4KX4A

Crystal structure of escherichia coli glutaredoxin 2 complex with glutathione
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
217
structure length
217
Chain Sequence
SAMKLYIYDHCPYCLKARMIFGLKNIPVELHVLLNDDAETPTRMVGQKQVPILQKDDSRYMPESMDIVHYVDKLDGKPLLTGKRSPAIDEWLRKVNGYANKLLLPRFAKSAFDEFSTPAARKYFVDKKEASAGNFADLLAHSDGLIKNISDDLRALDKLIVKPNAVNGELSEDDIQLFPLLRNLTLVAGINWPSRVADYRDNMAKQTQINLLSSMAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Glutaredoxin-2
publication title Crystal structures of E.coli glutaredoxin 2 with glutathione and of a mutant C9S/C12S without glutathione
rcsb
source organism Escherichia coli
total genus 82
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2013-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04399 Glutaredoxin2_C Glutaredoxin 2, C terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4kx4A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4kx4A01
3CSHA 1LJRA 3UARA 2CT6A 4FYUA 5IMCA 1HYUA 2KLXA 4F0CA 2UZ8A 4PX1A 1B4PA 2C3NA 2P5RA 1LU4A 1QGVA 4ZL9A 3W8JA 2MMNA 4GSNA 1WJKA 1GUKA 2ALBA 4XS1A 2MBSA 5J3RA 4PQIA 2GS3A 1SD9A 2NDOA 4ZB8A 3HD5A 2IIYA 2HSNB 4WBJA 2LEGA 1BG5A 4OMVA 4IVFA 2HSMB 3WT2A 3VK9A 1XWCA 4NXIA 4KDUA 1XVWA 2HZFA 1M0UA 1ERVA 3DRNA 3IXRA 3KP8A 3GSTA 4G19A 4E8HA 2B3SA 5FHIA 2LSTA 3A5WA 1ERWA 4FYCA 2YP6A 2K8VA 2I1UA 4V2LA 4QQ7A 4I2TA 3IA1A 5DALA 1WPIA 4K9ZA 4F03A 2YWIA 4RQRA 3GMFA 5ENUA 2GZZA 4TVEA 1Y25A 5ECKB 2FCHA 2ON7A 1OE8A 2REMA 6GSVA 2GQMA 4XRAA 3HHVA 1KTEA 1MDJA 14GSA 1Z6NA 2G0FA 1A23A 1K3YA 2RUEA 6GSSA 1R7HA 1TRSA 2XC2A 4L5OA 2VL2A 3F9UA 4HU9A 3QOUA 5COHA 1FO5A 3BJ5A 3FEUA 3KMOA 3WGEA 2FWEA 3I9V2 2OACA 2H6ZA 3HDCA 4G0IA 1O73A 2QKEA 16GSA 2WCIA 4I8BA 1JZOA 3PPUA 2E7PA 1XBSA 5EL8A 2BMXA 2K9FA 2XHFA 5ECPB 1OYJA 1B4QA 2MBTA 3APSA 3O3TA 4CHSA 1VRSD 4GSSA 1XVQA 5H5RA 1A8YA 3G7IA 4TR1B 4EXJA 1SENA 3RPNA 1YKAA 1V2AA 3H79A 3KH9A 2D2ZA 3HVXA 4ECCA 2MYGA 1GSDA 3V1WA 5CO3A 4BWQA 5IMAA 1AQXA 2A2RA 1U87A 2CA8A 5KN1A 1VF4A 1A0RP 5F06A 1Z3EA 1PX7A 1GSSA 1GRXA 5HFGA 4N0ZA 1SL0B 5EVOA 5ECSA 2E0QA 5ECLB 2NVLA 1ML6A 2V32A 2PU9C 3DKSA 1K0BA 3MAKA 4X43A 3TRPA 3GKXA 2OKAA 3APOA 5DCGA 1SK1A 1PX6A 1PA3A 2F9SA 3C1RA 3L9UA 2YZHA 2EIQA 5HFKA 1GSUA 4HJMA 4X1UA 3KIJA 3R2QA 3IAS2 2IJYA 5KEJA 1R26A 1F9MA 3D5JA 1M2BA 1TXXA 4USSA 2WB9A 2WZ9A 5IPGA 3GIXA 1OC9A 1PL1A 1H75A 2LRTA 1JZDA 3ZFLA 5CAXA 2R3XA 3KP9A 1JZWA 5HQPA 3BOAA 1N8JA 2A4VA 3A2VA 1LBKA 3UAPA 2L59A 2C0GA 2G2QA 1A2LA 2ZNMA 1AQWA 2KOKA 3CXGA 2B5EA 5IMZA 3LSZA 1HD2A 3LXZA 3EC3A 1BAYA 5IOXA 5G1LA 2VCQA 4N0VA 1JFUA 2H71A 3G7JA 3GSSA 3UOMA 3GKMA 2DJKA 3HJPA 1ZOFA 1TRVA 1PRXA 5KN3A 4TXOA 1TK0B 2CZ2A 3M3MA 3F4RA 3UBKA 1BYEA 4V1Ag 4PGTA 4MZCA 2HZEB 4TRXA 2WJUA 5ABRA 1AIUA 6GSWA 1PGTA 3FR3A 2H72A 2FWFA 4L5LA 2C0DA 5IIZA 1YEXA 3VPQA 2IMFA 4JRRA 5LCZA 4GCIA 4K2DA 3CSIA 2VL3A 2X8CA 1F37A 4ID0A 3ZMLA 1XW5A 4N30A 4FYBA 1VGLA 3HKRA 5F0GA 4EDYA 4O32A 1EWXA 2L57A 2YJ7A 3TJGA 4BVXB 1XIYA 1U88A 3I43A 4MJEA 4IBPA 1HQOA 1EV9A 4DSSB 3WYWA 1Q4JA 5ID2A 2DIYA 5C00A 1XXUA 3L9VA 4YAPA 1GULA 4MJAA 3VWWA 1XWAA 2YPMA 1B9XC 3CMIA 1HNBA 1BEDA 5D9TA 3ISOA 2XBQA 1FW1A 1CQGA 3LWAA 3QDNA 1O8WA 1PSQA 3C73A 3E0UA 1SD8A 2CX3A 5CRWA 4I97A 3FZ9A 1ZYQB 5HFIA 2JACA 4HI7A 5AN1A 3HZ8A 2OBIA 4JU5A 3C7MA 4TR3A 3CRUA 4DVCA 3IC8A 2NPBA 3F3RA 4FQUA 1SYXA 3FKFA 1S3AA 1EP7A 1XCCA 5IM9A 3QAGA 2H0GA 4FH8A 1FG4A 1YKCA 2JU5A 3D4TA 2IN3A 3IR4A 3FR9A 2MMOA 4PUAA 1GLQA 2WULA 3GX0A 2GT5A 3TOTA 3MDKA 1EEJA 2PN8A 3M9JA 2R5GA 1EV4A 5LNKe 2GQLA 3QAWA 3QCPA 4YQUA 3WGXA 1Z7PA 3TKSC 1I9DA 3KXOA 5L71A 2CVDA 3G9BA 1GP1A 3RAZA 2H1DA 4K8MA 3ME7A 2H1GA 1MEKA 5ELAA 3CTGA 3ZRDA 3MWHA 1X0RA 5A4WA 3KH7A 3QFAC 4J56E 4PNFA 2VM2A 2HNLA 3A2WA 4TW5A 2B6MA 1A2MA 5AGYA 2HRKB 1RQMA 3I6AA 2C0EA 4XRDA 4P3YB 3L4NA 3VFIA 1Y6EA 3DXBA 1PQNA 2CVKA 2X8GA 2DSAA 3LJRA 2VIMA 2PVOC 3HA9A 3RBTA 2L4QA 2VLTA 2OBKA 2C8UA 4HUAA 4PQHA 3IHQA 1GNEA 1JZRA 5J4UA 3TDGA 1T8EB 2HSMA 3KMNA 1V40A 1OVNA 4IN0A 2JSZA 2WDUA 4HZ4A 4OFMA 1UC7A 4KUNA 4ULXA 4I6XA 10GSA 1GLPA 1K3LA 3FY7A 5GAND 2OA7A 1TU7A 3ZZXA 4Q5RA 1MDKA 4LMWA 4IKHA 1BQ7A 4V2NA 2R4VA 4XCSA 1EP8A 1ZL9A 4ZBDA 4ZXGA 2N5BA 2B7JA 1A24A 2DJJA 4KAEA 2PGTA 2PMTA 4O5RA 5DJLA 1YJ6A 4G10A 2CAQA 5AIVA 4RI7A 3TJKA 2GSTA 5DBQA 4F0BA 1TOFA 4KDYA 2L5LA 4MH2A 2H30A 3M8NA 4YH2A 1WRYA 1J9BA 2H70A 1IYHA 4N10A 3ZMKA 4OO4A 2IMKA 3ZITA 4BL7B 2YZUA 2YV9A 3FZ4A 2C0FA 3PGTA 1GUHA 1OE7A 3D0ZA 2YN1A 4EDZA 2LQOA 2FD3A 1X9WB 1XW6A 3LFLA 4MZWA 1RW1A 1F6MC 4EF0A 2H6XA 5IPHA 1VF2A 1GSYA 1THOA 4I5QA 3BCIA 2GGTA 4KB3A 2E2MA 3DMLA 4NV5A 4IGJA 4TR1A 3EINA 1GTIA 3EE2A 1H4OA 3L0HA 5J9BA 3RDWA 2I9HA 1EZKA 17GSA 1YZXA 1VF1A 2K18A 1GTBA 1QQ2A 1TK5B 2JL4A 1JLVA 1ZZYA 3EMXA 2R37A 4X0XA 2HYXA 2M46A 1FHEA 3VLNA 3QFBC 2C80A 3UBLA 5ECIB 4ML6A 4NMUA 1ZCPA 3DVWA 3TKQA 4ACSA 3J7Yb 1CQHA 1M99A 5ECHB 2YWNA 3EWLA 2IPAA 1QXHA 3FRCA 2O89A 3TRXA 3A3TA 2Z9SA 3DWVA 4ISDA 5DVBA 4MJCA 2N5FA 4YQMA 4ZL7A 1OKDA 4GQFA 3GH9A 4KF9A 20GSA 3F4SA 3FW2A 3IRAA 3MNGA 4MJBA 3HVSA 1AQVA 1PN9A 5CREA 2HRAA 3GV1A 5C04A 3GKNA 1EGOA 1URMA 4AF2A 2V41A 2VCVA 2FHEA 3N5OA 2VLVA 1TK8B 3D22A 2LRCA 1GTUA 4HU7A 1AC1A 1X9SB 3HJMA 5D9XA 2MZCA 2JZSA 2VL2C 3CYNA 2VCWA 12GSA 4MDCA 2JADA 1THXA 2ZCTA 3Q18A 1DBYA 4MF7A 4N11A 4HOJA 2B7KA 3DEXA 4AGSA 2WFCA 2YNXA 2LNSA 2LV3A 2HZEA 3UJ1A 2LS5A 2RUFA 3RPPA 2VD0A 2L4CA 4BVYB 1YF0A 2TIRA 1GL8A 2YOIA 5CRHA 11GSA 5A5KA 3KCMA 5EY6A 4EL1A 1QUWA 4LA1A 1EGRA 4BWSA 1YEPA 2VCZA 4JEDA 1K0OA 2P5QA 2GZYA 3F63A 4G0KA 4ILFA 4PTSA 1R5PA 2R6KA 3IK9A 4XHMA 1A0FA 3QAVA 4PNGA 3UL3A 4IJIA 1S3CA 2XBIA 3TJBA 4Q5NA 4F2IA 2PBJA 4LL1B 4MK3A 5ECOB 4XS4B 4BVXA 3UMAA 5B8BA 4IP6A 5J9CA 1GH2A 4IJ3A 2F8FA 3I69A 1A2JA 3GX8A 4DSSA 4IQ1A 5G31A 4D73B 4KSMA 1GSFA 5DQYA 2H1BA 4K0GA 1UN2A 1GUMA 1B48A 4HZ2A 4NV2A 3M1GA 3ZLPA 5H5QA 4OD7A 5D9WA 4WEYA 4ZBBA 5INYA 1TRWA 3ERWA 1MD4A 4K1FA 3LQ7A 2J23A 2OJLA 4ZB9A 2L6CA 3NOFA 3DIEA 3TUEA 3GA4A 1X5DA 1USBA 5F8BA 1PL2A 2H8LA 3FK8A 2IMEA 4MLYA 4ZBAA 5IMFA 3KEBA 4WBRD 5CRGA 3UIWA 1YY7A 4WR5A 3VI7A 1U3IA 1OC8A 1YDKA 4PXOA 2GSRA 1WP0A 1PMTA 4Z7XA 2VCXA 1WWJA 3LEFA 2DMLA 2VAFA 3GKKA 3P8WA 5JCUA 3BCKA 4MF6A 4O92A 3ZL5A 2X99A 3HY2A 2LUSA 3UVHA 1QK8A 2CX4A 2EC4A 3D4MA 2LJKA 4IHUA 4GWRA 3J7Yk 4HS1A 2GZPA 3ZIJA 2H76A 2BJXA 1UA5A 4OFTA 13GSA 4AJ8A 4XTSA 3Q6OA 1O85A 2H75A 1V9WA 2HSYA 4KCEA 4CDOA 3GH6A 4MF5A 4WF4A 2DIZA 2CAIA 1B8XA 1U3AA 1SKSB 1Z5YE 2E2GA 3D6IA 1SU9A 2YANA 4KGIA 4TR4A 4POMA 3FZAA 2V6OA 2TRXA 3EMPA 4HJ2A 5A4UA 2IFQB 2HRKA 4AJ7A 2C1YA 2YWOA 2TRCP 2ES7A 2VLUA 1GTAA 3UEMA 6GSYA 3LGCA 3KM6A 1GSQA 2LQQA 4K6XA 3O6TA 5G1KA 4K7NA 1YF1A 1K0DA 1V58A 2LRNA 3GHAA 3SBCA 1T4YA 4TOPA 5DAKB 2RIIA 3WGDA 1DSBA 2WRTA 1K0MA 5F07A 1TRUA 5JWOB 2GTUA 2LJRA 2JZTA 2HI7A 2FA4A 5IO2A 3FZ5A 3AY8A 3W6GA 3GTUA 3IC4A 3ERFA 3LYKA 4FO5A 5B6MA 1E2YA 1SKRB 1S3DA 1NM3A 2DJ3A 1MTCA 1XWGA 5AISA 2B5XA 5LD0A 5KN2A 1F2EA 4F82A 2VOCA 1YQ1A 8GSSA 1O8XA 4LL4B 2KP2A 3VPTA 1BX9A 1T4ZA 5E59A 3L9SA 2GLRA 5DDLA 2CQ9A 3ZTLA 2PERA 3C71A 5DQSA 2H01A 3F8UA 3KGKA 5GZZB 3ERGA 4DEJA 1FB0A 2B1KA 2HLSA 2OADA 2QGVA 4TN8A 1VF3A 2FWGA 4WKWA 1ZGNA 1AUCA 3VWXA 3KJYA 1JLWA 1G6WA 2JZRA 4EE0A 4EO3A 5G2ZA 4ZILA 4EC0A 1UVZA 1F3BA 4KA0A 2DC5A 2AJQB 2F8AA 4ECJA 3OR5A 4JR4A 1KEBA 3ZFBA 4KCAA 1XZOA 5HR3A 4BL7A 2NBSA 1TDIA 4WF5A 2GSSA 4OFNA 3TKRA 3NIVA 4WETA 4GLTA 3RHBA 1GNWA 4HQSA 1SYRA 1FB6A 1NSWA 3GTUB 4JR6A 3TKPA 2OE3A 5GSSA 2YWMA 1K0CA 1Z9HA 2IL3A 3WT1A 3M9KA 2HRNA 4F9ZA 2FNOA 1GWCA 2VCTA 2H0HA 2FY6A 2YV7A 4QL7A 4MA9A 2FLSA 3DYRA 3P90A 2MMZA 2EIRA 5J5NA 2M72A 1X5CA 6GSTA 1MDIA 3CRTA 5F05A 2DJ2A 1W89A 2IWTA 4ML1A 3QPMA 1K0AA 1T1VA 5B6NA 3GN3A 3C1SA 2GT6A 5HR2A 1M2DA 5HR0A 3IK7A 4YQVA 5GSTA 3BD2A 4Q5QA 2AV4A 3GL5A 2NTOA 2L6DA 4WXTA 1J08A 1O6JA 6GSXA 2RM5A 2K6VA 5AIXA 4MZBA 3H4KA 3E3EA 1T00A 3IAM2 5B7CA 5G5EA 2J9HA 4K0NA 4POKA 1TW9A 3KD0A 2LKUA 1V57A 3R3EA 1NHYA 3ZYWA 3HVVA 3K8NA 4FIWA 4EVMA 2H66A 4HDEA 2C3TA 4IP1A 4POBA 3KZQA 5ECRB 1SJ6A 4ECIA 1DE2A 4TKYA 1M9AA 5D93A 3HXSA 4RUVA 4NHZA 3F0IA 4O7HA 2VL9A 1RK4A 2FUG2 3W8SA 3F4TA 4QL9A 1K0NA 1WIKA 3QD9A 4V1Ap 4JZQA 1R5AA 1SJIA 5ECMB 3PH9A 3JCML 3PR8A 3BBYA 3GURA 4PURA 1J0FA 2A2SA 2OE1A 3CBUA 2N5AA 2HE3A 1ERTA 4G9HA 1XOAA 2LTKA 5ECNB 4OCEA 3TB2A 3VURA 4MP4A 1M7TA 4KX4A 4OCFA 1ZMAA 2H74A 2O87A 3MSZA 1FVJA 1PKZA 2PPTA 1O7UA 4BVYA 3VWVA 1TI1A 4RQXA 2IMIA 3CTFA 3DVXA 3GUSA 3KTBA 1NHOA 3NZNA 3EVIA 3TJJA 18GSA 1Z7RA 2VO4A 4PUFC 2JSYA 3N9JA 2AB6A 3SWLA 2O85A 2ON5A 1ACVA 4IQAA 3EURA 1G0TA 5FWGA 1O81A 3GRXA 2CV4A 1ZYEA 1AW9A 4AJ6A 3ZVJD 4GXZA 5IMDA 3FR6A 22GSA 4XS4A 4KE3A 4H86A 4NHWA 2IMDA 4DSQA 4D73A 4WR4A 3RHCA 3P7XA 2DLXA 4I2UA 2WGRA 5DALB 3EU3A 3GL3A 5ECQB 4L8EA 4KSOA 2RLIA 3C8EA 2OE0A 4E8EA 3CSJA 4TXVA 1XOBA 4IW9A 2X8HA 4EUYA 2WS2A 4J2FA 1FAAA 2DJ0A 4MABA 1U6TA 2XPDA 1Q98A 2R2JA 5HR1A 2AHEA 5B8AA 2P0GA 3E9JB 1ST9A 5DCHA 2DBCA 4MPGA 5CP1A 3TGZA 4TR0A 5KN0A 2PUKC 4MPFA 4V2MA 1G7EA 1G6YA 5J41A 3UVTA 4BPYA 1W4VA 4IS0A 1ABAA 3ME8A 4NAXA 1Z6MA 2O7KA 1DE1A 2DMMA 2X64A 1SL2B 2C3QA 1SL1B 1T7PB 4GF0A 3TJFA 2L5OA 3ZREA 4BA7A 3TOUA 1NW2A 4ZIJA 5JCWA 1N2AA 4CW9A 1X5EA 1KBNA 3FHKA 2IFQA 2I4AA 4GQCA 3G7YA 1MD3A 4J57E 2XPEA 3Q74A 3IV4A 3HCZA 1C72A 4JBBA 4L0WA 3HYPA 4JE1A 2LNTA 4KW6A 5EPFA 3U5RE 1SK2A 2H73A 1AAZA 4LMVA 3M0FA 1X9MB 1JHBA 2HXKA 4ECBA 2H1AA 1EOHA 3F6FA 1OAZA 3P2AA 3LYPA 3IBHA 5DAKA 1KNGA 2HSHA 2CZ3A 4GTUA 4HEA2 2FWHA 3US3A 2YCDA 1OC9B 3F3QA 19GSA 3DD3A 1EEMA 1ERUA 5IOWA 4KNDA 3H93A 4HQZA 1TJDA 1QMVA 3Q19A 1A8LA 4EKZA 1DUGA 2DJ1A 2O8VB 3EYTA 4GSTA 4KDXA 1F3AA 2H19A 4XIHA 3LORA 1B9YC 2HFDA 3L78A 3KTLA 1QFNA 4ZL8A 5ELGA 3ZVJA 2I3YA 5G30A 3TRQA 2KP1A 4TXOB 5E4WA 2PVQA 3WD6A 4NWYA 4PQ1A 3TKSA 3GFKA 4KH7A 3ZIVA 3F6DA 1TP9A 5G5FA 2B5YA 2QSIA 5CRDA 5BMUA 2RM6A 5IQYA 3GNJA 3QMXA 2M80A 1HNAA 2GQKA 1ILOA 2P31A 4IELA 2YJHA 2AYTA 3ED3A 1WE0A 3EU4A 2FGXA 2V6KA 2AUVA 4NPBA 3LG6A 2H6YA 5JWQB 2HT9A 5CNWA 4XS6A 2GSQA 2QC7A 2F51A 3IPZA 2V1MA 4OO5A 1AXDA 1FVKA 3IE3A 1XWKA 5D73A 2B1LA 5CYYA 2PWJA 1OKTA 7GSSA 5FT3A 2VD1A 1XW9A 2MMAA 5ID2B 3APQA 1IYIA 4GRFA 1V98A 3H8QA 4YAVA 1XFLA 1FOVA 2GVPA 2F3MA 2LJAA 1G7OA 2VM1A 6GSUA 2V2GA 1M9BA 3GYKA 1TKDB 4L0UA 4MMMA 2AAWA 4MCUA 3D21A 1M2AA 4POLA 1R4WA 2HRFA 3QR6A 1WMJA 3IDVA 1XPVA 4MH3A 2KUCA 1HNCA 2KHPA 1PD21 2VUPA 1ON4A 1EOGA 4ZB6A 1SK0A 2H0IA 4Q5FA 3DGQA 1K3OA 3HZ4A 4G2EA 3HJOA 2I81A 1TU8A 3A2XA 5D9VA 2EIOA 4G0LA 1SJZA 2FA8A 3PINA 5GAPD 4OWYA 3FYGA 2C4JA 3VWUA 1BJXA 3U6VA 1PKWA 9GSSA 5D96A 4LLRA 5H5SA 1T3BA 5IMVA 3LXTA 5D8IA 3TCOA 3O76A 2K8SA 5IO0A 2ZUPA 1TI3A 4K7OA 4K7IA 3H1NA 1SKWB 2CVBA 1WOUA 3TKSE 1TTZA 1XWBA 4RI6A 1OC3A 1E6BA 3S9FA 4DSRA 1I5GA 5JWRB 5A4VA 5JCGA 2GDRA 3VI5A 2HQTA 1GSEA 2BTOT 3IOSA 5DJMA
