK8B 4KE3A 1XOBA 1ZYPA 4N3ZA 1HYUA 1A2MA 1EOHA 4IGJA 2VKZG 4N10A 4KW6A 3LFLA 4ML1A 3FK8A 3QR6A 2VCZA 1FHEA 1X9SB 4WF4A 2YV9A 2WW3A 5DALB 1TRUA 3IK7A 3I9V2 2VLTA 4LLRA 4PX1A 2B5EA 3KJYA 5H5QA 4MDCA 3GH6A 2XPDA 4HJMA 1F3AA 1TOFA 3GKKA 2D2ZA 4TVEA 2IIYA 1AW9A 4V1Ag 3G7YA 2WJUA 3L4NA 2VLUA 1OE7A 5AISA 2LS5A 5HR1A 3QD9A 4IJIA 2RM5A 2YV7A 5J41A 5A1NB 1G7OA 2VCWA 1XG8A 2LUSA 1R5AA 3TGZA 4NXIA 3H1NA 4LMWA 5J4YA 5BMUA 1GSUA 4I5QA 3FZ5A 4XHMA 4F82A 3IC4A 3WGDA 4WEYA 5G5EA 2X49A 3VWUA 4HJ2A 4G19A 5AN1A 3U6VA 1YKCA 5CRWA 5D93A 1AUCA 3ZVJD 3IA1A 5KEJA 3M3MA 3ZYWA 5ECLB 5DAKA 2DMMA 3QFBC 2EIRA 3VWXA 3TDGA 3TRXA 3UOMA 4MMMA 4AKHA 1X0RA 3RHCA 1M99A 2EFCA 2WW2A 2V6OA 3GTUB 2LRNA 4ECJA 1S4BP 4EL1A 4XTSA 1S3RA 3D5JA 4AKIA 1T3BA 3FW2A 1X5CA 4AI6A 1F3BA 1TK5B 4K5RA 5J4UA 5B6MA 4ECBA 2C0GA 2MMZA 1EGOA 1TU8A 1GSQA 1R7HA 2JZRA 1U6TA 1PGTA 3CSJA 6GSYA 4PURA 2JSYA 4O92A 3GL5A 4DEJA 3GIXA 3R3EA 1A2JA 1SYRA 1SL2B 5C04A 2WFCA 2HSMB 2L59A 1XVWA 1MTCA 4IN0A 1X9WB 17GSA 2OADA 3LXZA 4BVXA 5A4VA 2REMA 2AYTA 3ZRDA 4KDUA 1Q4JA 2MMAA 5FHIA 4Z2TA 1PN0A 2F8FA 1PD21 1YY7A 6GSUA 2WZ9A 1ERTA 5DALA 2YOIA 1XWAA 3PGTA 4F03A 2E0QA 1OAZA 2EC4A 1K0MA 5CRGA 1ILOA 2KUCA 3CWGA 4G9HA 4FYCA 1F6MC 5ELAA 3UVTA 4IP6A 4GXZA 2O89A 4N0VA 3KTLA 3KP9A 2H1DA 3KH7A 2O3EA 4HQZA 1U87A 2M80A 1JHBA 4WF5A 4A5PA 3DVWA 3Q18A 4XS1A 4IP1A 1OC9B 5A1NA 1V40A 2WW0A 2CAIA 5IOXA 1X5DA 1EP7A 3H8QA 2VD0A 4V2MA 3J7Yb 1YZXA 5DCHA 1G6WA 4PQHA 3ZZXA 4ECCA 3HCZA 1GNWA 3ZL5A 2K6VA 1J9BA 1SKRB 2R4VA 3TCOA 3WD6A 3FHKA 3L9VA 4WBJA 2I81A 4HU7A 4EF0A 2RLIA 3GURA 4AKGA 3O3TA 5E4WA 5FWGA 1ZL9A 3RAZA 3RBTA 1DUGA 1VF4A 3GTUA 4TR4A 3WGEA 2H6XA 2NPBA 3TKSA 4F2IA 4ZBAA 2AAWA 2PU9C 5IO0A 1VGLA 3IK9A 3TB2A 3FZ9A 3NOFA 3O6TA 2WS2A 2HRKA 3CHXC 1O7UA 3ZITA 3KMOA 4ZL7A 1M9AA 1VF1A 4V1Ap 2YPMA 4EIPA 2WZSA 1FOHA 4KH7A 1YF1A 3ZMKA 4FQUA 4CW9A 2L4QA 3LGCA 5J47A 1GTIA 4DVCA 2FNOA 5C00A 2WVZA 1BX9A 1YEXA 3UIWA 2N5FA 4F0BA 2VCTA 2P5QA 4YKGA 3VI5A 4OO4A 2JL4A 3FZ4A 1GUMA 2NTOA 3EWLA 4K6XA 2O7KA 4K7NA 5D9WA 2H19A 1N2AA 1ST9A 2GVPA 4OMVA 2GLRA 1E6BA 1GNEA 2I3YA 3BCIA 4MJCA 4GQCA 2KP2A 2QSIA 3ZMLA 4G10A 2LJKA 2LNSA 3WGXA 4NMUA 4K0NA 4TR1B 1QK8A 1TRVA 1SD9A 3GL3A 4D73B 5DJLA 5HR3A 2H76A 1JLWA 3IHGA 1USBA 2AB6A 4TKYA 4PQIA 3QAWA 3CMIA 4OCEA 4ZB6A 3D4MA 4E8EA 3CXGA 1ZYNA 5A34A 4MF6A 4LL4B 1OC9A 3LQ7A 1AQVA 3WYWA 3GKXA 4H86A 4JU5A 1GSFA 4TR0A 3HHVA 2C0DA 2I9HA 5GAPD 1SENA 2DJ3A 2KP1A 3FZAA 2HZEB 3AY8A 2WGRA 1UA5A 4ULXA 3TJKA 1Y1UA 2QKEA 1TI3A 2FWGA 2GSTA 1WOUA 1JZWA 4CY6A 3BOAA 2KLXA 5FT3A 3DIEA 1B4PA 4OD7A 4TR3A 5ECNB 3I43A 1HQOA 4NV5A 4POMA 2HRFA 4EO3A 2R6KA 5G1KA 2OJLA 2BMXA 1QXHA 4I8BA 4KA0A 4BIKA 1TK0B 5A5HA 2GSQA 3RPNA 4Q5FA 4GWRA 4POBA 4XRDA 3EC3A 5CRHA 1OKTA 3FYGA 3WT2A 4HOJA 1ON4A 1I5GA 1THOA 4O5RA 5CRDA 2HSYA 2H1LA 2WVXA 2MBTA 2OA7A 4X43A 4J2FA 3L9SA 1A8LA 2H71A 1PX7A 3ZFBA 1AXDA 3LYKA 1GWCA 1TRSA 3GV1A 1MDKA 2VOCA 4JZQA 3QAGA 4KNDA 4I2TA 4IJ3A 4MJBA 3Q6OA 3A5IA 5KN1A 3Q74A 2GSSA 2JACA 5E59A 4F9ZA 3HZ8A 2QA1A 4G2EA 4PI2C 1K0DA 1DBYA 2GQKA 1TRWA 4X4JA 3RPPA 1Z3EA 3HD5A 1Q98A 2RUEA 3F3QA 3C71A 1GH2A 5AIVA 2VL2A 8GSSA 3IAS2 1PSQA 4EC0A 2WB9A 2BTOT 4IW9A 3IRAA 4Q5QA 3G7IA 3F3RA 4QMKA 4MK3A 1Z7RA 3BCKA 4ZB8A 5HFIA 1MD3A 4E8HA 2AV4A 2VUPA 4TR1A 4G0IA 4HQSA 4ID0A 1F37A 1EZKA 2A2PA 2CV4A 5HR2A 2C8UA 2AUVA 3KH9A 4V2NA 1S3CA 4HDEA 1G7EA 1S3AA 3UBLA 3FKFA 2P0GA 1YEPA 1XWKA 4ZILA 4JR4A 5B7CA 1K3LA 2C3QA 2R0GA 3J7Yk 3UMAA 4G0KA 3MWHA 4IHUA 2HZEA 3G7JA 5ECIB 1YKAA 2ZCTA 1TXUA 4XS6A 2FWEA 3RDWA 3EU4A 4KCEA 3TJFA 1M3IA 3EE2A 1PMTA 2OE1A 5B8AA 2YZHA 22GSA 3QCPA 5KN3A 4BVXB 2GZYA 1EEJA 1FO5A 4MABA 4DSRA 3F4SA 13GSA 2YP6A 4QL7A 1CQHA 3GA4A 4O5QA 1Z9HA 2DJKA 2L6CA 1TW9A 4TOPA 1SD8A 1K0OA 1SVLA 1V58A 3VWWA 3QPMA 2L57A 5H5SA 2H1GA 1NM3A 2H0GA 4JR6A 1GUHA 4K5SA 3FR9A 3IXRA 3W6GA 4PI0C 4PGTA 1NSWA 4PNFA 4EUYA 4NPBA 2GTUA 2HYXA 4X1UA 2FWHA 3OR5A 4GRFA 1BAYA 3QMXA 2XPEA 4IELA 1T7PB 4WETA 2YWMA 3FR3A 3L0HA 3HVSA 3EMXA 2HSNB 1EGRA 2RM6A 3BJ5A 5HQPA 2H01A 2ZNMA 1YQ1A 1Z6MA 5GAND 1O6JA 2H70A 1K3YA 3C73A 3F9UA 9GSSA 1M0UA 1ERVA 1T4ZA 1DE1A 4IQ1A 3DVXA 4K7OA 4HUAA 1B9XC 3UAPA 2JSZA 1FB6A 5KN0A 3IE3A 2R2JA 1BF5A 2CVDA 2HRKB 3H4KA 4MA9A 5CYYA 2O5VA 5F8BA 3PPUA 2R3XA 4EDZA 4I2UA 4J56E 4KCAA 3ZVJA 1CQGA 2IMDA 2WRTA 1FW1A 2OT3A 3TUEA 2MMOA 1J0FA 2LJAA 3KM6A 2Z9SA 11GSA 1T8EB 2IN3A 3TJGA 1A0FA 1H75A 2I1UA 4TXVA 6GSTA 4ZBBA 5ENUA 2HXKA 2VM1A 4OFTA 1T1VA 3N9JA 3KIJA 2K8VA 5G30A 2OBIA 1GUKA 4EKZA 5A4UA 5AIXA 4LA1A 4CDOA 2QC7A 2VL3A 3R2QA 2OE0A 2H6YA 4BVYB 3NZNA 5J9BA 1EP8A 1W4VA 1WRYA 2EFEA 1I1IP 4AJ7A 4KDXA 3HMJG 2LSTA 2FA8A 19GSA 2IWTA 1GLQA 1SVMA 1O8XA 2QA2A 4O7HA 4OFNA 3NIVA 4KX4A 3W8JA 5IOWA 1MDIA 1ZCPA 1SU9A 4L8EA 2F3MA 5D8IA 2GT6A 1JFUA 1TI1A 3GN3A 2JADA 3VLNA 2EFHA 2N5BA 2QGVA 4RI6A 5A34B 4G0LA 5JCGA 2PVOC 1T4YA 18GSA 2KHPA 1XBSA 5H5RA 4KSOA 4BL7A 3L78A 4KDYA 1M9BA 4PUAA 1GSSA 3E3EA 2XBQA 4BWQA 4L5OA 5ID2B 20GSA 4FYBA 1AAZA 2E7PA 2YJHA 1TDIA 2HSNA 2C0FA 4L0WA 3D21A 2HRAA 2WULA 3KZQA 1AQXA 3TJJA 3I6AA 4JEDA 3FY7A 2BJXA 5D96A 3GRXA 3IR4A 4MCUA 2TRXA 3N5OA 3CYNA 3PH9A 1DE2A 3F6FA 3TRQA 2PBJA 4AJ6A 2LTKA 4MJAA 3VK9A 1A23A 4MH2A 2R0PA 5A5HB 1O73A 1KEBA 2WW1A 5INYA 3MYDA 3W8SA 2LQQA 2WVXB 4GQFA 3A3TA 2ZUPA 4WBRD 4KUNA 4GSSA 3IC8A 5J3RA 4K8MA 3RFRC 5COHA 5F06A 3EVIA 1J08A 3EU3A 1PL1A 1XCCA 1XWBA 5JCWA 2OACA 3L9UA 3H79A 4DSSB 1PA3A 2H66A 4JRRA 2DLXA 1K0BA 2C0EA 3P8WA 3KCMA 2F51A 1C72A 4GDFA 2C4JA 1V57A 4GCIA 16GSA 2HQTA 2MMNA 1ML6A 3IDVA 4EVMA 4G01A 4BVYA 1WMJA 5A4WA 2VAFA 1MD4A 4PQ1A 5G31A 3RGBC 4PTSA 1K0AA 3KEBA 2DIYA 3HDCA 4L5LA 1N25A 3TU3B 3IAM2 3HZ4A 5ECHB 1BEDA 2CX3A 2NVLA 3O76A 2HNLA 3LWAA 4BPYA 4TW5A 2IMFA 3GKMA 1YDKA 4HZ4A 3ZLPA 2R0CA 5JWOB 2EIOA 4PNGA 2DKHA 3HJPA 1M2AA 4FYUA 3HVNA 1HNCA 3VI7A 2NBSA 4ZIJA 1S3DA 1UN2A 2CT6A 2MZCA 2KOKA 2M46A 4WR5A 3M9KA 2YWOA 3CRUA 4AKXB 1OC3A 1OVNA 2YANA 1ABAA 1FVKA 5ID2A 1UVZA 2GT5A 4XIHA 5ECKB 3DEXA 2FWFA 3TJBA 2VD1A 2X99A 1RQMA 3IOSA 4KF9A 3ME8A 1GSEA 1Z5YE 5D73A 1A0RP 5BRTA 1SVOA 1B4QA 3TKQA 4GSNA 1TP9A 5CO3A 4MLYA 1UC7A 1XW9A 1G0TA 2B3SA 4RQXA 3A2VA 4ZB7A 1WPIA 2DJ1A 5IPGA 6GSWA 4O32A 2GZZA 2YCDA 4RI7A 3UARA 4PUFC 5IMZA 3VWVA 4OO5A 4WKWA 1XVQA 1XFLA 3DYRA 2B7JA 3F6DA 2H72A 2YWIA 5B8BA 4EDYA 4MPGA 2FHEA 3FR6A 1SL0B 1EWXA 2H0IA 2MBSA 4DSSA 1G6YA 3VPQA 3HJOA 3M0FA 4Z2RA 4KSMA 2H0HA 1SL1B 2B5XA 1OE8A 2LRTA 4HS1A 1IYIA 2JZTA 1A24A 3HKRA 1PFOA 5KOWA 5D9XA 4AF2A 5IPHA 2IL3A 2CA8A 4KGIA 5IMVA 3V1WA 4GF0A 2VM2A 2X8CA 5F05A 1I9DA 3APSA 3DXBA 1MDJA 1E2YA 2VIMA 4MP4A 2DJ2A 4MZCA 2B1LA 4Z2UA 2HT9A 1AC1A 3A2XA 2H1AA 2OE3A 2CZ2A 1DSBA 1TU7A 2HI7A 1F2EA 5JWQB 1O81A 2R5GA 1BJXA 3LJRA 3C1RA 2H30A 3GFKA 1QGVA 5IQYA 3KP8A 4RUVA 5IM9A 2JU5A 4AGSA 1U88A 4YKFA 6GSVA 5DDLA 14GSA 1N8JA 5EL8A 1GP1A 5IIZA 1SJ6A 4FIWA 3H93A 2YWNA 5EPFA 3EYTA 3MAKA 3QAVA 4FXYP 1R4WA 2F9SA 3US3A 1ZYEA 2FGXA 1X9MB 5ECSA 2L5LA 2K18A 2X8HA 3E0UA 3LXTA 3LG6A 1M3JA 3KD0A 2RUFA 1A8YA 4XS4A 3D4TA 4POKA 4YQUA 1XIYA 1RW1A 2PUKC 3EPTA 1M2BA 5DVBA 4N11A 3QDNA 2CAQA 4YAVA 2RIIA 3S9FA 1B9YC 3P2AA 3MDKA 4ZL8A 4IBPA 4HZ2A 3G9BA 2P5RA 1O8WA 3BD2A 4NHZA 3BBYA 4MF7A 2K8SA 5IMCA 2ON7A 1YF0A 1LJRA 4KAEA 1URMA 4NHWA 5EVOA 3APQA 3DMLA 3GSTA 4EE0A 2ES7A 3SWLA 1SJZA 2GZPA 2AHEA 4WR4A 4OWYA 5GZZB 2OBKA 2DKIA 2C3TA 3D0ZA 3F63A 1Y25A 4TXOA 4W66A 2VCQA 5ELGA 2IJYA 4BL7B 2NDOA 3ZFLA 3ERFA 4GTUA 4ACSA 1YVLA 1V2AA 5ECQB 3ISOA 2AJQB 2GS3A 4MZWA 3F0IA 4MPFA 4Z7XA 4J57E 4MJEA 1KBNA 1Z7PA 2LKUA 1BQ7A 4E68A 5KN2A 4USSA 4ISDA 2VL2C 3CSIA 2ALBA 3D6IA 3KGKA 4K9ZA 3LSZA 4ZXGA 2B7KA 2GSRA 3PR8A 3JCML 1HNAA 4LMVA 5IMFA 4OFMA 4IKHA 5KOXA 2E2GA 4ICYA 5J5NA 3CQFA 2X64A 2PWJA 4TN8A 1GTUA 3DKSA 2TRCP 2L6DA 1OKDA 2LQOA 3RHBA 4HEA2 4XCSA 2WCIA 1LU4A 5CREA 3HVXA 1K0NA 1WP0A 3LORA 7GSSA 3GYKA 5HFKA 3ERGA 4K7IA 2H6ZA 2XHFA 3GKNA 1FG4A 2H75A 2H73A 1ACVA 4Q5RA 5ECMB 3CRTA 3EINA 3MSZA 5LNKe 1SYXA 3TKSE 4BWSA 1QFNA 5IO2A 3FEUA 1PN9A 3VPTA 1JZOA 2LEGA 1NHYA 2M72A 1GLPA 1XWCA 2V32A 2HRNA 4NAXA 5ECPB 4GLTA 4CHSA 2V2GA 5AGYA 1EV9A 2YNXA 1K0CA 2A2SA 3M1GA 1M7TA 1AQWA 1NHOA 12GSA 3QOUA 4K1FA 1SK0A 4JE1A 3ZTLA 1BG5A 2V41A 1PQNA 2IMIA 1OC8A 3F8UA 4JBBA 4V2LA 1ZYQB 5L71A 2C1YA 1VRSD 3GUSA 2P31A 3UVHA 3KXOA 4K2XA 4HI7A 1A2LA 2H74A 2ON5A 1ZOFA 3P90A 2DJ0A 5D9VA 1O85A 3CBUA 3DWVA 2MYGA 3CTFA 1T00A 1V9WA 1ERWA 1PL2A 1XW6A 5DBQA 1KNGA 2C3NA 1TTZA 4HSCX 1PX6A 1FVJA 2GQMA 1QQ2A 2HE3A 2VO4A 5JCUA 2DBCA 2PERA 2FY6A 4LL1B 1BG1A 4AJ8A 1M2DA 4NV2A 3UEMA 2R37A 3D22A 2VLVA 4EIQA 3GMFA 3HVVA 4MNNA 2O8VB 1TKDB 3EMPA 1WJKA 1EOGA 3WT1A 2A4VA 2V6KA 4PHZC 1THXA 2I4AA 5GSSA 1XOAA 5ECRB 3ERWA 1WWJA 4NWYA 1FAAA 1SKWB 5CAXA
