4Q5NA

Crystal structure of the gluthatione s-transferase blo t 8
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
230
structure length
220
Chain Sequence
PLKIGYWDVRGFAEPIRMLLKHLNIEFEETRYGFLPNRDEWLAEKFTLGLEFPNLPYLFDGDFKMTESVAILKRLARANGMIATTEPALSYSEMIEAMIIDIRNRLINVVYAETPEEFEQKLADLRERLETSLGQLEAFFQKHGSQWVAGDKLTYVDFLAYEYLDWYRVFVKSTPIFEKFAKVSDYMKRFEELPSLKEYIARDEHRSASCLSPFARIGHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gluthatione S-transferase Blo t 8 isoform
publication title Crystal structure of the gluthatione S-transferase Blo t 8
rcsb
source organism Blomia tropicalis
molecule tags Transferase
total genus 74
structure length 220
sequence length 230
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4q5nA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4q5nA01
2CZ2A 5KEJA 3ZIJA 4IGJA 2FA4A 5IO0A 3VI5A 20GSA 4KE3A 4IHUA 4WR5A 1JFUA 1M2DA 1F9MA 2OBIA 3QMXA 4KH7A 3EU4A 4N0VA 2TIRA 3F0IA 4KB3A 1USBA 5JWRB 5D73A 2YV7A 1ZYEA 4L0UA 4HDEA 4NXIA 3PGTA 4ID0A 4Z7XA 1QQ2A 3G7IA 1Y6EA 3HVVA 2C80A 1N8JA 2JSYA 1OYJA 3HDCA 5DQSA 5HFGA 3ZTLA 1V58A 4OFTA 5J9CA 5JWOB 2J9HA 3VLNA 1K0BA 4OO5A 2CA8A 3NOFA 2QSIA 2VM1A 3KP8A 3GSTA 3ZFBA 2EC4A 3E3EA 1GTIA 2M72A 1FG4A 5LCZA 4TW5A 2F51A 3D21A 4EDYA 1WIKA 3CYNA 3QAGA 5AN1A 2GTUA 1A8LA 2P31A 4HU9A 1SJZA 4PQHA 1WPIA 1HD2A 1TRUA 4ZXGA 1SKWB 13GSA 2RM5A 5JCGA 5BMUA 5B8AA 2M46A 5AGYA 4P3YB 4V1Ag 3HVSA 2HE3A 3GUSA 3GKKA 3A5WA 3P7XA 2WDUA 3CTGA 2JSZA 4ACSA 3FY7A 1JLWA 3G7YA 1XCCA 3IPZA 3KTBA 4BVXA 2PN8A 2REMA 1Q98A 1WWJA 3VWVA 4K1FA 4ZIJA 2ON5A 1TRSA 4ZB6A 5DAKA 2H6ZA 2PVQA 3KMNA 2LUSA 4IELA 3PPUA 2WCIA 4KX4A 1CQHA 4IVFA 1OC8A 1G7OA 1TRWA 3LYKA 3QAVA 4ECIA 4G2EA 2CVKA 2MMOA 5G1LA 1Z3EA 4JBBA 4BWSA 4ULXA 1F3AA 4F03A 6GSUA 1XIYA 2GQLA 4WF5A 4K0NA 2K6VA 4MCUA 1UVZA 3GKXA 2HLSA 4PNGA 3F9UA 1FW1A 1R26A 2FLSA 2H01A 5E59A 5B6NA 2FWFA 1A2LA 2V41A 2A2RA 4TR1A 2ZCTA 2FWGA 4JRRA 2TRXA 4XS6A 3ZVJD 4G0LA 2YCDA 1W4VA 2ALBA 2GGTA 4NPBA 1FVKA 4HQZA 5DBQA 3LSZA 4DSRA 4G9HA 14GSA 4CHSA 3ZVJA 1WE0A 1V40A 4L8EA 2PBJA 1TP9A 4N30A 5IMVA 3L9VA 1GUKA 4K0GA 4MH3A 1K0OA 1VRSD 1B8XA 5F8BA 1PKWA 3E0UA 5C04A 1DE2A 3R3EA 2PVOC 1K0CA 3L4NA 4PGTA 3KTLA 2MYGA 22GSA 5ENUA 4ZL8A 3O3TA 5IMAA 2B5EA 2L5OA 2KLXA 4DSQA 5GZZB 3DVWA 3LGCA 2CVBA 4RI7A 2C8UA 2VLUA 2RLIA 3GMFA 1FB0A 4GQFA 2YNXA 1A0RP 2H73A 1V57A 1OKTA 17GSA 1F37A 4K7OA 1YF1A 2XHFA 2WRTA 1K0AA 1I9DA 1XWGA 1GLQA 1EZKA 2V6OA 5FWGA 2G0FA 3RPPA 3GX0A 3TOTA 3RAZA 1EOHA 1LBKA 2YN1A 4L5OA 1TK5B 3BBYA 5H5SA 5A4VA 3LFLA 1S3AA 5DAKB 1AUCA 4USSA 4HJ2A 3LXZA 4F0CA 3VWWA 3GHAA 1QFNA 1R4WA 1BG5A 2HSYA 1V98A 2I81A 2FGXA 4MJBA 1SU9A 1PRXA 5B7CA 1UN2A 1EWXA 1PX6A 2LSTA 4TVEA 2V32A 3DYRA 4EXJA 3F4TA 2IWTA 4WEYA 3LXTA 4KCAA 2VL9A 5ECLB 4JR6A 5GSTA 5GSSA 3DEXA 4NHZA 4HOJA 4X43A 1GSQA 1AQWA 2XBQA 1THOA 1GTUA 6GSTA 4GLTA 3TRPA 1X5EA 4BPYA 4G10A 3BCIA 3KD0A 3CSJA 1PN9A 5HR2A 4GQCA 1SK0A 5D96A 1TU7A 1GSYA 2OE3A 2OJLA 3MWHA 3FYGA 1VF2A 1GTBA 2HZEA 3W8JA 5IPGA 5IOWA 4TR1B 1AQVA 2NBSA 5CYYA 3C7MA 4MP4A 4KDYA 3J7Yk 2VM2A 1VF1A 3KP9A 1ON4A 4H86A 3ZFLA 2HQTA 3I69A 1ERUA 3UARA 4NAXA 3GKNA 4EO3A 4AJ6A 1V9WA 2B1LA 1QK8A 1AC1A 2V1MA 1YF0A 5ECOB 2YJ7A 1HNBA 3UBLA 1PQNA 2HRKA 2HRFA 4KNDA 4V2MA 2BTOT 2LEGA 1VF4A 4L5LA 2DSAA 3I6AA 5G31A 3TJFA 4F82A 1XWCA 3D4MA 5COHA 3D6IA 1TI1A 3LQ7A 5DVBA 3A2XA 2I1UA 4HI7A 5ECHB 2VLTA 2IL3A 2CV4A 2HZFA 2K9FA 3KH7A 1ZOFA 1SYXA 5ECKB 4ZBDA 2I3YA 4MMMA 2NPBA 2JZRA 4TOPA 4MJCA 3WGEA 1A23A 2HNLA 3EMPA 3VURA 1EGRA 1GUHA 2V2GA 2R4VA 3HCZA 5ID2A 3TOUA 3IR4A 2LQQA 2MBSA 3M9JA 1TW9A 4HQSA 3GURA 5ECMB 19GSA 2HXKA 3F63A 3TDGA 2VCTA 3C8EA 2CZ3A 4K6XA 2XBIA 3A2WA 4MJAA 10GSA 5H5RA 2R3XA 1BEDA 2K8VA 4ZILA 1ZGNA 2CAQA 1J0FA 4TR3A 3MNGA 4PNFA 3KIJA 4MDCA 3HHVA 4FIWA 5CRGA 2DJKA 3D4TA 4HZ2A 1DE1A 1MDKA 3KZQA 2OADA 3TRQA 2LS5A 1C72A 1U87A 2H6YA 3TKPA 3BCKA 5LD0A 3IAS2 5FT3A 4FYCA 2FWHA 4KSOA 1GLPA 1JZRA 4V2LA 5AISA 3KM6A 1T1VA 1PSQA 3HJPA 4YAVA 1M2BA 1X9WB 4EF0A 3UEMA 4LL4B 4IP1A 1O6JA 4LMVA 3RBTA 1XFLA 3DRNA 2H1AA 1PGTA 2DJ2A 3VI7A 5C00A 4LA1A 2HZEB 2C0GA 3OR5A 2FA8A 1R5AA 2LJKA 1A2MA 2FCHA 2JZSA 5A4UA 2KP2A 4HJMA 1HNAA 2IPAA 4EUYA 5KN2A 4ML1A 2CQ9A 1SYRA 2LNSA 2WZ9A 3DVXA 4ISDA 2L57A 1GP1A 2XPEA 3P90A 2H0HA 4POBA 3A2VA 3IA1A 4XS1A 3RHBA 5EVOA 1ZYQB 4F2IA 2FWEA 3GIXA 2IFQA 2HSMA 4BWQA 3KJYA 4BA7A 1ML6A 4TRXA 2FY6A 3IC8A 2QKEA 4OCEA 3QFBC 4D73A 3KGKA 1NHYA 3CRUA 2VO4A 2YWOA 1T8EB 1SKRB 3GV1A 1GL8A 2GT5A 2O7KA 3ZREA 4TN8A 4G19A 1T4YA 3M3MA 5DQYA 1PMTA 3TJGA 5IPHA 6GSSA 2AJQB 2HSHA 3UAPA 5D9TA 1OE7A 1GSDA 2N5BA 5A5KA 3ERGA 2DLXA 1Z7RA 11GSA 3M1GA 5IO2A 2CX4A 3VWUA 3IOSA 4IP6A 4KW6A 2P5RA 5EPFA 2E2MA 3GA4A 1HYUA 4OCFA 4GSNA 4MABA 3F8UA 3QD9A 3LORA 5ELGA 4G0KA 1OC3A 1TJDA 1O85A 3TKSA 3FZ9A 2LNTA 5HR1A 1KNGA 1JZOA 1YEXA 1AIUA 2UZ8A 1EP8A 2HFDA 3TJBA 2P5QA 2H74A 1PL2A 3CRTA 3RHCA 3C1RA 1FHEA 1TK8B 3TCOA 3DGQA 5LNKe 5ECPB 3DMLA 3LEFA 2C4JA 2PGTA 4JEDA 4OFNA 3PR8A 4GSTA 4X1UA 4E8HA 3F6DA 2MBTA 2C3TA 2VLVA 4HS1A 5KN0A 3ERWA 1EOGA 2IMDA 4YQUA 2MMNA 4F9ZA 4X0XA 3LJRA 4GRFA 2IMFA 2IJYA 3EVIA 2X64A 2HYXA 1AAZA 1OC9B 3MDKA 3HZ8A 3EINA 2GLRA 2R2JA 2YJHA 2OA7A 3TGZA 4L0WA 2H8LA 3K8NA 1LJRA 2LJRA 1TXXA 1AW9A 3UVHA 2B7KA 1TKDB 1NSWA 2OE1A 4GF0A 2GZPA 2KUCA 1TRVA 4POKA 4YQMA 1RQMA 4XCSA 4FYBA 5G30A 1K3LA 2PMTA 2VCZA 4AF2A 2JL4A 1Z6MA 1VGLA 3M0FA 4TR0A 1MDJA 1SD8A 2YPMA 1ZCPA 2DJ0A 3TJKA 4ZL7A 1YEPA 9GSSA 3NZNA 1Q4JA 4PQ1A 2KP1A 1XWAA 5J4UA 3BJ5A 4YH2A 2H0GA 2O87A 2LRCA 3HXSA 1ST9A 2AYTA 4ZBBA 2O89A 2IFQB 5KN3A 2BMXA 2LJAA 3DIEA 3FKFA 4RQRA 4IS0A 5CO3A 4D73B 4HU7A 2AV4A 4HUAA 4JR4A 2FHEA 2PUKC 2E7PA 2LRTA 1BJXA 1EEMA 4PTSA 4G0IA 6GSYA 3F4SA 4XIHA 4XHMA 2C3QA 2D2ZA 3ZLPA 3CTFA 3FR6A 3ZMLA 3EURA 3HKRA 1TU8A 1XWKA 1T00A 2FD3A 1S3DA 1GWCA 3KH9A 3GYKA 2DMLA 1QUWA 2VD0A 1I5GA 3UL3A 4J56E 3KEBA 3HYPA 3APOA 4WF4A 3F3QA 1RK4A 2ZUPA 1BQ7A 4IJ3A 1OKDA 3VPQA 5HQPA 1B9YC 3ZMKA 4XRDA 1O8WA 2TRCP 3DXBA 5EY6A 1TK0B 4EDZA 4OWYA 5ELAA 4ZL9A 4MPFA 4RI6A 2CAIA 4BVXB 1VF3A 2YV9A 2RUEA 2H30A 3DD3A 2VCWA 2RUFA 2HRNA 1AXDA 3ERFA 2JACA 1TTZA 5D9WA 2H1BA 4RQXA 4GWRA 2CVDA 3CBUA 4XTSA 4K7IA 3ED3A 2YWNA 4O5RA 2DMMA 4N10A 1SL0B 3F4RA 3G7JA 1XBSA 1PL1A 2DIZA 4PQIA 2YZUA 3L0HA 2WGRA 1YQ1A 4AJ7A 1N2AA 5CRHA 3VPTA 4FQUA 1JZDA 4PXOA 4QQ7A 4OFMA 1ILOA 1MD3A 2IIYA 4WKWA 2ZNMA 4GSSA 2C0EA 4K7NA 1HQOA 1Z9HA 1WRYA 1DBYA 1M99A 3EC3A 1M9AA 1CQGA 2H75A 2Z9SA 2H72A 5DCHA 3HJMA 3FK8A 4KF9A 1XWBA 3IHQA 2DBCA 3VWXA 2VIMA 4EC0A 4V1Ap 1G7EA 2H76A 2MMAA 3D22A 3TKSE 5INYA 3G9BA 1PD21 3GRXA 3M9KA 4Q5NA 2GSRA 2GQKA 1THXA 4KGIA 1WJKA 3PINA 5ECQB 5D8IA 2X8HA 5IM9A 3ZITA 4KUNA 3NIVA 1K3OA 2L4QA 1F6MC 3WT1A 5IMFA 1FB6A 5G2ZA 1GSFA 2VD1A 4N0ZA 1OE8A 2XC2A 2OBKA 3A3TA 5KN1A 4IBPA 2I9HA 1ZZYA 1X0RA 4NV2A 4EVMA 5J41A 2IMEA 2EIRA 2F8FA 2YWIA 1SK1A 2L6CA 4MZBA 3Q18A 2N5AA 18GSA 3W6GA 1SJIA 1O73A 2JZTA 1FVJA 1JZWA 1E2YA 2EIQA 1XOAA 3IXRA 4KSMA 4BL7A 1YY7A 5CRDA 2H1DA 1B4QA 3V1WA 1G6WA 1U3IA 1O7UA 6GSWA 1H75A 4O32A 4TXVA 4WXTA 1GSSA 4MZCA 3TKQA 3IDVA 1J08A 5HFKA 2C0DA 3QDNA 3P8WA 1NHOA 16GSA 4LLRA 3CMIA 4MJEA 2O85A 3BD2A 4I2UA 1O81A 3HD5A 3C73A 2H1GA 4IKHA 1T7PB 2RIIA 5F05A 3S9FA 3ZIVA 12GSA 5DCGA 5ECRB 1EGOA 3FW2A 5D93A 1BAYA 1XZOA 1TDIA 5HR0A 1KEBA 2L59A 4PUFC 3US3A 4NMUA 2WFCA 5DJMA 4I5QA 3UIWA 2N5FA 5ECSA 2VAFA 3MSZA 2E2GA 5ECIB 3CSIA 4ILFA 5JCUA 3L9UA 2B1KA 5B8BA 5JCWA 2PWJA 1YKCA 1ERVA 3IK7A 2CT6A 4N11A 2P0GA 2K18A 5CAXA 5B6MA 1EV9A 5J3RA 4GCIA 1U3AA 4XS4A 4MH2A 2GSQA 4NWYA 4MZWA 1SENA 3C1SA 1FOVA 4J2FA 1Z7PA 4ZB8A 4PURA 1H4OA 3IK9A 3APSA 1NM3A 2GSTA 1G6YA 1NW2A 1ERTA 2BJXA 4FH8A 3LWAA 2HRKB 3H79A 2AHEA 2LRNA 1XOBA 3GL3A 3TJJA 4I2TA 3IBHA 4KCEA 4DVCA 5J9BA 5IMDA 3H93A 1QXHA 1WP0A 5CP1A 2VCXA 2KHPA 3D5JA 5AIVA 4RUVA 4EL1A 4K8MA 3RDWA 4I97A 3CXGA 2F3MA 1XW6A 4V2NA 3IE3A 3KMOA 4ZB9A 2V6KA 3TRXA 1W89A 6GSXA 3AY8A 3ZRDA 2B6MA 1F2EA 5G5FA 3TKSC 2H66A 1UA5A 5G5EA 3CSHA 2C3NA 2VUPA 3J7Yb 1JHBA 7GSSA 3DKSA 5CNWA 4BL7B 4JZQA 2HT9A 5ID2B 3HZ4A 3GH9A 3EE2A 5HFIA 2M80A 4I6XA 1GSUA 5IQYA 2L5LA 3FR3A 4TKYA 4WETA 4ECCA 2IMIA 1KBNA 2MZCA 3FHKA 1X9MB 2B7JA 2K8SA 4IQ1A 3LG6A 4J57E 2WS2A 1GNEA 2B3SA 2X99A 3EU3A 3JCML 4QL9A 4O92A 2ES7A 5H5QA 2GSSA 4ECBA 3QFAC 1XW9A 3WGDA 4K2DA 2GT6A 3QPMA 1F3BA 4MF5A 3P2AA 3HJOA 4Q5FA 2GS3A 2DJ3A 4OD7A 1T3BA 4DSSA 5GAPD 2J23A 1PKZA 2E0QA 1K0MA 4Q5QA 3QOUA 2X8CA 4WR4A 1U6TA 5HR3A 3O6TA 1BYEA 2H71A 3Q74A 2KOKA 1JLVA 4MPGA 3FEUA 1EEJA 4XS4B 4TXOA 3TUEA 1TI3A 3KXOA 3ZYWA 2JU5A 3Q19A 5JWQB 1M0UA 3GTUA 2C1YA 2LQOA 2L6DA 3M8NA 3UJ1A 4PX1A 1DUGA 3U6VA 5F07A 4ECJA 1T4ZA 3ISOA 2HSMB 5ECNB 4FO5A 1QGVA 1K0NA 3IC4A 2A2SA 1SL1B 1RW1A 2G2QA 1DSBA 3SWLA 3F3RA 4WBJA 3FZAA 4I8BA 1M7TA 1GULA 1URMA 1WMJA 4EKZA 2VCQA 4IN0A 1X9SB 2GZYA 5DALA 5IIZA 3U5RE 2YANA 1SJ6A 1XVWA 2H19A 4CDOA 3N5OA 3GX8A 2AAWA 4JU5A 2FUG2 5DJLA 1OAZA 3F6FA 1QMVA 4EE0A 1A2JA 4PUAA 1Z5YE 1ACVA 4MK3A 1TOFA 4OO4A 2VOCA 5IOXA 4Q5RA 1YJ6A 2QGVA 3R2QA 3VFIA 1V2AA 2R6KA 3QAWA 4POLA 5IMCA 1MTCA 3ZL5A 3TKRA 1E6BA 4GXZA 1HNCA 1GH2A 1EV4A 1J9BA 1FAAA 3HY2A 2CX3A 1FO5A 3GSSA 3L78A 2R5GA 1BX9A 3FRCA 2I4AA 2DC5A 5D9VA 4MA9A 5IMZA 5CRWA 4OMVA 2R37A 3EWLA 5EL8A 1A8YA 2H70A 3TB2A 2PPTA 3WD6A 2GQMA 3KCMA 4BVYA 1ZMAA 2RM6A 1ERWA 2YZHA 1R7HA 3UVTA 1GRXA 4DSSB 2DIYA 4IQAA 3BOAA 3Q6OA 3GN3A 3I9V2 1SL2B 4KDUA 2VL3A 3H1NA 1G0TA 1R5PA 3HA9A 2NVLA 3ZZXA 3W8SA 1X5DA 2LKUA 1GUMA 3WYWA 2DJJA 5D9XA 2WULA 2JADA 1MEKA 1X5CA 4TXOB 6GSVA 1SKSB 1AQXA 3GKMA 3IRAA 5CREA 2X8GA 3FR9A 1B4PA 4FYUA 3GTUB 1XPVA 1ABAA 4MLYA 5J5NA 2VCVA 3MAKA 1K3YA 2L4CA 3SBCA 2O8VB 4LMWA 4ZBAA 3GL5A 1PX7A 5A4WA 1LU4A 3VK9A 3UOMA 2OKAA 3GFKA 8GSSA 2C0FA 1SK2A 1MDIA 1Z6NA 2GVPA 2HRAA 3APQA 1EP7A 1K0DA 1U88A 2HSNB 3IV4A 3GH6A 1SD9A 1PA3A 4IW9A 1O8XA 2WB9A 2XPDA 4YQVA 3UMAA 1XW5A 5DALB 3HVXA 2B5YA 4NHWA 1A0FA 5AIXA 3LYPA 3H4KA 1ZL9A 2YOIA 2PU9C 2YP6A 5E4WA 2FNOA 3WGXA 1B48A 3UBKA 4HZ4A 2HI7A 3PH9A 1M9BA 2H6XA 4AJ8A 4KAEA 3FZ4A 4DEJA 2F9SA 2WJUA 3EMXA 2AUVA 1KTEA 4F0BA 2VL2C 2ON7A 2PERA 2QC7A 1YZXA 3GNJA 5F0GA 1B9XC 4AGSA 2VL2A 4E8EA 4YAPA 2MMZA 4CW9A 5GAND 2OE0A 1OVNA 4JE1A 4O7HA 4NV5A 2AB6A 1GNWA 4GTUA 3QCPA 4MF6A 3I43A 4XRAA 1Y25A 4MF7A 2NTOA 3QR6A 3DWVA 3ME8A 4ML6A 3O76A 1GTAA 1YKAA 2IN3A 1YDKA 3N9JA 3EYTA 1IYIA 4POMA 3C71A 4QL7A 4WBRD 4KA0A 3IAM2 4BVYB 3RPNA 2YWMA 5DDLA 1M2AA 2LTKA 3D0ZA 3ME7A 1S3CA 2LV3A 5FHIA 4KDXA 2IMKA 4IJIA 3H8QA 3WT2A 5G1KA 1XVQA 2A4VA 1IYHA 3FZ5A 3E9JB 4TR4A 1WOUA 5F06A 2F8AA 2B5XA 1XXUA 1MD4A 1A24A 1OC9A 4HEA2 2OACA 2GDRA 4K9ZA 1GSEA 2NDOA 5ABRA 2GZZA 2EIOA 2H0IA 5L71A 3L9SA 1UC7A 2DJ1A 4LL1B
