3HKRA

Crystal structure of glutathione transferase pi y108v mutant
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
208
structure length
208
Chain Sequence
PYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIVTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase P
publication title Influence of the H-site residue 108 on human glutathione transferase P1-1 ligand binding: structure-thermodynamic relationships and thermal stability.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 79
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2009-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3hkrA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3hkrA01
2OE0A 4KSMA 2YJ7A 2PUKC 4CW9A 3FZAA 3F63A 3G7JA 1LJRA 2J23A 1TXXA 1PD21 2R2JA 3PGTA 4RI7A 3VPTA 1HD2A 1NHOA 3ZREA 1EWXA 1PA3A 2X8CA 1UVZA 1TK5B 1GSSA 2N5BA 3D4TA 3HXSA 2L57A 2C80A 2H1BA 3H1NA 4Q5NA 3TKSC 3UBKA 5JWOB 2PPTA 1B4QA 4OFTA 1SL1B 4AF2A 1Y25A 1KTEA 4I5QA 4MLYA 9GSSA 3GMFA 1SENA 2P0GA 4BVXA 4PNFA 2HRKB 5G30A 5LNKe 3GSSA 2AUVA 4LLRA 1BJXA 4WF5A 3TOTA 3K8NA 3KEBA 4I8BA 3HJMA 4MZCA 2XPEA 1X9MB 5IMDA 4E8EA 3C1RA 1NW2A 4NHZA 1VF4A 3EMXA 5D96A 2GSSA 4WBRD 3HVVA 2TRXA 4ZB9A 1G0TA 4TXOA 3F4SA 2F8AA 2GGTA 1U6TA 3WGEA 1M9BA 3LSZA 1SJIA 4MP4A 6GSWA 3ZIVA 2GSQA 4XTSA 5GZZB 2CZ3A 4V1Ap 2H66A 2H70A 3TB2A 1W89A 2MMOA 2YZUA 4HQZA 1KNGA 3KJYA 2WJUA 2MZCA 3KCMA 2WS2A 2G2QA 2B7KA 1ST9A 3GKKA 4F2IA 2LSTA 1VF2A 4XIHA 4MH2A 4ECIA 5C04A 2WCIA 5F07A 1THOA 2LUSA 2NBSA 3GA4A 3ME8A 3UJ1A 1X9SB 4FYCA 4E8HA 1TP9A 2LV3A 3I43A 3LYKA 4NXIA 3ZLPA 2O7KA 2VL9A 1FB6A 3M8NA 3ERWA 3TCOA 4KF9A 1KEBA 3RHCA 1GWCA 4HI7A 1TTZA 2CT6A 2H72A 2OE3A 4RI6A 3SBCA 2GT6A 2DJ1A 5F06A 2GS3A 5DVBA 1BX9A 1T8EB 2C0EA 4XS1A 3GNJA 5IMCA 2CA8A 4F0BA 1VF1A 1XXUA 3ZITA 4BWQA 2EC4A 5CRHA 2WGRA 4G0KA 4EE0A 3ZL5A 2YWOA 1Z5YE 1R5PA 1GNWA 4POMA 5A5KA 4ML6A 4WETA 2LNTA 4MJBA 4PX1A 1ERUA 2GQLA 2OKAA 4FO5A 2WFCA 2I1UA 3EYTA 3EINA 2R37A 3RDWA 1QQ2A 1O8XA 2HSHA 4N10A 2KHPA 1X5DA 4HS1A 3Q19A 1Z7PA 1PL2A 2R3XA 3NIVA 3D22A 2QKEA 4AJ7A 6GSUA 4HU9A 3PINA 4PGTA 3GKNA 1N8JA 1PMTA 3IC4A 1U3AA 3GX0A 2ZNMA 4AJ8A 1PKWA 1RQMA 5A4VA 3FR3A 2VCXA 1XCCA 2JSYA 5LCZA 1O6JA 3BJ5A 1QGVA 1GULA 4HJMA 5AIVA 4JEDA 4K7OA 2A2SA 3O3TA 1K0DA 3LEFA 3G7IA 2GLRA 2P31A 1AXDA 2HRNA 4EKZA 4KAEA 1K0OA 1YEPA 4IS0A 3TKPA 3QAVA 2K18A 4RUVA 4X43A 6GSVA 2V2GA 5F8BA 1K0AA 1A0RP 2YPMA 2V6OA 5DCHA 3KGKA 1TRWA 1PKZA 1XOAA 2PBJA 2QC7A 2YP6A 5HQPA 5ECOB 4AGSA 4V2NA 4NHWA 1VRSD 5G2ZA 3QMXA 1ERVA 5HFIA 3J7Yk 3M0FA 2FA4A 4IQAA 1SYXA 4FQUA 2HSNB 1ML6A 2F8FA 1LU4A 4Q5RA 4DVCA 2AJQB 1IYIA 1OE8A 4DSRA 3F3QA 1TI3A 1EOGA 1DE1A 1T3BA 2LRNA 2GZPA 5JWQB 3VPQA 4X0XA 1T00A 5GAPD 1JZWA 2H0GA 3UOMA 5EPFA 2NVLA 5J9BA 4HU7A 4G2EA 3HA9A 2E2GA 3LJRA 5FWGA 2N5AA 3QDNA 3IBHA 12GSA 2R5GA 4KCAA 1YDKA 3UBLA 1V2AA 2DBCA 3FK8A 3ED3A 1OC8A 1JLWA 2K8SA 1T1VA 2FLSA 5DCGA 4TRXA 5G5EA 4G0IA 2C0GA 1GTIA 4OCEA 4WR5A 1O8WA 4DSSB 2HYXA 3F9UA 4J56E 3EC3A 2RIIA 1UN2A 3HHVA 1X0RA 3DXBA 5GSTA 3N5OA 2RUEA 1ZYQB 4WKWA 1O81A 1TRSA 1JZDA 1WRYA 1LBKA 5D9VA 1XWAA 3JCML 4D73A 5IO2A 2ON5A 3KXOA 2C1YA 3G9BA 1DSBA 14GSA 5DJMA 2VUPA 5KN3A 1EEMA 4DEJA 2JADA 16GSA 1EGOA 1PRXA 2H0HA 1YKAA 2F9SA 3EU3A 5G1KA 2H6YA 2PU9C 3L9UA 1THXA 4KNDA 4F82A 1FVKA 1PL1A 2JZSA 5J3RA 3KMNA 3VLNA 2WULA 1OKTA 2CX3A 1CQHA 3E3EA 5F0GA 1SKWB 1R5AA 5DBQA 5G31A 3TJBA 2L6DA 2CV4A 2PWJA 5FHIA 1G6YA 3M9KA 1T4ZA 3ZZXA 2B3SA 2J9HA 1KBNA 1F2EA 5GAND 1XWCA 3ME7A 1UC7A 3TKRA 4EC0A 5KN0A 4PQ1A 2B1LA 4PQHA 5EVOA 1AC1A 20GSA 3IAS2 2H71A 2YV9A 1X9WB 4XS4A 4ZL8A 4NV5A 3I69A 1QFNA 1BYEA 1OE7A 5LD0A 4HUAA 1G6WA 3UIWA 4KB3A 2FNOA 3VFIA 3GYKA 1EZKA 3CTFA 2K9FA 1EEJA 1FG4A 3LXTA 4KH7A 4FYBA 3A2XA 3NOFA 1WP0A 3IK7A 2AV4A 1BEDA 3FRCA 1XWBA 5IO0A 2AB6A 5IMAA 4JE1A 4GCIA 2QSIA 5DQYA 4L5OA 5AIXA 3LWAA 1F3BA 2N5FA 1E2YA 3EVIA 3ZFLA 4OO4A 4OFMA 3GX8A 4KUNA 5IM9A 2VCVA 4IELA 4BL7A 1X5EA 2O87A 4BVXB 4ZB8A 1ZOFA 3F3RA 1R7HA 4K7IA 1OAZA 2LKUA 4K9ZA 1O7UA 2C0FA 5AN1A 4MPGA 1X5CA 5JCUA 2IFQA 3TJJA 3F4RA 1WWJA 2H6ZA 3L0HA 4WBJA 3U5RE 3WGDA 4TR0A 1V98A 1E6BA 3H93A 3FR9A 2DJKA 1AW9A 3P2AA 1AQWA 5JCGA 3IR4A 3KP9A 1XVQA 4L0UA 5DALA 2AAWA 4TXOB 4QL7A 3LGCA 2PVQA 2PMTA 3R2QA 2REMA 5DAKB 5DDLA 3CSIA 1MD3A 1S3CA 1FB0A 3UARA 1OC9A 2YV7A 2H74A 4RQRA 1OYJA 2HSMA 1ERTA 1PSQA 1EP7A 3CRTA 3VWXA 1WOUA 4F9ZA 2VL2A 2NPBA 4EDZA 1U87A 2JACA 2L6CA 1AAZA 1K0MA 4K1FA 2X64A 4N0ZA 3VI5A 2YZHA 5JCWA 1GLQA 4ACSA 4IW9A 2HFDA 5E59A 2HRAA 5CRDA 3J7Yb 4TR1A 1N2AA 3M3MA 3GUSA 2CVBA 5DAKA 1HNCA 1A23A 4MABA 3I6AA 1SK1A 4OO5A 1B4PA 4IKHA 2FWFA 3APQA 4OCFA 4ZXGA 3ERGA 1VF3A 3P90A 2H1AA 3EWLA 4XCSA 3C8EA 1DUGA 3FZ5A 8GSSA 1YY7A 1RW1A 4ZL7A 2DMMA 1R4WA 2F51A 3GKXA 4IP6A 4BPYA 5CYYA 1K3LA 5C00A 4XRDA 4K0GA 4N30A 4ECCA 4JR4A 1V57A 1JHBA 2FGXA 3DIEA 3TJKA 5E4WA 2YN1A 5D73A 4KDYA 1U88A 1B48A 3QAGA 3BOAA 3DVXA 2VD1A 2B1KA 4V1Ag 5D93A 1S3DA 4JZQA 1EGRA 4IJ3A 2M46A 2VIMA 1M0UA 2DIYA 2IJYA 5IMVA 3CYNA 5KEJA 4GXZA 4XRAA 5HR0A 1IYHA 4CHSA 2LEGA 3FR6A 4GTUA 3IXRA 3KM6A 2H73A 2GDRA 2E2MA 5D8IA 1JZRA 2VLTA 1MDJA 3IV4A 3QAWA 1XBSA 3W8SA 2M72A 3FY7A 2JZTA 2VCZA 1PQNA 5ECSA 5EY6A 3DD3A 3GRXA 3CTGA 2MMAA 5B6MA 2CQ9A 2AYTA 2KUCA 2MYGA 2VD0A 2B5EA 4IN0A 3LFLA 5A4WA 2DC5A 4HDEA 2OA7A 4HZ4A 2V41A 4ZL9A 1YKCA 5INYA 2FWHA 3WYWA 2DSAA 5ECNB 2DIZA 2WZ9A 4IBPA 2MMNA 4FIWA 4OMVA 5DJLA 4PQIA 3L9VA 4HZ2A 4YAVA 5H5QA 1M2BA 2OJLA 4WF4A 3TOUA 1M7TA 1AUCA 5J9CA 3V1WA 4NWYA 1W4VA 5IMZA 2EIRA 1TK8B 1K3OA 1I5GA 3E9JB 2DJ3A 3GL3A 3D21A 1TU8A 5F05A 5CP1A 5ABRA 1A2MA 4PXOA 2IPAA 4O5RA 4AJ6A 4MMMA 2IL3A 1M9AA 1Y6EA 3Q18A 4GWRA 3KMOA 5D9XA 1GSEA 4TR3A 3UVTA 3IE3A 4NV2A 4HOJA 1B9XC 3C71A 4IGJA 2IMDA 1SL2B 2RUFA 1XPVA 1GTBA 4GSSA 4BVYB 1O85A 3CBUA 3BD2A 3HKRA 2IMIA 2DJ0A 1XZOA 2O85A 2F3MA 2HZFA 6GSTA 4MZBA 3US3A 2GVPA 2K8VA 1GH2A 2YWMA 2BMXA 5ECIB 1FVJA 1TK0B 2VL3A 4NMUA 11GSA 1EOHA 2IIYA 3H8QA 1Q98A 3LQ7A 2D2ZA 2WRTA 3KH9A 4OFNA 1GSUA 3F6DA 4POBA 3GIXA 3H4KA 2LS5A 5CO3A 4BVYA 4D73B 2YANA 1GTAA 1B9YC 4KDUA 3ISOA 1TRUA 4MJCA 7GSSA 2JZRA 3RHBA 1HQOA 2H6XA 1WMJA 4ZBBA 1CQGA 2HQTA 3TKSA 1XWKA 2V32A 2L4QA 4JR6A 5JWRB 5IPGA 2H8LA 2V1MA 3LORA 4ECBA 4N0VA 4PURA 4CDOA 3D6IA 3N9JA 3TDGA 6GSYA 3W6GA 2MMZA 3KZQA 5D9WA 4DSQA 1EP8A 1XVWA 3O6TA 1GSFA 2XBQA 3P8WA 1YZXA 1MDIA 2HE3A 3DYRA 2CVDA 5H5RA 3APSA 4TKYA 1K0NA 4KX4A 2VLUA 5ECRB 2DJ2A 2IN3A 3D5JA 2LNSA 3C73A 4K0NA 1ILOA 4XS4B 5CRGA 5HR2A 5J41A 4ID0A 2MBSA 1ZYEA 2HXKA 3ERFA 4EO3A 1SKRB 4P3YB 5B6NA 3UMAA 3AY8A 2AHEA 2KP2A 3L78A 1WE0A 1YF1A 3PR8A 1USBA 2LTKA 1TDIA 4YAPA 1GNEA 2K6VA 4WR4A 4O7HA 1XW6A 3KP8A 2I3YA 1FOVA 3FYGA 2M80A 4GLTA 2C0DA 2YJHA 4L0WA 5COHA 1TW9A 5IIZA 2LRCA 4LA1A 3IDVA 3IHQA 3ZIJA 3CSJA 2EIOA 1F37A 1YJ6A 1SK2A 4EF0A 2O8VB 3ZMLA 1PX7A 4USSA 3IPZA 1I9DA 3PH9A 1GSDA 1ZGNA 4IJIA 4ZB6A 4BL7B 3FZ9A 3HZ4A 3MAKA 2CAIA 2E7PA 3TRPA 4KW6A 5CREA 3ZYWA 2HZEA 1OKDA 4MF6A 3HY2A 3F8UA 1AQVA 2CVKA 2JSZA 1A24A 1Z6NA 1EV9A 3VI7A 1Z6MA 3WT2A 4I6XA 2VCQA 5B7CA 2H0IA 4RQXA 1B8XA 2IFQB 4IHUA 1GP1A 5IQYA 4K6XA 2VM1A 4MPFA 3WGXA 5D9TA 2LJAA 4KCEA 5IOWA 4JU5A 4ECJA 5HR1A 3RAZA 3EURA 4BWSA 5DALB 2B5XA 2B6MA 3GURA 2FHEA 4ISDA 2V6KA 3P7XA 2BTOT 2FCHA 1RK4A 1QK8A 1AIUA 1JLVA 2I4AA 4G0LA 1OC9B 3DRNA 4YH2A 1JFUA 1NM3A 2HSMB 13GSA 4LL4B 3HVSA 2EIQA 4JBBA 4L5LA 2GSRA 3SWLA 4ZBAA 1H4OA 2IMEA 4I97A 2H30A 5L71A 3TUEA 4HJ2A 3RBTA 3IK9A 2C4JA 5FT3A 4K7NA 4WXTA 5CNWA 3KIJA 3Q6OA 4MDCA 1HNAA 3A2VA 5ID2B 2H1GA 3FKFA 3GH6A 2HI7A 2DJJA 4TR1B 22GSA 2XC2A 3IA1A 3DKSA 1SKSB 5J5NA 2E0QA 3IC8A 2LJKA 4G10A 3HDCA 2TIRA 1GUHA 1MD4A 2XBIA 1T7PB 4J2FA 5IMFA 19GSA 1Z9HA 2FWEA 2JU5A 4O32A 2Z9SA 1BQ7A 2VCTA 1SYRA 4MCUA 2PGTA 4MF7A 1V9WA 2L59A 4NAXA 2YWIA 3E0UA 5ID2A 3MSZA 2LRTA 1M2AA 6GSSA 1M99A 2HNLA 2LQOA 2KLXA 4MJEA 4GRFA 1A0FA 2PN8A 4LL1B 1A8YA 3F0IA 4EDYA 1AQXA 3FW2A 2FUG2 3HVXA 5CAXA 3M9JA 2NTOA 3BBYA 5IPHA 1ZZYA 2YNXA 2VM2A 4POLA 2R4VA 1G7OA 3H79A 4EVMA 2P5QA 1A2JA 3CMIA 3KD0A 2KP1A 3ZMKA 3KTLA 2GSTA 2HRKA 4V2MA 2C8UA 3CSHA 3TKQA 1SJZA 2GQKA 3MWHA 2HT9A 1ABAA 4PUFC 5ELAA 3QFAC 4PTSA 4YQVA 1F9MA 2KOKA 2VOCA 1V40A 5ECHB 2ALBA 3RPPA 1MEKA 2YCDA 3ZTLA 2G0FA 4GQFA 3EE2A 1GRXA 3VURA 3A3TA 1URMA 3IAM2 3MNGA 5DQSA 2ZUPA 4JRRA 3PPUA 2X99A 4ILFA 2H1DA 4KDXA 1FAAA 2FY6A 2RM6A 5ECPB 4KGIA 2L5LA 1QUWA 2I9HA 1NHYA 1ZMAA 1M2DA 4ZIJA 3S9FA 17GSA 3GTUB 2VAFA 2UZ8A 4QL9A 4F03A 4TR4A 3WD6A 3QD9A 5H5SA 3VWWA 4MJAA 2OACA 4TW5A 4TXVA 2ON7A 1ZCPA 4GQCA 5KN1A 3GKMA 1MTCA 3DVWA 2P5RA 3VWVA 4KA0A 2FWGA 3LG6A 2L5OA 3C1SA 3DMLA 3TKSE 4K8MA 3GV1A 3Q74A 3QCPA 3TJGA 3HJPA 5G1LA 2HLSA 3BCIA 2VLVA 4PUAA 2RLIA 2VCWA 5HFGA 2CZ2A 5AISA 4Q5QA 1XFLA 1YEXA 1MDKA 1SK0A 2C3NA 2XHFA 4GSTA 3GTUA 2LQQA 3W8JA 4FYUA 4MF5A 3DWVA 1Z7RA 5ECQB 1ERWA 5J4UA 1Q4JA 4ZILA 2L4CA 3A5WA 1PN9A 2FD3A 3MDKA 3U6VA 4V2LA 2DLXA 2IMKA 1FO5A 1FHEA 1ZL9A 1XWGA 1BG5A 3DEXA 4IQ1A 2YWNA 4FH8A 2R6KA 3QR6A 1T4YA 2H01A 1GTUA 2VL2C 4MH3A 4TVEA 1GLPA 2YOIA 3DGQA 1R26A 4HQSA 1A8LA 2C3TA 2OE1A 3R3EA 4NPBA 3KH7A 1S3AA 3L9SA 3UL3A 1K0BA 2TRCP 2GT5A 4Z7XA 4HEA2 2X8HA 1TOFA 5ECLB 3VWUA 5KN2A 1EV4A 5A4UA 4MZWA 3ZFBA 3GN3A 4QQ7A 4OWYA 3D0ZA 5ENUA 2WDUA 1QXHA 1SL0B 1TU7A 1XOBA 1C72A 3ZRDA 3FHKA 2DMLA 1GSYA 1SD9A 5GSSA 4J57E 4O92A 4IP1A 5HFKA 2GQMA 1A2LA 2HRFA 4ML1A 2XPDA 4F0CA 2BJXA 3HCZA 4OD7A 1ON4A 3TRXA 1GUMA 5ELGA 1YQ1A 3HZ8A 3KTBA 3OR5A 3QOUA 3ZVJA 1V58A 3C7MA 1FW1A 1TJDA 2QGVA 1WPIA 1GL8A 4YQMA 4EL1A 4XHMA 4N11A 1DE2A 4IVFA 1GUKA 3GFKA 1NSWA 2IMFA 4L8EA 2O89A 2NDOA 3NZNA 3G7YA 2HSYA 1H75A 3CXGA 3O76A 4ZBDA 1SJ6A 2A4VA 4G19A 2GZZA 3RPNA 3WT1A 1WJKA 1OC3A 2H76A 2H19A 2VO4A 2PVOC 4XS6A 3GL5A 4LMWA 3ZVJD 2MBTA 2WB9A 4GF0A 3FZ4A 3TRQA 3EU4A 1WIKA 4I2UA 4YQUA 10GSA 1U3IA 3IOSA 5ECMB 3F6FA 2PERA 1ACVA 3I9V2 1O73A 2I81A 2CAQA 3LYPA 3UAPA 1J08A 1XIYA 2HZEB 5EL8A 4G9HA 3APOA 5IOXA 2C3QA 3FEUA 4DSSA 4BA7A 1QMVA 3BCKA 6GSXA 2A2RA 1J9BA 1F6MC 1DBYA 5AGYA 1K3YA 4X1UA 1XW9A 1Z3EA 4POKA 4Q5FA 3F4TA 2OBKA 4EUYA 2LJRA 4GSNA 2X8GA 3VK9A 4MK3A 4LMVA 4TN8A 3QFBC 3TGZA 5B8AA 4H86A 1K0CA 3L4NA 5HR3A 2JL4A 1XW5A 5ECKB 2B5YA 1YF0A 4KE3A 3GSTA 5CRWA 4ULXA 3HD5A 1BAYA 3IRAA 2GTUA 1GSQA 2CX4A 2H75A 3LXZA 5G5FA 3UEMA 2GZYA 3UVHA 3CRUA 2IWTA 18GSA 3M1GA 3D4MA 1G7EA 1JZOA 4KSOA 1OVNA 1TI1A 4WEYA 2OADA 1TRVA 5BMUA 1HYUA 1SD8A 3TJFA 1PGTA 3QPMA 2ZCTA 4MA9A 2FA8A 1SU9A 3GH9A 3HYPA 1TKDB 4K2DA 1F3AA 1HNBA 3EMPA 5B8BA 3A2WA 1VGLA 2RM5A 2B7JA 2OBIA 4EXJA 4TOPA 4PNGA 1J0FA 3HJOA 2ES7A 4I2TA 1PX6A 1UA5A 3GHAA
