4KX4A

Crystal structure of escherichia coli glutaredoxin 2 complex with glutathione
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
217
structure length
217
Chain Sequence
SAMKLYIYDHCPYCLKARMIFGLKNIPVELHVLLNDDAETPTRMVGQKQVPILQKDDSRYMPESMDIVHYVDKLDGKPLLTGKRSPAIDEWLRKVNGYANKLLLPRFAKSAFDEFSTPAARKYFVDKKEASAGNFADLLAHSDGLIKNISDDLRALDKLIVKPNAVNGELSEDDIQLFPLLRNLTLVAGINWPSRVADYRDNMAKQTQINLLSSMAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaredoxin-2
publication title Crystal structures of E.coli glutaredoxin 2 with glutathione and of a mutant C9S/C12S without glutathione
rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 82
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2013-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04399 Glutaredoxin2_C Glutaredoxin 2, C terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4kx4A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4kx4A01
3IR4A 1YF0A 5ELGA 2FY6A 2JADA 4MH2A 1TKDB 5D96A 1TK8B 3KD0A 5CAXA 3DKSA 1XW9A 2ZCTA 4OWYA 5ECKB 1OE7A 2V41A 3VPTA 2I4AA 1ZL9A 4K7NA 2FNOA 1GLPA 2RM6A 1NM3A 12GSA 2V6OA 3BD2A 3KZQA 3P2AA 1TI3A 2J23A 1GWCA 1O85A 4J56E 4TXOA 2VO4A 1VF1A 4WBJA 4KE3A 4IKHA 1WMJA 13GSA 5IIZA 1JZWA 3LSZA 1SL1B 5HR1A 4TVEA 3LFLA 5D9VA 2MYGA 1QQ2A 2C3QA 4L5OA 2FWEA 4G10A 5DAKB 3F9UA 4TOPA 1AXDA 1R26A 3N5OA 2CZ3A 4IJ3A 3PR8A 2K9FA 6GSSA 1OVNA 2F51A 3Q19A 4K7IA 1OC9B 5L71A 3ZFBA 1URMA 4TXVA 4XS4B 1M2DA 2ZUPA 4TR3A 4ML6A 4V1Ap 1PX7A 1ERUA 3AY8A 5CRGA 2C80A 2BJXA 3UJ1A 1OAZA 5C00A 4O5RA 3MDKA 1TRSA 1VF3A 3VFIA 1TOFA 4MJAA 1SKRB 5G1KA 5BMUA 3GYKA 14GSA 2HZFA 2DC5A 4ZB6A 3P7XA 3QAGA 5DBQA 1AAZA 3IOSA 5HR2A 1X5EA 1X9MB 1FOVA 1EGOA 3FR9A 5DVBA 2OBKA 4XCSA 2J9HA 3TJKA 1M9AA 1ZOFA 4POMA 1AQXA 3FZ5A 5LCZA 3QOUA 1K0CA 3PH9A 2PVOC 4G19A 2VCZA 5B6NA 4YQUA 1BEDA 3CSIA 1JZDA 3M9KA 3JCML 1K3YA 2N5BA 2GDRA 2WGRA 2K8VA 4OFMA 3RPPA 1WP0A 5JCUA 20GSA 4JR6A 4PX1A 3CTGA 1MD4A 2DJJA 1J08A 4NHWA 4MK3A 3HHVA 1LJRA 5G1LA 4QL9A 1EV4A 2VIMA 3ZMKA 4WKWA 1GSYA 2GVPA 1ZZYA 2GSQA 3RPNA 2VL2C 1GSEA 1PA3A 1BAYA 4DSSA 1E6BA 3ME7A 2AAWA 1A2JA 4PNGA 1LU4A 3FKFA 4JRRA 2C0EA 2PN8A 5IM9A 2QKEA 1EOGA 2AB6A 2JZRA 3I9V2 4J2FA 1EZKA 5INYA 4GXZA 3RBTA 2HSHA 1W4VA 3VK9A 4PURA 2I1UA 1O7UA 2YWIA 2VL9A 3LYKA 1O6JA 4LA1A 3IDVA 2DMLA 2HRAA 1HD2A 3VPQA 4XHMA 2FHEA 5KN0A 3TRXA 2DJ3A 1FB0A 3GH6A 1XOBA 2JU5A 2XPDA 3TRPA 5ECHB 2C4JA 2B5YA 4WXTA 2V32A 4IELA 1GTIA 1YQ1A 1ZYQB 5JWQB 1ML6A 3FW2A 2LJAA 3UOMA 2NTOA 3O76A 2OE1A 1ACVA 3C7MA 4KSMA 2AHEA 2X8GA 1GSFA 1T4YA 3C71A 3GL5A 2PUKC 1Q4JA 1OYJA 3TJBA 1XW6A 2R37A 3EMXA 3LQ7A 4JU5A 1TP9A 1XWBA 3TOUA 5A4WA 2A2RA 4MMMA 3IV4A 4FYUA 5DJLA 2IIYA 2MBSA 2HRKA 3KMNA 4HOJA 4OCFA 1EEMA 2PPTA 2GLRA 2YV7A 3HCZA 4V1Ag 2PGTA 5CRWA 5HFGA 4GSNA 2LS5A 3LGCA 22GSA 5IMVA 1WRYA 4X1UA 3A5WA 2IMKA 1KTEA 3IBHA 5JWRB 2K6VA 1XVQA 3FY7A 5DJMA 1WOUA 4HJMA 4DSQA 1THXA 4KB3A 2JSYA 3G7YA 1N8JA 2JZSA 5ECSA 3TCOA 2B1LA 1TU8A 1YEPA 3QAVA 1B4QA 1F6MC 4MZWA 1QXHA 1DUGA 3EMPA 1XOAA 3CBUA 1X5CA 1A2MA 2R6KA 4E8HA 2LNSA 5HFIA 3TKRA 1A8YA 4EC0A 1C72A 1GNWA 4RQXA 3CMIA 5DCHA 4AJ8A 2VL3A 2VCXA 4IS0A 4K2DA 3MAKA 2A2SA 4O32A 5B8AA 2HLSA 3W8JA 3HJOA 5EL8A 11GSA 1R4WA 3IAS2 5IMFA 1F2EA 3C8EA 1M2AA 3FZAA 2GQMA 1G7OA 2H70A 3KCMA 1TXXA 3GKMA 1DE2A 4V2MA 4YQMA 3LG6A 3P8WA 5GSTA 5LD0A 1WJKA 1DE1A 1T4ZA 3QFBC 3RHBA 2V6KA 4RI6A 2WCIA 3KTLA 4HUAA 2NPBA 3GSSA 1T8EB 4LL1B 4MZCA 5KN1A 3VLNA 3PINA 5DAKA 3H79A 1K0OA 4YAVA 1MD3A 4TR1B 2PERA 3KP9A 3GTUB 5KEJA 2N5FA 1MDJA 3D4TA 1XVWA 2H8LA 4HQSA 3TKSA 1H4OA 2AV4A 2GZPA 3DRNA 5H5RA 3TDGA 1OC9A 2LUSA 2RIIA 3RAZA 3FYGA 4XS4A 3LJRA 4PQIA 4POKA 3H8QA 4TW5A 3GX8A 2VUPA 5IO0A 4ECIA 2B7KA 1G7EA 4MP4A 4WF5A 5DQSA 3WGXA 2QSIA 1Q98A 3QDNA 2FWFA 3HZ4A 3DD3A 3ZITA 2OE0A 3U6VA 3HVSA 3R3EA 1YZXA 2VLVA 1M2BA 1NW2A 2GT6A 5J3RA 1T00A 1SKSB 3GRXA 5JCWA 4Q5QA 4ECJA 4CHSA 4ZIJA 3D4MA 3IK7A 2DBCA 4HZ2A 2PVQA 4IBPA 5FT3A 1Z6NA 3EU3A 4WF4A 2C8UA 2K8SA 2GS3A 2X8CA 5ENUA 1ABAA 2LJKA 1V2AA 1U87A 1JFUA 4FIWA 2MZCA 5IMCA 3GKKA 1PX6A 1XPVA 3WD6A 1AC1A 1NHOA 1YKCA 2H6XA 3F4RA 2OE3A 3QMXA 3O6TA 4MF7A 2B6MA 1TRVA 1UN2A 6GSYA 1K3OA 3ZZXA 4HJ2A 4XRDA 2PMTA 2PBJA 3FHKA 3BCIA 3KP8A 4NAXA 5IOWA 4ID0A 3CRUA 3F3RA 3MSZA 4K1FA 2WRTA 1VF2A 5G31A 2QC7A 4HS1A 2LNTA 4YAPA 3W8SA 2C0DA 3ZREA 2H73A 2DJ0A 2ALBA 4I2UA 2YNXA 3J7Yb 4MPGA 4ISDA 3WGDA 5H5SA 2B1KA 3UL3A 4EDYA 3D0ZA 4MJEA 4NMUA 1AQVA 3A2XA 3M9JA 1HNAA 8GSSA 1KNGA 5AIXA 3OR5A 3V1WA 1YKAA 3UEMA 4LL4B 1FVJA 4CW9A 3GN3A 1U88A 3F4TA 1MEKA 2MMZA 4HI7A 2VLTA 2NBSA 3E3EA 4RQRA 2B7JA 2I9HA 3F4SA 1UA5A 5D9XA 3PPUA 1KBNA 2ON7A 2H74A 4X43A 3CSHA 4G9HA 2JSZA 4IHUA 3HD5A 5CYYA 3GKNA 1RQMA 2VCQA 1WIKA 2H66A 3IPZA 2R4VA 3EWLA 4LLRA 10GSA 2HYXA 1U3AA 1ERWA 3ME8A 4RI7A 4NV5A 2HQTA 3VWWA 2IMIA 2FGXA 4BA7A 3US3A 2HZEB 1ZMAA 6GSUA 2HSMB 2CV4A 1SK2A 3EVIA 1SJ6A 2XBIA 3L9SA 1TJDA 2GSTA 1KEBA 1PL2A 1YY7A 1A23A 2X99A 1WE0A 4QQ7A 3A2WA 1DBYA 1PN9A 2OKAA 3F8UA 3TUEA 2CT6A 3L4NA 3GL3A 1JLVA 2KLXA 1GUMA 3MWHA 4QL7A 4KF9A 5AGYA 1V58A 2I81A 2HNLA 2OBIA 4Q5NA 3D22A 4OMVA 4O7HA 1MDKA 2REMA 4XIHA 3I69A 3C73A 5D9WA 2XC2A 3L9VA 2GZYA 2HT9A 4MDCA 1PQNA 2YZHA 2KUCA 2Z9SA 2YANA 3FZ9A 3DVWA 3W6GA 4AGSA 3GHAA 3FR3A 2V2GA 2YCDA 3ERFA 2LTKA 3F6DA 4D73B 1Y6EA 2YJ7A 2AUVA 2RM5A 3G9BA 4KX4A 4BWQA 3KMOA 4F9ZA 3BJ5A 5FHIA 4TRXA 4XS1A 2LQOA 1FG4A 3TB2A 2JZTA 5EPFA 3GX0A 3HYPA 3LORA 4GSTA 5J5NA 2D2ZA 3D5JA 1V98A 2L6DA 4YH2A 2FUG2 4HQZA 3K8NA 3BBYA 2UZ8A 2VLUA 1HNCA 4JEDA 1CQHA 4I5QA 1FO5A 3GA4A 3LYPA 4LMVA 1HYUA 1E2YA 1A2LA 2FLSA 1F3AA 2FA4A 3UIWA 3I43A 1QMVA 1O81A 5KN3A 5F8BA 5E59A 1B9XC 4RUVA 5D9TA 4N10A 2BTOT 3S9FA 1GTBA 2E2MA 5EY6A 3Q6OA 2NDOA 3EU4A 3M8NA 5ID2B 2H1DA 4N11A 3D6IA 6GSWA 3ZVJD 3F6FA 4ZBDA 1GTUA 4DVCA 3DYRA 4MF6A 3FEUA 4EXJA 2K18A 2A4VA 2LSTA 4KSOA 1X9SB 2O85A 4PUFC 2IMDA 5CNWA 1GULA 4DEJA 2CAIA 3WT1A 4HU9A 4BL7B 3VI5A 2RLIA 3EYTA 4JE1A 4J57E 5HR3A 2LRCA 1YF1A 4LMWA 2KP2A 2IPAA 1JZRA 1SD8A 1ERVA 2WB9A 2FWGA 4TR1A 4F0CA 2EIOA 5B7CA 4OO4A 1BJXA 2B3SA 4FO5A 3GTUA 4IP1A 3KJYA 3H4KA 2CVKA 4IQAA 5IOXA 1PGTA 5ECLB 4BVXB 4DSRA 1R5AA 4KNDA 1PRXA 3HZ8A 2XHFA 3DVXA 2EC4A 3TJGA 5ECMB 4BVYB 3L78A 3GURA 3GNJA 4JBBA 2YPMA 3H93A 1K3LA 1XWGA 1G6WA 4AJ6A 2VAFA 3VWVA 1FHEA 4H86A 3I6AA 4PQHA 18GSA 1F37A 3DIEA 2V1MA 4EE0A 3E9JB 2CZ2A 3EC3A 4KA0A 3FK8A 2B5XA 2DIYA 5EVOA 2G2QA 5HQPA 5JWOB 3NIVA 4P3YB 1DSBA 4EF0A 3CRTA 5B6MA 4IW9A 5A4VA 4ECBA 4K9ZA 3TGZA 3CSJA 2CQ9A 1BYEA 1TI1A 3Q18A 3EE2A 5ELAA 5G5FA 5J9BA 3ZTLA 5FWGA 4KAEA 1GTAA 3HVXA 4V2LA 1VF4A 1RK4A 5CP1A 3RDWA 1EOHA 4HEA2 2M46A 2GGTA 4K7OA 1GH2A 6GSVA 3WGEA 3UVHA 1K0NA 2LRNA 2H76A 2CA8A 1PKWA 5DALB 3RHCA 5ABRA 1XW5A 3KH7A 2L4CA 3APOA 1EV9A 2I3YA 4NV2A 1SK0A 2MMOA 4MLYA 4Q5RA 1TU7A 4K0NA 1TTZA 4I6XA 1WPIA 1SK1A 2DIZA 3P90A 4OO5A 4NXIA 3IK9A 3N9JA 1TDIA 4PUAA 3O3TA 4KUNA 3SBCA 3UBKA 3WYWA 2YOIA 2XPEA 2YJHA 1W89A 5ECRB 2CAQA 3QPMA 1M9BA 2C3NA 2E2GA 2CVDA 1BX9A 2L57A 1OC8A 2O87A 1USBA 3U5RE 5B8BA 2CX4A 2H0HA 1PL1A 3F63A 2C3TA 1NSWA 3LXZA 2HSNB 2C0FA 5GAPD 1YDKA 4EVMA 1M0UA 2C0GA 3H1NA 5J4UA 2F8FA 4PNFA 2LQQA 3TKSC 2HE3A 2HZEA 4K8MA 2YZUA 2H72A 4ZBBA 2HSMA 3TKQA 4GQFA 4I97A 1Z7PA 4KCEA 3GUSA 3A2VA 2HI7A 2WFCA 2P5RA 2BMXA 4HU7A 2R5GA 1B4PA 3ZMLA 1AW9A 1FVKA 1QK8A 4XRAA 2TRXA 2MMAA 4OCEA 3NZNA 2YWOA 4IGJA 3KM6A 3R2QA 2O7KA 3ISOA 2P5QA 4EUYA 1Z3EA 5ECPB 3QD9A 2YWNA 3WT2A 3HKRA 3VWXA 1OKTA 1XWKA 1A24A 1ZGNA 2MBTA 1SJIA 16GSA 3L0HA 3J7Yk 3E0UA 4L5LA 3DEXA 4OFNA 2WULA 1R7HA 3IHQA 2L6CA 1IYIA 3KXOA 2IJYA 2GQLA 1U3IA 4ULXA 2LJRA 3BCKA 3GKXA 4FYBA 1GNEA 1UC7A 4G0LA 1EWXA 3TJJA 4D73A 4GQCA 1SENA 2H6YA 2L4QA 1T7PB 1J9BA 4KCAA 5IO2A 1Z5YE 2E7PA 1N2AA 3LWAA 4I8BA 4PXOA 5ECIB 2O89A 4BWSA 5F05A 4KDXA 4NHZA 1THOA 4I2TA 1GSUA 3M3MA 3GSTA 2R3XA 1MDIA 4EDZA 3HY2A 4FQUA 4G0IA 1K0MA 3IRAA 3FRCA 1EEJA 4CDOA 5IPGA 3G7JA 2H19A 3ZRDA 4KW6A 1X0RA 4MABA 3UVTA 3IC8A 4ZB9A 1VRSD 2LKUA 4JR4A 2YWMA 2GSSA 5J9CA 4N0ZA 1AUCA 3TJFA 2VM1A 5ID2A 1UVZA 4IJIA 1PKZA 5ECNB 3HVVA 1XXUA 4POLA 3ZLPA 4BPYA 2C1YA 3ZIVA 3C1SA 1SYXA 4F82A 3APQA 3KH9A 4G0KA 1SYRA 1FW1A 3ZL5A 5D8IA 1SL2B 3VURA 5A4UA 3KIJA 2M80A 1ST9A 5GSSA 2OADA 4ZB8A 2LRTA 5F07A 2IFQB 1O8WA 2L5OA 3UAPA 3LEFA 4BL7A 5D73A 1PMTA 1B9YC 1A0FA 2E0QA 4GLTA 4F03A 3D21A 2X8HA 1XFLA 1I9DA 2DSAA 1QUWA 2JACA 3TRQA 1K0AA 2VL2A 4BVXA 2ES7A 2LEGA 2EIRA 2VD1A 2LV3A 2IWTA 2H1BA 1Y25A 1GSSA 4HZ4A 4O92A 4BVYA 2IMEA 3G7IA 3DGQA 4OD7A 2WDUA 1ILOA 1A0RP 5CREA 2R2JA 3FR6A 4ECCA 3ZFLA 2XBQA 1QFNA 1V40A 2VCVA 4F0BA 1RW1A 3FZ4A 1ZCPA 5E4WA 2IN3A 4PGTA 4ZL8A 2IMFA 4KDUA 1Z9HA 4YQVA 4TXOB 3HA9A 4JZQA 3ERGA 3M0FA 1V9WA 1SU9A 1JZOA 4POBA 4KDYA 3ED3A 3VI7A 4E8EA 2AJQB 1XWAA 1FAAA 4V2NA 4MCUA 4Q5FA 5GZZB 3HJPA 1GLQA 2HRNA 5G30A 1S3AA 4FH8A 2VCTA 4N30A 4ZXGA 2TIRA 4MPFA 3KGKA 6GSTA 3ZIJA 4ZL7A 4OFTA 1X5DA 3A3TA 2EIQA 1U6TA 3ZVJA 7GSSA 5IPHA 1HNBA 1TRWA 2N5AA 4GRFA 5CRDA 3HDCA 1OC3A 5ECOB 3ERWA 2L59A 1VGLA 1G0TA 1M7TA 4WR4A 17GSA 3MNGA 2H1AA 4K6XA 1TW9A 3GIXA 1AIUA 3IE3A 4MH3A 2GT5A 3CXGA 4MJCA 2RUEA 3TKSE 5DALA 1T3BA 2P0GA 4F2IA 4ZL9A 2L5LA 4PQ1A 3UMAA 2H01A 2M72A 3UBLA 1V57A 5G2ZA 5AN1A 1TK0B 3M1GA 3GV1A 3CYNA 1Z7RA 4XS6A 4TR4A 1NHYA 3HJMA 1FB6A 3GFKA 1O8XA 1XWCA 4PTSA 3HXSA 2VM2A 1GSQA 3EINA 2FD3A 1EP7A 2H30A 3L9UA 3SWLA 1PSQA 1A8LA 2YV9A 4L8EA 2O8VB 3APSA 5D93A 2KOKA 4HDEA 2HFDA 1PD21 1I5GA 2ZNMA 1MTCA 3DWVA 4XTSA 2F8AA 2MMNA 2H0GA 3C1RA 1GRXA 5DCGA 2YP6A 2H0IA 5IMZA 4GTUA 2GZZA 1EGRA 1XIYA 4L0UA 5J41A 3IA1A 5KN2A 1YJ6A 3GH9A 2B5EA 2OA7A 2QGVA 5CO3A 5F0GA 1SD9A 2GSRA 4IN0A 1T1VA 4GCIA 4DSSB 1F3BA 1GSDA 3UARA 3VWUA 4L0WA 4X0XA 2DJ2A 3IC4A 4NPBA 5IMDA 2DJ1A 2JL4A 4KH7A 3PGTA 2KHPA 3TKPA 1GP1A 1S3DA 5DQYA 1J0FA 2FCHA 1EP8A 2CX3A 3IAM2 2WJUA 4ACSA 9GSSA 3DMLA 2H75A 5COHA 1JHBA 2GTUA 1R5PA 1OKDA 3QCPA 4NWYA 1CQGA 1JLWA 4AF2A 1XCCA 4WETA 2HRFA 3IXRA 4ILFA 3DXBA 3KTBA 3EURA 1TK5B 1ON4A 3QFAC 2DLXA 4ZBAA 1H75A 2PU9C 1SJZA 1K0BA 3NOFA 4ZILA 2HXKA 3F0IA 2H6ZA 1YEXA 2NVLA 4IP6A 1S3CA 5A5KA 1F9MA 4EKZA 4WR5A 2KP1A 1IYHA 2X64A 1SKWB 5C04A 1OE8A 3KEBA 1X9WB 2CVBA 4WBRD 2WZ9A 6GSXA 4EL1A 5F06A 2VCWA 5G5EA 4N0VA 1Z6MA 1BQ7A 2DJKA 2GQKA 5DDLA 2FA8A 1GL8A 1LBKA 5AIVA 3QR6A 2AYTA 3QAWA 2G0FA 4IVFA 2HRKB 1M99A 4IQ1A 1XZOA 4MA9A 4TKYA 4GWRA 2ON5A 4GF0A 4Z7XA 1B48A 1WWJA 1ZYEA 5IMAA 4WEYA 3ZYWA 4G2EA 2YN1A 2HSYA 2PWJA 1G6YA 3Q74A 5AISA 5GAND 2F9SA 4FYCA 3TOTA 2OJLA 4EO3A 1GUHA 2IL3A 1K0DA 3BOAA 4TR0A 4K0GA 1TRUA 3CTFA 5IQYA 4GSSA 2OACA 5CRHA 5ECQB 2TRCP 2P31A 5H5QA 5HFKA 1XBSA 3LXTA 2IFQA 5JCGA 4ML1A 2H1GA 1QGVA 4MZBA 1B8XA 1AQWA 4MJBA 1O73A 4USSA 1GUKA 2DMMA 2H71A 2VOCA 2VD0A 19GSA 4KGIA 5HR0A 1BG5A 2WS2A 4AJ7A 2RUFA 2FWHA 1HQOA 3GMFA 1ERTA 5LNKe 4MF5A 4TN8A 3F3QA 2F3MA 1SL0B
