5EVOA

Structure of dehydroascrobate reductase from pennisetum americanum in complex with two non-native ligands, acetate in the g-site and glycerol in the h-site
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
213
structure length
213
Chain Sequence
HMAVEVCVKAAVGAPDILGDCPFSQRVLLTLEEKKITYEMKLVDLSNKPEWFLKISPEGKVPVFNSGDGKWIADSDVITQVIEEKFPTPSLVTPPEYASVGSKIFPSFVKFLKSKDASDGSEKALLDELQALDEHLKAHGPYISGENVSAADLSLGPKLFHLQVALEHFKGWKIPENLTSVHAYTKALFSRESFVKTKPANQYLIAGWAPKVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Non-native ligands define the active site of Pennisetum glaucum (L.) R. Br dehydroascorbate reductase.
pubmed doi rcsb
source organism Cenchrus americanus
molecule tags Oxidoreductase
molecule keywords Dehydroascorbate reductase
total genus 67
structure length 213
sequence length 213
ec nomenclature ec 1.8.5.1: Glutathione dehydrogenase (ascorbate).
pdb deposition date 2015-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5evoA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5evoA01
4PX1A 1OKDA 3P7XA 2CZ3A 1T4YA 3DKSA 5DJLA 1YEPA 3VWWA 5DBQA 3F9UA 4WF5A 1MDKA 1T3BA 2FUG2 2VLVA 4OD7A 4HZ4A 1GRXA 3HD5A 5ECKB 5IO0A 4QQ7A 4EL1A 4JRRA 5GSTA 1YF1A 2H71A 4IN0A 3TJJA 1XOBA 2G0FA 1X9SB 4F82A 5H5SA 1PN9A 1PRXA 1XCCA 5HR3A 3H8QA 2PVOC 2HT9A 2VAFA 1GL8A 3FEUA 2X8CA 1SD9A 1SJZA 2H1DA 4RQRA 2GZPA 1EOHA 1BEDA 3APOA 4DSQA 1Y6EA 3TRPA 2VOCA 3MWHA 2AYTA 1U3AA 1EV4A 3F0IA 1NHOA 1R5PA 2YNXA 2AB6A 5A4WA 4XS4B 1GSYA 2IWTA 3M1GA 4NXIA 3E9JB 1KTEA 4X43A 3KM6A 4DSSA 4LLRA 1F2EA 2DMMA 4ECCA 3LEFA 3EC3A 1JLVA 2K8SA 2L5LA 5E59A 4XS1A 3CXGA 5C00A 2EIRA 3FZ9A 4JR6A 1XWCA 4YAVA 4YH2A 2H01A 3ZMKA 1T4ZA 2IMIA 3LSZA 2IMDA 4K8MA 2DJKA 4KB3A 1B9YC 4HUAA 3D4MA 3GFKA 3US3A 4JU5A 1DE2A 3GKKA 4F03A 1WIKA 3UOMA 1ZOFA 2HRFA 3GMFA 1H75A 5ENUA 4X1UA 4DSRA 3EWLA 1SYXA 2AHEA 1YDKA 1TJDA 5EVOA 3ZLPA 5G30A 2OE0A 2WB9A 2X8GA 2HZFA 4EKZA 5KN3A 3VFIA 4ECJA 2B3SA 4POMA 3DRNA 1EEJA 2R2JA 3PPUA 1Z6NA 5G31A 1GSDA 4JEDA 3DVWA 2GGTA 4WR4A 2FA4A 3IHQA 3WGXA 2KUCA 2K18A 7GSSA 5IPHA 4MJBA 1GTUA 3HJOA 3S9FA 2E0QA 1ILOA 2JSZA 4OCEA 2HZEB 3LXTA 3HHVA 1JHBA 2N5BA 2RIIA 3GNJA 5D96A 1FOVA 2MMZA 4NV2A 2H6YA 2PVQA 1UC7A 2HFDA 4KDUA 5IMVA 1MTCA 2LV3A 2CAIA 1EV9A 2C0DA 5J9BA 1XW6A 4F0CA 2YWOA 2QSIA 3RPPA 4Q5QA 4LA1A 2DLXA 4FIWA 4GXZA 3KIJA 3DIEA 1SKRB 4ISDA 3LG6A 3ME8A 2KLXA 4KA0A 5B7CA 4OO4A 2E2GA 4PGTA 3KP9A 1XVWA 2N5FA 3R3EA 2OE3A 2QKEA 1KBNA 2A4VA 1DSBA 4NHZA 4MLYA 2GQMA 5IMAA 1GP1A 3PH9A 1F3BA 3TOTA 2H8LA 2HRAA 3QFAC 1B8XA 1AUCA 3KTLA 1Z5YE 5DAKB 2OBKA 1DBYA 4MCUA 3H1NA 4TXOA 1Z3EA 5D8IA 1LBKA 1W4VA 3GL5A 2L57A 2GDRA 1OC8A 3TKPA 3IOSA 2GT5A 2ZNMA 3ZRDA 1OE8A 1HNBA 1K0OA 4GLTA 3A3TA 2OACA 5HFKA 2PPTA 4EUYA 2AAWA 5ELGA 5HFIA 3TGZA 5A5KA 1A8LA 4WEYA 1R4WA 3F4RA 3GH6A 1OE7A 3ISOA 1G6WA 3F4TA 3HA9A 4NAXA 2NBSA 4N0VA 1FB0A 1A0FA 2O7KA 2HI7A 1TI1A 5H5RA 4XS6A 5IPGA 1A23A 1AQVA 1V9WA 2QGVA 3EURA 2OA7A 1FO5A 1OYJA 2YV7A 5JCWA 2P5RA 3TKRA 1EEMA 4WBJA 3N9JA 2DJ0A 2JU5A 3FK8A 5KN0A 3QPMA 3UL3A 1ZZYA 3M3MA 3ZIJA 2LQQA 1O8WA 1Y25A 2K8VA 1I5GA 3BD2A 5F07A 5CP1A 5LD0A 4JR4A 2R5GA 4KE3A 2CVDA 4TRXA 4CW9A 2C3NA 2HLSA 1TRUA 2H1BA 4L0WA 3TJBA 4TKYA 2GS3A 4IKHA 5J9CA 2H0HA 2HSNB 1O7UA 4IVFA 3HVXA 2F51A 1ZYQB 3CMIA 4G2EA 4MZWA 3HZ4A 4L5LA 5EY6A 3F3RA 4MDCA 3VPTA 4BL7A 2F3MA 4XRAA 2X8HA 3HYPA 4GSTA 2PGTA 2X99A 4NMUA 3NOFA 4ZB8A 3FR9A 1TTZA 2JSYA 2M46A 4J2FA 3MSZA 1G7EA 2LEGA 1JZWA 2V2GA 2GQLA 2G2QA 1GTAA 3DWVA 4FYBA 4HS1A 3LQ7A 2I1UA 1TK0B 5DCHA 20GSA 5CRGA 3M0FA 1AXDA 4MPGA 3UJ1A 3TKSE 2C3TA 2ES7A 4MP4A 4IS0A 4ZL8A 2KHPA 4ZL9A 4KAEA 2B7JA 2IFQB 4J57E 4ZB9A 4TXVA 2CV4A 3ERWA 4N30A 3L0HA 5AISA 4OWYA 3VWXA 2RUEA 2L59A 3RDWA 3WT2A 4QL9A 1U3IA 2GLRA 1Q4JA 4G0KA 6GSYA 5CAXA 2BTOT 3HVSA 3FZ5A 3GYKA 2EIOA 3ERFA 3TJKA 4EDZA 3Q19A 1MD4A 2PWJA 2YWIA 5D93A 4E8HA 5IM9A 1VF4A 4KDXA 1SL1B 3IBHA 4GWRA 1XWGA 4BA7A 2VLTA 1XBSA 2LRNA 1HYUA 5IMCA 4PQHA 2L4CA 3BBYA 2LKUA 3H93A 2L6DA 2VD0A 1M2AA 4K0GA 3FZ4A 1URMA 1GTBA 3A2VA 2HSHA 2PU9C 5G5EA 1TOFA 2YJ7A 2C0FA 1X9MB 2FLSA 2IMEA 2GZZA 3DYRA 4Q5RA 5C04A 1RW1A 1ZGNA 2TRXA 3GN3A 3HJPA 2D2ZA 3GSTA 4L5OA 6GSSA 2FWGA 1VF2A 3LGCA 3J7Yb 1TRSA 3DXBA 3E3EA 10GSA 3L9VA 3G7IA 3EU3A 1KEBA 4LMVA 2H19A 1K0BA 3UEMA 2YP6A 5KN1A 4DEJA 3VWUA 2VIMA 2IL3A 5ECMB 4ECBA 1GUHA 3AY8A 1IYHA 3F4SA 3TOUA 2H75A 2C0EA 3D22A 3PR8A 3CSHA 3KMNA 3ZFLA 3KEBA 3KCMA 5ECSA 4EC0A 4MJAA 2E7PA 3KD0A 3M9KA 3TB2A 1PQNA 5CREA 1TW9A 5D73A 5GZZB 3TKSC 3JCML 2WS2A 2R6KA 3CRUA 1UA5A 1XWBA 2LTKA 4ZBBA 4BL7B 2VLUA 3GA4A 5D9VA 2PUKC 2EC4A 2FWFA 1ST9A 2PN8A 4V1Ap 4YAPA 2LSTA 3HDCA 1ZYEA 3VI5A 2B1LA 3LXZA 3KTBA 1ML6A 3J7Yk 4JBBA 2OADA 1MDIA 1MEKA 5D9WA 4G19A 3ZFBA 1VF1A 4KUNA 1YF0A 1O6JA 1TK5B 3IC4A 4TW5A 4POBA 2C0GA 3VLNA 2M72A 1K0NA 3DD3A 1PL1A 2OJLA 4RI6A 14GSA 3HVVA 3MDKA 3FR3A 2GQKA 4IJIA 4OO5A 5F0GA 2FHEA 1OVNA 4DSSB 4O92A 4PUAA 1TRVA 3C73A 3WT1A 2JZTA 3UVTA 3E0UA 1XW5A 3P8WA 1TU8A 2H76A 5ECOB 1T1VA 4GSSA 2LUSA 3VWVA 3VK9A 3GHAA 1U88A 4WR5A 4ILFA 5B8BA 3NZNA 4PQ1A 2BJXA 3A5WA 1SU9A 5G1LA 4IJ3A 3DGQA 3D0ZA 1PMTA 3HXSA 3C1RA 2VCZA 4D73B 2HSMB 3QD9A 5ECIB 2KOKA 3KXOA 4JZQA 2DIYA 1T8EB 