chains in the Genus database with same CATH superfamily
2OE0A 4KSMA 2WVXB 2YJ7A 2PUKC 4CW9A 3FZAA 3F63A 3G7JA 1LJRA 2J23A 1TXXA 1PD21 2R2JA 4GDFA 3PGTA 4RI7A 3VPTA 1HD2A 1NHOA 3ZREA 1EWXA 1PA3A 2X8CA 1UVZA 1TK5B 1GSSA 2N5BA 3D4TA 3HXSA 2L57A 2C80A 2H1BA 3H1NA 4MNNA 4Q5NA 3TKSC 3UBKA 5JWOB 2PPTA 1B4QA 4OFTA 1SVLA 1SL1B 4AF2A 1Y25A 1KTEA 4I5QA 4MLYA 9GSSA 2WVXA 3GMFA 1SENA 2P0GA 4BVXA 4PNFA 2HRKB 5G30A 5LNKe 3GSSA 2AUVA 4LLRA 1BJXA 4WF5A 3TOTA 3K8NA 3KEBA 4I8BA 3HJMA 4MZCA 2XPEA 1X9MB 1YVLA 2VKZG 5IMDA 4E8EA 3C1RA 1NW2A 4NHZA 1VF4A 3EMXA 5D96A 2GSSA 4WBRD 3HVVA 2TRXA 4ZB9A 1G0TA 4TXOA 3F4SA 2F8AA 2GGTA 1U6TA 3WGEA 1M9BA 3LSZA 1SJIA 4MP4A 6GSWA 3ZIVA 2GSQA 4XTSA 5GZZB 2CZ3A 4V1Ap 2H66A 2H70A 3TB2A 1W89A 2MMOA 2YZUA 4HQZA 1KNGA 3KJYA 2WJUA 2UV8G 2MZCA 3KCMA 2WS2A 2G2QA 2O3EA 2B7KA 1ST9A 3GKKA 4F2IA 2LSTA 1VF2A 4XIHA 4MH2A 4ECIA 5C04A 2WCIA 5F07A 1THOA 2LUSA 2NBSA 3GA4A 1Y1UA 3ME8A 3UJ1A 1X9SB 4FYCA 4E8HA 1TP9A 2LV3A 3I43A 3LYKA 4NXIA 4Z2RA 3ZLPA 2O7KA 2VL9A 1FB6A 3M8NA 3ERWA 3TCOA 4KF9A 1KEBA 3RHCA 1GWCA 4HI7A 1TTZA 2CT6A 2H72A 2OE3A 4RI6A 3SBCA 2GT6A 2DJ1A 4ICYA 2WW1A 5F06A 2GS3A 5DVBA 1BX9A 2OT3A 1T8EB 2C0EA 4XS1A 3GNJA 5IMCA 2CA8A 4F0BA 1VF1A 1XXUA 3ZITA 4BWQA 2EC4A 1M3JA 5CRHA 2WGRA 4G0KA 4EE0A 3ZL5A 2YWOA 1Z5YE 2EFCA 1R5PA 1GNWA 4POMA 5A5KA 4ML6A 4WETA 2LNTA 4MJBA 4PX1A 4CY8A 1ERUA 2GQLA 2OKAA 4FO5A 2WFCA 2I1UA 3EYTA 3EINA 2R37A 3RDWA 1QQ2A 1O8XA 2HSHA 4N10A 2KHPA 1X5DA 4HS1A 3Q19A 1Z7PA 1PL2A 4EIPA 2R3XA 3NIVA 3D22A 2QKEA 4AJ7A 6GSUA 4HU9A 3PINA 4PGTA 3GKNA 1N8JA 4K5SA 1PMTA 3IC4A 1U3AA 3GX0A 2ZNMA 4AJ8A 1PKWA 1RQMA 5A4VA 3FR3A 2VCXA 1XCCA 4W66A 2JSYA 5LCZA 1O6JA 3BJ5A 1QGVA 1GULA 4HJMA 5AIVA 4JEDA 4K7OA 2A2SA 3O3TA 1K0DA 3LEFA 3G7IA 1BF5A 2GLRA 2P31A 1AXDA 2HRNA 4EKZA 4KAEA 4AI6A 1K0OA 1YEPA 4IS0A 3TKPA 3QAVA 2K18A 4RUVA 4X43A 6GSVA 2V2GA 5F8BA 1K0AA 1A0RP 2YPMA 2V6OA 1SVMA 5DCHA 3KGKA 1TRWA 1PKZA 2A2PA 1XOAA 2PBJA 2QC7A 2YP6A 5HQPA 5ECOB 4AGSA 4V2NA 4NHWA 1VRSD 5G2ZA 3QMXA 3EPTA 1ERVA 5HFIA 3J7Yk 2EFHA 3M0FA 2FA4A 4IQAA 1SYXA 4FQUA 2HSNB 1ML6A 2F8FA 1LU4A 4Q5RA 4DVCA 2AJQB 1IYIA 1OE8A 4DSRA 3F3QA 1TI3A 1EOGA 4ZB7A 1DE1A 1T3BA 2LRNA 2GZPA 5JWQB 3VPQA 4X0XA 1T00A 5GAPD 1JZWA 2H0GA 3UOMA 5EPFA 2NVLA 5J9BA 4HU7A 4G2EA 3HA9A 2E2GA 3LJRA 5FWGA 2N5AA 5A5HA 1YEWC 3QDNA 3IBHA 12GSA 2R5GA 4KCAA 2QA1A 1YDKA 3UBLA 1V2AA 2DBCA 3FK8A 3ED3A 2HSNA 1OC8A 1JLWA 2K8SA 1T1VA 2FLSA 5DCGA 4TRXA 5G5EA 4G0IA 2C0GA 1GTIA 4OCEA 4WR5A 1O8WA 4DSSB 2HYXA 3F9UA 4J56E 3EC3A 2RIIA 1UN2A 3HHVA 1X0RA 3DXBA 5GSTA 3N5OA 2RUEA 1ZYQB 4WKWA 1O81A 1TRSA 1JZDA 1WRYA 1LBKA 5D9VA 1XWAA 3JCML 4D73A 4BIKA 5IO2A 2ON5A 3KXOA 2C1YA 3G9BA 1DSBA 5KOWA 14GSA 5DJMA 2VUPA 5KN3A 1EEMA 4DEJA 2JADA 16GSA 1EGOA 1PRXA 2H0HA 1YKAA 2F9SA 3EU3A 5G1KA 2H6YA 2PU9C 3L9UA 1THXA 4KNDA 4F82A 1FVKA 5J4VA 1PL1A 2JZSA 5J3RA 3KMNA 3VLNA 2WULA 1OKTA 2CX3A 1CQHA 3E3EA 5F0GA 1SKWB 1R5AA 5DBQA 5G31A 3TJBA 2L6DA 2CV4A 2PWJA 5FHIA 1G6YA 3M9KA 1T4ZA 3ZZXA 5BMUB 2B3SA 2J9HA 2WVYA 1KBNA 1F2EA 5GAND 1XWCA 3ME7A 1UC7A 3TKRA 4EC0A 5KN0A 4PQ1A 2B1LA 4QMKA 4PQHA 5EVOA 1AC1A 20GSA 3IAS2 2H71A 2YV9A 1X9WB 4XS4A 4ZL8A 4O5UA 4NV5A 3I69A 1QFNA 1BYEA 1OE7A 5LD0A 4HUAA 1G6WA 3UIWA 4KB3A 2FNOA 3VFIA 3GYKA 1EZKA 3CTFA 2K9FA 1EEJA 1FG4A 3LXTA 4KH7A 4FYBA 1FOHA 3A2XA 3NOFA 1WP0A 3IK7A 2EFEA 2H1LA 2AV4A 1BEDA 3FRCA 1XWBA 5IO0A 2AB6A 5IMAA 4JE1A 4GCIA 2QSIA 5DQYA 4L5OA 4YKFA 5AIXA 5A34B 3LWAA 1F3BA 2N5FA 1E2YA 3EVIA 3ZFLA 4OO4A 4OFMA 3GX8A 4KUNA 5IM9A 2VCVA 4IELA 4BL7A 1X5EA 2O87A 4BVXB 4ZB8A 1ZOFA 3F3RA 1R7HA 4K7IA 1OAZA 2LKUA 4K9ZA 1O7UA 2C0FA 5AN1A 4MPGA 1X5CA 5JCUA 4K2XA 2IFQA 3TJJA 3F4RA 1WWJA 2H6ZA 3L0HA 4WBJA 3U5RE 3WGDA 4TR0A 1V98A 5A34A 1E6BA 3H93A 3FR9A 2DJKA 1AW9A 3P2AA 1AQWA 5JCGA 3IR4A 3KP9A 1XVQA 4L0UA 5DALA 2AAWA 4TXOB 4QL7A 3LGCA 2PVQA 2PMTA 3R2QA 2REMA 5DAKB 5DDLA 3CSIA 1MD3A 2R0GA 1S3CA 1FB0A 3UARA 1OC9A 2YV7A 2H74A 4RQRA 1OYJA 2HSMA 1ERTA 1PSQA 1EP7A 3CRTA 3VWXA 5A1NB 1WOUA 4F9ZA 2VL2A 2NPBA 4EDZA 5J47A 1U87A 2JACA 2L6CA 1AAZA 1K0MA 4K1FA 3FMWA 2X64A 4PHZC 4N0ZA 3VI5A 2YZHA 5JCWA 1GLQA 4ACSA 4IW9A 2HFDA 5E59A 2HRAA 5CRDA 3J7Yb 4TR1A 1N2AA 3M3MA 3GUSA 2CVBA 5DAKA 1HNCA 1A23A 4MABA 3I6AA 1SK1A 4OO5A 1B4PA 4IKHA 2FWFA 1ZYNA 3APQA 4OCFA 4ZXGA 3ERGA 5A1NA 1VF3A 3P90A 2H1AA 3EWLA 4XCSA 3C8EA 4E68A 1DUGA 3FZ5A 8GSSA 1YY7A 1RW1A 1XG8A 4ZL7A 2DMMA 1R4WA 2F51A 3GKXA 4IP6A 4BPYA 5CYYA 1K3LA 5C00A 4XRDA 4K0GA 4N30A 4ECCA 4JR4A 1V57A 1JHBA 2FGXA 3DIEA 3TJKA 5E4WA 2YN1A 5D73A 4KDYA 1U88A 1I1IP 1B48A 3QAGA 3BOAA 3DVXA 2VD1A 2B1KA 4V1Ag 5D93A 1S3DA 4JZQA 1EGRA 4IJ3A 2M46A 2VIMA 1M0UA 2DIYA 2IJYA 5IMVA 3CYNA 5KEJA 4GXZA 4XRAA 5HR0A 1IYHA 4CHSA 2LEGA 3FR6A 4GTUA 3IXRA 3KM6A 2H73A 2GDRA 2E2MA 5D8IA 1JZRA 2VLTA 1MDJA 3IV4A 3QAWA 1XBSA 3W8SA 2M72A 3FY7A 4AKXB 2JZTA 2VCZA 1PQNA 5ECSA 5EY6A 3DD3A 1N25A 3GRXA 3CTGA 2MMAA 5B6MA 2CQ9A 2AYTA 2KUCA 2MYGA 2VD0A 2B5EA 3LFLA 5A4WA 4IN0A 2DC5A 2OA7A 4HDEA 4HZ4A 2V41A 4ZL9A 1YKCA 5INYA 2FWHA 3WYWA 2DSAA 5ECNB 2DIZA 2WZ9A 4IBPA 2MMNA 4FIWA 4OMVA 5DJLA 4PQIA 3CQFA 1SVOA 3L9VA 4HZ2A 4YAVA 5H5QA 1M2BA 2OJLA 4WF4A 3TOUA 1M7TA 1AUCA 5J9CA 3V1WA 4NWYA 1W4VA 5IMZA 2EIRA 1TK8B 1K3OA 1I5GA 3CHXC 3E9JB 2DJ3A 3GL3A 3D21A 1TU8A 5F05A 5CP1A 2WZSA 5ABRA 1A2MA 4PXOA 2IPAA 4O5RA 4AJ6A 4MMMA 2IL3A 1M9AA 1Y6EA 5J4YA 3Q18A 4GWRA 3KMOA 5D9XA 1GSEA 4TR3A 3UVTA 3IE3A 4NV2A 4HOJA 1B9XC 3C71A 4IGJA 2IMDA 1SL2B 2RUFA 1XPVA 1GTBA 5A5HB 4GSSA 4BVYB 1O85A 3CBUA 3BD2A 4Z2TA 3HKRA 2IMIA 2DJ0A 1XZOA 3LW9A 2O85A 2F3MA 2HZFA 6GSTA 4MZBA 3US3A 2GVPA 2K8VA 1GH2A 2YWMA 2BMXA 5ECIB 1FVJA 1TK0B 2X4AA 2VL3A 4NMUA 11GSA 1EOHA 2IIYA 3H8QA 1Q98A 3LQ7A 2D2ZA 2WRTA 3KH9A 1M3IA 4OFNA 1GSUA 3F6DA 4POBA 3GIXA 3H4KA 2LS5A 5CO3A 3HVNA 3A5IA 4AKGA 4K5RA 4BVYA 4D73B 2YANA 1GTAA 1B9YC 4KDUA 3ISOA 1TRUA 4MJCA 7GSSA 2JZRA 3RHBA 1HQOA 2H6XA 1WMJA 4ZBBA 1CQGA 2HQTA 3TKSA 1XWKA 2V32A 4AKIA 2L4QA 4JR6A 5JWRB 5IPGA 2H8LA 2V1MA 3LORA 4ECBA 4N0VA 4PURA 4CDOA 4FXYP 3D6IA 3N9JA 3TDGA 6GSYA 3W6GA 1PN0A 2MMZA 3KZQA 5D9WA 4DSQA 1EP8A 1XVWA 3O6TA 1GSFA 2XBQA 3P8WA 1YZXA 1MDIA 2HE3A 3DYRA 2CVDA 5H5RA 4Z2UA 3APSA 4TKYA 1K0NA 4KX4A 2WW3A 5ECRB 2VLUA 2DJ2A 2IN3A 3D5JA 2LNSA 3C73A 2QA2A 4K0NA 1ILOA 4XS4B 5CRGA 5HR2A 5J41A 4ID0A 2MBSA 1ZYEA 2HXKA 3ERFA 4EO3A 1SKRB 4P3YB 5B6NA 3UMAA 3AY8A 2AHEA 2KP2A 3L78A 1WE0A 1YF1A 3PR8A 1USBA 2LTKA 1TDIA 4YAPA 1GNEA 2K6VA 4WR4A 4O7HA 1XW6A 3KP8A 2I3YA 1FOVA 3FYGA 2M80A 4GLTA 2C0DA 2YJHA 4L0WA 5COHA 1TW9A 5IIZA 2LRCA 4LA1A 2O5VA 3IDVA 3IHQA 3ZIJA 3CSJA 2EIOA 1F37A 1YJ6A 1SK2A 2R0PA 4EF0A 2O8VB 3ZMLA 1PX7A 4USSA 3IPZA 1I9DA 3PH9A 1GSDA 1ZGNA 4IJIA 4ZB6A 4BL7B 3FZ9A 3HZ4A 3MAKA 2CAIA 2E7PA 3TRPA 4KW6A 2DKHA 5CREA 3ZYWA 2HZEA 1OKDA 4MF6A 3HY2A 3F8UA 1AQVA 3MYDA 2CVKA 2JSZA 1A24A 1Z6NA 1EV9A 3VI7A 1Z6MA 3WT2A 4I6XA 3HMJG 2VCQA 5B7CA 2H0IA 2R0CA 4RQXA 1B8XA 2IFQB 4IHUA 1GP1A 5IQYA 4K6XA 2VM1A 4MPFA 3WGXA 5D9TA 2LJAA 4KCEA 5IOWA 4JU5A 4ECJA 5HR1A 3RAZA 3EURA 4BWSA 2EFDA 5DALB 2B5XA 2B6MA 3GURA 2FHEA 4ISDA 2V6KA 3P7XA 2BTOT 2FCHA 1RK4A 1QK8A 1AIUA 1JLVA 2I4AA 5J40A 4G0LA 1OC9B 3DRNA 4YH2A 1JFUA 1NM3A 2HSMB 13GSA 4LL4B 3MIXA 3HVSA 2EIQA 4JBBA 4L5LA 2GSRA 3SWLA 4ZBAA 1H4OA 2IMEA 4I97A 2H30A 5L71A 3TUEA 4HJ2A 3RBTA 3IK9A 2C4JA 5FT3A 4K7NA 4WXTA 5CNWA 3KIJA 3Q6OA 4MDCA 1HNAA 3A2VA 5ID2B 2H1GA 3FKFA 3TU3B 3GH6A 2HI7A 2DJJA 4TR1B 22GSA 2XC2A 3IA1A 3DKSA 1SKSB 5J5NA 2E0QA 3IC8A 2LJKA 4G10A 3HDCA 2TIRA 1GUHA 1MD4A 2XBIA 1T7PB 4J2FA 5IMFA 19GSA 1Z9HA 2FWEA 2JU5A 4O32A 2Z9SA 1BQ7A 2VCTA 1SYRA 4MCUA 2PGTA 4MF7A 1V9WA 2L59A 3RGBC 4NAXA 2YWIA 3E0UA 5ID2A 3MSZA 2LRTA 1M2AA 6GSSA 1M99A 2HNLA 2LQOA 4A5PA 2KLXA 4MJEA 4GRFA 1A0FA 2PN8A 4LL1B 1A8YA 3F0IA 4EDYA 1AQXA 3FW2A 2FUG2 3HVXA 4G01A 5CAXA 3M9JA 2NTOA 3BBYA 5IPHA 1ZZYA 2YNXA 2VM2A 4POLA 2R4VA 1G7OA 3H79A 4EVMA 2P5QA 1A2JA 3CMIA 3KD0A 2KP1A 3ZMKA 3KTLA 2GSTA 2HRKA 4V2MA 2C8UA 3CSHA 3TKQA 1SJZA 2X49A 2GQKA 3MWHA 2HT9A 1ABAA 4PUFC 5ELAA 3QFAC 4PTSA 4YQVA 1F9MA 2KOKA 2VOCA 1V40A 5ECHB 2A4HA 2ALBA 3RPPA 1MEKA 3CWGA 2YCDA 3ZTLA 2G0FA 4GQFA 3EE2A 1GRXA 3VURA 3A3TA 1URMA 3IAM2 3MNGA 5DQSA 2ZUPA 4JRRA 3PPUA 2X99A 2WW2A 4ILFA 2H1DA 4KDXA 1FAAA 4PI2C 2FY6A 2RM6A 5ECPB 4KGIA 2L5LA 1QUWA 2I9HA 1NHYA 1ZMAA 1M2DA 4HSCX 4ZIJA 3S9FA 17GSA 3GTUB 2VAFA 2UZ8A 4QL9A 4F03A 4TR4A 3WD6A 3QD9A 5H5SA 3VWWA 4MJAA 2OACA 4TW5A 4O5QA 4TXVA 2ON7A 1ZCPA 4GQCA 5KN1A 3GKMA 1MTCA 3DVWA 2P5RA 3VWVA 4KA0A 2FWGA 1TXUA 3LG6A 2L5OA 3C1SA 3DMLA 3TKSE 4K8MA 4X4JA 3GV1A 3Q74A 3QCPA 3TJGA 3HJPA 5G1LA 2HLSA 3BCIA 2VLVA 4PUAA 2RLIA 2VCWA 5HFGA 2CZ2A 5AISA 4Q5QA 1XFLA 1YEXA 1MDKA 1SK0A 2C3NA 2XHFA 4GSTA 3GTUA 2LQQA 3W8JA 4FYUA 4MF5A 3DWVA 1Z7RA 5ECQB 1ERWA 5J4UA 2O36A 1Q4JA 4ZILA 2L4CA 3A5WA 1PN9A 2FD3A 3MDKA 3U6VA 4V2LA 2DLXA 2IMKA 1FO5A 1FHEA 1ZL9A 1XWGA 1BG5A 3DEXA 4IQ1A 2YWNA 4FH8A 2R6KA 3QR6A 1T4YA 2H01A 1GTUA 2VL2C 