4Q5NA

Crystal structure of the gluthatione s-transferase blo t 8
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
230
structure length
220
Chain Sequence
PLKIGYWDVRGFAEPIRMLLKHLNIEFEETRYGFLPNRDEWLAEKFTLGLEFPNLPYLFDGDFKMTESVAILKRLARANGMIATTEPALSYSEMIEAMIIDIRNRLINVVYAETPEEFEQKLADLRERLETSLGQLEAFFQKHGSQWVAGDKLTYVDFLAYEYLDWYRVFVKSTPIFEKFAKVSDYMKRFEELPSLKEYIARDEHRSASCLSPFARIGHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Gluthatione S-transferase Blo t 8 isoform
publication title Crystal structure of the gluthatione S-transferase Blo t 8
rcsb
source organism Blomia tropicalis
total genus 74
structure length 220
sequence length 230
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4q5nA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4q5nA01
2VL2C 2CAIA 3DRNA 4DSQA 1Z7RA 1T8EB 4JEDA 2H8LA 1U88A 1XFLA 4Q5QA 3VI7A 4F82A 2HXKA 4MZWA 1YKAA 4EF0A 2GZZA 4NXIA 3UBKA 5ID2A 2HI7A 4GRFA 3LYPA 3CBUA 3U6VA 2PGTA 4TOPA 2YANA 4PX1A 3H79A 1FG4A 2IWTA 2FCHA 3FZ9A 3CMIA 3LGCA 1K3LA 1VF4A 2H30A 4ISDA 4HJMA 5B6MA 4ZB6A 5FWGA 4K0GA 4IVFA 4ILFA 3AY8A 1Z9HA 4I97A 1K0DA 3RHBA 4HDEA 3EYTA 1FOVA 2C80A 2H74A 4TXOA 2D2ZA 2AYTA 3TJGA 2C3NA 5L71A 4WBRD 2MMZA 2V2GA 1FO5A 4XS1A 3IK7A 1YEPA 3NOFA 2GLRA 3HVVA 5GSSA 1Q98A 4POBA 3UARA 2LJAA 1ERUA 2MYGA 3F9UA 4ZL9A 3L9VA 4XTSA 1IYIA 2VCQA 1YDKA 4NV5A 3TKSE 4XS4A 3DIEA 1O81A 3EINA 1H75A 3PGTA 4PQHA 5ELGA 3I69A 2NDOA 4D73A 2HSNB 2NVLA 3U5RE 1O85A 1XWCA 4FQUA 4WETA 1T00A 1O73A 2FWGA 4HS1A 1ERWA 2MMOA 5EL8A 3US3A 2HSMA 3QCPA 5IMZA 1TW9A 2CA8A 4OFNA 1UC7A 1R5PA 3F4SA 2P0GA 1G6WA 2HQTA 2VLTA 9GSSA 3LQ7A 3A3TA 3HJMA 1OAZA 4KW6A 2CQ9A 3UBLA 1X5CA 1ST9A 3TKSC 3RPPA 1USBA 2YZHA 5CO3A 3CXGA 1GSDA 3DD3A 2QSIA 1TXXA 2E2MA 4O5RA 6GSWA 1TP9A 4IGJA 1MDIA 2FWHA 3ME7A 1PX7A 4MH2A 1EEMA 1DUGA 3FW2A 1TOFA 1PMTA 1TRWA 2YJHA 1M99A 2H1AA 1I5GA 1V57A 1O8WA 5J3RA 1T7PB 5CRDA 4HU7A 4KSOA 1QXHA 1MTCA 2R6KA 3M0FA 1K0BA 4RI7A 1TRVA 4L0WA 4FYUA 5G31A 2KHPA 1BJXA 3KM6A 1NW2A 2AV4A 2V1MA 4HZ2A 2TRCP 2AB6A 5D8IA 4F9ZA 4MLYA 1BQ7A 4WR4A 1Z3EA 1B9YC 4ID0A 13GSA 5CNWA 1OC9B 1WIKA 3GKMA 4TXVA 5DAKA 4KA0A 3O76A 2Z9SA 3H93A 4XCSA 1EOHA 1H4OA 2HLSA 3MAKA 1SD9A 3G7JA 1R4WA 3M9KA 2VL3A 4MJCA 1SYRA 2H72A 2DJ2A 5CP1A 2PN8A 2X8HA 17GSA 4X1UA 2R4VA 3LXTA 1I9DA 2PVOC 5LD0A 3APQA 2DMLA 4OD7A 3IXRA 1F3AA 1T3BA 4MA9A 4IS0A 1Y25A 2C0EA 3LORA 3TJFA 2X64A 1QK8A 4I2UA 2HRFA 4NHZA 1PRXA 2X8GA 1S3AA 2NTOA 2FY6A 2A2RA 3UIWA 3W8JA 3L9UA 1AC1A 3BOAA 1DSBA 1SYXA 2HZEB 1X9MB 3BCKA 4PUAA 2TIRA 2WULA 5HFIA 3TOUA 3F3RA 3ZIVA 5B7CA 4EO3A 2RUEA 3GYKA 3Q19A 4ZBBA 1GTBA 3F6DA 4KCEA 3H1NA 1HNCA 3FYGA 3UOMA 1GTIA 4E8EA 5JWQB 2PPTA 5DBQA 2C0FA 3HD5A 3ERGA 3HYPA 3MWHA 1J08A 2HYXA 2I3YA 5BMUA 5HFGA 4MZBA 1F2EA 2IJYA 3GN3A 4GLTA 2YN1A 3RDWA 5GAPD 1O8XA 1YY7A 5E59A 2VD0A 4LA1A 4MF7A 4WF4A 2ON5A 1EP7A 2WB9A 3ZMLA 3ERFA 5KN1A 2K8SA 1OKDA 3TKPA 5F07A 1T1VA 2I4AA 4FH8A 3LYKA 4BVYB 1AQXA 1YZXA 5EPFA 4YAPA 1GRXA 1YEXA 2HE3A 3TRXA 1GTAA 6GSYA 2J23A 3M3MA 2LJRA 1WPIA 4POMA 4G19A 1XVWA 2P5RA 2GQKA 3UMAA 5GZZB 3EU3A 3HJOA 4ZIJA 3P7XA 4NHWA 1TKDB 1A2MA 2H73A 4HU9A 2C8UA 1THXA 1FW1A 3SWLA 1Z7PA 4OCEA 5ECIB 1FAAA 3NZNA 4K9ZA 2XHFA 3ME8A 3EVIA 2AUVA 5IMAA 5CREA 1YQ1A 2K18A 5HQPA 1ZL9A 2P31A 1A2JA 2WGRA 4MPGA 2IMIA 3W6GA 3C8EA 3ZMKA 1Z6MA 1EP8A 4CDOA 4TR1B 4IQ1A 4L5LA 3ERWA 4Q5FA 1PL1A 2VCTA 5IQYA 2PBJA 2M80A 2JACA 1ML6A 2GSQA 1O6JA 1HYUA 1TI1A 5IMCA 1SL0B 2FGXA 2PWJA 1V40A 2DJKA 4EDZA 2LRNA 3EMXA 1F37A 3QAVA 2E2GA 3EE2A 2WCIA 4BWSA 4YQMA 2H0IA 4F2IA 1JZRA 4AGSA 3TRPA 2ON7A 3L78A 1GP1A 4JE1A 2YJ7A 5IIZA 3IBHA 1PSQA 1R5AA 3IC8A 4HQZA 4MJAA 3ZITA 3KCMA 3TJBA 2AJQB 2HZFA 3F4RA 5COHA 4HI7A 1SK2A 4FO5A 3GSSA 16GSA 3FY7A 1WMJA 1JZWA 4YH2A 4KDYA 5JWRB 3VWWA 4AJ6A 2B7JA 1M2BA 4MH3A 2F9SA 5ECKB 5ECSA 2LNTA 1F6MC 5J41A 3KP8A 3TGZA 4OO5A 4QL9A 1ERTA 3GA4A 4BWQA 4MZCA 2QKEA 3GUSA 2O7KA 1UA5A 3KD0A 2IPAA 2GSRA 4USSA 3D5JA 3IA1A 3O6TA 1XXUA 1X5DA 3VPTA 4OO4A 1Z6NA 4TR0A 4WBJA 4POLA 1AW9A 1RW1A 2DC5A 1PKZA 4HOJA 4GTUA 3WT1A 5KN2A 3K8NA 2LV3A 2O85A 3DXBA 2HZEA 2L4CA 2B5EA 4ECBA 3KTBA 1PL2A 3D21A 6GSTA 1U6TA 2H6ZA 2JADA 2OJLA 2GTUA 4DVCA 2N5AA 2CX3A 1NHYA 5ECLB 3KMNA 4IP1A 1AQWA 1F3BA 1K3OA 1A24A 1SJIA 2IFQA 3DYRA 2BMXA 2F8AA 4WR5A 1AQVA 3CSIA 4KDUA 2GZYA 1EV9A 1ABAA 5GSTA 4Q5NA 5G2ZA 4IJIA 3TJKA 1G7EA 4N10A 1RK4A 3F63A 1GNWA 2XPDA 4LL1B 5JCUA 2PERA 4K2DA 4MCUA 2YNXA 4MF6A 1VF1A 3D4MA 1XCCA 1N8JA 1DBYA 2GZPA 1VRSD 1FHEA 5A4UA 2GS3A 1V58A 2CVKA 5ENUA 5IPGA 1GTUA 2DJ0A 3F3QA 2F8FA 1QUWA 3NIVA 3IAM2 3IC4A 1JLVA 3H4KA 1XZOA 2B5XA 1A0RP 5GAND 5J9BA 4L0UA 2VAFA 4XRDA 4F0BA 5DCHA 4EL1A 2LSTA 2IIYA 5ECMB 5CAXA 1M2DA 2PUKC 3GX8A 1X9WB 3FK8A 2CZ3A 1VF2A 4KF9A 3F0IA 1U87A 4FYBA 5D9TA 5DALB 3VI5A 4K7NA 3CTFA 2F51A 3DEXA 3G7YA 2L5LA 4IJ3A 3HA9A 1ON4A 2LTKA 4N0VA 1SJ6A 1N2AA 4KB3A 3LG6A 2DIYA 2RUFA 5C00A 2R3XA 1IYHA 3KGKA 1E2YA 4K0NA 3KTLA 14GSA 3LSZA 1R26A 4HEA2 3LFLA 1E6BA 3KEBA 4G0LA 2OA7A 1WWJA 3GX0A 2BTOT 3I43A 3ISOA 2LEGA 3VLNA 3ZFLA 3EWLA 3I6AA 1W4VA 2RM6A 3QFBC 4IQAA 3TJJA 4N11A 4PNGA 1FVKA 3O3TA 4O92A 4RUVA 3WT2A 1XWKA 1V2AA 5LCZA 1K3YA 4ZB9A 3QD9A 4GQCA 3MNGA 4BL7A 3Q6OA 1OE8A 1NM3A 4ACSA 3FEUA 1WJKA 3TKQA 6GSXA 3HJPA 4MABA 5G1KA 3GTUB 2B1LA 4YQVA 3D0ZA 2QC7A 1GLPA 5HR1A 5DJLA 4IELA 3QOUA 1R7HA 2REMA 1ZYEA 3FR6A 5KEJA 2V6OA 2XBQA 3A2XA 3D22A 1EZKA 4DSRA 2JZTA 3ZVJD 3HCZA 1U3IA 1Z5YE 1XOBA 2PMTA 1A8YA 5ABRA 3HHVA 4OMVA 2GQLA 4I8BA 5IMVA 3S9FA 4RQRA 1WRYA 1S3CA 2UZ8A 1PX6A 4K8MA 4BVXB 2EIQA 3QFAC 5G5EA 1SL1B 2QGVA 3IAS2 3ZZXA 1V98A 5A5KA 1THOA 4I2TA 2WDUA 2WS2A 1TI3A 1EGRA 3A2WA 2DIZA 5F05A 2OBIA 5INYA 3EMPA 1WE0A 1EOGA 2DLXA 1SENA 3GL5A 1TRUA 1OE7A 7GSSA 5EVOA 3SBCA 3BD2A 5IOWA 4JBBA 3FR3A 2DSAA 1SK1A 2H6YA 2LRTA 1OYJA 4XHMA 1M9AA 5D9VA 4K6XA 2H75A 1MD4A 3VPQA 4NMUA 3Q18A 2I81A 3CSJA 4ZXGA 2DJJA 2H1DA 4X43A 1EEJA 1CQGA 2LKUA 4MJEA 5JCGA 3DGQA 3QAGA 2MMNA 4ZB8A 2KP1A 1PKWA 5HR2A 2KLXA 2LQQA 1J9BA 4O7HA 4MK3A 1M9BA 4J56E 4EKZA 1SKWB 5G1LA 5ELAA 3BBYA 3VWXA 3D6IA 2KOKA 4IBPA 3C71A 3LXZA 2GQMA 5F06A 3MSZA 20GSA 6GSUA 1WOUA 1GL8A 1K0OA 4L8EA 5ECQB 1SKSB 2CVDA 5FHIA 4TR4A 1FVJA 3KZQA 3UVTA 5HR0A 3G7IA 3RBTA 4ZL8A 3BJ5A 2L6DA 2HRKB 5CRHA 2K9FA 5ECHB 2B5YA 3ZLPA 2B7KA 4ECCA 3L9SA 2ZNMA 4IW9A 2GDRA 2B1KA 1ILOA 3J7Yb 5IMDA 2H66A 1PN9A 2JZRA 3GMFA 1B48A 2P5QA 1GSSA 4PNFA 1F9MA 1X5EA 2M72A 4OFMA 4D73B 4WEYA 4IKHA 2YV7A 2LS5A 4HUAA 1EV4A 2M46A 2MBTA 4QL7A 3W8SA 3UVHA 2JZSA 3N9JA 4ECIA 1GSEA 2O87A 4V1Ag 1UN2A 1JFUA 2LRCA 1QQ2A 1XWGA 3EC3A 1O7UA 4GSTA 4RI6A 1SKRB 2JL4A 1QMVA 2HSYA 4PTSA 1GNEA 2OE0A 1GUKA 3A2VA 4GF0A 2OADA 5AISA 3TB2A 1TK0B 4PGTA 6GSSA 4DEJA 3M9JA 3C73A 5D93A 4OFTA 4PUFC 3N5OA 1ZOFA 1AIUA 3PH9A 4NPBA 4TW5A 2V32A 1KTEA 2DJ1A 4PURA 2C0DA 5IM9A 3EURA 4H86A 1CQHA 19GSA 3KJYA 4HQSA 1Y6EA 3TRQA 3UJ1A 1JZOA 1GULA 1VF3A 2C0GA 2GT5A 4EC0A 3IK9A 4CW9A 3GV1A 3RHCA 2O89A 3FZ4A 5DQSA 4XS6A 2HSHA 3FZ5A 3EU4A 5F8BA 2YPMA 3GTUA 3DKSA 3PR8A 2R2JA 1OC9A 1QGVA 3IHQA 3TCOA 5D9WA 4EE0A 4GSSA 2K8VA 2GVPA 2MMAA 5DQYA 5J4UA 5DDLA 4PQIA 4NWYA 4ML6A 4V2NA 2H1BA 5ECRB 2VL9A 2H0GA 3OR5A 2EIOA 2VLVA 2CX4A 2VL2A 2YV9A 1W89A 3L4NA 1ZMAA 5DAKB 2OE1A 4BVXA 5A4WA 4TR3A 4Z7XA 2IMEA 4X0XA 2JSYA 2VOCA 1G0TA 2BJXA 2FNOA 1ZGNA 2WJUA 2PVQA 3R3EA 10GSA 4HZ4A 2VM2A 1AXDA 2E0QA 5CYYA 5CRWA 1OC8A 4ECJA 1XVQA 2CV4A 1XW5A 2VCWA 1T4ZA 1ZYQB 1J0FA 3IRAA 3C1SA 5H5RA 2WFCA 3LWAA 1BG5A 3M1GA 3HZ4A 1LJRA 1T4YA 4MPFA 1TU8A 1LBKA 1EWXA 3Q74A 2MZCA 4JU5A 2GT6A 2R5GA 1GH2A 2J9HA 1B4PA 4KAEA 1TDIA 4POKA 1B8XA 2FUG2 3CTGA 5B8AA 2YOIA 2H70A 5AN1A 2YWIA 4CHSA 1MEKA 3VWVA 5AIVA 1GSQA 3APOA 1YKCA 3KP9A 5IMFA 2XC2A 2FLSA 4LMWA 4IHUA 3ZL5A 4JRRA 5ECPB 1SD8A 1Q4JA 4AJ8A 2FD3A 3C1RA 4GQFA 3LEFA 2IMKA 1DE1A 4ZBAA 4F03A 2FHEA 3QDNA 5J9CA 2V41A 2OBKA 3VFIA 5IOXA 4WXTA 2VM1A 2YCDA 4G10A 4BVYA 5FT3A 2IMFA 5H5SA 1HNBA 4MP4A 2OACA 2HRKA 3FHKA 1TTZA 4KH7A 4WKWA 5G5FA 4LMVA 2FA4A 1WP0A 2VD1A 2C3QA 1BEDA 1XW9A 3ED3A 2H19A 4HJ2A 2RLIA 2AHEA 2WRTA 5H5QA 2A4VA 4KCAA 3GL3A 1PD21 1YF0A 1TK8B 5DCGA 1XIYA 3TUEA 2JU5A 4ZILA 1FB0A 6GSVA 2DBCA 2RIIA 2VLUA 1ZZYA 3GKXA 5D96A 4DSSB 3MDKA 1SK0A 2L5OA 4ZBDA 2H6XA 5F0GA 1BX9A 1K0MA 11GSA 2HFDA 2H1GA 3ZRDA 1XW6A 1DE2A 4YQUA 3KMOA 3TKSA 1GUMA 2L6CA 1EGOA 4KE3A 4LL4B 4V2LA 2HRAA 1ERVA 1S3DA 3HKRA 2OE3A 2AAWA 5D9XA 4J2FA 1TRSA 4TR1A 1A2LA 3HXSA 4LLRA 5EY6A 3GIXA 1BYEA 1GSUA 4GCIA 1HNAA 1TU7A 3VURA 2CT6A 1K0AA 3RPNA 3WGXA 1GSFA 2FA8A 1M2AA 2ES7A 5KN0A 3UEMA 4KUNA 2LUSA 5IO2A 3GNJA 4XRAA 4V2MA 2EIRA 2FWEA 1OVNA 3FZAA 2CVBA 2FWFA 3C7MA 4TVEA 3F4TA 1XPVA 1ZCPA 4OWYA 2DJ3A 1KNGA 2IMDA 1JHBA 1XOAA 1M0UA 3D4TA 3ZTLA 1X9SB 1C72A 2VCXA 4I5QA 3UL3A 4GWRA 2L4QA 1AAZA 4ML1A 3TDGA 1MDKA 5E4WA 2G2QA 1X0RA 2B6MA 1XWAA 4GXZA 2HT9A 3IV4A 3A5WA 1A8LA 3VWUA 2YP6A 2V6KA 4KGIA 4F0CA 4JR6A 4KSMA 1MD3A 4L5OA 3ZFBA 2DMMA 3E0UA 4TKYA 5ECOB 1GWCA 3CRUA 3PINA 2GSSA 2G0FA 2F3MA 2VCVA 5AGYA 1B4QA 1PQNA 4K7OA 2XBIA 1G6YA 3IPZA 1M7TA 1GUHA 4JZQA 4OCFA 3GKNA 5KN3A 2VO4A 4PQ1A 4J57E 18GSA 3H8QA 2CAQA 2X99A 2GGTA 5DVBA 4ZL7A 3WGDA 1ACVA 4EUYA 4XIHA 2L59A 5IO0A 1KEBA 2X8CA 3IE3A 3R2QA 1SU9A 4AF2A 1SL2B 3DMLA 4K7IA 3CSHA 5ID2B 1LU4A 3VK9A 2H0HA 1NSWA 2N5FA 3F8UA 2RM5A 2H01A 5J5NA 2EC4A 2KP2A 1GLQA 1OKTA 3QPMA 1XBSA 3ZREA 1OC3A 5B8BA 3V1WA 3TKRA 3E3EA 4G0KA 3P90A 3FKFA 4MJBA 3FRCA 1XWBA 3ZVJA 2ALBA 5G30A 2IFQB 1URMA 2LNSA 5ECNB 5C04A 3IOSA 1AUCA 4G0IA 1V9WA 3TOTA 4N30A 3KH9A 1TK5B 3APSA 4TXOB 4G2EA 1G7OA 3DVWA 4P3YB 2PU9C 3F6FA 4G9HA 2B3SA 3WGEA 2MBSA 4QQ7A 2N5BA 1TJDA 1GSYA 2XPEA 1RQMA 1FB6A 3HDCA 4IN0A 2O8VB 2GSTA 5B6NA 1K0NA 4Q5RA 4O32A 3IR4A 5A4VA 2VUPA 1YF1A 4XS4B 22GSA 3GRXA 3BCIA 3KH7A 5DALA 3L0HA 4DSSA 2HRNA 2LJKA 3KIJA 4EVMA 2KUCA 3QMXA 1MDJA 2WZ9A 3UAPA 8GSSA 4ULXA 3IDVA 3GFKA 4KX4A 3HZ8A 3P8WA 1QFNA 2C4JA 2HSMB 3QAWA 4WF5A 3ZIJA 3HVXA 5D73A 4K1FA 4TRXA 5DJMA 2I1UA 2C1YA 5JCWA 2NBSA 3QR6A 2H76A 2HNLA 2ZCTA 3GURA 4YAVA 3GKKA 3M8NA 4MF5A 2LQOA 2R37A 3G9BA 4AJ7A 4NV2A 4FYCA 4IP6A 4PXOA 4BA7A 4NAXA 2K6VA 1KBNA 2OKAA 3DWVA 5IPHA 1NHOA 1VGLA 3PPUA 2CZ2A 4TN8A 3CYNA 3WYWA 1K0CA 2YWNA 3KXOA 2YZUA 5HFKA 4I6XA 3WD6A 1HQOA 3FR9A 3HY2A 4BPYA 3P2AA 2E7PA 3J7Yk 4KDXA 4N0ZA 1BAYA 5AIXA 3I9V2 1HD2A 4FIWA 4JR4A 1JZDA 4MMMA 1PGTA 1B9XC 1YJ6A 3GH6A 4BL7B 5LNKe 3LJRA 2A2SA 2ZUPA 2VCZA 4EXJA 3E9JB 4V1Ap 2IN3A 3RAZA 12GSA 4GSNA 4RQXA 4E8HA 2H71A 3CRTA 3DVXA 4EDYA 3GSTA 1A23A 1U3AA 1A0FA 2C3TA 3GH9A 4MDCA 3GHAA 2YWMA 2YWOA 5HR3A 5CRGA 2VIMA 3JCML 2I9HA 1UVZA 5JWOB 4KNDA 2TRXA 2L57A 1SJZA 2JSZA 3HVSA 3ZYWA 2IL3A 2NPBA 1PA3A 1JLWA