chains in the Genus database with same CATH superfamily
2CZ2A 5KEJA 4K5RA 3ZIJA 4IGJA 2FA4A 5IO0A 3VI5A 20GSA 4KE3A 4IHUA 4WR5A 1JFUA 1M2DA 1F9MA 2OBIA 3QMXA 4KH7A 3EU4A 4N0VA 2TIRA 3F0IA 4KB3A 1USBA 5JWRB 5D73A 2YV7A 1ZYEA 4L0UA 4HDEA 4NXIA 3PGTA 4ID0A 4Z7XA 1QQ2A 3G7IA 1Y6EA 3HVVA 2C80A 1N8JA 2JSYA 1OYJA 3HDCA 5DQSA 5HFGA 3ZTLA 1V58A 4OFTA 5J9CA 5JWOB 2J9HA 3VLNA 2WW3A 1K0BA 4OO5A 2CA8A 3NOFA 2QSIA 2VM1A 3KP8A 3GSTA 3ZFBA 2EC4A 4AKIA 3E3EA 1GTIA 2M72A 1FG4A 5LCZA 3RFRC 4TW5A 2F51A 3D21A 4EDYA 1WIKA 3CYNA 3QAGA 5AN1A 2GTUA 1A8LA 2P31A 4HU9A 1SVOA 1SJZA 4PQHA 1WPIA 2WZSA 1HD2A 1TRUA 4ZXGA 1SKWB 1SVLA 13GSA 2RM5A 5JCGA 5BMUA 5B8AA 2WW0A 2M46A 5AGYA 4P3YB 4V1Ag 3HVSA 2HE3A 3GUSA 3GKKA 3A5WA 3P7XA 2WDUA 3CTGA 2JSZA 4ACSA 3FY7A 1JLWA 3G7YA 1XCCA 3IPZA 3KTBA 4BVXA 2PN8A 2REMA 1FOHA 1Q98A 1WWJA 3VWVA 4K1FA 4ZIJA 2ON5A 1TRSA 4ZB6A 5DAKA 2H6ZA 2PVQA 3KMNA 2LUSA 4IELA 2WVYA 3PPUA 2WCIA 4KX4A 1CQHA 2WW1A 4IVFA 1OC8A 1G7OA 1TRWA 3LYKA 4ICYA 3QAVA 4ECIA 2A2PA 4G2EA 2CVKA 2MMOA 5G1LA 1Z3EA 4JBBA 4BWSA 4ULXA 1F3AA 4F03A 6GSUA 1XIYA 2GQLA 4WF5A 4K0NA 2K6VA 4MCUA 1UVZA 3GKXA 2HLSA 4PNGA 3F9UA 1FW1A 1R26A 2FLSA 2H01A 3CWGA 5E59A 5B6NA 2FWFA 2EFDA 1A2LA 2V41A 2A2RA 4TR1A 2ZCTA 2FWGA 4JRRA 2TRXA 4XS6A 3ZVJD 4G0LA 1PFOA 2YCDA 1W4VA 2ALBA 2GGTA 4NPBA 1FVKA 4HQZA 5DBQA 3LSZA 4DSRA 4G9HA 14GSA 4CHSA 3ZVJA 1WE0A 1V40A 4L8EA 2PBJA 1TP9A 4N30A 5IMVA 3L9VA 1GUKA 4K0GA 4MH3A 1K0OA 1VRSD 1B8XA 5F8BA 1PKWA 3E0UA 5C04A 1DE2A 3R3EA 2PVOC 1K0CA 3L4NA 4PGTA 3KTLA 2MYGA 22GSA 5ENUA 4ZL8A 3O3TA 5IMAA 2B5EA 2L5OA 2KLXA 4DSQA 5GZZB 3DVWA 3LGCA 2CVBA 4RI7A 2C8UA 2VLUA 2RLIA 3GMFA 1FB0A 4GQFA 2YNXA 1A0RP 2H73A 1V57A 1OKTA 17GSA 1F37A 4K7OA 1YF1A 2XHFA 2WRTA 1K0AA 1I9DA 1XWGA 1GLQA 1EZKA 2V6OA 5FWGA 2G0FA 3RPPA 3GX0A 3TOTA 3RAZA 1EOHA 4K5SA 1LBKA 2YN1A 4L5OA 1TK5B 3BBYA 5H5SA 5A4VA 3LFLA 1S3AA 5DAKB 1AUCA 4USSA 4HJ2A 3LXZA 4F0CA 3VWWA 5A5HA 3GHAA 1QFNA 1R4WA 1BG5A 2HSYA 1V98A 2I81A 2FGXA 4MJBA 1SU9A 1PRXA 5B7CA 1UN2A 1EWXA 1PX6A 2LSTA 4TVEA 2V32A 3DYRA 4EXJA 3F4TA 2IWTA 4WEYA 3LXTA 4KCAA 2VL9A 5ECLB 5GSTA 5GSSA 4JR6A 3DEXA 4NHZA 4AKXB 4HOJA 4X43A 1GSQA 1AQWA 2XBQA 1THOA 1GTUA 6GSTA 4GLTA 3TRPA 1X5EA 4BPYA 4G10A 3BCIA 3KD0A 3CSJA 1PN9A 5HR2A 4GQCA 1SK0A 5D96A 1TU7A 1GSYA 2OE3A 2OJLA 3MWHA 3FYGA 1VF2A 3FMWA 1GTBA 2HZEA 3W8JA 5IPGA 5IOWA 4TR1B 1AQVA 2NBSA 5CYYA 3C7MA 4MP4A 4KDYA 3J7Yk 5J47A 2VM2A 1VF1A 3KP9A 1ON4A 4H86A 3ZFLA 4AKHA 2HQTA 3I69A 1ERUA 3UARA 4NAXA 3GKNA 4EO3A 4AJ6A 1V9WA 2B1LA 1QK8A 3MIXA 1AC1A 2V1MA 1YF0A 5ECOB 2YJ7A 1HNBA 3UBLA 1PQNA 2HRKA 2HRFA 4KNDA 4V2MA 2BTOT 2LEGA 1VF4A 4L5LA 2DSAA 3I6AA 5G31A 3TJFA 4F82A 1XWCA 3D4MA 5COHA 3D6IA 1TI1A 3LQ7A 5DVBA 3A2XA 4YKGA 2I1UA 4HI7A 5ECHB 2VLTA 4AKGA 2IL3A 2CV4A 2HZFA 2K9FA 3RGBC 3KH7A 1ZOFA 1SYXA 5ECKB 4ZBDA 2I3YA 4MMMA 2NPBA 2JZRA 4TOPA 4MJCA 3WGEA 1A23A 2HNLA 3EMPA 3VURA 1EGRA 1GUHA 2V2GA 2R4VA 3HCZA 5ID2A 3TOUA 3IR4A 2LQQA 2MBSA 3M9JA 1TW9A 4HQSA 3GURA 5ECMB 19GSA 2HXKA 3F63A 3TDGA 2VCTA 3C8EA 2CZ3A 4K6XA 2XBIA 3A2WA 4MJAA 10GSA 4O5QA 5H5RA 2R3XA 1BEDA 2K8VA 4ZILA 1ZGNA 2CAQA 1J0FA 4PI0C 4TR3A 3MNGA 4PNFA 3KIJA 4MDCA 2WVXB 3HHVA 2WW2A 4FIWA 5CRGA 2DJKA 3D4TA 4HZ2A 1DE1A 1MDKA 3KZQA 2OADA 3TRQA 2LS5A 1C72A 1U87A 2H6YA 3TKPA 3BCKA 5LD0A 3IAS2 5FT3A 4FYCA 3LW9A 2FWHA 4KSOA 1GLPA 1JZRA 4V2LA 5AISA 3KM6A 1T1VA 1PSQA 3HJPA 4YAVA 1M2BA 1X9WB 4EF0A 3UEMA 4E68A 4LL4B 4IP1A 1O6JA 4LMVA 3RBTA 1XFLA 3DRNA 2H1AA 1PGTA 2DJ2A 3VI7A 5C00A 4LA1A 1TXUA 2HZEB 2C0GA 3OR5A 2FA8A 1R5AA 2LJKA 1A2MA 2FCHA 2JZSA 5A4UA 2KP2A 4HJMA 1HNAA 2IPAA 4EUYA 5KN2A 4ML1A 2CQ9A 1SYRA 2LNSA 3DVXA 2WZ9A 4ISDA 2L57A 4FXYP 1GP1A 2XPEA 3P90A 2H0HA 4POBA 3A2VA 3IA1A 4XS1A 3RHBA 5EVOA 1ZYQB 4F2IA 5A34A 2FWEA 3GIXA 2IFQA 2HSMA 4BWQA 3KJYA 4BA7A 1ML6A 4TRXA 2FY6A 3IC8A 2QKEA 4OCEA 3QFBC 4D73A 3KGKA 1NHYA 3CRUA 2VO4A 2YWOA 1T8EB 1SKRB 3GV1A 1GL8A 2GT5A 2O7KA 3ZREA 4TN8A 4G19A 1T4YA 3M3MA 5DQYA 2O36A 1PMTA 3TJGA 5IPHA 6GSSA 2AJQB 2HSHA 3UAPA 5D9TA 1OE7A 1GSDA 2N5BA 5A5KA 3ERGA 2DLXA 1Z7RA 11GSA 3M1GA 5IO2A 2CX4A 3VWUA 3IOSA 4IP6A 4KW6A 2P5RA 5EPFA 2E2MA 3GA4A 1HYUA 4OCFA 4GSNA 4MABA 5KOXA 3F8UA 3QD9A 3LORA 5ELGA 4G0KA 1OC3A 1TJDA 1O85A 3TKSA 3FZ9A 2LNTA 5HR1A 1KNGA 1JZOA 1YEXA 1AIUA 2UZ8A 1EP8A 2HFDA 3TJBA 2P5QA 2X49A 4PHZC 2H74A 1PL2A 3CRTA 3RHCA 3C1RA 1FHEA 1TK8B 3TCOA 3DGQA 5LNKe 5ECPB 3DMLA 3LEFA 2C4JA 2PGTA 4JEDA 4OFNA 3PR8A 4GSTA 4X1UA 4E8HA 2EFCA 3F6DA 2MBTA 2C3TA 2VLVA 4HS1A 5KN0A 3ERWA 1EOGA 2IMDA 2R0GA 4YQUA 2MMNA 4F9ZA 4X0XA 3LJRA 4GRFA 2IMFA 2IJYA 3EVIA 2X64A 2HYXA 1AAZA 1OC9B 3MDKA 3HZ8A 3EINA 2GLRA 2R2JA 2YJHA 4W66A 2OA7A 3TGZA 4L0WA 2H8LA 3K8NA 1LJRA 2LJRA 1TXXA 1AW9A 3UVHA 4MNNA 2B7KA 1TKDB 1NSWA 2OE1A 4GF0A 2GZPA 2KUCA 1TRVA 4POKA 4YQMA 1RQMA 4XCSA 4FYBA 2H1LA 5G30A 1K3LA 2PMTA 2VCZA 4AF2A 2JL4A 1Z6MA 1VGLA 3M0FA 4TR0A 2EFHA 1MDJA 1SD8A 2YPMA 1ZCPA 3CQFA 2DJ0A 2O3EA 3TJKA 4ZL7A 1YEPA 9GSSA 1S4BP 2DKIA 3NZNA 1Q4JA 4PQ1A 2KP1A 1XWAA 5J4UA 3BJ5A 4YH2A 2H0GA 2O87A 1N25A 2LRCA 4Z2TA 3HXSA 5A34B 1ST9A 2AYTA 4AI6A 4ZBBA 2O89A 2IFQB 5KN3A 2BMXA 2LJAA 3DIEA 3FKFA 4RQRA 4IS0A 5CO3A 4D73B 4HU7A 2HSNA 2AV4A 4HUAA 4JR4A 2FHEA 2PUKC 2E7PA 2LRTA 1BJXA 4O5UA 1EEMA 4PTSA 4G0IA 6GSYA 3F4SA 4XIHA 4XHMA 2C3QA 2D2ZA 3ZLPA 3CTFA 3FR6A 3ZMLA 3EURA 3HKRA 1TU8A 1XWKA 1T00A 2FD3A 1S3DA 1GWCA 3KH9A 3GYKA 2DMLA 5J4VA 1QUWA 2VD0A 1I5GA 3UL3A 4J56E 3KEBA 3HYPA 3APOA 4WF4A 3F3QA 5BMUB 2O5VA 1RK4A 2ZUPA 1BQ7A 4IJ3A 1OKDA 3VPQA 5HQPA 1B9YC 3ZMKA 4XRDA 5BRTA 1O8WA 2TRCP 3DXBA 5EY6A 1TK0B 4EDZA 2OT3A 3EPTA 4OWYA 5ELAA 4ZL9A 4MPFA 4RI6A 2CAIA 4BVXB 1VF3A 2YV9A 2RUEA 2H30A 5KOWA 3DD3A 2VCWA 2RUFA 2HRNA 1AXDA 3ERFA 2JACA 1TTZA 5D9WA 2H1BA 4RQXA 4GWRA 2CVDA 3CBUA 4XTSA 4K7IA 3ED3A 2YWNA 4O5RA 2DMMA 4N10A 1SL0B 3F4RA 4ZB7A 3G7JA 1XBSA 1PL1A 2DIZA 4PQIA 2YZUA 3L0HA 2WGRA 1YQ1A 4AJ7A 1N2AA 5CRHA 3VPTA 4FQUA 1JZDA 4PXOA 4QQ7A 4OFMA 1ILOA 1MD3A 2IIYA 4WKWA 2ZNMA 4GSSA 2C0EA 4K7NA 1HQOA 1Z9HA 1WRYA 1DBYA 1M99A 3EC3A 1M9AA 1CQGA 2H75A 2QA1A 2Z9SA 2H72A 5DCHA 3HJMA 3FK8A 4KF9A 1XWBA 3IHQA 2DBCA 3VWXA 2VIMA 4EC0A 4V1Ap 1G7EA 2H76A 2MMAA 3D22A 3TKSE 5INYA 3G9BA 1PD21 3GRXA 3M9KA 4Q5NA 2GSRA 2GQKA 1THXA 4KGIA 1WJKA 3PINA 5ECQB 5D8IA 2X8HA 5IM9A 3ZITA 4KUNA 3NIVA 1K3OA 2L4QA 1F6MC 3WT1A 2DKHA 5IMFA 1FB6A 5G2ZA 1GSFA 2VD1A 4N0ZA 1OE8A 2XC2A 2OBKA 3A3TA 5KN1A 4IBPA 2I9HA 1ZZYA 1X0RA 4NV2A 4EVMA 5J41A 2IMEA 2EIRA 2F8FA 2YWIA 1SK1A 2L6CA 4MZBA 4BIKA 3Q18A 2N5AA 18GSA 2WVZA 3W6GA 1SJIA 1O73A 2JZTA 1FVJA 1JZWA 1E2YA 2EIQA 1XOAA 3IXRA 4KSMA 4BL7A 1YY7A 5CRDA 2H1DA 1B4QA 3V1WA 1G6WA 1U3IA 1O7UA 6GSWA 1H75A 1YEWC 4O32A 4TXVA 4WXTA 1GSSA 4MZCA 3TKQA 3IDVA 1J08A 5HFKA 2C0DA 3QDNA 3P8WA 5A5HB 1NHOA 16GSA 4LLRA 3CMIA 4MJEA 2O85A 3BD2A 4I2UA 1O81A 3HD5A 3C73A 4CY6A 2H1GA 4IKHA 1T7PB 2RIIA 5F05A 3S9FA 3ZIVA 12GSA 5DCGA 5ECRB 1EGOA 3FW2A 5D93A 1BAYA 1XZOA 1TDIA 5A1NA 5HR0A 1KEBA 2L59A 4PUFC 3US3A 4NMUA 2WFCA 5DJMA 4I5QA 3UIWA 2N5FA 5ECSA 2VAFA 3MSZA 2E2GA 5ECIB 3CSIA 4ILFA 5JCUA 3L9UA 2B1KA 5B8BA 5JCWA 2PWJA 1YKCA 1ERVA 4GDFA 3IK7A 2CT6A 4N11A 2P0GA 2K18A 5CAXA 5B6MA 1EV9A 5J3RA 4GCIA 1U3AA 4XS4A 4MH2A 2GSQA 1PN0A 4NWYA 4MZWA 1SENA 3C1SA 1FOVA 4J2FA 1Z7PA 4ZB8A 4PURA 1H4OA 3IK9A 3APSA 1NM3A 2GSTA 1S3RA 1G6YA 1NW2A 1ERTA 2BJXA 4FH8A 1Y1UA 3LWAA 2HRKB 3H79A 2AHEA 2LRNA 1XOBA 4HSCX 3GL3A 3TJJA 4I2TA 3IBHA 4KCEA 4DVCA 5J9BA 5IMDA 3H93A 1QXHA 1WP0A 5CP1A 2VCXA 2KHPA 3D5JA 5AIVA 4RUVA 4EL1A 1BG1A 4K8MA 3RDWA 4I97A 3CXGA 2F3MA 4PI2C 1XW6A 4V2NA 4Z2RA 3IE3A 3KMOA 4ZB9A 2V6KA 3TRXA 1W89A 6GSXA 3AY8A 3ZRDA 2B6MA 1F2EA 5G5FA 3TKSC 2H66A 1UA5A 5G5EA 3CSHA 2C3NA 2VUPA 3J7Yb 1JHBA 7GSSA 3DKSA 5CNWA 4BL7B 4YKFA 4JZQA 2HT9A 5ID2B 3HZ4A 3GH9A 3EE2A 5HFIA 2M80A 2VKZG 1M3JA 4I6XA 1GSUA 5IQYA 2L5LA 3FR3A 4TKYA 4WETA 4ECCA 2IMIA 1KBNA 2MZCA 3FHKA 1X9MB 2B7JA 2K8SA 4IQ1A 3LG6A 4J57E 2WS2A 1GNEA 2B3SA 2X99A 3EU3A 3JCML 4QL9A 4O92A 2ES7A 5H5QA 2GSSA 4ECBA 2UV8G 3QFAC 1XW9A 3WGDA 4K2DA 2GT6A 3QPMA 1F3BA 4MF5A 3P2AA 3HJOA 4Q5FA 5A1NB 2GS3A 2DJ3A 4OD7A 2A4HA 1T3BA 4DSSA 5GAPD 4A5PA 2J23A 1PKZA 2E0QA 1K0MA 4Q5QA 3QOUA 2X8CA 4WR4A 1U6TA 4N3ZA 5HR3A 3O6TA 1BF5A 1BYEA 2H71A 4CY8A 3Q74A 2KOKA 3A5IA 1JLVA 4MPGA 3FEUA 1EEJA 4XS4B 4TXOA 3TUEA 1TI3A 3KXOA 3ZYWA 2JU5A 3Q19A 4EIQA 5JWQB 1M0UA 3GTUA 2C1YA 2LQOA 2L6DA 1XG8A 3M8NA 3UJ1A 4PX1A 1DUGA 3U6VA 5F07A 4ECJA 1T4ZA 3ISOA 2HSMB 5ECNB 4FO5A 1QGVA 1K0NA 3IC4A 2A2SA 1SL1B 1RW1A 2G2QA 2EFEA 1DSBA 3SWLA 3F3RA 4WBJA 3FZAA 4I8BA 3IHGA 1M7TA 1GULA 1URMA 1WMJA 4EKZA 2VCQA 4IN0A 1X9SB 2GZYA 5DALA 5IIZA 3U5RE 2YANA 1SJ6A 1XVWA 2H19A 4CDOA 3N5OA 3GX8A 2AAWA 4JU5A 2FUG2 4X4JA 5DJLA 1OAZA 3F6FA 1QMVA 4EE0A 1A2JA 4PUAA 1Z5YE 1ACVA 4MK3A 1TOFA 4OO4A 2VOCA 5IOXA 4Q5RA 1YJ6A 2QGVA 3R2QA 3VFIA 1V2AA 2R6KA 3QAWA 4POLA 