chains in the Genus database with same CATH superfamily
3IR4A 1YF0A 5ELGA 2FY6A 2JADA 4MH2A 1TKDB 5D96A 2A4HA 1TK8B 3KD0A 5CAXA 3DKSA 1XW9A 2ZCTA 5A1NB 4OWYA 5ECKB 1OE7A 2V41A 3VPTA 2I4AA 1ZL9A 4K7NA 2FNOA 1GLPA 2RM6A 1NM3A 12GSA 2V6OA 3BD2A 3KZQA 3P2AA 1TI3A 2J23A 1GWCA 1O85A 4J56E 4TXOA 2VO4A 1VF1A 4WBJA 4KE3A 4IKHA 1WMJA 13GSA 5IIZA 1JZWA 3LSZA 1SL1B 5HR1A 4TVEA 3LFLA 5D9VA 5KOWA 2MYGA 1QQ2A 2C3QA 4L5OA 2FWEA 4G10A 5DAKB 3F9UA 4TOPA 1AXDA 1R26A 3N5OA 2CZ3A 5J4VA 4IJ3A 1SVMA 3PR8A 2K9FA 4K5SA 6GSSA 1OVNA 2F51A 3Q19A 4K7IA 1OC9B 1M3JA 5L71A 3ZFBA 1URMA 4TXVA 4XS4B 1M2DA 2ZUPA 4TR3A 5J47A 4ML6A 2O3EA 4V1Ap 1PX7A 1ERUA 3AY8A 5CRGA 2C80A 2BJXA 3UJ1A 1OAZA 5C00A 4O5RA 3MDKA 1TRSA 1VF3A 3VFIA 1TOFA 4MJAA 1SKRB 5G1KA 5BMUA 3GYKA 14GSA 1I1IP 2HZFA 3HMJG 2DC5A 4ZB6A 3P7XA 3QAGA 5DBQA 1AAZA 3IOSA 5HR2A 1X5EA 1X9MB 1FOVA 1EGOA 3FR9A 5DVBA 2OBKA 4XCSA 2J9HA 3TJKA 1M9AA 1ZOFA 4POMA 1AQXA 3FZ5A 5LCZA 3QOUA 1K0CA 3PH9A 4G01A 2PVOC 4FXYP 4G19A 2VCZA 5B6NA 4YQUA 1BEDA 4BIKA 3CSIA 1JZDA 3M9KA 3JCML 1K3YA 2N5BA 4Z2RA 2GDRA 1N25A 2OT3A 2WGRA 2K8VA 4OFMA 3RPPA 1WP0A 5JCUA 20GSA 4JR6A 4PX1A 3CTGA 1MD4A 2DJJA 1J08A 4NHWA 2WVXB 4MK3A 3HHVA 1LJRA 5G1LA 4QL9A 1EV4A 2VIMA 3ZMKA 4WKWA 1GSYA 2GVPA 4PHZC 1ZZYA 2GSQA 3RPNA 2VL2C 1GSEA 1PA3A 1BAYA 4DSSA 1E6BA 3ME7A 4O5QA 2AAWA 1A2JA 4PNGA 1LU4A 3FKFA 4JRRA 1SVLA 2C0EA 2PN8A 5IM9A 2QKEA 1EOGA 2AB6A 2JZRA 3I9V2 4J2FA 1EZKA 5INYA 4GXZA 3RBTA 2HSHA 1W4VA 3VK9A 4PURA 2I1UA 1O7UA 2YWIA 3IHGA 2VL9A 3LYKA 1O6JA 4LA1A 3IDVA 2DMLA 2HRAA 1HD2A 3VPQA 4XHMA 2FHEA 5KN0A 3TRXA 2DJ3A 1FB0A 3GH6A 5A5HB 1XOBA 2JU5A 2XPDA 3TRPA 5ECHB 2C4JA 2B5YA 4WXTA 2V32A 4IELA 1GTIA 1YQ1A 1ZYQB 5JWQB 1ML6A 3FW2A 2LJAA 3UOMA 4N3ZA 2NTOA 3O76A 2EFCA 2OE1A 1ACVA 3C7MA 4KSMA 2AHEA 2X8GA 1GSFA 1T4YA 3C71A 3GL5A 2PUKC 1Q4JA 1OYJA 3TJBA 1XW6A 2R37A 3EMXA 3LQ7A 4JU5A 1TP9A 1XWBA 3TOUA 5A4WA 2A2RA 4MMMA 3IV4A 4FYUA 5DJLA 2IIYA 2MBSA 1S4BP 2HRKA 3KMNA 4HOJA 4OCFA 1EEMA 2PPTA 2GLRA 2YV7A 3HCZA 4V1Ag 1BF5A 2PGTA 5CRWA 4K5RA 5HFGA 4GSNA 2LS5A 3LGCA 22GSA 5IMVA 1WRYA 3EPTA 4X1UA 3A5WA 2IMKA 1KTEA 3IBHA 5JWRB 2K6VA 1XVQA 3FY7A 5DJMA 1WOUA 4HJMA 4DSQA 1THXA 4KB3A 5A34A 4Z2TA 2JSYA 3G7YA 1N8JA 2JZSA 5ECSA 3TCOA 2B1LA 1TU8A 1YEPA 3QAVA 1B4QA 1F6MC 4MZWA 1QXHA 1DUGA 3EMPA 1XOAA 3CBUA 1X5CA 1A2MA 2R6KA 4E8HA 2LNSA 5HFIA 3TKRA 1A8YA 4EC0A 1C72A 1GNWA 1PN0A 4RQXA 3CMIA 5DCHA 4AJ8A 2VL3A 2VCXA 4IS0A 4K2DA 3MAKA 1TXUA 2A2SA 4O32A 1BG1A 5B8AA 2HLSA 3W8JA 3HJOA 5EL8A 11GSA 1R4WA 3IAS2 5IMFA 1F2EA 3C8EA 1M2AA 3FZAA 2GQMA 1G7OA 2H70A 3KCMA 1TXXA 3GKMA 4EIPA 1DE2A 4V2MA 4YQMA 3LG6A 3P8WA 5GSTA 5LD0A 1WJKA 1DE1A 1T4ZA 3QFBC 3RHBA 2V6KA 4RI6A 2WCIA 3KTLA 4HUAA 2NPBA 3GSSA 1T8EB 4LL1B 4MZCA 5KN1A 3VLNA 4YKGA 3PINA 5DAKA 3H79A 1K0OA 4YAVA 3RFRC 4O5UA 1MD3A 4TR1B 2PERA 3KP9A 3GTUB 5KEJA 2N5FA 1MDJA 3D4TA 1XVWA 2H8LA 4HQSA 3TKSA 1H4OA 2AV4A 2GZPA 3DRNA 5H5RA 3TDGA 1OC9A 2LUSA 2RIIA 3RAZA 3FYGA 4XS4A 3LJRA 4PQIA 4POKA 3H8QA 4TW5A 3GX8A 2VUPA 5IO0A 4ECIA 2B7KA 2DKIA 1G7EA 4MP4A 4WF5A 5DQSA 3WGXA 2QSIA 1Q98A 3QDNA 2FWFA 3HZ4A 3DD3A 3ZITA 2OE0A 3U6VA 3HVSA 3R3EA 1YZXA 2VLVA 1M2BA 1NW2A 2GT6A 2WW2A 5J3RA 1T00A 1SKSB 2VKZG 3GRXA 5JCWA 4Q5QA 3HVNA 4ECJA 4K2XA 4CHSA 4ZIJA 3D4MA 3IK7A 2DBCA 4HZ2A 2PVQA 4IBPA 5FT3A 1Z6NA 3EU3A 4WF4A 2C8UA 2K8SA 2GS3A 2X8CA 5ENUA 1ABAA 2LJKA 1V2AA 4W66A 1U87A 1JFUA 4FIWA 2MZCA 5IMCA 3GKKA 1PX6A 1XPVA 3WD6A 1AC1A 1NHOA 1YKCA 1SVOA 2H6XA 3F4RA 2OE3A 3QMXA 3O6TA 4MF7A 4CY6A 2B6MA 1TRVA 1UN2A 6GSYA 1K3OA 2WVXA 3ZZXA 4HJ2A 4XRDA 2PMTA 2PBJA 3FHKA 3BCIA 3KP8A 4NAXA 5IOWA 4ID0A 3CRUA 3F3RA 3MSZA 4K1FA 2WRTA 1VF2A 5G31A 2QC7A 4HS1A 2LNTA 4YAPA 3W8SA 2C0DA 3ZREA 2A2PA 2H73A 2DJ0A 2ALBA 4I2UA 2YNXA 3J7Yb 4MPGA 4ISDA 3WGDA 5H5SA 2B1KA 3UL3A 4EDYA 4ICYA 3D0ZA 4MJEA 4NMUA 1AQVA 3A2XA 3M9JA 1HNAA 8GSSA 1KNGA 5AIXA 3OR5A 3V1WA 1YKAA 3UEMA 4LL4B 1FVJA 4CW9A 3GN3A 1U88A 3F4TA 1MEKA 2MMZA 4HI7A 2VLTA 2NBSA 3E3EA 4RQRA 2B7JA 2I9HA 3F4SA 1UA5A 5D9XA 5A5HA 3PPUA 1KBNA 2ON7A 2H74A 4X43A 3CSHA 4G9HA 2JSZA 4IHUA 3HD5A 5CYYA 3GKNA 1RQMA 2VCQA 2UV8G 1WIKA 2H66A 3IPZA 2R4VA 3EWLA 2WW1A 4LLRA 10GSA 2HYXA 1U3AA 1ERWA 3ME8A 4RI7A 4NV5A 2HQTA 3VWWA 2IMIA 2FGXA 4BA7A 3US3A 2HZEB 1ZMAA 6GSUA 2HSMB 2CV4A 1SK2A 3EVIA 1SJ6A 2XBIA 3L9SA 1TJDA 2GSTA 1KEBA 1PL2A 1YY7A 1A23A 1M3IA 2X99A 1WE0A 4QQ7A 3A2WA 1DBYA 1PN9A 2OKAA 3F8UA 3TUEA 2CT6A 3L4NA 3GL3A 1JLVA 2KLXA 1GUMA 3MWHA 4QL7A 4KF9A 5AGYA 4QMKA 1V58A 2I81A 2HNLA 2OBIA 4Q5NA 3D22A 4OMVA 4O7HA 1MDKA 2REMA 4XIHA 3I69A 3C73A 5D9WA 2XC2A 3L9VA 2GZYA 2HT9A 4MDCA 1PQNA 2YZHA 2KUCA 2Z9SA 2YANA 3FZ9A 3DVWA 3W6GA 4AGSA 3GHAA 3FR3A 2V2GA 2YCDA 3ERFA 2LTKA 3F6DA 4D73B 1Y6EA 2YJ7A 2AUVA 2RM5A 3G9BA 4KX4A 4BWQA 3KMOA 4AKXB 3BJ5A 4F9ZA 5FHIA 4GDFA 4TRXA 4XS1A 2LQOA 1FG4A 3TB2A 4HSCX 2JZTA 5EPFA 3GX0A 3HYPA 4AKGA 3LORA 4GSTA 5J5NA 2D2ZA 3D5JA 1V98A 2L6DA 4YH2A 2FUG2 4HQZA 3K8NA 3BBYA 2UZ8A 2VLUA 1HNCA 4JEDA 1CQHA 4I5QA 1FO5A 3GA4A 3LYPA 4LMVA 1HYUA 1E2YA 1A2LA 2FLSA 1F3AA 2FA4A 3UIWA 3I43A 1QMVA 1O81A 5KN3A 5F8BA 5E59A 1B9XC 4RUVA 5D9TA 4N10A 2BTOT 3S9FA 1GTBA 2E2MA 5EY6A 3Q6OA 2NDOA 3EU4A 3M8NA 5ID2B 2H1DA 4N11A 3D6IA 6GSWA 3ZVJD 3F6FA 4ZBDA 1GTUA 4DVCA 3DYRA 4MF6A 3FEUA 4Z2UA 4EXJA 2K18A 2A4VA 2LSTA 4KSOA 1X9SB 2O85A 4PUFC 2IMDA 5CNWA 3CHXC 1GULA 4DEJA 2CAIA 3WT1A 2EFDA 4HU9A 4BL7B 3VI5A 2RLIA 3EYTA 4JE1A 4J57E 5HR3A 2LRCA 1YF1A 4LMWA 2KP2A 3RGBC 2IPAA 1JZRA 1SD8A 1ERVA 2WB9A 2FWGA 4TR1A 4F0CA 2X49A 2EIOA 5B7CA 4OO4A 1BJXA 2B3SA 4FO5A 3GTUA 4IP1A 3KJYA 3H4KA 2CVKA 4IQAA 5IOXA 1PGTA 5ECLB 4BVXB 4DSRA 1R5AA 4KNDA 1PRXA 3HZ8A 2XHFA 3DVXA 2EC4A 3TJGA 5ECMB 4BVYB 3L78A 3GURA 3GNJA 4JBBA 2YPMA 3H93A 1K3LA 1XWGA 1G6WA 4AJ6A 2VAFA 3VWVA 1FHEA 4H86A 2EFEA 3I6AA 4PQHA 18GSA 1F37A 3DIEA 2V1MA 4EE0A 3E9JB 2CZ2A 3EC3A 4KA0A 3FK8A 2B5XA 2DIYA 5EVOA 2G2QA 5HQPA 5JWOB 3NIVA 4P3YB 1DSBA 4EF0A 3CRTA 5B6MA 4IW9A 5A4VA 4ECBA 4K9ZA 3TGZA 3CSJA 2CQ9A 1BYEA 3A5IA 1TI1A 3Q18A 3EE2A 5ELAA 5G5FA 5J9BA 3ZTLA 5FWGA 4EIQA 2R0PA 4KAEA 1GTAA 3HVXA 4V2LA 1VF4A 1RK4A 3FMWA 5CP1A 3RDWA 1EOHA 4HEA2 2M46A 2GGTA 4K7OA 1GH2A 6GSVA 3WGEA 3UVHA 1K0NA 2LRNA 2H76A 2CA8A 2WW3A 1PKWA 5DALB 3RHCA 5ABRA 1XW5A 3KH7A 2L4CA 3APOA 1EV9A 2I3YA 4NV2A 1SK0A 2MMOA 4MLYA 4Q5RA 1TU7A 4K0NA 1TTZA 3MIXA 4I6XA 1WPIA 1SK1A 2DIZA 3P90A 4AI6A 4OO5A 4AKHA 4NXIA 3IK9A 3N9JA 1TDIA 4PUAA 3O3TA 4KUNA 3SBCA 3UBKA 3WYWA 2YOIA 2XPEA 2YJHA 1W89A 5ECRB 2CAQA 3QPMA 1M9BA 2C3NA 2E2GA 2CVDA 1BX9A 2L57A 1OC8A 2O87A 1USBA 3U5RE 5B8BA 2CX4A 4E68A 2H0HA 1PL1A 3F63A 2C3TA 1NSWA 3LXZA 4YKFA 2HSNB 2C0FA 5GAPD 1YDKA 4EVMA 3LW9A 1M0UA 2C0GA 3H1NA 5J4UA 2F8FA 4PNFA 2LQQA 3TKSC 2HE3A 2HZEA 4K8MA 2YZUA 2H72A 4ZBBA 2HSMA 3TKQA 4GQFA 4I97A 1Z7PA 2X4AA 4KCEA 3GUSA 3A2VA 2HI7A 2WFCA 2P5RA 2BMXA 4HU7A 2R5GA 1B4PA 3ZMLA 1AW9A 1FVKA 1QK8A 4XRAA 2TRXA 2MMAA 4OCEA 3NZNA 2YWOA 4IGJA 2WVYA 3KM6A 3R2QA 2O7KA 3ISOA 2P5QA 4EUYA 1Z3EA 5ECPB 3QD9A 2YWNA 3WT2A 3HKRA 3VWXA 4CY8A 1OKTA 1XWKA 1A24A 1ZGNA 2MBTA 1SJIA 16GSA 3L0HA 3J7Yk 3E0UA 4L5LA 3DEXA 4OFNA 2WULA 1R7HA 3IHQA 2L6CA 1IYIA 3KXOA 2IJYA 4X4JA 2GQLA 1U3IA 4ULXA 2LJRA 3BCKA 3GKXA 4FYBA 1GNEA 1UC7A 4G0LA 1EWXA 3TJJA 4D73A 4GQCA 1SENA 2H6YA 4PI0C 2L4QA 1T7PB 1J9BA 4KCAA 5IO2A 1Z5YE 2E7PA 1N2AA 2QA2A 2R0GA 3LWAA 4I8BA 4PXOA 5ECIB 2O89A 4BWSA 2O5VA 5F05A 4KDXA 4NHZA 1THOA 4I2TA 1PFOA 1GSUA 3M3MA 3CWGA 3GSTA 2R3XA 1MDIA 4EDZA 3HY2A 4FQUA 1K0MA 4G0IA 3IRAA 3FRCA 1EEJA 4CDOA 5IPGA 3G7JA 3CQFA 2H19A 3ZRDA 4KW6A 1X0RA 4MABA 3UVTA 1FOHA 3IC8A 4ZB9A 1VRSD 2LKUA 4JR4A 2YWMA 2GSSA 5J9CA 4N0ZA 1AUCA 3TJFA 2VM1A 5ID2A 1UVZA 4IJIA 1PKZA 5ECNB 3HVVA 1S3RA 1XXUA 4POLA 3ZLPA 2O36A 4BPYA 2C1YA 3ZIVA 3C1SA 1SYXA 4F82A 3APQA 3KH9A 4G0KA 1SYRA 1FW1A 5J4YA 3ZL5A 5D8IA 1SL2B 3VURA 5A4UA 3KIJA 2M80A 1ST9A 2WZSA 5GSSA 2OADA 4ZB8A 2LRTA 5F07A 2IFQB 1O8WA 2L5OA 3UAPA 3LEFA 4BL7A 5D73A 1PMTA 1B9YC 1A0FA 2E0QA 4GLTA 4F03A 3D21A 2X8HA 1XFLA 1I9DA 2DSAA 1QUWA 2JACA 3TRQA 1K0AA 2VL2A 4BVXA 2ES7A 2LEGA 2EIRA 2VD1A 2LV3A 2IWTA 2H1BA 1Y25A 1GSSA 4HZ4A 4O92A 4BVYA 2IMEA 3G7IA 3DGQA 4OD7A 2WDUA 1ILOA 1ZYPA 1A0RP 5CREA 2R2JA 1ZYNA 2QA1A 3FR6A 4ECCA 3ZFLA 2XBQA 1QFNA 1V40A 2VCVA 4F0BA 1RW1A 3FZ4A 1ZCPA 5E4WA 2IN3A 4PGTA 4ZL8A 2IMFA 4KDUA 1Z9HA 4YQVA 4TXOB 3HA9A 4JZQA 3ERGA 3M0FA 1V9WA 1SU9A 1JZOA 4POBA 4KDYA 3ED3A 3VI7A 4E8EA 2AJQB 1XWAA 1FAAA 4V2NA 4MCUA 4Q5FA 5GZZB 3HJPA 1GLQA 2HRNA 5G30A 1S3AA 4FH8A 2VCTA 4N30A 4ZXGA 2TIRA 4MPFA 3KGKA 6GSTA 3ZIJA 4ZL7A 4OFTA 1X5DA 3A3TA 2EIQA 1U6TA 3ZVJA 7GSSA 5IPHA 1HNBA 1TRWA 2N5AA 4GRFA 5CRDA 3HDCA 1OC3A 5ECOB 3ERWA 2L59A 1VGLA 1G0TA 1M7TA 4WR4A 17GSA 3MNGA 2H1AA 4K6XA 1TW9A 3GIXA 3TU3B 3IE3A 1AIUA 4MH3A 2GT5A 