chains in the Genus database with same CATH topology
2HLSA 3C8EA 2EIQA 3A2WA 2YJ7A 3GX8A 1YJ6A 3VURA 4YH2A 3LW9A 2G2QA 2FUG2 5GSTA 1GL8A 3EURA 4DSQA 1OYJA 2LNTA 4X0XA 2OKAA 4IS0A 6GSSA 1K3OA 5DQSA 5LD0A 4I6XA 4CY8A 1W89A 3E9JB 1SKSB 1IYHA 5B6NA 4MH3A 1SK1A 1PRXA 2CVBA 1AIUA 2IFQB 4F0CA 3ED3A 1Y6EA 2GQLA 2YZUA 4ZBDA 4GSTA 1EV4A 1QUWA 3F4TA 1GRXA 4K2DA 3HJMA 2HSMA 4ILFA 1GTAA 3HY2A 1XPVA 2FCHA 3MNGA 2G0FA 2CZ3A 1BYEA 2DSAA 2PN8A 1JZRA 1FB0A 4FH8A 4N30A 2J23A 2L5OA 1VF3A 5F0GA 3QFAC 1ERUA 1GULA 10GSA 2HFDA 1WE0A 5IMDA 4XRAA 5ECOB 3TKPA 1LBKA 2LV3A 5G5FA 1U3AA 3K8NA 1WIKA 3SBCA 3PINA 3HYPA 3MIXA 3DD3A 2XC2A 1HD2A 5J4VA 4L0UA 3M8NA 2X8GA 2B1KA 2O85A 2B6MA 2HSHA 3UBKA 5J9CA 1H4OA 4OCFA 4XS4B 3A5WA 3TKRA 1SJIA 1V98A 1VF2A 4ZL9A 3M9JA 1QMVA 5A5KA 1GSYA 1MEKA 3KTBA 1SK2A 4QL9A 1PKZA 3LEFA 3TKSC 5JWRB 5LCZA 2GGTA 1FOVA 2VL9A 5G1LA 4HU9A 2CVKA 3I69A 5D9TA 5CNWA 3DGQA 3IHQA 2DMLA 5F07A 3GNJA 3HA9A 3C7MA 3ZIVA 4PXOA 2IPAA 2H8LA 3GX0A 3CSHA 2B5YA 5EY6A 3F4RA 4ML6A 3LYPA 4O5UA 3ZIJA 4TXOB 2C80A 1KTEA 3KMNA 1TJDA 3UJ1A 1ZMAA 3DRNA 4FO5A 4WXTA 4QQ7A 1XXUA 4MF5A 2PPTA 2UV8G 1Z6NA 1PKWA 4KB3A 5J40A 2HZFA 2UZ8A 1XW5A 4RQRA 2DJJA 1R26A 1GSDA 2J9HA 1XWGA 4YQMA 5BMUB 3VFIA 2IFQA 4K0GA 3P7XA 1ZGNA 1F9MA 4YAPA 5DQYA 1ZZYA 3GSSA 2H1BA 3IV4A 4I97A 2IMEA 1NW2A 3FRCA 2O87A 3U5RE 4YQVA 4IQAA 2V1MA 2PVQA 3TOUA 4ECIA 3ME7A 2DC5A 2JZSA 3C1SA 5DAKB 4N0ZA 2LJRA 4Q5NA 3IPZA 2CQ9A 1TXXA 5DCGA 2YN1A 5G2ZA 2IMKA 3TOTA 2X4AA 3TRPA 2WDUA 2TIRA 2N5AA 3APOA 1X5EA 5ABRA 5CP1A 2L4CA 1RK4A 3ZREA 6GSXA 3HXSA 4MZBA 3GH9A 2E2MA 2DIZA 4P3YB 4D73A 3FMWA 1U3IA 2LRCA 4TRXA 1B48A 1JZDA 4IVFA 1B8XA 5HR0A 2FLSA 4ZB9A 3UL3A 1R5PA 4EXJA 4POLA 2A4HA 2PMTA 2F8AA 2FA4A 2FD3A 2A2RA 5IMAA 1HNBA 5HFGA 2VCXA 2VCVA 1JLVA 4BA7A 3IBHA 2K9FA 2XBIA 3CTGA 5DJMA 2GDRA 2CX4A 2PGTA 1XZOA 3Q19A 1EEMA 2EFDA 3GHAA 1GTBA 1TK8B 4KE3A 1XOBA 1ZYPA 4N3ZA 1HYUA 1A2MA 1EOHA 4IGJA 2VKZG 4N10A 4KW6A 3LFLA 4ML1A 3FK8A 3QR6A 2VCZA 1FHEA 1X9SB 4WF4A 2YV9A 5DALB 1TRUA 3IK7A 3I9V2 2VLTA 4LLRA 4PX1A 2B5EA 3KJYA 5H5QA 4MDCA 3GH6A 2XPDA 4HJMA 1F3AA 1TOFA 3GKKA 2D2ZA 4TVEA 2IIYA 1AW9A 4V1Ag 3G7YA 2WJUA 3L4NA 2VLUA 1OE7A 5AISA 2LS5A 5HR1A 3QD9A 4IJIA 2RM5A 2YV7A 5J41A 5A1NB 1G7OA 2VCWA 2LUSA 1R5AA 3TGZA 4NXIA 3H1NA 4LMWA 5J4YA 5BMUA 1GSUA 4I5QA 3FZ5A 4XHMA 4F82A 3IC4A 3WGDA 4WEYA 5G5EA 2X49A 3VWUA 4HJ2A 4G19A 5AN1A 3U6VA 1YKCA 5CRWA 5D93A 1AUCA 3ZVJD 3IA1A 5KEJA 3M3MA 3ZYWA 5ECLB 5DAKA 2DMMA 3QFBC 2EIRA 3VWXA 3TDGA 3TRXA 3UOMA 4MMMA 4AKHA 1X0RA 3RHCA 1M99A 2EFCA 2V6OA 3GTUB 2LRNA 4ECJA 4EL1A 4XTSA 3D5JA 4AKIA 1T3BA 3FW2A 1X5CA 4AI6A 1F3BA 1TK5B 4K5RA 5J4UA 5B6MA 4ECBA 2C0GA 2MMZA 1EGOA 1TU8A 1GSQA 1R7HA 2JZRA 1U6TA 1PGTA 3CSJA 6GSYA 4PURA 2JSYA 4O92A 3GL5A 4DEJA 3GIXA 3R3EA 1A2JA 1SYRA 1SL2B 5C04A 2WFCA 2HSMB 2L59A 1XVWA 1MTCA 4IN0A 1X9WB 17GSA 2OADA 3LXZA 4BVXA 5A4VA 2REMA 2AYTA 3ZRDA 4KDUA 1Q4JA 2MMAA 5FHIA 4Z2TA 1PN0A 2F8FA 1PD21 1YY7A 6GSUA 2WZ9A 1ERTA 5DALA 2YOIA 1XWAA 3PGTA 4F03A 2E0QA 1OAZA 2EC4A 1K0MA 5CRGA 1ILOA 2KUCA 3CWGA 4G9HA 4FYCA 1F6MC 5ELAA 3UVTA 4IP6A 4GXZA 2O89A 4N0VA 3KTLA 3KP9A 2H1DA 3KH7A 4HQZA 1U87A 2M80A 1JHBA 4WF5A 4A5PA 3DVWA 3Q18A 4XS1A 4IP1A 1OC9B 5A1NA 1V40A 2CAIA 5IOXA 1X5DA 1EP7A 3H8QA 2VD0A 4V2MA 3J7Yb 1YZXA 5DCHA 1G6WA 4PQHA 3ZZXA 4ECCA 3HCZA 1GNWA 3ZL5A 2K6VA 1J9BA 1SKRB 2R4VA 3TCOA 3WD6A 3FHKA 3L9VA 4WBJA 2I81A 4HU7A 4EF0A 2RLIA 3GURA 4AKGA 3O3TA 5E4WA 5FWGA 1ZL9A 3RAZA 3RBTA 1DUGA 1VF4A 3GTUA 4TR4A 3WGEA 2H6XA 2NPBA 3TKSA 4F2IA 4ZBAA 2AAWA 2PU9C 5IO0A 1VGLA 3IK9A 3TB2A 3FZ9A 3NOFA 3O6TA 2WS2A 2HRKA 1O7UA 3ZITA 3KMOA 4ZL7A 1M9AA 1VF1A 4V1Ap 2YPMA 4EIPA 1FOHA 4KH7A 1YF1A 3ZMKA 4FQUA 4CW9A 2L4QA 3LGCA 5J47A 1GTIA 4DVCA 2FNOA 5C00A 1BX9A 1YEXA 3UIWA 2N5FA 4F0BA 2VCTA 2P5QA 4YKGA 3VI5A 4OO4A 2JL4A 3FZ4A 1GUMA 2NTOA 3EWLA 4K6XA 2O7KA 4K7NA 5D9WA 2H19A 1N2AA 1ST9A 2GVPA 4OMVA 2GLRA 1E6BA 1GNEA 2I3YA 3BCIA 4MJCA 4GQCA 2KP2A 2QSIA 3ZMLA 4G10A 2LJKA 2LNSA 3WGXA 4NMUA 4K0NA 4TR1B 1QK8A 1TRVA 1SD9A 3GL3A 4D73B 5DJLA 5HR3A 2H76A 1JLWA 3IHGA 1USBA 2AB6A 4TKYA 4PQIA 3QAWA 3CMIA 4OCEA 4ZB6A 3D4MA 4E8EA 3CXGA 1ZYNA 5A34A 4MF6A 4LL4B 1OC9A 3LQ7A 1AQVA 3WYWA 3GKXA 4H86A 4JU5A 1GSFA 4TR0A 3HHVA 2C0DA 2I9HA 5GAPD 1SENA 2DJ3A 2KP1A 3FZAA 2HZEB 3AY8A 2WGRA 1UA5A 4ULXA 3TJKA 1Y1UA 2QKEA 1TI3A 2FWGA 2GSTA 1WOUA 1JZWA 4CY6A 3BOAA 2KLXA 5FT3A 3DIEA 1B4PA 4OD7A 4TR3A 5ECNB 3I43A 1HQOA 4NV5A 4POMA 2HRFA 4EO3A 2R6KA 5G1KA 2OJLA 2BMXA 1QXHA 4I8BA 4KA0A 1TK0B 5A5HA 2GSQA 3RPNA 4Q5FA 4GWRA 4POBA 4XRDA 3EC3A 5CRHA 1OKTA 3FYGA 3WT2A 4HOJA 1ON4A 1I5GA 1THOA 4O5RA 5CRDA 2HSYA 2H1LA 2MBTA 2OA7A 4X43A 4J2FA 3L9SA 1A8LA 2H71A 1PX7A 3ZFBA 1AXDA 3LYKA 1GWCA 1TRSA 3GV1A 1MDKA 2VOCA 4JZQA 3QAGA 4KNDA 4I2TA 4IJ3A 4MJBA 3Q6OA 3A5IA 5KN1A 3Q74A 2GSSA 2JACA 5E59A 4F9ZA 3HZ8A 2QA1A 4G2EA 1K0DA 1DBYA 2GQKA 1TRWA 4X4JA 3RPPA 1Z3EA 3HD5A 1Q98A 2RUEA 3F3QA 3C71A 1GH2A 5AIVA 2VL2A 8GSSA 3IAS2 1PSQA 4EC0A 2WB9A 2BTOT 4IW9A 4Q5QA 3G7IA 3IRAA 3F3RA 4QMKA 4MK3A 1Z7RA 3BCKA 4ZB8A 5HFIA 1MD3A 4E8HA 2AV4A 2VUPA 4TR1A 4G0IA 4HQSA 4ID0A 1F37A 1EZKA 2A2PA 2CV4A 5HR2A 2C8UA 2AUVA 3KH9A 4V2NA 1S3CA 4HDEA 1G7EA 1S3AA 3UBLA 3FKFA 2P0GA 1YEPA 1XWKA 4ZILA 4JR4A 5B7CA 1K3LA 2C3QA 2R0GA 3J7Yk 3UMAA 4G0KA 3MWHA 4IHUA 2HZEA 3G7JA 5ECIB 1YKAA 2ZCTA 1TXUA 4XS6A 2FWEA 3RDWA 3EU4A 4KCEA 3TJFA 3EE2A 1PMTA 2OE1A 5B8AA 2YZHA 22GSA 3QCPA 5KN3A 4BVXB 2GZYA 1EEJA 1FO5A 4MABA 4DSRA 3F4SA 13GSA 2YP6A 4QL7A 1CQHA 3GA4A 4O5QA 1Z9HA 2DJKA 2L6CA 1TW9A 4TOPA 1SD8A 1K0OA 1SVLA 1V58A 3VWWA 3QPMA 2L57A 5H5SA 2H1GA 1NM3A 2H0GA 4JR6A 1GUHA 4K5SA 3FR9A 3IXRA 3W6GA 4PGTA 1NSWA 4PNFA 4EUYA 4NPBA 2GTUA 2HYXA 4X1UA 2FWHA 3OR5A 4GRFA 1BAYA 3QMXA 2XPEA 4IELA 1T7PB 4WETA 2YWMA 3FR3A 3L0HA 3HVSA 3EMXA 2HSNB 1EGRA 2RM6A 3BJ5A 5HQPA 2H01A 2ZNMA 1YQ1A 1Z6MA 5GAND 1O6JA 2H70A 1K3YA 3C73A 3F9UA 9GSSA 1M0UA 1ERVA 1T4ZA 1DE1A 4IQ1A 3DVXA 4K7OA 4HUAA 1B9XC 3UAPA 2JSZA 1FB6A 5KN0A 3IE3A 2R2JA 1BF5A 2CVDA 2HRKB 3H4KA 4MA9A 5CYYA 2O5VA 5F8BA 3PPUA 2R3XA 4EDZA 4I2UA 4J56E 4KCAA 3ZVJA 1CQGA 2IMDA 2WRTA 1FW1A 2OT3A 3TUEA 2MMOA 1J0FA 2LJAA 3KM6A 2Z9SA 11GSA 1T8EB 2IN3A 3TJGA 1A0FA 1H75A 2I1UA 4TXVA 6GSTA 4ZBBA 5ENUA 2HXKA 2VM1A 4OFTA 1T1VA 3N9JA 3KIJA 2K8VA 5G30A 2OBIA 1GUKA 4EKZA 5A4UA 5AIXA 4LA1A 4CDOA 2QC7A 2VL3A 3R2QA 2OE0A 2H6YA 4BVYB 3NZNA 5J9BA 1EP8A 1W4VA 1WRYA 2EFEA 4AJ7A 4KDXA 3HMJG 2LSTA 2FA8A 19GSA 2IWTA 1GLQA 1SVMA 1O8XA 2QA2A 4O7HA 4OFNA 3NIVA 4KX4A 3W8JA 5IOWA 1MDIA 1ZCPA 1SU9A 4L8EA 2F3MA 5D8IA 2GT6A 1JFUA 1TI1A 3GN3A 2JADA 3VLNA 2EFHA 2N5BA 2QGVA 4RI6A 5A34B 4G0LA 5JCGA 2PVOC 1T4YA 18GSA 2KHPA 1XBSA 5H5RA 4KSOA 4BL7A 3L78A 4KDYA 1M9BA 4PUAA 1GSSA 3E3EA 2XBQA 4BWQA 4L5OA 5ID2B 20GSA 4FYBA 1AAZA 2E7PA 2YJHA 1TDIA 2HSNA 2C0FA 4L0WA 3D21A 2HRAA 2WULA 3KZQA 1AQXA 3TJJA 3I6AA 4JEDA 3FY7A 2BJXA 5D96A 3GRXA 3IR4A 4MCUA 2TRXA 3N5OA 3CYNA 3PH9A 1DE2A 3F6FA 3TRQA 2PBJA 4AJ6A 2LTKA 4MJAA 3VK9A 1A23A 4MH2A 2R0PA 5A5HB 1O73A 1KEBA 5INYA 3MYDA 3W8SA 2LQQA 4GQFA 3A3TA 2ZUPA 4WBRD 4KUNA 4GSSA 3IC8A 5J3RA 4K8MA 5COHA 5F06A 3EVIA 1J08A 3EU3A 1PL1A 1XCCA 1XWBA 5JCWA 2OACA 3L9UA 3H79A 4DSSB 1PA3A 2H66A 4JRRA 2DLXA 1K0BA 2C0EA 3P8WA 3KCMA 2F51A 1C72A 4GDFA 2C4JA 1V57A 4GCIA 16GSA 2HQTA 2MMNA 1ML6A 3IDVA 4EVMA 4G01A 4BVYA 1WMJA 5A4WA 2VAFA 1MD4A 4PQ1A 5G31A 4PTSA 1K0AA 3KEBA 2DIYA 3HDCA 4L5LA 1N25A 3TU3B 3IAM2 3HZ4A 5ECHB 1BEDA 2CX3A 2NVLA 3O76A 2HNLA 3LWAA 4BPYA 4TW5A 2IMFA 3GKMA 1YDKA 4HZ4A 3ZLPA 2R0CA 5JWOB 2EIOA 4PNGA 2DKHA 3HJPA 1M2AA 4FYUA 1HNCA 3VI7A 2NBSA 4ZIJA 1S3DA 1UN2A 2CT6A 2MZCA 2KOKA 2M46A 4WR5A 3M9KA 2YWOA 