5IMCA 1MTCA 3ZL5A 3TKRA 1E6BA 1ZYNA 4GXZA 1HNCA 3MYDA 1GH2A 1EV4A 1J9BA 1FAAA 3HY2A 2CX3A 1FO5A 3GSSA 3L78A 2R5GA 1BX9A 3FRCA 2I4AA 2DC5A 5D9VA 4MA9A 5IMZA 5CRWA 4OMVA 2R37A 3EWLA 5EL8A 1A8YA 2H70A 3TB2A 2PPTA 3WD6A 2GQMA 3KCMA 4BVYA 1ZMAA 2RM6A 1ERWA 2R0CA 2YZHA 1R7HA 3UVTA 1GRXA 4DSSB 2WVXA 2DIYA 4IQAA 3BOAA 3Q6OA 3GN3A 3I9V2 1SL2B 4KDUA 2VL3A 3CHXC 1SVMA 3H1NA 1G0TA 1R5PA 3HA9A 2NVLA 3ZZXA 3W8SA 1X5DA 2LKUA 1GUMA 3WYWA 2DJJA 5J4YA 4G01A 5D9XA 2WULA 2JADA 1MEKA 1X5CA 4TXOB 6GSVA 1SKSB 1AQXA 3GKMA 3IRAA 1I1IP 5CREA 2X8GA 3FR9A 1B4PA 4FYUA 3GTUB 1XPVA 1ABAA 4MLYA 5J5NA 2VCVA 3MAKA 1ZYPA 1K3YA 2L4CA 3SBCA 2O8VB 4LMWA 4ZBAA 3GL5A 1PX7A 5A4WA 1LU4A 3VK9A 3UOMA 2OKAA 3GFKA 8GSSA 2C0FA 3HMJG 1SK2A 1MDIA 1Z6NA 2GVPA 2HRAA 3APQA 3TU3B 2QA2A 1EP7A 1K0DA 1U88A 2HSNB 3IV4A 3GH6A 1SD9A 1PA3A 4IW9A 1O8XA 2WB9A 5J40A 4YQVA 2XPDA 3UMAA 1XW5A 5DALB 3HVXA 2B5YA 2R0PA 4NHWA 1A0FA 5AIXA 3LYPA 3H4KA 1ZL9A 2YOIA 2PU9C 2YP6A 5E4WA 2FNOA 3WGXA 4K2XA 1B48A 3UBKA 4HZ4A 2HI7A 3PH9A 1M9BA 2H6XA 4AJ8A 4KAEA 3HVNA 3FZ4A 4DEJA 2F9SA 2WJUA 3EMXA 2AUVA 1KTEA 4Z2UA 4F0BA 2VL2C 2ON7A 2PERA 2QC7A 1YZXA 3GNJA 5F0GA 1B9XC 4AGSA 2VL2A 4E8EA 4YAPA 2MMZA 4CW9A 5GAND 2OE0A 1OVNA 4JE1A 4O7HA 4NV5A 2AB6A 1GNWA 4EIPA 2X4AA 4GTUA 3QCPA 4MF6A 3I43A 4XRAA 1Y25A 4MF7A 2NTOA 3QR6A 3DWVA 3ME8A 1M3IA 4ML6A 3O76A 1GTAA 1YKAA 2IN3A 1YDKA 3N9JA 3EYTA 1IYIA 4POMA 3C71A 4QL7A 4WBRD 4KA0A 3IAM2 4BVYB 3RPNA 2YWMA 5DDLA 1M2AA 2LTKA 3D0ZA 3ME7A 1S3CA 2LV3A 5FHIA 4KDXA 2IMKA 4IJIA 3H8QA 3WT2A 5G1KA 1XVQA 2A4VA 1IYHA 3FZ5A 1YVLA 3E9JB 4TR4A 1WOUA 5F06A 4QMKA 2F8AA 2B5XA 1XXUA 1MD4A 1A24A 1OC9A 4HEA2 2OACA 2GDRA 4K9ZA 1GSEA 2NDOA 5ABRA 2GZZA 2EIOA 2H0IA 5L71A 3L9SA 1UC7A 2DJ1A 4LL1B
chains in the Genus database with same CATH topology
2CZ2A 5KEJA 4K5RA 3ZIJA 4IGJA 2FA4A 5IO0A 3VI5A 20GSA 4KE3A 4IHUA 4WR5A 1JFUA 1M2DA 1F9MA 2OBIA 3QMXA 4KH7A 3EU4A 4N0VA 2TIRA 3F0IA 4KB3A 1USBA 5JWRB 5D73A 2YV7A 1ZYEA 4L0UA 4HDEA 4NXIA 3PGTA 4ID0A 4Z7XA 1QQ2A 3G7IA 1Y6EA 3HVVA 2C80A 1N8JA 2JSYA 1OYJA 3HDCA 5DQSA 5HFGA 3ZTLA 1V58A 4OFTA 5J9CA 5JWOB 2J9HA 3VLNA 1K0BA 4OO5A 2CA8A 3NOFA 2QSIA 2VM1A 3KP8A 3GSTA 3ZFBA 2EC4A 4AKIA 3E3EA 1GTIA 2M72A 1FG4A 5LCZA 4TW5A 2F51A 3D21A 4EDYA 1WIKA 3CYNA 3QAGA 5AN1A 2GTUA 1A8LA 2P31A 4HU9A 1SVOA 1SJZA 4PQHA 1WPIA 1HD2A 1TRUA 4ZXGA 1SKWB 1SVLA 13GSA 2RM5A 5JCGA 5BMUA 5B8AA 2M46A 5AGYA 4P3YB 4V1Ag 3HVSA 2HE3A 3GUSA 3GKKA 3A5WA 3P7XA 2WDUA 3CTGA 2JSZA 4ACSA 3FY7A 1JLWA 3G7YA 1XCCA 3IPZA 3KTBA 4BVXA 2PN8A 2REMA 1FOHA 1Q98A 1WWJA 3VWVA 4K1FA 4ZIJA 2ON5A 1TRSA 4ZB6A 5DAKA 2H6ZA 2PVQA 3KMNA 2LUSA 4IELA 3PPUA 2WCIA 4KX4A 1CQHA 4IVFA 1OC8A 1G7OA 1TRWA 3LYKA 4ICYA 3QAVA 4ECIA 2A2PA 4G2EA 2CVKA 2MMOA 5G1LA 1Z3EA 4JBBA 4BWSA 4ULXA 1F3AA 4F03A 6GSUA 1XIYA 2GQLA 4WF5A 4K0NA 2K6VA 4MCUA 1UVZA 3GKXA 2HLSA 4PNGA 3F9UA 1FW1A 1R26A 2FLSA 2H01A 3CWGA 5E59A 5B6NA 2FWFA 2EFDA 1A2LA 2V41A 2A2RA 4TR1A 2ZCTA 2FWGA 4JRRA 2TRXA 4XS6A 3ZVJD 4G0LA 2YCDA 1W4VA 2ALBA 2GGTA 4NPBA 1FVKA 4HQZA 5DBQA 3LSZA 4DSRA 4G9HA 14GSA 4CHSA 3ZVJA 1WE0A 1V40A 4L8EA 2PBJA 1TP9A 4N30A 5IMVA 3L9VA 1GUKA 4K0GA 4MH3A 1K0OA 1VRSD 1B8XA 5F8BA 1PKWA 3E0UA 5C04A 1DE2A 3R3EA 2PVOC 1K0CA 3L4NA 4PGTA 3KTLA 2MYGA 22GSA 5ENUA 4ZL8A 3O3TA 5IMAA 2B5EA 2L5OA 2KLXA 4DSQA 5GZZB 3DVWA 3LGCA 2CVBA 4RI7A 2C8UA 2VLUA 2RLIA 3GMFA 1FB0A 4GQFA 2YNXA 1A0RP 2H73A 1V57A 1OKTA 17GSA 1F37A 4K7OA 1YF1A 2XHFA 2WRTA 1K0AA 1I9DA 1XWGA 1GLQA 1EZKA 2V6OA 5FWGA 2G0FA 3RPPA 3GX0A 3TOTA 3RAZA 1EOHA 4K5SA 1LBKA 2YN1A 4L5OA 1TK5B 3BBYA 5H5SA 5A4VA 3LFLA 1S3AA 5DAKB 1AUCA 4USSA 4HJ2A 3LXZA 4F0CA 3VWWA 5A5HA 3GHAA 1QFNA 1R4WA 1BG5A 2HSYA 1V98A 2I81A 2FGXA 4MJBA 1SU9A 1PRXA 5B7CA 1UN2A 1EWXA 1PX6A 2LSTA 4TVEA 2V32A 3DYRA 4EXJA 3F4TA 2IWTA 4WEYA 3LXTA 4KCAA 2VL9A 5ECLB 5GSTA 5GSSA 4JR6A 3DEXA 4NHZA 4AKXB 4HOJA 4X43A 1GSQA 1AQWA 2XBQA 1THOA 1GTUA 6GSTA 4GLTA 3TRPA 1X5EA 4BPYA 4G10A 3BCIA 3KD0A 3CSJA 1PN9A 5HR2A 4GQCA 1SK0A 5D96A 1TU7A 1GSYA 2OE3A 2OJLA 3MWHA 3FYGA 1VF2A 3FMWA 1GTBA 2HZEA 3W8JA 5IPGA 5IOWA 4TR1B 1AQVA 2NBSA 5CYYA 3C7MA 4MP4A 4KDYA 3J7Yk 5J47A 2VM2A 1VF1A 3KP9A 1ON4A 4H86A 3ZFLA 4AKHA 2HQTA 3I69A 1ERUA 3UARA 4NAXA 3GKNA 4EO3A 4AJ6A 1V9WA 2B1LA 1QK8A 3MIXA 1AC1A 2V1MA 1YF0A 5ECOB 2YJ7A 1HNBA 3UBLA 1PQNA 2HRKA 2HRFA 4KNDA 4V2MA 2BTOT 2LEGA 1VF4A 4L5LA 2DSAA 3I6AA 5G31A 3TJFA 4F82A 1XWCA 3D4MA 5COHA 3D6IA 1TI1A 3LQ7A 5DVBA 3A2XA 4YKGA 2I1UA 4HI7A 5ECHB 2VLTA 4AKGA 2IL3A 2CV4A 2HZFA 2K9FA 3KH7A 1ZOFA 1SYXA 5ECKB 4ZBDA 2I3YA 4MMMA 2NPBA 2JZRA 4TOPA 4MJCA 3WGEA 1A23A 2HNLA 3EMPA 3VURA 1EGRA 1GUHA 2V2GA 2R4VA 3HCZA 5ID2A 3TOUA 3IR4A 2LQQA 2MBSA 3M9JA 1TW9A 4HQSA 3GURA 5ECMB 19GSA 2HXKA 3F63A 3TDGA 2VCTA 3C8EA 2CZ3A 4K6XA 2XBIA 3A2WA 4MJAA 10GSA 4O5QA 5H5RA 2R3XA 1BEDA 2K8VA 4ZILA 1ZGNA 2CAQA 1J0FA 4TR3A 3MNGA 4PNFA 3KIJA 4MDCA 3HHVA 4FIWA 5CRGA 2DJKA 3D4TA 4HZ2A 1DE1A 1MDKA 3KZQA 2OADA 3TRQA 2LS5A 1C72A 1U87A 2H6YA 3TKPA 3BCKA 5LD0A 3IAS2 5FT3A 4FYCA 3LW9A 2FWHA 4KSOA 1GLPA 1JZRA 4V2LA 5AISA 3KM6A 1T1VA 1PSQA 3HJPA 4YAVA 1M2BA 1X9WB 4EF0A 3UEMA 4E68A 4LL4B 4IP1A 1O6JA 4LMVA 3RBTA 1XFLA 3DRNA 2H1AA 1PGTA 2DJ2A 3VI7A 5C00A 4LA1A 1TXUA 2HZEB 2C0GA 3OR5A 2FA8A 1R5AA 2LJKA 1A2MA 2FCHA 2JZSA 5A4UA 2KP2A 4HJMA 1HNAA 2IPAA 4EUYA 5KN2A 4ML1A 2CQ9A 1SYRA 2LNSA 2WZ9A 3DVXA 4ISDA 2L57A 1GP1A 2XPEA 3P90A 2H0HA 4POBA 3A2VA 3IA1A 4XS1A 3RHBA 5EVOA 1ZYQB 4F2IA 5A34A 2FWEA 3GIXA 2IFQA 2HSMA 4BWQA 3KJYA 4BA7A 1ML6A 4TRXA 2FY6A 3IC8A 2QKEA 4OCEA 3QFBC 4D73A 3KGKA 1NHYA 3CRUA 2VO4A 2YWOA 1T8EB 1SKRB 3GV1A 1GL8A 2GT5A 2O7KA 3ZREA 4TN8A 4G19A 1T4YA 3M3MA 5DQYA 1PMTA 3TJGA 5IPHA 6GSSA 2AJQB 2HSHA 3UAPA 5D9TA 1OE7A 1GSDA 2N5BA 5A5KA 3ERGA 2DLXA 1Z7RA 11GSA 3M1GA 5IO2A 2CX4A 3VWUA 3IOSA 4IP6A 4KW6A 2P5RA 5EPFA 2E2MA 3GA4A 1HYUA 4OCFA 4GSNA 4MABA 5KOXA 3F8UA 3QD9A 3LORA 5ELGA 4G0KA 1OC3A 1TJDA 1O85A 3TKSA 3FZ9A 2LNTA 5HR1A 1KNGA 1JZOA 1YEXA 1AIUA 2UZ8A 1EP8A 2HFDA 3TJBA 2P5QA 2X49A 2H74A 1PL2A 3CRTA 3RHCA 3C1RA 1FHEA 1TK8B 3TCOA 3DGQA 5LNKe 5ECPB 3DMLA 3LEFA 2C4JA 2PGTA 4JEDA 4OFNA 3PR8A 4GSTA 4X1UA 4E8HA 2EFCA 3F6DA 2MBTA 2C3TA 2VLVA 4HS1A 5KN0A 3ERWA 1EOGA 2IMDA 2R0GA 4YQUA 2MMNA 4F9ZA 4X0XA 3LJRA 4GRFA 2IMFA 2IJYA 3EVIA 2X64A 2HYXA 1AAZA 1OC9B 3MDKA 3HZ8A 3EINA 2GLRA 2R2JA 2YJHA 4W66A 2OA7A 3TGZA 4L0WA 2H8LA 3K8NA 1LJRA 2LJRA 1TXXA 1AW9A 3UVHA 4MNNA 2B7KA 1TKDB 1NSWA 2OE1A 4GF0A 2GZPA 2KUCA 1TRVA 4POKA 4YQMA 1RQMA 4XCSA 4FYBA 2H1LA 5G30A 1K3LA 2PMTA 2VCZA 4AF2A 2JL4A 1Z6MA 1VGLA 3M0FA 4TR0A 2EFHA 1MDJA 1SD8A 2YPMA 1ZCPA 2DJ0A 3TJKA 4ZL7A 1YEPA 9GSSA 2DKIA 3NZNA 1Q4JA 4PQ1A 2KP1A 1XWAA 5J4UA 3BJ5A 4YH2A 2H0GA 2O87A 1N25A 2LRCA 4Z2TA 3HXSA 5A34B 1ST9A 2AYTA 4AI6A 4ZBBA 2O89A 2IFQB 5KN3A 2BMXA 2LJAA 3DIEA 3FKFA 4RQRA 4IS0A 5CO3A 4D73B 4HU7A 2HSNA 2AV4A 4HUAA 4JR4A 2FHEA 2PUKC 2E7PA 2LRTA 1BJXA 4O5UA 1EEMA 4PTSA 4G0IA 6GSYA 3F4SA 4XIHA 4XHMA 2C3QA 2D2ZA 3ZLPA 3CTFA 3FR6A 3ZMLA 3EURA 3HKRA 1TU8A 1XWKA 1T00A 2FD3A 1S3DA 1GWCA 3KH9A 3GYKA 2DMLA 5J4VA 1QUWA 2VD0A 1I5GA 3UL3A 4J56E 3KEBA 3HYPA 3APOA 4WF4A 3F3QA 5BMUB 2O5VA 1RK4A 2ZUPA 1BQ7A 4IJ3A 1OKDA 3VPQA 5HQPA 1B9YC 3ZMKA 4XRDA 5BRTA 1O8WA 2TRCP 3DXBA 5EY6A 1TK0B 4EDZA 2OT3A 3EPTA 4OWYA 5ELAA 4ZL9A 4MPFA 4RI6A 2CAIA 4BVXB 1VF3A 2YV9A 2RUEA 2H30A 5KOWA 3DD3A 2VCWA 2RUFA 2HRNA 1AXDA 3ERFA 2JACA 1TTZA 5D9WA 2H1BA 4RQXA 4GWRA 2CVDA 3CBUA 4XTSA 4K7IA 3ED3A 2YWNA 4O5RA 2DMMA 4N10A 1SL0B 3F4RA 4ZB7A 3G7JA 1XBSA 1PL1A 2DIZA 4PQIA 2YZUA 3L0HA 2WGRA 1YQ1A 4AJ7A 1N2AA 5CRHA 3VPTA 4FQUA 1JZDA 4PXOA 4QQ7A 4OFMA 1ILOA 1MD3A 2IIYA 4WKWA 2ZNMA 4GSSA 2C0EA 4K7NA 1HQOA 1Z9HA 1WRYA 1DBYA 1M99A 3EC3A 1M9AA 1CQGA 2H75A 2QA1A 2Z9SA 2H72A 5DCHA 3HJMA 3FK8A 4KF9A 1XWBA 3IHQA 2DBCA 3VWXA 2VIMA 4EC0A 4V1Ap 1G7EA 2H76A 2MMAA 3D22A 3TKSE 5INYA 3G9BA 1PD21 3GRXA 3M9KA 4Q5NA 2GSRA 2GQKA 1THXA 4KGIA 1WJKA 3PINA 5ECQB 5D8IA 2X8HA 5IM9A 3ZITA 4KUNA 3NIVA 1K3OA 2L4QA 1F6MC 3WT1A 2DKHA 5IMFA 1FB6A 5G2ZA 1GSFA 2VD1A 4N0ZA 1OE8A 2XC2A 2OBKA 3A3TA 5KN1A 4IBPA 2I9HA 1ZZYA 1X0RA 4NV2A 4EVMA 5J41A 2IMEA 2EIRA 2F8FA 2YWIA 1SK1A 2L6CA 4MZBA 3Q18A 2N5AA 18GSA 3W6GA 1SJIA 1O73A 2JZTA 1FVJA 1JZWA 1E2YA 2EIQA 1XOAA 3IXRA 4KSMA 4BL7A 1YY7A 5CRDA 2H1DA 1B4QA 3V1WA 1G6WA 1U3IA 1O7UA 6GSWA 1H75A 4O32A 4TXVA 4WXTA 1GSSA 4MZCA 3TKQA 3IDVA 1J08A 5HFKA 2C0DA 3QDNA 3P8WA 5A5HB 1NHOA 16GSA 4LLRA 3CMIA 4MJEA 2O85A 3BD2A 4I2UA 1O81A 3HD5A 3C73A 4CY6A 2H1GA 4IKHA 1T7PB 2RIIA 5F05A 3S9FA 3ZIVA 12GSA 5DCGA 5ECRB 1EGOA 3FW2A 5D93A 1BAYA 1XZOA 1TDIA 5A1NA 5HR0A 1KEBA 2L59A 4PUFC 3US3A 4NMUA 2WFCA 5DJMA 4I5QA 3UIWA 2N5FA 5ECSA 2VAFA 3MSZA 2E2GA 5ECIB 3CSIA 4ILFA 5JCUA 3L9UA 2B1KA 5B8BA 5JCWA 2PWJA 1YKCA 1ERVA 4GDFA 3IK7A 2CT6A 4N11A 2P0GA 2K18A 5CAXA 5B6MA 1EV9A 5J3RA 4GCIA 1U3AA 4XS4A 4MH2A 2GSQA 1PN0A 4NWYA 4MZWA 1SENA 3C1SA 1FOVA 4J2FA 1Z7PA 4ZB8A 4PURA 1H4OA 3IK9A 3APSA 1NM3A 2GSTA 1G6YA 1NW2A 1ERTA 2BJXA 4FH8A 1Y1UA 3LWAA 2HRKB 3H79A 2AHEA 2LRNA 1XOBA 3GL3A 3TJJA 4I2TA 3IBHA 4KCEA 4DVCA 5J9BA 5IMDA 3H93A 1QXHA 1WP0A 5CP1A 2VCXA 2KHPA 3D5JA 5AIVA 4RUVA 4EL1A 1BG1A 4K8MA 3RDWA 4I97A 3CXGA 2F3MA 1XW6A 4V2NA 4Z2RA 3IE3A 3KMOA 4ZB9A 2V6KA 3TRXA 1W89A 6GSXA 3AY8A 3ZRDA 2B6MA 1F2EA 5G5FA 3TKSC 2H66A 1UA5A 5G5EA 3CSHA 2C3NA 2VUPA 3J7Yb 1JHBA 7GSSA 3DKSA 5CNWA 4BL7B 4YKFA 4JZQA 2HT9A 5ID2B 3HZ4A 3GH9A 3EE2A 5HFIA 2M80A 2VKZG 4I6XA 1GSUA 5IQYA 2L5LA 3FR3A 4TKYA 4WETA 4ECCA 2IMIA 1KBNA 2MZCA 3FHKA 1X9MB 2B7JA 2K8SA 4IQ1A 3LG6A 4J57E 2WS2A 1GNEA 2B3SA 2X99A 3EU3A 3JCML 4QL9A 4O92A 2ES7A 5H5QA 2GSSA 4ECBA 2UV8G 3QFAC 1XW9A 3WGDA 4K2DA 2GT6A 3QPMA 1F3BA 4MF5A 3P2AA 3HJOA 4Q5FA 5A1NB 2GS3A 2DJ3A 4OD7A 2A4HA 1T3BA 4DSSA 5GAPD 4A5PA 2J23A 