1JLWA

Anopheles dirus species b glutathione s-transferases 1-4
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
217
structure length
217
Chain Sequence
MDFYYLPGSAPCRAVQMTAAAVGVELNLKLTNLMAGEHMKPEFLKLNPQHCIPTLVDEDGFVLWESRAIQIYLVEKYGAHDADLAERLYPSDPRRRAVVHQRLFFDVAVLYQRFAEYYYPQIFGQKVPVGDPGRLRSMEQALEFLNTFLEGEQYVAGGDDPTIADLSILATIATYEVAGYDLRRYENVQRWYERTSAIVPGADKNVEGAKVFGRYFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords glutathione transferase GST1-4
publication title The crystal structures of glutathione S-transferases isozymes 1-3 and 1-4 from Anopheles dirus species B.
pubmed doi rcsb
source organism Anopheles cracens
molecule tags Transferase
total genus 82
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2001-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1jlwA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1jlwA01
3BJ5A 3ME7A 4USSA 3KH7A 5HFGA 1C72A 1F6MC 4KCEA 4AGSA 1X5DA 1ZGNA 3DD3A 1Z7RA 1XW9A 3R2QA 2FY6A 2HRKB 3EURA 1IYIA 4KDXA 3R3EA 3L0HA 3IC8A 5ECNB 4ZIJA 2IMKA 1TI3A 5D93A 4HQSA 3TKPA 2MZCA 3WGDA 2GSRA 2LJKA 4KUNA 1GLPA 1G6YA 4F0CA 4GLTA 2LEGA 2B3SA 3NIVA 3H93A 4TW5A 1HD2A 1PKWA 1K3LA 1GTUA 1ST9A 1XOBA 2YWIA 3IBHA 3D21A 5G1KA 1FB6A 5BMUA 3IE3A 1A2LA 2CX3A 5HR0A 1KEBA 2GGTA 2UZ8A 4PNFA 5DJMA 3HD5A 4Q5NA 3Q74A 4RI7A 1U88A 1ML6A 2GZYA 4DSSA 4ULXA 3KJYA 4PQHA 4HJMA 1V9WA 3CSHA 1R5AA 1EP7A 2CZ3A 4OMVA 5AGYA 3LYPA 3HCZA 4MF6A 3ZIJA 1QFNA 1A24A 3GX8A 2VM1A 1YF1A 3GYKA 1OKTA 4YAVA 1GH2A 4PGTA 2DLXA 2OBIA 3KCMA 1EWXA 1GSYA 2AJQB 4IS0A 1WOUA 2TRXA 2YWMA 4TXVA 3ZITA 3MDKA 3LXTA 3ZMKA 3TJJA 1JLWA 2FD3A 1KTEA 5ECRB 5A4UA 2N5FA 5LD0A 1W89A 2EIRA 3FR3A 2KP2A 3ZL5A 2H1DA 4BA7A 1T3BA 3C7MA 1XOAA 2HI7A 3LEFA 5CRHA 1SK2A 3ZIVA 2WZ9A 3CMIA 3CSJA 3L78A 2IPAA 3HXSA 3RPPA 2DMLA 2EIOA 5J9BA 4TXOA 5DJLA 2DJ1A 2K6VA 2I3YA 1OC9A 5JCUA 1SYRA 4NV5A 5INYA 1YKAA 3A2VA 4POMA 3RDWA 5HR3A 4HZ2A 4MLYA 1S3DA 3J7Yb 2GSTA 1U87A 2OE3A 1TKDB 1THOA 1YQ1A 4FYUA 4BVYA 3F63A 1WIKA 1THXA 3QDNA 2XHFA 4K8MA 3LGCA 4HOJA 1K0AA 1BJXA 5EY6A 3N5OA 5A4VA 2KHPA 4IBPA 1UA5A 4V2NA 4K7NA 4O32A 1Q4JA 4OD7A 1MD3A 4XCSA 5B8AA 2V1MA 1HQOA 2LS5A 4EKZA 3DEXA 4POBA 20GSA 1VF4A 1EV4A 1TU7A 2PWJA 1PX6A 4LL1B 2MMAA 1SKRB 3G7JA 1OKDA 1K0OA 4TR1A 2CA8A 3CBUA 2G0FA 3G7YA 2YV9A 2IWTA 3VWWA 5A4WA 1IYHA 2O8VB 2QC7A 1V57A 4IKHA 2YZUA 3F0IA 4MABA 4WKWA 4ZB9A 1M99A 3M9JA 1Z6MA 2K8VA 4MF5A 2VL3A 3P8WA 2CQ9A 1EGOA 4Q5FA 3HYPA 3HJOA 3O3TA 1JZOA 2YWNA 1SL0B 4BWQA 3TKSE 2VCTA 2LRCA 2IMFA 2LTKA 5IMVA 2H70A 1NM3A 1ON4A 5D9WA 2O85A 4HUAA 3RHCA 2PBJA 2OE0A 2ALBA 1OYJA 1ZOFA 3N9JA 2FWGA 1T4YA 18GSA 1WMJA 2M46A 2A2RA 3D6IA 4AJ7A 1ERVA 2AUVA 3P2AA 3ZMLA 1A23A 1GUMA 5G2ZA 3GRXA 2FHEA 2WGRA 3HJPA 1K0NA 5EL8A 2Z9SA 5IIZA 3M9KA 5LCZA 1B8XA 5IM9A 1O85A 1CQHA 1ZCPA 4XRDA 4MDCA 4POLA 5CYYA 2E7PA 4EO3A 3FW2A 5JWQB 5IMFA 4DEJA 2GSQA 4IGJA 2WB9A 4JRRA 1XWGA 1EGRA 2LKUA 4IVFA 2C0GA 4KH7A 4J56E 3LFLA 4ZL8A 3D4MA 2HRAA 1DSBA 3M3MA 1XVWA 3IA1A 2PVOC 4KW6A 1AUCA 1W4VA 4J57E 1YEPA 2BMXA 1XCCA 2FWFA 1AC1A 2V6KA 2FA8A 1XXUA 5F8BA 4MMMA 2H0IA 1LBKA 3APOA 4JE1A 1TJDA 4F82A 1MDJA 3EU3A 3TJFA 4DSSB 4I5QA 1TK0B 4K0GA 1TW9A 3GFKA 1PRXA 5ELAA 2NVLA 4QQ7A 3IC4A 2OACA 2TRCP 1FB0A 1B9XC 1J08A 3W8SA 1B9YC 4OWYA 2QKEA 4K2DA 4ZB6A 2NTOA 2VO4A 5HQPA 5E4WA 1Z7PA 2DJJA 2XC2A 2O89A 1GNWA 5AN1A 4G10A 3ZREA 2CZ2A 2K18A 2PMTA 4JBBA 1K0BA 4LMWA 4WF4A 3HZ4A 4PTSA 1V98A 1SKSB 1TRWA 1G7EA 3VURA 1BQ7A 2IL3A 2VCVA 5F0GA 3FHKA 4K6XA 4PXOA 4XIHA 2I81A 2VL2A 1MDIA 3HKRA 2B1LA 4N0VA 1R26A 3RPNA 3KP8A 2EC4A 5FT3A 1A0FA 1AIUA 4H86A 4TR3A 1PL1A 1TK8B 4MZBA 4WBRD 2B1KA 5B6MA 4TR4A 1U3IA 3OR5A 2NPBA 2YZHA 4BVYB 1FW1A 3UARA 4HZ4A 2I4AA 2PU9C 4TKYA 5J3RA 2V41A 1J0FA 2C1YA 1KBNA 2MMZA 1ILOA 1RK4A 4JR4A 4FIWA 1QMVA 4ACSA 5KEJA 1EOHA 4OFTA 1K0DA 3MAKA 3FZAA 1PSQA 3CTFA 5CREA 4JU5A 4ECJA 5CNWA 3HJMA 1R4WA 2H01A 3C1RA 4FH8A 2F8FA 6GSXA 1YZXA 2GVPA 3VI7A 3F4SA 1U6TA 5IPHA 4TR1B 3EMXA 1VGLA 3QPMA 2GQLA 4QL9A 2HZEB 4HJ2A 5DQSA 1OC3A 2ZUPA 1EP8A 3IOSA 4OO4A 2X8CA 3DXBA 4MCUA 5LNKe 1GWCA 1OVNA 2OA7A 5G5FA 1MTCA 4E8HA 4PQIA 3TKSC 4AF2A 4MF7A 3A2WA 4LL4B 3HVVA 4KDUA 1JZDA 3LORA 1EEJA 1GSSA 1M9BA 4L0WA 4MH2A 2B5XA 1GNEA 5IPGA 3F4RA 2J23A 3IXRA 3IAM2 3GKXA 4GCIA 4ZXGA 4WBJA 2WS2A 1MDKA 5F05A 1NHYA 5D9XA 3E9JB 2P0GA 1TP9A 3VI5A 4Q5QA 2B6MA 2HT9A 2PERA 5CAXA 1TU8A 1YJ6A 3UL3A 4N0ZA 2H75A 3EU4A 2J9HA 2LQOA 2FUG2 2HYXA 2JACA 1F9MA 3TOUA 3E0UA 4Z7XA 1OAZA 1G7OA 3L9VA 3FZ5A 3AY8A 3KTBA 10GSA 5DALA 1FVKA 2IN3A 4PNGA 1WRYA 4CW9A 1JLVA 2H1AA 1MD4A 2ON7A 2X8GA 1GL8A 4ZILA 3UBKA 2H72A 1TRUA 3ISOA 2A2SA 4ECBA 3BCIA 2JADA 2AV4A 1XIYA 5G1LA 1M9AA 1ZL9A 2VCXA 5G5EA 22GSA 4GF0A 3IPZA 4WEYA 3O6TA 2NBSA 5DQYA 2E2MA 3L4NA 2CVKA 1EV9A 3UAPA 1J9BA 5ECSA 2F51A 4MP4A 3BCKA 1ZYQB 1X5CA 4WXTA 5IMDA 2ON5A 3HHVA 4IP1A 2IJYA 2DBCA 3RAZA 3HY2A 4RQXA 4XRAA 4MK3A 3UIWA 3UVTA 1F37A 2RM6A 1WP0A 1V40A 3F4TA 4NV2A 1XVQA 4AJ6A 5JCGA 1K0MA 4G9HA 1X9MB 2TIRA 4PUAA 3CSIA 1SK0A 1SJ6A 3GUSA 4EF0A 3FKFA 1Z6NA 1T00A 2H6YA 3TDGA 1V58A 3TKRA 3F9UA 1F2EA 3IR4A 1S3CA 4IJ3A 5EPFA 2WCIA 1T1VA 1TK5B 3VLNA 2FLSA 4WF5A 5B8BA 1PN9A 2H6ZA 4MPGA 1BEDA 3F8UA 5ECQB 3A2XA 2VL2C 1K3OA 3I9V2 4IQAA 2LRTA 5HFKA 2I9HA 4KA0A 2YOIA 3LXZA 5H5SA 3K8NA 3PH9A 4I2UA 4N10A 4IQ1A 2M72A 4EVMA 1TTZA 3KP9A 2CT6A 3SBCA 1X0RA 4HEA2 4JEDA 4F0BA 1XWKA 3ZVJD 2MBTA 2F8AA 3TKQA 1A0RP 4KSOA 2JZTA 1Z9HA 2MMNA 4L5LA 2B5EA 2GT5A 4GTUA 1Q98A 2C3QA 2CVBA 4EXJA 1AW9A 3QR6A 3CYNA 1PKZA 2CVDA 3ZFLA 2DJ3A 1X9SB 4ZL7A 2PPTA 4KF9A 3IK7A 3FYGA 4HS1A 3QAVA 3FK8A 4I97A 4YQMA 5KN3A 5AISA 3IV4A 5JWRB 5IOWA 3H79A 2EIQA 3TGZA 1HYUA 17GSA 2RUEA 4PQ1A 3LWAA 2HZEA 4ECCA 2B7JA 4G19A 1JHBA 3TOTA 2WRTA 2LNTA 4OCEA 2XPEA 3FZ9A 1F3BA 5DCHA 5IMZA 2AB6A 3VPQA 4NHWA 1SD9A 3TKSA 1Z5YE 1TOFA 2DJKA 3GKNA 4NXIA 3EE2A 2OJLA 2R5GA 4MPFA 2LUSA 3VFIA 3TJGA 2YJ7A 2C3NA 3PINA 2JZRA 2V6OA 4OCFA 4DVCA 2LV3A 1O6JA 4P3YB 2F3MA 6GSUA 2H71A 5COHA 1GP1A 4G0LA 1T4ZA 1XW6A 4HDEA 1ERUA 5D9TA 5IMAA 4GSSA 4FYCA 3FR9A 5J41A 2E0QA 4NWYA 3BOAA 3LSZA 1FAAA 1GRXA 1JZWA 2X8HA 3D22A 3GX0A 1I9DA 4F2IA 4ID0A 3VWUA 4XS4A 3VK9A 1PQNA 5ECKB 3VWVA 3APSA 2B7KA 3WT1A 2HSYA 3UVHA 2LNSA 5DALB 2WFCA 1B48A 3WGEA 3ERFA 3ERGA 4ISDA 2PGTA 4MZCA 1Z3EA 1AXDA 3QAWA 4MJCA 4KGIA 3KIJA 2RM5A 1HNCA 1BYEA 3A5WA 6GSWA 3Q19A 3ZTLA 2VCWA 1EZKA 1SL2B 1AQXA 2AYTA 4GSNA 4MJAA 5D96A 2O7KA 5CRWA 4V1Ap 2FA4A 3UOMA 4V1Ag 1SL1B 2HSHA 2HNLA 1SU9A 2H0GA 1ZYEA 4OFMA 2P5RA 13GSA 1PA3A 1GULA 3ZZXA 5DVBA 3O76A 2FCHA 3TJBA 1DBYA 2BTOT 1VRSD 1U3AA 3KMNA 1F3AA 4G2EA 2PUKC 3FRCA 2R2JA 1GSDA 2IMIA 1JZRA 4KSMA 1CQGA 2HE3A 5ECLB 5ECHB 2E2GA 1FHEA 2WDUA 3F3QA 1EEMA 3P90A 3LYKA 2H73A 3M8NA 4EDZA 4N11A 3QD9A 3F3RA 3IDVA 1WE0A 4HQZA 4TRXA 1X9WB 1PGTA 2GDRA 2XBQA 2H6XA 3TJKA 3US3A 3DRNA 1BAYA 3FR6A 2NDOA 1A2MA 4HI7A 1O73A 4GSTA 3ERWA 4NPBA 5DAKA 2L5LA 5KN0A 1YKCA 2WJUA 3TUEA 1XFLA 2XBIA 4KNDA 3KZQA 5D9VA 4IELA 1QUWA 2H1GA 3BD2A 4J2FA 1ERWA 5EVOA 4XHMA 2MMOA 3DVWA 4L5OA 4D73A 4E8EA 4NAXA 3FZ4A 5ID2B 2H1BA 4POKA 3U5RE 2IFQA 4ZL9A 5F07A 3QCPA 1B4PA 2JU5A 3I43A 2K9FA 5DCGA 1KNGA 2BJXA 2VIMA 1A8YA 2DIYA 1M7TA 4YQUA 19GSA 5A5KA 2KUCA 5CRDA 1VF3A 4F03A 1UN2A 3GL5A 2HFDA 3VPTA 4BL7B 5ENUA 1GSEA 4LLRA 4BVXA 3IK9A 3GNJA 1XZOA 2H76A 3ZYWA 2VLTA 4XTSA 5JWOB 5ECIB 2YANA 5B6NA 4PX1A 1UC7A 2G2QA 2RIIA 3TRPA 3F6DA 3S9FA 4O7HA 2GQMA 1G6WA 3C8EA 1SD8A 2KLXA 1XWCA 2VLVA 4EE0A 4MZWA 3GHAA 4ZB8A 2H0HA 4ML1A 1SJZA 2JSYA 2P5QA 2PN8A 5ELGA 5AIVA 3MSZA 4RQRA 3GL3A 3HDCA 5J4UA 5D73A 6GSVA 3APQA 5JCWA 2HXKA 3DIEA 4RUVA 4JZQA 2FNOA 3Q18A 4I8BA 3C1SA 3KM6A 3PGTA 5FHIA 1VF2A 2L6DA 4IP6A 5ECPB 5GZZB 4YQVA 2X99A 2F9SA 1PMTA 2V32A 5H5RA 1DUGA 3I69A 5IMCA 4F9ZA 3I6AA 2C0EA 1M0UA 2CX4A 4FQUA 3DWVA 3ZRDA 1HNAA 2N5BA 2OBKA 2GTUA 2O87A 2GZPA 1GTAA 4RI6A 5HR1A 1QXHA 2C3TA 4KB3A 4GWRA 2L5OA 2YCDA 4XS4B 4KDYA 1AQWA 2QGVA 3J7Yk 1WPIA 4ZBBA 1TRVA 3DGQA 3UJ1A 1FOVA 1ACVA 2C0DA 4GXZA 3KEBA 12GSA 3GTUB 8GSSA 1VF1A 4EL1A 3ME8A 1TDIA 1GSFA 2AAWA 3ZLPA 4AJ8A 3UEMA 2LJAA 3KMOA 3KXOA 4N30A 3PR8A 4YAPA 1XBSA 4O92A 2DJ2A 2VLUA 1Y6EA 1DE1A 1GUKA 1SENA 3GH9A 4X1UA 4JR6A 4BPYA 5G31A 1SJIA 5H5QA 2IMEA 3D0ZA 4Q5RA 1OE7A 3G9BA 3IHQA 1O8XA 2VCQA 3QAGA 5KN1A 2DSAA 3GKKA 4L0UA 1E6BA 4FYBA 2QSIA 3EVIA 4I6XA 4TR0A 4QL7A 3EMPA 1NW2A 3TRXA 1A8LA 2JZSA 4CHSA 1Y25A 5E59A 5G30A 4PURA 3JCML 1O81A 4FO5A 1SKWB 3C73A 2L4QA 4ILFA 4IJIA 1H4OA 2H19A 2JL4A 1BX9A 4GQFA 3MNGA 2GS3A 1ERTA 1ABAA 1FO5A 2C4JA 3HA9A 5AIXA 2HRFA 2FWEA 1EOGA 3NOFA 4IN0A 4MJEA 2H8LA 4G0KA 1YEXA 6GSSA 3KTLA 4LMVA 2YJHA 3DVXA 2VCZA 2IMDA 5DAKB 3M0FA 1O7UA 2WULA 2HSMA 1UVZA 4TOPA 4V2LA 2L59A 5ECMB 3KD0A 4K7IA 5IQYA 2H30A 1ZZYA 4TVEA 4I2TA 2REMA 2RLIA 4D73B 3D5JA 5ID2A 1LJRA 1T7PB 4EUYA 1HNBA 2IFQB 2YNXA 3EINA 2HRNA 3DMLA 2AHEA 2CAQA 1SYXA 3CTGA 1GSUA 2R4VA 3MWHA 5CO3A 3ZVJA 4BL7A 2X64A 2D2ZA 2LQQA 2LRNA 4BVXB 3GA4A 1GUHA 1O8WA 1XWAA 3CXGA 1DE2A 6GSYA 3DYRA 3P7XA 1YF0A 1E2YA 3W8JA 3IRAA 2YP6A 2YN1A 4K9ZA 3GN3A 1N8JA 4ECIA 4LA1A 3ED3A 3DKSA 1G0TA 3W6GA 1R7HA 2MBSA 2VD1A 3WD6A 1TI1A 3BBYA 1BG5A 2XPDA 1V2AA 1XPVA 3Q6OA 5FWGA 2R3XA 2VL9A 2YWOA 3M1GA 3WT2A 3GH6A 1TXXA 3HVSA 5IO0A 2C80A 3A3TA 1WJKA 1K3YA 3TB2A 2L57A 2FWHA 4OO5A 3H4KA 3RBTA 4IW9A 1GTIA 1RQMA 3TCOA 1ZMAA 5D8IA 4GQCA 3VWXA 4V2MA 5J9CA 3WGXA 3GV1A 4KAEA 2VD0A 3H8QA 5B7CA 1WWJA 3ZFBA 4K1FA 1GLQA 1NSWA 3EWLA 2H74A 2HRKA 1PD21 4NHZA 3RHBA 2FGXA 5ABRA 3F6FA 11GSA 3UBLA 4XS1A 2CAIA 3L9UA 3CRTA 3NZNA 1XWBA 4WETA 2KP1A 1PL2A 4HU7A 3G7IA 3GTUA 4GRFA 3GKMA 2JSZA 4MH3A 4O5RA 1M2AA 4K0NA 3FY7A 3C71A 4CDOA 2R37A 1M2DA 2OADA 1PX7A 2LSTA 3D4TA 2A4VA 2HSNB 2PVQA 5CRGA 6GSTA 2DJ0A 3KH9A 2MYGA 5F06A 4EDYA 16GSA 5HR2A 2L6CA 2HQTA 4WR4A 5IO2A 4KCAA 4YH2A 3E3EA 3LG6A 2IIYA 3HVXA 4X0XA 2CV4A 3SWLA 5DDLA 2DMMA 1USBA 1I5GA 1FG4A 5HFIA 1FVJA 3PPUA 5GAND 1YDKA 1AAZA 3QFAC 5ECOB 2M80A 5GSSA 1MEKA 4ZBAA 5GSTA 1H75A 3EC3A 2R6KA 2HSMB 2GQKA 2V2GA 1R5PA 5CP1A 3U6VA 2B5YA 3QFBC 2ZNMA 2VM2A 2GZZA 3WYWA 2DIZA 2GLRA 5L71A 2RUFA 4KE3A 2GSSA 1S3AA 2HZFA 4TXOB 3GURA 3QMXA 1OC9B 3TRQA 3LJRA 4OFNA 2VOCA 1B4QA 2P31A 2C0FA 3LQ7A 3CRUA 2LJRA 4HU9A 14GSA 2OE1A 1A2JA 4IHUA 1AQVA 4PUFC 3KGKA 2GT6A 2DC5A 2C8UA 1QGVA 2I1UA 1OC8A 5KN2A 4DSRA 1QK8A 1T8EB 3FEUA 1N2AA 5C00A 1K0CA 3GSTA 1XW5A 4ZBDA 1JFUA 2YV7A 4MJBA 4K7OA 4ML6A 2YPMA 1LU4A 4NMUA 3GIXA 3GSSA 9GSSA 1TRSA 2OKAA 1X5EA 1YY7A 3IAS2 4MA9A 1SK1A 2VUPA 2L4CA 4BWSA 4DSQA 4TN8A 2N5AA 3V1WA 2HLSA 4WR5A 3HZ8A 3GMFA 1URMA 1OE8A 3QOUA 4KX4A 4XS6A 2KOKA 3UMAA 3EYTA 5IOXA 4L8EA 7GSSA 1QQ2A 2VAFA 1GSQA 4X43A 4G0IA 2ES7A 4EC0A 1GTBA 3L9SA 5C04A 2K8SA 5GAPD 1M2BA 5DBQA 1RW1A 1NHOA 2ZCTA 5J5NA 2H66A 3H1NA
