1JLWA

Anopheles dirus species b glutathione s-transferases 1-4
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
217
structure length
217
Chain Sequence
MDFYYLPGSAPCRAVQMTAAAVGVELNLKLTNLMAGEHMKPEFLKLNPQHCIPTLVDEDGFVLWESRAIQIYLVEKYGAHDADLAERLYPSDPRRRAVVHQRLFFDVAVLYQRFAEYYYPQIFGQKVPVGDPGRLRSMEQALEFLNTFLEGEQYVAGGDDPTIADLSILATIATYEVAGYDLRRYENVQRWYERTSAIVPGADKNVEGAKVFGRYFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords glutathione transferase GST1-4
publication title The crystal structures of glutathione S-transferases isozymes 1-3 and 1-4 from Anopheles dirus species B.
pubmed doi rcsb
source organism Anopheles cracens
molecule tags Transferase
total genus 82
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2001-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1jlwA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1jlwA01
2NVLA 3U6VA 2MMZA 3DD3A 12GSA 1S3AA 5CRDA 1SK0A 1PL1A 1ERWA 1THOA 2F3MA 4X0XA 1ERUA 2CT6A 3LJRA 1GSQA 2YWMA 1GSEA 3C8EA 1WWJA 3RPPA 3P8WA 3DWVA 3FHKA 4L0UA 4MZCA 1F2EA 5IMFA 1BG5A 4BA7A 1R5AA 2MBSA 1EZKA 2KP2A 1ST9A 3ISOA 1SK2A 2AUVA 4QQ7A 4E8EA 2LEGA 1QFNA 3F6FA 2OA7A 4POBA 5ID2B 1MEKA 4K1FA 2WJUA 1DE1A 1O7UA 4H86A 4MH3A 3UJ1A 2B3SA 2EIOA 5GSSA 8GSSA 2JZTA 2R5GA 3LWAA 1TRUA 1GRXA 1K0BA 3CRTA 4K7IA 1A2MA 4KE3A 1RW1A 4IELA 4BVXB 2IMIA 1OKDA 4V1Ap 1OE8A 5F06A 3M9KA 3OR5A 5E4WA 1X9MB 4K7OA 1G0TA 1V58A 3FYGA 2RM6A 2TRCP 3QDNA 1DE2A 3LYKA 1ZOFA 1M2AA 4TKYA 3FZ4A 3HVSA 3D4TA 1M7TA 2FD3A 1K0OA 2XBIA 4IS0A 5ECQB 5ECLB 1H4OA 2I1UA 2JSYA 3TRPA 3H4KA 1YQ1A 3LORA 3RAZA 2FA4A 3LGCA 1R7HA 2HSMB 2DJ2A 3LSZA 6GSUA 2HZEB 3J7Yk 3GHAA 2YWOA 2LRCA 4WBJA 5IQYA 4X1UA 3RBTA 2AHEA 4EUYA 2QSIA 1A2LA 4XS1A 2UZ8A 4ACSA 4I8BA 5COHA 3L78A 4MMMA 3G7YA 1K0MA 5H5QA 4E8HA 3GUSA 4I97A 1SKSB 5LNKe 4BL7B 3L9SA 1QUWA 4ML6A 1ON4A 1U87A 2H6ZA 2WCIA 1QK8A 3GNJA 3D4MA 3QPMA 5D73A 4J56E 1TW9A 5L71A 4ID0A 4ZIJA 3HYPA 3V1WA 5ECKB 3BD2A 4F9ZA 3FY7A 2V1MA 3S9FA 3F4SA 4OO5A 3F3RA 2NBSA 5A4VA 5A4UA 3UVHA 1TK8B 2C8UA 1WP0A 5GSTA 1OVNA 1KEBA 4EE0A 1TK5B 1T1VA 1YDKA 4RQRA 2N5FA 3HJMA 1G6YA 4FO5A 3TGZA 2YPMA 1K3LA 2PVOC 4PGTA 3DMLA 5IM9A 4JR6A 4HJ2A 2WS2A 3GKMA 4MJAA 2K8VA 2B7JA 4O7HA 4JR4A 2XHFA 1M2DA 1B8XA 3KP9A 5E59A 11GSA 1TDIA 4ZXGA 4G2EA 2IFQA 4WR4A 1Z9HA 5ECMB 1GTBA 1X5EA 3ME8A 3WYWA 2LJKA 2VL2A 2PGTA 4KUNA 3K8NA 2H76A 3P90A 4IJ3A 2BMXA 3AY8A 5D96A 2YZHA 3TJFA 1V2AA 3G7IA 2L4CA 3UMAA 5GZZB 4N10A 4ZILA 1GULA 3DXBA 3Q74A 3IK9A 3MSZA 4QL7A 2H0HA 2FY6A 1T7PB 3FR9A 2G2QA 3SBCA 2VLTA 5ECRB 1PKWA 4G10A 1OC3A 4QL9A 3HJOA 2AAWA 5IO2A 3P7XA 2QGVA 2C0EA 1M0UA 2DJ1A 1SJZA 4NMUA 2V32A 3H93A 1K0CA 4YQMA 4YQUA 5B7CA 3NIVA 3LXTA 4K9ZA 2FWFA 1OKTA 3F0IA 4V1Ag 2MMAA 4HU9A 5IOXA 4F82A 2GZZA 4ULXA 5CRWA 16GSA 2ZUPA 4LMWA 1UN2A 5ECIB 1SL2B 2IMDA 3MWHA 2DBCA 2RUFA 1AQWA 1T3BA 3JCML 4NHZA 1G7OA 3H8QA 1BAYA 2X8HA 1B4PA 2FWEA 2HRAA 1CQGA 1BYEA 2C4JA 2X64A 2EIQA 4OO4A 3FK8A 4PNFA 3D5JA 3QFAC 4EL1A 4F0CA 2I81A 1QMVA 4L0WA 18GSA 3IR4A 1F3BA 3GX0A 4XTSA 3BCIA 3ZMLA 1O8WA 4IBPA 1JHBA 3HA9A 2FWGA 1NHOA 5EY6A 2VM1A 2IJYA 1YJ6A 4TR0A 2H01A 4ECCA 1EWXA 1TKDB 5AIXA 2CAQA 5B8AA 2ON7A 3IAS2 1GUMA 5ID2A 3IA1A 5HQPA 4HDEA 3TKQA 5KN1A 2RIIA 3R2QA 2LNSA 4JU5A 1O85A 2DSAA 3MAKA 3KIJA 4PQIA 2NPBA 1THXA 3A2WA 2C3TA 2PN8A 1M2BA 3HZ8A 2H1GA 5BMUA 4ZL9A 2CAIA 1Z7PA 4ZL7A 3CSIA 3P2AA 1K0NA 2GSQA 2HI7A 2VCZA 4PXOA 5CYYA 2BTOT 4BVXA 3KH9A 2FLSA 1SD9A 4ILFA 1FB0A 1A0RP 5CO3A 1PA3A 2V41A 2MMOA 3TOUA 1DSBA 2HQTA 3C73A 1X0RA 5LD0A 2IFQB 1V40A 1RQMA 2O85A 2C0FA 2VUPA 3J7Yb 1A0FA 2CZ2A 4CDOA 2IMEA 3GL5A 2Z9SA 3PH9A 1HNBA 1I5GA 3FRCA 1FOVA 2M80A 1EEJA 3VWXA 1J08A 4LL4B 3F6DA 1KBNA 1PL2A 3Q6OA 5EPFA 4GCIA 2GSRA 2A4VA 4K7NA 3I6AA 2HZEA 3CSHA 1AW9A 2LJAA 2H74A 2LSTA 2H0GA 3QR6A 4KH7A 2OE3A 2H66A 2TIRA 3W6GA 5CP1A 1N2AA 2H72A 6GSSA 3D21A 3ZFBA 3BJ5A 3GTUA 2LJRA 4G19A 4ECJA 3APQA 4JRRA 4PURA 2IPAA 4K6XA 1SKRB 2GVPA 4EO3A 1JZRA 4K0NA 4ZBBA 1SU9A 1V57A 3EMXA 1B4QA 1SJIA 1TXXA 1JZOA 1AC1A 5D9VA 3N9JA 3F9UA 3EWLA 2F51A 3APSA 4ZBAA 6GSVA 22GSA 2OKAA 3DVWA 2AB6A 4NPBA 3EU4A 1XVWA 3ZREA 3O76A 4X43A 3KD0A 5EVOA 1A24A 4HQSA 3GYKA 4IN0A 2R6KA 2LQOA 2H30A 5GAND 3LEFA 4NAXA 4YQVA 3US3A 1O6JA 5CAXA 3A2VA 3HHVA 4YAPA 2ALBA 4FYCA 3HY2A 2K8SA 4PQHA 3QCPA 3HD5A 1Z3EA 1TRSA 2XPEA 3GRXA 2EC4A 1F6MC 3HJPA 2GT6A 2B1LA 3UAPA 5KEJA 2CA8A 4PQ1A 3CRUA 1XW9A 17GSA 5JCGA 4AJ8A 2JZRA 1U6TA 3KXOA 2PPTA 2GGTA 3KJYA 5D8IA 3Q18A 5DJLA 1E6BA 5AN1A 4TXOB 1S3DA 1GLPA 2IMKA 1Q98A 2IMFA 1SYXA 3F3QA 5G30A 1XOBA 1X9SB 4HOJA 2RM5A 4POLA 2BJXA 1MDJA 3C71A 1U88A 1OC9A 2KUCA 4K2DA 4G9HA 3RDWA 3PGTA 5JWRB 3IRAA 3VURA 5FT3A 2WDUA 1BEDA 2NTOA 1ZMAA 5HFGA 5J41A 3UOMA 3QMXA 2K6VA 4O5RA 2RLIA 4POKA 4MCUA 5ECPB 1USBA 1GSFA 1TRWA 3L9VA 1EOHA 4DEJA 2A2RA 2L57A 3E3EA 3KMNA 4DSSB 3GSTA 4OCEA 1XWAA 2DIZA 4D73A 4JBBA 5HR3A 3TJJA 4AJ6A 5G5EA 1FG4A 7GSSA 4I6XA 4L8EA 1TJDA 5ECSA 1HQOA 3D0ZA 4PX1A 2LQQA 4JE1A 3IXRA 4MF6A 5ECNB 4XCSA 5H5SA 1WE0A 3EU3A 4WF5A 3UL3A 1ZYQB 4FH8A 1EOGA 3KM6A 1EP8A 1VF3A 2HSYA 3GL3A 3L4NA 2OE1A 6GSYA 1N8JA 1YF0A 2PBJA 2OBIA 4F0BA 3IOSA 2VCQA 5FHIA 1O81A 5HR1A 2CVDA 3GTUB 1W4VA 5DJMA 1FB6A 1ABAA 3NZNA 2YJHA 4TR3A 1EGRA 4HEA2 3VFIA 1GP1A 5JWQB 3LXZA 5HR0A 4FYBA 1MDIA 2H8LA 2HNLA 4Z7XA 1YKCA 1V98A 3EURA 2YN1A 4KNDA 4HJMA 5ENUA 2WULA 1PQNA 4V2MA 2JSZA 5JWOB 3DGQA 3RHCA 2CV4A 2CQ9A 1GL8A 3BOAA 1U3AA 3D6IA 2CVBA 2R37A 4FQUA 1QGVA 4LL1B 5IMVA 3F8UA 4KX4A 3QD9A 1MD4A 1S3CA 4ZB9A 3PPUA 1TU7A 1YKAA 2REMA 1XXUA 4Q5FA 1A8LA 4O32A 3KCMA 4KSOA 3GH6A 1A8YA 2VCWA 5KN0A 5JCUA 4V2NA 1AQXA 2FGXA 4IW9A 5CRGA 4XS4A 3VPTA 3DVXA 4HS1A 3ERWA 4NXIA 4TOPA 2XC2A 3RHBA 3GKKA 3TB2A 3QAVA 1TP9A 1BQ7A 2IL3A 1X5DA 3GH9A 3M8NA 2DMLA 2O7KA 4KCEA 4ZBDA 2R2JA 4WEYA 3UARA 4ML1A 4ECIA 1OC9B 2VLVA 2JU5A 2DJ0A 3KP8A 3IC8A 2YNXA 1R26A 2E2MA 2KP1A 2OACA 4GQFA 4ISDA 4WXTA 4MZBA 1GTIA 1YZXA 1QXHA 2IIYA 3LG6A 3VI7A 1F9MA 4FYUA 5GAPD 3ERGA 4DSQA 1XCCA 4I5QA 3CSJA 3CTGA 2O89A 1W89A 4MDCA 4D73B 3N5OA 3C1SA 1XOAA 3GKXA 1XW6A 4G0LA 4BWSA 4ZB6A 3M9JA 1RK4A 3F63A 4GQCA 3F4TA 5B8BA 1Q4JA 4DVCA 3GA4A 1ML6A 3FR3A 1GSUA 1ZCPA 3IBHA 1XW5A 3D22A 4KDXA 2H73A 3TKRA 1IYHA 2LV3A 2PUKC 1NHYA 5DQSA 1IYIA 3TKSC 2PERA 2B5XA 1I9DA 1J9BA 2IN3A 4WBRD 5KN2A 2K18A 4OCFA 3A5WA 1GUHA 5DAKA 2L59A 3ME7A 3HVVA 2VL9A 2HRNA 4K8MA 4KGIA 2C3QA 3KH7A 5AGYA 3EINA 3I69A 1ILOA 2WRTA 3FZ5A 1J0FA 4TRXA 2YZUA 2JL4A 5LCZA 4PNGA 1A2JA 4NV2A 1YEPA 4TXOA 4HQZA 3EC3A 4YAVA 1K0AA 2WGRA 1PMTA 2B5YA 1WOUA 5HFKA 4IKHA 2N5BA 3O3TA 3KMOA 5FWGA 4HZ2A 1PKZA 2ZCTA 4KCAA 2L5OA 2HSNB 2MBTA 2L6DA 3R3EA 1OE7A 2FHEA 2GQMA 2IWTA 2WZ9A 4TW5A 3E9JB 3IHQA 4BVYA 2FA8A 3CYNA 3DIEA 4J57E 1V9WA 2HYXA 3IV4A 3CTFA 1PX7A 4MPGA 4IJIA 2HSHA 2GZPA 2KHPA 1WPIA 4DSSA 2YCDA 3KEBA 4GXZA 4IQAA 4N0VA 4Q5NA 2XPDA 1YF1A 1VF2A 2G0FA 1GSDA 4XS4B 4LLRA 5EL8A 1BX9A 1KTEA 3PR8A 2K9FA 1FO5A 1MTCA 1MDKA 3FW2A 2GQLA 5ECHB 4I2UA 4N0ZA 4MPFA 3NOFA 1M99A 4ZB8A 5D9TA 5HFIA 3GKNA 3ZLPA 2V6KA 2P31A 4POMA 1SENA 3MNGA 3QOUA 3HXSA 2VOCA 3ZIVA 1H75A 3TKSE 5AISA 1ERVA 5D9XA 3ZITA 2HRFA 1YEXA 1U3IA 1PSQA 3FR6A 2V6OA 1NSWA 2J9HA 1FW1A 1GNWA 2X99A 3W8SA 2OE0A 1ZZYA 3EE2A 1O8XA 4PUAA 1GSSA 2DJKA 1MD3A 3HKRA 1T4ZA 4DSRA 3VK9A 3I9V2 5DCGA 2DIYA 4OFNA 1JLVA 2AYTA 2QKEA 1DBYA 3QFBC 3HDCA 1T00A 1AXDA 2PMTA 5ELGA 1EV9A 1YY7A 2VD0A 4NHWA 3CXGA 1XWCA 2GLRA 3VI5A 1M9BA 3SWLA 1HNAA 1TU8A 1VF4A 2AV4A 4KSMA 20GSA 2L5LA 1AQVA 2OJLA 5DAKB 4CW9A 2AJQB 2PWJA 2FNOA 2MYGA 4CHSA 3ZFLA 3TDGA 2LKUA 4OMVA 5AIVA 1FVJA 2R3XA 5A4WA 2HFDA 2MMNA 2VL2C 1GUKA 4TN8A 3MDKA 2YOIA 2RUEA 2P5RA 3A2XA 1SK1A 3TRQA 2H19A 3G7JA 5D93A 3ZRDA 2LRNA 5G31A 4LMVA 4EC0A 4BVYB 2M46A 1ERTA 4RQXA 1B9XC 3UBKA 1JZWA 3LQ7A 3L9UA 2VCTA 2L4QA 3WD6A 1B48A 2YWIA 4GTUA 2DJ3A 4MABA 2FCHA 3G9BA 2H1BA 2QC7A 5HR2A 3VPQA 3CBUA 1LBKA 5C00A 3H1NA 3VWVA 3LFLA 4GSSA 4G0KA 4F2IA 3FZAA 4HI7A 3APOA 4HUAA 4L5OA 3UIWA 1XWKA 2VM2A 3TJGA 4AGSA 2PVQA 5DBQA 3ED3A 5DDLA 5G1KA 4TVEA 2R4VA 3ZTLA 9GSSA 1JZDA 1Z6NA 1PX6A 2H70A 1TK0B 4I2TA 1JFUA 2ES7A 2X8CA 2CVKA 1GTAA 3VWUA 4GSNA 2P0GA 3GN3A 1WJKA 3DEXA 4K0GA 1FVKA 2VO4A 2N5AA 3PINA 2HLSA 1AIUA 2GDRA 1FAAA 1F3AA 3C1RA 5IIZA 5IPHA 5H5RA 2GSTA 1VGLA 1FHEA 2VIMA 2H71A 1O73A 1X5CA 1Z7RA 1PD21 1C72A 1LU4A 3M3MA 4JEDA 4PUFC 3HZ4A 5G1LA 2YJ7A 4GRFA 2M72A 4EXJA 2KLXA 2PU9C 4GSTA 2LS5A 1Y25A 3KZQA 4P3YB 1K3OA 2OBKA 4HU7A 5IMZA 2WB9A 1M9AA 1R5PA 1HNCA 3A3TA 1G7EA 5A5KA 2NDOA 4FIWA 4IP1A 5DALA 4NV5A 4Q5RA 1B9YC 4OFTA 3VWWA 1TI3A 3WGEA 5CNWA 4XS6A 4WF4A 2JADA 4TR1A 3ZMKA 4GWRA 2JACA 3UEMA 1HD2A 4OD7A 1R4WA 6GSTA 1GTUA 3CMIA 1XWGA 3QAGA 5CREA 2I9HA 2HRKA 2GZYA 3F4RA 1UC7A 1T4YA 2E0QA 1PGTA 4MP4A 1TI1A 2YWNA 3ZZXA 1EGOA 3KGKA 6GSXA 4XHMA 2ON5A 4F03A 1WIKA 3GSSA 2F8AA 2H75A 3U5RE 2F8FA 3IK7A 4IQ1A 1E2YA 5INYA 4Q5QA 2TRXA 3GIXA 1X9WB 2GQKA 1K3YA 1TOFA 13GSA 2E7PA 3H79A 4MF5A 4XRAA 5J3RA 1T8EB 3KTBA 2C1YA 1GWCA 1VF1A 3IC4A 1NM3A 1SD8A 3UBLA 4EKZA 2VLUA 3GV1A 2MZCA 2LTKA 2HZFA 1SYRA 2E2GA 1XVQA 4MJEA 5ELAA 4OWYA 2LRTA 2HT9A 2YV9A 3DRNA 2XBQA 4KA0A 4WR5A 4XRDA 1WRYA 3WGDA 2C0DA 4JZQA 3WGXA 5B6MA 3GMFA 3TRXA 1WMJA 4IGJA 2F9SA 1OYJA 4KDYA 3WT1A 3ERFA 5J4UA 3M1GA 4AJ7A 1EP7A 2H6YA 1ZGNA 3ZVJA 5CRHA 2B5EA 3DKSA 4KDUA 3Q19A 1XPVA 2ZNMA 5D9WA 4L5LA 4MJBA 1XBSA 4V2LA 5G5FA 3DYRA 1GH2A 3L0HA 2VAFA 1ZL9A 3UVTA 1SJ6A 4GLTA 3EMPA 1URMA 3TJBA 1ZYEA 3FEUA 4G0IA 1QQ2A 4HZ4A 3ZVJD 4WETA 4TXVA 2C3NA 4MK3A 4RI7A 3BCKA 3FKFA 1SL1B 2H1DA 2CX3A 2VCVA 4NWYA 3IE3A 3IAM2 5J5NA 4IVFA 3GURA 3HCZA 4USSA 2HE3A 1EV4A 3ZIJA 2DLXA 2V2GA 2X8GA 5IMDA 1GNEA 2FWHA 4MF7A 1Z6MA 2VL3A 1G6WA 2YANA 3E0UA 3VLNA 3TCOA 1OAZA 1LJRA 1AUCA 2FUG2 3BBYA 5DQYA 1JLWA 4AF2A 4EF0A 4YH2A 5DVBA 1BJXA 2CZ3A 19GSA 1XZOA 3ZYWA 4EVMA 1HYUA 2DC5A 5JCWA 5IMCA 2HXKA 4BPYA 4J2FA 1AAZA 1OC8A 2O87A 4IP6A 2GT5A 1SKWB 1UVZA 4KB3A 1A23A 2OADA 6GSWA 1Y6EA 3I43A 1TTZA 5DALB 1CQHA 5G2ZA 2YV7A 4KAEA 1GLQA 4TR1B 2B6MA 1XWBA 4BWQA 1XFLA 5ABRA 2J23A 4IHUA 4TR4A 3GX8A 5J9CA 2H1AA 5IMAA 5F05A 1K0DA 2KOKA 3O6TA 2HRKB 4KW6A 4LA1A 2YP6A 5J9BA 2EIRA 1PRXA 4N11A 3TJKA 2GTUA 5F0GA 4PTSA 5IOWA 3TKPA 3M0FA 2H0IA 3IPZA 4RI6A 3EVIA 3ZL5A 4O92A 3IDVA 2D2ZA 2A2SA 2B1KA 3WT2A 4MA9A 1EEMA 5B6NA 1GSYA 2C80A 2C0GA 1F37A 2HSMA 2WFCA 4N30A 10GSA 1ACVA 2DJJA 2VD1A 3TUEA 4EDZA 2GS3A 2CX4A 5ECOB 14GSA 1PN9A 3LYPA 2GSSA 2I3YA 5IPGA 3W8JA 3QAWA 1NW2A 2B7KA 4WKWA 5IO0A 2VCXA 3GFKA 4RUVA 2O8VB 1XIYA 5C04A 1KNGA 2JZSA 2P5QA 3TOTA 4MJCA 2L6CA 2LNTA 4ZL8A 4GF0A 4BL7A 4MH2A 4XIHA 1UA5A 1DUGA 1SL0B 3EYTA 2I4AA 4OFMA 5DCHA 5F07A 4EDYA 5F8BA 4MLYA 1TRVA 3RPNA 3HVXA 2H6XA 3KTLA 4KF9A 2DMMA 4ECBA 3FZ9A 3C7MA 4MZWA 3TKSA 1VRSD 2LUSA 1Z5YE 5KN3A