chains in the Genus database with same CATH superfamily
3CSHA 1LJRA 3UARA 2CT6A 4FYUA 5IMCA 1HYUA 2KLXA 4F0CA 2UZ8A 4PX1A 1B4PA 2C3NA 2P5RA 1LU4A 1QGVA 4ZL9A 3W8JA 1SVMA 2MMNA 4GSNA 1WJKA 1GUKA 2ALBA 4XS1A 2MBSA 5J3RA 4PQIA 2GS3A 1SD9A 2NDOA 4ZB8A 3HD5A 1BF5A 2HSNB 2IIYA 4WBJA 2LEGA 1BG5A 4OMVA 4IVFA 2HSMB 3WT2A 3VK9A 1XWCA 4NXIA 4KDUA 1XVWA 2HZFA 1M0UA 1ERVA 3DRNA 3IXRA 3KP8A 3GSTA 4G19A 4E8HA 2B3SA 5FHIA 2LSTA 3A5WA 1ERWA 4FYCA 2YP6A 2K8VA 2O5VA 5J4YA 2I1UA 4V2LA 4QQ7A 4I2TA 3IA1A 5DALA 1WPIA 4K9ZA 4F03A 2YWIA 4RQRA 3GMFA 5ENUA 2GZZA 4TVEA 1Y25A 5ECKB 2FCHA 2ON7A 1OE8A 2REMA 6GSVA 2GQMA 4XRAA 3HHVA 1KTEA 1MDJA 1S3RA 2EFDA 4PI0C 4Z2TA 14GSA 1Z6NA 1FOHA 2G0FA 1A23A 1K3YA 2RUEA 6GSSA 1R7HA 1TRSA 2XC2A 4L5OA 2VL2A 3F9UA 4HU9A 3QOUA 5COHA 1FO5A 3BJ5A 3FEUA 3KMOA 3WGEA 2FWEA 3I9V2 2OACA 2H6ZA 3HDCA 4O5UA 4G0IA 1O73A 2QKEA 16GSA 2QA1A 2WCIA 4X4JA 4I8BA 1JZOA 3PPUA 2E7PA 1XBSA 5EL8A 2BMXA 2K9FA 2XHFA 5ECPB 1OYJA 1B4QA 2MBTA 3APSA 3O3TA 4CHSA 1VRSD 4GSSA 1XVQA 5H5RA 1A8YA 3G7IA 4TR1B 4EXJA 1SENA 3RPNA 1YKAA 1V2AA 3H79A 4BIKA 3KH9A 2D2ZA 3HVXA 3HMJG 4ECCA 2MYGA 1GSDA 3V1WA 5CO3A 4BWQA 4K2XA 5IMAA 1AQXA 2A2RA 1U87A 2CA8A 5KN1A 1VF4A 1A0RP 5F06A 1Z3EA 1PX7A 1GSSA 1GRXA 5HFGA 4N0ZA 1SL0B 5EVOA 5ECSA 2E0QA 5ECLB 2NVLA 1ML6A 2V32A 2PU9C 3A5IA 3DKSA 1K0BA 3MAKA 4G01A 4X43A 3TRPA 3GKXA 2OKAA 3APOA 5DCGA 1SK1A 1PX6A 1PA3A 2F9SA 3C1RA 3L9UA 2YZHA 2EIQA 5HFKA 1GSUA 4HJMA 4X1UA 3KIJA 3R2QA 3IAS2 2IJYA 5KEJA 1R26A 1F9MA 3D5JA 1M2BA 1TXXA 3TU3B 4USSA 2WB9A 2WZ9A 5A34B 5IPGA 3GIXA 1OC9A 1PL1A 1H75A 2LRTA 1JZDA 3ZFLA 5CAXA 2R3XA 3KP9A 1JZWA 5HQPA 3BOAA 1N8JA 2A4VA 3A2VA 1LBKA 3UAPA 2L59A 2C0GA 2G2QA 4Z2UA 1A2LA 2ZNMA 1AQWA 2KOKA 3CXGA 2B5EA 5IMZA 3LSZA 1HD2A 3LXZA 3EC3A 1BAYA 5IOXA 5G1LA 2VCQA 4N0VA 1JFUA 2H71A 2OT3A 3G7JA 3GSSA 3UOMA 4AKGA 3GKMA 2DJKA 3HJPA 1ZOFA 1TRVA 1PRXA 3FMWA 5KN3A 4TXOA 1TK0B 2CZ2A 4K5RA 3M3MA 3F4RA 3UBKA 1BYEA 4V1Ag 4PGTA 4MZCA 2HZEB 1PFOA 2WJUA 4TRXA 5ABRA 1AIUA 6GSWA 1PGTA 3FR3A 2H72A 2FWFA 3IHGA 4L5LA 2C0DA 5IIZA 1YEXA 3VPQA 2IMFA 4JRRA 5LCZA 4GCIA 3CSIA 2VL3A 4K2DA 2X8CA 1F37A 4ID0A 3ZMLA 1XW5A 4N30A 4FYBA 1VGLA 3HKRA 5F0GA 4EDYA 4O32A 1EWXA 2L57A 2YJ7A 3TJGA 4BVXB 1XIYA 1U88A 3I43A 4MJEA 4IBPA 1HQOA 1EV9A 4DSSB 3WYWA 1Q4JA 5ID2A 2DIYA 5C00A 1XXUA 3L9VA 4YAPA 1GULA 4MJAA 4QMKA 3VWWA 1XWAA 2YPMA 1B9XC 3CMIA 1HNBA 1BEDA 5D9TA 3ISOA 2XBQA 1FW1A 1CQGA 3LWAA 3QDNA 1O8WA 1PSQA 3C73A 3E0UA 1SD8A 4ZB7A 2CX3A 5CRWA 4I97A 3FZ9A 1ZYQB 5HFIA 2JACA 4HI7A 5AN1A 3HZ8A 2OBIA 4JU5A 3C7MA 4TR3A 3CRUA 4DVCA 3IC8A 2NPBA 3F3RA 4FQUA 1SYXA 3FKFA 1S3AA 1EP7A 1XCCA 5IM9A 3QAGA 2H0GA 4FH8A 1FG4A 1YKCA 2JU5A 3D4TA 2IN3A 3IR4A 3FR9A 2MMOA 4PUAA 1GLQA 2WULA 5A1NA 3GX0A 2GT5A 3TOTA 3MDKA 1EEJA 2PN8A 3M9JA 2R5GA 1EV4A 5LNKe 2GQLA 3QAWA 3QCPA 4YQUA 3WGXA 1Z7PA 3TKSC 1I9DA 3KXOA 5L71A 2CVDA 3G9BA 1TXUA 1GP1A 2WVZA 3MIXA 3RAZA 2H1DA 4K8MA 3ME7A 2H1GA 1MEKA 5ELAA 3CTGA 3ZRDA 3MWHA 1X0RA 5A4WA 3KH7A 3QFAC 4J56E 4PNFA 5J40A 2VM2A 2HNLA 3A2WA 4TW5A 2B6MA 1A2MA 2WW1A 5AGYA 2HRKB 1RQMA 4EIQA 3I6AA 2C0EA 4XRDA 4P3YB 3L4NA 3VFIA 1Y6EA 3DXBA 1PQNA 2CVKA 2X8GA 4YKGA 2DSAA 3LJRA 2VIMA 4W66A 2PVOC 3HA9A 3RBTA 2L4QA 2VLTA 2OBKA 2C8UA 4HUAA 1SVLA 4PQHA 3IHQA 1GNEA 1JZRA 5J4UA 2HSNA 3TDGA 1T8EB 2HSMA 3KMNA 1V40A 1OVNA 4IN0A 1I1IP 2JSZA 2WDUA 4HZ4A 4OFMA 1UC7A 4KUNA 4ULXA 4I6XA 10GSA 1GLPA 4K5SA 1K3LA 3FY7A 5GAND 2OA7A 1TU7A 2A2PA 3ZZXA 4Q5RA 1MDKA 4LMWA 4IKHA 1BQ7A 4V2NA 2R4VA 4XCSA 1EP8A 1ZL9A 4ZBDA 4ZXGA 2N5BA 2B7JA 1A24A 2DJJA 4KAEA 2PGTA 2PMTA 4O5RA 5DJLA 1YJ6A 4G10A 2CAQA 5AIVA 4RI7A 3TJKA 2GSTA 5DBQA 4F0BA 1TOFA 4KDYA 2L5LA 4MH2A 2H30A 3M8NA 4YH2A 1WRYA 1J9BA 2H70A 1IYHA 4N10A 3ZMKA 4OO4A 2IMKA 3ZITA 4BL7B 2YZUA 2YV9A 3FZ4A 2C0FA 3PGTA 1GUHA 1OE7A 3D0ZA 2YN1A 4EDZA 2LQOA 2FD3A 1X9WB 1XW6A 3LFLA 4MZWA 1RW1A 1F6MC 4EF0A 2H6XA 5IPHA 1VF2A 2EFCA 1GSYA 1THOA 4I5QA 3BCIA 2GGTA 4KB3A 2E2MA 3DMLA 4NV5A 4IGJA 4TR1A 3EINA 1GTIA 3EE2A 1H4OA 3L0HA 5J9BA 1ZYPA 3RDWA 2I9HA 1EZKA 17GSA 1YZXA 1VF1A 2K18A 1GTBA 4AKXB 1QQ2A 2R0PA 1TK5B 2JL4A 1JLVA 4CY8A 1ZZYA 3EMXA 2R37A 4X0XA 2HYXA 2M46A 1FHEA 3VLNA 3QFBC 2C80A 3UBLA 2DKIA 1YEWC 5ECIB 4ML6A 4NMUA 1ZCPA 3DVWA 4E68A 3TKQA 4ACSA 3J7Yb 1CQHA 4CY6A 1M99A 5ECHB 2YWNA 3EWLA 2IPAA 1QXHA 3FRCA 2O89A 3TRXA 3A3TA 2Z9SA 3DWVA 4ISDA 5DVBA 4MJCA 2N5FA 4YQMA 4ZL7A 1OKDA 4GQFA 3GH9A 4KF9A 20GSA 3F4SA 3FW2A 3IRAA 3MNGA 4MJBA 3HVSA 1AQVA 1PN9A 5CREA 2HRAA 3GV1A 5A34A 5C04A 3GKNA 1EGOA 1URMA 4O5QA 4AF2A 2V41A 2VCVA 2FHEA 3N5OA 2VLVA 4AI6A 1TK8B 3D22A 2LRCA 1GTUA 4HU7A 1AC1A 2X4AA 1X9SB 3HJMA 5D9XA 2MZCA 2JZSA 2VL2C 3CYNA 2WZSA 2VCWA 12GSA 4MDCA 2JADA 1THXA 2ZCTA 4PI2C 3Q18A 1DBYA 4MF7A 5A5HB 4N11A 4HOJA 2B7KA 3DEXA 4AGSA 2WFCA 2YNXA 2LNSA 2LV3A 2HZEA 3UJ1A 2LS5A 2RUFA 3RPPA 2VD0A 2L4CA 4BVYB 1YF0A 2TIRA 1GL8A 2YOIA 5CRHA 11GSA 5A5KA 2H1LA 3KCMA 5EY6A 4EL1A 1QUWA 4LA1A 1EGRA 4BWSA 1YEPA 2VCZA 4JEDA 1K0OA 2P5QA 2GZYA 3F63A 4G0KA 4ILFA 4PTSA 1R5PA 2R6KA 3IK9A 4XHMA 1A0FA 3QAVA 4PNGA 3UL3A 4IJIA 1S3CA 2XBIA 3TJBA 4Q5NA 4F2IA 2PBJA 4LL1B 4MK3A 5ECOB 4XS4B 4HSCX 4BVXA 3UMAA 5B8BA 4IP6A 5J9CA 1GH2A 4IJ3A 2F8FA 3I69A 1A2JA 3GX8A 4DSSA 4IQ1A 5G31A 4D73B 4KSMA 1GSFA 5DQYA 2H1BA 4K0GA 1UN2A 1GUMA 1B48A 4HZ2A 4NV2A 3M1GA 3ZLPA 5H5QA 4OD7A 5D9WA 4WEYA 4ZBBA 5INYA 1TRWA 3ERWA 1MD4A 4K1FA 3LQ7A 2J23A 2OJLA 4ZB9A 2L6CA 3NOFA 3DIEA 3TUEA 3GA4A 1X5DA 1USBA 5F8BA 1PL2A 2H8LA 3FK8A 3LW9A 2IMEA 4MLYA 4ZBAA 5IMFA 3KEBA 4WBRD 5CRGA 3UIWA 1YY7A 5KOXA 4WR5A 3VI7A 1U3IA 1OC8A 1YDKA 4PXOA 2EFHA 2GSRA 1WP0A 1PMTA 4Z7XA 2VCXA 1WWJA 3LEFA 2DMLA 2VAFA 3GKKA 3P8WA 5JCUA 3BCKA 4MF6A 4O92A 3ZL5A 2WVYA 2X99A 3HY2A 2LUSA 3UVHA 1QK8A 2CX4A 2EC4A 3D4MA 2LJKA 4IHUA 4GWRA 3J7Yk 4HS1A 2GZPA 3ZIJA 2H76A 2BJXA 1UA5A 4OFTA 13GSA 4AJ8A 4XTSA 3Q6OA 1O85A 2H75A 1V9WA 2HSYA 4KCEA 4CDOA 3GH6A 4MF5A 4WF4A 2DIZA 2CAIA 1B8XA 1U3AA 1SKSB 1Z5YE 2E2GA 3D6IA 1SU9A 2YANA 4KGIA 4TR4A 5J47A 4POMA 3FZAA 2V6OA 2TRXA 3EMPA 4HJ2A 5A4UA 2IFQB 2HRKA 4AJ7A 2C1YA 2YWOA 2WW2A 2TRCP 2ES7A 2VLUA 1GTAA 3UEMA 6GSYA 3LGCA 3KM6A 1GSQA 2LQQA 4K6XA 3O6TA 5G1KA 4K7NA 1YF1A 1K0DA 1V58A 2LRNA 3GHAA 1M3IA 3SBCA 1T4YA 4TOPA 5DAKB 2RIIA 3WGDA 1DSBA 2WRTA 1K0MA 5F07A 1TRUA 5JWOB 2GTUA 2LJRA 2JZTA 2HI7A 2FA4A 5IO2A 3FZ5A 3AY8A 3W6GA 3GTUA 3IC4A 3ERFA 3LYKA 4FO5A 5B6MA 1E2YA 1YVLA 1SKRB 1S3DA 1NM3A 2DJ3A 1MTCA 1XWGA 4GDFA 5AISA 2B5XA 5LD0A 5KN2A 1F2EA 4F82A 2VOCA 1YQ1A 8GSSA 1O8XA 4LL4B 2KP2A 3VPTA 1BX9A 1T4ZA 5E59A 3L9SA 2GLRA 5DDLA 2CQ9A 3ZTLA 2PERA 3C71A 5DQSA 2H01A 3F8UA 3KGKA 5GZZB 3ERGA 4DEJA 1FB0A 2B1KA 2HLSA 2OADA 2WVXB 2QGVA 4TN8A 1VF3A 2FWGA 4WKWA 1ZGNA 1AUCA 3VWXA 3KJYA 1JLWA 1G6WA 2JZRA 4EE0A 4EO3A 5G2ZA 4ZILA 4EC0A 1UVZA 1F3BA 4KA0A 2DC5A 2AJQB 2F8AA 4ECJA 3OR5A 5BMUB 4JR4A 1KEBA 3ZFBA 4KCAA 1XZOA 5HR3A 4BL7A 2NBSA 1TDIA 4WF5A 2GSSA 4OFNA 2VKZG 3TKRA 3NIVA 4WETA 4GLTA 3RHBA 1GNWA 4HQSA 1SYRA 1FB6A 1NSWA 3GTUB 4JR6A 3TKPA 2OE3A 5GSSA 2YWMA 1K0CA 1Z9HA 2IL3A 3WT1A 3M9KA 2HRNA 4F9ZA 2FNOA 1GWCA 2VCTA 2H0HA 2FY6A 2YV7A 4QL7A 4MA9A 2FLSA 4MNNA 3DYRA 3P90A 2MMZA 2EIRA 5J5NA 2M72A 1X5CA 6GSTA 2EFEA 1MDIA 3CRTA 5F05A 2DJ2A 1W89A 2IWTA 4ML1A 3QPMA 1K0AA 1T1VA 5B6NA 3GN3A 3C1SA 2GT6A 5HR2A 1M2DA 5HR0A 3IK7A 4YQVA 5GSTA 3BD2A 4Q5QA 2AV4A 3GL5A 2NTOA 2L6DA 4WXTA 1J08A 1O6JA 6GSXA 2RM5A 2K6VA 5AIXA 4MZBA 3H4KA 3E3EA 1T00A 3IAM2 5B7CA 5G5EA 2J9HA 4K0NA 3CQFA 4POKA 1TW9A 3KD0A 2LKUA 1V57A 3R3EA 1NHYA 3ZYWA 3HVVA 3K8NA 4FIWA 4EVMA 2H66A 4HDEA 2C3TA 4IP1A 4POBA 3KZQA 5ECRB 1SJ6A 4ECIA 1DE2A 4TKYA 1M9AA 3MYDA 5D93A 3HXSA 4RUVA 2X49A 4NHZA 3F0IA 4O7HA 2VL9A 1RK4A 1BG1A 2FUG2 3W8SA 3F4TA 4QL9A 1K0NA 1WIKA 3QD9A 4V1Ap 4JZQA 1R5AA 1SJIA 5ECMB 3PH9A 4PHZC 3JCML 3PR8A 3BBYA 3GURA 5A5HA 4PURA 1J0FA 2A2SA 2OE1A 3CBUA 2N5AA 2HE3A 1ERTA 4G9HA 2O36A 1XOAA 2LTKA 5ECNB 4OCEA 3TB2A 3VURA 5BRTA 4MP4A 1M7TA 4KX4A 4OCFA 1ZMAA 2H74A 2O87A 3MSZA 1FVJA 1PKZA 2PPTA 1O7UA 1Y1UA 4BVYA 1TI1A 3VWVA 4RQXA 2IMIA 3CTFA 3DVXA 3GUSA 3KTBA 1NHOA 3NZNA 3EVIA 3TJJA 18GSA 1Z7RA 2VO4A 4PUFC 2JSYA 3N9JA 2AB6A 3SWLA 2O85A 2ON5A 1ACVA 4IQAA 3EURA 1G0TA 5FWGA 1O81A 3GRXA 2CV4A 1ZYEA 1AW9A 4AJ6A 3ZVJD 4GXZA 5IMDA 3FR6A 22GSA 4XS4A 1PN0A 4KE3A 4H86A 4NHWA 2IMDA 4DSQA 4D73A 2A4HA 4WR4A 3RHCA 3P7XA 3HVNA 2DLXA 4I2UA 2WGRA 5DALB 3EU3A 3GL3A 5ECQB 2WW3A 4L8EA 4KSOA 2RLIA 3C8EA 2OE0A 4E8EA 3CSJA 4TXVA 1XOBA 4IW9A 2X8HA 4EUYA 2WS2A 4J2FA 1FAAA 2DJ0A 4MABA 1U6TA 2XPDA 1Q98A 2R2JA 5HR1A 2AHEA 4AKIA 5B8AA 2P0GA 3E9JB 1ST9A 5DCHA 2DBCA 4MPGA 5CP1A 3TGZA 4TR0A 5KN0A 2PUKC 4MPFA 4V2MA 1G7EA 1G6YA 5J41A 3UVTA 4BPYA 1W4VA 4IS0A 1ABAA 3ME8A 4NAXA 1Z6MA 1XG8A 2O7KA 1DE1A 2DMMA 2QA2A 2X64A 1SL2B 2C3QA 1SL1B 