chains in the Genus database with same CATH superfamily
3BJ5A 3ME7A 4USSA 3KH7A 5HFGA 1C72A 1F6MC 4KCEA 4AGSA 1X5DA 1ZGNA 3DD3A 1BG1A 1Z7RA 1XW9A 3R2QA 2OT3A 2FY6A 2HRKB 3EURA 2A4HA 1IYIA 4KDXA 3R3EA 3L0HA 3IC8A 5ECNB 4ZIJA 2IMKA 1TI3A 5D93A 4HQSA 2QA1A 3TKPA 2MZCA 3WGDA 2GSRA 2LJKA 4KUNA 1GLPA 1G6YA 4F0CA 4GLTA 2LEGA 2B3SA 3NIVA 3H93A 4TW5A 1HD2A 5J47A 1PKWA 1K3LA 1GTUA 1ST9A 1XOBA 2YWIA 3IBHA 3D21A 5G1KA 1FB6A 5BMUA 4HSCX 3IE3A 1A2LA 2CX3A 2WVYA 5HR0A 1KEBA 2GGTA 2UZ8A 4PNFA 5DJMA 3HD5A 4Q5NA 3Q74A 4RI7A 1U88A 3A5IA 1ML6A 2GZYA 4DSSA 4ULXA 3KJYA 4PQHA 4HJMA 1V9WA 3CSHA 1R5AA 1EP7A 2CZ3A 4OMVA 5AGYA 3LYPA 3HCZA 4MF6A 3ZIJA 1QFNA 1A24A 3GX8A 2VM1A 1YF1A 3GYKA 1OKTA 4YAVA 1GH2A 4PGTA 2DLXA 2OBIA 3KCMA 1EWXA 1M3JA 1GSYA 2AJQB 4IS0A 4CY6A 1WOUA 2TRXA 2YWMA 4TXVA 3ZITA 3MDKA 3LXTA 3ZMKA 2WW3A 3TJJA 1JLWA 2FD3A 1KTEA 5ECRB 5A4UA 2N5FA 5LD0A 5A1NB 1W89A 2EIRA 2R0PA 3FR3A 2KP2A 3ZL5A 2H1DA 4BA7A 1T3BA 3C7MA 1XOAA 2HI7A 3LEFA 5CRHA 1SK2A 3ZIVA 2WZ9A 3CMIA 3CSJA 3L78A 2IPAA 3HXSA 3RPPA 2DMLA 2EIOA 5J9BA 4TXOA 5DJLA 2DJ1A 2K6VA 2I3YA 1OC9A 5JCUA 1SYRA 4NV5A 5INYA 1YKAA 3A2VA 4POMA 3RDWA 5HR3A 4HZ2A 4MLYA 2X4AA 1S3DA 3J7Yb 2GSTA 1U87A 2OE3A 1TKDB 3HVNA 1THOA 1YQ1A 4FYUA 2R0GA 4BVYA 3F63A 1WIKA 1THXA 3QDNA 2XHFA 4K8MA 3LGCA 4HOJA 1K0AA 1BJXA 5EY6A 3N5OA 5A4VA 2WVXA 2KHPA 4IBPA 1UA5A 4V2NA 4K7NA 4O32A 1Q4JA 4OD7A 1MD3A 4XCSA 5B8AA 2V1MA 1HQOA 2LS5A 4EKZA 3DEXA 4POBA 20GSA 1VF4A 1EV4A 1TU7A 2PWJA 1PX6A 4LL1B 2MMAA 1SKRB 3G7JA 1OKDA 1K0OA 4TR1A 2CA8A 3CBUA 2G0FA 3G7YA 2YV9A 2IWTA 3VWWA 5A4WA 1IYHA 2O8VB 2QC7A 1V57A 4IKHA 2YZUA 3F0IA 4MABA 4WKWA 4ZB9A 1M99A 3M9JA 1Z6MA 2K8VA 4MF5A 2VL3A 3P8WA 2CQ9A 1EGOA 4Q5FA 3HYPA 3HJOA 3O3TA 1JZOA 2YWNA 1SL0B 4BWQA 3TKSE 2VCTA 2LRCA 2IMFA 2LTKA 4FXYP 5IMVA 2H70A 1NM3A 1ON4A 5D9WA 2O85A 4HUAA 3RHCA 2PBJA 2OE0A 2ALBA 1OYJA 1ZOFA 3N9JA 2FWGA 1T4YA 18GSA 1WMJA 2M46A 2A2RA 3D6IA 4AJ7A 1ERVA 2AUVA 3P2AA 3ZMLA 1A23A 1I1IP 1GUMA 5G2ZA 3GRXA 2FHEA 2WGRA 3HJPA 1K0NA 5EL8A 2Z9SA 5IIZA 3M9KA 5LCZA 1B8XA 5IM9A 1O85A 1CQHA 1SVMA 1ZCPA 4XRDA 4MDCA 4POLA 5CYYA 2E7PA 4EO3A 3FW2A 5JWQB 5IMFA 4DEJA 2GSQA 4IGJA 3TU3B 2WB9A 4JRRA 1XWGA 1EGRA 2LKUA 4IVFA 2C0GA 4KH7A 4J56E 3LFLA 4ZL8A 3D4MA 2HRAA 1DSBA 3M3MA 1XVWA 3IA1A 2PVOC 4KW6A 1AUCA 4ZB7A 1W4VA 4J57E 1YEPA 1SVLA 2BMXA 1XCCA 2FWFA 1AC1A 2V6KA 2FA8A 1XXUA 5F8BA 4MMMA 2H0IA 1LBKA 3APOA 4JE1A 1TJDA 2O3EA 4F82A 1MDJA 3EU3A 1TXUA 3TJFA 4DSSB 4I5QA 1TK0B 4K0GA 1TW9A 3GFKA 1PRXA 5ELAA 2NVLA 4QQ7A 3IC4A 2OACA 2TRCP 1FB0A 4PI2C 1B9XC 1J08A 3W8SA 1B9YC 4OWYA 2QKEA 4K2DA 4ZB6A 2NTOA 2VO4A 5HQPA 5E4WA 1Z7PA 2DJJA 2XC2A 2O89A 1GNWA 5AN1A 4G10A 3ZREA 2CZ2A 5A1NA 2K18A 2PMTA 4JBBA 1K0BA 4LMWA 4WF4A 3HZ4A 4PTSA 1V98A 1SKSB 1TRWA 1G7EA 3VURA 1BQ7A 2IL3A 4MNNA 2VCVA 5F0GA 3FHKA 4K6XA 1Y1UA 4PXOA 4XIHA 2I81A 2VL2A 1MDIA 3HKRA 2B1LA 4N0VA 1R26A 3RPNA 3KP8A 2EC4A 5FT3A 1A0FA 1AIUA 4H86A 4TR3A 1PL1A 1TK8B 4MZBA 4WBRD 2B1KA 5B6MA 4TR4A 1U3IA 3OR5A 2NPBA 2YZHA 3EPTA 4BVYB 1FW1A 3UARA 4HZ4A 2I4AA 2PU9C 4TKYA 5J3RA 2V41A 1J0FA 2C1YA 1KBNA 2MMZA 1ILOA 1RK4A 4JR4A 4FIWA 1QMVA 4ACSA 5KEJA 1EOHA 4OFTA 1PFOA 1K0DA 3MAKA 3MYDA 3FZAA 1PSQA 3CTFA 5CREA 4JU5A 4ECJA 5CNWA 3HJMA 1R4WA 5A34A 2H01A 4K5SA 3C1RA 4FH8A 2F8FA 6GSXA 1YZXA 2GVPA 3VI7A 3F4SA 1U6TA 5IPHA 4TR1B 3EMXA 1VGLA 3QPMA 2GQLA 4QL9A 2HZEB 4HJ2A 5DQSA 1OC3A 2ZUPA 1EP8A 3IOSA 4OO4A 2X8CA 3DXBA 4MCUA 5LNKe 3RFRC 1GWCA 1OVNA 2OA7A 5G5FA 1MTCA 4E8HA 4PQIA 3TKSC 4AF2A 4MF7A 3A2WA 4LL4B 3HVVA 4KDUA 1JZDA 3LORA 1EEJA 1GSSA 1M9BA 4L0WA 4MH2A 2B5XA 1GNEA 5IPGA 1ZYPA 3F4RA 2J23A 3IXRA 3IAM2 3GKXA 4GCIA 4ZXGA 4WBJA 2WS2A 1MDKA 5F05A 1NHYA 5D9XA 3E9JB 2P0GA 1TP9A 3VI5A 4Q5QA 2B6MA 2HT9A 2PERA 5CAXA 1TU8A 1YJ6A 3UL3A 4N0ZA 2H75A 3EU4A 2J9HA 2LQOA 2FUG2 2HYXA 2JACA 1F9MA 3TOUA 3E0UA 4Z7XA 1OAZA 1G7OA 3L9VA 3FZ5A 3AY8A 3KTBA 1M3IA 10GSA 5DALA 1FVKA 2IN3A 4PNGA 1WRYA 3MIXA 4CW9A 1JLVA 2H1AA 1MD4A 2ON7A 2X8GA 1GL8A 4ZILA 3UBKA 2H72A 1TRUA 3ISOA 1S4BP 2A2SA 4ECBA 3BCIA 2JADA 2AV4A 1XIYA 5G1LA 1M9AA 1ZL9A 2VCXA 5G5EA 22GSA 4YKGA 4GF0A 3IPZA 4WEYA 3O6TA 4E68A 2NBSA 5DQYA 2E2MA 3L4NA 2CVKA 2EFHA 1EV9A 3UAPA 1J9BA 5ECSA 2F51A 4MP4A 3BCKA 1ZYQB 4EIQA 1X5CA 4WXTA 5IMDA 2ON5A 3HHVA 4IP1A 2IJYA 5J4VA 2DBCA 3RAZA 3HY2A 4RQXA 4XRAA 4MK3A 3UIWA 3UVTA 1F37A 2RM6A 4PI0C 1WP0A 2WW1A 1V40A 3F4TA 4NV2A 2QA2A 1XVQA 4AJ6A 5JCGA 1K0MA 4G9HA 1X9MB 2TIRA 4PUAA 3CSIA 1SK0A 1SJ6A 3GUSA 4EF0A 3FKFA 1Z6NA 1T00A 2H6YA 3TDGA 1V58A 3TKRA 3F9UA 1F2EA 3IR4A 1S3CA 4IJ3A 5EPFA 2WCIA 1T1VA 1TK5B 3VLNA 2FLSA 4WF5A 5B8BA 1PN9A 3CQFA 2H6ZA 4MPGA 1BEDA 3F8UA 2O36A 5ECQB 3A2XA 2VL2C 1K3OA 3I9V2 4IQAA 4GDFA 2LRTA 5HFKA 4O5UA 2I9HA 4KA0A 2YOIA 3LXZA 5H5SA 1N25A 3K8NA 3PH9A 4I2UA 4N10A 4IQ1A 2M72A 4EVMA 1TTZA 3KP9A 2CT6A 3SBCA 1X0RA 4HEA2 4JEDA 4F0BA 1XWKA 3ZVJD 2MBTA 2F8AA 3TKQA 1A0RP 4KSOA 2JZTA 1Z9HA 2MMNA 4L5LA 2B5EA 2GT5A 4GTUA 1Q98A 2C3QA 2CVBA 4EXJA 1AW9A 3QR6A 3CYNA 1PKZA 2CVDA 3ZFLA 2DJ3A 1X9SB 4ZL7A 2PPTA 4KF9A 3IK7A 3FYGA 1PN0A 4HS1A 3QAVA 3FK8A 4I97A 4YQMA 5KN3A 5AISA 3IV4A 4AKGA 5JWRB 5IOWA 5A34B 3H79A 2EIQA 3TGZA 1HYUA 17GSA 2RUEA 1YEWC 4PQ1A 3LWAA 2HZEA 4ECCA 2B7JA 4G19A 1JHBA 3RGBC 3TOTA 2WRTA 4AI6A 2LNTA 4OCEA 2XPEA 3FZ9A 1F3BA 5DCHA 5IMZA 2AB6A 3VPQA 4NHWA 1SD9A 3TKSA 1Z5YE 1TOFA 2DJKA 3GKNA 4NXIA 3EE2A 2OJLA 2R5GA 4MPFA 2LUSA 4QMKA 3VFIA 3TJGA 2YJ7A 2C3NA 3PINA 2JZRA 2V6OA 4K2XA 4OCFA 4DVCA 2LV3A 1O6JA 4P3YB 2F3MA 6GSUA 2H71A 5COHA 1GP1A 4G0LA 1T4ZA 1XW6A 4HDEA 1ERUA 5D9TA 5IMAA 4GSSA 4FYCA 3FR9A 5J41A 2E0QA 4NWYA 3BOAA 3LSZA 1FAAA 5BRTA 2A2PA 5KOWA 1GRXA 1JZWA 2X8HA 3D22A 3GX0A 1I9DA 4F2IA 4ID0A 3VWUA 4XS4A 3VK9A 1YVLA 1PQNA 5ECKB 3VWVA 3APSA 2B7KA 3WT1A 2HSYA 3UVHA 2LNSA 5DALB 2WFCA 1B48A 3WGEA 3ERFA 3ERGA 4ISDA 2PGTA 4MZCA 1Z3EA 1AXDA 2X49A 3QAWA 4MJCA 4KGIA 3KIJA 2RM5A 1HNCA 1BYEA 3A5WA 6GSWA 3Q19A 3ZTLA 2VCWA 1EZKA 1SL2B 1AQXA 1ZYNA 2AYTA 4GSNA 4MJAA 5D96A 2O7KA 5CRWA 4V1Ap 2FA4A 3UOMA 4V1Ag 1SL1B 2HSHA 2HNLA 1SU9A 2H0GA 1ZYEA 4OFMA 2P5RA 13GSA 1PA3A 1GULA 3ZZXA 5DVBA 3O76A 2FCHA 3TJBA 1DBYA 2BTOT 1VRSD 1U3AA 3KMNA 1F3AA 4G2EA 2PUKC 3FRCA 2R2JA 1GSDA 2IMIA 1JZRA 4KSMA 1CQGA 2HE3A 5ECLB 5ECHB 2E2GA 1FHEA 2WDUA 3F3QA 1EEMA 3P90A 3LYKA 2H73A 3M8NA 4EDZA 4N11A 2WW0A 3QD9A 3F3RA 3IDVA 1WE0A 4HQZA 4TRXA 1X9WB 1PGTA 2GDRA 2XBQA 2H6XA 3TJKA 3US3A 3DRNA 1FOHA 1BAYA 3FR6A 2NDOA 1A2MA 4HI7A 1O73A 4GSTA 3ERWA 4NPBA 5DAKA 2L5LA 5KN0A 1YKCA 2WJUA 3TUEA 1XFLA 2XBIA 4KNDA 3KZQA 5D9VA 4IELA 1QUWA 2H1GA 3BD2A 4J2FA 1ERWA 2EFDA 5EVOA 4XHMA 2MMOA 3DVWA 4L5OA 4D73A 4E8EA 1XG8A 4NAXA 3FZ4A 5ID2B 2H1BA 4POKA 3U5RE 2IFQA 4ZL9A 5F07A 4W66A 3QCPA 1B4PA 2JU5A 3I43A 2K9FA 5DCGA 1KNGA 2BJXA 2VIMA 2O5VA 1A8YA 2DIYA 1M7TA 4YQUA 19GSA 5A5KA 2KUCA 5CRDA 1VF3A 4F03A 1UN2A 3GL5A 2HFDA 3VPTA 4BL7B 5ENUA 1GSEA 4LLRA 4BVXA 3IK9A 2VKZG 3GNJA 1XZOA 2H76A 3ZYWA 2VLTA 4XTSA 5JWOB 5ECIB 2YANA 5B6NA 4PX1A 1UC7A 2G2QA 2RIIA 3TRPA 3F6DA 3S9FA 4O7HA 2GQMA 1G6WA 3C8EA 1SD8A 2KLXA 1XWCA 2VLVA 4EE0A 4MZWA 3GHAA 4ZB8A 2H0HA 4ML1A 1SJZA 2JSYA 2P5QA 2PN8A 5ELGA 5AIVA 3MSZA 4RQRA 3GL3A 3HDCA 5J4UA 5D73A 6GSVA 3APQA 5JCWA 2HXKA 3DIEA 4RUVA 4JZQA 2FNOA 3Q18A 4I8BA 3C1SA 3KM6A 3PGTA 5FHIA 1VF2A 2L6DA 4IP6A 5ECPB 5GZZB 4YQVA 2X99A 2F9SA 1PMTA 2V32A 5H5RA 1DUGA 3I69A 5IMCA 4F9ZA 3I6AA 2C0EA 1M0UA 2CX4A 4FQUA 3DWVA 3ZRDA 1HNAA 2N5BA 2OBKA 2GTUA 2O87A 2GZPA 1GTAA 4RI6A 5HR1A 1QXHA 2C3TA 4KB3A 4GWRA 2L5OA 2YCDA 4XS4B 4KDYA 1AQWA 2QGVA 3J7Yk 1WPIA 4ZBBA 1TRVA 3DGQA 3UJ1A 1FOVA 1ACVA 2C0DA 4GXZA 3KEBA 4A5PA 12GSA 3GTUB 8GSSA 1VF1A 4EL1A 3ME8A 1TDIA 1GSFA 2AAWA 3ZLPA 4AJ8A 3UEMA 2LJAA 3KMOA 3KXOA 4N30A 3PR8A 4YAPA 1XBSA 4O92A 2DJ2A 2VLUA 1Y6EA 1DE1A 1GUKA 1SENA 3GH9A 4X1UA 4JR6A 2EFCA 4BPYA 2HSNA 5G31A 1SJIA 5H5QA 2IMEA 4N3ZA 3D0ZA 4Q5RA 3IHGA 1OE7A 3G9BA 3IHQA 1O8XA 2VCQA 3QAGA 5KN1A 2DSAA 3GKKA 4L0UA 1E6BA 4FYBA 2QSIA 3EVIA 4I6XA 4TR0A 4QL7A 3EMPA 1NW2A 3TRXA 1A8LA 2JZSA 4CHSA 1Y25A 5E59A 5G30A 4PURA 3JCML 1O81A 4FO5A 1SKWB 2R0CA 3C73A 2L4QA 4ILFA 4IJIA 1H4OA 2H19A 2JL4A 1BX9A 2DKIA 4GQFA 3MNGA 2GS3A 1ERTA 1ABAA 1FO5A 2C4JA 3HA9A 5AIXA 2HRFA 2FWEA 1EOGA 3NOFA 4IN0A 4MJEA 2H8LA 4G0KA 2WZSA 1YEXA 6GSSA 3KTLA 2WW2A 4LMVA 2YJHA 3DVXA 2VCZA 2IMDA 5DAKB 3M0FA 1O7UA 2WULA 2HSMA 1UVZA 4TOPA 4V2LA 2L59A 5ECMB 3KD0A 4K7IA 5IQYA 2H30A 1ZZYA 4TVEA 4I2TA 1S3RA 4X4JA 2REMA 2RLIA 4D73B 3D5JA 5ID2A 1LJRA 1T7PB 4EUYA 1HNBA 2IFQB 2YNXA 3EINA 2HRNA 3DMLA 2AHEA 2CAQA 1SYXA 3CTGA 1GSUA 2R4VA 3MWHA 5CO3A 3ZVJA 4BL7A 2X64A 2D2ZA 4K5RA 2LQQA 2LRNA 4BVXB 3GA4A 1GUHA 1O8WA 1XWAA 3CXGA 1DE2A 6GSYA 3DYRA 3P7XA 1YF0A 1E2YA 3W8JA 3IRAA 2YP6A 1SVOA 2UV8G 2YN1A 4K9ZA 3GN3A 1N8JA 4ECIA 4LA1A 3ED3A 3DKSA 1G0TA 3W6GA 1R7HA 2MBSA 2VD1A 3WD6A 