2DJ1A 4EDYA 3L9SA 1B4PA 1THXA 2HZEA 2IN3A 2LJRA 2VCTA 3G9BA 4AJ7A 1W89A 4QL7A 1YKCA 4CHSA 1BAYA 2RLIA 4MJEA 1EGOA 4V2LA 3A2WA 5DQSA 5JWOB 4ZL7A 1JZRA 3TRQA 1AQXA 4TXOB 3EYTA 1GTIA 1EZKA 2YOIA 4FYUA 2H6XA 1V2AA 3QAVA 1OAZA 5CRWA 3GSSA 2H0IA 4V2MA 1F6MC 1X0RA 2WZ9A 3L4NA 2YWMA 4G0LA 5CO3A 1M7TA 3I9V2 4O5RA 5KEJA 4TR3A 4K7OA 2H66A 1JLWA 4HZ2A 5IMFA 3IAS2 3IE3A 1XWKA 3EE2A 1M2BA 1SYRA 4KCEA 5CYYA 4AJ6A 3BCIA 4HQZA 4TR4A 1TKDB 3KMOA 2B5XA 3QMXA 1TDIA 3ZMLA 2PMTA 3APQA 2MZCA 4HDEA 5JCGA 3CTGA 1J9BA 1SKWB 2AV4A 5F05A 4AGSA 5L71A 1WRYA 2RUFA 2IJYA 2O8VB 2P0GA 3PGTA 3OR5A 1QUWA 5DAKA 1R7HA 3P2AA 4IQ1A 1JZOA 1USBA 1O81A 1V98A 2RM6A 5B6NA 4K6XA 3V1WA 3TUEA 5CNWA 2IIYA 2CX4A 4MA9A 3GV1A 2FD3A 4FYCA 3ZL5A 4D73A 5GAPD 4RI7A 5GAND 5DDLA 1PGTA 4I5QA 4ZILA 4ULXA 4WXTA 4IQAA 1X5CA 3U6VA 2K9FA 2VCWA 2CVBA 2FA8A 1PKZA 4ML1A 1GLPA 3EU4A 2DJ2A 5LCZA 4NWYA 2PBJA 4GRFA 1KNGA 3KP8A 1DUGA 3FYGA 3IC8A 5HFGA 6GSVA 2O85A 1HNAA 4IW9A 2UZ8A 2ZUPA 4BVYB 2XPDA 4IP6A 2TRCP 4GQCA 4F0BA 1J08A 2P5QA 4F2IA 4L0UA 3TKQA 1RQMA 4P3YB 4I2TA 2V6KA 3EVIA 5JCUA 1BJXA 2JZSA 2NDOA 5DCGA 1ZCPA 3TJGA 4K2DA 2GVPA 1LJRA 3QR6A 1FVKA 2HSYA 5DJMA 1XWAA 1QK8A 2C8UA 2L5OA 4KNDA 3KGKA 1A0RP 4IGJA 2VL2C 3LJRA 4I8BA 3APSA 2B5YA 4TR1B 5JWRB 1A2LA 4MF6A 4XS4A 4ZBAA 2J9HA 1C72A 3I6AA 5G2ZA 5FT3A 4HJ2A 4OFNA 5ECHB 4FH8A 4KCAA 2ON7A 1SK0A 3L9UA 4I6XA 2V32A 3DMLA 4ID0A 2MMNA 2F8FA 1GSFA 1SL0B 1XW9A 4PNFA 4NPBA 4EF0A 1Q98A 2YCDA 2YZHA 2VCVA 4N11A 2HNLA 3GL3A 5IIZA 2VO4A 2FNOA 2VL3A 2LS5A 3KJYA 2HRKB 4GCIA 1B4QA 2R4VA 4ZIJA 2FCHA 5HR2A 1RK4A 6GSXA 2OE1A 4HJMA 2B7KA 1OC3A 3EMXA 1GNWA 1VGLA 2HSMA 4EO3A 2R37A 3GRXA 1S3CA 1A24A 2GSQA 1VRSD 4K1FA 3VPQA 2IPAA 1ON4A 1ACVA 1ZL9A 1TP9A 4FQUA 1BYEA 2VM1A 4POKA 2FGXA 2V6OA 2ALBA 1GNEA 1X5DA 1SK1A 2LNTA 3KH9A 2CX3A 3RAZA 3D5JA 3K8NA 6GSWA 5CRHA 3GURA 3TDGA 16GSA 3H79A 4OCFA 1FHEA 1G7OA 4KX4A 3ZREA 3ZYWA 2NTOA 4HQSA 5DQYA 2CZ2A 2XHFA 3R2QA 1XZOA 5B8AA 5IOWA 5ID2B 5KN2A 1NW2A 1SK2A 2L6CA 4KSMA 3TKSA 1K3YA 5IO2A 4POLA 3I69A 2LNSA 2R3XA 1HNCA 2LJAA 2MBSA 4XTSA 4PNGA 4EE0A 1J0FA 4MK3A 2H30A 4G0IA 3CYNA 5EL8A 4K7NA 1MD3A 1WPIA 1TI3A 2QC7A 1YZXA 1SENA 2XBIA 3KZQA 4TR1A 3EMPA 5ECPB 3Q74A 1K0AA 1AW9A 3IAM2 2GT6A 2WRTA 4I97A 4GSNA 3CSIA 4H86A 3CTFA 1XOAA 1THOA 4LL4B 4G9HA 2IMFA 4WKWA 3W8JA 1XIYA 5INYA 4XIHA 4JE1A 2AUVA 4PURA 4PXOA 3MNGA 5CRDA 1GSSA 1QFNA 1OKTA 2FWEA 1Z6MA 5IQYA 4I2UA 1AC1A 3ED3A 2DJ3A 3WYWA 3QDNA 3C7MA 4MF5A 4V1Ag 3DEXA 2LRTA 11GSA 1XXUA 2LQOA 4ZBDA 1NSWA 4LMWA 2MMAA 4EXJA 2L4QA 4GQFA 3QAWA 1FW1A 2HQTA 3HZ8A 1WJKA 3ZZXA 1M9BA 3WD6A 1WMJA 5AIXA 3KH7A 1K0CA 4K7IA 5IOXA 5DALA 2VL2A 2NVLA 2K6VA 2C3QA 2PERA 4KDYA 1A8YA 4V2NA 1O8XA 1YEXA 2AJQB 4HEA2 4BWQA 1WOUA 1BQ7A 4KGIA 1ABAA 3H4KA 2VM2A 3M9JA 1ZMAA 2LJKA 3O3TA 3LWAA 3Q18A 5IMDA 2H0GA 1UVZA 1N2AA 3HJMA 3FKFA 1GUKA 1AIUA 2YWNA 2A2RA 5AIVA 4Z7XA 1NHYA 3UAPA 1M2DA 3W6GA 2VD1A 4MPFA 1I9DA 3BCKA 3C71A 1ERTA 1Z7RA 18GSA 1PL2A 1PX6A 3F6DA 4HU7A 4MH2A 4IELA 3ZVJA 2FY6A 1F9MA 1YQ1A 3F3QA 2TIRA 3O6TA 1TK8B 5A4UA 4ECIA 2M80A 1SL2B 1SD8A 3F63A 2KP1A 4J56E 1M0UA 1B9XC 4OMVA 3LYPA 1FG4A 2GTUA 3FRCA 4ZB6A 1WP0A 4YQUA 3QFBC 5J3RA 1F3AA 1GSUA 4K0NA 4L8EA 3UMAA 1G0TA 2F9SA 2VL9A 1EGRA 2JADA 4O7HA 1O73A 1PA3A 1V57A 2KP2A 4GTUA 4AJ8A 4GF0A 2EIQA 2MYGA 2XBQA 3HKRA 4PTSA 3BOAA 2CAQA 4CDOA 5J41A 3TJFA 1SJ6A 4K9ZA 4WETA 1G6YA 5ECQB 2CA8A 3LFLA 2CVKA 3FY7A 1HD2A 2JZRA 1QQ2A 1Z9HA 1E6BA 2CQ9A 3RHCA 2MMOA 3L78A 4MABA 2HYXA 1SJIA 1UN2A 2DIZA 4NHWA 1XFLA 2I3YA 4IHUA 3G7YA 4USSA 2C1YA 1QGVA 2DSAA 3IR4A 1K0MA 1M9AA 3D4TA 3C8EA 2HE3A 5H5QA 4HI7A 5D9XA 1PSQA 1GSQA 3NIVA 5LNKe 3MAKA 1OC9A 2I81A 1FVJA 1IYIA 2IMKA 1EWXA 3W8SA 1ERWA 4MZBA 2X64A 2CT6A 3GTUB 2WDUA 4FO5A 3HCZA 2B5EA 4WBRD 4O32A 3UARA 2JACA 5HQPA 3P90A 3PINA 3G7JA 2J23A 1R5AA 2H72A 2JL4A 1YKAA 4AF2A 2I4AA 1U87A 5ECRB 3EINA 4F9ZA 5ECLB 3F8UA 4BVYA 4G10A 1XPVA 4Q5NA 3RBTA 5F8BA 1GWCA 1ERUA 1H4OA 2IFQA 3CSJA 4TOPA 2DC5A 2H73A 5FWGA 3TCOA 2XPEA 1EOGA 1S3AA 1PX7A 4ZXGA 4PUFC 2C80A 2VCQA 2VCXA 5ID2A 1T00A 4OFMA 4DVCA 1K0DA 1B48A 22GSA 3GKXA 3HY2A 2LRCA 2ON5A 3VI7A 2H1GA 3VURA 4YQMA 5IMZA 1K3OA 1V40A 4KF9A 3GKMA 3GUSA 2H1AA 1EP7A 1JFUA 4NV5A 2YZUA 6GSUA 1SKSB 3FR6A 6GSTA 1VF3A 2HRKA 2B6MA 3D21A 4MH3A 3ZVJD 5DALB 4IP1A 4TN8A 3GKNA 4PQIA 5FHIA 1U6TA 2DJJA 4BPYA 4MF7A 2N5AA 3GH9A 1E2YA 1FAAA 1PKWA 4MZCA 2Z9SA 2GSSA 4RUVA 1AAZA 2XC2A 3FHKA 3SBCA 1N8JA 3DVXA 3WGEA 3RHBA 4TR0A 2B1KA 3D6IA 5HR0A 4HU9A 4RQXA 4BVXA 3FZAA 4XHMA 2REMA 3IV4A 1M99A 2E2MA 5DVBA 4OFTA 4HOJA 1GH2A 2DBCA 2ZCTA 2OBIA 2F8AA 2RM5A 3IK9A 3CBUA 3UBLA 3IRAA 3C1SA 1Z7PA 3I43A 2WJUA 3SWLA 9GSSA 2GSTA 3ME7A 2H74A 3IXRA 2NPBA 2C4JA 3ZITA 5A4VA 3GIXA 1BG5A 5GSSA 4KW6A 3IA1A 5E4WA 1A2JA 1MDJA 1WE0A 2HRNA 3QAGA 4ACSA 2FWHA 1YJ6A 2O89A 2V41A 4BVXB 2VUPA 1CQHA 1S3DA 4IBPA 5AGYA 5ABRA 4Q5FA 5EPFA 1PD21 5G1KA 2OKAA 1X9WB 2YPMA 5ECNB 2WGRA 4LL1B 1QXHA 2YV9A 4XCSA 1WWJA 3QCPA 3IK7A 3GX0A 8GSSA 1GULA 1GUMA 2YJHA 1HQOA 1AQWA 3UIWA 3F6FA 1CQGA 3GTUA 3RPNA 3BJ5A 1TRWA 4N10A 17GSA 2GSRA 3ZTLA 3IDVA 1OC9B 2A2SA 2HXKA 2P31A 5F06A 1TU7A 3Q6OA 5HR1A 19GSA 5J4UA 1JZDA 12GSA 3O76A 1GLQA 4N0ZA 4X0XA 4XRDA 4TVEA 4KH7A 4WF4A 2MBTA 3LORA 1ERVA 2WFCA 4KSOA 2I9HA 4E8EA 1QMVA 2YN1A 3CRTA 5ELAA 1BX9A 2YANA 1NM3A 3TRXA 3N5OA 4MJCA 4BWSA 1EP8A 3ZIVA 1XVQA 1A2MA 1TXXA 3FW2A 2BMXA 2WULA 4EVMA 3M8NA 4YQVA 1K3LA 1GSEA 5D9TA 5B6MA 3UBKA 2DMLA 1X5EA 5COHA 2H70A 2GZYA 1FB6A 1LU4A 5G5FA 1F37A 3A2XA 4ML6A 2V1MA 4MMMA 3LYKA 1YY7A 1O85A 13GSA 3IPZA 2H6ZA 3GX8A 3WGDA 2O87A 5J5NA 5JWQB 3UVHA 5AN1A 5BMUA 2WCIA 1DE1A 1V58A 1R26A 3ERGA 3QOUA 1T7PB 3U5RE