1PKZA 2E0QA 1K0MA 4Q5QA 3QOUA 2X8CA 4WR4A 1U6TA 4N3ZA 5HR3A 3O6TA 1BF5A 1BYEA 2H71A 4CY8A 3Q74A 2KOKA 3A5IA 1JLVA 4MPGA 3FEUA 1EEJA 4XS4B 4TXOA 3TUEA 1TI3A 3KXOA 3ZYWA 2JU5A 3Q19A 4EIQA 5JWQB 1M0UA 3GTUA 2C1YA 2LQOA 2L6DA 3M8NA 3UJ1A 4PX1A 1DUGA 3U6VA 5F07A 4ECJA 1T4ZA 3ISOA 2HSMB 5ECNB 4FO5A 1QGVA 1K0NA 3IC4A 2A2SA 1SL1B 1RW1A 2G2QA 2EFEA 1DSBA 3SWLA 3F3RA 4WBJA 3FZAA 4I8BA 3IHGA 1M7TA 1GULA 1URMA 1WMJA 4EKZA 2VCQA 4IN0A 1X9SB 2GZYA 5DALA 5IIZA 3U5RE 2YANA 1SJ6A 1XVWA 2H19A 4CDOA 3N5OA 3GX8A 2AAWA 4JU5A 2FUG2 4X4JA 5DJLA 1OAZA 3F6FA 1QMVA 4EE0A 1A2JA 4PUAA 1Z5YE 1ACVA 4MK3A 1TOFA 4OO4A 2VOCA 5IOXA 4Q5RA 1YJ6A 2QGVA 3R2QA 3VFIA 1V2AA 2R6KA 3QAWA 4POLA 5IMCA 1MTCA 3ZL5A 3TKRA 1E6BA 1ZYNA 4GXZA 1HNCA 3MYDA 1GH2A 1EV4A 1J9BA 1FAAA 3HY2A 2CX3A 1FO5A 3GSSA 3L78A 2R5GA 1BX9A 3FRCA 2I4AA 2DC5A 5D9VA 4MA9A 5IMZA 5CRWA 4OMVA 2R37A 3EWLA 5EL8A 1A8YA 2H70A 3TB2A 2PPTA 3WD6A 2GQMA 3KCMA 4BVYA 1ZMAA 2RM6A 1ERWA 2R0CA 2YZHA 1R7HA 3UVTA 1GRXA 4DSSB 2DIYA 4IQAA 3BOAA 3Q6OA 3GN3A 3I9V2 1SL2B 4KDUA 2VL3A 1SVMA 3H1NA 1G0TA 1R5PA 3HA9A 2NVLA 3ZZXA 3W8SA 1X5DA 2LKUA 1GUMA 3WYWA 2DJJA 5J4YA 4G01A 5D9XA 2WULA 2JADA 1MEKA 1X5CA 4TXOB 6GSVA 1SKSB 1AQXA 3GKMA 3IRAA 5CREA 2X8GA 3FR9A 1B4PA 4FYUA 3GTUB 1XPVA 1ABAA 4MLYA 5J5NA 2VCVA 3MAKA 1ZYPA 1K3YA 2L4CA 3SBCA 2O8VB 4LMWA 4ZBAA 3GL5A 1PX7A 5A4WA 1LU4A 3VK9A 3UOMA 2OKAA 3GFKA 8GSSA 2C0FA 3HMJG 1SK2A 1MDIA 1Z6NA 2GVPA 2HRAA 3APQA 3TU3B 2QA2A 1EP7A 1K0DA 1U88A 2HSNB 3IV4A 3GH6A 1SD9A 1PA3A 4IW9A 1O8XA 2WB9A 5J40A 4YQVA 2XPDA 3UMAA 1XW5A 5DALB 3HVXA 2B5YA 2R0PA 4NHWA 1A0FA 5AIXA 3LYPA 3H4KA 1ZL9A 2YOIA 2PU9C 2YP6A 5E4WA 2FNOA 3WGXA 4K2XA 1B48A 3UBKA 4HZ4A 2HI7A 3PH9A 1M9BA 2H6XA 4AJ8A 4KAEA 3FZ4A 4DEJA 2F9SA 2WJUA 3EMXA 2AUVA 1KTEA 4Z2UA 4F0BA 2VL2C 2ON7A 2PERA 2QC7A 1YZXA 3GNJA 5F0GA 1B9XC 4AGSA 2VL2A 4E8EA 4YAPA 2MMZA 4CW9A 5GAND 2OE0A 1OVNA 4JE1A 4O7HA 4NV5A 2AB6A 1GNWA 4EIPA 2X4AA 4GTUA 3QCPA 4MF6A 3I43A 4XRAA 1Y25A 4MF7A 2NTOA 3QR6A 3DWVA 3ME8A 4ML6A 3O76A 1GTAA 1YKAA 2IN3A 1YDKA 3N9JA 3EYTA 1IYIA 4POMA 3C71A 4QL7A 4WBRD 4KA0A 3IAM2 4BVYB 3RPNA 2YWMA 5DDLA 1M2AA 2LTKA 3D0ZA 3ME7A 1S3CA 2LV3A 5FHIA 4KDXA 2IMKA 4IJIA 3H8QA 3WT2A 5G1KA 1XVQA 2A4VA 1IYHA 3FZ5A 1YVLA 3E9JB 4TR4A 1WOUA 5F06A 4QMKA 2F8AA 2B5XA 1XXUA 1MD4A 1A24A 1OC9A 4HEA2 2OACA 2GDRA 4K9ZA 1GSEA 2NDOA 5ABRA 2GZZA 2EIOA 2H0IA 5L71A 3L9SA 1UC7A 2DJ1A 4LL1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CZ2 A;  5KEJ A;  3ZIJ A;  4IGJ A;  2FA4 A;  5IO0 A;  3VI5 A;  20GS A;  4KE3 A;  4IHU A;  4WR5 A;  1JFU A;  1M2D A;  1F9M A;  2OBI A;  3QMX A;  4KH7 A;  3EU4 A;  4N0V A;  2TIR A;  3F0I A;  4KB3 A;  1USB A;  5JWR B;  5D73 A;  2YV7 A;  1ZYE A;  4L0U A;  4HDE A;  4NXI A;  3PGT A;  4ID0 A;  4Z7X A;  1QQ2 A;  3G7I A;  1Y6E A;  3HVV A;  2C80 A;  1N8J A;  2JSY A;  1OYJ A;  3HDC A;  5DQS A;  5HFG A;  3ZTL A;  1V58 A;  4OFT A;  5J9C A;  5JWO B;  2J9H A;  3VLN A;  1K0B A;  4OO5 A;  2CA8 A;  3NOF A;  2QSI A;  2VM1 A;  3KP8 A;  3GST A;  3ZFB A;  2EC4 A;  3E3E A;  1GTI A;  2M72 A;  1FG4 A;  5LCZ A;  4TW5 A;  2F51 A;  3D21 A;  4EDY A;  1WIK A;  3CYN A;  3QAG A;  5AN1 A;  2GTU A;  1A8L A;  2P31 A;  4HU9 A;  1SJZ A;  4PQH A;  1WPI A;  1HD2 A;  1TRU A;  4ZXG A;  1SKW B;  13GS A;  2RM5 A;  5JCG A;  5BMU A;  5B8A A;  2M46 A;  5AGY A;  4P3Y B;  4V1A g;  3HVS A;  2HE3 A;  3GUS A;  3GKK A;  3A5W A;  3P7X A;  2WDU A;  3CTG A;  2JSZ A;  4ACS A;  3FY7 A;  1JLW A;  3G7Y A;  1XCC A;  3IPZ A;  3KTB A;  4BVX A;  2PN8 A;  2REM A;  1Q98 A;  1WWJ A;  3VWV A;  4K1F A;  4ZIJ A;  2ON5 A;  1TRS A;  4ZB6 A;  5DAK A;  2H6Z A;  2PVQ A;  3KMN A;  2LUS A;  4IEL A;  3PPU A;  2WCI A;  4KX4 A;  1CQH A;  4IVF A;  1OC8 A;  1G7O A;  1TRW A;  3LYK A;  3QAV A;  4ECI A;  4G2E A;  2CVK A;  2MMO A;  5G1L A;  1Z3E A;  4JBB A;  4BWS A;  4ULX A;  1F3A A;  4F03 A;  6GSU A;  1XIY A;  2GQL A;  4WF5 A;  4K0N A;  2K6V A;  4MCU A;  1UVZ A;  3GKX A;  2HLS A;  4PNG A;  3F9U A;  1FW1 A;  1R26 A;  2FLS A;  2H01 A;  5E59 A;  5B6N A;  2FWF A;  1A2L A;  2V41 A;  2A2R A;  4TR1 A;  2ZCT A;  2FWG A;  4JRR A;  2TRX A;  4XS6 A;  3ZVJ D;  4G0L A;  2YCD A;  1W4V A;  2ALB A;  2GGT A;  4NPB A;  1FVK A;  4HQZ A;  5DBQ A;  3LSZ A;  4DSR A;  4G9H A;  14GS A;  4CHS A;  3ZVJ A;  1WE0 A;  1V40 A;  4L8E A;  2PBJ A;  1TP9 A;  4N30 A;  5IMV A;  3L9V A;  1GUK A;  4K0G A;  4MH3 A;  1K0O A;  1VRS D;  1B8X A;  5F8B A;  1PKW A;  3E0U A;  5C04 A;  1DE2 A;  3R3E A;  2PVO C;  1K0C A;  3L4N A;  4PGT A;  3KTL A;  2MYG A;  22GS A;  5ENU A;  4ZL8 A;  3O3T A;  5IMA A;  2B5E A;  2L5O A;  2KLX A;  4DSQ A;  5GZZ B;  3DVW A;  3LGC A;  2CVB A;  4RI7 A;  2C8U A;  2VLU A;  2RLI A;  3GMF A;  1FB0 A;  4GQF A;  2YNX A;  1A0R P;  2H73 A;  1V57 A;  1OKT A;  17GS A;  1F37 A;  4K7O A;  1YF1 A;  2XHF A;  2WRT A;  1K0A A;  1I9D A;  1XWG A;  1GLQ A;  1EZK A;  2V6O A;  5FWG A;  2G0F A;  3RPP A;  3GX0 A;  3TOT A;  3RAZ A;  1EOH A;  1LBK A;  2YN1 A;  4L5O A;  1TK5 B;  3BBY A;  5H5S A;  5A4V A;  3LFL A;  1S3A A;  5DAK B;  1AUC A;  4USS A;  4HJ2 A;  3LXZ A;  4F0C A;  3VWW A;  3GHA A;  1QFN A;  1R4W A;  1BG5 A;  2HSY A;  1V98 A;  2I81 A;  2FGX A;  4MJB A;  1SU9 A;  1PRX A;  5B7C A;  1UN2 A;  1EWX A;  1PX6 A;  2LST A;  4TVE A;  2V32 A;  3DYR A;  4EXJ A;  3F4T A;  2IWT A;  4WEY A;  3LXT A;  4KCA A;  2VL9 A;  5ECL B;  4JR6 A;  5GST A;  5GSS A;  3DEX A;  4NHZ A;  4HOJ A;  4X43 A;  1GSQ A;  1AQW A;  2XBQ A;  1THO A;  1GTU A;  6GST A;  4GLT A;  3TRP A;  1X5E A;  4BPY A;  4G10 A;  3BCI A;  3KD0 A;  3CSJ A;  1PN9 A;  5HR2 A;  4GQC A;  1SK0 A;  5D96 A;  1TU7 A;  1GSY A;  2OE3 A;  2OJL A;  3MWH A;  3FYG A;  1VF2 A;  1GTB A;  2HZE A;  3W8J A;  5IPG A;  5IOW A;  4TR1 B;  1AQV A;  2NBS A;  5CYY A;  3C7M A;  4MP4 A;  4KDY A;  3J7Y k;  2VM2 A;  1VF1 A;  3KP9 A;  1ON4 A;  4H86 A;  3ZFL A;  2HQT A;  3I69 A;  1ERU A;  3UAR A;  4NAX A;  3GKN A;  4EO3 A;  4AJ6 A;  1V9W A;  2B1L A;  1QK8 A;  1AC1 A;  2V1M A;  1YF0 A;  5ECO B;  2YJ7 A;  1HNB A;  3UBL A;  1PQN A;  2HRK A;  2HRF A;  4KND A;  4V2M A;  2BTO T;  2LEG A;  1VF4 A;  4L5L A;  2DSA A;  3I6A A;  5G31 A;  3TJF A;  4F82 A;  1XWC A;  3D4M A;  5COH A;  3D6I A;  1TI1 A;  3LQ7 A;  5DVB A;  3A2X A;  2I1U A;  4HI7 A;  5ECH B;  2VLT A;  2IL3 A;  2CV4 A;  2HZF A;  2K9F A;  3KH7 A;  1ZOF A;  1SYX A;  5ECK B;  4ZBD A;  2I3Y A;  4MMM A;  2NPB A;  2JZR A;  4TOP A;  4MJC A;  3WGE A;  1A23 A;  2HNL A;  3EMP A;  3VUR A;  1EGR A;  1GUH A;  2V2G A;  2R4V A;  3HCZ A;  5ID2 A;  3TOU A;  3IR4 A;  2LQQ A;  2MBS A;  3M9J A;  1TW9 A;  4HQS A;  3GUR A;  5ECM B;  19GS A;  2HXK A;  3F63 A;  3TDG A;  2VCT A;  3C8E A;  2CZ3 A;  4K6X A;  2XBI A;  3A2W A;  4MJA A;  10GS A;  5H5R A;  2R3X A;  1BED A;  2K8V A;  4ZIL A;  1ZGN A;  2CAQ A;  1J0F A;  4TR3 A;  3MNG A;  4PNF A;  3KIJ A;  4MDC A;  3HHV A;  4FIW A;  5CRG A;  2DJK A;  3D4T A;  4HZ2 A;  1DE1 A;  1MDK A;  3KZQ A;  2OAD A;  3TRQ A;  2LS5 A;  1C72 A;  1U87 A;  2H6Y A;  3TKP A;  3BCK A;  5LD0 A;  3IAS 2;  5FT3 A;  4FYC A;  2FWH A;  4KSO A;  1GLP A;  1JZR A;  4V2L A;  5AIS A;  3KM6 A;  1T1V A;  1PSQ A;  3HJP A;  4YAV A;  1M2B A;  1X9W B;  4EF0 A;  3UEM A;  4LL4 B;  4IP1 A;  1O6J A;  4LMV A;  3RBT A;  1XFL A;  3DRN A;  2H1A A;  1PGT A;  2DJ2 A;  3VI7 A;  5C00 A;  4LA1 A;  2HZE B;  2C0G A;  3OR5 A;  2FA8 A;  1R5A A;  2LJK A;  1A2M A;  2FCH A;  2JZS A;  5A4U A;  2KP2 A;  4HJM A;  1HNA A;  2IPA A;  4EUY A;  5KN2 A;  4ML1 A;  2CQ9 A;  1SYR A;  2LNS A;  2WZ9 A;  3DVX A;  4ISD A;  2L57 A;  1GP1 A;  2XPE A;  3P90 A;  2H0H A;  4POB A;  3A2V A;  3IA1 A;  4XS1 A;  3RHB A;  5EVO A;  1ZYQ B;  4F2I A;  2FWE A;  3GIX A;  2IFQ A;  2HSM A;  4BWQ A;  3KJY A;  4BA7 A;  1ML6 A;  4TRX A;  2FY6 A;  3IC8 A;  2QKE A;  4OCE A;  3QFB C;  4D73 A;  3KGK A;  1NHY A;  3CRU A;  2VO4 A;  2YWO A;  1T8E B;  1SKR B;  3GV1 A;  1GL8 A;  2GT5 A;  2O7K A;  3ZRE A;  4TN8 A;  4G19 A;  1T4Y A;  3M3M A;  5DQY A;  1PMT A;  3TJG A;  5IPH A;  6GSS A;  2AJQ B;  2HSH A;  3UAP A;  5D9T A;  1OE7 A;  1GSD A;  2N5B A;  5A5K A;  3ERG A;  2DLX A;  1Z7R A;  11GS A;  3M1G A;  5IO2 A;  2CX4 A;  3VWU A;  3IOS A;  4IP6 A;  4KW6 A;  2P5R A;  5EPF A;  2E2M A;  3GA4 A;  1HYU A;  4OCF A;  4GSN A;  4MAB A;  3F8U A;  3QD9 A;  3LOR A;  5ELG A;  4G0K A;  1OC3 A;  1TJD A;  1O85 A;  3TKS A;  3FZ9 A;  2LNT A;  5HR1 A;  1KNG A;  1JZO A;  1YEX A;  1AIU A;  2UZ8 A;  1EP8 A;  2HFD A;  3TJB A;  2P5Q A;  2H74 A;  1PL2 A;  3CRT A;  3RHC A;  3C1R A;  1FHE A;  1TK8 B;  3TCO A;  3DGQ A;  5LNK e;  5ECP B;  3DML A;  3LEF A;  2C4J A;  2PGT A;  4JED A;  4OFN A;  3PR8 A;  4GST A;  4X1U A;  4E8H A;  3F6D A;  2MBT A;  2C3T A;  2VLV A;  4HS1 A;  5KN0 A;  3ERW A;  1EOG A;  2IMD A;  4YQU A;  2MMN A;  4F9Z A;  4X0X A;  3LJR A;  4GRF A;  2IMF A;  2IJY A;  3EVI A;  2X64 A;  2HYX A;  1AAZ A;  1OC9 B;  3MDK A;  3HZ8 A;  3EIN A;  2GLR A;  2R2J A;  2YJH A;  2OA7 A;  3TGZ A;  4L0W A;  2H8L A;  3K8N A;  1LJR A;  2LJR A;  1TXX A;  1AW9 A;  3UVH A;  2B7K A;  1TKD B;  1NSW A;  2OE1 A;  4GF0 A;  2GZP A;  2KUC A;  1TRV A;  4POK A;  4YQM A;  1RQM A;  4XCS A;  4FYB A;  5G30 A;  1K3L A;  2PMT A;  2VCZ A;  4AF2 A;  2JL4 A;  1Z6M A;  1VGL A;  3M0F A;  4TR0 A;  1MDJ A;  1SD8 A;  2YPM A;  1ZCP A;  2DJ0 A;  3TJK A;  4ZL7 A;  1YEP A;  9GSS A;  3NZN A;  1Q4J A;  4PQ1 A;  2KP1 A;  1XWA A;  5J4U A;  3BJ5 A;  4YH2 A;  2H0G A;  2O87 A;  2LRC A;  3HXS A;  1ST9 A;  2AYT A;  4ZBB A;  2O89 A;  2IFQ B;  5KN3 A;  2BMX A;  2LJA A;  3DIE A;  3FKF A;  4RQR A;  4IS0 A;  5CO3 A;  4D73 B;  4HU7 A;  2AV4 A;  4HUA A;  4JR4 A;  2FHE A;  2PUK C;  2E7P A;  2LRT A;  1BJX