1TI1A 3BBYA 1BG5A 2XPDA 1V2AA 1XPVA 3Q6OA 5FWGA 2R3XA 2VL9A 2YWOA 3M1GA 3WT2A 3GH6A 1TXXA 3HVSA 5IO0A 2C80A 3A3TA 1WJKA 1K3YA 3TB2A 2L57A 2FWHA 4OO5A 3H4KA 3RBTA 4IW9A 1GTIA 1RQMA 3TCOA 5A5HB 1ZMAA 5D8IA 4GQCA 3VWXA 2WVZA 2DKHA 4V2MA 5J9CA 3WGXA 3GV1A 4KAEA 2VD0A 4Z2RA 3H8QA 5B7CA 1WWJA 3ZFBA 4K1FA 1GLQA 1NSWA 3EWLA 2H74A 2HRKA 1PD21 4NHZA 3RHBA 3CHXC 2FGXA 4O5QA 5ABRA 3F6FA 11GSA 3UBLA 4AKHA 4XS1A 2CAIA 3L9UA 3CRTA 3NZNA 1XWBA 4WETA 2KP1A 1PL2A 4HU7A 3G7IA 3GTUA 4GRFA 3GKMA 2JSZA 4MH3A 4O5RA 1M2AA 4K0NA 3FY7A 3C71A 4CDOA 2R37A 4PHZC 1M2DA 2OADA 1PX7A 2LSTA 3D4TA 2A4VA 2HSNB 4BIKA 2PVQA 5CRGA 4G01A 5BMUB 6GSTA 2DJ0A 3KH9A 2MYGA 5F06A 4EDYA 16GSA 5HR2A 2L6CA 4YKFA 2HQTA 4CY8A 4WR4A 5IO2A 4KCAA 4YH2A 3E3EA 3LG6A 2IIYA 3HVXA 4X0XA 2CV4A 3FMWA 3SWLA 5DDLA 2DMMA 1USBA 1I5GA 1FG4A 5HFIA 1FVJA 4AKXB 3PPUA 5GAND 1YDKA 5KOXA 1AAZA 3QFAC 2EFEA 5ECOB 2M80A 5GSSA 1MEKA 3LW9A 4ZBAA 5GSTA 1H75A 3EC3A 2R6KA 2HSMB 2GQKA 2V2GA 1R5PA 5CP1A 3U6VA 2B5YA 3QFBC 2ZNMA 2H1LA 2VM2A 2GZZA 3WYWA 2DIZA 2GLRA 5L71A 2RUFA 4KE3A 2GSSA 1S3AA 2HZFA 4TXOB 3GURA 3QMXA 1OC9B 3TRQA 1BF5A 4EIPA 3LJRA 4ICYA 4OFNA 2VOCA 1B4QA 2P31A 2C0FA 3LQ7A 3CRUA 2LJRA 4HU9A 14GSA 2OE1A 1A2JA 4IHUA 1AQVA 4PUFC 3KGKA 2GT6A 2DC5A 2C8UA 1QGVA 2I1UA 1OC8A 5KN2A 4DSRA 1QK8A 1T8EB 3FEUA 1N2AA 5C00A 1K0CA 3GSTA 1XW5A 4ZBDA 1JFUA 2YV7A 4MJBA 5J40A 4K7OA 4ML6A 2WVXB 4AKIA 2YPMA 1LU4A 4NMUA 4Z2TA 3GIXA 3GSSA 9GSSA 1TRSA 2OKAA 1X5EA 1YY7A 3IAS2 4MA9A 1SK1A 2VUPA 2L4CA 5J4YA 4BWSA 4DSQA 4TN8A 2N5AA 3V1WA 2HLSA 4WR5A 3CWGA 3HZ8A 3GMFA 1URMA 1OE8A 3HMJG 3QOUA 4KX4A 4XS6A 2KOKA 3UMAA 3EYTA 5IOXA 4L8EA 7GSSA 1QQ2A 2VAFA 1GSQA 4X43A 4G0IA 2ES7A 4EC0A 1GTBA 3L9SA 5C04A 2K8SA 5A5HA 5GAPD 1M2BA 5DBQA 1RW1A 1NHOA 2ZCTA 5J5NA 2H66A 3H1NA 4Z2UA
chains in the Genus database with same CATH topology
3BJ5A 3ME7A 4USSA 3KH7A 5HFGA 1C72A 1F6MC 4KCEA 4AGSA 1X5DA 1ZGNA 3DD3A 1BG1A 1Z7RA 1XW9A 3R2QA 2OT3A 2FY6A 2HRKB 3EURA 2A4HA 1IYIA 4KDXA 3R3EA 3L0HA 3IC8A 5ECNB 4ZIJA 2IMKA 1TI3A 5D93A 4HQSA 2QA1A 3TKPA 2MZCA 3WGDA 2GSRA 2LJKA 4KUNA 1GLPA 1G6YA 4F0CA 4GLTA 2LEGA 2B3SA 3NIVA 3H93A 4TW5A 1HD2A 5J47A 1PKWA 1K3LA 1GTUA 1ST9A 1XOBA 2YWIA 3IBHA 3D21A 5G1KA 1FB6A 5BMUA 3IE3A 1A2LA 2CX3A 5HR0A 1KEBA 2GGTA 2UZ8A 4PNFA 5DJMA 3HD5A 4Q5NA 3Q74A 4RI7A 1U88A 3A5IA 1ML6A 2GZYA 4DSSA 4ULXA 3KJYA 4PQHA 4HJMA 1V9WA 3CSHA 1R5AA 1EP7A 2CZ3A 4OMVA 5AGYA 3LYPA 3HCZA 4MF6A 3ZIJA 1QFNA 1A24A 3GX8A 2VM1A 1YF1A 3GYKA 1OKTA 4YAVA 1GH2A 4PGTA 2DLXA 2OBIA 3KCMA 1EWXA 1GSYA 2AJQB 4IS0A 4CY6A 1WOUA 2TRXA 2YWMA 4TXVA 3ZITA 3MDKA 3LXTA 3ZMKA 3TJJA 1JLWA 2FD3A 1KTEA 5ECRB 5A4UA 2N5FA 5LD0A 5A1NB 1W89A 2EIRA 2R0PA 3FR3A 2KP2A 3ZL5A 2H1DA 4BA7A 1T3BA 3C7MA 1XOAA 2HI7A 3LEFA 5CRHA 1SK2A 3ZIVA 2WZ9A 3CMIA 3CSJA 3L78A 2IPAA 3HXSA 3RPPA 2DMLA 2EIOA 5J9BA 4TXOA 5DJLA 2DJ1A 2K6VA 2I3YA 1OC9A 5JCUA 1SYRA 4NV5A 5INYA 1YKAA 3A2VA 4POMA 3RDWA 5HR3A 4HZ2A 4MLYA 2X4AA 1S3DA 3J7Yb 2GSTA 1U87A 2OE3A 1TKDB 1THOA 1YQ1A 4FYUA 2R0GA 4BVYA 3F63A 1WIKA 1THXA 3QDNA 2XHFA 4K8MA 3LGCA 4HOJA 1K0AA 1BJXA 5EY6A 3N5OA 5A4VA 2KHPA 4IBPA 1UA5A 4V2NA 4K7NA 4O32A 1Q4JA 4OD7A 1MD3A 4XCSA 5B8AA 2V1MA 1HQOA 2LS5A 4EKZA 3DEXA 4POBA 20GSA 1VF4A 1EV4A 1TU7A 2PWJA 1PX6A 4LL1B 2MMAA 1SKRB 3G7JA 1OKDA 1K0OA 4TR1A 2CA8A 3CBUA 2G0FA 3G7YA 2YV9A 2IWTA 3VWWA 5A4WA 1IYHA 2O8VB 2QC7A 1V57A 4IKHA 2YZUA 3F0IA 4MABA 4WKWA 4ZB9A 1M99A 3M9JA 1Z6MA 2K8VA 4MF5A 2VL3A 3P8WA 2CQ9A 1EGOA 4Q5FA 3HYPA 3HJOA 3O3TA 1JZOA 2YWNA 1SL0B 4BWQA 3TKSE 2VCTA 2LRCA 2IMFA 2LTKA 5IMVA 2H70A 1NM3A 1ON4A 5D9WA 2O85A 4HUAA 3RHCA 2PBJA 2OE0A 2ALBA 1OYJA 1ZOFA 3N9JA 2FWGA 1T4YA 18GSA 1WMJA 2M46A 2A2RA 3D6IA 4AJ7A 1ERVA 2AUVA 3P2AA 3ZMLA 1A23A 1GUMA 5G2ZA 3GRXA 2FHEA 2WGRA 3HJPA 1K0NA 5EL8A 2Z9SA 5IIZA 3M9KA 5LCZA 1B8XA 5IM9A 1O85A 1CQHA 1SVMA 1ZCPA 4XRDA 4MDCA 4POLA 5CYYA 2E7PA 4EO3A 3FW2A 5JWQB 5IMFA 4DEJA 2GSQA 4IGJA 3TU3B 2WB9A 4JRRA 1XWGA 1EGRA 2LKUA 4IVFA 2C0GA 4KH7A 4J56E 3LFLA 4ZL8A 3D4MA 2HRAA 1DSBA 3M3MA 1XVWA 3IA1A 2PVOC 4KW6A 1AUCA 4ZB7A 1W4VA 4J57E 1YEPA 1SVLA 2BMXA 1XCCA 2FWFA 1AC1A 2V6KA 2FA8A 1XXUA 5F8BA 4MMMA 2H0IA 1LBKA 3APOA 4JE1A 1TJDA 4F82A 1MDJA 3EU3A 1TXUA 3TJFA 4DSSB 4I5QA 1TK0B 4K0GA 1TW9A 3GFKA 1PRXA 5ELAA 2NVLA 4QQ7A 3IC4A 2OACA 2TRCP 1FB0A 1B9XC 1J08A 3W8SA 1B9YC 4OWYA 2QKEA 4K2DA 4ZB6A 2NTOA 2VO4A 5HQPA 5E4WA 1Z7PA 2DJJA 2XC2A 2O89A 1GNWA 5AN1A 4G10A 3ZREA 2CZ2A 5A1NA 2K18A 2PMTA 4JBBA 1K0BA 4LMWA 4WF4A 3HZ4A 4PTSA 1V98A 1SKSB 1TRWA 1G7EA 3VURA 1BQ7A 2IL3A 4MNNA 2VCVA 5F0GA 3FHKA 4K6XA 1Y1UA 4PXOA 4XIHA 2I81A 2VL2A 1MDIA 3HKRA 2B1LA 4N0VA 1R26A 3RPNA 3KP8A 2EC4A 5FT3A 1A0FA 1AIUA 4H86A 4TR3A 1PL1A 1TK8B 4MZBA 4WBRD 2B1KA 5B6MA 4TR4A 1U3IA 3OR5A 2NPBA 2YZHA 3EPTA 4BVYB 1FW1A 3UARA 4HZ4A 2I4AA 2PU9C 4TKYA 5J3RA 2V41A 1J0FA 2C1YA 1KBNA 2MMZA 1ILOA 1RK4A 4JR4A 4FIWA 1QMVA 4ACSA 5KEJA 1EOHA 4OFTA 1K0DA 3MAKA 3MYDA 3FZAA 1PSQA 3CTFA 5CREA 4JU5A 4ECJA 5CNWA 3HJMA 1R4WA 5A34A 2H01A 4K5SA 3C1RA 4FH8A 2F8FA 6GSXA 1YZXA 2GVPA 3VI7A 3F4SA 1U6TA 5IPHA 4TR1B 3EMXA 1VGLA 3QPMA 2GQLA 4QL9A 2HZEB 4HJ2A 5DQSA 1OC3A 2ZUPA 1EP8A 3IOSA 4OO4A 2X8CA 3DXBA 4MCUA 5LNKe 1GWCA 1OVNA 2OA7A 5G5FA 1MTCA 4E8HA 4PQIA 3TKSC 4AF2A 4MF7A 3A2WA 4LL4B 3HVVA 4KDUA 1JZDA 3LORA 1EEJA 1GSSA 1M9BA 4L0WA 4MH2A 2B5XA 1GNEA 5IPGA 1ZYPA 3F4RA 2J23A 3IXRA 3IAM2 3GKXA 4GCIA 4ZXGA 4WBJA 2WS2A 1MDKA 5F05A 1NHYA 5D9XA 3E9JB 2P0GA 1TP9A 3VI5A 4Q5QA 2B6MA 2HT9A 2PERA 5CAXA 1TU8A 1YJ6A 3UL3A 4N0ZA 2H75A 3EU4A 2J9HA 2LQOA 2FUG2 2HYXA 2JACA 1F9MA 3TOUA 3E0UA 4Z7XA 1OAZA 1G7OA 3L9VA 3FZ5A 3AY8A 3KTBA 10GSA 5DALA 1FVKA 2IN3A 4PNGA 1WRYA 3MIXA 4CW9A 1JLVA 2H1AA 1MD4A 2ON7A 2X8GA 1GL8A 4ZILA 3UBKA 2H72A 1TRUA 3ISOA 2A2SA 4ECBA 3BCIA 2JADA 2AV4A 1XIYA 5G1LA 1M9AA 1ZL9A 2VCXA 5G5EA 22GSA 4YKGA 4GF0A 3IPZA 4WEYA 3O6TA 4E68A 2NBSA 5DQYA 2E2MA 3L4NA 2CVKA 2EFHA 1EV9A 3UAPA 1J9BA 5ECSA 2F51A 4MP4A 3BCKA 1ZYQB 4EIQA 1X5CA 4WXTA 5IMDA 2ON5A 3HHVA 4IP1A 2IJYA 5J4VA 2DBCA 3RAZA 3HY2A 4RQXA 4XRAA 4MK3A 3UIWA 3UVTA 1F37A 2RM6A 1WP0A 1V40A 3F4TA 4NV2A 2QA2A 1XVQA 4AJ6A 5JCGA 1K0MA 4G9HA 1X9MB 2TIRA 4PUAA 3CSIA 1SK0A 1SJ6A 3GUSA 4EF0A 3FKFA 1Z6NA 1T00A 2H6YA 3TDGA 1V58A 3TKRA 3F9UA 1F2EA 3IR4A 1S3CA 4IJ3A 5EPFA 2WCIA 1T1VA 1TK5B 3VLNA 2FLSA 4WF5A 5B8BA 1PN9A 2H6ZA 4MPGA 1BEDA 3F8UA 5ECQB 3A2XA 2VL2C 1K3OA 3I9V2 4IQAA 4GDFA 2LRTA 5HFKA 4O5UA 2I9HA 4KA0A 2YOIA 3LXZA 5H5SA 1N25A 3K8NA 3PH9A 4I2UA 4N10A 4IQ1A 2M72A 4EVMA 1TTZA 3KP9A 2CT6A 3SBCA 1X0RA 4HEA2 4JEDA 4F0BA 1XWKA 3ZVJD 2MBTA 2F8AA 3TKQA 1A0RP 4KSOA 2JZTA 1Z9HA 2MMNA 4L5LA 2B5EA 2GT5A 4GTUA 1Q98A 2C3QA 2CVBA 4EXJA 1AW9A 3QR6A 3CYNA 1PKZA 2CVDA 3ZFLA 2DJ3A 1X9SB 4ZL7A 2PPTA 4KF9A 3IK7A 3FYGA 1PN0A 4HS1A 3QAVA 3FK8A 4I97A 4YQMA 5KN3A 5AISA 3IV4A 4AKGA 5JWRB 5IOWA 5A34B 3H79A 2EIQA 3TGZA 1HYUA 17GSA 2RUEA 4PQ1A 3LWAA 2HZEA 4ECCA 2B7JA 4G19A 1JHBA 3TOTA 2WRTA 4AI6A 2LNTA 4OCEA 2XPEA 3FZ9A 1F3BA 5DCHA 5IMZA 2AB6A 3VPQA 4NHWA 1SD9A 3TKSA 1Z5YE 1TOFA 2DJKA 3GKNA 4NXIA 3EE2A 2OJLA 2R5GA 4MPFA 2LUSA 4QMKA 3VFIA 3TJGA 2YJ7A 2C3NA 3PINA 2JZRA 2V6OA 4K2XA 4OCFA 4DVCA 2LV3A 1O6JA 4P3YB 2F3MA 6GSUA 2H71A 5COHA 1GP1A 4G0LA 1T4ZA 1XW6A 4HDEA 1ERUA 5D9TA 5IMAA 4GSSA 4FYCA 3FR9A 5J41A 2E0QA 4NWYA 3BOAA 3LSZA 1FAAA 5BRTA 2A2PA 5KOWA 1GRXA 1JZWA 2X8HA 3D22A 3GX0A 1I9DA 4F2IA 4ID0A 3VWUA 4XS4A 3VK9A 1YVLA 1PQNA 5ECKB 3VWVA 3APSA 2B7KA 3WT1A 2HSYA 3UVHA 2LNSA 5DALB 2WFCA 1B48A 3WGEA 3ERFA 3ERGA 4ISDA 2PGTA 4MZCA 1Z3EA 1AXDA 2X49A 3QAWA 4MJCA 4KGIA 3KIJA 2RM5A 1HNCA 1BYEA 3A5WA 6GSWA 3Q19A 3ZTLA 2VCWA 1EZKA 1SL2B 1AQXA 1ZYNA 2AYTA 4GSNA 4MJAA 5D96A 2O7KA 5CRWA 4V1Ap 2FA4A 3UOMA 4V1Ag 1SL1B 2HSHA 2HNLA 1SU9A 2H0GA 1ZYEA 4OFMA 2P5RA 13GSA 1PA3A 1GULA 3ZZXA 5DVBA 3O76A 2FCHA 3TJBA 1DBYA 2BTOT 1VRSD 1U3AA 3KMNA 1F3AA 4G2EA 2PUKC 3FRCA 2R2JA 1GSDA 2IMIA 1JZRA 4KSMA 1CQGA 2HE3A 5ECLB 5ECHB 2E2GA 1FHEA 2WDUA 3F3QA 1EEMA 3P90A 3LYKA 2H73A 3M8NA 4EDZA 4N11A 3QD9A 3F3RA 3IDVA 1WE0A 4HQZA 4TRXA 1X9WB 1PGTA 2GDRA 2XBQA 2H6XA 3TJKA 3US3A 3DRNA 1FOHA 1BAYA 3FR6A 2NDOA 1A2MA 4HI7A 1O73A 4GSTA 3ERWA 4NPBA 5DAKA 2L5LA 5KN0A 1YKCA 2WJUA 3TUEA 1XFLA 2XBIA 4KNDA 3KZQA 5D9VA 4IELA 1QUWA 2H1GA 3BD2A 4J2FA 1ERWA 2EFDA 5EVOA 4XHMA 2MMOA 3DVWA 4L5OA 4D73A 4E8EA 4NAXA 3FZ4A 5ID2B 2H1BA 4POKA 3U5RE 2IFQA 4ZL9A 5F07A 4W66A 3QCPA 1B4PA 2JU5A 3I43A 2K9FA 5DCGA 1KNGA 2BJXA 2VIMA 2O5VA 1A8YA 2DIYA 1M7TA 4YQUA 19GSA 5A5KA 2KUCA 5CRDA 1VF3A 4F03A 1UN2A 3GL5A 2HFDA 3VPTA 4BL7B 5ENUA 1GSEA 4LLRA 4BVXA 3IK9A 2VKZG 3GNJA 1XZOA 2H76A 3ZYWA 2VLTA 4XTSA 5JWOB 5ECIB 2YANA 5B6NA 4PX1A 1UC7A 2G2QA 2RIIA 3TRPA 3F6DA 3S9FA 4O7HA 2GQMA 1G6WA 3C8EA 1SD8A 2KLXA 1XWCA 2VLVA 4EE0A 4MZWA 3GHAA 4ZB8A 2H0HA 4ML1A 1SJZA 2JSYA 2P5QA 2PN8A 5ELGA 5AIVA 3MSZA 4RQRA 3GL3A 3HDCA 5J4UA 5D73A 6GSVA 3APQA 5JCWA 2HXKA 3DIEA 4RUVA 4JZQA 2FNOA 3Q18A 4I8BA 3C1SA 3KM6A 3PGTA 5FHIA 1VF2A 2L6DA 4IP6A 5ECPB 5GZZB 4YQVA 2X99A 2F9SA 1PMTA 2V32A 5H5RA 1DUGA 3I69A 5IMCA 4F9ZA 3I6AA 2C0EA 1M0UA 2CX4A 4FQUA 3DWVA 3ZRDA 1HNAA 2N5BA 2OBKA 2GTUA 2O87A 2GZPA 1GTAA 4RI6A 5HR1A 1QXHA 2C3TA 4KB3A 4GWRA 2L5OA 2YCDA 4XS4B 4KDYA 1AQWA 2QGVA 3J7Yk 1WPIA 4ZBBA 1TRVA 3DGQA 3UJ1A 1FOVA 1ACVA 2C0DA 4GXZA 3KEBA 4A5PA 12GSA 3GTUB 8GSSA 1VF1A 4EL1A 3ME8A 1TDIA 1GSFA 2AAWA 3ZLPA 4AJ8A 3UEMA 2LJAA 3KMOA 3KXOA 4N30A 3PR8A 4YAPA 1XBSA 4O92A 2DJ2A 2VLUA 1Y6EA 1DE1A 1GUKA 1SENA 3GH9A 4X1UA 4JR6A 2EFCA 4BPYA 2HSNA 5G31A 1SJIA 5H5QA 2IMEA 4N3ZA 3D0ZA 4Q5RA 3IHGA 1OE7A 3G9BA 3IHQA 1O8XA 2VCQA 3QAGA 5KN1A 2DSAA 3GKKA 4L0UA 1E6BA 4FYBA 2QSIA 3EVIA 4I6XA 4TR0A 4QL7A 3EMPA 1NW2A 3TRXA 1A8LA 2JZSA 4CHSA 1Y25A 5E59A 5G30A 4PURA 3JCML 1O81A 4FO5A 1SKWB 2R0CA 3C73A 2L4QA 4ILFA 