3CRUA 4AKXB 1OC3A 1OVNA 2YANA 1ABAA 1FVKA 5ID2A 1UVZA 2GT5A 4XIHA 5ECKB 3DEXA 2FWFA 3TJBA 2VD1A 2X99A 1RQMA 3IOSA 4KF9A 3ME8A 1GSEA 1Z5YE 5D73A 1A0RP 5BRTA 1SVOA 1B4QA 3TKQA 4GSNA 1TP9A 5CO3A 4MLYA 1UC7A 1XW9A 1G0TA 2B3SA 4RQXA 3A2VA 4ZB7A 1WPIA 2DJ1A 5IPGA 6GSWA 4O32A 2GZZA 2YCDA 4RI7A 3UARA 4PUFC 5IMZA 3VWVA 4OO5A 4WKWA 1XVQA 1XFLA 3DYRA 2B7JA 3F6DA 2H72A 2YWIA 5B8BA 4EDYA 4MPGA 2FHEA 3FR6A 1SL0B 1EWXA 2H0IA 2MBSA 4DSSA 1G6YA 3VPQA 3HJOA 3M0FA 4Z2RA 4KSMA 2H0HA 1SL1B 2B5XA 1OE8A 2LRTA 4HS1A 1IYIA 2JZTA 1A24A 3HKRA 5KOWA 5D9XA 4AF2A 5IPHA 2IL3A 2CA8A 4KGIA 5IMVA 3V1WA 4GF0A 2VM2A 2X8CA 5F05A 1I9DA 3APSA 3DXBA 1MDJA 1E2YA 2VIMA 4MP4A 2DJ2A 4MZCA 2B1LA 4Z2UA 2HT9A 1AC1A 3A2XA 2H1AA 2OE3A 2CZ2A 1DSBA 1TU7A 2HI7A 1F2EA 5JWQB 1O81A 2R5GA 1BJXA 3LJRA 3C1RA 2H30A 3GFKA 1QGVA 5IQYA 3KP8A 4RUVA 5IM9A 2JU5A 4AGSA 1U88A 4YKFA 6GSVA 5DDLA 14GSA 1N8JA 5EL8A 1GP1A 5IIZA 1SJ6A 4FIWA 3H93A 2YWNA 5EPFA 3EYTA 3MAKA 3QAVA 1R4WA 2F9SA 3US3A 1ZYEA 2FGXA 1X9MB 5ECSA 2L5LA 2K18A 2X8HA 3E0UA 3LXTA 3LG6A 3KD0A 2RUFA 1A8YA 4XS4A 3D4TA 4POKA 4YQUA 1XIYA 1RW1A 2PUKC 3EPTA 1M2BA 5DVBA 4N11A 3QDNA 2CAQA 4YAVA 2RIIA 3S9FA 1B9YC 3P2AA 3MDKA 4ZL8A 4IBPA 4HZ2A 3G9BA 2P5RA 1O8WA 3BD2A 4NHZA 3BBYA 4MF7A 2K8SA 5IMCA 2ON7A 1YF0A 1LJRA 4KAEA 1URMA 4NHWA 5EVOA 3APQA 3DMLA 3GSTA 4EE0A 2ES7A 3SWLA 1SJZA 2GZPA 2AHEA 4WR4A 4OWYA 5GZZB 2OBKA 2DKIA 2C3TA 3D0ZA 3F63A 1Y25A 4TXOA 4W66A 2VCQA 5ELGA 2IJYA 4BL7B 2NDOA 3ZFLA 3ERFA 4GTUA 4ACSA 1YVLA 1V2AA 5ECQB 3ISOA 2AJQB 2GS3A 4MZWA 3F0IA 4MPFA 4Z7XA 4J57E 4MJEA 1KBNA 1Z7PA 2LKUA 1BQ7A 4E68A 5KN2A 4USSA 4ISDA 2VL2C 3CSIA 2ALBA 3D6IA 3KGKA 4K9ZA 3LSZA 4ZXGA 2B7KA 2GSRA 3PR8A 3JCML 1HNAA 4LMVA 5IMFA 4OFMA 4IKHA 5KOXA 2E2GA 4ICYA 5J5NA 2X64A 2PWJA 4TN8A 1GTUA 3DKSA 2TRCP 2L6DA 1OKDA 2LQOA 3RHBA 4HEA2 4XCSA 2WCIA 1LU4A 5CREA 3HVXA 1K0NA 1WP0A 3LORA 7GSSA 3GYKA 5HFKA 3ERGA 4K7IA 2H6ZA 2XHFA 3GKNA 1FG4A 2H75A 2H73A 1ACVA 4Q5RA 5ECMB 3CRTA 3EINA 3MSZA 5LNKe 1SYXA 3TKSE 4BWSA 1QFNA 5IO2A 3FEUA 1PN9A 3VPTA 1JZOA 2LEGA 1NHYA 2M72A 1GLPA 1XWCA 2V32A 2HRNA 4NAXA 5ECPB 4GLTA 4CHSA 2V2GA 5AGYA 1EV9A 2YNXA 1K0CA 2A2SA 3M1GA 1M7TA 1AQWA 1NHOA 12GSA 3QOUA 4K1FA 1SK0A 4JE1A 3ZTLA 1BG5A 2V41A 1PQNA 2IMIA 1OC8A 3F8UA 4JBBA 4V2LA 1ZYQB 5L71A 2C1YA 1VRSD 3GUSA 2P31A 3UVHA 3KXOA 4K2XA 4HI7A 1A2LA 2H74A 2ON5A 1ZOFA 3P90A 2DJ0A 5D9VA 1O85A 3CBUA 3DWVA 2MYGA 3CTFA 1T00A 1V9WA 1ERWA 1PL2A 1XW6A 5DBQA 1KNGA 2C3NA 1TTZA 1PX6A 1FVJA 2GQMA 1QQ2A 2HE3A 2VO4A 5JCUA 2DBCA 2PERA 2FY6A 4LL1B 1BG1A 4AJ8A 1M2DA 4NV2A 3UEMA 2R37A 3D22A 2VLVA 4EIQA 3GMFA 3HVVA 4MNNA 2O8VB 1TKDB 3EMPA 1WJKA 1EOGA 3WT1A 2A4VA 2V6KA 1THXA 2I4AA 5GSSA 1XOAA 5ECRB 3ERWA 1WWJA 4NWYA 1FAAA 1SKWB 5CAXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HLS A;  3C8E A;  2EIQ A;  3A2W A;  2YJ7 A;  3GX8 A;  1YJ6 A;  3VUR A;  4YH2 A;  2G2Q A;  2FUG 2;  5GST A;  1GL8 A;  3EUR A;  4DSQ A;  1OYJ A;  2LNT A;  4X0X A;  2OKA A;  4IS0 A;  6GSS A;  1K3O A;  5DQS A;  5LD0 A;  4I6X A;  1W89 A;  3E9J B;  1SKS B;  1IYH A;  5B6N A;  4MH3 A;  1SK1 A;  1PRX A;  2CVB A;  1AIU A;  2IFQ B;  4F0C A;  3ED3 A;  1Y6E A;  2GQL A;  2YZU A;  4ZBD A;  4GST A;  1EV4 A;  1QUW A;  3F4T A;  1GRX A;  4K2D A;  3HJM A;  2HSM A;  4ILF A;  1GTA A;  3HY2 A;  1XPV A;  2FCH A;  3MNG A;  2G0F A;  2CZ3 A;  1BYE A;  2DSA A;  2PN8 A;  1JZR A;  1FB0 A;  4FH8 A;  4N30 A;  2J23 A;  2L5O A;  1VF3 A;  5F0G A;  3QFA C;  1ERU A;  1GUL A;  10GS A;  2HFD A;  1WE0 A;  5IMD A;  4XRA A;  5ECO B;  3TKP A;  1LBK A;  2LV3 A;  5G5F A;  1U3A A;  3K8N A;  1WIK A;  3SBC A;  3PIN A;  3HYP A;  3DD3 A;  2XC2 A;  1HD2 A;  4L0U A;  3M8N A;  2X8G A;  2B1K A;  2O85 A;  2B6M A;  2HSH A;  3UBK A;  5J9C A;  1H4O A;  4OCF A;  4XS4 B;  3A5W A;  3TKR A;  1SJI A;  1V98 A;  1VF2 A;  4ZL9 A;  3M9J A;  1QMV A;  5A5K A;  1GSY A;  1MEK A;  3KTB A;  1SK2 A;  4QL9 A;  1PKZ A;  3LEF A;  3TKS C;  5JWR B;  5LCZ A;  2GGT A;  1FOV A;  2VL9 A;  5G1L A;  4HU9 A;  2CVK A;  3I69 A;  5D9T A;  5CNW A;  3DGQ A;  3IHQ A;  2DML A;  5F07 A;  3GNJ A;  3HA9 A;  3C7M A;  3ZIV A;  4PXO A;  2IPA A;  2H8L A;  3GX0 A;  3CSH A;  2B5Y A;  5EY6 A;  3F4R A;  4ML6 A;  3LYP A;  3ZIJ A;  4TXO B;  2C80 A;  1KTE A;  3KMN A;  1TJD A;  3UJ1 A;  1ZMA A;  3DRN A;  4FO5 A;  4WXT A;  4QQ7 A;  1XXU A;  4MF5 A;  2PPT A;  1Z6N A;  1PKW A;  4KB3 A;  2HZF A;  2UZ8 A;  1XW5 A;  4RQR A;  2DJJ A;  1R26 A;  1GSD A;  2J9H A;  1XWG A;  4YQM A;  3VFI A;  2IFQ A;  4K0G A;  3P7X A;  1ZGN A;  1F9M A;  4YAP A;  5DQY A;  1ZZY A;  3GSS A;  2H1B A;  3IV4 A;  4I97 A;  2IME A;  1NW2 A;  3FRC A;  2O87 A;  3U5R E;  4YQV A;  4IQA A;  2V1M A;  2PVQ A;  3TOU A;  4ECI A;  3ME7 A;  2DC5 A;  2JZS A;  3C1S A;  5DAK B;  4N0Z A;  2LJR A;  4Q5N A;  3IPZ A;  2CQ9 A;  1TXX A;  5DCG A;  2YN1 A;  5G2Z A;  2IMK A;  3TOT A;  3TRP A;  2WDU A;  2TIR A;  2N5A A;  3APO A;  1X5E A;  5ABR A;  5CP1 A;  2L4C A;  1RK4 A;  3ZRE A;  6GSX A;  3HXS A;  4MZB A;  3GH9 A;  2E2M A;  2DIZ A;  4P3Y B;  4D73 A;  1U3I A;  2LRC A;  4TRX A;  1B48 A;  1JZD A;  4IVF A;  1B8X A;  5HR0 A;  2FLS A;  4ZB9 A;  3UL3 A;  1R5P A;  4EXJ A;  4POL A;  2PMT A;  2F8A A;  2FA4 A;  2FD3 A;  2A2R A;  5IMA A;  1HNB A;  5HFG A;  2VCX A;  2VCV A;  1JLV A;  4BA7 A;  3IBH A;  2K9F A;  2XBI A;  3CTG A;  5DJM A;  2GDR A;  2CX4 A;  2PGT A;  1XZO A;  3Q19 A;  1EEM A;  3GHA A;  1GTB A;  1TK8 B;  4KE3 A;  1XOB A;  1HYU A;  1A2M A;  1EOH A;  4IGJ A;  4N10 A;  4KW6 A;  3LFL A;  4ML1 A;  3FK8 A;  3QR6 A;  2VCZ A;  1FHE A;  1X9S B;  4WF4 A;  2YV9 A;  5DAL B;  1TRU A;  3IK7 A;  3I9V 2;  2VLT A;  4LLR A;  4PX1 A;  2B5E A;  3KJY A;  5H5Q A;  4MDC A;  3GH6 A;  2XPD A;  4HJM A;  1F3A A;  1TOF A;  3GKK A;  2D2Z A;  4TVE A;  2IIY A;  1AW9 A;  4V1A g;  3G7Y A;  2WJU A;  3L4N A;  2VLU A;  1OE7 A;  5AIS A;  2LS5 A;  5HR1 A;  3QD9 A;  4IJI A;  2RM5 A;  2YV7 A;  5J41 A;  1G7O A;  2VCW A;  2LUS A;  1R5A A;  3TGZ A;  4NXI A;  3H1N A;  4LMW A;  5BMU A;  1GSU A;  4I5Q A;  3FZ5 A;  4XHM A;  4F82 A;  3IC4 A;  3WGD A;  4WEY A;  5G5E A;  3VWU A;  4HJ2 A;  4G19 A;  5AN1 A;  3U6V A;  1YKC A;  5CRW A;  5D93 A;  1AUC A;  3ZVJ D;  3IA1 A;  5KEJ A;  3M3M A;  3ZYW A;  5ECL B;  5DAK A;  2DMM A;  3QFB C;  2EIR A;  3VWX A;  3TDG A;  3TRX A;  3UOM A;  4MMM A;  1X0R A;  3RHC A;  1M99 A;  2V6O A;  3GTU B;  2LRN A;  4ECJ A;  4EL1 A;  4XTS A;  3D5J A;  1T3B A;  3FW2 A;  1X5C A;  1F3B A;  1TK5 B;  5J4U A;  5B6M A;  4ECB A;  2C0G A;  2MMZ A;  1EGO A;  1TU8 A;  1GSQ A;  1R7H A;  2JZR A;  1U6T A;  1PGT A;  3CSJ A;  6GSY A;  4PUR A;  2JSY A;  4O92 A;  3GL5 A;  4DEJ A;  3GIX A;  3R3E A;  1A2J A;  1SYR A;  1SL2 B;  5C04 A;  2WFC A;  2HSM B;  2L59 A;  1XVW A;  1MTC A;  4IN0 A;  1X9W B;  17GS A;  2OAD A;  3LXZ A;  4BVX A;  5A4V A;  2REM A;  2AYT A;  3ZRD A;  4KDU A;  1Q4J A;  2MMA A;  5FHI A;  2F8F A;  1PD2 1;  1YY7 A;  6GSU A;  2WZ9 A;  1ERT A;  5DAL A;  2YOI A;  1XWA A;  3PGT A;  4F03 A;  2E0Q A;  1OAZ A;  2EC4 A;  1K0M A;  5CRG A;  1ILO A;  2KUC A;  4G9H A;  4FYC A;  1F6M C;  5ELA A;  3UVT A;  4IP6 A;  4GXZ A;  2O89 A;  4N0V A;  3KTL A;  3KP9 A;  2H1D A;  3KH7 A;  4HQZ A;  1U87 A;  2M80 A;  1JHB A;  4WF5 A;  3DVW A;  3Q18 A;  4XS1 A;  4IP1 A;  1OC9 B;  1V40 A;  2CAI A;  5IOX A;  1X5D A;  1EP7 A;  3H8Q A;  2VD0 A;  4V2M A;  3J7Y b;  1YZX A;  5DCH A;  1G6W A;  4PQH A;  3ZZX A;  4ECC A;  3HCZ A;  1GNW A;  3ZL5 A;  2K6V A;  1J9B A;  1SKR B;  2R4V A;  3TCO A;  3WD6 A;  3FHK A;  3L9V A;  4WBJ A;  2I81 A;  4HU7 A;  4EF0 A;  2RLI A;  3GUR A;  3O3T A;  5E4W A;  5FWG A;  1ZL9 A;  3RAZ A;  3RBT A;  1DUG A;  1VF4 A;  3GTU A;  4TR4 A;  3WGE A;  2H6X A;  2NPB A;  3TKS A;  4F2I A;  4ZBA A;  2AAW A;  2PU9 C;  5IO0 A;  1VGL A;  3IK9 A;  3TB2 A;  3FZ9 A;  3NOF A;  3O6T A;  2WS2 A;  2HRK A;  1O7U A;  3ZIT A;  3KMO A;  4ZL7 A;  1M9A A;  1VF1 A;  4V1A p;  2YPM A;  4KH7 A;  1YF1 A;  3ZMK A;  4FQU A;  4CW9 A;  2L4Q A;  3LGC A;  1GTI A;  4DVC A;  2FNO A;  5C00 A;  1BX9 A;  1YEX A;  3UIW A;  2N5F A;  4F0B A;  2VCT A;  2P5Q A;  3VI5 A;  4OO4 A;  2JL4 A;  