chains in the Genus database with same CATH superfamily
2NVLA 3U6VA 2MMZA 3DD3A 12GSA 1S3AA 5CRDA 1SK0A 1PL1A 1ERWA 1THOA 2F3MA 4X0XA 1ERUA 2CT6A 3LJRA 4ICYA 1GSQA 2YWMA 1GSEA 3C8EA 1WWJA 3RPPA 3P8WA 3DWVA 3FHKA 4L0UA 4MZCA 1F2EA 5IMFA 1BG5A 4BA7A 1R5AA 2MBSA 1EZKA 2KP2A 1ST9A 3ISOA 1SK2A 2AUVA 4QQ7A 4E8EA 2LEGA 1QFNA 3F6FA 2O3EA 2OA7A 4POBA 5ID2B 1MEKA 4K1FA 2WJUA 1DE1A 1O7UA 4H86A 4MH3A 3UJ1A 2B3SA 2EIOA 5GSSA 8GSSA 2WVYA 2JZTA 2R5GA 3LWAA 1TRUA 1GRXA 1K0BA 3CRTA 4K7IA 1A2MA 4KE3A 1RW1A 4IELA 4BVXB 4N3ZA 2IMIA 1OKDA 4V1Ap 1OE8A 5F06A 3M9KA 3OR5A 5E4WA 2QA2A 1X9MB 4K7OA 1G0TA 1V58A 3FYGA 2RM6A 2TRCP 3QDNA 1DE2A 3LYKA 1ZOFA 1M2AA 4TKYA 3FZ4A 2WVXA 4YKFA 3HVSA 3D4TA 1M7TA 2FD3A 1K0OA 2XBIA 2R0PA 4IS0A 5ECQB 5ECLB 1H4OA 2I1UA 2JSYA 3TRPA 3H4KA 5A34A 1YQ1A 3LORA 3RAZA 2FA4A 3LGCA 1R7HA 2HSMB 2DJ2A 3LSZA 6GSUA 2HZEB 3J7Yk 3GHAA 2YWOA 2LRCA 4WBJA 5IQYA 4X1UA 3RBTA 2AHEA 4EUYA 2QSIA 1A2LA 4XS1A 2UZ8A 4ACSA 4I8BA 5COHA 3L78A 5A1NA 4MMMA 3G7YA 1K0MA 5H5QA 4E8HA 3GUSA 4I97A 1SKSB 5LNKe 4BL7B 3L9SA 1QUWA 3FMWA 4ML6A 1ON4A 1U87A 2H6ZA 2WCIA 1QK8A 3GNJA 3D4MA 3QPMA 5D73A 4J56E 1TW9A 5L71A 4ID0A 4ZIJA 3HYPA 3V1WA 5ECKB 3BD2A 4F9ZA 2WW0A 3FY7A 2V1MA 3S9FA 3F4SA 4OO5A 3F3RA 2NBSA 5A4VA 5A4UA 3UVHA 1TK8B 2C8UA 1WP0A 5GSTA 4E68A 1OVNA 1KEBA 4EE0A 1TK5B 1T1VA 1YDKA 4RQRA 4CY8A 2N5FA 3HJMA 1G6YA 4FO5A 3TGZA 2YPMA 1K3LA 2PVOC 4PGTA 4ZB7A 3DMLA 5IM9A 4JR6A 4HJ2A 2WS2A 3GKMA 4MJAA 2K8VA 2B7JA 4O7HA 4JR4A 2XHFA 1M2DA 1B8XA 3KP9A 5E59A 4MNNA 11GSA 1TDIA 4ZXGA 5BRTA 4G2EA 2IFQA 4WR4A 1Z9HA 5ECMB 1GTBA 1X5EA 3ME8A 3WYWA 2LJKA 2VL2A 2PGTA 4KUNA 3K8NA 2H76A 3P90A 4K5RA 1ZYNA 4IJ3A 2BMXA 3MIXA 3AY8A 5D96A 2YZHA 3TJFA 1V2AA 5A5HA 3G7IA 2R0CA 2L4CA 3UMAA 5GZZB 4N10A 4ZILA 1GULA 3DXBA 3Q74A 3IK9A 3MSZA 4QL7A 2H0HA 2FY6A 1T7PB 3FR9A 2G2QA 3SBCA 2VLTA 5ECRB 1PKWA 4G10A 1OC3A 2R0GA 4QL9A 3HJOA 2AAWA 5IO2A 3P7XA 2QGVA 2C0EA 1M0UA 2DJ1A 1SJZA 3TU3B 4NMUA 2V32A 3H93A 1K0CA 4YQMA 4YQUA 5B7CA 3NIVA 3LXTA 3LW9A 4K9ZA 2FWFA 1OKTA 3F0IA 4V1Ag 2MMAA 4HU9A 5IOXA 4F82A 4AI6A 2GZZA 4ULXA 5CRWA 16GSA 2ZUPA 4LMWA 1UN2A 5ECIB 1SL2B 2IMDA 3MWHA 2DBCA 2WVXB 2RUFA 1AQWA 1T3BA 3JCML 4NHZA 1G7OA 3H8QA 1BAYA 2X8HA 1B4PA 2FWEA 2HRAA 1CQGA 1BYEA 2C4JA 2X64A 2EIQA 5A34B 4OO4A 3FK8A 4PNFA 3D5JA 3QFAC 4O5UA 3CQFA 4EL1A 4K2XA 4F0CA 2I81A 2EFDA 1QMVA 4AKXB 4L0WA 18GSA 3IR4A 1F3BA 3GX0A 4XTSA 3BCIA 3ZMLA 1O8WA 4IBPA 1JHBA 3HA9A 2FWGA 4FXYP 1NHOA 5EY6A 2VM1A 2IJYA 1YJ6A 4TR0A 5A1NB 2H01A 4ECCA 1EWXA 1TKDB 5AIXA 2CAQA 4X4JA 5B8AA 2ON7A 2UV8G 3IAS2 2OT3A 1GUMA 5ID2A 3IA1A 5HQPA 4HDEA 3TKQA 5KN1A 2RIIA 3R2QA 2LNSA 4JU5A 1O85A 2DSAA 3MAKA 3KIJA 4PQIA 2NPBA 1THXA 3A2WA 2C3TA 2PN8A 1M2BA 3HZ8A 2H1GA 5BMUA 4ZL9A 2CAIA 1Z7PA 4ZL7A 3CSIA 3P2AA 1K0NA 2GSQA 2HI7A 2VCZA 4PXOA 5CYYA 2BTOT 4BVXA 3KH9A 2FLSA 1SD9A 4ILFA 1FB0A 1A0RP 5CO3A 1PA3A 2V41A 2MMOA 3TOUA 1DSBA 2HQTA 3C73A 1X0RA 5LD0A 2IFQB 1V40A 1RQMA 2O85A 2C0FA 2VUPA 3J7Yb 1A0FA 2CZ2A 4CDOA 2IMEA 3GL5A 2Z9SA 3PH9A 3HMJG 1HNBA 1I5GA 3FRCA 1FOVA 2M80A 1EEJA 3VWXA 4GDFA 1J08A 4LL4B 3F6DA 1KBNA 1PL2A 3Q6OA 5EPFA 4GCIA 2GSRA 2A4VA 4K7NA 3I6AA 2HZEA 3CSHA 1AW9A 2LJAA 2H74A 2LSTA 2H0GA 3QR6A 2WW3A 4KH7A 2OE3A 2H66A 2TIRA 3W6GA 5CP1A 1N2AA 2H72A 6GSSA 3D21A 3ZFBA 3BJ5A 3GTUA 2LJRA 4G19A 4ECJA 3APQA 4JRRA 4PURA 2IPAA 4K6XA 1SKRB 2GVPA 4EO3A 1JZRA 4K0NA 4ZBBA 1SU9A 1V57A 3EMXA 1B4QA 1SJIA 1TXXA 1JZOA 1AC1A 5D9VA 3N9JA 3F9UA 3EWLA 2F51A 3APSA 4ZBAA 6GSVA 22GSA 2OKAA 3DVWA 2AB6A 4NPBA 3EU4A 1XVWA 3ZREA 3O76A 4X43A 3KD0A 5EVOA 1A24A 4HQSA 3GYKA 4IN0A 5J47A 2R6KA 2LQOA 2H30A 5GAND 3LEFA 4NAXA 4YQVA 3US3A 1O6JA 5CAXA 3A2VA 3HHVA 4YAPA 2ALBA 1FOHA 4FYCA 3HY2A 2K8SA 4PQHA 3QCPA 2DKIA 3HD5A 1Z3EA 1TRSA 2XPEA 3GRXA 3RGBC 2EC4A 1F6MC 3HJPA 2GT6A 2B1LA 3UAPA 5KEJA 2CA8A 4PQ1A 3CRUA 1XW9A 17GSA 5JCGA 4AJ8A 2JZRA 1U6TA 3KXOA 2PPTA 2GGTA 3KJYA 1YEWC 5D8IA 3Q18A 5DJLA 1E6BA 5AN1A 4TXOB 1S3DA 1GLPA 2IMKA 1Q98A 1SVMA 2IMFA 1SYXA 3F3QA 5G30A 1XOBA 1X9SB 4HOJA 2RM5A 4POLA 4G01A 2BJXA 1MDJA 3C71A 1U88A 1OC9A 2KUCA 4K2DA 4G9HA 3RDWA 3PGTA 5BMUB 5JWRB 3IRAA 3VURA 5FT3A 2WDUA 1BEDA 2NTOA 1ZMAA 5HFGA 5J41A 3UOMA 3QMXA 2K6VA 4O5RA 2RLIA 4POKA 4MCUA 5ECPB 1USBA 1GSFA 3CHXC 1TRWA 3L9VA 1EOHA 4DEJA 2A2RA 2L57A 3E3EA 3KMNA 4DSSB 3GSTA 4OCEA 1XWAA 2DIZA 4D73A 4JBBA 5HR3A 3TJJA 4AJ6A 5G5EA 1FG4A 7GSSA 4I6XA 4L8EA 1TJDA 5ECSA 1HQOA 3D0ZA 4PX1A 2LQQA 4JE1A 3IXRA 4MF6A 5ECNB 4XCSA 5H5SA 1WE0A 3EU3A 4WF5A 3UL3A 1ZYQB 4FH8A 1EOGA 3KM6A 1EP8A 2O5VA 1VF3A 1YVLA 2HSYA 3GL3A 3L4NA 2OE1A 6GSYA 1N8JA 1YF0A 2PBJA 2OBIA 4F0BA 3IOSA 2VCQA 5FHIA 1O81A 5HR1A 2CVDA 3GTUB 1W4VA 5DJMA 1FB6A 1ABAA 3NZNA 2YJHA 2O36A 4YKGA 4TR3A 1EGRA 4HEA2 3VFIA 1GP1A 5JWQB 3LXZA 5HR0A 4FYBA 1MDIA 1ZYPA 2H8LA 2HNLA 4Z7XA 4CY6A 1YKCA 1V98A 3EURA 5J4YA 2YN1A 4KNDA 4HJMA 5ENUA 2WULA 1PQNA 4V2MA 2JSZA 5JWOB 3DGQA 3RHCA 2CV4A 2CQ9A 1GL8A 2HSNA 3BOAA 1U3AA 3D6IA 2CVBA 2R37A 4FQUA 1QGVA 4LL1B 5IMVA 3F8UA 4KX4A 3HVNA 3QD9A 1MD4A 1S3CA 4ZB9A 3PPUA 1TU7A 1YKAA 2REMA 1XXUA 4Q5FA 1A8LA 4O32A 3KCMA 3MYDA 4KSOA 3GH6A 1A8YA 2VCWA 5KN0A 5JCUA 4V2NA 1AQXA 2FGXA 4IW9A 5CRGA 4XS4A 3VPTA 3DVXA 4HS1A 3ERWA 4NXIA 4TOPA 2XC2A 3RHBA 3GKKA 3TB2A 3QAVA 1TP9A 1BQ7A 2IL3A 1X5DA 3GH9A 3M8NA 2DMLA 2O7KA 4KCEA 4ZBDA 2R2JA 4WEYA 3UARA 4ML1A 4ECIA 1OC9B 2VLVA 2JU5A 2DJ0A 3KP8A 3IC8A 2YNXA 1R26A 2E2MA 2KP1A 2OACA 4GQFA 4ISDA 4WXTA 4MZBA 1GTIA 1YZXA 1QXHA 2IIYA 3LG6A 3VI7A 1F9MA 4FYUA 5GAPD 3ERGA 5J40A 4DSQA 1XCCA 4I5QA 3CSJA 3CTGA 2O89A 1W89A 4MDCA 4D73B 3N5OA 3C1SA 1XOAA 1Y1UA 3GKXA 1XW6A 4G0LA 4BWSA 4ZB6A 3M9JA 1RK4A 3F63A 4GQCA 3F4TA 5B8BA 1Q4JA 4DVCA 3GA4A 1PFOA 1ML6A 3FR3A 1GSUA 1ZCPA 3IBHA 1XW5A 3D22A 4Z2RA 4K5SA 4KDXA 2H73A 3TKRA 1IYHA 2LV3A 2PUKC 1NHYA 5DQSA 1IYIA 3TKSC 2PERA 2B5XA 1I9DA 1J9BA 5J4VA 2IN3A 4AKGA 4WBRD 5KN2A 2K18A 4OCFA 3A5WA 1GUHA 5DAKA 2L59A 3ME7A 3HVVA 2X4AA 2VL9A 1TXUA 2HRNA 4K8MA 4KGIA 2C3QA 3KH7A 5AGYA 3EINA 3I69A 4HSCX 1ILOA 2WRTA 3FZ5A 1J0FA 4TRXA 2YZUA 2JL4A 5LCZA 4PNGA 1A2JA 4NV2A 1YEPA 4TXOA 4HQZA 3EC3A 4YAVA 1K0AA 2WGRA 1PMTA 2B5YA 1WOUA 5HFKA 4IKHA 2N5BA 3O3TA 3KMOA 5FWGA 4HZ2A 1PKZA 2ZCTA 4KCAA 2L5OA 2HSNB 1S3RA 2MBTA 2L6DA 3R3EA 1OE7A 2FHEA 2GQMA 2IWTA 2WZ9A 4TW5A 3E9JB 3IHQA 4BVYA 2FA8A 3CYNA 4W66A 3DIEA 4J57E 1V9WA 2HYXA 3IV4A 3CTFA 1PX7A 4MPGA 4IJIA 2HSHA 2GZPA 2KHPA 1WPIA 4DSSA 2YCDA 3KEBA 4GXZA 4IQAA 4N0VA 4Q5NA 2XPDA 1YF1A 1M3IA 1VF2A 2G0FA 1GSDA 4XS4B 4LLRA 5EL8A 1BX9A 1KTEA 3PR8A 2K9FA 1FO5A 1MTCA 1MDKA 3FW2A 2EFEA 2GQLA 5ECHB 4I2UA 4N0ZA 4MPFA 3NOFA 1M99A 4ZB8A 5D9TA 5HFIA 3GKNA 3ZLPA 2V6KA 2P31A 4POMA 3RFRC 1SENA 3MNGA 3QOUA 3HXSA 2VOCA 2WZSA 3ZIVA 1H75A 3TKSE 5AISA 1ERVA 5D9XA 3ZITA 2HRFA 1YEXA 1U3IA 1PSQA 3FR6A 2V6OA 1NSWA 2J9HA 1FW1A 1GNWA 2X99A 3W8SA 2OE0A 1ZZYA 3EE2A 1O8XA 4PUAA 1GSSA 2DJKA 1MD3A 3HKRA 1T4ZA 4DSRA 3VK9A 3I9V2 5DCGA 2DIYA 4OFNA 1JLVA 2AYTA 2QKEA 1DBYA 3QFBC 3HDCA 1T00A 1AXDA 2PMTA 5ELGA 1EV9A 1YY7A 2VD0A 4NHWA 3CXGA 1M3JA 1XWCA 2GLRA 3VI5A 1M9BA 3SWLA 1HNAA 4A5PA 1TU8A 1VF4A 2AV4A 4KSMA 20GSA 2L5LA 1AQVA 2OJLA 5DAKB 4CW9A 2AJQB 2PWJA 2FNOA 2MYGA 4CHSA 3ZFLA 3TDGA 2LKUA 4OMVA 5AIVA 1FVJA 2R3XA 5A4WA 2HFDA 2MMNA 2VL2C 1GUKA 4TN8A 3MDKA 2YOIA 2RUEA 1SVLA 2P5RA 3A2XA 1SK1A 3TRQA 2H19A 3G7JA 5D93A 3ZRDA 2LRNA 5G31A 4LMVA 4EC0A 4BVYB 2WVZA 2M46A 1ERTA 4RQXA 1B9XC 3UBKA 1JZWA 3LQ7A 3L9UA 2VCTA 2L4QA 3WD6A 1B48A 2YWIA 4GTUA 2DJ3A 4MABA 2FCHA 3G9BA 2H1BA 2QC7A 5HR2A 3VPQA 3CBUA 1LBKA 5C00A 3H1NA 3VWVA 3LFLA 4GSSA 4G0KA 4F2IA 3FZAA 4HI7A 3APOA 4HUAA 1BG1A 4L5OA 2QA1A 3UIWA 1XWKA 2VM2A 3TJGA 4AGSA 2PVQA 5DBQA 3ED3A 5KOWA 5DDLA 5G1KA 4TVEA 2R4VA 1S4BP 3ZTLA 2DKHA 9GSSA 1JZDA 1Z6NA 1PX6A 2H70A 1TK0B 4I2TA 1JFUA 2ES7A 2X8CA 2CVKA 1GTAA 3VWUA 4GSNA 1PN0A 2P0GA 3GN3A 1WJKA 3DEXA 4K0GA 1FVKA 2VO4A 4Z2UA 2N5AA 3PINA 2HLSA 1AIUA 2GDRA 1FAAA 1F3AA 3C1RA 5IIZA 5IPHA 5H5RA 2GSTA 1VGLA 1FHEA 2VIMA 2H71A 2A4HA 3A5IA 1O73A 1X5CA 1Z7RA 1PD21 1C72A 1LU4A 3M3MA 2WW2A 2A2PA 4JEDA 4PUFC 3HZ4A 5KOXA 5G1LA 2YJ7A 4GRFA 2M72A 4EXJA 2KLXA 2PU9C 4GSTA 2LS5A 1Y25A 3KZQA 4P3YB 1K3OA 2OBKA 4HU7A 5IMZA 2WB9A 1M9AA 1R5PA 1HNCA 3A3TA 1G7EA 5A5KA 2NDOA 4FIWA 4IP1A 5DALA 4NV5A 1BF5A 4Q5RA 1B9YC 4OFTA 3VWWA 1TI3A 3WGEA 5CNWA 4XS6A 4PI2C 4WF4A 2JADA 4TR1A 3ZMKA 4GWRA 4AKIA 2JACA 3UEMA 1HD2A 4OD7A 1R4WA 6GSTA 1GTUA 3CMIA 1XWGA 3QAGA 5CREA 2I9HA 2HRKA 2GZYA 3F4RA 1UC7A 1T4YA 2E0QA 1PGTA 4MP4A 1TI1A 2YWNA 3ZZXA 1EGOA 4PI0C 3KGKA 6GSXA 4XHMA 2ON5A 4F03A 1WIKA 3GSSA 2F8AA 2H75A 3U5RE 2F8FA 3IK7A 4IQ1A 1E2YA 5INYA 3CWGA 4Q5QA 2TRXA 3GIXA 1X9WB 2GQKA 1K3YA 1TOFA 13GSA 2E7PA 3H79A 4MF5A 4XRAA 5J3RA 1T8EB 3KTBA 1I1IP 2C1YA 3IHGA 1GWCA 4O5QA 1VF1A 1XG8A 3IC4A 1NM3A 1SD8A 3UBLA 4EKZA 2VLUA 3GV1A 2MZCA 2LTKA 