3CXGA 4MJCA 2RUEA 3TKSE 5DALA 1T3BA 2P0GA 4F2IA 4ZL9A 5BMUB 2L5LA 4PQ1A 3UMAA 2H01A 2M72A 3UBLA 1V57A 5G2ZA 5AN1A 1TK0B 3M1GA 3GV1A 3CYNA 1XG8A 1Z7RA 4XS6A 4TR4A 1NHYA 3HJMA 1FB6A 3GFKA 1O8XA 1XWCA 4PTSA 5J40A 3HXSA 2VM2A 1GSQA 3EINA 2FD3A 1EP7A 2H30A 3L9UA 3SWLA 1PSQA 1A8LA 2YV9A 4L8EA 2O8VB 3APSA 5D93A 2KOKA 4HDEA 2HFDA 1PD21 1I5GA 2ZNMA 1MTCA 3DWVA 4XTSA 2F8AA 2MMNA 2H0GA 3C1RA 1GRXA 5DCGA 2YP6A 2WVZA 2H0IA 5IMZA 4GTUA 2GZZA 1EGRA 2HSNA 1XIYA 2H1LA 4L0UA 5J41A 4MNNA 3IA1A 4PI2C 3MYDA 5KN2A 1YJ6A 3GH9A 2B5EA 2OA7A 2QGVA 5CO3A 5F0GA 1SD9A 2GSRA 4IN0A 1T1VA 2DKHA 4GCIA 4DSSB 1F3BA 1GSDA 3UARA 3VWUA 4L0WA 4X0XA 2DJ2A 3IC4A 4NPBA 5IMDA 2DJ1A 2JL4A 4KH7A 3PGTA 2KHPA 3TKPA 1GP1A 1S3DA 5DQYA 1J0FA 2FCHA 1EP8A 2CX3A 3IAM2 2WJUA 4ACSA 9GSSA 3DMLA 2H75A 5COHA 1JHBA 2GTUA 1R5PA 1OKDA 3QCPA 4NWYA 1CQGA 1JLWA 4AF2A 1XCCA 4WETA 2HRFA 3IXRA 5BRTA 4ILFA 3DXBA 3KTBA 3EURA 1TK5B 1ON4A 3QFAC 2DLXA 4ZBAA 1H75A 2PU9C 1SJZA 1K0BA 3NOFA 5A1NA 4ZILA 2HXKA 3F0IA 2H6ZA 1YEXA 2NVLA 4IP6A 1S3CA 5A5KA 1F9MA 4EKZA 4WR5A 2KP1A 1IYHA 2X64A 1YVLA 1SKWB 5C04A 1OE8A 3KEBA 1X9WB 2CVBA 4WBRD 2WZ9A 6GSXA 4EL1A 5F06A 2VCWA 5G5EA 4N0VA 1Z6MA 1BQ7A 2DJKA 2GQKA 5DDLA 2FA8A 1GL8A 1LBKA 5AIVA 3QR6A 2AYTA 3QAWA 2G0FA 4IVFA 2HRKB 1M99A 4IQ1A 1XZOA 4MA9A 1YEWC 5KOXA 4TKYA 4GWRA 2EFHA 2ON5A 4GF0A 4Z7XA 2WW0A 1B48A 1WWJA 1ZYEA 5IMAA 4WEYA 3ZYWA 4G2EA 2YN1A 2HSYA 2PWJA 1G6YA 3Q74A 5AISA 4A5PA 5GAND 2F9SA 4FYCA 3TOTA 1Y1UA 2OJLA 4EO3A 1GUHA 2IL3A 1K0DA 3BOAA 4TR0A 4K0GA 1TRUA 3CTFA 5IQYA 4GSSA 2OACA 5CRHA 5ECQB 2TRCP 2P31A 5H5QA 5HFKA 1XBSA 3LXTA 4ZB7A 2IFQA 5JCGA 4ML1A 5A34B 4AKIA 1QGVA 2H1GA 1B8XA 4MZBA 1AQWA 4MJBA 1O73A 4USSA 1GUKA 2DMMA 2H71A 2VOCA 2VD0A 19GSA 4KGIA 2R0CA 5HR0A 1BG5A 2WS2A 4AJ7A 2RUFA 2FWHA 1HQOA 3GMFA 1ERTA 5LNKe 4MF5A 4TN8A 3F3QA 2F3MA 1SL0B
chains in the Genus database with same CATH topology
3IR4A 1YF0A 5ELGA 2FY6A 2JADA 4MH2A 1TKDB 5D96A 2A4HA 1TK8B 3KD0A 5CAXA 3DKSA 1XW9A 2ZCTA 5A1NB 4OWYA 5ECKB 1OE7A 2V41A 3VPTA 2I4AA 1ZL9A 4K7NA 2FNOA 1GLPA 2RM6A 1NM3A 12GSA 2V6OA 3BD2A 3KZQA 3P2AA 1TI3A 2J23A 1GWCA 1O85A 4J56E 4TXOA 2VO4A 1VF1A 4WBJA 4KE3A 4IKHA 1WMJA 13GSA 5IIZA 1JZWA 3LSZA 1SL1B 5HR1A 4TVEA 3LFLA 5D9VA 5KOWA 2MYGA 1QQ2A 2C3QA 4L5OA 2FWEA 4G10A 5DAKB 3F9UA 4TOPA 1AXDA 1R26A 3N5OA 2CZ3A 5J4VA 4IJ3A 1SVMA 3PR8A 2K9FA 4K5SA 6GSSA 1OVNA 2F51A 3Q19A 4K7IA 1OC9B 5L71A 3ZFBA 1URMA 4TXVA 4XS4B 1M2DA 2ZUPA 4TR3A 5J47A 4ML6A 4V1Ap 1PX7A 1ERUA 3AY8A 5CRGA 2C80A 2BJXA 3UJ1A 1OAZA 5C00A 4O5RA 3MDKA 1TRSA 1VF3A 3VFIA 1TOFA 4MJAA 1SKRB 5G1KA 5BMUA 3GYKA 14GSA 2HZFA 3HMJG 2DC5A 4ZB6A 3P7XA 3QAGA 5DBQA 1AAZA 3IOSA 5HR2A 1X5EA 1X9MB 1FOVA 1EGOA 3FR9A 5DVBA 2OBKA 4XCSA 2J9HA 3TJKA 1M9AA 1ZOFA 4POMA 1AQXA 3FZ5A 5LCZA 3QOUA 1K0CA 3PH9A 4G01A 2PVOC 4G19A 2VCZA 5B6NA 4YQUA 1BEDA 3CSIA 1JZDA 3M9KA 3JCML 1K3YA 2N5BA 4Z2RA 2GDRA 1N25A 2OT3A 2WGRA 2K8VA 4OFMA 3RPPA 1WP0A 5JCUA 20GSA 4JR6A 4PX1A 3CTGA 1MD4A 2DJJA 1J08A 4NHWA 4MK3A 3HHVA 1LJRA 5G1LA 4QL9A 1EV4A 2VIMA 3ZMKA 4WKWA 1GSYA 2GVPA 1ZZYA 2GSQA 3RPNA 2VL2C 1GSEA 1PA3A 1BAYA 4DSSA 1E6BA 3ME7A 4O5QA 2AAWA 1A2JA 4PNGA 1LU4A 3FKFA 4JRRA 1SVLA 2C0EA 2PN8A 5IM9A 2QKEA 1EOGA 2AB6A 2JZRA 3I9V2 4J2FA 1EZKA 5INYA 4GXZA 3RBTA 2HSHA 1W4VA 3VK9A 4PURA 2I1UA 1O7UA 2YWIA 3IHGA 2VL9A 3LYKA 1O6JA 4LA1A 3IDVA 2DMLA 2HRAA 1HD2A 3VPQA 4XHMA 2FHEA 5KN0A 3TRXA 2DJ3A 1FB0A 3GH6A 5A5HB 1XOBA 2JU5A 2XPDA 3TRPA 5ECHB 2C4JA 2B5YA 4WXTA 2V32A 4IELA 1GTIA 1YQ1A 1ZYQB 5JWQB 1ML6A 3FW2A 2LJAA 3UOMA 4N3ZA 2NTOA 3O76A 2EFCA 2OE1A 1ACVA 3C7MA 4KSMA 2AHEA 2X8GA 1GSFA 1T4YA 3C71A 3GL5A 2PUKC 1Q4JA 1OYJA 3TJBA 1XW6A 2R37A 3EMXA 3LQ7A 4JU5A 1TP9A 1XWBA 3TOUA 5A4WA 2A2RA 4MMMA 3IV4A 4FYUA 5DJLA 2IIYA 2MBSA 2HRKA 3KMNA 4HOJA 4OCFA 1EEMA 2PPTA 2GLRA 2YV7A 3HCZA 4V1Ag 1BF5A 2PGTA 5CRWA 4K5RA 5HFGA 4GSNA 2LS5A 3LGCA 22GSA 5IMVA 1WRYA 3EPTA 4X1UA 3A5WA 2IMKA 1KTEA 3IBHA 5JWRB 2K6VA 1XVQA 3FY7A 5DJMA 1WOUA 4HJMA 4DSQA 1THXA 4KB3A 5A34A 4Z2TA 2JSYA 3G7YA 1N8JA 2JZSA 5ECSA 3TCOA 2B1LA 1TU8A 1YEPA 3QAVA 1B4QA 1F6MC 4MZWA 1QXHA 1DUGA 3EMPA 1XOAA 3CBUA 1X5CA 1A2MA 2R6KA 4E8HA 2LNSA 5HFIA 3TKRA 1A8YA 4EC0A 1C72A 1GNWA 1PN0A 4RQXA 3CMIA 5DCHA 4AJ8A 2VL3A 2VCXA 4IS0A 4K2DA 3MAKA 1TXUA 2A2SA 4O32A 1BG1A 5B8AA 2HLSA 3W8JA 3HJOA 5EL8A 11GSA 1R4WA 3IAS2 5IMFA 1F2EA 3C8EA 1M2AA 3FZAA 2GQMA 1G7OA 2H70A 3KCMA 1TXXA 3GKMA 4EIPA 1DE2A 4V2MA 4YQMA 3LG6A 3P8WA 5GSTA 5LD0A 1WJKA 1DE1A 1T4ZA 3QFBC 3RHBA 2V6KA 4RI6A 2WCIA 3KTLA 4HUAA 2NPBA 3GSSA 1T8EB 4LL1B 4MZCA 5KN1A 3VLNA 4YKGA 3PINA 5DAKA 3H79A 1K0OA 4YAVA 4O5UA 1MD3A 4TR1B 2PERA 3KP9A 3GTUB 5KEJA 2N5FA 1MDJA 3D4TA 1XVWA 2H8LA 4HQSA 3TKSA 1H4OA 2AV4A 2GZPA 3DRNA 5H5RA 3TDGA 1OC9A 2LUSA 2RIIA 3RAZA 3FYGA 4XS4A 3LJRA 4PQIA 4POKA 3H8QA 4TW5A 3GX8A 2VUPA 5IO0A 4ECIA 2B7KA 2DKIA 1G7EA 4MP4A 4WF5A 5DQSA 3WGXA 2QSIA 1Q98A 3QDNA 2FWFA 3HZ4A 3DD3A 3ZITA 2OE0A 3U6VA 3HVSA 3R3EA 1YZXA 2VLVA 1M2BA 1NW2A 2GT6A 5J3RA 1T00A 1SKSB 2VKZG 3GRXA 5JCWA 4Q5QA 4ECJA 4K2XA 4CHSA 4ZIJA 3D4MA 3IK7A 2DBCA 4HZ2A 2PVQA 4IBPA 5FT3A 1Z6NA 3EU3A 4WF4A 2C8UA 2K8SA 2GS3A 2X8CA 5ENUA 1ABAA 2LJKA 1V2AA 4W66A 1U87A 1JFUA 4FIWA 2MZCA 5IMCA 3GKKA 1PX6A 1XPVA 3WD6A 1AC1A 1NHOA 1YKCA 1SVOA 2H6XA 3F4RA 2OE3A 3QMXA 3O6TA 4MF7A 4CY6A 2B6MA 1TRVA 1UN2A 6GSYA 1K3OA 3ZZXA 4HJ2A 4XRDA 2PMTA 2PBJA 3FHKA 3BCIA 3KP8A 4NAXA 5IOWA 4ID0A 3CRUA 3F3RA 3MSZA 4K1FA 2WRTA 1VF2A 5G31A 2QC7A 4HS1A 2LNTA 4YAPA 3W8SA 2C0DA 3ZREA 2A2PA 2H73A 2DJ0A 2ALBA 4I2UA 2YNXA 3J7Yb 4MPGA 4ISDA 3WGDA 5H5SA 2B1KA 3UL3A 4EDYA 4ICYA 3D0ZA 4MJEA 4NMUA 1AQVA 3A2XA 3M9JA 1HNAA 8GSSA 1KNGA 5AIXA 3OR5A 3V1WA 1YKAA 3UEMA 4LL4B 1FVJA 4CW9A 3GN3A 1U88A 3F4TA 1MEKA 2MMZA 4HI7A 2VLTA 2NBSA 3E3EA 4RQRA 2B7JA 2I9HA 3F4SA 1UA5A 5D9XA 5A5HA 3PPUA 1KBNA 2ON7A 2H74A 4X43A 3CSHA 4G9HA 2JSZA 4IHUA 3HD5A 5CYYA 3GKNA 1RQMA 2VCQA 2UV8G 1WIKA 2H66A 3IPZA 2R4VA 3EWLA 4LLRA 10GSA 2HYXA 1U3AA 1ERWA 3ME8A 4RI7A 4NV5A 2HQTA 3VWWA 2IMIA 2FGXA 4BA7A 3US3A 2HZEB 1ZMAA 6GSUA 2HSMB 2CV4A 1SK2A 3EVIA 1SJ6A 2XBIA 3L9SA 1TJDA 2GSTA 1KEBA 1PL2A 1YY7A 1A23A 2X99A 1WE0A 4QQ7A 3A2WA 1DBYA 1PN9A 2OKAA 3F8UA 3TUEA 2CT6A 3L4NA 3GL3A 1JLVA 2KLXA 1GUMA 3MWHA 4QL7A 4KF9A 5AGYA 4QMKA 1V58A 2I81A 2HNLA 2OBIA 4Q5NA 3D22A 4OMVA 4O7HA 1MDKA 2REMA 4XIHA 3I69A 3C73A 5D9WA 2XC2A 3L9VA 2GZYA 2HT9A 4MDCA 1PQNA 2YZHA 2KUCA 2Z9SA 2YANA 3FZ9A 3DVWA 3W6GA 4AGSA 3GHAA 3FR3A 2V2GA 2YCDA 3ERFA 2LTKA 3F6DA 4D73B 1Y6EA 2YJ7A 2AUVA 2RM5A 3G9BA 4KX4A 4BWQA 3KMOA 4AKXB 3BJ5A 4F9ZA 5FHIA 4GDFA 4TRXA 4XS1A 2LQOA 1FG4A 3TB2A 2JZTA 5EPFA 3GX0A 3HYPA 4AKGA 3LORA 4GSTA 5J5NA 2D2ZA 3D5JA 1V98A 2L6DA 4YH2A 2FUG2 4HQZA 3K8NA 3BBYA 2UZ8A 2VLUA 1HNCA 4JEDA 1CQHA 4I5QA 1FO5A 3GA4A 3LYPA 4LMVA 1HYUA 1E2YA 1A2LA 2FLSA 1F3AA 2FA4A 3UIWA 3I43A 1QMVA 1O81A 5KN3A 5F8BA 5E59A 1B9XC 4RUVA 5D9TA 4N10A 2BTOT 3S9FA 1GTBA 2E2MA 5EY6A 3Q6OA 2NDOA 3EU4A 3M8NA 5ID2B 2H1DA 4N11A 3D6IA 6GSWA 3ZVJD 3F6FA 4ZBDA 1GTUA 4DVCA 3DYRA 4MF6A 3FEUA 4Z2UA 4EXJA 2K18A 2A4VA 2LSTA 4KSOA 1X9SB 2O85A 4PUFC 2IMDA 5CNWA 1GULA 4DEJA 2CAIA 3WT1A 2EFDA 4HU9A 4BL7B 3VI5A 2RLIA 3EYTA 4JE1A 4J57E 5HR3A 2LRCA 1YF1A 4LMWA 2KP2A 2IPAA 1JZRA 1SD8A 1ERVA 2WB9A 2FWGA 4TR1A 4F0CA 2X49A 2EIOA 5B7CA 4OO4A 1BJXA 2B3SA 4FO5A 3GTUA 4IP1A 3KJYA 3H4KA 2CVKA 4IQAA 5IOXA 1PGTA 5ECLB 4BVXB 4DSRA 1R5AA 4KNDA 1PRXA 3HZ8A 2XHFA 3DVXA 2EC4A 3TJGA 5ECMB 4BVYB 3L78A 3GURA 3GNJA 4JBBA 2YPMA 3H93A 1K3LA 1XWGA 1G6WA 4AJ6A 2VAFA 3VWVA 1FHEA 4H86A 2EFEA 3I6AA 4PQHA 18GSA 1F37A 3DIEA 2V1MA 4EE0A 3E9JB 2CZ2A 3EC3A 4KA0A 3FK8A 2B5XA 2DIYA 5EVOA 2G2QA 5HQPA 5JWOB 3NIVA 4P3YB 1DSBA 4EF0A 3CRTA 5B6MA 4IW9A 5A4VA 4ECBA 4K9ZA 3TGZA 3CSJA 2CQ9A 1BYEA 3A5IA 1TI1A 3Q18A 3EE2A 5ELAA 5G5FA 5J9BA 3ZTLA 5FWGA 4EIQA 2R0PA 4KAEA 1GTAA 3HVXA 4V2LA 1VF4A 1RK4A 3FMWA 5CP1A 3RDWA 1EOHA 4HEA2 2M46A 2GGTA 4K7OA 1GH2A 6GSVA 3WGEA 3UVHA 1K0NA 2LRNA 2H76A 2CA8A 1PKWA 5DALB 3RHCA 5ABRA 1XW5A 3KH7A 2L4CA 3APOA 1EV9A 2I3YA 4NV2A 1SK0A 2MMOA 4MLYA 4Q5RA 1TU7A 4K0NA 1TTZA 3MIXA 4I6XA 1WPIA 1SK1A 2DIZA 3P90A 4AI6A 4OO5A 4AKHA 4NXIA 3IK9A 3N9JA 1TDIA 4PUAA 3O3TA 4KUNA 3SBCA 3UBKA 3WYWA 2YOIA 2XPEA 2YJHA 1W89A 5ECRB 2CAQA 3QPMA 1M9BA 2C3NA 2E2GA 2CVDA 1BX9A 2L57A 1OC8A 2O87A 1USBA 3U5RE 5B8BA 2CX4A 4E68A 2H0HA 1PL1A 3F63A 2C3TA 1NSWA 3LXZA 4YKFA 2HSNB 2C0FA 5GAPD 1YDKA 4EVMA 3LW9A 1M0UA 2C0GA 3H1NA 5J4UA 2F8FA 4PNFA 2LQQA 3TKSC 2HE3A 2HZEA 4K8MA 2YZUA 2H72A 4ZBBA 2HSMA 3TKQA 4GQFA 4I97A 1Z7PA 2X4AA 4KCEA 3GUSA 3A2VA 2HI7A 2WFCA 2P5RA 2BMXA 4HU7A 2R5GA 1B4PA 3ZMLA 1AW9A 1FVKA 1QK8A 4XRAA 2TRXA 2MMAA 4OCEA 3NZNA 2YWOA 4IGJA 3KM6A 3R2QA 2O7KA 3ISOA 2P5QA 4EUYA 1Z3EA 5ECPB 3QD9A 2YWNA 3WT2A 3HKRA 3VWXA 4CY8A 1OKTA 1XWKA 1A24A 1ZGNA 2MBTA 1SJIA 16GSA 3L0HA 3J7Yk 3E0UA 4L5LA 3DEXA 4OFNA 2WULA 1R7HA 3IHQA 2L6CA 1IYIA 3KXOA 2IJYA 4X4JA 2GQLA 1U3IA 4ULXA 2LJRA 3BCKA 3GKXA 4FYBA 1GNEA 1UC7A 4G0LA 1EWXA 3TJJA 4D73A 4GQCA 1SENA 2H6YA 2L4QA 1T7PB 1J9BA 4KCAA 5IO2A 1Z5YE 2E7PA 1N2AA 2QA2A 2R0GA 3LWAA 4I8BA 4PXOA 5ECIB 2O89A 4BWSA 2O5VA 5F05A 4KDXA 4NHZA 1THOA 4I2TA 1GSUA 3M3MA 3CWGA 3GSTA 2R3XA 1MDIA 4EDZA 3HY2A 4FQUA 1K0MA 4G0IA 3IRAA 3FRCA 1EEJA 4CDOA 5IPGA 3G7JA 2H19A 3ZRDA 4KW6A 1X0RA 4MABA 3UVTA 1FOHA 3IC8A 4ZB9A 1VRSD 2LKUA 4JR4A 2YWMA 2GSSA 5J9CA 4N0ZA 1AUCA 3TJFA 2VM1A 5ID2A 1UVZA 4IJIA 1PKZA 5ECNB 3HVVA 1XXUA 4POLA 3ZLPA 4BPYA 2C1YA 3ZIVA 3C1SA 1SYXA 4F82A 3APQA 3KH9A 4G0KA 1SYRA 1FW1A 5J4YA 3ZL5A 5D8IA 1SL2B 3VURA 5A4UA 3KIJA 2M80A 1ST9A 5GSSA 2OADA 4ZB8A 2LRTA 5F07A 2IFQB 1O8WA 2L5OA 3UAPA 3LEFA 4BL7A 5D73A 1PMTA 1B9YC 1A0FA 2E0QA 4GLTA 4F03A 3D21A 2X8HA 1XFLA 1I9DA 2DSAA 1QUWA 2JACA 3TRQA 1K0AA 2VL2A 4BVXA 2ES7A 2LEGA 2EIRA 2VD1A 