3FZ4 A;  1GUM A;  2NTO A;  3EWL A;  4K6X A;  2O7K A;  4K7N A;  5D9W A;  2H19 A;  1N2A A;  1ST9 A;  2GVP A;  4OMV A;  2GLR A;  1E6B A;  1GNE A;  2I3Y A;  3BCI A;  4MJC A;  4GQC A;  2KP2 A;  2QSI A;  3ZML A;  4G10 A;  2LJK A;  2LNS A;  3WGX A;  4NMU A;  4K0N A;  4TR1 B;  1QK8 A;  1TRV A;  1SD9 A;  3GL3 A;  4D73 B;  5DJL A;  5HR3 A;  2H76 A;  1JLW A;  1USB A;  2AB6 A;  4TKY A;  4PQI A;  3QAW A;  3CMI A;  4OCE A;  4ZB6 A;  3D4M A;  4E8E A;  3CXG A;  4LL4 B;  4MF6 A;  1OC9 A;  3LQ7 A;  1AQV A;  3WYW A;  3GKX A;  4H86 A;  4JU5 A;  1GSF A;  4TR0 A;  3HHV A;  2C0D A;  2I9H A;  5GAP D;  1SEN A;  2DJ3 A;  2KP1 A;  3FZA A;  2HZE B;  3AY8 A;  2WGR A;  1UA5 A;  4ULX A;  3TJK A;  2QKE A;  1TI3 A;  2FWG A;  2GST A;  1WOU A;  1JZW A;  3BOA A;  2KLX A;  5FT3 A;  3DIE A;  1B4P A;  4OD7 A;  4TR3 A;  5ECN B;  3I43 A;  1HQO A;  4NV5 A;  4POM A;  2HRF A;  4EO3 A;  2R6K A;  5G1K A;  2OJL A;  2BMX A;  1QXH A;  4I8B A;  4KA0 A;  1TK0 B;  2GSQ A;  3RPN A;  4Q5F A;  4GWR A;  4POB A;  4XRD A;  3EC3 A;  5CRH A;  1OKT A;  3FYG A;  3WT2 A;  4HOJ A;  1ON4 A;  1I5G A;  1THO A;  4O5R A;  5CRD A;  2HSY A;  2MBT A;  2OA7 A;  4X43 A;  4J2F A;  3L9S A;  1A8L A;  2H71 A;  1PX7 A;  3ZFB A;  1AXD A;  3LYK A;  1GWC A;  1TRS A;  3GV1 A;  1MDK A;  2VOC A;  4JZQ A;  3QAG A;  4KND A;  4I2T A;  4IJ3 A;  4MJB A;  3Q6O A;  5KN1 A;  3Q74 A;  2GSS A;  2JAC A;  5E59 A;  4F9Z A;  3HZ8 A;  4G2E A;  1K0D A;  1DBY A;  2GQK A;  1TRW A;  3RPP A;  1Z3E A;  3HD5 A;  1Q98 A;  2RUE A;  3F3Q A;  3C71 A;  1GH2 A;  5AIV A;  2VL2 A;  8GSS A;  3IAS 2;  1PSQ A;  4EC0 A;  2WB9 A;  2BTO T;  4IW9 A;  4Q5Q A;  3G7I A;  3IRA A;  3F3R A;  4MK3 A;  1Z7R A;  3BCK A;  4ZB8 A;  5HFI A;  1MD3 A;  4E8H A;  2AV4 A;  2VUP A;  4TR1 A;  4G0I A;  4HQS A;  4ID0 A;  1F37 A;  1EZK A;  2CV4 A;  5HR2 A;  2C8U A;  2AUV A;  3KH9 A;  4V2N A;  1S3C A;  4HDE A;  1G7E A;  1S3A A;  3UBL A;  3FKF A;  2P0G A;  1YEP A;  1XWK A;  4ZIL A;  4JR4 A;  5B7C A;  1K3L A;  2C3Q A;  3J7Y k;  3UMA A;  4G0K A;  3MWH A;  4IHU A;  2HZE A;  3G7J A;  5ECI B;  1YKA A;  2ZCT A;  4XS6 A;  3RDW A;  2FWE A;  3EU4 A;  4KCE A;  3TJF A;  3EE2 A;  1PMT A;  2OE1 A;  5B8A A;  2YZH A;  22GS A;  3QCP A;  5KN3 A;  4BVX B;  2GZY A;  1EEJ A;  1FO5 A;  4MAB A;  4DSR A;  3F4S A;  13GS A;  2YP6 A;  4QL7 A;  1CQH A;  3GA4 A;  1Z9H A;  2DJK A;  2L6C A;  1TW9 A;  4TOP A;  1SD8 A;  1K0O A;  1V58 A;  3VWW A;  3QPM A;  2L57 A;  5H5S A;  2H1G A;  1NM3 A;  2H0G A;  4JR6 A;  1GUH A;  3FR9 A;  3IXR A;  3W6G A;  4PGT A;  1NSW A;  4PNF A;  4EUY A;  4NPB A;  2GTU A;  2HYX A;  4X1U A;  2FWH A;  3OR5 A;  4GRF A;  1BAY A;  3QMX A;  2XPE A;  4IEL A;  1T7P B;  4WET A;  2YWM A;  3FR3 A;  3L0H A;  3HVS A;  3EMX A;  2HSN B;  1EGR A;  2RM6 A;  3BJ5 A;  5HQP A;  2H01 A;  2ZNM A;  1YQ1 A;  1Z6M A;  5GAN D;  1O6J A;  2H70 A;  1K3Y A;  3C73 A;  3F9U A;  9GSS A;  1M0U A;  1ERV A;  1T4Z A;  1DE1 A;  4IQ1 A;  3DVX A;  4K7O A;  4HUA A;  1B9X C;  3UAP A;  2JSZ A;  1FB6 A;  5KN0 A;  3IE3 A;  2R2J A;  2CVD A;  2HRK B;  3H4K A;  4MA9 A;  5CYY A;  5F8B A;  3PPU A;  2R3X A;  4EDZ A;  4I2U A;  4J56 E;  4KCA A;  3ZVJ A;  1CQG A;  2IMD A;  2WRT A;  1FW1 A;  3TUE A;  2MMO A;  1J0F A;  2LJA A;  3KM6 A;  2Z9S A;  11GS A;  1T8E B;  2IN3 A;  3TJG A;  1A0F A;  1H75 A;  2I1U A;  4TXV A;  6GST A;  4ZBB A;  5ENU A;  2HXK A;  2VM1 A;  4OFT A;  1T1V A;  3N9J A;  3KIJ A;  2K8V A;  5G30 A;  2OBI A;  1GUK A;  4EKZ A;  5A4U A;  5AIX A;  4LA1 A;  4CDO A;  2QC7 A;  2VL3 A;  3R2Q A;  2OE0 A;  2H6Y A;  4BVY B;  3NZN A;  5J9B A;  1EP8 A;  1W4V A;  1WRY A;  4AJ7 A;  4KDX A;  2LST A;  2FA8 A;  19GS A;  2IWT A;  1GLQ A;  1O8X A;  4O7H A;  4OFN A;  3NIV A;  4KX4 A;  3W8J A;  5IOW A;  1MDI A;  1ZCP A;  1SU9 A;  4L8E A;  2F3M A;  5D8I A;  2GT6 A;  1JFU A;  1TI1 A;  3GN3 A;  2JAD A;  3VLN A;  2N5B A;  2QGV A;  4RI6 A;  4G0L A;  5JCG A;  2PVO C;  1T4Y A;  18GS A;  2KHP A;  1XBS A;  5H5R A;  4KSO A;  4BL7 A;  3L78 A;  4KDY A;  1M9B A;  4PUA A;  1GSS A;  3E3E A;  2XBQ A;  4BWQ A;  4L5O A;  5ID2 B;  20GS A;  4FYB A;  1AAZ A;  2E7P A;  2YJH A;  1TDI A;  2C0F A;  4L0W A;  3D21 A;  2HRA A;  2WUL A;  3KZQ A;  1AQX A;  3TJJ A;  3I6A A;  4JED A;  3FY7 A;  2BJX A;  5D96 A;  3GRX A;  3IR4 A;  4MCU A;  2TRX A;  3N5O A;  3CYN A;  3PH9 A;  1DE2 A;  3F6F A;  3TRQ A;  2PBJ A;  4AJ6 A;  2LTK A;  4MJA A;  3VK9 A;  1A23 A;  4MH2 A;  1O73 A;  1KEB A;  5INY A;  3W8S A;  2LQQ A;  4GQF A;  3A3T A;  2ZUP A;  4WBR D;  4KUN A;  4GSS A;  3IC8 A;  5J3R A;  4K8M A;  5COH A;  5F06 A;  3EVI A;  1J08 A;  3EU3 A;  1PL1 A;  1XCC A;  1XWB A;  5JCW A;  2OAC A;  3L9U A;  3H79 A;  4DSS B;  1PA3 A;  2H66 A;  4JRR A;  2DLX A;  1K0B A;  2C0E A;  3P8W A;  3KCM A;  2F51 A;  1C72 A;  2C4J A;  1V57 A;  4GCI A;  16GS A;  2HQT A;  2MMN A;  1ML6 A;  3IDV A;  4EVM A;  4BVY A;  1WMJ A;  5A4W A;  2VAF A;  1MD4 A;  4PQ1 A;  5G31 A;  4PTS A;  1K0A A;  3KEB A;  2DIY A;  3HDC A;  4L5L A;  3IAM 2;  3HZ4 A;  5ECH B;  1BED A;  2CX3 A;  2NVL A;  3O76 A;  2HNL A;  3LWA A;  4BPY A;  4TW5 A;  2IMF A;  3GKM A;  1YDK A;  4HZ4 A;  3ZLP A;  5JWO B;  2EIO A;  4PNG A;  3HJP A;  1M2A A;  4FYU A;  1HNC A;  3VI7 A;  2NBS A;  4ZIJ A;  1S3D A;  1UN2 A;  2CT6 A;  2MZC A;  2KOK A;  2M46 A;  4WR5 A;  3M9K A;  2YWO A;  3CRU A;  1OC3 A;  1OVN A;  2YAN A;  1ABA A;  1FVK A;  5ID2 A;  1UVZ A;  2GT5 A;  4XIH A;  5ECK B;  3DEX A;  2FWF A;  3TJB A;  2VD1 A;  2X99 A;  1RQM A;  3IOS A;  4KF9 A;  3ME8 A;  1GSE A;  1Z5Y E;  5D73 A;  1A0R P;  1B4Q A;  3TKQ A;  4GSN A;  1TP9 A;  5CO3 A;  4MLY A;  1UC7 A;  1XW9 A;  1G0T A;  2B3S A;  4RQX A;  3A2V A;  1WPI A;  2DJ1 A;  5IPG A;  6GSW A;  4O32 A;  2GZZ A;  2YCD A;  4RI7 A;  3UAR A;  4PUF C;  5IMZ A;  3VWV A;  4OO5 A;  4WKW A;  1XVQ A;  1XFL A;  3DYR A;  2B7J A;  3F6D A;  2H72 A;  2YWI A;  5B8B A;  4EDY A;  4MPG A;  2FHE A;  3FR6 A;  1SL0 B;  1EWX A;  2H0I A;  2MBS A;  4DSS A;  1G6Y A;  3VPQ A;  3HJO A;  3M0F A;  4KSM A;  2H0H A;  1SL1 B;  2B5X A;  1OE8 A;  2LRT A;  4HS1 A;  1IYI A;  2JZT A;  1A24 A;  3HKR A;  5D9X A;  4AF2 A;  5IPH A;  2IL3 A;  2CA8 A;  4KGI A;  5IMV A;  3V1W A;  4GF0 A;  2VM2 A;  2X8C A;  5F05 A;  1I9D A;  3APS A;  3DXB A;  1MDJ A;  1E2Y A;  2VIM A;  4MP4 A;  2DJ2 A;  4MZC A;  2B1L A;  2HT9 A;  1AC1 A;  3A2X A;  2H1A A;  2OE3 A;  2CZ2 A;  1DSB A;  1TU7 A;  2HI7 A;  1F2E A;  5JWQ B;  1O81 A;  2R5G A;  1BJX A;  3LJR A;  3C1R A;  2H30 A;  3GFK A;  1QGV A;  5IQY A;  3KP8 A;  4RUV A;  5IM9 A;  2JU5 A;  4AGS A;  1U88 A;  6GSV A;  5DDL A;  14GS A;  1N8J A;  5EL8 A;  1GP1 A;  5IIZ A;  1SJ6 A;  4FIW A;  3H93 A;  2YWN A;  5EPF A;  3EYT A;  3MAK A;  3QAV A;  1R4W A;  2F9S A;  3US3 A;  1ZYE A;  2FGX A;  1X9M B;  5ECS A;  2L5L A;  2K18 A;  2X8H A;  3E0U A;  3LXT A;  3LG6 A;  3KD0 A;  2RUF A;  1A8Y A;  4XS4 A;  3D4T A;  4POK A;  4YQU A;  1XIY A;  1RW1 A;  2PUK C;  1M2B A;  5DVB A;  4N11 A;  3QDN A;  2CAQ A;  4YAV A;  2RII A;  3S9F A;  1B9Y C;  3P2A A;  3MDK A;  4ZL8 A;  4IBP A;  4HZ2 A;  3G9B A;  2P5R A;  1O8W A;  3BD2 A;  4NHZ A;  3BBY A;  4MF7 A;  2K8S A;  5IMC A;  2ON7 A;  1YF0 A;  1LJR A;  4KAE A;  1URM A;  4NHW A;  5EVO A;  3APQ A;  3DML A;  3GST A;  4EE0 A;  2ES7 A;  3SWL A;  1SJZ A;  2GZP A;  2AHE A;  4WR4 A;  4OWY A;  5GZZ B;  2OBK A;  2C3T A;  3D0Z A;  3F63 A;  1Y25 A;  4TXO A;  2VCQ A;  5ELG A;  2IJY A;  4BL7 B;  2NDO A;  3ZFL A;  3ERF A;  4GTU A;  4ACS A;  1V2A A;  5ECQ B;  3ISO A;  2AJQ B;  2GS3 A;  4MZW A;  3F0I A;  4MPF A;  4Z7X A;  4J57 E;  4MJE A;  1KBN A;  1Z7P A;  2LKU A;  1BQ7 A;  5KN2 A;  4USS A;  4ISD A;  2VL2 C;  3CSI A;  2ALB A;  3D6I A;  3KGK A;  4K9Z A;  3LSZ A;  4ZXG A;  2B7K A;  2GSR A;  3PR8 A;  3JCM L;  1HNA A;  4LMV A;  5IMF A;  4OFM A;  4IKH A;  2E2G A;  5J5N A;  2X64 A;  2PWJ A;  4TN8 A;  1GTU A;  3DKS A;  2TRC P;  2L6D A;  1OKD A;  2LQO A;  3RHB A;  4HEA 2;  4XCS A;  2WCI A;  1LU4 A;  5CRE A;  3HVX A;  1K0N A;  1WP0 A;  3LOR A;  7GSS A;  3GYK A;  5HFK A;  3ERG A;  4K7I A;  2H6Z A;  2XHF A;  3GKN A;  1FG4 A;  2H75 A;  2H73 A;  1ACV A;  4Q5R A;  5ECM B;  3CRT A;  3EIN A;  3MSZ A;  5LNK e;  1SYX A;  3TKS E;  4BWS A;  1QFN A;  5IO2 A;  3FEU A;  1PN9 A;  3VPT A;  1JZO A;  2LEG A;  1NHY A;  2M72 A;  1GLP A;  1XWC A;  2V32 A;  2HRN A;  4NAX A;  5ECP B;  4GLT A;  4CHS A;  2V2G A;  5AGY A;  1EV9 A;  2YNX A;  1K0C A;  2A2S A;  3M1G A;  1M7T A;  1AQW A;  1NHO A;  12GS A;  3QOU A;  4K1F A;  1SK0 A;  4JE1 A;  3ZTL A;  1BG5 A;  2V41 A;  1PQN A;  2IMI A;  1OC8 A;  3F8U A;  4JBB A;  4V2L A;  1ZYQ B;  5L71 A;  2C1Y A;  1VRS D;  3GUS A;  2P31 A;  3UVH A;  3KXO A;  4HI7 A;  1A2L A;  2H74 A;  2ON5 A;  1ZOF A;  3P90 A;  2DJ0 A;  5D9V A;  1O85 A;  3CBU A;  3DWV A;  2MYG A;  3CTF A;  1T00 A;  1V9W A;  1ERW A;  1PL2 A;  1XW6 A;  5DBQ A;  1KNG A;  2C3N A;  1TTZ A;  1PX6 A;  1FVJ A;  2GQM A;  1QQ2 A;  2HE3 A;  2VO4 A;  5JCU A;  2DBC A;  2PER A;  2FY6 A;  4LL1 B;  4AJ8 A;  1M2D A;  4NV2 A;  3UEM A;  2R37 A;  3D22 A;  2VLV A;  3GMF A;  3HVV A;  2O8V B;  1TKD B;  3EMP A;  1WJK A;  1EOG A;  3WT1 A;  2A4V A;  2V6K A;  1THX A;  2I4A A;  5GSS A;  1XOA A;  5ECR B;  3ERW A;  1WWJ A;  4NWY A;  1FAA A;  1SKW B;  5CAX A; 