chains in the Genus database with same CATH superfamily
2VL2C 2CAIA 2OT3A 3DRNA 4DSQA 1Z7RA 1T8EB 4JEDA 2H8LA 1U88A 1XFLA 4Q5QA 3VI7A 4F82A 2HXKA 4MZWA 1SVOA 1YKAA 4EF0A 2GZZA 4NXIA 3UBKA 2EFHA 5ID2A 2HI7A 4GRFA 3LYPA 3CBUA 3U6VA 2PGTA 4TOPA 2YANA 4PX1A 3H79A 1FG4A 2IWTA 2FCHA 3FZ9A 3CMIA 3LGCA 1K3LA 1VF4A 2H30A 4ISDA 4HJMA 5B6MA 1ZYPA 4ZB6A 5FWGA 2WVXB 4K0GA 4IVFA 4ILFA 3AY8A 1Z9HA 4I97A 1K0DA 3RHBA 4HDEA 3EYTA 1FOVA 3HMJG 2C80A 2H74A 4TXOA 2D2ZA 2AYTA 3TJGA 2C3NA 5L71A 4WBRD 2MMZA 4Z2UA 2V2GA 1FO5A 4XS1A 3IK7A 1YEPA 3NOFA 2GLRA 3HVVA 5GSSA 1Q98A 4POBA 3UARA 2LJAA 1ERUA 2R0CA 2MYGA 5J4YA 3F9UA 4ZL9A 3L9VA 4XTSA 1IYIA 2VCQA 1YDKA 4NV5A 3TKSE 4XS4A 3DIEA 1N25A 1O81A 3EINA 1H75A 3PGTA 4PQHA 5ELGA 3I69A 2NDOA 4D73A 2HSNB 2NVLA 3U5RE 1O85A 1XWCA 4FQUA 4WETA 1T00A 1O73A 2FWGA 4HS1A 1SVMA 1ERWA 2MMOA 4AKGA 5EL8A 3US3A 2HSMA 3QCPA 5IMZA 1TW9A 2CA8A 1BG1A 4OFNA 1UC7A 1R5PA 3F4SA 2P0GA 1G6WA 2HQTA 2VLTA 9GSSA 3LQ7A 3A3TA 3HJMA 5J47A 1OAZA 4KW6A 2CQ9A 3UBLA 1X5CA 1YVLA 1ST9A 3TKSC 3RPPA 1USBA 2YZHA 5CO3A 3CXGA 1GSDA 3DD3A 2QSIA 1TXXA 2E2MA 4O5RA 6GSWA 1TP9A 4IGJA 1MDIA 2FWHA 1PX7A 3ME7A 4MH2A 1EEMA 5KOXA 1DUGA 3FW2A 1TOFA 1PMTA 1TRWA 2YJHA 1M99A 2H1AA 4AI6A 1I5GA 1FOHA 1V57A 1O8WA 5J3RA 1T7PB 5CRDA 4HU7A 4KSOA 3TU3B 1QXHA 1MTCA 2R6KA 3M0FA 1K0BA 4RI7A 1TRVA 4L0WA 4FYUA 5G31A 2KHPA 1BJXA 3KM6A 3EPTA 2UV8G 1NW2A 2AV4A 2V1MA 4HZ2A 2TRCP 2AB6A 5D8IA 4F9ZA 4MLYA 1BQ7A 4WR4A 1Z3EA 1B9YC 4ID0A 13GSA 5CNWA 1OC9B 1WIKA 3GKMA 4TXVA 5DAKA 4KA0A 3O76A 2Z9SA 3H93A 4XCSA 2DKIA 1EOHA 1H4OA 2HLSA 3MAKA 1SD9A 3G7JA 1R4WA 3M9KA 2VL3A 2A4HA 4MJCA 1SYRA 2H72A 2DJ2A 5CP1A 2PN8A 2X8HA 17GSA 4X1UA 2R4VA 3LXTA 1I9DA 4YKGA 2PVOC 5LD0A 3APQA 2DMLA 4OD7A 3IXRA 1F3AA 1T3BA 4MA9A 4IS0A 1Y25A 2C0EA 3LORA 3TJFA 2X64A 1QK8A 4I2UA 2WW2A 2HRFA 4NHZA 1PRXA 2X8GA 1S3AA 2NTOA 2FY6A 2A2RA 3UIWA 3W8JA 3L9UA 1AC1A 3BOAA 2VKZG 1DSBA 1SYXA 2HZEB 4X4JA 1X9MB 3BCKA 4QMKA 4PUAA 2TIRA 2WULA 5HFIA 3TOUA 4O5QA 3F3RA 3ZIVA 2WVXA 3CWGA 5B7CA 4EO3A 2RUEA 3GYKA 3Q19A 4ZBBA 1GTBA 3F6DA 4KCEA 3H1NA 1HNCA 3FYGA 3UOMA 1GTIA 4E8EA 5JWQB 2PPTA 5DBQA 2C0FA 3HD5A 3ERGA 3HYPA 3MWHA 1J08A 2HYXA 2I3YA 5BMUA 5HFGA 4MZBA 1F2EA 2IJYA 3GN3A 4GLTA 2YN1A 3RDWA 5GAPD 1O8XA 1YY7A 5E59A 2VD0A 4LA1A 4MF7A 4WF4A 2ON5A 1EP7A 2WB9A 3ZMLA 3ERFA 5KN1A 2K8SA 1OKDA 3TKPA 5F07A 1T1VA 2I4AA 4FH8A 3LYKA 4BVYB 1AQXA 1YZXA 5EPFA 4YAPA 1GRXA 1YEXA 2HE3A 3TRXA 1GTAA 6GSYA 2J23A 3M3MA 2LJRA 1WPIA 4POMA 4G19A 1XVWA 2P5RA 2GQKA 3UMAA 2X49A 5GZZB 2HSNA 4AKXB 3EU3A 3HJOA 4ZIJA 3P7XA 4NHWA 1TKDB 1A2MA 2H73A 4HU9A 2C8UA 1THXA 1FW1A 3SWLA 1Z7PA 4OCEA 5ECIB 1FAAA 3NZNA 4K9ZA 2XHFA 3ME8A 3EVIA 2AUVA 5IMAA 5CREA 1YQ1A 2K18A 5HQPA 1ZL9A 2P31A 1A2JA 2WGRA 4MPGA 2IMIA 3W6GA 3C8EA 3ZMKA 1Z6MA 1EP8A 4CDOA 4TR1B 4IQ1A 4L5LA 3ERWA 4Q5FA 1PL1A 2VCTA 5IQYA 2PBJA 2M80A 2QA1A 2JACA 1ML6A 2GSQA 1O6JA 1HYUA 5KOWA 1TI1A 5IMCA 1SL0B 2FGXA 2PWJA 1V40A 2DJKA 4EDZA 2LRNA 3EMXA 1F37A 3QAVA 2E2GA 3EE2A 2WCIA 4BWSA 4YQMA 1BF5A 2H0IA 4F2IA 1JZRA 4AGSA 4AKIA 3TRPA 2ON7A 3L78A 1GP1A 4JE1A 2YJ7A 5IIZA 3IBHA 1PSQA 1R5AA 3IC8A 4HQZA 4MJAA 3ZITA 3KCMA 3TJBA 2AJQB 2HZFA 3F4RA 5COHA 4HI7A 1SK2A 4FO5A 3GSSA 4Z2TA 16GSA 3FY7A 1WMJA 1JZWA 4YH2A 5A1NB 4KDYA 5JWRB 3VWWA 4AJ6A 2B7JA 1Y1UA 1M2BA 4MH3A 2F9SA 5ECKB 5ECSA 2LNTA 5A5HB 4GDFA 1F6MC 5J41A 3KP8A 3TGZA 4OO5A 4QL9A 3RFRC 1ERTA 3GA4A 4BWQA 4MZCA 2QKEA 3GUSA 2O7KA 1UA5A 3KD0A 2IPAA 2GSRA 4USSA 3D5JA 3IA1A 3O6TA 1XXUA 1X5DA 3VPTA 4OO4A 1Z6NA 4TR0A 4WBJA 4POLA 1AW9A 1RW1A 2DC5A 1PKZA 4HOJA 4GTUA 3WT1A 5KN2A 3K8NA 2LV3A 2O85A 3DXBA 2HZEA 2L4CA 2B5EA 4ECBA 3KTBA 1PL2A 3D21A 6GSTA 1U6TA 2H6ZA 2JADA 2OJLA 2GTUA 4DVCA 2N5AA 2CX3A 1NHYA 5ECLB 3KMNA 4IP1A 1AQWA 1F3BA 1K3OA 3CQFA 1A24A 1SJIA 2IFQA 3DYRA 2BMXA 2F8AA 4WR5A 2R0PA 1AQVA 3CSIA 4KDUA 2GZYA 1EV9A 1ABAA 5GSTA 4Q5NA 5G2ZA 4IJIA 3TJKA 4N3ZA 4N10A 1G7EA 1RK4A 3F63A 1GNWA 2XPDA 4LL1B 5JCUA 2PERA 4K2DA 4MCUA 2YNXA 4MF6A 1VF1A 4YKFA 3D4MA 1XCCA 1N8JA 1DBYA 2GZPA 1VRSD 1FHEA 5A4UA 4CY8A 2GS3A 1V58A 2CVKA 5ENUA 5IPGA 1GTUA 2DJ0A 3F3QA 2F8FA 1QUWA 3NIVA 3IAM2 3IC4A 1JLVA 3H4KA 1XZOA 2B5XA 1A0RP 1PFOA 5GAND 5J9BA 4L0UA 2VAFA 4XRDA 4F0BA 5DCHA 4EL1A 2LSTA 2IIYA 5ECMB 5CAXA 1M2DA 4EIPA 2PUKC 3GX8A 1X9WB 3FK8A 2CZ3A 1VF2A 4KF9A 3F0IA 1U87A 4FYBA 5D9TA 5DALB 3VI5A 4K7NA 3CTFA 2F51A 3DEXA 3G7YA 2L5LA 4IJ3A 3HA9A 1ON4A 2LTKA 4N0VA 1SJ6A 1N2AA 4KB3A 3LG6A 2DIYA 2RUFA 5C00A 2R3XA 1IYHA 3KGKA 1E2YA 4K0NA 3KTLA 14GSA 3LSZA 1R26A 4HEA2 3LFLA 1E6BA 3KEBA 4G0LA 2WW3A 2OA7A 1WWJA 3GX0A 2BTOT 3I43A 3ISOA 2LEGA 3VLNA 3ZFLA 3EWLA 3I6AA 1W4VA 2RM6A 3QFBC 4IQAA 3TJJA 4N11A 4PNGA 1FVKA 3O3TA 4O92A 4RUVA 3WT2A 2O5VA 1XWKA 1V2AA 5LCZA 1K3YA 4ZB9A 3QD9A 4GQCA 3MNGA 4BL7A 3Q6OA 1OE8A 1NM3A 4ACSA 3FEUA 1WJKA 3TKQA 6GSXA 3HJPA 4MABA 5G1KA 3GTUB 2B1LA 4YQVA 3D0ZA 2QC7A 1GLPA 5HR1A 5DJLA 4IELA 3QOUA 1R7HA 2REMA 1ZYEA 3FR6A 5KEJA 2V6OA 2XBQA 3A2XA 3D22A 1EZKA 4DSRA 2JZTA 3ZVJD 3HCZA 1U3IA 2O3EA 1Z5YE 5A34B 1XOBA 2PMTA 1A8YA 5ABRA 3HHVA 4OMVA 2GQLA 4I8BA 5IMVA 3S9FA 4RQRA 1WRYA 1S3CA 2UZ8A 1PX6A 4K8MA 4BVXB 2EIQA 3QFAC 5G5EA 1SL1B 2QGVA 3IAS2 3ZZXA 1V98A 5A5KA 1THOA 4I2TA 2WDUA 2WS2A 1TI3A 1EGRA 3A2WA 2DIZA 5F05A 2OBIA 5INYA 3EMPA 1WE0A 1EOGA 2DLXA 1SENA 3GL5A 4G01A 1TRUA 1OE7A 7GSSA 5EVOA 3SBCA 3BD2A 5IOWA 4JBBA 3FR3A 2DSAA 1SK1A 2H6YA 2LRTA 1OYJA 4XHMA 1M9AA 5D9VA 4K6XA 2H75A 1MD4A 3VPQA 4NMUA 3Q18A 1I1IP 2I81A 3CSJA 4ZXGA 2DJJA 2H1DA 4X43A 1EEJA 1CQGA 2LKUA 4MJEA 5JCGA 3DGQA 3QAGA 2MMNA 4ZB8A 2KP1A 1PKWA 5HR2A 2KLXA 2LQQA 1J9BA 4O7HA 4MK3A 1M9BA 4J56E 4EKZA 1SKWB 5G1LA 5ELAA 3BBYA 3VWXA 3D6IA 2KOKA 4IBPA 3C71A 3LXZA 2GQMA 5F06A 3MSZA 20GSA 6GSUA 1WOUA 1GL8A 1K0OA 4L8EA 5ECQB 1SKSB 4MNNA 2CVDA 5FHIA 4TR4A 1FVJA 3KZQA 3UVTA 5HR0A 3G7IA 3RBTA 4ZL8A 3BJ5A 3FMWA 2L6DA 4Z2RA 2HRKB 5CRHA 2K9FA 5ECHB 4ICYA 2B5YA 3ZLPA 2B7KA 4ECCA 3L9SA 2ZNMA 4IW9A 2GDRA 2B1KA 1ILOA 3J7Yb 5IMDA 2H66A 2EFDA 1PN9A 2JZRA 3GMFA 1B48A 2P5QA 1GSSA 3IHGA 2EFEA 4PNFA 2QA2A 1F9MA 2M72A 1X5EA 4OFMA 4D73B 4WEYA 4IKHA 2YV7A 2LS5A 4HUAA 1EV4A 2M46A 2MBTA 4QL7A 3W8SA 3UVHA 2JZSA 3N9JA 4ECIA 1GSEA 2O87A 4V1Ag 1UN2A 1JFUA 2LRCA 1QQ2A 1XWGA 3EC3A 1O7UA 4GSTA 4RI6A 1SKRB 2JL4A 1QMVA 2HSYA 4PTSA 1GNEA 2OE0A 1GUKA 3A2VA 4GF0A 2OADA 5AISA 3TB2A 1TK0B 4PGTA 6GSSA 4DEJA 3M9JA 3C73A 5D93A 1M3IA 4OFTA 4PUFC 3N5OA 1ZOFA 1AIUA 3PH9A 4NPBA 4TW5A 2V32A 1KTEA 2DJ1A 2WZSA 4PURA 2C0DA 5IM9A 3EURA 4H86A 1CQHA 19GSA 3KJYA 4HQSA 1Y6EA 3TRQA 3UJ1A 1JZOA 1GULA 1VF3A 2C0GA 2GT5A 4EC0A 3IK9A 4CW9A 3GV1A 3RHCA 4AKHA 2O89A 3FZ4A 5DQSA 4XS6A 2HSHA 3FZ5A 3EU4A 5F8BA 2YPMA 3GTUA 3DKSA 3PR8A 2R2JA 2DKHA 1OC9A 1QGVA 1YEWC 3IHQA 3TCOA 5D9WA 4EE0A 4GSSA 2K8VA 2GVPA 2MMAA 5DQYA 5J4UA 5DDLA 4PQIA 4NWYA 4ML6A 4V2NA 2H1BA 4K5SA 5ECRB 2VL9A 2H0GA 3OR5A 2EIOA 2VLVA 2CX4A 2VL2A 2YV9A 1W89A 3L4NA 1ZMAA 5DAKB 2OE1A 4BVXA 5A4WA 4TR3A 4Z7XA 2IMEA 4X0XA 2JSYA 2VOCA 1G0TA 2A2PA 2BJXA 2FNOA 1ZGNA 2WJUA 2PVQA 3R3EA 3CHXC 10GSA 4HZ4A 2WW1A 2VM2A 1AXDA 2E0QA 5CYYA 5CRWA 4EIQA 1OC8A 4ECJA 1XVQA 5BRTA 2CV4A 1XW5A 2VCWA 1T4ZA 1ZYQB 1J0FA 3IRAA 3C1SA 5H5RA 2WFCA 3LWAA 1BG5A 3M1GA 3HZ4A 1LJRA 1T4YA 4MPFA 1TU8A 1LBKA 1EWXA 3Q74A 2MZCA 4JU5A 2GT6A 2R5GA 1GH2A 2J9HA 1B4PA 4KAEA 1TDIA 4POKA 1B8XA 2FUG2 3CTGA 5B8AA 2YOIA 2H70A 1ZYNA 5AN1A 2YWIA 4CHSA 1MEKA 3VWVA 5AIVA 1GSQA 3APOA 1YKCA 3KP9A 5IMFA 2XC2A 2FLSA 4LMWA 4IHUA 3ZL5A 4JRRA 5ECPB 1SD8A 1Q4JA 4AJ8A 2FD3A 3C1RA 4GQFA 3LEFA 2IMKA 1DE1A 4ZBAA 4F03A 2FHEA 3QDNA 5BMUB 5J9CA 2V41A 2OBKA 3VFIA 5IOXA 4WXTA 2VM1A 5J4VA 2YCDA 4G10A 4BVYA 5FT3A 2IMFA 5H5SA 1HNBA 4MP4A 2OACA 2HRKA 3FHKA 1TTZA 4KH7A 4WKWA 5G5FA 4LMVA 2FA4A 1WP0A 2VD1A 2C3QA 1BEDA 1XW9A 3ED3A 2H19A 4HJ2A 2RLIA 2AHEA 2WRTA 5H5QA 2A4VA 4KCAA 3GL3A 1PD21 1YF0A 1TK8B 5DCGA 1XIYA 3TUEA 2JU5A 3MYDA 1FB0A 4ZILA 6GSVA 2DBCA 2RIIA 2VLUA 1ZZYA 3GKXA 5D96A 4DSSB 3MDKA 1SK0A 2L5OA 4ZBDA 2H6XA 5F0GA 1BX9A 1K0MA 11GSA 2HFDA 2H1GA 3ZRDA 1XW6A 1DE2A 4YQUA 3KMOA 3TKSA 1GUMA 2L6CA 1EGOA 4KE3A 4LL4B 4V2LA 2HRAA 1ERVA 1S3DA 3HKRA 3HVNA 4K5RA 2OE3A 2AAWA 5D9XA 4J2FA 1TRSA 4TR1A 1A2LA 3HXSA 4LLRA 5EY6A 3GIXA 1BYEA 1GSUA 4GCIA 1HNAA 1TU7A 3VURA 2CT6A 1K0AA 3RPNA 3WGXA 1GSFA 2FA8A 1M2AA 2ES7A 5KN0A 3UEMA 4KUNA 2LUSA 5IO2A 3GNJA 4XRAA 4V2MA 4FXYP 2EIRA 2FWEA 1OVNA 3FZAA 2CVBA 2FWFA 3C7MA 4TVEA 1TXUA 3F4TA 1XPVA 1ZCPA 4OWYA 4BIKA 2DJ3A 3LW9A 1KNGA 2IMDA 1JHBA 1XOAA 1M0UA 3D4TA 3ZTLA 1X9SB 1C72A 2VCXA 4I5QA 3UL3A 4GWRA 2L4QA 1AAZA 4ML1A 3TDGA 2WVZA 4ZB7A 1MDKA 2G2QA 5E4WA 1X0RA 2B6MA 1XWAA 4GXZA 2HT9A 3IV4A 3A5WA 4HSCX 1A8LA 3VWUA 2YP6A 1SVLA 4A5PA 2V6KA 4KGIA 5A1NA 4F0CA 4JR6A 4KSMA 1MD3A 4L5OA 3ZFBA 4E68A 2DMMA 3E0UA 4TKYA 5ECOB 5A5HA 1GWCA 3CRUA 3PINA 2GSSA 2G0FA 2F3MA 2VCVA 5AGYA 1B4QA 1PQNA 4K7OA 2XBIA 1G6YA 4O5UA 1S4BP 3IPZA 1M7TA 1GUHA 