4IJIA 1H4OA 2H19A 2JL4A 1BX9A 2DKIA 4GQFA 3MNGA 2GS3A 1ERTA 1ABAA 1FO5A 2C4JA 3HA9A 5AIXA 2HRFA 2FWEA 1EOGA 3NOFA 4IN0A 4MJEA 2H8LA 4G0KA 1YEXA 6GSSA 3KTLA 4LMVA 2YJHA 3DVXA 2VCZA 2IMDA 5DAKB 3M0FA 1O7UA 2WULA 2HSMA 1UVZA 4TOPA 4V2LA 2L59A 5ECMB 3KD0A 4K7IA 5IQYA 2H30A 1ZZYA 4TVEA 4I2TA 4X4JA 2REMA 2RLIA 4D73B 3D5JA 5ID2A 1LJRA 1T7PB 4EUYA 1HNBA 2IFQB 2YNXA 3EINA 2HRNA 3DMLA 2AHEA 2CAQA 1SYXA 3CTGA 1GSUA 2R4VA 3MWHA 5CO3A 3ZVJA 4BL7A 2X64A 2D2ZA 4K5RA 2LQQA 2LRNA 4BVXB 3GA4A 1GUHA 1O8WA 1XWAA 3CXGA 1DE2A 6GSYA 3DYRA 3P7XA 1YF0A 1E2YA 3W8JA 3IRAA 2YP6A 1SVOA 2UV8G 2YN1A 4K9ZA 3GN3A 1N8JA 4ECIA 4LA1A 3ED3A 3DKSA 1G0TA 3W6GA 1R7HA 2MBSA 2VD1A 3WD6A 1TI1A 3BBYA 1BG5A 2XPDA 1V2AA 1XPVA 3Q6OA 5FWGA 2R3XA 2VL9A 2YWOA 3M1GA 3WT2A 3GH6A 1TXXA 3HVSA 5IO0A 2C80A 3A3TA 1WJKA 1K3YA 3TB2A 2L57A 2FWHA 4OO5A 3H4KA 3RBTA 4IW9A 1GTIA 1RQMA 3TCOA 5A5HB 1ZMAA 5D8IA 4GQCA 3VWXA 2DKHA 4V2MA 5J9CA 3WGXA 3GV1A 4KAEA 2VD0A 4Z2RA 3H8QA 5B7CA 1WWJA 3ZFBA 4K1FA 1GLQA 1NSWA 3EWLA 2H74A 2HRKA 1PD21 4NHZA 3RHBA 2FGXA 4O5QA 5ABRA 3F6FA 11GSA 3UBLA 4AKHA 4XS1A 2CAIA 3L9UA 3CRTA 3NZNA 1XWBA 4WETA 2KP1A 1PL2A 4HU7A 3G7IA 3GTUA 4GRFA 3GKMA 2JSZA 4MH3A 4O5RA 1M2AA 4K0NA 3FY7A 3C71A 4CDOA 2R37A 1M2DA 2OADA 1PX7A 2LSTA 3D4TA 2A4VA 2HSNB 2PVQA 5CRGA 4G01A 5BMUB 6GSTA 2DJ0A 3KH9A 2MYGA 5F06A 4EDYA 16GSA 5HR2A 2L6CA 4YKFA 2HQTA 4CY8A 4WR4A 5IO2A 4KCAA 4YH2A 3E3EA 3LG6A 2IIYA 3HVXA 4X0XA 2CV4A 3FMWA 3SWLA 5DDLA 2DMMA 1USBA 1I5GA 1FG4A 5HFIA 1FVJA 4AKXB 3PPUA 5GAND 1YDKA 5KOXA 1AAZA 3QFAC 2EFEA 5ECOB 2M80A 5GSSA 1MEKA 3LW9A 4ZBAA 5GSTA 1H75A 3EC3A 2R6KA 2HSMB 2GQKA 2V2GA 1R5PA 5CP1A 3U6VA 2B5YA 3QFBC 2ZNMA 2H1LA 2VM2A 2GZZA 3WYWA 2DIZA 2GLRA 5L71A 2RUFA 4KE3A 2GSSA 1S3AA 2HZFA 4TXOB 3GURA 3QMXA 1OC9B 3TRQA 1BF5A 4EIPA 3LJRA 4ICYA 4OFNA 2VOCA 1B4QA 2P31A 2C0FA 3LQ7A 3CRUA 2LJRA 4HU9A 14GSA 2OE1A 1A2JA 4IHUA 1AQVA 4PUFC 3KGKA 2GT6A 2DC5A 2C8UA 1QGVA 2I1UA 1OC8A 5KN2A 4DSRA 1QK8A 1T8EB 3FEUA 1N2AA 5C00A 1K0CA 3GSTA 1XW5A 4ZBDA 1JFUA 2YV7A 4MJBA 5J40A 4K7OA 4ML6A 4AKIA 2YPMA 1LU4A 4NMUA 4Z2TA 3GIXA 3GSSA 9GSSA 1TRSA 2OKAA 1X5EA 1YY7A 3IAS2 4MA9A 1SK1A 2VUPA 2L4CA 5J4YA 4BWSA 4DSQA 4TN8A 2N5AA 3V1WA 2HLSA 4WR5A 3CWGA 3HZ8A 3GMFA 1URMA 1OE8A 3HMJG 3QOUA 4KX4A 4XS6A 2KOKA 3UMAA 3EYTA 5IOXA 4L8EA 7GSSA 1QQ2A 2VAFA 1GSQA 4X43A 4G0IA 2ES7A 4EC0A 1GTBA 3L9SA 5C04A 2K8SA 5A5HA 5GAPD 1M2BA 5DBQA 1RW1A 1NHOA 2ZCTA 5J5NA 2H66A 3H1NA 4Z2UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BJ5 A;  3ME7 A;  4USS A;  3KH7 A;  5HFG A;  1C72 A;  1F6M C;  4KCE A;  4AGS A;  1X5D A;  1ZGN A;  3DD3 A;  1Z7R A;  1XW9 A;  3R2Q A;  2FY6 A;  2HRK B;  3EUR A;  1IYI A;  4KDX A;  3R3E A;  3L0H A;  3IC8 A;  5ECN B;  4ZIJ A;  2IMK A;  1TI3 A;  5D93 A;  4HQS A;  3TKP A;  2MZC A;  3WGD A;  2GSR A;  2LJK A;  4KUN A;  1GLP A;  1G6Y A;  4F0C A;  4GLT A;  2LEG A;  2B3S A;  3NIV A;  3H93 A;  4TW5 A;  1HD2 A;  1PKW A;  1K3L A;  1GTU A;  1ST9 A;  1XOB A;  2YWI A;  3IBH A;  3D21 A;  5G1K A;  1FB6 A;  5BMU A;  3IE3 A;  1A2L A;  2CX3 A;  5HR0 A;  1KEB A;  2GGT A;  2UZ8 A;  4PNF A;  5DJM A;  3HD5 A;  4Q5N A;  3Q74 A;  4RI7 A;  1U88 A;  1ML6 A;  2GZY A;  4DSS A;  4ULX A;  3KJY A;  4PQH A;  4HJM A;  1V9W A;  3CSH A;  1R5A A;  1EP7 A;  2CZ3 A;  4OMV A;  5AGY A;  3LYP A;  3HCZ A;  4MF6 A;  3ZIJ A;  1QFN A;  1A24 A;  3GX8 A;  2VM1 A;  1YF1 A;  3GYK A;  1OKT A;  4YAV A;  1GH2 A;  4PGT A;  2DLX A;  2OBI A;  3KCM A;  1EWX A;  1GSY A;  2AJQ B;  4IS0 A;  1WOU A;  2TRX A;  2YWM A;  4TXV A;  3ZIT A;  3MDK A;  3LXT A;  3ZMK A;  3TJJ A;  1JLW A;  2FD3 A;  1KTE A;  5ECR B;  5A4U A;  2N5F A;  5LD0 A;  1W89 A;  2EIR A;  3FR3 A;  2KP2 A;  3ZL5 A;  2H1D A;  4BA7 A;  1T3B A;  3C7M A;  1XOA A;  2HI7 A;  3LEF A;  5CRH A;  1SK2 A;  3ZIV A;  2WZ9 A;  3CMI A;  3CSJ A;  3L78 A;  2IPA A;  3HXS A;  3RPP A;  2DML A;  2EIO A;  5J9B A;  4TXO A;  5DJL A;  2DJ1 A;  2K6V A;  2I3Y A;  1OC9 A;  5JCU A;  1SYR A;  4NV5 A;  5INY A;  1YKA A;  3A2V A;  4POM A;  3RDW A;  5HR3 A;  4HZ2 A;  4MLY A;  1S3D A;  3J7Y b;  2GST A;  1U87 A;  2OE3 A;  1TKD B;  1THO A;  1YQ1 A;  4FYU A;  4BVY A;  3F63 A;  1WIK A;  1THX A;  3QDN A;  2XHF A;  4K8M A;  3LGC A;  4HOJ A;  1K0A A;  1BJX A;  5EY6 A;  3N5O A;  5A4V A;  2KHP A;  4IBP A;  1UA5 A;  4V2N A;  4K7N A;  4O32 A;  1Q4J A;  4OD7 A;  1MD3 A;  4XCS A;  5B8A A;  2V1M A;  1HQO A;  2LS5 A;  4EKZ A;  3DEX A;  4POB A;  20GS A;  1VF4 A;  1EV4 A;  1TU7 A;  2PWJ A;  1PX6 A;  4LL1 B;  2MMA A;  1SKR B;  3G7J A;  1OKD A;  1K0O A;  4TR1 A;  2CA8 A;  3CBU A;  2G0F A;  3G7Y A;  2YV9 A;  2IWT A;  3VWW A;  5A4W A;  1IYH A;  2O8V B;  2QC7 A;  1V57 A;  4IKH A;  2YZU A;  3F0I A;  4MAB A;  4WKW A;  4ZB9 A;  1M99 A;  3M9J A;  1Z6M A;  2K8V A;  4MF5 A;  2VL3 A;  3P8W A;  2CQ9 A;  1EGO A;  4Q5F A;  3HYP A;  3HJO A;  3O3T A;  1JZO A;  2YWN A;  1SL0 B;  4BWQ A;  3TKS E;  2VCT A;  2LRC A;  2IMF A;  2LTK A;  5IMV A;  2H70 A;  1NM3 A;  1ON4 A;  5D9W A;  2O85 A;  4HUA A;  3RHC A;  2PBJ A;  2OE0 A;  2ALB A;  1OYJ A;  1ZOF A;  3N9J A;  2FWG A;  1T4Y A;  18GS A;  1WMJ A;  2M46 A;  2A2R A;  3D6I A;  4AJ7 A;  1ERV A;  2AUV A;  3P2A A;  3ZML A;  1A23 A;  1GUM A;  5G2Z A;  3GRX A;  2FHE A;  2WGR A;  3HJP A;  1K0N A;  5EL8 A;  2Z9S A;  5IIZ A;  3M9K A;  5LCZ A;  1B8X A;  5IM9 A;  1O85 A;  1CQH A;  1ZCP A;  4XRD A;  4MDC A;  4POL A;  5CYY A;  2E7P A;  4EO3 A;  3FW2 A;  5JWQ B;  5IMF A;  4DEJ A;  2GSQ A;  4IGJ A;  2WB9 A;  4JRR A;  1XWG A;  1EGR A;  2LKU A;  4IVF A;  2C0G A;  4KH7 A;  4J56 E;  3LFL A;  4ZL8 A;  3D4M A;  2HRA A;  1DSB A;  3M3M A;  1XVW A;  3IA1 A;  2PVO C;  4KW6 A;  1AUC A;  1W4V A;  4J57 E;  1YEP A;  2BMX A;  1XCC A;  2FWF A;  1AC1 A;  2V6K A;  2FA8 A;  1XXU A;  5F8B A;  4MMM A;  2H0I A;  1LBK A;  3APO A;  4JE1 A;  1TJD A;  4F82 A;  1MDJ A;  3EU3 A;  3TJF A;  4DSS B;  4I5Q A;  1TK0 B;  4K0G A;  1TW9 A;  3GFK A;  1PRX A;  5ELA A;  2NVL A;  4QQ7 A;  3IC4 A;  2OAC A;  2TRC P;  1FB0 A;  1B9X C;  1J08 A;  3W8S A;  1B9Y C;  4OWY A;  2QKE A;  4K2D A;  4ZB6 A;  2NTO A;  2VO4 A;  5HQP A;  5E4W A;  1Z7P A;  2DJJ A;  2XC2 A;  2O89 A;  1GNW A;  5AN1 A;  4G10 A;  3ZRE A;  2CZ2 A;  2K18 A;  2PMT A;  4JBB A;  1K0B A;  4LMW A;  4WF4 A;  3HZ4 A;  4PTS A;  1V98 A;  1SKS B;  1TRW A;  1G7E A;  3VUR A;  1BQ7 A;  2IL3 A;  2VCV A;  5F0G A;  3FHK A;  4K6X A;  4PXO A;  4XIH A;  2I81 A;  2VL2 A;  1MDI A;  3HKR A;  2B1L A;  4N0V A;  1R26 A;  3RPN A;  3KP8 A;  2EC4 A;  5FT3 A;  1A0F A;  1AIU A;  4H86 A;  4TR3 A;  1PL1 A;  1TK8 B;  4MZB A;  4WBR D;  2B1K A;  5B6M A;  4TR4 A;  1U3I A;  3OR5 A;  2NPB A;  2YZH A;  4BVY B;  1FW1 A;  3UAR A;  4HZ4 A;  2I4A A;  2PU9 C;  4TKY A;  5J3R A;  2V41 A;  1J0F A;  2C1Y A;  1KBN A;  2MMZ A;  1ILO A;  1RK4 A;  4JR4 A;  4FIW A;  1QMV A;  4ACS A;  5KEJ A;  1EOH A;  4OFT A;  1K0D A;  3MAK A;  3FZA A;  1PSQ A;  3CTF A;  5CRE A;  4JU5 A;  4ECJ A;  5CNW A;  3HJM A;  1R4W A;  2H01 A;  3C1R A;  4FH8 A;  2F8F A;  6GSX A;  1YZX A;  2GVP A;  3VI7 A;  3F4S A;  1U6T A;  5IPH A;  4TR1 B;  3EMX A;  1VGL A;  3QPM A;  2GQL A;  4QL9 A;  2HZE B;  4HJ2 A;  5DQS A;  1OC3 A;  2ZUP A;  1EP8 A;  3IOS A;  4OO4 A;  2X8C A;  3DXB A;  4MCU A;  5LNK e;  1GWC A;  1OVN A;  2OA7 A;  5G5F A;  1MTC A;  4E8H A;  4PQI A;  3TKS C;  4AF2 A;  4MF7 A;  3A2W A;  4LL4 B;  3HVV A;  4KDU A;  1JZD A;  3LOR A;  1EEJ A;  1GSS A;  1M9B A;  4L0W A;  4MH2 A;  2B5X A;  1GNE A;  5IPG A;  3F4R A;  2J23 A;  3IXR A;  3IAM 2;  3GKX A;  4GCI A;  4ZXG A;  4WBJ A;  2WS2 A;  1MDK A;  5F05 A;  1NHY A;  5D9X A;  3E9J B;  2P0G A;  1TP9 A;  3VI5 A;  4Q5Q A;  2B6M A;  2HT9 A;  2PER A;  5CAX A;  1TU8 A;  1YJ6 A;  3UL3 A;  4N0Z A;  2H75 A;  3EU4 A;  2J9H A;  2LQO A;  2FUG 2;  2HYX A;  2JAC A;  1F9M A;  3TOU A;  3E0U A;  4Z7X A;  1OAZ A;  1G7O A;  3L9V A;  3FZ5 A;  3AY8 A;  3KTB A;  10GS A;  5DAL A;  1FVK A;  2IN3 A;  4PNG A;  1WRY A;  4CW9 A;  1JLV A;  2H1A A;  1MD4 A;  2ON7 A;  2X8G A;  1GL8 A;  4ZIL A;  3UBK A;  2H72 A;  1TRU A;  3ISO A;  2A2S A;  4ECB A;  3BCI A;  2JAD A;  2AV4 A;  1XIY A;  5G1L A;  1M9A A;  1ZL9 A;  2VCX A;  5G5E A;  22GS A;  4GF0 A;  3IPZ A;  4WEY A;  3O6T A;  2NBS A;  5DQY A;  2E2M A;  3L4N A;  2CVK A;  1EV9 A;  3UAP A;  1J9B A;  5ECS A;  2F51 A;  4MP4 A;  3BCK A;  1ZYQ B;  1X5C A;  4WXT A;  5IMD A;  2ON5 A;  3HHV A;  4IP1 A;  2IJY A;  2DBC A;  3RAZ A;  3HY2 A;  4RQX A;  4XRA A;  4MK3 A;  3UIW A;  3UVT A;  1F37 A;  2RM6 A;  1WP0 A;  1V40 A;  3F4T A;  4NV2 A;  1XVQ A;  4AJ6 A;  5JCG A;  1K0M A;  4G9H A;  1X9M B;  2TIR A;  4PUA A;  3CSI A;  1SK0 A;  1SJ6 A;  3GUS A;  4EF0 A;  3FKF A;  1Z6N A;  1T00 A;  2H6Y A;  3TDG A;  1V58 A;  3TKR A;  3F9U A;  1F2E A;  3IR4 A;  1S3C A;  4IJ3 A;  5EPF A;  2WCI A;  1T1V A;  1TK5 B;  3VLN A;  2FLS A;  4WF5 A;  5B8B A;  1PN9 A;  2H6Z A;  4MPG A;  1BED A;  3F8U A;  5ECQ B;  3A2X A;  2VL2 C;  1K3O A;  3I9V 2;  4IQA A;  2LRT A;  5HFK A;  2I9H A;  4KA0 A;  2YOI A;  3LXZ A;  5H5S A;  3K8N A;  3PH9 A;  4I2U A;  4N10 A;  4IQ1 A;  2M72 A;  4EVM A;  1TTZ A;  3KP9 A;  2CT6 A;  3SBC A;  1X0R A;  4HEA 2;  4JED A;  4F0B A;  1XWK A;  3ZVJ D;  2MBT A;  2F8A A;  3TKQ A;  1A0R P;  4KSO A;  2JZT A;  1Z9H A;  2MMN A;  4L5L A;  2B5E A;  2GT5 A;  4GTU A;  1Q98 A;  2C3Q A;  2CVB A;  4EXJ A;  1AW9 A;  3QR6 A;  3CYN A;  1PKZ A;  2CVD A;  3ZFL A;  2DJ3 A;  1X9S B;  4ZL7 A;  2PPT A;  4KF9 A;  3IK7 A;  3FYG A;  4HS1 A;  3QAV A;  3FK8 A;  4I97 A;  4YQM A;  5KN3 A;  5AIS A;  3IV4 A;  5JWR B;  5IOW A;  3H79 A;  2EIQ A;  3TGZ A;  1HYU A;  17GS A;  2RUE A;  4PQ1 A;  3LWA A;  2HZE A;  4ECC A;  2B7J A;  4G19 A;  1JHB A;  