3HKRA

Crystal structure of glutathione transferase pi y108v mutant
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
208
structure length
208
Chain Sequence
PYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIVTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase P
publication title Influence of the H-site residue 108 on human glutathione transferase P1-1 ligand binding: structure-thermodynamic relationships and thermal stability.
pubmed doi rcsb
source organism Homo sapiens
total genus 79
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2009-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3hkrA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3hkrA01
2YPMA 3RBTA 4TW5A 3UOMA 2LQQA 5DALB 2B7JA 2NDOA 2RUFA 3CSIA 2ON5A 3IC8A 2FA8A 3GV1A 4ZL7A 3KIJA 1GSDA 1OC3A 3UEMA 2V1MA 4BVXA 1GSYA 4O7HA 1H75A 3VURA 14GSA 4L0UA 2H19A 1XIYA 3L9VA 5IOWA 2FLSA 1RK4A 3E3EA 1X0RA 3LG6A 3UMAA 3R2QA 3CXGA 3TJBA 4ACSA 2GVPA 2YCDA 2M80A 4V2MA 4LL1B 3FR6A 2H76A 1SD9A 4XRDA 5B6MA 1ON4A 2LKUA 1TRSA 3I6AA 1ABAA 4YAPA 1PQNA 2QGVA 5ECSA 2GQKA 1AXDA 1A8LA 1PN9A 1EOGA 2FA4A 1O85A 3GSSA 3KTBA 1QQ2A 3L4NA 2OADA 1X5EA 4BL7B 4N0ZA 2MZCA 3HHVA 4DSSA 4ECIA 5HFGA 3GL5A 3KD0A 2L5LA 4XTSA 1OC9A 3GFKA 1Z9HA 3A2WA 3KP9A 3E0UA 2CV4A 4WKWA 2GT6A 4NWYA 5JWRB 3O6TA 3TB2A 4JBBA 3H4KA 4FYCA 1JZDA 1YEXA 3LSZA 3QD9A 4V2NA 4HJMA 10GSA 4PQIA 2MBTA 3TJGA 3IA1A 2LJAA 5L71A 1TU7A 3F4SA 1DBYA 4OWYA 3EU4A 1GULA 2H8LA 2V6OA 5IOXA 3UL3A 1GL8A 3VI5A 3EU3A 3FZ9A 5FHIA 2H66A 1K0NA 2O8VB 1O8XA 2L4QA 2IN3A 3ZMLA 3HD5A 2HE3A 4G19A 3VWVA 2X99A 1G6YA 2R37A 4V1Ap 2HXKA 1T4ZA 4IELA 2OBIA 1A8YA 1JLWA 3HCZA 4IP1A 4ZBDA 4XRAA 2IMEA 3US3A 4MH2A 4PXOA 3F9UA 1TK8B 5H5RA 4YAVA 4IN0A 4Q5NA 2KLXA 1ZGNA 5IMAA 1HNBA 4Q5QA 2B1LA 1ZMAA 4F82A 4TR0A 2CAQA 4HZ4A 4F03A 4AJ7A 3QPMA 2RM5A 1GWCA 4GSSA 1OKTA 2RUEA 1XWKA 3CTFA 2EC4A 1EV4A 4MZCA 4J56E 1O7UA 4BVYB 3PPUA 2LV3A 1PMTA 3IAM2 4OCEA 2JZRA 4JEDA 5G5EA 1JHBA 3J7Yb 2OKAA 1XW9A 3UIWA 5ECOB 3GTUA 2FCHA 2QC7A 2ZUPA 5EPFA 3DVWA 2HRAA 3DMLA 3IRAA 1WP0A 4K2DA 4MA9A 3RHBA 2ON7A 2MMOA 4KDUA 3TCOA 3A2VA 3I43A 3APOA 2IIYA 4L5OA 3RDWA 3QDNA 1QK8A 2P5QA 3EINA 2M46A 2BJXA 1XOAA 2OBKA 3PR8A 2CVDA 4TRXA 1WIKA 20GSA 2VO4A 4JR4A 3D4MA 5H5SA 4TR1A 1YY7A 2VCWA 1O8WA 2YANA 4MZBA 1GUMA 1B9XC 3EVIA 2GGTA 2GSQA 2O7KA 3I9V2 1MDIA 4HDEA 3TDGA 4NV2A 1WPIA 3ZVJD 2VCTA 5ECLB 1NHYA 1GNEA 4RI6A 3Q6OA 3QR6A 4F2IA 1MTCA 4ECCA 4EF0A 4EDZA 2H73A 1MEKA 1TK5B 1TU8A 2HSNB 4I97A 8GSSA 5LCZA 5HR3A 4HQZA 1NSWA 3GRXA 4N0VA 4OCFA 2F3MA 1DSBA 1NM3A 3IC4A 1ZOFA 5IMFA 1TP9A 1C72A 5J41A 2DMMA 4X1UA 3EMPA 2GSTA 4ZBAA 2WCIA 1TRWA 3W8JA 2BMXA 2F9SA 4OMVA 3LWAA 5ELAA 4ID0A 1HYUA 2YWMA 4MLYA 5DCHA 4GCIA 1X5DA 1VRSD 1K0MA 4TN8A 2VL2C 3M0FA 2CT6A 5D9XA 5IMZA 1JZOA 1K3OA 2R5GA 2F51A 1AAZA 1EZKA 2XBIA 1SD8A 1A2JA 3V1WA 3DVXA 2K6VA 1F6MC 5JWOB 3UVTA 3KXOA 3TKQA 4EDYA 3P8WA 2PBJA 2GSSA 4JE1A 2FWFA 3ERGA 5DCGA 4NHWA 1K0OA 2MMZA 1SK0A 4XHMA 7GSSA 2PVOC 3GNJA 3CBUA 4I2UA 2HSMB 2DJ0A 1V57A 2C3NA 3F6FA 1RW1A 4QL9A 2H6XA 1VF2A 2YV7A 2B1KA 4KSMA 1G0TA 1XPVA 3BJ5A 3ZRDA 4OD7A 2HFDA 1EEMA 1X5CA 2ZNMA 1DUGA 4YQUA 4PUFC 4GSTA 5IPHA 2PERA 2GZPA 3MWHA 4ZB9A 2A2SA 3VWXA 4FO5A 4JR6A 2L59A 1YF1A 1K0DA 5AGYA 2H71A 17GSA 1GLQA 2IPAA 2GZZA 6GSXA 2JZTA 3W8SA 4BL7A 3IHQA 3LXTA 1YJ6A 2XHFA 3RAZA 4ZB6A 2HSYA 2I4AA 3ZL5A 2H0IA 3WGXA 1FB6A 4WR4A 1K0BA 5J9CA 1SL1B 1T4YA 2AUVA 2H0HA 1WOUA 2VOCA 3QOUA 2DIZA 1BYEA 5IMVA 1SJ6A 4H86A 2P0GA 1M9AA 3RHCA 3GSTA 1SL2B 2OACA 1FO5A 2CZ3A 2VM2A 1OE8A 3VI7A 2YWIA 5ECHB 4ZB8A 5ECNB 4KE3A 1AQVA 1J9BA 1PL1A 1GSFA 4F0BA 5ID2B 2G0FA 2TIRA 1Y6EA 4EE0A 2ALBA 4GXZA 3MSZA 3U6VA 2ES7A 1B48A 3M8NA 1O6JA 5AN1A 3J7Yk 2VD0A 4ZL8A 5B8BA 1YZXA 5DJLA 1FOVA 4ISDA 1BQ7A 3GKNA 3KJYA 2H1AA 2AJQB 2TRCP 3GHAA 3EE2A 5GAPD 5CP1A 2DJ2A 3CTGA 3FK8A 2C0GA 2LQOA 4ULXA 1ERTA 2YJHA 2H72A 5EL8A 3ZIVA 3IK9A 5FT3A 5KN0A 3S9FA 2MYGA 5B8AA 3ZIJA 3F4TA 2FY6A 2GZYA 5AIXA 3C8EA 1JLVA 1SL0B 1U6TA 4IGJA 1XWCA 4BVYA 1XVWA 5AIVA 2LJKA 4EVMA 1E2YA 5F06A 2N5AA 2P5RA 2MMNA 2H74A 5HR1A 1U3AA 2VUPA 2MBSA 1ST9A 1WRYA 3EURA 2H1DA 2V6KA 1WJKA 1YQ1A 3LFLA 1JZWA 3HY2A 2FHEA 1BG5A 2B6MA 3PGTA 4FYBA 4Z7XA 2GQMA 3TOUA 2EIQA 4ZL9A 3CYNA 4ZXGA 1WWJA 3G7YA 4IP6A 4WEYA 5G1KA 4ECBA 3H8QA 2DJ3A 3TKSE 5CRDA 3LJRA 4PNGA 4L5LA 1OAZA 3DYRA 3L78A 4GWRA 1JZRA 1UA5A 1CQHA 4AJ6A 3TRQA 5C04A 4KAEA 3C71A 1PA3A 2C3TA 2H30A 1VF3A 4G9HA 2EIRA 3H79A 3D21A 1FVKA 3QCPA 2KP1A 2REMA 2YZHA 1ZCPA 2HLSA 3FEUA 4GQFA 2AYTA 2P31A 1PKWA 3FYGA 4PQHA 4JU5A 2QKEA 4NV5A 2UZ8A 1V58A 2HT9A 1R5AA 2KP2A 5EVOA 3F4RA 5F05A 1TXXA 2K8SA 2B3SA 4WR5A 1EP8A 1YKCA 5IPGA 1WMJA 1Z7PA 2L6DA 3GIXA 3WGDA 4K1FA 4Q5RA 3ZITA 3H1NA 3EWLA 3MAKA 2YZUA 1SKSB 4TXOA 1X9SB 3HXSA 5D9VA 2LS5A 3GUSA 1LJRA 3ISOA 2LNTA 3KCMA 5CO3A 2LRNA 2YWOA 1EP7A 3TKRA 3ZFLA 3ZLPA 4POLA 3L0HA 2PUKC 5DAKB 2VCVA 4RI7A 3L9SA 2HZEB 3ZYWA 3M9KA 2L5OA 2DJKA 4AJ8A 1S3DA 2LRCA 1EWXA 5G30A 3AY8A 1SKRB 3DGQA 4YQVA 1XWBA 4NPBA 4TKYA 4KB3A 4MPFA 3DIEA 4HUAA 2GSRA 4HU7A 1OC8A 3L9UA 1I9DA 2AV4A 5G31A 3KMOA 4MP4A 2C8UA 1GUKA 4KA0A 2JZSA 2IFQB 5ECKB 4NXIA 16GSA 5D93A 5EY6A 1KNGA 2HSMA 2VCQA 3WT1A 4MMMA 1JFUA 4IJIA 2HI7A 4RUVA 6GSTA 2M72A 3GKXA 3MNGA 4POMA 12GSA 2LJRA 3VWUA 3PH9A 2ZCTA 2DJ1A 1PKZA 3HJOA 4J2FA 3KTLA 2JSZA 4MJBA 1XWAA 2EIOA 1ERWA 1M2BA 1YKAA 1GRXA 4D73A 2IMKA 3FKFA 1GSEA 1M0UA 4HI7A 2TRXA 3QFAC 4E8HA 1R5PA 4PX1A 3ZREA 2DSAA 4GQCA 2WZ9A 1GH2A 3WD6A 4MK3A 4KH7A 1J08A 1ERVA 4JRRA 3ZZXA 1PGTA 2L4CA 1TK0B 2VLTA 2YP6A 1PL2A 4K7OA 4QQ7A 2IMIA 2I3YA 3KH9A 4LLRA 6GSVA 5DVBA 1K3LA 3IAS2 5AISA 1GSQA 4IQ1A 3U5RE 4EXJA 1F3AA 3QAWA 4IS0A 3WGEA 2LEGA 4IJ3A 2K9FA 4NMUA 2YV9A 5ID2A 3HVSA 2H6YA 4RQRA 6GSUA 3UAPA 4MF5A 1G7OA 2GS3A 4K0NA 5E59A 3TKSC 3P7XA 5FWGA 3RPPA 2VL2A 1UVZA 4I5QA 2BTOT 4IQAA 4DSQA 5JCWA 4L0WA 2J23A 3HJPA 1SU9A 4LL4B 3UJ1A 1KEBA 4PUAA 4XS4B 3EYTA 1KTEA 1U88A 1XWGA 4LA1A 4MPGA 4WBJA 5G2ZA 2VAFA 4MJCA 4WETA 2GDRA 1TI1A 2WULA 3O3TA 3GYKA 2VD1A 3M1GA 5D73A 4TVEA 4HZ2A 4DEJA 5JCUA 5DJMA 3GX8A 1RQMA 4POBA 3F63A 3LQ7A 4I6XA 2H01A 3UBKA 1FAAA 1Z7RA 2HQTA 2X8HA 3NIVA 3VK9A 1HNAA 1FB0A 5A5KA 1R4WA 1T00A 1XVQA 2IWTA 5DALA 4GSNA 4PURA 5A4VA 3Q74A 1BX9A 3KH7A 5IO2A 1EV9A 4YH2A 2FWGA 5GSTA 5IQYA 4OFTA 2YNXA 4ML1A 3F0IA 2LTKA 1W4VA 4TR4A 5GAND 4KCAA 2B7KA 4LMVA 2MMAA 1VF4A 3N9JA 2O89A 1XW5A 1U87A 22GSA 3RPNA 1GTUA 1T7PB 2IMDA 4O5RA 2I1UA 3ZVJA 5A4UA 1SJIA 2YJ7A 4X43A 3KM6A 4I8BA 4K6XA 1A24A 3APSA 1V98A 4CW9A 3GURA 4TR3A 4K7IA 3KGKA 1FHEA 4ILFA 2HNLA 4XIHA 2V41A 3E9JB 5KN1A 2V2GA 3C73A 4K9ZA 1XZOA 2V32A 3NOFA 3HA9A 2PN8A 3ZTLA 2B5EA 3D5JA 3KEBA 1Z5YE 5B7CA 1N8JA 2CVBA 3CRUA 1XOBA 4J57E 1WE0A 3HZ8A 1SKWB 3GTUB 5DAKA 3CSHA 5IMCA 3TJKA 5ECPB 1M99A 2N5BA 4K8MA 3BCIA 4XS6A 5F8BA 18GSA 4KF9A 3TUEA 3P2AA 2H70A 2GLRA 2GQLA 1PRXA 1F3BA 2VLVA 1GLPA 3O76A 3FHKA 2PWJA 5KN3A 5ECQB 4FIWA 2F8AA 1XCCA 4TR1B 3FY7A 4X0XA 2XPDA 3IOSA 2CVKA 3DWVA 2IFQA 3IBHA 4EL1A 3HYPA 5CRGA 4FQUA 1HD2A 2CQ9A 3PINA 2K8VA 1UN2A 3BOAA 4XS1A 3C1RA 4MF7A 4BWSA 4HQSA 3WYWA 1OKDA 1AIUA 1DE2A 4WXTA 4N30A 4ZIJA 4ZILA 1PX7A 4POKA 1ILOA 3F8UA 5HQPA 2JL4A 4I2TA 4IBPA 1TJDA 1OE7A 1F2EA 3CSJA 3LYPA 1BEDA 4KDYA 4NAXA 2N5FA 2JU5A 3ERFA 3CMIA 2C1YA 1AQXA 4MDCA 5CAXA 3IR4A 1LBKA 1B4QA 4DSRA 19GSA 2H0GA 4USSA 2FD3A 4BA7A 4HEA2 5DQYA 1W89A 1Q98A 2XPEA 1NHOA 1B4PA 3R3EA 2LSTA 3VPTA 6GSYA 1MD4A 4TXVA 4JZQA 1ACVA 4OFNA 4WBRD 3D22A 3IV4A 2OE1A 1ZYEA 3G7IA 2LUSA 3DEXA 5DQSA 1M7TA 1M9BA 3HJMA 6GSSA 1A2LA 5ECMB 1X9WB 2PPTA 2AHEA 2DMLA 4EKZA 1O81A 4EUYA 4XS4A 3IXRA 5COHA 3SBCA 3G9BA 1XBSA 2HRKB 2O87A 5ABRA 3GA4A 2G2QA 1A0RP 1Z3EA 3F3RA 2GTUA 2X8GA 4PNFA 1EGRA 4L8EA 2B5YA 1TKDB 4G0IA 4DVCA 3GH6A 1LU4A 3HKRA 1M2DA 4F0CA 5INYA 2NPBA 1V40A 3ME8A 3FW2A 1URMA 2DIYA 2HRFA 1BJXA 2H1GA 2CZ2A 2FWEA 1Q4JA 3H93A 1OYJA 1GP1A 2FNOA 5J4UA 3Q19A 3HDCA 3TRPA 5J5NA 3DD3A 2E0QA 1ZL9A 2E7PA 1S3AA 2XBQA 4TOPA 1GUHA 1VF1A 5GZZB 3P90A 3A3TA 3FRCA 1QFNA 1HNCA 4KSOA 1PX6A 1B9YC 4OO4A 4PQ1A 1R7HA 4AGSA 1TI3A 5IO0A 1ERUA 2CX4A 5E4WA 4PTSA 1USBA 2X64A 2E2GA 3DXBA 2PGTA 4K0GA 4BWQA 3W6GA 1PD21 2D2ZA 2DC5A 4AF2A 4HOJA 1S3CA 1MDKA 2LRTA 3GKMA 1HQOA 4IW9A 5A4WA 3D6IA 5G1LA 4E8EA 4MJAA 2CAIA 2L6CA 5J3RA 2R6KA 4KX4A 5ELGA 1Y25A 5KEJA 1TDIA 1U3IA 1M2AA 1AC1A 3TKSA 1K0AA 2C4JA 1ML6A 2LNSA 2QSIA 1V2AA 4V1Ag 2IL3A 4GTUA 3ED3A 4WF4A 3UARA 4XCSA 3M9JA 4MF6A 5F0GA 4KDXA 1E6BA 3FZ5A 2A2RA 1MDJA 4N11A 1QXHA 1A0FA 3D4TA 3KP8A 1XW6A 1MD3A 1OVNA 2PMTA 4OFMA 2VIMA 2FGXA 3HVVA 2I9HA 1SK1A 4GF0A 5CREA 1G7EA 3D0ZA 1TTZA 2VL9A 3A5WA 5D9WA 3FR3A 4ECJA 2WJUA 3UVHA 1QMVA 1G6WA 3GX0A 2C0DA 3DKSA 5F07A 3G7JA 3BBYA 3FZ4A 2WDUA 2K18A 4BVXB 2NTOA 3GKKA 2FUG2 3DRNA 4FYUA 3SWLA 1THOA 1GNWA 3GMFA 5CYYA 3UBLA 3F6DA 1KBNA 3EMXA 5D9TA 2IMFA 1ZYQB 2YOIA 2PVQA 2I81A 3WT2A 1YEPA 2IJYA 5LD0A 4WF5A 3KZQA 1DE1A 4IKHA 3VLNA 2C0FA 1SK2A 2RM6A 1H4OA 1YDKA 3VWWA 1SYRA 3FZAA 3QMXA 2PU9C 4KW6A 3LEFA 2H75A 2H1BA 3HVXA 2VCZA 3TRXA 2KUCA 2YWNA 4G0KA 3N5OA 1TOFA 5JWQB 4OO5A 2DBCA 4P3YB 3BCKA 5IIZA 4FH8A 4DSSB 4TXOB 3A2XA 5GSSA 2R2JA 3MDKA 1GSUA 4MZWA 4N10A 5CNWA 1K3YA 1OC9B 3BD2A 1R26A 13GSA 2WFCA 2OJLA 3TKPA 3GH9A 4GLTA 4ML6A 2OE0A 3TJFA 4F9ZA 4O92A 2WRTA 1AW9A 1TW9A 1CQGA 5D8IA 2WS2A 2YN1A 4G2EA 2JACA 5IMDA 4RQXA 1X9MB 5G5FA 2GT5A 5IM9A 5ENUA 5LNKe 1T8EB 3JCML 4GRFA 4EO3A 1AQWA 1J0FA 1NW2A 5DBQA 2HRNA 1GTBA 3IK7A 3TOTA 1EOHA 2CA8A 3KMNA 3OR5A 5JCGA 3ZMKA 2HYXA 3IPZA 3ERWA 5DDLA 3LGCA 1THXA 5CRHA 6GSWA 4KGIA 4HJ2A 2VCXA 1A2MA 2HZFA 1IYIA 2VL3A 1N2AA 2F8FA 2B5XA 2HRKA 2HSHA 3GL3A 3EC3A 4G10A 1T1VA 1Z6MA 4YQMA 1A23A 4D73B 3HZ4A 4V2LA 4KUNA 3VFIA 5CRWA 2J9HA 2KHPA 5HFIA 2R4VA 4MJEA 1FW1A 4LMWA 1B8XA 3IDVA 1SYXA 2NVLA 3QAGA 2HZEA 1Z6NA 5H5QA 1GTAA 4HS1A 2OE3A 3IE3A 2E2MA 1K0CA 2C0EA 1YF0A 3GN3A 5ECIB 2DJJA 2VLUA 3I69A 3C7MA 4CHSA 5HFKA 5BMUA 2Z9SA 2C80A 1EEJA 4HU9A 2AAWA 1SENA 1TRUA 11GSA 2C3QA 2JADA 4QL7A 2O85A 5B6NA 1SJZA 2L57A 5HR2A 1QGVA 4O32A 4MH3A 2X8CA 3TJJA 3LXZA 4ZBBA 1IYHA 4NHZA 4KCEA 4KNDA 1FG4A 4PGTA 3K8NA 4G0LA 3LORA 4BPYA 2DLXA 4Q5FA 1ZZYA 5HR0A 2VM1A 3ZFBA 2R3XA 2AB6A 4MABA 1PSQA 2RLIA 1EGOA 3FR9A 3QFBC 1TRVA 2XC2A 1XXUA 1BAYA 3TGZA 3C1SA 3NZNA 3APQA 2FWHA 4EC0A 5C00A 3LYKA 3Q18A 1F9MA 2KOKA 4IVFA 5J9BA 9GSSA 1XFLA 2A4VA 2WGRA 1AUCA 1V9WA 2CX3A 2H6ZA 1O73A 4K7NA 4CDOA 1UC7A 1FVJA 3ME7A 1GSSA 5ECRB 3CRTA 2OA7A 1F37A 2JSYA 1T3BA 4IHUA 1QUWA 3QAVA 5D96A 5KN2A 3M3MA 1I5GA 2RIIA 1GTIA 2WB9A 3VPQA 1VGLA 2NBSA 4MCUA 3F3QA