A;  1EEM A;  4PTS A;  4G0I A;  6GSY A;  3F4S A;  4XIH A;  4XHM A;  2C3Q A;  2D2Z A;  3ZLP A;  3CTF A;  3FR6 A;  3ZML A;  3EUR A;  3HKR A;  1TU8 A;  1XWK A;  1T00 A;  2FD3 A;  1S3D A;  1GWC A;  3KH9 A;  3GYK A;  2DML A;  1QUW A;  2VD0 A;  1I5G A;  3UL3 A;  4J56 E;  3KEB A;  3HYP A;  3APO A;  4WF4 A;  3F3Q A;  1RK4 A;  2ZUP A;  1BQ7 A;  4IJ3 A;  1OKD A;  3VPQ A;  5HQP A;  1B9Y C;  3ZMK A;  4XRD A;  1O8W A;  2TRC P;  3DXB A;  5EY6 A;  1TK0 B;  4EDZ A;  4OWY A;  5ELA A;  4ZL9 A;  4MPF A;  4RI6 A;  2CAI A;  4BVX B;  1VF3 A;  2YV9 A;  2RUE A;  2H30 A;  3DD3 A;  2VCW A;  2RUF A;  2HRN A;  1AXD A;  3ERF A;  2JAC A;  1TTZ A;  5D9W A;  2H1B A;  4RQX A;  4GWR A;  2CVD A;  3CBU A;  4XTS A;  4K7I A;  3ED3 A;  2YWN A;  4O5R A;  2DMM A;  4N10 A;  1SL0 B;  3F4R A;  3G7J A;  1XBS A;  1PL1 A;  2DIZ A;  4PQI A;  2YZU A;  3L0H A;  2WGR A;  1YQ1 A;  4AJ7 A;  1N2A A;  5CRH A;  3VPT A;  4FQU A;  1JZD A;  4PXO A;  4QQ7 A;  4OFM A;  1ILO A;  1MD3 A;  2IIY A;  4WKW A;  2ZNM A;  4GSS A;  2C0E A;  4K7N A;  1HQO A;  1Z9H A;  1WRY A;  1DBY A;  1M99 A;  3EC3 A;  1M9A A;  1CQG A;  2H75 A;  2Z9S A;  2H72 A;  5DCH A;  3HJM A;  3FK8 A;  4KF9 A;  1XWB A;  3IHQ A;  2DBC A;  3VWX A;  2VIM A;  4EC0 A;  4V1A p;  1G7E A;  2H76 A;  2MMA A;  3D22 A;  3TKS E;  5INY A;  3G9B A;  1PD2 1;  3GRX A;  3M9K A;  4Q5N A;  2GSR A;  2GQK A;  1THX A;  4KGI A;  1WJK A;  3PIN A;  5ECQ B;  5D8I A;  2X8H A;  5IM9 A;  3ZIT A;  4KUN A;  3NIV A;  1K3O A;  2L4Q A;  1F6M C;  3WT1 A;  5IMF A;  1FB6 A;  5G2Z A;  1GSF A;  2VD1 A;  4N0Z A;  1OE8 A;  2XC2 A;  2OBK A;  3A3T A;  5KN1 A;  4IBP A;  2I9H A;  1ZZY A;  1X0R A;  4NV2 A;  4EVM A;  5J41 A;  2IME A;  2EIR A;  2F8F A;  2YWI A;  1SK1 A;  2L6C A;  4MZB A;  3Q18 A;  2N5A A;  18GS A;  3W6G A;  1SJI A;  1O73 A;  2JZT A;  1FVJ A;  1JZW A;  1E2Y A;  2EIQ A;  1XOA A;  3IXR A;  4KSM A;  4BL7 A;  1YY7 A;  5CRD A;  2H1D A;  1B4Q A;  3V1W A;  1G6W A;  1U3I A;  1O7U A;  6GSW A;  1H75 A;  4O32 A;  4TXV A;  4WXT A;  1GSS A;  4MZC A;  3TKQ A;  3IDV A;  1J08 A;  5HFK A;  2C0D A;  3QDN A;  3P8W A;  1NHO A;  16GS A;  4LLR A;  3CMI A;  4MJE A;  2O85 A;  3BD2 A;  4I2U A;  1O81 A;  3HD5 A;  3C73 A;  2H1G A;  4IKH A;  1T7P B;  2RII A;  5F05 A;  3S9F A;  3ZIV A;  12GS A;  5DCG A;  5ECR B;  1EGO A;  3FW2 A;  5D93 A;  1BAY A;  1XZO A;  1TDI A;  5HR0 A;  1KEB A;  2L59 A;  4PUF C;  3US3 A;  4NMU A;  2WFC A;  5DJM A;  4I5Q A;  3UIW A;  2N5F A;  5ECS A;  2VAF A;  3MSZ A;  2E2G A;  5ECI B;  3CSI A;  4ILF A;  5JCU A;  3L9U A;  2B1K A;  5B8B A;  5JCW A;  2PWJ A;  1YKC A;  1ERV A;  3IK7 A;  2CT6 A;  4N11 A;  2P0G A;  2K18 A;  5CAX A;  5B6M A;  1EV9 A;  5J3R A;  4GCI A;  1U3A A;  4XS4 A;  4MH2 A;  2GSQ A;  4NWY A;  4MZW A;  1SEN A;  3C1S A;  1FOV A;  4J2F A;  1Z7P A;  4ZB8 A;  4PUR A;  1H4O A;  3IK9 A;  3APS A;  1NM3 A;  2GST A;  1G6Y A;  1NW2 A;  1ERT A;  2BJX A;  4FH8 A;  3LWA A;  2HRK B;  3H79 A;  2AHE A;  2LRN A;  1XOB A;  3GL3 A;  3TJJ A;  4I2T A;  3IBH A;  4KCE A;  4DVC A;  5J9B A;  5IMD A;  3H93 A;  1QXH A;  1WP0 A;  5CP1 A;  2VCX A;  2KHP A;  3D5J A;  5AIV A;  4RUV A;  4EL1 A;  4K8M A;  3RDW A;  4I97 A;  3CXG A;  2F3M A;  1XW6 A;  4V2N A;  3IE3 A;  3KMO A;  4ZB9 A;  2V6K A;  3TRX A;  1W89 A;  6GSX A;  3AY8 A;  3ZRD A;  2B6M A;  1F2E A;  5G5F A;  3TKS C;  2H66 A;  1UA5 A;  5G5E A;  3CSH A;  2C3N A;  2VUP A;  3J7Y b;  1JHB A;  7GSS A;  3DKS A;  5CNW A;  4BL7 B;  4JZQ A;  2HT9 A;  5ID2 B;  3HZ4 A;  3GH9 A;  3EE2 A;  5HFI A;  2M80 A;  4I6X A;  1GSU A;  5IQY A;  2L5L A;  3FR3 A;  4TKY A;  4WET A;  4ECC A;  2IMI A;  1KBN A;  2MZC A;  3FHK A;  1X9M B;  2B7J A;  2K8S A;  4IQ1 A;  3LG6 A;  4J57 E;  2WS2 A;  1GNE A;  2B3S A;  2X99 A;  3EU3 A;  3JCM L;  4QL9 A;  4O92 A;  2ES7 A;  5H5Q A;  2GSS A;  4ECB A;  3QFA C;  1XW9 A;  3WGD A;  4K2D A;  2GT6 A;  3QPM A;  1F3B A;  4MF5 A;  3P2A A;  3HJO A;  4Q5F A;  2GS3 A;  2DJ3 A;  4OD7 A;  1T3B A;  4DSS A;  5GAP D;  2J23 A;  1PKZ A;  2E0Q A;  1K0M A;  4Q5Q A;  3QOU A;  2X8C A;  4WR4 A;  1U6T A;  5HR3 A;  3O6T A;  1BYE A;  2H71 A;  3Q74 A;  2KOK A;  1JLV A;  4MPG A;  3FEU A;  1EEJ A;  4XS4 B;  4TXO A;  3TUE A;  1TI3 A;  3KXO A;  3ZYW A;  2JU5 A;  3Q19 A;  5JWQ B;  1M0U A;  3GTU A;  2C1Y A;  2LQO A;  2L6D A;  3M8N A;  3UJ1 A;  4PX1 A;  1DUG A;  3U6V A;  5F07 A;  4ECJ A;  1T4Z A;  3ISO A;  2HSM B;  5ECN B;  4FO5 A;  1QGV A;  1K0N A;  3IC4 A;  2A2S A;  1SL1 B;  1RW1 A;  2G2Q A;  1DSB A;  3SWL A;  3F3R A;  4WBJ A;  3FZA A;  4I8B A;  1M7T A;  1GUL A;  1URM A;  1WMJ A;  4EKZ A;  2VCQ A;  4IN0 A;  1X9S B;  2GZY A;  5DAL A;  5IIZ A;  3U5R E;  2YAN A;  1SJ6 A;  1XVW A;  2H19 A;  4CDO A;  3N5O A;  3GX8 A;  2AAW A;  4JU5 A;  2FUG 2;  5DJL A;  1OAZ A;  3F6F A;  1QMV A;  4EE0 A;  1A2J A;  4PUA A;  1Z5Y E;  1ACV A;  4MK3 A;  1TOF A;  4OO4 A;  2VOC A;  5IOX A;  4Q5R A;  1YJ6 A;  2QGV A;  3R2Q A;  3VFI A;  1V2A A;  2R6K A;  3QAW A;  4POL A;  5IMC A;  1MTC A;  3ZL5 A;  3TKR A;  1E6B A;  4GXZ A;  1HNC A;  1GH2 A;  1EV4 A;  1J9B A;  1FAA A;  3HY2 A;  2CX3 A;  1FO5 A;  3GSS A;  3L78 A;  2R5G A;  1BX9 A;  3FRC A;  2I4A A;  2DC5 A;  5D9V A;  4MA9 A;  5IMZ A;  5CRW A;  4OMV A;  2R37 A;  3EWL A;  5EL8 A;  1A8Y A;  2H70 A;  3TB2 A;  2PPT A;  3WD6 A;  2GQM A;  3KCM A;  4BVY A;  1ZMA A;  2RM6 A;  1ERW A;  2YZH A;  1R7H A;  3UVT A;  1GRX A;  4DSS B;  2DIY A;  4IQA A;  3BOA A;  3Q6O A;  3GN3 A;  3I9V 2;  1SL2 B;  4KDU A;  2VL3 A;  3H1N A;  1G0T A;  1R5P A;  3HA9 A;  2NVL A;  3ZZX A;  3W8S A;  1X5D A;  2LKU A;  1GUM A;  3WYW A;  2DJJ A;  5D9X A;  2WUL A;  2JAD A;  1MEK A;  1X5C A;  4TXO B;  6GSV A;  1SKS B;  1AQX A;  3GKM A;  3IRA A;  5CRE A;  2X8G A;  3FR9 A;  1B4P A;  4FYU A;  3GTU B;  1XPV A;  1ABA A;  4MLY A;  5J5N A;  2VCV A;  3MAK A;  1K3Y A;  2L4C A;  3SBC A;  2O8V B;  4LMW A;  4ZBA A;  3GL5 A;  1PX7 A;  5A4W A;  1LU4 A;  3VK9 A;  3UOM A;  2OKA A;  3GFK A;  8GSS A;  2C0F A;  1SK2 A;  1MDI A;  1Z6N A;  2GVP A;  2HRA A;  3APQ A;  1EP7 A;  1K0D A;  1U88 A;  2HSN B;  3IV4 A;  3GH6 A;  1SD9 A;  1PA3 A;  4IW9 A;  1O8X A;  2WB9 A;  2XPD A;  4YQV A;  3UMA A;  1XW5 A;  5DAL B;  3HVX A;  2B5Y A;  4NHW A;  1A0F A;  5AIX A;  3LYP A;  3H4K A;  1ZL9 A;  2YOI A;  2PU9 C;  2YP6 A;  5E4W A;  2FNO A;  3WGX A;  1B48 A;  3UBK A;  4HZ4 A;  2HI7 A;  3PH9 A;  1M9B A;  2H6X A;  4AJ8 A;  4KAE A;  3FZ4 A;  4DEJ A;  2F9S A;  2WJU A;  3EMX A;  2AUV A;  1KTE A;  4F0B A;  2VL2 C;  2ON7 A;  2PER A;  2QC7 A;  1YZX A;  3GNJ A;  5F0G A;  1B9X C;  4AGS A;  2VL2 A;  4E8E A;  4YAP A;  2MMZ A;  4CW9 A;  5GAN D;  2OE0 A;  1OVN A;  4JE1 A;  4O7H A;  4NV5 A;  2AB6 A;  1GNW A;  4GTU A;  3QCP A;  4MF6 A;  3I43 A;  4XRA A;  1Y25 A;  4MF7 A;  2NTO A;  3QR6 A;  3DWV A;  3ME8 A;  4ML6 A;  3O76 A;  1GTA A;  1YKA A;  2IN3 A;  1YDK A;  3N9J A;  3EYT A;  1IYI A;  4POM A;  3C71 A;  4QL7 A;  4WBR D;  4KA0 A;  3IAM 2;  4BVY B;  3RPN A;  2YWM A;  5DDL A;  1M2A A;  2LTK A;  3D0Z A;  3ME7 A;  1S3C A;  2LV3 A;  5FHI A;  4KDX A;  2IMK A;  4IJI A;  3H8Q A;  3WT2 A;  5G1K A;  1XVQ A;  2A4V A;  1IYH A;  3FZ5 A;  3E9J B;  4TR4 A;  1WOU A;  5F06 A;  2F8A A;  2B5X A;  1XXU A;  1MD4 A;  1A24 A;  1OC9 A;  4HEA 2;  2OAC A;  2GDR A;  4K9Z A;  1GSE A;  2NDO A;  5ABR A;  2GZZ A;  2EIO A;  2H0I A;  5L71 A;  3L9S A;  1UC7 A;  2DJ1 A;  4LL1 B; 
#chains in the Genus database with same CATH topology
 2CZ2 A;  5KEJ A;  4K5R A;  3ZIJ A;  4IGJ A;  2FA4 A;  5IO0 A;  3VI5 A;  20GS A;  4KE3 A;  4IHU A;  4WR5 A;  1JFU A;  1M2D A;  1F9M A;  2OBI A;  3QMX A;  4KH7 A;  3EU4 A;  4N0V A;  2TIR A;  3F0I A;  4KB3 A;  1USB A;  5JWR B;  5D73 A;  2YV7 A;  1ZYE A;  4L0U A;  4HDE A;  4NXI A;  3PGT A;  4ID0 A;  4Z7X A;  1QQ2 A;  3G7I A;  1Y6E A;  3HVV A;  2C80 A;  1N8J A;  2JSY A;  1OYJ A;  3HDC A;  5DQS A;  5HFG A;  3ZTL A;  1V58 A;  4OFT A;  5J9C A;  5JWO B;  2J9H A;  3VLN A;  2WW3 A;  1K0B A;  4OO5 A;  2CA8 A;  3NOF A;  2QSI A;  2VM1 A;  3KP8 A;  3GST A;  3ZFB A;  2EC4 A;  4AKI A;  3E3E A;  1GTI A;  2M72 A;  1FG4 A;  5LCZ A;  3RFR C;  4TW5 A;  2F51 A;  3D21 A;  4EDY A;  1WIK A;  3CYN A;  3QAG A;  5AN1 A;  2GTU A;  1A8L A;  2P31 A;  4HU9 A;  1SVO A;  1SJZ A;  4PQH A;  1WPI A;  2WZS A;  1HD2 A;  1TRU A;  4ZXG A;  1SKW B;  1SVL A;  13GS A;  2RM5 A;  5JCG A;  5BMU A;  5B8A A;  2WW0 A;  2M46 A;  5AGY A;  4P3Y B;  4V1A g;  3HVS A;  2HE3 A;  3GUS A;  3GKK A;  3A5W A;  3P7X A;  2WDU A;  3CTG A;  2JSZ A;  4ACS A;  3FY7 A;  1JLW A;  3G7Y A;  1XCC A;  3IPZ A;  3KTB A;  4BVX A;  2PN8 A;  2REM A;  1FOH A;  1Q98 A;  1WWJ A;  3VWV A;  4K1F A;  4ZIJ A;  2ON5 A;  1TRS A;  4ZB6 A;  5DAK A;  2H6Z A;  2PVQ A;  3KMN A;  2LUS A;  4IEL A;  2WVY A;  3PPU A;  2WCI A;  4KX4 A;  1CQH A;  2WW1 A;  4IVF A;  1OC8 A;  1G7O A;  1TRW A;  3LYK A;  4ICY A;  3QAV A;  4ECI A;  2A2P A;  4G2E A;  2CVK A;  2MMO A;  5G1L A;  1Z3E A;  4JBB A;  4BWS A;  4ULX A;  1F3A A;  4F03 A;  6GSU A;  1XIY A;  2GQL A;  4WF5 A;  4K0N A;  2K6V A;  4MCU A;  1UVZ A;  3GKX A;  2HLS A;  4PNG A;  3F9U A;  1FW1 A;  1R26 A;  2FLS A;  2H01 A;  3CWG A;  5E59 A;  5B6N A;  2FWF A;  2EFD A;  1A2L A;  2V41 A;  2A2R A;  4TR1 A;  2ZCT A;  2FWG A;  4JRR A;  2TRX A;  4XS6 A;  3ZVJ D;  4G0L A;  1PFO A;  2YCD A;  1W4V A;  2ALB A;  2GGT A;  4NPB A;  1FVK A;  4HQZ A;  5DBQ A;  3LSZ A;  4DSR A;  4G9H A;  14GS A;  4CHS A;  3ZVJ A;  1WE0 A;  1V40 A;  4L8E A;  2PBJ A;  1TP9 A;  4N30 A;  5IMV A;  3L9V A;  1GUK A;  4K0G A;  4MH3 A;  1K0O A;  1VRS D;  1B8X A;  5F8B A;  1PKW A;  3E0U A;  5C04 A;  1DE2 A;  3R3E A;  2PVO C;  1K0C A;  3L4N A;  4PGT A;  3KTL A;  2MYG A;  