2LV3A 2IWTA 2H1BA 1Y25A 1GSSA 4HZ4A 4O92A 4BVYA 2IMEA 3G7IA 3DGQA 4OD7A 2WDUA 1ILOA 1ZYPA 1A0RP 5CREA 2R2JA 1ZYNA 2QA1A 3FR6A 4ECCA 3ZFLA 2XBQA 1QFNA 1V40A 2VCVA 4F0BA 1RW1A 3FZ4A 1ZCPA 5E4WA 2IN3A 4PGTA 4ZL8A 2IMFA 4KDUA 1Z9HA 4YQVA 4TXOB 3HA9A 4JZQA 3ERGA 3M0FA 1V9WA 1SU9A 1JZOA 4POBA 4KDYA 3ED3A 3VI7A 4E8EA 2AJQB 1XWAA 1FAAA 4V2NA 4MCUA 4Q5FA 5GZZB 3HJPA 1GLQA 2HRNA 5G30A 1S3AA 4FH8A 2VCTA 4N30A 4ZXGA 2TIRA 4MPFA 3KGKA 6GSTA 3ZIJA 4ZL7A 4OFTA 1X5DA 3A3TA 2EIQA 1U6TA 3ZVJA 7GSSA 5IPHA 1HNBA 1TRWA 2N5AA 4GRFA 5CRDA 3HDCA 1OC3A 5ECOB 3ERWA 2L59A 1VGLA 1G0TA 1M7TA 4WR4A 17GSA 3MNGA 2H1AA 4K6XA 1TW9A 3GIXA 3TU3B 3IE3A 1AIUA 4MH3A 2GT5A 3CXGA 4MJCA 2RUEA 3TKSE 5DALA 1T3BA 2P0GA 4F2IA 4ZL9A 5BMUB 2L5LA 4PQ1A 3UMAA 2H01A 2M72A 3UBLA 1V57A 5G2ZA 5AN1A 1TK0B 3M1GA 3GV1A 3CYNA 1Z7RA 4XS6A 4TR4A 1NHYA 3HJMA 1FB6A 3GFKA 1O8XA 1XWCA 4PTSA 5J40A 3HXSA 2VM2A 1GSQA 3EINA 2FD3A 1EP7A 2H30A 3L9UA 3SWLA 1PSQA 1A8LA 2YV9A 4L8EA 2O8VB 3APSA 5D93A 2KOKA 4HDEA 2HFDA 1PD21 1I5GA 2ZNMA 1MTCA 3DWVA 4XTSA 2F8AA 2MMNA 2H0GA 3C1RA 1GRXA 5DCGA 2YP6A 2H0IA 5IMZA 4GTUA 2GZZA 1EGRA 2HSNA 1XIYA 2H1LA 4L0UA 5J41A 4MNNA 3IA1A 3MYDA 5KN2A 1YJ6A 3GH9A 2B5EA 2OA7A 2QGVA 5CO3A 5F0GA 1SD9A 2GSRA 4IN0A 1T1VA 2DKHA 4GCIA 4DSSB 1F3BA 1GSDA 3UARA 3VWUA 4L0WA 4X0XA 2DJ2A 3IC4A 4NPBA 5IMDA 2DJ1A 2JL4A 4KH7A 3PGTA 2KHPA 3TKPA 1GP1A 1S3DA 5DQYA 1J0FA 2FCHA 1EP8A 2CX3A 3IAM2 2WJUA 4ACSA 9GSSA 3DMLA 2H75A 5COHA 1JHBA 2GTUA 1R5PA 1OKDA 3QCPA 4NWYA 1CQGA 1JLWA 4AF2A 1XCCA 4WETA 2HRFA 3IXRA 5BRTA 4ILFA 3DXBA 3KTBA 3EURA 1TK5B 1ON4A 3QFAC 2DLXA 4ZBAA 1H75A 2PU9C 1SJZA 1K0BA 3NOFA 5A1NA 4ZILA 2HXKA 3F0IA 2H6ZA 1YEXA 2NVLA 4IP6A 1S3CA 5A5KA 1F9MA 4EKZA 4WR5A 2KP1A 1IYHA 2X64A 1YVLA 1SKWB 5C04A 1OE8A 3KEBA 1X9WB 2CVBA 4WBRD 2WZ9A 6GSXA 4EL1A 5F06A 2VCWA 5G5EA 4N0VA 1Z6MA 1BQ7A 2DJKA 2GQKA 5DDLA 2FA8A 1GL8A 1LBKA 5AIVA 3QR6A 2AYTA 3QAWA 2G0FA 4IVFA 2HRKB 1M99A 4IQ1A 1XZOA 4MA9A 5KOXA 4TKYA 4GWRA 2EFHA 2ON5A 4GF0A 4Z7XA 1B48A 1WWJA 1ZYEA 5IMAA 4WEYA 3ZYWA 4G2EA 2YN1A 2HSYA 2PWJA 1G6YA 3Q74A 5AISA 4A5PA 5GAND 2F9SA 4FYCA 3TOTA 1Y1UA 2OJLA 4EO3A 1GUHA 2IL3A 1K0DA 3BOAA 4TR0A 4K0GA 1TRUA 3CTFA 5IQYA 4GSSA 2OACA 5CRHA 5ECQB 2TRCP 2P31A 5H5QA 5HFKA 1XBSA 3LXTA 4ZB7A 2IFQA 5JCGA 4ML1A 5A34B 4AKIA 1QGVA 2H1GA 1B8XA 4MZBA 1AQWA 4MJBA 1O73A 4USSA 1GUKA 2DMMA 2H71A 2VOCA 2VD0A 19GSA 4KGIA 2R0CA 5HR0A 1BG5A 2WS2A 4AJ7A 2RUFA 2FWHA 1HQOA 3GMFA 1ERTA 5LNKe 4MF5A 4TN8A 3F3QA 2F3MA 1SL0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IR4 A;  1YF0 A;  5ELG A;  2FY6 A;  2JAD A;  4MH2 A;  1TKD B;  5D96 A;  1TK8 B;  3KD0 A;  5CAX A;  3DKS A;  1XW9 A;  2ZCT A;  4OWY A;  5ECK B;  1OE7 A;  2V41 A;  3VPT A;  2I4A A;  1ZL9 A;  4K7N A;  2FNO A;  1GLP A;  2RM6 A;  1NM3 A;  12GS A;  2V6O A;  3BD2 A;  3KZQ A;  3P2A A;  1TI3 A;  2J23 A;  1GWC A;  1O85 A;  4J56 E;  4TXO A;  2VO4 A;  1VF1 A;  4WBJ A;  4KE3 A;  4IKH A;  1WMJ A;  13GS A;  5IIZ A;  1JZW A;  3LSZ A;  1SL1 B;  5HR1 A;  4TVE A;  3LFL A;  5D9V A;  2MYG A;  1QQ2 A;  2C3Q A;  4L5O A;  2FWE A;  4G10 A;  5DAK B;  3F9U A;  4TOP A;  1AXD A;  1R26 A;  3N5O A;  2CZ3 A;  4IJ3 A;  3PR8 A;  2K9F A;  6GSS A;  1OVN A;  2F51 A;  3Q19 A;  4K7I A;  1OC9 B;  5L71 A;  3ZFB A;  1URM A;  4TXV A;  4XS4 B;  1M2D A;  2ZUP A;  4TR3 A;  4ML6 A;  4V1A p;  1PX7 A;  1ERU A;  3AY8 A;  5CRG A;  2C80 A;  2BJX A;  3UJ1 A;  1OAZ A;  5C00 A;  4O5R A;  3MDK A;  1TRS A;  1VF3 A;  3VFI A;  1TOF A;  4MJA A;  1SKR B;  5G1K A;  5BMU A;  3GYK A;  14GS A;  2HZF A;  2DC5 A;  4ZB6 A;  3P7X A;  3QAG A;  5DBQ A;  1AAZ A;  3IOS A;  5HR2 A;  1X5E A;  1X9M B;  1FOV A;  1EGO A;  3FR9 A;  5DVB A;  2OBK A;  4XCS A;  2J9H A;  3TJK A;  1M9A A;  1ZOF A;  4POM A;  1AQX A;  3FZ5 A;  5LCZ A;  3QOU A;  1K0C A;  3PH9 A;  2PVO C;  4G19 A;  2VCZ A;  5B6N A;  4YQU A;  1BED A;  3CSI A;  1JZD A;  3M9K A;  3JCM L;  1K3Y A;  2N5B A;  2GDR A;  2WGR A;  2K8V A;  4OFM A;  3RPP A;  1WP0 A;  5JCU A;  20GS A;  4JR6 A;  4PX1 A;  3CTG A;  1MD4 A;  2DJJ A;  1J08 A;  4NHW A;  4MK3 A;  3HHV A;  1LJR A;  5G1L A;  4QL9 A;  1EV4 A;  2VIM A;  3ZMK A;  4WKW A;  1GSY A;  2GVP A;  1ZZY A;  2GSQ A;  3RPN A;  2VL2 C;  1GSE A;  1PA3 A;  1BAY A;  4DSS A;  1E6B A;  3ME7 A;  2AAW A;  1A2J A;  4PNG A;  1LU4 A;  3FKF A;  4JRR A;  2C0E A;  2PN8 A;  5IM9 A;  2QKE A;  1EOG A;  2AB6 A;  2JZR A;  3I9V 2;  4J2F A;  1EZK A;  5INY A;  4GXZ A;  3RBT A;  2HSH A;  1W4V A;  3VK9 A;  4PUR A;  2I1U A;  1O7U A;  2YWI A;  2VL9 A;  3LYK A;  1O6J A;  4LA1 A;  3IDV A;  2DML A;  2HRA A;  1HD2 A;  3VPQ A;  4XHM A;  2FHE A;  5KN0 A;  3TRX A;  2DJ3 A;  1FB0 A;  3GH6 A;  1XOB A;  2JU5 A;  2XPD A;  3TRP A;  5ECH B;  2C4J A;  2B5Y A;  4WXT A;  2V32 A;  4IEL A;  1GTI A;  1YQ1 A;  1ZYQ B;  5JWQ B;  1ML6 A;  3FW2 A;  2LJA A;  3UOM A;  2NTO A;  3O76 A;  2OE1 A;  1ACV A;  3C7M A;  4KSM A;  2AHE A;  2X8G A;  1GSF A;  1T4Y A;  3C71 A;  3GL5 A;  2PUK C;  1Q4J A;  1OYJ A;  3TJB A;  1XW6 A;  2R37 A;  3EMX A;  3LQ7 A;  4JU5 A;  1TP9 A;  1XWB A;  3TOU A;  5A4W A;  2A2R A;  4MMM A;  3IV4 A;  4FYU A;  5DJL A;  2IIY A;  2MBS A;  2HRK A;  3KMN A;  4HOJ A;  4OCF A;  1EEM A;  2PPT A;  2GLR A;  2YV7 A;  3HCZ A;  4V1A g;  2PGT A;  5CRW A;  5HFG A;  4GSN A;  2LS5 A;  3LGC A;  22GS A;  5IMV A;  1WRY A;  4X1U A;  3A5W A;  2IMK A;  1KTE A;  3IBH A;  5JWR B;  2K6V A;  1XVQ A;  3FY7 A;  5DJM A;  1WOU A;  4HJM A;  4DSQ A;  1THX A;  4KB3 A;  2JSY A;  3G7Y A;  1N8J A;  2JZS A;  5ECS A;  3TCO A;  2B1L A;  1TU8 A;  1YEP A;  3QAV A;  1B4Q A;  1F6M C;  4MZW A;  1QXH A;  1DUG A;  3EMP A;  1XOA A;  3CBU A;  1X5C A;  1A2M A;  2R6K A;  4E8H A;  2LNS A;  5HFI A;  3TKR A;  1A8Y A;  4EC0 A;  1C72 A;  1GNW A;  4RQX A;  3CMI A;  5DCH A;  4AJ8 A;  2VL3 A;  2VCX A;  4IS0 A;  4K2D A;  3MAK A;  2A2S A;  4O32 A;  5B8A A;  2HLS A;  3W8J A;  3HJO A;  5EL8 A;  11GS A;  1R4W A;  3IAS 2;  5IMF A;  1F2E A;  3C8E A;  1M2A A;  3FZA A;  2GQM A;  1G7O A;  2H70 A;  3KCM A;  1TXX A;  3GKM A;  1DE2 A;  4V2M A;  4YQM A;  3LG6 A;  3P8W A;  5GST A;  5LD0 A;  1WJK A;  1DE1 A;  1T4Z A;  3QFB C;  3RHB A;  2V6K A;  4RI6 A;  2WCI A;  3KTL A;  4HUA A;  2NPB A;  3GSS A;  1T8E B;  4LL1 B;  4MZC A;  5KN1 A;  3VLN A;  3PIN A;  5DAK A;  3H79 A;  1K0O A;  4YAV A;  1MD3 A;  4TR1 B;  2PER A;  3KP9 A;  3GTU B;  5KEJ A;  2N5F A;  1MDJ A;  3D4T A;  1XVW A;  2H8L A;  4HQS A;  3TKS A;  1H4O A;  2AV4 A;  2GZP A;  3DRN A;  5H5R A;  3TDG A;  1OC9 A;  2LUS A;  2RII A;  3RAZ A;  3FYG A;  4XS4 A;  3LJR A;  4PQI A;  4POK A;  3H8Q A;  4TW5 A;  3GX8 A;  2VUP A;  5IO0 A;  4ECI A;  2B7K A;  1G7E A;  4MP4 A;  4WF5 A;  5DQS A;  3WGX A;  2QSI A;  1Q98 A;  3QDN A;  2FWF A;  3HZ4 A;  3DD3 A;  3ZIT A;  2OE0 A;  3U6V A;  3HVS A;  3R3E A;  1YZX A;  2VLV A;  1M2B A;  1NW2 A;  2GT6 A;  5J3R A;  1T00 A;  1SKS B;  3GRX A;  5JCW A;  4Q5Q A;  4ECJ A;  4CHS A;  4ZIJ A;  3D4M A;  3IK7 A;  2DBC A;  4HZ2 A;  2PVQ A;  4IBP A;  5FT3 A;  1Z6N A;  3EU3 A;  4WF4 A;  2C8U A;  2K8S A;  2GS3 A;  2X8C A;  5ENU A;  1ABA A;  2LJK A;  1V2A A;  1U87 A;  1JFU A;  4FIW A;  2MZC A;  5IMC A;  3GKK A;  1PX6 A;  1XPV A;  3WD6 A;  1AC1 A;  1NHO A;  1YKC A;  2H6X A;  3F4R A;  2OE3 A;  3QMX A;  3O6T A;  4MF7 A;  2B6M A;  1TRV A;  1UN2 A;  6GSY A;  1K3O A;  3ZZX A;  4HJ2 A;  4XRD A;  2PMT A;  2PBJ A;  3FHK A;  3BCI A;  3KP8 A;  4NAX A;  5IOW A;  4ID0 A;  3CRU A;  3F3R A;  3MSZ A;  4K1F A;  2WRT A;  1VF2 A;  5G31 A;  2QC7 A;  4HS1 A;  2LNT A;  4YAP A;  3W8S A;  2C0D A;  3ZRE A;  2H73 A;  2DJ0 A;  2ALB A;  4I2U A;  2YNX A;  3J7Y b;  4MPG A;  4ISD A;  3WGD A;  5H5S A;  2B1K A;  3UL3 A;  4EDY A;  3D0Z A;  4MJE A;  4NMU A;  1AQV A;  3A2X A;  3M9J A;  1HNA A;  8GSS A;  1KNG A;  5AIX A;  3OR5 A;  3V1W A;  1YKA A;  3UEM A;  4LL4 B;  1FVJ A;  4CW9 A;  3GN3 A;  1U88 A;  3F4T A;  1MEK A;  2MMZ A;  4HI7 A;  2VLT A;  2NBS A;  3E3E A;  4RQR A;  2B7J A;  2I9H A;  3F4S A;  1UA5 A;  5D9X A;  3PPU A;  1KBN A;  2ON7 A;  2H74 A;  4X43 A;  3CSH A;  4G9H A;  2JSZ A;  4IHU A;  3HD5 A;  5CYY A;  3GKN A;  1RQM A;  2VCQ A;  1WIK A;  2H66 A;  3IPZ A;  2R4V A;  3EWL A;  4LLR A;  10GS A;  2HYX A;  1U3A A;  1ERW A;  3ME8 A;  4RI7 A;  4NV5 A;  2HQT A;  3VWW A;  2IMI A;  2FGX A;  4BA7 A;  3US3 A;  2HZE B;  1ZMA A;  6GSU A;  2HSM B;  2CV4 A;  1SK2 A;  3EVI A;  1SJ6 A;  2XBI A;  3L9S A;  1TJD A;  2GST A;  1KEB A;  1PL2 A;  1YY7 A;  1A23 A;  2X99 A;  1WE0 A;  4QQ7 A;  3A2W A;  1DBY A;  1PN9 A;  2OKA A;  3F8U A;  3TUE A;  2CT6 A;  3L4N A;  3GL3 A;  1JLV A;  2KLX A;  1GUM A;  3MWH A;  4QL7 A;  4KF9 A;  5AGY A;  1V58 A;  2I81 A;  2HNL A;  2OBI A;  4Q5N A;  3D22 A;  4OMV A;  4O7H A;  1MDK A;  2REM A;  4XIH A;  3I69 A;  3C73 A;  5D9W A;  2XC2 A;  3L9V A;  2GZY A;  2HT9 A;  4MDC A;  1PQN A;  2YZH A;  2KUC A;  2Z9S A;  2YAN A;  3FZ9 A;  3DVW A;  3W6G A;  4AGS A;  3GHA A;  3FR3 A;  2V2G A;  2YCD A;  3ERF A;  2LTK A;  3F6D A;  4D73 B;  1Y6E A;  2YJ7 A;  2AUV A;  2RM5 A;  3G9B A;  4KX4 A;  4BWQ A;  3KMO A;  4F9Z A;  3BJ5 A;  5FHI A;  4TRX A;  4XS1 A;  2LQO A;  1FG4 A;  3TB2 A;  2JZT A;  5EPF A;  3GX0 A;  3HYP A;  3LOR A;  4GST A;  5J5N A;  2D2Z A;  3D5J A;  1V98 A;  2L6D A;  4YH2 A;  2FUG 2;  4HQZ A;  3K8N A;  3BBY A;  2UZ8 A;  2VLU A;  1HNC A;  4JED A;  1CQH A;  4I5Q A;  1FO5 A;  3GA4 A;  3LYP A;  4LMV A;  1HYU A;  1E2Y A;  1A2L A;  2FLS A;  1F3A A;  2FA4 A;  3UIW A;  3I43 A;  1QMV A;  1O81 A;  5KN3 A;  5F8B A;  5E59 A;  1B9X C;  4RUV A;  5D9T A;  4N10 A;  2BTO T;  3S9F A;  1GTB A;  2E2M A;  5EY6 A;  3Q6O A;  2NDO A;  3EU4 A;  3M8N A;  5ID2 B;  2H1D A;  4N11 A;  3D6I A;  6GSW A;  3ZVJ D;  3F6F A;  4ZBD A;  1GTU A;  4DVC A;  3DYR A;  4MF6 A;  3FEU A;  4EXJ A;  2K18 A;  2A4V A;  2LST A;  4KSO A;  1X9S B;  2O85 A;  4PUF C;  2IMD A;  5CNW A;  1GUL A;  4DEJ A;  2CAI A;  3WT1 A;  4HU9 A;  4BL7 B;  3VI5 A;  2RLI A;  3EYT A;  4JE1 A;  4J57 E;  5HR3 A;  2LRC A;  1YF1 A;  4LMW A;  2KP2 A;  2IPA A;  1JZR A;  1SD8 A;  1ERV A;  2WB9 A;  2FWG A;  4TR1 A;  4F0C A;  2EIO A;  5B7C A;  4OO4 A;  1BJX A;  2B3S A;  4FO5 A;  3GTU A;  4IP1 A;  3KJY A;  3H4K A;  2CVK A;  4IQA A;  5IOX A;  1PGT A;  5ECL B;  4BVX B;  4DSR A;  1R5A A;  4KND A;  1PRX A;  3HZ8 A;  2XHF A;  3DVX A;  2EC4 A;  3TJG A;  5ECM B;  4BVY B;  3L78 A;  3GUR A;  3GNJ A;  4JBB A;  2YPM A;  3H93 A;  1K3L A;  1XWG A;  1G6W A;  4AJ6 A;  2VAF A;  3VWV A;  1FHE A;  4H86 A;  3I6A A;  4PQH A;  18GS A;  1F37 A;  3DIE A;  2V1M A;  4EE0 A;  3E9J B;  2CZ2 A;  3EC3 A;  4KA0 A;  3FK8 A;  2B5X A;  2DIY A;  5EVO A;  2G2Q A;  5HQP A;  5JWO B;  3NIV A;  4P3Y B;  1DSB A;  4EF0 A;  3CRT A;  5B6M A;  4IW9 A;  5A4V A;  4ECB A;  4K9Z A;  3TGZ A;  3CSJ A;  2CQ9 A;  1BYE A;  1TI1 A;  3Q18 A;  3EE2 A;  5ELA A;  5G5F A;  5J9B A;  3ZTL A;  5FWG A;  4KAE A;  1GTA A;  3HVX A;  4V2L A;  1VF4 A;  1RK4 A;  5CP1 A;  3RDW A;  1EOH A;  4HEA 2;  2M46 A;  2GGT A;  4K7O A;  1GH2 A;  6GSV A;  3WGE A;  3UVH A;  1K0N A;  2LRN A;  2H76 A;  2CA8 A;  1PKW A;  5DAL B;  3RHC A;  5ABR A;  1XW5 A;  3KH7 A;  2L4C A;  3APO A;  1EV9 A;  2I3Y A;  4NV2 A;  1SK0 A;  2MMO A;  4MLY A;  4Q5R A;  1TU7 A;  4K0N A;  1TTZ A;  4I6X A;  1WPI A;  1SK1 A;  2DIZ A;  3P90 A;  4OO5 A;  4NXI A;  3IK9 A;  3N9J A;  1TDI A;  4PUA A;  3O3T A;  4KUN A;  3SBC A;  3UBK A;  3WYW A;  2YOI A;  2XPE A;  2YJH A;  1W89 A;  5ECR B;  2CAQ A;  3QPM A;  1M9B A;  2C3N A;  2E2G A;  2CVD A;  1BX9 A;  2L57 A;  1OC8 A;  2O87 A;  1USB A;  3U5R E;  5B8B A;  2CX4 A;  2H0H A;  1PL1 A;  3F63 A;  2C3T A;  1NSW A;  3LXZ A;  2HSN B;  2C0F A;  5GAP D;  1YDK A;  4EVM A;  1M0U A;  2C0G A;  3H1N A;  5J4U A;  2F8F A;  4PNF A;  2LQQ A;  3TKS C;  2HE3 A;  2HZE A;  4K8M A;  2YZU A;  2H72 A;  4ZBB A;  2HSM A;  3TKQ A;  4GQF A;  4I97 A;  1Z7P A;  4KCE A;  3GUS A;  3A2V A;  2HI7 A;  2WFC A;  2P5R A;  2BMX A;  4HU7 A;  2R5G A;  1B4P A;  3ZML A;  1AW9 A;  1FVK A;  1QK8 A;  4XRA A;  2TRX A;  2MMA A;  4OCE A;  3NZN A;  2YWO A;  4IGJ A;  3KM6 A;  3R2Q A;  2O7K A;  3ISO A;  2P5Q A;  4EUY A;  1Z3E A;  5ECP B;  3QD9 A;  2YWN A;  3WT2 A;  3HKR A;  3VWX A;  1OKT A;  1XWK A;  1A24 A;  1ZGN A;  2MBT A;  1SJI A;  16GS A;  3L0H A;  3J7Y k;  3E0U A;  4L5L A;  3DEX A;  4OFN A;  2WUL A;  1R7H A;  3IHQ A;  2L6C A;  1IYI A;  3KXO A;  2IJY A;  2GQL A;  1U3I A;  4ULX A;  2LJR A;  3BCK A;  3GKX A;  4FYB A;  1GNE A;  1UC7 A;  4G0L A;  1EWX A;  3TJJ A;  4D73 A;  4GQC A;  1SEN A;  2H6Y A;  2L4Q A;  1T7P B;  1J9B A;  4KCA A;  5IO2 A;  1Z5Y E;  2E7P A;  1N2A A;  3LWA A;  4I8B A;  4PXO A;  5ECI B;  2O89 A;  4BWS A;  5F05 A;  4KDX A;  4NHZ A;  1THO A;  4I2T A;  1GSU A;  3M3M A;  3GST A;  2R3X A;  1MDI A;  4EDZ A;  3HY2 A;  4FQU A;  4G0I A;  1K0M A;  3IRA A;  3FRC A;  1EEJ A;  4CDO A;  5IPG A;  3G7J A;  2H19 A;  3ZRD A;  4KW6 A;  1X0R A;  4MAB A;  3UVT A;  3IC8 A;  4ZB9 A;  1VRS D;  2LKU A;  4JR4 A;  2YWM A;  2GSS A;  5J9C A;  4N0Z A;  1AUC A;  3TJF A;  2VM1 A;  5ID2 A;  1UVZ A;  4IJI A;  1PKZ A;  5ECN B;  3HVV A;  1XXU A;  4POL A;  3ZLP A;  4BPY A;  2C1Y A;  3ZIV A;  3C1S A;  1SYX A;  4F82 A;  3APQ A;  3KH9 A;  4G0K A;  1SYR A;  1FW1 A;  3ZL5 A;  5D8I A;  1SL2 B;  3VUR A;  5A4U A;  3KIJ A;  2M80 A;  1ST9 A;  5GSS A;  2OAD A;  4ZB8 A;  2LRT A;  5F07 A;  2IFQ B;  1O8W A;  2L5O A;  3UAP A;  3LEF A;  4BL7 A;  5D73 A;  1PMT A;  1B9Y C;  1A0F A;  2E0Q A;  4GLT A;  4F03 A;  3D21 A;  2X8H A;  1XFL A;  1I9D A;  2DSA A;  1QUW A;  2JAC A;  3TRQ A;  1K0A A;  2VL2 A;  4BVX A;  2ES7 A;  2LEG A;  2EIR A;  2VD1 A;  2LV3 A;  2IWT A;  2H1B A;  1Y25 A;  1GSS A;  4HZ4 A;  4O92 A;  4BVY A;  2IME A;  3G7I A;  3DGQ A;  4OD7 A;  2WDU A;  1ILO A;  1A0R P;  5CRE A;  2R2J A;  3FR6 A;  4ECC A;  3ZFL A;  2XBQ A;  1QFN A;  1V40 A;  2VCV A;  4F0B A;  1RW1 A;  3FZ4 A;  1ZCP A;  5E4W A;  2IN3 A;  4PGT A;  4ZL8 A;  2IMF A;  4KDU A;  1Z9H A;  4YQV A;  4TXO B;  3HA9 A;  4JZQ A;  3ERG A;  3M0F A;  1V9W A;  1SU9 A;  1JZO A;  4POB A;  4KDY A;  3ED3 A;  3VI7 A;  4E8E A;  2AJQ B;  1XWA A;  1FAA A;  4V2N A;  4MCU A;  4Q5F A;  5GZZ B;  3HJP A;  1GLQ A;  2HRN A;  5G30 A;  1S3A A;  4FH8 A;  2VCT A;  4N30 A;  4ZXG A;  2TIR A;  4MPF A;  3KGK A;  6GST A;  3ZIJ A;  4ZL7 A;  4OFT A;  1X5D A;  3A3T A;  2EIQ A;  1U6T A;  3ZVJ A;  7GSS A;  5IPH A;  1HNB A;  1TRW A;  2N5A A;  4GRF A;  5CRD A;  3HDC A;  1OC3 A;  5ECO B;  3ERW A;  2L59 A;  1VGL A;  1G0T A;  1M7T A;  4WR4 A;  17GS A;  3MNG A;  2H1A A;  4K6X A;  1TW9 A;  3GIX A;  1AIU A;  3IE3 A;  4MH3 A;  2GT5 A;  3CXG A;  4MJC A;  2RUE A;  3TKS E;  5DAL A;  1T3B A;  2P0G A;  4F2I A;  4ZL9 A;  2L5L A;  4PQ1 A;  3UMA A;  2H01 A;  2M72 A;  3UBL A;  1V57 A;  5G2Z A;  5AN1 A;  1TK0 B;  3M1G A;  3GV1 A;  3CYN A;  1Z7R A;  4XS6 A;  4TR4 A;  1NHY A;  3HJM A;  1FB6 A;  3GFK A;  1O8X A;  1XWC A;  4PTS A;  3HXS A;  2VM2 A;  1GSQ A;  3EIN A;  2FD3 A;  1EP7 A;  2H30 A;  3L9U A;  3SWL A;  1PSQ A;  1A8L A;  2YV9 A;  4L8E A;  2O8V B;  3APS A;  5D93 A;  2KOK A;  4HDE A;  2HFD A;  1PD2 1;  1I5G A;  2ZNM A;  1MTC A;  3DWV A;  4XTS A;  2F8A A;  2MMN A;  2H0G A;  3C1R A;  1GRX A;  5DCG A;  2YP6 A;  2H0I A;  5IMZ A;  4GTU A;  2GZZ A;  1EGR A;  1XIY A;  4L0U A;  5J41 A;  3IA1 A;  5KN2 A;  1YJ6 A;  3GH9 A;  2B5E A;  2OA7 A;  2QGV A;  5CO3 A;  5F0G A;  1SD9 A;  2GSR A;  4IN0 A;  1T1V A;  4GCI A;  4DSS B;  1F3B A;  1GSD A;  3UAR A;  3VWU A;  4L0W A;  4X0X A;  2DJ2 A;  3IC4 A;  4NPB A;  5IMD A;  2DJ1 A;  2JL4 A;  4KH7 A;  3PGT A;  2KHP A;  3TKP A;  1GP1 A;  1S3D A;  5DQY A;  1J0F A;  2FCH A;  1EP8 A;  2CX3 A;  3IAM 2;  2WJU A;  4ACS A;  9GSS A;  3DML A;  2H75 A;  5COH A;  1JHB A;  2GTU A;  1R5P A;  1OKD A;  3QCP A;  4NWY A;  1CQG A;  1JLW A;  4AF2 A;  1XCC A;  4WET A;  2HRF A;  3IXR A;  4ILF A;  3DXB A;  3KTB A;  3EUR A;  1TK5 B;  1ON4 A;  3QFA C;  2DLX A;  4ZBA A;  1H75 A;  2PU9 C;  1SJZ A;  1K0B A;  3NOF A;  4ZIL A;  2HXK A;  3F0I A;  2H6Z A;  1YEX A;  2NVL A;  4IP6 A;  1S3C A;  5A5K A;  1F9M A;  4EKZ A;  4WR5 A;  2KP1 A;  1IYH A;  2X64 A;  1SKW B;  5C04 A;  1OE8 A;  3KEB A;  1X9W B;  2CVB A;  4WBR D;  2WZ9 A;  6GSX A;  4EL1 A;  5F06 A;  2VCW A;  5G5E A;  4N0V A;  1Z6M A;  1BQ7 A;  2DJK A;  2GQK A;  5DDL A;  2FA8 A;  1GL8 A;  1LBK A;  5AIV A;  3QR6 A;  2AYT A;  3QAW A;  2G0F A;  4IVF A;  2HRK B;  1M99 A;  4IQ1 A;  1XZO A;  4MA9 A;  4TKY A;  4GWR A;  2ON5 A;  4GF0 A;  4Z7X A;  1B48 A;  1WWJ A;  1ZYE A;  5IMA A;  4WEY A;  3ZYW A;  4G2E A;  2YN1 A;  2HSY A;  2PWJ A;  1G6Y A;  3Q74 A;  5AIS A;  5GAN D;  2F9S A;  4FYC A;  3TOT A;  2OJL A;  4EO3 A;  1GUH A;  2IL3 A;  1K0D A;  3BOA A;  4TR0 A;  4K0G A;  1TRU A;  3CTF A;  5IQY A;  4GSS A;  2OAC A;  5CRH A;  5ECQ B;  2TRC P;  2P31 A;  5H5Q A;  5HFK A;  1XBS A;  3LXT A;  2IFQ A;  5JCG A;  4ML1 A;  2H1G A;  1QGV A;  4MZB A;  1B8X A;  1AQW A;  4MJB A;  1O73 A;  4USS A;  1GUK A;  2DMM A;  2H71 A;  2VOC A;  2VD0 A;  19GS A;  4KGI A;  5HR0 A;  1BG5 A;  2WS2 A;  4AJ7 A;  2RUF A;  2FWH A;  1HQO A;  3GMF A;  1ERT A;  5LNK e;  4MF5 A;  4TN8 A;  3F3Q A;  2F3M A;  1SL0 B; 
#chains in the Genus database with same CATH topology
 3IR4 A;  1YF0 A;  5ELG A;  2FY6 A;  2JAD A;  4MH2 A;  1TKD B;  5D96 A;  2A4H A;  1TK8 B;  3KD0 A;  5CAX A;  3DKS A;  1XW9 A;  2ZCT A;  5A1N B;  4OWY A;  5ECK B;  1OE7 A;  2V41 A;  3VPT A;  2I4A A;  1ZL9 A;  4K7N A;  2FNO A;  1GLP A;  2RM6 A;  1NM3 A;  12GS A;  2V6O A;  3BD2 A;  3KZQ A;  3P2A A;  1TI3 A;  2J23 A;  1GWC A;  1O85 A;  4J56 E;  4TXO A;  2VO4 A;  1VF1 A;  4WBJ A;  4KE3 A;  4IKH A;  1WMJ A;  13GS A;  5IIZ A;  1JZW A;  3LSZ A;  1SL1 B;  5HR1 A;  4TVE A;  3LFL A;  5D9V A;  5KOW A;  2MYG A;  1QQ2 A;  2C3Q A;  4L5O A;  2FWE A;  4G10 A;  5DAK B;  3F9U A;  4TOP A;  1AXD A;  1R26 A;  3N5O A;  2CZ3 A;  5J4V A;  4IJ3 A;  1SVM A;  3PR8 A;  2K9F A;  4K5S A;  6GSS A;  1OVN A;  2F51 A;  3Q19 A;  4K7I A;  1OC9 B;  1M3J A;  5L71 A;  3ZFB A;  1URM A;  4TXV A;  4XS4 B;  1M2D A;  2ZUP A;  4TR3 A;  5J47 A;  4ML6 A;  2O3E A;  4V1A p;  1PX7 A;  1ERU A;  3AY8 A;  5CRG A;  2C80 A;  2BJX A;  3UJ1 A;  1OAZ A;  5C00 A;  4O5R A;  3MDK A;  1TRS A;  1VF3 A;  3VFI A;  1TOF A;  4MJA A;  1SKR B;  5G1K A;  5BMU A;  3GYK A;  14GS A;  1I1I P;  2HZF A;  3HMJ G;  2DC5 A;  4ZB6 A;  3P7X A;  3QAG A;  5DBQ A;  1AAZ A;  3IOS A;  5HR2 A;  1X5E A;  1X9M B;  1FOV A;  1EGO A;  3FR9 A;  5DVB A;  2OBK A;  4XCS A;  2J9H A;  3TJK A;  1M9A A;  1ZOF A;  4POM A;  1AQX A;  3FZ5 A;  5LCZ A;  3QOU A;  1K0C A;  3PH9 A;  4G01 A;  2PVO C;  4FXY P;  4G19 A;  2VCZ A;  5B6N A;  4YQU A;  1BED A;  4BIK A;  3CSI A;  1JZD A;  3M9K A;  3JCM L;  1K3Y A;  2N5B A;  4Z2R A;  2GDR A;  1N25 A;  2OT3 A;  2WGR A;  2K8V A;  4OFM A;  3RPP A;  1WP0 A;  5JCU A;  20GS A;  4JR6 A;  4PX1 A;  3CTG A;  1MD4 A;  2DJJ A;  1J08 A;  4NHW A;  2WVX B;  4MK3 A;  3HHV A;  1LJR A;  5G1L A;  4QL9 A;  1EV4 A;  2VIM A;  3ZMK A;  4WKW A;  1GSY A;  2GVP A;  4PHZ C;  1ZZY A;  2GSQ A;  3RPN A;  2VL2 C;  1GSE A;  1PA3 A;  1BAY A;  4DSS A;  1E6B A;  3ME7 A;  4O5Q A;  2AAW A;  1A2J A;  4PNG A;  1LU4 A;  3FKF A;  4JRR A;  1SVL A;  2C0E A;  2PN8 A;  5IM9 A;  2QKE A;  1EOG A;  2AB6 A;  2JZR A;  3I9V 2;  4J2F A;  1EZK A;  5INY A;  4GXZ A;  3RBT A;  2HSH A;  1W4V A;  3VK9 A;  4PUR A;  2I1U A;  1O7U A;  2YWI A;  3IHG A;  