chains in the Genus database with same CATH superfamily
2WW3A 2YPMA 3RBTA 4TW5A 2WVZA 3UOMA 2LQQA 5DALB 2B7JA 2NDOA 2RUFA 3CSIA 2ON5A 3IC8A 2FA8A 3GV1A 4ZL7A 3KIJA 1GSDA 1OC3A 3UEMA 2V1MA 4BVXA 1GSYA 4O7HA 1H75A 3VURA 14GSA 4L0UA 2H19A 1XIYA 3L9VA 5IOWA 2FLSA 1RK4A 3E3EA 1X0RA 3LG6A 3UMAA 3R2QA 3CXGA 3TJBA 4ACSA 2GVPA 2YCDA 2M80A 4V2MA 4LL1B 3FR6A 2H76A 1SD9A 4XRDA 5B6MA 1ON4A 2LKUA 1TRSA 3I6AA 1ABAA 4YAPA 1PQNA 2QGVA 5ECSA 4PI2C 2GQKA 1AXDA 2WZSA 1A8LA 1PN9A 1EOGA 2FA4A 1O85A 3GSSA 3KTBA 1QQ2A 3L4NA 2OADA 1X5EA 4BL7B 4N0ZA 2OT3A 2MZCA 3HHVA 4DSSA 4FXYP 4ECIA 5HFGA 3GL5A 3KD0A 2L5LA 4XTSA 1OC9A 3GFKA 1Z9HA 3A2WA 3TU3B 3KP9A 3E0UA 2CV4A 4WKWA 2GT6A 4NWYA 5JWRB 3O6TA 3TB2A 4JBBA 3H4KA 4FYCA 1JZDA 1YEXA 3LSZA 3QD9A 4V2NA 4HJMA 10GSA 4PQIA 2MBTA 3TJGA 3IA1A 2LJAA 5L71A 1TU7A 3F4SA 1DBYA 4OWYA 3EU4A 1GULA 2H8LA 2V6OA 5IOXA 3UL3A 1GL8A 3VI5A 3EU3A 3FZ9A 5FHIA 2H66A 1K0NA 2O8VB 1O8XA 2L4QA 2IN3A 3ZMLA 3HD5A 2HE3A 4G19A 3VWVA 2X99A 1G6YA 2R37A 4V1Ap 2HXKA 4Z2UA 1T4ZA 4IELA 2OBIA 1A8YA 1JLWA 3HCZA 4IP1A 4ZBDA 4XRAA 2IMEA 3US3A 4MH2A 4PXOA 3F9UA 1TK8B 5H5RA 4YAVA 4IN0A 4Q5NA 2KLXA 1ZGNA 5IMAA 1HNBA 4Q5QA 4K2XA 2B1LA 1ZMAA 1YEWC 4F82A 4TR0A 2CAQA 4HZ4A 4F03A 4AJ7A 3QPMA 2RM5A 1GWCA 4GSSA 1OKTA 2RUEA 1XWKA 3CTFA 2EC4A 1EV4A 4MZCA 4J56E 1O7UA 4BVYB 3PPUA 2LV3A 1PMTA 3IAM2 4OCEA 2JZRA 4JEDA 5G5EA 1JHBA 3J7Yb 2OKAA 1XW9A 3UIWA 2QA1A 5ECOB 3GTUA 2FCHA 2QC7A 2ZUPA 5EPFA 3DVWA 2HRAA 3DMLA 3IRAA 1WP0A 4K2DA 4MA9A 3RHBA 3FMWA 2ON7A 2MMOA 4KDUA 3TCOA 2EFCA 3A2VA 2EFEA 3I43A 3APOA 2IIYA 4L5OA 3RDWA 3QDNA 1QK8A 2P5QA 3EINA 2M46A 2BJXA 1XOAA 2OBKA 3PR8A 2CVDA 4TRXA 1WIKA 20GSA 2VO4A 4JR4A 3D4MA 5H5SA 4TR1A 1YY7A 2VCWA 1O8WA 2YANA 4MZBA 2DKHA 1GUMA 1B9XC 3EVIA 2GGTA 2GSQA 2O7KA 3I9V2 1MDIA 4HDEA 3TDGA 4NV2A 1WPIA 3ZVJD 2VCTA 5ECLB 2O36A 1NHYA 1GNEA 4RI6A 3Q6OA 3QR6A 1M3JA 1MTCA 4F2IA 4ECCA 4EF0A 4EDZA 2H73A 1MEKA 1TK5B 1TU8A 2HSNB 4I97A 8GSSA 5LCZA 5HR3A 4HQZA 1NSWA 3GRXA 4N0VA 4OCFA 2F3MA 1DSBA 1NM3A 3IC4A 1ZOFA 5IMFA 1TP9A 1C72A 5J41A 2DMMA 4X1UA 3EMPA 2GSTA 4ZBAA 2WCIA 1TRWA 3W8JA 2BMXA 2F9SA 4OMVA 3LWAA 5ELAA 4ID0A 1HYUA 2WVYA 2YWMA 4MLYA 5DCHA 4GCIA 1X5DA 1VRSD 1K0MA 4TN8A 2VL2C 3M0FA 2CT6A 5D9XA 5IMZA 1JZOA 1K3OA 2R5GA 2F51A 1AAZA 3MIXA 1EZKA 2XBIA 1SD8A 1A2JA 4K5SA 3V1WA 3DVXA 2K6VA 1F6MC 5JWOB 3UVTA 3KXOA 3TKQA 4EDYA 3P8WA 2PBJA 2GSSA 1PN0A 4JE1A 2FWFA 3ERGA 5DCGA 4NHWA 1K0OA 2MMZA 1SK0A 4XHMA 7GSSA 2PVOC 3GNJA 3CBUA 4I2UA 2HSMB 2X49A 2DJ0A 1V57A 2C3NA 3F6FA 1RW1A 4QL9A 2H6XA 1VF2A 2YV7A 2B1KA 1Y1UA 4KSMA 1G0TA 1XPVA 3BJ5A 3ZRDA 4OD7A 2HFDA 1EEMA 1X5CA 2ZNMA 1DUGA 4YQUA 4PUFC 4GSTA 5IPHA 2PERA 2GZPA 3MWHA 4ZB9A 2A2SA 3VWXA 4FO5A 4JR6A 2L59A 1YF1A 1K0DA 5AGYA 2H71A 17GSA 1GLQA 2IPAA 4W66A 2GZZA 3A5IA 6GSXA 2JZTA 3W8SA 4BL7A 3IHQA 3LXTA 1YJ6A 2XHFA 3RAZA 4ZB6A 2HSYA 2I4AA 3ZL5A 2H0IA 3WGXA 1FB6A 4WR4A 1K0BA 5J9CA 1SL1B 1T4YA 2AUVA 2H0HA 1WOUA 2VOCA 3QOUA 2DIZA 1BYEA 5IMVA 1SJ6A 4H86A 2P0GA 1M9AA 3RHCA 3GSTA 1SL2B 2OACA 1FO5A 2CZ3A 2VM2A 1OE8A 3VI7A 2YWIA 1ZYPA 5ECHB 4ZB8A 5ECNB 4KE3A 1AQVA 1J9BA 1PL1A 1GSFA 1BF5A 4F0BA 5ID2B 2G0FA 2TIRA 1Y6EA 4EE0A 2ALBA 4GXZA 3MSZA 3U6VA 2ES7A 1B48A 3M8NA 1O6JA 5AN1A 3J7Yk 2VD0A 4ZL8A 5B8BA 1YZXA 5DJLA 1FOVA 4ISDA 1BQ7A 3GKNA 3KJYA 2H1AA 4CY6A 2TRCP 2AJQB 3GHAA 3EE2A 5GAPD 5CP1A 5A34B 2DJ2A 3CTGA 3FK8A 2C0GA 2LQOA 4ULXA 1ERTA 2YJHA 2H72A 5EL8A 3ZIVA 3IK9A 5FT3A 5KN0A 3S9FA 2MYGA 5B8AA 3ZIJA 3F4TA 2FY6A 2GZYA 5AIXA 3C8EA 1JLVA 1SL0B 1U6TA 4IGJA 5J40A 1XWCA 5A1NA 4BVYA 1XVWA 5AIVA 2LJKA 4EVMA 1E2YA 5F06A 2N5AA 2P5RA 2MMNA 2H74A 5HR1A 1U3AA 2VUPA 1S3RA 2MBSA 1ST9A 1WRYA 3EURA 2H1DA 2V6KA 1WJKA 1YQ1A 3LFLA 1JZWA 3HY2A 2FHEA 1BG5A 2B6MA 3PGTA 4FYBA 4Z7XA 2GQMA 3RGBC 3CWGA 3TOUA 2EIQA 4ZL9A 3CYNA 4ZXGA 1WWJA 3G7YA 4IP6A 4WEYA 5G1KA 4ECBA 3H8QA 2DJ3A 3TKSE 5CRDA 3LJRA 4PNGA 4L5LA 1OAZA 3DYRA 3L78A 4GWRA 1JZRA 1UA5A 1CQHA 4YKGA 4AJ6A 3TRQA 4G01A 5C04A 4KAEA 3C71A 1PA3A 2C3TA 2H30A 1VF3A 4G9HA 4GDFA 2EIRA 3H79A 3D21A 1FVKA 3QCPA 2KP1A 2REMA 2YZHA 1ZCPA 2HLSA 3FEUA 4GQFA 2AYTA 2P31A 1PKWA 3FYGA 1M3IA 4PQHA 4JU5A 2QKEA 4NV5A 2UZ8A 1V58A 2HT9A 1R5AA 2KP2A 5EVOA 3F4RA 5F05A 1TXXA 2K8SA 2B3SA 4WR5A 1EP8A 1YKCA 5IPGA 1WMJA 1Z7PA 2L6DA 3GIXA 3WGDA 4K1FA 4Q5RA 5BRTA 3ZITA 3H1NA 3EWLA 3MAKA 2YZUA 1SKSB 4TXOA 1X9SB 3HXSA 5D9VA 2LS5A 3GUSA 1LJRA 3ISOA 2LNTA 3KCMA 2QA2A 3IHGA 3HVNA 5CO3A 2LRNA 2YWOA 1EP7A 3TKRA 3ZFLA 3ZLPA 4POLA 3L0HA 2PUKC 5DAKB 2VCVA 4RI7A 3L9SA 2HZEB 3ZYWA 3M9KA 4AKIA 2L5OA 2DJKA 4AJ8A 1S3DA 2LRCA 1EWXA 5G30A 3AY8A 1SKRB 3DGQA 4YQVA 1XWBA 4NPBA 4TKYA 4MPFA 3DIEA 4KB3A 4HUAA 2GSRA 4HU7A 1OC8A 3L9UA 2O3EA 1I9DA 2AV4A 5G31A 3KMOA 4MP4A 2C8UA 1GUKA 4CY8A 4KA0A 2JZSA 4E68A 2IFQB 5ECKB 4NXIA 16GSA 5D93A 5EY6A 1KNGA 4X4JA 2HSMA 2VCQA 3WT1A 4MMMA 1JFUA 4IJIA 2HI7A 4RUVA 6GSTA 2M72A 3GKXA 3MNGA 4POMA 12GSA 2LJRA 2WVXA 3VWUA 3PH9A 2ZCTA 2DJ1A 1YVLA 2VKZG 1PKZA 3HJOA 4J2FA 3KTLA 2JSZA 4PI0C 4MJBA 1XWAA 2EIOA 1ERWA 1M2BA 4AKXB 1YKAA 1GRXA 4D73A 5A5HB 2IMKA 3FKFA 1GSEA 1M0UA 4HI7A 2TRXA 3QFAC 4E8HA 1R5PA 4PX1A 3ZREA 2DSAA 4GQCA 2WZ9A 1S4BP 1GH2A 3WD6A 4MK3A 4KH7A 1J08A 1ERVA 4JRRA 3ZZXA 1PGTA 2L4CA 3RFRC 1TK0B 2VLTA 2YP6A 1PL2A 4K7OA 4QQ7A 2IMIA 2I3YA 3KH9A 4LLRA 6GSVA 5DVBA 1K3LA 3IAS2 5AISA 1GSQA 4AKGA 4IQ1A 3U5RE 4EXJA 1F3AA 3QAWA 4IS0A 3WGEA 2LEGA 4IJ3A 2K9FA 4NMUA 2YV9A 5ID2A 3HVSA 2H6YA 4RQRA 6GSUA 3UAPA 1ZYNA 2GS3A 4MF5A 1G7OA 4K0NA 5E59A 3TKSC 3MYDA 3P7XA 5FWGA 3RPPA 2VL2A 1UVZA 4I5QA 2BTOT 5J47A 4IQAA 4DSQA 5JCWA 4L0WA 4PHZC 5A34A 2J23A 3HJPA 1SU9A 4LL4B 3UJ1A 1SVOA 2H1LA 1KEBA 4PUAA 4XS4B 3EYTA 1KTEA 1U88A 1XWGA 4LA1A 4MPGA 4WBJA 5G2ZA 2VAFA 4MJCA 4WETA 2GDRA 1TI1A 2WULA 3O3TA 3GYKA 2VD1A 3M1GA 5D73A 4TVEA 4HZ2A 4DEJA 5JCUA 5DJMA 3GX8A 1RQMA 4POBA 3F63A 3LQ7A 4I6XA 2H01A 3UBKA 1FAAA 1Z7RA 2HQTA 2WW1A 2X8HA 3NIVA 3VK9A 4EIQA 1HNAA 1FB0A 5A5KA 1R4WA 1T00A 1XVQA 2IWTA 5DALA 2R0CA 4GSNA 4PURA 5A4VA 3Q74A 1BX9A 3KH7A 5IO2A 3CQFA 1EV9A 4YH2A 2FWGA 5GSTA 5IQYA 4OFTA 2YNXA 4ML1A 4N3ZA 3F0IA 2LTKA 1W4VA 4TR4A 5GAND 4KCAA 2B7KA 4LMVA 2MMAA 1VF4A 3N9JA 2O89A 2R0PA 1XW5A 1U87A 22GSA 3RPNA 1GTUA 1T7PB 2IMDA 4O5RA 2I1UA 3ZVJA 5A4UA 1SJIA 2YJ7A 4X43A 3KM6A 4AI6A 4I8BA 4K6XA 1A24A 3APSA 4O5UA 1V98A 4CW9A 3GURA 4TR3A 4K7IA 3KGKA 2UV8G 1FHEA 1SVMA 4ILFA 2HNLA 4XIHA 2V41A 3E9JB 3HMJG 5KN1A 2V2GA 3C73A 4K9ZA 1XZOA 2V32A 3NOFA 3HA9A 2PN8A 3ZTLA 2B5EA 3D5JA 3KEBA 1Z5YE 4K5RA 5B7CA 1N8JA 2CVBA 3CRUA 1XOBA 4J57E 1WE0A 3HZ8A 1TXUA 1SKWB 3GTUB 5DAKA 3CSHA 5IMCA 3TJKA 5ECPB 1M99A 2N5BA 4K8MA 3BCIA 4XS6A 5F8BA 18GSA 4KF9A 3TUEA 3P2AA 2H70A 2GLRA 2GQLA 1PRXA 1F3BA 2VLVA 1GLPA 1FOHA 3O76A 3FHKA 3EPTA 2PWJA 5KN3A 5ECQB 4FIWA 2EFDA 2F8AA 1XCCA 4TR1B 3FY7A 4X0XA 2XPDA 5KOXA 3IOSA 2CVKA 3DWVA 2IFQA 3IBHA 4EL1A 3HYPA 5CRGA 4FQUA 1HD2A 2CQ9A 3PINA 2K8VA 1UN2A 3BOAA 4XS1A 3C1RA 4MF7A 1BG1A 4BWSA 4HQSA 3WYWA 1OKDA 1AIUA 1DE2A 4WXTA 4N30A 4ZIJA 4ZILA 1PX7A 4POKA 1ILOA 3F8UA 5HQPA 2JL4A 4I2TA 4IBPA 1TJDA 1OE7A 1F2EA 3CSJA 3LYPA 1BEDA 4KDYA 4NAXA 2N5FA 2JU5A 3ERFA 3CMIA 2C1YA 1AQXA 4MDCA 5CAXA 3IR4A 1LBKA 1B4QA 4DSRA 4A5PA 19GSA 2H0GA 4USSA 2FD3A 4BA7A 4HEA2 5DQYA 1W89A 2DKIA 1Q98A 2XPEA 1NHOA 1B4PA 3R3EA 2LSTA 3VPTA 6GSYA 1MD4A 4TXVA 4JZQA 1ACVA 4OFNA 4WBRD 3D22A 4Z2TA 3IV4A 2OE1A 1ZYEA 3G7IA 2LUSA 3DEXA 5DQSA 1M7TA 1M9BA 3HJMA 6GSSA 1A2LA 5ECMB 1X9WB 2PPTA 3CHXC 2AHEA 2DMLA 4EKZA 1O81A 4EUYA 4XS4A 4QMKA 3IXRA 5COHA 3SBCA 3G9BA 1XBSA 2HSNA 2HRKB 2O87A 5ABRA 3GA4A 2G2QA 1A0RP 1Z3EA 3F3RA 2GTUA 2X8GA 4PNFA 1EGRA 4L8EA 2B5YA 1TKDB 4G0IA 4DVCA 3GH6A 1LU4A 3HKRA 1M2DA 4F0CA 2R0GA 5INYA 2NPBA 1V40A 3ME8A 3FW2A 1URMA 2DIYA 2HRFA 2EFHA 1BJXA 2H1GA 2CZ2A 2FWEA 1Q4JA 3H93A 1OYJA 1GP1A 2FNOA 5J4UA 3Q19A 3HDCA 3TRPA 5J5NA 3DD3A 2E0QA 1ZL9A 2E7PA 1S3AA 2XBQA 4TOPA 1GUHA 1VF1A 5GZZB 3P90A 3A3TA 3FRCA 5BMUB 2A4HA 4ZB7A 1I1IP 1N25A 1QFNA 1HNCA 4KSOA 1PX6A 1B9YC 4OO4A 4PQ1A 1R7HA 4AGSA 1TI3A 5IO0A 1ERUA 2CX4A 5E4WA 4PTSA 1USBA 2X64A 2E2GA 3DXBA 2PGTA 4K0GA 4BWQA 3W6GA 1PD21 5J4VA 2D2ZA 2DC5A 1PFOA 4AF2A 4HOJA 1S3CA 1MDKA 2LRTA 3GKMA 1HQOA 4IW9A 5A4WA 3D6IA 5G1LA 4E8EA 4MJAA 2CAIA 2L6CA 5J3RA 2R6KA 4KX4A 5ELGA 1Y25A 5KEJA 1TDIA 1U3IA 1M2AA 1AC1A 3TKSA 1K0AA 2C4JA 1ML6A 2LNSA 2QSIA 1V2AA 4V1Ag 2IL3A 4GTUA 3ED3A 4WF4A 3UARA 4XCSA 5A1NB 3M9JA 4MF6A 5F0GA 4KDXA 1E6BA 4AKHA 3FZ5A 2A2RA 1MDJA 4N11A 1QXHA 1A0FA 3D4TA 3KP8A 1XW6A 1MD3A 1OVNA 2PMTA 4OFMA 2VIMA 2FGXA 3HVVA 2I9HA 1SK1A 4GF0A 5CREA 1G7EA 3D0ZA 5KOWA 1TTZA 4EIPA 2VL9A 3A5WA 5D9WA 3FR3A 4ECJA 2WJUA 3UVHA 1QMVA 1G6WA 3GX0A 2C0DA 3DKSA 5F07A 3G7JA 3BBYA 3FZ4A 2WDUA 2K18A 4BVXB 2NTOA 3GKKA 2FUG2 3DRNA 4FYUA 3SWLA 1THOA 1GNWA 3GMFA 5CYYA 3UBLA 3F6DA 1KBNA 3EMXA 5D9TA 2IMFA 1ZYQB 2YOIA 2PVQA 2I81A 3WT2A 1YEPA 2IJYA 5LD0A 4WF5A 3KZQA 1DE1A 4IKHA 3VLNA 2C0FA 1SK2A 2RM6A 4ICYA 1H4OA 1YDKA 3VWWA 1SYRA 3FZAA 3QMXA 