22GS A;  5ENU A;  4ZL8 A;  3O3T A;  5IMA A;  2B5E A;  2L5O A;  2KLX A;  4DSQ A;  5GZZ B;  3DVW A;  3LGC A;  2CVB A;  4RI7 A;  2C8U A;  2VLU A;  2RLI A;  3GMF A;  1FB0 A;  4GQF A;  2YNX A;  1A0R P;  2H73 A;  1V57 A;  1OKT A;  17GS A;  1F37 A;  4K7O A;  1YF1 A;  2XHF A;  2WRT A;  1K0A A;  1I9D A;  1XWG A;  1GLQ A;  1EZK A;  2V6O A;  5FWG A;  2G0F A;  3RPP A;  3GX0 A;  3TOT A;  3RAZ A;  1EOH A;  4K5S A;  1LBK A;  2YN1 A;  4L5O A;  1TK5 B;  3BBY A;  5H5S A;  5A4V A;  3LFL A;  1S3A A;  5DAK B;  1AUC A;  4USS A;  4HJ2 A;  3LXZ A;  4F0C A;  3VWW A;  5A5H A;  3GHA A;  1QFN A;  1R4W A;  1BG5 A;  2HSY A;  1V98 A;  2I81 A;  2FGX A;  4MJB A;  1SU9 A;  1PRX A;  5B7C A;  1UN2 A;  1EWX A;  1PX6 A;  2LST A;  4TVE A;  2V32 A;  3DYR A;  4EXJ A;  3F4T A;  2IWT A;  4WEY A;  3LXT A;  4KCA A;  2VL9 A;  5ECL B;  5GST A;  5GSS A;  4JR6 A;  3DEX A;  4NHZ A;  4AKX B;  4HOJ A;  4X43 A;  1GSQ A;  1AQW A;  2XBQ A;  1THO A;  1GTU A;  6GST A;  4GLT A;  3TRP A;  1X5E A;  4BPY A;  4G10 A;  3BCI A;  3KD0 A;  3CSJ A;  1PN9 A;  5HR2 A;  4GQC A;  1SK0 A;  5D96 A;  1TU7 A;  1GSY A;  2OE3 A;  2OJL A;  3MWH A;  3FYG A;  1VF2 A;  3FMW A;  1GTB A;  2HZE A;  3W8J A;  5IPG A;  5IOW A;  4TR1 B;  1AQV A;  2NBS A;  5CYY A;  3C7M A;  4MP4 A;  4KDY A;  3J7Y k;  5J47 A;  2VM2 A;  1VF1 A;  3KP9 A;  1ON4 A;  4H86 A;  3ZFL A;  4AKH A;  2HQT A;  3I69 A;  1ERU A;  3UAR A;  4NAX A;  3GKN A;  4EO3 A;  4AJ6 A;  1V9W A;  2B1L A;  1QK8 A;  3MIX A;  1AC1 A;  2V1M A;  1YF0 A;  5ECO B;  2YJ7 A;  1HNB A;  3UBL A;  1PQN A;  2HRK A;  2HRF A;  4KND A;  4V2M A;  2BTO T;  2LEG A;  1VF4 A;  4L5L A;  2DSA A;  3I6A A;  5G31 A;  3TJF A;  4F82 A;  1XWC A;  3D4M A;  5COH A;  3D6I A;  1TI1 A;  3LQ7 A;  5DVB A;  3A2X A;  4YKG A;  2I1U A;  4HI7 A;  5ECH B;  2VLT A;  4AKG A;  2IL3 A;  2CV4 A;  2HZF A;  2K9F A;  3RGB C;  3KH7 A;  1ZOF A;  1SYX A;  5ECK B;  4ZBD A;  2I3Y A;  4MMM A;  2NPB A;  2JZR A;  4TOP A;  4MJC A;  3WGE A;  1A23 A;  2HNL A;  3EMP A;  3VUR A;  1EGR A;  1GUH A;  2V2G A;  2R4V A;  3HCZ A;  5ID2 A;  3TOU A;  3IR4 A;  2LQQ A;  2MBS A;  3M9J A;  1TW9 A;  4HQS A;  3GUR A;  5ECM B;  19GS A;  2HXK A;  3F63 A;  3TDG A;  2VCT A;  3C8E A;  2CZ3 A;  4K6X A;  2XBI A;  3A2W A;  4MJA A;  10GS A;  4O5Q A;  5H5R A;  2R3X A;  1BED A;  2K8V A;  4ZIL A;  1ZGN A;  2CAQ A;  1J0F A;  4PI0 C;  4TR3 A;  3MNG A;  4PNF A;  3KIJ A;  4MDC A;  2WVX B;  3HHV A;  2WW2 A;  4FIW A;  5CRG A;  2DJK A;  3D4T A;  4HZ2 A;  1DE1 A;  1MDK A;  3KZQ A;  2OAD A;  3TRQ A;  2LS5 A;  1C72 A;  1U87 A;  2H6Y A;  3TKP A;  3BCK A;  5LD0 A;  3IAS 2;  5FT3 A;  4FYC A;  3LW9 A;  2FWH A;  4KSO A;  1GLP A;  1JZR A;  4V2L A;  5AIS A;  3KM6 A;  1T1V A;  1PSQ A;  3HJP A;  4YAV A;  1M2B A;  1X9W B;  4EF0 A;  3UEM A;  4E68 A;  4LL4 B;  4IP1 A;  1O6J A;  4LMV A;  3RBT A;  1XFL A;  3DRN A;  2H1A A;  1PGT A;  2DJ2 A;  3VI7 A;  5C00 A;  4LA1 A;  1TXU A;  2HZE B;  2C0G A;  3OR5 A;  2FA8 A;  1R5A A;  2LJK A;  1A2M A;  2FCH A;  2JZS A;  5A4U A;  2KP2 A;  4HJM A;  1HNA A;  2IPA A;  4EUY A;  5KN2 A;  4ML1 A;  2CQ9 A;  1SYR A;  2LNS A;  3DVX A;  2WZ9 A;  4ISD A;  2L57 A;  4FXY P;  1GP1 A;  2XPE A;  3P90 A;  2H0H A;  4POB A;  3A2V A;  3IA1 A;  4XS1 A;  3RHB A;  5EVO A;  1ZYQ B;  4F2I A;  5A34 A;  2FWE A;  3GIX A;  2IFQ A;  2HSM A;  4BWQ A;  3KJY A;  4BA7 A;  1ML6 A;  4TRX A;  2FY6 A;  3IC8 A;  2QKE A;  4OCE A;  3QFB C;  4D73 A;  3KGK A;  1NHY A;  3CRU A;  2VO4 A;  2YWO A;  1T8E B;  1SKR B;  3GV1 A;  1GL8 A;  2GT5 A;  2O7K A;  3ZRE A;  4TN8 A;  4G19 A;  1T4Y A;  3M3M A;  5DQY A;  2O36 A;  1PMT A;  3TJG A;  5IPH A;  6GSS A;  2AJQ B;  2HSH A;  3UAP A;  5D9T A;  1OE7 A;  1GSD A;  2N5B A;  5A5K A;  3ERG A;  2DLX A;  1Z7R A;  11GS A;  3M1G A;  5IO2 A;  2CX4 A;  3VWU A;  3IOS A;  4IP6 A;  4KW6 A;  2P5R A;  5EPF A;  2E2M A;  3GA4 A;  1HYU A;  4OCF A;  4GSN A;  4MAB A;  5KOX A;  3F8U A;  3QD9 A;  3LOR A;  5ELG A;  4G0K A;  1OC3 A;  1TJD A;  1O85 A;  3TKS A;  3FZ9 A;  2LNT A;  5HR1 A;  1KNG A;  1JZO A;  1YEX A;  1AIU A;  2UZ8 A;  1EP8 A;  2HFD A;  3TJB A;  2P5Q A;  2X49 A;  4PHZ C;  2H74 A;  1PL2 A;  3CRT A;  3RHC A;  3C1R A;  1FHE A;  1TK8 B;  3TCO A;  3DGQ A;  5LNK e;  5ECP B;  3DML A;  3LEF A;  2C4J A;  2PGT A;  4JED A;  4OFN A;  3PR8 A;  4GST A;  4X1U A;  4E8H A;  2EFC A;  3F6D A;  2MBT A;  2C3T A;  2VLV A;  4HS1 A;  5KN0 A;  3ERW A;  1EOG A;  2IMD A;  2R0G A;  4YQU A;  2MMN A;  4F9Z A;  4X0X A;  3LJR A;  4GRF A;  2IMF A;  2IJY A;  3EVI A;  2X64 A;  2HYX A;  1AAZ A;  1OC9 B;  3MDK A;  3HZ8 A;  3EIN A;  2GLR A;  2R2J A;  2YJH A;  4W66 A;  2OA7 A;  3TGZ A;  4L0W A;  2H8L A;  3K8N A;  1LJR A;  2LJR A;  1TXX A;  1AW9 A;  3UVH A;  4MNN A;  2B7K A;  1TKD B;  1NSW A;  2OE1 A;  4GF0 A;  2GZP A;  2KUC A;  1TRV A;  4POK A;  4YQM A;  1RQM A;  4XCS A;  4FYB A;  2H1L A;  5G30 A;  1K3L A;  2PMT A;  2VCZ A;  4AF2 A;  2JL4 A;  1Z6M A;  1VGL A;  3M0F A;  4TR0 A;  2EFH A;  1MDJ A;  1SD8 A;  2YPM A;  1ZCP A;  3CQF A;  2DJ0 A;  2O3E A;  3TJK A;  4ZL7 A;  1YEP A;  9GSS A;  1S4B P;  2DKI A;  3NZN A;  1Q4J A;  4PQ1 A;  2KP1 A;  1XWA A;  5J4U A;  3BJ5 A;  4YH2 A;  2H0G A;  2O87 A;  1N25 A;  2LRC A;  4Z2T A;  3HXS A;  5A34 B;  1ST9 A;  2AYT A;  4AI6 A;  4ZBB A;  2O89 A;  2IFQ B;  5KN3 A;  2BMX A;  2LJA A;  3DIE A;  3FKF A;  4RQR A;  4IS0 A;  5CO3 A;  4D73 B;  4HU7 A;  2HSN A;  2AV4 A;  4HUA A;  4JR4 A;  2FHE A;  2PUK C;  2E7P A;  2LRT A;  1BJX A;  4O5U A;  1EEM A;  4PTS A;  4G0I A;  6GSY A;  3F4S A;  4XIH A;  4XHM A;  2C3Q A;  2D2Z A;  3ZLP A;  3CTF A;  3FR6 A;  3ZML A;  3EUR A;  3HKR A;  1TU8 A;  1XWK A;  1T00 A;  2FD3 A;  1S3D A;  1GWC A;  3KH9 A;  3GYK A;  2DML A;  5J4V A;  1QUW A;  2VD0 A;  1I5G A;  3UL3 A;  4J56 E;  3KEB A;  3HYP A;  3APO A;  4WF4 A;  3F3Q A;  5BMU B;  2O5V A;  1RK4 A;  2ZUP A;  1BQ7 A;  4IJ3 A;  1OKD A;  3VPQ A;  5HQP A;  1B9Y C;  3ZMK A;  4XRD A;  5BRT A;  1O8W A;  2TRC P;  3DXB A;  5EY6 A;  1TK0 B;  4EDZ A;  2OT3 A;  3EPT A;  4OWY A;  5ELA A;  4ZL9 A;  4MPF A;  4RI6 A;  2CAI A;  4BVX B;  1VF3 A;  2YV9 A;  2RUE A;  2H30 A;  5KOW A;  3DD3 A;  2VCW A;  2RUF A;  2HRN A;  1AXD A;  3ERF A;  2JAC A;  1TTZ A;  5D9W A;  2H1B A;  4RQX A;  4GWR A;  2CVD A;  3CBU A;  4XTS A;  4K7I A;  3ED3 A;  2YWN A;  4O5R A;  2DMM A;  4N10 A;  1SL0 B;  3F4R A;  4ZB7 A;  3G7J A;  1XBS A;  1PL1 A;  2DIZ A;  4PQI A;  2YZU A;  3L0H A;  2WGR A;  1YQ1 A;  4AJ7 A;  1N2A A;  5CRH A;  3VPT A;  4FQU A;  1JZD A;  4PXO A;  4QQ7 A;  4OFM A;  1ILO A;  1MD3 A;  2IIY A;  4WKW A;  2ZNM A;  4GSS A;  2C0E A;  4K7N A;  1HQO A;  1Z9H A;  1WRY A;  1DBY A;  1M99 A;  3EC3 A;  1M9A A;  1CQG A;  2H75 A;  2QA1 A;  2Z9S A;  2H72 A;  5DCH A;  3HJM A;  3FK8 A;  4KF9 A;  1XWB A;  3IHQ A;  2DBC A;  3VWX A;  2VIM A;  4EC0 A;  4V1A p;  1G7E A;  2H76 A;  2MMA A;  3D22 A;  3TKS E;  5INY A;  3G9B A;  1PD2 1;  3GRX A;  3M9K A;  4Q5N A;  2GSR A;  2GQK A;  1THX A;  4KGI A;  1WJK A;  3PIN A;  5ECQ B;  5D8I A;  2X8H A;  5IM9 A;  3ZIT A;  4KUN A;  3NIV A;  1K3O A;  2L4Q A;  1F6M C;  3WT1 A;  2DKH A;  5IMF A;  1FB6 A;  5G2Z A;  1GSF A;  2VD1 A;  4N0Z A;  1OE8 A;  2XC2 A;  2OBK A;  3A3T A;  5KN1 A;  4IBP A;  2I9H A;  1ZZY A;  1X0R A;  4NV2 A;  4EVM A;  5J41 A;  2IME A;  2EIR A;  2F8F A;  2YWI A;  1SK1 A;  2L6C A;  4MZB A;  4BIK A;  3Q18 A;  2N5A A;  18GS A;  2WVZ A;  3W6G A;  1SJI A;  1O73 A;  2JZT A;  1FVJ A;  1JZW A;  1E2Y A;  2EIQ A;  1XOA A;  3IXR A;  4KSM A;  4BL7 A;  1YY7 A;  5CRD A;  2H1D A;  1B4Q A;  3V1W A;  1G6W A;  1U3I A;  1O7U A;  6GSW A;  1H75 A;  1YEW C;  4O32 A;  4TXV A;  4WXT A;  1GSS A;  4MZC A;  3TKQ A;  3IDV A;  1J08 A;  5HFK A;  2C0D A;  3QDN A;  3P8W A;  5A5H B;  1NHO A;  16GS A;  4LLR A;  3CMI A;  4MJE A;  2O85 A;  3BD2 A;  4I2U A;  1O81 A;  3HD5 A;  3C73 A;  4CY6 A;  2H1G A;  4IKH A;  1T7P B;  2RII A;  5F05 A;  3S9F A;  3ZIV A;  12GS A;  5DCG A;  5ECR B;  1EGO A;  3FW2 A;  5D93 A;  1BAY A;  1XZO A;  1TDI A;  5A1N A;  5HR0 A;  1KEB A;  2L59 A;  4PUF C;  3US3 A;  4NMU A;  2WFC A;  5DJM A;  4I5Q A;  3UIW A;  2N5F A;  5ECS A;  2VAF A;  3MSZ A;  2E2G A;  5ECI B;  3CSI A;  4ILF A;  5JCU A;  3L9U A;  2B1K A;  5B8B A;  5JCW A;  2PWJ A;  1YKC A;  1ERV A;  4GDF A;  3IK7 A;  2CT6 A;  4N11 A;  2P0G A;  2K18 A;  5CAX A;  5B6M A;  1EV9 A;  5J3R A;  4GCI A;  1U3A A;  4XS4 A;  4MH2 A;  2GSQ A;  1PN0 A;  4NWY A;  4MZW A;  1SEN A;  3C1S A;  1FOV A;  4J2F A;  1Z7P A;  4ZB8 A;  4PUR A;  1H4O A;  3IK9 A;  3APS A;  1NM3 A;  2GST A;  1S3R A;  1G6Y A;  1NW2 A;  1ERT A;  2BJX A;  4FH8 A;  1Y1U A;  3LWA A;  2HRK B;  3H79 A;  2AHE A;  2LRN A;  1XOB A;  4HSC X;  3GL3 A;  3TJJ A;  4I2T A;  3IBH A;  4KCE A;  4DVC A;  5J9B A;  5IMD A;  3H93 A;  1QXH A;  1WP0 A;  5CP1 A;  2VCX A;  2KHP A;  3D5J A;  5AIV A;  4RUV A;  4EL1 A;  1BG1 A;  4K8M A;  3RDW A;  4I97 A;  3CXG A;  2F3M A;  4PI2 C;  1XW6 A;  4V2N A;  4Z2R A;  3IE3 A;  3KMO A;  4ZB9 A;  2V6K A;  3TRX A;  1W89 A;  6GSX A;  3AY8 A;  3ZRD A;  2B6M A;  1F2E A;  5G5F A;  3TKS C;  2H66 A;  1UA5 A;  5G5E A;  3CSH A;  2C3N A;  2VUP A;  3J7Y b;  1JHB A;  7GSS A;  3DKS A;  5CNW A;  4BL7 B;  4YKF A;  4JZQ A;  2HT9 A;  5ID2 B;  3HZ4 A;  3GH9 A;  3EE2 A;  5HFI A;  2M80 A;  2VKZ G;  1M3J A;  4I6X A;  1GSU A;  5IQY A;  2L5L A;  3FR3 A;  4TKY A;  4WET A;  4ECC A;  2IMI A;  1KBN A;  2MZC A;  3FHK A;  1X9M B;  2B7J A;  2K8S A;  4IQ1 A;  3LG6 A;  4J57 E;  2WS2 A;  1GNE A;  2B3S A;  2X99 A;  3EU3 A;  3JCM L;  4QL9 A;  4O92 A;  2ES7 A;  5H5Q A;  2GSS A;  4ECB A;  2UV8 G;  3QFA C;  1XW9 A;  3WGD A;  4K2D A;  2GT6 A;  3QPM A;  1F3B A;  4MF5 