2HZFA 1SYRA 2E2GA 1XVQA 4MJEA 5ELAA 4OWYA 2LRTA 2HT9A 2YV9A 3DRNA 2XBQA 4KA0A 4WR5A 4XRDA 1WRYA 3WGDA 2C0DA 4JZQA 2X49A 3WGXA 5B6MA 3GMFA 3TRXA 1WMJA 4IGJA 2F9SA 1OYJA 4BIKA 4KDYA 3WT1A 2H1LA 3ERFA 5J4UA 3M1GA 4AJ7A 1EP7A 2H6YA 1ZGNA 3ZVJA 5CRHA 2B5EA 2VKZG 3DKSA 4KDUA 3Q19A 1XPVA 2ZNMA 5D9WA 4L5LA 4MJBA 1XBSA 4V2LA 5G5FA 3DYRA 1GH2A 3L0HA 2VAFA 1ZL9A 4EIQA 3UVTA 1SJ6A 4GLTA 3EMPA 1URMA 3TJBA 1ZYEA 3FEUA 4G0IA 1QQ2A 4HZ4A 3ZVJD 4WETA 4TXVA 2C3NA 4MK3A 1SVOA 4RI7A 3BCKA 3FKFA 1SL1B 2H1DA 2CX3A 2VCVA 4NWYA 3IE3A 1N25A 3IAM2 2EFCA 5J5NA 4IVFA 3GURA 3HCZA 4USSA 4QMKA 2HE3A 1EV4A 3ZIJA 2DLXA 2V2GA 2X8GA 5IMDA 1GNEA 2FWHA 4MF7A 1Z6MA 2VL3A 1G6WA 2YANA 3E0UA 3VLNA 3TCOA 1OAZA 1LJRA 1AUCA 2FUG2 3EPTA 3BBYA 5DQYA 1JLWA 4AF2A 4EF0A 4YH2A 5DVBA 1BJXA 2CZ3A 19GSA 1XZOA 3ZYWA 4EVMA 1HYUA 2DC5A 5JCWA 5IMCA 2HXKA 4BPYA 4J2FA 1AAZA 1OC8A 2O87A 4IP6A 2GT5A 1SKWB 1UVZA 4KB3A 1A23A 2OADA 6GSWA 1Y6EA 3I43A 1TTZA 4Z2TA 5DALB 1CQHA 5G2ZA 2YV7A 4KAEA 1GLQA 2EFHA 4TR1B 2B6MA 1XWBA 4BWQA 2WW1A 1XFLA 5ABRA 2J23A 4IHUA 4TR4A 3GX8A 5J9CA 2H1AA 5IMAA 5F05A 1K0DA 2KOKA 3O6TA 2HRKB 4KW6A 4LA1A 2YP6A 5J9BA 2EIRA 4PHZC 1PRXA 4N11A 3TJKA 2GTUA 5F0GA 4PTSA 5IOWA 3TKPA 3M0FA 2H0IA 3IPZA 4RI6A 3EVIA 3ZL5A 4O92A 3IDVA 2D2ZA 2A2SA 2B1KA 3WT2A 4MA9A 1EEMA 5B6NA 1GSYA 2C80A 2C0GA 1F37A 2HSMA 2WFCA 4N30A 10GSA 1ACVA 2DJJA 4EIPA 5A5HB 2VD1A 3TUEA 4EDZA 2GS3A 2CX4A 5ECOB 14GSA 1PN9A 3LYPA 2GSSA 2I3YA 5IPGA 3W8JA 3QAWA 1NW2A 2B7KA 4AKHA 4WKWA 5IO0A 2VCXA 3GFKA 4RUVA 2O8VB 1XIYA 5C04A 1KNGA 2JZSA 2P5QA 3TOTA 4MJCA 2L6CA 2LNTA 4ZL8A 4GF0A 4BL7A 4MH2A 4XIHA 1UA5A 1DUGA 1SL0B 3EYTA 2I4AA 4OFMA 5DCHA 5F07A 4EDYA 5F8BA 4MLYA 1TRVA 3RPNA 3HVXA 2H6XA 3KTLA 4KF9A 2DMMA 4ECBA 3FZ9A 3C7MA 4MZWA 3TKSA 1VRSD 2LUSA 1Z5YE 5KN3A
chains in the Genus database with same CATH topology
2NVLA 3U6VA 2MMZA 3DD3A 12GSA 1S3AA 5CRDA 1SK0A 1PL1A 1ERWA 1THOA 2F3MA 4X0XA 1ERUA 2CT6A 3LJRA 4ICYA 1GSQA 2YWMA 1GSEA 3C8EA 1WWJA 3RPPA 3P8WA 3DWVA 3FHKA 4L0UA 4MZCA 1F2EA 5IMFA 1BG5A 4BA7A 1R5AA 2MBSA 1EZKA 2KP2A 1ST9A 3ISOA 1SK2A 2AUVA 4QQ7A 4E8EA 2LEGA 1QFNA 3F6FA 2OA7A 4POBA 5ID2B 1MEKA 4K1FA 2WJUA 1DE1A 1O7UA 4H86A 4MH3A 3UJ1A 2B3SA 2EIOA 5GSSA 8GSSA 2JZTA 2R5GA 3LWAA 1TRUA 1GRXA 1K0BA 3CRTA 4K7IA 1A2MA 4KE3A 1RW1A 4IELA 4BVXB 4N3ZA 2IMIA 1OKDA 4V1Ap 1OE8A 5F06A 3M9KA 3OR5A 5E4WA 2QA2A 1X9MB 4K7OA 1G0TA 1V58A 3FYGA 2RM6A 2TRCP 3QDNA 1DE2A 3LYKA 1ZOFA 1M2AA 4TKYA 3FZ4A 4YKFA 3HVSA 3D4TA 1M7TA 2FD3A 1K0OA 2XBIA 2R0PA 4IS0A 5ECQB 5ECLB 1H4OA 2I1UA 2JSYA 3TRPA 3H4KA 5A34A 1YQ1A 3LORA 3RAZA 2FA4A 3LGCA 1R7HA 2HSMB 2DJ2A 3LSZA 6GSUA 2HZEB 3J7Yk 3GHAA 2YWOA 2LRCA 4WBJA 5IQYA 4X1UA 3RBTA 2AHEA 4EUYA 2QSIA 1A2LA 4XS1A 2UZ8A 4ACSA 4I8BA 5COHA 3L78A 5A1NA 4MMMA 3G7YA 1K0MA 5H5QA 4E8HA 3GUSA 4I97A 1SKSB 5LNKe 4BL7B 3L9SA 1QUWA 3FMWA 4ML6A 1ON4A 1U87A 2H6ZA 2WCIA 1QK8A 3GNJA 3D4MA 3QPMA 5D73A 4J56E 1TW9A 5L71A 4ID0A 4ZIJA 3HYPA 3V1WA 5ECKB 3BD2A 4F9ZA 3FY7A 2V1MA 3S9FA 3F4SA 4OO5A 3F3RA 2NBSA 5A4VA 5A4UA 3UVHA 1TK8B 2C8UA 1WP0A 5GSTA 4E68A 1OVNA 1KEBA 4EE0A 1TK5B 1T1VA 1YDKA 4RQRA 4CY8A 2N5FA 3HJMA 1G6YA 4FO5A 3TGZA 2YPMA 1K3LA 2PVOC 4PGTA 4ZB7A 3DMLA 5IM9A 4JR6A 4HJ2A 2WS2A 3GKMA 4MJAA 2K8VA 2B7JA 4O7HA 4JR4A 2XHFA 1M2DA 1B8XA 3KP9A 5E59A 4MNNA 11GSA 1TDIA 4ZXGA 5BRTA 4G2EA 2IFQA 4WR4A 1Z9HA 5ECMB 1GTBA 1X5EA 3ME8A 3WYWA 2LJKA 2VL2A 2PGTA 4KUNA 3K8NA 2H76A 3P90A 4K5RA 1ZYNA 4IJ3A 2BMXA 3MIXA 3AY8A 5D96A 2YZHA 3TJFA 1V2AA 5A5HA 3G7IA 2R0CA 2L4CA 3UMAA 5GZZB 4N10A 4ZILA 1GULA 3DXBA 3Q74A 3IK9A 3MSZA 4QL7A 2H0HA 2FY6A 1T7PB 3FR9A 2G2QA 3SBCA 2VLTA 5ECRB 1PKWA 4G10A 1OC3A 2R0GA 4QL9A 3HJOA 2AAWA 5IO2A 3P7XA 2QGVA 2C0EA 1M0UA 2DJ1A 1SJZA 3TU3B 4NMUA 2V32A 3H93A 1K0CA 4YQMA 4YQUA 5B7CA 3NIVA 3LXTA 3LW9A 4K9ZA 2FWFA 1OKTA 3F0IA 4V1Ag 2MMAA 4HU9A 5IOXA 4F82A 4AI6A 2GZZA 4ULXA 5CRWA 16GSA 2ZUPA 4LMWA 1UN2A 5ECIB 1SL2B 2IMDA 3MWHA 2DBCA 2RUFA 1AQWA 1T3BA 3JCML 4NHZA 1G7OA 3H8QA 1BAYA 2X8HA 1B4PA 2FWEA 2HRAA 1CQGA 1BYEA 2C4JA 2X64A 2EIQA 5A34B 4OO4A 3FK8A 4PNFA 3D5JA 3QFAC 4O5UA 4EL1A 4K2XA 4F0CA 2I81A 2EFDA 1QMVA 4AKXB 4L0WA 18GSA 3IR4A 1F3BA 3GX0A 4XTSA 3BCIA 3ZMLA 1O8WA 4IBPA 1JHBA 3HA9A 2FWGA 1NHOA 5EY6A 2VM1A 2IJYA 1YJ6A 4TR0A 5A1NB 2H01A 4ECCA 1EWXA 1TKDB 5AIXA 2CAQA 4X4JA 5B8AA 2ON7A 2UV8G 3IAS2 2OT3A 1GUMA 5ID2A 3IA1A 5HQPA 4HDEA 3TKQA 5KN1A 2RIIA 3R2QA 2LNSA 4JU5A 1O85A 2DSAA 3MAKA 3KIJA 4PQIA 2NPBA 1THXA 3A2WA 2C3TA 2PN8A 1M2BA 3HZ8A 2H1GA 5BMUA 4ZL9A 2CAIA 1Z7PA 4ZL7A 3CSIA 3P2AA 1K0NA 2GSQA 2HI7A 2VCZA 4PXOA 5CYYA 2BTOT 4BVXA 3KH9A 2FLSA 1SD9A 4ILFA 1FB0A 1A0RP 5CO3A 1PA3A 2V41A 2MMOA 3TOUA 1DSBA 2HQTA 3C73A 1X0RA 5LD0A 2IFQB 1V40A 1RQMA 2O85A 2C0FA 2VUPA 3J7Yb 1A0FA 2CZ2A 4CDOA 2IMEA 3GL5A 2Z9SA 3PH9A 3HMJG 1HNBA 1I5GA 3FRCA 1FOVA 2M80A 1EEJA 3VWXA 4GDFA 1J08A 4LL4B 3F6DA 1KBNA 1PL2A 3Q6OA 5EPFA 4GCIA 2GSRA 2A4VA 4K7NA 3I6AA 2HZEA 3CSHA 1AW9A 2LJAA 2H74A 2LSTA 2H0GA 3QR6A 4KH7A 2OE3A 2H66A 2TIRA 3W6GA 5CP1A 1N2AA 2H72A 6GSSA 3D21A 3ZFBA 3BJ5A 3GTUA 2LJRA 4G19A 4ECJA 3APQA 4JRRA 4PURA 2IPAA 4K6XA 1SKRB 2GVPA 4EO3A 1JZRA 4K0NA 4ZBBA 1SU9A 1V57A 3EMXA 1B4QA 1SJIA 1TXXA 1JZOA 1AC1A 5D9VA 3N9JA 3F9UA 3EWLA 2F51A 3APSA 4ZBAA 6GSVA 22GSA 2OKAA 3DVWA 2AB6A 4NPBA 3EU4A 1XVWA 3ZREA 3O76A 4X43A 3KD0A 5EVOA 1A24A 4HQSA 3GYKA 4IN0A 5J47A 2R6KA 2LQOA 2H30A 5GAND 3LEFA 4NAXA 4YQVA 3US3A 1O6JA 5CAXA 3A2VA 3HHVA 4YAPA 2ALBA 1FOHA 4FYCA 3HY2A 2K8SA 4PQHA 3QCPA 2DKIA 3HD5A 1Z3EA 1TRSA 2XPEA 3GRXA 2EC4A 1F6MC 3HJPA 2GT6A 2B1LA 3UAPA 5KEJA 2CA8A 4PQ1A 3CRUA 1XW9A 17GSA 5JCGA 4AJ8A 2JZRA 1U6TA 3KXOA 2PPTA 2GGTA 3KJYA 5D8IA 3Q18A 5DJLA 1E6BA 5AN1A 4TXOB 1S3DA 1GLPA 2IMKA 1Q98A 1SVMA 2IMFA 1SYXA 3F3QA 5G30A 1XOBA 1X9SB 4HOJA 2RM5A 4POLA 4G01A 2BJXA 1MDJA 3C71A 1U88A 1OC9A 2KUCA 4K2DA 4G9HA 3RDWA 3PGTA 5BMUB 5JWRB 3IRAA 3VURA 5FT3A 2WDUA 1BEDA 2NTOA 1ZMAA 5HFGA 5J41A 3UOMA 3QMXA 2K6VA 4O5RA 2RLIA 4POKA 4MCUA 5ECPB 1USBA 1GSFA 1TRWA 3L9VA 1EOHA 4DEJA 2A2RA 2L57A 3E3EA 3KMNA 4DSSB 3GSTA 4OCEA 1XWAA 2DIZA 4D73A 4JBBA 5HR3A 3TJJA 4AJ6A 5G5EA 1FG4A 7GSSA 4I6XA 4L8EA 1TJDA 5ECSA 1HQOA 3D0ZA 4PX1A 2LQQA 4JE1A 3IXRA 4MF6A 5ECNB 4XCSA 5H5SA 1WE0A 3EU3A 4WF5A 3UL3A 1ZYQB 4FH8A 1EOGA 3KM6A 1EP8A 2O5VA 1VF3A 1YVLA 2HSYA 3GL3A 3L4NA 2OE1A 6GSYA 1N8JA 1YF0A 2PBJA 2OBIA 4F0BA 3IOSA 2VCQA 5FHIA 1O81A 5HR1A 2CVDA 3GTUB 1W4VA 5DJMA 1FB6A 1ABAA 3NZNA 2YJHA 4YKGA 4TR3A 1EGRA 4HEA2 3VFIA 1GP1A 5JWQB 3LXZA 5HR0A 4FYBA 1MDIA 1ZYPA 2H8LA 2HNLA 4Z7XA 4CY6A 1YKCA 1V98A 3EURA 5J4YA 2YN1A 4KNDA 4HJMA 5ENUA 2WULA 1PQNA 4V2MA 2JSZA 5JWOB 3DGQA 3RHCA 2CV4A 2CQ9A 1GL8A 2HSNA 3BOAA 1U3AA 3D6IA 2CVBA 2R37A 4FQUA 1QGVA 4LL1B 5IMVA 3F8UA 4KX4A 3QD9A 1MD4A 1S3CA 4ZB9A 3PPUA 1TU7A 1YKAA 2REMA 1XXUA 4Q5FA 1A8LA 4O32A 3KCMA 3MYDA 4KSOA 3GH6A 1A8YA 2VCWA 5KN0A 5JCUA 4V2NA 1AQXA 2FGXA 4IW9A 5CRGA 4XS4A 3VPTA 3DVXA 4HS1A 3ERWA 4NXIA 4TOPA 2XC2A 3RHBA 3GKKA 3TB2A 3QAVA 1TP9A 1BQ7A 2IL3A 1X5DA 3GH9A 3M8NA 2DMLA 2O7KA 4KCEA 4ZBDA 2R2JA 4WEYA 3UARA 4ML1A 4ECIA 1OC9B 2VLVA 2JU5A 2DJ0A 3KP8A 3IC8A 2YNXA 1R26A 2E2MA 2KP1A 2OACA 4GQFA 4ISDA 4WXTA 4MZBA 1GTIA 1YZXA 1QXHA 2IIYA 3LG6A 3VI7A 1F9MA 4FYUA 5GAPD 3ERGA 5J40A 4DSQA 1XCCA 4I5QA 3CSJA 3CTGA 2O89A 1W89A 4MDCA 4D73B 3N5OA 3C1SA 1XOAA 1Y1UA 3GKXA 1XW6A 4G0LA 4BWSA 4ZB6A 3M9JA 1RK4A 3F63A 4GQCA 3F4TA 5B8BA 1Q4JA 4DVCA 3GA4A 1ML6A 3FR3A 1GSUA 1ZCPA 3IBHA 1XW5A 3D22A 4Z2RA 4K5SA 4KDXA 2H73A 3TKRA 1IYHA 2LV3A 2PUKC 1NHYA 5DQSA 1IYIA 3TKSC 2PERA 2B5XA 1I9DA 1J9BA 5J4VA 2IN3A 4AKGA 4WBRD 5KN2A 2K18A 4OCFA 3A5WA 1GUHA 5DAKA 2L59A 3ME7A 3HVVA 2X4AA 2VL9A 1TXUA 2HRNA 4K8MA 4KGIA 2C3QA 3KH7A 5AGYA 3EINA 3I69A 1ILOA 2WRTA 3FZ5A 1J0FA 4TRXA 2YZUA 2JL4A 5LCZA 4PNGA 1A2JA 4NV2A 1YEPA 4TXOA 4HQZA 3EC3A 4YAVA 1K0AA 2WGRA 1PMTA 2B5YA 1WOUA 5HFKA 4IKHA 2N5BA 3O3TA 3KMOA 5FWGA 4HZ2A 1PKZA 2ZCTA 4KCAA 2L5OA 2HSNB 2MBTA 2L6DA 3R3EA 1OE7A 2FHEA 2GQMA 2IWTA 2WZ9A 4TW5A 3E9JB 3IHQA 4BVYA 2FA8A 3CYNA 4W66A 3DIEA 4J57E 1V9WA 2HYXA 3IV4A 3CTFA 1PX7A 4MPGA 4IJIA 2HSHA 2GZPA 2KHPA 1WPIA 4DSSA 2YCDA 3KEBA 4GXZA 4IQAA 4N0VA 4Q5NA 2XPDA 1YF1A 1VF2A 2G0FA 1GSDA 4XS4B 4LLRA 5EL8A 1BX9A 1KTEA 3PR8A 2K9FA 1FO5A 1MTCA 1MDKA 3FW2A 2EFEA 2GQLA 5ECHB 4I2UA 4N0ZA 4MPFA 3NOFA 1M99A 4ZB8A 5D9TA 5HFIA 3GKNA 3ZLPA 2V6KA 2P31A 4POMA 1SENA 3MNGA 3QOUA 3HXSA 2VOCA 3ZIVA 1H75A 3TKSE 5AISA 1ERVA 5D9XA 3ZITA 2HRFA 1YEXA 1U3IA 1PSQA 3FR6A 2V6OA 1NSWA 2J9HA 1FW1A 1GNWA 2X99A 3W8SA 2OE0A 1ZZYA 3EE2A 1O8XA 4PUAA 1GSSA 2DJKA 1MD3A 3HKRA 1T4ZA 4DSRA 3VK9A 3I9V2 5DCGA 2DIYA 4OFNA 1JLVA 2AYTA 2QKEA 1DBYA 3QFBC 3HDCA 1T00A 1AXDA 2PMTA 5ELGA 1EV9A 1YY7A 2VD0A 4NHWA 3CXGA 1XWCA 2GLRA 3VI5A 1M9BA 3SWLA 1HNAA 4A5PA 1TU8A 1VF4A 2AV4A 4KSMA 20GSA 2L5LA 1AQVA 2OJLA 5DAKB 4CW9A 2AJQB 2PWJA 2FNOA 2MYGA 4CHSA 3ZFLA 3TDGA 2LKUA 4OMVA 5AIVA 1FVJA 2R3XA 5A4WA 2HFDA 2MMNA 2VL2C 1GUKA 4TN8A 3MDKA 2YOIA 2RUEA 1SVLA 2P5RA 3A2XA 1SK1A 3TRQA 2H19A 3G7JA 5D93A 3ZRDA 2LRNA 5G31A 4LMVA 4EC0A 4BVYB 2M46A 1ERTA 4RQXA 1B9XC 3UBKA 1JZWA 3LQ7A 3L9UA 2VCTA 2L4QA 3WD6A 1B48A 2YWIA 4GTUA 2DJ3A 4MABA 2FCHA 3G9BA 2H1BA 2QC7A 5HR2A 3VPQA 3CBUA 1LBKA 5C00A 3H1NA 3VWVA 3LFLA 4GSSA 4G0KA 4F2IA 3FZAA 4HI7A 3APOA 4HUAA 1BG1A 4L5OA 2QA1A 3UIWA 1XWKA 2VM2A 3TJGA 4AGSA 2PVQA 5DBQA 3ED3A 5KOWA 5DDLA 5G1KA 4TVEA 2R4VA 3ZTLA 2DKHA 9GSSA 1JZDA 1Z6NA 1PX6A 2H70A 1TK0B 4I2TA 1JFUA 2ES7A 2X8CA 2CVKA 1GTAA 3VWUA 4GSNA 1PN0A 2P0GA 3GN3A 1WJKA 3DEXA 4K0GA 1FVKA 2VO4A 4Z2UA 2N5AA 3PINA 2HLSA 1AIUA 2GDRA 1FAAA 1F3AA 3C1RA 5IIZA 5IPHA 5H5RA 2GSTA 1VGLA 1FHEA 2VIMA 2H71A 2A4HA 3A5IA 1O73A 1X5CA 1Z7RA 1PD21 1C72A 1LU4A 3M3MA 2A2PA 4JEDA 4PUFC 3HZ4A 5KOXA 5G1LA 2YJ7A 4GRFA 2M72A 4EXJA 