#chains in the Genus database with same CATH topology
 2HLS A;  3C8E A;  2EIQ A;  3A2W A;  2YJ7 A;  3GX8 A;  1YJ6 A;  3VUR A;  4YH2 A;  3LW9 A;  2G2Q A;  2FUG 2;  5GST A;  1GL8 A;  3EUR A;  4DSQ A;  1OYJ A;  2LNT A;  4X0X A;  2OKA A;  4IS0 A;  6GSS A;  1K3O A;  5DQS A;  5LD0 A;  4I6X A;  4CY8 A;  1W89 A;  2O36 A;  3E9J B;  1SKS B;  1IYH A;  5B6N A;  4MH3 A;  1SK1 A;  1PRX A;  2CVB A;  1AIU A;  2IFQ B;  4F0C A;  3ED3 A;  1Y6E A;  2GQL A;  2YZU A;  4ZBD A;  4GST A;  1EV4 A;  1QUW A;  3F4T A;  1GRX A;  4K2D A;  3HJM A;  2HSM A;  4ILF A;  1GTA A;  3HY2 A;  1XPV A;  2FCH A;  3MNG A;  2G0F A;  2CZ3 A;  1BYE A;  2DSA A;  2PN8 A;  1JZR A;  1FB0 A;  4FH8 A;  4N30 A;  2J23 A;  2L5O A;  1VF3 A;  5F0G A;  3QFA C;  1ERU A;  1GUL A;  10GS A;  2HFD A;  1WE0 A;  5IMD A;  4XRA A;  5ECO B;  3TKP A;  1LBK A;  2LV3 A;  5G5F A;  1U3A A;  3K8N A;  1WIK A;  3SBC A;  3PIN A;  3HYP A;  3MIX A;  3DD3 A;  2XC2 A;  1HD2 A;  5J4V A;  4L0U A;  3M8N A;  2X8G A;  2B1K A;  2O85 A;  2B6M A;  2HSH A;  3UBK A;  5J9C A;  1H4O A;  4OCF A;  4XS4 B;  3A5W A;  3TKR A;  1SJI A;  1V98 A;  1VF2 A;  4ZL9 A;  3M9J A;  1QMV A;  5A5K A;  1GSY A;  1MEK A;  3KTB A;  1SK2 A;  4QL9 A;  1PKZ A;  3LEF A;  3TKS C;  5JWR B;  5LCZ A;  2GGT A;  1FOV A;  2VL9 A;  5G1L A;  4HU9 A;  2CVK A;  3I69 A;  5D9T A;  5CNW A;  3DGQ A;  3IHQ A;  2DML A;  5F07 A;  3GNJ A;  3HA9 A;  3C7M A;  3ZIV A;  4PXO A;  2IPA A;  2H8L A;  3GX0 A;  3CSH A;  2B5Y A;  5EY6 A;  3F4R A;  4ML6 A;  3LYP A;  4O5U A;  3ZIJ A;  4TXO B;  2C80 A;  1KTE A;  3KMN A;  1TJD A;  3UJ1 A;  1ZMA A;  3DRN A;  4FO5 A;  4WXT A;  4QQ7 A;  1XXU A;  2WVY A;  4MF5 A;  2PPT A;  2UV8 G;  1Z6N A;  1PKW A;  4KB3 A;  5J40 A;  2HZF A;  2UZ8 A;  1XW5 A;  4RQR A;  2DJJ A;  1R26 A;  1GSD A;  2J9H A;  1XWG A;  4YQM A;  5BMU B;  3VFI A;  2IFQ A;  4K0G A;  3P7X A;  1ZGN A;  1F9M A;  4YAP A;  5DQY A;  1ZZY A;  3GSS A;  2H1B A;  3IV4 A;  4I97 A;  2IME A;  1NW2 A;  3FRC A;  2O87 A;  3U5R E;  4YQV A;  4IQA A;  2V1M A;  2PVQ A;  3TOU A;  4ECI A;  3ME7 A;  2DC5 A;  2JZS A;  3C1S A;  5DAK B;  4N0Z A;  2LJR A;  4Q5N A;  3IPZ A;  2CQ9 A;  1TXX A;  5DCG A;  2YN1 A;  5G2Z A;  2IMK A;  3TOT A;  2X4A A;  3TRP A;  2WDU A;  2TIR A;  2N5A A;  3APO A;  1X5E A;  5ABR A;  5CP1 A;  2L4C A;  1RK4 A;  3ZRE A;  6GSX A;  3HXS A;  4MZB A;  3GH9 A;  2E2M A;  2DIZ A;  4P3Y B;  4D73 A;  3FMW A;  1U3I A;  2LRC A;  4TRX A;  1B48 A;  1JZD A;  4IVF A;  1B8X A;  5HR0 A;  2FLS A;  4ZB9 A;  3UL3 A;  1R5P A;  1YEW C;  4EXJ A;  4POL A;  2A4H A;  2PMT A;  2F8A A;  2FA4 A;  2FD3 A;  2A2R A;  5IMA A;  1HNB A;  5HFG A;  2VCX A;  2VCV A;  1JLV A;  4BA7 A;  3IBH A;  2K9F A;  2XBI A;  3CTG A;  5DJM A;  2GDR A;  2CX4 A;  2PGT A;  1XZO A;  3Q19 A;  1EEM A;  2EFD A;  3GHA A;  1GTB A;  1TK8 B;  4KE3 A;  1XOB A;  1ZYP A;  4N3Z A;  1HYU A;  1A2M A;  1EOH A;  4IGJ A;  2VKZ G;  4N10 A;  4KW6 A;  3LFL A;  4ML1 A;  3FK8 A;  3QR6 A;  2VCZ A;  1FHE A;  1X9S B;  4WF4 A;  2YV9 A;  2WW3 A;  5DAL B;  1TRU A;  3IK7 A;  3I9V 2;  2VLT A;  4LLR A;  4PX1 A;  2B5E A;  3KJY A;  5H5Q A;  4MDC A;  3GH6 A;  2XPD A;  4HJM A;  1F3A A;  1TOF A;  3GKK A;  2D2Z A;  4TVE A;  2IIY A;  1AW9 A;  4V1A g;  3G7Y A;  2WJU A;  3L4N A;  2VLU A;  1OE7 A;  5AIS A;  2LS5 A;  5HR1 A;  3QD9 A;  4IJI A;  2RM5 A;  2YV7 A;  5J41 A;  5A1N B;  1G7O A;  2VCW A;  1XG8 A;  2LUS A;  1R5A A;  3TGZ A;  4NXI A;  3H1N A;  4LMW A;  5J4Y A;  5BMU A;  1GSU A;  4I5Q A;  3FZ5 A;  4XHM A;  4F82 A;  3IC4 A;  3WGD A;  4WEY A;  5G5E A;  2X49 A;  3VWU A;  4HJ2 A;  4G19 A;  5AN1 A;  3U6V A;  1YKC A;  5CRW A;  5D93 A;  1AUC A;  3ZVJ D;  3IA1 A;  5KEJ A;  3M3M A;  3ZYW A;  5ECL B;  5DAK A;  2DMM A;  3QFB C;  2EIR A;  3VWX A;  3TDG A;  3TRX A;  3UOM A;  4MMM A;  4AKH A;  1X0R A;  3RHC A;  1M99 A;  2EFC A;  2WW2 A;  2V6O A;  3GTU B;  2LRN A;  4ECJ A;  1S4B P;  4EL1 A;  4XTS A;  1S3R A;  3D5J A;  4AKI A;  1T3B A;  3FW2 A;  1X5C A;  4AI6 A;  1F3B A;  1TK5 B;  4K5R A;  5J4U A;  5B6M A;  4ECB A;  2C0G A;  2MMZ A;  1EGO A;  1TU8 A;  1GSQ A;  1R7H A;  2JZR A;  1U6T A;  1PGT A;  3CSJ A;  6GSY A;  4PUR A;  2JSY A;  4O92 A;  3GL5 A;  4DEJ A;  3GIX A;  3R3E A;  1A2J A;  1SYR A;  1SL2 B;  5C04 A;  2WFC A;  2HSM B;  2L59 A;  1XVW A;  1MTC A;  4IN0 A;  1X9W B;  17GS A;  2OAD A;  3LXZ A;  4BVX A;  5A4V A;  2REM A;  2AYT A;  3ZRD A;  4KDU A;  1Q4J A;  2MMA A;  5FHI A;  4Z2T A;  1PN0 A;  2F8F A;  1PD2 1;  1YY7 A;  6GSU A;  2WZ9 A;  1ERT A;  5DAL A;  2YOI A;  1XWA A;  3PGT A;  4F03 A;  2E0Q A;  1OAZ A;  2EC4 A;  1K0M A;  5CRG A;  1ILO A;  2KUC A;  3CWG A;  4G9H A;  4FYC A;  1F6M C;  5ELA A;  3UVT A;  4IP6 A;  4GXZ A;  2O89 A;  4N0V A;  3KTL A;  3KP9 A;  2H1D A;  3KH7 A;  2O3E A;  4HQZ A;  1U87 A;  2M80 A;  1JHB A;  4WF5 A;  4A5P A;  3DVW A;  3Q18 A;  4XS1 A;  4IP1 A;  1OC9 B;  5A1N A;  1V40 A;  2WW0 A;  2CAI A;  5IOX A;  1X5D A;  1EP7 A;  3H8Q A;  2VD0 A;  4V2M A;  3J7Y b;  1YZX A;  5DCH A;  1G6W A;  4PQH A;  3ZZX A;  4ECC A;  3HCZ A;  1GNW A;  3ZL5 A;  2K6V A;  1J9B A;  1SKR B;  2R4V A;  3TCO A;  3WD6 A;  3FHK A;  3L9V A;  4WBJ A;  2I81 A;  4HU7 A;  4EF0 A;  2RLI A;  3GUR A;  4AKG A;  3O3T A;  5E4W A;  5FWG A;  1ZL9 A;  3RAZ A;  3RBT A;  1DUG A;  1VF4 A;  3GTU A;  4TR4 A;  3WGE A;  2H6X A;  2NPB A;  3TKS A;  4F2I A;  4ZBA A;  2AAW A;  2PU9 C;  5IO0 A;  1VGL A;  3IK9 A;  3TB2 A;  3FZ9 A;  3NOF A;  3O6T A;  2WS2 A;  2HRK A;  3CHX C;  1O7U A;  3ZIT A;  3KMO A;  4ZL7 A;  1M9A A;  1VF1 A;  4V1A p;  2YPM A;  4EIP A;  2WZS A;  1FOH A;  4KH7 A;  1YF1 A;  3ZMK A;  4FQU A;  4CW9 A;  2L4Q A;  3LGC A;  5J47 A;  1GTI A;  4DVC A;  2FNO A;  5C00 A;  2WVZ A;  1BX9 A;  1YEX A;  3UIW A;  2N5F A;  4F0B A;  2VCT A;  2P5Q A;  4YKG A;  3VI5 A;  4OO4 A;  2JL4 A;  3FZ4 A;  1GUM A;  2NTO A;  3EWL A;  4K6X A;  2O7K A;  4K7N A;  5D9W A;  2H19 A;  1N2A A;  1ST9 A;  2GVP A;  4OMV A;  2GLR A;  1E6B A;  1GNE A;  2I3Y A;  3BCI A;  4MJC A;  4GQC A;  2KP2 A;  2QSI A;  3ZML A;  4G10 A;  2LJK A;  2LNS A;  3WGX A;  4NMU A;  4K0N A;  4TR1 B;  1QK8 A;  1TRV A;  1SD9 A;  3GL3 A;  4D73 B;  5DJL A;  5HR3 A;  2H76 A;  1JLW A;  3IHG A;  1USB A;  2AB6 A;  4TKY A;  4PQI A;  3QAW A;  3CMI A;  4OCE A;  4ZB6 A;  3D4M A;  4E8E A;  3CXG A;  1ZYN A;  5A34 A;  4MF6 A;  4LL4 B;  1OC9 A;  3LQ7 A;  1AQV A;  3WYW A;  3GKX A;  4H86 A;  4JU5 A;  1GSF A;  4TR0 A;  3HHV A;  2C0D A;  2I9H A;  5GAP D;  1SEN A;  2DJ3 A;  2KP1 A;  3FZA A;  2HZE B;  3AY8 A;  2WGR A;  1UA5 A;  4ULX A;  3TJK A;  1Y1U A;  2QKE A;  1TI3 A;  2FWG A;  2GST A;  1WOU A;  1JZW A;  4CY6 A;  3BOA A;  2KLX A;  5FT3 A;  3DIE A;  1B4P A;  4OD7 A;  4TR3 A;  5ECN B;  3I43 A;  1HQO A;  4NV5 A;  4POM A;  2HRF A;  4EO3 A;  2R6K A;  5G1K A;  2OJL A;  2BMX A;  1QXH A;  4I8B A;  4KA0 A;  4BIK A;  1TK0 B;  5A5H A;  2GSQ A;  3RPN A;  4Q5F A;  4GWR A;  4POB A;  4XRD A;  3EC3 A;  5CRH A;  1OKT A;  3FYG A;  3WT2 