4JZQA 4OCFA 3GKNA 5KN3A 2VO4A 4PQ1A 4J57E 18GSA 3H8QA 2CAQA 2X99A 2GGTA 5DVBA 4ZL7A 3WGDA 1ACVA 4EUYA 4XIHA 2EFCA 2L59A 5IO0A 1KEBA 2X8CA 4W66A 3IE3A 3R2QA 1SU9A 4AF2A 1SL2B 3DMLA 4K7IA 3CSHA 5ID2B 1LU4A 3VK9A 2H0HA 1XG8A 1NSWA 2N5FA 3F8UA 2RM5A 2H01A 5J5NA 2EC4A 2KP2A 1GLQA 1OKTA 3QPMA 1XBSA 3ZREA 1OC3A 5B8BA 3V1WA 3TKRA 3E3EA 4G0KA 3P90A 3FKFA 4MJBA 3FRCA 1XWBA 3ZVJA 2ALBA 5G30A 2IFQB 1URMA 2LNSA 5ECNB 4CY6A 5C04A 2WW0A 3IOSA 1AUCA 4G0IA 1V9WA 3TOTA 4N30A 2R0GA 3RGBC 3KH9A 1TK5B 3APSA 4TXOB 4G2EA 1G7OA 3DVWA 4P3YB 2PU9C 3F6FA 4G9HA 2B3SA 3WGEA 2MBSA 4QQ7A 2N5BA 4PI0C 1TJDA 1GSYA 1S3RA 2XPEA 1RQMA 1FB6A 3HDCA 4IN0A 2O8VB 2GSTA 5B6NA 1K0NA 4Q5RA 1M3JA 4O32A 3IR4A 5A4VA 2VUPA 1YF1A 4XS4B 22GSA 3GRXA 3BCIA 3KH7A 5DALA 3L0HA 4DSSA 2HRNA 2LJKA 3KIJA 4EVMA 2KUCA 3QMXA 1MDJA 2WZ9A 3UAPA 8GSSA 4ULXA 3IDVA 3GFKA 4KX4A 3HZ8A 3P8WA 1QFNA 3A5IA 2C4JA 2HSMB 3QAWA 4WF5A 3ZIJA 3HVXA 5D73A 4K1FA 4K2XA 4TRXA 5DJMA 2I1UA 2C1YA 5JCWA 2NBSA 3QR6A 2H76A 2HNLA 2ZCTA 3GURA 4YAVA 3GKKA 3M8NA 4MF5A 5J40A 2LQOA 2R37A 3G9BA 4AJ7A 4NV2A 4FYCA 2WVYA 2X4AA 4IP6A 4PXOA 4BA7A 4NAXA 2K6VA 1KBNA 2OKAA 3DWVA 5IPHA 1NHOA 1VGLA 3PPUA 2CZ2A 4TN8A 3CYNA 3WYWA 1K0CA 2YWNA 3KXOA 2YZUA 5HFKA 3MIXA 4I6XA 3WD6A 1HQOA 3FR9A 4PI2C 3HY2A 4BPYA 3P2AA 1PN0A 2E7PA 3J7Yk 4KDXA 4N0ZA 1BAYA 5AIXA 3I9V2 1HD2A 4FIWA 4JR4A 1JZDA 4MMMA 1PGTA 1B9XC 1YJ6A 3GH6A 4BL7B 5LNKe 3LJRA 2A2SA 2ZUPA 2VCZA 4EXJA 3E9JB 4V1Ap 2IN3A 3RAZA 12GSA 4GSNA 4RQXA 4E8HA 2H71A 3CRTA 3DVXA 4EDYA 3GSTA 5A34A 1A23A 1U3AA 1A0FA 2C3TA 3GH9A 4MDCA 3GHAA 2YWMA 2O36A 2YWOA 4PHZC 5HR3A 5CRGA 2VIMA 3JCML 2I9HA 2H1LA 1UVZA 5JWOB 4KNDA 2TRXA 2L57A 1SJZA 2JSZA 3HVSA 3ZYWA 2IL3A 2NPBA 1PA3A 1JLWA
chains in the Genus database with same CATH topology
2VL2C 2CAIA 2OT3A 3DRNA 4DSQA 1Z7RA 1T8EB 4JEDA 2H8LA 1U88A 1XFLA 4Q5QA 3VI7A 4F82A 2HXKA 4MZWA 1SVOA 1YKAA 4EF0A 2GZZA 4NXIA 3UBKA 2EFHA 5ID2A 2HI7A 4GRFA 3LYPA 3CBUA 3U6VA 2PGTA 4TOPA 2YANA 4PX1A 3H79A 1FG4A 2IWTA 2FCHA 3FZ9A 3CMIA 3LGCA 1K3LA 1VF4A 2H30A 4ISDA 4HJMA 5B6MA 1ZYPA 4ZB6A 5FWGA 4K0GA 4IVFA 4ILFA 3AY8A 1Z9HA 4I97A 1K0DA 3RHBA 4HDEA 3EYTA 1FOVA 3HMJG 2C80A 2H74A 4TXOA 2D2ZA 2AYTA 3TJGA 2C3NA 5L71A 4WBRD 2MMZA 4Z2UA 2V2GA 1FO5A 4XS1A 3IK7A 1YEPA 3NOFA 2GLRA 3HVVA 5GSSA 1Q98A 4POBA 3UARA 2LJAA 1ERUA 2R0CA 2MYGA 5J4YA 3F9UA 4ZL9A 3L9VA 4XTSA 1IYIA 2VCQA 1YDKA 4NV5A 3TKSE 4XS4A 3DIEA 1N25A 1O81A 3EINA 1H75A 3PGTA 4PQHA 5ELGA 3I69A 2NDOA 4D73A 2HSNB 2NVLA 3U5RE 1O85A 1XWCA 4FQUA 4WETA 1T00A 1O73A 2FWGA 4HS1A 1SVMA 1ERWA 2MMOA 4AKGA 5EL8A 3US3A 2HSMA 3QCPA 5IMZA 1TW9A 2CA8A 1BG1A 4OFNA 1UC7A 1R5PA 3F4SA 2P0GA 1G6WA 2HQTA 2VLTA 9GSSA 3LQ7A 3A3TA 3HJMA 5J47A 1OAZA 4KW6A 2CQ9A 3UBLA 1X5CA 1YVLA 1ST9A 3TKSC 3RPPA 1USBA 2YZHA 5CO3A 3CXGA 1GSDA 3DD3A 2QSIA 1TXXA 2E2MA 4O5RA 6GSWA 1TP9A 4IGJA 1MDIA 2FWHA 3ME7A 1PX7A 4MH2A 1EEMA 5KOXA 1DUGA 3FW2A 1TOFA 1PMTA 1TRWA 2YJHA 1M99A 2H1AA 4AI6A 1I5GA 1FOHA 1V57A 1O8WA 5J3RA 1T7PB 5CRDA 4HU7A 4KSOA 3TU3B 1QXHA 1MTCA 2R6KA 3M0FA 1K0BA 4RI7A 1TRVA 4L0WA 4FYUA 5G31A 2KHPA 1BJXA 3KM6A 3EPTA 2UV8G 1NW2A 2AV4A 2V1MA 4HZ2A 2TRCP 2AB6A 5D8IA 4F9ZA 4MLYA 1BQ7A 4WR4A 1Z3EA 1B9YC 4ID0A 13GSA 5CNWA 1OC9B 1WIKA 3GKMA 4TXVA 5DAKA 4KA0A 3O76A 2Z9SA 3H93A 4XCSA 2DKIA 1EOHA 1H4OA 2HLSA 3MAKA 1SD9A 3G7JA 1R4WA 3M9KA 2VL3A 2A4HA 4MJCA 1SYRA 2H72A 2DJ2A 5CP1A 2PN8A 2X8HA 17GSA 4X1UA 2R4VA 3LXTA 1I9DA 4YKGA 2PVOC 5LD0A 3APQA 2DMLA 4OD7A 3IXRA 1F3AA 1T3BA 4MA9A 4IS0A 1Y25A 2C0EA 3LORA 3TJFA 2X64A 1QK8A 4I2UA 2HRFA 4NHZA 1PRXA 2X8GA 1S3AA 2NTOA 2FY6A 2A2RA 3UIWA 3W8JA 3L9UA 1AC1A 3BOAA 2VKZG 1DSBA 1SYXA 2HZEB 4X4JA 1X9MB 3BCKA 4QMKA 4PUAA 2TIRA 2WULA 5HFIA 3TOUA 4O5QA 3F3RA 3ZIVA 3CWGA 5B7CA 4EO3A 2RUEA 3GYKA 3Q19A 4ZBBA 1GTBA 3F6DA 4KCEA 3H1NA 1HNCA 3FYGA 3UOMA 1GTIA 4E8EA 5JWQB 2PPTA 5DBQA 2C0FA 3HD5A 3ERGA 3HYPA 3MWHA 1J08A 2HYXA 2I3YA 5BMUA 5HFGA 4MZBA 1F2EA 2IJYA 3GN3A 4GLTA 2YN1A 3RDWA 5GAPD 1O8XA 1YY7A 5E59A 2VD0A 4LA1A 4MF7A 4WF4A 2ON5A 1EP7A 2WB9A 3ZMLA 3ERFA 5KN1A 2K8SA 1OKDA 3TKPA 5F07A 1T1VA 2I4AA 4FH8A 3LYKA 4BVYB 1AQXA 1YZXA 5EPFA 4YAPA 1GRXA 1YEXA 2HE3A 3TRXA 1GTAA 6GSYA 2J23A 3M3MA 2LJRA 1WPIA 4POMA 4G19A 1XVWA 2P5RA 2GQKA 3UMAA 2X49A 5GZZB 2HSNA 4AKXB 3EU3A 3HJOA 4ZIJA 3P7XA 4NHWA 1TKDB 1A2MA 2H73A 4HU9A 2C8UA 1THXA 1FW1A 3SWLA 1Z7PA 4OCEA 5ECIB 1FAAA 3NZNA 4K9ZA 2XHFA 3ME8A 3EVIA 2AUVA 5IMAA 5CREA 1YQ1A 2K18A 5HQPA 1ZL9A 2P31A 1A2JA 2WGRA 4MPGA 2IMIA 3W6GA 3C8EA 3ZMKA 1Z6MA 1EP8A 4CDOA 4TR1B 4IQ1A 4L5LA 3ERWA 4Q5FA 1PL1A 2VCTA 5IQYA 2PBJA 2M80A 2QA1A 2JACA 1ML6A 2GSQA 1O6JA 1HYUA 5KOWA 1TI1A 5IMCA 1SL0B 2FGXA 2PWJA 1V40A 2DJKA 4EDZA 2LRNA 3EMXA 1F37A 3QAVA 2E2GA 3EE2A 2WCIA 4BWSA 4YQMA 1BF5A 2H0IA 4F2IA 1JZRA 4AGSA 4AKIA 3TRPA 2ON7A 3L78A 1GP1A 4JE1A 2YJ7A 5IIZA 3IBHA 1PSQA 1R5AA 3IC8A 4HQZA 4MJAA 3ZITA 3KCMA 3TJBA 2AJQB 2HZFA 3F4RA 5COHA 4HI7A 1SK2A 4FO5A 3GSSA 4Z2TA 16GSA 3FY7A 1WMJA 1JZWA 4YH2A 5A1NB 4KDYA 5JWRB 3VWWA 4AJ6A 2B7JA 1Y1UA 1M2BA 4MH3A 2F9SA 5ECKB 5ECSA 2LNTA 5A5HB 4GDFA 1F6MC 5J41A 3KP8A 3TGZA 4OO5A 4QL9A 1ERTA 3GA4A 4BWQA 4MZCA 2QKEA 3GUSA 2O7KA 1UA5A 3KD0A 2IPAA 2GSRA 4USSA 3D5JA 3IA1A 3O6TA 1XXUA 1X5DA 3VPTA 4OO4A 1Z6NA 4TR0A 4WBJA 4POLA 1AW9A 1RW1A 2DC5A 1PKZA 4HOJA 4GTUA 3WT1A 5KN2A 3K8NA 2LV3A 2O85A 3DXBA 2HZEA 2L4CA 2B5EA 4ECBA 3KTBA 1PL2A 3D21A 6GSTA 1U6TA 2H6ZA 2JADA 2OJLA 2GTUA 4DVCA 2N5AA 2CX3A 1NHYA 5ECLB 3KMNA 4IP1A 1AQWA 1F3BA 1K3OA 1A24A 1SJIA 2IFQA 3DYRA 2BMXA 2F8AA 4WR5A 2R0PA 1AQVA 3CSIA 4KDUA 2GZYA 1EV9A 1ABAA 5GSTA 4Q5NA 5G2ZA 4IJIA 3TJKA 4N3ZA 4N10A 1G7EA 1RK4A 3F63A 1GNWA 2XPDA 4LL1B 5JCUA 2PERA 4K2DA 4MCUA 2YNXA 4MF6A 1VF1A 4YKFA 3D4MA 1XCCA 1N8JA 1DBYA 2GZPA 1VRSD 1FHEA 5A4UA 4CY8A 2GS3A 1V58A 2CVKA 5ENUA 5IPGA 1GTUA 2DJ0A 3F3QA 2F8FA 1QUWA 3NIVA 3IAM2 3IC4A 1JLVA 3H4KA 1XZOA 2B5XA 1A0RP 5GAND 5J9BA 4L0UA 2VAFA 4XRDA 4F0BA 5DCHA 4EL1A 2LSTA 2IIYA 5ECMB 5CAXA 1M2DA 4EIPA 2PUKC 3GX8A 1X9WB 3FK8A 2CZ3A 1VF2A 4KF9A 3F0IA 1U87A 4FYBA 5D9TA 5DALB 3VI5A 4K7NA 3CTFA 2F51A 3DEXA 3G7YA 2L5LA 4IJ3A 3HA9A 1ON4A 2LTKA 4N0VA 1SJ6A 1N2AA 4KB3A 3LG6A 2DIYA 2RUFA 5C00A 2R3XA 1IYHA 3KGKA 1E2YA 4K0NA 3KTLA 14GSA 3LSZA 1R26A 4HEA2 3LFLA 1E6BA 3KEBA 4G0LA 2OA7A 1WWJA 3GX0A 2BTOT 3I43A 3ISOA 2LEGA 3VLNA 3ZFLA 3EWLA 3I6AA 1W4VA 2RM6A 3QFBC 4IQAA 3TJJA 4N11A 4PNGA 1FVKA 3O3TA 4O92A 4RUVA 3WT2A 2O5VA 1XWKA 1V2AA 5LCZA 1K3YA 4ZB9A 3QD9A 4GQCA 3MNGA 4BL7A 3Q6OA 1OE8A 1NM3A 4ACSA 3FEUA 1WJKA 3TKQA 6GSXA 3HJPA 4MABA 5G1KA 3GTUB 2B1LA 4YQVA 3D0ZA 2QC7A 1GLPA 5HR1A 5DJLA 4IELA 3QOUA 1R7HA 2REMA 1ZYEA 3FR6A 5KEJA 2V6OA 2XBQA 3A2XA 3D22A 1EZKA 4DSRA 2JZTA 3ZVJD 3HCZA 1U3IA 1Z5YE 5A34B 1XOBA 2PMTA 1A8YA 5ABRA 3HHVA 4OMVA 2GQLA 4I8BA 5IMVA 3S9FA 4RQRA 1WRYA 1S3CA 2UZ8A 1PX6A 4K8MA 4BVXB 2EIQA 3QFAC 5G5EA 1SL1B 2QGVA 3IAS2 3ZZXA 1V98A 5A5KA 1THOA 4I2TA 2WDUA 2WS2A 1TI3A 1EGRA 3A2WA 2DIZA 5F05A 2OBIA 5INYA 3EMPA 1WE0A 1EOGA 2DLXA 1SENA 3GL5A 4G01A 1TRUA 1OE7A 7GSSA 5EVOA 3SBCA 3BD2A 5IOWA 4JBBA 3FR3A 2DSAA 1SK1A 2H6YA 2LRTA 1OYJA 4XHMA 1M9AA 5D9VA 4K6XA 2H75A 1MD4A 3VPQA 4NMUA 3Q18A 2I81A 3CSJA 4ZXGA 2DJJA 2H1DA 4X43A 1EEJA 1CQGA 2LKUA 4MJEA 5JCGA 3DGQA 3QAGA 2MMNA 4ZB8A 2KP1A 1PKWA 5HR2A 2KLXA 2LQQA 1J9BA 4O7HA 4MK3A 1M9BA 4J56E 4EKZA 1SKWB 5G1LA 5ELAA 3BBYA 3VWXA 3D6IA 2KOKA 4IBPA 3C71A 3LXZA 2GQMA 5F06A 3MSZA 20GSA 6GSUA 1WOUA 1GL8A 1K0OA 4L8EA 5ECQB 1SKSB 4MNNA 2CVDA 5FHIA 4TR4A 1FVJA 3KZQA 3UVTA 5HR0A 3G7IA 3RBTA 4ZL8A 3BJ5A 3FMWA 2L6DA 4Z2RA 2HRKB 5CRHA 2K9FA 5ECHB 4ICYA 2B5YA 3ZLPA 2B7KA 4ECCA 3L9SA 2ZNMA 4IW9A 2GDRA 2B1KA 1ILOA 3J7Yb 5IMDA 2H66A 2EFDA 1PN9A 2JZRA 3GMFA 1B48A 2P5QA 1GSSA 3IHGA 2EFEA 4PNFA 2QA2A 1F9MA 2M72A 1X5EA 4OFMA 4D73B 4WEYA 4IKHA 2YV7A 2LS5A 4HUAA 1EV4A 2M46A 2MBTA 4QL7A 3W8SA 3UVHA 2JZSA 3N9JA 4ECIA 1GSEA 2O87A 4V1Ag 1UN2A 1JFUA 2LRCA 1QQ2A 1XWGA 3EC3A 1O7UA 4GSTA 4RI6A 1SKRB 2JL4A 1QMVA 2HSYA 4PTSA 1GNEA 2OE0A 1GUKA 3A2VA 4GF0A 2OADA 5AISA 3TB2A 1TK0B 4PGTA 6GSSA 4DEJA 3M9JA 3C73A 5D93A 4OFTA 4PUFC 3N5OA 1ZOFA 1AIUA 3PH9A 4NPBA 4TW5A 2V32A 1KTEA 2DJ1A 4PURA 2C0DA 5IM9A 3EURA 4H86A 1CQHA 19GSA 3KJYA 4HQSA 1Y6EA 3TRQA 3UJ1A 1JZOA 1GULA 1VF3A 2C0GA 2GT5A 4EC0A 3IK9A 4CW9A 3GV1A 3RHCA 4AKHA 2O89A 3FZ4A 5DQSA 4XS6A 2HSHA 3FZ5A 3EU4A 5F8BA 2YPMA 3GTUA 3DKSA 3PR8A 2R2JA 2DKHA 1OC9A 1QGVA 3IHQA 3TCOA 5D9WA 4EE0A 4GSSA 2K8VA 2GVPA 2MMAA 5DQYA 5J4UA 5DDLA 4PQIA 4NWYA 4ML6A 4V2NA 2H1BA 4K5SA 5ECRB 2VL9A 2H0GA 3OR5A 2EIOA 2VLVA 2CX4A 2VL2A 2YV9A 1W89A 3L4NA 1ZMAA 5DAKB 2OE1A 4BVXA 5A4WA 4TR3A 4Z7XA 2IMEA 4X0XA 2JSYA 2VOCA 1G0TA 2A2PA 2BJXA 2FNOA 1ZGNA 2WJUA 2PVQA 3R3EA 10GSA 4HZ4A 2VM2A 1AXDA 2E0QA 5CYYA 5CRWA 4EIQA 1OC8A 4ECJA 1XVQA 5BRTA 2CV4A 1XW5A 2VCWA 1T4ZA 1ZYQB 1J0FA 3IRAA 3C1SA 5H5RA 2WFCA 3LWAA 1BG5A 3M1GA 3HZ4A 1LJRA 1T4YA 4MPFA 1TU8A 1LBKA 1EWXA 3Q74A 2MZCA 4JU5A 2GT6A 2R5GA 1GH2A 2J9HA 1B4PA 4KAEA 1TDIA 4POKA 1B8XA 2FUG2 3CTGA 5B8AA 2YOIA 2H70A 1ZYNA 5AN1A 2YWIA 4CHSA 1MEKA 3VWVA 5AIVA 1GSQA 3APOA 1YKCA 3KP9A 5IMFA 2XC2A 2FLSA 4LMWA 4IHUA 3ZL5A 4JRRA 5ECPB 1SD8A 1Q4JA 4AJ8A 2FD3A 3C1RA 4GQFA 3LEFA 2IMKA 1DE1A 4ZBAA 4F03A 2FHEA 3QDNA 5BMUB 5J9CA 2V41A 2OBKA 3VFIA 5IOXA 4WXTA 2VM1A 5J4VA 2YCDA 4G10A 4BVYA 5FT3A 2IMFA 5H5SA 1HNBA 4MP4A 2OACA 2HRKA 3FHKA 1TTZA 4KH7A 4WKWA 5G5FA 4LMVA 2FA4A 1WP0A 2VD1A 2C3QA 1BEDA 1XW9A 3ED3A 2H19A 4HJ2A 2RLIA 2AHEA 2WRTA 5H5QA 2A4VA 4KCAA 3GL3A 1PD21 1YF0A 1TK8B 5DCGA 1XIYA 3TUEA 2JU5A 3MYDA 1FB0A 4ZILA 6GSVA 2DBCA 2RIIA 2VLUA 1ZZYA 3GKXA 5D96A 4DSSB 3MDKA 1SK0A 2L5OA 4ZBDA 2H6XA 5F0GA 1BX9A 1K0MA 11GSA 2HFDA 2H1GA 3ZRDA 1XW6A 1DE2A 4YQUA 3KMOA 3TKSA 1GUMA 2L6CA 1EGOA 4KE3A 4LL4B 4V2LA 2HRAA 1ERVA 