2KLXA 2PU9C 4GSTA 2LS5A 1Y25A 3KZQA 4P3YB 1K3OA 2OBKA 4HU7A 5IMZA 2WB9A 1M9AA 1R5PA 1HNCA 3A3TA 1G7EA 5A5KA 2NDOA 4FIWA 4IP1A 5DALA 4NV5A 1BF5A 4Q5RA 1B9YC 4OFTA 3VWWA 1TI3A 3WGEA 5CNWA 4XS6A 4WF4A 2JADA 4TR1A 3ZMKA 4GWRA 4AKIA 2JACA 3UEMA 1HD2A 4OD7A 1R4WA 6GSTA 1GTUA 3CMIA 1XWGA 3QAGA 5CREA 2I9HA 2HRKA 2GZYA 3F4RA 1UC7A 1T4YA 2E0QA 1PGTA 4MP4A 1TI1A 2YWNA 3ZZXA 1EGOA 3KGKA 6GSXA 4XHMA 2ON5A 4F03A 1WIKA 3GSSA 2F8AA 2H75A 3U5RE 2F8FA 3IK7A 4IQ1A 1E2YA 5INYA 3CWGA 4Q5QA 2TRXA 3GIXA 1X9WB 2GQKA 1K3YA 1TOFA 13GSA 2E7PA 3H79A 4MF5A 4XRAA 5J3RA 1T8EB 3KTBA 2C1YA 3IHGA 4O5QA 1GWCA 1VF1A 3IC4A 1NM3A 1SD8A 3UBLA 4EKZA 2VLUA 3GV1A 2MZCA 2LTKA 2HZFA 1SYRA 2E2GA 1XVQA 4MJEA 5ELAA 4OWYA 2LRTA 2HT9A 2YV9A 3DRNA 2XBQA 4KA0A 4WR5A 4XRDA 1WRYA 3WGDA 2C0DA 4JZQA 2X49A 3WGXA 5B6MA 3GMFA 3TRXA 1WMJA 4IGJA 2F9SA 1OYJA 4KDYA 3WT1A 2H1LA 3ERFA 5J4UA 3M1GA 4AJ7A 1EP7A 2H6YA 1ZGNA 3ZVJA 5CRHA 2B5EA 2VKZG 3DKSA 4KDUA 3Q19A 1XPVA 2ZNMA 5D9WA 4L5LA 4MJBA 1XBSA 4V2LA 5G5FA 3DYRA 1GH2A 3L0HA 2VAFA 1ZL9A 4EIQA 3UVTA 1SJ6A 4GLTA 3EMPA 1URMA 3TJBA 1ZYEA 3FEUA 4G0IA 1QQ2A 4HZ4A 3ZVJD 4WETA 4TXVA 2C3NA 4MK3A 1SVOA 4RI7A 3BCKA 3FKFA 1SL1B 2H1DA 2CX3A 2VCVA 4NWYA 3IE3A 1N25A 3IAM2 2EFCA 5J5NA 4IVFA 3GURA 3HCZA 4USSA 4QMKA 2HE3A 1EV4A 3ZIJA 2DLXA 2V2GA 2X8GA 5IMDA 1GNEA 2FWHA 4MF7A 1Z6MA 2VL3A 1G6WA 2YANA 3E0UA 3VLNA 3TCOA 1OAZA 1LJRA 1AUCA 2FUG2 3EPTA 3BBYA 5DQYA 1JLWA 4AF2A 4EF0A 4YH2A 5DVBA 1BJXA 2CZ3A 19GSA 1XZOA 3ZYWA 4EVMA 1HYUA 2DC5A 5JCWA 5IMCA 2HXKA 4BPYA 4J2FA 1AAZA 1OC8A 2O87A 4IP6A 2GT5A 1SKWB 1UVZA 4KB3A 1A23A 2OADA 6GSWA 1Y6EA 3I43A 1TTZA 4Z2TA 5DALB 1CQHA 5G2ZA 2YV7A 4KAEA 1GLQA 2EFHA 4TR1B 2B6MA 1XWBA 4BWQA 1XFLA 5ABRA 2J23A 4IHUA 4TR4A 3GX8A 5J9CA 2H1AA 5IMAA 5F05A 1K0DA 2KOKA 3O6TA 2HRKB 4KW6A 4LA1A 2YP6A 5J9BA 2EIRA 1PRXA 4N11A 3TJKA 2GTUA 5F0GA 4PTSA 5IOWA 3TKPA 3M0FA 2H0IA 3IPZA 4RI6A 3EVIA 3ZL5A 4O92A 3IDVA 2D2ZA 2A2SA 2B1KA 3WT2A 4MA9A 1EEMA 5B6NA 1GSYA 2C80A 2C0GA 1F37A 2HSMA 2WFCA 4N30A 10GSA 1ACVA 2DJJA 4EIPA 5A5HB 2VD1A 3TUEA 4EDZA 2GS3A 2CX4A 5ECOB 14GSA 1PN9A 3LYPA 2GSSA 2I3YA 5IPGA 3W8JA 3QAWA 1NW2A 2B7KA 4AKHA 4WKWA 5IO0A 2VCXA 3GFKA 4RUVA 2O8VB 1XIYA 5C04A 1KNGA 2JZSA 2P5QA 3TOTA 4MJCA 2L6CA 2LNTA 4ZL8A 4GF0A 4BL7A 4MH2A 4XIHA 1UA5A 1DUGA 1SL0B 3EYTA 2I4AA 4OFMA 5DCHA 5F07A 4EDYA 5F8BA 4MLYA 1TRVA 3RPNA 3HVXA 2H6XA 3KTLA 4KF9A 2DMMA 4ECBA 3FZ9A 3C7MA 4MZWA 3TKSA 1VRSD 2LUSA 1Z5YE 5KN3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NVL A;  3U6V A;  2MMZ A;  3DD3 A;  12GS A;  1S3A A;  5CRD A;  1SK0 A;  1PL1 A;  1ERW A;  1THO A;  2F3M A;  4X0X A;  1ERU A;  2CT6 A;  3LJR A;  1GSQ A;  2YWM A;  1GSE A;  3C8E A;  1WWJ A;  3RPP A;  3P8W A;  3DWV A;  3FHK A;  4L0U A;  4MZC A;  1F2E A;  5IMF A;  1BG5 A;  4BA7 A;  1R5A A;  2MBS A;  1EZK A;  2KP2 A;  1ST9 A;  3ISO A;  1SK2 A;  2AUV A;  4QQ7 A;  4E8E A;  2LEG A;  1QFN A;  3F6F A;  2OA7 A;  4POB A;  5ID2 B;  1MEK A;  4K1F A;  2WJU A;  1DE1 A;  1O7U A;  4H86 A;  4MH3 A;  3UJ1 A;  2B3S A;  2EIO A;  5GSS A;  8GSS A;  2JZT A;  2R5G A;  3LWA A;  1TRU A;  1GRX A;  1K0B A;  3CRT A;  4K7I A;  1A2M A;  4KE3 A;  1RW1 A;  4IEL A;  4BVX B;  2IMI A;  1OKD A;  4V1A p;  1OE8 A;  5F06 A;  3M9K A;  3OR5 A;  5E4W A;  1X9M B;  4K7O A;  1G0T A;  1V58 A;  3FYG A;  2RM6 A;  2TRC P;  3QDN A;  1DE2 A;  3LYK A;  1ZOF A;  1M2A A;  4TKY A;  3FZ4 A;  3HVS A;  3D4T A;  1M7T A;  2FD3 A;  1K0O A;  2XBI A;  4IS0 A;  5ECQ B;  5ECL B;  1H4O A;  2I1U A;  2JSY A;  3TRP A;  3H4K A;  1YQ1 A;  3LOR A;  3RAZ A;  2FA4 A;  3LGC A;  1R7H A;  2HSM B;  2DJ2 A;  3LSZ A;  6GSU A;  2HZE B;  3J7Y k;  3GHA A;  2YWO A;  2LRC A;  4WBJ A;  5IQY A;  4X1U A;  3RBT A;  2AHE A;  4EUY A;  2QSI A;  1A2L A;  4XS1 A;  2UZ8 A;  4ACS A;  4I8B A;  5COH A;  3L78 A;  4MMM A;  3G7Y A;  1K0M A;  5H5Q A;  4E8H A;  3GUS A;  4I97 A;  1SKS B;  5LNK e;  4BL7 B;  3L9S A;  1QUW A;  4ML6 A;  1ON4 A;  1U87 A;  2H6Z A;  2WCI A;  1QK8 A;  3GNJ A;  3D4M A;  3QPM A;  5D73 A;  4J56 E;  1TW9 A;  5L71 A;  4ID0 A;  4ZIJ A;  3HYP A;  3V1W A;  5ECK B;  3BD2 A;  4F9Z A;  3FY7 A;  2V1M A;  3S9F A;  3F4S A;  4OO5 A;  3F3R A;  2NBS A;  5A4V A;  5A4U A;  3UVH A;  1TK8 B;  2C8U A;  1WP0 A;  5GST A;  1OVN A;  1KEB A;  4EE0 A;  1TK5 B;  1T1V A;  1YDK A;  4RQR A;  2N5F A;  3HJM A;  1G6Y A;  4FO5 A;  3TGZ A;  2YPM A;  1K3L A;  2PVO C;  4PGT A;  3DML A;  5IM9 A;  4JR6 A;  4HJ2 A;  2WS2 A;  3GKM A;  4MJA A;  2K8V A;  2B7J A;  4O7H A;  4JR4 A;  2XHF A;  1M2D A;  1B8X A;  3KP9 A;  5E59 A;  11GS A;  1TDI A;  4ZXG A;  4G2E A;  2IFQ A;  4WR4 A;  1Z9H A;  5ECM B;  1GTB A;  1X5E A;  3ME8 A;  3WYW A;  2LJK A;  2VL2 A;  2PGT A;  4KUN A;  3K8N A;  2H76 A;  3P90 A;  4IJ3 A;  2BMX A;  3AY8 A;  5D96 A;  2YZH A;  3TJF A;  1V2A A;  3G7I A;  2L4C A;  3UMA A;  5GZZ B;  4N10 A;  4ZIL A;  1GUL A;  3DXB A;  3Q74 A;  3IK9 A;  3MSZ A;  4QL7 A;  2H0H A;  2FY6 A;  1T7P B;  3FR9 A;  2G2Q A;  3SBC A;  2VLT A;  5ECR B;  1PKW A;  4G10 A;  1OC3 A;  4QL9 A;  3HJO A;  2AAW A;  5IO2 A;  3P7X A;  2QGV A;  2C0E A;  1M0U A;  2DJ1 A;  1SJZ A;  4NMU A;  2V32 A;  3H93 A;  1K0C A;  4YQM A;  4YQU A;  5B7C A;  3NIV A;  3LXT A;  4K9Z A;  2FWF A;  1OKT A;  3F0I A;  4V1A g;  2MMA A;  4HU9 A;  5IOX A;  4F82 A;  2GZZ A;  4ULX A;  5CRW A;  16GS A;  2ZUP A;  4LMW A;  1UN2 A;  5ECI B;  1SL2 B;  2IMD A;  3MWH A;  2DBC A;  2RUF A;  1AQW A;  1T3B A;  3JCM L;  4NHZ A;  1G7O A;  3H8Q A;  1BAY A;  2X8H A;  1B4P A;  2FWE A;  2HRA A;  1CQG A;  1BYE A;  2C4J A;  2X64 A;  2EIQ A;  4OO4 A;  3FK8 A;  4PNF A;  3D5J A;  3QFA C;  4EL1 A;  4F0C A;  2I81 A;  1QMV A;  4L0W A;  18GS A;  3IR4 A;  1F3B A;  3GX0 A;  4XTS A;  3BCI A;  3ZML A;  1O8W A;  4IBP A;  1JHB A;  3HA9 A;  2FWG A;  1NHO A;  5EY6 A;  2VM1 A;  2IJY A;  1YJ6 A;  4TR0 A;  2H01 A;  4ECC A;  1EWX A;  1TKD B;  5AIX A;  2CAQ A;  5B8A A;  2ON7 A;  3IAS 2;  1GUM A;  5ID2 A;  3IA1 A;  5HQP A;  4HDE A;  3TKQ A;  5KN1 A;  2RII A;  3R2Q A;  2LNS A;  4JU5 A;  1O85 A;  2DSA A;  3MAK A;  3KIJ A;  4PQI A;  2NPB A;  1THX A;  3A2W A;  2C3T A;  2PN8 A;  1M2B A;  3HZ8 A;  2H1G A;  5BMU A;  4ZL9 A;  2CAI A;  1Z7P A;  4ZL7 A;  3CSI A;  3P2A A;  1K0N A;  2GSQ A;  2HI7 A;  2VCZ A;  4PXO A;  5CYY A;  2BTO T;  4BVX A;  3KH9 A;  2FLS A;  1SD9 A;  4ILF A;  1FB0 A;  1A0R P;  5CO3 A;  1PA3 A;  2V41 A;  2MMO A;  3TOU A;  1DSB A;  2HQT A;  3C73 A;  1X0R A;  5LD0 A;  2IFQ B;  1V40 A;  1RQM A;  2O85 A;  2C0F A;  2VUP A;  3J7Y b;  1A0F A;  2CZ2 A;  4CDO A;  2IME A;  3GL5 A;  2Z9S A;  3PH9 A;  1HNB A;  1I5G A;  3FRC A;  1FOV A;  2M80 A;  1EEJ A;  3VWX A;  1J08 A;  4LL4 B;  3F6D A;  1KBN A;  1PL2 A;  3Q6O A;  5EPF A;  4GCI A;  2GSR A;  2A4V A;  4K7N A;  3I6A A;  2HZE A;  3CSH A;  1AW9 A;  2LJA A;  2H74 A;  2LST A;  2H0G A;  3QR6 A;  4KH7 A;  2OE3 A;  2H66 A;  2TIR A;  3W6G A;  5CP1 A;  1N2A A;  2H72 A;  6GSS A;  3D21 A;  3ZFB A;  3BJ5 A;  3GTU A;  2LJR A;  4G19 A;  4ECJ A;  3APQ A;  4JRR A;  4PUR A;  2IPA A;  4K6X A;  1SKR B;  2GVP A;  4EO3 A;  1JZR A;  4K0N A;  4ZBB A;  1SU9 A;  1V57 A;  3EMX A;  1B4Q A;  1SJI A;  1TXX A;  1JZO A;  1AC1 A;  5D9V A;  3N9J A;  3F9U A;  3EWL A;  2F51 A;  3APS A;  4ZBA A;  6GSV A;  22GS A;  2OKA A;  3DVW A;  2AB6 A;  4NPB A;  3EU4 A;  1XVW A;  3ZRE A;  3O76 A;  4X43 A;  3KD0 A;  5EVO A;  1A24 A;  4HQS A;  3GYK A;  4IN0 A;  2R6K A;  2LQO A;  2H30 A;  5GAN D;  3LEF A;  4NAX A;  4YQV A;  3US3 A;  1O6J A;  5CAX A;  3A2V A;  3HHV A;  4YAP A;  2ALB A;  4FYC A;  3HY2 A;  2K8S A;  4PQH A;  3QCP A;  3HD5 A;  1Z3E A;  1TRS A;  2XPE A;  3GRX A;  2EC4 A;  1F6M C;  3HJP A;  2GT6 A;  2B1L A;  3UAP A;  5KEJ A;  2CA8 A;  4PQ1 A;  3CRU A;  1XW9 A;  17GS A;  5JCG A;  4AJ8 A;  2JZR A;  1U6T A;  3KXO A;  2PPT A;  2GGT A;  3KJY A;  5D8I A;  3Q18 A;  5DJL A;  1E6B A;  5AN1 A;  4TXO B;  1S3D A;  1GLP A;  2IMK A;  1Q98 A;  2IMF A;  1SYX A;  3F3Q A;  5G30 A;  1XOB A;  1X9S B;  4HOJ A;  2RM5 A;  4POL A;  2BJX A;  1MDJ A;  3C71 A;  1U88 A;  1OC9 A;  2KUC A;  4K2D A;  4G9H A;  3RDW A;  3PGT A;  5JWR B;  3IRA A;  3VUR A;  5FT3 A;  2WDU A;  1BED A;  2NTO A;  1ZMA A;  5HFG A;  5J41 A;  3UOM A;  3QMX A;  2K6V A;  4O5R A;  2RLI A;  4POK A;  4MCU A;  5ECP B;  1USB A;  1GSF A;  1TRW A;  3L9V A;  1EOH A;  4DEJ A;  2A2R A;  2L57 A;  3E3E A;  3KMN A;  4DSS B;  3GST A;  4OCE A;  1XWA A;  2DIZ A;  4D73 A;  4JBB A;  5HR3 A;  3TJJ A;  4AJ6 A;  5G5E A;  1FG4 A;  7GSS A;  4I6X A;  4L8E A;  1TJD A;  5ECS A;  1HQO A;  3D0Z A;  4PX1 A;  2LQQ A;  4JE1 A;  3IXR A;  4MF6 A;  5ECN B;  4XCS A;  5H5S A;  1WE0 A;  3EU3 A;  4WF5 A;  3UL3 A;  1ZYQ B;  4FH8 A;  1EOG A;  3KM6 A;  1EP8 A;  1VF3 A;  2HSY A;  3GL3 A;  3L4N A;  2OE1 A;  6GSY A;  1N8J A;  1YF0 A;  2PBJ A;  2OBI A;  4F0B A;  3IOS A;  2VCQ A;  5FHI A;  1O81 A;  5HR1 A;  2CVD A;  3GTU B;  1W4V A;  5DJM A;  1FB6 A;  1ABA A;  3NZN A;  2YJH A;  4TR3 A;  1EGR A;  4HEA 2;  3VFI A;  1GP1 A;  5JWQ B;  3LXZ A;  5HR0 A;  4FYB A;  1MDI A;  2H8L A;  2HNL A;  4Z7X A;  1YKC A;  1V98 A;  3EUR A;  2YN1 A;  4KND A;  4HJM A;  5ENU A;  2WUL A;  1PQN A;  4V2M A;  2JSZ A;  5JWO B;  3DGQ A;  3RHC A;  2CV4 A;  2CQ9 A;  1GL8 A;  3BOA A;  1U3A A;  3D6I A;  2CVB A;  2R37 A;  4FQU A;  1QGV A;  4LL1 B;  5IMV A;  3F8U A;  4KX4 A;  3QD9 A;  1MD4 A;  1S3C A;  4ZB9 A;  3PPU A;  1TU7 A;  1YKA A;  2REM A;  1XXU A;  4Q5F A;  1A8L A;  4O32 A;  3KCM A;  4KSO A;  3GH6 A;  1A8Y A;  2VCW A;  5KN0 A;  5JCU A;  4V2N A;  1AQX A;  2FGX A;  4IW9 A;  5CRG A;  4XS4 A;  3VPT A;  3DVX A;  4HS1 A;  3ERW A;  4NXI A;  4TOP A;  2XC2 A;  3RHB A;  3GKK A;  3TB2 A;  3QAV A;  1TP9 A;  