A;  4HOJ A;  1ON4 A;  1I5G A;  1THO A;  4O5R A;  5CRD A;  2HSY A;  2H1L A;  2WVX A;  2MBT A;  2OA7 A;  4X43 A;  4J2F A;  3L9S A;  1A8L A;  2H71 A;  1PX7 A;  3ZFB A;  1AXD A;  3LYK A;  1GWC A;  1TRS A;  3GV1 A;  1MDK A;  2VOC A;  4JZQ A;  3QAG A;  4KND A;  4I2T A;  4IJ3 A;  4MJB A;  3Q6O A;  3A5I A;  5KN1 A;  3Q74 A;  2GSS A;  2JAC A;  5E59 A;  4F9Z A;  3HZ8 A;  2QA1 A;  4G2E A;  4PI2 C;  1K0D A;  1DBY A;  2GQK A;  1TRW A;  4X4J A;  3RPP A;  1Z3E A;  3HD5 A;  1Q98 A;  2RUE A;  3F3Q A;  3C71 A;  1GH2 A;  5AIV A;  2VL2 A;  8GSS A;  3IAS 2;  1PSQ A;  4EC0 A;  2WB9 A;  2BTO T;  4IW9 A;  3IRA A;  4Q5Q A;  3G7I A;  3F3R A;  4QMK A;  4MK3 A;  1Z7R A;  3BCK A;  4ZB8 A;  5HFI A;  1MD3 A;  4E8H A;  2AV4 A;  2VUP A;  4TR1 A;  4G0I A;  4HQS A;  4ID0 A;  1F37 A;  1EZK A;  2A2P A;  2CV4 A;  5HR2 A;  2C8U A;  2AUV A;  3KH9 A;  4V2N A;  1S3C A;  4HDE A;  1G7E A;  1S3A A;  3UBL A;  3FKF A;  2P0G A;  1YEP A;  1XWK A;  4ZIL A;  4JR4 A;  5B7C A;  1K3L A;  2C3Q A;  2R0G A;  3J7Y k;  3UMA A;  4G0K A;  3MWH A;  4IHU A;  2HZE A;  3G7J A;  5ECI B;  1YKA A;  2ZCT A;  1TXU A;  4XS6 A;  2FWE A;  3RDW A;  3EU4 A;  4KCE A;  3TJF A;  1M3I A;  3EE2 A;  1PMT A;  2OE1 A;  5B8A A;  2YZH A;  22GS A;  3QCP A;  5KN3 A;  4BVX B;  2GZY A;  1EEJ A;  1FO5 A;  4MAB A;  4DSR A;  3F4S A;  13GS A;  2YP6 A;  4QL7 A;  1CQH A;  3GA4 A;  4O5Q A;  1Z9H A;  2DJK A;  2L6C A;  1TW9 A;  4TOP A;  1SD8 A;  1K0O A;  1SVL A;  1V58 A;  3VWW A;  3QPM A;  2L57 A;  5H5S A;  2H1G A;  1NM3 A;  2H0G A;  4JR6 A;  1GUH A;  4K5S A;  3FR9 A;  3IXR A;  3W6G A;  4PI0 C;  4PGT A;  1NSW A;  4PNF A;  4EUY A;  4NPB A;  2GTU A;  2HYX A;  4X1U A;  2FWH A;  3OR5 A;  4GRF A;  1BAY A;  3QMX A;  2XPE A;  4IEL A;  1T7P B;  4WET A;  2YWM A;  3FR3 A;  3L0H A;  3HVS A;  3EMX A;  2HSN B;  1EGR A;  2RM6 A;  3BJ5 A;  5HQP A;  2H01 A;  2ZNM A;  1YQ1 A;  1Z6M A;  5GAN D;  1O6J A;  2H70 A;  1K3Y A;  3C73 A;  3F9U A;  9GSS A;  1M0U A;  1ERV A;  1T4Z A;  1DE1 A;  4IQ1 A;  3DVX A;  4K7O A;  4HUA A;  1B9X C;  3UAP A;  2JSZ A;  1FB6 A;  5KN0 A;  3IE3 A;  2R2J A;  1BF5 A;  2CVD A;  2HRK B;  3H4K A;  4MA9 A;  5CYY A;  2O5V A;  5F8B A;  3PPU A;  2R3X A;  4EDZ A;  4I2U A;  4J56 E;  4KCA A;  3ZVJ A;  1CQG A;  2IMD A;  2WRT A;  1FW1 A;  2OT3 A;  3TUE A;  2MMO A;  1J0F A;  2LJA A;  3KM6 A;  2Z9S A;  11GS A;  1T8E B;  2IN3 A;  3TJG A;  1A0F A;  1H75 A;  2I1U A;  4TXV A;  6GST A;  4ZBB A;  5ENU A;  2HXK A;  2VM1 A;  4OFT A;  1T1V A;  3N9J A;  3KIJ A;  2K8V A;  5G30 A;  2OBI A;  1GUK A;  4EKZ A;  5A4U A;  5AIX A;  4LA1 A;  4CDO A;  2QC7 A;  2VL3 A;  3R2Q A;  2OE0 A;  2H6Y A;  4BVY B;  3NZN A;  5J9B A;  1EP8 A;  1W4V A;  1WRY A;  2EFE A;  1I1I P;  4AJ7 A;  4KDX A;  3HMJ G;  2LST A;  2FA8 A;  19GS A;  2IWT A;  1GLQ A;  1SVM A;  1O8X A;  2QA2 A;  4O7H A;  4OFN A;  3NIV A;  4KX4 A;  3W8J A;  5IOW A;  1MDI A;  1ZCP A;  1SU9 A;  4L8E A;  2F3M A;  5D8I A;  2GT6 A;  1JFU A;  1TI1 A;  3GN3 A;  2JAD A;  3VLN A;  2EFH A;  2N5B A;  2QGV A;  4RI6 A;  5A34 B;  4G0L A;  5JCG A;  2PVO C;  1T4Y A;  18GS A;  2KHP A;  1XBS A;  5H5R A;  4KSO A;  4BL7 A;  3L78 A;  4KDY A;  1M9B A;  4PUA A;  1GSS A;  3E3E A;  2XBQ A;  4BWQ A;  4L5O A;  5ID2 B;  20GS A;  4FYB A;  1AAZ A;  2E7P A;  2YJH A;  1TDI A;  2HSN A;  2C0F A;  4L0W A;  3D21 A;  2HRA A;  2WUL A;  3KZQ A;  1AQX A;  3TJJ A;  3I6A A;  4JED A;  3FY7 A;  2BJX A;  5D96 A;  3GRX A;  3IR4 A;  4MCU A;  2TRX A;  3N5O A;  3CYN A;  3PH9 A;  1DE2 A;  3F6F A;  3TRQ A;  2PBJ A;  4AJ6 A;  2LTK A;  4MJA A;  3VK9 A;  1A23 A;  4MH2 A;  2R0P A;  5A5H B;  1O73 A;  1KEB A;  2WW1 A;  5INY A;  3MYD A;  3W8S A;  2LQQ A;  2WVX B;  4GQF A;  3A3T A;  2ZUP A;  4WBR D;  4KUN A;  4GSS A;  3IC8 A;  5J3R A;  4K8M A;  3RFR C;  5COH A;  5F06 A;  3EVI A;  1J08 A;  3EU3 A;  1PL1 A;  1XCC A;  1XWB A;  5JCW A;  2OAC A;  3L9U A;  3H79 A;  4DSS B;  1PA3 A;  2H66 A;  4JRR A;  2DLX A;  1K0B A;  2C0E A;  3P8W A;  3KCM A;  2F51 A;  1C72 A;  4GDF A;  2C4J A;  1V57 A;  4GCI A;  16GS A;  2HQT A;  2MMN A;  1ML6 A;  3IDV A;  4EVM A;  4G01 A;  4BVY A;  1WMJ A;  5A4W A;  2VAF A;  1MD4 A;  4PQ1 A;  5G31 A;  3RGB C;  4PTS A;  1K0A A;  3KEB A;  2DIY A;  3HDC A;  4L5L A;  1N25 A;  3TU3 B;  3IAM 2;  3HZ4 A;  5ECH B;  1BED A;  2CX3 A;  2NVL A;  3O76 A;  2HNL A;  3LWA A;  4BPY A;  4TW5 A;  2IMF A;  3GKM A;  1YDK A;  4HZ4 A;  3ZLP A;  2R0C A;  5JWO B;  2EIO A;  4PNG A;  2DKH A;  3HJP A;  1M2A A;  4FYU A;  3HVN A;  1HNC A;  3VI7 A;  2NBS A;  4ZIJ A;  1S3D A;  1UN2 A;  2CT6 A;  2MZC A;  2KOK A;  2M46 A;  4WR5 A;  3M9K A;  2YWO A;  3CRU A;  4AKX B;  1OC3 A;  1OVN A;  2YAN A;  1ABA A;  1FVK A;  5ID2 A;  1UVZ A;  2GT5 A;  4XIH A;  5ECK B;  3DEX A;  2FWF A;  3TJB A;  2VD1 A;  2X99 A;  1RQM A;  3IOS A;  4KF9 A;  3ME8 A;  1GSE A;  1Z5Y E;  5D73 A;  1A0R P;  5BRT A;  1SVO A;  1B4Q A;  3TKQ A;  4GSN A;  1TP9 A;  5CO3 A;  4MLY A;  1UC7 A;  1XW9 A;  1G0T A;  2B3S A;  4RQX A;  3A2V A;  4ZB7 A;  1WPI A;  2DJ1 A;  5IPG A;  6GSW A;  4O32 A;  2GZZ A;  2YCD A;  4RI7 A;  3UAR A;  4PUF C;  5IMZ A;  3VWV A;  4OO5 A;  4WKW A;  1XVQ A;  1XFL A;  3DYR A;  2B7J A;  3F6D A;  2H72 A;  2YWI A;  5B8B A;  4EDY A;  4MPG A;  2FHE A;  3FR6 A;  1SL0 B;  1EWX A;  2H0I A;  2MBS A;  4DSS A;  1G6Y A;  3VPQ A;  3HJO A;  3M0F A;  4Z2R A;  4KSM A;  2H0H A;  1SL1 B;  2B5X A;  1OE8 A;  2LRT A;  4HS1 A;  1IYI A;  2JZT A;  1A24 A;  3HKR A;  1PFO A;  5KOW A;  5D9X A;  4AF2 A;  5IPH A;  2IL3 A;  2CA8 A;  4KGI A;  5IMV A;  3V1W A;  4GF0 A;  2VM2 A;  2X8C A;  5F05 A;  1I9D A;  3APS A;  3DXB A;  1MDJ A;  1E2Y A;  2VIM A;  4MP4 A;  2DJ2 A;  4MZC A;  2B1L A;  4Z2U A;  2HT9 A;  1AC1 A;  3A2X A;  2H1A A;  2OE3 A;  2CZ2 A;  1DSB A;  1TU7 A;  2HI7 A;  1F2E A;  5JWQ B;  1O81 A;  2R5G A;  1BJX A;  3LJR A;  3C1R A;  2H30 A;  3GFK A;  1QGV A;  5IQY A;  3KP8 A;  4RUV A;  5IM9 A;  2JU5 A;  4AGS A;  1U88 A;  4YKF A;  6GSV A;  5DDL A;  14GS A;  1N8J A;  5EL8 A;  1GP1 A;  5IIZ A;  1SJ6 A;  4FIW A;  3H93 A;  2YWN A;  5EPF A;  3EYT A;  3MAK A;  3QAV A;  4FXY P;  1R4W A;  2F9S A;  3US3 A;  1ZYE A;  2FGX A;  1X9M B;  5ECS A;  2L5L A;  2K18 A;  2X8H A;  3E0U A;  3LXT A;  3LG6 A;  1M3J A;  3KD0 A;  2RUF A;  1A8Y A;  4XS4 A;  3D4T A;  4POK A;  4YQU A;  1XIY A;  1RW1 A;  2PUK C;  3EPT A;  1M2B A;  5DVB A;  4N11 A;  3QDN A;  2CAQ A;  4YAV A;  2RII A;  3S9F A;  1B9Y C;  3P2A A;  3MDK A;  4ZL8 A;  4IBP A;  4HZ2 A;  3G9B A;  2P5R A;  1O8W A;  3BD2 A;  4NHZ A;  3BBY A;  4MF7 A;  2K8S A;  5IMC A;  2ON7 A;  1YF0 A;  1LJR A;  4KAE A;  1URM A;  4NHW A;  5EVO A;  3APQ A;  3DML A;  3GST A;  4EE0 A;  2ES7 A;  3SWL A;  1SJZ A;  2GZP A;  2AHE A;  4WR4 A;  4OWY A;  5GZZ B;  2OBK A;  2DKI A;  2C3T A;  3D0Z A;  3F63 A;  1Y25 A;  4TXO A;  4W66 A;  2VCQ A;  5ELG A;  2IJY A;  4BL7 B;  2NDO A;  3ZFL A;  3ERF A;  4GTU A;  4ACS A;  1YVL A;  1V2A A;  5ECQ B;  3ISO A;  2AJQ B;  2GS3 A;  4MZW A;  3F0I A;  4MPF A;  4Z7X A;  4J57 E;  4MJE A;  1KBN A;  1Z7P A;  2LKU A;  1BQ7 A;  4E68 A;  5KN2 A;  4USS A;  4ISD A;  2VL2 C;  3CSI A;  2ALB A;  3D6I A;  3KGK A;  4K9Z A;  3LSZ A;  4ZXG A;  2B7K A;  2GSR A;  3PR8 A;  3JCM L;  1HNA A;  4LMV A;  5IMF A;  4OFM A;  4IKH A;  5KOX A;  2E2G A;  4ICY A;  5J5N A;  3CQF A;  2X64 A;  2PWJ A;  4TN8 A;  1GTU A;  3DKS A;  2TRC P;  2L6D A;  1OKD A;  2LQO A;  3RHB A;  4HEA 2;  4XCS A;  2WCI A;  1LU4 A;  5CRE A;  3HVX A;  1K0N A;  1WP0 A;  3LOR A;  7GSS A;  3GYK A;  5HFK A;  3ERG A;  4K7I A;  2H6Z A;  2XHF A;  3GKN A;  1FG4 A;  2H75 A;  2H73 A;  1ACV A;  4Q5R A;  5ECM B;  3CRT A;  3EIN A;  3MSZ A;  5LNK e;  1SYX A;  3TKS E;  4BWS A;  1QFN A;  5IO2 A;  3FEU A;  1PN9 A;  3VPT A;  1JZO A;  2LEG A;  1NHY A;  2M72 A;  1GLP A;  1XWC A;  2V32 A;  2HRN A;  4NAX A;  5ECP B;  4GLT A;  4CHS A;  2V2G A;  5AGY A;  1EV9 A;  2YNX A;  1K0C A;  2A2S A;  3M1G A;  1M7T A;  1AQW A;  1NHO A;  12GS A;  3QOU A;  4K1F A;  1SK0 A;  4JE1 A;  3ZTL A;  1BG5 A;  2V41 A;  1PQN A;  2IMI A;  1OC8 A;  3F8U A;  4JBB A;  4V2L A;  1ZYQ B;  5L71 A;  2C1Y A;  1VRS D;  3GUS A;  2P31 A;  3UVH A;  3KXO A;  4K2X A;  4HI7 A;  1A2L A;  2H74 A;  2ON5 A;  1ZOF A;  3P90 A;  2DJ0 A;  5D9V A;  1O85 A;  3CBU A;  3DWV A;  2MYG A;  3CTF A;  1T00 A;  1V9W A;  1ERW A;  1PL2 A;  1XW6 A;  5DBQ A;  1KNG A;  2C3N A;  1TTZ A;  4HSC X;  1PX6 A;  1FVJ A;  2GQM A;  1QQ2 A;  2HE3 A;  2VO4 A;  5JCU A;  2DBC A;  2PER A;  2FY6 A;  4LL1 B;  1BG1 A;  4AJ8 A;  1M2D A;  4NV2 A;  3UEM A;  2R37 A;  3D22 A;  2VLV A;  4EIQ A;  3GMF A;  3HVV A;  4MNN A;  2O8V B;  1TKD B;  3EMP A;  1WJK A;  1EOG A;  3WT1 A;  2A4V A;  2V6K A;  4PHZ C;  1THX A;  2I4A A;  5GSS A;  1XOA A;  5ECR B;  3ERW A;  1WWJ A;  4NWY A;  1FAA A;  1SKW B;  5CAX A; 