4MH3A 4TVEA 4AKHA 1GLPA 2YOIA 3DGQA 1R26A 4HQSA 1A8LA 2C3TA 2OE1A 3R3EA 4NPBA 3KH7A 1S3AA 3L9SA 3UL3A 1K0BA 2TRCP 2GT5A 4Z7XA 4HEA2 4YKGA 2X8HA 1TOFA 5ECLB 3VWUA 5KN2A 1EV4A 5A4UA 4MZWA 3ZFBA 3GN3A 4QQ7A 4OWYA 5KOXA 3D0ZA 3RFRC 5ENUA 2WDUA 1QXHA 4N3ZA 1SL0B 1TU7A 1XOBA 1C72A 3ZRDA 3FHKA 2DMLA 1GSYA 1SD9A 5GSSA 4J57E 4O92A 4IP1A 5HFKA 2GQMA 1A2LA 2HRFA 4ML1A 2XPDA 4F0CA 2BJXA 3HCZA 4OD7A 1ON4A 3TRXA 1GUMA 5ELGA 1YQ1A 3HZ8A 3KTBA 3OR5A 3QOUA 3ZVJA 1V58A 3C7MA 1FW1A 1TJDA 2QGVA 1WPIA 1GL8A 4YQMA 4EL1A 4XHMA 4N11A 1DE2A 4IVFA 1GUKA 3GFKA 1NSWA 2IMFA 4CY6A 4L8EA 2O89A 2NDOA 3NZNA 3G7YA 2HSYA 1H75A 3CXGA 3O76A 4ZBDA 1SJ6A 2A4VA 2WW0A 4G19A 2GZZA 3RPNA 4EIQA 3WT1A 1WJKA 1OC3A 2H76A 2DKIA 2H19A 2VO4A 2PVOC 4XS6A 3GL5A 4LMWA 3ZVJD 2MBTA 2WB9A 4GF0A 3FZ4A 3TRQA 3EU4A 1WIKA 4I2UA 4YQUA 10GSA 1U3IA 3IOSA 5ECMB 3F6FA 2PERA 1ACVA 1S4BP 3I9V2 1O73A 2I81A 2CAQA 3LYPA 3UAPA 1J08A 1XIYA 2HZEB 1S3RA 5EL8A 4G9HA 1ZYPA 3APOA 1BG1A 5IOXA 2C3QA 3FEUA 4DSSA 5BRTA 4BA7A 1QMVA 3BCKA 6GSXA 2A2RA 1J9BA 1F6MC 1DBYA 5AGYA 1K3YA 4X1UA 1XW9A 1Z3EA 4POKA 4Q5FA 3F4TA 2OBKA 4EUYA 2LJRA 4GSNA 2X8GA 3VK9A 4MK3A 4LMVA 4TN8A 3QFBC 3TGZA 5B8AA 4H86A 1K0CA 3L4NA 5HR3A 2JL4A 1XW5A 5ECKB 2B5YA 1YF0A 4KE3A 3GSTA 5CRWA 4ULXA 3IHGA 3HD5A 1BAYA 3IRAA 2GTUA 1GSQA 4PI0C 2CX4A 2H75A 3LXZA 5G5FA 3UEMA 2GZYA 3UVHA 3CRUA 2IWTA 18GSA 3M1GA 3D4MA 1G7EA 1JZOA 4KSOA 1OVNA 1TI1A 4WEYA 2OADA 1TRVA 5BMUA 1HYUA 1SD8A 3TJFA 1PGTA 3QPMA 2ZCTA 4MA9A 2FA8A 1SU9A 3GH9A 3HYPA 1TKDB 4K2DA 1F3AA 1HNBA 3EMPA 5B8BA 3A2WA 1VGLA 2RM5A 2B7JA 2OBIA 4EXJA 2WVZA 4TOPA 4PNGA 1J0FA 3HJOA 2ES7A 4I2TA 1PFOA 1PX6A 1UA5A 3GHAA
chains in the Genus database with same CATH topology
2OE0A 4KSMA 2YJ7A 2PUKC 4CW9A 3FZAA 3F63A 3G7JA 1LJRA 2J23A 1TXXA 1PD21 2R2JA 4GDFA 3PGTA 4RI7A 3VPTA 1HD2A 1NHOA 3ZREA 1EWXA 1PA3A 2X8CA 1UVZA 1TK5B 1GSSA 2N5BA 3D4TA 3HXSA 2L57A 2C80A 2H1BA 3H1NA 4MNNA 4Q5NA 3TKSC 3UBKA 5JWOB 2PPTA 1B4QA 4OFTA 1SVLA 1SL1B 4AF2A 1Y25A 1KTEA 4I5QA 4MLYA 9GSSA 3GMFA 1SENA 2P0GA 4BVXA 4PNFA 2HRKB 5G30A 5LNKe 3GSSA 2AUVA 4LLRA 1BJXA 4WF5A 3TOTA 3K8NA 3KEBA 4I8BA 3HJMA 4MZCA 2XPEA 1X9MB 1YVLA 2VKZG 5IMDA 4E8EA 3C1RA 1NW2A 4NHZA 1VF4A 3EMXA 5D96A 2GSSA 4WBRD 3HVVA 2TRXA 4ZB9A 1G0TA 4TXOA 3F4SA 2F8AA 2GGTA 1U6TA 3WGEA 1M9BA 3LSZA 1SJIA 4MP4A 6GSWA 3ZIVA 2GSQA 4XTSA 5GZZB 2CZ3A 4V1Ap 2H66A 2H70A 3TB2A 1W89A 2MMOA 2YZUA 4HQZA 1KNGA 3KJYA 2WJUA 2UV8G 2MZCA 3KCMA 2WS2A 2G2QA 2B7KA 1ST9A 3GKKA 4F2IA 2LSTA 1VF2A 4XIHA 4MH2A 4ECIA 5C04A 2WCIA 5F07A 1THOA 2LUSA 2NBSA 3GA4A 1Y1UA 3ME8A 3UJ1A 1X9SB 4FYCA 4E8HA 1TP9A 2LV3A 3I43A 3LYKA 4NXIA 4Z2RA 3ZLPA 2O7KA 2VL9A 1FB6A 3M8NA 3ERWA 3TCOA 4KF9A 1KEBA 3RHCA 1GWCA 4HI7A 1TTZA 2CT6A 2H72A 2OE3A 4RI6A 3SBCA 2GT6A 2DJ1A 4ICYA 5F06A 2GS3A 5DVBA 1BX9A 2OT3A 1T8EB 2C0EA 4XS1A 3GNJA 5IMCA 2CA8A 4F0BA 1VF1A 1XXUA 3ZITA 4BWQA 2EC4A 5CRHA 2WGRA 4G0KA 4EE0A 3ZL5A 2YWOA 1Z5YE 2EFCA 1R5PA 1GNWA 4POMA 5A5KA 4ML6A 4WETA 2LNTA 4MJBA 4PX1A 4CY8A 1ERUA 2GQLA 2OKAA 4FO5A 2WFCA 2I1UA 3EYTA 3EINA 2R37A 3RDWA 1QQ2A 1O8XA 2HSHA 4N10A 2KHPA 1X5DA 4HS1A 3Q19A 1Z7PA 1PL2A 4EIPA 2R3XA 3NIVA 3D22A 2QKEA 4AJ7A 6GSUA 4HU9A 3PINA 4PGTA 3GKNA 1N8JA 4K5SA 1PMTA 3IC4A 1U3AA 3GX0A 2ZNMA 4AJ8A 1PKWA 1RQMA 5A4VA 3FR3A 2VCXA 1XCCA 4W66A 2JSYA 5LCZA 1O6JA 3BJ5A 1QGVA 1GULA 4HJMA 5AIVA 4JEDA 4K7OA 2A2SA 3O3TA 1K0DA 3LEFA 3G7IA 1BF5A 2GLRA 2P31A 1AXDA 2HRNA 4EKZA 4KAEA 4AI6A 1K0OA 1YEPA 4IS0A 3TKPA 3QAVA 2K18A 4RUVA 4X43A 6GSVA 2V2GA 5F8BA 1K0AA 1A0RP 2YPMA 2V6OA 1SVMA 5DCHA 3KGKA 1TRWA 1PKZA 2A2PA 1XOAA 2PBJA 2QC7A 2YP6A 5HQPA 5ECOB 4AGSA 4V2NA 4NHWA 1VRSD 5G2ZA 3QMXA 3EPTA 1ERVA 5HFIA 3J7Yk 2EFHA 3M0FA 2FA4A 4IQAA 1SYXA 4FQUA 2HSNB 1ML6A 2F8FA 1LU4A 4Q5RA 4DVCA 2AJQB 1IYIA 1OE8A 4DSRA 3F3QA 1TI3A 1EOGA 4ZB7A 1DE1A 1T3BA 2LRNA 2GZPA 5JWQB 3VPQA 4X0XA 1T00A 5GAPD 1JZWA 2H0GA 3UOMA 5EPFA 2NVLA 5J9BA 4HU7A 4G2EA 3HA9A 2E2GA 3LJRA 5FWGA 2N5AA 5A5HA 3QDNA 3IBHA 12GSA 2R5GA 4KCAA 2QA1A 1YDKA 3UBLA 1V2AA 2DBCA 3FK8A 3ED3A 2HSNA 1OC8A 1JLWA 2K8SA 1T1VA 2FLSA 5DCGA 4TRXA 5G5EA 4G0IA 2C0GA 1GTIA 4OCEA 4WR5A 1O8WA 4DSSB 2HYXA 3F9UA 4J56E 3EC3A 2RIIA 1UN2A 3HHVA 1X0RA 3DXBA 5GSTA 3N5OA 2RUEA 1ZYQB 4WKWA 1O81A 1TRSA 1JZDA 1WRYA 1LBKA 5D9VA 1XWAA 3JCML 4D73A 5IO2A 2ON5A 3KXOA 2C1YA 3G9BA 1DSBA 5KOWA 14GSA 5DJMA 2VUPA 5KN3A 1EEMA 4DEJA 2JADA 16GSA 1EGOA 1PRXA 2H0HA 1YKAA 2F9SA 3EU3A 5G1KA 2H6YA 2PU9C 3L9UA 1THXA 4KNDA 4F82A 1FVKA 5J4VA 1PL1A 2JZSA 5J3RA 3KMNA 3VLNA 2WULA 1OKTA 2CX3A 1CQHA 3E3EA 5F0GA 1SKWB 1R5AA 5DBQA 5G31A 3TJBA 2L6DA 2CV4A 2PWJA 5FHIA 1G6YA 3M9KA 1T4ZA 3ZZXA 5BMUB 2B3SA 2J9HA 1KBNA 1F2EA 5GAND 1XWCA 3ME7A 1UC7A 3TKRA 4EC0A 5KN0A 4PQ1A 2B1LA 4QMKA 4PQHA 5EVOA 1AC1A 20GSA 3IAS2 2H71A 2YV9A 1X9WB 4XS4A 4ZL8A 4O5UA 4NV5A 3I69A 1QFNA 1BYEA 1OE7A 5LD0A 4HUAA 1G6WA 3UIWA 4KB3A 2FNOA 3VFIA 3GYKA 1EZKA 3CTFA 2K9FA 1EEJA 1FG4A 3LXTA 4KH7A 4FYBA 1FOHA 3A2XA 3NOFA 1WP0A 3IK7A 2EFEA 2H1LA 2AV4A 1BEDA 3FRCA 1XWBA 5IO0A 2AB6A 5IMAA 4JE1A 4GCIA 2QSIA 5DQYA 4L5OA 4YKFA 5AIXA 5A34B 3LWAA 1F3BA 2N5FA 1E2YA 3EVIA 3ZFLA 4OO4A 4OFMA 3GX8A 4KUNA 5IM9A 2VCVA 4IELA 4BL7A 1X5EA 2O87A 4BVXB 4ZB8A 1ZOFA 3F3RA 1R7HA 4K7IA 1OAZA 2LKUA 4K9ZA 1O7UA 2C0FA 5AN1A 4MPGA 1X5CA 5JCUA 4K2XA 2IFQA 3TJJA 3F4RA 1WWJA 2H6ZA 3L0HA 4WBJA 3U5RE 3WGDA 4TR0A 1V98A 5A34A 1E6BA 3H93A 3FR9A 2DJKA 1AW9A 3P2AA 1AQWA 5JCGA 3IR4A 3KP9A 1XVQA 4L0UA 5DALA 2AAWA 4TXOB 4QL7A 3LGCA 2PVQA 2PMTA 3R2QA 2REMA 5DAKB 5DDLA 3CSIA 1MD3A 2R0GA 1S3CA 1FB0A 3UARA 1OC9A 2YV7A 2H74A 4RQRA 1OYJA 2HSMA 1ERTA 1PSQA 1EP7A 3CRTA 3VWXA 5A1NB 1WOUA 4F9ZA 2VL2A 2NPBA 4EDZA 5J47A 1U87A 2JACA 2L6CA 1AAZA 1K0MA 4K1FA 3FMWA 2X64A 4N0ZA 3VI5A 2YZHA 5JCWA 1GLQA 4ACSA 4IW9A 2HFDA 5E59A 2HRAA 5CRDA 3J7Yb 4TR1A 1N2AA 3M3MA 3GUSA 2CVBA 5DAKA 1HNCA 1A23A 4MABA 3I6AA 1SK1A 4OO5A 1B4PA 4IKHA 2FWFA 1ZYNA 3APQA 4OCFA 4ZXGA 3ERGA 5A1NA 1VF3A 3P90A 2H1AA 3EWLA 4XCSA 3C8EA 4E68A 1DUGA 3FZ5A 8GSSA 1YY7A 1RW1A 4ZL7A 2DMMA 1R4WA 2F51A 3GKXA 4IP6A 4BPYA 5CYYA 1K3LA 5C00A 4XRDA 4K0GA 4N30A 4ECCA 4JR4A 1V57A 1JHBA 2FGXA 3DIEA 3TJKA 5E4WA 2YN1A 5D73A 4KDYA 1U88A 1B48A 3QAGA 3BOAA 3DVXA 2VD1A 2B1KA 4V1Ag 5D93A 1S3DA 4JZQA 1EGRA 4IJ3A 2M46A 2VIMA 1M0UA 2DIYA 2IJYA 5IMVA 3CYNA 5KEJA 4GXZA 4XRAA 5HR0A 1IYHA 4CHSA 2LEGA 3FR6A 4GTUA 3IXRA 3KM6A 2H73A 2GDRA 2E2MA 5D8IA 1JZRA 2VLTA 1MDJA 3IV4A 3QAWA 1XBSA 3W8SA 2M72A 3FY7A 4AKXB 2JZTA 2VCZA 1PQNA 5ECSA 5EY6A 3DD3A 1N25A 3GRXA 3CTGA 2MMAA 5B6MA 2CQ9A 2AYTA 2KUCA 2MYGA 2VD0A 2B5EA 3LFLA 5A4WA 4IN0A 2DC5A 2OA7A 4HDEA 4HZ4A 2V41A 4ZL9A 1YKCA 5INYA 2FWHA 3WYWA 2DSAA 5ECNB 2DIZA 2WZ9A 4IBPA 2MMNA 4FIWA 4OMVA 5DJLA 4PQIA 1SVOA 3L9VA 4HZ2A 4YAVA 5H5QA 1M2BA 2OJLA 4WF4A 3TOUA 1M7TA 1AUCA 5J9CA 3V1WA 4NWYA 1W4VA 5IMZA 2EIRA 1TK8B 1K3OA 1I5GA 3E9JB 2DJ3A 3GL3A 3D21A 1TU8A 5F05A 5CP1A 5ABRA 1A2MA 4PXOA 2IPAA 4O5RA 4AJ6A 4MMMA 2IL3A 1M9AA 1Y6EA 5J4YA 3Q18A 4GWRA 3KMOA 5D9XA 1GSEA 4TR3A 3UVTA 3IE3A 4NV2A 4HOJA 1B9XC 3C71A 4IGJA 2IMDA 1SL2B 2RUFA 1XPVA 1GTBA 5A5HB 4GSSA 4BVYB 1O85A 3CBUA 3BD2A 4Z2TA 3HKRA 2IMIA 2DJ0A 1XZOA 3LW9A 2O85A 2F3MA 2HZFA 6GSTA 4MZBA 3US3A 2GVPA 2K8VA 1GH2A 2YWMA 2BMXA 5ECIB 1FVJA 1TK0B 2X4AA 2VL3A 4NMUA 11GSA 1EOHA 2IIYA 3H8QA 1Q98A 3LQ7A 2D2ZA 2WRTA 3KH9A 4OFNA 1GSUA 3F6DA 4POBA 3GIXA 3H4KA 2LS5A 5CO3A 3A5IA 4AKGA 4K5RA 4BVYA 4D73B 2YANA 1GTAA 1B9YC 4KDUA 3ISOA 1TRUA 4MJCA 7GSSA 2JZRA 3RHBA 1HQOA 2H6XA 1WMJA 4ZBBA 1CQGA 2HQTA 3TKSA 1XWKA 2V32A 4AKIA 2L4QA 4JR6A 5JWRB 5IPGA 2H8LA 2V1MA 3LORA 4ECBA 4N0VA 4PURA 4CDOA 3D6IA 3N9JA 3TDGA 6GSYA 3W6GA 1PN0A 2MMZA 3KZQA 5D9WA 4DSQA 1EP8A 1XVWA 3O6TA 1GSFA 2XBQA 3P8WA 1YZXA 1MDIA 2HE3A 3DYRA 2CVDA 5H5RA 4Z2UA 3APSA 4TKYA 1K0NA 4KX4A 2VLUA 5ECRB 2DJ2A 2IN3A 3D5JA 2LNSA 3C73A 2QA2A 4K0NA 1ILOA 4XS4B 5CRGA 5HR2A 5J41A 4ID0A 2MBSA 1ZYEA 2HXKA 3ERFA 4EO3A 1SKRB 4P3YB 5B6NA 3UMAA 3AY8A 2AHEA 2KP2A 3L78A 1WE0A 1YF1A 3PR8A 1USBA 2LTKA 1TDIA 4YAPA 1GNEA 2K6VA 4WR4A 4O7HA 1XW6A 3KP8A 2I3YA 1FOVA 3FYGA 2M80A 4GLTA 2C0DA 2YJHA 4L0WA 5COHA 1TW9A 5IIZA 2LRCA 4LA1A 2O5VA 3IDVA 3IHQA 3ZIJA 3CSJA 2EIOA 1F37A 1YJ6A 1SK2A 2R0PA 4EF0A 2O8VB 3ZMLA 1PX7A 4USSA 3IPZA 1I9DA 3PH9A 1GSDA 1ZGNA 4IJIA 4ZB6A 4BL7B 3FZ9A 3HZ4A 3MAKA 2CAIA 2E7PA 3TRPA 4KW6A 2DKHA 5CREA 3ZYWA 2HZEA 1OKDA 4MF6A 3HY2A 3F8UA 1AQVA 3MYDA 2CVKA 2JSZA 1A24A 1Z6NA 1EV9A 3VI7A 1Z6MA 3WT2A 4I6XA 3HMJG 2VCQA 5B7CA 2H0IA 2R0CA 4RQXA 1B8XA 2IFQB 4IHUA 1GP1A 5IQYA 4K6XA 2VM1A 4MPFA 3WGXA 5D9TA 2LJAA 4KCEA 5IOWA 4JU5A 4ECJA 5HR1A 3RAZA 3EURA 4BWSA 2EFDA 5DALB 2B5XA 2B6MA 3GURA 2FHEA 4ISDA 2V6KA 3P7XA 2BTOT 2FCHA 1RK4A 1QK8A 1AIUA 1JLVA 2I4AA 5J40A 4G0LA 1OC9B 3DRNA 4YH2A 1JFUA 1NM3A 2HSMB 13GSA 4LL4B 3MIXA 3HVSA 2EIQA 4JBBA 4L5LA 2GSRA 3SWLA 4ZBAA 1H4OA 2IMEA 4I97A 2H30A 5L71A 3TUEA 4HJ2A 3RBTA 3IK9A 2C4JA 5FT3A 4K7NA 4WXTA 5CNWA 3KIJA 3Q6OA 4MDCA 1HNAA 3A2VA 5ID2B 2H1GA 3FKFA 3TU3B 3GH6A 2HI7A 2DJJA 4TR1B 22GSA 2XC2A 3IA1A 3DKSA 1SKSB 5J5NA 2E0QA 3IC8A 2LJKA 4G10A 3HDCA 2TIRA 1GUHA 1MD4A 2XBIA 1T7PB 4J2FA 5IMFA 19GSA 1Z9HA 2FWEA 2JU5A 4O32A 2Z9SA 1BQ7A 2VCTA 1SYRA 4MCUA 2PGTA 4MF7A 1V9WA 2L59A 4NAXA 2YWIA 3E0UA 5ID2A 3MSZA 2LRTA 1M2AA 6GSSA 1M99A 2HNLA 2LQOA 4A5PA 2KLXA 4MJEA 4GRFA 1A0FA 2PN8A 4LL1B 1A8YA 3F0IA 4EDYA 1AQXA 3FW2A 2FUG2 3HVXA 4G01A 5CAXA 3M9JA 2NTOA 3BBYA 5IPHA 1ZZYA 2YNXA 2VM2A 4POLA 2R4VA 1G7OA 3H79A 4EVMA 2P5QA 1A2JA 3CMIA 3KD0A 2KP1A 3ZMKA 3KTLA 2GSTA 2HRKA 4V2MA 2C8UA 3CSHA 3TKQA 1SJZA 2X49A 2GQKA 3MWHA 2HT9A 1ABAA 4PUFC 5ELAA 3QFAC 4PTSA 4YQVA 1F9MA 2KOKA 2VOCA 1V40A 5ECHB 2A4HA 2ALBA 3RPPA 1MEKA 3CWGA 2YCDA 3ZTLA 2G0FA 4GQFA 3EE2A 1GRXA 3VURA 3A3TA 1URMA 3IAM2 3MNGA 5DQSA 