2PU9C 4KW6A 3LEFA 2H75A 2H1BA 4O5QA 3HVXA 2VCZA 3TRXA 2KUCA 2YWNA 4G0KA 3N5OA 1TOFA 5JWQB 4OO5A 2DBCA 4P3YB 3BCKA 5IIZA 4FH8A 4DSSB 4TXOB 3A2XA 5GSSA 2R2JA 3MDKA 1GSUA 4MZWA 4N10A 5CNWA 1K3YA 1OC9B 3BD2A 3LW9A 1R26A 13GSA 2WFCA 2OJLA 3TKPA 3GH9A 4GLTA 2A2PA 4ML6A 2OE0A 3TJFA 4F9ZA 4O92A 2WRTA 1AW9A 1TW9A 2O5VA 1CQGA 5D8IA 2WS2A 2YN1A 4G2EA 2JACA 5IMDA 4RQXA 1X9MB 5G5FA 2GT5A 5IM9A 5ENUA 5LNKe 1T8EB 3JCML 4GRFA 4EO3A 1AQWA 1J0FA 1NW2A 5DBQA 2HRNA 1GTBA 3IK7A 3TOTA 1XG8A 1EOHA 4Z2RA 2CA8A 3KMNA 3OR5A 5JCGA 3ZMKA 2HYXA 3IPZA 3ERWA 5DDLA 4YKFA 4BIKA 3LGCA 1THXA 5CRHA 6GSWA 4KGIA 4HJ2A 2VCXA 1A2MA 2HZFA 1IYIA 2WVXB 2VL3A 1N2AA 2F8FA 2B5XA 2HRKA 2HSHA 3GL3A 3EC3A 4G10A 1T1VA 1Z6MA 4HSCX 4YQMA 1A23A 4D73B 3HZ4A 4V2LA 4KUNA 3VFIA 5CRWA 2J9HA 2KHPA 5HFIA 2R4VA 4MJEA 1FW1A 4LMWA 1B8XA 3IDVA 1SYXA 2NVLA 3QAGA 2HZEA 1Z6NA 4MNNA 5H5QA 1GTAA 4HS1A 2OE3A 3IE3A 2E2MA 1SVLA 1K0CA 2C0EA 1YF0A 3GN3A 5ECIB 2DJJA 2VLUA 3I69A 3C7MA 4CHSA 5HFKA 5BMUA 2Z9SA 2C80A 1EEJA 4HU9A 2AAWA 1SENA 1TRUA 11GSA 2C3QA 2JADA 4QL7A 2O85A 5B6NA 1SJZA 2L57A 5HR2A 1QGVA 4O32A 4MH3A 2X8CA 3TJJA 3LXZA 4ZBBA 1IYHA 4NHZA 4KCEA 4KNDA 1FG4A 4PGTA 3K8NA 4G0LA 3LORA 4BPYA 2DLXA 4Q5FA 1ZZYA 2WW2A 5HR0A 2VM1A 3ZFBA 2R3XA 2AB6A 4MABA 1PSQA 2RLIA 1EGOA 5J4YA 3FR9A 2WW0A 3QFBC 1TRVA 2XC2A 1XXUA 1BAYA 5A5HA 3TGZA 3C1SA 3NZNA 3APQA 2FWHA 4EC0A 5C00A 3LYKA 3Q18A 1F9MA 2KOKA 4IVFA 5J9BA 9GSSA 1XFLA 2A4VA 2WGRA 1AUCA 1V9WA 2CX3A 2H6ZA 1O73A 4K7NA 4CDOA 1UC7A 1FVJA 3ME7A 1GSSA 5ECRB 3CRTA 2X4AA 2OA7A 1F37A 2JSYA 1T3BA 4IHUA 1QUWA 3QAVA 5D96A 5KN2A 3M3MA 1I5GA 2RIIA 1GTIA 2WB9A 3VPQA 1VGLA 2NBSA 4MCUA 3F3QA
chains in the Genus database with same CATH topology
2YPMA 3RBTA 4TW5A 3UOMA 2LQQA 5DALB 2B7JA 2NDOA 2RUFA 3CSIA 2ON5A 3IC8A 2FA8A 3GV1A 4ZL7A 3KIJA 1GSDA 1OC3A 3UEMA 2V1MA 4BVXA 1GSYA 4O7HA 1H75A 3VURA 14GSA 4L0UA 2H19A 1XIYA 3L9VA 5IOWA 2FLSA 1RK4A 3E3EA 1X0RA 3LG6A 3UMAA 3R2QA 3CXGA 3TJBA 4ACSA 2GVPA 2YCDA 2M80A 4V2MA 4LL1B 3FR6A 2H76A 1SD9A 4XRDA 5B6MA 1ON4A 2LKUA 1TRSA 3I6AA 1ABAA 4YAPA 1PQNA 2QGVA 5ECSA 2GQKA 1AXDA 1A8LA 1PN9A 1EOGA 2FA4A 1O85A 3GSSA 3L4NA 1QQ2A 3KTBA 2OADA 1X5EA 4BL7B 4N0ZA 2OT3A 2MZCA 3HHVA 4DSSA 4ECIA 5HFGA 3GL5A 3KD0A 2L5LA 4XTSA 1OC9A 3GFKA 1Z9HA 3A2WA 3TU3B 3KP9A 3E0UA 2CV4A 4WKWA 2GT6A 4NWYA 5JWRB 3O6TA 3TB2A 4JBBA 3H4KA 4FYCA 1JZDA 1YEXA 3LSZA 3QD9A 4V2NA 4HJMA 10GSA 4PQIA 2MBTA 3TJGA 3IA1A 2LJAA 5L71A 1TU7A 3F4SA 1DBYA 4OWYA 3EU4A 1GULA 2H8LA 2V6OA 5IOXA 3UL3A 1GL8A 3VI5A 3EU3A 3FZ9A 5FHIA 2H66A 1K0NA 2O8VB 1O8XA 2L4QA 2IN3A 3ZMLA 3HD5A 2HE3A 4G19A 3VWVA 2X99A 1G6YA 2R37A 4V1Ap 2HXKA 4Z2UA 1T4ZA 4IELA 2OBIA 1A8YA 1JLWA 3HCZA 4IP1A 4ZBDA 4XRAA 2IMEA 3US3A 4MH2A 4PXOA 3F9UA 1TK8B 5H5RA 4YAVA 4IN0A 4Q5NA 2KLXA 1ZGNA 5IMAA 1HNBA 4Q5QA 4K2XA 2B1LA 1ZMAA 4F82A 4TR0A 2CAQA 4HZ4A 4F03A 4AJ7A 3QPMA 2RM5A 1GWCA 4GSSA 1OKTA 2RUEA 1XWKA 3CTFA 2EC4A 1EV4A 4MZCA 4J56E 1O7UA 4BVYB 3PPUA 2LV3A 1PMTA 3IAM2 4OCEA 2JZRA 4JEDA 5G5EA 1JHBA 3J7Yb 2OKAA 1XW9A 3UIWA 2QA1A 5ECOB 3GTUA 2FCHA 2QC7A 2ZUPA 5EPFA 3DVWA 2HRAA 3DMLA 3IRAA 1WP0A 4K2DA 4MA9A 3RHBA 3FMWA 2ON7A 2MMOA 4KDUA 3TCOA 2EFCA 3A2VA 2EFEA 3I43A 3APOA 2IIYA 4L5OA 3RDWA 3QDNA 1QK8A 2P5QA 3EINA 2M46A 2BJXA 1XOAA 2OBKA 3PR8A 2CVDA 4TRXA 1WIKA 20GSA 2VO4A 4JR4A 3D4MA 5H5SA 4TR1A 1YY7A 2VCWA 1O8WA 2YANA 4MZBA 2DKHA 1GUMA 1B9XC 3EVIA 2GGTA 2GSQA 2O7KA 3I9V2 1MDIA 4HDEA 3TDGA 4NV2A 1WPIA 3ZVJD 2VCTA 5ECLB 1NHYA 1GNEA 4RI6A 3Q6OA 3QR6A 4F2IA 1MTCA 4ECCA 4EF0A 4EDZA 2H73A 1MEKA 1TK5B 1TU8A 2HSNB 4I97A 8GSSA 5LCZA 5HR3A 4HQZA 1NSWA 3GRXA 4N0VA 4OCFA 2F3MA 1DSBA 1NM3A 3IC4A 1ZOFA 5IMFA 1TP9A 1C72A 5J41A 2DMMA 4X1UA 3EMPA 2GSTA 4ZBAA 2WCIA 1TRWA 3W8JA 2BMXA 2F9SA 4OMVA 3LWAA 5ELAA 4ID0A 1HYUA 2YWMA 4MLYA 5DCHA 4GCIA 1X5DA 1VRSD 1K0MA 4TN8A 2VL2C 3M0FA 2CT6A 5D9XA 5IMZA 1JZOA 1K3OA 2R5GA 2F51A 1AAZA 3MIXA 1EZKA 2XBIA 1SD8A 1A2JA 4K5SA 3V1WA 3DVXA 2K6VA 1F6MC 5JWOB 3UVTA 3KXOA 3TKQA 4EDYA 3P8WA 2PBJA 2GSSA 1PN0A 4JE1A 2FWFA 3ERGA 5DCGA 4NHWA 1K0OA 2MMZA 1SK0A 4XHMA 7GSSA 2PVOC 3GNJA 3CBUA 4I2UA 2HSMB 2X49A 2DJ0A 1V57A 2C3NA 3F6FA 1RW1A 4QL9A 2H6XA 1VF2A 2YV7A 2B1KA 1Y1UA 4KSMA 1G0TA 1XPVA 3BJ5A 3ZRDA 4OD7A 2HFDA 1EEMA 1X5CA 2ZNMA 1DUGA 4YQUA 4PUFC 4GSTA 5IPHA 2PERA 2GZPA 3MWHA 4ZB9A 2A2SA 3VWXA 4FO5A 4JR6A 2L59A 1YF1A 1K0DA 5AGYA 2H71A 17GSA 1GLQA 2IPAA 4W66A 2GZZA 3A5IA 6GSXA 2JZTA 3W8SA 4BL7A 3IHQA 3LXTA 1YJ6A 2XHFA 3RAZA 4ZB6A 2HSYA 2I4AA 3ZL5A 2H0IA 3WGXA 1FB6A 4WR4A 1K0BA 5J9CA 1SL1B 1T4YA 2AUVA 2H0HA 1WOUA 2VOCA 3QOUA 2DIZA 1BYEA 5IMVA 1SJ6A 4H86A 2P0GA 1M9AA 3RHCA 3GSTA 1SL2B 2OACA 1FO5A 2CZ3A 2VM2A 1OE8A 3VI7A 2YWIA 1ZYPA 5ECHB 4ZB8A 5ECNB 4KE3A 1AQVA 1J9BA 1PL1A 1GSFA 1BF5A 4F0BA 5ID2B 2G0FA 2TIRA 1Y6EA 4EE0A 2ALBA 4GXZA 3MSZA 3U6VA 2ES7A 1B48A 3M8NA 1O6JA 5AN1A 3J7Yk 2VD0A 4ZL8A 5B8BA 1YZXA 5DJLA 1FOVA 4ISDA 1BQ7A 3GKNA 3KJYA 2H1AA 4CY6A 2TRCP 2AJQB 3GHAA 3EE2A 5GAPD 5CP1A 5A34B 2DJ2A 3CTGA 3FK8A 2C0GA 2LQOA 4ULXA 1ERTA 2YJHA 2H72A 5EL8A 3ZIVA 3IK9A 5FT3A 5KN0A 3S9FA 2MYGA 5B8AA 3ZIJA 3F4TA 2FY6A 2GZYA 5AIXA 3C8EA 1JLVA 1SL0B 1U6TA 4IGJA 5J40A 1XWCA 5A1NA 4BVYA 1XVWA 5AIVA 2LJKA 4EVMA 1E2YA 5F06A 2N5AA 2P5RA 2MMNA 2H74A 5HR1A 1U3AA 2VUPA 2MBSA 1ST9A 1WRYA 3EURA 2H1DA 2V6KA 1WJKA 1YQ1A 3LFLA 1JZWA 3HY2A 2FHEA 1BG5A 2B6MA 3PGTA 4FYBA 4Z7XA 2GQMA 3CWGA 3TOUA 2EIQA 4ZL9A 3CYNA 4ZXGA 1WWJA 3G7YA 4IP6A 4WEYA 5G1KA 4ECBA 3H8QA 2DJ3A 3TKSE 5CRDA 3LJRA 4PNGA 4L5LA 1OAZA 3DYRA 3L78A 4GWRA 1JZRA 1UA5A 1CQHA 4YKGA 4AJ6A 3TRQA 4G01A 5C04A 4KAEA 3C71A 1PA3A 2C3TA 2H30A 1VF3A 4G9HA 4GDFA 2EIRA 3H79A 3D21A 1FVKA 3QCPA 2KP1A 2REMA 2YZHA 1ZCPA 2HLSA 3FEUA 4GQFA 2AYTA 2P31A 1PKWA 3FYGA 4PQHA 4JU5A 2QKEA 4NV5A 2UZ8A 1V58A 2HT9A 1R5AA 2KP2A 5EVOA 3F4RA 5F05A 1TXXA 2K8SA 2B3SA 4WR5A 1EP8A 1YKCA 5IPGA 1WMJA 1Z7PA 2L6DA 3GIXA 3WGDA 4K1FA 4Q5RA 5BRTA 3ZITA 3H1NA 3EWLA 3MAKA 2YZUA 1SKSB 4TXOA 1X9SB 3HXSA 5D9VA 2LS5A 3GUSA 1LJRA 3ISOA 2LNTA 3KCMA 2QA2A 3IHGA 5CO3A 2LRNA 2YWOA 1EP7A 3TKRA 3ZFLA 3ZLPA 4POLA 3L0HA 2PUKC 5DAKB 2VCVA 4RI7A 3L9SA 2HZEB 3ZYWA 3M9KA 4AKIA 2L5OA 2DJKA 4AJ8A 1S3DA 2LRCA 1EWXA 5G30A 3AY8A 1SKRB 3DGQA 4YQVA 1XWBA 4NPBA 4TKYA 4MPFA 3DIEA 4KB3A 4HUAA 2GSRA 4HU7A 1OC8A 3L9UA 1I9DA 2AV4A 5G31A 3KMOA 4MP4A 2C8UA 1GUKA 4CY8A 4KA0A 2JZSA 4E68A 2IFQB 5ECKB 4NXIA 16GSA 5D93A 5EY6A 1KNGA 4X4JA 2HSMA 2VCQA 3WT1A 4MMMA 1JFUA 4IJIA 2HI7A 4RUVA 6GSTA 2M72A 3GKXA 3MNGA 4POMA 12GSA 2LJRA 3VWUA 3PH9A 2ZCTA 2DJ1A 1YVLA 2VKZG 1PKZA 3HJOA 4J2FA 3KTLA 2JSZA 4MJBA 1XWAA 2EIOA 1ERWA 1M2BA 4AKXB 1YKAA 1GRXA 4D73A 5A5HB 2IMKA 3FKFA 1GSEA 1M0UA 4HI7A 2TRXA 3QFAC 4E8HA 1R5PA 4PX1A 3ZREA 2DSAA 4GQCA 2WZ9A 1GH2A 3WD6A 4MK3A 4KH7A 1J08A 1ERVA 4JRRA 3ZZXA 1PGTA 2L4CA 1TK0B 2VLTA 2YP6A 1PL2A 4K7OA 4QQ7A 2IMIA 2I3YA 3KH9A 4LLRA 6GSVA 5DVBA 1K3LA 3IAS2 5AISA 1GSQA 4AKGA 4IQ1A 3U5RE 4EXJA 1F3AA 3QAWA 4IS0A 3WGEA 2LEGA 4IJ3A 2K9FA 4NMUA 2YV9A 5ID2A 3HVSA 2H6YA 4RQRA 6GSUA 3UAPA 1ZYNA 2GS3A 4MF5A 1G7OA 4K0NA 5E59A 3TKSC 3MYDA 3P7XA 5FWGA 3RPPA 2VL2A 1UVZA 4I5QA 2BTOT 5J47A 4IQAA 4DSQA 5JCWA 4L0WA 5A34A 2J23A 3HJPA 1SU9A 4LL4B 3UJ1A 1SVOA 2H1LA 1KEBA 4PUAA 4XS4B 3EYTA 1KTEA 1U88A 1XWGA 4LA1A 4MPGA 4WBJA 5G2ZA 2VAFA 4MJCA 4WETA 2GDRA 1TI1A 2WULA 3O3TA 3GYKA 2VD1A 3M1GA 5D73A 4TVEA 4HZ2A 4DEJA 5JCUA 5DJMA 3GX8A 1RQMA 4POBA 3F63A 3LQ7A 4I6XA 2H01A 3UBKA 1FAAA 1Z7RA 2HQTA 2X8HA 3NIVA 3VK9A 4EIQA 1HNAA 1FB0A 5A5KA 1R4WA 1T00A 1XVQA 2IWTA 5DALA 2R0CA 4GSNA 4PURA 5A4VA 3Q74A 1BX9A 3KH7A 5IO2A 1EV9A 4YH2A 2FWGA 5GSTA 5IQYA 4OFTA 2YNXA 4ML1A 4N3ZA 3F0IA 2LTKA 1W4VA 4TR4A 5GAND 4KCAA 2B7KA 4LMVA 2MMAA 1VF4A 3N9JA 2O89A 2R0PA 1XW5A 1U87A 22GSA 3RPNA 1GTUA 1T7PB 2IMDA 4O5RA 2I1UA 3ZVJA 5A4UA 1SJIA 2YJ7A 4X43A 3KM6A 4AI6A 4I8BA 4K6XA 1A24A 3APSA 4O5UA 1V98A 4CW9A 3GURA 4TR3A 4K7IA 3KGKA 2UV8G 1FHEA 1SVMA 4ILFA 2HNLA 4XIHA 2V41A 3E9JB 3HMJG 5KN1A 2V2GA 3C73A 4K9ZA 1XZOA 2V32A 3NOFA 3HA9A 2PN8A 3ZTLA 2B5EA 3D5JA 3KEBA 1Z5YE 4K5RA 5B7CA 1N8JA 2CVBA 3CRUA 1XOBA 4J57E 1WE0A 3HZ8A 1TXUA 1SKWB 3GTUB 5DAKA 3CSHA 5IMCA 3TJKA 5ECPB 1M99A 2N5BA 4K8MA 3BCIA 4XS6A 5F8BA 18GSA 4KF9A 3TUEA 3P2AA 2H70A 2GLRA 2GQLA 1PRXA 1F3BA 2VLVA 1GLPA 1FOHA 3O76A 3FHKA 3EPTA 2PWJA 5KN3A 5ECQB 4FIWA 2EFDA 2F8AA 1XCCA 4TR1B 3FY7A 4X0XA 2XPDA 5KOXA 3IOSA 2CVKA 3DWVA 2IFQA 3IBHA 4EL1A 3HYPA 5CRGA 4FQUA 1HD2A 2CQ9A 3PINA 2K8VA 1UN2A 3BOAA 4XS1A 3C1RA 4MF7A 1BG1A 4BWSA 4HQSA 3WYWA 1OKDA 1AIUA 1DE2A 4WXTA 4N30A 4ZIJA 4ZILA 1PX7A 4POKA 1ILOA 3F8UA 5HQPA 2JL4A 4I2TA 4IBPA 1TJDA 1OE7A 1F2EA 3CSJA 3LYPA 1BEDA 4KDYA 4NAXA 2N5FA 2JU5A 3ERFA 3CMIA 2C1YA 1AQXA 4MDCA 5CAXA 3IR4A 1LBKA 1B4QA 4DSRA 4A5PA 19GSA 2H0GA 4USSA 2FD3A 4BA7A 4HEA2 5DQYA 1W89A 2DKIA 1Q98A 2XPEA 1NHOA 1B4PA 3R3EA 2LSTA 3VPTA 6GSYA 1MD4A 4TXVA 4JZQA 1ACVA 4OFNA 4WBRD 3D22A 4Z2TA 3IV4A 2OE1A 1ZYEA 3G7IA 2LUSA 3DEXA 5DQSA 1M7TA 1M9BA 3HJMA 6GSSA 1A2LA 5ECMB 1X9WB 2PPTA 2AHEA 2DMLA 4EKZA 1O81A 4EUYA 4XS4A 4QMKA 3IXRA 5COHA 3SBCA 3G9BA 1XBSA 2HSNA 2HRKB 2O87A 5ABRA 3GA4A 2G2QA 1A0RP 1Z3EA 3F3RA 2GTUA 2X8GA 4PNFA 1EGRA 4L8EA 2B5YA 1TKDB 4G0IA 4DVCA 3GH6A 1LU4A 3HKRA 1M2DA 4F0CA 2R0GA 5INYA 2NPBA 1V40A 3ME8A 3FW2A 1URMA 2DIYA 2HRFA 2EFHA 1BJXA 2H1GA 2CZ2A 2FWEA 1Q4JA 3H93A 1OYJA 1GP1A 2FNOA 5J4UA 3Q19A 3HDCA 3TRPA 5J5NA 3DD3A 2E0QA 1ZL9A 2E7PA 1S3AA 2XBQA 4TOPA 1GUHA 1VF1A 5GZZB 3P90A 3A3TA 3FRCA 5BMUB 2A4HA 4ZB7A 1N25A 1QFNA 1HNCA 4KSOA 1PX6A 1B9YC 4OO4A 4PQ1A 1R7HA 4AGSA 1TI3A 5IO0A 1ERUA 2CX4A 5E4WA 4PTSA 1USBA 2X64A 2E2GA 3DXBA 2PGTA 4K0GA 4BWQA 3W6GA 1PD21 5J4VA 2D2ZA 2DC5A 4AF2A 4HOJA 1S3CA 1MDKA 2LRTA 3GKMA 1HQOA 4IW9A 5A4WA 3D6IA 5G1LA 4E8EA 4MJAA 2CAIA 2L6CA 5J3RA 