1BQ7 A;  2IL3 A;  1X5D A;  3GH9 A;  3M8N A;  2DML A;  2O7K A;  4KCE A;  4ZBD A;  2R2J A;  4WEY A;  3UAR A;  4ML1 A;  4ECI A;  1OC9 B;  2VLV A;  2JU5 A;  2DJ0 A;  3KP8 A;  3IC8 A;  2YNX A;  1R26 A;  2E2M A;  2KP1 A;  2OAC A;  4GQF A;  4ISD A;  4WXT A;  4MZB A;  1GTI A;  1YZX A;  1QXH A;  2IIY A;  3LG6 A;  3VI7 A;  1F9M A;  4FYU A;  5GAP D;  3ERG A;  4DSQ A;  1XCC A;  4I5Q A;  3CSJ A;  3CTG A;  2O89 A;  1W89 A;  4MDC A;  4D73 B;  3N5O A;  3C1S A;  1XOA A;  3GKX A;  1XW6 A;  4G0L A;  4BWS A;  4ZB6 A;  3M9J A;  1RK4 A;  3F63 A;  4GQC A;  3F4T A;  5B8B A;  1Q4J A;  4DVC A;  3GA4 A;  1ML6 A;  3FR3 A;  1GSU A;  1ZCP A;  3IBH A;  1XW5 A;  3D22 A;  4KDX A;  2H73 A;  3TKR A;  1IYH A;  2LV3 A;  2PUK C;  1NHY A;  5DQS A;  1IYI A;  3TKS C;  2PER A;  2B5X A;  1I9D A;  1J9B A;  2IN3 A;  4WBR D;  5KN2 A;  2K18 A;  4OCF A;  3A5W A;  1GUH A;  5DAK A;  2L59 A;  3ME7 A;  3HVV A;  2VL9 A;  2HRN A;  4K8M A;  4KGI A;  2C3Q A;  3KH7 A;  5AGY A;  3EIN A;  3I69 A;  1ILO A;  2WRT A;  3FZ5 A;  1J0F A;  4TRX A;  2YZU A;  2JL4 A;  5LCZ A;  4PNG A;  1A2J A;  4NV2 A;  1YEP A;  4TXO A;  4HQZ A;  3EC3 A;  4YAV A;  1K0A A;  2WGR A;  1PMT A;  2B5Y A;  1WOU A;  5HFK A;  4IKH A;  2N5B A;  3O3T A;  3KMO A;  5FWG A;  4HZ2 A;  1PKZ A;  2ZCT A;  4KCA A;  2L5O A;  2HSN B;  2MBT A;  2L6D A;  3R3E A;  1OE7 A;  2FHE A;  2GQM A;  2IWT A;  2WZ9 A;  4TW5 A;  3E9J B;  3IHQ A;  4BVY A;  2FA8 A;  3CYN A;  3DIE A;  4J57 E;  1V9W A;  2HYX A;  3IV4 A;  3CTF A;  1PX7 A;  4MPG A;  4IJI A;  2HSH A;  2GZP A;  2KHP A;  1WPI A;  4DSS A;  2YCD A;  3KEB A;  4GXZ A;  4IQA A;  4N0V A;  4Q5N A;  2XPD A;  1YF1 A;  1VF2 A;  2G0F A;  1GSD A;  4XS4 B;  4LLR A;  5EL8 A;  1BX9 A;  1KTE A;  3PR8 A;  2K9F A;  1FO5 A;  1MTC A;  1MDK A;  3FW2 A;  2GQL A;  5ECH B;  4I2U A;  4N0Z A;  4MPF A;  3NOF A;  1M99 A;  4ZB8 A;  5D9T A;  5HFI A;  3GKN A;  3ZLP A;  2V6K A;  2P31 A;  4POM A;  1SEN A;  3MNG A;  3QOU A;  3HXS A;  2VOC A;  3ZIV A;  1H75 A;  3TKS E;  5AIS A;  1ERV A;  5D9X A;  3ZIT A;  2HRF A;  1YEX A;  1U3I A;  1PSQ A;  3FR6 A;  2V6O A;  1NSW A;  2J9H A;  1FW1 A;  1GNW A;  2X99 A;  3W8S A;  2OE0 A;  1ZZY A;  3EE2 A;  1O8X A;  4PUA A;  1GSS A;  2DJK A;  1MD3 A;  3HKR A;  1T4Z A;  4DSR A;  3VK9 A;  3I9V 2;  5DCG A;  2DIY A;  4OFN A;  1JLV A;  2AYT A;  2QKE A;  1DBY A;  3QFB C;  3HDC A;  1T00 A;  1AXD A;  2PMT A;  5ELG A;  1EV9 A;  1YY7 A;  2VD0 A;  4NHW A;  3CXG A;  1XWC A;  2GLR A;  3VI5 A;  1M9B A;  3SWL A;  1HNA A;  1TU8 A;  1VF4 A;  2AV4 A;  4KSM A;  20GS A;  2L5L A;  1AQV A;  2OJL A;  5DAK B;  4CW9 A;  2AJQ B;  2PWJ A;  2FNO A;  2MYG A;  4CHS A;  3ZFL A;  3TDG A;  2LKU A;  4OMV A;  5AIV A;  1FVJ A;  2R3X A;  5A4W A;  2HFD A;  2MMN A;  2VL2 C;  1GUK A;  4TN8 A;  3MDK A;  2YOI A;  2RUE A;  2P5R A;  3A2X A;  1SK1 A;  3TRQ A;  2H19 A;  3G7J A;  5D93 A;  3ZRD A;  2LRN A;  5G31 A;  4LMV A;  4EC0 A;  4BVY B;  2M46 A;  1ERT A;  4RQX A;  1B9X C;  3UBK A;  1JZW A;  3LQ7 A;  3L9U A;  2VCT A;  2L4Q A;  3WD6 A;  1B48 A;  2YWI A;  4GTU A;  2DJ3 A;  4MAB A;  2FCH A;  3G9B A;  2H1B A;  2QC7 A;  5HR2 A;  3VPQ A;  3CBU A;  1LBK A;  5C00 A;  3H1N A;  3VWV A;  3LFL A;  4GSS A;  4G0K A;  4F2I A;  3FZA A;  4HI7 A;  3APO A;  4HUA A;  4L5O A;  3UIW A;  1XWK A;  2VM2 A;  3TJG A;  4AGS A;  2PVQ A;  5DBQ A;  3ED3 A;  5DDL A;  5G1K A;  4TVE A;  2R4V A;  3ZTL A;  9GSS A;  1JZD A;  1Z6N A;  1PX6 A;  2H70 A;  1TK0 B;  4I2T A;  1JFU A;  2ES7 A;  2X8C A;  2CVK A;  1GTA A;  3VWU A;  4GSN A;  2P0G A;  3GN3 A;  1WJK A;  3DEX A;  4K0G A;  1FVK A;  2VO4 A;  2N5A A;  3PIN A;  2HLS A;  1AIU A;  2GDR A;  1FAA A;  1F3A A;  3C1R A;  5IIZ A;  5IPH A;  5H5R A;  2GST A;  1VGL A;  1FHE A;  2VIM A;  2H71 A;  1O73 A;  1X5C A;  1Z7R A;  1PD2 1;  1C72 A;  1LU4 A;  3M3M A;  4JED A;  4PUF C;  3HZ4 A;  5G1L A;  2YJ7 A;  4GRF A;  2M72 A;  4EXJ A;  2KLX A;  2PU9 C;  4GST A;  2LS5 A;  1Y25 A;  3KZQ A;  4P3Y B;  1K3O A;  2OBK A;  4HU7 A;  5IMZ A;  2WB9 A;  1M9A A;  1R5P A;  1HNC A;  3A3T A;  1G7E A;  5A5K A;  2NDO A;  4FIW A;  4IP1 A;  5DAL A;  4NV5 A;  4Q5R A;  1B9Y C;  4OFT A;  3VWW A;  1TI3 A;  3WGE A;  5CNW A;  4XS6 A;  4WF4 A;  2JAD A;  4TR1 A;  3ZMK A;  4GWR A;  2JAC A;  3UEM A;  1HD2 A;  4OD7 A;  1R4W A;  6GST A;  1GTU A;  3CMI A;  1XWG A;  3QAG A;  5CRE A;  2I9H A;  2HRK A;  2GZY A;  3F4R A;  1UC7 A;  1T4Y A;  2E0Q A;  1PGT A;  4MP4 A;  1TI1 A;  2YWN A;  3ZZX A;  1EGO A;  3KGK A;  6GSX A;  4XHM A;  2ON5 A;  4F03 A;  1WIK A;  3GSS A;  2F8A A;  2H75 A;  3U5R E;  2F8F A;  3IK7 A;  4IQ1 A;  1E2Y A;  5INY A;  4Q5Q A;  2TRX A;  3GIX A;  1X9W B;  2GQK A;  1K3Y A;  1TOF A;  13GS A;  2E7P A;  3H79 A;  4MF5 A;  4XRA A;  5J3R A;  1T8E B;  3KTB A;  2C1Y A;  1GWC A;  1VF1 A;  3IC4 A;  1NM3 A;  1SD8 A;  3UBL A;  4EKZ A;  2VLU A;  3GV1 A;  2MZC A;  2LTK A;  2HZF A;  1SYR A;  2E2G A;  1XVQ A;  4MJE A;  5ELA A;  4OWY A;  2LRT A;  2HT9 A;  2YV9 A;  3DRN A;  2XBQ A;  4KA0 A;  4WR5 A;  4XRD A;  1WRY A;  3WGD A;  2C0D A;  4JZQ A;  3WGX A;  5B6M A;  3GMF A;  3TRX A;  1WMJ A;  4IGJ A;  2F9S A;  1OYJ A;  4KDY A;  3WT1 A;  3ERF A;  5J4U A;  3M1G A;  4AJ7 A;  1EP7 A;  2H6Y A;  1ZGN A;  3ZVJ A;  5CRH A;  2B5E A;  3DKS A;  4KDU A;  3Q19 A;  1XPV A;  2ZNM A;  5D9W A;  4L5L A;  4MJB A;  1XBS A;  4V2L A;  5G5F A;  3DYR A;  1GH2 A;  3L0H A;  2VAF A;  1ZL9 A;  3UVT A;  1SJ6 A;  4GLT A;  3EMP A;  1URM A;  3TJB A;  1ZYE A;  3FEU A;  4G0I A;  1QQ2 A;  4HZ4 A;  3ZVJ D;  4WET A;  4TXV A;  2C3N A;  4MK3 A;  4RI7 A;  3BCK A;  3FKF A;  1SL1 B;  2H1D A;  2CX3 A;  2VCV A;  4NWY A;  3IE3 A;  3IAM 2;  5J5N A;  4IVF A;  3GUR A;  3HCZ A;  4USS A;  2HE3 A;  1EV4 A;  3ZIJ A;  2DLX A;  2V2G A;  2X8G A;  5IMD A;  1GNE A;  2FWH A;  4MF7 A;  1Z6M A;  2VL3 A;  1G6W A;  2YAN A;  3E0U A;  3VLN A;  3TCO A;  1OAZ A;  1LJR A;  1AUC A;  2FUG 2;  3BBY A;  5DQY A;  1JLW A;  4AF2 A;  4EF0 A;  4YH2 A;  5DVB A;  1BJX A;  2CZ3 A;  19GS A;  1XZO A;  3ZYW A;  4EVM A;  1HYU A;  2DC5 A;  5JCW A;  5IMC A;  2HXK A;  4BPY A;  4J2F A;  1AAZ A;  1OC8 A;  2O87 A;  4IP6 A;  2GT5 A;  1SKW B;  1UVZ A;  4KB3 A;  1A23 A;  2OAD A;  6GSW A;  1Y6E A;  3I43 A;  1TTZ A;  5DAL B;  1CQH A;  5G2Z A;  2YV7 A;  4KAE A;  1GLQ A;  4TR1 B;  2B6M A;  1XWB A;  4BWQ A;  1XFL A;  5ABR A;  2J23 A;  4IHU A;  4TR4 A;  3GX8 A;  5J9C A;  2H1A A;  5IMA A;  5F05 A;  1K0D A;  2KOK A;  3O6T A;  2HRK B;  4KW6 A;  4LA1 A;  2YP6 A;  5J9B A;  2EIR A;  1PRX A;  4N11 A;  3TJK A;  2GTU A;  5F0G A;  4PTS A;  5IOW A;  3TKP A;  3M0F A;  2H0I A;  3IPZ A;  4RI6 A;  3EVI A;  3ZL5 A;  4O92 A;  3IDV A;  2D2Z A;  2A2S A;  2B1K A;  3WT2 A;  4MA9 A;  1EEM A;  5B6N A;  1GSY A;  2C80 A;  2C0G A;  1F37 A;  2HSM A;  2WFC A;  4N30 A;  10GS A;  1ACV A;  2DJJ A;  2VD1 A;  3TUE A;  4EDZ A;  2GS3 A;  2CX4 A;  5ECO B;  14GS A;  1PN9 A;  3LYP A;  2GSS A;  2I3Y A;  5IPG A;  3W8J A;  3QAW A;  1NW2 A;  2B7K A;  4WKW A;  5IO0 A;  2VCX A;  3GFK A;  4RUV A;  2O8V B;  1XIY A;  5C04 A;  1KNG A;  2JZS A;  2P5Q A;  3TOT A;  4MJC A;  2L6C A;  2LNT A;  4ZL8 A;  4GF0 A;  4BL7 A;  4MH2 A;  4XIH A;  1UA5 A;  1DUG A;  1SL0 B;  3EYT A;  2I4A A;  4OFM A;  5DCH A;  5F07 A;  4EDY A;  5F8B A;  4MLY A;  1TRV A;  3RPN A;  3HVX A;  2H6X A;  3KTL A;  4KF9 A;  2DMM A;  4ECB A;  3FZ9 A;  3C7M A;  4MZW A;  3TKS A;  1VRS D;  2LUS A;  1Z5Y E;  5KN3 A; 
#chains in the Genus database with same CATH topology
 2NVL A;  3U6V A;  2MMZ A;  3DD3 A;  12GS A;  1S3A A;  5CRD A;  1SK0 A;  1PL1 A;  1ERW A;  1THO A;  2F3M A;  4X0X A;  1ERU A;  2CT6 A;  3LJR A;  4ICY A;  1GSQ A;  2YWM A;  1GSE A;  3C8E A;  1WWJ A;  3RPP A;  3P8W A;  3DWV A;  3FHK A;  4L0U A;  4MZC A;  1F2E A;  5IMF A;  1BG5 A;  4BA7 A;  1R5A A;  2MBS A;  1EZK A;  2KP2 A;  1ST9 A;  3ISO A;  1SK2 A;  2AUV A;  4QQ7 A;  4E8E A;  2LEG A;  1QFN A;  3F6F A;  2O3E A;  2OA7 A;  4POB A;  5ID2 B;  1MEK A;  4K1F A;  2WJU A;  1DE1 A;  1O7U A;  4H86 A;  4MH3 A;  3UJ1 A;  2B3S A;  2EIO A;  5GSS A;  8GSS A;  2WVY A;  2JZT A;  2R5G A;  3LWA A;  1TRU A;  1GRX A;  1K0B A;  3CRT A;  4K7I A;  1A2M A;  4KE3 A;  1RW1 A;  4IEL A;  4BVX B;  4N3Z A;  2IMI A;  1OKD A;  4V1A p;  1OE8 A;  5F06 A;  3M9K A;  3OR5 A;  5E4W A;  2QA2 A;  1X9M B;  4K7O A;  1G0T A;  1V58 A;  3FYG A;  2RM6 A;  2TRC P;  3QDN A;  1DE2 A;  3LYK A;  1ZOF A;  1M2A A;  4TKY A;  3FZ4 A;  2WVX A;  4YKF A;  3HVS A;  3D4T A;  1M7T A;  2FD3 A;  1K0O A;  2XBI A;  2R0P A;  4IS0 A;  5ECQ B;  5ECL B;  1H4O A;  2I1U A;  2JSY A;  3TRP A;  3H4K A;  5A34 A;  1YQ1 A;  3LOR A;  3RAZ A;  2FA4 A;  3LGC A;  1R7H A;  2HSM B;  2DJ2 A;  3LSZ A;  6GSU A;  2HZE B;  3J7Y k;  3GHA A;  2YWO A;  2LRC A;  4WBJ A;  5IQY A;  4X1U A;  3RBT A;  2AHE A;  4EUY A;  2QSI A;  1A2L A;  4XS1 A;  2UZ8 A;  4ACS A;  4I8B A;  5COH A;  3L78 A;  5A1N A;  4MMM A;  3G7Y A;  1K0M A;  5H5Q A;  4E8H A;  3GUS A;  4I97 A;  1SKS B;  5LNK e;  4BL7 B;  3L9S A;  1QUW A;  3FMW A;  4ML6 A;  1ON4 A;  1U87 A;  2H6Z A;  2WCI A;  1QK8 A;  3GNJ A;  3D4M A;  3QPM A;  5D73 A;  4J56 E;  1TW9 A;  5L71 A;  4ID0 A;  4ZIJ A;  3HYP A;  3V1W A;  5ECK B;  3BD2 A;  4F9Z A;  2WW0 A;  3FY7 A;  2V1M A;  3S9F A;  3F4S A;  4OO5 A;  3F3R A;  2NBS A;  5A4V A;  5A4U A;  3UVH A;  1TK8 B;  2C8U A;  1WP0 A;  5GST A;  4E68 A;  1OVN A;  1KEB A;  4EE0 A;  1TK5 B;  1T1V A;  1YDK A;  4RQR A;  4CY8 A;  2N5F A;  3HJM A;  1G6Y A;  4FO5 A;  3TGZ A;  2YPM A;  1K3L A;  2PVO C;  4PGT A;  4ZB7 A;  3DML A;  5IM9 A;  4JR6 A;  4HJ2 A;  2WS2 A;  3GKM A;  4MJA A;  2K8V A;  2B7J A;  4O7H A;  4JR4 A;  2XHF A;  1M2D A;  1B8X A;  3KP9 A;  5E59 A;  4MNN A;  11GS