chains in the Genus database with same CATH superfamily
4PX1A 1OKDA 3P7XA 4O5UA 2CZ3A 1YVLA 1T4YA 3DKSA 5DJLA 1YEPA 3VWWA 5DBQA 4E68A 3F9UA 4WF5A 1MDKA 1T3BA 2FUG2 2VLVA 4OD7A 4HZ4A 1GRXA 3HD5A 5ECKB 5IO0A 4QQ7A 4EL1A 4JRRA 5GSTA 1YF1A 2H71A 4IN0A 3TJJA 1XOBA 2G0FA 1X9SB 3A5IA 4F82A 5H5SA 1PN9A 3MIXA 1PRXA 1XCCA 1YEWC 5HR3A 3H8QA 2PVOC 2HT9A 2VAFA 1GL8A 3FEUA 2X8CA 1SD9A 1SJZA 2H1DA 4RQRA 2GZPA 1EOHA 1BEDA 3APOA 4DSQA 1Y6EA 3TRPA 2VOCA 3MWHA 2AYTA 1U3AA 2X4AA 1EV4A 3F0IA 1NHOA 1R5PA 2YNXA 2AB6A 5A4WA 4GDFA 4XS4B 1GSYA 2IWTA 1SVOA 3M1GA 4NXIA 3E9JB 1KTEA 4X43A 3KM6A 4DSSA 4LLRA 1F2EA 2DMMA 4ECCA 3LEFA 3EC3A 1JLVA 2K8SA 2L5LA 2EFCA 5E59A 4XS1A 3CXGA 5C00A 2EIRA 3FZ9A 4JR6A 1XWCA 4YAVA 4YH2A 2H01A 3ZMKA 1T4ZA 2IMIA 3LSZA 2IMDA 4K8MA 2DJKA 4KB3A 1B9YC 4HUAA 3D4MA 3GFKA 3US3A 4JU5A 1DE2A 3GKKA 2A2PA 4F03A 1WIKA 3UOMA 1ZOFA 2HRFA 3GMFA 1H75A 5ENUA 4X1UA 4DSRA 3EWLA 1SYXA 2AHEA 1YDKA 1TJDA 5EVOA 3ZLPA 5G30A 2OE0A 2WB9A 2X8GA 2HZFA 4EKZA 5KN3A 3VFIA 4ECJA 2EFDA 2B3SA 4POMA 3DRNA 1EEJA 2R2JA 3CWGA 3PPUA 1Z6NA 4Z2UA 5G31A 1GSDA 4JEDA 3DVWA 2GGTA 4WR4A 2FA4A 3IHQA 3WGXA 2KUCA 2K18A 7GSSA 5IPHA 2QA1A 1GTUA 4MJBA 3HJOA 3S9FA 2E0QA 1ILOA 2JSZA 4OCEA 2HZEB 3LXTA 3HHVA 1JHBA 2N5BA 2RIIA 3GNJA 5D96A 1FOVA 2MMZA 4NV2A 2H6YA 2PVQA 1UC7A 2HFDA 4KDUA 5IMVA 1MTCA 2LV3A 2CAIA 1EV9A 2C0DA 1XW6A 5J9BA 4F0CA 2YWOA 2QSIA 3RPPA 4Q5QA 4LA1A 2DLXA 4FIWA 4GXZA 3CQFA 3KIJA 3DIEA 1SKRB 4ISDA 3LG6A 3ME8A 2KLXA 4KA0A 5B7CA 4OO4A 2E2GA 4PGTA 3KP9A 1XVWA 2N5FA 3R3EA 2OE3A 2QKEA 1KBNA 2A4VA 1DSBA 4NHZA 4MLYA 2GQMA 5IMAA 1GP1A 2QA2A 3PH9A 1F3BA 4MNNA 3TOTA 2H8LA 2HRAA 3QFAC 1B8XA 1AUCA 3KTLA 1Z5YE 5DAKB 2OBKA 1DBYA 4MCUA 3H1NA 4TXOA 1Z3EA 5D8IA 1SVLA 1LBKA 1W4VA 3GL5A 2L57A 2GDRA 1OC8A 3TKPA 3IOSA 2GT5A 2ZNMA 3ZRDA 1OE8A 1HNBA 1K0OA 4GLTA 3A3TA 2OACA 5HFKA 2PPTA 4EUYA 2AAWA 4K2XA 5ELGA 5HFIA 3TGZA 5A5KA 1A8LA 4WEYA 1R4WA 3F4RA 3GH6A 1OE7A 3ISOA 1G6WA 3F4TA 3HA9A 4NAXA 2NBSA 4N0VA 1FB0A 4AKHA 1A0FA 2O7KA 2HI7A 1TI1A 5H5RA 4XS6A 5IPGA 1S4BP 1A23A 1AQVA 1V9WA 2QGVA 5J4VA 3EURA 2OA7A 1FO5A 1OYJA 2YV7A 5JCWA 2P5RA 3IHGA 3TKRA 1EEMA 4WBJA 3N9JA 5KOWA 2DJ0A 2JU5A 3FK8A 5KN0A 3QPMA 3UL3A 1ZZYA 3M3MA 3ZIJA 5A34A 2LQQA 1O8WA 1Y25A 2K8VA 1I5GA 3BD2A 5F07A 5CP1A 5LD0A 4JR4A 2R5GA 4KE3A 2CVDA 4TRXA 4CW9A 2C3NA 2HLSA 1I1IP 1TRUA 2H1BA 3TU3B 4L0WA 3TJBA 4TKYA 2GS3A 4IKHA 5J9CA 2H0HA 2HSNB 1O7UA 4IVFA 3HVXA 1PN0A 2F51A 1ZYQB 3CMIA 4G2EA 4MZWA 3HZ4A 4L5LA 5EY6A 3F3RA 4MDCA 3CHXC 3VPTA 4BL7A 2F3MA 2X8HA 4XRAA 4YKFA 3HYPA 4GSTA 2PGTA 2X99A 4NMUA 3NOFA 4ZB8A 1ZYNA 3FR9A 1TTZA 2R0CA 2JSYA 2M46A 4J2FA 4N3ZA 3MSZA 1G7EA 2LEGA 1JZWA 2V2GA 2GQLA 2G2QA 1GTAA 3DWVA 4FYBA 4HS1A 3LQ7A 2I1UA 1TK0B 5DCHA 4ICYA 20GSA 5A5HA 5CRGA 3M0FA 1AXDA 4MPGA 3UJ1A 3TKSE 2C3TA 2ES7A 4MP4A 4IS0A 4ZL8A 2KHPA 4ZL9A 4KAEA 2B7JA 2IFQB 4J57E 4ZB9A 4TXVA 2CV4A 3ERWA 4N30A 3L0HA 5AISA 4OWYA 3VWXA 2RUEA 2L59A 4Z2RA 3RDWA 3WT2A 4QL9A 1U3IA 2GLRA 1Q4JA 4G0KA 6GSYA 5CAXA 2BTOT 3HVSA 3FZ5A 3GYKA 3HMJG 2EIOA 3ERFA 3TJKA 4EDZA 3Q19A 1MD4A 2PWJA 2YWIA 5D93A 4E8HA 2DKHA 5IM9A 1VF4A 4KDXA 1SL1B 3IBHA 4GWRA 1XWGA 4BA7A 2VLTA 1XBSA 2LRNA 1HYUA 5IMCA 4PQHA 2L4CA 3BBYA 2LKUA 3H93A 2L6DA 2VD0A 1M2AA 4K0GA 3FZ4A 1URMA 1GTBA 3A2VA 2HSHA 2PU9C 5G5EA 1TOFA 2YJ7A 2C0FA 1X9MB 2FLSA 2IMEA 2GZZA 3DYRA 4Q5RA 5C04A 1RW1A 1ZGNA 2TRXA 3GN3A 3HJPA 2D2ZA 3GSTA 4L5OA 6GSSA 2WW1A 2FWGA 4AI6A 1VF2A 3LGCA 3J7Yb 1TRSA 3DXBA 3E3EA 10GSA 3L9VA 3G7IA 3EU3A 1KEBA 4LMVA 2H19A 1K0BA 3UEMA 2YP6A 5KN1A 4DEJA 3VWUA 2VIMA 2IL3A 5ECMB 4ECBA 1GUHA 3AY8A 1IYHA 3F4SA 3TOUA 2H75A 2C0EA 3D22A 3PR8A 2WVYA 3CSHA 3KMNA 3ZFLA 3KEBA 3KCMA 5ECSA 4EC0A 4MJAA 2E7PA 3KD0A 3M9KA 3TB2A 1PQNA 5CREA 1TW9A 5D73A 1XG8A 5GZZB 3TKSC 3JCML 2DKIA 2WS2A 4K5RA 2R6KA 3CRUA 1UA5A 1XWBA 2LTKA 4ZBBA 4BL7B 2VLUA 3GA4A 5D9VA 2PUKC 2EC4A 2FWFA 1ST9A 2PN8A 4V1Ap 4YAPA 2LSTA 3HDCA 1ZYEA 3VI5A 2B1LA 3LXZA 3KTBA 1ML6A 3J7Yk 4JBBA 2OADA 2HSNA 1MDIA 1MEKA 5D9WA 4G19A 3ZFBA 1VF1A 4KUNA 1YF0A 1O6JA 1TK5B 3IC4A 4TW5A 4POBA 2C0GA 3VLNA 2M72A 1K0NA 3DD3A 1PL1A 2OJLA 4RI6A 14GSA 3HVVA 4Z2TA 3MDKA 3FR3A 2GQKA 4IJIA 4OO5A 5F0GA 2FHEA 1OVNA 4DSSB 4O92A 4PUAA 1TRVA 3C73A 3WT1A 2JZTA 3UVTA 3E0UA 1XW5A 4O5QA 3P8WA 1TU8A 2H76A 5ECOB 1T1VA 4GSSA 2LUSA 3VWVA 3VK9A 3GHAA 1U88A 4WR5A 4ILFA 5B8BA 3NZNA 4PQ1A 2BJXA 3A5WA 1SU9A 5G1LA 4IJ3A 3DGQA 3D0ZA 1PMTA 3HXSA 3C1RA 2VCZA 4D73B 2HSMB 3QD9A 5ECIB 2KOKA 3KXOA 4JZQA 2DIYA 1T8EB 2DJ1A 4EDYA 3L9SA 1B4PA 1THXA 2HZEA 2IN3A 2LJRA 4AKIA 2VCTA 3G9BA 4AJ7A 1W89A 4QL7A 1YKCA 4CHSA 1BAYA 2RLIA 4MJEA 1EGOA 4V2LA 3A2WA 5DQSA 5JWOB 4ZL7A 1JZRA 3TRQA 1AQXA 4TXOB 3EYTA 1GTIA 1EZKA 2YOIA 4FYUA 2WVXA 2H6XA 1V2AA 3QAVA 1OAZA 5CRWA 3GSSA 