3TOT A;  2WRT A;  2LNT A;  4OCE A;  2XPE A;  3FZ9 A;  1F3B A;  5DCH A;  5IMZ A;  2AB6 A;  3VPQ A;  4NHW A;  1SD9 A;  3TKS A;  1Z5Y E;  1TOF A;  2DJK A;  3GKN A;  4NXI A;  3EE2 A;  2OJL A;  2R5G A;  4MPF A;  2LUS A;  3VFI A;  3TJG A;  2YJ7 A;  2C3N A;  3PIN A;  2JZR A;  2V6O A;  4OCF A;  4DVC A;  2LV3 A;  1O6J A;  4P3Y B;  2F3M A;  6GSU A;  2H71 A;  5COH A;  1GP1 A;  4G0L A;  1T4Z A;  1XW6 A;  4HDE A;  1ERU A;  5D9T A;  5IMA A;  4GSS A;  4FYC A;  3FR9 A;  5J41 A;  2E0Q A;  4NWY A;  3BOA A;  3LSZ A;  1FAA A;  1GRX A;  1JZW A;  2X8H A;  3D22 A;  3GX0 A;  1I9D A;  4F2I A;  4ID0 A;  3VWU A;  4XS4 A;  3VK9 A;  1PQN A;  5ECK B;  3VWV A;  3APS A;  2B7K A;  3WT1 A;  2HSY A;  3UVH A;  2LNS A;  5DAL B;  2WFC A;  1B48 A;  3WGE A;  3ERF A;  3ERG A;  4ISD A;  2PGT A;  4MZC A;  1Z3E A;  1AXD A;  3QAW A;  4MJC A;  4KGI A;  3KIJ A;  2RM5 A;  1HNC A;  1BYE A;  3A5W A;  6GSW A;  3Q19 A;  3ZTL A;  2VCW A;  1EZK A;  1SL2 B;  1AQX A;  2AYT A;  4GSN A;  4MJA A;  5D96 A;  2O7K A;  5CRW A;  4V1A p;  2FA4 A;  3UOM A;  4V1A g;  1SL1 B;  2HSH A;  2HNL A;  1SU9 A;  2H0G A;  1ZYE A;  4OFM A;  2P5R A;  13GS A;  1PA3 A;  1GUL A;  3ZZX A;  5DVB A;  3O76 A;  2FCH A;  3TJB A;  1DBY A;  2BTO T;  1VRS D;  1U3A A;  3KMN A;  1F3A A;  4G2E A;  2PUK C;  3FRC A;  2R2J A;  1GSD A;  2IMI A;  1JZR A;  4KSM A;  1CQG A;  2HE3 A;  5ECL B;  5ECH B;  2E2G A;  1FHE A;  2WDU A;  3F3Q A;  1EEM A;  3P90 A;  3LYK A;  2H73 A;  3M8N A;  4EDZ A;  4N11 A;  3QD9 A;  3F3R A;  3IDV A;  1WE0 A;  4HQZ A;  4TRX A;  1X9W B;  1PGT A;  2GDR A;  2XBQ A;  2H6X A;  3TJK A;  3US3 A;  3DRN A;  1BAY A;  3FR6 A;  2NDO A;  1A2M A;  4HI7 A;  1O73 A;  4GST A;  3ERW A;  4NPB A;  5DAK A;  2L5L A;  5KN0 A;  1YKC A;  2WJU A;  3TUE A;  1XFL A;  2XBI A;  4KND A;  3KZQ A;  5D9V A;  4IEL A;  1QUW A;  2H1G A;  3BD2 A;  4J2F A;  1ERW A;  5EVO A;  4XHM A;  2MMO A;  3DVW A;  4L5O A;  4D73 A;  4E8E A;  4NAX A;  3FZ4 A;  5ID2 B;  2H1B A;  4POK A;  3U5R E;  2IFQ A;  4ZL9 A;  5F07 A;  3QCP A;  1B4P A;  2JU5 A;  3I43 A;  2K9F A;  5DCG A;  1KNG A;  2BJX A;  2VIM A;  1A8Y A;  2DIY A;  1M7T A;  4YQU A;  19GS A;  5A5K A;  2KUC A;  5CRD A;  1VF3 A;  4F03 A;  1UN2 A;  3GL5 A;  2HFD A;  3VPT A;  4BL7 B;  5ENU A;  1GSE A;  4LLR A;  4BVX A;  3IK9 A;  3GNJ A;  1XZO A;  2H76 A;  3ZYW A;  2VLT A;  4XTS A;  5JWO B;  5ECI B;  2YAN A;  5B6N A;  4PX1 A;  1UC7 A;  2G2Q A;  2RII A;  3TRP A;  3F6D A;  3S9F A;  4O7H A;  2GQM A;  1G6W A;  3C8E A;  1SD8 A;  2KLX A;  1XWC A;  2VLV A;  4EE0 A;  4MZW A;  3GHA A;  4ZB8 A;  2H0H A;  4ML1 A;  1SJZ A;  2JSY A;  2P5Q A;  2PN8 A;  5ELG A;  5AIV A;  3MSZ A;  4RQR A;  3GL3 A;  3HDC A;  5J4U A;  5D73 A;  6GSV A;  3APQ A;  5JCW A;  2HXK A;  3DIE A;  4RUV A;  4JZQ A;  2FNO A;  3Q18 A;  4I8B A;  3C1S A;  3KM6 A;  3PGT A;  5FHI A;  1VF2 A;  2L6D A;  4IP6 A;  5ECP B;  5GZZ B;  4YQV A;  2X99 A;  2F9S A;  1PMT A;  2V32 A;  5H5R A;  1DUG A;  3I69 A;  5IMC A;  4F9Z A;  3I6A A;  2C0E A;  1M0U A;  2CX4 A;  4FQU A;  3DWV A;  3ZRD A;  1HNA A;  2N5B A;  2OBK A;  2GTU A;  2O87 A;  2GZP A;  1GTA A;  4RI6 A;  5HR1 A;  1QXH A;  2C3T A;  4KB3 A;  4GWR A;  2L5O A;  2YCD A;  4XS4 B;  4KDY A;  1AQW A;  2QGV A;  3J7Y k;  1WPI A;  4ZBB A;  1TRV A;  3DGQ A;  3UJ1 A;  1FOV A;  1ACV A;  2C0D A;  4GXZ A;  3KEB A;  12GS A;  3GTU B;  8GSS A;  1VF1 A;  4EL1 A;  3ME8 A;  1TDI A;  1GSF A;  2AAW A;  3ZLP A;  4AJ8 A;  3UEM A;  2LJA A;  3KMO A;  3KXO A;  4N30 A;  3PR8 A;  4YAP A;  1XBS A;  4O92 A;  2DJ2 A;  2VLU A;  1Y6E A;  1DE1 A;  1GUK A;  1SEN A;  3GH9 A;  4X1U A;  4JR6 A;  4BPY A;  5G31 A;  1SJI A;  5H5Q A;  2IME A;  3D0Z A;  4Q5R A;  1OE7 A;  3G9B A;  3IHQ A;  1O8X A;  2VCQ A;  3QAG A;  5KN1 A;  2DSA A;  3GKK A;  4L0U A;  1E6B A;  4FYB A;  2QSI A;  3EVI A;  4I6X A;  4TR0 A;  4QL7 A;  3EMP A;  1NW2 A;  3TRX A;  1A8L A;  2JZS A;  4CHS A;  1Y25 A;  5E59 A;  5G30 A;  4PUR A;  3JCM L;  1O81 A;  4FO5 A;  1SKW B;  3C73 A;  2L4Q A;  4ILF A;  4IJI A;  1H4O A;  2H19 A;  2JL4 A;  1BX9 A;  4GQF A;  3MNG A;  2GS3 A;  1ERT A;  1ABA A;  1FO5 A;  2C4J A;  3HA9 A;  5AIX A;  2HRF A;  2FWE A;  1EOG A;  3NOF A;  4IN0 A;  4MJE A;  2H8L A;  4G0K A;  1YEX A;  6GSS A;  3KTL A;  4LMV A;  2YJH A;  3DVX A;  2VCZ A;  2IMD A;  5DAK B;  3M0F A;  1O7U A;  2WUL A;  2HSM A;  1UVZ A;  4TOP A;  4V2L A;  2L59 A;  5ECM B;  3KD0 A;  4K7I A;  5IQY A;  2H30 A;  1ZZY A;  4TVE A;  4I2T A;  2REM A;  2RLI A;  4D73 B;  3D5J A;  5ID2 A;  1LJR A;  1T7P B;  4EUY A;  1HNB A;  2IFQ B;  2YNX A;  3EIN A;  2HRN A;  3DML A;  2AHE A;  2CAQ A;  1SYX A;  3CTG A;  1GSU A;  2R4V A;  3MWH A;  5CO3 A;  3ZVJ A;  4BL7 A;  2X64 A;  2D2Z A;  2LQQ A;  2LRN A;  4BVX B;  3GA4 A;  1GUH A;  1O8W A;  1XWA A;  3CXG A;  1DE2 A;  6GSY A;  3DYR A;  3P7X A;  1YF0 A;  1E2Y A;  3W8J A;  3IRA A;  2YP6 A;  2YN1 A;  4K9Z A;  3GN3 A;  1N8J A;  4ECI A;  4LA1 A;  3ED3 A;  3DKS A;  1G0T A;  3W6G A;  1R7H A;  2MBS A;  2VD1 A;  3WD6 A;  1TI1 A;  3BBY A;  1BG5 A;  2XPD A;  1V2A A;  1XPV A;  3Q6O A;  5FWG A;  2R3X A;  2VL9 A;  2YWO A;  3M1G A;  3WT2 A;  3GH6 A;  1TXX A;  3HVS A;  5IO0 A;  2C80 A;  3A3T A;  1WJK A;  1K3Y A;  3TB2 A;  2L57 A;  2FWH A;  4OO5 A;  3H4K A;  3RBT A;  4IW9 A;  1GTI A;  1RQM A;  3TCO A;  1ZMA A;  5D8I A;  4GQC A;  3VWX A;  4V2M A;  5J9C A;  3WGX A;  3GV1 A;  4KAE A;  2VD0 A;  3H8Q A;  5B7C A;  1WWJ A;  3ZFB A;  4K1F A;  1GLQ A;  1NSW A;  3EWL A;  2H74 A;  2HRK A;  1PD2 1;  4NHZ A;  3RHB A;  2FGX A;  5ABR A;  3F6F A;  11GS A;  3UBL A;  4XS1 A;  2CAI A;  3L9U A;  3CRT A;  3NZN A;  1XWB A;  4WET A;  2KP1 A;  1PL2 A;  4HU7 A;  3G7I A;  3GTU A;  4GRF A;  3GKM A;  2JSZ A;  4MH3 A;  4O5R A;  1M2A A;  4K0N A;  3FY7 A;  3C71 A;  4CDO A;  2R37 A;  1M2D A;  2OAD A;  1PX7 A;  2LST A;  3D4T A;  2A4V A;  2HSN B;  2PVQ A;  5CRG A;  6GST A;  2DJ0 A;  3KH9 A;  2MYG A;  5F06 A;  4EDY A;  16GS A;  5HR2 A;  2L6C A;  2HQT A;  4WR4 A;  5IO2 A;  4KCA A;  4YH2 A;  3E3E A;  3LG6 A;  2IIY A;  3HVX A;  4X0X A;  2CV4 A;  3SWL A;  5DDL A;  2DMM A;  1USB A;  1I5G A;  1FG4 A;  5HFI A;  1FVJ A;  3PPU A;  5GAN D;  1YDK A;  1AAZ A;  3QFA C;  5ECO B;  2M80 A;  5GSS A;  1MEK A;  4ZBA A;  5GST A;  1H75 A;  3EC3 A;  2R6K A;  2HSM B;  2GQK A;  2V2G A;  1R5P A;  5CP1 A;  3U6V A;  2B5Y A;  3QFB C;  2ZNM A;  2VM2 A;  2GZZ A;  3WYW A;  2DIZ A;  2GLR A;  5L71 A;  2RUF A;  4KE3 A;  2GSS A;  1S3A A;  2HZF A;  4TXO B;  3GUR A;  3QMX A;  1OC9 B;  3TRQ A;  3LJR A;  4OFN A;  2VOC A;  1B4Q A;  2P31 A;  2C0F A;  3LQ7 A;  3CRU A;  2LJR A;  4HU9 A;  14GS A;  2OE1 A;  1A2J A;  4IHU A;  1AQV A;  4PUF C;  3KGK A;  2GT6 A;  2DC5 A;  2C8U A;  1QGV A;  2I1U A;  1OC8 A;  5KN2 A;  4DSR A;  1QK8 A;  1T8E B;  3FEU A;  1N2A A;  5C00 A;  1K0C A;  3GST A;  1XW5 A;  4ZBD A;  1JFU A;  2YV7 A;  4MJB A;  4K7O A;  4ML6 A;  2YPM A;  1LU4 A;  4NMU A;  3GIX A;  3GSS A;  9GSS A;  1TRS A;  2OKA A;  1X5E A;  1YY7 A;  3IAS 2;  4MA9 A;  1SK1 A;  2VUP A;  2L4C A;  4BWS A;  4DSQ A;  4TN8 A;  2N5A A;  3V1W A;  2HLS A;  4WR5 A;  3HZ8 A;  3GMF A;  1URM A;  1OE8 A;  3QOU A;  4KX4 A;  4XS6 A;  2KOK A;  3UMA A;  3EYT A;  5IOX A;  4L8E A;  7GSS A;  1QQ2 A;  2VAF A;  1GSQ A;  4X43 A;  4G0I A;  2ES7 A;  4EC0 A;  1GTB A;  3L9S A;  5C04 A;  2K8S A;  5GAP D;  1M2B A;  5DBQ A;  1RW1 A;  1NHO A;  2ZCT A;  5J5N A;  2H66 A;  3H1N A; 
#chains in the Genus database with same CATH topology
 3BJ5 A;  3ME7 A;  4USS A;  3KH7 A;  5HFG A;  1C72 A;  1F6M C;  4KCE A;  4AGS A;  1X5D A;  1ZGN A;  3DD3 A;  1BG1 A;  1Z7R A;  1XW9 A;  3R2Q A;  2OT3 A;  2FY6 A;  2HRK B;  3EUR A;  2A4H A;  1IYI A;  4KDX A;  3R3E A;  3L0H A;  3IC8 A;  5ECN B;  4ZIJ A;  2IMK A;  1TI3 A;  5D93 A;  4HQS A;  2QA1 A;  3TKP A;  2MZC A;  3WGD A;  2GSR A;  2LJK A;  4KUN A;  1GLP A;  1G6Y A;  4F0C A;  4GLT A;  2LEG A;  2B3S A;  3NIV A;  3H93 A;  4TW5 A;  1HD2 A;  5J47 A;  1PKW A;  1K3L A;  1GTU A;  1ST9 A;  1XOB A;  2YWI A;  3IBH A;  3D21 A;  5G1K A;  1FB6 A;  5BMU A;  4HSC X;  3IE3 A;  1A2L A;  2CX3 A;  2WVY A;  5HR0 A;  1KEB A;  2GGT A;  2UZ8 A;  4PNF A;  5DJM A;  3HD5 A;  4Q5N A;  3Q74 A;  4RI7 A;  1U88 A;  3A5I A;  1ML6 A;  2GZY A;  4DSS A;  4ULX A;  3KJY A;  4PQH A;  4HJM A;  1V9W A;  3CSH A;  1R5A A;  1EP7 A;  2CZ3 A;  4OMV A;  5AGY A;  3LYP A;  3HCZ A;  4MF6 A;  3ZIJ A;  1QFN A;  1A24 A;  3GX8 A;  2VM1 A;  1YF1 A;  3GYK A;  1OKT A;  4YAV A;  1GH2 A;  4PGT A;  2DLX A;  2OBI A;  3KCM A;  1EWX A;  1M3J A;  1GSY A;  2AJQ B;  4IS0 A;  4CY6 A;  1WOU A;  2TRX A;  2YWM A;  4TXV A;  3ZIT A;  3MDK A;  3LXT A;  3ZMK A;  2WW3 A;  3TJJ A;  1JLW A;  2FD3 A;  1KTE A;  5ECR B;  5A4U A;  2N5F A;  5LD0 A;  5A1N B;  1W89 A;  2EIR A;  2R0P A;  3FR3 A;  2KP2 A;  3ZL5 A;  2H1D A;  4BA7 A;  1T3B A;  3C7M A;  1XOA A;  2HI7 A;  3LEF A;  5CRH A;  1SK2 A;  3ZIV A;  2WZ9 A;  3CMI A;  3CSJ A;  3L78 A;  2IPA A;  3HXS A;  3RPP A;  2DML A;  2EIO A;  5J9B A;  4TXO A;  5DJL A;  2DJ1 A;  2K6V A;  2I3Y A;  1OC9 A;  5JCU A;  1SYR A;  4NV5 A;  5INY A;  1YKA A;  3A2V A;  4POM A;  3RDW A;  5HR3 A;  4HZ2 A;  4MLY A;  2X4A A;  1S3D A;  3J7Y b;  2GST A;  1U87 A;  2OE3 A;  1TKD B;  3HVN A;  1THO A;  1YQ1 A;  4FYU A;  2R0G A;  4BVY A;  3F63 A;  1WIK A;  1THX A;  3QDN A;  2XHF A;  4K8M A;  3LGC A;  4HOJ A;  1K0A A;  1BJX A;  5EY6 A;  3N5O A;  5A4V A;  2WVX A;  2KHP A;  4IBP A;  1UA5 A;  4V2N A;  4K7N A;  4O32 A;  1Q4J A;  4OD7 A;  1MD3 A;  4XCS A;  5B8A A;  2V1M A;  1HQO A;  2LS5 A;  4EKZ A;  3DEX A;  4POB A;  20GS A;  1VF4 A;  1EV4 A;  1TU7 A;  2PWJ A;  1PX6 A;  4LL1 B;  2MMA A;  1SKR B;  3G7J A;  1OKD A;  1K0O