1T7PB 4GF0A 3TJFA 2L5OA 3ZREA 4BA7A 3TOUA 1NW2A 4ZIJA 5JCWA 3RGBC 1N2AA 4CW9A 3CWGA 1S4BP 4AKHA 1X5EA 1KBNA 3FHKA 4Z2RA 2IFQA 2I4AA 4GQCA 3G7YA 1MD3A 4J57E 2XPEA 3Q74A 3IV4A 3HCZA 1C72A 4JBBA 4L0WA 3HYPA 4JE1A 2LNTA 4KW6A 5EPFA 3U5RE 1SK2A 2H73A 1SVOA 1AAZA 4LMVA 3M0FA 1X9MB 1ZYNA 1JHBA 2HXKA 4ECBA 2H1AA 1EOHA 3F6FA 1OAZA 3P2AA 3LYPA 3IBHA 5DAKA 1KNGA 2HSHA 2CZ3A 4GTUA 4HEA2 4FXYP 2FWHA 3US3A 2YCDA 1OC9B 3F3QA 19GSA 3DD3A 1EEMA 1M3JA 1ERUA 5IOWA 4KNDA 3H93A 4HQZA 1TJDA 1QMVA 3Q19A 1A8LA 4EKZA 1DUGA 2DJ1A 2O8VB 3EYTA 4GSTA 4KDXA 1F3AA 2UV8G 2DKHA 2H19A 4XIHA 3LORA 1B9YC 2HFDA 3L78A 3KTLA 1QFNA 4ZL8A 4YKFA 5ELGA 3ZVJA 2WVXA 2WW0A 2I3YA 5G30A 3TRQA 2KP1A 4TXOB 5E4WA 2PVQA 3WD6A 5J4VA 4NWYA 4PQ1A 3TKSA 3GFKA 4KH7A 3ZIVA 3F6DA 1TP9A 5G5FA 2B5YA 2QSIA 5CRDA 5BMUA 2RM6A 5IQYA 3GNJA 3QMXA 2M80A 1HNAA 2GQKA 1ILOA 2P31A 4IELA 2YJHA 2AYTA 3ED3A 1WE0A 3EU4A 2FGXA 2V6KA 2AUVA 4NPBA 3LG6A 2H6YA 5JWQB 2HT9A 5CNWA 4XS6A 2GSQA 2QC7A 2F51A 3IPZA 2V1MA 4OO5A 1AXDA 1FVKA 3IE3A 1XWKA 5D73A 2B1LA 5CYYA 2PWJA 1OKTA 7GSSA 5FT3A 2VD1A 1XW9A 2MMAA 5ID2B 3APQA 1IYIA 4GRFA 1V98A 3H8QA 4YAVA 1XFLA 1FOVA 2GVPA 2F3MA 2LJAA 1G7OA 2VM1A 4A5PA 6GSUA 2V2GA 1M9BA 3GYKA 1TKDB 4L0UA 3RFRC 4MMMA 2AAWA 3EPTA 4MCUA 3D21A 1M2AA 4POLA 1R4WA 2HRFA 3QR6A 1WMJA 3IDVA 1XPVA 4MH3A 4EIPA 2KUCA 1HNCA 4N3ZA 2KHPA 1PD21 2R0CA 2VUPA 2R0GA 1ON4A 1EOGA 4ZB6A 1SK0A 2H0IA 4Q5FA 3DGQA 1K3OA 3HZ4A 4G2EA 3HJOA 2I81A 1TU8A 3A2XA 5D9VA 2EIOA 4G0LA 1SJZA 2FA8A 3PINA 5GAPD 4OWYA 3FYGA 2C4JA 3VWUA 1BJXA 3U6VA 1PKWA 9GSSA 5D96A 4LLRA 5H5SA 1T3BA 5IMVA 3LXTA 5A1NB 5D8IA 3TCOA 3O76A 2K8SA 5IO0A 2ZUPA 1TI3A 4K7OA 2O3EA 4K7IA 3H1NA 1SKWB 2CVBA 1WOUA 3TKSE 1TTZA 1XWBA 4RI6A 1OC3A 5KOWA 1E6BA 3S9FA 4DSRA 1N25A 1I5GA 5JWRB 5A4VA 5JCGA 2GDRA 3VI5A 4ICYA 2HQTA 1GSEA 3CHXC 2BTOT 3IOSA 5DJMA
chains in the Genus database with same CATH topology
3CSHA 1LJRA 3UARA 2CT6A 4FYUA 5IMCA 1HYUA 2KLXA 4F0CA 2UZ8A 4PX1A 1B4PA 2C3NA 2P5RA 1LU4A 1QGVA 4ZL9A 3W8JA 1SVMA 2MMNA 4GSNA 1WJKA 1GUKA 2ALBA 4XS1A 2MBSA 5J3RA 4PQIA 2GS3A 1SD9A 2NDOA 4ZB8A 3HD5A 1BF5A 2HSNB 2IIYA 4WBJA 2LEGA 1BG5A 4OMVA 4IVFA 2HSMB 3WT2A 3VK9A 1XWCA 4NXIA 4KDUA 1XVWA 2HZFA 1M0UA 1ERVA 3DRNA 3IXRA 3KP8A 3GSTA 4G19A 4E8HA 2B3SA 5FHIA 2LSTA 3A5WA 1ERWA 4FYCA 2YP6A 2K8VA 2O5VA 5J4YA 2I1UA 4V2LA 4QQ7A 4I2TA 3IA1A 5DALA 1WPIA 4K9ZA 4F03A 2YWIA 4RQRA 3GMFA 5ENUA 2GZZA 4TVEA 1Y25A 5ECKB 2FCHA 2ON7A 1OE8A 2REMA 6GSVA 2GQMA 4XRAA 3HHVA 1KTEA 1MDJA 2EFDA 4Z2TA 14GSA 1Z6NA 1FOHA 2G0FA 1A23A 1K3YA 2RUEA 6GSSA 1R7HA 1TRSA 2XC2A 4L5OA 2VL2A 3F9UA 4HU9A 3QOUA 5COHA 1FO5A 3BJ5A 3FEUA 3KMOA 3WGEA 2FWEA 3I9V2 2OACA 2H6ZA 3HDCA 4O5UA 4G0IA 1O73A 2QKEA 16GSA 2QA1A 2WCIA 4X4JA 4I8BA 1JZOA 3PPUA 2E7PA 1XBSA 5EL8A 2BMXA 2K9FA 2XHFA 5ECPB 1OYJA 1B4QA 2MBTA 3APSA 3O3TA 4CHSA 1VRSD 4GSSA 1XVQA 5H5RA 1A8YA 3G7IA 4TR1B 4EXJA 1SENA 3RPNA 1YKAA 1V2AA 3H79A 3KH9A 2D2ZA 3HVXA 3HMJG 4ECCA 2MYGA 1GSDA 3V1WA 5CO3A 4BWQA 4K2XA 5IMAA 1AQXA 2A2RA 1U87A 2CA8A 5KN1A 1VF4A 1A0RP 5F06A 1Z3EA 1PX7A 1GSSA 1GRXA 5HFGA 4N0ZA 1SL0B 5EVOA 5ECSA 2E0QA 5ECLB 2NVLA 1ML6A 2V32A 2PU9C 3A5IA 3DKSA 1K0BA 3MAKA 4G01A 4X43A 3TRPA 3GKXA 2OKAA 3APOA 5DCGA 1SK1A 1PX6A 1PA3A 2F9SA 3C1RA 3L9UA 2YZHA 2EIQA 5HFKA 1GSUA 4HJMA 4X1UA 3KIJA 3R2QA 3IAS2 2IJYA 5KEJA 1R26A 1F9MA 3D5JA 1M2BA 1TXXA 3TU3B 4USSA 2WB9A 2WZ9A 5A34B 5IPGA 3GIXA 1OC9A 1PL1A 1H75A 2LRTA 1JZDA 3ZFLA 5CAXA 2R3XA 3KP9A 1JZWA 5HQPA 3BOAA 1N8JA 2A4VA 3A2VA 1LBKA 3UAPA 2L59A 2C0GA 2G2QA 4Z2UA 1A2LA 2ZNMA 1AQWA 2KOKA 3CXGA 2B5EA 5IMZA 3LSZA 1HD2A 3LXZA 3EC3A 1BAYA 5IOXA 5G1LA 2VCQA 4N0VA 1JFUA 2H71A 2OT3A 3G7JA 3GSSA 3UOMA 4AKGA 3GKMA 2DJKA 3HJPA 1ZOFA 1TRVA 1PRXA 3FMWA 5KN3A 4TXOA 1TK0B 2CZ2A 4K5RA 3M3MA 3F4RA 3UBKA 1BYEA 4V1Ag 4PGTA 4MZCA 2HZEB 4TRXA 2WJUA 5ABRA 1AIUA 6GSWA 1PGTA 3FR3A 2H72A 2FWFA 3IHGA 4L5LA 2C0DA 5IIZA 1YEXA 3VPQA 2IMFA 4JRRA 5LCZA 4GCIA 3CSIA 2VL3A 4K2DA 2X8CA 1F37A 4ID0A 3ZMLA 1XW5A 4N30A 4FYBA 1VGLA 3HKRA 5F0GA 4EDYA 4O32A 1EWXA 2L57A 2YJ7A 3TJGA 4BVXB 1XIYA 1U88A 3I43A 4MJEA 4IBPA 1HQOA 1EV9A 4DSSB 3WYWA 1Q4JA 5ID2A 2DIYA 5C00A 1XXUA 3L9VA 4YAPA 1GULA 4MJAA 4QMKA 3VWWA 1XWAA 2YPMA 1B9XC 3CMIA 1HNBA 1BEDA 5D9TA 3ISOA 2XBQA 1FW1A 1CQGA 3LWAA 3QDNA 1O8WA 1PSQA 3C73A 3E0UA 1SD8A 4ZB7A 2CX3A 5CRWA 4I97A 3FZ9A 1ZYQB 5HFIA 2JACA 4HI7A 5AN1A 3HZ8A 2OBIA 4JU5A 3C7MA 4TR3A 3CRUA 4DVCA 3IC8A 2NPBA 3F3RA 4FQUA 1SYXA 3FKFA 1S3AA 1EP7A 1XCCA 5IM9A 3QAGA 2H0GA 4FH8A 1FG4A 1YKCA 2JU5A 3D4TA 2IN3A 3IR4A 3FR9A 2MMOA 4PUAA 1GLQA 2WULA 5A1NA 3GX0A 2GT5A 3TOTA 3MDKA 1EEJA 2PN8A 3M9JA 2R5GA 1EV4A 5LNKe 2GQLA 3QAWA 3QCPA 4YQUA 3WGXA 1Z7PA 3TKSC 1I9DA 3KXOA 5L71A 2CVDA 3G9BA 1TXUA 1GP1A 3MIXA 3RAZA 2H1DA 4K8MA 3ME7A 2H1GA 1MEKA 5ELAA 3CTGA 3ZRDA 3MWHA 1X0RA 5A4WA 3KH7A 3QFAC 4J56E 4PNFA 5J40A 2VM2A 2HNLA 3A2WA 4TW5A 2B6MA 1A2MA 5AGYA 2HRKB 1RQMA 4EIQA 3I6AA 2C0EA 4XRDA 4P3YB 3L4NA 3VFIA 1Y6EA 3DXBA 1PQNA 2CVKA 2X8GA 4YKGA 2DSAA 3LJRA 2VIMA 4W66A 2PVOC 3HA9A 3RBTA 2L4QA 2VLTA 2OBKA 2C8UA 4HUAA 1SVLA 4PQHA 3IHQA 1GNEA 1JZRA 5J4UA 2HSNA 3TDGA 1T8EB 2HSMA 3KMNA 1V40A 1OVNA 4IN0A 2JSZA 2WDUA 4HZ4A 4OFMA 1UC7A 4KUNA 4ULXA 4I6XA 10GSA 1GLPA 4K5SA 1K3LA 3FY7A 5GAND 2OA7A 1TU7A 2A2PA 3ZZXA 4Q5RA 1MDKA 4LMWA 4IKHA 1BQ7A 4V2NA 2R4VA 4XCSA 1EP8A 1ZL9A 4ZBDA 4ZXGA 2N5BA 2B7JA 1A24A 2DJJA 4KAEA 2PGTA 2PMTA 4O5RA 5DJLA 1YJ6A 4G10A 2CAQA 5AIVA 4RI7A 3TJKA 2GSTA 5DBQA 4F0BA 1TOFA 4KDYA 2L5LA 4MH2A 2H30A 3M8NA 4YH2A 1WRYA 1J9BA 2H70A 1IYHA 4N10A 3ZMKA 4OO4A 2IMKA 3ZITA 4BL7B 2YZUA 2YV9A 3FZ4A 2C0FA 3PGTA 1GUHA 1OE7A 3D0ZA 2YN1A 4EDZA 2LQOA 2FD3A 1X9WB 1XW6A 3LFLA 4MZWA 1RW1A 1F6MC 4EF0A 2H6XA 5IPHA 1VF2A 2EFCA 1GSYA 1THOA 4I5QA 3BCIA 2GGTA 4KB3A 2E2MA 3DMLA 4NV5A 4IGJA 4TR1A 3EINA 1GTIA 3EE2A 1H4OA 3L0HA 5J9BA 1ZYPA 3RDWA 2I9HA 1EZKA 17GSA 1YZXA 1VF1A 2K18A 1GTBA 4AKXB 1QQ2A 2R0PA 1TK5B 2JL4A 1JLVA 4CY8A 1ZZYA 3EMXA 2R37A 4X0XA 2HYXA 2M46A 1FHEA 3VLNA 3QFBC 2C80A 3UBLA 2DKIA 5ECIB 4ML6A 4NMUA 1ZCPA 3DVWA 4E68A 3TKQA 4ACSA 3J7Yb 1CQHA 4CY6A 1M99A 5ECHB 2YWNA 3EWLA 2IPAA 1QXHA 3FRCA 2O89A 3TRXA 3A3TA 2Z9SA 3DWVA 4ISDA 5DVBA 4MJCA 2N5FA 4YQMA 4ZL7A 1OKDA 4GQFA 3GH9A 4KF9A 20GSA 3F4SA 3FW2A 3IRAA 3MNGA 4MJBA 3HVSA 1AQVA 1PN9A 5CREA 2HRAA 3GV1A 5A34A 5C04A 3GKNA 1EGOA 1URMA 4O5QA 4AF2A 2V41A 2VCVA 2FHEA 3N5OA 2VLVA 4AI6A 1TK8B 3D22A 2LRCA 1GTUA 4HU7A 1AC1A 2X4AA 1X9SB 3HJMA 5D9XA 2MZCA 2JZSA 2VL2C 3CYNA 2VCWA 12GSA 4MDCA 2JADA 1THXA 2ZCTA 3Q18A 1DBYA 4MF7A 5A5HB 4N11A 4HOJA 2B7KA 3DEXA 4AGSA 2WFCA 2YNXA 2LNSA 2LV3A 2HZEA 3UJ1A 2LS5A 2RUFA 3RPPA 2VD0A 2L4CA 4BVYB 1YF0A 2TIRA 1GL8A 2YOIA 5CRHA 11GSA 5A5KA 2H1LA 3KCMA 5EY6A 4EL1A 1QUWA 4LA1A 1EGRA 4BWSA 1YEPA 2VCZA 4JEDA 1K0OA 2P5QA 2GZYA 3F63A 4G0KA 4ILFA 4PTSA 1R5PA 2R6KA 3IK9A 4XHMA 1A0FA 3QAVA 4PNGA 3UL3A 4IJIA 1S3CA 2XBIA 3TJBA 4Q5NA 4F2IA 2PBJA 4LL1B 4MK3A 5ECOB 4XS4B 4BVXA 3UMAA 5B8BA 4IP6A 5J9CA 1GH2A 4IJ3A 2F8FA 3I69A 1A2JA 3GX8A 4DSSA 4IQ1A 5G31A 4D73B 4KSMA 1GSFA 5DQYA 2H1BA 4K0GA 1UN2A 1GUMA 1B48A 4HZ2A 4NV2A 3M1GA 3ZLPA 5H5QA 4OD7A 5D9WA 4WEYA 4ZBBA 5INYA 1TRWA 3ERWA 1MD4A 4K1FA 3LQ7A 2J23A 2OJLA 4ZB9A 2L6CA 3NOFA 3DIEA 3TUEA 3GA4A 1X5DA 1USBA 5F8BA 1PL2A 2H8LA 3FK8A 3LW9A 2IMEA 4MLYA 4ZBAA 5IMFA 3KEBA 4WBRD 5CRGA 3UIWA 1YY7A 5KOXA 4WR5A 3VI7A 1U3IA 1OC8A 1YDKA 4PXOA 2EFHA 2GSRA 1WP0A 1PMTA 4Z7XA 2VCXA 1WWJA 3LEFA 2DMLA 2VAFA 3GKKA 3P8WA 5JCUA 3BCKA 4MF6A 4O92A 3ZL5A 2X99A 3HY2A 2LUSA 3UVHA 1QK8A 2CX4A 2EC4A 3D4MA 2LJKA 4IHUA 4GWRA 3J7Yk 4HS1A 2GZPA 3ZIJA 2H76A 2BJXA 1UA5A 4OFTA 13GSA 4AJ8A 4XTSA 3Q6OA 1O85A 2H75A 1V9WA 2HSYA 4KCEA 4CDOA 3GH6A 4MF5A 4WF4A 2DIZA 2CAIA 1B8XA 1U3AA 1SKSB 1Z5YE 2E2GA 3D6IA 1SU9A 2YANA 4KGIA 4TR4A 5J47A 4POMA 3FZAA 2V6OA 2TRXA 3EMPA 4HJ2A 5A4UA 2IFQB 2HRKA 4AJ7A 2C1YA 2YWOA 2TRCP 2ES7A 2VLUA 1GTAA 3UEMA 6GSYA 3LGCA 3KM6A 1GSQA 2LQQA 4K6XA 3O6TA 5G1KA 4K7NA 1YF1A 1K0DA 1V58A 2LRNA 3GHAA 3SBCA 1T4YA 4TOPA 5DAKB 2RIIA 3WGDA 1DSBA 2WRTA 1K0MA 5F07A 1TRUA 5JWOB 2GTUA 2LJRA 2JZTA 2HI7A 2FA4A 5IO2A 3FZ5A 3AY8A 3W6GA 3GTUA 3IC4A 3ERFA 3LYKA 4FO5A 5B6MA 1E2YA 1YVLA 1SKRB 1S3DA 1NM3A 2DJ3A 1MTCA 1XWGA 4GDFA 5AISA 2B5XA 5LD0A 5KN2A 1F2EA 4F82A 2VOCA 1YQ1A 8GSSA 1O8XA 4LL4B 2KP2A 3VPTA 1BX9A 1T4ZA 5E59A 3L9SA 2GLRA 5DDLA 2CQ9A 3ZTLA 2PERA 3C71A 5DQSA 2H01A 3F8UA 3KGKA 5GZZB 3ERGA 4DEJA 1FB0A 2B1KA 2HLSA 2OADA 2QGVA 4TN8A 1VF3A 2FWGA 4WKWA 1ZGNA 1AUCA 3VWXA 3KJYA 1JLWA 1G6WA 2JZRA 4EE0A 4EO3A 5G2ZA 4ZILA 4EC0A 1UVZA 1F3BA 4KA0A 2DC5A 2AJQB 2F8AA 4ECJA 3OR5A 5BMUB 4JR4A 1KEBA 3ZFBA 4KCAA 1XZOA 5HR3A 4BL7A 2NBSA 1TDIA 4WF5A 2GSSA 4OFNA 2VKZG 3TKRA 3NIVA 4WETA 4GLTA 3RHBA 1GNWA 4HQSA 1SYRA 1FB6A 1NSWA 3GTUB 4JR6A 3TKPA 2OE3A 5GSSA 2YWMA 1K0CA 1Z9HA 2IL3A 3WT1A 3M9KA 2HRNA 4F9ZA 2FNOA 1GWCA 2VCTA 2H0HA 2FY6A 2YV7A 4QL7A 4MA9A 2FLSA 4MNNA 3DYRA 3P90A 2MMZA 2EIRA 5J5NA 2M72A 1X5CA 6GSTA 2EFEA 1MDIA 3CRTA 5F05A 2DJ2A 1W89A 2IWTA 4ML1A 3QPMA 1K0AA 1T1VA 5B6NA 3GN3A 3C1SA 2GT6A 5HR2A 1M2DA 5HR0A 3IK7A 4YQVA 5GSTA 3BD2A 4Q5QA 2AV4A 3GL5A 2NTOA 2L6DA 4WXTA 1J08A 1O6JA 6GSXA 2RM5A 2K6VA 5AIXA 4MZBA 3H4KA 3E3EA 1T00A 3IAM2 5B7CA 5G5EA 2J9HA 4K0NA 4POKA 1TW9A 3KD0A 2LKUA 1V57A 3R3EA 1NHYA 3ZYWA 3HVVA 3K8NA 4FIWA 4EVMA 2H66A 4HDEA 2C3TA 4IP1A 4POBA 3KZQA 5ECRB 1SJ6A 4ECIA 1DE2A 4TKYA 1M9AA 3MYDA 5D93A 3HXSA 4RUVA 2X49A 4NHZA 3F0IA 4O7HA 2VL9A 1RK4A 1BG1A 2FUG2 3W8SA 3F4TA 4QL9A 1K0NA 1WIKA 3QD9A 4V1Ap 4JZQA 1R5AA 1SJIA 5ECMB 3PH9A 3JCML 3PR8A 3BBYA 3GURA 5A5HA 4PURA 1J0FA 2A2SA 2OE1A 3CBUA 2N5AA 2HE3A 1ERTA 4G9HA 1XOAA 2LTKA 5ECNB 4OCEA 3TB2A 3VURA 5BRTA 4MP4A 1M7TA 4KX4A 4OCFA 1ZMAA 2H74A 2O87A 3MSZA 1FVJA 1PKZA 2PPTA 1O7UA 1Y1UA 4BVYA 1TI1A 3VWVA 4RQXA 