2H0IA 4V2MA 1F6MC 1X0RA 2WZ9A 2A4HA 3L4NA 2YWMA 4G0LA 5CO3A 1M7TA 3I9V2 4O5RA 5KEJA 4TR3A 4K7OA 2H66A 1JLWA 4HZ2A 5IMFA 3IAS2 3IE3A 1XWKA 3EE2A 1M2BA 4HSCX 1SYRA 4KCEA 5CYYA 2R0PA 4AJ6A 3BCIA 1ZYPA 4HQZA 4TR4A 5J47A 1TKDB 3KMOA 2B5XA 3QMXA 1TDIA 3ZMLA 2PMTA 3APQA 2MZCA 4HDEA 5JCGA 3CTGA 1J9BA 1SKWB 2AV4A 4CY6A 4YKGA 5F05A 4AGSA 2WVXB 5L71A 2R0GA 5A5HB 2RUFA 1WRYA 2IJYA 2O8VB 2P0GA 3PGTA 3OR5A 3LW9A 1QUWA 5A34B 5DAKA 1PFOA 1R7HA 3P2AA 4IQ1A 2OT3A 1JZOA 1USBA 1O81A 1V98A 2RM6A 5B6NA 4K6XA 3V1WA 3TUEA 5CNWA 2IIYA 2CX4A 4MA9A 3GV1A 2FD3A 4FYCA 3ZL5A 4D73A 5GAPD 4RI7A 5GAND 5DDLA 1PGTA 4I5QA 4ZILA 4ULXA 4IQAA 4WXTA 4CY8A 1X5CA 3U6VA 2K9FA 5J40A 2VCWA 2CVBA 2FA8A 1PKZA 4ML1A 1GLPA 3EU4A 2DJ2A 5LCZA 4NWYA 2PBJA 4GRFA 1KNGA 3KP8A 1DUGA 3FYGA 3IC8A 5HFGA 2O36A 6GSVA 1M3IA 2O85A 1HNAA 4IW9A 2UZ8A 2ZUPA 4BVYB 2XPDA 4IP6A 2TRCP 4GQCA 4F0BA 1J08A 2P5QA 5A1NA 4F2IA 4L0UA 3TKQA 1RQMA 4P3YB 4I2TA 2V6KA 3EVIA 5JCUA 1BJXA 2JZSA 2NDOA 5DCGA 1ZCPA 3TJGA 4K2DA 2GVPA 1LJRA 3QR6A 1FVKA 2HSYA 5DJMA 1XWAA 1QK8A 2C8UA 2L5OA 4KNDA 3KGKA 1A0RP 4IGJA 2VL2C 3LJRA 4I8BA 3APSA 2B5YA 4TR1B 5JWRB 1A2LA 4MF6A 4XS4A 4ZBAA 2J9HA 1C72A 3I6AA 5G2ZA 5FT3A 4HJ2A 4OFNA 5ECHB 4FH8A 4KCAA 2ON7A 1SK0A 3L9UA 4I6XA 2V32A 3DMLA 4ID0A 2MMNA 2F8FA 1GSFA 1SVMA 1SL0B 1XW9A 4PNFA 4NPBA 4EF0A 1Q98A 2YCDA 2YZHA 2VCVA 4N11A 2HNLA 3GL3A 5IIZA 2VO4A 5A1NB 2FNOA 2VL3A 2LS5A 3KJYA 2HRKB 4GCIA 1B4QA 2R4VA 4ZIJA 2FCHA 5HR2A 1RK4A 6GSXA 2OE1A 4HJMA 2B7KA 1OC3A 3EMXA 1GNWA 5J4YA 1VGLA 2HSMA 4EO3A 2R37A 3GRXA 1S3CA 1A24A 4PI0C 2GSQA 1VRSD 4K1FA 3VPQA 2IPAA 1ON4A 1ACVA 1ZL9A 1TP9A 2EFHA 4FQUA 1BYEA 2VM1A 4POKA 4W66A 2FGXA 2V6OA 2ALBA 1GNEA 3RGBC 1X5DA 1SK1A 2LNTA 3KH9A 4PHZC 2CX3A 3RAZA 3D5JA 3K8NA 6GSWA 5CRHA 3GURA 3TDGA 16GSA 4X4JA 3H79A 1S3RA 4OCFA 1FHEA 1G7OA 4KX4A 3ZREA 3ZYWA 2NTOA 4HQSA 5DQYA 2CZ2A 2XHFA 1FOHA 3R2QA 2EFEA 1XZOA 5B8AA 5IOWA 5ID2B 5KN2A 1NW2A 1SK2A 2L6CA 4KSMA 3TKSA 1K3YA 5IO2A 4POLA 3I69A 2LNSA 2R3XA 1HNCA 2LJAA 2MBSA 4XTSA 4PNGA 4EE0A 1J0FA 4MK3A 2H30A 4G0IA 3CYNA 4K7NA 5EL8A 1MD3A 1WPIA 3EPTA 1TI3A 2QC7A 1YZXA 1SENA 2XBIA 3KZQA 4TR1A 3EMPA 5ECPB 3Q74A 1K0AA 1AW9A 3IAM2 2GT6A 2WRTA 4I97A 4GSNA 3CSIA 4H86A 3CTFA 1XOAA 1THOA 4LL4B 4G9HA 2IMFA 4WKWA 3W8JA 1XIYA 5INYA 4XIHA 4JE1A 2AUVA 4PURA 4PXOA 3MNGA 5CRDA 1GSSA 1QFNA 1OKTA 2FWEA 1Z6MA 5IQYA 4I2UA 1AC1A 3ED3A 2DJ3A 3WYWA 3QDNA 3C7MA 4MF5A 4V1Ag 3DEXA 2LRTA 11GSA 1XXUA 2LQOA 4ZBDA 1NSWA 4LMWA 2MMAA 4EXJA 1TXUA 2L4QA 3HVNA 4GQFA 3QAWA 1FW1A 2HQTA 3HZ8A 1WJKA 2O5VA 3ZZXA 1M9BA 3WD6A 1WMJA 5AIXA 3KH7A 1K0CA 4K7IA 5IOXA 5DALA 2VL2A 2NVLA 2K6VA 2C3QA 2PERA 4KDYA 1A8YA 4V2NA 1O8XA 1YEXA 2AJQB 4HEA2 4BWQA 1WOUA 1BQ7A 4KGIA 1ABAA 3H4KA 2VM2A 2WZSA 3M9JA 1ZMAA 2LJKA 3O3TA 3LWAA 3Q18A 5IMDA 2H0GA 1UVZA 1N2AA 3HJMA 3FKFA 1GUKA 1AIUA 2YWNA 2A2RA 5AIVA 4Z7XA 1NHYA 3UAPA 1M2DA 3W6GA 2VD1A 4MPFA 1I9DA 3BCKA 3C71A 1ERTA 1Z7RA 4G01A 18GSA 1PL2A 1PX6A 3F6DA 4HU7A 4MH2A 4IELA 3ZVJA 4PI2C 2FY6A 1F9MA 1YQ1A 3F3QA 2TIRA 3O6TA 1TK8B 5A4UA 4ECIA 2M80A 1SL2B 1SD8A 3F63A 4FXYP 2KP1A 4J56E 1M0UA 1B9XC 4OMVA 3LYPA 1FG4A 2GTUA 3FRCA 4ZB6A 1WP0A 4YQUA 3QFBC 5J3RA 1F3AA 1GSUA 4K0NA 4L8EA 3UMAA 1G0TA 2F9SA 2VL9A 1EGRA 2JADA 4O7HA 1Y1UA 1O73A 1PA3A 1M3JA 1V57A 2KP2A 4GTUA 4AJ8A 4GF0A 2EIQA 2MYGA 2XBQA 3HKRA 4PTSA 3BOAA 2CAQA 4CDOA 5J41A 3TJFA 2WW3A 1SJ6A 4K9ZA 3RFRC 4WETA 1G6YA 5ECQB 2CA8A 3LFLA 2CVKA 3FY7A 1HD2A 2JZRA 1QQ2A 1Z9HA 1E6BA 2CQ9A 3RHCA 2MMOA 3L78A 2WW0A 4MABA 2HYXA 1SJIA 1UN2A 2DIZA 4NHWA 1XFLA 2I3YA 4IHUA 3G7YA 4USSA 2C1YA 1QGVA 2DSAA 3IR4A 1K0MA 1M9AA 3D4TA 3C8EA 2HE3A 5H5QA 4HI7A 5D9XA 1PSQA 1GSQA 3NIVA 5LNKe 3MAKA 1OC9A 2I81A 1FVJA 1IYIA 2IMKA 1EWXA 3W8SA 1ERWA 4MZBA 2X64A 2CT6A 2VKZG 3GTUB 4EIQA 2WDUA 4FO5A 3HCZA 2B5EA 4WBRD 4O32A 3UARA 2JACA 5HQPA 3P90A 3PINA 3G7JA 2J23A 1R5AA 4A5PA 2H72A 2JL4A 1YKAA 4AF2A 2I4AA 1U87A 2WVZA 5ECRB 3EINA 4F9ZA 5ECLB 3F8UA 4BVYA 4G10A 1XPVA 4Q5NA 3RBTA 5F8BA 1GWCA 1ERUA 1H4OA 2IFQA 3CSJA 4TOPA 2DC5A 2H73A 5FWGA 3TCOA 2XPEA 1EOGA 1S3AA 1PX7A 2O3EA 4ZXGA 4PUFC 2C80A 2VCQA 2VCXA 5ID2A 1T00A 4QMKA 4OFMA 4AKGA 4DVCA 1K0DA 1B48A 22GSA 3GKXA 3HY2A 2LRCA 2ON5A 3VI7A 2H1GA 3VURA 4YQMA 1K3OA 1V40A 4KF9A 5IMZA 3GKMA 3GUSA 2H1AA 1EP7A 2UV8G 1JFUA 4NV5A 2YZUA 6GSUA 1SKSB 3FR6A 6GSTA 4K5SA 1VF3A 2HRKA 2B6MA 3D21A 4MH3A 3ZVJD 5DALB 4IP1A 4TN8A 3GKNA 4PQIA 5FHIA 1U6TA 2DJJA 4BPYA 4MF7A 2N5AA 3GH9A 1E2YA 4BIKA 5KOXA 1FAAA 1PKWA 4MZCA 2Z9SA 2GSSA 4RUVA 1AAZA 2XC2A 3FHKA 3SBCA 1N8JA 3DVXA 3WGEA 3RHBA 4TR0A 2B1KA 3D6IA 5HR0A 4HU9A 2X49A 1BF5A 4RQXA 4BVXA 3FZAA 4XHMA 2REMA 3IV4A 1M99A 2E2MA 5DVBA 4OFTA 4HOJA 5BMUB 1GH2A 2DBCA 2ZCTA 3MYDA 2OBIA 2F8AA 2RM5A 2WW2A 3IK9A 3CBUA 3UBLA 3IRAA 3C1SA 1Z7PA 3I43A 2WJUA 3SWLA 9GSSA 2GSTA 3ME7A 1N25A 2H74A 3IXRA 2NPBA 2C4JA 3ZITA 3FMWA 5A4VA 3GIXA 1BG5A 5GSSA 4KW6A 3IA1A 5E4WA 1A2JA 1MDJA 1WE0A 2HRNA 3QAGA 4ACSA 2FWHA 1YJ6A 2O89A 2V41A 4BVXB 2VUPA 1CQHA 1S3DA 4IBPA 5AGYA 5ABRA 4Q5FA 5EPFA 1PD21 5G1KA 2OKAA 1X9WB 2YPMA 5ECNB 2WGRA 4LL1B 1BG1A 1QXHA 2YV9A 4XCSA 1WWJA 3QCPA 3IK7A 3GX0A 8GSSA 1GULA 1GUMA 2YJHA 1HQOA 1AQWA 5BRTA 3UIWA 3F6FA 4ZB7A 1CQGA 3GTUA 3RPNA 3BJ5A 1TRWA 4N10A 17GSA 2GSRA 3ZTLA 3IDVA 1OC9B 2A2SA 2HXKA 2P31A 5F06A 1TU7A 3Q6OA 5HR1A 19GSA 4EIPA 5J4UA 1JZDA 12GSA 3O76A 1GLQA 4N0ZA 4X0XA 4XRDA 4TVEA 4KH7A 4WF4A 2MBTA 3LORA 2H1LA 1ERVA 2WFCA 4KSOA 2I9HA 4E8EA 1QMVA 2YN1A 3CRTA 5ELAA 1BX9A 2YANA 1NM3A 3TRXA 3N5OA 4MJCA 4BWSA 1EP8A 3ZIVA 1XVQA 4AKXB 1A2MA 1TXXA 3FW2A 2BMXA 2WULA 4EVMA 3M8NA 4YQVA 1K3LA 1GSEA 5D9TA 5B6MA 3UBKA 2DMLA 1X5EA 5COHA 2H70A 2GZYA 1FB6A 1LU4A 5G5FA 1F37A 3A2XA 4ML6A 2V1MA 4MMMA 3LYKA 1YY7A 1O85A 13GSA 3IPZA 2H6ZA 3GX8A 3WGDA 2O87A 5J5NA 5JWQB 3UVHA 5AN1A 5BMUA 2WCIA 1DE1A 1V58A 1R26A 3ERGA 3QOUA 1T7PB 3U5RE