2ZUPA 4JRRA 3PPUA 2X99A 4ILFA 2H1DA 4KDXA 1FAAA 2FY6A 2RM6A 5ECPB 4KGIA 2L5LA 1QUWA 2I9HA 1NHYA 1ZMAA 1M2DA 4ZIJA 3S9FA 17GSA 3GTUB 2VAFA 2UZ8A 4QL9A 4F03A 4TR4A 3WD6A 3QD9A 5H5SA 3VWWA 4MJAA 2OACA 4TW5A 4O5QA 4TXVA 2ON7A 1ZCPA 4GQCA 5KN1A 3GKMA 1MTCA 3DVWA 2P5RA 3VWVA 4KA0A 2FWGA 1TXUA 3LG6A 2L5OA 3C1SA 3DMLA 3TKSE 4K8MA 4X4JA 3GV1A 3Q74A 3QCPA 3TJGA 3HJPA 5G1LA 2HLSA 3BCIA 2VLVA 4PUAA 2RLIA 2VCWA 5HFGA 2CZ2A 5AISA 4Q5QA 1XFLA 1YEXA 1MDKA 1SK0A 2C3NA 2XHFA 4GSTA 3GTUA 2LQQA 3W8JA 4FYUA 4MF5A 3DWVA 1Z7RA 5ECQB 1ERWA 5J4UA 1Q4JA 4ZILA 2L4CA 3A5WA 1PN9A 2FD3A 3MDKA 3U6VA 4V2LA 2DLXA 2IMKA 1FO5A 1FHEA 1ZL9A 1XWGA 1BG5A 3DEXA 4IQ1A 2YWNA 4FH8A 2R6KA 3QR6A 1T4YA 2H01A 1GTUA 2VL2C 4MH3A 4TVEA 4AKHA 1GLPA 2YOIA 3DGQA 1R26A 4HQSA 1A8LA 2C3TA 2OE1A 3R3EA 4NPBA 3KH7A 1S3AA 3L9SA 3UL3A 1K0BA 2TRCP 2GT5A 4Z7XA 4HEA2 4YKGA 2X8HA 1TOFA 5ECLB 3VWUA 5KN2A 1EV4A 5A4UA 4MZWA 3ZFBA 3GN3A 4QQ7A 4OWYA 5KOXA 3D0ZA 5ENUA 2WDUA 1QXHA 4N3ZA 1SL0B 1TU7A 1XOBA 1C72A 3ZRDA 3FHKA 2DMLA 1GSYA 1SD9A 5GSSA 4J57E 4O92A 4IP1A 5HFKA 2GQMA 1A2LA 2HRFA 4ML1A 2XPDA 4F0CA 2BJXA 3HCZA 4OD7A 1ON4A 3TRXA 1GUMA 5ELGA 1YQ1A 3HZ8A 3KTBA 3OR5A 3QOUA 3ZVJA 1V58A 3C7MA 1FW1A 1TJDA 2QGVA 1WPIA 1GL8A 4YQMA 4EL1A 4XHMA 4N11A 1DE2A 4IVFA 1GUKA 3GFKA 1NSWA 2IMFA 4CY6A 4L8EA 2O89A 2NDOA 3NZNA 3G7YA 2HSYA 1H75A 3CXGA 3O76A 4ZBDA 1SJ6A 2A4VA 4G19A 2GZZA 3RPNA 4EIQA 3WT1A 1WJKA 1OC3A 2H76A 2DKIA 2H19A 2VO4A 2PVOC 4XS6A 3GL5A 4LMWA 3ZVJD 2MBTA 2WB9A 4GF0A 3FZ4A 3TRQA 3EU4A 1WIKA 4I2UA 4YQUA 10GSA 1U3IA 3IOSA 5ECMB 3F6FA 2PERA 1ACVA 3I9V2 1O73A 2I81A 2CAQA 3LYPA 3UAPA 1J08A 1XIYA 2HZEB 5EL8A 4G9HA 1ZYPA 3APOA 1BG1A 5IOXA 2C3QA 3FEUA 4DSSA 5BRTA 4BA7A 1QMVA 3BCKA 6GSXA 2A2RA 1J9BA 1F6MC 1DBYA 5AGYA 1K3YA 4X1UA 1XW9A 1Z3EA 4POKA 4Q5FA 3F4TA 2OBKA 4EUYA 2LJRA 4GSNA 2X8GA 3VK9A 4MK3A 4LMVA 4TN8A 3QFBC 3TGZA 5B8AA 4H86A 1K0CA 3L4NA 5HR3A 2JL4A 1XW5A 5ECKB 2B5YA 1YF0A 4KE3A 3GSTA 5CRWA 4ULXA 3IHGA 3HD5A 1BAYA 3IRAA 2GTUA 1GSQA 2CX4A 2H75A 3LXZA 5G5FA 3UEMA 2GZYA 3UVHA 3CRUA 2IWTA 18GSA 3M1GA 3D4MA 1G7EA 1JZOA 4KSOA 1OVNA 1TI1A 4WEYA 2OADA 1TRVA 5BMUA 1HYUA 1SD8A 3TJFA 1PGTA 3QPMA 2ZCTA 4MA9A 2FA8A 1SU9A 3GH9A 3HYPA 1TKDB 4K2DA 1F3AA 1HNBA 3EMPA 5B8BA 3A2WA 1VGLA 2RM5A 2B7JA 2OBIA 4EXJA 4TOPA 4PNGA 1J0FA 3HJOA 2ES7A 4I2TA 1PX6A 1UA5A 3GHAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OE0 A;  4KSM A;  2YJ7 A;  2PUK C;  4CW9 A;  3FZA A;  3F63 A;  3G7J A;  1LJR A;  2J23 A;  1TXX A;  1PD2 1;  2R2J A;  3PGT A;  4RI7 A;  3VPT A;  1HD2 A;  1NHO A;  3ZRE A;  1EWX A;  1PA3 A;  2X8C A;  1UVZ A;  1TK5 B;  1GSS A;  2N5B A;  3D4T A;  3HXS A;  2L57 A;  2C80 A;  2H1B A;  3H1N A;  4Q5N A;  3TKS C;  3UBK A;  5JWO B;  2PPT A;  1B4Q A;  4OFT A;  1SL1 B;  4AF2 A;  1Y25 A;  1KTE A;  4I5Q A;  4MLY A;  9GSS A;  3GMF A;  1SEN A;  2P0G A;  4BVX A;  4PNF A;  2HRK B;  5G30 A;  5LNK e;  3GSS A;  2AUV A;  4LLR A;  1BJX A;  4WF5 A;  3TOT A;  3K8N A;  3KEB A;  4I8B A;  3HJM A;  4MZC A;  2XPE A;  1X9M B;  5IMD A;  4E8E A;  3C1R A;  1NW2 A;  4NHZ A;  1VF4 A;  3EMX A;  5D96 A;  2GSS A;  4WBR D;  3HVV A;  2TRX A;  4ZB9 A;  1G0T A;  4TXO A;  3F4S A;  2F8A A;  2GGT A;  1U6T A;  3WGE A;  1M9B A;  3LSZ A;  1SJI A;  4MP4 A;  6GSW A;  3ZIV A;  2GSQ A;  4XTS A;  5GZZ B;  2CZ3 A;  4V1A p;  2H66 A;  2H70 A;  3TB2 A;  1W89 A;  2MMO A;  2YZU A;  4HQZ A;  1KNG A;  3KJY A;  2WJU A;  2MZC A;  3KCM A;  2WS2 A;  2G2Q A;  2B7K A;  1ST9 A;  3GKK A;  4F2I A;  2LST A;  1VF2 A;  4XIH A;  4MH2 A;  4ECI A;  5C04 A;  2WCI A;  5F07 A;  1THO A;  2LUS A;  2NBS A;  3GA4 A;  3ME8 A;  3UJ1 A;  1X9S B;  4FYC A;  4E8H A;  1TP9 A;  2LV3 A;  3I43 A;  3LYK A;  4NXI A;  3ZLP A;  2O7K A;  2VL9 A;  1FB6 A;  3M8N A;  3ERW A;  3TCO A;  4KF9 A;  1KEB A;  3RHC A;  1GWC A;  4HI7 A;  1TTZ A;  2CT6 A;  2H72 A;  2OE3 A;  4RI6 A;  3SBC A;  2GT6 A;  2DJ1 A;  5F06 A;  2GS3 A;  5DVB A;  1BX9 A;  1T8E B;  2C0E A;  4XS1 A;  3GNJ A;  5IMC A;  2CA8 A;  4F0B A;  1VF1 A;  1XXU A;  3ZIT A;  4BWQ A;  2EC4 A;  5CRH A;  2WGR A;  4G0K A;  4EE0 A;  3ZL5 A;  2YWO A;  1Z5Y E;  1R5P A;  1GNW A;  4POM A;  5A5K A;  4ML6 A;  4WET A;  2LNT A;  4MJB A;  4PX1 A;  1ERU A;  2GQL A;  2OKA A;  4FO5 A;  2WFC A;  2I1U A;  3EYT A;  3EIN A;  2R37 A;  3RDW A;  1QQ2 A;  1O8X A;  2HSH A;  4N10 A;  2KHP A;  1X5D A;  4HS1 A;  3Q19 A;  1Z7P A;  1PL2 A;  2R3X A;  3NIV A;  3D22 A;  2QKE A;  4AJ7 A;  6GSU A;  4HU9 A;  3PIN A;  4PGT A;  3GKN A;  1N8J A;  1PMT A;  3IC4 A;  1U3A A;  3GX0 A;  2ZNM A;  4AJ8 A;  1PKW A;  1RQM A;  5A4V A;  3FR3 A;  2VCX A;  1XCC A;  2JSY A;  5LCZ A;  1O6J A;  3BJ5 A;  1QGV A;  1GUL A;  4HJM A;  5AIV A;  4JED A;  4K7O A;  2A2S A;  3O3T A;  1K0D A;  3LEF A;  3G7I A;  2GLR A;  2P31 A;  1AXD A;  2HRN A;  4EKZ A;  4KAE A;  1K0O A;  1YEP A;  4IS0 A;  3TKP A;  3QAV A;  2K18 A;  4RUV A;  4X43 A;  6GSV A;  2V2G A;  5F8B A;  1K0A A;  1A0R P;  2YPM A;  2V6O A;  5DCH A;  3KGK A;  1TRW A;  1PKZ A;  1XOA A;  2PBJ A;  2QC7 A;  2YP6 A;  5HQP A;  5ECO B;  4AGS A;  4V2N A;  4NHW A;  1VRS D;  5G2Z A;  3QMX A;  1ERV A;  5HFI A;  3J7Y k;  3M0F A;  2FA4 A;  4IQA A;  1SYX A;  4FQU A;  2HSN B;  1ML6 A;  2F8F A;  1LU4 A;  4Q5R A;  4DVC A;  2AJQ B;  1IYI A;  1OE8 A;  4DSR A;  3F3Q A;  1TI3 A;  1EOG A;  1DE1 A;  1T3B A;  2LRN A;  2GZP A;  5JWQ B;  3VPQ A;  4X0X A;  1T00 A;  5GAP D;  1JZW A;  2H0G A;  3UOM A;  5EPF A;  2NVL A;  5J9B A;  4HU7 A;  4G2E A;  3HA9 A;  2E2G A;  3LJR A;  5FWG A;  2N5A A;  3QDN A;  3IBH A;  12GS A;  2R5G A;  4KCA A;  1YDK A;  3UBL A;  1V2A A;  2DBC A;  3FK8 A;  3ED3 A;  1OC8 A;  1JLW A;  2K8S A;  1T1V A;  2FLS A;  5DCG A;  4TRX A;  5G5E A;  4G0I A;  2C0G A;  1GTI A;  4OCE A;  4WR5 A;  1O8W A;  4DSS B;  2HYX A;  3F9U A;  4J56 E;  3EC3 A;  2RII A;  1UN2 A;  3HHV A;  1X0R A;  3DXB A;  5GST A;  3N5O A;  2RUE A;  1ZYQ B;  4WKW A;  1O81 A;  1TRS A;  1JZD A;  1WRY A;  1LBK A;  5D9V A;  1XWA A;  3JCM L;  4D73 A;  5IO2 A;  2ON5 A;  3KXO A;  2C1Y A;  3G9B A;  1DSB A;  14GS A;  5DJM A;  2VUP A;  5KN3 A;  1EEM A;  4DEJ A;  2JAD A;  16GS A;  1EGO A;  1PRX A;  2H0H A;  1YKA A;  2F9S A;  3EU3 A;  5G1K A;  2H6Y A;  2PU9 C;  3L9U A;  1THX A;  4KND A;  4F82 A;  1FVK A;  1PL1 A;  2JZS A;  5J3R A;  3KMN A;  3VLN A;  2WUL A;  1OKT A;  2CX3 A;  1CQH A;  3E3E A;  5F0G A;  1SKW B;  1R5A A;  5DBQ A;  5G31 A;  3TJB A;  2L6D A;  2CV4 A;  2PWJ A;  5FHI A;  1G6Y A;  3M9K A;  1T4Z A;  3ZZX A;  2B3S A;  2J9H A;  1KBN A;  1F2E A;  5GAN D;  1XWC A;  3ME7 A;  1UC7 A;  3TKR A;  4EC0 A;  5KN0 A;  4PQ1 A;  2B1L A;  4PQH A;  5EVO A;  1AC1 A;  20GS A;  3IAS 2;  2H71 A;  2YV9 A;  1X9W B;  4XS4 A;  4ZL8 A;  4NV5 A;  3I69 A;  1QFN A;  1BYE A;  1OE7 A;  5LD0 A;  4HUA A;  1G6W A;  3UIW A;  4KB3 A;  2FNO A;  3VFI A;  3GYK A;  1EZK A;  3CTF A;  2K9F A;  1EEJ A;  1FG4 A;  3LXT A;  4KH7 A;  4FYB A;  3A2X A;  3NOF A;  1WP0 A;  3IK7 A;  2AV4 A;  1BED A;  3FRC A;  1XWB A;  5IO0 A;  2AB6 A;  5IMA A;  4JE1 A;  4GCI A;  2QSI A;  5DQY A;  4L5O A;  5AIX A;  3LWA A;  1F3B A;  2N5F A;  1E2Y A;  3EVI A;  3ZFL A;  4OO4 A;  4OFM A;  3GX8 A;  4KUN A;  5IM9 A;  2VCV A;  4IEL A;  4BL7 A;  1X5E A;  2O87 A;  4BVX B;  4ZB8 A;  1ZOF A;  3F3R A;  1R7H A;  4K7I A;  1OAZ A;  2LKU A;  4K9Z A;  1O7U A;  2C0F A;  5AN1 A;  4MPG A;  1X5C A;  5JCU A;  2IFQ A;  3TJJ A;  3F4R A;  1WWJ A;  2H6Z A;  3L0H A;  4WBJ A;  3U5R E;  3WGD A;  4TR0 A;  1V98 A;  1E6B A;  3H93 A;  3FR9 A;  2DJK A;  1AW9 A;  3P2A A;  1AQW A;  5JCG A;  3IR4 A;  3KP9 A;  1XVQ A;  4L0U A;  5DAL A;  2AAW A;  4TXO B;  4QL7 A;  3LGC A;  2PVQ A;  2PMT A;  3R2Q A;  2REM A;  5DAK B;  5DDL A;  3CSI A;  1MD3 A;  1S3C A;  1FB0 A;  3UAR A;  1OC9 A;  2YV7 A;  2H74 A;  4RQR A;  1OYJ A;  2HSM A;  1ERT A;  1PSQ A;  1EP7 A;  3CRT A;  3VWX A;  1WOU A;  4F9Z A;  2VL2 A;  2NPB A;  4EDZ A;  1U87 A;  2JAC A;  2L6C A;  1AAZ A;  1K0M A;  4K1F A;  2X64 A;  4N0Z A;  3VI5 A;  2YZH A;  5JCW A;  1GLQ A;  4ACS A;  4IW9 A;  2HFD A;  5E59 A;  2HRA A;  5CRD A;  3J7Y b;  4TR1 A;  1N2A A;  3M3M A;  3GUS A;  2CVB A;  5DAK A;  1HNC A;  1A23 A;  4MAB A;  3I6A A;  1SK1 A;  4OO5 A;  1B4P A;  4IKH A;  2FWF A;  3APQ A;  4OCF A;  4ZXG A;  3ERG A;  1VF3 A;  3P90 A;  2H1A A;  3EWL A;  4XCS A;  3C8E A;  1DUG A;  3FZ5 A;  8GSS A;  1YY7 A;  1RW1 A;  4ZL7 A;  2DMM A;  1R4W A;  2F51 A;  3GKX A;  4IP6 A;  4BPY A;  5CYY A;  1K3L A;  5C00 A;  4XRD A;  4K0G A;  4N30 A;  4ECC A;  4JR4 A;  1V57 A;  1JHB A;  2FGX A;  3DIE A;  3TJK A;  5E4W A;  2YN1 A;  5D73 A;  4KDY A;  1U88 A;  1B48 A;  3QAG A;  3BOA A;  3DVX A;  2VD1 A;  2B1K A;  4V1A g;  5D93 A;  1S3D A;  4JZQ A;  1EGR A;  4IJ3 A;  2M46 A;  2VIM A;  1M0U A;  2DIY A;  2IJY A;  5IMV A;  3CYN A;  5KEJ A;  4GXZ A;  4XRA A;  5HR0 A;  1IYH A;  4CHS A;  2LEG A;  3FR6 A;  4GTU A;  3IXR A;  3KM6 A;  2H73 A;  2GDR A;  2E2M A;  5D8I A;  1JZR A;  2VLT A;  1MDJ A;  3IV4 A;  3QAW A;  1XBS A;  3W8S A;  2M72 A;  3FY7 A;  2JZT A;  2VCZ A;  1PQN A;  5ECS A;  5EY6 A;  3DD3 A;  3GRX A;  3CTG A;  2MMA A;  5B6M A;  2CQ9 A;  2AYT A;  2KUC A;  2MYG A;  2VD0 A;  2B5E A;  4IN0 A;  3LFL A;  5A4W A;  2DC5 A;  4HDE A;  2OA7 A;  4HZ4 A;  2V41 A;  4ZL9 A;  1YKC A;  5INY A;  2FWH A;  3WYW A;  2DSA A;  5ECN B;  2DIZ A;  2WZ9 A;  4IBP A;  2MMN A;  4FIW A;  4OMV A;  5DJL A;  4PQI A;  3L9V A;  4HZ2 A;  4YAV A;  5H5Q A;  1M2B A;  2OJL A;  4WF4 A;  3TOU A;  1M7T A;  1AUC A;  5J9C A;  3V1W A;  4NWY A;  1W4V A;  5IMZ A;  2EIR A;  1TK8 B;  1K3O A;  1I5G A;  3E9J B;  2DJ3 A;  3GL3 A;  3D21 A;  1TU8 A;  5F05 A;  5CP1 A;  5ABR A;  1A2M A;  4PXO A;  2IPA