#chains in the Genus database with same CATH homology
 2HLS A;  3C8E A;  2EIQ A;  3A2W A;  2YJ7 A;  3GX8 A;  1YJ6 A;  3VUR A;  4YH2 A;  3LW9 A;  2G2Q A;  2FUG 2;  5GST A;  1GL8 A;  3EUR A;  4DSQ A;  1OYJ A;  2LNT A;  4X0X A;  2OKA A;  4IS0 A;  6GSS A;  1K3O A;  5DQS A;  5LD0 A;  4I6X A;  4CY8 A;  1W89 A;  3E9J B;  1SKS B;  1IYH A;  5B6N A;  4MH3 A;  1SK1 A;  1PRX A;  2CVB A;  1AIU A;  2IFQ B;  4F0C A;  3ED3 A;  1Y6E A;  2GQL A;  2YZU A;  4ZBD A;  4GST A;  1EV4 A;  1QUW A;  3F4T A;  1GRX A;  4K2D A;  3HJM A;  2HSM A;  4ILF A;  1GTA A;  3HY2 A;  1XPV A;  2FCH A;  3MNG A;  2G0F A;  2CZ3 A;  1BYE A;  2DSA A;  2PN8 A;  1JZR A;  1FB0 A;  4FH8 A;  4N30 A;  2J23 A;  2L5O A;  1VF3 A;  5F0G A;  3QFA C;  1ERU A;  1GUL A;  10GS A;  2HFD A;  1WE0 A;  5IMD A;  4XRA A;  5ECO B;  3TKP A;  1LBK A;  2LV3 A;  5G5F A;  1U3A A;  3K8N A;  1WIK A;  3SBC A;  3PIN A;  3HYP A;  3MIX A;  3DD3 A;  2XC2 A;  1HD2 A;  5J4V A;  4L0U A;  3M8N A;  2X8G A;  2B1K A;  2O85 A;  2B6M A;  2HSH A;  3UBK A;  5J9C A;  1H4O A;  4OCF A;  4XS4 B;  3A5W A;  3TKR A;  1SJI A;  1V98 A;  1VF2 A;  4ZL9 A;  3M9J A;  1QMV A;  5A5K A;  1GSY A;  1MEK A;  3KTB A;  1SK2 A;  4QL9 A;  1PKZ A;  3LEF A;  3TKS C;  5JWR B;  5LCZ A;  2GGT A;  1FOV A;  2VL9 A;  5G1L A;  4HU9 A;  2CVK A;  3I69 A;  5D9T A;  5CNW A;  3DGQ A;  3IHQ A;  2DML A;  5F07 A;  3GNJ A;  3HA9 A;  3C7M A;  3ZIV A;  4PXO A;  2IPA A;  2H8L A;  3GX0 A;  3CSH A;  2B5Y A;  5EY6 A;  3F4R A;  4ML6 A;  3LYP A;  4O5U A;  3ZIJ A;  4TXO B;  2C80 A;  1KTE A;  3KMN A;  1TJD A;  3UJ1 A;  1ZMA A;  3DRN A;  4FO5 A;  4WXT A;  4QQ7 A;  1XXU A;  4MF5 A;  2PPT A;  2UV8 G;  1Z6N A;  1PKW A;  4KB3 A;  5J40 A;  2HZF A;  2UZ8 A;  1XW5 A;  4RQR A;  2DJJ A;  1R26 A;  1GSD A;  2J9H A;  1XWG A;  4YQM A;  5BMU B;  3VFI A;  2IFQ A;  4K0G A;  3P7X A;  1ZGN A;  1F9M A;  4YAP A;  5DQY A;  1ZZY A;  3GSS A;  2H1B A;  3IV4 A;  4I97 A;  2IME A;  1NW2 A;  3FRC A;  2O87 A;  3U5R E;  4YQV A;  4IQA A;  2V1M A;  2PVQ A;  3TOU A;  4ECI A;  3ME7 A;  2DC5 A;  2JZS A;  3C1S A;  5DAK B;  4N0Z A;  2LJR A;  4Q5N A;  3IPZ A;  2CQ9 A;  1TXX A;  5DCG A;  2YN1 A;  5G2Z A;  2IMK A;  3TOT A;  2X4A A;  3TRP A;  2WDU A;  2TIR A;  2N5A A;  3APO A;  1X5E A;  5ABR A;  5CP1 A;  2L4C A;  1RK4 A;  3ZRE A;  6GSX A;  3HXS A;  4MZB A;  3GH9 A;  2E2M A;  2DIZ A;  4P3Y B;  4D73 A;  3FMW A;  1U3I A;  2LRC A;  4TRX A;  1B48 A;  1JZD A;  4IVF A;  1B8X A;  5HR0 A;  2FLS A;  4ZB9 A;  3UL3 A;  1R5P A;  4EXJ A;  4POL A;  2A4H A;  2PMT A;  2F8A A;  2FA4 A;  2FD3 A;  2A2R A;  5IMA A;  1HNB A;  5HFG A;  2VCX A;  2VCV A;  1JLV A;  4BA7 A;  3IBH A;  2K9F A;  2XBI A;  3CTG A;  5DJM A;  2GDR A;  2CX4 A;  2PGT A;  1XZO A;  3Q19 A;  1EEM A;  2EFD A;  3GHA A;  1GTB A;  1TK8 B;  4KE3 A;  1XOB A;  1ZYP A;  4N3Z A;  1HYU A;  1A2M A;  1EOH A;  4IGJ A;  2VKZ G;  4N10 A;  4KW6 A;  3LFL A;  4ML1 A;  3FK8 A;  3QR6 A;  2VCZ A;  1FHE A;  1X9S B;  4WF4 A;  2YV9 A;  5DAL B;  1TRU A;  3IK7 A;  3I9V 2;  2VLT A;  4LLR A;  4PX1 A;  2B5E A;  3KJY A;  5H5Q A;  4MDC A;  3GH6 A;  2XPD A;  4HJM A;  1F3A A;  1TOF A;  3GKK A;  2D2Z A;  4TVE A;  2IIY A;  1AW9 A;  4V1A g;  3G7Y A;  2WJU A;  3L4N A;  2VLU A;  1OE7 A;  5AIS A;  2LS5 A;  5HR1 A;  3QD9 A;  4IJI A;  2RM5 A;  2YV7 A;  5J41 A;  5A1N B;  1G7O A;  2VCW A;  2LUS A;  1R5A A;  3TGZ A;  4NXI A;  3H1N A;  4LMW A;  5J4Y A;  5BMU A;  1GSU A;  4I5Q A;  3FZ5 A;  4XHM A;  4F82 A;  3IC4 A;  3WGD A;  4WEY A;  5G5E A;  2X49 A;  3VWU A;  4HJ2 A;  4G19 A;  5AN1 A;  3U6V A;  1YKC A;  5CRW A;  5D93 A;  1AUC A;  3ZVJ D;  3IA1 A;  5KEJ A;  3M3M A;  3ZYW A;  5ECL B;  5DAK A;  2DMM A;  3QFB C;  2EIR A;  3VWX A;  3TDG A;  3TRX A;  3UOM A;  4MMM A;  4AKH A;  1X0R A;  3RHC A;  1M99 A;  2EFC A;  2V6O A;  3GTU B;  2LRN A;  4ECJ A;  4EL1 A;  4XTS A;  3D5J A;  4AKI A;  1T3B A;  3FW2 A;  1X5C A;  4AI6 A;  1F3B A;  1TK5 B;  4K5R A;  5J4U A;  5B6M A;  4ECB A;  2C0G A;  2MMZ A;  1EGO A;  1TU8 A;  1GSQ A;  1R7H A;  2JZR A;  1U6T A;  1PGT A;  3CSJ A;  6GSY A;  4PUR A;  2JSY A;  4O92 A;  3GL5 A;  4DEJ A;  3GIX A;  3R3E A;  1A2J A;  1SYR A;  1SL2 B;  5C04 A;  2WFC A;  2HSM B;  2L59 A;  1XVW A;  1MTC A;  4IN0 A;  1X9W B;  17GS A;  2OAD A;  3LXZ A;  4BVX A;  5A4V A;  2REM A;  2AYT A;  3ZRD A;  4KDU A;  1Q4J A;  2MMA A;  5FHI A;  4Z2T A;  1PN0 A;  2F8F A;  1PD2 1;  1YY7 A;  6GSU A;  2WZ9 A;  1ERT A;  5DAL A;  2YOI A;  1XWA A;  3PGT A;  4F03 A;  2E0Q A;  1OAZ A;  2EC4 A;  1K0M A;  5CRG A;  1ILO A;  2KUC A;  3CWG A;  4G9H A;  4FYC A;  1F6M C;  5ELA A;  3UVT A;  4IP6 A;  4GXZ A;  2O89 A;  4N0V A;  3KTL A;  3KP9 A;  2H1D A;  3KH7 A;  4HQZ A;  1U87 A;  2M80 A;  1JHB A;  4WF5 A;  4A5P A;  3DVW A;  3Q18 A;  4XS1 A;  4IP1 A;  1OC9 B;  5A1N A;  1V40 A;  2CAI A;  5IOX A;  1X5D A;  1EP7 A;  3H8Q A;  2VD0 A;  4V2M A;  3J7Y b;  1YZX A;  5DCH A;  1G6W A;  4PQH A;  3ZZX A;  4ECC A;  3HCZ A;  1GNW A;  3ZL5 A;  2K6V A;  1J9B A;  1SKR B;  2R4V A;  3TCO A;  3WD6 A;  3FHK A;  3L9V A;  4WBJ A;  2I81 A;  4HU7 A;  4EF0 A;  2RLI A;  3GUR A;  4AKG A;  3O3T A;  5E4W A;  5FWG A;  1ZL9 A;  3RAZ A;  3RBT A;  1DUG A;  1VF4 A;  3GTU A;  4TR4 A;  3WGE A;  2H6X A;  2NPB A;  3TKS A;  4F2I A;  4ZBA A;  2AAW A;  2PU9 C;  5IO0 A;  1VGL A;  3IK9 A;  3TB2 A;  3FZ9 A;  3NOF A;  3O6T A;  2WS2 A;  2HRK A;  1O7U A;  3ZIT A;  3KMO A;  4ZL7 A;  1M9A A;  1VF1 A;  4V1A p;  2YPM A;  4EIP A;  1FOH A;  4KH7 A;  1YF1 A;  3ZMK A;  4FQU A;  4CW9 A;  2L4Q A;  3LGC A;  5J47 A;  1GTI A;  4DVC A;  2FNO A;  5C00 A;  1BX9 A;  1YEX A;  3UIW A;  2N5F A;  4F0B A;  2VCT A;  2P5Q A;  4YKG A;  3VI5 A;  4OO4 A;  2JL4 A;  3FZ4 A;  1GUM A;  2NTO A;  3EWL A;  4K6X A;  2O7K A;  4K7N A;  5D9W A;  2H19 A;  1N2A A;  1ST9 A;  2GVP A;  4OMV A;  2GLR A;  1E6B A;  1GNE A;  2I3Y A;  3BCI A;  4MJC A;  4GQC A;  2KP2 A;  2QSI A;  3ZML A;  4G10 A;  2LJK A;  2LNS A;  3WGX A;  4NMU A;  4K0N A;  4TR1 B;  1QK8 A;  1TRV A;  1SD9 A;  3GL3 A;  4D73 B;  5DJL A;  5HR3 A;  2H76 A;  1JLW A;  3IHG A;  1USB A;  2AB6 A;  4TKY A;  4PQI A;  3QAW A;  3CMI A;  4OCE A;  4ZB6 A;  3D4M A;  4E8E A;  3CXG A;  1ZYN A;  5A34 A;  4MF6 A;  4LL4 B;  1OC9 A;  3LQ7 A;  1AQV A;  3WYW A;  3GKX A;  4H86 A;  4JU5 A;  1GSF A;  4TR0 A;  3HHV A;  2C0D A;  2I9H A;  5GAP D;  1SEN A;  2DJ3 A;  2KP1 A;  3FZA A;  2HZE B;  3AY8 A;  2WGR A;  1UA5 A;  4ULX A;  3TJK A;  1Y1U A;  2QKE A;  1TI3 A;  2FWG A;  2GST A;  1WOU A;  1JZW A;  4CY6 A;  3BOA A;  2KLX A;  5FT3 A;  3DIE A;  1B4P A;  4OD7 A;  4TR3 A;  5ECN B;  3I43 A;  1HQO A;  4NV5 A;  4POM A;  2HRF A;  4EO3 A;  2R6K A;  5G1K A;  2OJL A;  2BMX A;  1QXH A;  4I8B A;  4KA0 A;  1TK0 B;  5A5H A;  2GSQ A;  3RPN A;  4Q5F A;  4GWR A;  4POB A;  4XRD A;  3EC3 A;  5CRH A;  1OKT A;  3FYG A;  3WT2 A;  4HOJ A;  1ON4 A;  1I5G A;  1THO A;  4O5R A;  5CRD A;  2HSY A;  2H1L A;  2MBT A;  2OA7 A;  4X43 A;  4J2F A;  3L9S A;  1A8L A;  2H71 A;  1PX7 A;  3ZFB A;  1AXD A;  3LYK A;  1GWC A;  1TRS A;  3GV1 A;  1MDK A;  2VOC A;  4JZQ A;  3QAG A;  4KND A;  4I2T A;  4IJ3 A;  4MJB A;  3Q6O A;  3A5I A;  5KN1 A;  3Q74 A;  2GSS A;  2JAC A;  5E59 A;  4F9Z A;  3HZ8 A;  2QA1 A;  4G2E A;  1K0D A;  1DBY A;  2GQK A;  1TRW A;  4X4J A;  3RPP A;  1Z3E A;  3HD5 A;  1Q98 A;  2RUE A;  3F3Q A;  3C71 A;  1GH2 A;  5AIV A;  2VL2 A;  8GSS A;  3IAS 2;  1PSQ A;  4EC0 A;  2WB9 A;  2BTO