chains in the Genus database with same CATH topology
4PX1A 1OKDA 3P7XA 4O5UA 2CZ3A 1YVLA 1T4YA 3DKSA 5DJLA 1YEPA 3VWWA 5DBQA 4E68A 3F9UA 4WF5A 1MDKA 1T3BA 2FUG2 2VLVA 4OD7A 4HZ4A 1GRXA 3HD5A 5ECKB 5IO0A 4QQ7A 4EL1A 4JRRA 5GSTA 1YF1A 2H71A 4IN0A 3TJJA 1XOBA 2G0FA 1X9SB 3A5IA 4F82A 5H5SA 1PN9A 3MIXA 1PRXA 1XCCA 5HR3A 3H8QA 2PVOC 2HT9A 2VAFA 1GL8A 3FEUA 2X8CA 1SD9A 1SJZA 2H1DA 4RQRA 2GZPA 1EOHA 1BEDA 3APOA 4DSQA 1Y6EA 3TRPA 2VOCA 3MWHA 2AYTA 1U3AA 2X4AA 1EV4A 3F0IA 1NHOA 1R5PA 2YNXA 2AB6A 5A4WA 4GDFA 4XS4B 1GSYA 2IWTA 1SVOA 3M1GA 4NXIA 3E9JB 1KTEA 4X43A 3KM6A 4DSSA 4LLRA 1F2EA 2DMMA 4ECCA 3LEFA 3EC3A 1JLVA 2K8SA 2L5LA 2EFCA 5E59A 4XS1A 3CXGA 5C00A 2EIRA 3FZ9A 4JR6A 1XWCA 4YAVA 4YH2A 2H01A 3ZMKA 1T4ZA 2IMIA 3LSZA 2IMDA 4K8MA 2DJKA 4KB3A 1B9YC 4HUAA 3D4MA 3GFKA 3US3A 4JU5A 1DE2A 3GKKA 2A2PA 4F03A 1WIKA 3UOMA 1ZOFA 2HRFA 3GMFA 1H75A 5ENUA 4X1UA 4DSRA 3EWLA 1SYXA 2AHEA 1YDKA 1TJDA 5EVOA 3ZLPA 5G30A 2OE0A 2WB9A 2X8GA 2HZFA 4EKZA 5KN3A 3VFIA 4ECJA 2EFDA 2B3SA 4POMA 3DRNA 1EEJA 2R2JA 3CWGA 3PPUA 1Z6NA 4Z2UA 5G31A 1GSDA 4JEDA 3DVWA 2GGTA 4WR4A 2FA4A 3IHQA 3WGXA 2KUCA 2K18A 7GSSA 5IPHA 2QA1A 1GTUA 4MJBA 3HJOA 3S9FA 2E0QA 1ILOA 2JSZA 4OCEA 2HZEB 3LXTA 3HHVA 1JHBA 2N5BA 2RIIA 3GNJA 5D96A 1FOVA 2MMZA 4NV2A 2H6YA 2PVQA 1UC7A 2HFDA 4KDUA 5IMVA 1MTCA 2LV3A 2CAIA 1EV9A 2C0DA 1XW6A 5J9BA 4F0CA 2YWOA 2QSIA 3RPPA 4Q5QA 4LA1A 2DLXA 4FIWA 4GXZA 3KIJA 3DIEA 1SKRB 4ISDA 3LG6A 3ME8A 2KLXA 4KA0A 5B7CA 4OO4A 2E2GA 4PGTA 3KP9A 1XVWA 2N5FA 3R3EA 2OE3A 2QKEA 1KBNA 2A4VA 1DSBA 4NHZA 4MLYA 2GQMA 5IMAA 1GP1A 2QA2A 3PH9A 1F3BA 4MNNA 3TOTA 2H8LA 2HRAA 3QFAC 1B8XA 1AUCA 3KTLA 1Z5YE 5DAKB 2OBKA 1DBYA 4MCUA 3H1NA 4TXOA 1Z3EA 5D8IA 1SVLA 1LBKA 1W4VA 3GL5A 2L57A 2GDRA 1OC8A 3TKPA 3IOSA 2GT5A 2ZNMA 3ZRDA 1OE8A 1HNBA 1K0OA 4GLTA 3A3TA 2OACA 5HFKA 2PPTA 4EUYA 2AAWA 4K2XA 5ELGA 5HFIA 3TGZA 5A5KA 1A8LA 4WEYA 1R4WA 3F4RA 3GH6A 1OE7A 3ISOA 1G6WA 3F4TA 3HA9A 4NAXA 2NBSA 4N0VA 1FB0A 4AKHA 1A0FA 2O7KA 2HI7A 1TI1A 5H5RA 4XS6A 5IPGA 1A23A 1AQVA 1V9WA 2QGVA 5J4VA 3EURA 2OA7A 1FO5A 1OYJA 2YV7A 5JCWA 2P5RA 3IHGA 3TKRA 1EEMA 4WBJA 3N9JA 5KOWA 2DJ0A 2JU5A 3FK8A 5KN0A 3QPMA 3UL3A 1ZZYA 3M3MA 3ZIJA 5A34A 2LQQA 1O8WA 1Y25A 2K8VA 1I5GA 3BD2A 5F07A 5CP1A 5LD0A 4JR4A 2R5GA 4KE3A 2CVDA 4TRXA 4CW9A 2C3NA 2HLSA 1TRUA 2H1BA 3TU3B 4L0WA 3TJBA 4TKYA 2GS3A 4IKHA 5J9CA 2H0HA 2HSNB 1O7UA 4IVFA 3HVXA 1PN0A 2F51A 1ZYQB 3CMIA 4G2EA 4MZWA 3HZ4A 4L5LA 5EY6A 3F3RA 4MDCA 3VPTA 4BL7A 2F3MA 2X8HA 4XRAA 4YKFA 3HYPA 4GSTA 2PGTA 2X99A 4NMUA 3NOFA 4ZB8A 1ZYNA 3FR9A 1TTZA 2R0CA 2JSYA 2M46A 4J2FA 4N3ZA 3MSZA 1G7EA 2LEGA 1JZWA 2V2GA 2GQLA 2G2QA 1GTAA 3DWVA 4FYBA 4HS1A 3LQ7A 2I1UA 1TK0B 5DCHA 4ICYA 20GSA 5A5HA 5CRGA 3M0FA 1AXDA 4MPGA 3UJ1A 3TKSE 2C3TA 2ES7A 4MP4A 4IS0A 4ZL8A 2KHPA 4ZL9A 4KAEA 2B7JA 2IFQB 4J57E 4ZB9A 4TXVA 2CV4A 3ERWA 4N30A 3L0HA 5AISA 4OWYA 3VWXA 2RUEA 2L59A 4Z2RA 3RDWA 3WT2A 4QL9A 1U3IA 2GLRA 1Q4JA 4G0KA 6GSYA 5CAXA 2BTOT 3HVSA 3FZ5A 3GYKA 3HMJG 2EIOA 3ERFA 3TJKA 4EDZA 3Q19A 1MD4A 2PWJA 2YWIA 5D93A 4E8HA 2DKHA 5IM9A 1VF4A 4KDXA 1SL1B 3IBHA 4GWRA 1XWGA 4BA7A 2VLTA 1XBSA 2LRNA 1HYUA 5IMCA 4PQHA 2L4CA 3BBYA 2LKUA 3H93A 2L6DA 2VD0A 1M2AA 4K0GA 3FZ4A 1URMA 1GTBA 3A2VA 2HSHA 2PU9C 5G5EA 1TOFA 2YJ7A 2C0FA 1X9MB 2FLSA 2IMEA 2GZZA 3DYRA 4Q5RA 5C04A 1RW1A 1ZGNA 2TRXA 3GN3A 3HJPA 2D2ZA 3GSTA 4L5OA 6GSSA 2FWGA 4AI6A 1VF2A 3LGCA 3J7Yb 1TRSA 3DXBA 3E3EA 10GSA 3L9VA 3G7IA 3EU3A 1KEBA 4LMVA 2H19A 1K0BA 3UEMA 2YP6A 5KN1A 4DEJA 3VWUA 2VIMA 2IL3A 5ECMB 4ECBA 1GUHA 3AY8A 1IYHA 3F4SA 3TOUA 2H75A 2C0EA 3D22A 3PR8A 3CSHA 3KMNA 3ZFLA 3KEBA 3KCMA 5ECSA 4EC0A 4MJAA 2E7PA 3KD0A 3M9KA 3TB2A 1PQNA 5CREA 1TW9A 5D73A 5GZZB 3TKSC 3JCML 2DKIA 2WS2A 4K5RA 2R6KA 3CRUA 1UA5A 1XWBA 2LTKA 4ZBBA 4BL7B 2VLUA 3GA4A 5D9VA 2PUKC 2EC4A 2FWFA 1ST9A 2PN8A 4V1Ap 4YAPA 2LSTA 3HDCA 1ZYEA 3VI5A 2B1LA 3LXZA 3KTBA 1ML6A 3J7Yk 4JBBA 2OADA 2HSNA 1MDIA 1MEKA 5D9WA 4G19A 3ZFBA 1VF1A 4KUNA 1YF0A 1O6JA 1TK5B 3IC4A 4TW5A 4POBA 2C0GA 3VLNA 2M72A 1K0NA 3DD3A 1PL1A 2OJLA 4RI6A 14GSA 3HVVA 4Z2TA 3MDKA 3FR3A 2GQKA 4IJIA 4OO5A 5F0GA 2FHEA 1OVNA 4DSSB 4O92A 4PUAA 1TRVA 3C73A 3WT1A 2JZTA 3UVTA 3E0UA 1XW5A 4O5QA 3P8WA 1TU8A 2H76A 5ECOB 1T1VA 4GSSA 2LUSA 3VWVA 3VK9A 3GHAA 1U88A 4WR5A 4ILFA 5B8BA 3NZNA 4PQ1A 2BJXA 3A5WA 1SU9A 5G1LA 4IJ3A 3DGQA 3D0ZA 1PMTA 3HXSA 3C1RA 2VCZA 4D73B 2HSMB 3QD9A 5ECIB 2KOKA 3KXOA 4JZQA 2DIYA 1T8EB 2DJ1A 4EDYA 3L9SA 1B4PA 1THXA 2HZEA 2IN3A 2LJRA 4AKIA 2VCTA 3G9BA 4AJ7A 1W89A 4QL7A 1YKCA 4CHSA 1BAYA 2RLIA 4MJEA 1EGOA 4V2LA 