2IMIA 3CTFA 3DVXA 3GUSA 3KTBA 1NHOA 3NZNA 3EVIA 3TJJA 18GSA 1Z7RA 2VO4A 4PUFC 2JSYA 3N9JA 2AB6A 3SWLA 2O85A 2ON5A 1ACVA 4IQAA 3EURA 1G0TA 5FWGA 1O81A 3GRXA 2CV4A 1ZYEA 1AW9A 4AJ6A 3ZVJD 4GXZA 5IMDA 3FR6A 22GSA 4XS4A 1PN0A 4KE3A 4H86A 4NHWA 2IMDA 4DSQA 4D73A 2A4HA 4WR4A 3RHCA 3P7XA 2DLXA 4I2UA 2WGRA 5DALB 3EU3A 3GL3A 5ECQB 4L8EA 4KSOA 2RLIA 3C8EA 2OE0A 4E8EA 3CSJA 4TXVA 1XOBA 4IW9A 2X8HA 4EUYA 2WS2A 4J2FA 1FAAA 2DJ0A 4MABA 1U6TA 2XPDA 1Q98A 2R2JA 5HR1A 2AHEA 4AKIA 5B8AA 2P0GA 3E9JB 1ST9A 5DCHA 2DBCA 4MPGA 5CP1A 3TGZA 4TR0A 5KN0A 2PUKC 4MPFA 4V2MA 1G7EA 1G6YA 5J41A 3UVTA 4BPYA 1W4VA 4IS0A 1ABAA 3ME8A 4NAXA 1Z6MA 2O7KA 1DE1A 2DMMA 2QA2A 2X64A 1SL2B 2C3QA 1SL1B 1T7PB 4GF0A 3TJFA 2L5OA 3ZREA 4BA7A 3TOUA 1NW2A 4ZIJA 5JCWA 1N2AA 4CW9A 3CWGA 4AKHA 1X5EA 1KBNA 3FHKA 4Z2RA 2IFQA 2I4AA 4GQCA 3G7YA 1MD3A 4J57E 2XPEA 3Q74A 3IV4A 3HCZA 1C72A 4JBBA 4L0WA 3HYPA 4JE1A 2LNTA 4KW6A 5EPFA 3U5RE 1SK2A 2H73A 1SVOA 1AAZA 4LMVA 3M0FA 1X9MB 1ZYNA 1JHBA 2HXKA 4ECBA 2H1AA 1EOHA 3F6FA 1OAZA 3P2AA 3LYPA 3IBHA 5DAKA 1KNGA 2HSHA 2CZ3A 4GTUA 4HEA2 2FWHA 3US3A 2YCDA 1OC9B 3F3QA 19GSA 3DD3A 1EEMA 1ERUA 5IOWA 4KNDA 3H93A 4HQZA 1TJDA 1QMVA 3Q19A 1A8LA 4EKZA 1DUGA 2DJ1A 2O8VB 3EYTA 4GSTA 4KDXA 1F3AA 2UV8G 2DKHA 2H19A 4XIHA 3LORA 1B9YC 2HFDA 3L78A 3KTLA 1QFNA 4ZL8A 4YKFA 5ELGA 3ZVJA 2I3YA 5G30A 3TRQA 2KP1A 4TXOB 5E4WA 2PVQA 3WD6A 5J4VA 4NWYA 4PQ1A 3TKSA 3GFKA 4KH7A 3ZIVA 3F6DA 1TP9A 5G5FA 2B5YA 2QSIA 5CRDA 5BMUA 2RM6A 5IQYA 3GNJA 3QMXA 2M80A 1HNAA 2GQKA 1ILOA 2P31A 4IELA 2YJHA 2AYTA 3ED3A 1WE0A 3EU4A 2FGXA 2V6KA 2AUVA 4NPBA 3LG6A 2H6YA 5JWQB 2HT9A 5CNWA 4XS6A 2GSQA 2QC7A 2F51A 3IPZA 2V1MA 4OO5A 1AXDA 1FVKA 3IE3A 1XWKA 5D73A 2B1LA 5CYYA 2PWJA 1OKTA 7GSSA 5FT3A 2VD1A 1XW9A 2MMAA 5ID2B 3APQA 1IYIA 4GRFA 1V98A 3H8QA 4YAVA 1XFLA 1FOVA 2GVPA 2F3MA 2LJAA 1G7OA 2VM1A 4A5PA 6GSUA 2V2GA 1M9BA 3GYKA 1TKDB 4L0UA 4MMMA 2AAWA 3EPTA 4MCUA 3D21A 1M2AA 4POLA 1R4WA 2HRFA 3QR6A 1WMJA 3IDVA 1XPVA 4MH3A 4EIPA 2KUCA 1HNCA 4N3ZA 2KHPA 1PD21 2R0CA 2VUPA 2R0GA 1ON4A 1EOGA 4ZB6A 1SK0A 2H0IA 4Q5FA 3DGQA 1K3OA 3HZ4A 4G2EA 3HJOA 2I81A 1TU8A 3A2XA 5D9VA 2EIOA 4G0LA 1SJZA 2FA8A 3PINA 5GAPD 4OWYA 3FYGA 2C4JA 3VWUA 1BJXA 3U6VA 1PKWA 9GSSA 5D96A 4LLRA 5H5SA 1T3BA 5IMVA 3LXTA 5A1NB 5D8IA 3TCOA 3O76A 2K8SA 5IO0A 2ZUPA 1TI3A 4K7OA 4K7IA 3H1NA 1SKWB 2CVBA 1WOUA 3TKSE 1TTZA 1XWBA 4RI6A 1OC3A 5KOWA 1E6BA 3S9FA 4DSRA 1N25A 1I5GA 5JWRB 5A4VA 5JCGA 2GDRA 3VI5A 4ICYA 2HQTA 1GSEA 2BTOT 3IOSA 5DJMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CSH A;  1LJR A;  3UAR A;  2CT6 A;  4FYU A;  5IMC A;  1HYU A;  2KLX A;  4F0C A;  2UZ8 A;  4PX1 A;  1B4P A;  2C3N A;  2P5R A;  1LU4 A;  1QGV A;  4ZL9 A;  3W8J A;  2MMN A;  4GSN A;  1WJK A;  1GUK A;  2ALB A;  4XS1 A;  2MBS A;  5J3R A;  4PQI A;  2GS3 A;  1SD9 A;  2NDO A;  4ZB8 A;  3HD5 A;  2IIY A;  2HSN B;  4WBJ A;  2LEG A;  1BG5 A;  4OMV A;  4IVF A;  2HSM B;  3WT2 A;  3VK9 A;  1XWC A;  4NXI A;  4KDU A;  1XVW A;  2HZF A;  1M0U A;  1ERV A;  3DRN A;  3IXR A;  3KP8 A;  3GST A;  4G19 A;  4E8H A;  2B3S A;  5FHI A;  2LST A;  3A5W A;  1ERW A;  4FYC A;  2YP6 A;  2K8V A;  2I1U A;  4V2L A;  4QQ7 A;  4I2T A;  3IA1 A;  5DAL A;  1WPI A;  4K9Z A;  4F03 A;  2YWI A;  4RQR A;  3GMF A;  5ENU A;  2GZZ A;  4TVE A;  1Y25 A;  5ECK B;  2FCH A;  2ON7 A;  1OE8 A;  2REM A;  6GSV A;  2GQM A;  4XRA A;  3HHV A;  1KTE A;  1MDJ A;  14GS A;  1Z6N A;  2G0F A;  1A23 A;  1K3Y A;  2RUE A;  6GSS A;  1R7H A;  1TRS A;  2XC2 A;  4L5O A;  2VL2 A;  3F9U A;  4HU9 A;  3QOU A;  5COH A;  1FO5 A;  3BJ5 A;  3FEU A;  3KMO A;  3WGE A;  2FWE A;  3I9V 2;  2OAC A;  2H6Z A;  3HDC A;  4G0I A;  1O73 A;  2QKE A;  16GS A;  2WCI A;  4I8B A;  1JZO A;  3PPU A;  2E7P A;  1XBS A;  5EL8 A;  2BMX A;  2K9F A;  2XHF A;  5ECP B;  1OYJ A;  1B4Q A;  2MBT A;  3APS A;  3O3T A;  4CHS A;  1VRS D;  4GSS A;  1XVQ A;  5H5R A;  1A8Y A;  3G7I A;  4TR1 B;  4EXJ A;  1SEN A;  3RPN A;  1YKA A;  1V2A A;  3H79 A;  3KH9 A;  2D2Z A;  3HVX A;  4ECC A;  2MYG A;  1GSD A;  3V1W A;  5CO3 A;  4BWQ A;  5IMA A;  1AQX A;  2A2R A;  1U87 A;  2CA8 A;  5KN1 A;  1VF4 A;  1A0R P;  5F06 A;  1Z3E A;  1PX7 A;  1GSS A;  1GRX A;  5HFG A;  4N0Z A;  1SL0 B;  5EVO A;  5ECS A;  2E0Q A;  5ECL B;  2NVL A;  1ML6 A;  2V32 A;  2PU9 C;  3DKS A;  1K0B A;  3MAK A;  4X43 A;  3TRP A;  3GKX A;  2OKA A;  3APO A;  5DCG A;  1SK1 A;  1PX6 A;  1PA3 A;  2F9S A;  3C1R A;  3L9U A;  2YZH A;  2EIQ A;  5HFK A;  1GSU A;  4HJM A;  4X1U A;  3KIJ A;  3R2Q A;  3IAS 2;  2IJY A;  5KEJ A;  1R26 A;  1F9M A;  3D5J A;  1M2B A;  1TXX A;  4USS A;  2WB9 A;  2WZ9 A;  5IPG A;  3GIX A;  1OC9 A;  1PL1 A;  1H75 A;  2LRT A;  1JZD A;  3ZFL A;  5CAX A;  2R3X A;  3KP9 A;  1JZW A;  5HQP A;  3BOA A;  1N8J A;  2A4V A;  3A2V A;  1LBK A;  3UAP A;  2L59 A;  2C0G A;  2G2Q A;  1A2L A;  2ZNM A;  1AQW A;  2KOK A;  3CXG A;  2B5E A;  5IMZ A;  3LSZ A;  1HD2 A;  3LXZ A;  3EC3 A;  1BAY A;  5IOX A;  5G1L A;  2VCQ A;  4N0V A;  1JFU A;  2H71 A;  3G7J A;  3GSS A;  3UOM A;  3GKM A;  2DJK A;  3HJP A;  1ZOF A;  1TRV A;  1PRX A;  5KN3 A;  4TXO A;  1TK0 B;  2CZ2 A;  3M3M A;  3F4R A;  3UBK A;  1BYE A;  4V1A g;  4PGT A;  4MZC A;  2HZE B;  4TRX A;  2WJU A;  5ABR A;  1AIU A;  6GSW A;  1PGT A;  3FR3 A;  2H72 A;  2FWF A;  4L5L A;  2C0D A;  5IIZ A;  1YEX A;  3VPQ A;  2IMF A;  4JRR A;  5LCZ A;  4GCI A;  4K2D A;  3CSI A;  2VL3 A;  2X8C A;  1F37 A;  4ID0 A;  3ZML A;  1XW5 A;  4N30 A;  4FYB A;  1VGL A;  3HKR A;  5F0G A;  4EDY A;  4O32 A;  1EWX A;  2L57 A;  2YJ7 A;  3TJG A;  4BVX B;  1XIY A;  1U88 A;  3I43 A;  4MJE A;  4IBP A;  1HQO A;  1EV9 A;  4DSS B;  3WYW A;  1Q4J A;  5ID2 A;  2DIY A;  5C00 A;  1XXU A;  3L9V A;  4YAP A;  1GUL A;  4MJA A;  3VWW A;  1XWA A;  2YPM A;  1B9X C;  3CMI A;  1HNB A;  1BED A;  5D9T A;  3ISO A;  2XBQ A;  1FW1 A;  1CQG A;  3LWA A;  3QDN A;  1O8W A;  1PSQ A;  3C73 A;  3E0U A;  1SD8 A;  2CX3 A;  5CRW A;  4I97 A;  3FZ9 A;  1ZYQ B;  5HFI A;  2JAC A;  4HI7 A;  5AN1 A;  3HZ8 A;  2OBI A;  4JU5 A;  3C7M A;  4TR3 A;  3CRU A;  4DVC A;  3IC8 A;  2NPB A;  3F3R A;  4FQU A;  1SYX A;  3FKF A;  1S3A A;  1EP7 A;  1XCC A;  5IM9 A;  3QAG A;  2H0G A;  4FH8 A;  1FG4 A;  1YKC A;  2JU5 A;  3D4T A;  2IN3 A;  3IR4 A;  3FR9 A;  2MMO A;  4PUA A;  1GLQ A;  2WUL A;  3GX0 A;  2GT5 A;  3TOT A;  3MDK A;  1EEJ A;  2PN8 A;  3M9J A;  2R5G A;  1EV4 A;  5LNK e;  2GQL A;  3QAW A;  3QCP A;  4YQU A;  3WGX A;  1Z7P A;  3TKS C;  1I9D A;  3KXO A;  5L71 A;  2CVD A;  3G9B A;  1GP1 A;  3RAZ A;  2H1D A;  4K8M A;  3ME7 A;  2H1G A;  1MEK A;  5ELA A;  3CTG A;  3ZRD A;  3MWH A;  1X0R A;  5A4W A;  3KH7 A;  3QFA C;  4J56 E;  4PNF A;  2VM2 A;  2HNL A;  3A2W A;  4TW5 A;  2B6M A;  1A2M A;  5AGY A;  2HRK B;  1RQM A;  3I6A A;  2C0E A;  4XRD A;  4P3Y B;  3L4N A;  3VFI A;  1Y6E A;  3DXB A;  1PQN A;  2CVK A;  2X8G A;  2DSA A;  3LJR A;  2VIM A;  2PVO C;  3HA9 A;  3RBT A;  2L4Q A;  2VLT A;  2OBK A;  2C8U A;  4HUA A;  4PQH A;  3IHQ A;  1GNE A;  1JZR A;  5J4U A;  3TDG A;  1T8E B;  2HSM A;  3KMN A;  1V40 A;  1OVN A;  4IN0 A;  2JSZ A;  2WDU A;  4HZ4 A;  4OFM A;  1UC7 A;  4KUN A;  4ULX A;  4I6X A;  10GS A;  1GLP A;  1K3L A;  3FY7 A;  5GAN D;  2OA7 A;  1TU7 A;  3ZZX A;  4Q5R A;  1MDK A;  4LMW A;  4IKH A;  1BQ7 A;  4V2N A;  2R4V A;  4XCS A;  1EP8 A;  1ZL9 A;  4ZBD A;  4ZXG A;  2N5B A;  2B7J A;  1A24 A;  2DJJ A;  4KAE A;  2PGT A;  2PMT A;  4O5R A;  5DJL A;  1YJ6 A;  4G10 A;  2CAQ A;  5AIV A;  4RI7 A;  3TJK A;  2GST A;  5DBQ A;  4F0B A;  1TOF A;  4KDY A;  2L5L A;  4MH2 A;  2H30 A;  3M8N A;  4YH2 A;  1WRY A;  1J9B A;  2H70 A;  1IYH A;  4N10 A;  3ZMK A;  4OO4 A;  2IMK A;  3ZIT A;  4BL7 B;  2YZU A;  2YV9 A;  3FZ4 A;  2C0F A;  3PGT A;  1GUH A;  1OE7 A;  3D0Z A;  2YN1 A;  4EDZ A;  2LQO A;  2FD3 A;  1X9W B;  1XW6 A;  3LFL A;  4MZW A;  1RW1 A;  1F6M C;  4EF0 A;  2H6X A;  5IPH A;  1VF2 A;  1GSY A;  1THO A;  4I5Q A;  3BCI A;  2GGT A;  4KB3 A;  2E2M A;  3DML A;  4NV5 A;  4IGJ A;  4TR1 A;  3EIN A;  1GTI A;  3EE2 A;  1H4O A;  3L0H A;  5J9B A;  3RDW A;  2I9H A;  1EZK A;  17GS A;  1YZX A;  1VF1 A;  2K18 A;  1GTB A;  1QQ2 A;  1TK5 B;  2JL4 A;  1JLV A;  1ZZY A;  3EMX A;  2R37 A;  4X0X A;  2HYX A;  2M46 A;  1FHE A;  3VLN A;  3QFB C;  2C80 A;  3UBL A;  5ECI B;  4ML6 A;  4NMU A;  1ZCP A;  3DVW A;  3TKQ A;  4ACS A;  3J7Y b;  1CQH A;  1M99 A;  5ECH B;  2YWN A;  3EWL A;  2IPA A;  1QXH A;  3FRC A;  2O89 A;  3TRX A;  3A3T A;  2Z9S A;  3DWV A;  4ISD A;  5DVB A;  4MJC A;  2N5F A;  4YQM A;  4ZL7 A;  1OKD A;  4GQF A;  3GH9 A;  4KF9 A;  20GS A;  3F4S A;  3FW2 A;  3IRA A;  3MNG A;  4MJB A;  3HVS A;  1AQV A;  1PN9 A;  5CRE A;  2HRA A;  3GV1 A;  5C04 A;  3GKN A;  1EGO A;  1URM A;  4AF2 A;  2V41 A;  2VCV A;  2FHE A;  3N5O A;  2VLV A;  1TK8 B;  3D22 A;  2LRC A;  1GTU A;  4HU7 A;  1AC1 A;  1X9S B;  3HJM A;  5D9X A;  2MZC A;  2JZS A;  2VL2 C;  3CYN A;  2VCW A;  12GS A;  4MDC A;  2JAD A;  1THX A;  2ZCT A;  3Q18 A;  1DBY A;  4MF7 A;  4N11 A;  4HOJ A;  2B7K A;  3DEX A;  4AGS A;  2WFC A;  2YNX A;  2LNS A;  2LV3 A;  2HZE A;  3UJ1 A;  2LS5 A;  2RUF A;  3RPP A;  2VD0 A;  2L4C A;  4BVY B;  1YF0 A;  2TIR A;  1GL8 A;  2YOI A;  5CRH A;  11GS A;  5A5K A;  3KCM A;  5EY6 A;  4EL1 A;  1QUW A;  4LA1 A;  1EGR A;  4BWS A;  1YEP A;  2VCZ A;  4JED A;  1K0O A;  2P5Q A;  2GZY A;  3F63 A;  4G0K A;  4ILF A;  4PTS A;  1R5P A;  2R6K A;  3IK9 A;  4XHM A;  1A0F A;  3QAV A;  4PNG A;  3UL3 A;  4IJI A;  1S3C A;  2XBI A;  3TJB A;  4Q5N A;  4F2I A;  2PBJ A;  4LL1 B;  4MK3 A;  5ECO B;  4XS4 B;  4BVX A;  3UMA A;  5B8B A;  4IP6 A;  5J9C A;  1GH2 A;  4IJ3 A;  2F8F A;  3I69 A;  1A2J A;  3GX8 A;  4DSS A;  4IQ1 A;  5G31 