1S3DA 3HKRA 4K5RA 2OE3A 2AAWA 5D9XA 4J2FA 1TRSA 4TR1A 1A2LA 3HXSA 4LLRA 5EY6A 3GIXA 1BYEA 1GSUA 4GCIA 1HNAA 1TU7A 3VURA 2CT6A 1K0AA 3RPNA 3WGXA 1GSFA 2FA8A 1M2AA 2ES7A 5KN0A 3UEMA 4KUNA 2LUSA 5IO2A 3GNJA 4XRAA 4V2MA 2EIRA 2FWEA 1OVNA 3FZAA 2CVBA 2FWFA 3C7MA 4TVEA 1TXUA 3F4TA 1XPVA 1ZCPA 4OWYA 2DJ3A 3LW9A 1KNGA 2IMDA 1JHBA 1XOAA 1M0UA 3D4TA 3ZTLA 1X9SB 1C72A 2VCXA 4I5QA 3UL3A 4GWRA 2L4QA 1AAZA 4ML1A 3TDGA 4ZB7A 1MDKA 5E4WA 2G2QA 1X0RA 2B6MA 1XWAA 4GXZA 2HT9A 3IV4A 3A5WA 1A8LA 3VWUA 2YP6A 1SVLA 4A5PA 2V6KA 4KGIA 5A1NA 4F0CA 4JR6A 4KSMA 1MD3A 4L5OA 3ZFBA 4E68A 2DMMA 3E0UA 4TKYA 5ECOB 5A5HA 1GWCA 3CRUA 3PINA 2GSSA 2G0FA 2F3MA 2VCVA 5AGYA 1B4QA 1PQNA 4K7OA 2XBIA 1G6YA 4O5UA 3IPZA 1M7TA 1GUHA 4JZQA 4OCFA 3GKNA 5KN3A 2VO4A 4PQ1A 4J57E 18GSA 3H8QA 2CAQA 2X99A 2GGTA 5DVBA 4ZL7A 3WGDA 1ACVA 4EUYA 4XIHA 2EFCA 2L59A 5IO0A 1KEBA 2X8CA 4W66A 3IE3A 3R2QA 1SU9A 4AF2A 1SL2B 3DMLA 4K7IA 3CSHA 5ID2B 1LU4A 3VK9A 2H0HA 1NSWA 2N5FA 3F8UA 2RM5A 2H01A 5J5NA 2EC4A 2KP2A 1GLQA 1OKTA 3QPMA 1XBSA 3ZREA 1OC3A 5B8BA 3V1WA 3TKRA 3E3EA 4G0KA 3P90A 3FKFA 4MJBA 3FRCA 1XWBA 3ZVJA 2ALBA 5G30A 2IFQB 1URMA 2LNSA 5ECNB 4CY6A 5C04A 3IOSA 1AUCA 4G0IA 1V9WA 3TOTA 4N30A 2R0GA 3KH9A 1TK5B 3APSA 4TXOB 4G2EA 1G7OA 3DVWA 4P3YB 2PU9C 3F6FA 4G9HA 2B3SA 3WGEA 2MBSA 4QQ7A 2N5BA 1TJDA 1GSYA 2XPEA 1RQMA 1FB6A 3HDCA 4IN0A 2O8VB 2GSTA 5B6NA 1K0NA 4Q5RA 4O32A 3IR4A 5A4VA 2VUPA 1YF1A 4XS4B 22GSA 3GRXA 3BCIA 3KH7A 5DALA 3L0HA 4DSSA 2HRNA 2LJKA 3KIJA 4EVMA 2KUCA 3QMXA 1MDJA 2WZ9A 3UAPA 8GSSA 4ULXA 3IDVA 3GFKA 4KX4A 3HZ8A 3P8WA 1QFNA 3A5IA 2C4JA 2HSMB 3QAWA 4WF5A 3ZIJA 3HVXA 5D73A 4K1FA 4K2XA 4TRXA 5DJMA 2I1UA 2C1YA 5JCWA 2NBSA 3QR6A 2H76A 2HNLA 2ZCTA 3GURA 4YAVA 3GKKA 3M8NA 4MF5A 5J40A 2LQOA 2R37A 3G9BA 4AJ7A 4NV2A 4FYCA 2X4AA 4IP6A 4PXOA 4BA7A 4NAXA 2K6VA 1KBNA 2OKAA 3DWVA 5IPHA 1NHOA 1VGLA 3PPUA 2CZ2A 4TN8A 3CYNA 3WYWA 1K0CA 2YWNA 3KXOA 2YZUA 5HFKA 3MIXA 4I6XA 3WD6A 1HQOA 3FR9A 3HY2A 4BPYA 3P2AA 1PN0A 2E7PA 3J7Yk 4KDXA 4N0ZA 1BAYA 5AIXA 3I9V2 1HD2A 4FIWA 4JR4A 1JZDA 4MMMA 1PGTA 1B9XC 1YJ6A 3GH6A 4BL7B 5LNKe 3LJRA 2A2SA 2ZUPA 2VCZA 4EXJA 3E9JB 4V1Ap 2IN3A 3RAZA 12GSA 4GSNA 4RQXA 4E8HA 2H71A 3CRTA 3DVXA 4EDYA 3GSTA 5A34A 1A23A 1U3AA 1A0FA 2C3TA 3GH9A 4MDCA 3GHAA 2YWMA 2YWOA 5HR3A 5CRGA 2VIMA 3JCML 2I9HA 2H1LA 1UVZA 5JWOB 4KNDA 2TRXA 2L57A 1SJZA 2JSZA 3HVSA 3ZYWA 2IL3A 2NPBA 1PA3A 1JLWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VL2 C;  2CAI A;  3DRN A;  4DSQ A;  1Z7R A;  1T8E B;  4JED A;  2H8L A;  1U88 A;  1XFL A;  4Q5Q A;  3VI7 A;  4F82 A;  2HXK A;  4MZW A;  1YKA A;  4EF0 A;  2GZZ A;  4NXI A;  3UBK A;  5ID2 A;  2HI7 A;  4GRF A;  3LYP A;  3CBU A;  3U6V A;  2PGT A;  4TOP A;  2YAN A;  4PX1 A;  3H79 A;  1FG4 A;  2IWT A;  2FCH A;  3FZ9 A;  3CMI A;  3LGC A;  1K3L A;  1VF4 A;  2H30 A;  4ISD A;  4HJM A;  5B6M A;  4ZB6 A;  5FWG A;  4K0G A;  4IVF A;  4ILF A;  3AY8 A;  1Z9H A;  4I97 A;  1K0D A;  3RHB A;  4HDE A;  3EYT A;  1FOV A;  2C80 A;  2H74 A;  4TXO A;  2D2Z A;  2AYT A;  3TJG A;  2C3N A;  5L71 A;  4WBR D;  2MMZ A;  2V2G A;  1FO5 A;  4XS1 A;  3IK7 A;  1YEP A;  3NOF A;  2GLR A;  3HVV A;  5GSS A;  1Q98 A;  4POB A;  3UAR A;  2LJA A;  1ERU A;  2MYG A;  3F9U A;  4ZL9 A;  3L9V A;  4XTS A;  1IYI A;  2VCQ A;  1YDK A;  4NV5 A;  3TKS E;  4XS4 A;  3DIE A;  1O81 A;  3EIN A;  1H75 A;  3PGT A;  4PQH A;  5ELG A;  3I69 A;  2NDO A;  4D73 A;  2HSN B;  2NVL A;  3U5R E;  1O85 A;  1XWC A;  4FQU A;  4WET A;  1T00 A;  1O73 A;  2FWG A;  4HS1 A;  1ERW A;  2MMO A;  5EL8 A;  3US3 A;  2HSM A;  3QCP A;  5IMZ A;  1TW9 A;  2CA8 A;  4OFN A;  1UC7 A;  1R5P A;  3F4S A;  2P0G A;  1G6W A;  2HQT A;  2VLT A;  9GSS A;  3LQ7 A;  3A3T A;  3HJM A;  1OAZ A;  4KW6 A;  2CQ9 A;  3UBL A;  1X5C A;  1ST9 A;  3TKS C;  3RPP A;  1USB A;  2YZH A;  5CO3 A;  3CXG A;  1GSD A;  3DD3 A;  2QSI A;  1TXX A;  2E2M A;  4O5R A;  6GSW A;  1TP9 A;  4IGJ A;  1MDI A;  2FWH A;  3ME7 A;  1PX7 A;  4MH2 A;  1EEM A;  1DUG A;  3FW2 A;  1TOF A;  1PMT A;  1TRW A;  2YJH A;  1M99 A;  2H1A A;  1I5G A;  1V57 A;  1O8W A;  5J3R A;  1T7P B;  5CRD A;  4HU7 A;  4KSO A;  1QXH A;  1MTC A;  2R6K A;  3M0F A;  1K0B A;  4RI7 A;  1TRV A;  4L0W A;  4FYU A;  5G31 A;  2KHP A;  1BJX A;  3KM6 A;  1NW2 A;  2AV4 A;  2V1M A;  4HZ2 A;  2TRC P;  2AB6 A;  5D8I A;  4F9Z A;  4MLY A;  1BQ7 A;  4WR4 A;  1Z3E A;  1B9Y C;  4ID0 A;  13GS A;  5CNW A;  1OC9 B;  1WIK A;  3GKM A;  4TXV A;  5DAK A;  4KA0 A;  3O76 A;  2Z9S A;  3H93 A;  4XCS A;  1EOH A;  1H4O A;  2HLS A;  3MAK A;  1SD9 A;  3G7J A;  1R4W A;  3M9K A;  2VL3 A;  4MJC A;  1SYR A;  2H72 A;  2DJ2 A;  5CP1 A;  2PN8 A;  2X8H A;  17GS A;  4X1U A;  2R4V A;  3LXT A;  1I9D A;  2PVO C;  5LD0 A;  3APQ A;  2DML A;  4OD7 A;  3IXR A;  1F3A A;  1T3B A;  4MA9 A;  4IS0 A;  1Y25 A;  2C0E A;  3LOR A;  3TJF A;  2X64 A;  1QK8 A;  4I2U A;  2HRF A;  4NHZ A;  1PRX A;  2X8G A;  1S3A A;  2NTO A;  2FY6 A;  2A2R A;  3UIW A;  3W8J A;  3L9U A;  1AC1 A;  3BOA A;  1DSB A;  1SYX A;  2HZE B;  1X9M B;  3BCK A;  4PUA A;  2TIR A;  2WUL A;  5HFI A;  3TOU A;  3F3R A;  3ZIV A;  5B7C A;  4EO3 A;  2RUE A;  3GYK A;  3Q19 A;  4ZBB A;  1GTB A;  3F6D A;  4KCE A;  3H1N A;  1HNC A;  3FYG A;  3UOM A;  1GTI A;  4E8E A;  5JWQ B;  2PPT A;  5DBQ A;  2C0F A;  3HD5 A;  3ERG A;  3HYP A;  3MWH A;  1J08 A;  2HYX A;  2I3Y A;  5BMU A;  5HFG A;  4MZB A;  1F2E A;  2IJY A;  3GN3 A;  4GLT A;  2YN1 A;  3RDW A;  5GAP D;  1O8X A;  1YY7 A;  5E59 A;  2VD0 A;  4LA1 A;  4MF7 A;  4WF4 A;  2ON5 A;  1EP7 A;  2WB9 A;  3ZML A;  3ERF A;  5KN1 A;  2K8S A;  1OKD A;  3TKP A;  5F07 A;  1T1V A;  2I4A A;  4FH8 A;  3LYK A;  4BVY B;  1AQX A;  1YZX A;  5EPF A;  4YAP A;  1GRX A;  1YEX A;  2HE3 A;  3TRX A;  1GTA A;  6GSY A;  2J23 A;  3M3M A;  2LJR A;  1WPI A;  4POM A;  4G19 A;  1XVW A;  2P5R A;  2GQK A;  3UMA A;  5GZZ B;  3EU3 A;  3HJO A;  4ZIJ A;  3P7X A;  4NHW A;  1TKD B;  1A2M A;  2H73 A;  4HU9 A;  2C8U A;  1THX A;  1FW1 A;  3SWL A;  1Z7P A;  4OCE A;  5ECI B;  1FAA A;  3NZN A;  4K9Z A;  2XHF A;  3ME8 A;  3EVI A;  2AUV A;  5IMA A;  5CRE A;  1YQ1 A;  2K18 A;  5HQP A;  1ZL9 A;  2P31 A;  1A2J A;  2WGR A;  4MPG A;  2IMI A;  3W6G A;  3C8E A;  3ZMK A;  1Z6M A;  1EP8 A;  4CDO A;  4TR1 B;  4IQ1 A;  4L5L A;  3ERW A;  4Q5F A;  1PL1 A;  2VCT A;  5IQY A;  2PBJ A;  2M80 A;  2JAC A;  1ML6 A;  2GSQ A;  1O6J A;  1HYU A;  1TI1 A;  5IMC A;  1SL0 B;  2FGX A;  2PWJ A;  1V40 A;  2DJK A;  4EDZ A;  2LRN A;  3EMX A;  1F37 A;  3QAV A;  2E2G A;  3EE2 A;  2WCI A;  4BWS A;  4YQM A;  2H0I A;  4F2I A;  1JZR A;  4AGS A;  3TRP A;  2ON7 A;  3L78 A;  1GP1 A;  4JE1 A;  2YJ7 A;  5IIZ A;  3IBH A;  1PSQ A;  1R5A A;  3IC8 A;  4HQZ A;  4MJA A;  3ZIT A;  3KCM A;  3TJB A;  2AJQ B;  2HZF A;  3F4R A;  5COH A;  4HI7 A;  1SK2 A;  4FO5 A;  3GSS A;  16GS A;  3FY7 A;  1WMJ A;  1JZW A;  4YH2 A;  4KDY A;  5JWR B;  3VWW A;  4AJ6 A;  2B7J A;  1M2B A;  4MH3 A;  2F9S A;  5ECK B;  5ECS A;  2LNT A;  1F6M C;  5J41 A;  3KP8 A;  3TGZ A;  4OO5 A;  4QL9 A;  1ERT A;  3GA4 A;  4BWQ A;  4MZC A;  2QKE A;  3GUS A;  2O7K A;  1UA5 A;  3KD0 A;  2IPA A;  2GSR A;  4USS A;  3D5J A;  3IA1 A;  3O6T A;  1XXU A;  1X5D A;  3VPT A;  4OO4 A;  1Z6N A;  4TR0 A;  4WBJ A;  4POL A;  1AW9 A;  1RW1 A;  2DC5 A;  1PKZ A;  4HOJ A;  4GTU A;  3WT1 A;  5KN2 A;  3K8N A;  2LV3 A;  2O85 A;  3DXB A;  2HZE A;  2L4C A;  2B5E A;  4ECB A;  3KTB A;  1PL2 A;  3D21 A;  6GST A;  1U6T A;  2H6Z A;  2JAD A;  2OJL A;  2GTU A;  4DVC A;  2N5A A;  2CX3 A;  1NHY A;  5ECL B;  3KMN A;  4IP1 A;  1AQW A;  1F3B A;  1K3O A;  1A24 A;  1SJI A;  2IFQ A;  3DYR A;  2BMX A;  2F8A A;  4WR5 A;  1AQV A;  3CSI A;  4KDU A;  2GZY A;  1EV9 A;  1ABA A;  5GST A;  4Q5N A;  5G2Z A;  4IJI A;  3TJK A;  1G7E A;  4N10 A;  1RK4 A;  3F63 A;  1GNW A;  2XPD A;  4LL1 B;  5JCU A;  2PER A;  4K2D A;  4MCU A;  2YNX A;  4MF6 A;  1VF1 A;  3D4M A;  1XCC A;  1N8J A;  1DBY A;  2GZP A;  1VRS D;  1FHE A;  5A4U A;  2GS3 A;  1V58 A;  2CVK A;  5ENU A;  5IPG A;  1GTU A;  2DJ0 A;  3F3Q A;  2F8F A;  1QUW A;  3NIV A;  3IAM 2;  3IC4 A;  1JLV A;  3H4K A;  1XZO A;  2B5X A;  1A0R P;  5GAN D;  5J9B A;  4L0U A;  2VAF A;  4XRD A;  4F0B A;  5DCH A;  4EL1 A;  2LST A;  2IIY A;  5ECM B;  5CAX A;  1M2D A;  2PUK C;  3GX8 A;  1X9W B;  3FK8 A;  2CZ3 A;  1VF2 A;  4KF9 A;  3F0I A;  1U87 A;  4FYB A;  5D9T A;  5DAL B;  3VI5 A;  4K7N A;  3CTF A;  2F51 A;  3DEX A;  3G7Y A;  2L5L A;  4IJ3 A;  3HA9 A;  1ON4 A;  2LTK A;  4N0V A;  1SJ6 A;  1N2A A;  4KB3 A;  3LG6 A;  2DIY A;  2RUF A;  5C00 A;  2R3X A;  1IYH A;  3KGK A;  1E2Y A;  4K0N A;  3KTL A;  14GS A;  3LSZ A;  1R26 A;  4HEA 2;  3LFL A;  1E6B A;  3KEB A;  4G0L A;  2OA7 A;  1WWJ A;  3GX0 A;  2BTO T;  3I43 A;  3ISO A;  2LEG A;  3VLN A;  3ZFL A;  3EWL A;  3I6A A;  1W4V A;  2RM6 A;  3QFB C;  4IQA A;  3TJJ A;  4N11 A;  4PNG A;  1FVK A;  3O3T A;  4O92 A;  4RUV A;  3WT2 A;  1XWK A;  1V2A A;  5LCZ A;  1K3Y A;  4ZB9 A;  3QD9 A;  4GQC A;  3MNG A;  4BL7 A;  3Q6O A;  1OE8 A;  1NM3 A;  4ACS A;  3FEU A;  1WJK A;  3TKQ A;  6GSX A;  3HJP A;  4MAB A;  5G1K A;  3GTU B;  2B1L A;  4YQV A;  3D0Z A;  2QC7 A;  1GLP A;  5HR1 A;  5DJL A;  4IEL A;  3QOU A;  1R7H A;  2REM A;  1ZYE A;  3FR6 A;  5KEJ A;  2V6O A;  2XBQ A;  3A2X A;  3D22 A;  1EZK A;  4DSR A;  2JZT A;  3ZVJ D;  3HCZ A;  1U3I A;  1Z5Y E;  1XOB A;  2PMT A;  1A8Y A;  5ABR A;  3HHV A;  4OMV A;  2GQL A;  4I8B A;  5IMV A;  3S9F A;  4RQR A;  1WRY A;  1S3C A;  2UZ8 A;  1PX6 A;  4K8M A;  4BVX B;  2EIQ A;  3QFA C;  5G5E A;  1SL1 B;  2QGV A;  3IAS 2;  3ZZX A;  1V98 A;  5A5K A;  1THO A;  4I2T A;  2WDU A;  2WS2 A;  1TI3 A;  1EGR A;  3A2W A;  2DIZ A;  5F05 A;  