A;  4O5R A;  4AJ6 A;  4MMM A;  2IL3 A;  1M9A A;  1Y6E A;  3Q18 A;  4GWR A;  3KMO A;  5D9X A;  1GSE A;  4TR3 A;  3UVT A;  3IE3 A;  4NV2 A;  4HOJ A;  1B9X C;  3C71 A;  4IGJ A;  2IMD A;  1SL2 B;  2RUF A;  1XPV A;  1GTB A;  4GSS A;  4BVY B;  1O85 A;  3CBU A;  3BD2 A;  3HKR A;  2IMI A;  2DJ0 A;  1XZO A;  2O85 A;  2F3M A;  2HZF A;  6GST A;  4MZB A;  3US3 A;  2GVP A;  2K8V A;  1GH2 A;  2YWM A;  2BMX A;  5ECI B;  1FVJ A;  1TK0 B;  2VL3 A;  4NMU A;  11GS A;  1EOH A;  2IIY A;  3H8Q A;  1Q98 A;  3LQ7 A;  2D2Z A;  2WRT A;  3KH9 A;  4OFN A;  1GSU A;  3F6D A;  4POB A;  3GIX A;  3H4K A;  2LS5 A;  5CO3 A;  4BVY A;  4D73 B;  2YAN A;  1GTA A;  1B9Y C;  4KDU A;  3ISO A;  1TRU A;  4MJC A;  7GSS A;  2JZR A;  3RHB A;  1HQO A;  2H6X A;  1WMJ A;  4ZBB A;  1CQG A;  2HQT A;  3TKS A;  1XWK A;  2V32 A;  2L4Q A;  4JR6 A;  5JWR B;  5IPG A;  2H8L A;  2V1M A;  3LOR A;  4ECB A;  4N0V A;  4PUR A;  4CDO A;  3D6I A;  3N9J A;  3TDG A;  6GSY A;  3W6G A;  2MMZ A;  3KZQ A;  5D9W A;  4DSQ A;  1EP8 A;  1XVW A;  3O6T A;  1GSF A;  2XBQ A;  3P8W A;  1YZX A;  1MDI A;  2HE3 A;  3DYR A;  2CVD A;  5H5R A;  3APS A;  4TKY A;  1K0N A;  4KX4 A;  2VLU A;  5ECR B;  2DJ2 A;  2IN3 A;  3D5J A;  2LNS A;  3C73 A;  4K0N A;  1ILO A;  4XS4 B;  5CRG A;  5HR2 A;  5J41 A;  4ID0 A;  2MBS A;  1ZYE A;  2HXK A;  3ERF A;  4EO3 A;  1SKR B;  4P3Y B;  5B6N A;  3UMA A;  3AY8 A;  2AHE A;  2KP2 A;  3L78 A;  1WE0 A;  1YF1 A;  3PR8 A;  1USB A;  2LTK A;  1TDI A;  4YAP A;  1GNE A;  2K6V A;  4WR4 A;  4O7H A;  1XW6 A;  3KP8 A;  2I3Y A;  1FOV A;  3FYG A;  2M80 A;  4GLT A;  2C0D A;  2YJH A;  4L0W A;  5COH A;  1TW9 A;  5IIZ A;  2LRC A;  4LA1 A;  3IDV A;  3IHQ A;  3ZIJ A;  3CSJ A;  2EIO A;  1F37 A;  1YJ6 A;  1SK2 A;  4EF0 A;  2O8V B;  3ZML A;  1PX7 A;  4USS A;  3IPZ A;  1I9D A;  3PH9 A;  1GSD A;  1ZGN A;  4IJI A;  4ZB6 A;  4BL7 B;  3FZ9 A;  3HZ4 A;  3MAK A;  2CAI A;  2E7P A;  3TRP A;  4KW6 A;  5CRE A;  3ZYW A;  2HZE A;  1OKD A;  4MF6 A;  3HY2 A;  3F8U A;  1AQV A;  2CVK A;  2JSZ A;  1A24 A;  1Z6N A;  1EV9 A;  3VI7 A;  1Z6M A;  3WT2 A;  4I6X A;  2VCQ A;  5B7C A;  2H0I A;  4RQX A;  1B8X A;  2IFQ B;  4IHU A;  1GP1 A;  5IQY A;  4K6X A;  2VM1 A;  4MPF A;  3WGX A;  5D9T A;  2LJA A;  4KCE A;  5IOW A;  4JU5 A;  4ECJ A;  5HR1 A;  3RAZ A;  3EUR A;  4BWS A;  5DAL B;  2B5X A;  2B6M A;  3GUR A;  2FHE A;  4ISD A;  2V6K A;  3P7X A;  2BTO T;  2FCH A;  1RK4 A;  1QK8 A;  1AIU A;  1JLV A;  2I4A A;  4G0L A;  1OC9 B;  3DRN A;  4YH2 A;  1JFU A;  1NM3 A;  2HSM B;  13GS A;  4LL4 B;  3HVS A;  2EIQ A;  4JBB A;  4L5L A;  2GSR A;  3SWL A;  4ZBA A;  1H4O A;  2IME A;  4I97 A;  2H30 A;  5L71 A;  3TUE A;  4HJ2 A;  3RBT A;  3IK9 A;  2C4J A;  5FT3 A;  4K7N A;  4WXT A;  5CNW A;  3KIJ A;  3Q6O A;  4MDC A;  1HNA A;  3A2V A;  5ID2 B;  2H1G A;  3FKF A;  3GH6 A;  2HI7 A;  2DJJ A;  4TR1 B;  22GS A;  2XC2 A;  3IA1 A;  3DKS A;  1SKS B;  5J5N A;  2E0Q A;  3IC8 A;  2LJK A;  4G10 A;  3HDC A;  2TIR A;  1GUH A;  1MD4 A;  2XBI A;  1T7P B;  4J2F A;  5IMF A;  19GS A;  1Z9H A;  2FWE A;  2JU5 A;  4O32 A;  2Z9S A;  1BQ7 A;  2VCT A;  1SYR A;  4MCU A;  2PGT A;  4MF7 A;  1V9W A;  2L59 A;  4NAX A;  2YWI A;  3E0U A;  5ID2 A;  3MSZ A;  2LRT A;  1M2A A;  6GSS A;  1M99 A;  2HNL A;  2LQO A;  2KLX A;  4MJE A;  4GRF A;  1A0F A;  2PN8 A;  4LL1 B;  1A8Y A;  3F0I A;  4EDY A;  1AQX A;  3FW2 A;  2FUG 2;  3HVX A;  5CAX A;  3M9J A;  2NTO A;  3BBY A;  5IPH A;  1ZZY A;  2YNX A;  2VM2 A;  4POL A;  2R4V A;  1G7O A;  3H79 A;  4EVM A;  2P5Q A;  1A2J A;  3CMI A;  3KD0 A;  2KP1 A;  3ZMK A;  3KTL A;  2GST A;  2HRK A;  4V2M A;  2C8U A;  3CSH A;  3TKQ A;  1SJZ A;  2GQK A;  3MWH A;  2HT9 A;  1ABA A;  4PUF C;  5ELA A;  3QFA C;  4PTS A;  4YQV A;  1F9M A;  2KOK A;  2VOC A;  1V40 A;  5ECH B;  2ALB A;  3RPP A;  1MEK A;  2YCD A;  3ZTL A;  2G0F A;  4GQF A;  3EE2 A;  1GRX A;  3VUR A;  3A3T A;  1URM A;  3IAM 2;  3MNG A;  5DQS A;  2ZUP A;  4JRR A;  3PPU A;  2X99 A;  4ILF A;  2H1D A;  4KDX A;  1FAA A;  2FY6 A;  2RM6 A;  5ECP B;  4KGI A;  2L5L A;  1QUW A;  2I9H A;  1NHY A;  1ZMA A;  1M2D A;  4ZIJ A;  3S9F A;  17GS A;  3GTU B;  2VAF A;  2UZ8 A;  4QL9 A;  4F03 A;  4TR4 A;  3WD6 A;  3QD9 A;  5H5S A;  3VWW A;  4MJA A;  2OAC A;  4TW5 A;  4TXV A;  2ON7 A;  1ZCP A;  4GQC A;  5KN1 A;  3GKM A;  1MTC A;  3DVW A;  2P5R A;  3VWV A;  4KA0 A;  2FWG A;  3LG6 A;  2L5O A;  3C1S A;  3DML A;  3TKS E;  4K8M A;  3GV1 A;  3Q74 A;  3QCP A;  3TJG A;  3HJP A;  5G1L A;  2HLS A;  3BCI A;  2VLV A;  4PUA A;  2RLI A;  2VCW A;  5HFG A;  2CZ2 A;  5AIS A;  4Q5Q A;  1XFL A;  1YEX A;  1MDK A;  1SK0 A;  2C3N A;  2XHF A;  4GST A;  3GTU A;  2LQQ A;  3W8J A;  4FYU A;  4MF5 A;  3DWV A;  1Z7R A;  5ECQ B;  1ERW A;  5J4U A;  1Q4J A;  4ZIL A;  2L4C A;  3A5W A;  1PN9 A;  2FD3 A;  3MDK A;  3U6V A;  4V2L A;  2DLX A;  2IMK A;  1FO5 A;  1FHE A;  1ZL9 A;  1XWG A;  1BG5 A;  3DEX A;  4IQ1 A;  2YWN A;  4FH8 A;  2R6K A;  3QR6 A;  1T4Y A;  2H01 A;  1GTU A;  2VL2 C;  4MH3 A;  4TVE A;  1GLP A;  2YOI A;  3DGQ A;  1R26 A;  4HQS A;  1A8L A;  2C3T A;  2OE1 A;  3R3E A;  4NPB A;  3KH7 A;  1S3A A;  3L9S A;  3UL3 A;  1K0B A;  2TRC P;  2GT5 A;  4Z7X A;  4HEA 2;  2X8H A;  1TOF A;  5ECL B;  3VWU A;  5KN2 A;  1EV4 A;  5A4U A;  4MZW A;  3ZFB A;  3GN3 A;  4QQ7 A;  4OWY A;  3D0Z A;  5ENU A;  2WDU A;  1QXH A;  1SL0 B;  1TU7 A;  1XOB A;  1C72 A;  3ZRD A;  3FHK A;  2DML A;  1GSY A;  1SD9 A;  5GSS A;  4J57 E;  4O92 A;  4IP1 A;  5HFK A;  2GQM A;  1A2L A;  2HRF A;  4ML1 A;  2XPD A;  4F0C A;  2BJX A;  3HCZ A;  4OD7 A;  1ON4 A;  3TRX A;  1GUM A;  5ELG A;  1YQ1 A;  3HZ8 A;  3KTB A;  3OR5 A;  3QOU A;  3ZVJ A;  1V58 A;  3C7M A;  1FW1 A;  1TJD A;  2QGV A;  1WPI A;  1GL8 A;  4YQM A;  4EL1 A;  4XHM A;  4N11 A;  1DE2 A;  4IVF A;  1GUK A;  3GFK A;  1NSW A;  2IMF A;  4L8E A;  2O89 A;  2NDO A;  3NZN A;  3G7Y A;  2HSY A;  1H75 A;  3CXG A;  3O76 A;  4ZBD A;  1SJ6 A;  2A4V A;  4G19 A;  2GZZ A;  3RPN A;  3WT1 A;  1WJK A;  1OC3 A;  2H76 A;  2H19 A;  2VO4 A;  2PVO C;  4XS6 A;  3GL5 A;  4LMW A;  3ZVJ D;  2MBT A;  2WB9 A;  4GF0 A;  3FZ4 A;  3TRQ A;  3EU4 A;  1WIK A;  4I2U A;  4YQU A;  10GS A;  1U3I A;  3IOS A;  5ECM B;  3F6F A;  2PER A;  1ACV A;  3I9V 2;  1O73 A;  2I81 A;  2CAQ A;  3LYP A;  3UAP A;  1J08 A;  1XIY A;  2HZE B;  5EL8 A;  4G9H A;  3APO A;  5IOX A;  2C3Q A;  3FEU A;  4DSS A;  4BA7 A;  1QMV A;  3BCK A;  6GSX A;  2A2R A;  1J9B A;  1F6M C;  1DBY A;  5AGY A;  1K3Y A;  4X1U A;  1XW9 A;  1Z3E A;  4POK A;  4Q5F A;  3F4T A;  2OBK A;  4EUY A;  2LJR A;  4GSN A;  2X8G A;  3VK9 A;  4MK3 A;  4LMV A;  4TN8 A;  3QFB C;  3TGZ A;  5B8A A;  4H86 A;  1K0C A;  3L4N A;  5HR3 A;  2JL4 A;  1XW5 A;  5ECK B;  2B5Y A;  1YF0 A;  4KE3 A;  3GST A;  5CRW A;  4ULX A;  3HD5 A;  1BAY A;  3IRA A;  2GTU A;  1GSQ A;  2CX4 A;  2H75 A;  3LXZ A;  5G5F A;  3UEM A;  2GZY A;  3UVH A;  3CRU A;  2IWT A;  18GS A;  3M1G A;  3D4M A;  1G7E A;  1JZO A;  4KSO A;  1OVN A;  1TI1 A;  4WEY A;  2OAD A;  1TRV A;  5BMU A;  1HYU A;  1SD8 A;  3TJF A;  1PGT A;  3QPM A;  2ZCT A;  4MA9 A;  2FA8 A;  1SU9 A;  3GH9 A;  3HYP A;  1TKD B;  4K2D A;  1F3A A;  1HNB A;  3EMP A;  5B8B A;  3A2W A;  1VGL A;  2RM5 A;  2B7J A;  2OBI A;  4EXJ A;  4TOP A;  4PNG A;  1J0F A;  3HJO A;  2ES7 A;  4I2T A;  1PX6 A;  1UA5 A;  3GHA A; 
#chains in the Genus database with same CATH topology
 2OE0 A;  4KSM A;  2WVX B;  2YJ7 A;  2PUK C;  4CW9 A;  3FZA A;  3F63 A;  3G7J A;  1LJR A;  2J23 A;  1TXX A;  1PD2 1;  2R2J A;  4GDF A;  3PGT A;  4RI7 A;  3VPT A;  1HD2 A;  1NHO A;  3ZRE A;  1EWX A;  1PA3 A;  2X8C A;  1UVZ A;  1TK5 B;  1GSS A;  2N5B A;  3D4T A;  3HXS A;  2L57 A;  2C80 A;  2H1B A;  3H1N A;  4MNN A;  4Q5N A;  3TKS C;  3UBK A;  5JWO B;  2PPT A;  1B4Q A;  4OFT A;  1SVL A;  1SL1 B;  4AF2 A;  1Y25 A;  1KTE A;  4I5Q A;  4MLY A;  9GSS A;  2WVX A;  3GMF A;  1SEN A;  2P0G A;  4BVX A;  4PNF A;  2HRK B;  5G30 A;  5LNK e;  3GSS A;  2AUV A;  4LLR A;  1BJX A;  4WF5 A;  3TOT A;  3K8N A;  3KEB A;  4I8B A;  3HJM A;  4MZC A;  2XPE A;  1X9M B;  1YVL A;  2VKZ G;  5IMD A;  4E8E A;  3C1R A;  1NW2 A;  4NHZ A;  1VF4 A;  3EMX A;  5D96 A;  2GSS A;  4WBR D;  3HVV A;  2TRX A;  4ZB9 A;  1G0T A;  4TXO A;  3F4S A;  2F8A A;  2GGT A;  1U6T A;  3WGE A;  1M9B A;  3LSZ A;  1SJI A;  4MP4 A;  6GSW A;  3ZIV A;  2GSQ A;  4XTS A;  5GZZ B;  2CZ3 A;  4V1A p;  2H66 A;  2H70 A;  3TB2 A;  1W89 A;  2MMO A;  2YZU A;  4HQZ A;  1KNG A;  3KJY A;  2WJU A;  2UV8 G;  2MZC A;  3KCM A;  2WS2 A;  2G2Q A;  2O3E A;  2B7K A;  1ST9 A;  3GKK A;  4F2I A;  2LST A;  1VF2 A;  4XIH A;  4MH2 A;  4ECI A;  5C04 A;  2WCI A;  5F07 A;  1THO A;  2LUS A;  2NBS A;  3GA4 A;  1Y1U A;  3ME8 A;  3UJ1 A;  1X9S B;  4FYC A;  4E8H A;  1TP9 A;  2LV3 A;  3I43 A;  3LYK A;  4NXI A;  4Z2R A;  3ZLP A;  2O7K A;  2VL9 A;  1FB6 A;  3M8N A;  3ERW A;  3TCO A;  4KF9 A;  1KEB A;  3RHC A;  1GWC A;  4HI7 A;  1TTZ A;  2CT6 A;  2H72 A;  2OE3 A;  4RI6 A;  3SBC A;  2GT6 A;  2DJ1 A;  4ICY A;  2WW1 A;  5F06 A;  2GS3 A;  5DVB A;  1BX9 A;  2OT3 A;  1T8E B;  2C0E A;  4XS1 A;  3GNJ A;  5IMC A;  2CA8 A;  4F0B A;  1VF1 A;  1XXU A;  3ZIT A;  4BWQ A;  2EC4 A;  1M3J A;  5CRH A;  2WGR A;  4G0K A;  4EE0 A;  3ZL5 A;  2YWO A;  1Z5Y E;  2EFC A;  1R5P A;  1GNW A;  4POM A;  5A5K A;  4ML6 A;  4WET A;  2LNT A;  4MJB A;  4PX1 A;  4CY8 A;  1ERU A;  2GQL A;  2OKA A;  4FO5 A;  2WFC A;  2I1U A;  3EYT A;  3EIN A;  2R37 A;  3RDW A;  1QQ2 A;  1O8X A;  2HSH A;  4N10 A;  2KHP A;  1X5D A;  4HS1 A;  3Q19 A;  1Z7P A;  1PL2 A;  4EIP A;  2R3X A;  3NIV A;  3D22 A;  2QKE A;  4AJ7 A;  6GSU A;  4HU9 A;  3PIN A;  4PGT A;  3GKN A;  1N8J