3A2WA 5DQSA 5JWOB 4ZL7A 1JZRA 3TRQA 1AQXA 4TXOB 3EYTA 1GTIA 1EZKA 2YOIA 4FYUA 2H6XA 1V2AA 3QAVA 1OAZA 5CRWA 3GSSA 2H0IA 4V2MA 1F6MC 1X0RA 2WZ9A 2A4HA 3L4NA 2YWMA 4G0LA 5CO3A 1M7TA 3I9V2 4O5RA 5KEJA 4TR3A 4K7OA 2H66A 1JLWA 4HZ2A 5IMFA 3IAS2 3IE3A 1XWKA 3EE2A 1M2BA 1SYRA 4KCEA 5CYYA 2R0PA 4AJ6A 3BCIA 1ZYPA 4HQZA 4TR4A 5J47A 1TKDB 3KMOA 2B5XA 3QMXA 1TDIA 3ZMLA 2PMTA 3APQA 2MZCA 4HDEA 5JCGA 3CTGA 1J9BA 1SKWB 2AV4A 4CY6A 4YKGA 5F05A 4AGSA 5L71A 2R0GA 5A5HB 2RUFA 1WRYA 2IJYA 2O8VB 2P0GA 3PGTA 3OR5A 3LW9A 1QUWA 5A34B 5DAKA 1R7HA 3P2AA 4IQ1A 2OT3A 1JZOA 1USBA 1O81A 1V98A 2RM6A 5B6NA 4K6XA 3V1WA 3TUEA 5CNWA 2IIYA 2CX4A 4MA9A 3GV1A 2FD3A 4FYCA 3ZL5A 4D73A 5GAPD 4RI7A 5GAND 5DDLA 1PGTA 4I5QA 4ZILA 4ULXA 4IQAA 4WXTA 4CY8A 1X5CA 3U6VA 2K9FA 5J40A 2VCWA 2CVBA 2FA8A 1PKZA 4ML1A 1GLPA 3EU4A 2DJ2A 5LCZA 4NWYA 2PBJA 4GRFA 1KNGA 3KP8A 1DUGA 3FYGA 3IC8A 5HFGA 6GSVA 2O85A 1HNAA 4IW9A 2UZ8A 2ZUPA 4BVYB 2XPDA 4IP6A 2TRCP 4GQCA 4F0BA 1J08A 2P5QA 5A1NA 4F2IA 4L0UA 3TKQA 1RQMA 4P3YB 4I2TA 2V6KA 3EVIA 5JCUA 1BJXA 2JZSA 2NDOA 5DCGA 1ZCPA 3TJGA 4K2DA 2GVPA 1LJRA 3QR6A 1FVKA 2HSYA 5DJMA 1XWAA 1QK8A 2C8UA 2L5OA 4KNDA 3KGKA 1A0RP 4IGJA 2VL2C 3LJRA 4I8BA 3APSA 2B5YA 4TR1B 5JWRB 1A2LA 4MF6A 4XS4A 4ZBAA 2J9HA 1C72A 3I6AA 5G2ZA 5FT3A 4HJ2A 4OFNA 5ECHB 4FH8A 4KCAA 2ON7A 1SK0A 3L9UA 4I6XA 2V32A 3DMLA 4ID0A 2MMNA 2F8FA 1GSFA 1SVMA 1SL0B 1XW9A 4PNFA 4NPBA 4EF0A 1Q98A 2YCDA 2YZHA 2VCVA 4N11A 2HNLA 3GL3A 5IIZA 2VO4A 5A1NB 2FNOA 2VL3A 2LS5A 3KJYA 2HRKB 4GCIA 1B4QA 2R4VA 4ZIJA 2FCHA 5HR2A 1RK4A 6GSXA 2OE1A 4HJMA 2B7KA 1OC3A 3EMXA 1GNWA 5J4YA 1VGLA 2HSMA 4EO3A 2R37A 3GRXA 1S3CA 1A24A 2GSQA 1VRSD 4K1FA 3VPQA 2IPAA 1ON4A 1ACVA 1ZL9A 1TP9A 2EFHA 4FQUA 1BYEA 2VM1A 4POKA 4W66A 2FGXA 2V6OA 2ALBA 1GNEA 1X5DA 1SK1A 2LNTA 3KH9A 2CX3A 3RAZA 3D5JA 3K8NA 6GSWA 5CRHA 3GURA 3TDGA 16GSA 4X4JA 3H79A 4OCFA 1FHEA 1G7OA 4KX4A 3ZREA 3ZYWA 2NTOA 4HQSA 5DQYA 2CZ2A 2XHFA 1FOHA 3R2QA 2EFEA 1XZOA 5B8AA 5IOWA 5ID2B 5KN2A 1NW2A 1SK2A 2L6CA 4KSMA 3TKSA 1K3YA 5IO2A 4POLA 3I69A 2LNSA 2R3XA 1HNCA 2LJAA 2MBSA 4XTSA 4PNGA 4EE0A 1J0FA 4MK3A 2H30A 4G0IA 3CYNA 4K7NA 5EL8A 1MD3A 1WPIA 3EPTA 1TI3A 2QC7A 1YZXA 1SENA 2XBIA 3KZQA 4TR1A 3EMPA 5ECPB 3Q74A 1K0AA 1AW9A 3IAM2 2GT6A 2WRTA 4I97A 4GSNA 3CSIA 4H86A 3CTFA 1XOAA 1THOA 4LL4B 4G9HA 2IMFA 4WKWA 3W8JA 1XIYA 5INYA 4XIHA 4JE1A 2AUVA 4PURA 4PXOA 3MNGA 5CRDA 1GSSA 1QFNA 1OKTA 2FWEA 1Z6MA 5IQYA 4I2UA 1AC1A 3ED3A 2DJ3A 3WYWA 3QDNA 3C7MA 4MF5A 4V1Ag 3DEXA 2LRTA 11GSA 1XXUA 2LQOA 4ZBDA 1NSWA 4LMWA 2MMAA 4EXJA 1TXUA 2L4QA 4GQFA 3QAWA 1FW1A 2HQTA 3HZ8A 1WJKA 2O5VA 3ZZXA 1M9BA 3WD6A 1WMJA 5AIXA 3KH7A 1K0CA 4K7IA 5IOXA 5DALA 2VL2A 2NVLA 2K6VA 2C3QA 2PERA 4KDYA 1A8YA 4V2NA 1O8XA 1YEXA 2AJQB 4HEA2 4BWQA 1WOUA 1BQ7A 4KGIA 1ABAA 3H4KA 2VM2A 3M9JA 1ZMAA 2LJKA 3O3TA 3LWAA 3Q18A 5IMDA 2H0GA 1UVZA 1N2AA 3HJMA 3FKFA 1GUKA 1AIUA 2YWNA 2A2RA 5AIVA 4Z7XA 1NHYA 3UAPA 1M2DA 3W6GA 2VD1A 4MPFA 1I9DA 3BCKA 3C71A 1ERTA 1Z7RA 4G01A 18GSA 1PL2A 1PX6A 3F6DA 4HU7A 4MH2A 4IELA 3ZVJA 2FY6A 1F9MA 1YQ1A 3F3QA 2TIRA 3O6TA 1TK8B 5A4UA 4ECIA 2M80A 1SL2B 1SD8A 3F63A 2KP1A 4J56E 1M0UA 1B9XC 4OMVA 3LYPA 1FG4A 2GTUA 3FRCA 4ZB6A 1WP0A 4YQUA 3QFBC 5J3RA 1F3AA 1GSUA 4K0NA 4L8EA 3UMAA 1G0TA 2F9SA 2VL9A 1EGRA 2JADA 4O7HA 1Y1UA 1O73A 1PA3A 1V57A 2KP2A 4GTUA 4AJ8A 4GF0A 2EIQA 2MYGA 2XBQA 3HKRA 4PTSA 3BOAA 2CAQA 4CDOA 5J41A 3TJFA 1SJ6A 4K9ZA 4WETA 1G6YA 5ECQB 2CA8A 3LFLA 2CVKA 3FY7A 1HD2A 2JZRA 1QQ2A 1Z9HA 1E6BA 2CQ9A 3RHCA 2MMOA 3L78A 4MABA 2HYXA 1SJIA 1UN2A 2DIZA 4NHWA 1XFLA 2I3YA 4IHUA 3G7YA 4USSA 2C1YA 1QGVA 2DSAA 3IR4A 1K0MA 1M9AA 3D4TA 3C8EA 2HE3A 5H5QA 4HI7A 5D9XA 1PSQA 1GSQA 3NIVA 5LNKe 3MAKA 1OC9A 2I81A 1FVJA 1IYIA 2IMKA 1EWXA 3W8SA 1ERWA 4MZBA 2X64A 2CT6A 2VKZG 3GTUB 4EIQA 2WDUA 4FO5A 3HCZA 2B5EA 4WBRD 4O32A 3UARA 2JACA 5HQPA 3P90A 3PINA 3G7JA 2J23A 1R5AA 4A5PA 2H72A 2JL4A 1YKAA 4AF2A 2I4AA 1U87A 5ECRB 3EINA 4F9ZA 5ECLB 3F8UA 4BVYA 4G10A 1XPVA 4Q5NA 3RBTA 5F8BA 1GWCA 1ERUA 1H4OA 2IFQA 3CSJA 4TOPA 2DC5A 2H73A 5FWGA 3TCOA 2XPEA 1EOGA 1S3AA 1PX7A 4ZXGA 4PUFC 2C80A 2VCQA 2VCXA 5ID2A 1T00A 4QMKA 4OFMA 4AKGA 4DVCA 1K0DA 1B48A 22GSA 3GKXA 3HY2A 2LRCA 2ON5A 3VI7A 2H1GA 3VURA 4YQMA 1K3OA 1V40A 4KF9A 5IMZA 3GKMA 3GUSA 2H1AA 1EP7A 2UV8G 1JFUA 4NV5A 2YZUA 6GSUA 1SKSB 3FR6A 6GSTA 4K5SA 1VF3A 2HRKA 2B6MA 3D21A 4MH3A 3ZVJD 5DALB 4IP1A 4TN8A 3GKNA 4PQIA 5FHIA 1U6TA 2DJJA 4BPYA 4MF7A 2N5AA 3GH9A 1E2YA 5KOXA 1FAAA 1PKWA 4MZCA 2Z9SA 2GSSA 4RUVA 1AAZA 2XC2A 3FHKA 3SBCA 1N8JA 3DVXA 3WGEA 3RHBA 4TR0A 2B1KA 3D6IA 5HR0A 4HU9A 2X49A 1BF5A 4RQXA 4BVXA 3FZAA 4XHMA 2REMA 3IV4A 1M99A 2E2MA 5DVBA 4OFTA 4HOJA 5BMUB 1GH2A 2DBCA 2ZCTA 3MYDA 2OBIA 2F8AA 2RM5A 3IK9A 3CBUA 3UBLA 3IRAA 3C1SA 1Z7PA 3I43A 2WJUA 3SWLA 9GSSA 2GSTA 3ME7A 1N25A 2H74A 3IXRA 2NPBA 2C4JA 3ZITA 3FMWA 5A4VA 3GIXA 1BG5A 5GSSA 4KW6A 3IA1A 5E4WA 1A2JA 1MDJA 1WE0A 2HRNA 3QAGA 4ACSA 2FWHA 1YJ6A 2O89A 2V41A 4BVXB 2VUPA 1CQHA 1S3DA 4IBPA 5AGYA 5ABRA 4Q5FA 5EPFA 1PD21 5G1KA 2OKAA 1X9WB 2YPMA 5ECNB 2WGRA 4LL1B 1BG1A 1QXHA 2YV9A 4XCSA 1WWJA 3QCPA 3IK7A 3GX0A 8GSSA 1GULA 1GUMA 2YJHA 1HQOA 1AQWA 5BRTA 3UIWA 3F6FA 4ZB7A 1CQGA 3GTUA 3RPNA 3BJ5A 