A;  4TR1 A;  2CA8 A;  3CBU A;  2G0F A;  3G7Y A;  2YV9 A;  2IWT A;  3VWW A;  5A4W A;  1IYH A;  2O8V B;  2QC7 A;  1V57 A;  4IKH A;  2YZU A;  3F0I A;  4MAB A;  4WKW A;  4ZB9 A;  1M99 A;  3M9J A;  1Z6M A;  2K8V A;  4MF5 A;  2VL3 A;  3P8W A;  2CQ9 A;  1EGO A;  4Q5F A;  3HYP A;  3HJO A;  3O3T A;  1JZO A;  2YWN A;  1SL0 B;  4BWQ A;  3TKS E;  2VCT A;  2LRC A;  2IMF A;  2LTK A;  4FXY P;  5IMV A;  2H70 A;  1NM3 A;  1ON4 A;  5D9W A;  2O85 A;  4HUA A;  3RHC A;  2PBJ A;  2OE0 A;  2ALB A;  1OYJ A;  1ZOF A;  3N9J A;  2FWG A;  1T4Y A;  18GS A;  1WMJ A;  2M46 A;  2A2R A;  3D6I A;  4AJ7 A;  1ERV A;  2AUV A;  3P2A A;  3ZML A;  1A23 A;  1I1I P;  1GUM A;  5G2Z A;  3GRX A;  2FHE A;  2WGR A;  3HJP A;  1K0N A;  5EL8 A;  2Z9S A;  5IIZ A;  3M9K A;  5LCZ A;  1B8X A;  5IM9 A;  1O85 A;  1CQH A;  1SVM A;  1ZCP A;  4XRD A;  4MDC A;  4POL A;  5CYY A;  2E7P A;  4EO3 A;  3FW2 A;  5JWQ B;  5IMF A;  4DEJ A;  2GSQ A;  4IGJ A;  3TU3 B;  2WB9 A;  4JRR A;  1XWG A;  1EGR A;  2LKU A;  4IVF A;  2C0G A;  4KH7 A;  4J56 E;  3LFL A;  4ZL8 A;  3D4M A;  2HRA A;  1DSB A;  3M3M A;  1XVW A;  3IA1 A;  2PVO C;  4KW6 A;  1AUC A;  4ZB7 A;  1W4V A;  4J57 E;  1YEP A;  1SVL A;  2BMX A;  1XCC A;  2FWF A;  1AC1 A;  2V6K A;  2FA8 A;  1XXU A;  5F8B A;  4MMM A;  2H0I A;  1LBK A;  3APO A;  4JE1 A;  1TJD A;  2O3E A;  4F82 A;  1MDJ A;  3EU3 A;  1TXU A;  3TJF A;  4DSS B;  4I5Q A;  1TK0 B;  4K0G A;  1TW9 A;  3GFK A;  1PRX A;  5ELA A;  2NVL A;  4QQ7 A;  3IC4 A;  2OAC A;  2TRC P;  1FB0 A;  4PI2 C;  1B9X C;  1J08 A;  3W8S A;  1B9Y C;  4OWY A;  2QKE A;  4K2D A;  4ZB6 A;  2NTO A;  2VO4 A;  5HQP A;  5E4W A;  1Z7P A;  2DJJ A;  2XC2 A;  2O89 A;  1GNW A;  5AN1 A;  4G10 A;  3ZRE A;  2CZ2 A;  5A1N A;  2K18 A;  2PMT A;  4JBB A;  1K0B A;  4LMW A;  4WF4 A;  3HZ4 A;  4PTS A;  1V98 A;  1SKS B;  1TRW A;  1G7E A;  3VUR A;  1BQ7 A;  2IL3 A;  4MNN A;  2VCV A;  5F0G A;  3FHK A;  4K6X A;  1Y1U A;  4PXO A;  4XIH A;  2I81 A;  2VL2 A;  1MDI A;  3HKR A;  2B1L A;  4N0V A;  1R26 A;  3RPN A;  3KP8 A;  2EC4 A;  5FT3 A;  1A0F A;  1AIU A;  4H86 A;  4TR3 A;  1PL1 A;  1TK8 B;  4MZB A;  4WBR D;  2B1K A;  5B6M A;  4TR4 A;  1U3I A;  3OR5 A;  2NPB A;  2YZH A;  3EPT A;  4BVY B;  1FW1 A;  3UAR A;  4HZ4 A;  2I4A A;  2PU9 C;  4TKY A;  5J3R A;  2V41 A;  1J0F A;  2C1Y A;  1KBN A;  2MMZ A;  1ILO A;  1RK4 A;  4JR4 A;  4FIW A;  1QMV A;  4ACS A;  5KEJ A;  1EOH A;  4OFT A;  1PFO A;  1K0D A;  3MAK A;  3MYD A;  3FZA A;  1PSQ A;  3CTF A;  5CRE A;  4JU5 A;  4ECJ A;  5CNW A;  3HJM A;  1R4W A;  5A34 A;  2H01 A;  4K5S A;  3C1R A;  4FH8 A;  2F8F A;  6GSX A;  1YZX A;  2GVP A;  3VI7 A;  3F4S A;  1U6T A;  5IPH A;  4TR1 B;  3EMX A;  1VGL A;  3QPM A;  2GQL A;  4QL9 A;  2HZE B;  4HJ2 A;  5DQS A;  1OC3 A;  2ZUP A;  1EP8 A;  3IOS A;  4OO4 A;  2X8C A;  3DXB A;  4MCU A;  5LNK e;  3RFR C;  1GWC A;  1OVN A;  2OA7 A;  5G5F A;  1MTC A;  4E8H A;  4PQI A;  3TKS C;  4AF2 A;  4MF7 A;  3A2W A;  4LL4 B;  3HVV A;  4KDU A;  1JZD A;  3LOR A;  1EEJ A;  1GSS A;  1M9B A;  4L0W A;  4MH2 A;  2B5X A;  1GNE A;  5IPG A;  1ZYP A;  3F4R A;  2J23 A;  3IXR A;  3IAM 2;  3GKX A;  4GCI A;  4ZXG A;  4WBJ A;  2WS2 A;  1MDK A;  5F05 A;  1NHY A;  5D9X A;  3E9J B;  2P0G A;  1TP9 A;  3VI5 A;  4Q5Q A;  2B6M A;  2HT9 A;  2PER A;  5CAX A;  1TU8 A;  1YJ6 A;  3UL3 A;  4N0Z A;  2H75 A;  3EU4 A;  2J9H A;  2LQO A;  2FUG 2;  2HYX A;  2JAC A;  1F9M A;  3TOU A;  3E0U A;  4Z7X A;  1OAZ A;  1G7O A;  3L9V A;  3FZ5 A;  3AY8 A;  3KTB A;  1M3I A;  10GS A;  5DAL A;  1FVK A;  2IN3 A;  4PNG A;  1WRY A;  3MIX A;  4CW9 A;  1JLV A;  2H1A A;  1MD4 A;  2ON7 A;  2X8G A;  1GL8 A;  4ZIL A;  3UBK A;  2H72 A;  1TRU A;  3ISO A;  1S4B P;  2A2S A;  4ECB A;  3BCI A;  2JAD A;  2AV4 A;  1XIY A;  5G1L A;  1M9A A;  1ZL9 A;  2VCX A;  5G5E A;  22GS A;  4YKG A;  4GF0 A;  3IPZ A;  4WEY A;  3O6T A;  4E68 A;  2NBS A;  5DQY A;  2E2M A;  3L4N A;  2CVK A;  2EFH A;  1EV9 A;  3UAP A;  1J9B A;  5ECS A;  2F51 A;  4MP4 A;  3BCK A;  1ZYQ B;  4EIQ A;  1X5C A;  4WXT A;  5IMD A;  2ON5 A;  3HHV A;  4IP1 A;  2IJY A;  5J4V A;  2DBC A;  3RAZ A;  3HY2 A;  4RQX A;  4XRA A;  4MK3 A;  3UIW A;  3UVT A;  1F37 A;  2RM6 A;  4PI0 C;  1WP0 A;  2WW1 A;  1V40 A;  3F4T A;  4NV2 A;  2QA2 A;  1XVQ A;  4AJ6 A;  5JCG A;  1K0M A;  4G9H A;  1X9M B;  2TIR A;  4PUA A;  3CSI A;  1SK0 A;  1SJ6 A;  3GUS A;  4EF0 A;  3FKF A;  1Z6N A;  1T00 A;  2H6Y A;  3TDG A;  1V58 A;  3TKR A;  3F9U A;  1F2E A;  3IR4 A;  1S3C A;  4IJ3 A;  5EPF A;  2WCI A;  1T1V A;  1TK5 B;  3VLN A;  2FLS A;  4WF5 A;  5B8B A;  1PN9 A;  3CQF A;  2H6Z A;  4MPG A;  1BED A;  3F8U A;  2O36 A;  5ECQ B;  3A2X A;  2VL2 C;  1K3O A;  3I9V 2;  4IQA A;  4GDF A;  2LRT A;  5HFK A;  4O5U A;  2I9H A;  4KA0 A;  2YOI A;  3LXZ A;  5H5S A;  1N25 A;  3K8N A;  3PH9 A;  4I2U A;  4N10 A;  4IQ1 A;  2M72 A;  4EVM A;  1TTZ A;  3KP9 A;  2CT6 A;  3SBC A;  1X0R A;  4HEA 2;  4JED A;  4F0B A;  1XWK A;  3ZVJ D;  2MBT A;  2F8A A;  3TKQ A;  1A0R P;  4KSO A;  2JZT A;  1Z9H A;  2MMN A;  4L5L A;  2B5E A;  2GT5 A;  4GTU A;  1Q98 A;  2C3Q A;  2CVB A;  4EXJ A;  1AW9 A;  3QR6 A;  3CYN A;  1PKZ A;  2CVD A;  3ZFL A;  2DJ3 A;  1X9S B;  4ZL7 A;  2PPT A;  4KF9 A;  3IK7 A;  3FYG A;  1PN0 A;  4HS1 A;  3QAV A;  3FK8 A;  4I97 A;  4YQM A;  5KN3 A;  5AIS A;  3IV4 A;  4AKG A;  5JWR B;  5IOW A;  5A34 B;  3H79 A;  2EIQ A;  3TGZ A;  1HYU A;  17GS A;  2RUE A;  1YEW C;  4PQ1 A;  3LWA A;  2HZE A;  4ECC A;  2B7J A;  4G19 A;  1JHB A;  3RGB C;  3TOT A;  2WRT A;  4AI6 A;  2LNT A;  4OCE A;  2XPE A;  3FZ9 A;  1F3B A;  5DCH A;  5IMZ A;  2AB6 A;  3VPQ A;  4NHW A;  1SD9 A;  3TKS A;  1Z5Y E;  1TOF A;  2DJK A;  3GKN A;  4NXI A;  3EE2 A;  2OJL A;  2R5G A;  4MPF A;  2LUS A;  4QMK A;  3VFI A;  3TJG A;  2YJ7 A;  2C3N A;  3PIN A;  2JZR A;  2V6O A;  4K2X A;  4OCF A;  4DVC A;  2LV3 A;  1O6J A;  4P3Y B;  2F3M A;  6GSU A;  2H71 A;  5COH A;  1GP1 A;  4G0L A;  1T4Z A;  1XW6 A;  4HDE A;  1ERU A;  5D9T A;  5IMA A;  4GSS A;  4FYC A;  3FR9 A;  5J41 A;  2E0Q A;  4NWY A;  3BOA A;  3LSZ A;  1FAA A;  5BRT A;  2A2P A;  5KOW A;  1GRX A;  1JZW A;  2X8H A;  3D22 A;  3GX0 A;  1I9D A;  4F2I A;  4ID0 A;  3VWU A;  4XS4 A;  3VK9 A;  1YVL A;  1PQN A;  5ECK B;  3VWV A;  3APS A;  2B7K A;  3WT1 A;  2HSY A;  3UVH A;  2LNS A;  5DAL B;  2WFC A;  1B48 A;  3WGE A;  3ERF A;  3ERG A;  4ISD A;  2PGT A;  4MZC A;  1Z3E A;  1AXD A;  2X49 A;  3QAW A;  4MJC A;  4KGI A;  3KIJ A;  2RM5 A;  1HNC A;  1BYE A;  3A5W A;  6GSW A;  3Q19 A;  3ZTL A;  2VCW A;  1EZK A;  1SL2 B;  1AQX A;  1ZYN A;  2AYT A;  4GSN A;  4MJA A;  5D96 A;  2O7K A;  5CRW A;  4V1A p;  2FA4 A;  3UOM A;  4V1A g;  1SL1 B;  2HSH A;  2HNL A;  1SU9 A;  2H0G A;  1ZYE A;  4OFM A;  2P5R A;  13GS A;  1PA3 A;  1GUL A;  3ZZX A;  5DVB A;  3O76 A;  2FCH A;  3TJB A;  1DBY A;  2BTO T;  1VRS D;  1U3A A;  3KMN A;  1F3A A;  4G2E A;  2PUK C;  3FRC A;  2R2J A;  1GSD A;  2IMI A;  1JZR A;  4KSM A;  1CQG A;  2HE3 A;  5ECL B;  5ECH B;  2E2G A;  1FHE A;  2WDU A;  3F3Q A;  1EEM A;  3P90 A;  3LYK A;  2H73 A;  3M8N A;  4EDZ A;  4N11 A;  2WW0 A;  3QD9 A;  3F3R A;  3IDV A;  1WE0 A;  4HQZ A;  4TRX A;  1X9W B;  1PGT A;  2GDR A;  2XBQ A;  2H6X A;  3TJK A;  3US3 A;  3DRN A;  1FOH A;  1BAY A;  3FR6 A;  2NDO A;  1A2M A;  4HI7 A;  1O73 A;  4GST A;  3ERW A;  4NPB A;  5DAK A;  2L5L A;  5KN0 A;  1YKC A;  2WJU A;  3TUE A;  1XFL A;  2XBI A;  4KND A;  3KZQ A;  5D9V A;  4IEL A;  1QUW A;  2H1G A;  3BD2 A;  4J2F A;  1ERW A;  2EFD A;  5EVO A;  4XHM A;  2MMO A;  3DVW A;  4L5O A;  4D73 A;  4E8E A;  1XG8 A;  4NAX A;  3FZ4 A;  5ID2 B;  2H1B A;  4POK A;  3U5R E;  2IFQ A;  4ZL9 A;  5F07 A;  4W66 A;  3QCP A;  1B4P A;  2JU5 A;  3I43 A;  2K9F A;  5DCG A;  1KNG A;  2BJX A;  2VIM A;  2O5V A;  1A8Y A;  2DIY A;  1M7T A;  4YQU A;  19GS A;  5A5K A;  2KUC A;  5CRD A;  1VF3 A;  4F03 A;  1UN2 A;  3GL5 A;  2HFD A;  3VPT A;  4BL7 B;  5ENU A;  1GSE A;  4LLR A;  4BVX A;  3IK9 A;  2VKZ G;  3GNJ A;  1XZO A;  2H76 A;  3ZYW A;  2VLT A;  4XTS A;  5JWO B;  5ECI B;  2YAN A;  5B6N A;  4PX1 A;  1UC7 A;  2G2Q A;  2RII A;  3TRP A;  3F6D A;  3S9F A;  4O7H A;  2GQM A;  1G6W A;  3C8E A;  1SD8 A;  2KLX A;  1XWC A;  2VLV A;  4EE0 A;  4MZW A;  3GHA A;  4ZB8 A;  2H0H A;  4ML1 A;  1SJZ A;  2JSY A;  2P5Q A;  2PN8 A;  5ELG A;  5AIV A;  3MSZ A;  4RQR A;  3GL3 A;  3HDC A;  5J4U A;  5D73 A;  6GSV A;  3APQ A;  5JCW A;  2HXK A;  3DIE A;  4RUV A;  4JZQ A;  2FNO A;  3Q18 A;  4I8B A;  3C1S A;  3KM6 A;  3PGT A;  5FHI A;  1VF2 A;  2L6D A;  4IP6 A;  5ECP B;  5GZZ B;  4YQV A;  2X99 A;  2F9S A;  1PMT A;  2V32 A;  5H5R A;  1DUG A;  3I69 A;  5IMC A;  4F9Z A;  3I6A A;  2C0E A;  1M0U A;  2CX4 A;  4FQU A;  3DWV A;  3ZRD A;  1HNA A;  2N5B A;  2OBK A;  2GTU A;  2O87 A;  2GZP A;  1GTA A;  4RI6 A;  5HR1 A;  1QXH A;  2C3T A;  4KB3 A;  4GWR A;  2L5O A;  2YCD A;  4XS4 B;  4KDY A;  1AQW A;  2QGV A;  3J7Y k;  1WPI A;  4ZBB A;  1TRV A;  3DGQ A;  3UJ1 A;  1FOV A;  1ACV A;  2C0D A;  4GXZ A;  3KEB A;  4A5P A;  12GS A;  3GTU B;  8GSS A;  1VF1 A;  4EL1 A;  3ME8 A;  1TDI A;  1GSF A;  2AAW A;  3ZLP A;  4AJ8 A;  3UEM A;  2LJA A;  3KMO A;  3KXO A;  4N30 A;  3PR8 A;  4YAP A;  1XBS A;  4O92 A;  2DJ2 A;  2VLU A;  1Y6E A;  1DE1 A;  1GUK A;  1SEN A;  3GH9 A;  4X1U A;  4JR6 A;  2EFC A;  4BPY A;  2HSN A;  5G31 A;  1SJI A;  5H5Q A;  2IME A;  4N3Z A;  3D0Z A;  4Q5R A;  3IHG A;  1OE7 A;  3G9B A;  3IHQ A;  1O8X A;  2VCQ A;  3QAG A;  5KN1 A;  2DSA A;  3GKK A;  4L0U A;  1E6B A;  4FYB A;  2QSI A;  3EVI A;  4I6X A;  4TR0 A;  4QL7 A;  3EMP A;  1NW2 A;  3TRX A;  1A8L A;  2JZS A;  4CHS A;  1Y25 A;  5E59 A;  5G30 A;  4PUR A;  3JCM L;  1O81 A;  