2R6KA 4KX4A 5ELGA 1Y25A 5KEJA 1TDIA 1U3IA 1M2AA 1AC1A 3TKSA 1K0AA 2C4JA 1ML6A 2LNSA 2QSIA 1V2AA 4V1Ag 2IL3A 4GTUA 3ED3A 4WF4A 3UARA 4XCSA 5A1NB 3M9JA 4MF6A 5F0GA 4KDXA 1E6BA 4AKHA 3FZ5A 2A2RA 1MDJA 4N11A 1QXHA 1A0FA 3D4TA 3KP8A 1XW6A 1MD3A 1OVNA 2PMTA 4OFMA 2VIMA 2FGXA 3HVVA 2I9HA 1SK1A 4GF0A 5CREA 1G7EA 3D0ZA 5KOWA 1TTZA 4EIPA 2VL9A 3A5WA 5D9WA 3FR3A 4ECJA 2WJUA 3UVHA 1QMVA 1G6WA 3GX0A 2C0DA 3DKSA 5F07A 3G7JA 3BBYA 3FZ4A 2WDUA 2K18A 4BVXB 2NTOA 3GKKA 2FUG2 3DRNA 4FYUA 3SWLA 1THOA 1GNWA 3GMFA 5CYYA 3UBLA 3F6DA 1KBNA 3EMXA 5D9TA 2IMFA 1ZYQB 2YOIA 2PVQA 2I81A 3WT2A 1YEPA 2IJYA 5LD0A 4WF5A 3KZQA 1DE1A 4IKHA 3VLNA 2C0FA 1SK2A 2RM6A 4ICYA 1H4OA 1YDKA 3VWWA 1SYRA 3FZAA 3QMXA 2PU9C 4KW6A 3LEFA 2H75A 2H1BA 4O5QA 3HVXA 2VCZA 3TRXA 2KUCA 2YWNA 4G0KA 3N5OA 1TOFA 5JWQB 4OO5A 2DBCA 4P3YB 3BCKA 5IIZA 4FH8A 4DSSB 4TXOB 3A2XA 5GSSA 2R2JA 3MDKA 1GSUA 4MZWA 4N10A 5CNWA 1K3YA 1OC9B 3BD2A 3LW9A 1R26A 13GSA 2WFCA 2OJLA 3TKPA 3GH9A 4GLTA 2A2PA 4ML6A 2OE0A 3TJFA 4F9ZA 4O92A 2WRTA 1AW9A 1TW9A 2O5VA 1CQGA 5D8IA 2WS2A 2YN1A 4G2EA 2JACA 5IMDA 4RQXA 1X9MB 5G5FA 2GT5A 5IM9A 5ENUA 5LNKe 1T8EB 3JCML 4GRFA 4EO3A 1AQWA 1J0FA 1NW2A 5DBQA 2HRNA 1GTBA 3IK7A 3TOTA 1EOHA 4Z2RA 2CA8A 3KMNA 3OR5A 5JCGA 3ZMKA 2HYXA 3IPZA 3ERWA 5DDLA 4YKFA 3LGCA 1THXA 5CRHA 6GSWA 4KGIA 4HJ2A 2VCXA 1A2MA 2HZFA 1IYIA 2VL3A 1N2AA 2F8FA 2B5XA 2HRKA 2HSHA 3GL3A 3EC3A 4G10A 1T1VA 1Z6MA 4YQMA 1A23A 4D73B 3HZ4A 4V2LA 4KUNA 3VFIA 5CRWA 2J9HA 2KHPA 5HFIA 2R4VA 4MJEA 1FW1A 4LMWA 1B8XA 3IDVA 1SYXA 2NVLA 3QAGA 2HZEA 1Z6NA 4MNNA 5H5QA 1GTAA 4HS1A 2OE3A 3IE3A 2E2MA 1SVLA 1K0CA 2C0EA 1YF0A 3GN3A 5ECIB 2DJJA 2VLUA 3I69A 3C7MA 4CHSA 5HFKA 5BMUA 2Z9SA 2C80A 1EEJA 4HU9A 2AAWA 1SENA 1TRUA 11GSA 2C3QA 2JADA 4QL7A 2O85A 5B6NA 1SJZA 2L57A 5HR2A 1QGVA 4O32A 4MH3A 2X8CA 3TJJA 3LXZA 4ZBBA 1IYHA 4NHZA 4KCEA 4KNDA 1FG4A 4PGTA 3K8NA 4G0LA 3LORA 4BPYA 2DLXA 4Q5FA 1ZZYA 5HR0A 2VM1A 3ZFBA 2R3XA 2AB6A 4MABA 1PSQA 2RLIA 1EGOA 5J4YA 3FR9A 3QFBC 1TRVA 2XC2A 1XXUA 1BAYA 5A5HA 3TGZA 3C1SA 3NZNA 3APQA 2FWHA 4EC0A 5C00A 3LYKA 3Q18A 1F9MA 2KOKA 4IVFA 5J9BA 9GSSA 1XFLA 2A4VA 2WGRA 1AUCA 1V9WA 2CX3A 2H6ZA 1O73A 4K7NA 4CDOA 1UC7A 1FVJA 3ME7A 1GSSA 5ECRB 3CRTA 2X4AA 2OA7A 1F37A 2JSYA 1T3BA 4IHUA 1QUWA 3QAVA 5D96A 5KN2A 3M3MA 1I5GA 2RIIA 1GTIA 2WB9A 3VPQA 1VGLA 2NBSA 4MCUA 3F3QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YPM A;  3RBT A;  4TW5 A;  3UOM A;  2LQQ A;  5DAL B;  2B7J A;  2NDO A;  2RUF A;  3CSI A;  2ON5 A;  3IC8 A;  2FA8 A;  3GV1 A;  4ZL7 A;  3KIJ A;  1GSD A;  1OC3 A;  3UEM A;  2V1M A;  4BVX A;  1GSY A;  4O7H A;  1H75 A;  3VUR A;  14GS A;  4L0U A;  2H19 A;  1XIY A;  3L9V A;  5IOW A;  2FLS A;  1RK4 A;  3E3E A;  1X0R A;  3LG6 A;  3UMA A;  3R2Q A;  3CXG A;  3TJB A;  4ACS A;  2GVP A;  2YCD A;  2M80 A;  4V2M A;  4LL1 B;  3FR6 A;  2H76 A;  1SD9 A;  4XRD A;  5B6M A;  1ON4 A;  2LKU A;  1TRS A;  3I6A A;  1ABA A;  4YAP A;  1PQN A;  2QGV A;  5ECS A;  2GQK A;  1AXD A;  1A8L A;  1PN9 A;  1EOG A;  2FA4 A;  1O85 A;  3GSS A;  3KTB A;  1QQ2 A;  3L4N A;  2OAD A;  1X5E A;  4BL7 B;  4N0Z A;  2MZC A;  3HHV A;  4DSS A;  4ECI A;  5HFG A;  3GL5 A;  3KD0 A;  2L5L A;  4XTS A;  1OC9 A;  3GFK A;  1Z9H A;  3A2W A;  3KP9 A;  3E0U A;  2CV4 A;  4WKW A;  2GT6 A;  4NWY A;  5JWR B;  3O6T A;  3TB2 A;  4JBB A;  3H4K A;  4FYC A;  1JZD A;  1YEX A;  3LSZ A;  3QD9 A;  4V2N A;  4HJM A;  10GS A;  4PQI A;  2MBT A;  3TJG A;  3IA1 A;  2LJA A;  5L71 A;  1TU7 A;  3F4S A;  1DBY A;  4OWY A;  3EU4 A;  1GUL A;  2H8L A;  2V6O A;  5IOX A;  3UL3 A;  1GL8 A;  3VI5 A;  3EU3 A;  3FZ9 A;  5FHI A;  2H66 A;  1K0N A;  2O8V B;  1O8X A;  2L4Q A;  2IN3 A;  3ZML A;  3HD5 A;  2HE3 A;  4G19 A;  3VWV A;  2X99 A;  1G6Y A;  2R37 A;  4V1A p;  2HXK A;  1T4Z A;  4IEL A;  2OBI A;  1A8Y A;  1JLW A;  3HCZ A;  4IP1 A;  4ZBD A;  4XRA A;  2IME A;  3US3 A;  4MH2 A;  4PXO A;  3F9U A;  1TK8 B;  5H5R A;  4YAV A;  4IN0 A;  4Q5N A;  2KLX A;  1ZGN A;  5IMA A;  1HNB A;  4Q5Q A;  2B1L A;  1ZMA A;  4F82 A;  4TR0 A;  2CAQ A;  4HZ4 A;  4F03 A;  4AJ7 A;  3QPM A;  2RM5 A;  1GWC A;  4GSS A;  1OKT A;  2RUE A;  1XWK A;  3CTF A;  2EC4 A;  1EV4 A;  4MZC A;  4J56 E;  1O7U A;  4BVY B;  3PPU A;  2LV3 A;  1PMT A;  3IAM 2;  4OCE A;  2JZR A;  4JED A;  5G5E A;  1JHB A;  3J7Y b;  2OKA A;  1XW9 A;  3UIW A;  5ECO B;  3GTU A;  2FCH A;  2QC7 A;  2ZUP A;  5EPF A;  3DVW A;  2HRA A;  3DML A;  3IRA A;  1WP0 A;  4K2D A;  4MA9 A;  3RHB A;  2ON7 A;  2MMO A;  4KDU A;  3TCO A;  3A2V A;  3I43 A;  3APO A;  2IIY A;  4L5O A;  3RDW A;  3QDN A;  1QK8 A;  2P5Q A;  3EIN A;  2M46 A;  2BJX A;  1XOA A;  2OBK A;  3PR8 A;  2CVD A;  4TRX A;  1WIK A;  20GS A;  2VO4 A;  4JR4 A;  3D4M A;  5H5S A;  4TR1 A;  1YY7 A;  2VCW A;  1O8W A;  2YAN A;  4MZB A;  1GUM A;  1B9X C;  3EVI A;  2GGT A;  2GSQ A;  2O7K A;  3I9V 2;  1MDI A;  4HDE A;  3TDG A;  4NV2 A;  1WPI A;  3ZVJ D;  2VCT A;  5ECL B;  1NHY A;  1GNE A;  4RI6 A;  3Q6O A;  3QR6 A;  4F2I A;  1MTC A;  4ECC A;  4EF0 A;  4EDZ A;  2H73 A;  1MEK A;  1TK5 B;  1TU8 A;  2HSN B;  4I97 A;  8GSS A;  5LCZ A;  5HR3 A;  4HQZ A;  1NSW A;  3GRX A;  4N0V A;  4OCF A;  2F3M A;  1DSB A;  1NM3 A;  3IC4 A;  1ZOF A;  5IMF A;  1TP9 A;  1C72 A;  5J41 A;  2DMM A;  4X1U A;  3EMP A;  2GST A;  4ZBA A;  2WCI A;  1TRW A;  3W8J A;  2BMX A;  2F9S A;  4OMV A;  3LWA A;  5ELA A;  4ID0 A;  1HYU A;  2YWM A;  4MLY A;  5DCH A;  4GCI A;  1X5D A;  1VRS D;  1K0M A;  4TN8 A;  2VL2 C;  3M0F A;  2CT6 A;  5D9X A;  5IMZ A;  1JZO A;  1K3O A;  2R5G A;  2F51 A;  1AAZ A;  1EZK A;  2XBI A;  1SD8 A;  1A2J A;  3V1W A;  3DVX A;  2K6V A;  1F6M C;  5JWO B;  3UVT A;  3KXO A;  3TKQ A;  4EDY A;  3P8W A;  2PBJ A;  2GSS A;  4JE1 A;  2FWF A;  3ERG A;  5DCG A;  4NHW A;  1K0O A;  2MMZ A;  1SK0 A;  4XHM A;  7GSS A;  2PVO C;  3GNJ A;  3CBU A;  4I2U A;  2HSM B;  2DJ0 A;  1V57 A;  2C3N A;  3F6F A;  1RW1 A;  4QL9 A;  2H6X A;  1VF2 A;  2YV7 A;  2B1K A;  4KSM A;  1G0T A;  1XPV A;  3BJ5 A;  3ZRD A;  4OD7 A;  2HFD A;  1EEM A;  1X5C A;  2ZNM A;  1DUG A;  4YQU A;  4PUF C;  4GST A;  5IPH A;  2PER A;  2GZP A;  3MWH A;  4ZB9 A;  2A2S A;  3VWX A;  4FO5 A;  4JR6 A;  2L59 A;  1YF1 A;  1K0D A;  5AGY A;  2H71 A;  17GS A;  1GLQ A;  2IPA A;  2GZZ A;  6GSX A;  2JZT A;  3W8S A;  4BL7 A;  3IHQ A;  3LXT A;  1YJ6 A;  2XHF A;  3RAZ A;  4ZB6 A;  2HSY A;  2I4A A;  3ZL5 A;  2H0I A;  3WGX A;  1FB6 A;  4WR4 A;  1K0B A;  5J9C A;  1SL1 B;  1T4Y A;  2AUV A;  2H0H A;  1WOU A;  2VOC A;  3QOU A;  2DIZ A;  1BYE A;  5IMV A;  1SJ6 A;  4H86 A;  2P0G A;  1M9A A;  3RHC A;  3GST A;  1SL2 B;  2OAC A;  1FO5 A;  2CZ3 A;  2VM2 A;  1OE8 A;  3VI7 A;  2YWI A;  5ECH B;  4ZB8 A;  5ECN B;  4KE3 A;  1AQV A;  1J9B A;  1PL1 A;  1GSF A;  4F0B A;  5ID2 B;  2G0F A;  2TIR A;  1Y6E A;  4EE0 A;  2ALB A;  4GXZ A;  3MSZ A;  3U6V A;  2ES7 A;  1B48 A;  3M8N A;  1O6J A;  5AN1 A;  3J7Y k;  2VD0 A;  4ZL8 A;  5B8B A;  1YZX A;  5DJL A;  1FOV A;  4ISD A;  1BQ7 A;  3GKN A;  3KJY A;  2H1A A;  2AJQ B;  2TRC P;  3GHA A;  3EE2 A;  5GAP D;  5CP1 A;  2DJ2 A;  3CTG A;  3FK8 A;  2C0G A;  2LQO A;  4ULX A;  1ERT A;  2YJH A;  2H72 A;  5EL8 A;  3ZIV A;  3IK9 A;  5FT3 A;  5KN0 A;  3S9F A;  2MYG A;  5B8A A;  3ZIJ A;  3F4T A;  2FY6 A;  2GZY A;  5AIX A;  3C8E A;  1JLV A;  1SL0 B;  1U6T A;  4IGJ A;  1XWC A;  4BVY A;  1XVW A;  5AIV A;  2LJK A;  4EVM A;  1E2Y A;  5F06 A;  2N5A A;  2P5R A;  2MMN A;  2H74 A;  5HR1 A;  1U3A A;  2VUP A;  2MBS A;  1ST9 A;  1WRY A;  3EUR A;  2H1D A;  2V6K A;  1WJK A;  1YQ1 A;  3LFL A;  1JZW A;  3HY2 A;  2FHE A;  1BG5 A;  2B6M A;  3PGT A;  4FYB A;  4Z7X A;  2GQM A;  3TOU A;  2EIQ A;  4ZL9 A;  3CYN A;  4ZXG A;  1WWJ A;  3G7Y A;  4IP6 A;  4WEY A;  5G1K A;  4ECB A;  3H8Q A;  2DJ3 A;  3TKS E;  5CRD A;  3LJR A;  4PNG A;  4L5L A;  1OAZ A;  3DYR A;  3L78 A;  4GWR A;  1JZR A;  1UA5 A;  1CQH A;  4AJ6 A;  3TRQ A;  5C04 A;  4KAE A;  3C71 A;  1PA3 A;  2C3T A;  2H30 A;  1VF3 A;  4G9H A;  2EIR A;  3H79 A;  3D21 A;  1FVK A;  3QCP A;  2KP1 A;  2REM A;  2YZH A;  1ZCP A;  2HLS A;  3FEU A;  4GQF A;  2AYT A;  2P31 A;  1PKW A;  3FYG A;  4PQH A;  4JU5 A;  2QKE A;  4NV5 A;  2UZ8 A;  1V58 A;  2HT9 A;  1R5A A;  2KP2 A;  5EVO A;  3F4R A;  5F05 A;  1TXX A;  2K8S A;  2B3S A;  4WR5 A;  1EP8 A;  1YKC A;  5IPG A;  1WMJ A;  1Z7P A;  2L6D A;  3GIX A;  3WGD A;  4K1F A;  4Q5R A;  3ZIT A;  3H1N A;  3EWL A;  3MAK A;  2YZU A;  1SKS B;  4TXO A;  1X9S B;  3HXS A;  5D9V A;  2LS5 A;  3GUS A;  1LJR A;  3ISO A;  2LNT A;  3KCM A;  5CO3 A;  2LRN A;  2YWO A;  1EP7 A;  3TKR A;  3ZFL A;  3ZLP A;  4POL A;  3L0H A;  2PUK C;  5DAK B;  2VCV A;  4RI7 A;  3L9S A;  2HZE B;  3ZYW A;  3M9K A;  2L5O A;  2DJK A;  4AJ8 A;  1S3D A;  2LRC A;  1EWX A;  5G30 A;  3AY8 A;  1SKR B;  3DGQ A;  4YQV A;  1XWB A;  4NPB A;  4TKY A;  4KB3 A;  4MPF A;  3DIE A;  4HUA A;  2GSR A;  4HU7 A;  1OC8 A;  3L9U A;  1I9D A;  2AV4 A;  5G31 A;  3KMO A;  4MP4 A;  2C8U A;  1GUK A;  4KA0 A;  2JZS A;  2IFQ B;  5ECK B;  4NXI A;  16GS A;  5D93 A;  5EY6 A;  1KNG A;  2HSM A;  2VCQ A;  3WT1 A;  4MMM A;  1JFU A;  4IJI A;  2HI7 A;  4RUV A;  6GST A;  2M72 A;  3GKX A;  3MNG A;  4POM A;  12GS A;  2LJR A;  3VWU A;  3PH9 A;  2ZCT A;  2DJ1 A;  1PKZ A;  3HJO A;  4J2F A;  3KTL A;  2JSZ A;  4MJB A;  1XWA A;  2EIO A;  1ERW A;  1M2B A;  1YKA A;  1GRX A;  4D73 A;  2IMK A;  3FKF A;  1GSE A;  1M0U A;  4HI7 A;  2TRX A;  3QFA C;  4E8H A;  1R5P A;  4PX1 A;  3ZRE A;  2DSA A;  4GQC A;  2WZ9 A;  1GH2 A;  3WD6 A;  4MK3 A;  4KH7 A;  1J08 A;  1ERV A;  4JRR A;  3ZZX A;  1PGT A;  2L4C A;  1TK0 B;  2VLT A;  2YP6 A;  1PL2 A;  4K7O A;  4QQ7 A;  2IMI A;  2I3Y A;  3KH9 A;  4LLR