2VL9 A;  3LYK A;  1O6J A;  4LA1 A;  3IDV A;  2DML A;  2HRA A;  1HD2 A;  3VPQ A;  4XHM A;  2FHE A;  5KN0 A;  3TRX A;  2DJ3 A;  1FB0 A;  3GH6 A;  5A5H B;  1XOB A;  2JU5 A;  2XPD A;  3TRP A;  5ECH B;  2C4J A;  2B5Y A;  4WXT A;  2V32 A;  4IEL A;  1GTI A;  1YQ1 A;  1ZYQ B;  5JWQ B;  1ML6 A;  3FW2 A;  2LJA A;  3UOM A;  4N3Z A;  2NTO A;  3O76 A;  2EFC A;  2OE1 A;  1ACV A;  3C7M A;  4KSM A;  2AHE A;  2X8G A;  1GSF A;  1T4Y A;  3C71 A;  3GL5 A;  2PUK C;  1Q4J A;  1OYJ A;  3TJB A;  1XW6 A;  2R37 A;  3EMX A;  3LQ7 A;  4JU5 A;  1TP9 A;  1XWB A;  3TOU A;  5A4W A;  2A2R A;  4MMM A;  3IV4 A;  4FYU A;  5DJL A;  2IIY A;  2MBS A;  1S4B P;  2HRK A;  3KMN A;  4HOJ A;  4OCF A;  1EEM A;  2PPT A;  2GLR A;  2YV7 A;  3HCZ A;  4V1A g;  1BF5 A;  2PGT A;  5CRW A;  4K5R A;  5HFG A;  4GSN A;  2LS5 A;  3LGC A;  22GS A;  5IMV A;  1WRY A;  3EPT A;  4X1U A;  3A5W A;  2IMK A;  1KTE A;  3IBH A;  5JWR B;  2K6V A;  1XVQ A;  3FY7 A;  5DJM A;  1WOU A;  4HJM A;  4DSQ A;  1THX A;  4KB3 A;  5A34 A;  4Z2T A;  2JSY A;  3G7Y A;  1N8J A;  2JZS A;  5ECS A;  3TCO A;  2B1L A;  1TU8 A;  1YEP A;  3QAV A;  1B4Q A;  1F6M C;  4MZW A;  1QXH A;  1DUG A;  3EMP A;  1XOA A;  3CBU A;  1X5C A;  1A2M A;  2R6K A;  4E8H A;  2LNS A;  5HFI A;  3TKR A;  1A8Y A;  4EC0 A;  1C72 A;  1GNW A;  1PN0 A;  4RQX A;  3CMI A;  5DCH A;  4AJ8 A;  2VL3 A;  2VCX A;  4IS0 A;  4K2D A;  3MAK A;  1TXU A;  2A2S A;  4O32 A;  1BG1 A;  5B8A A;  2HLS A;  3W8J A;  3HJO A;  5EL8 A;  11GS A;  1R4W A;  3IAS 2;  5IMF A;  1F2E A;  3C8E A;  1M2A A;  3FZA A;  2GQM A;  1G7O A;  2H70 A;  3KCM A;  1TXX A;  3GKM A;  4EIP A;  1DE2 A;  4V2M A;  4YQM A;  3LG6 A;  3P8W A;  5GST A;  5LD0 A;  1WJK A;  1DE1 A;  1T4Z A;  3QFB C;  3RHB A;  2V6K A;  4RI6 A;  2WCI A;  3KTL A;  4HUA A;  2NPB A;  3GSS A;  1T8E B;  4LL1 B;  4MZC A;  5KN1 A;  3VLN A;  4YKG A;  3PIN A;  5DAK A;  3H79 A;  1K0O A;  4YAV A;  3RFR C;  4O5U A;  1MD3 A;  4TR1 B;  2PER A;  3KP9 A;  3GTU B;  5KEJ A;  2N5F A;  1MDJ A;  3D4T A;  1XVW A;  2H8L A;  4HQS A;  3TKS A;  1H4O A;  2AV4 A;  2GZP A;  3DRN A;  5H5R A;  3TDG A;  1OC9 A;  2LUS A;  2RII A;  3RAZ A;  3FYG A;  4XS4 A;  3LJR A;  4PQI A;  4POK A;  3H8Q A;  4TW5 A;  3GX8 A;  2VUP A;  5IO0 A;  4ECI A;  2B7K A;  2DKI A;  1G7E A;  4MP4 A;  4WF5 A;  5DQS A;  3WGX A;  2QSI A;  1Q98 A;  3QDN A;  2FWF A;  3HZ4 A;  3DD3 A;  3ZIT A;  2OE0 A;  3U6V A;  3HVS A;  3R3E A;  1YZX A;  2VLV A;  1M2B A;  1NW2 A;  2GT6 A;  2WW2 A;  5J3R A;  1T00 A;  1SKS B;  2VKZ G;  3GRX A;  5JCW A;  4Q5Q A;  3HVN A;  4ECJ A;  4K2X A;  4CHS A;  4ZIJ A;  3D4M A;  3IK7 A;  2DBC A;  4HZ2 A;  2PVQ A;  4IBP A;  5FT3 A;  1Z6N A;  3EU3 A;  4WF4 A;  2C8U A;  2K8S A;  2GS3 A;  2X8C A;  5ENU A;  1ABA A;  2LJK A;  1V2A A;  4W66 A;  1U87 A;  1JFU A;  4FIW A;  2MZC A;  5IMC A;  3GKK A;  1PX6 A;  1XPV A;  3WD6 A;  1AC1 A;  1NHO A;  1YKC A;  1SVO A;  2H6X A;  3F4R A;  2OE3 A;  3QMX A;  3O6T A;  4MF7 A;  4CY6 A;  2B6M A;  1TRV A;  1UN2 A;  6GSY A;  1K3O A;  2WVX A;  3ZZX A;  4HJ2 A;  4XRD A;  2PMT A;  2PBJ A;  3FHK A;  3BCI A;  3KP8 A;  4NAX A;  5IOW A;  4ID0 A;  3CRU A;  3F3R A;  3MSZ A;  4K1F A;  2WRT A;  1VF2 A;  5G31 A;  2QC7 A;  4HS1 A;  2LNT A;  4YAP A;  3W8S A;  2C0D A;  3ZRE A;  2A2P A;  2H73 A;  2DJ0 A;  2ALB A;  4I2U A;  2YNX A;  3J7Y b;  4MPG A;  4ISD A;  3WGD A;  5H5S A;  2B1K A;  3UL3 A;  4EDY A;  4ICY A;  3D0Z A;  4MJE A;  4NMU A;  1AQV A;  3A2X A;  3M9J A;  1HNA A;  8GSS A;  1KNG A;  5AIX A;  3OR5 A;  3V1W A;  1YKA A;  3UEM A;  4LL4 B;  1FVJ A;  4CW9 A;  3GN3 A;  1U88 A;  3F4T A;  1MEK A;  2MMZ A;  4HI7 A;  2VLT A;  2NBS A;  3E3E A;  4RQR A;  2B7J A;  2I9H A;  3F4S A;  1UA5 A;  5D9X A;  5A5H A;  3PPU A;  1KBN A;  2ON7 A;  2H74 A;  4X43 A;  3CSH A;  4G9H A;  2JSZ A;  4IHU A;  3HD5 A;  5CYY A;  3GKN A;  1RQM A;  2VCQ A;  2UV8 G;  1WIK A;  2H66 A;  3IPZ A;  2R4V A;  3EWL A;  2WW1 A;  4LLR A;  10GS A;  2HYX A;  1U3A A;  1ERW A;  3ME8 A;  4RI7 A;  4NV5 A;  2HQT A;  3VWW A;  2IMI A;  2FGX A;  4BA7 A;  3US3 A;  2HZE B;  1ZMA A;  6GSU A;  2HSM B;  2CV4 A;  1SK2 A;  3EVI A;  1SJ6 A;  2XBI A;  3L9S A;  1TJD A;  2GST A;  1KEB A;  1PL2 A;  1YY7 A;  1A23 A;  1M3I A;  2X99 A;  1WE0 A;  4QQ7 A;  3A2W A;  1DBY A;  1PN9 A;  2OKA A;  3F8U A;  3TUE A;  2CT6 A;  3L4N A;  3GL3 A;  1JLV A;  2KLX A;  1GUM A;  3MWH A;  4QL7 A;  4KF9 A;  5AGY A;  4QMK A;  1V58 A;  2I81 A;  2HNL A;  2OBI A;  4Q5N A;  3D22 A;  4OMV A;  4O7H A;  1MDK A;  2REM A;  4XIH A;  3I69 A;  3C73 A;  5D9W A;  2XC2 A;  3L9V A;  2GZY A;  2HT9 A;  4MDC A;  1PQN A;  2YZH A;  2KUC A;  2Z9S A;  2YAN A;  3FZ9 A;  3DVW A;  3W6G A;  4AGS A;  3GHA A;  3FR3 A;  2V2G A;  2YCD A;  3ERF A;  2LTK A;  3F6D A;  4D73 B;  1Y6E A;  2YJ7 A;  2AUV A;  2RM5 A;  3G9B A;  4KX4 A;  4BWQ A;  3KMO A;  4AKX B;  3BJ5 A;  4F9Z A;  5FHI A;  4GDF A;  4TRX A;  4XS1 A;  2LQO A;  1FG4 A;  3TB2 A;  4HSC X;  2JZT A;  5EPF A;  3GX0 A;  3HYP A;  4AKG A;  3LOR A;  4GST A;  5J5N A;  2D2Z A;  3D5J A;  1V98 A;  2L6D A;  4YH2 A;  2FUG 2;  4HQZ A;  3K8N A;  3BBY A;  2UZ8 A;  2VLU A;  1HNC A;  4JED A;  1CQH A;  4I5Q A;  1FO5 A;  3GA4 A;  3LYP A;  4LMV A;  1HYU A;  1E2Y A;  1A2L A;  2FLS A;  1F3A A;  2FA4 A;  3UIW A;  3I43 A;  1QMV A;  1O81 A;  5KN3 A;  5F8B A;  5E59 A;  1B9X C;  4RUV A;  5D9T A;  4N10 A;  2BTO T;  3S9F A;  1GTB A;  2E2M A;  5EY6 A;  3Q6O A;  2NDO A;  3EU4 A;  3M8N A;  5ID2 B;  2H1D A;  4N11 A;  3D6I A;  6GSW A;  3ZVJ D;  3F6F A;  4ZBD A;  1GTU A;  4DVC A;  3DYR A;  4MF6 A;  3FEU A;  4Z2U A;  4EXJ A;  2K18 A;  2A4V A;  2LST A;  4KSO A;  1X9S B;  2O85 A;  4PUF C;  2IMD A;  5CNW A;  3CHX C;  1GUL A;  4DEJ A;  2CAI A;  3WT1 A;  2EFD A;  4HU9 A;  4BL7 B;  3VI5 A;  2RLI A;  3EYT A;  4JE1 A;  4J57 E;  5HR3 A;  2LRC A;  1YF1 A;  4LMW A;  2KP2 A;  3RGB C;  2IPA A;  1JZR A;  1SD8 A;  1ERV A;  2WB9 A;  2FWG A;  4TR1 A;  4F0C A;  2X49 A;  2EIO A;  5B7C A;  4OO4 A;  1BJX A;  2B3S A;  4FO5 A;  3GTU A;  4IP1 A;  3KJY A;  3H4K A;  2CVK A;  4IQA A;  5IOX A;  1PGT A;  5ECL B;  4BVX B;  4DSR A;  1R5A A;  4KND A;  1PRX A;  3HZ8 A;  2XHF A;  3DVX A;  2EC4 A;  3TJG A;  5ECM B;  4BVY B;  3L78 A;  3GUR A;  3GNJ A;  4JBB A;  2YPM A;  3H93 A;  1K3L A;  1XWG A;  1G6W A;  4AJ6 A;  2VAF A;  3VWV A;  1FHE A;  4H86 A;  2EFE A;  3I6A A;  4PQH A;  18GS A;  1F37 A;  3DIE A;  2V1M A;  4EE0 A;  3E9J B;  2CZ2 A;  3EC3 A;  4KA0 A;  3FK8 A;  2B5X A;  2DIY A;  5EVO A;  2G2Q A;  5HQP A;  5JWO B;  3NIV A;  4P3Y B;  1DSB A;  4EF0 A;  3CRT A;  5B6M A;  4IW9 A;  5A4V A;  4ECB A;  4K9Z A;  3TGZ A;  3CSJ A;  2CQ9 A;  1BYE A;  3A5I A;  1TI1 A;  3Q18 A;  3EE2 A;  5ELA A;  5G5F A;  5J9B A;  3ZTL A;  5FWG A;  4EIQ A;  2R0P A;  4KAE A;  1GTA A;  3HVX A;  4V2L A;  1VF4 A;  1RK4 A;  3FMW A;  5CP1 A;  3RDW A;  1EOH A;  4HEA 2;  2M46 A;  2GGT A;  4K7O A;  1GH2 A;  6GSV A;  3WGE A;  3UVH A;  1K0N A;  2LRN A;  2H76 A;  2CA8 A;  2WW3 A;  1PKW A;  5DAL B;  3RHC A;  5ABR A;  1XW5 A;  3KH7 A;  2L4C A;  3APO A;  1EV9 A;  2I3Y A;  4NV2 A;  1SK0 A;  2MMO A;  4MLY A;  4Q5R A;  1TU7 A;  4K0N A;  1TTZ A;  3MIX A;  4I6X A;  1WPI A;  1SK1 A;  2DIZ A;  3P90 A;  4AI6 A;  4OO5 A;  4AKH A;  4NXI A;  3IK9 A;  3N9J A;  1TDI A;  4PUA A;  3O3T A;  4KUN A;  3SBC A;  3UBK A;  3WYW A;  2YOI A;  2XPE A;  2YJH A;  1W89 A;  5ECR B;  2CAQ A;  3QPM A;  1M9B A;  2C3N A;  2E2G A;  2CVD A;  1BX9 A;  2L57 A;  1OC8 A;  2O87 A;  1USB A;  3U5R E;  5B8B A;  2CX4 A;  4E68 A;  2H0H A;  1PL1 A;  3F63 A;  2C3T A;  1NSW A;  3LXZ A;  4YKF A;  2HSN B;  2C0F A;  5GAP D;  1YDK A;  4EVM A;  3LW9 A;  1M0U A;  2C0G A;  3H1N A;  5J4U A;  2F8F A;  4PNF A;  2LQQ A;  3TKS C;  2HE3 A;  2HZE A;  4K8M A;  2YZU A;  2H72 A;  4ZBB A;  2HSM A;  3TKQ A;  4GQF A;  4I97 A;  1Z7P A;  2X4A A;  4KCE A;  3GUS A;  3A2V A;  2HI7 A;  2WFC A;  2P5R A;  2BMX A;  4HU7 A;  2R5G A;  1B4P A;  3ZML A;  1AW9 A;  1FVK A;  1QK8 A;  4XRA A;  2TRX A;  2MMA A;  4OCE A;  3NZN A;  2YWO A;  4IGJ A;  2WVY A;  3KM6 A;  3R2Q A;  2O7K A;  3ISO A;  2P5Q A;  4EUY A;  1Z3E A;  5ECP B;  3QD9 A;  2YWN A;  3WT2 A;  3HKR A;  3VWX A;  4CY8 A;  1OKT A;  1XWK A;  1A24 A;  1ZGN A;  2MBT A;  1SJI A;  16GS A;  3L0H A;  3J7Y k;  3E0U A;  4L5L A;  3DEX A;  4OFN A;  2WUL A;  1R7H A;  3IHQ A;  2L6C A;  1IYI A;  3KXO A;  2IJY A;  4X4J A;  2GQL A;  1U3I A;  4ULX A;  2LJR A;  3BCK A;  3GKX A;  4FYB A;  1GNE A;  1UC7 A;  4G0L A;  1EWX A;  3TJJ A;  4D73 A;  4GQC A;  1SEN A;  2H6Y A;  4PI0 C;  2L4Q A;  1T7P B;  1J9B A;  4KCA A;  5IO2 A;  1Z5Y E;  2E7P A;  1N2A A;  2QA2 A;  2R0G A;  3LWA A;  4I8B A;  4PXO A;  5ECI B;  2O89 A;  4BWS A;  2O5V A;  5F05 A;  4KDX A;  4NHZ A;  1THO A;  4I2T A;  1PFO A;  1GSU A;  3M3M A;  3CWG A;  3GST A;  2R3X A;  1MDI A;  4EDZ A;  3HY2 A;  4FQU A;  1K0M A;  4G0I A;  3IRA A;  3FRC A;  1EEJ A;  4CDO A;  5IPG A;  3G7J A;  3CQF A;  2H19 A;  3ZRD A;  4KW6 A;  1X0R A;  4MAB A;  3UVT A;  1FOH A;  3IC8 A;  4ZB9 A;  1VRS D;  2LKU A;  4JR4 A;  2YWM A;  2GSS A;  5J9C A;  4N0Z A;  1AUC A;  3TJF A;  2VM1 A;  5ID2 A;  1UVZ A;  4IJI A;  1PKZ A;  5ECN B;  3HVV A;  1S3R A;  1XXU A;  4POL A;  3ZLP A;  2O36 A;  4BPY A;  2C1Y A;  3ZIV A;  3C1S A;  1SYX A;  4F82 A;  3APQ A;  3KH9 A;  4G0K A;  1SYR A;  1FW1 A;  5J4Y A;  3ZL5 A;  5D8I A;  1SL2 B;  3VUR A;  5A4U A;  3KIJ A;  2M80 A;  1ST9 A;  2WZS A;  5GSS A;  2OAD A;  4ZB8 A;  2LRT A;  5F07 A;  2IFQ B;  1O8W A;  2L5O A;  3UAP A;  3LEF A;  4BL7 A;  5D73 A;  1PMT A;  1B9Y C;  1A0F A;  2E0Q A;  4GLT A;  4F03 A;  3D21 A;  2X8H A;  1XFL A;  1I9D A;  2DSA A;  1QUW A;  2JAC A;  3TRQ A;  1K0A A;  2VL2 A;  