A;  1TDI A;  4ZXG A;  5BRT A;  4G2E A;  2IFQ A;  4WR4 A;  1Z9H A;  5ECM B;  1GTB A;  1X5E A;  3ME8 A;  3WYW A;  2LJK A;  2VL2 A;  2PGT A;  4KUN A;  3K8N A;  2H76 A;  3P90 A;  4K5R A;  1ZYN A;  4IJ3 A;  2BMX A;  3MIX A;  3AY8 A;  5D96 A;  2YZH A;  3TJF A;  1V2A A;  5A5H A;  3G7I A;  2R0C A;  2L4C A;  3UMA A;  5GZZ B;  4N10 A;  4ZIL A;  1GUL A;  3DXB A;  3Q74 A;  3IK9 A;  3MSZ A;  4QL7 A;  2H0H A;  2FY6 A;  1T7P B;  3FR9 A;  2G2Q A;  3SBC A;  2VLT A;  5ECR B;  1PKW A;  4G10 A;  1OC3 A;  2R0G A;  4QL9 A;  3HJO A;  2AAW A;  5IO2 A;  3P7X A;  2QGV A;  2C0E A;  1M0U A;  2DJ1 A;  1SJZ A;  3TU3 B;  4NMU A;  2V32 A;  3H93 A;  1K0C A;  4YQM A;  4YQU A;  5B7C A;  3NIV A;  3LXT A;  3LW9 A;  4K9Z A;  2FWF A;  1OKT A;  3F0I A;  4V1A g;  2MMA A;  4HU9 A;  5IOX A;  4F82 A;  4AI6 A;  2GZZ A;  4ULX A;  5CRW A;  16GS A;  2ZUP A;  4LMW A;  1UN2 A;  5ECI B;  1SL2 B;  2IMD A;  3MWH A;  2DBC A;  2WVX B;  2RUF A;  1AQW A;  1T3B A;  3JCM L;  4NHZ A;  1G7O A;  3H8Q A;  1BAY A;  2X8H A;  1B4P A;  2FWE A;  2HRA A;  1CQG A;  1BYE A;  2C4J A;  2X64 A;  2EIQ A;  5A34 B;  4OO4 A;  3FK8 A;  4PNF A;  3D5J A;  3QFA C;  4O5U A;  3CQF A;  4EL1 A;  4K2X A;  4F0C A;  2I81 A;  2EFD A;  1QMV A;  4AKX B;  4L0W A;  18GS A;  3IR4 A;  1F3B A;  3GX0 A;  4XTS A;  3BCI A;  3ZML A;  1O8W A;  4IBP A;  1JHB A;  3HA9 A;  2FWG A;  4FXY P;  1NHO A;  5EY6 A;  2VM1 A;  2IJY A;  1YJ6 A;  4TR0 A;  5A1N B;  2H01 A;  4ECC A;  1EWX A;  1TKD B;  5AIX A;  2CAQ A;  4X4J A;  5B8A A;  2ON7 A;  2UV8 G;  3IAS 2;  2OT3 A;  1GUM A;  5ID2 A;  3IA1 A;  5HQP A;  4HDE A;  3TKQ A;  5KN1 A;  2RII A;  3R2Q A;  2LNS A;  4JU5 A;  1O85 A;  2DSA A;  3MAK A;  3KIJ A;  4PQI A;  2NPB A;  1THX A;  3A2W A;  2C3T A;  2PN8 A;  1M2B A;  3HZ8 A;  2H1G A;  5BMU A;  4ZL9 A;  2CAI A;  1Z7P A;  4ZL7 A;  3CSI A;  3P2A A;  1K0N A;  2GSQ A;  2HI7 A;  2VCZ A;  4PXO A;  5CYY A;  2BTO T;  4BVX A;  3KH9 A;  2FLS A;  1SD9 A;  4ILF A;  1FB0 A;  1A0R P;  5CO3 A;  1PA3 A;  2V41 A;  2MMO A;  3TOU A;  1DSB A;  2HQT A;  3C73 A;  1X0R A;  5LD0 A;  2IFQ B;  1V40 A;  1RQM A;  2O85 A;  2C0F A;  2VUP A;  3J7Y b;  1A0F A;  2CZ2 A;  4CDO A;  2IME A;  3GL5 A;  2Z9S A;  3PH9 A;  3HMJ G;  1HNB A;  1I5G A;  3FRC A;  1FOV A;  2M80 A;  1EEJ A;  3VWX A;  4GDF A;  1J08 A;  4LL4 B;  3F6D A;  1KBN A;  1PL2 A;  3Q6O A;  5EPF A;  4GCI A;  2GSR A;  2A4V A;  4K7N A;  3I6A A;  2HZE A;  3CSH A;  1AW9 A;  2LJA A;  2H74 A;  2LST A;  2H0G A;  3QR6 A;  2WW3 A;  4KH7 A;  2OE3 A;  2H66 A;  2TIR A;  3W6G A;  5CP1 A;  1N2A A;  2H72 A;  6GSS A;  3D21 A;  3ZFB A;  3BJ5 A;  3GTU A;  2LJR A;  4G19 A;  4ECJ A;  3APQ A;  4JRR A;  4PUR A;  2IPA A;  4K6X A;  1SKR B;  2GVP A;  4EO3 A;  1JZR A;  4K0N A;  4ZBB A;  1SU9 A;  1V57 A;  3EMX A;  1B4Q A;  1SJI A;  1TXX A;  1JZO A;  1AC1 A;  5D9V A;  3N9J A;  3F9U A;  3EWL A;  2F51 A;  3APS A;  4ZBA A;  6GSV A;  22GS A;  2OKA A;  3DVW A;  2AB6 A;  4NPB A;  3EU4 A;  1XVW A;  3ZRE A;  3O76 A;  4X43 A;  3KD0 A;  5EVO A;  1A24 A;  4HQS A;  3GYK A;  4IN0 A;  5J47 A;  2R6K A;  2LQO A;  2H30 A;  5GAN D;  3LEF A;  4NAX A;  4YQV A;  3US3 A;  1O6J A;  5CAX A;  3A2V A;  3HHV A;  4YAP A;  2ALB A;  1FOH A;  4FYC A;  3HY2 A;  2K8S A;  4PQH A;  3QCP A;  2DKI A;  3HD5 A;  1Z3E A;  1TRS A;  2XPE A;  3GRX A;  3RGB C;  2EC4 A;  1F6M C;  3HJP A;  2GT6 A;  2B1L A;  3UAP A;  5KEJ A;  2CA8 A;  4PQ1 A;  3CRU A;  1XW9 A;  17GS A;  5JCG A;  4AJ8 A;  2JZR A;  1U6T A;  3KXO A;  2PPT A;  2GGT A;  3KJY A;  1YEW C;  5D8I A;  3Q18 A;  5DJL A;  1E6B A;  5AN1 A;  4TXO B;  1S3D A;  1GLP A;  2IMK A;  1Q98 A;  1SVM A;  2IMF A;  1SYX A;  3F3Q A;  5G30 A;  1XOB A;  1X9S B;  4HOJ A;  2RM5 A;  4POL A;  4G01 A;  2BJX A;  1MDJ A;  3C71 A;  1U88 A;  1OC9 A;  2KUC A;  4K2D A;  4G9H A;  3RDW A;  3PGT A;  5BMU B;  5JWR B;  3IRA A;  3VUR A;  5FT3 A;  2WDU A;  1BED A;  2NTO A;  1ZMA A;  5HFG A;  5J41 A;  3UOM A;  3QMX A;  2K6V A;  4O5R A;  2RLI A;  4POK A;  4MCU A;  5ECP B;  1USB A;  1GSF A;  3CHX C;  1TRW A;  3L9V A;  1EOH A;  4DEJ A;  2A2R A;  2L57 A;  3E3E A;  3KMN A;  4DSS B;  3GST A;  4OCE A;  1XWA A;  2DIZ A;  4D73 A;  4JBB A;  5HR3 A;  3TJJ A;  4AJ6 A;  5G5E A;  1FG4 A;  7GSS A;  4I6X A;  4L8E A;  1TJD A;  5ECS A;  1HQO A;  3D0Z A;  4PX1 A;  2LQQ A;  4JE1 A;  3IXR A;  4MF6 A;  5ECN B;  4XCS A;  5H5S A;  1WE0 A;  3EU3 A;  4WF5 A;  3UL3 A;  1ZYQ B;  4FH8 A;  1EOG A;  3KM6 A;  1EP8 A;  2O5V A;  1VF3 A;  1YVL A;  2HSY A;  3GL3 A;  3L4N A;  2OE1 A;  6GSY A;  1N8J A;  1YF0 A;  2PBJ A;  2OBI A;  4F0B A;  3IOS A;  2VCQ A;  5FHI A;  1O81 A;  5HR1 A;  2CVD A;  3GTU B;  1W4V A;  5DJM A;  1FB6 A;  1ABA A;  3NZN A;  2YJH A;  2O36 A;  4YKG A;  4TR3 A;  1EGR A;  4HEA 2;  3VFI A;  1GP1 A;  5JWQ B;  3LXZ A;  5HR0 A;  4FYB A;  1MDI A;  1ZYP A;  2H8L A;  2HNL A;  4Z7X A;  4CY6 A;  1YKC A;  1V98 A;  3EUR A;  5J4Y A;  2YN1 A;  4KND A;  4HJM A;  5ENU A;  2WUL A;  1PQN A;  4V2M A;  2JSZ A;  5JWO B;  3DGQ A;  3RHC A;  2CV4 A;  2CQ9 A;  1GL8 A;  2HSN A;  3BOA A;  1U3A A;  3D6I A;  2CVB A;  2R37 A;  4FQU A;  1QGV A;  4LL1 B;  5IMV A;  3F8U A;  4KX4 A;  3HVN A;  3QD9 A;  1MD4 A;  1S3C A;  4ZB9 A;  3PPU A;  1TU7 A;  1YKA A;  2REM A;  1XXU A;  4Q5F A;  1A8L A;  4O32 A;  3KCM A;  3MYD A;  4KSO A;  3GH6 A;  1A8Y A;  2VCW A;  5KN0 A;  5JCU A;  4V2N A;  1AQX A;  2FGX A;  4IW9 A;  5CRG A;  4XS4 A;  3VPT A;  3DVX A;  4HS1 A;  3ERW A;  4NXI A;  4TOP A;  2XC2 A;  3RHB A;  3GKK A;  3TB2 A;  3QAV A;  1TP9 A;  1BQ7 A;  2IL3 A;  1X5D A;  3GH9 A;  3M8N A;  2DML A;  2O7K A;  4KCE A;  4ZBD A;  2R2J A;  4WEY A;  3UAR A;  4ML1 A;  4ECI A;  1OC9 B;  2VLV A;  2JU5 A;  2DJ0 A;  3KP8 A;  3IC8 A;  2YNX A;  1R26 A;  2E2M A;  2KP1 A;  2OAC A;  4GQF A;  4ISD A;  4WXT A;  4MZB A;  1GTI A;  1YZX A;  1QXH A;  2IIY A;  3LG6 A;  3VI7 A;  1F9M A;  4FYU A;  5GAP D;  3ERG A;  5J40 A;  4DSQ A;  1XCC A;  4I5Q A;  3CSJ A;  3CTG A;  2O89 A;  1W89 A;  4MDC A;  4D73 B;  3N5O A;  3C1S A;  1XOA A;  1Y1U A;  3GKX A;  1XW6 A;  4G0L A;  4BWS A;  4ZB6 A;  3M9J A;  1RK4 A;  3F63 A;  4GQC A;  3F4T A;  5B8B A;  1Q4J A;  4DVC A;  3GA4 A;  1PFO A;  1ML6 A;  3FR3 A;  1GSU A;  1ZCP A;  3IBH A;  1XW5 A;  3D22 A;  4Z2R A;  4K5S A;  4KDX A;  2H73 A;  3TKR A;  1IYH A;  2LV3 A;  2PUK C;  1NHY A;  5DQS A;  1IYI A;  3TKS C;  2PER A;  2B5X A;  1I9D A;  1J9B A;  5J4V A;  2IN3 A;  4AKG A;  4WBR D;  5KN2 A;  2K18 A;  4OCF A;  3A5W A;  1GUH A;  5DAK A;  2L59 A;  3ME7 A;  3HVV A;  2X4A A;  2VL9 A;  1TXU A;  2HRN A;  4K8M A;  4KGI A;  2C3Q A;  3KH7 A;  5AGY A;  3EIN A;  3I69 A;  4HSC X;  1ILO A;  2WRT A;  3FZ5 A;  1J0F A;  4TRX A;  2YZU A;  2JL4 A;  5LCZ A;  4PNG A;  1A2J A;  4NV2 A;  1YEP A;  4TXO A;  4HQZ A;  3EC3 A;  4YAV A;  1K0A A;  2WGR A;  1PMT A;  2B5Y A;  1WOU A;  5HFK A;  4IKH A;  2N5B A;  3O3T A;  3KMO A;  5FWG A;  4HZ2 A;  1PKZ A;  2ZCT A;  4KCA A;  2L5O A;  2HSN B;  1S3R A;  2MBT A;  2L6D A;  3R3E A;  1OE7 A;  2FHE A;  2GQM A;  2IWT A;  2WZ9 A;  4TW5 A;  3E9J B;  3IHQ A;  4BVY A;  2FA8 A;  3CYN A;  4W66 A;  3DIE A;  4J57 E;  1V9W A;  2HYX A;  3IV4 A;  3CTF A;  1PX7 A;  4MPG A;  4IJI A;  2HSH A;  2GZP A;  2KHP A;  1WPI A;  4DSS A;  2YCD A;  3KEB A;  4GXZ A;  4IQA A;  4N0V A;  4Q5N A;  2XPD A;  1YF1 A;  1M3I A;  1VF2 A;  2G0F A;  1GSD A;  4XS4 B;  4LLR A;  5EL8 A;  1BX9 A;  1KTE A;  3PR8 A;  2K9F A;  1FO5 A;  1MTC A;  1MDK A;  3FW2 A;  2EFE A;  2GQL A;  5ECH B;  4I2U A;  4N0Z A;  4MPF A;  3NOF A;  1M99 A;  4ZB8 A;  5D9T A;  5HFI A;  3GKN A;  3ZLP A;  2V6K A;  2P31 A;  4POM A;  3RFR C;  1SEN A;  3MNG A;  3QOU A;  3HXS A;  2VOC A;  2WZS A;  3ZIV A;  1H75 A;  3TKS E;  5AIS A;  1ERV A;  5D9X A;  3ZIT A;  2HRF A;  1YEX A;  1U3I A;  1PSQ A;  3FR6 A;  2V6O A;  1NSW A;  2J9H A;  1FW1 A;  1GNW A;  2X99 A;  3W8S A;  2OE0 A;  1ZZY A;  3EE2 A;  1O8X A;  4PUA A;  1GSS A;  2DJK A;  1MD3 A;  3HKR A;  1T4Z A;  4DSR A;  3VK9 A;  3I9V 2;  5DCG A;  2DIY A;  4OFN A;  1JLV A;  2AYT A;  2QKE A;  1DBY A;  3QFB C;  3HDC A;  1T00 A;  1AXD A;  2PMT A;  5ELG A;  1EV9 A;  1YY7 A;  2VD0 A;  4NHW A;  3CXG A;  1M3J A;  1XWC A;  2GLR A;  3VI5 A;  1M9B A;  3SWL A;  1HNA A;  4A5P A;  1TU8 A;  1VF4 A;  2AV4 A;  4KSM A;  20GS A;  2L5L A;  1AQV A;  2OJL A;  5DAK B;  4CW9 A;  2AJQ B;  2PWJ A;  2FNO A;  2MYG A;  4CHS A;  3ZFL A;  3TDG A;  2LKU A;  4OMV A;  5AIV A;  1FVJ A;  2R3X A;  5A4W A;  2HFD A;  2MMN A;  2VL2 C;  1GUK A;  4TN8 A;  3MDK A;  2YOI A;  2RUE A;  1SVL A;  2P5R A;  3A2X A;  1SK1 A;  3TRQ A;  2H19 A;  3G7J A;  5D93 A;  3ZRD A;  2LRN A;  5G31 A;  4LMV A;  4EC0 A;  4BVY B;  2WVZ A;  2M46 A;  1ERT A;  4RQX A;  1B9X C;  3UBK A;  1JZW A;  3LQ7 A;  3L9U A;  2VCT A;  2L4Q A;  3WD6 A;  1B48 A;  2YWI A;  4GTU A;  2DJ3 A;  4MAB A;  2FCH A;  3G9B A;  2H1B A;  2QC7 A;  5HR2 A;  3VPQ A;  3CBU A;  1LBK A;  5C00 A;  3H1N A;  3VWV A;  3LFL A;  4GSS A;  4G0K A;  4F2I A;  3FZA A;  4HI7 A;  3APO A;  4HUA A;  1BG1 A;  4L5O A;  2QA1 A;  3UIW A;  1XWK A;  2VM2 A;  3TJG A;  4AGS A;  2PVQ A;  5DBQ A;  3ED3 A;  5KOW A;  5DDL A;  5G1K A;  4TVE A;  2R4V A;  1S4B P;  3ZTL A;  2DKH A;  9GSS A;  1JZD A;  1Z6N A;  1PX6 A;  2H70 A;  1TK0 B;  4I2T A;  1JFU A;  2ES7 A;  2X8C A;  2CVK A;  1GTA A;  3VWU A;  4GSN A;  1PN0 A;  2P0G A;  3GN3 A;  1WJK A;  3DEX A;  4K0G A;  1FVK A;  2VO4 A;  4Z2U A;  2N5A A;  3PIN A;  2HLS A;  1AIU A;  2GDR A;  1FAA A;  1F3A A;  3C1R A;  5IIZ A;  5IPH A;  5H5R A;  2GST A;  1VGL A;  1FHE A;  2VIM A;  2H71 A;  2A4H A;  3A5I A;  1O73 A;  1X5C A;  1Z7R A;  1PD2 1;  1C72 A;  1LU4 A;  3M3M A;  2WW2 A;  2A2P A;  4JED A;  4PUF C;  