A;  6GSV A;  5DVB A;  1K3L A;  3IAS 2;  5AIS A;  1GSQ A;  4IQ1 A;  3U5R E;  4EXJ A;  1F3A A;  3QAW A;  4IS0 A;  3WGE A;  2LEG A;  4IJ3 A;  2K9F A;  4NMU A;  2YV9 A;  5ID2 A;  3HVS A;  2H6Y A;  4RQR A;  6GSU A;  3UAP A;  4MF5 A;  1G7O A;  2GS3 A;  4K0N A;  5E59 A;  3TKS C;  3P7X A;  5FWG A;  3RPP A;  2VL2 A;  1UVZ A;  4I5Q A;  2BTO T;  4IQA A;  4DSQ A;  5JCW A;  4L0W A;  2J23 A;  3HJP A;  1SU9 A;  4LL4 B;  3UJ1 A;  1KEB A;  4PUA A;  4XS4 B;  3EYT A;  1KTE A;  1U88 A;  1XWG A;  4LA1 A;  4MPG A;  4WBJ A;  5G2Z A;  2VAF A;  4MJC A;  4WET A;  2GDR A;  1TI1 A;  2WUL A;  3O3T A;  3GYK A;  2VD1 A;  3M1G A;  5D73 A;  4TVE A;  4HZ2 A;  4DEJ A;  5JCU A;  5DJM A;  3GX8 A;  1RQM A;  4POB A;  3F63 A;  3LQ7 A;  4I6X A;  2H01 A;  3UBK A;  1FAA A;  1Z7R A;  2HQT A;  2X8H A;  3NIV A;  3VK9 A;  1HNA A;  1FB0 A;  5A5K A;  1R4W A;  1T00 A;  1XVQ A;  2IWT A;  5DAL A;  4GSN A;  4PUR A;  5A4V A;  3Q74 A;  1BX9 A;  3KH7 A;  5IO2 A;  1EV9 A;  4YH2 A;  2FWG A;  5GST A;  5IQY A;  4OFT A;  2YNX A;  4ML1 A;  3F0I A;  2LTK A;  1W4V A;  4TR4 A;  5GAN D;  4KCA A;  2B7K A;  4LMV A;  2MMA A;  1VF4 A;  3N9J A;  2O89 A;  1XW5 A;  1U87 A;  22GS A;  3RPN A;  1GTU A;  1T7P B;  2IMD A;  4O5R A;  2I1U A;  3ZVJ A;  5A4U A;  1SJI A;  2YJ7 A;  4X43 A;  3KM6 A;  4I8B A;  4K6X A;  1A24 A;  3APS A;  1V98 A;  4CW9 A;  3GUR A;  4TR3 A;  4K7I A;  3KGK A;  1FHE A;  4ILF A;  2HNL A;  4XIH A;  2V41 A;  3E9J B;  5KN1 A;  2V2G A;  3C73 A;  4K9Z A;  1XZO A;  2V32 A;  3NOF A;  3HA9 A;  2PN8 A;  3ZTL A;  2B5E A;  3D5J A;  3KEB A;  1Z5Y E;  5B7C A;  1N8J A;  2CVB A;  3CRU A;  1XOB A;  4J57 E;  1WE0 A;  3HZ8 A;  1SKW B;  3GTU B;  5DAK A;  3CSH A;  5IMC A;  3TJK A;  5ECP B;  1M99 A;  2N5B A;  4K8M A;  3BCI A;  4XS6 A;  5F8B A;  18GS A;  4KF9 A;  3TUE A;  3P2A A;  2H70 A;  2GLR A;  2GQL A;  1PRX A;  1F3B A;  2VLV A;  1GLP A;  3O76 A;  3FHK A;  2PWJ A;  5KN3 A;  5ECQ B;  4FIW A;  2F8A A;  1XCC A;  4TR1 B;  3FY7 A;  4X0X A;  2XPD A;  3IOS A;  2CVK A;  3DWV A;  2IFQ A;  3IBH A;  4EL1 A;  3HYP A;  5CRG A;  4FQU A;  1HD2 A;  2CQ9 A;  3PIN A;  2K8V A;  1UN2 A;  3BOA A;  4XS1 A;  3C1R A;  4MF7 A;  4BWS A;  4HQS A;  3WYW A;  1OKD A;  1AIU A;  1DE2 A;  4WXT A;  4N30 A;  4ZIJ A;  4ZIL A;  1PX7 A;  4POK A;  1ILO A;  3F8U A;  5HQP A;  2JL4 A;  4I2T A;  4IBP A;  1TJD A;  1OE7 A;  1F2E A;  3CSJ A;  3LYP A;  1BED A;  4KDY A;  4NAX A;  2N5F A;  2JU5 A;  3ERF A;  3CMI A;  2C1Y A;  1AQX A;  4MDC A;  5CAX A;  3IR4 A;  1LBK A;  1B4Q A;  4DSR A;  19GS A;  2H0G A;  4USS A;  2FD3 A;  4BA7 A;  4HEA 2;  5DQY A;  1W89 A;  1Q98 A;  2XPE A;  1NHO A;  1B4P A;  3R3E A;  2LST A;  3VPT A;  6GSY A;  1MD4 A;  4TXV A;  4JZQ A;  1ACV A;  4OFN A;  4WBR D;  3D22 A;  3IV4 A;  2OE1 A;  1ZYE A;  3G7I A;  2LUS A;  3DEX A;  5DQS A;  1M7T A;  1M9B A;  3HJM A;  6GSS A;  1A2L A;  5ECM B;  1X9W B;  2PPT A;  2AHE A;  2DML A;  4EKZ A;  1O81 A;  4EUY A;  4XS4 A;  3IXR A;  5COH A;  3SBC A;  3G9B A;  1XBS A;  2HRK B;  2O87 A;  5ABR A;  3GA4 A;  2G2Q A;  1A0R P;  1Z3E A;  3F3R A;  2GTU A;  2X8G A;  4PNF A;  1EGR A;  4L8E A;  2B5Y A;  1TKD B;  4G0I A;  4DVC A;  3GH6 A;  1LU4 A;  3HKR A;  1M2D A;  4F0C A;  5INY A;  2NPB A;  1V40 A;  3ME8 A;  3FW2 A;  1URM A;  2DIY A;  2HRF A;  1BJX A;  2H1G A;  2CZ2 A;  2FWE A;  1Q4J A;  3H93 A;  1OYJ A;  1GP1 A;  2FNO A;  5J4U A;  3Q19 A;  3HDC A;  3TRP A;  5J5N A;  3DD3 A;  2E0Q A;  1ZL9 A;  2E7P A;  1S3A A;  2XBQ A;  4TOP A;  1GUH A;  1VF1 A;  5GZZ B;  3P90 A;  3A3T A;  3FRC A;  1QFN A;  1HNC A;  4KSO A;  1PX6 A;  1B9Y C;  4OO4 A;  4PQ1 A;  1R7H A;  4AGS A;  1TI3 A;  5IO0 A;  1ERU A;  2CX4 A;  5E4W A;  4PTS A;  1USB A;  2X64 A;  2E2G A;  3DXB A;  2PGT A;  4K0G A;  4BWQ A;  3W6G A;  1PD2 1;  2D2Z A;  2DC5 A;  4AF2 A;  4HOJ A;  1S3C A;  1MDK A;  2LRT A;  3GKM A;  1HQO A;  4IW9 A;  5A4W A;  3D6I A;  5G1L A;  4E8E A;  4MJA A;  2CAI A;  2L6C A;  5J3R A;  2R6K A;  4KX4 A;  5ELG A;  1Y25 A;  5KEJ A;  1TDI A;  1U3I A;  1M2A A;  1AC1 A;  3TKS A;  1K0A A;  2C4J A;  1ML6 A;  2LNS A;  2QSI A;  1V2A A;  4V1A g;  2IL3 A;  4GTU A;  3ED3 A;  4WF4 A;  3UAR A;  4XCS A;  3M9J A;  4MF6 A;  5F0G A;  4KDX A;  1E6B A;  3FZ5 A;  2A2R A;  1MDJ A;  4N11 A;  1QXH A;  1A0F A;  3D4T A;  3KP8 A;  1XW6 A;  1MD3 A;  1OVN A;  2PMT A;  4OFM A;  2VIM A;  2FGX A;  3HVV A;  2I9H A;  1SK1 A;  4GF0 A;  5CRE A;  1G7E A;  3D0Z A;  1TTZ A;  2VL9 A;  3A5W A;  5D9W A;  3FR3 A;  4ECJ A;  2WJU A;  3UVH A;  1QMV A;  1G6W A;  3GX0 A;  2C0D A;  3DKS A;  5F07 A;  3G7J A;  3BBY A;  3FZ4 A;  2WDU A;  2K18 A;  4BVX B;  2NTO A;  3GKK A;  2FUG 2;  3DRN A;  4FYU A;  3SWL A;  1THO A;  1GNW A;  3GMF A;  5CYY A;  3UBL A;  3F6D A;  1KBN A;  3EMX A;  5D9T A;  2IMF A;  1ZYQ B;  2YOI A;  2PVQ A;  2I81 A;  3WT2 A;  1YEP A;  2IJY A;  5LD0 A;  4WF5 A;  3KZQ A;  1DE1 A;  4IKH A;  3VLN A;  2C0F A;  1SK2 A;  2RM6 A;  1H4O A;  1YDK A;  3VWW A;  1SYR A;  3FZA A;  3QMX A;  2PU9 C;  4KW6 A;  3LEF A;  2H75 A;  2H1B A;  3HVX A;  2VCZ A;  3TRX A;  2KUC A;  2YWN A;  4G0K A;  3N5O A;  1TOF A;  5JWQ B;  4OO5 A;  2DBC A;  4P3Y B;  3BCK A;  5IIZ A;  4FH8 A;  4DSS B;  4TXO B;  3A2X A;  5GSS A;  2R2J A;  3MDK A;  1GSU A;  4MZW A;  4N10 A;  5CNW A;  1K3Y A;  1OC9 B;  3BD2 A;  1R26 A;  13GS A;  2WFC A;  2OJL A;  3TKP A;  3GH9 A;  4GLT A;  4ML6 A;  2OE0 A;  3TJF A;  4F9Z A;  4O92 A;  2WRT A;  1AW9 A;  1TW9 A;  1CQG A;  5D8I A;  2WS2 A;  2YN1 A;  4G2E A;  2JAC A;  5IMD A;  4RQX A;  1X9M B;  5G5F A;  2GT5 A;  5IM9 A;  5ENU A;  5LNK e;  1T8E B;  3JCM L;  4GRF A;  4EO3 A;  1AQW A;  1J0F A;  1NW2 A;  5DBQ A;  2HRN A;  1GTB A;  3IK7 A;  3TOT A;  1EOH A;  2CA8 A;  3KMN A;  3OR5 A;  5JCG A;  3ZMK A;  2HYX A;  3IPZ A;  3ERW A;  5DDL A;  3LGC A;  1THX A;  5CRH A;  6GSW A;  4KGI A;  4HJ2 A;  2VCX A;  1A2M A;  2HZF A;  1IYI A;  2VL3 A;  1N2A A;  2F8F A;  2B5X A;  2HRK A;  2HSH A;  3GL3 A;  3EC3 A;  4G10 A;  1T1V A;  1Z6M A;  4YQM A;  1A23 A;  4D73 B;  3HZ4 A;  4V2L A;  4KUN A;  3VFI A;  5CRW A;  2J9H A;  2KHP A;  5HFI A;  2R4V A;  4MJE A;  1FW1 A;  4LMW A;  1B8X A;  3IDV A;  1SYX A;  2NVL A;  3QAG A;  2HZE A;  1Z6N A;  5H5Q A;  1GTA A;  4HS1 A;  2OE3 A;  3IE3 A;  2E2M A;  1K0C A;  2C0E A;  1YF0 A;  3GN3 A;  5ECI B;  2DJJ A;  2VLU A;  3I69 A;  3C7M A;  4CHS A;  5HFK A;  5BMU A;  2Z9S A;  2C80 A;  1EEJ A;  4HU9 A;  2AAW A;  1SEN A;  1TRU A;  11GS A;  2C3Q A;  2JAD A;  4QL7 A;  2O85 A;  5B6N A;  1SJZ A;  2L57 A;  5HR2 A;  1QGV A;  4O32 A;  4MH3 A;  2X8C A;  3TJJ A;  3LXZ A;  4ZBB A;  1IYH A;  4NHZ A;  4KCE A;  4KND A;  1FG4 A;  4PGT A;  3K8N A;  4G0L A;  3LOR A;  4BPY A;  2DLX A;  4Q5F A;  1ZZY A;  5HR0 A;  2VM1 A;  3ZFB A;  2R3X A;  2AB6 A;  4MAB A;  1PSQ A;  2RLI A;  1EGO A;  3FR9 A;  3QFB C;  1TRV A;  2XC2 A;  1XXU A;  1BAY A;  3TGZ A;  3C1S A;  3NZN A;  3APQ A;  2FWH A;  4EC0 A;  5C00 A;  3LYK A;  3Q18 A;  1F9M A;  2KOK A;  4IVF A;  5J9B A;  9GSS A;  1XFL A;  2A4V A;  2WGR A;  1AUC A;  1V9W A;  2CX3 A;  2H6Z A;  1O73 A;  4K7N A;  4CDO A;  1UC7 A;  1FVJ A;  3ME7 A;  1GSS A;  5ECR B;  3CRT A;  2OA7 A;  1F37 A;  2JSY A;  1T3B A;  4IHU A;  1QUW A;  3QAV A;  5D96 A;  5KN2 A;  3M3M A;  1I5G A;  2RII A;  1GTI A;  2WB9 A;  3VPQ A;  1VGL A;  2NBS A;  4MCU A;  3F3Q A; 
#chains in the Genus database with same CATH topology
 2WW3 A;  2YPM A;  3RBT A;  4TW5 A;  2WVZ A;  3UOM A;  2LQQ A;  5DAL B;  2B7J A;  2NDO A;  2RUF A;  3CSI A;  2ON5 A;  3IC8 A;  2FA8 A;  3GV1 A;  4ZL7 A;  3KIJ A;  1GSD A;  1OC3 A;  3UEM A;  2V1M A;  4BVX A;  1GSY A;  4O7H A;  1H75 A;  3VUR A;  14GS A;  4L0U A;  2H19 A;  1XIY A;  3L9V A;  5IOW A;  2FLS A;  1RK4 A;  3E3E A;  1X0R A;  3LG6 A;  3UMA A;  3R2Q A;  3CXG A;  3TJB A;  4ACS A;  2GVP A;  2YCD A;  2M80 A;  4V2M A;  4LL1 B;  3FR6 A;  2H76 A;  1SD9 A;  4XRD A;  5B6M A;  1ON4 A;  2LKU A;  1TRS A;  3I6A A;  1ABA A;  4YAP A;  1PQN A;  2QGV A;  5ECS A;  4PI2 C;  2GQK A;  1AXD A;  2WZS A;  1A8L A;  1PN9 A;  1EOG A;  2FA4 A;  1O85 A;  3GSS A;  3KTB A;  1QQ2 A;  3L4N A;  2OAD A;  1X5E A;  4BL7 B;  4N0Z A;  2OT3 A;  2MZC A;  3HHV A;  4DSS A;  4FXY P;  4ECI A;  5HFG A;  3GL5 A;  3KD0 A;  2L5L A;  4XTS A;  1OC9 A;  3GFK A;  1Z9H A;  3A2W A;  3TU3 B;  3KP9 A;  3E0U A;  2CV4 A;  4WKW A;  2GT6 A;  4NWY A;  5JWR B;  3O6T A;  3TB2 A;  4JBB A;  3H4K A;  4FYC A;  1JZD A;  1YEX A;  3LSZ A;  3QD9 A;  4V2N A;  4HJM A;  10GS A;  4PQI A;  2MBT A;  3TJG A;  3IA1 A;  2LJA A;  5L71 A;  1TU7 A;  3F4S A;  1DBY A;  4OWY A;  3EU4 A;  1GUL A;  2H8L A;  2V6O A;  5IOX A;  3UL3 A;  1GL8 A;  3VI5 A;  3EU3 A;  3FZ9 A;  5FHI A;  2H66 A;  1K0N A;  2O8V B;  1O8X A;  2L4Q A;  2IN3 A;  3ZML A;  3HD5 A;  2HE3 A;  4G19 A;  3VWV A;  2X99 A;  1G6Y A;  2R37 A;  4V1A p;  2HXK A;  4Z2U A;  1T4Z A;  4IEL A;  2OBI A;  1A8Y A;  1JLW A;  3HCZ A;  4IP1 A;  4ZBD A;  4XRA A;  2IME A;  3US3 A;  4MH2 A;  4PXO A;  3F9U A;  1TK8 B;  5H5R A;  4YAV A;  4IN0 A;  4Q5N A;  2KLX A;  1ZGN A;  5IMA A;  1HNB A;  4Q5Q A;  4K2X A;  2B1L A;  1ZMA A;  1YEW C;  4F82 A;  4TR0 A;  2CAQ A;  4HZ4 A;  4F03 A;  4AJ7 A;  3QPM A;  2RM5 A;  1GWC A;  4GSS A;  1OKT A;  2RUE A;  1XWK A;  3CTF A;  2EC4 A;  1EV4 A;  4MZC A;  4J56 E;  1O7U A;  4BVY B;  3PPU A;  2LV3 A;  1PMT A;  3IAM 2;  4OCE A;  2JZR A;  4JED A;  5G5E A;  1JHB A;  3J7Y b;  2OKA A;  1XW9 A;  3UIW A;  2QA1 A;  5ECO B;  3GTU A;  2FCH A;  2QC7 A;  2ZUP A;  5EPF A;  3DVW A;  2HRA A;  3DML A;  3IRA A;  1WP0 A;  4K2D A;  4MA9 A;  3RHB A;  3FMW A;  2ON7 A;  2MMO A;  4KDU A;  3TCO A;  2EFC A;  3A2V A;  2EFE A;  3I43 A;  3APO A;  2IIY A;  4L5O A;  3RDW A;  3QDN A;  1QK8 A;  2P5Q A;  3EIN A;  2M46 A;  2BJX A;  1XOA A;  2OBK A;  3PR8 A;  2CVD A;  4TRX A;  1WIK A;  20GS A;  2VO4 A;  4JR4 A;  3D4M A;  5H5S A;  4TR1 A;  1YY7 A;  2VCW A;  1O8W A;  2YAN A;  4MZB A;  2DKH A;  1GUM A;  1B9X C;  3EVI A;  2GGT A;  2GSQ A;  2O7K A;  3I9V 2;  1MDI A;  4HDE A;  3TDG A;  4NV2 A;  1WPI A;  3ZVJ D;  2VCT A;  5ECL B;  2O36 A;  1NHY A;  1GNE A;  4RI6 A;  3Q6O A;  3QR6 A;  1M3J A;  1MTC A;  4F2I A;  4ECC A;  4EF0 A;  4EDZ A;  2H73 A;  1MEK A;  1TK5 B;  1TU8 A;  2HSN B;  4I97 A;  8GSS A;  5LCZ A;  5HR3 A;  4HQZ A;  1NSW A;  3GRX A;  4N0V A;  4OCF A;  2F3M A;  1DSB A;  1NM3 A;  3IC4 A;  1ZOF A;  5IMF A;  1TP9 A;  1C72 A;  5J41 A;  2DMM A;  4X1U A;  3EMP A;  2GST A;  4ZBA A;  2WCI A;  1TRW A;  3W8J A;  2BMX A;  2F9S A;  4OMV A;  3LWA A;  5ELA A;  4ID0 A;  1HYU A;  2WVY A;  2YWM A;  4MLY A;  5DCH A;  4GCI A;  1X5D A;  1VRS D;  1K0M A;  4TN8 A;  2VL2 C;  3M0F A;  2CT6 A;  5D9X A;  5IMZ A;  1JZO A;  1K3O A;  2R5G A;  2F51 A;  1AAZ A;  3MIX A;  1EZK A;  2XBI A;  1SD8 A;  1A2J A;  4K5S A;  3V1W A;  3DVX A;  2K6V A;  1F6M C;  5JWO B;  3UVT A;  3KXO A;  3TKQ A;  4EDY A;  3P8W A;  2PBJ A;  2GSS A;  1PN0 A;  4JE1 A;  2FWF A;  3ERG A;  5DCG A;  4NHW A;  1K0O A;  2MMZ A;  1SK0 A;  4XHM A;  7GSS A;  2PVO C;  3GNJ A;  3CBU A;  4I2U A;  2HSM B;  2X49 A;  2DJ0 A;  1V57 A;  2C3N A;  3F6F A;  1RW1 A;  4QL9 A;  2H6X A;  1VF2 A;  2YV7 A;  2B1K A;  1Y1U A;  4KSM A;  1G0T A;  1XPV A;  3BJ5 A;  3ZRD A;  4OD7 A;  2HFD A;  1EEM A;  1X5C A;  2ZNM A;  1DUG A;  4YQU A;  4PUF C;  4GST A;  5IPH A;  2PER A;  2GZP A;  3MWH A;  4ZB9 A;  2A2S A;  3VWX A;  4FO5 A;  4JR6 A;  2L59 A;  1YF1 A;  1K0D A;  5AGY A;  2H71 A;  17GS A;  1GLQ A;  2IPA A;  4W66 A;  2GZZ A;  3A5I A;  6GSX A;  2JZT A;  3W8S A;  4BL7 A;  3IHQ A;  3LXT A;  1YJ6 A;  2XHF A;  3RAZ A;  4ZB6 A;  2HSY A;  2I4A A;  3ZL5 A;  2H0I A;  3WGX A;  1FB6 A;  4WR4 A;  1K0B A;  5J9C A;  1SL1 B;  1T4Y A;  2AUV A;  2H0H A;  1WOU A;  2VOC A;  3QOU A;  2DIZ A;  1BYE A;  5IMV A;  1SJ6 A;  4H86 A;  2P0G A;  1M9A A;  3RHC A;  3GST A;  1SL2 B;  2OAC A;  1FO5 A;  2CZ3 A;  2VM2 A;  1OE8 A;  3VI7 A;  2YWI A;  1ZYP A;  5ECH B;  4ZB8 A;  5ECN B;  4KE3 A;  1AQV A;  1J9B A;  1PL1 A;  1GSF A;  1BF5 A;  4F0B A;  5ID2 B;  2G0F A;  2TIR A;  1Y6E A;  4EE0 A;  2ALB A;  4GXZ A;  3MSZ A;  3U6V A;  2ES7 A;  1B48 A;  3M8N A;  1O6J A;  5AN1 A;  3J7Y k;  2VD0 A;  4ZL8 A;  5B8B A;  1YZX A;  5DJL A;  1FOV A;  4ISD A;  1BQ7 A;  3GKN A;  3KJY A;  2H1A A;  4CY6 A;  2TRC P;  2AJQ B;  3GHA A;  3EE2 A;  5GAP D;  5CP1 A;  5A34 B;  2DJ2 A;  3CTG A;  3FK8 A;  2C0G A;  2LQO A;  4ULX A;  1ERT A;  2YJH A;  2H72 A;  5EL8 A;  3ZIV A;  3IK9 A;  5FT3 A;  5KN0 A;  3S9F A;  2MYG A;  5B8A A;  3ZIJ A;  3F4T A;  2FY6 A;  2GZY A;  5AIX A;  3C8E A;  1JLV A;  1SL0 B;  1U6T A;  4IGJ A;  5J40 A;  1XWC A;  5A1N A;  4BVY A;  1XVW A;  5AIV A;  2LJK A;  4EVM A;  1E2Y A;  5F06 A;  2N5A A;  2P5R A;  2MMN A;  2H74 A;  5HR1 A;  1U3A A;  2VUP A;  1S3R A;  2MBS A;  1ST9 A;  1WRY A;  3EUR A;  2H1D A;  2V6K A;  1WJK A;  1YQ1 A;  3LFL A;  1JZW A;  3HY2 A;  2FHE A;  1BG5 A;  2B6M A;  3PGT A;  4FYB A;  4Z7X A;  2GQM A;  3RGB C;  3CWG A;  3TOU A;  2EIQ A;  4ZL9 A;  3CYN A;  4ZXG A;  1WWJ A;  3G7Y A;  4IP6 A;  4WEY A;  5G1K A;  4ECB A;  3H8Q A;  2DJ3 A;  3TKS E;  5CRD A;  3LJR A;  4PNG A;  4L5L A;  1OAZ A;  3DYR A;  3L78 A;  4GWR A;  1JZR A;  1UA5 A;  1CQH A;  4YKG A;  4AJ6 A;  3TRQ A;  4G01 A;  5C04 A;  4KAE A;  3C71 A;  1PA3 A;  2C3T A;  2H30 A;  1VF3 A;  4G9H A;  4GDF A;  2EIR A;  3H79 A;  3D21 A;  1FVK A;  3QCP A;  2KP1 A;  2REM A;  2YZH A;  1ZCP A;  2HLS A;  3FEU A;  4GQF A;  2AYT A;  2P31 A;  1PKW A;  3FYG A;  1M3I A;  4PQH A;  4JU5 A;  2QKE A;  4NV5 A;  2UZ8 A;  1V58 A;  2HT9 A;  1R5A A;  2KP2 A;  5EVO A;  3F4R A;  5F05 A;  1TXX A;  2K8S A;  2B3S A;  4WR5 A;  1EP8 A;  1YKC A;  5IPG A;  1WMJ A;  1Z7P A;  2L6D A;  3GIX A;  3WGD A;  4K1F A;  4Q5R A;  5BRT A;  3ZIT A;  3H1N A;  3EWL A;  3MAK A;  2YZU A;  1SKS B;  4TXO A;  1X9S B;  3HXS A;  5D9V A;  2LS5 A;  3GUS A;  1LJR A;  3ISO A;  2LNT A;  3KCM A;  2QA2 A;  3IHG A;  3HVN A;  5CO3 A;  2LRN A;  2YWO A;  1EP7 A;  3TKR A;  3ZFL A;  3ZLP A;  4POL A;  3L0H A;  2PUK C;  5DAK B;  2VCV A;  4RI7 A;  3L9S A;  2HZE B;  3ZYW A;  3M9K A;  4AKI A;  2L5O A;  2DJK A;  4AJ8 A;  1S3D A;  2LRC A;  1EWX A;  5G30 A;  3AY8 A;  1SKR B;  3DGQ A;  4YQV A;  1XWB A;  4NPB A;  4TKY A;  4MPF A;  3DIE A;  4KB3 A;  4HUA A;  2GSR A;  4HU7 A;  1OC8 A;  3L9U A;  2O3E A;  1I9D A;  2AV4 A;  5G31 A;  3KMO A;  4MP4 A;  2C8U A;  1GUK A;  4CY8 A;  4KA0 A;  2JZS A;  4E68 A;  2IFQ B;  5ECK B;  4NXI A;  16GS A;  5D93 A;  5EY6 A;  1KNG A;  4X4J A;  2HSM A;  2VCQ A;  3WT1 A;  4MMM A;  1JFU A;  4IJI A;  2HI7 A;  4RUV A;  6GST A;  2M72 A;  3GKX A;  3MNG A;  4POM A;  12GS A;  2LJR A;  2WVX A;  3VWU A;  3PH9 A;  2ZCT A;  2DJ1 A;  1YVL A;  2VKZ G;  1PKZ A;  3HJO A;  4J2F A;  3KTL A;  2JSZ A;  4PI0 C;  4MJB A;  1XWA A;  2EIO A;  1ERW A;  1M2B A;  4AKX B;  1YKA A;  1GRX A;  4D73 A;  5A5H B;  2IMK A;  3FKF A;  1GSE A;  1M0U A;  4HI7 A;  2TRX A;  3QFA C;  4E8H A;  1R5P A;  4PX1 A;  3ZRE A;  2DSA A;  4GQC A;  2WZ9 A;  1S4B P;  1GH2 A;  3WD6 A;  4MK3 A;  4KH7 A;  1J08 A;  1ERV A;  4JRR A;  3ZZX A;  1PGT A;  2L4C A;  3RFR C;  1TK0 B;  2VLT A;  2YP6 A;  1PL2 A;  4K7O A;  4QQ7 A;  2IMI A;  2I3Y A;  3KH9 A;  4LLR A;  6GSV A;  5DVB A;  1K3L A;  3IAS 2;  5AIS A;  1GSQ A;  4AKG A;  4IQ1 A;  3U5R E;  4EXJ A;  1F3A A;  3QAW A;  4IS0 A;  3WGE A;  2LEG A;  4IJ3 A;  2K9F A;  4NMU A;  2YV9 A;  5ID2 A;  3HVS A;  2H6Y A;  4RQR A;  6GSU A;  3UAP A;  1ZYN A;  2GS3 A;  4MF5 A;  1G7O A;  4K0N A;  5E59 A;  3TKS C;  3MYD A;  3P7X A;  5FWG A;  3RPP A;  2VL2 A;  1UVZ A;  4I5Q A;  2BTO T;  5J47 A;  4IQA A;  4DSQ A;  5JCW A;  4L0W A;  4PHZ C;  5A34 A;  2J23 A;  3HJP A;  1SU9 A;  4LL4 B;  3UJ1 A;  1SVO A;  2H1L A;  1KEB A;  4PUA A;  4XS4 B;  3EYT A;  1KTE A;  1U88 A;  1XWG A;  4LA1 A;  4MPG A;  4WBJ A;  5G2Z A;  2VAF A;  4MJC A;  4WET A;  2GDR A;  1TI1 A;  2WUL A;  3O3T A;  3GYK A;  2VD1 A;  3M1G A;  5D73 A;  4TVE A;  4HZ2 A;  4DEJ A;  5JCU A;  5DJM A;  3GX8 A;  1RQM A;  4POB A;  3F63 A;  3LQ7 A;  4I6X A;  2H01 A;  3UBK A;  1FAA A;  1Z7R A;  2HQT A;  2WW1 A;  2X8H A;  3NIV A;  3VK9 A;  4EIQ A;  1HNA A;  1FB0 A;  5A5K A;  1R4W A;  1T00 A;  1XVQ A;  2IWT A;  5DAL A;  2R0C A;  4GSN A;  4PUR A;  5A4V A;  3Q74 A;  1BX9 A;  3KH7 A;  5IO2 A;  3CQF A;  1EV9 A;  4YH2 A;  2FWG A;  5GST A;  5IQY A;  4OFT A;  2YNX A;  4ML1 A;  4N3Z A;  3F0I A;  2LTK A;  1W4V A;  4TR4 A;  5GAN D;  4KCA A;  2B7K A;  4LMV A;  2MMA A;  1VF4 A;  3N9J A;  2O89 A;  2R0P A;  1XW5 A;  1U87 A;  22GS A;  3RPN A;  1GTU A;  1T7P B;  2IMD A;  4O5R A;  2I1U A;  3ZVJ A;  5A4U A;  1SJI A;  2YJ7 A;  4X43 A;  3KM6 A;  4AI6 A;  4I8B A;  4K6X A;  1A24 A;  3APS A;  4O5U A;  1V98 A;  4CW9 A;  3GUR A;  4TR3 A;  4K7I A;  3KGK A;  2UV8 G;  1FHE A;  1SVM A;  4ILF A;  2HNL A;  4XIH A;  2V41 A;  3E9J B;  3HMJ G;  5KN1 A;  2V2G A;  3C73 A;  4K9Z A;  1XZO A;  2V32 A;  3NOF A;  3HA9 A;  2PN8 A;  3ZTL A;  2B5E A;  3D5J A;  3KEB A;  1Z5Y E;  4K5R A;  5B7C A;  1N8J A;  2CVB A;  3CRU A;  1XOB A;  4J57 E;  1WE0 A;  3HZ8 A;  1TXU A;  1SKW B;  3GTU B;  5DAK A;  3CSH A;  5IMC A;  3TJK A;  5ECP B;  1M99 A;  2N5B A;  4K8M A;  3BCI A;  4XS6 A;  5F8B A;  18GS A;  4KF9 A;  3TUE A;  3P2A A;  2H70 A;  2GLR A;  2GQL A;  1PRX A;  1F3B A;  2VLV A;  1GLP A;  1FOH A;  3O76 A;  3FHK A;  3EPT A;  2PWJ A;  5KN3 A;  5ECQ B;  4FIW A;  2EFD A;  2F8A A;  1XCC A;  4TR1 B;  3FY7 A;  4X0X A;  2XPD A;  5KOX A;  3IOS A;  2CVK A;  3DWV A;  2IFQ A;  3IBH A;  4EL1 A;  3HYP A;  5CRG A;  4FQU A;  1HD2 A;  2CQ9 A;  3PIN A;  2K8V A;  1UN2 A;  3BOA A;  4XS1 A;  3C1R A;  4MF7 A;  1BG1 A;  4BWS A;  4HQS A;  3WYW A;  1OKD A;  1AIU A;  1DE2 A;  4WXT A;  4N30 A;  4ZIJ A;  4ZIL A;  1PX7 A;  4POK A;  1ILO A;  3F8U A;  5HQP A;  2JL4 A;  4I2T A;  4IBP A;  1TJD A;  1OE7 A;  1F2E A;  3CSJ A;  3LYP A;  1BED A;  4KDY A;  4NAX A;  2N5F A;  2JU5 A;  3ERF A;  3CMI A;  2C1Y A;  1AQX A;  4MDC A;  5CAX A;  3IR4 A;  1LBK A;  1B4Q A;  4DSR A;  4A5P A;  19GS A;  2H0G A;  4USS A;  2FD3 A;  4BA7 A;  4HEA 2;  5DQY A;  1W89 A;  2DKI A;  1Q98 A;  2XPE A;  1NHO A;  1B4P A;  3R3E A;  2LST A;  3VPT A;  6GSY A;  1MD4 A;  4TXV A;  4JZQ A;  1ACV A;  4OFN A;  4WBR D;  3D22 A;  4Z2T A;  3IV4 A;  2OE1 A;  1ZYE A;  3G7I A;  2LUS A;  3DEX A;  5DQS A;  1M7T A;  1M9B A;  3HJM A;  6GSS A;  1A2L A;  5ECM B;  1X9W B;  2PPT A;  3CHX C;  2AHE A;  2DML A;  4EKZ A;  1O81 A;  4EUY A;  4XS4 A;  4QMK A;  3IXR A;  5COH A;  3SBC A;  3G9B A;  1XBS A;  2HSN A;  2HRK B;  2O87 A;  5ABR A;  3GA4 A;  2G2Q A;  1A0R P;  1Z3E A;  3F3R A;  2GTU A;  2X8G A;  4PNF A;  1EGR A;  4L8E A;  2B5Y A;  1TKD B;  4G0I A;  4DVC A;  3GH6 A;  1LU4 A;  3HKR A;  1M2D A;  4F0C A;  2R0G A;  5INY A;  2NPB A;  1V40 A;  3ME8 A;  3FW2 A;  1URM A;  2DIY A;  2HRF A;  2EFH A;  1BJX A;  2H1G A;  2CZ2 A;  2FWE A;  1Q4J A;  3H93 A;  1OYJ A;  1GP1 A;  2FNO A;  5J4U A;  3Q19 A;  3HDC A;  3TRP A;  5J5N A;  3DD3 A;  2E0Q A;  1ZL9 A;  2E7P A;  1S3A A;  2XBQ A;  4TOP A;  1GUH A;  1VF1 A;  5GZZ B;  3P90 A;  3A3T A;  3FRC A;  5BMU B;  2A4H A;  4ZB7 A;  1I1I P;  1N25 A;  1QFN A;  1HNC A;  4KSO A;  1PX6 A;  1B9Y C;  4OO4 A;  4PQ1 A;  1R7H A;  4AGS A;  1TI3 A;  5IO0 A;  1ERU A;  2CX4 A;  5E4W A;  4PTS A;  1USB A;  2X64 A;  2E2G A;  3DXB A;  2PGT A;  4K0G A;  4BWQ A;  3W6G