2OBI A;  5INY A;  3EMP A;  1WE0 A;  1EOG A;  2DLX A;  1SEN A;  3GL5 A;  1TRU A;  1OE7 A;  7GSS A;  5EVO A;  3SBC A;  3BD2 A;  5IOW A;  4JBB A;  3FR3 A;  2DSA A;  1SK1 A;  2H6Y A;  2LRT A;  1OYJ A;  4XHM A;  1M9A A;  5D9V A;  4K6X A;  2H75 A;  1MD4 A;  3VPQ A;  4NMU A;  3Q18 A;  2I81 A;  3CSJ A;  4ZXG A;  2DJJ A;  2H1D A;  4X43 A;  1EEJ A;  1CQG A;  2LKU A;  4MJE A;  5JCG A;  3DGQ A;  3QAG A;  2MMN A;  4ZB8 A;  2KP1 A;  1PKW A;  5HR2 A;  2KLX A;  2LQQ A;  1J9B A;  4O7H A;  4MK3 A;  1M9B A;  4J56 E;  4EKZ A;  1SKW B;  5G1L A;  5ELA A;  3BBY A;  3VWX A;  3D6I A;  2KOK A;  4IBP A;  3C71 A;  3LXZ A;  2GQM A;  5F06 A;  3MSZ A;  20GS A;  6GSU A;  1WOU A;  1GL8 A;  1K0O A;  4L8E A;  5ECQ B;  1SKS B;  2CVD A;  5FHI A;  4TR4 A;  1FVJ A;  3KZQ A;  3UVT A;  5HR0 A;  3G7I A;  3RBT A;  4ZL8 A;  3BJ5 A;  2L6D A;  2HRK B;  5CRH A;  2K9F A;  5ECH B;  2B5Y A;  3ZLP A;  2B7K A;  4ECC A;  3L9S A;  2ZNM A;  4IW9 A;  2GDR A;  2B1K A;  1ILO A;  3J7Y b;  5IMD A;  2H66 A;  1PN9 A;  2JZR A;  3GMF A;  1B48 A;  2P5Q A;  1GSS A;  4PNF A;  1F9M A;  1X5E A;  2M72 A;  4OFM A;  4D73 B;  4WEY A;  4IKH A;  2YV7 A;  2LS5 A;  4HUA A;  1EV4 A;  2M46 A;  2MBT A;  4QL7 A;  3W8S A;  3UVH A;  2JZS A;  3N9J A;  4ECI A;  1GSE A;  2O87 A;  4V1A g;  1UN2 A;  1JFU A;  2LRC A;  1QQ2 A;  1XWG A;  3EC3 A;  1O7U A;  4GST A;  4RI6 A;  1SKR B;  2JL4 A;  1QMV A;  2HSY A;  4PTS A;  1GNE A;  2OE0 A;  1GUK A;  3A2V A;  4GF0 A;  2OAD A;  5AIS A;  3TB2 A;  1TK0 B;  4PGT A;  6GSS A;  4DEJ A;  3M9J A;  3C73 A;  5D93 A;  4OFT A;  4PUF C;  3N5O A;  1ZOF A;  1AIU A;  3PH9 A;  4NPB A;  4TW5 A;  2V32 A;  1KTE A;  2DJ1 A;  4PUR A;  2C0D A;  5IM9 A;  3EUR A;  4H86 A;  1CQH A;  19GS A;  3KJY A;  4HQS A;  1Y6E A;  3TRQ A;  3UJ1 A;  1JZO A;  1GUL A;  1VF3 A;  2C0G A;  2GT5 A;  4EC0 A;  3IK9 A;  4CW9 A;  3GV1 A;  3RHC A;  2O89 A;  3FZ4 A;  5DQS A;  4XS6 A;  2HSH A;  3FZ5 A;  3EU4 A;  5F8B A;  2YPM A;  3GTU A;  3DKS A;  3PR8 A;  2R2J A;  1OC9 A;  1QGV A;  3IHQ A;  3TCO A;  5D9W A;  4EE0 A;  4GSS A;  2K8V A;  2GVP A;  2MMA A;  5DQY A;  5J4U A;  5DDL A;  4PQI A;  4NWY A;  4ML6 A;  4V2N A;  2H1B A;  5ECR B;  2VL9 A;  2H0G A;  3OR5 A;  2EIO A;  2VLV A;  2CX4 A;  2VL2 A;  2YV9 A;  1W89 A;  3L4N A;  1ZMA A;  5DAK B;  2OE1 A;  4BVX A;  5A4W A;  4TR3 A;  4Z7X A;  2IME A;  4X0X A;  2JSY A;  2VOC A;  1G0T A;  2BJX A;  2FNO A;  1ZGN A;  2WJU A;  2PVQ A;  3R3E A;  10GS A;  4HZ4 A;  2VM2 A;  1AXD A;  2E0Q A;  5CYY A;  5CRW A;  1OC8 A;  4ECJ A;  1XVQ A;  2CV4 A;  1XW5 A;  2VCW A;  1T4Z A;  1ZYQ B;  1J0F A;  3IRA A;  3C1S A;  5H5R A;  2WFC A;  3LWA A;  1BG5 A;  3M1G A;  3HZ4 A;  1LJR A;  1T4Y A;  4MPF A;  1TU8 A;  1LBK A;  1EWX A;  3Q74 A;  2MZC A;  4JU5 A;  2GT6 A;  2R5G A;  1GH2 A;  2J9H A;  1B4P A;  4KAE A;  1TDI A;  4POK A;  1B8X A;  2FUG 2;  3CTG A;  5B8A A;  2YOI A;  2H70 A;  5AN1 A;  2YWI A;  4CHS A;  1MEK A;  3VWV A;  5AIV A;  1GSQ A;  3APO A;  1YKC A;  3KP9 A;  5IMF A;  2XC2 A;  2FLS A;  4LMW A;  4IHU A;  3ZL5 A;  4JRR A;  5ECP B;  1SD8 A;  1Q4J A;  4AJ8 A;  2FD3 A;  3C1R A;  4GQF A;  3LEF A;  2IMK A;  1DE1 A;  4ZBA A;  4F03 A;  2FHE A;  3QDN A;  5J9C A;  2V41 A;  2OBK A;  3VFI A;  5IOX A;  4WXT A;  2VM1 A;  2YCD A;  4G10 A;  4BVY A;  5FT3 A;  2IMF A;  5H5S A;  1HNB A;  4MP4 A;  2OAC A;  2HRK A;  3FHK A;  1TTZ A;  4KH7 A;  4WKW A;  5G5F A;  4LMV A;  2FA4 A;  1WP0 A;  2VD1 A;  2C3Q A;  1BED A;  1XW9 A;  3ED3 A;  2H19 A;  4HJ2 A;  2RLI A;  2AHE A;  2WRT A;  5H5Q A;  2A4V A;  4KCA A;  3GL3 A;  1PD2 1;  1YF0 A;  1TK8 B;  5DCG A;  1XIY A;  3TUE A;  2JU5 A;  4ZIL A;  1FB0 A;  6GSV A;  2DBC A;  2RII A;  2VLU A;  1ZZY A;  3GKX A;  5D96 A;  4DSS B;  3MDK A;  1SK0 A;  2L5O A;  4ZBD A;  2H6X A;  5F0G A;  1BX9 A;  1K0M A;  11GS A;  2HFD A;  2H1G A;  3ZRD A;  1XW6 A;  1DE2 A;  4YQU A;  3KMO A;  3TKS A;  1GUM A;  2L6C A;  1EGO A;  4KE3 A;  4LL4 B;  4V2L A;  2HRA A;  1ERV A;  1S3D A;  3HKR A;  2OE3 A;  2AAW A;  5D9X A;  4J2F A;  1TRS A;  4TR1 A;  1A2L A;  3HXS A;  4LLR A;  5EY6 A;  3GIX A;  1BYE A;  1GSU A;  4GCI A;  1HNA A;  1TU7 A;  3VUR A;  2CT6 A;  1K0A A;  3RPN A;  3WGX A;  1GSF A;  2FA8 A;  1M2A A;  2ES7 A;  5KN0 A;  3UEM A;  4KUN A;  2LUS A;  5IO2 A;  3GNJ A;  4XRA A;  4V2M A;  2EIR A;  2FWE A;  1OVN A;  3FZA A;  2CVB A;  2FWF A;  3C7M A;  4TVE A;  3F4T A;  1XPV A;  1ZCP A;  4OWY A;  2DJ3 A;  1KNG A;  2IMD A;  1JHB A;  1XOA A;  1M0U A;  3D4T A;  3ZTL A;  1X9S B;  1C72 A;  2VCX A;  4I5Q A;  3UL3 A;  4GWR A;  2L4Q A;  1AAZ A;  4ML1 A;  3TDG A;  1MDK A;  5E4W A;  2G2Q A;  1X0R A;  2B6M A;  1XWA A;  4GXZ A;  2HT9 A;  3IV4 A;  3A5W A;  1A8L A;  3VWU A;  2YP6 A;  2V6K A;  4KGI A;  4F0C A;  4JR6 A;  4KSM A;  1MD3 A;  4L5O A;  3ZFB A;  2DMM A;  3E0U A;  4TKY A;  5ECO B;  1GWC A;  3CRU A;  3PIN A;  2GSS A;  2G0F A;  2F3M A;  2VCV A;  5AGY A;  1B4Q A;  1PQN A;  4K7O A;  2XBI A;  1G6Y A;  3IPZ A;  1M7T A;  1GUH A;  4JZQ A;  4OCF A;  3GKN A;  5KN3 A;  2VO4 A;  4PQ1 A;  4J57 E;  18GS A;  3H8Q A;  2CAQ A;  2X99 A;  2GGT A;  5DVB A;  4ZL7 A;  3WGD A;  1ACV A;  4EUY A;  4XIH A;  2L59 A;  5IO0 A;  1KEB A;  2X8C A;  3IE3 A;  3R2Q A;  1SU9 A;  4AF2 A;  1SL2 B;  3DML A;  4K7I A;  3CSH A;  5ID2 B;  1LU4 A;  3VK9 A;  2H0H A;  1NSW A;  2N5F A;  3F8U A;  2RM5 A;  2H01 A;  5J5N A;  2EC4 A;  2KP2 A;  1GLQ A;  1OKT A;  3QPM A;  1XBS A;  3ZRE A;  1OC3 A;  5B8B A;  3V1W A;  3TKR A;  3E3E A;  4G0K A;  3P90 A;  3FKF A;  4MJB A;  3FRC A;  1XWB A;  3ZVJ A;  2ALB A;  5G30 A;  2IFQ B;  1URM A;  2LNS A;  5ECN B;  5C04 A;  3IOS A;  1AUC A;  4G0I A;  1V9W A;  3TOT A;  4N30 A;  3KH9 A;  1TK5 B;  3APS A;  4TXO B;  4G2E A;  1G7O A;  3DVW A;  4P3Y B;  2PU9 C;  3F6F A;  4G9H A;  2B3S A;  3WGE A;  2MBS A;  4QQ7 A;  2N5B A;  1TJD A;  1GSY A;  2XPE A;  1RQM A;  1FB6 A;  3HDC A;  4IN0 A;  2O8V B;  2GST A;  5B6N A;  1K0N A;  4Q5R A;  4O32 A;  3IR4 A;  5A4V A;  2VUP A;  1YF1 A;  4XS4 B;  22GS A;  3GRX A;  3BCI A;  3KH7 A;  5DAL A;  3L0H A;  4DSS A;  2HRN A;  2LJK A;  3KIJ A;  4EVM A;  2KUC A;  3QMX A;  1MDJ A;  2WZ9 A;  3UAP A;  8GSS A;  4ULX A;  3IDV A;  3GFK A;  4KX4 A;  3HZ8 A;  3P8W A;  1QFN A;  2C4J A;  2HSM B;  3QAW A;  4WF5 A;  3ZIJ A;  3HVX A;  5D73 A;  4K1F A;  4TRX A;  5DJM A;  2I1U A;  2C1Y A;  5JCW A;  2NBS A;  3QR6 A;  2H76 A;  2HNL A;  2ZCT A;  3GUR A;  4YAV A;  3GKK A;  3M8N A;  4MF5 A;  2LQO A;  2R37 A;  3G9B A;  4AJ7 A;  4NV2 A;  4FYC A;  4IP6 A;  4PXO A;  4BA7 A;  4NAX A;  2K6V A;  1KBN A;  2OKA A;  3DWV A;  5IPH A;  1NHO A;  1VGL A;  3PPU A;  2CZ2 A;  4TN8 A;  3CYN A;  3WYW A;  1K0C A;  2YWN A;  3KXO A;  2YZU A;  5HFK A;  4I6X A;  3WD6 A;  1HQO A;  3FR9 A;  3HY2 A;  4BPY A;  3P2A A;  2E7P A;  3J7Y k;  4KDX A;  4N0Z A;  1BAY A;  5AIX A;  3I9V 2;  1HD2 A;  4FIW A;  4JR4 A;  1JZD A;  4MMM A;  1PGT A;  1B9X C;  1YJ6 A;  3GH6 A;  4BL7 B;  5LNK e;  3LJR A;  2A2S A;  2ZUP A;  2VCZ A;  4EXJ A;  3E9J B;  4V1A p;  2IN3 A;  3RAZ A;  12GS A;  4GSN A;  4RQX A;  4E8H A;  2H71 A;  3CRT A;  3DVX A;  4EDY A;  3GST A;  1A23 A;  1U3A A;  1A0F A;  2C3T A;  3GH9 A;  4MDC A;  3GHA A;  2YWM A;  2YWO A;  5HR3 A;  5CRG A;  2VIM A;  3JCM L;  2I9H A;  1UVZ A;  5JWO B;  4KND A;  2TRX A;  2L57 A;  1SJZ A;  2JSZ A;  3HVS A;  3ZYW A;  2IL3 A;  2NPB A;  1PA3 A;  1JLW A; 
#chains in the Genus database with same CATH topology
 2VL2 C;  2CAI A;  2OT3 A;  3DRN A;  4DSQ A;  1Z7R A;  1T8E B;  4JED A;  2H8L A;  1U88 A;  1XFL A;  4Q5Q A;  3VI7 A;  4F82 A;  2HXK A;  4MZW A;  1SVO A;  1YKA A;  4EF0 A;  2GZZ A;  4NXI A;  3UBK A;  2EFH A;  5ID2 A;  2HI7 A;  4GRF A;  3LYP A;  3CBU A;  3U6V A;  2PGT A;  4TOP A;  2YAN A;  4PX1 A;  3H79 A;  1FG4 A;  2IWT A;  2FCH A;  3FZ9 A;  3CMI A;  3LGC A;  1K3L A;  1VF4 A;  2H30 A;  4ISD A;  4HJM A;  5B6M A;  1ZYP A;  4ZB6 A;  5FWG A;  2WVX B;  4K0G A;  4IVF A;  4ILF A;  3AY8 A;  1Z9H A;  4I97 A;  1K0D A;  3RHB A;  4HDE A;  3EYT A;  1FOV A;  3HMJ G;  2C80 A;  2H74 A;  4TXO A;  2D2Z A;  2AYT A;  3TJG A;  2C3N A;  5L71 A;  4WBR D;  2MMZ A;  4Z2U A;  2V2G A;  1FO5 A;  4XS1 A;  3IK7 A;  1YEP A;  3NOF A;  2GLR A;  3HVV A;  5GSS A;  1Q98 A;  4POB A;  3UAR A;  2LJA A;  1ERU A;  2R0C A;  2MYG A;  5J4Y A;  3F9U A;  4ZL9 A;  3L9V A;  4XTS A;  1IYI A;  2VCQ A;  1YDK A;  4NV5 A;  3TKS E;  4XS4 A;  3DIE A;  1N25 A;  1O81 A;  3EIN A;  1H75 A;  3PGT A;  4PQH A;  5ELG A;  3I69 A;  2NDO A;  4D73 A;  2HSN B;  2NVL A;  3U5R E;  1O85 A;  1XWC A;  4FQU A;  4WET A;  1T00 A;  1O73 A;  2FWG A;  4HS1 A;  1SVM A;  1ERW A;  2MMO A;  4AKG A;  5EL8 A;  3US3 A;  2HSM A;  3QCP A;  5IMZ A;  1TW9 A;  2CA8 A;  1BG1 A;  4OFN A;  1UC7 A;  1R5P A;  3F4S A;  2P0G A;  1G6W A;  2HQT A;  2VLT A;  9GSS A;  3LQ7 A;  3A3T A;  3HJM A;  5J47 A;  1OAZ A;  4KW6 A;  2CQ9 A;  3UBL A;  1X5C A;  1YVL A;  1ST9 A;  3TKS C;  3RPP A;  1USB A;  2YZH A;  5CO3 A;  3CXG A;  1GSD A;  3DD3 A;  2QSI A;  1TXX A;  2E2M A;  4O5R A;  6GSW A;  1TP9 A;  4IGJ A;  1MDI A;  2FWH A;  1PX7 A;  3ME7 A;  4MH2 A;  1EEM A;  5KOX A;  1DUG A;  3FW2 A;  1TOF A;  1PMT A;  1TRW A;  2YJH A;  1M99 A;  2H1A A;  4AI6 A;  1I5G A;  1FOH A;  1V57 A;  1O8W A;  5J3R A;  1T7P B;  5CRD A;  4HU7 A;  4KSO A;  3TU3 B;  1QXH A;  1MTC A;  2R6K A;  3M0F A;  1K0B A;  4RI7 A;  1TRV A;  4L0W A;  4FYU A;  5G31 A;  2KHP A;  1BJX A;  3KM6 A;  3EPT A;  2UV8 G;  1NW2 A;  2AV4 A;  2V1M A;  4HZ2 A;  2TRC P;  2AB6 A;  5D8I A;  4F9Z A;  4MLY A;  1BQ7 A;  4WR4 A;  1Z3E A;  1B9Y C;  4ID0 A;  13GS A;  5CNW A;  1OC9 B;  1WIK A;  3GKM A;  4TXV A;  5DAK A;  4KA0 A;  3O76 A;  2Z9S A;  3H93 A;  