4FO5 A;  1SKW B;  2R0C A;  3C73 A;  2L4Q A;  4ILF A;  4IJI A;  1H4O A;  2H19 A;  2JL4 A;  1BX9 A;  2DKI A;  4GQF A;  3MNG A;  2GS3 A;  1ERT A;  1ABA A;  1FO5 A;  2C4J A;  3HA9 A;  5AIX A;  2HRF A;  2FWE A;  1EOG A;  3NOF A;  4IN0 A;  4MJE A;  2H8L A;  4G0K A;  2WZS A;  1YEX A;  6GSS A;  3KTL A;  2WW2 A;  4LMV A;  2YJH A;  3DVX A;  2VCZ A;  2IMD A;  5DAK B;  3M0F A;  1O7U A;  2WUL A;  2HSM A;  1UVZ A;  4TOP A;  4V2L A;  2L59 A;  5ECM B;  3KD0 A;  4K7I A;  5IQY A;  2H30 A;  1ZZY A;  4TVE A;  4I2T A;  1S3R A;  4X4J A;  2REM A;  2RLI A;  4D73 B;  3D5J A;  5ID2 A;  1LJR A;  1T7P B;  4EUY A;  1HNB A;  2IFQ B;  2YNX A;  3EIN A;  2HRN A;  3DML A;  2AHE A;  2CAQ A;  1SYX A;  3CTG A;  1GSU A;  2R4V A;  3MWH A;  5CO3 A;  3ZVJ A;  4BL7 A;  2X64 A;  2D2Z A;  4K5R A;  2LQQ A;  2LRN A;  4BVX B;  3GA4 A;  1GUH A;  1O8W A;  1XWA A;  3CXG A;  1DE2 A;  6GSY A;  3DYR A;  3P7X A;  1YF0 A;  1E2Y A;  3W8J A;  3IRA A;  2YP6 A;  1SVO A;  2UV8 G;  2YN1 A;  4K9Z A;  3GN3 A;  1N8J A;  4ECI A;  4LA1 A;  3ED3 A;  3DKS A;  1G0T A;  3W6G A;  1R7H A;  2MBS A;  2VD1 A;  3WD6 A;  1TI1 A;  3BBY A;  1BG5 A;  2XPD A;  1V2A A;  1XPV A;  3Q6O A;  5FWG A;  2R3X A;  2VL9 A;  2YWO A;  3M1G A;  3WT2 A;  3GH6 A;  1TXX A;  3HVS A;  5IO0 A;  2C80 A;  3A3T A;  1WJK A;  1K3Y A;  3TB2 A;  2L57 A;  2FWH A;  4OO5 A;  3H4K A;  3RBT A;  4IW9 A;  1GTI A;  1RQM A;  3TCO A;  5A5H B;  1ZMA A;  5D8I A;  4GQC A;  3VWX A;  2WVZ A;  2DKH A;  4V2M A;  5J9C A;  3WGX A;  3GV1 A;  4KAE A;  2VD0 A;  4Z2R A;  3H8Q A;  5B7C A;  1WWJ A;  3ZFB A;  4K1F A;  1GLQ A;  1NSW A;  3EWL A;  2H74 A;  2HRK A;  1PD2 1;  4NHZ A;  3RHB A;  3CHX C;  2FGX A;  4O5Q A;  5ABR A;  3F6F A;  11GS A;  3UBL A;  4AKH A;  4XS1 A;  2CAI A;  3L9U A;  3CRT A;  3NZN A;  1XWB A;  4WET A;  2KP1 A;  1PL2 A;  4HU7 A;  3G7I A;  3GTU A;  4GRF A;  3GKM A;  2JSZ A;  4MH3 A;  4O5R A;  1M2A A;  4K0N A;  3FY7 A;  3C71 A;  4CDO A;  2R37 A;  4PHZ C;  1M2D A;  2OAD A;  1PX7 A;  2LST A;  3D4T A;  2A4V A;  2HSN B;  4BIK A;  2PVQ A;  5CRG A;  4G01 A;  5BMU B;  6GST A;  2DJ0 A;  3KH9 A;  2MYG A;  5F06 A;  4EDY A;  16GS A;  5HR2 A;  2L6C A;  4YKF A;  2HQT A;  4CY8 A;  4WR4 A;  5IO2 A;  4KCA A;  4YH2 A;  3E3E A;  3LG6 A;  2IIY A;  3HVX A;  4X0X A;  2CV4 A;  3FMW A;  3SWL A;  5DDL A;  2DMM A;  1USB A;  1I5G A;  1FG4 A;  5HFI A;  1FVJ A;  4AKX B;  3PPU A;  5GAN D;  1YDK A;  5KOX A;  1AAZ A;  3QFA C;  2EFE A;  5ECO B;  2M80 A;  5GSS A;  1MEK A;  3LW9 A;  4ZBA A;  5GST A;  1H75 A;  3EC3 A;  2R6K A;  2HSM B;  2GQK A;  2V2G A;  1R5P A;  5CP1 A;  3U6V A;  2B5Y A;  3QFB C;  2ZNM A;  2H1L A;  2VM2 A;  2GZZ A;  3WYW A;  2DIZ A;  2GLR A;  5L71 A;  2RUF A;  4KE3 A;  2GSS A;  1S3A A;  2HZF A;  4TXO B;  3GUR A;  3QMX A;  1OC9 B;  3TRQ A;  1BF5 A;  4EIP A;  3LJR A;  4ICY A;  4OFN A;  2VOC A;  1B4Q A;  2P31 A;  2C0F A;  3LQ7 A;  3CRU A;  2LJR A;  4HU9 A;  14GS A;  2OE1 A;  1A2J A;  4IHU A;  1AQV A;  4PUF C;  3KGK A;  2GT6 A;  2DC5 A;  2C8U A;  1QGV A;  2I1U A;  1OC8 A;  5KN2 A;  4DSR A;  1QK8 A;  1T8E B;  3FEU A;  1N2A A;  5C00 A;  1K0C A;  3GST A;  1XW5 A;  4ZBD A;  1JFU A;  2YV7 A;  4MJB A;  5J40 A;  4K7O A;  4ML6 A;  2WVX B;  4AKI A;  2YPM A;  1LU4 A;  4NMU A;  4Z2T A;  3GIX A;  3GSS A;  9GSS A;  1TRS A;  2OKA A;  1X5E A;  1YY7 A;  3IAS 2;  4MA9 A;  1SK1 A;  2VUP A;  2L4C A;  5J4Y A;  4BWS A;  4DSQ A;  4TN8 A;  2N5A A;  3V1W A;  2HLS A;  4WR5 A;  3CWG A;  3HZ8 A;  3GMF A;  1URM A;  1OE8 A;  3HMJ G;  3QOU A;  4KX4 A;  4XS6 A;  2KOK A;  3UMA A;  3EYT A;  5IOX A;  4L8E A;  7GSS A;  1QQ2 A;  2VAF A;  1GSQ A;  4X43 A;  4G0I A;  2ES7 A;  4EC0 A;  1GTB A;  3L9S A;  5C04 A;  2K8S A;  5A5H A;  5GAP D;  1M2B A;  5DBQ A;  1RW1 A;  1NHO A;  2ZCT A;  5J5N A;  2H66 A;  3H1N A;  4Z2U A; 
#chains in the Genus database with same CATH homology
 3BJ5 A;  3ME7 A;  4USS A;  3KH7 A;  5HFG A;  1C72 A;  1F6M C;  4KCE A;  4AGS A;  1X5D A;  1ZGN A;  3DD3 A;  1BG1 A;  1Z7R A;  1XW9 A;  3R2Q A;  2OT3 A;  2FY6 A;  2HRK B;  3EUR A;  2A4H A;  1IYI A;  4KDX A;  3R3E A;  3L0H A;  3IC8 A;  5ECN B;  4ZIJ A;  2IMK A;  1TI3 A;  5D93 A;  4HQS A;  2QA1 A;  3TKP A;  2MZC A;  3WGD A;  2GSR A;  2LJK A;  4KUN A;  1GLP A;  1G6Y A;  4F0C A;  4GLT A;  2LEG A;  2B3S A;  3NIV A;  3H93 A;  4TW5 A;  1HD2 A;  5J47 A;  1PKW A;  1K3L A;  1GTU A;  1ST9 A;  1XOB A;  2YWI A;  3IBH A;  3D21 A;  5G1K A;  1FB6 A;  5BMU A;  3IE3 A;  1A2L A;  2CX3 A;  5HR0 A;  1KEB A;  2GGT A;  2UZ8 A;  4PNF A;  5DJM A;  3HD5 A;  4Q5N A;  3Q74 A;  4RI7 A;  1U88 A;  3A5I A;  1ML6 A;  2GZY A;  4DSS A;  4ULX A;  3KJY A;  4PQH A;  4HJM A;  1V9W A;  3CSH A;  1R5A A;  1EP7 A;  2CZ3 A;  4OMV A;  5AGY A;  3LYP A;  3HCZ A;  4MF6 A;  3ZIJ A;  1QFN A;  1A24 A;  3GX8 A;  2VM1 A;  1YF1 A;  3GYK A;  1OKT A;  4YAV A;  1GH2 A;  4PGT A;  2DLX A;  2OBI A;  3KCM A;  1EWX A;  1GSY A;  2AJQ B;  4IS0 A;  4CY6 A;  1WOU A;  2TRX A;  2YWM A;  4TXV A;  3ZIT A;  3MDK A;  3LXT A;  3ZMK A;  3TJJ A;  1JLW A;  2FD3 A;  1KTE A;  5ECR B;  5A4U A;  2N5F A;  5LD0 A;  5A1N B;  1W89 A;  2EIR A;  2R0P A;  3FR3 A;  2KP2 A;  3ZL5 A;  2H1D A;  4BA7 A;  1T3B A;  3C7M A;  1XOA A;  2HI7 A;  3LEF A;  5CRH A;  1SK2 A;  3ZIV A;  2WZ9 A;  3CMI A;  3CSJ A;  3L78 A;  2IPA A;  3HXS A;  3RPP A;  2DML A;  2EIO A;  5J9B A;  4TXO A;  5DJL A;  2DJ1 A;  2K6V A;  2I3Y A;  1OC9 A;  5JCU A;  1SYR A;  4NV5 A;  5INY A;  1YKA A;  3A2V A;  4POM A;  3RDW A;  5HR3 A;  4HZ2 A;  4MLY A;  2X4A A;  1S3D A;  3J7Y b;  2GST A;  1U87 A;  2OE3 A;  1TKD B;  1THO A;  1YQ1 A;  4FYU A;  2R0G A;  4BVY A;  3F63 A;  1WIK A;  1THX A;  3QDN A;  2XHF A;  4K8M A;  3LGC A;  4HOJ A;  1K0A A;  1BJX A;  5EY6 A;  3N5O A;  5A4V A;  2KHP A;  4IBP A;  1UA5 A;  4V2N A;  4K7N A;  4O32 A;  1Q4J A;  4OD7 A;  1MD3 A;  4XCS A;  5B8A A;  2V1M A;  1HQO A;  2LS5 A;  4EKZ A;  3DEX A;  4POB A;  20GS A;  1VF4 A;  1EV4 A;  1TU7 A;  2PWJ A;  1PX6 A;  4LL1 B;  2MMA A;  1SKR B;  3G7J A;  1OKD A;  1K0O A;  4TR1 A;  2CA8 A;  3CBU A;  2G0F A;  3G7Y A;  2YV9 A;  2IWT A;  3VWW A;  5A4W A;  1IYH A;  2O8V B;  2QC7 A;  1V57 A;  4IKH A;  2YZU A;  3F0I A;  4MAB A;  4WKW A;  4ZB9 A;  1M99 A;  3M9J A;  1Z6M A;  2K8V A;  4MF5 A;  2VL3 A;  3P8W A;  2CQ9 A;  1EGO A;  4Q5F A;  3HYP A;  3HJO A;  3O3T A;  1JZO A;  2YWN A;  1SL0 B;  4BWQ A;  3TKS E;  2VCT A;  2LRC A;  2IMF A;  2LTK A;  5IMV A;  2H70 A;  1NM3 A;  1ON4 A;  5D9W A;  2O85 A;  4HUA A;  3RHC A;  2PBJ A;  2OE0 A;  2ALB A;  1OYJ A;  1ZOF A;  3N9J A;  2FWG A;  1T4Y A;  18GS A;  1WMJ A;  2M46 A;  2A2R A;  3D6I A;  4AJ7 A;  1ERV A;  2AUV A;  3P2A A;  3ZML A;  1A23 A;  1GUM A;  5G2Z A;  3GRX A;  2FHE A;  2WGR A;  3HJP A;  1K0N A;  5EL8 A;  2Z9S A;  5IIZ A;  3M9K A;  5LCZ A;  1B8X A;  5IM9 A;  1O85 A;  1CQH A;  1SVM A;  1ZCP A;  4XRD A;  4MDC A;  4POL A;  5CYY A;  2E7P A;  4EO3 A;  3FW2 A;  5JWQ B;  5IMF A;  4DEJ A;  2GSQ A;  4IGJ A;  3TU3 B;  2WB9 A;  4JRR A;  1XWG A;  1EGR A;  2LKU A;  4IVF A;  2C0G A;  4KH7 A;  4J56 E;  3LFL A;  4ZL8 A;  3D4M A;  2HRA A;  1DSB A;  3M3M A;  1XVW A;  3IA1 A;  2PVO C;  4KW6 A;  1AUC A;  4ZB7 A;  1W4V A;  4J57 E;  1YEP A;  1SVL A;  2BMX A;  1XCC A;  2FWF A;  1AC1 A;  2V6K A;  2FA8 A;  1XXU A;  5F8B A;  4MMM A;  2H0I A;  1LBK A;  3APO A;  4JE1 A;  1TJD A;  4F82 A;  1MDJ A;  3EU3 A;  1TXU A;  3TJF A;  4DSS B;  4I5Q A;  1TK0 B;  4K0G A;  1TW9 A;  3GFK A;  1PRX A;  5ELA A;  2NVL A;  4QQ7 A;  3IC4 A;  2OAC A;  2TRC P;  1FB0 A;  1B9X C;  1J08 A;  3W8S A;  1B9Y C;  4OWY A;  2QKE A;  4K2D A;  4ZB6 A;  2NTO A;  2VO4 A;  5HQP A;  5E4W A;  1Z7P A;  2DJJ A;  2XC2 A;  2O89 A;  1GNW A;  5AN1 A;  4G10 A;  3ZRE A;  2CZ2 A;  5A1N A;  2K18 A;  2PMT A;  4JBB A;  1K0B A;  4LMW A;  4WF4 A;  3HZ4 A;  4PTS A;  1V98 A;  1SKS B;  1TRW A;  1G7E A;  3VUR A;  1BQ7 A;  2IL3 A;  4MNN A;  2VCV A;  5F0G A;  3FHK A;  4K6X A;  1Y1U A;  4PXO A;  4XIH A;  2I81 A;  2VL2 A;  1MDI A;  3HKR A;  2B1L A;  4N0V A;  1R26 A;  3RPN A;  3KP8 A;  2EC4 A;  5FT3 A;  1A0F A;  1AIU A;  4H86 A;  4TR3 A;  1PL1 A;  1TK8 B;  4MZB A;  4WBR D;  2B1K A;  5B6M A;  4TR4 A;  1U3I A;  3OR5 A;  2NPB A;  2YZH A;  3EPT A;  4BVY B;  1FW1 A;  3UAR A;  4HZ4 A;  2I4A A;  2PU9 C;  4TKY A;  5J3R A;  2V41 A;  1J0F A;  2C1Y A;  1KBN A;  2MMZ A;  1ILO A;  1RK4 A;  4JR4 A;  4FIW A;  1QMV A;  4ACS A;  5KEJ A;  1EOH A;  4OFT A;  1K0D A;  3MAK A;  3MYD A;  3FZA A;  1PSQ A;  3CTF A;  5CRE A;  4JU5 A;  4ECJ A;  5CNW A;  3HJM A;  1R4W A;  5A34 A;  2H01 A;  4K5S A;  3C1R A;  4FH8 A;  2F8F A;  6GSX A;  1YZX A;  2GVP A;  3VI7 A;  3F4S A;  1U6T A;  5IPH A;  4TR1 B;  3EMX A;  1VGL A;  3QPM A;  2GQL A;  4QL9 A;  2HZE B;  4HJ2 A;  5DQS A;  1OC3 A;  2ZUP A;  1EP8 A;  3IOS A;  4OO4 A;  2X8C A;  3DXB A;  4MCU A;  5LNK e;  1GWC A;  1OVN A;  2OA7 A;  5G5F A;  1MTC A;  4E8H A;  4PQI A;  3TKS C;  4AF2 A;  4MF7 A;  3A2W A;  4LL4 B;  3HVV A;  4KDU A;  1JZD A;  3LOR A;  1EEJ A;  1GSS A;  1M9B A;  4L0W A;  4MH2 A;  2B5X A;  1GNE A;  5IPG A;  1ZYP A;  3F4R A;  2J23 A;  3IXR A;  3IAM 2;  3GKX A;  4GCI A;  4ZXG A;  4WBJ A;  2WS2 A;  1MDK A;  5F05 A;  1NHY A;  5D9X A;  3E9J B;  2P0G A;  1TP9 A;  3VI5 A;  4Q5Q A;  2B6M A;  2HT9 A;  2PER A;  5CAX A;  1TU8 A;  1YJ6 A;  3UL3 A;  4N0Z A;  2H75 A;  3EU4 A;  2J9H A;  2LQO A;  2FUG 2;  2HYX A;  2JAC A;  1F9M A;  3TOU A;  3E0U A;  4Z7X A;  1OAZ A;  1G7O A;  3L9V A;  3FZ5 A;  3AY8 A;  3KTB A;  10GS A;  5DAL A;  1FVK A;  2IN3 A;  4PNG A;  1WRY A;  3MIX A;  4CW9 A;  1JLV A;  2H1A A;  1MD4 A;  2ON7 A;  2X8G A;  1GL8 A;  4ZIL A;  3UBK A;  2H72 A;  1TRU A;  3ISO A;  2A2S A;  