A;  4D73 B;  4KSM A;  1GSF A;  5DQY A;  2H1B A;  4K0G A;  1UN2 A;  1GUM A;  1B48 A;  4HZ2 A;  4NV2 A;  3M1G A;  3ZLP A;  5H5Q A;  4OD7 A;  5D9W A;  4WEY A;  4ZBB A;  5INY A;  1TRW A;  3ERW A;  1MD4 A;  4K1F A;  3LQ7 A;  2J23 A;  2OJL A;  4ZB9 A;  2L6C A;  3NOF A;  3DIE A;  3TUE A;  3GA4 A;  1X5D A;  1USB A;  5F8B A;  1PL2 A;  2H8L A;  3FK8 A;  2IME A;  4MLY A;  4ZBA A;  5IMF A;  3KEB A;  4WBR D;  5CRG A;  3UIW A;  1YY7 A;  4WR5 A;  3VI7 A;  1U3I A;  1OC8 A;  1YDK A;  4PXO A;  2GSR A;  1WP0 A;  1PMT A;  4Z7X A;  2VCX A;  1WWJ A;  3LEF A;  2DML A;  2VAF A;  3GKK A;  3P8W A;  5JCU A;  3BCK A;  4MF6 A;  4O92 A;  3ZL5 A;  2X99 A;  3HY2 A;  2LUS A;  3UVH A;  1QK8 A;  2CX4 A;  2EC4 A;  3D4M A;  2LJK A;  4IHU A;  4GWR A;  3J7Y k;  4HS1 A;  2GZP A;  3ZIJ A;  2H76 A;  2BJX A;  1UA5 A;  4OFT A;  13GS A;  4AJ8 A;  4XTS A;  3Q6O A;  1O85 A;  2H75 A;  1V9W A;  2HSY A;  4KCE A;  4CDO A;  3GH6 A;  4MF5 A;  4WF4 A;  2DIZ A;  2CAI A;  1B8X A;  1U3A A;  1SKS B;  1Z5Y E;  2E2G A;  3D6I A;  1SU9 A;  2YAN A;  4KGI A;  4TR4 A;  4POM A;  3FZA A;  2V6O A;  2TRX A;  3EMP A;  4HJ2 A;  5A4U A;  2IFQ B;  2HRK A;  4AJ7 A;  2C1Y A;  2YWO A;  2TRC P;  2ES7 A;  2VLU A;  1GTA A;  3UEM A;  6GSY A;  3LGC A;  3KM6 A;  1GSQ A;  2LQQ A;  4K6X A;  3O6T A;  5G1K A;  4K7N A;  1YF1 A;  1K0D A;  1V58 A;  2LRN A;  3GHA A;  3SBC A;  1T4Y A;  4TOP A;  5DAK B;  2RII A;  3WGD A;  1DSB A;  2WRT A;  1K0M A;  5F07 A;  1TRU A;  5JWO B;  2GTU A;  2LJR A;  2JZT A;  2HI7 A;  2FA4 A;  5IO2 A;  3FZ5 A;  3AY8 A;  3W6G A;  3GTU A;  3IC4 A;  3ERF A;  3LYK A;  4FO5 A;  5B6M A;  1E2Y A;  1SKR B;  1S3D A;  1NM3 A;  2DJ3 A;  1MTC A;  1XWG A;  5AIS A;  2B5X A;  5LD0 A;  5KN2 A;  1F2E A;  4F82 A;  2VOC A;  1YQ1 A;  8GSS A;  1O8X A;  4LL4 B;  2KP2 A;  3VPT A;  1BX9 A;  1T4Z A;  5E59 A;  3L9S A;  2GLR A;  5DDL A;  2CQ9 A;  3ZTL A;  2PER A;  3C71 A;  5DQS A;  2H01 A;  3F8U A;  3KGK A;  5GZZ B;  3ERG A;  4DEJ A;  1FB0 A;  2B1K A;  2HLS A;  2OAD A;  2QGV A;  4TN8 A;  1VF3 A;  2FWG A;  4WKW A;  1ZGN A;  1AUC A;  3VWX A;  3KJY A;  1JLW A;  1G6W A;  2JZR A;  4EE0 A;  4EO3 A;  5G2Z A;  4ZIL A;  4EC0 A;  1UVZ A;  1F3B A;  4KA0 A;  2DC5 A;  2AJQ B;  2F8A A;  4ECJ A;  3OR5 A;  4JR4 A;  1KEB A;  3ZFB A;  4KCA A;  1XZO A;  5HR3 A;  4BL7 A;  2NBS A;  1TDI A;  4WF5 A;  2GSS A;  4OFN A;  3TKR A;  3NIV A;  4WET A;  4GLT A;  3RHB A;  1GNW A;  4HQS A;  1SYR A;  1FB6 A;  1NSW A;  3GTU B;  4JR6 A;  3TKP A;  2OE3 A;  5GSS A;  2YWM A;  1K0C A;  1Z9H A;  2IL3 A;  3WT1 A;  3M9K A;  2HRN A;  4F9Z A;  2FNO A;  1GWC A;  2VCT A;  2H0H A;  2FY6 A;  2YV7 A;  4QL7 A;  4MA9 A;  2FLS A;  3DYR A;  3P90 A;  2MMZ A;  2EIR A;  5J5N A;  2M72 A;  1X5C A;  6GST A;  1MDI A;  3CRT A;  5F05 A;  2DJ2 A;  1W89 A;  2IWT A;  4ML1 A;  3QPM A;  1K0A A;  1T1V A;  5B6N A;  3GN3 A;  3C1S A;  2GT6 A;  5HR2 A;  1M2D A;  5HR0 A;  3IK7 A;  4YQV A;  5GST A;  3BD2 A;  4Q5Q A;  2AV4 A;  3GL5 A;  2NTO A;  2L6D A;  4WXT A;  1J08 A;  1O6J A;  6GSX A;  2RM5 A;  2K6V A;  5AIX A;  4MZB A;  3H4K A;  3E3E A;  1T00 A;  3IAM 2;  5B7C A;  5G5E A;  2J9H A;  4K0N A;  4POK A;  1TW9 A;  3KD0 A;  2LKU A;  1V57 A;  3R3E A;  1NHY A;  3ZYW A;  3HVV A;  3K8N A;  4FIW A;  4EVM A;  2H66 A;  4HDE A;  2C3T A;  4IP1 A;  4POB A;  3KZQ A;  5ECR B;  1SJ6 A;  4ECI A;  1DE2 A;  4TKY A;  1M9A A;  5D93 A;  3HXS A;  4RUV A;  4NHZ A;  3F0I A;  4O7H A;  2VL9 A;  1RK4 A;  2FUG 2;  3W8S A;  3F4T A;  4QL9 A;  1K0N A;  1WIK A;  3QD9 A;  4V1A p;  4JZQ A;  1R5A A;  1SJI A;  5ECM B;  3PH9 A;  3JCM L;  3PR8 A;  3BBY A;  3GUR A;  4PUR A;  1J0F A;  2A2S A;  2OE1 A;  3CBU A;  2N5A A;  2HE3 A;  1ERT A;  4G9H A;  1XOA A;  2LTK A;  5ECN B;  4OCE A;  3TB2 A;  3VUR A;  4MP4 A;  1M7T A;  4KX4 A;  4OCF A;  1ZMA A;  2H74 A;  2O87 A;  3MSZ A;  1FVJ A;  1PKZ A;  2PPT A;  1O7U A;  4BVY A;  3VWV A;  1TI1 A;  4RQX A;  2IMI A;  3CTF A;  3DVX A;  3GUS A;  3KTB A;  1NHO A;  3NZN A;  3EVI A;  3TJJ A;  18GS A;  1Z7R A;  2VO4 A;  4PUF C;  2JSY A;  3N9J A;  2AB6 A;  3SWL A;  2O85 A;  2ON5 A;  1ACV A;  4IQA A;  3EUR A;  1G0T A;  5FWG A;  1O81 A;  3GRX A;  2CV4 A;  1ZYE A;  1AW9 A;  4AJ6 A;  3ZVJ D;  4GXZ A;  5IMD A;  3FR6 A;  22GS A;  4XS4 A;  4KE3 A;  4H86 A;  4NHW A;  2IMD A;  4DSQ A;  4D73 A;  4WR4 A;  3RHC A;  3P7X A;  2DLX A;  4I2U A;  2WGR A;  5DAL B;  3EU3 A;  3GL3 A;  5ECQ B;  4L8E A;  4KSO A;  2RLI A;  3C8E A;  2OE0 A;  4E8E A;  3CSJ A;  4TXV A;  1XOB A;  4IW9 A;  2X8H A;  4EUY A;  2WS2 A;  4J2F A;  1FAA A;  2DJ0 A;  4MAB A;  1U6T A;  2XPD A;  1Q98 A;  2R2J A;  5HR1 A;  2AHE A;  5B8A A;  2P0G A;  3E9J B;  1ST9 A;  5DCH A;  2DBC A;  4MPG A;  5CP1 A;  3TGZ A;  4TR0 A;  5KN0 A;  2PUK C;  4MPF A;  4V2M A;  1G7E A;  1G6Y A;  5J41 A;  3UVT A;  4BPY A;  1W4V A;  4IS0 A;  1ABA A;  3ME8 A;  4NAX A;  1Z6M A;  2O7K A;  1DE1 A;  2DMM A;  2X64 A;  1SL2 B;  2C3Q A;  1SL1 B;  1T7P B;  4GF0 A;  3TJF A;  2L5O A;  3ZRE A;  4BA7 A;  3TOU A;  1NW2 A;  4ZIJ A;  5JCW A;  1N2A A;  4CW9 A;  1X5E A;  1KBN A;  3FHK A;  2IFQ A;  2I4A A;  4GQC A;  3G7Y A;  1MD3 A;  4J57 E;  2XPE A;  3Q74 A;  3IV4 A;  3HCZ A;  1C72 A;  4JBB A;  4L0W A;  3HYP A;  4JE1 A;  2LNT A;  4KW6 A;  5EPF A;  3U5R E;  1SK2 A;  2H73 A;  1AAZ A;  4LMV A;  3M0F A;  1X9M B;  1JHB A;  2HXK A;  4ECB A;  2H1A A;  1EOH A;  3F6F A;  1OAZ A;  3P2A A;  3LYP A;  3IBH A;  5DAK A;  1KNG A;  2HSH A;  2CZ3 A;  4GTU A;  4HEA 2;  2FWH A;  3US3 A;  2YCD A;  1OC9 B;  3F3Q A;  19GS A;  3DD3 A;  1EEM A;  1ERU A;  5IOW A;  4KND A;  3H93 A;  4HQZ A;  1TJD A;  1QMV A;  3Q19 A;  1A8L A;  4EKZ A;  1DUG A;  2DJ1 A;  2O8V B;  3EYT A;  4GST A;  4KDX A;  1F3A A;  2H19 A;  4XIH A;  3LOR A;  1B9Y C;  2HFD A;  3L78 A;  3KTL A;  1QFN A;  4ZL8 A;  5ELG A;  3ZVJ A;  2I3Y A;  5G30 A;  3TRQ A;  2KP1 A;  4TXO B;  5E4W A;  2PVQ A;  3WD6 A;  4NWY A;  4PQ1 A;  3TKS A;  3GFK A;  4KH7 A;  3ZIV A;  3F6D A;  1TP9 A;  5G5F A;  2B5Y A;  2QSI A;  5CRD A;  5BMU A;  2RM6 A;  5IQY A;  3GNJ A;  3QMX A;  2M80 A;  1HNA A;  2GQK A;  1ILO A;  2P31 A;  4IEL A;  2YJH A;  2AYT A;  3ED3 A;  1WE0 A;  3EU4 A;  2FGX A;  2V6K A;  2AUV A;  4NPB A;  3LG6 A;  2H6Y A;  5JWQ B;  2HT9 A;  5CNW A;  4XS6 A;  2GSQ A;  2QC7 A;  2F51 A;  3IPZ A;  2V1M A;  4OO5 A;  1AXD A;  1FVK A;  3IE3 A;  1XWK A;  5D73 A;  2B1L A;  5CYY A;  2PWJ A;  1OKT A;  7GSS A;  5FT3 A;  2VD1 A;  1XW9 A;  2MMA A;  5ID2 B;  3APQ A;  1IYI A;  4GRF A;  1V98 A;  3H8Q A;  4YAV A;  1XFL A;  1FOV A;  2GVP A;  2F3M A;  2LJA A;  1G7O A;  2VM1 A;  6GSU A;  2V2G A;  1M9B A;  3GYK A;  1TKD B;  4L0U A;  4MMM A;  2AAW A;  4MCU A;  3D21 A;  1M2A A;  4POL A;  1R4W A;  2HRF A;  3QR6 A;  1WMJ A;  3IDV A;  1XPV A;  4MH3 A;  2KUC A;  1HNC A;  2KHP A;  1PD2 1;  2VUP A;  1ON4 A;  1EOG A;  4ZB6 A;  1SK0 A;  2H0I A;  4Q5F A;  3DGQ A;  1K3O A;  3HZ4 A;  4G2E A;  3HJO A;  2I81 A;  1TU8 A;  3A2X A;  5D9V A;  2EIO A;  4G0L A;  1SJZ A;  2FA8 A;  3PIN A;  5GAP D;  4OWY A;  3FYG A;  2C4J A;  3VWU A;  1BJX A;  3U6V A;  1PKW A;  9GSS A;  5D96 A;  4LLR A;  5H5S A;  1T3B A;  5IMV A;  3LXT A;  5D8I A;  3TCO A;  3O76 A;  2K8S A;  5IO0 A;  2ZUP A;  1TI3 A;  4K7O A;  4K7I A;  3H1N A;  1SKW B;  2CVB A;  1WOU A;  3TKS E;  1TTZ A;  1XWB A;  4RI6 A;  1OC3 A;  1E6B A;  3S9F A;  4DSR A;  1I5G A;  5JWR B;  5A4V A;  5JCG A;  2GDR A;  3VI5 A;  2HQT A;  1GSE A;  2BTO T;  3IOS A;  5DJM A; 
#chains in the Genus database with same CATH topology
 3CSH A;  1LJR A;  3UAR A;  2CT6 A;  4FYU A;  5IMC A;  1HYU A;  2KLX A;  4F0C A;  2UZ8 A;  4PX1 A;  1B4P A;  2C3N A;  2P5R A;  1LU4 A;  1QGV A;  4ZL9 A;  3W8J A;  1SVM A;  2MMN A;  4GSN A;  1WJK A;  1GUK A;  2ALB A;  4XS1 A;  2MBS A;  5J3R A;  4PQI A;  2GS3 A;  1SD9 A;  2NDO A;  4ZB8 A;  3HD5 A;  1BF5 A;  2HSN B;  2IIY A;  4WBJ A;  2LEG A;  1BG5 A;  4OMV A;  4IVF A;  2HSM B;  3WT2 A;  3VK9 A;  1XWC A;  4NXI A;  4KDU A;  1XVW A;  2HZF A;  1M0U A;  1ERV A;  3DRN A;  3IXR A;  3KP8 A;  3GST A;  4G19 A;  4E8H A;  2B3S A;  5FHI A;  2LST A;  3A5W A;  1ERW A;  4FYC A;  2YP6 A;  2K8V A;  2O5V A;  5J4Y A;  2I1U A;  4V2L A;  4QQ7 A;  4I2T A;  3IA1 A;  5DAL A;  1WPI A;  4K9Z A;  4F03 A;  2YWI A;  4RQR A;  3GMF A;  5ENU A;  2GZZ A;  4TVE A;  1Y25 A;  5ECK B;  2FCH A;  2ON7 A;  1OE8 A;  2REM A;  6GSV A;  2GQM A;  4XRA A;  3HHV A;  1KTE A;  1MDJ A;  1S3R A;  2EFD A;  4PI0 C;  4Z2T A;  14GS A;  1Z6N A;  1FOH A;  2G0F A;  1A23 A;  1K3Y A;  2RUE A;  6GSS A;  1R7H A;  1TRS A;  2XC2 A;  4L5O A;  2VL2 A;  3F9U A;  4HU9 A;  3QOU A;  5COH A;  1FO5 A;  3BJ5 A;  3FEU A;  3KMO A;  3WGE A;  2FWE A;  3I9V 2;  2OAC A;  2H6Z A;  3HDC A;  4O5U A;  4G0I A;  1O73 A;  2QKE A;  16GS A;  2QA1 A;  2WCI A;  4X4J A;  4I8B A;  1JZO A;  3PPU A;  2E7P A;  1XBS A;  5EL8 A;  2BMX A;  2K9F A;  2XHF A;  5ECP B;  1OYJ A;  1B4Q A;  2MBT A;  3APS A;  3O3T A;  4CHS A;  1VRS D;  4GSS A;  1XVQ A;  5H5R A;  1A8Y A;  3G7I A;  4TR1 B;  4EXJ A;  1SEN A;  3RPN A;  1YKA A;  1V2A A;  3H79 A;  4BIK A;  3KH9 A;  2D2Z A;  3HVX A;  3HMJ G;  4ECC A;  2MYG A;  1GSD A;  3V1W A;  5CO3 A;  4BWQ A;  4K2X A;  5IMA A;  1AQX A;  2A2R A;  1U87 A;  2CA8 A;  5KN1 A;  1VF4 A;  1A0R P;  5F06 A;  1Z3E A;  1PX7 A;  1GSS A;  1GRX A;  5HFG A;  4N0Z A;  1SL0 B;  5EVO A;  5ECS A;  2E0Q A;  5ECL B;  2NVL A;  1ML6 A;  2V32 A;  2PU9 C;  3A5I A;  3DKS A;  1K0B A;  3MAK A;  4G01 A;  4X43 A;  3TRP A;  3GKX A;  2OKA A;  3APO A;  5DCG A;  1SK1 A;  1PX6 A;  1PA3 A;  2F9S A;  3C1R A;  3L9U A;  2YZH A;  2EIQ A;  5HFK A;  1GSU A;  4HJM A;  4X1U A;  3KIJ A;  3R2Q A;  3IAS 2;  2IJY A;  5KEJ A;  1R26 A;  1F9M A;  3D5J A;  