A;  4K5S A;  1PMT A;  3IC4 A;  1U3A A;  3GX0 A;  2ZNM A;  4AJ8 A;  1PKW A;  1RQM A;  5A4V A;  3FR3 A;  2VCX A;  1XCC A;  4W66 A;  2JSY A;  5LCZ A;  1O6J A;  3BJ5 A;  1QGV A;  1GUL A;  4HJM A;  5AIV A;  4JED A;  4K7O A;  2A2S A;  3O3T A;  1K0D A;  3LEF A;  3G7I A;  1BF5 A;  2GLR A;  2P31 A;  1AXD A;  2HRN A;  4EKZ A;  4KAE A;  4AI6 A;  1K0O A;  1YEP A;  4IS0 A;  3TKP A;  3QAV A;  2K18 A;  4RUV A;  4X43 A;  6GSV A;  2V2G A;  5F8B A;  1K0A A;  1A0R P;  2YPM A;  2V6O A;  1SVM A;  5DCH A;  3KGK A;  1TRW A;  1PKZ A;  2A2P A;  1XOA A;  2PBJ A;  2QC7 A;  2YP6 A;  5HQP A;  5ECO B;  4AGS A;  4V2N A;  4NHW A;  1VRS D;  5G2Z A;  3QMX A;  3EPT A;  1ERV A;  5HFI A;  3J7Y k;  2EFH A;  3M0F A;  2FA4 A;  4IQA A;  1SYX A;  4FQU A;  2HSN B;  1ML6 A;  2F8F A;  1LU4 A;  4Q5R A;  4DVC A;  2AJQ B;  1IYI A;  1OE8 A;  4DSR A;  3F3Q A;  1TI3 A;  1EOG A;  4ZB7 A;  1DE1 A;  1T3B A;  2LRN A;  2GZP A;  5JWQ B;  3VPQ A;  4X0X A;  1T00 A;  5GAP D;  1JZW A;  2H0G A;  3UOM A;  5EPF A;  2NVL A;  5J9B A;  4HU7 A;  4G2E A;  3HA9 A;  2E2G A;  3LJR A;  5FWG A;  2N5A A;  5A5H A;  1YEW C;  3QDN A;  3IBH A;  12GS A;  2R5G A;  4KCA A;  2QA1 A;  1YDK A;  3UBL A;  1V2A A;  2DBC A;  3FK8 A;  3ED3 A;  2HSN A;  1OC8 A;  1JLW A;  2K8S A;  1T1V A;  2FLS A;  5DCG A;  4TRX A;  5G5E A;  4G0I A;  2C0G A;  1GTI A;  4OCE A;  4WR5 A;  1O8W A;  4DSS B;  2HYX A;  3F9U A;  4J56 E;  3EC3 A;  2RII A;  1UN2 A;  3HHV A;  1X0R A;  3DXB A;  5GST A;  3N5O A;  2RUE A;  1ZYQ B;  4WKW A;  1O81 A;  1TRS A;  1JZD A;  1WRY A;  1LBK A;  5D9V A;  1XWA A;  3JCM L;  4D73 A;  4BIK A;  5IO2 A;  2ON5 A;  3KXO A;  2C1Y A;  3G9B A;  1DSB A;  5KOW A;  14GS A;  5DJM A;  2VUP A;  5KN3 A;  1EEM A;  4DEJ A;  2JAD A;  16GS A;  1EGO A;  1PRX A;  2H0H A;  1YKA A;  2F9S A;  3EU3 A;  5G1K A;  2H6Y A;  2PU9 C;  3L9U A;  1THX A;  4KND A;  4F82 A;  1FVK A;  5J4V A;  1PL1 A;  2JZS A;  5J3R A;  3KMN A;  3VLN A;  2WUL A;  1OKT A;  2CX3 A;  1CQH A;  3E3E A;  5F0G A;  1SKW B;  1R5A A;  5DBQ A;  5G31 A;  3TJB A;  2L6D A;  2CV4 A;  2PWJ A;  5FHI A;  1G6Y A;  3M9K A;  1T4Z A;  3ZZX A;  5BMU B;  2B3S A;  2J9H A;  2WVY A;  1KBN A;  1F2E A;  5GAN D;  1XWC A;  3ME7 A;  1UC7 A;  3TKR A;  4EC0 A;  5KN0 A;  4PQ1 A;  2B1L A;  4QMK A;  4PQH A;  5EVO A;  1AC1 A;  20GS A;  3IAS 2;  2H71 A;  2YV9 A;  1X9W B;  4XS4 A;  4ZL8 A;  4O5U A;  4NV5 A;  3I69 A;  1QFN A;  1BYE A;  1OE7 A;  5LD0 A;  4HUA A;  1G6W A;  3UIW A;  4KB3 A;  2FNO A;  3VFI A;  3GYK A;  1EZK A;  3CTF A;  2K9F A;  1EEJ A;  1FG4 A;  3LXT A;  4KH7 A;  4FYB A;  1FOH A;  3A2X A;  3NOF A;  1WP0 A;  3IK7 A;  2EFE A;  2H1L A;  2AV4 A;  1BED A;  3FRC A;  1XWB A;  5IO0 A;  2AB6 A;  5IMA A;  4JE1 A;  4GCI A;  2QSI A;  5DQY A;  4L5O A;  4YKF A;  5AIX A;  5A34 B;  3LWA A;  1F3B A;  2N5F A;  1E2Y A;  3EVI A;  3ZFL A;  4OO4 A;  4OFM A;  3GX8 A;  4KUN A;  5IM9 A;  2VCV A;  4IEL A;  4BL7 A;  1X5E A;  2O87 A;  4BVX B;  4ZB8 A;  1ZOF A;  3F3R A;  1R7H A;  4K7I A;  1OAZ A;  2LKU A;  4K9Z A;  1O7U A;  2C0F A;  5AN1 A;  4MPG A;  1X5C A;  5JCU A;  4K2X A;  2IFQ A;  3TJJ A;  3F4R A;  1WWJ A;  2H6Z A;  3L0H A;  4WBJ A;  3U5R E;  3WGD A;  4TR0 A;  1V98 A;  5A34 A;  1E6B A;  3H93 A;  3FR9 A;  2DJK A;  1AW9 A;  3P2A A;  1AQW A;  5JCG A;  3IR4 A;  3KP9 A;  1XVQ A;  4L0U A;  5DAL A;  2AAW A;  4TXO B;  4QL7 A;  3LGC A;  2PVQ A;  2PMT A;  3R2Q A;  2REM A;  5DAK B;  5DDL A;  3CSI A;  1MD3 A;  2R0G A;  1S3C A;  1FB0 A;  3UAR A;  1OC9 A;  2YV7 A;  2H74 A;  4RQR A;  1OYJ A;  2HSM A;  1ERT A;  1PSQ A;  1EP7 A;  3CRT A;  3VWX A;  5A1N B;  1WOU A;  4F9Z A;  2VL2 A;  2NPB A;  4EDZ A;  5J47 A;  1U87 A;  2JAC A;  2L6C A;  1AAZ A;  1K0M A;  4K1F A;  3FMW A;  2X64 A;  4PHZ C;  4N0Z A;  3VI5 A;  2YZH A;  5JCW A;  1GLQ A;  4ACS A;  4IW9 A;  2HFD A;  5E59 A;  2HRA A;  5CRD A;  3J7Y b;  4TR1 A;  1N2A A;  3M3M A;  3GUS A;  2CVB A;  5DAK A;  1HNC A;  1A23 A;  4MAB A;  3I6A A;  1SK1 A;  4OO5 A;  1B4P A;  4IKH A;  2FWF A;  1ZYN A;  3APQ A;  4OCF A;  4ZXG A;  3ERG A;  5A1N A;  1VF3 A;  3P90 A;  2H1A A;  3EWL A;  4XCS A;  3C8E A;  4E68 A;  1DUG A;  3FZ5 A;  8GSS A;  1YY7 A;  1RW1 A;  1XG8 A;  4ZL7 A;  2DMM A;  1R4W A;  2F51 A;  3GKX A;  4IP6 A;  4BPY A;  5CYY A;  1K3L A;  5C00 A;  4XRD A;  4K0G A;  4N30 A;  4ECC A;  4JR4 A;  1V57 A;  1JHB A;  2FGX A;  3DIE A;  3TJK A;  5E4W A;  2YN1 A;  5D73 A;  4KDY A;  1U88 A;  1I1I P;  1B48 A;  3QAG A;  3BOA A;  3DVX A;  2VD1 A;  2B1K A;  4V1A g;  5D93 A;  1S3D A;  4JZQ A;  1EGR A;  4IJ3 A;  2M46 A;  2VIM A;  1M0U A;  2DIY A;  2IJY A;  5IMV A;  3CYN A;  5KEJ A;  4GXZ A;  4XRA A;  5HR0 A;  1IYH A;  4CHS A;  2LEG A;  3FR6 A;  4GTU A;  3IXR A;  3KM6 A;  2H73 A;  2GDR A;  2E2M A;  5D8I A;  1JZR A;  2VLT A;  1MDJ A;  3IV4 A;  3QAW A;  1XBS A;  3W8S A;  2M72 A;  3FY7 A;  4AKX B;  2JZT A;  2VCZ A;  1PQN A;  5ECS A;  5EY6 A;  3DD3 A;  1N25 A;  3GRX A;  3CTG A;  2MMA A;  5B6M A;  2CQ9 A;  2AYT A;  2KUC A;  2MYG A;  2VD0 A;  2B5E A;  3LFL A;  5A4W A;  4IN0 A;  2DC5 A;  2OA7 A;  4HDE A;  4HZ4 A;  2V41 A;  4ZL9 A;  1YKC A;  5INY A;  2FWH A;  3WYW A;  2DSA A;  5ECN B;  2DIZ A;  2WZ9 A;  4IBP A;  2MMN A;  4FIW A;  4OMV A;  5DJL A;  4PQI A;  3CQF A;  1SVO A;  3L9V A;  4HZ2 A;  4YAV A;  5H5Q A;  1M2B A;  2OJL A;  4WF4 A;  3TOU A;  1M7T A;  1AUC A;  5J9C A;  3V1W A;  4NWY A;  1W4V A;  5IMZ A;  2EIR A;  1TK8 B;  1K3O A;  1I5G A;  3CHX C;  3E9J B;  2DJ3 A;  3GL3 A;  3D21 A;  1TU8 A;  5F05 A;  5CP1 A;  2WZS A;  5ABR A;  1A2M A;  4PXO A;  2IPA A;  4O5R A;  4AJ6 A;  4MMM A;  2IL3 A;  1M9A A;  1Y6E A;  5J4Y A;  3Q18 A;  4GWR A;  3KMO A;  5D9X A;  1GSE A;  4TR3 A;  3UVT A;  3IE3 A;  4NV2 A;  4HOJ A;  1B9X C;  3C71 A;  4IGJ A;  2IMD A;  1SL2 B;  2RUF A;  1XPV A;  1GTB A;  5A5H B;  4GSS A;  4BVY B;  1O85 A;  3CBU A;  3BD2 A;  4Z2T A;  3HKR A;  2IMI A;  2DJ0 A;  1XZO A;  3LW9 A;  2O85 A;  2F3M A;  2HZF A;  6GST A;  4MZB A;  3US3 A;  2GVP A;  2K8V A;  1GH2 A;  2YWM A;  2BMX A;  5ECI B;  1FVJ A;  1TK0 B;  2X4A A;  2VL3 A;  4NMU A;  11GS A;  1EOH A;  2IIY A;  3H8Q A;  1Q98 A;  3LQ7 A;  2D2Z A;  2WRT A;  3KH9 A;  1M3I A;  4OFN A;  1GSU A;  3F6D A;  4POB A;  3GIX A;  3H4K A;  2LS5 A;  5CO3 A;  3HVN A;  3A5I A;  4AKG A;  4K5R A;  4BVY A;  4D73 B;  2YAN A;  1GTA A;  1B9Y C;  4KDU A;  3ISO A;  1TRU A;  4MJC A;  7GSS A;  2JZR A;  3RHB A;  1HQO A;  2H6X A;  1WMJ A;  4ZBB A;  1CQG A;  2HQT A;  3TKS A;  1XWK A;  2V32 A;  4AKI A;  2L4Q A;  4JR6 A;  5JWR B;  5IPG A;  2H8L A;  2V1M A;  3LOR A;  4ECB A;  4N0V A;  4PUR A;  4CDO A;  4FXY P;  3D6I A;  3N9J A;  3TDG A;  6GSY A;  3W6G A;  1PN0 A;  2MMZ A;  3KZQ A;  5D9W A;  4DSQ A;  1EP8 A;  1XVW A;  3O6T A;  1GSF A;  2XBQ A;  3P8W A;  1YZX A;  1MDI A;  2HE3 A;  3DYR A;  2CVD A;  5H5R A;  4Z2U A;  3APS A;  4TKY A;  1K0N A;  4KX4 A;  2WW3 A;  5ECR B;  2VLU A;  2DJ2 A;  2IN3 A;  3D5J A;  2LNS A;  3C73 A;  2QA2 A;  4K0N A;  1ILO A;  4XS4 B;  5CRG A;  5HR2 A;  5J41 A;  4ID0 A;  2MBS A;  1ZYE A;  2HXK A;  3ERF A;  4EO3 A;  1SKR B;  4P3Y B;  5B6N A;  3UMA A;  3AY8 A;  2AHE A;  2KP2 A;  3L78 A;  1WE0 A;  1YF1 A;  3PR8 A;  1USB A;  2LTK A;  1TDI A;  4YAP A;  1GNE A;  2K6V A;  4WR4 A;  4O7H A;  1XW6 A;  3KP8 A;  2I3Y A;  1FOV A;  3FYG A;  2M80 A;  4GLT A;  2C0D A;  2YJH A;  4L0W A;  5COH A;  1TW9 A;  5IIZ A;  2LRC A;  4LA1 A;  2O5V A;  3IDV A;  3IHQ A;  3ZIJ A;  3CSJ A;  2EIO A;  1F37 A;  1YJ6 A;  1SK2 A;  2R0P A;  4EF0 A;  2O8V B;  3ZML A;  1PX7 A;  4USS A;  3IPZ A;  1I9D A;  3PH9 A;  1GSD A;  1ZGN A;  4IJI A;  4ZB6 A;  4BL7 B;  3FZ9 A;  3HZ4 A;  3MAK A;  2CAI A;  2E7P A;  3TRP A;  4KW6 A;  2DKH A;  5CRE A;  3ZYW A;  2HZE A;  1OKD A;  4MF6 A;  3HY2 A;  3F8U A;  1AQV A;  3MYD A;  2CVK A;  2JSZ A;  1A24 A;  1Z6N A;  1EV9 A;  3VI7 A;  1Z6M A;  3WT2 A;  4I6X A;  3HMJ G;  2VCQ A;  5B7C A;  2H0I A;  2R0C A;  4RQX A;  1B8X A;  2IFQ B;  4IHU A;  1GP1 A;  5IQY A;  4K6X A;  2VM1 A;  4MPF A;  3WGX A;  5D9T A;  2LJA A;  4KCE A;  5IOW A;  4JU5 A;  4ECJ A;  5HR1 A;  3RAZ A;  3EUR A;  4BWS A;  2EFD A;  5DAL B;  2B5X A;  2B6M A;  3GUR A;  2FHE A;  4ISD A;  2V6K A;  3P7X A;  2BTO T;  2FCH A;  1RK4 A;  1QK8 A;  1AIU A;  1JLV A;  2I4A A;  5J40 A;  4G0L A;  1OC9 B;  3DRN A;  4YH2 A;  1JFU A;  1NM3 A;  2HSM B;  13GS A;  4LL4 B;  3MIX A;  3HVS A;  2EIQ A;  4JBB A;  4L5L A;  2GSR A;  3SWL A;  4ZBA A;  1H4O A;  2IME A;  4I97 A;  2H30 A;  5L71 A;  3TUE A;  4HJ2 A;  3RBT A;  3IK9 A;  2C4J A;  5FT3 A;  4K7N A;  4WXT A;  5CNW A;  3KIJ A;  3Q6O A;  4MDC A;  1HNA A;  3A2V A;  5ID2 B;  2H1G A;  3FKF A;  3TU3 B;  3GH6 A;  2HI7 A;  2DJJ A;  4TR1 B;  22GS A;  2XC2 A;  3IA1 A;  3DKS A;  1SKS B;  5J5N A;  2E0Q A;  3IC8 A;  2LJK A;  4G10 A;  3HDC A;  2TIR A;  1GUH A;  1MD4 A;  2XBI A;  1T7P B;  4J2F A;  5IMF A;  19GS A;  1Z9H A;  2FWE A;  2JU5 A;  4O32 A;  2Z9S A;  1BQ7 A;  2VCT A;  1SYR A;  4MCU A;  2PGT A;  4MF7 A;  1V9W A;  2L59 A;  3RGB C;  4NAX A;  2YWI A;  3E0U A;  5ID2 A;  3MSZ A;  2LRT A;  1M2A A;  6GSS A;  1M99 A;  2HNL A;  2LQO A;  4A5P A;  2KLX A;  4MJE A;  4GRF A;  1A0F A;  2PN8 A;  4LL1 B;  1A8Y A;  3F0I A;  4EDY A;  1AQX A;  3FW2 A;  2FUG 2;  3HVX A;  4G01 A;  5CAX A;  3M9J A;  2NTO A;  3BBY A;  5IPH A;  1ZZY A;  2YNX A;  2VM2 A;  4POL A;  2R4V A;  1G7O A;  3H79 A;  4EVM A;  2P5Q A;  1A2J A;  3CMI A;  3KD0 A;  2KP1 A;  3ZMK A;  3KTL A;  2GST A;  2HRK A;  4V2M A;  2C8U A;  3CSH A;  3TKQ A;  1SJZ A;  2X49 A;  2GQK A;  3MWH A;  2HT9 A;  1ABA A;  4PUF C;  5ELA A;  3QFA C;  4PTS A;  4YQV A;  1F9M A;  2KOK A;  2VOC A;  1V40 A;  5ECH B;  2A4H