T;  4IW9 A;  4Q5Q A;  3G7I A;  3IRA A;  3F3R A;  4QMK A;  4MK3 A;  1Z7R A;  3BCK A;  4ZB8 A;  5HFI A;  1MD3 A;  4E8H A;  2AV4 A;  2VUP A;  4TR1 A;  4G0I A;  4HQS A;  4ID0 A;  1F37 A;  1EZK A;  2A2P A;  2CV4 A;  5HR2 A;  2C8U A;  2AUV A;  3KH9 A;  4V2N A;  1S3C A;  4HDE A;  1G7E A;  1S3A A;  3UBL A;  3FKF A;  2P0G A;  1YEP A;  1XWK A;  4ZIL A;  4JR4 A;  5B7C A;  1K3L A;  2C3Q A;  2R0G A;  3J7Y k;  3UMA A;  4G0K A;  3MWH A;  4IHU A;  2HZE A;  3G7J A;  5ECI B;  1YKA A;  2ZCT A;  1TXU A;  4XS6 A;  2FWE A;  3RDW A;  3EU4 A;  4KCE A;  3TJF A;  3EE2 A;  1PMT A;  2OE1 A;  5B8A A;  2YZH A;  22GS A;  3QCP A;  5KN3 A;  4BVX B;  2GZY A;  1EEJ A;  1FO5 A;  4MAB A;  4DSR A;  3F4S A;  13GS A;  2YP6 A;  4QL7 A;  1CQH A;  3GA4 A;  4O5Q A;  1Z9H A;  2DJK A;  2L6C A;  1TW9 A;  4TOP A;  1SD8 A;  1K0O A;  1SVL A;  1V58 A;  3VWW A;  3QPM A;  2L57 A;  5H5S A;  2H1G A;  1NM3 A;  2H0G A;  4JR6 A;  1GUH A;  4K5S A;  3FR9 A;  3IXR A;  3W6G A;  4PGT A;  1NSW A;  4PNF A;  4EUY A;  4NPB A;  2GTU A;  2HYX A;  4X1U A;  2FWH A;  3OR5 A;  4GRF A;  1BAY A;  3QMX A;  2XPE A;  4IEL A;  1T7P B;  4WET A;  2YWM A;  3FR3 A;  3L0H A;  3HVS A;  3EMX A;  2HSN B;  1EGR A;  2RM6 A;  3BJ5 A;  5HQP A;  2H01 A;  2ZNM A;  1YQ1 A;  1Z6M A;  5GAN D;  1O6J A;  2H70 A;  1K3Y A;  3C73 A;  3F9U A;  9GSS A;  1M0U A;  1ERV A;  1T4Z A;  1DE1 A;  4IQ1 A;  3DVX A;  4K7O A;  4HUA A;  1B9X C;  3UAP A;  2JSZ A;  1FB6 A;  5KN0 A;  3IE3 A;  2R2J A;  1BF5 A;  2CVD A;  2HRK B;  3H4K A;  4MA9 A;  5CYY A;  2O5V A;  5F8B A;  3PPU A;  2R3X A;  4EDZ A;  4I2U A;  4J56 E;  4KCA A;  3ZVJ A;  1CQG A;  2IMD A;  2WRT A;  1FW1 A;  2OT3 A;  3TUE A;  2MMO A;  1J0F A;  2LJA A;  3KM6 A;  2Z9S A;  11GS A;  1T8E B;  2IN3 A;  3TJG A;  1A0F A;  1H75 A;  2I1U A;  4TXV A;  6GST A;  4ZBB A;  5ENU A;  2HXK A;  2VM1 A;  4OFT A;  1T1V A;  3N9J A;  3KIJ A;  2K8V A;  5G30 A;  2OBI A;  1GUK A;  4EKZ A;  5A4U A;  5AIX A;  4LA1 A;  4CDO A;  2QC7 A;  2VL3 A;  3R2Q A;  2OE0 A;  2H6Y A;  4BVY B;  3NZN A;  5J9B A;  1EP8 A;  1W4V A;  1WRY A;  2EFE A;  4AJ7 A;  4KDX A;  3HMJ G;  2LST A;  2FA8 A;  19GS A;  2IWT A;  1GLQ A;  1SVM A;  1O8X A;  2QA2 A;  4O7H A;  4OFN A;  3NIV A;  4KX4 A;  3W8J A;  5IOW A;  1MDI A;  1ZCP A;  1SU9 A;  4L8E A;  2F3M A;  5D8I A;  2GT6 A;  1JFU A;  1TI1 A;  3GN3 A;  2JAD A;  3VLN A;  2EFH A;  2N5B A;  2QGV A;  4RI6 A;  5A34 B;  4G0L A;  5JCG A;  2PVO C;  1T4Y A;  18GS A;  2KHP A;  1XBS A;  5H5R A;  4KSO A;  4BL7 A;  3L78 A;  4KDY A;  1M9B A;  4PUA A;  1GSS A;  3E3E A;  2XBQ A;  4BWQ A;  4L5O A;  5ID2 B;  20GS A;  4FYB A;  1AAZ A;  2E7P A;  2YJH A;  1TDI A;  2HSN A;  2C0F A;  4L0W A;  3D21 A;  2HRA A;  2WUL A;  3KZQ A;  1AQX A;  3TJJ A;  3I6A A;  4JED A;  3FY7 A;  2BJX A;  5D96 A;  3GRX A;  3IR4 A;  4MCU A;  2TRX A;  3N5O A;  3CYN A;  3PH9 A;  1DE2 A;  3F6F A;  3TRQ A;  2PBJ A;  4AJ6 A;  2LTK A;  4MJA A;  3VK9 A;  1A23 A;  4MH2 A;  2R0P A;  5A5H B;  1O73 A;  1KEB A;  5INY A;  3MYD A;  3W8S A;  2LQQ A;  4GQF A;  3A3T A;  2ZUP A;  4WBR D;  4KUN A;  4GSS A;  3IC8 A;  5J3R A;  4K8M A;  5COH A;  5F06 A;  3EVI A;  1J08 A;  3EU3 A;  1PL1 A;  1XCC A;  1XWB A;  5JCW A;  2OAC A;  3L9U A;  3H79 A;  4DSS B;  1PA3 A;  2H66 A;  4JRR A;  2DLX A;  1K0B A;  2C0E A;  3P8W A;  3KCM A;  2F51 A;  1C72 A;  4GDF A;  2C4J A;  1V57 A;  4GCI A;  16GS A;  2HQT A;  2MMN A;  1ML6 A;  3IDV A;  4EVM A;  4G01 A;  4BVY A;  1WMJ A;  5A4W A;  2VAF A;  1MD4 A;  4PQ1 A;  5G31 A;  4PTS A;  1K0A A;  3KEB A;  2DIY A;  3HDC A;  4L5L A;  1N25 A;  3TU3 B;  3IAM 2;  3HZ4 A;  5ECH B;  1BED A;  2CX3 A;  2NVL A;  3O76 A;  2HNL A;  3LWA A;  4BPY A;  4TW5 A;  2IMF A;  3GKM A;  1YDK A;  4HZ4 A;  3ZLP A;  2R0C A;  5JWO B;  2EIO A;  4PNG A;  2DKH A;  3HJP A;  1M2A A;  4FYU A;  1HNC A;  3VI7 A;  2NBS A;  4ZIJ A;  1S3D A;  1UN2 A;  2CT6 A;  2MZC A;  2KOK A;  2M46 A;  4WR5 A;  3M9K A;  2YWO A;  3CRU A;  4AKX B;  1OC3 A;  1OVN A;  2YAN A;  1ABA A;  1FVK A;  5ID2 A;  1UVZ A;  2GT5 A;  4XIH A;  5ECK B;  3DEX A;  2FWF A;  3TJB A;  2VD1 A;  2X99 A;  1RQM A;  3IOS A;  4KF9 A;  3ME8 A;  1GSE A;  1Z5Y E;  5D73 A;  1A0R P;  5BRT A;  1SVO A;  1B4Q A;  3TKQ A;  4GSN A;  1TP9 A;  5CO3 A;  4MLY A;  1UC7 A;  1XW9 A;  1G0T A;  2B3S A;  4RQX A;  3A2V A;  4ZB7 A;  1WPI A;  2DJ1 A;  5IPG A;  6GSW A;  4O32 A;  2GZZ A;  2YCD A;  4RI7 A;  3UAR A;  4PUF C;  5IMZ A;  3VWV A;  4OO5 A;  4WKW A;  1XVQ A;  1XFL A;  3DYR A;  2B7J A;  3F6D A;  2H72 A;  2YWI A;  5B8B A;  4EDY A;  4MPG A;  2FHE A;  3FR6 A;  1SL0 B;  1EWX A;  2H0I A;  2MBS A;  4DSS A;  1G6Y A;  3VPQ A;  3HJO A;  3M0F A;  4Z2R A;  4KSM A;  2H0H A;  1SL1 B;  2B5X A;  1OE8 A;  2LRT A;  4HS1 A;  1IYI A;  2JZT A;  1A24 A;  3HKR A;  5KOW A;  5D9X A;  4AF2 A;  5IPH A;  2IL3 A;  2CA8 A;  4KGI A;  5IMV A;  3V1W A;  4GF0 A;  2VM2 A;  2X8C A;  5F05 A;  1I9D A;  3APS A;  3DXB A;  1MDJ A;  1E2Y A;  2VIM A;  4MP4 A;  2DJ2 A;  4MZC A;  2B1L A;  4Z2U A;  2HT9 A;  1AC1 A;  3A2X A;  2H1A A;  2OE3 A;  2CZ2 A;  1DSB A;  1TU7 A;  2HI7 A;  1F2E A;  5JWQ B;  1O81 A;  2R5G A;  1BJX A;  3LJR A;  3C1R A;  2H30 A;  3GFK A;  1QGV A;  5IQY A;  3KP8 A;  4RUV A;  5IM9 A;  2JU5 A;  4AGS A;  1U88 A;  4YKF A;  6GSV A;  5DDL A;  14GS A;  1N8J A;  5EL8 A;  1GP1 A;  5IIZ A;  1SJ6 A;  4FIW A;  3H93 A;  2YWN A;  5EPF A;  3EYT A;  3MAK A;  3QAV A;  1R4W A;  2F9S A;  3US3 A;  1ZYE A;  2FGX A;  1X9M B;  5ECS A;  2L5L A;  2K18 A;  2X8H A;  3E0U A;  3LXT A;  3LG6 A;  3KD0 A;  2RUF A;  1A8Y A;  4XS4 A;  3D4T A;  4POK A;  4YQU A;  1XIY A;  1RW1 A;  2PUK C;  3EPT A;  1M2B A;  5DVB A;  4N11 A;  3QDN A;  2CAQ A;  4YAV A;  2RII A;  3S9F A;  1B9Y C;  3P2A A;  3MDK A;  4ZL8 A;  4IBP A;  4HZ2 A;  3G9B A;  2P5R A;  1O8W A;  3BD2 A;  4NHZ A;  3BBY A;  4MF7 A;  2K8S A;  5IMC A;  2ON7 A;  1YF0 A;  1LJR A;  4KAE A;  1URM A;  4NHW A;  5EVO A;  3APQ A;  3DML A;  3GST A;  4EE0 A;  2ES7 A;  3SWL A;  1SJZ A;  2GZP A;  2AHE A;  4WR4 A;  4OWY A;  5GZZ B;  2OBK A;  2DKI A;  2C3T A;  3D0Z A;  3F63 A;  1Y25 A;  4TXO A;  4W66 A;  2VCQ A;  5ELG A;  2IJY A;  4BL7 B;  2NDO A;  3ZFL A;  3ERF A;  4GTU A;  4ACS A;  1YVL A;  1V2A A;  5ECQ B;  3ISO A;  2AJQ B;  2GS3 A;  4MZW A;  3F0I A;  4MPF A;  4Z7X A;  4J57 E;  4MJE A;  1KBN A;  1Z7P A;  2LKU A;  1BQ7 A;  4E68 A;  5KN2 A;  4USS A;  4ISD A;  2VL2 C;  3CSI A;  2ALB A;  3D6I A;  3KGK A;  4K9Z A;  3LSZ A;  4ZXG A;  2B7K A;  2GSR A;  3PR8 A;  3JCM L;  1HNA A;  4LMV A;  5IMF A;  4OFM A;  4IKH A;  5KOX A;  2E2G A;  4ICY A;  5J5N A;  2X64 A;  2PWJ A;  4TN8 A;  1GTU A;  3DKS A;  2TRC P;  2L6D A;  1OKD A;  2LQO A;  3RHB A;  4HEA 2;  4XCS A;  2WCI A;  1LU4 A;  5CRE A;  3HVX A;  1K0N A;  1WP0 A;  3LOR A;  7GSS A;  3GYK A;  5HFK A;  3ERG A;  4K7I A;  2H6Z A;  2XHF A;  3GKN A;  1FG4 A;  2H75 A;  2H73 A;  1ACV A;  4Q5R A;  5ECM B;  3CRT A;  3EIN A;  3MSZ A;  5LNK e;  1SYX A;  3TKS E;  4BWS A;  1QFN A;  5IO2 A;  3FEU A;  1PN9 A;  3VPT A;  1JZO A;  2LEG A;  1NHY A;  2M72 A;  1GLP A;  1XWC A;  2V32 A;  2HRN A;  4NAX A;  5ECP B;  4GLT A;  4CHS A;  2V2G A;  5AGY A;  1EV9 A;  2YNX A;  1K0C A;  2A2S A;  3M1G A;  1M7T A;  1AQW A;  1NHO A;  12GS A;  3QOU A;  4K1F A;  1SK0 A;  4JE1 A;  3ZTL A;  1BG5 A;  2V41 A;  1PQN A;  2IMI A;  1OC8 A;  3F8U A;  4JBB A;  4V2L A;  1ZYQ B;  5L71 A;  2C1Y A;  1VRS D;  3GUS A;  2P31 A;  3UVH A;  3KXO A;  4K2X A;  4HI7 A;  1A2L A;  2H74 A;  2ON5 A;  1ZOF A;  3P90 A;  2DJ0 A;  5D9V A;  1O85 A;  3CBU A;  3DWV A;  2MYG A;  3CTF A;  1T00 A;  1V9W A;  1ERW A;  1PL2 A;  1XW6 A;  5DBQ A;  1KNG A;  2C3N A;  1TTZ A;  1PX6 A;  1FVJ A;  2GQM A;  1QQ2 A;  2HE3 A;  2VO4 A;  5JCU A;  2DBC A;  2PER A;  2FY6 A;  4LL1 B;  1BG1 A;  4AJ8 A;  1M2D A;  4NV2 A;  3UEM A;  2R37 A;  3D22 A;  2VLV A;  4EIQ A;  3GMF A;  3HVV A;  4MNN A;  2O8V B;  1TKD B;  3EMP A;  1WJK A;  1EOG A;  3WT1 A;  2A4V A;  2V6K A;  1THX A;  2I4A A;  5GSS A;  1XOA A;  5ECR B;  3ERW A;  1WWJ A;  4NWY A;  1FAA A;  1SKW B;  5CAX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...