1M2B A;  1TXX A;  3TU3 B;  4USS A;  2WB9 A;  2WZ9 A;  5A34 B;  5IPG A;  3GIX A;  1OC9 A;  1PL1 A;  1H75 A;  2LRT A;  1JZD A;  3ZFL A;  5CAX A;  2R3X A;  3KP9 A;  1JZW A;  5HQP A;  3BOA A;  1N8J A;  2A4V A;  3A2V A;  1LBK A;  3UAP A;  2L59 A;  2C0G A;  2G2Q A;  4Z2U A;  1A2L A;  2ZNM A;  1AQW A;  2KOK A;  3CXG A;  2B5E A;  5IMZ A;  3LSZ A;  1HD2 A;  3LXZ A;  3EC3 A;  1BAY A;  5IOX A;  5G1L A;  2VCQ A;  4N0V A;  1JFU A;  2H71 A;  2OT3 A;  3G7J A;  3GSS A;  3UOM A;  4AKG A;  3GKM A;  2DJK A;  3HJP A;  1ZOF A;  1TRV A;  1PRX A;  3FMW A;  5KN3 A;  4TXO A;  1TK0 B;  2CZ2 A;  4K5R A;  3M3M A;  3F4R A;  3UBK A;  1BYE A;  4V1A g;  4PGT A;  4MZC A;  2HZE B;  1PFO A;  2WJU A;  4TRX A;  5ABR A;  1AIU A;  6GSW A;  1PGT A;  3FR3 A;  2H72 A;  2FWF A;  3IHG A;  4L5L A;  2C0D A;  5IIZ A;  1YEX A;  3VPQ A;  2IMF A;  4JRR A;  5LCZ A;  4GCI A;  3CSI A;  2VL3 A;  4K2D A;  2X8C A;  1F37 A;  4ID0 A;  3ZML A;  1XW5 A;  4N30 A;  4FYB A;  1VGL A;  3HKR A;  5F0G A;  4EDY A;  4O32 A;  1EWX A;  2L57 A;  2YJ7 A;  3TJG A;  4BVX B;  1XIY A;  1U88 A;  3I43 A;  4MJE A;  4IBP A;  1HQO A;  1EV9 A;  4DSS B;  3WYW A;  1Q4J A;  5ID2 A;  2DIY A;  5C00 A;  1XXU A;  3L9V A;  4YAP A;  1GUL A;  4MJA A;  4QMK A;  3VWW A;  1XWA A;  2YPM A;  1B9X C;  3CMI A;  1HNB A;  1BED A;  5D9T A;  3ISO A;  2XBQ A;  1FW1 A;  1CQG A;  3LWA A;  3QDN A;  1O8W A;  1PSQ A;  3C73 A;  3E0U A;  1SD8 A;  4ZB7 A;  2CX3 A;  5CRW A;  4I97 A;  3FZ9 A;  1ZYQ B;  5HFI A;  2JAC A;  4HI7 A;  5AN1 A;  3HZ8 A;  2OBI A;  4JU5 A;  3C7M A;  4TR3 A;  3CRU A;  4DVC A;  3IC8 A;  2NPB A;  3F3R A;  4FQU A;  1SYX A;  3FKF A;  1S3A A;  1EP7 A;  1XCC A;  5IM9 A;  3QAG A;  2H0G A;  4FH8 A;  1FG4 A;  1YKC A;  2JU5 A;  3D4T A;  2IN3 A;  3IR4 A;  3FR9 A;  2MMO A;  4PUA A;  1GLQ A;  2WUL A;  5A1N A;  3GX0 A;  2GT5 A;  3TOT A;  3MDK A;  1EEJ A;  2PN8 A;  3M9J A;  2R5G A;  1EV4 A;  5LNK e;  2GQL A;  3QAW A;  3QCP A;  4YQU A;  3WGX A;  1Z7P A;  3TKS C;  1I9D A;  3KXO A;  5L71 A;  2CVD A;  3G9B A;  1TXU A;  1GP1 A;  2WVZ A;  3MIX A;  3RAZ A;  2H1D A;  4K8M A;  3ME7 A;  2H1G A;  1MEK A;  5ELA A;  3CTG A;  3ZRD A;  3MWH A;  1X0R A;  5A4W A;  3KH7 A;  3QFA C;  4J56 E;  4PNF A;  5J40 A;  2VM2 A;  2HNL A;  3A2W A;  4TW5 A;  2B6M A;  1A2M A;  2WW1 A;  5AGY A;  2HRK B;  1RQM A;  4EIQ A;  3I6A A;  2C0E A;  4XRD A;  4P3Y B;  3L4N A;  3VFI A;  1Y6E A;  3DXB A;  1PQN A;  2CVK A;  2X8G A;  4YKG A;  2DSA A;  3LJR A;  2VIM A;  4W66 A;  2PVO C;  3HA9 A;  3RBT A;  2L4Q A;  2VLT A;  2OBK A;  2C8U A;  4HUA A;  1SVL A;  4PQH A;  3IHQ A;  1GNE A;  1JZR A;  5J4U A;  2HSN A;  3TDG A;  1T8E B;  2HSM A;  3KMN A;  1V40 A;  1OVN A;  4IN0 A;  1I1I P;  2JSZ A;  2WDU A;  4HZ4 A;  4OFM A;  1UC7 A;  4KUN A;  4ULX A;  4I6X A;  10GS A;  1GLP A;  4K5S A;  1K3L A;  3FY7 A;  5GAN D;  2OA7 A;  1TU7 A;  2A2P A;  3ZZX A;  4Q5R A;  1MDK A;  4LMW A;  4IKH A;  1BQ7 A;  4V2N A;  2R4V A;  4XCS A;  1EP8 A;  1ZL9 A;  4ZBD A;  4ZXG A;  2N5B A;  2B7J A;  1A24 A;  2DJJ A;  4KAE A;  2PGT A;  2PMT A;  4O5R A;  5DJL A;  1YJ6 A;  4G10 A;  2CAQ A;  5AIV A;  4RI7 A;  3TJK A;  2GST A;  5DBQ A;  4F0B A;  1TOF A;  4KDY A;  2L5L A;  4MH2 A;  2H30 A;  3M8N A;  4YH2 A;  1WRY A;  1J9B A;  2H70 A;  1IYH A;  4N10 A;  3ZMK A;  4OO4 A;  2IMK A;  3ZIT A;  4BL7 B;  2YZU A;  2YV9 A;  3FZ4 A;  2C0F A;  3PGT A;  1GUH A;  1OE7 A;  3D0Z A;  2YN1 A;  4EDZ A;  2LQO A;  2FD3 A;  1X9W B;  1XW6 A;  3LFL A;  4MZW A;  1RW1 A;  1F6M C;  4EF0 A;  2H6X A;  5IPH A;  1VF2 A;  2EFC A;  1GSY A;  1THO A;  4I5Q A;  3BCI A;  2GGT A;  4KB3 A;  2E2M A;  3DML A;  4NV5 A;  4IGJ A;  4TR1 A;  3EIN A;  1GTI A;  3EE2 A;  1H4O A;  3L0H A;  5J9B A;  1ZYP A;  3RDW A;  2I9H A;  1EZK A;  17GS A;  1YZX A;  1VF1 A;  2K18 A;  1GTB A;  4AKX B;  1QQ2 A;  2R0P A;  1TK5 B;  2JL4 A;  1JLV A;  4CY8 A;  1ZZY A;  3EMX A;  2R37 A;  4X0X A;  2HYX A;  2M46 A;  1FHE A;  3VLN A;  3QFB C;  2C80 A;  3UBL A;  2DKI A;  1YEW C;  5ECI B;  4ML6 A;  4NMU A;  1ZCP A;  3DVW A;  4E68 A;  3TKQ A;  4ACS A;  3J7Y b;  1CQH A;  4CY6 A;  1M99 A;  5ECH B;  2YWN A;  3EWL A;  2IPA A;  1QXH A;  3FRC A;  2O89 A;  3TRX A;  3A3T A;  2Z9S A;  3DWV A;  4ISD A;  5DVB A;  4MJC A;  2N5F A;  4YQM A;  4ZL7 A;  1OKD A;  4GQF A;  3GH9 A;  4KF9 A;  20GS A;  3F4S A;  3FW2 A;  3IRA A;  3MNG A;  4MJB A;  3HVS A;  1AQV A;  1PN9 A;  5CRE A;  2HRA A;  3GV1 A;  5A34 A;  5C04 A;  3GKN A;  1EGO A;  1URM A;  4O5Q A;  4AF2 A;  2V41 A;  2VCV A;  2FHE A;  3N5O A;  2VLV A;  4AI6 A;  1TK8 B;  3D22 A;  2LRC A;  1GTU A;  4HU7 A;  1AC1 A;  2X4A A;  1X9S B;  3HJM A;  5D9X A;  2MZC A;  2JZS A;  2VL2 C;  3CYN A;  2WZS A;  2VCW A;  12GS A;  4MDC A;  2JAD A;  1THX A;  2ZCT A;  4PI2 C;  3Q18 A;  1DBY A;  4MF7 A;  5A5H B;  4N11 A;  4HOJ A;  2B7K A;  3DEX A;  4AGS A;  2WFC A;  2YNX A;  2LNS A;  2LV3 A;  2HZE A;  3UJ1 A;  2LS5 A;  2RUF A;  3RPP A;  2VD0 A;  2L4C A;  4BVY B;  1YF0 A;  2TIR A;  1GL8 A;  2YOI A;  5CRH A;  11GS A;  5A5K A;  2H1L A;  3KCM A;  5EY6 A;  4EL1 A;  1QUW A;  4LA1 A;  1EGR A;  4BWS A;  1YEP A;  2VCZ A;  4JED A;  1K0O A;  2P5Q A;  2GZY A;  3F63 A;  4G0K A;  4ILF A;  4PTS A;  1R5P A;  2R6K A;  3IK9 A;  4XHM A;  1A0F A;  3QAV A;  4PNG A;  3UL3 A;  4IJI A;  1S3C A;  2XBI A;  3TJB A;  4Q5N A;  4F2I A;  2PBJ A;  4LL1 B;  4MK3 A;  5ECO B;  4XS4 B;  4HSC X;  4BVX A;  3UMA A;  5B8B A;  4IP6 A;  5J9C A;  1GH2 A;  4IJ3 A;  2F8F A;  3I69 A;  1A2J A;  3GX8 A;  4DSS A;  4IQ1 A;  5G31 A;  4D73 B;  4KSM A;  1GSF A;  5DQY A;  2H1B A;  4K0G A;  1UN2 A;  1GUM A;  1B48 A;  4HZ2 A;  4NV2 A;  3M1G A;  3ZLP A;  5H5Q A;  4OD7 A;  5D9W A;  4WEY A;  4ZBB A;  5INY A;  1TRW A;  3ERW A;  1MD4 A;  4K1F A;  3LQ7 A;  2J23 A;  2OJL A;  4ZB9 A;  2L6C A;  3NOF A;  3DIE A;  3TUE A;  3GA4 A;  1X5D A;  1USB A;  5F8B A;  1PL2 A;  2H8L A;  3FK8 A;  3LW9 A;  2IME A;  4MLY A;  4ZBA A;  5IMF A;  3KEB A;  4WBR D;  5CRG A;  3UIW A;  1YY7 A;  5KOX A;  4WR5 A;  3VI7 A;  1U3I A;  1OC8 A;  1YDK A;  4PXO A;  2EFH A;  2GSR A;  1WP0 A;  1PMT A;  4Z7X A;  2VCX A;  1WWJ A;  3LEF A;  2DML A;  2VAF A;  3GKK A;  3P8W A;  5JCU A;  3BCK A;  4MF6 A;  4O92 A;  3ZL5 A;  2WVY A;  2X99 A;  3HY2 A;  2LUS A;  3UVH A;  1QK8 A;  2CX4 A;  2EC4 A;  3D4M A;  2LJK A;  4IHU A;  4GWR A;  3J7Y k;  4HS1 A;  2GZP A;  3ZIJ A;  2H76 A;  2BJX A;  1UA5 A;  4OFT A;  13GS A;  4AJ8 A;  4XTS A;  3Q6O A;  1O85 A;  2H75 A;  1V9W A;  2HSY A;  4KCE A;  4CDO A;  3GH6 A;  4MF5 A;  4WF4 A;  2DIZ A;  2CAI A;  1B8X A;  1U3A A;  1SKS B;  1Z5Y E;  2E2G A;  3D6I A;  1SU9 A;  2YAN A;  4KGI A;  4TR4 A;  5J47 A;  4POM A;  3FZA A;  2V6O A;  2TRX A;  3EMP A;  4HJ2 A;  5A4U A;  2IFQ B;  2HRK A;  4AJ7 A;  2C1Y A;  2YWO A;  2WW2 A;  2TRC P;  2ES7 A;  2VLU A;  1GTA A;  3UEM A;  6GSY A;  3LGC A;  3KM6 A;  1GSQ A;  2LQQ A;  4K6X A;  3O6T A;  5G1K A;  4K7N A;  1YF1 A;  1K0D A;  1V58 A;  2LRN A;  3GHA A;  1M3I A;  3SBC A;  1T4Y A;  4TOP A;  5DAK B;  2RII A;  3WGD A;  1DSB A;  2WRT A;  1K0M A;  5F07 A;  1TRU A;  5JWO B;  2GTU A;  2LJR A;  2JZT A;  2HI7 A;  2FA4 A;  5IO2 A;  3FZ5 A;  3AY8 A;  3W6G A;  3GTU A;  3IC4 A;  3ERF A;  3LYK A;  4FO5 A;  5B6M A;  1E2Y A;  1YVL A;  1SKR B;  1S3D A;  1NM3 A;  2DJ3 A;  1MTC A;  1XWG A;  4GDF A;  5AIS A;  2B5X A;  5LD0 A;  5KN2 A;  1F2E A;  4F82 A;  2VOC A;  1YQ1 A;  8GSS A;  1O8X A;  4LL4 B;  2KP2 A;  3VPT A;  1BX9 A;  1T4Z A;  5E59 A;  3L9S A;  2GLR A;  5DDL A;  2CQ9 A;  3ZTL A;  2PER A;  3C71 A;  5DQS A;  2H01 A;  3F8U A;  3KGK A;  5GZZ B;  3ERG A;  4DEJ A;  1FB0 A;  2B1K A;  2HLS A;  2OAD A;  2WVX B;  2QGV A;  4TN8 A;  1VF3 A;  2FWG A;  4WKW A;  1ZGN A;  1AUC A;  3VWX A;  3KJY A;  1JLW A;  1G6W A;  2JZR A;  4EE0 A;  4EO3 A;  5G2Z A;  4ZIL A;  4EC0 A;  1UVZ A;  1F3B A;  4KA0 A;  2DC5 A;  2AJQ B;  2F8A A;  4ECJ A;  3OR5 A;  5BMU B;  4JR4 A;  1KEB A;  3ZFB A;  4KCA A;  1XZO A;  5HR3 A;  4BL7 A;  2NBS A;  1TDI A;  4WF5 A;  2GSS A;  4OFN A;  2VKZ G;  3TKR A;  3NIV A;  4WET A;  4GLT A;  3RHB A;  1GNW A;  4HQS A;  1SYR A;  1FB6 A;  1NSW A;  3GTU B;  4JR6 A;  3TKP A;  2OE3 A;  5GSS A;  2YWM A;  1K0C A;  1Z9H A;  2IL3 A;  3WT1 A;  3M9K A;  2HRN A;  4F9Z A;  2FNO A;  1GWC A;  2VCT A;  2H0H A;  2FY6 A;  2YV7 A;  4QL7 A;  4MA9 A;  2FLS A;  4MNN A;  3DYR A;  3P90 A;  2MMZ A;  2EIR A;  5J5N A;  2M72 A;  1X5C A;  6GST A;  2EFE A;  1MDI A;  3CRT A;  5F05 A;  2DJ2 A;  1W89 A;  2IWT A;  4ML1 A;  3QPM A;  1K0A A;  1T1V A;  5B6N A;  3GN3 A;  3C1S A;  2GT6 A;  5HR2 A;  1M2D A;  5HR0 A;  3IK7 A;  4YQV A;  5GST A;  3BD2 A;  4Q5Q A;  2AV4 A;  3GL5 A;  2NTO A;  2L6D A;  4WXT A;  1J08 A;  1O6J A;  6GSX A;  2RM5 A;  2K6V A;  5AIX A;  4MZB A;  3H4K A;  3E3E A;  1T00 A;  3IAM 2;  5B7C A;  5G5E A;  2J9H A;  4K0N A;  3CQF A;  4POK A;  1TW9 A;  3KD0 A;  2LKU A;  1V57 A;  3R3E A;  1NHY A;  3ZYW A;  3HVV A;  3K8N A;  4FIW A;  4EVM A;  2H66 A;  4HDE A;  2C3T A;  4IP1 A;  4POB A;  3KZQ A;  5ECR B;  1SJ6 A;  4ECI A;  1DE2 A;  4TKY A;  1M9A A;  3MYD A;  5D93 A;  3HXS A;  4RUV A;  2X49 A;  4NHZ A;  3F0I A;  4O7H A;  2VL9 A;  1RK4 A;  1BG1 A;  2FUG 2;  3W8S A;  3F4T A;  4QL9 A;  1K0N A;  1WIK A;  3QD9 A;  4V1A p;  4JZQ A;  1R5A A;  1SJI A;  5ECM B;  3PH9 A;  4PHZ C;  3JCM L;  3PR8 A;  3BBY A;  3GUR A;  5A5H A;  4PUR A;  1J0F A;  2A2S A;  2OE1 A;  3CBU A;  2N5A A;  2HE3 A;  1ERT A;  4G9H A;  2O36 A;  1XOA A;  2LTK A;  5ECN B;  4OCE A;  3TB2 A;  3VUR A;  5BRT A;  4MP4 A;  1M7T A;  4KX4 A;  4OCF A;  1ZMA A;  2H74 A;  2O87 A;  3MSZ A;  1FVJ A;  1PKZ A;  2PPT A;  1O7U A;  1Y1U A;  4BVY A;  1TI1 A;  3VWV A;  4RQX A;  2IMI A;  3CTF A;  