A;  3P2A A;  3HJO A;  4Q5F A;  5A1N B;  2GS3 A;  2DJ3 A;  4OD7 A;  2A4H A;  1T3B A;  4DSS A;  5GAP D;  4A5P A;  2J23 A;  1PKZ A;  2E0Q A;  1K0M A;  4Q5Q A;  3QOU A;  2X8C A;  4WR4 A;  1U6T A;  4N3Z A;  5HR3 A;  3O6T A;  1BF5 A;  1BYE A;  2H71 A;  4CY8 A;  3Q74 A;  2KOK A;  3A5I A;  1JLV A;  4MPG A;  3FEU A;  1EEJ A;  4XS4 B;  4TXO A;  3TUE A;  1TI3 A;  3KXO A;  3ZYW A;  2JU5 A;  3Q19 A;  4EIQ A;  5JWQ B;  1M0U A;  3GTU A;  2C1Y A;  2LQO A;  2L6D A;  1XG8 A;  3M8N A;  3UJ1 A;  4PX1 A;  1DUG A;  3U6V A;  5F07 A;  4ECJ A;  1T4Z A;  3ISO A;  2HSM B;  5ECN B;  4FO5 A;  1QGV A;  1K0N A;  3IC4 A;  2A2S A;  1SL1 B;  1RW1 A;  2G2Q A;  2EFE A;  1DSB A;  3SWL A;  3F3R A;  4WBJ A;  3FZA A;  4I8B A;  3IHG A;  1M7T A;  1GUL A;  1URM A;  1WMJ A;  4EKZ A;  2VCQ A;  4IN0 A;  1X9S B;  2GZY A;  5DAL A;  5IIZ A;  3U5R E;  2YAN A;  1SJ6 A;  1XVW A;  2H19 A;  4CDO A;  3N5O A;  3GX8 A;  2AAW A;  4JU5 A;  2FUG 2;  4X4J A;  5DJL A;  1OAZ A;  3F6F A;  1QMV A;  4EE0 A;  1A2J A;  4PUA A;  1Z5Y E;  1ACV A;  4MK3 A;  1TOF A;  4OO4 A;  2VOC A;  5IOX A;  4Q5R A;  1YJ6 A;  2QGV A;  3R2Q A;  3VFI A;  1V2A A;  2R6K A;  3QAW A;  4POL A;  5IMC A;  1MTC A;  3ZL5 A;  3TKR A;  1E6B A;  1ZYN A;  4GXZ A;  1HNC A;  3MYD A;  1GH2 A;  1EV4 A;  1J9B A;  1FAA A;  3HY2 A;  2CX3 A;  1FO5 A;  3GSS A;  3L78 A;  2R5G A;  1BX9 A;  3FRC A;  2I4A A;  2DC5 A;  5D9V A;  4MA9 A;  5IMZ A;  5CRW A;  4OMV A;  2R37 A;  3EWL A;  5EL8 A;  1A8Y A;  2H70 A;  3TB2 A;  2PPT A;  3WD6 A;  2GQM A;  3KCM A;  4BVY A;  1ZMA A;  2RM6 A;  1ERW A;  2R0C A;  2YZH A;  1R7H A;  3UVT A;  1GRX A;  4DSS B;  2WVX A;  2DIY A;  4IQA A;  3BOA A;  3Q6O A;  3GN3 A;  3I9V 2;  1SL2 B;  4KDU A;  2VL3 A;  3CHX C;  1SVM A;  3H1N A;  1G0T A;  1R5P A;  3HA9 A;  2NVL A;  3ZZX A;  3W8S A;  1X5D A;  2LKU A;  1GUM A;  3WYW A;  2DJJ A;  5J4Y A;  4G01 A;  5D9X A;  2WUL A;  2JAD A;  1MEK A;  1X5C A;  4TXO B;  6GSV A;  1SKS B;  1AQX A;  3GKM A;  3IRA A;  1I1I P;  5CRE A;  2X8G A;  3FR9 A;  1B4P A;  4FYU A;  3GTU B;  1XPV A;  1ABA A;  4MLY A;  5J5N A;  2VCV A;  3MAK A;  1ZYP A;  1K3Y A;  2L4C A;  3SBC A;  2O8V B;  4LMW A;  4ZBA A;  3GL5 A;  1PX7 A;  5A4W A;  1LU4 A;  3VK9 A;  3UOM A;  2OKA A;  3GFK A;  8GSS A;  2C0F A;  3HMJ G;  1SK2 A;  1MDI A;  1Z6N A;  2GVP A;  2HRA A;  3APQ A;  3TU3 B;  2QA2 A;  1EP7 A;  1K0D A;  1U88 A;  2HSN B;  3IV4 A;  3GH6 A;  1SD9 A;  1PA3 A;  4IW9 A;  1O8X A;  2WB9 A;  5J40 A;  4YQV A;  2XPD A;  3UMA A;  1XW5 A;  5DAL B;  3HVX A;  2B5Y A;  2R0P A;  4NHW A;  1A0F A;  5AIX A;  3LYP A;  3H4K A;  1ZL9 A;  2YOI A;  2PU9 C;  2YP6 A;  5E4W A;  2FNO A;  3WGX A;  4K2X A;  1B48 A;  3UBK A;  4HZ4 A;  2HI7 A;  3PH9 A;  1M9B A;  2H6X A;  4AJ8 A;  4KAE A;  3HVN A;  3FZ4 A;  4DEJ A;  2F9S A;  2WJU A;  3EMX A;  2AUV A;  1KTE A;  4Z2U A;  4F0B A;  2VL2 C;  2ON7 A;  2PER A;  2QC7 A;  1YZX A;  3GNJ A;  5F0G A;  1B9X C;  4AGS A;  2VL2 A;  4E8E A;  4YAP A;  2MMZ A;  4CW9 A;  5GAN D;  2OE0 A;  1OVN A;  4JE1 A;  4O7H A;  4NV5 A;  2AB6 A;  1GNW A;  4EIP A;  2X4A A;  4GTU A;  3QCP A;  4MF6 A;  3I43 A;  4XRA A;  1Y25 A;  4MF7 A;  2NTO A;  3QR6 A;  3DWV A;  3ME8 A;  1M3I A;  4ML6 A;  3O76 A;  1GTA A;  1YKA A;  2IN3 A;  1YDK A;  3N9J A;  3EYT A;  1IYI A;  4POM A;  3C71 A;  4QL7 A;  4WBR D;  4KA0 A;  3IAM 2;  4BVY B;  3RPN A;  2YWM A;  5DDL A;  1M2A A;  2LTK A;  3D0Z A;  3ME7 A;  1S3C A;  2LV3 A;  5FHI A;  4KDX A;  2IMK A;  4IJI A;  3H8Q A;  3WT2 A;  5G1K A;  1XVQ A;  2A4V A;  1IYH A;  3FZ5 A;  1YVL A;  3E9J B;  4TR4 A;  1WOU A;  5F06 A;  4QMK A;  2F8A A;  2B5X A;  1XXU A;  1MD4 A;  1A24 A;  1OC9 A;  4HEA 2;  2OAC A;  2GDR A;  4K9Z A;  1GSE A;  2NDO A;  5ABR A;  2GZZ A;  2EIO A;  2H0I A;  5L71 A;  3L9S A;  1UC7 A;  2DJ1 A;  4LL1 B; 
#chains in the Genus database with same CATH homology
 2CZ2 A;  5KEJ A;  4K5R A;  3ZIJ A;  4IGJ A;  2FA4 A;  5IO0 A;  3VI5 A;  20GS A;  4KE3 A;  4IHU A;  4WR5 A;  1JFU A;  1M2D A;  1F9M A;  2OBI A;  3QMX A;  4KH7 A;  3EU4 A;  4N0V A;  2TIR A;  3F0I A;  4KB3 A;  1USB A;  5JWR B;  5D73 A;  2YV7 A;  1ZYE A;  4L0U A;  4HDE A;  4NXI A;  3PGT A;  4ID0 A;  4Z7X A;  1QQ2 A;  3G7I A;  1Y6E A;  3HVV A;  2C80 A;  1N8J A;  2JSY A;  1OYJ A;  3HDC A;  5DQS A;  5HFG A;  3ZTL A;  1V58 A;  4OFT A;  5J9C A;  5JWO B;  2J9H A;  3VLN A;  1K0B A;  4OO5 A;  2CA8 A;  3NOF A;  2QSI A;  2VM1 A;  3KP8 A;  3GST A;  3ZFB A;  2EC4 A;  4AKI A;  3E3E A;  1GTI A;  2M72 A;  1FG4 A;  5LCZ A;  4TW5 A;  2F51 A;  3D21 A;  4EDY A;  1WIK A;  3CYN A;  3QAG A;  5AN1 A;  2GTU A;  1A8L A;  2P31 A;  4HU9 A;  1SVO A;  1SJZ A;  4PQH A;  1WPI A;  1HD2 A;  1TRU A;  4ZXG A;  1SKW B;  1SVL A;  13GS A;  2RM5 A;  5JCG A;  5BMU A;  5B8A A;  2M46 A;  5AGY A;  4P3Y B;  4V1A g;  3HVS A;  2HE3 A;  3GUS A;  3GKK A;  3A5W A;  3P7X A;  2WDU A;  3CTG A;  2JSZ A;  4ACS A;  3FY7 A;  1JLW A;  3G7Y A;  1XCC A;  3IPZ A;  3KTB A;  4BVX A;  2PN8 A;  2REM A;  1FOH A;  1Q98 A;  1WWJ A;  3VWV A;  4K1F A;  4ZIJ A;  2ON5 A;  1TRS A;  4ZB6 A;  5DAK A;  2H6Z A;  2PVQ A;  3KMN A;  2LUS A;  4IEL A;  3PPU A;  2WCI A;  4KX4 A;  1CQH A;  4IVF A;  1OC8 A;  1G7O A;  1TRW A;  3LYK A;  4ICY A;  3QAV A;  4ECI A;  2A2P A;  4G2E A;  2CVK A;  2MMO A;  5G1L A;  1Z3E A;  4JBB A;  4BWS A;  4ULX A;  1F3A A;  4F03 A;  6GSU A;  1XIY A;  2GQL A;  4WF5 A;  4K0N A;  2K6V A;  4MCU A;  1UVZ A;  3GKX A;  2HLS A;  4PNG A;  3F9U A;  1FW1 A;  1R26 A;  2FLS A;  2H01 A;  3CWG A;  5E59 A;  5B6N A;  2FWF A;  2EFD A;  1A2L A;  2V41 A;  2A2R A;  4TR1 A;  2ZCT A;  2FWG A;  4JRR A;  2TRX A;  4XS6 A;  3ZVJ D;  4G0L A;  2YCD A;  1W4V A;  2ALB A;  2GGT A;  4NPB A;  1FVK A;  4HQZ A;  5DBQ A;  3LSZ A;  4DSR A;  4G9H A;  14GS A;  4CHS A;  3ZVJ A;  1WE0 A;  1V40 A;  4L8E A;  2PBJ A;  1TP9 A;  4N30 A;  5IMV A;  3L9V A;  1GUK A;  4K0G A;  4MH3 A;  1K0O A;  1VRS D;  1B8X A;  5F8B A;  1PKW A;  3E0U A;  5C04 A;  1DE2 A;  3R3E A;  2PVO C;  1K0C A;  3L4N A;  4PGT A;  3KTL A;  2MYG A;  22GS A;  5ENU A;  4ZL8 A;  3O3T A;  5IMA A;  2B5E A;  2L5O A;  2KLX A;  4DSQ A;  5GZZ B;  3DVW A;  3LGC A;  2CVB A;  4RI7 A;  2C8U A;  2VLU A;  2RLI A;  3GMF A;  1FB0 A;  4GQF A;  2YNX A;  1A0R P;  2H73 A;  1V57 A;  1OKT A;  17GS A;  1F37 A;  4K7O A;  1YF1 A;  2XHF A;  2WRT A;  1K0A A;  1I9D A;  1XWG A;  1GLQ A;  1EZK A;  2V6O A;  5FWG A;  2G0F A;  3RPP A;  3GX0 A;  3TOT A;  3RAZ A;  1EOH A;  4K5S A;  1LBK A;  2YN1 A;  4L5O A;  1TK5 B;  3BBY A;  5H5S A;  5A4V A;  3LFL A;  1S3A A;  5DAK B;  1AUC A;  4USS A;  4HJ2 A;  3LXZ A;  4F0C A;  3VWW A;  5A5H A;  3GHA A;  1QFN A;  1R4W A;  1BG5 A;  2HSY A;  1V98 A;  2I81 A;  2FGX A;  4MJB A;  1SU9 A;  1PRX A;  5B7C A;  1UN2 A;  1EWX A;  1PX6 A;  2LST A;  4TVE A;  2V32 A;  3DYR A;  4EXJ A;  3F4T A;  2IWT A;  4WEY A;  3LXT A;  4KCA A;  2VL9 A;  5ECL B;  5GST A;  5GSS A;  4JR6 A;  3DEX A;  4NHZ A;  4AKX B;  4HOJ A;  4X43 A;  1GSQ A;  1AQW A;  2XBQ A;  1THO A;  1GTU A;  6GST A;  4GLT A;  3TRP A;  1X5E A;  4BPY A;  4G10 A;  3BCI A;  3KD0 A;  3CSJ A;  1PN9 A;  5HR2 A;  4GQC A;  1SK0 A;  5D96 A;  1TU7 A;  1GSY A;  2OE3 A;  2OJL A;  3MWH A;  3FYG A;  1VF2 A;  3FMW A;  1GTB A;  2HZE A;  3W8J A;  5IPG A;  5IOW A;  4TR1 B;  1AQV A;  2NBS A;  5CYY A;  3C7M A;  4MP4 A;  4KDY A;  3J7Y k;  5J47 A;  2VM2 A;  1VF1 A;  3KP9 A;  1ON4 A;  4H86 A;  3ZFL A;  4AKH A;  2HQT A;  3I69 A;  1ERU A;  3UAR A;  4NAX A;  3GKN A;  4EO3 A;  4AJ6 A;  1V9W A;  2B1L A;  1QK8 A;  3MIX A;  1AC1 A;  2V1M A;  1YF0 A;  5ECO B;  2YJ7 A;  1HNB A;  3UBL A;  1PQN A;  2HRK A;  2HRF A;  4KND A;  4V2M A;  2BTO T;  2LEG A;  1VF4 A;  4L5L A;  2DSA A;  3I6A A;  5G31 A;  3TJF A;  4F82 A;  1XWC A;  3D4M A;  5COH A;  3D6I A;  1TI1 A;  3LQ7 A;  5DVB A;  3A2X A;  4YKG A;  2I1U A;  4HI7 A;  5ECH B;  2VLT A;  4AKG A;  2IL3 A;  2CV4 A;  2HZF A;  2K9F A;  3KH7 A;  1ZOF A;  1SYX A;  5ECK B;  4ZBD A;  2I3Y A;  4MMM A;  2NPB A;  2JZR A;  4TOP A;  4MJC A;  3WGE A;  1A23 A;  2HNL A;  3EMP A;  3VUR A;  1EGR A;  1GUH A;  2V2G A;  2R4V A;  3HCZ A;  5ID2 A;  3TOU A;  3IR4 A;  2LQQ A;  2MBS A;  3M9J A;  1TW9 A;  4HQS A;  3GUR A;  5ECM B;  19GS A;  2HXK A;  3F63 A;  3TDG A;  2VCT A;  3C8E A;  2CZ3 A;  4K6X A;  2XBI A;  3A2W A;  4MJA A;  10GS A;  4O5Q A;  5H5R A;  2R3X A;  1BED A;  2K8V A;  4ZIL A;  1ZGN A;  2CAQ A;  1J0F A;  4TR3 A;  3MNG A;  4PNF A;  3KIJ A;  4MDC A;  3HHV A;  4FIW A;  5CRG A;  2DJK A;  3D4T A;  4HZ2 A;  1DE1 A;  1MDK A;  3KZQ A;  2OAD A;  3TRQ A;  2LS5 A;  1C72 A;  1U87 A;  2H6Y A;  3TKP A;  3BCK A;  5LD0 A;  3IAS 2;  5FT3 A;  4FYC A;  3LW9 A;  2FWH A;  4KSO A;  1GLP A;  1JZR A;  4V2L A;  5AIS A;  3KM6 A;  1T1V A;  1PSQ A;  3HJP A;  4YAV A;  1M2B A;  1X9W B;  4EF0 A;  3UEM A;  4E68 A;  4LL4 B;  4IP1 A;  1O6J A;  4LMV A;  3RBT A;  1XFL A;  3DRN A;  2H1A A;  1PGT A;  2DJ2 A;  3VI7 A;  5C00 A;  4LA1 A;  1TXU A;  2HZE B;  2C0G A;  3OR5 A;  2FA8 A;  1R5A A;  2LJK A;  1A2M A;  2FCH A;  2JZS A;  5A4U A;  2KP2 A;  4HJM A;  1HNA A;  2IPA A;  4EUY A;  5KN2 A;  4ML1 A;  2CQ9 A;  1SYR A;  2LNS A;  2WZ9 A;  3DVX A;  4ISD A;  2L57 A;  1GP1 A;  2XPE A;  3P90 A;  2H0H A;  4POB A;  3A2V A;  3IA1 A;  4XS1 A;  3RHB A;  5EVO A;  1ZYQ B;  4F2I A;  5A34 A;  2FWE A;  3GIX A;  2IFQ A;  2HSM A;  4BWQ A;  3KJY A;  4BA7 A;  1ML6 A;  4TRX A;  2FY6 A;  3IC8 A;  2QKE A;  4OCE A;  3QFB C;  4D73 A;  3KGK A;  1NHY A;  3CRU A;  2VO4 A;  2YWO A;  1T8E B;  1SKR B;  3GV1 A;  1GL8 A;  2GT5 A;  2O7K A;  3ZRE A;  4TN8 A;  4G19 A;  1T4Y A;  3M3M A;  5DQY A;  1PMT A;  3TJG A;  5IPH A;  6GSS A;  2AJQ B;  2HSH A;  3UAP A;  5D9T A;  