4XCS A;  2DKI A;  1EOH A;  1H4O A;  2HLS A;  3MAK A;  1SD9 A;  3G7J A;  1R4W A;  3M9K A;  2VL3 A;  2A4H A;  4MJC A;  1SYR A;  2H72 A;  2DJ2 A;  5CP1 A;  2PN8 A;  2X8H A;  17GS A;  4X1U A;  2R4V A;  3LXT A;  1I9D A;  4YKG A;  2PVO C;  5LD0 A;  3APQ A;  2DML A;  4OD7 A;  3IXR A;  1F3A A;  1T3B A;  4MA9 A;  4IS0 A;  1Y25 A;  2C0E A;  3LOR A;  3TJF A;  2X64 A;  1QK8 A;  4I2U A;  2WW2 A;  2HRF A;  4NHZ A;  1PRX A;  2X8G A;  1S3A A;  2NTO A;  2FY6 A;  2A2R A;  3UIW A;  3W8J A;  3L9U A;  1AC1 A;  3BOA A;  2VKZ G;  1DSB A;  1SYX A;  2HZE B;  4X4J A;  1X9M B;  3BCK A;  4QMK A;  4PUA A;  2TIR A;  2WUL A;  5HFI A;  3TOU A;  4O5Q A;  3F3R A;  3ZIV A;  2WVX A;  3CWG A;  5B7C A;  4EO3 A;  2RUE A;  3GYK A;  3Q19 A;  4ZBB A;  1GTB A;  3F6D A;  4KCE A;  3H1N A;  1HNC A;  3FYG A;  3UOM A;  1GTI A;  4E8E A;  5JWQ B;  2PPT A;  5DBQ A;  2C0F A;  3HD5 A;  3ERG A;  3HYP A;  3MWH A;  1J08 A;  2HYX A;  2I3Y A;  5BMU A;  5HFG A;  4MZB A;  1F2E A;  2IJY A;  3GN3 A;  4GLT A;  2YN1 A;  3RDW A;  5GAP D;  1O8X A;  1YY7 A;  5E59 A;  2VD0 A;  4LA1 A;  4MF7 A;  4WF4 A;  2ON5 A;  1EP7 A;  2WB9 A;  3ZML A;  3ERF A;  5KN1 A;  2K8S A;  1OKD A;  3TKP A;  5F07 A;  1T1V A;  2I4A A;  4FH8 A;  3LYK A;  4BVY B;  1AQX A;  1YZX A;  5EPF A;  4YAP A;  1GRX A;  1YEX A;  2HE3 A;  3TRX A;  1GTA A;  6GSY A;  2J23 A;  3M3M A;  2LJR A;  1WPI A;  4POM A;  4G19 A;  1XVW A;  2P5R A;  2GQK A;  3UMA A;  2X49 A;  5GZZ B;  2HSN A;  4AKX B;  3EU3 A;  3HJO A;  4ZIJ A;  3P7X A;  4NHW A;  1TKD B;  1A2M A;  2H73 A;  4HU9 A;  2C8U A;  1THX A;  1FW1 A;  3SWL A;  1Z7P A;  4OCE A;  5ECI B;  1FAA A;  3NZN A;  4K9Z A;  2XHF A;  3ME8 A;  3EVI A;  2AUV A;  5IMA A;  5CRE A;  1YQ1 A;  2K18 A;  5HQP A;  1ZL9 A;  2P31 A;  1A2J A;  2WGR A;  4MPG A;  2IMI A;  3W6G A;  3C8E A;  3ZMK A;  1Z6M A;  1EP8 A;  4CDO A;  4TR1 B;  4IQ1 A;  4L5L A;  3ERW A;  4Q5F A;  1PL1 A;  2VCT A;  5IQY A;  2PBJ A;  2M80 A;  2QA1 A;  2JAC A;  1ML6 A;  2GSQ A;  1O6J A;  1HYU A;  5KOW A;  1TI1 A;  5IMC A;  1SL0 B;  2FGX A;  2PWJ A;  1V40 A;  2DJK A;  4EDZ A;  2LRN A;  3EMX A;  1F37 A;  3QAV A;  2E2G A;  3EE2 A;  2WCI A;  4BWS A;  4YQM A;  1BF5 A;  2H0I A;  4F2I A;  1JZR A;  4AGS A;  4AKI A;  3TRP A;  2ON7 A;  3L78 A;  1GP1 A;  4JE1 A;  2YJ7 A;  5IIZ A;  3IBH A;  1PSQ A;  1R5A A;  3IC8 A;  4HQZ A;  4MJA A;  3ZIT A;  3KCM A;  3TJB A;  2AJQ B;  2HZF A;  3F4R A;  5COH A;  4HI7 A;  1SK2 A;  4FO5 A;  3GSS A;  4Z2T A;  16GS A;  3FY7 A;  1WMJ A;  1JZW A;  4YH2 A;  5A1N B;  4KDY A;  5JWR B;  3VWW A;  4AJ6 A;  2B7J A;  1Y1U A;  1M2B A;  4MH3 A;  2F9S A;  5ECK B;  5ECS A;  2LNT A;  5A5H B;  4GDF A;  1F6M C;  5J41 A;  3KP8 A;  3TGZ A;  4OO5 A;  4QL9 A;  3RFR C;  1ERT A;  3GA4 A;  4BWQ A;  4MZC A;  2QKE A;  3GUS A;  2O7K A;  1UA5 A;  3KD0 A;  2IPA A;  2GSR A;  4USS A;  3D5J A;  3IA1 A;  3O6T A;  1XXU A;  1X5D A;  3VPT A;  4OO4 A;  1Z6N A;  4TR0 A;  4WBJ A;  4POL A;  1AW9 A;  1RW1 A;  2DC5 A;  1PKZ A;  4HOJ A;  4GTU A;  3WT1 A;  5KN2 A;  3K8N A;  2LV3 A;  2O85 A;  3DXB A;  2HZE A;  2L4C A;  2B5E A;  4ECB A;  3KTB A;  1PL2 A;  3D21 A;  6GST A;  1U6T A;  2H6Z A;  2JAD A;  2OJL A;  2GTU A;  4DVC A;  2N5A A;  2CX3 A;  1NHY A;  5ECL B;  3KMN A;  4IP1 A;  1AQW A;  1F3B A;  1K3O A;  3CQF A;  1A24 A;  1SJI A;  2IFQ A;  3DYR A;  2BMX A;  2F8A A;  4WR5 A;  2R0P A;  1AQV A;  3CSI A;  4KDU A;  2GZY A;  1EV9 A;  1ABA A;  5GST A;  4Q5N A;  5G2Z A;  4IJI A;  3TJK A;  4N3Z A;  4N10 A;  1G7E A;  1RK4 A;  3F63 A;  1GNW A;  2XPD A;  4LL1 B;  5JCU A;  2PER A;  4K2D A;  4MCU A;  2YNX A;  4MF6 A;  1VF1 A;  4YKF A;  3D4M A;  1XCC A;  1N8J A;  1DBY A;  2GZP A;  1VRS D;  1FHE A;  5A4U A;  4CY8 A;  2GS3 A;  1V58 A;  2CVK A;  5ENU A;  5IPG A;  1GTU A;  2DJ0 A;  3F3Q A;  2F8F A;  1QUW A;  3NIV A;  3IAM 2;  3IC4 A;  1JLV A;  3H4K A;  1XZO A;  2B5X A;  1A0R P;  1PFO A;  5GAN D;  5J9B A;  4L0U A;  2VAF A;  4XRD A;  4F0B A;  5DCH A;  4EL1 A;  2LST A;  2IIY A;  5ECM B;  5CAX A;  1M2D A;  4EIP A;  2PUK C;  3GX8 A;  1X9W B;  3FK8 A;  2CZ3 A;  1VF2 A;  4KF9 A;  3F0I A;  1U87 A;  4FYB A;  5D9T A;  5DAL B;  3VI5 A;  4K7N A;  3CTF A;  2F51 A;  3DEX A;  3G7Y A;  2L5L A;  4IJ3 A;  3HA9 A;  1ON4 A;  2LTK A;  4N0V A;  1SJ6 A;  1N2A A;  4KB3 A;  3LG6 A;  2DIY A;  2RUF A;  5C00 A;  2R3X A;  1IYH A;  3KGK A;  1E2Y A;  4K0N A;  3KTL A;  14GS A;  3LSZ A;  1R26 A;  4HEA 2;  3LFL A;  1E6B A;  3KEB A;  4G0L A;  2WW3 A;  2OA7 A;  1WWJ A;  3GX0 A;  2BTO T;  3I43 A;  3ISO A;  2LEG A;  3VLN A;  3ZFL A;  3EWL A;  3I6A A;  1W4V A;  2RM6 A;  3QFB C;  4IQA A;  3TJJ A;  4N11 A;  4PNG A;  1FVK A;  3O3T A;  4O92 A;  4RUV A;  3WT2 A;  2O5V A;  1XWK A;  1V2A A;  5LCZ A;  1K3Y A;  4ZB9 A;  3QD9 A;  4GQC A;  3MNG A;  4BL7 A;  3Q6O A;  1OE8 A;  1NM3 A;  4ACS A;  3FEU A;  1WJK A;  3TKQ A;  6GSX A;  3HJP A;  4MAB A;  5G1K A;  3GTU B;  2B1L A;  4YQV A;  3D0Z A;  2QC7 A;  1GLP A;  5HR1 A;  5DJL A;  4IEL A;  3QOU A;  1R7H A;  2REM A;  1ZYE A;  3FR6 A;  5KEJ A;  2V6O A;  2XBQ A;  3A2X A;  3D22 A;  1EZK A;  4DSR A;  2JZT A;  3ZVJ D;  3HCZ A;  1U3I A;  2O3E A;  1Z5Y E;  5A34 B;  1XOB A;  2PMT A;  1A8Y A;  5ABR A;  3HHV A;  4OMV A;  2GQL A;  4I8B A;  5IMV A;  3S9F A;  4RQR A;  1WRY A;  1S3C A;  2UZ8 A;  1PX6 A;  4K8M A;  4BVX B;  2EIQ A;  3QFA C;  5G5E A;  1SL1 B;  2QGV A;  3IAS 2;  3ZZX A;  1V98 A;  5A5K A;  1THO A;  4I2T A;  2WDU A;  2WS2 A;  1TI3 A;  1EGR A;  3A2W A;  2DIZ A;  5F05 A;  2OBI A;  5INY A;  3EMP A;  1WE0 A;  1EOG A;  2DLX A;  1SEN A;  3GL5 A;  4G01 A;  1TRU A;  1OE7 A;  7GSS A;  5EVO A;  3SBC A;  3BD2 A;  5IOW A;  4JBB A;  3FR3 A;  2DSA A;  1SK1 A;  2H6Y A;  2LRT A;  1OYJ A;  4XHM A;  1M9A A;  5D9V A;  4K6X A;  2H75 A;  1MD4 A;  3VPQ A;  4NMU A;  3Q18 A;  1I1I P;  2I81 A;  3CSJ A;  4ZXG A;  2DJJ A;  2H1D A;  4X43 A;  1EEJ A;  1CQG A;  2LKU A;  4MJE A;  5JCG A;  3DGQ A;  3QAG A;  2MMN A;  4ZB8 A;  2KP1 A;  1PKW A;  5HR2 A;  2KLX A;  2LQQ A;  1J9B A;  4O7H A;  4MK3 A;  1M9B A;  4J56 E;  4EKZ A;  1SKW B;  5G1L A;  5ELA A;  3BBY A;  3VWX A;  3D6I A;  2KOK A;  4IBP A;  3C71 A;  3LXZ A;  2GQM A;  5F06 A;  3MSZ A;  20GS A;  6GSU A;  1WOU A;  1GL8 A;  1K0O A;  4L8E A;  5ECQ B;  1SKS B;  4MNN A;  2CVD A;  5FHI A;  4TR4 A;  1FVJ A;  3KZQ A;  3UVT A;  5HR0 A;  3G7I A;  3RBT A;  4ZL8 A;  3BJ5 A;  3FMW A;  2L6D A;  4Z2R A;  2HRK B;  5CRH A;  2K9F A;  5ECH B;  4ICY A;  2B5Y A;  3ZLP A;  2B7K A;  4ECC A;  3L9S A;  2ZNM A;  4IW9 A;  2GDR A;  2B1K A;  1ILO A;  3J7Y b;  5IMD A;  2H66 A;  2EFD A;  1PN9 A;  2JZR A;  3GMF A;  1B48 A;  2P5Q A;  1GSS A;  3IHG A;  2EFE A;  4PNF A;  2QA2 A;  1F9M A;  2M72 A;  1X5E A;  4OFM A;  4D73 B;  4WEY A;  4IKH A;  2YV7 A;  2LS5 A;  4HUA A;  1EV4 A;  2M46 A;  2MBT A;  4QL7 A;  3W8S A;  3UVH A;  2JZS A;  3N9J A;  4ECI A;  1GSE A;  2O87 A;  4V1A g;  1UN2 A;  1JFU A;  2LRC A;  1QQ2 A;  1XWG A;  3EC3 A;  1O7U A;  4GST A;  4RI6 A;  1SKR B;  2JL4 A;  1QMV A;  2HSY A;  4PTS A;  1GNE A;  2OE0 A;  1GUK A;  3A2V A;  4GF0 A;  2OAD A;  5AIS A;  3TB2 A;  1TK0 B;  4PGT A;  6GSS A;  4DEJ A;  3M9J A;  3C73 A;  5D93 A;  1M3I A;  4OFT A;  4PUF C;  3N5O A;  1ZOF A;  1AIU A;  3PH9 A;  4NPB A;  4TW5 A;  2V32 A;  1KTE A;  2DJ1 A;  2WZS A;  4PUR A;  2C0D A;  5IM9 A;  3EUR A;  4H86 A;  1CQH A;  19GS A;  3KJY A;  4HQS A;  1Y6E A;  3TRQ A;  3UJ1 A;  1JZO A;  1GUL A;  1VF3 A;  2C0G A;  2GT5 A;  4EC0 A;  3IK9 A;  4CW9 A;  3GV1 A;  3RHC A;  4AKH A;  2O89 A;  3FZ4 A;  5DQS A;  4XS6 A;  2HSH A;  3FZ5 A;  3EU4 A;  5F8B A;  2YPM A;  3GTU A;  3DKS A;  3PR8 A;  2R2J A;  2DKH A;  1OC9 A;  1QGV A;  1YEW C;  3IHQ A;  3TCO A;  5D9W A;  4EE0 A;  4GSS A;  2K8V A;  2GVP A;  2MMA A;  5DQY A;  5J4U A;  5DDL A;  4PQI A;  4NWY A;  4ML6 A;  4V2N A;  2H1B A;  4K5S A;  5ECR B;  2VL9 A;  2H0G A;  3OR5 A;  2EIO A;  2VLV A;  2CX4 A;  2VL2 A;  2YV9 A;  1W89 A;  3L4N A;  1ZMA A;  5DAK B;  2OE1 A;  4BVX A;  5A4W A;  4TR3 A;  4Z7X A;  2IME A;  4X0X A;  2JSY A;  2VOC A;  1G0T A;  2A2P A;  2BJX A;  2FNO A;  1ZGN A;  2WJU A;  2PVQ A;  3R3E A;  3CHX C;  10GS A;  4HZ4 A;  2WW1 A;  2VM2 A;  1AXD A;  2E0Q A;  5CYY A;  5CRW A;  4EIQ A;  1OC8 A;  4ECJ A;  1XVQ A;  5BRT A;  2CV4 A;  1XW5 A;  2VCW A;  1T4Z A;  1ZYQ B;  1J0F A;  3IRA A;  3C1S A;  5H5R A;  2WFC A;  3LWA A;  1BG5 A;  3M1G A;  3HZ4 A;  1LJR A;  1T4Y A;  4MPF A;  1TU8 A;  1LBK A;  1EWX A;  3Q74 A;  2MZC A;  4JU5 A;  2GT6 A;  2R5G A;  1GH2 A;  2J9H A;  1B4P A;  4KAE A;  1TDI A;  4POK A;  1B8X A;  2FUG 2;  3CTG A;  5B8A A;  2YOI A;  2H70 A;  1ZYN A;  5AN1 A;  2YWI A;  4CHS A;  1MEK A;  3VWV A;  5AIV A;  1GSQ A;  3APO A;  1YKC A;  3KP9 A;  5IMF A;  2XC2 A;  2FLS A;  4LMW A;  4IHU A;  3ZL5 A;  4JRR A;  5ECP B;  1SD8 A;  1Q4J A;  4AJ8 A;  2FD3 A;  3C1R A;  4GQF A;  3LEF A;  2IMK A;  1DE1 A;  4ZBA A;  4F03 A;  2FHE A;  3QDN A;  5BMU B;  5J9C A;  2V41 A;  2OBK A;  3VFI A;  5IOX A;  4WXT A;  2VM1 A;  5J4V A;  2YCD A;  4G10 A;  4BVY A;  5FT3 A;  2IMF A;  5H5S A;  1HNB A;  4MP4 A;  2OAC A;  2HRK A;  3FHK A;  1TTZ A;  4KH7 A;  4WKW A;  5G5F A;  4LMV A;  2FA4 A;  1WP0 A;  2VD1 A;  2C3Q A;  1BED A;  1XW9 A;  3ED3 A;  2H19 A;  4HJ2 A;  2RLI A;  2AHE A;  2WRT A;  5H5Q A;  2A4V A;  4KCA A;  3GL3 A;  1PD2 1;  1YF0 A;  1TK8 B;  5DCG A;  1XIY A;  3TUE A;  2JU5 A;  3MYD A;  1FB0 A;  4ZIL A;  6GSV A;  2DBC A;  2RII A;  2VLU A;  1ZZY A;  3GKX A;  5D96 A;  4DSS B;  3MDK A;  1SK0 A;  2L5O A;  4ZBD A;  2H6X A;  5F0G A;  1BX9 A;  1K0M A;  11GS A;  2HFD A;  2H1G A;  3ZRD A;  1XW6 A;  1DE2 A;  4YQU A;  3KMO A;  3TKS A;  1GUM A;  2L6C A;  1EGO A;  4KE3 