3DVX A;  3GUS A;  3KTB A;  1NHO A;  3NZN A;  3EVI A;  3TJJ A;  18GS A;  1Z7R A;  2VO4 A;  4PUF C;  2JSY A;  3N9J A;  2AB6 A;  3SWL A;  2O85 A;  2ON5 A;  1ACV A;  4IQA A;  3EUR A;  1G0T A;  5FWG A;  1O81 A;  3GRX A;  2CV4 A;  1ZYE A;  1AW9 A;  4AJ6 A;  3ZVJ D;  4GXZ A;  5IMD A;  3FR6 A;  22GS A;  4XS4 A;  1PN0 A;  4KE3 A;  4H86 A;  4NHW A;  2IMD A;  4DSQ A;  4D73 A;  2A4H A;  4WR4 A;  3RHC A;  3P7X A;  3HVN A;  2DLX A;  4I2U A;  2WGR A;  5DAL B;  3EU3 A;  3GL3 A;  5ECQ B;  2WW3 A;  4L8E A;  4KSO A;  2RLI A;  3C8E A;  2OE0 A;  4E8E A;  3CSJ A;  4TXV A;  1XOB A;  4IW9 A;  2X8H A;  4EUY A;  2WS2 A;  4J2F A;  1FAA A;  2DJ0 A;  4MAB A;  1U6T A;  2XPD A;  1Q98 A;  2R2J A;  5HR1 A;  2AHE A;  4AKI A;  5B8A A;  2P0G A;  3E9J B;  1ST9 A;  5DCH A;  2DBC A;  4MPG A;  5CP1 A;  3TGZ A;  4TR0 A;  5KN0 A;  2PUK C;  4MPF A;  4V2M A;  1G7E A;  1G6Y A;  5J41 A;  3UVT A;  4BPY A;  1W4V A;  4IS0 A;  1ABA A;  3ME8 A;  4NAX A;  1Z6M A;  1XG8 A;  2O7K A;  1DE1 A;  2DMM A;  2QA2 A;  2X64 A;  1SL2 B;  2C3Q A;  1SL1 B;  1T7P B;  4GF0 A;  3TJF A;  2L5O A;  3ZRE A;  4BA7 A;  3TOU A;  1NW2 A;  4ZIJ A;  5JCW A;  3RGB C;  1N2A A;  4CW9 A;  3CWG A;  1S4B P;  4AKH A;  1X5E A;  1KBN A;  3FHK A;  4Z2R A;  2IFQ A;  2I4A A;  4GQC A;  3G7Y A;  1MD3 A;  4J57 E;  2XPE A;  3Q74 A;  3IV4 A;  3HCZ A;  1C72 A;  4JBB A;  4L0W A;  3HYP A;  4JE1 A;  2LNT A;  4KW6 A;  5EPF A;  3U5R E;  1SK2 A;  2H73 A;  1SVO A;  1AAZ A;  4LMV A;  3M0F A;  1X9M B;  1ZYN A;  1JHB A;  2HXK A;  4ECB A;  2H1A A;  1EOH A;  3F6F A;  1OAZ A;  3P2A A;  3LYP A;  3IBH A;  5DAK A;  1KNG A;  2HSH A;  2CZ3 A;  4GTU A;  4HEA 2;  4FXY P;  2FWH A;  3US3 A;  2YCD A;  1OC9 B;  3F3Q A;  19GS A;  3DD3 A;  1EEM A;  1M3J A;  1ERU A;  5IOW A;  4KND A;  3H93 A;  4HQZ A;  1TJD A;  1QMV A;  3Q19 A;  1A8L A;  4EKZ A;  1DUG A;  2DJ1 A;  2O8V B;  3EYT A;  4GST A;  4KDX A;  1F3A A;  2UV8 G;  2DKH A;  2H19 A;  4XIH A;  3LOR A;  1B9Y C;  2HFD A;  3L78 A;  3KTL A;  1QFN A;  4ZL8 A;  4YKF A;  5ELG A;  3ZVJ A;  2WVX A;  2WW0 A;  2I3Y A;  5G30 A;  3TRQ A;  2KP1 A;  4TXO B;  5E4W A;  2PVQ A;  3WD6 A;  5J4V A;  4NWY A;  4PQ1 A;  3TKS A;  3GFK A;  4KH7 A;  3ZIV A;  3F6D A;  1TP9 A;  5G5F A;  2B5Y A;  2QSI A;  5CRD A;  5BMU A;  2RM6 A;  5IQY A;  3GNJ A;  3QMX A;  2M80 A;  1HNA A;  2GQK A;  1ILO A;  2P31 A;  4IEL A;  2YJH A;  2AYT A;  3ED3 A;  1WE0 A;  3EU4 A;  2FGX A;  2V6K A;  2AUV A;  4NPB A;  3LG6 A;  2H6Y A;  5JWQ B;  2HT9 A;  5CNW A;  4XS6 A;  2GSQ A;  2QC7 A;  2F51 A;  3IPZ A;  2V1M A;  4OO5 A;  1AXD A;  1FVK A;  3IE3 A;  1XWK A;  5D73 A;  2B1L A;  5CYY A;  2PWJ A;  1OKT A;  7GSS A;  5FT3 A;  2VD1 A;  1XW9 A;  2MMA A;  5ID2 B;  3APQ A;  1IYI A;  4GRF A;  1V98 A;  3H8Q A;  4YAV A;  1XFL A;  1FOV A;  2GVP A;  2F3M A;  2LJA A;  1G7O A;  2VM1 A;  4A5P A;  6GSU A;  2V2G A;  1M9B A;  3GYK A;  1TKD B;  4L0U A;  3RFR C;  4MMM A;  2AAW A;  3EPT A;  4MCU A;  3D21 A;  1M2A A;  4POL A;  1R4W A;  2HRF A;  3QR6 A;  1WMJ A;  3IDV A;  1XPV A;  4MH3 A;  4EIP A;  2KUC A;  1HNC A;  4N3Z A;  2KHP A;  1PD2 1;  2R0C A;  2VUP A;  2R0G A;  1ON4 A;  1EOG A;  4ZB6 A;  1SK0 A;  2H0I A;  4Q5F A;  3DGQ A;  1K3O A;  3HZ4 A;  4G2E A;  3HJO A;  2I81 A;  1TU8 A;  3A2X A;  5D9V A;  2EIO A;  4G0L A;  1SJZ A;  2FA8 A;  3PIN A;  5GAP D;  4OWY A;  3FYG A;  2C4J A;  3VWU A;  1BJX A;  3U6V A;  1PKW A;  9GSS A;  5D96 A;  4LLR A;  5H5S A;  1T3B A;  5IMV A;  3LXT A;  5A1N B;  5D8I A;  3TCO A;  3O76 A;  2K8S A;  5IO0 A;  2ZUP A;  1TI3 A;  4K7O A;  2O3E A;  4K7I A;  3H1N A;  1SKW B;  2CVB A;  1WOU A;  3TKS E;  1TTZ A;  1XWB A;  4RI6 A;  1OC3 A;  5KOW A;  1E6B A;  3S9F A;  4DSR A;  1N25 A;  1I5G A;  5JWR B;  5A4V A;  5JCG A;  2GDR A;  3VI5 A;  4ICY A;  2HQT A;  1GSE A;  3CHX C;  2BTO T;  3IOS A;  5DJM A; 
#chains in the Genus database with same CATH homology
 3CSH A;  1LJR A;  3UAR A;  2CT6 A;  4FYU A;  5IMC A;  1HYU A;  2KLX A;  4F0C A;  2UZ8 A;  4PX1 A;  1B4P A;  2C3N A;  2P5R A;  1LU4 A;  1QGV A;  4ZL9 A;  3W8J A;  1SVM A;  2MMN A;  4GSN A;  1WJK A;  1GUK A;  2ALB A;  4XS1 A;  2MBS A;  5J3R A;  4PQI A;  2GS3 A;  1SD9 A;  2NDO A;  4ZB8 A;  3HD5 A;  1BF5 A;  2HSN B;  2IIY A;  4WBJ A;  2LEG A;  1BG5 A;  4OMV A;  4IVF A;  2HSM B;  3WT2 A;  3VK9 A;  1XWC A;  4NXI A;  4KDU A;  1XVW A;  2HZF A;  1M0U A;  1ERV A;  3DRN A;  3IXR A;  3KP8 A;  3GST A;  4G19 A;  4E8H A;  2B3S A;  5FHI A;  2LST A;  3A5W A;  1ERW A;  4FYC A;  2YP6 A;  2K8V A;  2O5V A;  5J4Y A;  2I1U A;  4V2L A;  4QQ7 A;  4I2T A;  3IA1 A;  5DAL A;  1WPI A;  4K9Z A;  4F03 A;  2YWI A;  4RQR A;  3GMF A;  5ENU A;  2GZZ A;  4TVE A;  1Y25 A;  5ECK B;  2FCH A;  2ON7 A;  1OE8 A;  2REM A;  6GSV A;  2GQM A;  4XRA A;  3HHV A;  1KTE A;  1MDJ A;  2EFD A;  4Z2T A;  14GS A;  1Z6N A;  1FOH A;  2G0F A;  1A23 A;  1K3Y A;  2RUE A;  6GSS A;  1R7H A;  1TRS A;  2XC2 A;  4L5O A;  2VL2 A;  3F9U A;  4HU9 A;  3QOU A;  5COH A;  1FO5 A;  3BJ5 A;  3FEU A;  3KMO A;  3WGE A;  2FWE A;  3I9V 2;  2OAC A;  2H6Z A;  3HDC A;  4O5U A;  4G0I A;  1O73 A;  2QKE A;  16GS A;  2QA1 A;  2WCI A;  4X4J A;  4I8B A;  1JZO A;  3PPU A;  2E7P A;  1XBS A;  5EL8 A;  2BMX A;  2K9F A;  2XHF A;  5ECP B;  1OYJ A;  1B4Q A;  2MBT A;  3APS A;  3O3T A;  4CHS A;  1VRS D;  4GSS A;  1XVQ A;  5H5R A;  1A8Y A;  3G7I A;  4TR1 B;  4EXJ A;  1SEN A;  3RPN A;  1YKA A;  1V2A A;  3H79 A;  3KH9 A;  2D2Z A;  3HVX A;  3HMJ G;  4ECC A;  2MYG A;  1GSD A;  3V1W A;  5CO3 A;  4BWQ A;  4K2X A;  5IMA A;  1AQX A;  2A2R A;  1U87 A;  2CA8 A;  5KN1 A;  1VF4 A;  1A0R P;  5F06 A;  1Z3E A;  1PX7 A;  1GSS A;  1GRX A;  5HFG A;  4N0Z A;  1SL0 B;  5EVO A;  5ECS A;  2E0Q A;  5ECL B;  2NVL A;  1ML6 A;  2V32 A;  2PU9 C;  3A5I A;  3DKS A;  1K0B A;  3MAK A;  4G01 A;  4X43 A;  3TRP A;  3GKX A;  2OKA A;  3APO A;  5DCG A;  1SK1 A;  1PX6 A;  1PA3 A;  2F9S A;  3C1R A;  3L9U A;  2YZH A;  2EIQ A;  5HFK A;  1GSU A;  4HJM A;  4X1U A;  3KIJ A;  3R2Q A;  3IAS 2;  2IJY A;  5KEJ A;  1R26 A;  1F9M A;  3D5J A;  1M2B A;  1TXX A;  3TU3 B;  4USS A;  2WB9 A;  2WZ9 A;  5A34 B;  5IPG A;  3GIX A;  1OC9 A;  1PL1 A;  1H75 A;  2LRT A;  1JZD A;  3ZFL A;  5CAX A;  2R3X A;  3KP9 A;  1JZW A;  5HQP A;  3BOA A;  1N8J A;  2A4V A;  3A2V A;  1LBK A;  3UAP A;  2L59 A;  2C0G A;  2G2Q A;  4Z2U A;  1A2L A;  2ZNM A;  1AQW A;  2KOK A;  3CXG A;  2B5E A;  5IMZ A;  3LSZ A;  1HD2 A;  3LXZ A;  3EC3 A;  1BAY A;  5IOX A;  5G1L A;  2VCQ A;  4N0V A;  1JFU A;  2H71 A;  2OT3 A;  3G7J A;  3GSS A;  3UOM A;  4AKG A;  3GKM A;  2DJK A;  3HJP A;  1ZOF A;  1TRV A;  1PRX A;  3FMW A;  5KN3 A;  4TXO A;  1TK0 B;  2CZ2 A;  4K5R A;  3M3M A;  3F4R A;  3UBK A;  1BYE A;  4V1A g;  4PGT A;  4MZC A;  2HZE B;  4TRX A;  2WJU A;  5ABR A;  1AIU A;  6GSW A;  1PGT A;  3FR3 A;  2H72 A;  2FWF A;  3IHG A;  4L5L A;  2C0D A;  5IIZ A;  1YEX A;  3VPQ A;  2IMF A;  4JRR A;  5LCZ A;  4GCI A;  3CSI A;  2VL3 A;  4K2D A;  2X8C A;  1F37 A;  4ID0 A;  3ZML A;  1XW5 A;  4N30 A;  4FYB A;  1VGL A;  3HKR A;  5F0G A;  4EDY A;  4O32 A;  1EWX A;  2L57 A;  2YJ7 A;  3TJG A;  4BVX B;  1XIY A;  1U88 A;  3I43 A;  4MJE A;  4IBP A;  1HQO A;  1EV9 A;  4DSS B;  3WYW A;  1Q4J A;  5ID2 A;  2DIY A;  5C00 A;  1XXU A;  3L9V A;  4YAP A;  1GUL A;  4MJA A;  4QMK A;  3VWW A;  1XWA A;  2YPM A;  1B9X C;  3CMI A;  1HNB A;  1BED A;  5D9T A;  3ISO A;  2XBQ A;  1FW1 A;  1CQG A;  3LWA A;  3QDN A;  1O8W A;  1PSQ A;  3C73 A;  3E0U A;  1SD8 A;  4ZB7 A;  2CX3 A;  5CRW A;  4I97 A;  3FZ9 A;  1ZYQ B;  5HFI A;  2JAC A;  4HI7 A;  5AN1 A;  3HZ8 A;  2OBI A;  4JU5 A;  3C7M A;  4TR3 A;  3CRU A;  4DVC A;  3IC8 A;  2NPB A;  3F3R A;  4FQU A;  1SYX A;  3FKF A;  1S3A A;  1EP7 A;  1XCC A;  5IM9 A;  3QAG A;  2H0G A;  4FH8 A;  1FG4 A;  1YKC A;  2JU5 A;  3D4T A;  2IN3 A;  3IR4 A;  3FR9 A;  2MMO A;  4PUA A;  1GLQ A;  2WUL A;  5A1N A;  3GX0 A;  2GT5 A;  3TOT A;  3MDK A;  1EEJ A;  2PN8 A;  3M9J A;  2R5G A;  1EV4 A;  5LNK e;  2GQL A;  3QAW A;  3QCP A;  4YQU A;  3WGX A;  1Z7P A;  3TKS C;  1I9D A;  3KXO A;  5L71 A;  2CVD A;  3G9B A;  1TXU A;  1GP1 A;  3MIX A;  3RAZ A;  2H1D A;  4K8M A;  3ME7 A;  2H1G A;  1MEK A;  5ELA A;  3CTG A;  3ZRD A;  3MWH A;  1X0R A;  5A4W A;  3KH7 A;  3QFA C;  4J56 E;  4PNF A;  5J40 A;  2VM2 A;  2HNL A;  3A2W A;  4TW5 A;  2B6M A;  1A2M A;  5AGY A;  2HRK B;  1RQM A;  4EIQ A;  3I6A A;  2C0E A;  4XRD A;  4P3Y B;  3L4N A;  3VFI A;  1Y6E A;  3DXB A;  1PQN A;  2CVK A;  2X8G A;  4YKG A;  2DSA A;  3LJR A;  2VIM A;  4W66 A;  2PVO C;  3HA9 A;  3RBT A;  2L4Q A;  2VLT A;  2OBK A;  2C8U A;  4HUA A;  1SVL A;  4PQH A;  3IHQ A;  1GNE A;  1JZR A;  5J4U A;  2HSN A;  3TDG A;  1T8E B;  2HSM A;  3KMN A;  1V40 A;  1OVN A;  4IN0 A;  2JSZ A;  2WDU A;  4HZ4 A;  4OFM A;  1UC7 A;  4KUN A;  4ULX A;  4I6X A;  10GS A;  1GLP A;  4K5S A;  1K3L A;  3FY7 A;  5GAN D;  2OA7 A;  1TU7 A;  2A2P A;  3ZZX A;  4Q5R A;  1MDK A;  4LMW A;  4IKH A;  1BQ7 A;  4V2N A;  2R4V A;  4XCS A;  1EP8 A;  1ZL9 A;  4ZBD A;  4ZXG A;  2N5B A;  2B7J A;  1A24 A;  2DJJ A;  4KAE A;  2PGT A;  2PMT A;  4O5R A;  5DJL A;  1YJ6 A;  4G10 A;  2CAQ A;  5AIV A;  4RI7 A;  3TJK A;  2GST A;  5DBQ A;  4F0B A;  1TOF A;  4KDY A;  2L5L A;  4MH2 A;  2H30 A;  3M8N A;  4YH2 A;  1WRY A;  1J9B A;  2H70 A;  1IYH A;  4N10 A;  3ZMK A;  4OO4 A;  2IMK A;  3ZIT A;  4BL7 B;  2YZU A;  2YV9 A;  3FZ4 A;  2C0F A;  3PGT A;  1GUH A;  1OE7 A;  3D0Z A;  2YN1 A;  4EDZ A;  2LQO A;  2FD3 A;  1X9W B;  1XW6 A;  3LFL A;  4MZW A;  1RW1 A;  1F6M C;  4EF0 A;  2H6X A;  5IPH A;  1VF2 A;  2EFC A;  1GSY A;  1THO A;  4I5Q A;  3BCI A;  2GGT A;  4KB3 A;  2E2M A;  3DML A;  4NV5 A;  4IGJ A;  4TR1 A;  3EIN