3HZ4 A;  5KOX A;  5G1L A;  2YJ7 A;  4GRF A;  2M72 A;  4EXJ A;  2KLX A;  2PU9 C;  4GST A;  2LS5 A;  1Y25 A;  3KZQ A;  4P3Y B;  1K3O A;  2OBK A;  4HU7 A;  5IMZ A;  2WB9 A;  1M9A A;  1R5P A;  1HNC A;  3A3T A;  1G7E A;  5A5K A;  2NDO A;  4FIW A;  4IP1 A;  5DAL A;  4NV5 A;  1BF5 A;  4Q5R A;  1B9Y C;  4OFT A;  3VWW A;  1TI3 A;  3WGE A;  5CNW A;  4XS6 A;  4PI2 C;  4WF4 A;  2JAD A;  4TR1 A;  3ZMK A;  4GWR A;  4AKI A;  2JAC A;  3UEM A;  1HD2 A;  4OD7 A;  1R4W A;  6GST A;  1GTU A;  3CMI A;  1XWG A;  3QAG A;  5CRE A;  2I9H A;  2HRK A;  2GZY A;  3F4R A;  1UC7 A;  1T4Y A;  2E0Q A;  1PGT A;  4MP4 A;  1TI1 A;  2YWN A;  3ZZX A;  1EGO A;  4PI0 C;  3KGK A;  6GSX A;  4XHM A;  2ON5 A;  4F03 A;  1WIK A;  3GSS A;  2F8A A;  2H75 A;  3U5R E;  2F8F A;  3IK7 A;  4IQ1 A;  1E2Y A;  5INY A;  3CWG A;  4Q5Q A;  2TRX A;  3GIX A;  1X9W B;  2GQK A;  1K3Y A;  1TOF A;  13GS A;  2E7P A;  3H79 A;  4MF5 A;  4XRA A;  5J3R A;  1T8E B;  3KTB A;  1I1I P;  2C1Y A;  3IHG A;  1GWC A;  4O5Q A;  1VF1 A;  1XG8 A;  3IC4 A;  1NM3 A;  1SD8 A;  3UBL A;  4EKZ A;  2VLU A;  3GV1 A;  2MZC A;  2LTK A;  2HZF A;  1SYR A;  2E2G A;  1XVQ A;  4MJE A;  5ELA A;  4OWY A;  2LRT A;  2HT9 A;  2YV9 A;  3DRN A;  2XBQ A;  4KA0 A;  4WR5 A;  4XRD A;  1WRY A;  3WGD A;  2C0D A;  4JZQ A;  2X49 A;  3WGX A;  5B6M A;  3GMF A;  3TRX A;  1WMJ A;  4IGJ A;  2F9S A;  1OYJ A;  4BIK A;  4KDY A;  3WT1 A;  2H1L A;  3ERF A;  5J4U A;  3M1G A;  4AJ7 A;  1EP7 A;  2H6Y A;  1ZGN A;  3ZVJ A;  5CRH A;  2B5E A;  2VKZ G;  3DKS A;  4KDU A;  3Q19 A;  1XPV A;  2ZNM A;  5D9W A;  4L5L A;  4MJB A;  1XBS A;  4V2L A;  5G5F A;  3DYR A;  1GH2 A;  3L0H A;  2VAF A;  1ZL9 A;  4EIQ A;  3UVT A;  1SJ6 A;  4GLT A;  3EMP A;  1URM A;  3TJB A;  1ZYE A;  3FEU A;  4G0I A;  1QQ2 A;  4HZ4 A;  3ZVJ D;  4WET A;  4TXV A;  2C3N A;  4MK3 A;  1SVO A;  4RI7 A;  3BCK A;  3FKF A;  1SL1 B;  2H1D A;  2CX3 A;  2VCV A;  4NWY A;  3IE3 A;  1N25 A;  3IAM 2;  2EFC A;  5J5N A;  4IVF A;  3GUR A;  3HCZ A;  4USS A;  4QMK A;  2HE3 A;  1EV4 A;  3ZIJ A;  2DLX A;  2V2G A;  2X8G A;  5IMD A;  1GNE A;  2FWH A;  4MF7 A;  1Z6M A;  2VL3 A;  1G6W A;  2YAN A;  3E0U A;  3VLN A;  3TCO A;  1OAZ A;  1LJR A;  1AUC A;  2FUG 2;  3EPT A;  3BBY A;  5DQY A;  1JLW A;  4AF2 A;  4EF0 A;  4YH2 A;  5DVB A;  1BJX A;  2CZ3 A;  19GS A;  1XZO A;  3ZYW A;  4EVM A;  1HYU A;  2DC5 A;  5JCW A;  5IMC A;  2HXK A;  4BPY A;  4J2F A;  1AAZ A;  1OC8 A;  2O87 A;  4IP6 A;  2GT5 A;  1SKW B;  1UVZ A;  4KB3 A;  1A23 A;  2OAD A;  6GSW A;  1Y6E A;  3I43 A;  1TTZ A;  4Z2T A;  5DAL B;  1CQH A;  5G2Z A;  2YV7 A;  4KAE A;  1GLQ A;  2EFH A;  4TR1 B;  2B6M A;  1XWB A;  4BWQ A;  2WW1 A;  1XFL A;  5ABR A;  2J23 A;  4IHU A;  4TR4 A;  3GX8 A;  5J9C A;  2H1A A;  5IMA A;  5F05 A;  1K0D A;  2KOK A;  3O6T A;  2HRK B;  4KW6 A;  4LA1 A;  2YP6 A;  5J9B A;  2EIR A;  4PHZ C;  1PRX A;  4N11 A;  3TJK A;  2GTU A;  5F0G A;  4PTS A;  5IOW A;  3TKP A;  3M0F A;  2H0I A;  3IPZ A;  4RI6 A;  3EVI A;  3ZL5 A;  4O92 A;  3IDV A;  2D2Z A;  2A2S A;  2B1K A;  3WT2 A;  4MA9 A;  1EEM A;  5B6N A;  1GSY A;  2C80 A;  2C0G A;  1F37 A;  2HSM A;  2WFC A;  4N30 A;  10GS A;  1ACV A;  2DJJ A;  4EIP A;  5A5H B;  2VD1 A;  3TUE A;  4EDZ A;  2GS3 A;  2CX4 A;  5ECO B;  14GS A;  1PN9 A;  3LYP A;  2GSS A;  2I3Y A;  5IPG A;  3W8J A;  3QAW A;  1NW2 A;  2B7K A;  4AKH A;  4WKW A;  5IO0 A;  2VCX A;  3GFK A;  4RUV A;  2O8V B;  1XIY A;  5C04 A;  1KNG A;  2JZS A;  2P5Q A;  3TOT A;  4MJC A;  2L6C A;  2LNT A;  4ZL8 A;  4GF0 A;  4BL7 A;  4MH2 A;  4XIH A;  1UA5 A;  1DUG A;  1SL0 B;  3EYT A;  2I4A A;  4OFM A;  5DCH A;  5F07 A;  4EDY A;  5F8B A;  4MLY A;  1TRV A;  3RPN A;  3HVX A;  2H6X A;  3KTL A;  4KF9 A;  2DMM A;  4ECB A;  3FZ9 A;  3C7M A;  4MZW A;  3TKS A;  1VRS D;  2LUS A;  1Z5Y E;  5KN3 A; 
#chains in the Genus database with same CATH homology
 2NVL A;  3U6V A;  2MMZ A;  3DD3 A;  12GS A;  1S3A A;  5CRD A;  1SK0 A;  1PL1 A;  1ERW A;  1THO A;  2F3M A;  4X0X A;  1ERU A;  2CT6 A;  3LJR A;  4ICY A;  1GSQ A;  2YWM A;  1GSE A;  3C8E A;  1WWJ A;  3RPP A;  3P8W A;  3DWV A;  3FHK A;  4L0U A;  4MZC A;  1F2E A;  5IMF A;  1BG5 A;  4BA7 A;  1R5A A;  2MBS A;  1EZK A;  2KP2 A;  1ST9 A;  3ISO A;  1SK2 A;  2AUV A;  4QQ7 A;  4E8E A;  2LEG A;  1QFN A;  3F6F A;  2OA7 A;  4POB A;  5ID2 B;  1MEK A;  4K1F A;  2WJU A;  1DE1 A;  1O7U A;  4H86 A;  4MH3 A;  3UJ1 A;  2B3S A;  2EIO A;  5GSS A;  8GSS A;  2JZT A;  2R5G A;  3LWA A;  1TRU A;  1GRX A;  1K0B A;  3CRT A;  4K7I A;  1A2M A;  4KE3 A;  1RW1 A;  4IEL A;  4BVX B;  4N3Z A;  2IMI A;  1OKD A;  4V1A p;  1OE8 A;  5F06 A;  3M9K A;  3OR5 A;  5E4W A;  2QA2 A;  1X9M B;  4K7O A;  1G0T A;  1V58 A;  3FYG A;  2RM6 A;  2TRC P;  3QDN A;  1DE2 A;  3LYK A;  1ZOF A;  1M2A A;  4TKY A;  3FZ4 A;  4YKF A;  3HVS A;  3D4T A;  1M7T A;  2FD3 A;  1K0O A;  2XBI A;  2R0P A;  4IS0 A;  5ECQ B;  5ECL B;  1H4O A;  2I1U A;  2JSY A;  3TRP A;  3H4K A;  5A34 A;  1YQ1 A;  3LOR A;  3RAZ A;  2FA4 A;  3LGC A;  1R7H A;  2HSM B;  2DJ2 A;  3LSZ A;  6GSU A;  2HZE B;  3J7Y k;  3GHA A;  2YWO A;  2LRC A;  4WBJ A;  5IQY A;  4X1U A;  3RBT A;  2AHE A;  4EUY A;  2QSI A;  1A2L A;  4XS1 A;  2UZ8 A;  4ACS A;  4I8B A;  5COH A;  3L78 A;  5A1N A;  4MMM A;  3G7Y A;  1K0M A;  5H5Q A;  4E8H A;  3GUS A;  4I97 A;  1SKS B;  5LNK e;  4BL7 B;  3L9S A;  1QUW A;  3FMW A;  4ML6 A;  1ON4 A;  1U87 A;  2H6Z A;  2WCI A;  1QK8 A;  3GNJ A;  3D4M A;  3QPM A;  5D73 A;  4J56 E;  1TW9 A;  5L71 A;  4ID0 A;  4ZIJ A;  3HYP A;  3V1W A;  5ECK B;  3BD2 A;  4F9Z A;  3FY7 A;  2V1M A;  3S9F A;  3F4S A;  4OO5 A;  3F3R A;  2NBS A;  5A4V A;  5A4U A;  3UVH A;  1TK8 B;  2C8U A;  1WP0 A;  5GST A;  4E68 A;  1OVN A;  1KEB A;  4EE0 A;  1TK5 B;  1T1V A;  1YDK A;  4RQR A;  4CY8 A;  2N5F A;  3HJM A;  1G6Y A;  4FO5 A;  3TGZ A;  2YPM A;  1K3L A;  2PVO C;  4PGT A;  4ZB7 A;  3DML A;  5IM9 A;  4JR6 A;  4HJ2 A;  2WS2 A;  3GKM A;  4MJA A;  2K8V A;  2B7J A;  4O7H A;  4JR4 A;  2XHF A;  1M2D A;  1B8X A;  3KP9 A;  5E59 A;  4MNN A;  11GS A;  1TDI A;  4ZXG A;  5BRT A;  4G2E A;  2IFQ A;  4WR4 A;  1Z9H A;  5ECM B;  1GTB A;  1X5E A;  3ME8 A;  3WYW A;  2LJK A;  2VL2 A;  2PGT A;  4KUN A;  3K8N A;  2H76 A;  3P90 A;  4K5R A;  1ZYN A;  4IJ3 A;  2BMX A;  3MIX A;  3AY8 A;  5D96 A;  2YZH A;  3TJF A;  1V2A A;  5A5H A;  3G7I A;  2R0C A;  2L4C A;  3UMA A;  5GZZ B;  4N10 A;  4ZIL A;  1GUL A;  3DXB A;  3Q74 A;  3IK9 A;  3MSZ A;  4QL7 A;  2H0H A;  2FY6 A;  1T7P B;  3FR9 A;  2G2Q A;  3SBC A;  2VLT A;  5ECR B;  1PKW A;  4G10 A;  1OC3 A;  2R0G A;  4QL9 A;  3HJO A;  2AAW A;  5IO2 A;  3P7X A;  2QGV A;  2C0E A;  1M0U A;  2DJ1 A;  1SJZ A;  3TU3 B;  4NMU A;  2V32 A;  3H93 A;  1K0C A;  4YQM A;  4YQU A;  5B7C A;  3NIV A;  3LXT A;  3LW9 A;  4K9Z A;  2FWF A;  1OKT A;  3F0I A;  4V1A g;  2MMA A;  4HU9 A;  5IOX A;  4F82 A;  4AI6 A;  2GZZ A;  4ULX A;  5CRW A;  16GS A;  2ZUP A;  4LMW A;  1UN2 A;  5ECI B;  1SL2 B;  2IMD A;  3MWH A;  2DBC A;  2RUF A;  1AQW A;  1T3B A;  3JCM L;  4NHZ A;  1G7O A;  3H8Q A;  1BAY A;  2X8H A;  1B4P A;  2FWE A;  2HRA A;  1CQG A;  1BYE A;  2C4J A;  2X64 A;  2EIQ A;  5A34 B;  4OO4 A;  3FK8 A;  4PNF A;  3D5J A;  3QFA C;  4O5U A;  4EL1 A;  4K2X A;  4F0C A;  2I81 A;  2EFD A;  1QMV A;  4AKX B;  4L0W A;  18GS A;  3IR4 A;  1F3B A;  3GX0 A;  4XTS A;  3BCI A;  3ZML A;  1O8W A;  4IBP A;  1JHB A;  3HA9 A;  2FWG A;  1NHO A;  5EY6 A;  2VM1 A;  2IJY A;  1YJ6 A;  4TR0 A;  5A1N B;  2H01 A;  4ECC A;  1EWX A;  1TKD B;  5AIX A;  2CAQ A;  4X4J A;  5B8A A;  2ON7 A;  2UV8 G;  3IAS 2;  2OT3 A;  1GUM A;  5ID2 A;  3IA1 A;  5HQP A;  4HDE A;  3TKQ A;  5KN1 A;  2RII A;  3R2Q A;  2LNS A;  4JU5 A;  1O85 A;  2DSA A;  3MAK A;  3KIJ A;  4PQI A;  2NPB A;  1THX A;  3A2W A;  2C3T A;  2PN8 A;  1M2B A;  3HZ8 A;  2H1G A;  5BMU A;  4ZL9 A;  2CAI A;  1Z7P A;  4ZL7 A;  3CSI A;  3P2A A;  1K0N A;  2GSQ A;  2HI7 A;  2VCZ A;  4PXO A;  5CYY A;  2BTO T;  4BVX A;  3KH9 A;  2FLS A;  1SD9 A;  4ILF A;  1FB0 A;  1A0R P;  5CO3 A;  1PA3 A;  2V41 A;  2MMO A;  3TOU A;  1DSB A;  2HQT A;  3C73 A;  1X0R A;  5LD0 A;  2IFQ B;  1V40 A;  1RQM A;  2O85 A;  2C0F A;  2VUP A;  3J7Y b;  1A0F A;  2CZ2 A;  4CDO A;  2IME A;  3GL5 A;  2Z9S A;  3PH9 A;  3HMJ G;  1HNB A;  1I5G A;  3FRC A;  1FOV A;  2M80 A;  1EEJ A;  3VWX A;  4GDF A;  1J08 A;  4LL4 B;  3F6D A;  1KBN A;  1PL2 A;  3Q6O A;  5EPF A;  4GCI A;  2GSR A;  2A4V A;  4K7N A;  3I6A A;  2HZE A;  3CSH A;  1AW9 A;  2LJA A;  2H74 A;  2LST A;  2H0G A;  3QR6 A;  4KH7 A;  2OE3 A;  2H66 A;  2TIR A;  3W6G A;  5CP1 A;  1N2A A;  2H72 A;  6GSS A;  3D21 A;  3ZFB A;  3BJ5 A;  3GTU A;  2LJR A;  4G19 A;  4ECJ A;  3APQ A;  4JRR A;  4PUR A;  2IPA A;  4K6X A;  1SKR B;  2GVP A;  4EO3 A;  1JZR A;  4K0N A;  4ZBB A;  1SU9 A;  1V57 A;  3EMX A;  1B4Q A;  1SJI A;  1TXX A;  1JZO A;  1AC1 A;  5D9V A;  3N9J A;  3F9U A;  3EWL A;  2F51 A;  3APS A;  4ZBA A;  6GSV A;  22GS A;  2OKA A;  3DVW A;  2AB6 A;  4NPB A;  3EU4 A;  1XVW A;  3ZRE A;  3O76 A;  4X43 A;  3KD0 A;  5EVO A;  1A24 A;  4HQS A;  3GYK A;  4IN0 A;  5J47 A;  2R6K A;  2LQO A;  2H30 A;  5GAN D;  3LEF A;  4NAX A;  4YQV A;  3US3 A;  1O6J A;  5CAX A;  3A2V A;  3HHV A;  4YAP A;  2ALB A;  1FOH A;  4FYC A;  3HY2 A;  2K8S A;  4PQH A;  3QCP A;  2DKI A;  3HD5 A;  1Z3E A;  1TRS A;  2XPE A;  3GRX A;  2EC4 A;  1F6M C;  3HJP A;  2GT6 A;  2B1L A;  3UAP A;  5KEJ A;  2CA8 A;  4PQ1 A;  3CRU A;  1XW9 A;  17GS A;  5JCG A;  4AJ8 A;  2JZR A;  1U6T A;  3KXO A;  2PPT A;  2GGT A;  3KJY A;  5D8I A;  3Q18 A;  5DJL A;  1E6B A;  5AN1 A;  4TXO B;  1S3D A;  1GLP A;  2IMK A;  1Q98 A;  1SVM A;  2IMF A;  1SYX A;  3F3Q A;  5G30 A;  