1TRWA 4N10A 17GSA 2GSRA 3ZTLA 3IDVA 1OC9B 2A2SA 2HXKA 2P31A 5F06A 1TU7A 3Q6OA 5HR1A 19GSA 4EIPA 5J4UA 1JZDA 12GSA 3O76A 1GLQA 4N0ZA 4X0XA 4XRDA 4TVEA 4KH7A 4WF4A 2MBTA 3LORA 2H1LA 1ERVA 2WFCA 4KSOA 2I9HA 4E8EA 1QMVA 2YN1A 3CRTA 5ELAA 1BX9A 2YANA 1NM3A 3TRXA 3N5OA 4MJCA 4BWSA 1EP8A 3ZIVA 1XVQA 4AKXB 1A2MA 1TXXA 3FW2A 2BMXA 2WULA 4EVMA 3M8NA 4YQVA 1K3LA 1GSEA 5D9TA 5B6MA 3UBKA 2DMLA 1X5EA 5COHA 2H70A 2GZYA 1FB6A 1LU4A 5G5FA 1F37A 3A2XA 4ML6A 2V1MA 4MMMA 3LYKA 1YY7A 1O85A 13GSA 3IPZA 2H6ZA 3GX8A 3WGDA 2O87A 5J5NA 5JWQB 3UVHA 5AN1A 5BMUA 2WCIA 1DE1A 1V58A 1R26A 3ERGA 3QOUA 1T7PB 3U5RE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PX1 A;  1OKD A;  3P7X A;  2CZ3 A;  1T4Y A;  3DKS A;  5DJL A;  1YEP A;  3VWW A;  5DBQ A;  3F9U A;  4WF5 A;  1MDK A;  1T3B A;  2FUG 2;  2VLV A;  4OD7 A;  4HZ4 A;  1GRX A;  3HD5 A;  5ECK B;  5IO0 A;  4QQ7 A;  4EL1 A;  4JRR A;  5GST A;  1YF1 A;  2H71 A;  4IN0 A;  3TJJ A;  1XOB A;  2G0F A;  1X9S B;  4F82 A;  5H5S A;  1PN9 A;  1PRX A;  1XCC A;  5HR3 A;  3H8Q A;  2PVO C;  2HT9 A;  2VAF A;  1GL8 A;  3FEU A;  2X8C A;  1SD9 A;  1SJZ A;  2H1D A;  4RQR A;  2GZP A;  1EOH A;  1BED A;  3APO A;  4DSQ A;  1Y6E A;  3TRP A;  2VOC A;  3MWH A;  2AYT A;  1U3A A;  1EV4 A;  3F0I A;  1NHO A;  1R5P A;  2YNX A;  2AB6 A;  5A4W A;  4XS4 B;  1GSY A;  2IWT A;  3M1G A;  4NXI A;  3E9J B;  1KTE A;  4X43 A;  3KM6 A;  4DSS A;  4LLR A;  1F2E A;  2DMM A;  4ECC A;  3LEF A;  3EC3 A;  1JLV A;  2K8S A;  2L5L A;  5E59 A;  4XS1 A;  3CXG A;  5C00 A;  2EIR A;  3FZ9 A;  4JR6 A;  1XWC A;  4YAV A;  4YH2 A;  2H01 A;  3ZMK A;  1T4Z A;  2IMI A;  3LSZ A;  2IMD A;  4K8M A;  2DJK A;  4KB3 A;  1B9Y C;  4HUA A;  3D4M A;  3GFK A;  3US3 A;  4JU5 A;  1DE2 A;  3GKK A;  4F03 A;  1WIK A;  3UOM A;  1ZOF A;  2HRF A;  3GMF A;  1H75 A;  5ENU A;  4X1U A;  4DSR A;  3EWL A;  1SYX A;  2AHE A;  1YDK A;  1TJD A;  5EVO A;  3ZLP A;  5G30 A;  2OE0 A;  2WB9 A;  2X8G A;  2HZF A;  4EKZ A;  5KN3 A;  3VFI A;  4ECJ A;  2B3S A;  4POM A;  3DRN A;  1EEJ A;  2R2J A;  3PPU A;  1Z6N A;  5G31 A;  1GSD A;  4JED A;  3DVW A;  2GGT A;  4WR4 A;  2FA4 A;  3IHQ A;  3WGX A;  2KUC A;  2K18 A;  7GSS A;  5IPH A;  4MJB A;  1GTU A;  3HJO A;  3S9F A;  2E0Q A;  1ILO A;  2JSZ A;  4OCE A;  2HZE B;  3LXT A;  3HHV A;  1JHB A;  2N5B A;  2RII A;  3GNJ A;  5D96 A;  1FOV A;  2MMZ A;  4NV2 A;  2H6Y A;  2PVQ A;  1UC7 A;  2HFD A;  4KDU A;  5IMV A;  1MTC A;  2LV3 A;  2CAI A;  1EV9 A;  2C0D A;  5J9B A;  1XW6 A;  4F0C A;  2YWO A;  2QSI A;  3RPP A;  4Q5Q A;  4LA1 A;  2DLX A;  4FIW A;  4GXZ A;  3KIJ A;  3DIE A;  1SKR B;  4ISD A;  3LG6 A;  3ME8 A;  2KLX A;  4KA0 A;  5B7C A;  4OO4 A;  2E2G A;  4PGT A;  3KP9 A;  1XVW A;  2N5F A;  3R3E A;  2OE3 A;  2QKE A;  1KBN A;  2A4V A;  1DSB A;  4NHZ A;  4MLY A;  2GQM A;  5IMA A;  1GP1 A;  3PH9 A;  1F3B A;  3TOT A;  2H8L A;  2HRA A;  3QFA C;  1B8X A;  1AUC A;  3KTL A;  1Z5Y E;  5DAK B;  2OBK A;  1DBY A;  4MCU A;  3H1N A;  4TXO A;  1Z3E A;  5D8I A;  1LBK A;  1W4V A;  3GL5 A;  2L57 A;  2GDR A;  1OC8 A;  3TKP A;  3IOS A;  2GT5 A;  2ZNM A;  3ZRD A;  1OE8 A;  1HNB A;  1K0O A;  4GLT A;  3A3T A;  2OAC A;  5HFK A;  2PPT A;  4EUY A;  2AAW A;  5ELG A;  5HFI A;  3TGZ A;  5A5K A;  1A8L A;  4WEY A;  1R4W A;  3F4R A;  3GH6 A;  1OE7 A;  3ISO A;  1G6W A;  3F4T A;  3HA9 A;  4NAX A;  2NBS A;  4N0V A;  1FB0 A;  1A0F A;  2O7K A;  2HI7 A;  1TI1 A;  5H5R A;  4XS6 A;  5IPG A;  1A23 A;  1AQV A;  1V9W A;  2QGV A;  3EUR A;  2OA7 A;  1FO5 A;  1OYJ A;  2YV7 A;  5JCW A;  2P5R A;  3TKR A;  1EEM A;  4WBJ A;  3N9J A;  2DJ0 A;  2JU5 A;  3FK8 A;  5KN0 A;  3QPM A;  3UL3 A;  1ZZY A;  3M3M A;  3ZIJ A;  2LQQ A;  1O8W A;  1Y25 A;  2K8V A;  1I5G A;  3BD2 A;  5F07 A;  5CP1 A;  5LD0 A;  4JR4 A;  2R5G A;  4KE3 A;  2CVD A;  4TRX A;  4CW9 A;  2C3N A;  2HLS A;  1TRU A;  2H1B A;  4L0W A;  3TJB A;  4TKY A;  2GS3 A;  4IKH A;  5J9C A;  2H0H A;  2HSN B;  1O7U A;  4IVF A;  3HVX A;  2F51 A;  1ZYQ B;  3CMI A;  4G2E A;  4MZW A;  3HZ4 A;  4L5L A;  5EY6 A;  3F3R A;  4MDC A;  3VPT A;  4BL7 A;  2F3M A;  4XRA A;  2X8H A;  3HYP A;  4GST A;  2PGT A;  2X99 A;  4NMU A;  3NOF A;  4ZB8 A;  3FR9 A;  1TTZ A;  2JSY A;  2M46 A;  4J2F A;  3MSZ A;  1G7E A;  2LEG A;  1JZW A;  2V2G A;  2GQL A;  2G2Q A;  1GTA A;  3DWV A;  4FYB A;  4HS1 A;  3LQ7 A;  2I1U A;  1TK0 B;  5DCH A;  20GS A;  5CRG A;  3M0F A;  1AXD A;  4MPG A;  3UJ1 A;  3TKS E;  2C3T A;  2ES7 A;  4MP4 A;  4IS0 A;  4ZL8 A;  2KHP A;  4ZL9 A;  4KAE A;  2B7J A;  2IFQ B;  4J57 E;  4ZB9 A;  4TXV A;  2CV4 A;  3ERW A;  4N30 A;  3L0H A;  5AIS A;  4OWY A;  3VWX A;  2RUE A;  2L59 A;  3RDW A;  3WT2 A;  4QL9 A;  1U3I A;  2GLR A;  1Q4J A;  4G0K A;  6GSY A;  5CAX A;  2BTO T;  3HVS A;  3FZ5 A;  3GYK A;  2EIO A;  3ERF A;  3TJK A;  4EDZ A;  3Q19 A;  1MD4 A;  2PWJ A;  2YWI A;  5D93 A;  4E8H A;  5IM9 A;  1VF4 A;  4KDX A;  1SL1 B;  3IBH A;  4GWR A;  1XWG A;  4BA7 A;  2VLT A;  1XBS A;  2LRN A;  1HYU A;  5IMC A;  4PQH A;  2L4C A;  3BBY A;  2LKU A;  3H93 A;  2L6D A;  2VD0 A;  1M2A A;  4K0G A;  3FZ4 A;  1URM A;  1GTB A;  3A2V A;  2HSH A;  2PU9 C;  5G5E A;  1TOF A;  2YJ7 A;  2C0F A;  1X9M B;  