A;  1PD2 1;  5J4V A;  2D2Z A;  2DC5 A;  1PFO A;  4AF2 A;  4HOJ A;  1S3C A;  1MDK A;  2LRT A;  3GKM A;  1HQO A;  4IW9 A;  5A4W A;  3D6I A;  5G1L A;  4E8E A;  4MJA A;  2CAI A;  2L6C A;  5J3R A;  2R6K A;  4KX4 A;  5ELG A;  1Y25 A;  5KEJ A;  1TDI A;  1U3I A;  1M2A A;  1AC1 A;  3TKS A;  1K0A A;  2C4J A;  1ML6 A;  2LNS A;  2QSI A;  1V2A A;  4V1A g;  2IL3 A;  4GTU A;  3ED3 A;  4WF4 A;  3UAR A;  4XCS A;  5A1N B;  3M9J A;  4MF6 A;  5F0G A;  4KDX A;  1E6B A;  4AKH A;  3FZ5 A;  2A2R A;  1MDJ A;  4N11 A;  1QXH A;  1A0F A;  3D4T A;  3KP8 A;  1XW6 A;  1MD3 A;  1OVN A;  2PMT A;  4OFM A;  2VIM A;  2FGX A;  3HVV A;  2I9H A;  1SK1 A;  4GF0 A;  5CRE A;  1G7E A;  3D0Z A;  5KOW A;  1TTZ A;  4EIP A;  2VL9 A;  3A5W A;  5D9W A;  3FR3 A;  4ECJ A;  2WJU A;  3UVH A;  1QMV A;  1G6W A;  3GX0 A;  2C0D A;  3DKS A;  5F07 A;  3G7J A;  3BBY A;  3FZ4 A;  2WDU A;  2K18 A;  4BVX B;  2NTO A;  3GKK A;  2FUG 2;  3DRN A;  4FYU A;  3SWL A;  1THO A;  1GNW A;  3GMF A;  5CYY A;  3UBL A;  3F6D A;  1KBN A;  3EMX A;  5D9T A;  2IMF A;  1ZYQ B;  2YOI A;  2PVQ A;  2I81 A;  3WT2 A;  1YEP A;  2IJY A;  5LD0 A;  4WF5 A;  3KZQ A;  1DE1 A;  4IKH A;  3VLN A;  2C0F A;  1SK2 A;  2RM6 A;  4ICY A;  1H4O A;  1YDK A;  3VWW A;  1SYR A;  3FZA A;  3QMX A;  2PU9 C;  4KW6 A;  3LEF A;  2H75 A;  2H1B A;  4O5Q A;  3HVX A;  2VCZ A;  3TRX A;  2KUC A;  2YWN A;  4G0K A;  3N5O A;  1TOF A;  5JWQ B;  4OO5 A;  2DBC A;  4P3Y B;  3BCK A;  5IIZ A;  4FH8 A;  4DSS B;  4TXO B;  3A2X A;  5GSS A;  2R2J A;  3MDK A;  1GSU A;  4MZW A;  4N10 A;  5CNW A;  1K3Y A;  1OC9 B;  3BD2 A;  3LW9 A;  1R26 A;  13GS A;  2WFC A;  2OJL A;  3TKP A;  3GH9 A;  4GLT A;  2A2P A;  4ML6 A;  2OE0 A;  3TJF A;  4F9Z A;  4O92 A;  2WRT A;  1AW9 A;  1TW9 A;  2O5V A;  1CQG A;  5D8I A;  2WS2 A;  2YN1 A;  4G2E A;  2JAC A;  5IMD A;  4RQX A;  1X9M B;  5G5F A;  2GT5 A;  5IM9 A;  5ENU A;  5LNK e;  1T8E B;  3JCM L;  4GRF A;  4EO3 A;  1AQW A;  1J0F A;  1NW2 A;  5DBQ A;  2HRN A;  1GTB A;  3IK7 A;  3TOT A;  1XG8 A;  1EOH A;  4Z2R A;  2CA8 A;  3KMN A;  3OR5 A;  5JCG A;  3ZMK A;  2HYX A;  3IPZ A;  3ERW A;  5DDL A;  4YKF A;  4BIK A;  3LGC A;  1THX A;  5CRH A;  6GSW A;  4KGI A;  4HJ2 A;  2VCX A;  1A2M A;  2HZF A;  1IYI A;  2WVX B;  2VL3 A;  1N2A A;  2F8F A;  2B5X A;  2HRK A;  2HSH A;  3GL3 A;  3EC3 A;  4G10 A;  1T1V A;  1Z6M A;  4HSC X;  4YQM A;  1A23 A;  4D73 B;  3HZ4 A;  4V2L A;  4KUN A;  3VFI A;  5CRW A;  2J9H A;  2KHP A;  5HFI A;  2R4V A;  4MJE A;  1FW1 A;  4LMW A;  1B8X A;  3IDV A;  1SYX A;  2NVL A;  3QAG A;  2HZE A;  1Z6N A;  4MNN A;  5H5Q A;  1GTA A;  4HS1 A;  2OE3 A;  3IE3 A;  2E2M A;  1SVL A;  1K0C A;  2C0E A;  1YF0 A;  3GN3 A;  5ECI B;  2DJJ A;  2VLU A;  3I69 A;  3C7M A;  4CHS A;  5HFK A;  5BMU A;  2Z9S A;  2C80 A;  1EEJ A;  4HU9 A;  2AAW A;  1SEN A;  1TRU A;  11GS A;  2C3Q A;  2JAD A;  4QL7 A;  2O85 A;  5B6N A;  1SJZ A;  2L57 A;  5HR2 A;  1QGV A;  4O32 A;  4MH3 A;  2X8C A;  3TJJ A;  3LXZ A;  4ZBB A;  1IYH A;  4NHZ A;  4KCE A;  4KND A;  1FG4 A;  4PGT A;  3K8N A;  4G0L A;  3LOR A;  4BPY A;  2DLX A;  4Q5F A;  1ZZY A;  2WW2 A;  5HR0 A;  2VM1 A;  3ZFB A;  2R3X A;  2AB6 A;  4MAB A;  1PSQ A;  2RLI A;  1EGO A;  5J4Y A;  3FR9 A;  2WW0 A;  3QFB C;  1TRV A;  2XC2 A;  1XXU A;  1BAY A;  5A5H A;  3TGZ A;  3C1S A;  3NZN A;  3APQ A;  2FWH A;  4EC0 A;  5C00 A;  3LYK A;  3Q18 A;  1F9M A;  2KOK A;  4IVF A;  5J9B A;  9GSS A;  1XFL A;  2A4V A;  2WGR A;  1AUC A;  1V9W A;  2CX3 A;  2H6Z A;  1O73 A;  4K7N A;  4CDO A;  1UC7 A;  1FVJ A;  3ME7 A;  1GSS A;  5ECR B;  3CRT A;  2X4A A;  2OA7 A;  1F37 A;  2JSY A;  1T3B A;  4IHU A;  1QUW A;  3QAV A;  5D96 A;  5KN2 A;  3M3M A;  1I5G A;  2RII A;  1GTI A;  2WB9 A;  3VPQ A;  1VGL A;  2NBS A;  4MCU A;  3F3Q A; 
#chains in the Genus database with same CATH homology
 2YPM A;  3RBT A;  4TW5 A;  3UOM A;  2LQQ A;  5DAL B;  2B7J A;  2NDO A;  2RUF A;  3CSI A;  2ON5 A;  3IC8 A;  2FA8 A;  3GV1 A;  4ZL7 A;  3KIJ A;  1GSD A;  1OC3 A;  3UEM A;  2V1M A;  4BVX A;  1GSY A;  4O7H A;  1H75 A;  3VUR A;  14GS A;  4L0U A;  2H19 A;  1XIY A;  3L9V A;  5IOW A;  2FLS A;  1RK4 A;  3E3E A;  1X0R A;  3LG6 A;  3UMA A;  3R2Q A;  3CXG A;  3TJB A;  4ACS A;  2GVP A;  2YCD A;  2M80 A;  4V2M A;  4LL1 B;  3FR6 A;  2H76 A;  1SD9 A;  4XRD A;  5B6M A;  1ON4 A;  2LKU A;  1TRS A;  3I6A A;  1ABA A;  4YAP A;  1PQN A;  2QGV A;  5ECS A;  2GQK A;  1AXD A;  1A8L A;  1PN9 A;  1EOG A;  2FA4 A;  1O85 A;  3GSS A;  3L4N A;  1QQ2 A;  3KTB A;  2OAD A;  1X5E A;  4BL7 B;  4N0Z A;  2OT3 A;  2MZC A;  3HHV A;  4DSS A;  4ECI A;  5HFG A;  3GL5 A;  3KD0 A;  2L5L A;  4XTS A;  1OC9 A;  3GFK A;  1Z9H A;  3A2W A;  3TU3 B;  3KP9 A;  3E0U A;  2CV4 A;  4WKW A;  2GT6 A;  4NWY A;  5JWR B;  3O6T A;  3TB2 A;  4JBB A;  3H4K A;  4FYC A;  1JZD A;  1YEX A;  3LSZ A;  3QD9 A;  4V2N A;  4HJM A;  10GS A;  4PQI A;  2MBT A;  3TJG A;  3IA1 A;  2LJA A;  5L71 A;  1TU7 A;  3F4S A;  1DBY A;  4OWY A;  3EU4 A;  1GUL A;  2H8L A;  2V6O A;  5IOX A;  3UL3 A;  1GL8 A;  3VI5 A;  3EU3 A;  3FZ9 A;  5FHI A;  2H66 A;  1K0N A;  2O8V B;  1O8X A;  2L4Q A;  2IN3 A;  3ZML A;  3HD5 A;  2HE3 A;  4G19 A;  3VWV A;  2X99 A;  1G6Y A;  2R37 A;  4V1A p;  2HXK A;  4Z2U A;  1T4Z A;  4IEL A;  2OBI A;  1A8Y A;  1JLW A;  3HCZ A;  4IP1 A;  4ZBD A;  4XRA A;  2IME A;  3US3 A;  4MH2 A;  4PXO A;  3F9U A;  1TK8 B;  5H5R A;  4YAV A;  4IN0 A;  4Q5N A;  2KLX A;  1ZGN A;  5IMA A;  1HNB A;  4Q5Q A;  4K2X A;  2B1L A;  1ZMA A;  4F82 A;  4TR0 A;  2CAQ A;  4HZ4 A;  4F03 A;  4AJ7 A;  3QPM A;  2RM5 A;  1GWC A;  4GSS A;  1OKT A;  2RUE A;  1XWK A;  3CTF A;  2EC4 A;  1EV4 A;  4MZC A;  4J56 E;  1O7U A;  4BVY B;  3PPU A;  2LV3 A;  1PMT A;  3IAM 2;  4OCE A;  2JZR A;  4JED A;  5G5E A;  1JHB A;  3J7Y b;  2OKA A;  1XW9 A;  3UIW A;  2QA1 A;  5ECO B;  3GTU A;  2FCH A;  2QC7 A;  2ZUP A;  5EPF A;  3DVW A;  2HRA A;  3DML A;  3IRA A;  1WP0 A;  4K2D A;  4MA9 A;  3RHB A;  3FMW A;  2ON7 A;  2MMO A;  4KDU A;  3TCO A;  2EFC A;  3A2V A;  2EFE A;  3I43 A;  3APO A;  2IIY A;  4L5O A;  3RDW A;  3QDN A;  1QK8 A;  2P5Q A;  3EIN A;  2M46 A;  2BJX A;  1XOA A;  2OBK A;  3PR8 A;  2CVD A;  4TRX A;  1WIK A;  20GS A;  2VO4 A;  4JR4 A;  3D4M A;  5H5S A;  4TR1 A;  1YY7 A;  2VCW A;  1O8W A;  2YAN A;  4MZB A;  2DKH A;  1GUM A;  1B9X C;  3EVI A;  2GGT A;  2GSQ A;  2O7K A;  3I9V 2;  1MDI A;  4HDE A;  3TDG A;  4NV2 A;  1WPI A;  3ZVJ D;  2VCT A;  5ECL B;  1NHY A;  1GNE A;  4RI6 A;  3Q6O A;  3QR6 A;  4F2I A;  1MTC A;  4ECC A;  4EF0 A;  4EDZ A;  2H73 A;  1MEK A;  1TK5 B;  1TU8 A;  2HSN B;  4I97 A;  8GSS A;  5LCZ A;  5HR3 A;  4HQZ A;  1NSW A;  3GRX A;  4N0V A;  4OCF A;  2F3M A;  1DSB A;  1NM3 A;  3IC4 A;  1ZOF A;  5IMF A;  1TP9 A;  1C72 A;  5J41 A;  2DMM A;  4X1U A;  3EMP A;  2GST A;  4ZBA A;  2WCI A;  1TRW A;  3W8J A;  2BMX A;  2F9S A;  4OMV A;  3LWA A;  5ELA A;  4ID0 A;  1HYU A;  2YWM A;  4MLY A;  5DCH A;  4GCI A;  1X5D A;  1VRS D;  1K0M A;  4TN8 A;  2VL2 C;  3M0F A;  2CT6 A;  5D9X A;  5IMZ A;  1JZO A;  1K3O A;  2R5G A;  2F51 A;  1AAZ A;  3MIX A;  1EZK A;  2XBI A;  1SD8 A;  1A2J A;  4K5S A;  3V1W A;  3DVX A;  2K6V A;  1F6M C;  5JWO B;  3UVT A;  3KXO A;  3TKQ A;  4EDY A;  3P8W A;  2PBJ A;  2GSS A;  1PN0 A;  4JE1 A;  2FWF A;  3ERG A;  5DCG A;  4NHW A;  1K0O A;  2MMZ A;  1SK0 A;  4XHM A;  7GSS A;  2PVO C;  3GNJ A;  3CBU A;  4I2U A;  2HSM B;  2X49 A;  2DJ0 A;  1V57 A;  2C3N A;  3F6F A;  1RW1 A;  4QL9 A;  2H6X A;  1VF2 A;  2YV7 A;  2B1K A;  1Y1U A;  4KSM A;  1G0T A;  1XPV A;  3BJ5 A;  3ZRD A;  4OD7 A;  2HFD A;  1EEM A;  1X5C A;  2ZNM A;  1DUG A;  4YQU A;  4PUF C;  4GST A;  5IPH A;  2PER A;  2GZP A;  3MWH A;  4ZB9 A;  2A2S A;  3VWX A;  4FO5 A;  4JR6 A;  2L59 A;  1YF1 A;  1K0D A;  5AGY A;  2H71 A;  17GS A;  1GLQ A;  2IPA A;  4W66 A;  2GZZ A;  3A5I A;  6GSX A;  2JZT A;  3W8S A;  4BL7 A;  3IHQ A;  3LXT A;  1YJ6 A;  2XHF A;  3RAZ A;  4ZB6 A;  2HSY A;  2I4A A;  3ZL5 A;  2H0I A;  3WGX A;  1FB6 A;  4WR4 A;  1K0B A;  5J9C A;  1SL1 B;  1T4Y A;  2AUV A;  2H0H A;  1WOU A;  2VOC A;  3QOU A;  2DIZ A;  1BYE A;  5IMV A;  1SJ6 A;  4H86 A;  2P0G A;  1M9A A;  3RHC A;  3GST A;  1SL2 B;  2OAC A;  1FO5 A;  2CZ3 A;  2VM2 A;  1OE8 A;  3VI7 A;  2YWI A;  1ZYP A;  5ECH B;  4ZB8 A;  5ECN B;  4KE3 A;  1AQV A;  1J9B A;  1PL1 A;  1GSF A;  1BF5 A;  4F0B A;  5ID2 B;  2G0F A;  2TIR A;  1Y6E A;  4EE0 A;  2ALB A;  4GXZ A;  3MSZ A;  3U6V A;  2ES7 A;  1B48 A;  3M8N A;  1O6J A;  5AN1 A;  3J7Y k;  2VD0 A;  4ZL8 A;  5B8B A;  1YZX A;  5DJL A;  1FOV A;  4ISD A;  1BQ7 A;  3GKN A;  3KJY A;  2H1A A;  4CY6 A;  2TRC P;  2AJQ B;  3GHA A;  3EE2 A;  5GAP D;  5CP1 A;  5A34 B;  2DJ2 A;  3CTG A;  3FK8 A;  2C0G A;  2LQO A;  4ULX A;  1ERT A;  2YJH A;  2H72 A;  5EL8 A;  3ZIV A;  3IK9 A;  5FT3 A;  5KN0 A;  3S9F A;  2MYG A;  5B8A A;  3ZIJ A;  3F4T A;  2FY6 A;  2GZY A;  5AIX A;  3C8E A;  1JLV A;  1SL0 B;  1U6T A;  4IGJ A;  5J40 A;  1XWC A;  5A1N A;  4BVY A;  1XVW A;  5AIV A;  2LJK A;  4EVM A;  1E2Y A;  5F06 A;  2N5A A;  2P5R A;  2MMN A;  2H74 A;  5HR1 A;  1U3A A;  2VUP A;  2MBS A;  1ST9 A;  1WRY A;  3EUR A;  2H1D A;  2V6K A;  1WJK A;  1YQ1 A;  3LFL A;  1JZW A;  3HY2 A;  2FHE A;  1BG5 A;  2B6M A;  3PGT A;  4FYB A;  4Z7X A;  2GQM A;  3CWG A;  3TOU A;  2EIQ A;  4ZL9 A;  3CYN A;  4ZXG A;  1WWJ A;  3G7Y A;  4IP6 A;  4WEY A;  5G1K A;  4ECB A;  3H8Q A;  2DJ3 A;  3TKS E;  5CRD A;  3LJR A;  4PNG A;  4L5L A;  1OAZ A;  3DYR A;  3L78 A;  4GWR A;  1JZR A;  1UA5 A;  1CQH A;  4YKG A;  4AJ6 A;  3TRQ A;  4G01 A;  5C04 A;  4KAE A;  3C71 A;  1PA3 A;  2C3T A;  2H30 A;  1VF3 A;  4G9H A;  4GDF A;  2EIR A;  3H79 