A;  2ALB A;  3RPP A;  1MEK A;  3CWG A;  2YCD A;  3ZTL A;  2G0F A;  4GQF A;  3EE2 A;  1GRX A;  3VUR A;  3A3T A;  1URM A;  3IAM 2;  3MNG A;  5DQS A;  2ZUP A;  4JRR A;  3PPU A;  2X99 A;  2WW2 A;  4ILF A;  2H1D A;  4KDX A;  1FAA A;  4PI2 C;  2FY6 A;  2RM6 A;  5ECP B;  4KGI A;  2L5L A;  1QUW A;  2I9H A;  1NHY A;  1ZMA A;  1M2D A;  4HSC X;  4ZIJ A;  3S9F A;  17GS A;  3GTU B;  2VAF A;  2UZ8 A;  4QL9 A;  4F03 A;  4TR4 A;  3WD6 A;  3QD9 A;  5H5S A;  3VWW A;  4MJA A;  2OAC A;  4TW5 A;  4O5Q A;  4TXV A;  2ON7 A;  1ZCP A;  4GQC A;  5KN1 A;  3GKM A;  1MTC A;  3DVW A;  2P5R A;  3VWV A;  4KA0 A;  2FWG A;  1TXU A;  3LG6 A;  2L5O A;  3C1S A;  3DML A;  3TKS E;  4K8M A;  4X4J A;  3GV1 A;  3Q74 A;  3QCP A;  3TJG A;  3HJP A;  5G1L A;  2HLS A;  3BCI A;  2VLV A;  4PUA A;  2RLI A;  2VCW A;  5HFG A;  2CZ2 A;  5AIS A;  4Q5Q A;  1XFL A;  1YEX A;  1MDK A;  1SK0 A;  2C3N A;  2XHF A;  4GST A;  3GTU A;  2LQQ A;  3W8J A;  4FYU A;  4MF5 A;  3DWV A;  1Z7R A;  5ECQ B;  1ERW A;  5J4U A;  2O36 A;  1Q4J A;  4ZIL A;  2L4C A;  3A5W A;  1PN9 A;  2FD3 A;  3MDK A;  3U6V A;  4V2L A;  2DLX A;  2IMK A;  1FO5 A;  1FHE A;  1ZL9 A;  1XWG A;  1BG5 A;  3DEX A;  4IQ1 A;  2YWN A;  4FH8 A;  2R6K A;  3QR6 A;  1T4Y A;  2H01 A;  1GTU A;  2VL2 C;  4MH3 A;  4TVE A;  4AKH A;  1GLP A;  2YOI A;  3DGQ A;  1R26 A;  4HQS A;  1A8L A;  2C3T A;  2OE1 A;  3R3E A;  4NPB A;  3KH7 A;  1S3A A;  3L9S A;  3UL3 A;  1K0B A;  2TRC P;  2GT5 A;  4Z7X A;  4HEA 2;  4YKG A;  2X8H A;  1TOF A;  5ECL B;  3VWU A;  5KN2 A;  1EV4 A;  5A4U A;  4MZW A;  3ZFB A;  3GN3 A;  4QQ7 A;  4OWY A;  5KOX A;  3D0Z A;  3RFR C;  5ENU A;  2WDU A;  1QXH A;  4N3Z A;  1SL0 B;  1TU7 A;  1XOB A;  1C72 A;  3ZRD A;  3FHK A;  2DML A;  1GSY A;  1SD9 A;  5GSS A;  4J57 E;  4O92 A;  4IP1 A;  5HFK A;  2GQM A;  1A2L A;  2HRF A;  4ML1 A;  2XPD A;  4F0C A;  2BJX A;  3HCZ A;  4OD7 A;  1ON4 A;  3TRX A;  1GUM A;  5ELG A;  1YQ1 A;  3HZ8 A;  3KTB A;  3OR5 A;  3QOU A;  3ZVJ A;  1V58 A;  3C7M A;  1FW1 A;  1TJD A;  2QGV A;  1WPI A;  1GL8 A;  4YQM A;  4EL1 A;  4XHM A;  4N11 A;  1DE2 A;  4IVF A;  1GUK A;  3GFK A;  1NSW A;  2IMF A;  4CY6 A;  4L8E A;  2O89 A;  2NDO A;  3NZN A;  3G7Y A;  2HSY A;  1H75 A;  3CXG A;  3O76 A;  4ZBD A;  1SJ6 A;  2A4V A;  2WW0 A;  4G19 A;  2GZZ A;  3RPN A;  4EIQ A;  3WT1 A;  1WJK A;  1OC3 A;  2H76 A;  2DKI A;  2H19 A;  2VO4 A;  2PVO C;  4XS6 A;  3GL5 A;  4LMW A;  3ZVJ D;  2MBT A;  2WB9 A;  4GF0 A;  3FZ4 A;  3TRQ A;  3EU4 A;  1WIK A;  4I2U A;  4YQU A;  10GS A;  1U3I A;  3IOS A;  5ECM B;  3F6F A;  2PER A;  1ACV A;  1S4B P;  3I9V 2;  1O73 A;  2I81 A;  2CAQ A;  3LYP A;  3UAP A;  1J08 A;  1XIY A;  2HZE B;  1S3R A;  5EL8 A;  4G9H A;  1ZYP A;  3APO A;  1BG1 A;  5IOX A;  2C3Q A;  3FEU A;  4DSS A;  5BRT A;  4BA7 A;  1QMV A;  3BCK A;  6GSX A;  2A2R A;  1J9B A;  1F6M C;  1DBY A;  5AGY A;  1K3Y A;  4X1U A;  1XW9 A;  1Z3E A;  4POK A;  4Q5F A;  3F4T A;  2OBK A;  4EUY A;  2LJR A;  4GSN A;  2X8G A;  3VK9 A;  4MK3 A;  4LMV A;  4TN8 A;  3QFB C;  3TGZ A;  5B8A A;  4H86 A;  1K0C A;  3L4N A;  5HR3 A;  2JL4 A;  1XW5 A;  5ECK B;  2B5Y A;  1YF0 A;  4KE3 A;  3GST A;  5CRW A;  4ULX A;  3IHG A;  3HD5 A;  1BAY A;  3IRA A;  2GTU A;  1GSQ A;  4PI0 C;  2CX4 A;  2H75 A;  3LXZ A;  5G5F A;  3UEM A;  2GZY A;  3UVH A;  3CRU A;  2IWT A;  18GS A;  3M1G A;  3D4M A;  1G7E A;  1JZO A;  4KSO A;  1OVN A;  1TI1 A;  4WEY A;  2OAD A;  1TRV A;  5BMU A;  1HYU A;  1SD8 A;  3TJF A;  1PGT A;  3QPM A;  2ZCT A;  4MA9 A;  2FA8 A;  1SU9 A;  3GH9 A;  3HYP A;  1TKD B;  4K2D A;  1F3A A;  1HNB A;  3EMP A;  5B8B A;  3A2W A;  1VGL A;  2RM5 A;  2B7J A;  2OBI A;  4EXJ A;  2WVZ A;  4TOP A;  4PNG A;  1J0F A;  3HJO A;  2ES7 A;  4I2T A;  1PFO A;  1PX6 A;  1UA5 A;  3GHA A; 
#chains in the Genus database with same CATH homology
 2OE0 A;  4KSM A;  2YJ7 A;  2PUK C;  4CW9 A;  3FZA A;  3F63 A;  3G7J A;  1LJR A;  2J23 A;  1TXX A;  1PD2 1;  2R2J A;  4GDF A;  3PGT A;  4RI7 A;  3VPT A;  1HD2 A;  1NHO A;  3ZRE A;  1EWX A;  1PA3 A;  2X8C A;  1UVZ A;  1TK5 B;  1GSS A;  2N5B A;  3D4T A;  3HXS A;  2L57 A;  2C80 A;  2H1B A;  3H1N A;  4MNN A;  4Q5N A;  3TKS C;  3UBK A;  5JWO B;  2PPT A;  1B4Q A;  4OFT A;  1SVL A;  1SL1 B;  4AF2 A;  1Y25 A;  1KTE A;  4I5Q A;  4MLY A;  9GSS A;  3GMF A;  1SEN A;  2P0G A;  4BVX A;  4PNF A;  2HRK B;  5G30 A;  5LNK e;  3GSS A;  2AUV A;  4LLR A;  1BJX A;  4WF5 A;  3TOT A;  3K8N A;  3KEB A;  4I8B A;  3HJM A;  4MZC A;  2XPE A;  1X9M B;  1YVL A;  2VKZ G;  5IMD A;  4E8E A;  3C1R A;  1NW2 A;  4NHZ A;  1VF4 A;  3EMX A;  5D96 A;  2GSS A;  4WBR D;  3HVV A;  2TRX A;  4ZB9 A;  1G0T A;  4TXO A;  3F4S A;  2F8A A;  2GGT A;  1U6T A;  3WGE A;  1M9B A;  3LSZ A;  1SJI A;  4MP4 A;  6GSW A;  3ZIV A;  2GSQ A;  4XTS A;  5GZZ B;  2CZ3 A;  4V1A p;  2H66 A;  2H70 A;  3TB2 A;  1W89 A;  2MMO A;  2YZU A;  4HQZ A;  1KNG A;  3KJY A;  2WJU A;  2UV8 G;  2MZC A;  3KCM A;  2WS2 A;  2G2Q A;  2B7K A;  1ST9 A;  3GKK A;  4F2I A;  2LST A;  1VF2 A;  4XIH A;  4MH2 A;  4ECI A;  5C04 A;  2WCI A;  5F07 A;  1THO A;  2LUS A;  2NBS A;  3GA4 A;  1Y1U A;  3ME8 A;  3UJ1 A;  1X9S B;  4FYC A;  4E8H A;  1TP9 A;  2LV3 A;  3I43 A;  3LYK A;  4NXI A;  4Z2R A;  3ZLP A;  2O7K A;  2VL9 A;  1FB6 A;  3M8N A;  3ERW A;  3TCO A;  4KF9 A;  1KEB A;  3RHC A;  1GWC A;  4HI7 A;  1TTZ A;  2CT6 A;  2H72 A;  2OE3 A;  4RI6 A;  3SBC A;  2GT6 A;  2DJ1 A;  4ICY A;  5F06 A;  2GS3 A;  5DVB A;  1BX9 A;  2OT3 A;  1T8E B;  2C0E A;  4XS1 A;  3GNJ A;  5IMC A;  2CA8 A;  4F0B A;  1VF1 A;  1XXU A;  3ZIT A;  4BWQ A;  2EC4 A;  5CRH A;  2WGR A;  4G0K A;  4EE0 A;  3ZL5 A;  2YWO A;  1Z5Y E;  2EFC A;  1R5P A;  1GNW A;  4POM A;  5A5K A;  4ML6 A;  4WET A;  2LNT A;  4MJB A;  4PX1 A;  4CY8 A;  1ERU A;  2GQL A;  2OKA A;  4FO5 A;  2WFC A;  2I1U A;  3EYT A;  3EIN A;  2R37 A;  3RDW A;  1QQ2 A;  1O8X A;  2HSH A;  4N10 A;  2KHP A;  1X5D A;  4HS1 A;  3Q19 A;  1Z7P A;  1PL2 A;  4EIP A;  2R3X A;  3NIV A;  3D22 A;  2QKE A;  4AJ7 A;  6GSU A;  4HU9 A;  3PIN A;  4PGT A;  3GKN A;  1N8J A;  4K5S A;  1PMT A;  3IC4 A;  1U3A A;  3GX0 A;  2ZNM A;  4AJ8 A;  1PKW A;  1RQM A;  5A4V A;  3FR3 A;  2VCX A;  1XCC A;  4W66 A;  2JSY A;  5LCZ A;  1O6J A;  3BJ5 A;  1QGV A;  1GUL A;  4HJM A;  5AIV A;  4JED A;  4K7O A;  2A2S A;  3O3T A;  1K0D A;  3LEF A;  3G7I A;  1BF5 A;  2GLR A;  2P31 A;  1AXD A;  2HRN A;  4EKZ A;  4KAE A;  4AI6 A;  1K0O A;  1YEP A;  4IS0 A;  3TKP A;  3QAV A;  2K18 A;  4RUV A;  4X43 A;  6GSV A;  2V2G A;  5F8B A;  1K0A A;  1A0R P;  2YPM A;  2V6O A;  1SVM A;  5DCH A;  3KGK A;  1TRW A;  1PKZ A;  2A2P A;  1XOA A;  2PBJ A;  2QC7 A;  2YP6 A;  5HQP A;  5ECO B;  4AGS A;  4V2N A;  4NHW A;  1VRS D;  5G2Z A;  3QMX A;  3EPT A;  1ERV A;  5HFI A;  3J7Y k;  2EFH A;  3M0F A;  2FA4 A;  4IQA A;  1SYX A;  4FQU A;  2HSN B;  1ML6 A;  2F8F A;  1LU4 A;  4Q5R A;  4DVC A;  2AJQ B;  1IYI A;  1OE8 A;  4DSR A;  3F3Q A;  1TI3 A;  1EOG A;  4ZB7 A;  1DE1 A;  1T3B A;  2LRN A;  2GZP A;  5JWQ B;  3VPQ A;  4X0X A;  1T00 A;  5GAP D;  1JZW A;  2H0G A;  3UOM A;  5EPF A;  2NVL A;  5J9B A;  4HU7 A;  4G2E A;  3HA9 A;  2E2G A;  3LJR A;  5FWG A;  2N5A A;  5A5H A;  3QDN A;  3IBH A;  12GS A;  2R5G A;  4KCA A;  2QA1 A;  1YDK A;  3UBL A;  1V2A A;  2DBC A;  3FK8 A;  3ED3 A;  2HSN A;  1OC8 A;  1JLW A;  2K8S A;  1T1V A;  2FLS A;  5DCG A;  4TRX A;  5G5E A;  4G0I A;  2C0G A;  1GTI A;  4OCE A;  4WR5 A;  1O8W A;  4DSS B;  2HYX A;  3F9U A;  4J56 E;  3EC3 A;  2RII A;  1UN2 A;  3HHV A;  1X0R A;  3DXB A;  5GST A;  3N5O A;  2RUE A;  1ZYQ B;  4WKW A;  1O81 A;  1TRS A;  1JZD A;  1WRY A;  1LBK A;  5D9V A;  1XWA A;  3JCM L;  4D73 A;  5IO2 A;  2ON5 A;  3KXO A;  2C1Y A;  3G9B A;  1DSB A;  5KOW A;  14GS A;  5DJM A;  2VUP A;  5KN3 A;  1EEM A;  4DEJ A;  2JAD A;  16GS A;  1EGO A;  1PRX A;  2H0H A;  1YKA A;  2F9S A;  3EU3 A;  5G1K A;  2H6Y A;  2PU9 C;  3L9U A;  1THX A;  4KND A;  4F82 A;  1FVK A;  5J4V A;  1PL1 A;  2JZS A;  5J3R A;  3KMN A;  3VLN A;  2WUL A;  1OKT A;  2CX3 A;  1CQH A;  3E3E A;  5F0G A;  1SKW B;  1R5A A;  5DBQ A;  5G31 A;  3TJB A;  2L6D A;  2CV4 A;  2PWJ A;  5FHI A;  1G6Y A;  3M9K A;  1T4Z A;  3ZZX A;  5BMU B;  2B3S A;  2J9H A;  1KBN A;  1F2E A;  5GAN D;  1XWC A;  3ME7 A;  1UC7 A;  3TKR A;  4EC0 A;  5KN0 A;  4PQ1 A;  2B1L A;  4QMK A;  4PQH A;  5EVO A;  1AC1 A;  20GS A;  3IAS 2;  2H71 A;  2YV9 A;  1X9W B;  4XS4 A;  4ZL8 A;  4O5U A;  4NV5 A;  3I69 A;  1QFN A;  1BYE A;  1OE7 A;  5LD0 A;  4HUA A;  1G6W A;  3UIW A;  4KB3 A;  2FNO A;  3VFI A;  3GYK A;  1EZK A;  3CTF A;  2K9F A;  1EEJ A;  1FG4 A;  3LXT A;  4KH7 A;  4FYB A;  1FOH A;  3A2X A;  3NOF A;  1WP0 A;  3IK7 A;  2EFE A;  2H1L A;  2AV4 A;  1BED A;  3FRC A;  1XWB A;  5IO0 A;  2AB6 A;  5IMA A;  4JE1 A;  4GCI A;  2QSI A;  5DQY A;  4L5O A;  4YKF A;  5AIX A;  5A34 B;  3LWA A;  1F3B A;  2N5F A;  1E2Y A;  3EVI A;  3ZFL A;  4OO4 A;  4OFM A;  3GX8 A;  4KUN A;  5IM9 A;  2VCV A;  4IEL A;  4BL7 A;  1X5E A;  2O87 A;  4BVX B;  4ZB8 A;  1ZOF A;  3F3R A;  1R7H A;  4K7I A;  1OAZ A;  2LKU A;  4K9Z A;  1O7U A;  2C0F A;  5AN1 A;  4MPG A;  1X5C A;  5JCU A;  4K2X A;  2IFQ A;  3TJJ A;  3F4R A;  1WWJ A;  2H6Z A;  3L0H A;  4WBJ A;  3U5R E;  3WGD A;  4TR0 A;  1V98 A;  5A34 A;  1E6B A;  3H93 A;  3FR9 A;  2DJK A;  1AW9 A;  3P2A A;  1AQW A;  5JCG A;  3IR4 A;  3KP9 A;  1XVQ A;  4L0U A;  5DAL A;  2AAW A;  4TXO B;  4QL7 A;  3LGC A;  2PVQ A;  2PMT A;  3R2Q A;  2REM A;  5DAK B;  5DDL A;  3CSI A;  1MD3 A;  2R0G A;  1S3C A;  1FB0 A;  3UAR A;  1OC9 A;  2YV7 A;  2H74 A;  4RQR A;  1OYJ A;  2HSM A;  1ERT A;  1PSQ A;  1EP7 A;  3CRT A;  3VWX A;  5A1N B;  1WOU