4BVX A;  2ES7 A;  2LEG A;  2EIR A;  2VD1 A;  2LV3 A;  2IWT A;  2H1B A;  1Y25 A;  1GSS A;  4HZ4 A;  4O92 A;  4BVY A;  2IME A;  3G7I A;  3DGQ A;  4OD7 A;  2WDU A;  1ILO A;  1ZYP A;  1A0R P;  5CRE A;  2R2J A;  1ZYN A;  2QA1 A;  3FR6 A;  4ECC A;  3ZFL A;  2XBQ A;  1QFN A;  1V40 A;  2VCV A;  4F0B A;  1RW1 A;  3FZ4 A;  1ZCP A;  5E4W A;  2IN3 A;  4PGT A;  4ZL8 A;  2IMF A;  4KDU A;  1Z9H A;  4YQV A;  4TXO B;  3HA9 A;  4JZQ A;  3ERG A;  3M0F A;  1V9W A;  1SU9 A;  1JZO A;  4POB A;  4KDY A;  3ED3 A;  3VI7 A;  4E8E A;  2AJQ B;  1XWA A;  1FAA A;  4V2N A;  4MCU A;  4Q5F A;  5GZZ B;  3HJP A;  1GLQ A;  2HRN A;  5G30 A;  1S3A A;  4FH8 A;  2VCT A;  4N30 A;  4ZXG A;  2TIR A;  4MPF A;  3KGK A;  6GST A;  3ZIJ A;  4ZL7 A;  4OFT A;  1X5D A;  3A3T A;  2EIQ A;  1U6T A;  3ZVJ A;  7GSS A;  5IPH A;  1HNB A;  1TRW A;  2N5A A;  4GRF A;  5CRD A;  3HDC A;  1OC3 A;  5ECO B;  3ERW A;  2L59 A;  1VGL A;  1G0T A;  1M7T A;  4WR4 A;  17GS A;  3MNG A;  2H1A A;  4K6X A;  1TW9 A;  3GIX A;  3TU3 B;  3IE3 A;  1AIU A;  4MH3 A;  2GT5 A;  3CXG A;  4MJC A;  2RUE A;  3TKS E;  5DAL A;  1T3B A;  2P0G A;  4F2I A;  4ZL9 A;  5BMU B;  2L5L A;  4PQ1 A;  3UMA A;  2H01 A;  2M72 A;  3UBL A;  1V57 A;  5G2Z A;  5AN1 A;  1TK0 B;  3M1G A;  3GV1 A;  3CYN A;  1XG8 A;  1Z7R A;  4XS6 A;  4TR4 A;  1NHY A;  3HJM A;  1FB6 A;  3GFK A;  1O8X A;  1XWC A;  4PTS A;  5J40 A;  3HXS A;  2VM2 A;  1GSQ A;  3EIN A;  2FD3 A;  1EP7 A;  2H30 A;  3L9U A;  3SWL A;  1PSQ A;  1A8L A;  2YV9 A;  4L8E A;  2O8V B;  3APS A;  5D93 A;  2KOK A;  4HDE A;  2HFD A;  1PD2 1;  1I5G A;  2ZNM A;  1MTC A;  3DWV A;  4XTS A;  2F8A A;  2MMN A;  2H0G A;  3C1R A;  1GRX A;  5DCG A;  2YP6 A;  2WVZ A;  2H0I A;  5IMZ A;  4GTU A;  2GZZ A;  1EGR A;  2HSN A;  1XIY A;  2H1L A;  4L0U A;  5J41 A;  4MNN A;  3IA1 A;  4PI2 C;  3MYD A;  5KN2 A;  1YJ6 A;  3GH9 A;  2B5E A;  2OA7 A;  2QGV A;  5CO3 A;  5F0G A;  1SD9 A;  2GSR A;  4IN0 A;  1T1V A;  2DKH A;  4GCI A;  4DSS B;  1F3B A;  1GSD A;  3UAR A;  3VWU A;  4L0W A;  4X0X A;  2DJ2 A;  3IC4 A;  4NPB A;  5IMD A;  2DJ1 A;  2JL4 A;  4KH7 A;  3PGT A;  2KHP A;  3TKP A;  1GP1 A;  1S3D A;  5DQY A;  1J0F A;  2FCH A;  1EP8 A;  2CX3 A;  3IAM 2;  2WJU A;  4ACS A;  9GSS A;  3DML A;  2H75 A;  5COH A;  1JHB A;  2GTU A;  1R5P A;  1OKD A;  3QCP A;  4NWY A;  1CQG A;  1JLW A;  4AF2 A;  1XCC A;  4WET A;  2HRF A;  3IXR A;  5BRT A;  4ILF A;  3DXB A;  3KTB A;  3EUR A;  1TK5 B;  1ON4 A;  3QFA C;  2DLX A;  4ZBA A;  1H75 A;  2PU9 C;  1SJZ A;  1K0B A;  3NOF A;  5A1N A;  4ZIL A;  2HXK A;  3F0I A;  2H6Z A;  1YEX A;  2NVL A;  4IP6 A;  1S3C A;  5A5K A;  1F9M A;  4EKZ A;  4WR5 A;  2KP1 A;  1IYH A;  2X64 A;  1YVL A;  1SKW B;  5C04 A;  1OE8 A;  3KEB A;  1X9W B;  2CVB A;  4WBR D;  2WZ9 A;  6GSX A;  4EL1 A;  5F06 A;  2VCW A;  5G5E A;  4N0V A;  1Z6M A;  1BQ7 A;  2DJK A;  2GQK A;  5DDL A;  2FA8 A;  1GL8 A;  1LBK A;  5AIV A;  3QR6 A;  2AYT A;  3QAW A;  2G0F A;  4IVF A;  2HRK B;  1M99 A;  4IQ1 A;  1XZO A;  4MA9 A;  1YEW C;  5KOX A;  4TKY A;  4GWR A;  2EFH A;  2ON5 A;  4GF0 A;  4Z7X A;  2WW0 A;  1B48 A;  1WWJ A;  1ZYE A;  5IMA A;  4WEY A;  3ZYW A;  4G2E A;  2YN1 A;  2HSY A;  2PWJ A;  1G6Y A;  3Q74 A;  5AIS A;  4A5P A;  5GAN D;  2F9S A;  4FYC A;  3TOT A;  1Y1U A;  2OJL A;  4EO3 A;  1GUH A;  2IL3 A;  1K0D A;  3BOA A;  4TR0 A;  4K0G A;  1TRU A;  3CTF A;  5IQY A;  4GSS A;  2OAC A;  5CRH A;  5ECQ B;  2TRC P;  2P31 A;  5H5Q A;  5HFK A;  1XBS A;  3LXT A;  4ZB7 A;  2IFQ A;  5JCG A;  4ML1 A;  5A34 B;  4AKI A;  1QGV A;  2H1G A;  1B8X A;  4MZB A;  1AQW A;  4MJB A;  1O73 A;  4USS A;  1GUK A;  2DMM A;  2H71 A;  2VOC A;  2VD0 A;  19GS A;  4KGI A;  2R0C A;  5HR0 A;  1BG5 A;  2WS2 A;  4AJ7 A;  2RUF A;  2FWH A;  1HQO A;  3GMF A;  1ERT A;  5LNK e;  4MF5 A;  4TN8 A;  3F3Q A;  2F3M A;  1SL0 B; 
#chains in the Genus database with same CATH homology
 3IR4 A;  1YF0 A;  5ELG A;  2FY6 A;  2JAD A;  4MH2 A;  1TKD B;  5D96 A;  2A4H A;  1TK8 B;  3KD0 A;  5CAX A;  3DKS A;  1XW9 A;  2ZCT A;  5A1N B;  4OWY A;  5ECK B;  1OE7 A;  2V41 A;  3VPT A;  2I4A A;  1ZL9 A;  4K7N A;  2FNO A;  1GLP A;  2RM6 A;  1NM3 A;  12GS A;  2V6O A;  3BD2 A;  3KZQ A;  3P2A A;  1TI3 A;  2J23 A;  1GWC A;  1O85 A;  4J56 E;  4TXO A;  2VO4 A;  1VF1 A;  4WBJ A;  4KE3 A;  4IKH A;  1WMJ A;  13GS A;  5IIZ A;  1JZW A;  3LSZ A;  1SL1 B;  5HR1 A;  4TVE A;  3LFL A;  5D9V A;  5KOW A;  2MYG A;  1QQ2 A;  2C3Q A;  4L5O A;  2FWE A;  4G10 A;  5DAK B;  3F9U A;  4TOP A;  1AXD A;  1R26 A;  3N5O A;  2CZ3 A;  5J4V A;  4IJ3 A;  1SVM A;  3PR8 A;  2K9F A;  4K5S A;  6GSS A;  1OVN A;  2F51 A;  3Q19 A;  4K7I A;  1OC9 B;  5L71 A;  3ZFB A;  1URM A;  4TXV A;  4XS4 B;  1M2D A;  2ZUP A;  4TR3 A;  5J47 A;  4ML6 A;  4V1A p;  1PX7 A;  1ERU A;  3AY8 A;  5CRG A;  2C80 A;  2BJX A;  3UJ1 A;  1OAZ A;  5C00 A;  4O5R A;  3MDK A;  1TRS A;  1VF3 A;  3VFI A;  1TOF A;  4MJA A;  1SKR B;  5G1K A;  5BMU A;  3GYK A;  14GS A;  2HZF A;  3HMJ G;  2DC5 A;  4ZB6 A;  3P7X A;  3QAG A;  5DBQ A;  1AAZ A;  3IOS A;  5HR2 A;  1X5E A;  1X9M B;  1FOV A;  1EGO A;  3FR9 A;  5DVB A;  2OBK A;  4XCS A;  2J9H A;  3TJK A;  1M9A A;  1ZOF A;  4POM A;  1AQX A;  3FZ5 A;  5LCZ A;  3QOU A;  1K0C A;  3PH9 A;  4G01 A;  2PVO C;  4G19 A;  2VCZ A;  5B6N A;  4YQU A;  1BED A;  3CSI A;  1JZD A;  3M9K A;  3JCM L;  1K3Y A;  2N5B A;  4Z2R A;  2GDR A;  1N25 A;  2OT3 A;  2WGR A;  2K8V A;  4OFM A;  3RPP A;  1WP0 A;  5JCU A;  20GS A;  4JR6 A;  4PX1 A;  3CTG A;  1MD4 A;  2DJJ A;  1J08 A;  4NHW A;  4MK3 A;  3HHV A;  1LJR A;  5G1L A;  4QL9 A;  1EV4 A;  2VIM A;  3ZMK A;  4WKW A;  1GSY A;  2GVP A;  1ZZY A;  2GSQ A;  3RPN A;  2VL2 C;  1GSE A;  1PA3 A;  1BAY A;  4DSS A;  1E6B A;  3ME7 A;  4O5Q A;  2AAW A;  1A2J A;  4PNG A;  1LU4 A;  3FKF A;  4JRR A;  1SVL A;  2C0E A;  2PN8 A;  5IM9 A;  2QKE A;  1EOG A;  2AB6 A;  2JZR A;  3I9V 2;  4J2F A;  1EZK A;  5INY A;  4GXZ A;  3RBT A;  2HSH A;  1W4V A;  3VK9 A;  4PUR A;  2I1U A;  1O7U A;  2YWI A;  3IHG A;  2VL9 A;  3LYK A;  1O6J A;  4LA1 A;  3IDV A;  2DML A;  2HRA A;  1HD2 A;  3VPQ A;  4XHM A;  2FHE A;  5KN0 A;  3TRX A;  2DJ3 A;  1FB0 A;  3GH6 A;  5A5H B;  1XOB A;  2JU5 A;  2XPD A;  3TRP A;  5ECH B;  2C4J A;  2B5Y A;  4WXT A;  2V32 A;  4IEL A;  1GTI A;  1YQ1 A;  1ZYQ B;  5JWQ B;  1ML6 A;  3FW2 A;  2LJA A;  3UOM A;  4N3Z A;  2NTO A;  3O76 A;  2EFC A;  2OE1 A;  1ACV A;  3C7M A;  4KSM A;  2AHE A;  2X8G A;  1GSF A;  1T4Y A;  3C71 A;  3GL5 A;  2PUK C;  1Q4J A;  1OYJ A;  3TJB A;  1XW6 A;  2R37 A;  3EMX A;  3LQ7 A;  4JU5 A;  1TP9 A;  1XWB A;  3TOU A;  5A4W A;  2A2R A;  4MMM A;  3IV4 A;  4FYU A;  5DJL A;  2IIY A;  2MBS A;  2HRK A;  3KMN A;  4HOJ A;  4OCF A;  1EEM A;  2PPT A;  2GLR A;  2YV7 A;  3HCZ A;  4V1A g;  1BF5 A;  2PGT A;  5CRW A;  4K5R A;  5HFG A;  4GSN A;  2LS5 A;  3LGC A;  22GS A;  5IMV A;  1WRY A;  3EPT A;  4X1U A;  3A5W A;  2IMK A;  1KTE A;  3IBH A;  5JWR B;  2K6V A;  1XVQ A;  3FY7 A;  5DJM A;  1WOU A;  4HJM A;  4DSQ A;  1THX A;  4KB3 A;  5A34 A;  4Z2T A;  2JSY A;  3G7Y A;  1N8J A;  2JZS A;  5ECS A;  3TCO A;  2B1L A;  1TU8 A;  1YEP A;  3QAV A;  1B4Q A;  1F6M C;  4MZW A;  1QXH A;  1DUG A;  3EMP A;  1XOA A;  3CBU A;  1X5C A;  1A2M A;  2R6K A;  4E8H A;  2LNS A;  5HFI A;  3TKR A;  1A8Y A;  4EC0 A;  1C72 A;  1GNW A;  1PN0 A;  4RQX A;  3CMI A;  5DCH A;  4AJ8 A;  2VL3 A;  2VCX A;  4IS0 A;  4K2D A;  3MAK A;  1TXU A;  2A2S A;  4O32 A;  1BG1 A;  5B8A A;  2HLS A;  3W8J A;  3HJO A;  5EL8 A;  11GS A;  1R4W A;  3IAS 2;  5IMF A;  1F2E A;  3C8E A;  1M2A A;  3FZA A;  2GQM A;  1G7O A;  2H70 A;  3KCM A;  1TXX A;  3GKM A;  4EIP A;  1DE2 A;  4V2M A;  4YQM A;  3LG6 A;  3P8W A;  5GST A;  5LD0 A;  1WJK A;  1DE1 A;  1T4Z A;  3QFB C;  3RHB A;  2V6K A;  4RI6 A;  2WCI A;  3KTL A;  4HUA A;  2NPB A;  3GSS A;  1T8E B;  4LL1 B;  4MZC A;  5KN1 A;  3VLN A;  4YKG A;  3PIN A;  5DAK A;  3H79 A;  1K0O A;  4YAV A;  4O5U A;  1MD3 A;  4TR1 B;  2PER A;  3KP9 A;  3GTU B;  5KEJ A;  2N5F A;  1MDJ A;  3D4T A;  1XVW A;  2H8L A;  4HQS A;  3TKS A;  1H4O A;  2AV4 A;  2GZP A;  3DRN A;  5H5R A;  3TDG A;  1OC9 A;  2LUS A;  2RII A;  3RAZ A;  3FYG A;  4XS4 A;  3LJR A;  4PQI A;  4POK A;  3H8Q A;  4TW5 A;  3GX8 A;  2VUP A;  5IO0 A;  4ECI A;  2B7K A;  2DKI A;  1G7E A;  4MP4 A;  4WF5 A;  5DQS A;  3WGX A;  2QSI A;  1Q98 A;  3QDN A;  2FWF A;  3HZ4 A;  3DD3 A;  3ZIT A;  2OE0 A;  3U6V A;  3HVS A;  3R3E A;  1YZX A;  2VLV A;  1M2B A;  1NW2 A;  2GT6 A;  5J3R A;  1T00 A;  1SKS B;  2VKZ G;  3GRX A;  5JCW A;  4Q5Q A;  4ECJ A;  4K2X A;  4CHS A;  4ZIJ A;  3D4M A;  3IK7 A;  2DBC A;  4HZ2 A;  2PVQ A;  4IBP A;  5FT3 A;  1Z6N A;  3EU3 A;  4WF4 A;  2C8U A;  2K8S A;  2GS3 A;  2X8C A;  5ENU A;  1ABA A;  2LJK A;  1V2A A;  4W66 A;  1U87 A;  1JFU A;  4FIW A;  2MZC A;  5IMC A;  3GKK A;  1PX6 A;  1XPV A;  3WD6 A;  1AC1 A;  1NHO A;  1YKC A;  1SVO A;  2H6X A;  3F4R A;  2OE3 A;  3QMX A;  3O6T A;  4MF7 A;  4CY6 A;  2B6M A;  1TRV A;  1UN2 A;  6GSY A;  1K3O A;  3ZZX A;  4HJ2 A;  4XRD A;  2PMT A;  2PBJ A;  3FHK A;  3BCI A;  3KP8 A;  4NAX A;  5IOW A;  4ID0 A;  3CRU A;  3F3R A;  3MSZ A;  4K1F A;  2WRT A;  1VF2 A;  5G31 A;  2QC7 A;  4HS1 A;  2LNT A;  4YAP A;  3W8S A;  2C0D A;  3ZRE A;  2A2P A;  2H73 A;  2DJ0 A;  2ALB A;  4I2U A;  2YNX A;  3J7Y b;  4MPG A;  4ISD A;  3WGD A;  5H5S A;  2B1K A;  3UL3 A;  4EDY A;  4ICY A;  3D0Z A;  4MJE A;  4NMU A;  1AQV A;  3A2X A;  3M9J A;  1HNA A;  8GSS A;  1KNG A;  5AIX A;  3OR5 A;  3V1W A;  1YKA A;  3UEM A;  4LL4 B;  1FVJ A;  4CW9 A;  3GN3 A;  1U88 A;  3F4T A;  1MEK A;  2MMZ A;  4HI7 A;  2VLT A;  2NBS A;  3E3E A;  4RQR A;  2B7J A;  2I9H A;  3F4S A;  1UA5 A;  5D9X