A;  3D21 A;  1FVK A;  3QCP A;  2KP1 A;  2REM A;  2YZH A;  1ZCP A;  2HLS A;  3FEU A;  4GQF A;  2AYT A;  2P31 A;  1PKW A;  3FYG A;  4PQH A;  4JU5 A;  2QKE A;  4NV5 A;  2UZ8 A;  1V58 A;  2HT9 A;  1R5A A;  2KP2 A;  5EVO A;  3F4R A;  5F05 A;  1TXX A;  2K8S A;  2B3S A;  4WR5 A;  1EP8 A;  1YKC A;  5IPG A;  1WMJ A;  1Z7P A;  2L6D A;  3GIX A;  3WGD A;  4K1F A;  4Q5R A;  5BRT A;  3ZIT A;  3H1N A;  3EWL A;  3MAK A;  2YZU A;  1SKS B;  4TXO A;  1X9S B;  3HXS A;  5D9V A;  2LS5 A;  3GUS A;  1LJR A;  3ISO A;  2LNT A;  3KCM A;  2QA2 A;  3IHG A;  5CO3 A;  2LRN A;  2YWO A;  1EP7 A;  3TKR A;  3ZFL A;  3ZLP A;  4POL A;  3L0H A;  2PUK C;  5DAK B;  2VCV A;  4RI7 A;  3L9S A;  2HZE B;  3ZYW A;  3M9K A;  4AKI A;  2L5O A;  2DJK A;  4AJ8 A;  1S3D A;  2LRC A;  1EWX A;  5G30 A;  3AY8 A;  1SKR B;  3DGQ A;  4YQV A;  1XWB A;  4NPB A;  4TKY A;  4MPF A;  3DIE A;  4KB3 A;  4HUA A;  2GSR A;  4HU7 A;  1OC8 A;  3L9U A;  1I9D A;  2AV4 A;  5G31 A;  3KMO A;  4MP4 A;  2C8U A;  1GUK A;  4CY8 A;  4KA0 A;  2JZS A;  4E68 A;  2IFQ B;  5ECK B;  4NXI A;  16GS A;  5D93 A;  5EY6 A;  1KNG A;  4X4J A;  2HSM A;  2VCQ A;  3WT1 A;  4MMM A;  1JFU A;  4IJI A;  2HI7 A;  4RUV A;  6GST A;  2M72 A;  3GKX A;  3MNG A;  4POM A;  12GS A;  2LJR A;  3VWU A;  3PH9 A;  2ZCT A;  2DJ1 A;  1YVL A;  2VKZ G;  1PKZ A;  3HJO A;  4J2F A;  3KTL A;  2JSZ A;  4MJB A;  1XWA A;  2EIO A;  1ERW A;  1M2B A;  4AKX B;  1YKA A;  1GRX A;  4D73 A;  5A5H B;  2IMK A;  3FKF A;  1GSE A;  1M0U A;  4HI7 A;  2TRX A;  3QFA C;  4E8H A;  1R5P A;  4PX1 A;  3ZRE A;  2DSA A;  4GQC A;  2WZ9 A;  1GH2 A;  3WD6 A;  4MK3 A;  4KH7 A;  1J08 A;  1ERV A;  4JRR A;  3ZZX A;  1PGT A;  2L4C A;  1TK0 B;  2VLT A;  2YP6 A;  1PL2 A;  4K7O A;  4QQ7 A;  2IMI A;  2I3Y A;  3KH9 A;  4LLR A;  6GSV A;  5DVB A;  1K3L A;  3IAS 2;  5AIS A;  1GSQ A;  4AKG A;  4IQ1 A;  3U5R E;  4EXJ A;  1F3A A;  3QAW A;  4IS0 A;  3WGE A;  2LEG A;  4IJ3 A;  2K9F A;  4NMU A;  2YV9 A;  5ID2 A;  3HVS A;  2H6Y A;  4RQR A;  6GSU A;  3UAP A;  1ZYN A;  2GS3 A;  4MF5 A;  1G7O A;  4K0N A;  5E59 A;  3TKS C;  3MYD A;  3P7X A;  5FWG A;  3RPP A;  2VL2 A;  1UVZ A;  4I5Q A;  2BTO T;  5J47 A;  4IQA A;  4DSQ A;  5JCW A;  4L0W A;  5A34 A;  2J23 A;  3HJP A;  1SU9 A;  4LL4 B;  3UJ1 A;  1SVO A;  2H1L A;  1KEB A;  4PUA A;  4XS4 B;  3EYT A;  1KTE A;  1U88 A;  1XWG A;  4LA1 A;  4MPG A;  4WBJ A;  5G2Z A;  2VAF A;  4MJC A;  4WET A;  2GDR A;  1TI1 A;  2WUL A;  3O3T A;  3GYK A;  2VD1 A;  3M1G A;  5D73 A;  4TVE A;  4HZ2 A;  4DEJ A;  5JCU A;  5DJM A;  3GX8 A;  1RQM A;  4POB A;  3F63 A;  3LQ7 A;  4I6X A;  2H01 A;  3UBK A;  1FAA A;  1Z7R A;  2HQT A;  2X8H A;  3NIV A;  3VK9 A;  4EIQ A;  1HNA A;  1FB0 A;  5A5K A;  1R4W A;  1T00 A;  1XVQ A;  2IWT A;  5DAL A;  2R0C A;  4GSN A;  4PUR A;  5A4V A;  3Q74 A;  1BX9 A;  3KH7 A;  5IO2 A;  1EV9 A;  4YH2 A;  2FWG A;  5GST A;  5IQY A;  4OFT A;  2YNX A;  4ML1 A;  4N3Z A;  3F0I A;  2LTK A;  1W4V A;  4TR4 A;  5GAN D;  4KCA A;  2B7K A;  4LMV A;  2MMA A;  1VF4 A;  3N9J A;  2O89 A;  2R0P A;  1XW5 A;  1U87 A;  22GS A;  3RPN A;  1GTU A;  1T7P B;  2IMD A;  4O5R A;  2I1U A;  3ZVJ A;  5A4U A;  1SJI A;  2YJ7 A;  4X43 A;  3KM6 A;  4AI6 A;  4I8B A;  4K6X A;  1A24 A;  3APS A;  4O5U A;  1V98 A;  4CW9 A;  3GUR A;  4TR3 A;  4K7I A;  3KGK A;  2UV8 G;  1FHE A;  1SVM A;  4ILF A;  2HNL A;  4XIH A;  2V41 A;  3E9J B;  3HMJ G;  5KN1 A;  2V2G A;  3C73 A;  4K9Z A;  1XZO A;  2V32 A;  3NOF A;  3HA9 A;  2PN8 A;  3ZTL A;  2B5E A;  3D5J A;  3KEB A;  1Z5Y E;  4K5R A;  5B7C A;  1N8J A;  2CVB A;  3CRU A;  1XOB A;  4J57 E;  1WE0 A;  3HZ8 A;  1TXU A;  1SKW B;  3GTU B;  5DAK A;  3CSH A;  5IMC A;  3TJK A;  5ECP B;  1M99 A;  2N5B A;  4K8M A;  3BCI A;  4XS6 A;  5F8B A;  18GS A;  4KF9 A;  3TUE A;  3P2A A;  2H70 A;  2GLR A;  2GQL A;  1PRX A;  1F3B A;  2VLV A;  1GLP A;  1FOH A;  3O76 A;  3FHK A;  3EPT A;  2PWJ A;  5KN3 A;  5ECQ B;  4FIW A;  2EFD A;  2F8A A;  1XCC A;  4TR1 B;  3FY7 A;  4X0X A;  2XPD A;  5KOX A;  3IOS A;  2CVK A;  3DWV A;  2IFQ A;  3IBH A;  4EL1 A;  3HYP A;  5CRG A;  4FQU A;  1HD2 A;  2CQ9 A;  3PIN A;  2K8V A;  1UN2 A;  3BOA A;  4XS1 A;  3C1R A;  4MF7 A;  1BG1 A;  4BWS A;  4HQS A;  3WYW A;  1OKD A;  1AIU A;  1DE2 A;  4WXT A;  4N30 A;  4ZIJ A;  4ZIL A;  1PX7 A;  4POK A;  1ILO A;  3F8U A;  5HQP A;  2JL4 A;  4I2T A;  4IBP A;  1TJD A;  1OE7 A;  1F2E A;  3CSJ A;  3LYP A;  1BED A;  4KDY A;  4NAX A;  2N5F A;  2JU5 A;  3ERF A;  3CMI A;  2C1Y A;  1AQX A;  4MDC A;  5CAX A;  3IR4 A;  1LBK A;  1B4Q A;  4DSR A;  4A5P A;  19GS A;  2H0G A;  4USS A;  2FD3 A;  4BA7 A;  4HEA 2;  5DQY A;  1W89 A;  2DKI A;  1Q98 A;  2XPE A;  1NHO A;  1B4P A;  3R3E A;  2LST A;  3VPT A;  6GSY A;  1MD4 A;  4TXV A;  4JZQ A;  1ACV A;  4OFN A;  4WBR D;  3D22 A;  4Z2T A;  3IV4 A;  2OE1 A;  1ZYE A;  3G7I A;  2LUS A;  3DEX A;  5DQS A;  1M7T A;  1M9B A;  3HJM A;  6GSS A;  1A2L A;  5ECM B;  1X9W B;  2PPT A;  2AHE A;  2DML A;  4EKZ A;  1O81 A;  4EUY A;  4XS4 A;  4QMK A;  3IXR A;  5COH A;  3SBC A;  3G9B A;  1XBS A;  2HSN A;  2HRK B;  2O87 A;  5ABR A;  3GA4 A;  2G2Q A;  1A0R P;  1Z3E A;  3F3R A;  2GTU A;  2X8G A;  4PNF A;  1EGR A;  4L8E A;  2B5Y A;  1TKD B;  4G0I A;  4DVC A;  3GH6 A;  1LU4 A;  3HKR A;  1M2D A;  4F0C A;  2R0G A;  5INY A;  2NPB A;  1V40 A;  3ME8 A;  3FW2 A;  1URM A;  2DIY A;  2HRF A;  2EFH A;  1BJX A;  2H1G A;  2CZ2 A;  2FWE A;  1Q4J A;  3H93 A;  1OYJ A;  1GP1 A;  2FNO A;  5J4U A;  3Q19 A;  3HDC A;  3TRP A;  5J5N A;  3DD3 A;  2E0Q A;  1ZL9 A;  2E7P A;  1S3A A;  2XBQ A;  4TOP A;  1GUH A;  1VF1 A;  5GZZ B;  3P90 A;  3A3T A;  3FRC A;  5BMU B;  2A4H A;  4ZB7 A;  1N25 A;  1QFN A;  1HNC A;  4KSO A;  1PX6 A;  1B9Y C;  4OO4 A;  4PQ1 A;  1R7H A;  4AGS A;  1TI3 A;  5IO0 A;  1ERU A;  2CX4 A;  5E4W A;  4PTS A;  1USB A;  2X64 A;  2E2G A;  3DXB A;  2PGT A;  4K0G A;  4BWQ A;  3W6G A;  1PD2 1;  5J4V A;  2D2Z A;  2DC5 A;  4AF2 A;  4HOJ A;  1S3C A;  1MDK A;  2LRT A;  3GKM A;  1HQO A;  4IW9 A;  5A4W A;  3D6I A;  5G1L A;  4E8E A;  4MJA A;  2CAI A;  2L6C A;  5J3R A;  2R6K A;  4KX4 A;  5ELG A;  1Y25 A;  5KEJ A;  1TDI A;  1U3I A;  1M2A A;  1AC1 A;  3TKS A;  1K0A A;  2C4J A;  1ML6 A;  2LNS A;  2QSI A;  1V2A A;  4V1A g;  2IL3 A;  4GTU A;  3ED3 A;  4WF4 A;  3UAR A;  4XCS A;  5A1N B;  3M9J A;  4MF6 A;  5F0G A;  4KDX A;  1E6B A;  4AKH A;  3FZ5 A;  2A2R A;  1MDJ A;  4N11 A;  1QXH A;  1A0F A;  3D4T A;  3KP8 A;  1XW6 A;  1MD3 A;  1OVN A;  2PMT A;  4OFM A;  2VIM A;  2FGX A;  3HVV A;  2I9H A;  1SK1 A;  4GF0 A;  5CRE A;  1G7E A;  3D0Z A;  5KOW A;  1TTZ A;  4EIP A;  2VL9 A;  3A5W A;  5D9W A;  3FR3 A;  4ECJ A;  2WJU A;  3UVH A;  1QMV A;  1G6W A;  3GX0 A;  2C0D A;  3DKS A;  5F07 A;  3G7J A;  3BBY A;  3FZ4 A;  2WDU A;  2K18 A;  4BVX B;  2NTO A;  3GKK A;  2FUG 2;  3DRN A;  4FYU A;  3SWL A;  1THO A;  1GNW A;  3GMF A;  5CYY A;  3UBL A;  3F6D A;  1KBN A;  3EMX A;  5D9T A;  2IMF A;  1ZYQ B;  2YOI A;  2PVQ A;  2I81 A;  3WT2 A;  1YEP A;  2IJY A;  5LD0 A;  4WF5 A;  3KZQ A;  1DE1 A;  4IKH A;  3VLN A;  2C0F A;  1SK2 A;  2RM6 A;  4ICY A;  1H4O A;  1YDK A;  3VWW A;  1SYR A;  3FZA A;  3QMX A;  2PU9 C;  4KW6 A;  3LEF A;  2H75 A;  2H1B A;  4O5Q A;  3HVX A;  2VCZ A;  3TRX A;  2KUC A;  2YWN A;  4G0K A;  3N5O A;  1TOF A;  5JWQ B;  4OO5 A;  2DBC A;  4P3Y B;  3BCK A;  5IIZ A;  4FH8 A;  4DSS B;  4TXO B;  3A2X A;  5GSS A;  2R2J A;  3MDK A;  1GSU A;  4MZW A;  4N10 A;  5CNW A;  1K3Y A;  1OC9 B;  3BD2 A;  3LW9 A;  1R26 A;  13GS A;  2WFC A;  2OJL A;  3TKP A;  3GH9 A;  4GLT A;  2A2P A;  4ML6 A;  2OE0 A;  3TJF A;  4F9Z A;  4O92 A;  2WRT A;  1AW9 A;  1TW9 A;  2O5V A;  1CQG A;  5D8I A;  2WS2 A;  2YN1 A;  4G2E A;  2JAC A;  5IMD A;  4RQX A;  1X9M B;  5G5F A;  2GT5 A;  5IM9 A;  5ENU A;  5LNK e;  1T8E B;  3JCM L;  4GRF A;  4EO3 A;  1AQW A;  1J0F A;  1NW2 A;  5DBQ A;  2HRN A;  1GTB A;  3IK7 A;  3TOT A;  1EOH A;  4Z2R A;  2CA8 A;  3KMN A;  3OR5 A;  5JCG A;  3ZMK A;  2HYX A;  3IPZ A;  3ERW A;  5DDL A;  4YKF A;  3LGC A;  1THX A;  5CRH A;  6GSW A;  4KGI A;  4HJ2 A;  2VCX A;  1A2M A;  2HZF A;  1IYI A;  2VL3 A;  1N2A A;  2F8F A;  2B5X A;  2HRK A;  2HSH A;  3GL3 A;  3EC3 A;  4G10 A;  1T1V A;  1Z6M A;  4YQM A;  1A23 A;  4D73 B;  3HZ4 A;  4V2L A;  4KUN A;  3VFI A;  5CRW A;  2J9H A;  2KHP A;  5HFI A;  2R4V A;  4MJE A;  1FW1 A;  4LMW A;  1B8X A;  3IDV A;  1SYX A;  2NVL A;  3QAG A;  2HZE A;  1Z6N A;  4MNN A;  5H5Q A;  1GTA A;  4HS1 A;  2OE3 A;  3IE3 A;  2E2M A;  1SVL A;  1K0C A;  2C0E A;  1YF0 A;  3GN3 A;  5ECI B;  2DJJ A;  2VLU A;  3I69 A;  3C7M A;  4CHS A;  5HFK A;  5BMU A;  2Z9S A;  2C80 A;  1EEJ A;  4HU9 A;  2AAW A;  1SEN A;  1TRU A;  11GS A;  2C3Q A;  2JAD A;  4QL7 A;  2O85 A;  5B6N A;  1SJZ A;  2L57 A;  5HR2 A;  1QGV A;  4O32 A;  4MH3 A;  2X8C A;  3TJJ A;  3LXZ A;  4ZBB A;  1IYH A;  4NHZ A;  4KCE A;  4KND A;  1FG4 A;  4PGT A;  3K8N A;  4G0L A;  3LOR A;  4BPY A;  2DLX A;  4Q5F A;  1ZZY A;  5HR0 A;  2VM1 A;  3ZFB A;  2R3X A;  2AB6 A;  4MAB A;  1PSQ A;  2RLI A;  1EGO A;  5J4Y A;  3FR9 A;  3QFB C;  1TRV A;  2XC2 A;  1XXU A;  1BAY A;  5A5H A;  3TGZ A;  3C1S A;  3NZN A;  3APQ A;  2FWH A;  4EC0 A;  5C00 A;  3LYK A;  3Q18 A;  1F9M A;  2KOK A;  4IVF A;  5J9B A;  9GSS A;  1XFL A;  2A4V A;  2WGR A;  1AUC A;  1V9W A;  2CX3 A;  2H6Z A;  1O73 A;  4K7N A;  4CDO A;  1UC7 A;  1FVJ A;  3ME7 A;  1GSS A;  5ECR B;  3CRT A;  2X4A A;  2OA7 A;  1F37 A;  2JSY A;  1T3B A;  4IHU A;  1QUW A;  3QAV A;  5D96 A;  5KN2 A;  3M3M A;  1I5G A;  2RII A;  1GTI A;  2WB9 A;  3VPQ A;  1VGL A;  2NBS A;  4MCU A;  3F3Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...