1XOB A;  1X9S B;  4HOJ A;  2RM5 A;  4POL A;  4G01 A;  2BJX A;  1MDJ A;  3C71 A;  1U88 A;  1OC9 A;  2KUC A;  4K2D A;  4G9H A;  3RDW A;  3PGT A;  5BMU B;  5JWR B;  3IRA A;  3VUR A;  5FT3 A;  2WDU A;  1BED A;  2NTO A;  1ZMA A;  5HFG A;  5J41 A;  3UOM A;  3QMX A;  2K6V A;  4O5R A;  2RLI A;  4POK A;  4MCU A;  5ECP B;  1USB A;  1GSF A;  1TRW A;  3L9V A;  1EOH A;  4DEJ A;  2A2R A;  2L57 A;  3E3E A;  3KMN A;  4DSS B;  3GST A;  4OCE A;  1XWA A;  2DIZ A;  4D73 A;  4JBB A;  5HR3 A;  3TJJ A;  4AJ6 A;  5G5E A;  1FG4 A;  7GSS A;  4I6X A;  4L8E A;  1TJD A;  5ECS A;  1HQO A;  3D0Z A;  4PX1 A;  2LQQ A;  4JE1 A;  3IXR A;  4MF6 A;  5ECN B;  4XCS A;  5H5S A;  1WE0 A;  3EU3 A;  4WF5 A;  3UL3 A;  1ZYQ B;  4FH8 A;  1EOG A;  3KM6 A;  1EP8 A;  2O5V A;  1VF3 A;  1YVL A;  2HSY A;  3GL3 A;  3L4N A;  2OE1 A;  6GSY A;  1N8J A;  1YF0 A;  2PBJ A;  2OBI A;  4F0B A;  3IOS A;  2VCQ A;  5FHI A;  1O81 A;  5HR1 A;  2CVD A;  3GTU B;  1W4V A;  5DJM A;  1FB6 A;  1ABA A;  3NZN A;  2YJH A;  4YKG A;  4TR3 A;  1EGR A;  4HEA 2;  3VFI A;  1GP1 A;  5JWQ B;  3LXZ A;  5HR0 A;  4FYB A;  1MDI A;  1ZYP A;  2H8L A;  2HNL A;  4Z7X A;  4CY6 A;  1YKC A;  1V98 A;  3EUR A;  5J4Y A;  2YN1 A;  4KND A;  4HJM A;  5ENU A;  2WUL A;  1PQN A;  4V2M A;  2JSZ A;  5JWO B;  3DGQ A;  3RHC A;  2CV4 A;  2CQ9 A;  1GL8 A;  2HSN A;  3BOA A;  1U3A A;  3D6I A;  2CVB A;  2R37 A;  4FQU A;  1QGV A;  4LL1 B;  5IMV A;  3F8U A;  4KX4 A;  3QD9 A;  1MD4 A;  1S3C A;  4ZB9 A;  3PPU A;  1TU7 A;  1YKA A;  2REM A;  1XXU A;  4Q5F A;  1A8L A;  4O32 A;  3KCM A;  3MYD A;  4KSO A;  3GH6 A;  1A8Y A;  2VCW A;  5KN0 A;  5JCU A;  4V2N A;  1AQX A;  2FGX A;  4IW9 A;  5CRG A;  4XS4 A;  3VPT A;  3DVX A;  4HS1 A;  3ERW A;  4NXI A;  4TOP A;  2XC2 A;  3RHB A;  3GKK A;  3TB2 A;  3QAV A;  1TP9 A;  1BQ7 A;  2IL3 A;  1X5D A;  3GH9 A;  3M8N A;  2DML A;  2O7K A;  4KCE A;  4ZBD A;  2R2J A;  4WEY A;  3UAR A;  4ML1 A;  4ECI A;  1OC9 B;  2VLV A;  2JU5 A;  2DJ0 A;  3KP8 A;  3IC8 A;  2YNX A;  1R26 A;  2E2M A;  2KP1 A;  2OAC A;  4GQF A;  4ISD A;  4WXT A;  4MZB A;  1GTI A;  1YZX A;  1QXH A;  2IIY A;  3LG6 A;  3VI7 A;  1F9M A;  4FYU A;  5GAP D;  3ERG A;  5J40 A;  4DSQ A;  1XCC A;  4I5Q A;  3CSJ A;  3CTG A;  2O89 A;  1W89 A;  4MDC A;  4D73 B;  3N5O A;  3C1S A;  1XOA A;  1Y1U A;  3GKX A;  1XW6 A;  4G0L A;  4BWS A;  4ZB6 A;  3M9J A;  1RK4 A;  3F63 A;  4GQC A;  3F4T A;  5B8B A;  1Q4J A;  4DVC A;  3GA4 A;  1ML6 A;  3FR3 A;  1GSU A;  1ZCP A;  3IBH A;  1XW5 A;  3D22 A;  4Z2R A;  4K5S A;  4KDX A;  2H73 A;  3TKR A;  1IYH A;  2LV3 A;  2PUK C;  1NHY A;  5DQS A;  1IYI A;  3TKS C;  2PER A;  2B5X A;  1I9D A;  1J9B A;  5J4V A;  2IN3 A;  4AKG A;  4WBR D;  5KN2 A;  2K18 A;  4OCF A;  3A5W A;  1GUH A;  5DAK A;  2L59 A;  3ME7 A;  3HVV A;  2X4A A;  2VL9 A;  1TXU A;  2HRN A;  4K8M A;  4KGI A;  2C3Q A;  3KH7 A;  5AGY A;  3EIN A;  3I69 A;  1ILO A;  2WRT A;  3FZ5 A;  1J0F A;  4TRX A;  2YZU A;  2JL4 A;  5LCZ A;  4PNG A;  1A2J A;  4NV2 A;  1YEP A;  4TXO A;  4HQZ A;  3EC3 A;  4YAV A;  1K0A A;  2WGR A;  1PMT A;  2B5Y A;  1WOU A;  5HFK A;  4IKH A;  2N5B A;  3O3T A;  3KMO A;  5FWG A;  4HZ2 A;  1PKZ A;  2ZCT A;  4KCA A;  2L5O A;  2HSN B;  2MBT A;  2L6D A;  3R3E A;  1OE7 A;  2FHE A;  2GQM A;  2IWT A;  2WZ9 A;  4TW5 A;  3E9J B;  3IHQ A;  4BVY A;  2FA8 A;  3CYN A;  4W66 A;  3DIE A;  4J57 E;  1V9W A;  2HYX A;  3IV4 A;  3CTF A;  1PX7 A;  4MPG A;  4IJI A;  2HSH A;  2GZP A;  2KHP A;  1WPI A;  4DSS A;  2YCD A;  3KEB A;  4GXZ A;  4IQA A;  4N0V A;  4Q5N A;  2XPD A;  1YF1 A;  1VF2 A;  2G0F A;  1GSD A;  4XS4 B;  4LLR A;  5EL8 A;  1BX9 A;  1KTE A;  3PR8 A;  2K9F A;  1FO5 A;  1MTC A;  1MDK A;  3FW2 A;  2EFE A;  2GQL A;  5ECH B;  4I2U A;  4N0Z A;  4MPF A;  3NOF A;  1M99 A;  4ZB8 A;  5D9T A;  5HFI A;  3GKN A;  3ZLP A;  2V6K A;  2P31 A;  4POM A;  1SEN A;  3MNG A;  3QOU A;  3HXS A;  2VOC A;  3ZIV A;  1H75 A;  3TKS E;  5AIS A;  1ERV A;  5D9X A;  3ZIT A;  2HRF A;  1YEX A;  1U3I A;  1PSQ A;  3FR6 A;  2V6O A;  1NSW A;  2J9H A;  1FW1 A;  1GNW A;  2X99 A;  3W8S A;  2OE0 A;  1ZZY A;  3EE2 A;  1O8X A;  4PUA A;  1GSS A;  2DJK A;  1MD3 A;  3HKR A;  1T4Z A;  4DSR A;  3VK9 A;  3I9V 2;  5DCG A;  2DIY A;  4OFN A;  1JLV A;  2AYT A;  2QKE A;  1DBY A;  3QFB C;  3HDC A;  1T00 A;  1AXD A;  2PMT A;  5ELG A;  1EV9 A;  1YY7 A;  2VD0 A;  4NHW A;  3CXG A;  1XWC A;  2GLR A;  3VI5 A;  1M9B A;  3SWL A;  1HNA A;  4A5P A;  1TU8 A;  1VF4 A;  2AV4 A;  4KSM A;  20GS A;  2L5L A;  1AQV A;  2OJL A;  5DAK B;  4CW9 A;  2AJQ B;  2PWJ A;  2FNO A;  2MYG A;  4CHS A;  3ZFL A;  3TDG A;  2LKU A;  4OMV A;  5AIV A;  1FVJ A;  2R3X A;  5A4W A;  2HFD A;  2MMN A;  2VL2 C;  1GUK A;  4TN8 A;  3MDK A;  2YOI A;  2RUE A;  1SVL A;  2P5R A;  3A2X A;  1SK1 A;  3TRQ A;  2H19 A;  3G7J A;  5D93 A;  3ZRD A;  2LRN A;  5G31 A;  4LMV A;  4EC0 A;  4BVY B;  2M46 A;  1ERT A;  4RQX A;  1B9X C;  3UBK A;  1JZW A;  3LQ7 A;  3L9U A;  2VCT A;  2L4Q A;  3WD6 A;  1B48 A;  2YWI A;  4GTU A;  2DJ3 A;  4MAB A;  2FCH A;  3G9B A;  2H1B A;  2QC7 A;  5HR2 A;  3VPQ A;  3CBU A;  1LBK A;  5C00 A;  3H1N A;  3VWV A;  3LFL A;  4GSS A;  4G0K A;  4F2I A;  3FZA A;  4HI7 A;  3APO A;  4HUA A;  1BG1 A;  4L5O A;  2QA1 A;  3UIW A;  1XWK A;  2VM2 A;  3TJG A;  4AGS A;  2PVQ A;  5DBQ A;  3ED3 A;  5KOW A;  5DDL A;  5G1K A;  4TVE A;  2R4V A;  3ZTL A;  2DKH A;  9GSS A;  1JZD A;  1Z6N A;  1PX6 A;  2H70 A;  1TK0 B;  4I2T A;  1JFU A;  2ES7 A;  2X8C A;  2CVK A;  1GTA A;  3VWU A;  4GSN A;  1PN0 A;  2P0G A;  3GN3 A;  1WJK A;  3DEX A;  4K0G A;  1FVK A;  2VO4 A;  4Z2U A;  2N5A A;  3PIN A;  2HLS A;  1AIU A;  2GDR A;  1FAA A;  1F3A A;  3C1R A;  5IIZ A;  5IPH A;  5H5R A;  2GST A;  1VGL A;  1FHE A;  2VIM A;  2H71 A;  2A4H A;  3A5I A;  1O73 A;  1X5C A;  1Z7R A;  1PD2 1;  1C72 A;  1LU4 A;  3M3M A;  2A2P A;  4JED A;  4PUF C;  3HZ4 A;  5KOX A;  5G1L A;  2YJ7 A;  4GRF A;  2M72 A;  4EXJ A;  2KLX A;  2PU9 C;  4GST A;  2LS5 A;  1Y25 A;  3KZQ A;  4P3Y B;  1K3O A;  2OBK A;  4HU7 A;  5IMZ A;  2WB9 A;  1M9A A;  1R5P A;  1HNC A;  3A3T A;  1G7E A;  5A5K A;  2NDO A;  4FIW A;  4IP1 A;  5DAL A;  4NV5 A;  1BF5 A;  4Q5R A;  1B9Y C;  4OFT A;  3VWW A;  1TI3 A;  3WGE A;  5CNW A;  4XS6 A;  4WF4 A;  2JAD A;  4TR1 A;  3ZMK A;  4GWR A;  4AKI A;  2JAC A;  3UEM A;  1HD2 A;  4OD7 A;  1R4W A;  6GST A;  1GTU A;  3CMI A;  1XWG A;  3QAG A;  5CRE A;  2I9H A;  2HRK A;  2GZY A;  3F4R A;  1UC7 A;  1T4Y A;  2E0Q A;  1PGT A;  4MP4 A;  1TI1 A;  2YWN A;  3ZZX A;  1EGO A;  3KGK A;  6GSX A;  4XHM A;  2ON5 A;  4F03 A;  1WIK A;  3GSS A;  2F8A A;  2H75 A;  3U5R E;  2F8F A;  3IK7 A;  4IQ1 A;  1E2Y A;  5INY A;  3CWG A;  4Q5Q A;  2TRX A;  3GIX A;  1X9W B;  2GQK A;  1K3Y A;  1TOF A;  13GS A;  2E7P A;  3H79 A;  4MF5 A;  4XRA A;  5J3R A;  1T8E B;  3KTB A;  2C1Y A;  3IHG A;  4O5Q A;  1GWC A;  1VF1 A;  3IC4 A;  1NM3 A;  1SD8 A;  3UBL A;  4EKZ A;  2VLU A;  3GV1 A;  2MZC A;  2LTK A;  2HZF A;  1SYR A;  2E2G A;  1XVQ A;  4MJE A;  5ELA A;  4OWY A;  2LRT A;  2HT9 A;  2YV9 A;  3DRN A;  2XBQ A;  4KA0 A;  4WR5 A;  4XRD A;  1WRY A;  3WGD A;  2C0D A;  4JZQ A;  2X49 A;  3WGX A;  5B6M A;  3GMF A;  3TRX A;  1WMJ A;  4IGJ A;  2F9S A;  1OYJ A;  4KDY A;  3WT1 A;  2H1L A;  3ERF A;  5J4U A;  3M1G A;  4AJ7 A;  1EP7 A;  2H6Y A;  1ZGN A;  3ZVJ A;  5CRH A;  2B5E A;  2VKZ G;  3DKS A;  4KDU A;  3Q19 A;  1XPV A;  2ZNM A;  5D9W A;  4L5L A;  4MJB A;  1XBS A;  4V2L A;  5G5F A;  3DYR A;  1GH2 A;  3L0H A;  2VAF A;  1ZL9 A;  4EIQ A;  3UVT A;  1SJ6 A;  4GLT A;  3EMP A;  1URM A;  3TJB A;  1ZYE A;  3FEU A;  4G0I A;  1QQ2 A;  4HZ4 A;  3ZVJ D;  4WET A;  4TXV A;  2C3N A;  4MK3 A;  1SVO A;  4RI7 A;  3BCK A;  3FKF A;  1SL1 B;  2H1D A;  2CX3 A;  2VCV A;  4NWY A;  3IE3 A;  1N25 A;  3IAM 2;  2EFC A;  5J5N A;  4IVF A;  3GUR A;  3HCZ A;  4USS A;  4QMK A;  2HE3 A;  1EV4 A;  3ZIJ A;  2DLX A;  2V2G A;  2X8G A;  5IMD A;  1GNE A;  2FWH A;  4MF7 A;  1Z6M A;  2VL3 A;  1G6W A;  2YAN A;  3E0U A;  3VLN A;  3TCO A;  1OAZ A;  1LJR A;  1AUC A;  2FUG 2;  3EPT A;  3BBY A;  5DQY A;  1JLW A;  4AF2 A;  4EF0 A;  4YH2 A;  5DVB A;  1BJX A;  2CZ3 A;  19GS A;  1XZO A;  3ZYW A;  4EVM A;  1HYU A;  2DC5 A;  5JCW A;  5IMC A;  2HXK A;  4BPY A;  4J2F A;  1AAZ A;  1OC8 A;  2O87 A;  4IP6 A;  2GT5 A;  1SKW B;  1UVZ A;  4KB3 A;  1A23 A;  2OAD A;  6GSW A;  1Y6E A;  3I43 A;  1TTZ A;  4Z2T A;  5DAL B;  1CQH A;  5G2Z A;  2YV7 A;  4KAE A;  1GLQ A;  2EFH A;  4TR1 B;  2B6M A;  1XWB A;  4BWQ A;  1XFL A;  5ABR A;  2J23 A;  4IHU A;  4TR4 A;  3GX8 A;  5J9C A;  2H1A A;  5IMA A;  5F05 A;  1K0D A;  2KOK A;  3O6T A;  2HRK B;  4KW6 A;  4LA1 A;  2YP6 A;  5J9B A;  2EIR A;  1PRX A;  4N11 A;  3TJK A;  2GTU A;  5F0G A;  4PTS A;  5IOW A;  3TKP A;  3M0F A;  2H0I A;  3IPZ A;  4RI6 A;  3EVI A;  3ZL5 A;  4O92 A;  3IDV A;  2D2Z A;  2A2S A;  2B1K A;  3WT2 A;  4MA9 A;  1EEM A;  5B6N A;  1GSY A;  2C80 A;  2C0G A;  1F37 A;  2HSM A;  2WFC A;  4N30 A;  10GS A;  1ACV A;  2DJJ A;  4EIP A;  5A5H B;  2VD1 A;  3TUE A;  4EDZ A;  2GS3 A;  2CX4 A;  5ECO B;  14GS A;  1PN9 A;  3LYP A;  2GSS A;  2I3Y A;  5IPG A;  3W8J A;  3QAW A;  1NW2 A;  2B7K A;  4AKH A;  4WKW A;  5IO0 A;  2VCX A;  3GFK A;  4RUV A;  2O8V B;  1XIY A;  5C04 A;  1KNG A;  2JZS A;  2P5Q A;  3TOT A;  4MJC A;  2L6C A;  2LNT A;  4ZL8 A;  4GF0 A;  4BL7 A;  4MH2 A;  4XIH A;  1UA5 A;  1DUG A;  1SL0 B;  3EYT A;  2I4A A;  4OFM A;  5DCH A;  5F07 A;  4EDY A;  5F8B A;  4MLY A;  1TRV A;  3RPN A;  3HVX A;  2H6X A;  3KTL A;  4KF9 A;  2DMM A;  4ECB A;  3FZ9 A;  3C7M A;  4MZW A;  3TKS A;  1VRS D;  2LUS A;  1Z5Y E;  5KN3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...