A;  1GTI A;  3EE2 A;  1H4O A;  3L0H A;  5J9B A;  1ZYP A;  3RDW A;  2I9H A;  1EZK A;  17GS A;  1YZX A;  1VF1 A;  2K18 A;  1GTB A;  4AKX B;  1QQ2 A;  2R0P A;  1TK5 B;  2JL4 A;  1JLV A;  4CY8 A;  1ZZY A;  3EMX A;  2R37 A;  4X0X A;  2HYX A;  2M46 A;  1FHE A;  3VLN A;  3QFB C;  2C80 A;  3UBL A;  2DKI A;  5ECI B;  4ML6 A;  4NMU A;  1ZCP A;  3DVW A;  4E68 A;  3TKQ A;  4ACS A;  3J7Y b;  1CQH A;  4CY6 A;  1M99 A;  5ECH B;  2YWN A;  3EWL A;  2IPA A;  1QXH A;  3FRC A;  2O89 A;  3TRX A;  3A3T A;  2Z9S A;  3DWV A;  4ISD A;  5DVB A;  4MJC A;  2N5F A;  4YQM A;  4ZL7 A;  1OKD A;  4GQF A;  3GH9 A;  4KF9 A;  20GS A;  3F4S A;  3FW2 A;  3IRA A;  3MNG A;  4MJB A;  3HVS A;  1AQV A;  1PN9 A;  5CRE A;  2HRA A;  3GV1 A;  5A34 A;  5C04 A;  3GKN A;  1EGO A;  1URM A;  4O5Q A;  4AF2 A;  2V41 A;  2VCV A;  2FHE A;  3N5O A;  2VLV A;  4AI6 A;  1TK8 B;  3D22 A;  2LRC A;  1GTU A;  4HU7 A;  1AC1 A;  2X4A A;  1X9S B;  3HJM A;  5D9X A;  2MZC A;  2JZS A;  2VL2 C;  3CYN A;  2VCW A;  12GS A;  4MDC A;  2JAD A;  1THX A;  2ZCT A;  3Q18 A;  1DBY A;  4MF7 A;  5A5H B;  4N11 A;  4HOJ A;  2B7K A;  3DEX A;  4AGS A;  2WFC A;  2YNX A;  2LNS A;  2LV3 A;  2HZE A;  3UJ1 A;  2LS5 A;  2RUF A;  3RPP A;  2VD0 A;  2L4C A;  4BVY B;  1YF0 A;  2TIR A;  1GL8 A;  2YOI A;  5CRH A;  11GS A;  5A5K A;  2H1L A;  3KCM A;  5EY6 A;  4EL1 A;  1QUW A;  4LA1 A;  1EGR A;  4BWS A;  1YEP A;  2VCZ A;  4JED A;  1K0O A;  2P5Q A;  2GZY A;  3F63 A;  4G0K A;  4ILF A;  4PTS A;  1R5P A;  2R6K A;  3IK9 A;  4XHM A;  1A0F A;  3QAV A;  4PNG A;  3UL3 A;  4IJI A;  1S3C A;  2XBI A;  3TJB A;  4Q5N A;  4F2I A;  2PBJ A;  4LL1 B;  4MK3 A;  5ECO B;  4XS4 B;  4BVX A;  3UMA A;  5B8B A;  4IP6 A;  5J9C A;  1GH2 A;  4IJ3 A;  2F8F A;  3I69 A;  1A2J A;  3GX8 A;  4DSS A;  4IQ1 A;  5G31 A;  4D73 B;  4KSM A;  1GSF A;  5DQY A;  2H1B A;  4K0G A;  1UN2 A;  1GUM A;  1B48 A;  4HZ2 A;  4NV2 A;  3M1G A;  3ZLP A;  5H5Q A;  4OD7 A;  5D9W A;  4WEY A;  4ZBB A;  5INY A;  1TRW A;  3ERW A;  1MD4 A;  4K1F A;  3LQ7 A;  2J23 A;  2OJL A;  4ZB9 A;  2L6C A;  3NOF A;  3DIE A;  3TUE A;  3GA4 A;  1X5D A;  1USB A;  5F8B A;  1PL2 A;  2H8L A;  3FK8 A;  3LW9 A;  2IME A;  4MLY A;  4ZBA A;  5IMF A;  3KEB A;  4WBR D;  5CRG A;  3UIW A;  1YY7 A;  5KOX A;  4WR5 A;  3VI7 A;  1U3I A;  1OC8 A;  1YDK A;  4PXO A;  2EFH A;  2GSR A;  1WP0 A;  1PMT A;  4Z7X A;  2VCX A;  1WWJ A;  3LEF A;  2DML A;  2VAF A;  3GKK A;  3P8W A;  5JCU A;  3BCK A;  4MF6 A;  4O92 A;  3ZL5 A;  2X99 A;  3HY2 A;  2LUS A;  3UVH A;  1QK8 A;  2CX4 A;  2EC4 A;  3D4M A;  2LJK A;  4IHU A;  4GWR A;  3J7Y k;  4HS1 A;  2GZP A;  3ZIJ A;  2H76 A;  2BJX A;  1UA5 A;  4OFT A;  13GS A;  4AJ8 A;  4XTS A;  3Q6O A;  1O85 A;  2H75 A;  1V9W A;  2HSY A;  4KCE A;  4CDO A;  3GH6 A;  4MF5 A;  4WF4 A;  2DIZ A;  2CAI A;  1B8X A;  1U3A A;  1SKS B;  1Z5Y E;  2E2G A;  3D6I A;  1SU9 A;  2YAN A;  4KGI A;  4TR4 A;  5J47 A;  4POM A;  3FZA A;  2V6O A;  2TRX A;  3EMP A;  4HJ2 A;  5A4U A;  2IFQ B;  2HRK A;  4AJ7 A;  2C1Y A;  2YWO A;  2TRC P;  2ES7 A;  2VLU A;  1GTA A;  3UEM A;  6GSY A;  3LGC A;  3KM6 A;  1GSQ A;  2LQQ A;  4K6X A;  3O6T A;  5G1K A;  4K7N A;  1YF1 A;  1K0D A;  1V58 A;  2LRN A;  3GHA A;  3SBC A;  1T4Y A;  4TOP A;  5DAK B;  2RII A;  3WGD A;  1DSB A;  2WRT A;  1K0M A;  5F07 A;  1TRU A;  5JWO B;  2GTU A;  2LJR A;  2JZT A;  2HI7 A;  2FA4 A;  5IO2 A;  3FZ5 A;  3AY8 A;  3W6G A;  3GTU A;  3IC4 A;  3ERF A;  3LYK A;  4FO5 A;  5B6M A;  1E2Y A;  1YVL A;  1SKR B;  1S3D A;  1NM3 A;  2DJ3 A;  1MTC A;  1XWG A;  4GDF A;  5AIS A;  2B5X A;  5LD0 A;  5KN2 A;  1F2E A;  4F82 A;  2VOC A;  1YQ1 A;  8GSS A;  1O8X A;  4LL4 B;  2KP2 A;  3VPT A;  1BX9 A;  1T4Z A;  5E59 A;  3L9S A;  2GLR A;  5DDL A;  2CQ9 A;  3ZTL A;  2PER A;  3C71 A;  5DQS A;  2H01 A;  3F8U A;  3KGK A;  5GZZ B;  3ERG A;  4DEJ A;  1FB0 A;  2B1K A;  2HLS A;  2OAD A;  2QGV A;  4TN8 A;  1VF3 A;  2FWG A;  4WKW A;  1ZGN A;  1AUC A;  3VWX A;  3KJY A;  1JLW A;  1G6W A;  2JZR A;  4EE0 A;  4EO3 A;  5G2Z A;  4ZIL A;  4EC0 A;  1UVZ A;  1F3B A;  4KA0 A;  2DC5 A;  2AJQ B;  2F8A A;  4ECJ A;  3OR5 A;  5BMU B;  4JR4 A;  1KEB A;  3ZFB A;  4KCA A;  1XZO A;  5HR3 A;  4BL7 A;  2NBS A;  1TDI A;  4WF5 A;  2GSS A;  4OFN A;  2VKZ G;  3TKR A;  3NIV A;  4WET A;  4GLT A;  3RHB A;  1GNW A;  4HQS A;  1SYR A;  1FB6 A;  1NSW A;  3GTU B;  4JR6 A;  3TKP A;  2OE3 A;  5GSS A;  2YWM A;  1K0C A;  1Z9H A;  2IL3 A;  3WT1 A;  3M9K A;  2HRN A;  4F9Z A;  2FNO A;  1GWC A;  2VCT A;  2H0H A;  2FY6 A;  2YV7 A;  4QL7 A;  4MA9 A;  2FLS A;  4MNN A;  3DYR A;  3P90 A;  2MMZ A;  2EIR A;  5J5N A;  2M72 A;  1X5C A;  6GST A;  2EFE A;  1MDI A;  3CRT A;  5F05 A;  2DJ2 A;  1W89 A;  2IWT A;  4ML1 A;  3QPM A;  1K0A A;  1T1V A;  5B6N A;  3GN3 A;  3C1S A;  2GT6 A;  5HR2 A;  1M2D A;  5HR0 A;  3IK7 A;  4YQV A;  5GST A;  3BD2 A;  4Q5Q A;  2AV4 A;  3GL5 A;  2NTO A;  2L6D A;  4WXT A;  1J08 A;  1O6J A;  6GSX A;  2RM5 A;  2K6V A;  5AIX A;  4MZB A;  3H4K A;  3E3E A;  1T00 A;  3IAM 2;  5B7C A;  5G5E A;  2J9H A;  4K0N A;  4POK A;  1TW9 A;  3KD0 A;  2LKU A;  1V57 A;  3R3E A;  1NHY A;  3ZYW A;  3HVV A;  3K8N A;  4FIW A;  4EVM A;  2H66 A;  4HDE A;  2C3T A;  4IP1 A;  4POB A;  3KZQ A;  5ECR B;  1SJ6 A;  4ECI A;  1DE2 A;  4TKY A;  1M9A A;  3MYD A;  5D93 A;  3HXS A;  4RUV A;  2X49 A;  4NHZ A;  3F0I A;  4O7H A;  2VL9 A;  1RK4 A;  1BG1 A;  2FUG 2;  3W8S A;  3F4T A;  4QL9 A;  1K0N A;  1WIK A;  3QD9 A;  4V1A p;  4JZQ A;  1R5A A;  1SJI A;  5ECM B;  3PH9 A;  3JCM L;  3PR8 A;  3BBY A;  3GUR A;  5A5H A;  4PUR A;  1J0F A;  2A2S A;  2OE1 A;  3CBU A;  2N5A A;  2HE3 A;  1ERT A;  4G9H A;  1XOA A;  2LTK A;  5ECN B;  4OCE A;  3TB2 A;  3VUR A;  5BRT A;  4MP4 A;  1M7T A;  4KX4 A;  4OCF A;  1ZMA A;  2H74 A;  2O87 A;  3MSZ A;  1FVJ A;  1PKZ A;  2PPT A;  1O7U A;  1Y1U A;  4BVY A;  1TI1 A;  3VWV A;  4RQX A;  2IMI A;  3CTF A;  3DVX A;  3GUS A;  3KTB A;  1NHO A;  3NZN A;  3EVI A;  3TJJ A;  18GS A;  1Z7R A;  2VO4 A;  4PUF C;  2JSY A;  3N9J A;  2AB6 A;  3SWL A;  2O85 A;  2ON5 A;  1ACV A;  4IQA A;  3EUR A;  1G0T A;  5FWG A;  1O81 A;  3GRX A;  2CV4 A;  1ZYE A;  1AW9 A;  4AJ6 A;  3ZVJ D;  4GXZ A;  5IMD A;  3FR6 A;  22GS A;  4XS4 A;  1PN0 A;  4KE3 A;  4H86 A;  4NHW A;  2IMD A;  4DSQ A;  4D73 A;  2A4H A;  4WR4 A;  3RHC A;  3P7X A;  2DLX A;  4I2U A;  2WGR A;  5DAL B;  3EU3 A;  3GL3 A;  5ECQ B;  4L8E A;  4KSO A;  2RLI A;  3C8E A;  2OE0 A;  4E8E A;  3CSJ A;  4TXV A;  1XOB A;  4IW9 A;  2X8H A;  4EUY A;  2WS2 A;  4J2F A;  1FAA A;  2DJ0 A;  4MAB A;  1U6T A;  2XPD A;  1Q98 A;  2R2J A;  5HR1 A;  2AHE A;  4AKI A;  5B8A A;  2P0G A;  3E9J B;  1ST9 A;  5DCH A;  2DBC A;  4MPG A;  5CP1 A;  3TGZ A;  4TR0 A;  5KN0 A;  2PUK C;  4MPF A;  4V2M A;  1G7E A;  1G6Y A;  5J41 A;  3UVT A;  4BPY A;  1W4V A;  4IS0 A;  1ABA A;  3ME8 A;  4NAX A;  1Z6M A;  2O7K A;  1DE1 A;  2DMM A;  2QA2 A;  2X64 A;  1SL2 B;  2C3Q A;  1SL1 B;  1T7P B;  4GF0 A;  3TJF A;  2L5O A;  3ZRE A;  4BA7 A;  3TOU A;  1NW2 A;  4ZIJ A;  5JCW A;  1N2A A;  4CW9 A;  3CWG A;  4AKH A;  1X5E A;  1KBN A;  3FHK A;  4Z2R A;  2IFQ A;  2I4A A;  4GQC A;  3G7Y A;  1MD3 A;  4J57 E;  2XPE A;  3Q74 A;  3IV4 A;  3HCZ A;  1C72 A;  4JBB A;  4L0W A;  3HYP A;  4JE1 A;  2LNT A;  4KW6 A;  5EPF A;  3U5R E;  1SK2 A;  2H73 A;  1SVO A;  1AAZ A;  4LMV A;  3M0F A;  1X9M B;  1ZYN A;  1JHB A;  2HXK A;  4ECB A;  2H1A A;  1EOH A;  3F6F A;  1OAZ A;  3P2A A;  3LYP A;  3IBH A;  5DAK A;  1KNG A;  2HSH A;  2CZ3 A;  4GTU A;  4HEA 2;  2FWH A;  3US3 A;  2YCD A;  1OC9 B;  3F3Q A;  19GS A;  3DD3 A;  1EEM A;  1ERU A;  5IOW A;  4KND A;  3H93 A;  4HQZ A;  1TJD A;  1QMV A;  3Q19 A;  1A8L A;  4EKZ A;  1DUG A;  2DJ1 A;  2O8V B;  3EYT A;  4GST A;  4KDX A;  1F3A A;  2UV8 G;  2DKH A;  2H19 A;  4XIH A;  3LOR A;  1B9Y C;  2HFD A;  3L78 A;  3KTL A;  1QFN A;  4ZL8 A;  4YKF A;  5ELG A;  3ZVJ A;  2I3Y A;  5G30 A;  3TRQ A;  2KP1 A;  4TXO B;  5E4W A;  2PVQ A;  3WD6 A;  5J4V A;  4NWY A;  4PQ1 A;  3TKS A;  3GFK A;  4KH7 A;  3ZIV A;  3F6D A;  1TP9 A;  5G5F A;  2B5Y A;  2QSI A;  5CRD A;  5BMU A;  2RM6 A;  5IQY A;  3GNJ A;  3QMX A;  2M80 A;  1HNA A;  2GQK A;  1ILO A;  2P31 A;  4IEL A;  2YJH A;  2AYT A;  3ED3 A;  1WE0 A;  3EU4 A;  2FGX A;  2V6K A;  2AUV A;  4NPB A;  3LG6 A;  2H6Y A;  5JWQ B;  2HT9 A;  5CNW A;  4XS6 A;  2GSQ A;  2QC7 A;  2F51 A;  3IPZ A;  2V1M A;  4OO5 A;  1AXD A;  1FVK A;  3IE3 A;  1XWK A;  5D73 A;  2B1L A;  5CYY A;  2PWJ A;  1OKT A;  7GSS A;  5FT3 A;  2VD1 A;  1XW9 A;  2MMA A;  5ID2 B;  3APQ A;  1IYI A;  4GRF A;  1V98 A;  3H8Q A;  4YAV A;  1XFL A;  1FOV A;  2GVP A;  2F3M A;  2LJA A;  1G7O A;  2VM1 A;  4A5P A;  6GSU A;  2V2G A;  1M9B A;  3GYK A;  1TKD B;  4L0U A;  4MMM A;  2AAW A;  3EPT A;  4MCU A;  3D21 A;  1M2A A;  4POL A;  1R4W A;  2HRF A;  3QR6 A;  1WMJ A;  3IDV A;  1XPV A;  4MH3 A;  4EIP A;  2KUC A;  1HNC A;  4N3Z A;  2KHP A;  1PD2 1;  2R0C A;  2VUP A;  2R0G A;  1ON4 A;  1EOG A;  4ZB6 A;  1SK0 A;  2H0I A;  4Q5F A;  3DGQ A;  1K3O A;  3HZ4 A;  4G2E A;  3HJO A;  2I81 A;  1TU8 A;  3A2X A;  5D9V A;  2EIO A;  4G0L A;  1SJZ A;  2FA8 A;  3PIN A;  5GAP D;  4OWY A;  3FYG A;  2C4J A;  3VWU A;  1BJX A;  3U6V A;  1PKW A;  9GSS A;  5D96 A;  4LLR A;  5H5S A;  1T3B A;  5IMV A;  3LXT A;  5A1N B;  5D8I A;  3TCO A;  3O76 A;  2K8S A;  5IO0 A;  2ZUP A;  1TI3 A;  4K7O A;  4K7I A;  3H1N A;  1SKW B;  2CVB A;  1WOU A;  3TKS E;  1TTZ A;  1XWB A;  4RI6 A;  1OC3 A;  5KOW A;  1E6B A;  3S9F A;  4DSR A;  1N25 A;  1I5G A;  5JWR B;  5A4V A;  5JCG A;  2GDR A;  3VI5 A;  4ICY A;  2HQT A;  1GSE A;  2BTO T;  3IOS A;  5DJM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...