A;  4LL4 B;  4V2L A;  2HRA A;  1ERV A;  1S3D A;  3HKR A;  3HVN A;  4K5R A;  2OE3 A;  2AAW A;  5D9X A;  4J2F A;  1TRS A;  4TR1 A;  1A2L A;  3HXS A;  4LLR A;  5EY6 A;  3GIX A;  1BYE A;  1GSU A;  4GCI A;  1HNA A;  1TU7 A;  3VUR A;  2CT6 A;  1K0A A;  3RPN A;  3WGX A;  1GSF A;  2FA8 A;  1M2A A;  2ES7 A;  5KN0 A;  3UEM A;  4KUN A;  2LUS A;  5IO2 A;  3GNJ A;  4XRA A;  4V2M A;  4FXY P;  2EIR A;  2FWE A;  1OVN A;  3FZA A;  2CVB A;  2FWF A;  3C7M A;  4TVE A;  1TXU A;  3F4T A;  1XPV A;  1ZCP A;  4OWY A;  4BIK A;  2DJ3 A;  3LW9 A;  1KNG A;  2IMD A;  1JHB A;  1XOA A;  1M0U A;  3D4T A;  3ZTL A;  1X9S B;  1C72 A;  2VCX A;  4I5Q A;  3UL3 A;  4GWR A;  2L4Q A;  1AAZ A;  4ML1 A;  3TDG A;  2WVZ A;  4ZB7 A;  1MDK A;  2G2Q A;  5E4W A;  1X0R A;  2B6M A;  1XWA A;  4GXZ A;  2HT9 A;  3IV4 A;  3A5W A;  4HSC X;  1A8L A;  3VWU A;  2YP6 A;  1SVL A;  4A5P A;  2V6K A;  4KGI A;  5A1N A;  4F0C A;  4JR6 A;  4KSM A;  1MD3 A;  4L5O A;  3ZFB A;  4E68 A;  2DMM A;  3E0U A;  4TKY A;  5ECO B;  5A5H A;  1GWC A;  3CRU A;  3PIN A;  2GSS A;  2G0F A;  2F3M A;  2VCV A;  5AGY A;  1B4Q A;  1PQN A;  4K7O A;  2XBI A;  1G6Y A;  4O5U A;  1S4B P;  3IPZ A;  1M7T A;  1GUH A;  4JZQ A;  4OCF A;  3GKN A;  5KN3 A;  2VO4 A;  4PQ1 A;  4J57 E;  18GS A;  3H8Q A;  2CAQ A;  2X99 A;  2GGT A;  5DVB A;  4ZL7 A;  3WGD A;  1ACV A;  4EUY A;  4XIH A;  2EFC A;  2L59 A;  5IO0 A;  1KEB A;  2X8C A;  4W66 A;  3IE3 A;  3R2Q A;  1SU9 A;  4AF2 A;  1SL2 B;  3DML A;  4K7I A;  3CSH A;  5ID2 B;  1LU4 A;  3VK9 A;  2H0H A;  1XG8 A;  1NSW A;  2N5F A;  3F8U A;  2RM5 A;  2H01 A;  5J5N A;  2EC4 A;  2KP2 A;  1GLQ A;  1OKT A;  3QPM A;  1XBS A;  3ZRE A;  1OC3 A;  5B8B A;  3V1W A;  3TKR A;  3E3E A;  4G0K A;  3P90 A;  3FKF A;  4MJB A;  3FRC A;  1XWB A;  3ZVJ A;  2ALB A;  5G30 A;  2IFQ B;  1URM A;  2LNS A;  5ECN B;  4CY6 A;  5C04 A;  2WW0 A;  3IOS A;  1AUC A;  4G0I A;  1V9W A;  3TOT A;  4N30 A;  2R0G A;  3RGB C;  3KH9 A;  1TK5 B;  3APS A;  4TXO B;  4G2E A;  1G7O A;  3DVW A;  4P3Y B;  2PU9 C;  3F6F A;  4G9H A;  2B3S A;  3WGE A;  2MBS A;  4QQ7 A;  2N5B A;  4PI0 C;  1TJD A;  1GSY A;  1S3R A;  2XPE A;  1RQM A;  1FB6 A;  3HDC A;  4IN0 A;  2O8V B;  2GST A;  5B6N A;  1K0N A;  4Q5R A;  1M3J A;  4O32 A;  3IR4 A;  5A4V A;  2VUP A;  1YF1 A;  4XS4 B;  22GS A;  3GRX A;  3BCI A;  3KH7 A;  5DAL A;  3L0H A;  4DSS A;  2HRN A;  2LJK A;  3KIJ A;  4EVM A;  2KUC A;  3QMX A;  1MDJ A;  2WZ9 A;  3UAP A;  8GSS A;  4ULX A;  3IDV A;  3GFK A;  4KX4 A;  3HZ8 A;  3P8W A;  1QFN A;  3A5I A;  2C4J A;  2HSM B;  3QAW A;  4WF5 A;  3ZIJ A;  3HVX A;  5D73 A;  4K1F A;  4K2X A;  4TRX A;  5DJM A;  2I1U A;  2C1Y A;  5JCW A;  2NBS A;  3QR6 A;  2H76 A;  2HNL A;  2ZCT A;  3GUR A;  4YAV A;  3GKK A;  3M8N A;  4MF5 A;  5J40 A;  2LQO A;  2R37 A;  3G9B A;  4AJ7 A;  4NV2 A;  4FYC A;  2WVY A;  2X4A A;  4IP6 A;  4PXO A;  4BA7 A;  4NAX A;  2K6V A;  1KBN A;  2OKA A;  3DWV A;  5IPH A;  1NHO A;  1VGL A;  3PPU A;  2CZ2 A;  4TN8 A;  3CYN A;  3WYW A;  1K0C A;  2YWN A;  3KXO A;  2YZU A;  5HFK A;  3MIX A;  4I6X A;  3WD6 A;  1HQO A;  3FR9 A;  4PI2 C;  3HY2 A;  4BPY A;  3P2A A;  1PN0 A;  2E7P A;  3J7Y k;  4KDX A;  4N0Z A;  1BAY A;  5AIX A;  3I9V 2;  1HD2 A;  4FIW A;  4JR4 A;  1JZD A;  4MMM A;  1PGT A;  1B9X C;  1YJ6 A;  3GH6 A;  4BL7 B;  5LNK e;  3LJR A;  2A2S A;  2ZUP A;  2VCZ A;  4EXJ A;  3E9J B;  4V1A p;  2IN3 A;  3RAZ A;  12GS A;  4GSN A;  4RQX A;  4E8H A;  2H71 A;  3CRT A;  3DVX A;  4EDY A;  3GST A;  5A34 A;  1A23 A;  1U3A A;  1A0F A;  2C3T A;  3GH9 A;  4MDC A;  3GHA A;  2YWM A;  2O36 A;  2YWO A;  4PHZ C;  5HR3 A;  5CRG A;  2VIM A;  3JCM L;  2I9H A;  2H1L A;  1UVZ A;  5JWO B;  4KND A;  2TRX A;  2L57 A;  1SJZ A;  2JSZ A;  3HVS A;  3ZYW A;  2IL3 A;  2NPB A;  1PA3 A;  1JLW A; 
#chains in the Genus database with same CATH homology
 2VL2 C;  2CAI A;  2OT3 A;  3DRN A;  4DSQ A;  1Z7R A;  1T8E B;  4JED A;  2H8L A;  1U88 A;  1XFL A;  4Q5Q A;  3VI7 A;  4F82 A;  2HXK A;  4MZW A;  1SVO A;  1YKA A;  4EF0 A;  2GZZ A;  4NXI A;  3UBK A;  2EFH A;  5ID2 A;  2HI7 A;  4GRF A;  3LYP A;  3CBU A;  3U6V A;  2PGT A;  4TOP A;  2YAN A;  4PX1 A;  3H79 A;  1FG4 A;  2IWT A;  2FCH A;  3FZ9 A;  3CMI A;  3LGC A;  1K3L A;  1VF4 A;  2H30 A;  4ISD A;  4HJM A;  5B6M A;  1ZYP A;  4ZB6 A;  5FWG A;  4K0G A;  4IVF A;  4ILF A;  3AY8 A;  1Z9H A;  4I97 A;  1K0D A;  3RHB A;  4HDE A;  3EYT A;  1FOV A;  3HMJ G;  2C80 A;  2H74 A;  4TXO A;  2D2Z A;  2AYT A;  3TJG A;  2C3N A;  5L71 A;  4WBR D;  2MMZ A;  4Z2U A;  2V2G A;  1FO5 A;  4XS1 A;  3IK7 A;  1YEP A;  3NOF A;  2GLR A;  3HVV A;  5GSS A;  1Q98 A;  4POB A;  3UAR A;  2LJA A;  1ERU A;  2R0C A;  2MYG A;  5J4Y A;  3F9U A;  4ZL9 A;  3L9V A;  4XTS A;  1IYI A;  2VCQ A;  1YDK A;  4NV5 A;  3TKS E;  4XS4 A;  3DIE A;  1N25 A;  1O81 A;  3EIN A;  1H75 A;  3PGT A;  4PQH A;  5ELG A;  3I69 A;  2NDO A;  4D73 A;  2HSN B;  2NVL A;  3U5R E;  1O85 A;  1XWC A;  4FQU A;  4WET A;  1T00 A;  1O73 A;  2FWG A;  4HS1 A;  1SVM A;  1ERW A;  2MMO A;  4AKG A;  5EL8 A;  3US3 A;  2HSM A;  3QCP A;  5IMZ A;  1TW9 A;  2CA8 A;  1BG1 A;  4OFN A;  1UC7 A;  1R5P A;  3F4S A;  2P0G A;  1G6W A;  2HQT A;  2VLT A;  9GSS A;  3LQ7 A;  3A3T A;  3HJM A;  5J47 A;  1OAZ A;  4KW6 A;  2CQ9 A;  3UBL A;  1X5C A;  1YVL A;  1ST9 A;  3TKS C;  3RPP A;  1USB A;  2YZH A;  5CO3 A;  3CXG A;  1GSD A;  3DD3 A;  2QSI A;  1TXX A;  2E2M A;  4O5R A;  6GSW A;  1TP9 A;  4IGJ A;  1MDI A;  2FWH A;  3ME7 A;  1PX7 A;  4MH2 A;  1EEM A;  5KOX A;  1DUG A;  3FW2 A;  1TOF A;  1PMT A;  1TRW A;  2YJH A;  1M99 A;  2H1A A;  4AI6 A;  1I5G A;  1FOH A;  1V57 A;  1O8W A;  5J3R A;  1T7P B;  5CRD A;  4HU7 A;  4KSO A;  3TU3 B;  1QXH A;  1MTC A;  2R6K A;  3M0F A;  1K0B A;  4RI7 A;  1TRV A;  4L0W A;  4FYU A;  5G31 A;  2KHP A;  1BJX A;  3KM6 A;  3EPT A;  2UV8 G;  1NW2 A;  2AV4 A;  2V1M A;  4HZ2 A;  2TRC P;  2AB6 A;  5D8I A;  4F9Z A;  4MLY A;  1BQ7 A;  4WR4 A;  1Z3E A;  1B9Y C;  4ID0 A;  13GS A;  5CNW A;  1OC9 B;  1WIK A;  3GKM A;  4TXV A;  5DAK A;  4KA0 A;  3O76 A;  2Z9S A;  3H93 A;  4XCS A;  2DKI A;  1EOH A;  1H4O A;  2HLS A;  3MAK A;  1SD9 A;  3G7J A;  1R4W A;  3M9K A;  2VL3 A;  2A4H A;  4MJC A;  1SYR A;  2H72 A;  2DJ2 A;  5CP1 A;  2PN8 A;  2X8H A;  17GS A;  4X1U A;  2R4V A;  3LXT A;  1I9D A;  4YKG A;  2PVO C;  5LD0 A;  3APQ A;  2DML A;  4OD7 A;  3IXR A;  1F3A A;  1T3B A;  4MA9 A;  4IS0 A;  1Y25 A;  2C0E A;  3LOR A;  3TJF A;  2X64 A;  1QK8 A;  4I2U A;  2HRF A;  4NHZ A;  1PRX A;  2X8G A;  1S3A A;  2NTO A;  2FY6 A;  2A2R A;  3UIW A;  3W8J A;  3L9U A;  1AC1 A;  3BOA A;  2VKZ G;  1DSB A;  1SYX A;  2HZE B;  4X4J A;  1X9M B;  3BCK A;  4QMK A;  4PUA A;  2TIR A;  2WUL A;  5HFI A;  3TOU A;  4O5Q A;  3F3R A;  3ZIV A;  3CWG A;  5B7C A;  4EO3 A;  2RUE A;  3GYK A;  3Q19 A;  4ZBB A;  1GTB A;  3F6D A;  4KCE A;  3H1N A;  1HNC A;  3FYG A;  3UOM A;  1GTI A;  4E8E A;  5JWQ B;  2PPT A;  5DBQ A;  2C0F A;  3HD5 A;  3ERG A;  3HYP A;  3MWH A;  1J08 A;  2HYX A;  2I3Y A;  5BMU A;  5HFG A;  4MZB A;  1F2E A;  2IJY A;  3GN3 A;  4GLT A;  2YN1 A;  3RDW A;  5GAP D;  1O8X A;  1YY7 A;  5E59 A;  2VD0 A;  4LA1 A;  4MF7 A;  4WF4 A;  2ON5 A;  1EP7 A;  2WB9 A;  3ZML A;  3ERF A;  5KN1 A;  2K8S A;  1OKD A;  3TKP A;  5F07 A;  1T1V A;  2I4A A;  4FH8 A;  3LYK A;  4BVY B;  1AQX A;  1YZX A;  5EPF A;  4YAP A;  1GRX A;  1YEX A;  2HE3 A;  3TRX A;  1GTA A;  6GSY A;  2J23 A;  3M3M A;  2LJR A;  1WPI A;  4POM A;  4G19 A;  1XVW A;  2P5R A;  2GQK A;  3UMA A;  2X49 A;  5GZZ B;  2HSN A;  4AKX B;  3EU3 A;  3HJO A;  4ZIJ A;  3P7X A;  4NHW A;  1TKD B;  1A2M A;  2H73 A;  4HU9 A;  2C8U A;  1THX A;  1FW1 A;  3SWL A;  1Z7P A;  4OCE A;  5ECI B;  1FAA A;  3NZN A;  4K9Z A;  2XHF A;  3ME8 A;  3EVI A;  2AUV A;  5IMA A;  5CRE A;  1YQ1 A;  2K18 A;  5HQP A;  1ZL9 A;  2P31 A;  1A2J A;  2WGR A;  4MPG A;  2IMI A;  3W6G A;  3C8E A;  3ZMK A;  1Z6M A;  1EP8 A;  4CDO A;  4TR1 B;  4IQ1 A;  4L5L A;  3ERW A;  4Q5F A;  1PL1 A;  2VCT A;  5IQY A;  2PBJ A;  2M80 A;  2QA1 A;  2JAC A;  1ML6 A;  2GSQ A;  1O6J A;  1HYU A;  5KOW A;  1TI1 A;  5IMC A;  1SL0 B;  2FGX A;  2PWJ A;  1V40 A;  2DJK A;  4EDZ A;  2LRN A;  3EMX A;  1F37 A;  3QAV A;  2E2G A;  3EE2 A;  2WCI A;  4BWS A;  4YQM A;  1BF5 A;  2H0I A;  4F2I A;  1JZR A;  4AGS A;  4AKI A;  3TRP A;  2ON7 A;  3L78 A;  1GP1 A;  4JE1 A;  2YJ7 A;  5IIZ A;  3IBH A;  1PSQ A;  1R5A A;  3IC8 A;  4HQZ A;  4MJA A;  3ZIT A;  3KCM A;  3TJB A;  2AJQ B;  2HZF A;  3F4R A;  5COH A;  4HI7 A;  1SK2 A;  4FO5 A;  3GSS A;  4Z2T A;  16GS A;  3FY7 A;  1WMJ A;  1JZW A;  4YH2 A;  5A1N B;  4KDY A;  5JWR B;  3VWW A;  4AJ6 A;  2B7J A;  1Y1U A;  1M2B A;  4MH3 A;  2F9S A;  5ECK B;  5ECS A;  2LNT A;  5A5H B;  4GDF A;  1F6M C;  5J41 A;  3KP8 A;  3TGZ A;  4OO5 A;  4QL9 A;  1ERT A;  3GA4 A;  4BWQ A;  4MZC A;  2QKE A;  3GUS A;  2O7K A;  1UA5 A;  3KD0 A;  2IPA A;  2GSR A;  4USS A;  3D5J A;  3IA1 A;  3O6T A;  1XXU A;  1X5D A;  3VPT A;  4OO4 A;  1Z6N A;  4TR0 A;  4WBJ A;  4POL A;  1AW9 A;  1RW1 A;  2DC5 A;  1PKZ A;  4HOJ A;  4GTU A;  3WT1 A;  5KN2 A;  3K8N A;  2LV3 A;  2O85 A;  3DXB A;  2HZE A;  2L4C A;  2B5E A;  4ECB A;  3KTB A;  1PL2 A;  3D21 A;  6GST A;  1U6T A;  2H6Z A;  2JAD A;  2OJL A;  2GTU A;  4DVC A;  2N5A A;  2CX3 A;  1NHY A;  5ECL B;  3KMN A;  4IP1 A;  1AQW A;  1F3B A;  1K3O A;  1A24 A;  1SJI A;  2IFQ A;  3DYR A;  2BMX A;  2F8A A;  4WR5 A;  2R0P A;  1AQV A;  3CSI A;  4KDU A;  2GZY A;  1EV9 A;  1ABA A;  5GST A;  4Q5N A;  5G2Z A;  4IJI A;  3TJK A;  4N3Z A;  4N10 A;  1G7E A;  1RK4 A;  3F63 A;  1GNW A;  2XPD A;  4LL1 B;  5JCU A;  2PER A;  4K2D A;  4MCU A;  2YNX A;  4MF6 