1OE7 A;  1GSD A;  2N5B A;  5A5K A;  3ERG A;  2DLX A;  1Z7R A;  11GS A;  3M1G A;  5IO2 A;  2CX4 A;  3VWU A;  3IOS A;  4IP6 A;  4KW6 A;  2P5R A;  5EPF A;  2E2M A;  3GA4 A;  1HYU A;  4OCF A;  4GSN A;  4MAB A;  5KOX A;  3F8U A;  3QD9 A;  3LOR A;  5ELG A;  4G0K A;  1OC3 A;  1TJD A;  1O85 A;  3TKS A;  3FZ9 A;  2LNT A;  5HR1 A;  1KNG A;  1JZO A;  1YEX A;  1AIU A;  2UZ8 A;  1EP8 A;  2HFD A;  3TJB A;  2P5Q A;  2X49 A;  2H74 A;  1PL2 A;  3CRT A;  3RHC A;  3C1R A;  1FHE A;  1TK8 B;  3TCO A;  3DGQ A;  5LNK e;  5ECP B;  3DML A;  3LEF A;  2C4J A;  2PGT A;  4JED A;  4OFN A;  3PR8 A;  4GST A;  4X1U A;  4E8H A;  2EFC A;  3F6D A;  2MBT A;  2C3T A;  2VLV A;  4HS1 A;  5KN0 A;  3ERW A;  1EOG A;  2IMD A;  2R0G A;  4YQU A;  2MMN A;  4F9Z A;  4X0X A;  3LJR A;  4GRF A;  2IMF A;  2IJY A;  3EVI A;  2X64 A;  2HYX A;  1AAZ A;  1OC9 B;  3MDK A;  3HZ8 A;  3EIN A;  2GLR A;  2R2J A;  2YJH A;  4W66 A;  2OA7 A;  3TGZ A;  4L0W A;  2H8L A;  3K8N A;  1LJR A;  2LJR A;  1TXX A;  1AW9 A;  3UVH A;  4MNN A;  2B7K A;  1TKD B;  1NSW A;  2OE1 A;  4GF0 A;  2GZP A;  2KUC A;  1TRV A;  4POK A;  4YQM A;  1RQM A;  4XCS A;  4FYB A;  2H1L A;  5G30 A;  1K3L A;  2PMT A;  2VCZ A;  4AF2 A;  2JL4 A;  1Z6M A;  1VGL A;  3M0F A;  4TR0 A;  2EFH A;  1MDJ A;  1SD8 A;  2YPM A;  1ZCP A;  2DJ0 A;  3TJK A;  4ZL7 A;  1YEP A;  9GSS A;  2DKI A;  3NZN A;  1Q4J A;  4PQ1 A;  2KP1 A;  1XWA A;  5J4U A;  3BJ5 A;  4YH2 A;  2H0G A;  2O87 A;  1N25 A;  2LRC A;  4Z2T A;  3HXS A;  5A34 B;  1ST9 A;  2AYT A;  4AI6 A;  4ZBB A;  2O89 A;  2IFQ B;  5KN3 A;  2BMX A;  2LJA A;  3DIE A;  3FKF A;  4RQR A;  4IS0 A;  5CO3 A;  4D73 B;  4HU7 A;  2HSN A;  2AV4 A;  4HUA A;  4JR4 A;  2FHE A;  2PUK C;  2E7P A;  2LRT A;  1BJX A;  4O5U A;  1EEM A;  4PTS A;  4G0I A;  6GSY A;  3F4S A;  4XIH A;  4XHM A;  2C3Q A;  2D2Z A;  3ZLP A;  3CTF A;  3FR6 A;  3ZML A;  3EUR A;  3HKR A;  1TU8 A;  1XWK A;  1T00 A;  2FD3 A;  1S3D A;  1GWC A;  3KH9 A;  3GYK A;  2DML A;  5J4V A;  1QUW A;  2VD0 A;  1I5G A;  3UL3 A;  4J56 E;  3KEB A;  3HYP A;  3APO A;  4WF4 A;  3F3Q A;  5BMU B;  2O5V A;  1RK4 A;  2ZUP A;  1BQ7 A;  4IJ3 A;  1OKD A;  3VPQ A;  5HQP A;  1B9Y C;  3ZMK A;  4XRD A;  5BRT A;  1O8W A;  2TRC P;  3DXB A;  5EY6 A;  1TK0 B;  4EDZ A;  2OT3 A;  3EPT A;  4OWY A;  5ELA A;  4ZL9 A;  4MPF A;  4RI6 A;  2CAI A;  4BVX B;  1VF3 A;  2YV9 A;  2RUE A;  2H30 A;  5KOW A;  3DD3 A;  2VCW A;  2RUF A;  2HRN A;  1AXD A;  3ERF A;  2JAC A;  1TTZ A;  5D9W A;  2H1B A;  4RQX A;  4GWR A;  2CVD A;  3CBU A;  4XTS A;  4K7I A;  3ED3 A;  2YWN A;  4O5R A;  2DMM A;  4N10 A;  1SL0 B;  3F4R A;  4ZB7 A;  3G7J A;  1XBS A;  1PL1 A;  2DIZ A;  4PQI A;  2YZU A;  3L0H A;  2WGR A;  1YQ1 A;  4AJ7 A;  1N2A A;  5CRH A;  3VPT A;  4FQU A;  1JZD A;  4PXO A;  4QQ7 A;  4OFM A;  1ILO A;  1MD3 A;  2IIY A;  4WKW A;  2ZNM A;  4GSS A;  2C0E A;  4K7N A;  1HQO A;  1Z9H A;  1WRY A;  1DBY A;  1M99 A;  3EC3 A;  1M9A A;  1CQG A;  2H75 A;  2QA1 A;  2Z9S A;  2H72 A;  5DCH A;  3HJM A;  3FK8 A;  4KF9 A;  1XWB A;  3IHQ A;  2DBC A;  3VWX A;  2VIM A;  4EC0 A;  4V1A p;  1G7E A;  2H76 A;  2MMA A;  3D22 A;  3TKS E;  5INY A;  3G9B A;  1PD2 1;  3GRX A;  3M9K A;  4Q5N A;  2GSR A;  2GQK A;  1THX A;  4KGI A;  1WJK A;  3PIN A;  5ECQ B;  5D8I A;  2X8H A;  5IM9 A;  3ZIT A;  4KUN A;  3NIV A;  1K3O A;  2L4Q A;  1F6M C;  3WT1 A;  2DKH A;  5IMF A;  1FB6 A;  5G2Z A;  1GSF A;  2VD1 A;  4N0Z A;  1OE8 A;  2XC2 A;  2OBK A;  3A3T A;  5KN1 A;  4IBP A;  2I9H A;  1ZZY A;  1X0R A;  4NV2 A;  4EVM A;  5J41 A;  2IME A;  2EIR A;  2F8F A;  2YWI A;  1SK1 A;  2L6C A;  4MZB A;  3Q18 A;  2N5A A;  18GS A;  3W6G A;  1SJI A;  1O73 A;  2JZT A;  1FVJ A;  1JZW A;  1E2Y A;  2EIQ A;  1XOA A;  3IXR A;  4KSM A;  4BL7 A;  1YY7 A;  5CRD A;  2H1D A;  1B4Q A;  3V1W A;  1G6W A;  1U3I A;  1O7U A;  6GSW A;  1H75 A;  4O32 A;  4TXV A;  4WXT A;  1GSS A;  4MZC A;  3TKQ A;  3IDV A;  1J08 A;  5HFK A;  2C0D A;  3QDN A;  3P8W A;  5A5H B;  1NHO A;  16GS A;  4LLR A;  3CMI A;  4MJE A;  2O85 A;  3BD2 A;  4I2U A;  1O81 A;  3HD5 A;  3C73 A;  4CY6 A;  2H1G A;  4IKH A;  1T7P B;  2RII A;  5F05 A;  3S9F A;  3ZIV A;  12GS A;  5DCG A;  5ECR B;  1EGO A;  3FW2 A;  5D93 A;  1BAY A;  1XZO A;  1TDI A;  5A1N A;  5HR0 A;  1KEB A;  2L59 A;  4PUF C;  3US3 A;  4NMU A;  2WFC A;  5DJM A;  4I5Q A;  3UIW A;  2N5F A;  5ECS A;  2VAF A;  3MSZ A;  2E2G A;  5ECI B;  3CSI A;  4ILF A;  5JCU A;  3L9U A;  2B1K A;  5B8B A;  5JCW A;  2PWJ A;  1YKC A;  1ERV A;  4GDF A;  3IK7 A;  2CT6 A;  4N11 A;  2P0G A;  2K18 A;  5CAX A;  5B6M A;  1EV9 A;  5J3R A;  4GCI A;  1U3A A;  4XS4 A;  4MH2 A;  2GSQ A;  1PN0 A;  4NWY A;  4MZW A;  1SEN A;  3C1S A;  1FOV A;  4J2F A;  1Z7P A;  4ZB8 A;  4PUR A;  1H4O A;  3IK9 A;  3APS A;  1NM3 A;  2GST A;  1G6Y A;  1NW2 A;  1ERT A;  2BJX A;  4FH8 A;  1Y1U A;  3LWA A;  2HRK B;  3H79 A;  2AHE A;  2LRN A;  1XOB A;  3GL3 A;  3TJJ A;  4I2T A;  3IBH A;  4KCE A;  4DVC A;  5J9B A;  5IMD A;  3H93 A;  1QXH A;  1WP0 A;  5CP1 A;  2VCX A;  2KHP A;  3D5J A;  5AIV A;  4RUV A;  4EL1 A;  1BG1 A;  4K8M A;  3RDW A;  4I97 A;  3CXG A;  2F3M A;  1XW6 A;  4V2N A;  4Z2R A;  3IE3 A;  3KMO A;  4ZB9 A;  2V6K A;  3TRX A;  1W89 A;  6GSX A;  3AY8 A;  3ZRD A;  2B6M A;  1F2E A;  5G5F A;  3TKS C;  2H66 A;  1UA5 A;  5G5E A;  3CSH A;  2C3N A;  2VUP A;  3J7Y b;  1JHB A;  7GSS A;  3DKS A;  5CNW A;  4BL7 B;  4YKF A;  4JZQ A;  2HT9 A;  5ID2 B;  3HZ4 A;  3GH9 A;  3EE2 A;  5HFI A;  2M80 A;  2VKZ G;  4I6X A;  1GSU A;  5IQY A;  2L5L A;  3FR3 A;  4TKY A;  4WET A;  4ECC A;  2IMI A;  1KBN A;  2MZC A;  3FHK A;  1X9M B;  2B7J A;  2K8S A;  4IQ1 A;  3LG6 A;  4J57 E;  2WS2 A;  1GNE A;  2B3S A;  2X99 A;  3EU3 A;  3JCM L;  4QL9 A;  4O92 A;  2ES7 A;  5H5Q A;  2GSS A;  4ECB A;  2UV8 G;  3QFA C;  1XW9 A;  3WGD A;  4K2D A;  2GT6 A;  3QPM A;  1F3B A;  4MF5 A;  3P2A A;  3HJO A;  4Q5F A;  5A1N B;  2GS3 A;  2DJ3 A;  4OD7 A;  2A4H A;  1T3B A;  4DSS A;  5GAP D;  4A5P A;  2J23 A;  1PKZ A;  2E0Q A;  1K0M A;  4Q5Q A;  3QOU A;  2X8C A;  4WR4 A;  1U6T A;  4N3Z A;  5HR3 A;  3O6T A;  1BF5 A;  1BYE A;  2H71 A;  4CY8 A;  3Q74 A;  2KOK A;  3A5I A;  1JLV A;  4MPG A;  3FEU A;  1EEJ A;  4XS4 B;  4TXO A;  3TUE A;  1TI3 A;  3KXO A;  3ZYW A;  2JU5 A;  3Q19 A;  4EIQ A;  5JWQ B;  1M0U A;  3GTU A;  2C1Y A;  2LQO A;  2L6D A;  3M8N A;  3UJ1 A;  4PX1 A;  1DUG A;  3U6V A;  5F07 A;  4ECJ A;  1T4Z A;  3ISO A;  2HSM B;  5ECN B;  4FO5 A;  1QGV A;  1K0N A;  3IC4 A;  2A2S A;  1SL1 B;  1RW1 A;  2G2Q A;  2EFE A;  1DSB A;  3SWL A;  3F3R A;  4WBJ A;  3FZA A;  4I8B A;  3IHG A;  1M7T A;  1GUL A;  1URM A;  1WMJ A;  4EKZ A;  2VCQ A;  4IN0 A;  1X9S B;  2GZY A;  5DAL A;  5IIZ A;  3U5R E;  2YAN A;  1SJ6 A;  1XVW A;  2H19 A;  4CDO A;  3N5O A;  3GX8 A;  2AAW A;  4JU5 A;  2FUG 2;  4X4J A;  5DJL A;  1OAZ A;  3F6F A;  1QMV A;  4EE0 A;  1A2J A;  4PUA A;  1Z5Y E;  1ACV A;  4MK3 A;  1TOF A;  4OO4 A;  2VOC A;  5IOX A;  4Q5R A;  1YJ6 A;  2QGV A;  3R2Q A;  3VFI A;  1V2A A;  2R6K A;  3QAW A;  4POL A;  5IMC A;  1MTC A;  3ZL5 A;  3TKR A;  1E6B A;  1ZYN A;  4GXZ A;  1HNC A;  3MYD A;  1GH2 A;  1EV4 A;  1J9B A;  1FAA A;  3HY2 A;  2CX3 A;  1FO5 A;  3GSS A;  3L78 A;  2R5G A;  1BX9 A;  3FRC A;  2I4A A;  2DC5 A;  5D9V A;  4MA9 A;  5IMZ A;  5CRW A;  4OMV A;  2R37 A;  3EWL A;  5EL8 A;  1A8Y A;  2H70 A;  3TB2 A;  2PPT A;  3WD6 A;  2GQM A;  3KCM A;  4BVY A;  1ZMA A;  2RM6 A;  1ERW A;  2R0C A;  2YZH A;  1R7H A;  3UVT A;  1GRX A;  4DSS B;  2DIY A;  4IQA A;  3BOA A;  3Q6O A;  3GN3 A;  3I9V 2;  1SL2 B;  4KDU A;  2VL3 A;  1SVM A;  3H1N A;  1G0T A;  1R5P A;  3HA9 A;  2NVL A;  3ZZX A;  3W8S A;  1X5D A;  2LKU A;  1GUM A;  3WYW A;  2DJJ A;  5J4Y A;  4G01 A;  5D9X A;  2WUL A;  2JAD A;  1MEK A;  1X5C A;  4TXO B;  6GSV A;  1SKS B;  1AQX A;  3GKM A;  3IRA A;  5CRE A;  2X8G A;  3FR9 A;  1B4P A;  4FYU A;  3GTU B;  1XPV A;  1ABA A;  4MLY A;  5J5N A;  2VCV A;  3MAK A;  1ZYP A;  1K3Y A;  2L4C A;  3SBC A;  2O8V B;  4LMW A;  4ZBA A;  3GL5 A;  1PX7 A;  5A4W A;  1LU4 A;  3VK9 A;  3UOM A;  2OKA A;  3GFK A;  8GSS A;  2C0F A;  3HMJ G;  1SK2 A;  1MDI A;  1Z6N A;  2GVP A;  2HRA A;  3APQ A;  3TU3 B;  2QA2 A;  1EP7 A;  1K0D A;  1U88 A;  2HSN B;  3IV4 A;  3GH6 A;  1SD9 A;  1PA3 A;  4IW9 A;  1O8X A;  2WB9 A;  5J40 A;  4YQV A;  2XPD A;  3UMA A;  1XW5 A;  5DAL B;  3HVX A;  2B5Y A;  2R0P A;  4NHW A;  1A0F A;  5AIX A;  3LYP A;  3H4K A;  1ZL9 A;  2YOI A;  2PU9 C;  2YP6 A;  5E4W A;  2FNO A;  3WGX A;  4K2X A;  1B48 A;  3UBK A;  4HZ4 A;  2HI7 A;  3PH9 A;  1M9B A;  2H6X A;  4AJ8 A;  4KAE A;  3FZ4 A;  4DEJ A;  2F9S A;  2WJU A;  3EMX A;  2AUV A;  1KTE A;  4Z2U A;  4F0B A;  2VL2 C;  2ON7 A;  2PER A;  2QC7 A;  1YZX A;  3GNJ A;  5F0G A;  1B9X C;  4AGS A;  2VL2 A;  4E8E A;  4YAP A;  2MMZ A;  4CW9 A;  5GAN D;  2OE0 A;  1OVN A;  4JE1 A;  4O7H A;  4NV5 A;  2AB6 A;  1GNW A;  4EIP A;  2X4A A;  4GTU A;  3QCP A;  4MF6 A;  3I43 A;  4XRA A;  1Y25 A;  4MF7 A;  2NTO A;  3QR6 A;  3DWV A;  3ME8 A;  4ML6 A;  3O76 A;  1GTA A;  1YKA A;  2IN3 A;  1YDK A;  3N9J A;  3EYT A;  1IYI A;  4POM A;  3C71 A;  4QL7 A;  4WBR D;  4KA0 A;  3IAM 2;  4BVY B;  3RPN A;  2YWM A;  5DDL A;  1M2A A;  2LTK A;  3D0Z A;  3ME7 A;  1S3C A;  2LV3 A;  5FHI A;  4KDX A;  2IMK A;  4IJI A;  3H8Q A;  3WT2 A;  5G1K A;  1XVQ A;  2A4V A;  1IYH A;  3FZ5 A;  1YVL A;  3E9J B;  4TR4 A;  1WOU A;  5F06 A;  4QMK A;  2F8A A;  2B5X A;  1XXU A;  1MD4 A;  1A24 A;  1OC9 A;  4HEA 2;  2OAC A;  2GDR A;  4K9Z A;  1GSE A;  2NDO A;  5ABR A;  2GZZ A;  2EIO A;  2H0I A;  5L71 A;  3L9S A;  1UC7 A;  2DJ1 A;  4LL1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...