4ECB A;  3BCI A;  2JAD A;  2AV4 A;  1XIY A;  5G1L A;  1M9A A;  1ZL9 A;  2VCX A;  5G5E A;  22GS A;  4YKG A;  4GF0 A;  3IPZ A;  4WEY A;  3O6T A;  4E68 A;  2NBS A;  5DQY A;  2E2M A;  3L4N A;  2CVK A;  2EFH A;  1EV9 A;  3UAP A;  1J9B A;  5ECS A;  2F51 A;  4MP4 A;  3BCK A;  1ZYQ B;  4EIQ A;  1X5C A;  4WXT A;  5IMD A;  2ON5 A;  3HHV A;  4IP1 A;  2IJY A;  5J4V A;  2DBC A;  3RAZ A;  3HY2 A;  4RQX A;  4XRA A;  4MK3 A;  3UIW A;  3UVT A;  1F37 A;  2RM6 A;  1WP0 A;  1V40 A;  3F4T A;  4NV2 A;  2QA2 A;  1XVQ A;  4AJ6 A;  5JCG A;  1K0M A;  4G9H A;  1X9M B;  2TIR A;  4PUA A;  3CSI A;  1SK0 A;  1SJ6 A;  3GUS A;  4EF0 A;  3FKF A;  1Z6N A;  1T00 A;  2H6Y A;  3TDG A;  1V58 A;  3TKR A;  3F9U A;  1F2E A;  3IR4 A;  1S3C A;  4IJ3 A;  5EPF A;  2WCI A;  1T1V A;  1TK5 B;  3VLN A;  2FLS A;  4WF5 A;  5B8B A;  1PN9 A;  2H6Z A;  4MPG A;  1BED A;  3F8U A;  5ECQ B;  3A2X A;  2VL2 C;  1K3O A;  3I9V 2;  4IQA A;  4GDF A;  2LRT A;  5HFK A;  4O5U A;  2I9H A;  4KA0 A;  2YOI A;  3LXZ A;  5H5S A;  1N25 A;  3K8N A;  3PH9 A;  4I2U A;  4N10 A;  4IQ1 A;  2M72 A;  4EVM A;  1TTZ A;  3KP9 A;  2CT6 A;  3SBC A;  1X0R A;  4HEA 2;  4JED A;  4F0B A;  1XWK A;  3ZVJ D;  2MBT A;  2F8A A;  3TKQ A;  1A0R P;  4KSO A;  2JZT A;  1Z9H A;  2MMN A;  4L5L A;  2B5E A;  2GT5 A;  4GTU A;  1Q98 A;  2C3Q A;  2CVB A;  4EXJ A;  1AW9 A;  3QR6 A;  3CYN A;  1PKZ A;  2CVD A;  3ZFL A;  2DJ3 A;  1X9S B;  4ZL7 A;  2PPT A;  4KF9 A;  3IK7 A;  3FYG A;  1PN0 A;  4HS1 A;  3QAV A;  3FK8 A;  4I97 A;  4YQM A;  5KN3 A;  5AIS A;  3IV4 A;  4AKG A;  5JWR B;  5IOW A;  5A34 B;  3H79 A;  2EIQ A;  3TGZ A;  1HYU A;  17GS A;  2RUE A;  4PQ1 A;  3LWA A;  2HZE A;  4ECC A;  2B7J A;  4G19 A;  1JHB A;  3TOT A;  2WRT A;  4AI6 A;  2LNT A;  4OCE A;  2XPE A;  3FZ9 A;  1F3B A;  5DCH A;  5IMZ A;  2AB6 A;  3VPQ A;  4NHW A;  1SD9 A;  3TKS A;  1Z5Y E;  1TOF A;  2DJK A;  3GKN A;  4NXI A;  3EE2 A;  2OJL A;  2R5G A;  4MPF A;  2LUS A;  4QMK A;  3VFI A;  3TJG A;  2YJ7 A;  2C3N A;  3PIN A;  2JZR A;  2V6O A;  4K2X A;  4OCF A;  4DVC A;  2LV3 A;  1O6J A;  4P3Y B;  2F3M A;  6GSU A;  2H71 A;  5COH A;  1GP1 A;  4G0L A;  1T4Z A;  1XW6 A;  4HDE A;  1ERU A;  5D9T A;  5IMA A;  4GSS A;  4FYC A;  3FR9 A;  5J41 A;  2E0Q A;  4NWY A;  3BOA A;  3LSZ A;  1FAA A;  5BRT A;  2A2P A;  5KOW A;  1GRX A;  1JZW A;  2X8H A;  3D22 A;  3GX0 A;  1I9D A;  4F2I A;  4ID0 A;  3VWU A;  4XS4 A;  3VK9 A;  1YVL A;  1PQN A;  5ECK B;  3VWV A;  3APS A;  2B7K A;  3WT1 A;  2HSY A;  3UVH A;  2LNS A;  5DAL B;  2WFC A;  1B48 A;  3WGE A;  3ERF A;  3ERG A;  4ISD A;  2PGT A;  4MZC A;  1Z3E A;  1AXD A;  2X49 A;  3QAW A;  4MJC A;  4KGI A;  3KIJ A;  2RM5 A;  1HNC A;  1BYE A;  3A5W A;  6GSW A;  3Q19 A;  3ZTL A;  2VCW A;  1EZK A;  1SL2 B;  1AQX A;  1ZYN A;  2AYT A;  4GSN A;  4MJA A;  5D96 A;  2O7K A;  5CRW A;  4V1A p;  2FA4 A;  3UOM A;  4V1A g;  1SL1 B;  2HSH A;  2HNL A;  1SU9 A;  2H0G A;  1ZYE A;  4OFM A;  2P5R A;  13GS A;  1PA3 A;  1GUL A;  3ZZX A;  5DVB A;  3O76 A;  2FCH A;  3TJB A;  1DBY A;  2BTO T;  1VRS D;  1U3A A;  3KMN A;  1F3A A;  4G2E A;  2PUK C;  3FRC A;  2R2J A;  1GSD A;  2IMI A;  1JZR A;  4KSM A;  1CQG A;  2HE3 A;  5ECL B;  5ECH B;  2E2G A;  1FHE A;  2WDU A;  3F3Q A;  1EEM A;  3P90 A;  3LYK A;  2H73 A;  3M8N A;  4EDZ A;  4N11 A;  3QD9 A;  3F3R A;  3IDV A;  1WE0 A;  4HQZ A;  4TRX A;  1X9W B;  1PGT A;  2GDR A;  2XBQ A;  2H6X A;  3TJK A;  3US3 A;  3DRN A;  1FOH A;  1BAY A;  3FR6 A;  2NDO A;  1A2M A;  4HI7 A;  1O73 A;  4GST A;  3ERW A;  4NPB A;  5DAK A;  2L5L A;  5KN0 A;  1YKC A;  2WJU A;  3TUE A;  1XFL A;  2XBI A;  4KND A;  3KZQ A;  5D9V A;  4IEL A;  1QUW A;  2H1G A;  3BD2 A;  4J2F A;  1ERW A;  2EFD A;  5EVO A;  4XHM A;  2MMO A;  3DVW A;  4L5O A;  4D73 A;  4E8E A;  4NAX A;  3FZ4 A;  5ID2 B;  2H1B A;  4POK A;  3U5R E;  2IFQ A;  4ZL9 A;  5F07 A;  4W66 A;  3QCP A;  1B4P A;  2JU5 A;  3I43 A;  2K9F A;  5DCG A;  1KNG A;  2BJX A;  2VIM A;  2O5V A;  1A8Y A;  2DIY A;  1M7T A;  4YQU A;  19GS A;  5A5K A;  2KUC A;  5CRD A;  1VF3 A;  4F03 A;  1UN2 A;  3GL5 A;  2HFD A;  3VPT A;  4BL7 B;  5ENU A;  1GSE A;  4LLR A;  4BVX A;  3IK9 A;  2VKZ G;  3GNJ A;  1XZO A;  2H76 A;  3ZYW A;  2VLT A;  4XTS A;  5JWO B;  5ECI B;  2YAN A;  5B6N A;  4PX1 A;  1UC7 A;  2G2Q A;  2RII A;  3TRP A;  3F6D A;  3S9F A;  4O7H A;  2GQM A;  1G6W A;  3C8E A;  1SD8 A;  2KLX A;  1XWC A;  2VLV A;  4EE0 A;  4MZW A;  3GHA A;  4ZB8 A;  2H0H A;  4ML1 A;  1SJZ A;  2JSY A;  2P5Q A;  2PN8 A;  5ELG A;  5AIV A;  3MSZ A;  4RQR A;  3GL3 A;  3HDC A;  5J4U A;  5D73 A;  6GSV A;  3APQ A;  5JCW A;  2HXK A;  3DIE A;  4RUV A;  4JZQ A;  2FNO A;  3Q18 A;  4I8B A;  3C1S A;  3KM6 A;  3PGT A;  5FHI A;  1VF2 A;  2L6D A;  4IP6 A;  5ECP B;  5GZZ B;  4YQV A;  2X99 A;  2F9S A;  1PMT A;  2V32 A;  5H5R A;  1DUG A;  3I69 A;  5IMC A;  4F9Z A;  3I6A A;  2C0E A;  1M0U A;  2CX4 A;  4FQU A;  3DWV A;  3ZRD A;  1HNA A;  2N5B A;  2OBK A;  2GTU A;  2O87 A;  2GZP A;  1GTA A;  4RI6 A;  5HR1 A;  1QXH A;  2C3T A;  4KB3 A;  4GWR A;  2L5O A;  2YCD A;  4XS4 B;  4KDY A;  1AQW A;  2QGV A;  3J7Y k;  1WPI A;  4ZBB A;  1TRV A;  3DGQ A;  3UJ1 A;  1FOV A;  1ACV A;  2C0D A;  4GXZ A;  3KEB A;  4A5P A;  12GS A;  3GTU B;  8GSS A;  1VF1 A;  4EL1 A;  3ME8 A;  1TDI A;  1GSF A;  2AAW A;  3ZLP A;  4AJ8 A;  3UEM A;  2LJA A;  3KMO A;  3KXO A;  4N30 A;  3PR8 A;  4YAP A;  1XBS A;  4O92 A;  2DJ2 A;  2VLU A;  1Y6E A;  1DE1 A;  1GUK A;  1SEN A;  3GH9 A;  4X1U A;  4JR6 A;  2EFC A;  4BPY A;  2HSN A;  5G31 A;  1SJI A;  5H5Q A;  2IME A;  4N3Z A;  3D0Z A;  4Q5R A;  3IHG A;  1OE7 A;  3G9B A;  3IHQ A;  1O8X A;  2VCQ A;  3QAG A;  5KN1 A;  2DSA A;  3GKK A;  4L0U A;  1E6B A;  4FYB A;  2QSI A;  3EVI A;  4I6X A;  4TR0 A;  4QL7 A;  3EMP A;  1NW2 A;  3TRX A;  1A8L A;  2JZS A;  4CHS A;  1Y25 A;  5E59 A;  5G30 A;  4PUR A;  3JCM L;  1O81 A;  4FO5 A;  1SKW B;  2R0C A;  3C73 A;  2L4Q A;  4ILF A;  4IJI A;  1H4O A;  2H19 A;  2JL4 A;  1BX9 A;  2DKI A;  4GQF A;  3MNG A;  2GS3 A;  1ERT A;  1ABA A;  1FO5 A;  2C4J A;  3HA9 A;  5AIX A;  2HRF A;  2FWE A;  1EOG A;  3NOF A;  4IN0 A;  4MJE A;  2H8L A;  4G0K A;  1YEX A;  6GSS A;  3KTL A;  4LMV A;  2YJH A;  3DVX A;  2VCZ A;  2IMD A;  5DAK B;  3M0F A;  1O7U A;  2WUL A;  2HSM A;  1UVZ A;  4TOP A;  4V2L A;  2L59 A;  5ECM B;  3KD0 A;  4K7I A;  5IQY A;  2H30 A;  1ZZY A;  4TVE A;  4I2T A;  4X4J A;  2REM A;  2RLI A;  4D73 B;  3D5J A;  5ID2 A;  1LJR A;  1T7P B;  4EUY A;  1HNB A;  2IFQ B;  2YNX A;  3EIN A;  2HRN A;  3DML A;  2AHE A;  2CAQ A;  1SYX A;  3CTG A;  1GSU A;  2R4V A;  3MWH A;  5CO3 A;  3ZVJ A;  4BL7 A;  2X64 A;  2D2Z A;  4K5R A;  2LQQ A;  2LRN A;  4BVX B;  3GA4 A;  1GUH A;  1O8W A;  1XWA A;  3CXG A;  1DE2 A;  6GSY A;  3DYR A;  3P7X A;  1YF0 A;  1E2Y A;  3W8J A;  3IRA A;  2YP6 A;  1SVO A;  2UV8 G;  2YN1 A;  4K9Z A;  3GN3 A;  1N8J A;  4ECI A;  4LA1 A;  3ED3 A;  3DKS A;  1G0T A;  3W6G A;  1R7H A;  2MBS A;  2VD1 A;  3WD6 A;  1TI1 A;  3BBY A;  1BG5 A;  2XPD A;  1V2A A;  1XPV A;  3Q6O A;  5FWG A;  2R3X A;  2VL9 A;  2YWO A;  3M1G A;  3WT2 A;  3GH6 A;  1TXX A;  3HVS A;  5IO0 A;  2C80 A;  3A3T A;  1WJK A;  1K3Y A;  3TB2 A;  2L57 A;  2FWH A;  4OO5 A;  3H4K A;  3RBT A;  4IW9 A;  1GTI A;  1RQM A;  3TCO A;  5A5H B;  1ZMA A;  5D8I A;  4GQC A;  3VWX A;  2DKH A;  4V2M A;  5J9C A;  3WGX A;  3GV1 A;  4KAE A;  2VD0 A;  4Z2R A;  3H8Q A;  5B7C A;  1WWJ A;  3ZFB A;  4K1F A;  1GLQ A;  1NSW A;  3EWL A;  2H74 A;  2HRK A;  1PD2 1;  4NHZ A;  3RHB A;  2FGX A;  4O5Q A;  5ABR A;  3F6F A;  11GS A;  3UBL A;  4AKH A;  4XS1 A;  2CAI A;  3L9U A;  3CRT A;  3NZN A;  1XWB A;  4WET A;  2KP1 A;  1PL2 A;  4HU7 A;  3G7I A;  3GTU A;  4GRF A;  3GKM A;  2JSZ A;  4MH3 A;  4O5R A;  1M2A A;  4K0N A;  3FY7 A;  3C71 A;  4CDO A;  2R37 A;  1M2D A;  2OAD A;  1PX7 A;  2LST A;  3D4T A;  2A4V A;  2HSN B;  2PVQ A;  5CRG A;  4G01 A;  5BMU B;  6GST A;  2DJ0 A;  3KH9 A;  2MYG A;  5F06 A;  4EDY A;  16GS A;  5HR2 A;  2L6C A;  4YKF A;  2HQT A;  4CY8 A;  4WR4 A;  5IO2 A;  4KCA A;  4YH2 A;  3E3E A;  3LG6 A;  2IIY A;  3HVX A;  4X0X A;  2CV4 A;  3FMW A;  3SWL A;  5DDL A;  2DMM A;  1USB A;  1I5G A;  1FG4 A;  5HFI A;  1FVJ A;  4AKX B;  3PPU A;  5GAN D;  1YDK A;  5KOX A;  1AAZ A;  3QFA C;  2EFE A;  5ECO B;  2M80 A;  5GSS A;  1MEK A;  3LW9 A;  4ZBA A;  5GST A;  1H75 A;  3EC3 A;  2R6K A;  2HSM B;  2GQK A;  2V2G A;  1R5P A;  5CP1 A;  3U6V A;  2B5Y A;  3QFB C;  2ZNM A;  2H1L A;  2VM2 A;  2GZZ A;  3WYW A;  2DIZ A;  2GLR A;  5L71 A;  2RUF A;  4KE3 A;  2GSS A;  1S3A A;  2HZF A;  4TXO B;  3GUR A;  3QMX A;  1OC9 B;  3TRQ A;  1BF5 A;  4EIP A;  3LJR A;  4ICY A;  4OFN A;  2VOC A;  1B4Q A;  2P31 A;  2C0F A;  3LQ7 A;  3CRU A;  2LJR A;  4HU9 A;  14GS A;  2OE1 A;  1A2J A;  4IHU A;  1AQV A;  4PUF C;  3KGK A;  2GT6 A;  2DC5 A;  2C8U A;  1QGV A;  2I1U A;  1OC8 A;  5KN2 A;  4DSR A;  1QK8 A;  1T8E B;  3FEU A;  1N2A A;  5C00 A;  1K0C A;  3GST A;  1XW5 A;  4ZBD A;  1JFU A;  2YV7 A;  4MJB A;  5J40 A;  4K7O A;  4ML6 A;  4AKI A;  2YPM A;  1LU4 A;  4NMU A;  4Z2T A;  3GIX A;  3GSS A;  9GSS A;  1TRS A;  2OKA A;  1X5E A;  1YY7 A;  3IAS 2;  4MA9 A;  1SK1 A;  2VUP A;  2L4C A;  5J4Y A;  4BWS A;  4DSQ A;  4TN8 A;  2N5A A;  3V1W A;  2HLS A;  4WR5 A;  3CWG A;  3HZ8 A;  3GMF A;  1URM A;  1OE8 A;  3HMJ G;  3QOU A;  4KX4 A;  4XS6 A;  2KOK A;  3UMA A;  3EYT A;  5IOX A;  4L8E A;  7GSS A;  1QQ2 A;  2VAF A;  1GSQ A;  4X43 A;  4G0I A;  2ES7 A;  4EC0 A;  1GTB A;  3L9S A;  5C04 A;  2K8S A;  5A5H A;  5GAP D;  1M2B A;  5DBQ A;  1RW1 A;  1NHO A;  2ZCT A;  5J5N A;  2H66 A;  3H1N A;  4Z2U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...