A;  1VF1 A;  4YKF A;  3D4M A;  1XCC A;  1N8J A;  1DBY A;  2GZP A;  1VRS D;  1FHE A;  5A4U A;  4CY8 A;  2GS3 A;  1V58 A;  2CVK A;  5ENU A;  5IPG A;  1GTU A;  2DJ0 A;  3F3Q A;  2F8F A;  1QUW A;  3NIV A;  3IAM 2;  3IC4 A;  1JLV A;  3H4K A;  1XZO A;  2B5X A;  1A0R P;  5GAN D;  5J9B A;  4L0U A;  2VAF A;  4XRD A;  4F0B A;  5DCH A;  4EL1 A;  2LST A;  2IIY A;  5ECM B;  5CAX A;  1M2D A;  4EIP A;  2PUK C;  3GX8 A;  1X9W B;  3FK8 A;  2CZ3 A;  1VF2 A;  4KF9 A;  3F0I A;  1U87 A;  4FYB A;  5D9T A;  5DAL B;  3VI5 A;  4K7N A;  3CTF A;  2F51 A;  3DEX A;  3G7Y A;  2L5L A;  4IJ3 A;  3HA9 A;  1ON4 A;  2LTK A;  4N0V A;  1SJ6 A;  1N2A A;  4KB3 A;  3LG6 A;  2DIY A;  2RUF A;  5C00 A;  2R3X A;  1IYH A;  3KGK A;  1E2Y A;  4K0N A;  3KTL A;  14GS A;  3LSZ A;  1R26 A;  4HEA 2;  3LFL A;  1E6B A;  3KEB A;  4G0L A;  2OA7 A;  1WWJ A;  3GX0 A;  2BTO T;  3I43 A;  3ISO A;  2LEG A;  3VLN A;  3ZFL A;  3EWL A;  3I6A A;  1W4V A;  2RM6 A;  3QFB C;  4IQA A;  3TJJ A;  4N11 A;  4PNG A;  1FVK A;  3O3T A;  4O92 A;  4RUV A;  3WT2 A;  2O5V A;  1XWK A;  1V2A A;  5LCZ A;  1K3Y A;  4ZB9 A;  3QD9 A;  4GQC A;  3MNG A;  4BL7 A;  3Q6O A;  1OE8 A;  1NM3 A;  4ACS A;  3FEU A;  1WJK A;  3TKQ A;  6GSX A;  3HJP A;  4MAB A;  5G1K A;  3GTU B;  2B1L A;  4YQV A;  3D0Z A;  2QC7 A;  1GLP A;  5HR1 A;  5DJL A;  4IEL A;  3QOU A;  1R7H A;  2REM A;  1ZYE A;  3FR6 A;  5KEJ A;  2V6O A;  2XBQ A;  3A2X A;  3D22 A;  1EZK A;  4DSR A;  2JZT A;  3ZVJ D;  3HCZ A;  1U3I A;  1Z5Y E;  5A34 B;  1XOB A;  2PMT A;  1A8Y A;  5ABR A;  3HHV A;  4OMV A;  2GQL A;  4I8B A;  5IMV A;  3S9F A;  4RQR A;  1WRY A;  1S3C A;  2UZ8 A;  1PX6 A;  4K8M A;  4BVX B;  2EIQ A;  3QFA C;  5G5E A;  1SL1 B;  2QGV A;  3IAS 2;  3ZZX A;  1V98 A;  5A5K A;  1THO A;  4I2T A;  2WDU A;  2WS2 A;  1TI3 A;  1EGR A;  3A2W A;  2DIZ A;  5F05 A;  2OBI A;  5INY A;  3EMP A;  1WE0 A;  1EOG A;  2DLX A;  1SEN A;  3GL5 A;  4G01 A;  1TRU A;  1OE7 A;  7GSS A;  5EVO A;  3SBC A;  3BD2 A;  5IOW A;  4JBB A;  3FR3 A;  2DSA A;  1SK1 A;  2H6Y A;  2LRT A;  1OYJ A;  4XHM A;  1M9A A;  5D9V A;  4K6X A;  2H75 A;  1MD4 A;  3VPQ A;  4NMU A;  3Q18 A;  2I81 A;  3CSJ A;  4ZXG A;  2DJJ A;  2H1D A;  4X43 A;  1EEJ A;  1CQG A;  2LKU A;  4MJE A;  5JCG A;  3DGQ A;  3QAG A;  2MMN A;  4ZB8 A;  2KP1 A;  1PKW A;  5HR2 A;  2KLX A;  2LQQ A;  1J9B A;  4O7H A;  4MK3 A;  1M9B A;  4J56 E;  4EKZ A;  1SKW B;  5G1L A;  5ELA A;  3BBY A;  3VWX A;  3D6I A;  2KOK A;  4IBP A;  3C71 A;  3LXZ A;  2GQM A;  5F06 A;  3MSZ A;  20GS A;  6GSU A;  1WOU A;  1GL8 A;  1K0O A;  4L8E A;  5ECQ B;  1SKS B;  4MNN A;  2CVD A;  5FHI A;  4TR4 A;  1FVJ A;  3KZQ A;  3UVT A;  5HR0 A;  3G7I A;  3RBT A;  4ZL8 A;  3BJ5 A;  3FMW A;  2L6D A;  4Z2R A;  2HRK B;  5CRH A;  2K9F A;  5ECH B;  4ICY A;  2B5Y A;  3ZLP A;  2B7K A;  4ECC A;  3L9S A;  2ZNM A;  4IW9 A;  2GDR A;  2B1K A;  1ILO A;  3J7Y b;  5IMD A;  2H66 A;  2EFD A;  1PN9 A;  2JZR A;  3GMF A;  1B48 A;  2P5Q A;  1GSS A;  3IHG A;  2EFE A;  4PNF A;  2QA2 A;  1F9M A;  2M72 A;  1X5E A;  4OFM A;  4D73 B;  4WEY A;  4IKH A;  2YV7 A;  2LS5 A;  4HUA A;  1EV4 A;  2M46 A;  2MBT A;  4QL7 A;  3W8S A;  3UVH A;  2JZS A;  3N9J A;  4ECI A;  1GSE A;  2O87 A;  4V1A g;  1UN2 A;  1JFU A;  2LRC A;  1QQ2 A;  1XWG A;  3EC3 A;  1O7U A;  4GST A;  4RI6 A;  1SKR B;  2JL4 A;  1QMV A;  2HSY A;  4PTS A;  1GNE A;  2OE0 A;  1GUK A;  3A2V A;  4GF0 A;  2OAD A;  5AIS A;  3TB2 A;  1TK0 B;  4PGT A;  6GSS A;  4DEJ A;  3M9J A;  3C73 A;  5D93 A;  4OFT A;  4PUF C;  3N5O A;  1ZOF A;  1AIU A;  3PH9 A;  4NPB A;  4TW5 A;  2V32 A;  1KTE A;  2DJ1 A;  4PUR A;  2C0D A;  5IM9 A;  3EUR A;  4H86 A;  1CQH A;  19GS A;  3KJY A;  4HQS A;  1Y6E A;  3TRQ A;  3UJ1 A;  1JZO A;  1GUL A;  1VF3 A;  2C0G A;  2GT5 A;  4EC0 A;  3IK9 A;  4CW9 A;  3GV1 A;  3RHC A;  4AKH A;  2O89 A;  3FZ4 A;  5DQS A;  4XS6 A;  2HSH A;  3FZ5 A;  3EU4 A;  5F8B A;  2YPM A;  3GTU A;  3DKS A;  3PR8 A;  2R2J A;  2DKH A;  1OC9 A;  1QGV A;  3IHQ A;  3TCO A;  5D9W A;  4EE0 A;  4GSS A;  2K8V A;  2GVP A;  2MMA A;  5DQY A;  5J4U A;  5DDL A;  4PQI A;  4NWY A;  4ML6 A;  4V2N A;  2H1B A;  4K5S A;  5ECR B;  2VL9 A;  2H0G A;  3OR5 A;  2EIO A;  2VLV A;  2CX4 A;  2VL2 A;  2YV9 A;  1W89 A;  3L4N A;  1ZMA A;  5DAK B;  2OE1 A;  4BVX A;  5A4W A;  4TR3 A;  4Z7X A;  2IME A;  4X0X A;  2JSY A;  2VOC A;  1G0T A;  2A2P A;  2BJX A;  2FNO A;  1ZGN A;  2WJU A;  2PVQ A;  3R3E A;  10GS A;  4HZ4 A;  2VM2 A;  1AXD A;  2E0Q A;  5CYY A;  5CRW A;  4EIQ A;  1OC8 A;  4ECJ A;  1XVQ A;  5BRT A;  2CV4 A;  1XW5 A;  2VCW A;  1T4Z A;  1ZYQ B;  1J0F A;  3IRA A;  3C1S A;  5H5R A;  2WFC A;  3LWA A;  1BG5 A;  3M1G A;  3HZ4 A;  1LJR A;  1T4Y A;  4MPF A;  1TU8 A;  1LBK A;  1EWX A;  3Q74 A;  2MZC A;  4JU5 A;  2GT6 A;  2R5G A;  1GH2 A;  2J9H A;  1B4P A;  4KAE A;  1TDI A;  4POK A;  1B8X A;  2FUG 2;  3CTG A;  5B8A A;  2YOI A;  2H70 A;  1ZYN A;  5AN1 A;  2YWI A;  4CHS A;  1MEK A;  3VWV A;  5AIV A;  1GSQ A;  3APO A;  1YKC A;  3KP9 A;  5IMF A;  2XC2 A;  2FLS A;  4LMW A;  4IHU A;  3ZL5 A;  4JRR A;  5ECP B;  1SD8 A;  1Q4J A;  4AJ8 A;  2FD3 A;  3C1R A;  4GQF A;  3LEF A;  2IMK A;  1DE1 A;  4ZBA A;  4F03 A;  2FHE A;  3QDN A;  5BMU B;  5J9C A;  2V41 A;  2OBK A;  3VFI A;  5IOX A;  4WXT A;  2VM1 A;  5J4V A;  2YCD A;  4G10 A;  4BVY A;  5FT3 A;  2IMF A;  5H5S A;  1HNB A;  4MP4 A;  2OAC A;  2HRK A;  3FHK A;  1TTZ A;  4KH7 A;  4WKW A;  5G5F A;  4LMV A;  2FA4 A;  1WP0 A;  2VD1 A;  2C3Q A;  1BED A;  1XW9 A;  3ED3 A;  2H19 A;  4HJ2 A;  2RLI A;  2AHE A;  2WRT A;  5H5Q A;  2A4V A;  4KCA A;  3GL3 A;  1PD2 1;  1YF0 A;  1TK8 B;  5DCG A;  1XIY A;  3TUE A;  2JU5 A;  3MYD A;  1FB0 A;  4ZIL A;  6GSV A;  2DBC A;  2RII A;  2VLU A;  1ZZY A;  3GKX A;  5D96 A;  4DSS B;  3MDK A;  1SK0 A;  2L5O A;  4ZBD A;  2H6X A;  5F0G A;  1BX9 A;  1K0M A;  11GS A;  2HFD A;  2H1G A;  3ZRD A;  1XW6 A;  1DE2 A;  4YQU A;  3KMO A;  3TKS A;  1GUM A;  2L6C A;  1EGO A;  4KE3 A;  4LL4 B;  4V2L A;  2HRA A;  1ERV A;  1S3D A;  3HKR A;  4K5R A;  2OE3 A;  2AAW A;  5D9X A;  4J2F A;  1TRS A;  4TR1 A;  1A2L A;  3HXS A;  4LLR A;  5EY6 A;  3GIX A;  1BYE A;  1GSU A;  4GCI A;  1HNA A;  1TU7 A;  3VUR A;  2CT6 A;  1K0A A;  3RPN A;  3WGX A;  1GSF A;  2FA8 A;  1M2A A;  2ES7 A;  5KN0 A;  3UEM A;  4KUN A;  2LUS A;  5IO2 A;  3GNJ A;  4XRA A;  4V2M A;  2EIR A;  2FWE A;  1OVN A;  3FZA A;  2CVB A;  2FWF A;  3C7M A;  4TVE A;  1TXU A;  3F4T A;  1XPV A;  1ZCP A;  4OWY A;  2DJ3 A;  3LW9 A;  1KNG A;  2IMD A;  1JHB A;  1XOA A;  1M0U A;  3D4T A;  3ZTL A;  1X9S B;  1C72 A;  2VCX A;  4I5Q A;  3UL3 A;  4GWR A;  2L4Q A;  1AAZ A;  4ML1 A;  3TDG A;  4ZB7 A;  1MDK A;  5E4W A;  2G2Q A;  1X0R A;  2B6M A;  1XWA A;  4GXZ A;  2HT9 A;  3IV4 A;  3A5W A;  1A8L A;  3VWU A;  2YP6 A;  1SVL A;  4A5P A;  2V6K A;  4KGI A;  5A1N A;  4F0C A;  4JR6 A;  4KSM A;  1MD3 A;  4L5O A;  3ZFB A;  4E68 A;  2DMM A;  3E0U A;  4TKY A;  5ECO B;  5A5H A;  1GWC A;  3CRU A;  3PIN A;  2GSS A;  2G0F A;  2F3M A;  2VCV A;  5AGY A;  1B4Q A;  1PQN A;  4K7O A;  2XBI A;  1G6Y A;  4O5U A;  3IPZ A;  1M7T A;  1GUH A;  4JZQ A;  4OCF A;  3GKN A;  5KN3 A;  2VO4 A;  4PQ1 A;  4J57 E;  18GS A;  3H8Q A;  2CAQ A;  2X99 A;  2GGT A;  5DVB A;  4ZL7 A;  3WGD A;  1ACV A;  4EUY A;  4XIH A;  2EFC A;  2L59 A;  5IO0 A;  1KEB A;  2X8C A;  4W66 A;  3IE3 A;  3R2Q A;  1SU9 A;  4AF2 A;  1SL2 B;  3DML A;  4K7I A;  3CSH A;  5ID2 B;  1LU4 A;  3VK9 A;  2H0H A;  1NSW A;  2N5F A;  3F8U A;  2RM5 A;  2H01 A;  5J5N A;  2EC4 A;  2KP2 A;  1GLQ A;  1OKT A;  3QPM A;  1XBS A;  3ZRE A;  1OC3 A;  5B8B A;  3V1W A;  3TKR A;  3E3E A;  4G0K A;  3P90 A;  3FKF A;  4MJB A;  3FRC A;  1XWB A;  3ZVJ A;  2ALB A;  5G30 A;  2IFQ B;  1URM A;  2LNS A;  5ECN B;  4CY6 A;  5C04 A;  3IOS A;  1AUC A;  4G0I A;  1V9W A;  3TOT A;  4N30 A;  2R0G A;  3KH9 A;  1TK5 B;  3APS A;  4TXO B;  4G2E A;  1G7O A;  3DVW A;  4P3Y B;  2PU9 C;  3F6F A;  4G9H A;  2B3S A;  3WGE A;  2MBS A;  4QQ7 A;  2N5B A;  1TJD A;  1GSY A;  2XPE A;  1RQM A;  1FB6 A;  3HDC A;  4IN0 A;  2O8V B;  2GST A;  5B6N A;  1K0N A;  4Q5R A;  4O32 A;  3IR4 A;  5A4V A;  2VUP A;  1YF1 A;  4XS4 B;  22GS A;  3GRX A;  3BCI A;  3KH7 A;  5DAL A;  3L0H A;  4DSS A;  2HRN A;  2LJK A;  3KIJ A;  4EVM A;  2KUC A;  3QMX A;  1MDJ A;  2WZ9 A;  3UAP A;  8GSS A;  4ULX A;  3IDV A;  3GFK A;  4KX4 A;  3HZ8 A;  3P8W A;  1QFN A;  3A5I A;  2C4J A;  2HSM B;  3QAW A;  4WF5 A;  3ZIJ A;  3HVX A;  5D73 A;  4K1F A;  4K2X A;  4TRX A;  5DJM A;  2I1U A;  2C1Y A;  5JCW A;  2NBS A;  3QR6 A;  2H76 A;  2HNL A;  2ZCT A;  3GUR A;  4YAV A;  3GKK A;  3M8N A;  4MF5 A;  5J40 A;  2LQO A;  2R37 A;  3G9B A;  4AJ7 A;  4NV2 A;  4FYC A;  2X4A A;  4IP6 A;  4PXO A;  4BA7 A;  4NAX A;  2K6V A;  1KBN A;  2OKA A;  3DWV A;  5IPH A;  1NHO A;  1VGL A;  3PPU A;  2CZ2 A;  4TN8 A;  3CYN A;  3WYW A;  1K0C A;  2YWN A;  3KXO A;  2YZU A;  5HFK A;  3MIX A;  4I6X A;  3WD6 A;  1HQO A;  3FR9 A;  3HY2 A;  4BPY A;  3P2A A;  1PN0 A;  2E7P A;  3J7Y k;  4KDX A;  4N0Z A;  1BAY A;  5AIX A;  3I9V 2;  1HD2 A;  4FIW A;  4JR4 A;  1JZD A;  4MMM A;  1PGT A;  1B9X C;  1YJ6 A;  3GH6 A;  4BL7 B;  5LNK e;  3LJR A;  2A2S A;  2ZUP A;  2VCZ A;  4EXJ A;  3E9J B;  4V1A p;  2IN3 A;  3RAZ A;  12GS A;  4GSN A;  4RQX A;  4E8H A;  2H71 A;  3CRT A;  3DVX A;  4EDY A;  3GST A;  5A34 A;  1A23 A;  1U3A A;  1A0F A;  2C3T A;  3GH9 A;  4MDC A;  3GHA A;  2YWM A;  2YWO A;  5HR3 A;  5CRG A;  2VIM A;  3JCM L;  2I9H A;  2H1L A;  1UVZ A;  5JWO B;  4KND A;  2TRX A;  2L57 A;  1SJZ A;  2JSZ A;  3HVS A;  3ZYW A;  2IL3 A;  2NPB A;  1PA3 A;  1JLW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...