A;  4F9Z A;  2VL2 A;  2NPB A;  4EDZ A;  5J47 A;  1U87 A;  2JAC A;  2L6C A;  1AAZ A;  1K0M A;  4K1F A;  3FMW A;  2X64 A;  4N0Z A;  3VI5 A;  2YZH A;  5JCW A;  1GLQ A;  4ACS A;  4IW9 A;  2HFD A;  5E59 A;  2HRA A;  5CRD A;  3J7Y b;  4TR1 A;  1N2A A;  3M3M A;  3GUS A;  2CVB A;  5DAK A;  1HNC A;  1A23 A;  4MAB A;  3I6A A;  1SK1 A;  4OO5 A;  1B4P A;  4IKH A;  2FWF A;  1ZYN A;  3APQ A;  4OCF A;  4ZXG A;  3ERG A;  5A1N A;  1VF3 A;  3P90 A;  2H1A A;  3EWL A;  4XCS A;  3C8E A;  4E68 A;  1DUG A;  3FZ5 A;  8GSS A;  1YY7 A;  1RW1 A;  4ZL7 A;  2DMM A;  1R4W A;  2F51 A;  3GKX A;  4IP6 A;  4BPY A;  5CYY A;  1K3L A;  5C00 A;  4XRD A;  4K0G A;  4N30 A;  4ECC A;  4JR4 A;  1V57 A;  1JHB A;  2FGX A;  3DIE A;  3TJK A;  5E4W A;  2YN1 A;  5D73 A;  4KDY A;  1U88 A;  1B48 A;  3QAG A;  3BOA A;  3DVX A;  2VD1 A;  2B1K A;  4V1A g;  5D93 A;  1S3D A;  4JZQ A;  1EGR A;  4IJ3 A;  2M46 A;  2VIM A;  1M0U A;  2DIY A;  2IJY A;  5IMV A;  3CYN A;  5KEJ A;  4GXZ A;  4XRA A;  5HR0 A;  1IYH A;  4CHS A;  2LEG A;  3FR6 A;  4GTU A;  3IXR A;  3KM6 A;  2H73 A;  2GDR A;  2E2M A;  5D8I A;  1JZR A;  2VLT A;  1MDJ A;  3IV4 A;  3QAW A;  1XBS A;  3W8S A;  2M72 A;  3FY7 A;  4AKX B;  2JZT A;  2VCZ A;  1PQN A;  5ECS A;  5EY6 A;  3DD3 A;  1N25 A;  3GRX A;  3CTG A;  2MMA A;  5B6M A;  2CQ9 A;  2AYT A;  2KUC A;  2MYG A;  2VD0 A;  2B5E A;  3LFL A;  5A4W A;  4IN0 A;  2DC5 A;  2OA7 A;  4HDE A;  4HZ4 A;  2V41 A;  4ZL9 A;  1YKC A;  5INY A;  2FWH A;  3WYW A;  2DSA A;  5ECN B;  2DIZ A;  2WZ9 A;  4IBP A;  2MMN A;  4FIW A;  4OMV A;  5DJL A;  4PQI A;  1SVO A;  3L9V A;  4HZ2 A;  4YAV A;  5H5Q A;  1M2B A;  2OJL A;  4WF4 A;  3TOU A;  1M7T A;  1AUC A;  5J9C A;  3V1W A;  4NWY A;  1W4V A;  5IMZ A;  2EIR A;  1TK8 B;  1K3O A;  1I5G A;  3E9J B;  2DJ3 A;  3GL3 A;  3D21 A;  1TU8 A;  5F05 A;  5CP1 A;  5ABR A;  1A2M A;  4PXO A;  2IPA A;  4O5R A;  4AJ6 A;  4MMM A;  2IL3 A;  1M9A A;  1Y6E A;  5J4Y A;  3Q18 A;  4GWR A;  3KMO A;  5D9X A;  1GSE A;  4TR3 A;  3UVT A;  3IE3 A;  4NV2 A;  4HOJ A;  1B9X C;  3C71 A;  4IGJ A;  2IMD A;  1SL2 B;  2RUF A;  1XPV A;  1GTB A;  5A5H B;  4GSS A;  4BVY B;  1O85 A;  3CBU A;  3BD2 A;  4Z2T A;  3HKR A;  2IMI A;  2DJ0 A;  1XZO A;  3LW9 A;  2O85 A;  2F3M A;  2HZF A;  6GST A;  4MZB A;  3US3 A;  2GVP A;  2K8V A;  1GH2 A;  2YWM A;  2BMX A;  5ECI B;  1FVJ A;  1TK0 B;  2X4A A;  2VL3 A;  4NMU A;  11GS A;  1EOH A;  2IIY A;  3H8Q A;  1Q98 A;  3LQ7 A;  2D2Z A;  2WRT A;  3KH9 A;  4OFN A;  1GSU A;  3F6D A;  4POB A;  3GIX A;  3H4K A;  2LS5 A;  5CO3 A;  3A5I A;  4AKG A;  4K5R A;  4BVY A;  4D73 B;  2YAN A;  1GTA A;  1B9Y C;  4KDU A;  3ISO A;  1TRU A;  4MJC A;  7GSS A;  2JZR A;  3RHB A;  1HQO A;  2H6X A;  1WMJ A;  4ZBB A;  1CQG A;  2HQT A;  3TKS A;  1XWK A;  2V32 A;  4AKI A;  2L4Q A;  4JR6 A;  5JWR B;  5IPG A;  2H8L A;  2V1M A;  3LOR A;  4ECB A;  4N0V A;  4PUR A;  4CDO A;  3D6I A;  3N9J A;  3TDG A;  6GSY A;  3W6G A;  1PN0 A;  2MMZ A;  3KZQ A;  5D9W A;  4DSQ A;  1EP8 A;  1XVW A;  3O6T A;  1GSF A;  2XBQ A;  3P8W A;  1YZX A;  1MDI A;  2HE3 A;  3DYR A;  2CVD A;  5H5R A;  4Z2U A;  3APS A;  4TKY A;  1K0N A;  4KX4 A;  2VLU A;  5ECR B;  2DJ2 A;  2IN3 A;  3D5J A;  2LNS A;  3C73 A;  2QA2 A;  4K0N A;  1ILO A;  4XS4 B;  5CRG A;  5HR2 A;  5J41 A;  4ID0 A;  2MBS A;  1ZYE A;  2HXK A;  3ERF A;  4EO3 A;  1SKR B;  4P3Y B;  5B6N A;  3UMA A;  3AY8 A;  2AHE A;  2KP2 A;  3L78 A;  1WE0 A;  1YF1 A;  3PR8 A;  1USB A;  2LTK A;  1TDI A;  4YAP A;  1GNE A;  2K6V A;  4WR4 A;  4O7H A;  1XW6 A;  3KP8 A;  2I3Y A;  1FOV A;  3FYG A;  2M80 A;  4GLT A;  2C0D A;  2YJH A;  4L0W A;  5COH A;  1TW9 A;  5IIZ A;  2LRC A;  4LA1 A;  2O5V A;  3IDV A;  3IHQ A;  3ZIJ A;  3CSJ A;  2EIO A;  1F37 A;  1YJ6 A;  1SK2 A;  2R0P A;  4EF0 A;  2O8V B;  3ZML A;  1PX7 A;  4USS A;  3IPZ A;  1I9D A;  3PH9 A;  1GSD A;  1ZGN A;  4IJI A;  4ZB6 A;  4BL7 B;  3FZ9 A;  3HZ4 A;  3MAK A;  2CAI A;  2E7P A;  3TRP A;  4KW6 A;  2DKH A;  5CRE A;  3ZYW A;  2HZE A;  1OKD A;  4MF6 A;  3HY2 A;  3F8U A;  1AQV A;  3MYD A;  2CVK A;  2JSZ A;  1A24 A;  1Z6N A;  1EV9 A;  3VI7 A;  1Z6M A;  3WT2 A;  4I6X A;  3HMJ G;  2VCQ A;  5B7C A;  2H0I A;  2R0C A;  4RQX A;  1B8X A;  2IFQ B;  4IHU A;  1GP1 A;  5IQY A;  4K6X A;  2VM1 A;  4MPF A;  3WGX A;  5D9T A;  2LJA A;  4KCE A;  5IOW A;  4JU5 A;  4ECJ A;  5HR1 A;  3RAZ A;  3EUR A;  4BWS A;  2EFD A;  5DAL B;  2B5X A;  2B6M A;  3GUR A;  2FHE A;  4ISD A;  2V6K A;  3P7X A;  2BTO T;  2FCH A;  1RK4 A;  1QK8 A;  1AIU A;  1JLV A;  2I4A A;  5J40 A;  4G0L A;  1OC9 B;  3DRN A;  4YH2 A;  1JFU A;  1NM3 A;  2HSM B;  13GS A;  4LL4 B;  3MIX A;  3HVS A;  2EIQ A;  4JBB A;  4L5L A;  2GSR A;  3SWL A;  4ZBA A;  1H4O A;  2IME A;  4I97 A;  2H30 A;  5L71 A;  3TUE A;  4HJ2 A;  3RBT A;  3IK9 A;  2C4J A;  5FT3 A;  4K7N A;  4WXT A;  5CNW A;  3KIJ A;  3Q6O A;  4MDC A;  1HNA A;  3A2V A;  5ID2 B;  2H1G A;  3FKF A;  3TU3 B;  3GH6 A;  2HI7 A;  2DJJ A;  4TR1 B;  22GS A;  2XC2 A;  3IA1 A;  3DKS A;  1SKS B;  5J5N A;  2E0Q A;  3IC8 A;  2LJK A;  4G10 A;  3HDC A;  2TIR A;  1GUH A;  1MD4 A;  2XBI A;  1T7P B;  4J2F A;  5IMF A;  19GS A;  1Z9H A;  2FWE A;  2JU5 A;  4O32 A;  2Z9S A;  1BQ7 A;  2VCT A;  1SYR A;  4MCU A;  2PGT A;  4MF7 A;  1V9W A;  2L59 A;  4NAX A;  2YWI A;  3E0U A;  5ID2 A;  3MSZ A;  2LRT A;  1M2A A;  6GSS A;  1M99 A;  2HNL A;  2LQO A;  4A5P A;  2KLX A;  4MJE A;  4GRF A;  1A0F A;  2PN8 A;  4LL1 B;  1A8Y A;  3F0I A;  4EDY A;  1AQX A;  3FW2 A;  2FUG 2;  3HVX A;  4G01 A;  5CAX A;  3M9J A;  2NTO A;  3BBY A;  5IPH A;  1ZZY A;  2YNX A;  2VM2 A;  4POL A;  2R4V A;  1G7O A;  3H79 A;  4EVM A;  2P5Q A;  1A2J A;  3CMI A;  3KD0 A;  2KP1 A;  3ZMK A;  3KTL A;  2GST A;  2HRK A;  4V2M A;  2C8U A;  3CSH A;  3TKQ A;  1SJZ A;  2X49 A;  2GQK A;  3MWH A;  2HT9 A;  1ABA A;  4PUF C;  5ELA A;  3QFA C;  4PTS A;  4YQV A;  1F9M A;  2KOK A;  2VOC A;  1V40 A;  5ECH B;  2A4H A;  2ALB A;  3RPP A;  1MEK A;  3CWG A;  2YCD A;  3ZTL A;  2G0F A;  4GQF A;  3EE2 A;  1GRX A;  3VUR A;  3A3T A;  1URM A;  3IAM 2;  3MNG A;  5DQS A;  2ZUP A;  4JRR A;  3PPU A;  2X99 A;  4ILF A;  2H1D A;  4KDX A;  1FAA A;  2FY6 A;  2RM6 A;  5ECP B;  4KGI A;  2L5L A;  1QUW A;  2I9H A;  1NHY A;  1ZMA A;  1M2D A;  4ZIJ A;  3S9F A;  17GS A;  3GTU B;  2VAF A;  2UZ8 A;  4QL9 A;  4F03 A;  4TR4 A;  3WD6 A;  3QD9 A;  5H5S A;  3VWW A;  4MJA A;  2OAC A;  4TW5 A;  4O5Q A;  4TXV A;  2ON7 A;  1ZCP A;  4GQC A;  5KN1 A;  3GKM A;  1MTC A;  3DVW A;  2P5R A;  3VWV A;  4KA0 A;  2FWG A;  1TXU A;  3LG6 A;  2L5O A;  3C1S A;  3DML A;  3TKS E;  4K8M A;  4X4J A;  3GV1 A;  3Q74 A;  3QCP A;  3TJG A;  3HJP A;  5G1L A;  2HLS A;  3BCI A;  2VLV A;  4PUA A;  2RLI A;  2VCW A;  5HFG A;  2CZ2 A;  5AIS A;  4Q5Q A;  1XFL A;  1YEX A;  1MDK A;  1SK0 A;  2C3N A;  2XHF A;  4GST A;  3GTU A;  2LQQ A;  3W8J A;  4FYU A;  4MF5 A;  3DWV A;  1Z7R A;  5ECQ B;  1ERW A;  5J4U A;  1Q4J A;  4ZIL A;  2L4C A;  3A5W A;  1PN9 A;  2FD3 A;  3MDK A;  3U6V A;  4V2L A;  2DLX A;  2IMK A;  1FO5 A;  1FHE A;  1ZL9 A;  1XWG A;  1BG5 A;  3DEX A;  4IQ1 A;  2YWN A;  4FH8 A;  2R6K A;  3QR6 A;  1T4Y A;  2H01 A;  1GTU A;  2VL2 C;  4MH3 A;  4TVE A;  4AKH A;  1GLP A;  2YOI A;  3DGQ A;  1R26 A;  4HQS A;  1A8L A;  2C3T A;  2OE1 A;  3R3E A;  4NPB A;  3KH7 A;  1S3A A;  3L9S A;  3UL3 A;  1K0B A;  2TRC P;  2GT5 A;  4Z7X A;  4HEA 2;  4YKG A;  2X8H A;  1TOF A;  5ECL B;  3VWU A;  5KN2 A;  1EV4 A;  5A4U A;  4MZW A;  3ZFB A;  3GN3 A;  4QQ7 A;  4OWY A;  5KOX A;  3D0Z A;  5ENU A;  2WDU A;  1QXH A;  4N3Z A;  1SL0 B;  1TU7 A;  1XOB A;  1C72 A;  3ZRD A;  3FHK A;  2DML A;  1GSY A;  1SD9 A;  5GSS A;  4J57 E;  4O92 A;  4IP1 A;  5HFK A;  2GQM A;  1A2L A;  2HRF A;  4ML1 A;  2XPD A;  4F0C A;  2BJX A;  3HCZ A;  4OD7 A;  1ON4 A;  3TRX A;  1GUM A;  5ELG A;  1YQ1 A;  3HZ8 A;  3KTB A;  3OR5 A;  3QOU A;  3ZVJ A;  1V58 A;  3C7M A;  1FW1 A;  1TJD A;  2QGV A;  1WPI A;  1GL8 A;  4YQM A;  4EL1 A;  4XHM A;  4N11 A;  1DE2 A;  4IVF A;  1GUK A;  3GFK A;  1NSW A;  2IMF A;  4CY6 A;  4L8E A;  2O89 A;  2NDO A;  3NZN A;  3G7Y A;  2HSY A;  1H75 A;  3CXG A;  3O76 A;  4ZBD A;  1SJ6 A;  2A4V A;  4G19 A;  2GZZ A;  3RPN A;  4EIQ A;  3WT1 A;  1WJK A;  1OC3 A;  2H76 A;  2DKI A;  2H19 A;  2VO4 A;  2PVO C;  4XS6 A;  3GL5 A;  4LMW A;  3ZVJ D;  2MBT A;  2WB9 A;  4GF0 A;  3FZ4 A;  3TRQ A;  3EU4 A;  1WIK A;  4I2U A;  4YQU A;  10GS A;  1U3I A;  3IOS A;  5ECM B;  3F6F A;  2PER A;  1ACV A;  3I9V 2;  1O73 A;  2I81 A;  2CAQ A;  3LYP A;  3UAP A;  1J08 A;  1XIY A;  2HZE B;  5EL8 A;  4G9H A;  1ZYP A;  3APO A;  1BG1 A;  5IOX A;  2C3Q A;  3FEU A;  4DSS A;  5BRT A;  4BA7 A;  1QMV A;  3BCK A;  6GSX A;  2A2R A;  1J9B A;  1F6M C;  1DBY A;  5AGY A;  1K3Y A;  4X1U A;  1XW9 A;  1Z3E A;  4POK A;  4Q5F A;  3F4T A;  2OBK A;  4EUY A;  2LJR A;  4GSN A;  2X8G A;  3VK9 A;  4MK3 A;  4LMV A;  4TN8 A;  3QFB C;  3TGZ A;  5B8A A;  4H86 A;  1K0C A;  3L4N A;  5HR3 A;  2JL4 A;  1XW5 A;  5ECK B;  2B5Y A;  1YF0 A;  4KE3 A;  3GST A;  5CRW A;  4ULX A;  3IHG A;  3HD5 A;  1BAY A;  3IRA A;  2GTU A;  1GSQ A;  2CX4 A;  2H75 A;  3LXZ A;  5G5F A;  3UEM A;  2GZY A;  3UVH A;  3CRU A;  2IWT A;  18GS A;  3M1G A;  3D4M A;  1G7E A;  1JZO A;  4KSO A;  1OVN A;  1TI1 A;  4WEY A;  2OAD A;  1TRV A;  5BMU A;  1HYU A;  1SD8 A;  3TJF A;  1PGT A;  3QPM A;  2ZCT A;  4MA9 A;  2FA8 A;  1SU9 A;  3GH9 A;  3HYP A;  1TKD B;  4K2D A;  1F3A A;  1HNB A;  3EMP A;  5B8B A;  3A2W A;  1VGL A;  2RM5 A;  2B7J A;  2OBI A;  4EXJ A;  4TOP A;  4PNG A;  1J0F A;  3HJO A;  2ES7 A;  4I2T A;  1PX6 A;  1UA5 A;  3GHA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...