A;  5A5H A;  3PPU A;  1KBN A;  2ON7 A;  2H74 A;  4X43 A;  3CSH A;  4G9H A;  2JSZ A;  4IHU A;  3HD5 A;  5CYY A;  3GKN A;  1RQM A;  2VCQ A;  2UV8 G;  1WIK A;  2H66 A;  3IPZ A;  2R4V A;  3EWL A;  4LLR A;  10GS A;  2HYX A;  1U3A A;  1ERW A;  3ME8 A;  4RI7 A;  4NV5 A;  2HQT A;  3VWW A;  2IMI A;  2FGX A;  4BA7 A;  3US3 A;  2HZE B;  1ZMA A;  6GSU A;  2HSM B;  2CV4 A;  1SK2 A;  3EVI A;  1SJ6 A;  2XBI A;  3L9S A;  1TJD A;  2GST A;  1KEB A;  1PL2 A;  1YY7 A;  1A23 A;  2X99 A;  1WE0 A;  4QQ7 A;  3A2W A;  1DBY A;  1PN9 A;  2OKA A;  3F8U A;  3TUE A;  2CT6 A;  3L4N A;  3GL3 A;  1JLV A;  2KLX A;  1GUM A;  3MWH A;  4QL7 A;  4KF9 A;  5AGY A;  4QMK A;  1V58 A;  2I81 A;  2HNL A;  2OBI A;  4Q5N A;  3D22 A;  4OMV A;  4O7H A;  1MDK A;  2REM A;  4XIH A;  3I69 A;  3C73 A;  5D9W A;  2XC2 A;  3L9V A;  2GZY A;  2HT9 A;  4MDC A;  1PQN A;  2YZH A;  2KUC A;  2Z9S A;  2YAN A;  3FZ9 A;  3DVW A;  3W6G A;  4AGS A;  3GHA A;  3FR3 A;  2V2G A;  2YCD A;  3ERF A;  2LTK A;  3F6D A;  4D73 B;  1Y6E A;  2YJ7 A;  2AUV A;  2RM5 A;  3G9B A;  4KX4 A;  4BWQ A;  3KMO A;  4AKX B;  3BJ5 A;  4F9Z A;  5FHI A;  4GDF A;  4TRX A;  4XS1 A;  2LQO A;  1FG4 A;  3TB2 A;  2JZT A;  5EPF A;  3GX0 A;  3HYP A;  4AKG A;  3LOR A;  4GST A;  5J5N A;  2D2Z A;  3D5J A;  1V98 A;  2L6D A;  4YH2 A;  2FUG 2;  4HQZ A;  3K8N A;  3BBY A;  2UZ8 A;  2VLU A;  1HNC A;  4JED A;  1CQH A;  4I5Q A;  1FO5 A;  3GA4 A;  3LYP A;  4LMV A;  1HYU A;  1E2Y A;  1A2L A;  2FLS A;  1F3A A;  2FA4 A;  3UIW A;  3I43 A;  1QMV A;  1O81 A;  5KN3 A;  5F8B A;  5E59 A;  1B9X C;  4RUV A;  5D9T A;  4N10 A;  2BTO T;  3S9F A;  1GTB A;  2E2M A;  5EY6 A;  3Q6O A;  2NDO A;  3EU4 A;  3M8N A;  5ID2 B;  2H1D A;  4N11 A;  3D6I A;  6GSW A;  3ZVJ D;  3F6F A;  4ZBD A;  1GTU A;  4DVC A;  3DYR A;  4MF6 A;  3FEU A;  4Z2U A;  4EXJ A;  2K18 A;  2A4V A;  2LST A;  4KSO A;  1X9S B;  2O85 A;  4PUF C;  2IMD A;  5CNW A;  1GUL A;  4DEJ A;  2CAI A;  3WT1 A;  2EFD A;  4HU9 A;  4BL7 B;  3VI5 A;  2RLI A;  3EYT A;  4JE1 A;  4J57 E;  5HR3 A;  2LRC A;  1YF1 A;  4LMW A;  2KP2 A;  2IPA A;  1JZR A;  1SD8 A;  1ERV A;  2WB9 A;  2FWG A;  4TR1 A;  4F0C A;  2X49 A;  2EIO A;  5B7C A;  4OO4 A;  1BJX A;  2B3S A;  4FO5 A;  3GTU A;  4IP1 A;  3KJY A;  3H4K A;  2CVK A;  4IQA A;  5IOX A;  1PGT A;  5ECL B;  4BVX B;  4DSR A;  1R5A A;  4KND A;  1PRX A;  3HZ8 A;  2XHF A;  3DVX A;  2EC4 A;  3TJG A;  5ECM B;  4BVY B;  3L78 A;  3GUR A;  3GNJ A;  4JBB A;  2YPM A;  3H93 A;  1K3L A;  1XWG A;  1G6W A;  4AJ6 A;  2VAF A;  3VWV A;  1FHE A;  4H86 A;  2EFE A;  3I6A A;  4PQH A;  18GS A;  1F37 A;  3DIE A;  2V1M A;  4EE0 A;  3E9J B;  2CZ2 A;  3EC3 A;  4KA0 A;  3FK8 A;  2B5X A;  2DIY A;  5EVO A;  2G2Q A;  5HQP A;  5JWO B;  3NIV A;  4P3Y B;  1DSB A;  4EF0 A;  3CRT A;  5B6M A;  4IW9 A;  5A4V A;  4ECB A;  4K9Z A;  3TGZ A;  3CSJ A;  2CQ9 A;  1BYE A;  3A5I A;  1TI1 A;  3Q18 A;  3EE2 A;  5ELA A;  5G5F A;  5J9B A;  3ZTL A;  5FWG A;  4EIQ A;  2R0P A;  4KAE A;  1GTA A;  3HVX A;  4V2L A;  1VF4 A;  1RK4 A;  3FMW A;  5CP1 A;  3RDW A;  1EOH A;  4HEA 2;  2M46 A;  2GGT A;  4K7O A;  1GH2 A;  6GSV A;  3WGE A;  3UVH A;  1K0N A;  2LRN A;  2H76 A;  2CA8 A;  1PKW A;  5DAL B;  3RHC A;  5ABR A;  1XW5 A;  3KH7 A;  2L4C A;  3APO A;  1EV9 A;  2I3Y A;  4NV2 A;  1SK0 A;  2MMO A;  4MLY A;  4Q5R A;  1TU7 A;  4K0N A;  1TTZ A;  3MIX A;  4I6X A;  1WPI A;  1SK1 A;  2DIZ A;  3P90 A;  4AI6 A;  4OO5 A;  4AKH A;  4NXI A;  3IK9 A;  3N9J A;  1TDI A;  4PUA A;  3O3T A;  4KUN A;  3SBC A;  3UBK A;  3WYW A;  2YOI A;  2XPE A;  2YJH A;  1W89 A;  5ECR B;  2CAQ A;  3QPM A;  1M9B A;  2C3N A;  2E2G A;  2CVD A;  1BX9 A;  2L57 A;  1OC8 A;  2O87 A;  1USB A;  3U5R E;  5B8B A;  2CX4 A;  4E68 A;  2H0H A;  1PL1 A;  3F63 A;  2C3T A;  1NSW A;  3LXZ A;  4YKF A;  2HSN B;  2C0F A;  5GAP D;  1YDK A;  4EVM A;  3LW9 A;  1M0U A;  2C0G A;  3H1N A;  5J4U A;  2F8F A;  4PNF A;  2LQQ A;  3TKS C;  2HE3 A;  2HZE A;  4K8M A;  2YZU A;  2H72 A;  4ZBB A;  2HSM A;  3TKQ A;  4GQF A;  4I97 A;  1Z7P A;  2X4A A;  4KCE A;  3GUS A;  3A2V A;  2HI7 A;  2WFC A;  2P5R A;  2BMX A;  4HU7 A;  2R5G A;  1B4P A;  3ZML A;  1AW9 A;  1FVK A;  1QK8 A;  4XRA A;  2TRX A;  2MMA A;  4OCE A;  3NZN A;  2YWO A;  4IGJ A;  3KM6 A;  3R2Q A;  2O7K A;  3ISO A;  2P5Q A;  4EUY A;  1Z3E A;  5ECP B;  3QD9 A;  2YWN A;  3WT2 A;  3HKR A;  3VWX A;  4CY8 A;  1OKT A;  1XWK A;  1A24 A;  1ZGN A;  2MBT A;  1SJI A;  16GS A;  3L0H A;  3J7Y k;  3E0U A;  4L5L A;  3DEX A;  4OFN A;  2WUL A;  1R7H A;  3IHQ A;  2L6C A;  1IYI A;  3KXO A;  2IJY A;  4X4J A;  2GQL A;  1U3I A;  4ULX A;  2LJR A;  3BCK A;  3GKX A;  4FYB A;  1GNE A;  1UC7 A;  4G0L A;  1EWX A;  3TJJ A;  4D73 A;  4GQC A;  1SEN A;  2H6Y A;  2L4Q A;  1T7P B;  1J9B A;  4KCA A;  5IO2 A;  1Z5Y E;  2E7P A;  1N2A A;  2QA2 A;  2R0G A;  3LWA A;  4I8B A;  4PXO A;  5ECI B;  2O89 A;  4BWS A;  2O5V A;  5F05 A;  4KDX A;  4NHZ A;  1THO A;  4I2T A;  1GSU A;  3M3M A;  3CWG A;  3GST A;  2R3X A;  1MDI A;  4EDZ A;  3HY2 A;  4FQU A;  1K0M A;  4G0I A;  3IRA A;  3FRC A;  1EEJ A;  4CDO A;  5IPG A;  3G7J A;  2H19 A;  3ZRD A;  4KW6 A;  1X0R A;  4MAB A;  3UVT A;  1FOH A;  3IC8 A;  4ZB9 A;  1VRS D;  2LKU A;  4JR4 A;  2YWM A;  2GSS A;  5J9C A;  4N0Z A;  1AUC A;  3TJF A;  2VM1 A;  5ID2 A;  1UVZ A;  4IJI A;  1PKZ A;  5ECN B;  3HVV A;  1XXU A;  4POL A;  3ZLP A;  4BPY A;  2C1Y A;  3ZIV A;  3C1S A;  1SYX A;  4F82 A;  3APQ A;  3KH9 A;  4G0K A;  1SYR A;  1FW1 A;  5J4Y A;  3ZL5 A;  5D8I A;  1SL2 B;  3VUR A;  5A4U A;  3KIJ A;  2M80 A;  1ST9 A;  5GSS A;  2OAD A;  4ZB8 A;  2LRT A;  5F07 A;  2IFQ B;  1O8W A;  2L5O A;  3UAP A;  3LEF A;  4BL7 A;  5D73 A;  1PMT A;  1B9Y C;  1A0F A;  2E0Q A;  4GLT A;  4F03 A;  3D21 A;  2X8H A;  1XFL A;  1I9D A;  2DSA A;  1QUW A;  2JAC A;  3TRQ A;  1K0A A;  2VL2 A;  4BVX A;  2ES7 A;  2LEG A;  2EIR A;  2VD1 A;  2LV3 A;  2IWT A;  2H1B A;  1Y25 A;  1GSS A;  4HZ4 A;  4O92 A;  4BVY A;  2IME A;  3G7I A;  3DGQ A;  4OD7 A;  2WDU A;  1ILO A;  1ZYP A;  1A0R P;  5CRE A;  2R2J A;  1ZYN A;  2QA1 A;  3FR6 A;  4ECC A;  3ZFL A;  2XBQ A;  1QFN A;  1V40 A;  2VCV A;  4F0B A;  1RW1 A;  3FZ4 A;  1ZCP A;  5E4W A;  2IN3 A;  4PGT A;  4ZL8 A;  2IMF A;  4KDU A;  1Z9H A;  4YQV A;  4TXO B;  3HA9 A;  4JZQ A;  3ERG A;  3M0F A;  1V9W A;  1SU9 A;  1JZO A;  4POB A;  4KDY A;  3ED3 A;  3VI7 A;  4E8E A;  2AJQ B;  1XWA A;  1FAA A;  4V2N A;  4MCU A;  4Q5F A;  5GZZ B;  3HJP A;  1GLQ A;  2HRN A;  5G30 A;  1S3A A;  4FH8 A;  2VCT A;  4N30 A;  4ZXG A;  2TIR A;  4MPF A;  3KGK A;  6GST A;  3ZIJ A;  4ZL7 A;  4OFT A;  1X5D A;  3A3T A;  2EIQ A;  1U6T A;  3ZVJ A;  7GSS A;  5IPH A;  1HNB A;  1TRW A;  2N5A A;  4GRF A;  5CRD A;  3HDC A;  1OC3 A;  5ECO B;  3ERW A;  2L59 A;  1VGL A;  1G0T A;  1M7T A;  4WR4 A;  17GS A;  3MNG A;  2H1A A;  4K6X A;  1TW9 A;  3GIX A;  3TU3 B;  3IE3 A;  1AIU A;  4MH3 A;  2GT5 A;  3CXG A;  4MJC A;  2RUE A;  3TKS E;  5DAL A;  1T3B A;  2P0G A;  4F2I A;  4ZL9 A;  5BMU B;  2L5L A;  4PQ1 A;  3UMA A;  2H01 A;  2M72 A;  3UBL A;  1V57 A;  5G2Z A;  5AN1 A;  1TK0 B;  3M1G A;  3GV1 A;  3CYN A;  1Z7R A;  4XS6 A;  4TR4 A;  1NHY A;  3HJM A;  1FB6 A;  3GFK A;  1O8X A;  1XWC A;  4PTS A;  5J40 A;  3HXS A;  2VM2 A;  1GSQ A;  3EIN A;  2FD3 A;  1EP7 A;  2H30 A;  3L9U A;  3SWL A;  1PSQ A;  1A8L A;  2YV9 A;  4L8E A;  2O8V B;  3APS A;  5D93 A;  2KOK A;  4HDE A;  2HFD A;  1PD2 1;  1I5G A;  2ZNM A;  1MTC A;  3DWV A;  4XTS A;  2F8A A;  2MMN A;  2H0G A;  3C1R A;  1GRX A;  5DCG A;  2YP6 A;  2H0I A;  5IMZ A;  4GTU A;  2GZZ A;  1EGR A;  2HSN A;  1XIY A;  2H1L A;  4L0U A;  5J41 A;  4MNN A;  3IA1 A;  3MYD A;  5KN2 A;  1YJ6 A;  3GH9 A;  2B5E A;  2OA7 A;  2QGV A;  5CO3 A;  5F0G A;  1SD9 A;  2GSR A;  4IN0 A;  1T1V A;  2DKH A;  4GCI A;  4DSS B;  1F3B A;  1GSD A;  3UAR A;  3VWU A;  4L0W A;  4X0X A;  2DJ2 A;  3IC4 A;  4NPB A;  5IMD A;  2DJ1 A;  2JL4 A;  4KH7 A;  3PGT A;  2KHP A;  3TKP A;  1GP1 A;  1S3D A;  5DQY A;  1J0F A;  2FCH A;  1EP8 A;  2CX3 A;  3IAM 2;  2WJU A;  4ACS A;  9GSS A;  3DML A;  2H75 A;  5COH A;  1JHB A;  2GTU A;  1R5P A;  1OKD A;  3QCP A;  4NWY A;  1CQG A;  1JLW A;  4AF2 A;  1XCC A;  4WET A;  2HRF A;  3IXR A;  5BRT A;  4ILF A;  3DXB A;  3KTB A;  3EUR A;  1TK5 B;  1ON4 A;  3QFA C;  2DLX A;  4ZBA A;  1H75 A;  2PU9 C;  1SJZ A;  1K0B A;  3NOF A;  5A1N A;  4ZIL A;  2HXK A;  3F0I A;  2H6Z A;  1YEX A;  2NVL A;  4IP6 A;  1S3C A;  5A5K A;  1F9M A;  4EKZ A;  4WR5 A;  2KP1 A;  1IYH A;  2X64 A;  1YVL A;  1SKW B;  5C04 A;  1OE8 A;  3KEB A;  1X9W B;  2CVB A;  4WBR D;  2WZ9 A;  6GSX A;  4EL1 A;  5F06 A;  2VCW A;  5G5E A;  4N0V A;  1Z6M A;  1BQ7 A;  2DJK A;  2GQK A;  5DDL A;  2FA8 A;  1GL8 A;  1LBK A;  5AIV A;  3QR6 A;  2AYT A;  3QAW A;  2G0F A;  4IVF A;  2HRK B;  1M99 A;  4IQ1 A;  1XZO A;  4MA9 A;  5KOX A;  4TKY A;  4GWR A;  2EFH A;  2ON5 A;  4GF0 A;  4Z7X A;  1B48 A;  1WWJ A;  1ZYE A;  5IMA A;  4WEY A;  3ZYW A;  4G2E A;  2YN1 A;  2HSY A;  2PWJ A;  1G6Y A;  3Q74 A;  5AIS A;  4A5P A;  5GAN D;  2F9S A;  4FYC A;  3TOT A;  1Y1U A;  2OJL A;  4EO3 A;  1GUH A;  2IL3 A;  1K0D A;  3BOA A;  4TR0 A;  4K0G A;  1TRU A;  3CTF A;  5IQY A;  4GSS A;  2OAC A;  5CRH A;  5ECQ B;  2TRC P;  2P31 A;  5H5Q A;  5HFK A;  1XBS A;  3LXT A;  4ZB7 A;  2IFQ A;  5JCG A;  4ML1 A;  5A34 B;  4AKI A;  1QGV A;  2H1G A;  1B8X A;  4MZB A;  1AQW A;  4MJB A;  1O73 A;  4USS A;  1GUK A;  2DMM A;  2H71 A;  2VOC A;  2VD0 A;  19GS A;  4KGI A;  2R0C A;  5HR0 A;  1BG5 A;  2WS2 A;  4AJ7 A;  2RUF A;  2FWH A;  1HQO A;  3GMF A;  1ERT A;  5LNK e;  4MF5 A;  4TN8 A;  3F3Q A;  2F3M A;  1SL0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...