2FLS A;  2IME A;  2GZZ A;  3DYR A;  4Q5R A;  5C04 A;  1RW1 A;  1ZGN A;  2TRX A;  3GN3 A;  3HJP A;  2D2Z A;  3GST A;  4L5O A;  6GSS A;  2FWG A;  1VF2 A;  3LGC A;  3J7Y b;  1TRS A;  3DXB A;  3E3E A;  10GS A;  3L9V A;  3G7I A;  3EU3 A;  1KEB A;  4LMV A;  2H19 A;  1K0B A;  3UEM A;  2YP6 A;  5KN1 A;  4DEJ A;  3VWU A;  2VIM A;  2IL3 A;  5ECM B;  4ECB A;  1GUH A;  3AY8 A;  1IYH A;  3F4S A;  3TOU A;  2H75 A;  2C0E A;  3D22 A;  3PR8 A;  3CSH A;  3KMN A;  3ZFL A;  3KEB A;  3KCM A;  5ECS A;  4EC0 A;  4MJA A;  2E7P A;  3KD0 A;  3M9K A;  3TB2 A;  1PQN A;  5CRE A;  1TW9 A;  5D73 A;  5GZZ B;  3TKS C;  3JCM L;  2WS2 A;  2R6K A;  3CRU A;  1UA5 A;  1XWB A;  2LTK A;  4ZBB A;  4BL7 B;  2VLU A;  3GA4 A;  5D9V A;  2PUK C;  2EC4 A;  2FWF A;  1ST9 A;  2PN8 A;  4V1A p;  4YAP A;  2LST A;  3HDC A;  1ZYE A;  3VI5 A;  2B1L A;  3LXZ A;  3KTB A;  1ML6 A;  3J7Y k;  4JBB A;  2OAD A;  1MDI A;  1MEK A;  5D9W A;  4G19 A;  3ZFB A;  1VF1 A;  4KUN A;  1YF0 A;  1O6J A;  1TK5 B;  3IC4 A;  4TW5 A;  4POB A;  2C0G A;  3VLN A;  2M72 A;  1K0N A;  3DD3 A;  1PL1 A;  2OJL A;  4RI6 A;  14GS A;  3HVV A;  3MDK A;  3FR3 A;  2GQK A;  4IJI A;  4OO5 A;  5F0G A;  2FHE A;  1OVN A;  4DSS B;  4O92 A;  4PUA A;  1TRV A;  3C73 A;  3WT1 A;  2JZT A;  3UVT A;  3E0U A;  1XW5 A;  3P8W A;  1TU8 A;  2H76 A;  5ECO B;  1T1V A;  4GSS A;  2LUS A;  3VWV A;  3VK9 A;  3GHA A;  1U88 A;  4WR5 A;  4ILF A;  5B8B A;  3NZN A;  4PQ1 A;  2BJX A;  3A5W A;  1SU9 A;  5G1L A;  4IJ3 A;  3DGQ A;  3D0Z A;  1PMT A;  3HXS A;  3C1R A;  2VCZ A;  4D73 B;  2HSM B;  3QD9 A;  5ECI B;  2KOK A;  3KXO A;  4JZQ A;  2DIY A;  1T8E B;  2DJ1 A;  4EDY A;  3L9S A;  1B4P A;  1THX A;  2HZE A;  2IN3 A;  2LJR A;  2VCT A;  3G9B A;  4AJ7 A;  1W89 A;  4QL7 A;  1YKC A;  4CHS A;  1BAY A;  2RLI A;  4MJE A;  1EGO A;  4V2L A;  3A2W A;  5DQS A;  5JWO B;  4ZL7 A;  1JZR A;  3TRQ A;  1AQX A;  4TXO B;  3EYT A;  1GTI A;  1EZK A;  2YOI A;  4FYU A;  2H6X A;  1V2A A;  3QAV A;  1OAZ A;  5CRW A;  3GSS A;  2H0I A;  4V2M A;  1F6M C;  1X0R A;  2WZ9 A;  3L4N A;  2YWM A;  4G0L A;  5CO3 A;  1M7T A;  3I9V 2;  4O5R A;  5KEJ A;  4TR3 A;  4K7O A;  2H66 A;  1JLW A;  4HZ2 A;  5IMF A;  3IAS 2;  3IE3 A;  1XWK A;  3EE2 A;  1M2B A;  1SYR A;  4KCE A;  5CYY A;  4AJ6 A;  3BCI A;  4HQZ A;  4TR4 A;  1TKD B;  3KMO A;  2B5X A;  3QMX A;  1TDI A;  3ZML A;  2PMT A;  3APQ A;  2MZC A;  4HDE A;  5JCG A;  3CTG A;  1J9B A;  1SKW B;  2AV4 A;  5F05 A;  4AGS A;  5L71 A;  1WRY A;  2RUF A;  2IJY A;  2O8V B;  2P0G A;  3PGT A;  3OR5 A;  1QUW A;  5DAK A;  1R7H A;  3P2A A;  4IQ1 A;  1JZO A;  1USB A;  1O81 A;  1V98 A;  2RM6 A;  5B6N A;  4K6X A;  3V1W A;  3TUE A;  5CNW A;  2IIY A;  2CX4 A;  4MA9 A;  3GV1 A;  2FD3 A;  4FYC A;  3ZL5 A;  4D73 A;  5GAP D;  4RI7 A;  5GAN D;  5DDL A;  1PGT A;  4I5Q A;  4ZIL A;  4ULX A;  4WXT A;  4IQA A;  1X5C A;  3U6V A;  2K9F A;  2VCW A;  2CVB A;  2FA8 A;  1PKZ A;  4ML1 A;  1GLP A;  3EU4 A;  2DJ2 A;  5LCZ A;  4NWY A;  2PBJ A;  4GRF A;  1KNG A;  3KP8 A;  1DUG A;  3FYG A;  3IC8 A;  5HFG A;  6GSV A;  2O85 A;  1HNA A;  4IW9 A;  2UZ8 A;  2ZUP A;  4BVY B;  2XPD A;  4IP6 A;  2TRC P;  4GQC A;  4F0B A;  1J08 A;  2P5Q A;  4F2I A;  4L0U A;  3TKQ A;  1RQM A;  4P3Y B;  4I2T A;  2V6K A;  3EVI A;  5JCU A;  1BJX A;  2JZS A;  2NDO A;  5DCG A;  1ZCP A;  3TJG A;  4K2D A;  2GVP A;  1LJR A;  3QR6 A;  1FVK A;  2HSY A;  5DJM A;  1XWA A;  1QK8 A;  2C8U A;  2L5O A;  4KND A;  3KGK A;  1A0R P;  4IGJ A;  2VL2 C;  3LJR A;  4I8B A;  3APS A;  2B5Y A;  4TR1 B;  5JWR B;  1A2L A;  4MF6 A;  4XS4 A;  4ZBA A;  2J9H A;  1C72 A;  3I6A A;  5G2Z A;  5FT3 A;  4HJ2 A;  4OFN A;  5ECH B;  4FH8 A;  4KCA A;  2ON7 A;  1SK0 A;  3L9U A;  4I6X A;  2V32 A;  3DML A;  4ID0 A;  2MMN A;  2F8F A;  1GSF A;  1SL0 B;  1XW9 A;  4PNF A;  4NPB A;  4EF0 A;  1Q98 A;  2YCD A;  2YZH A;  2VCV A;  4N11 A;  2HNL A;  3GL3 A;  5IIZ A;  2VO4 A;  2FNO A;  2VL3 A;  2LS5 A;  3KJY A;  2HRK B;  4GCI A;  1B4Q A;  2R4V A;  4ZIJ A;  2FCH A;  5HR2 A;  1RK4 A;  6GSX A;  2OE1 A;  4HJM A;  2B7K A;  1OC3 A;  3EMX A;  1GNW A;  1VGL A;  2HSM A;  4EO3 A;  2R37 A;  3GRX A;  1S3C A;  1A24 A;  2GSQ A;  1VRS D;  4K1F A;  3VPQ A;  2IPA A;  1ON4 A;  1ACV A;  1ZL9 A;  1TP9 A;  4FQU A;  1BYE A;  2VM1 A;  4POK A;  2FGX A;  2V6O A;  2ALB A;  1GNE A;  1X5D A;  1SK1 A;  2LNT A;  3KH9 A;  2CX3 A;  3RAZ A;  3D5J A;  3K8N A;  6GSW A;  5CRH A;  3GUR A;  3TDG A;  16GS A;  3H79 A;  4OCF A;  1FHE A;  1G7O A;  4KX4 A;  3ZRE A;  3ZYW A;  2NTO A;  4HQS A;  5DQY A;  2CZ2 A;  2XHF A;  3R2Q A;  1XZO A;  5B8A A;  5IOW A;  5ID2 B;  5KN2 A;  1NW2 A;  1SK2 A;  2L6C A;  4KSM A;  3TKS A;  1K3Y A;  5IO2 A;  4POL A;  3I69 A;  2LNS A;  2R3X A;  1HNC A;  2LJA A;  2MBS A;  4XTS A;  4PNG A;  4EE0 A;  1J0F A;  4MK3 A;  2H30 A;  4G0I A;  3CYN A;  5EL8 A;  4K7N A;  1MD3 A;  1WPI A;  1TI3 A;  2QC7 A;  1YZX A;  1SEN A;  2XBI A;  3KZQ A;  4TR1 A;  3EMP A;  5ECP B;  3Q74 A;  1K0A A;  1AW9 A;  3IAM 2;  2GT6 A;  2WRT A;  4I97 A;  4GSN A;  3CSI A;  4H86 A;  3CTF A;  1XOA A;  1THO A;  4LL4 B;  4G9H A;  2IMF A;  4WKW A;  3W8J A;  1XIY A;  5INY A;  4XIH A;  4JE1 A;  2AUV A;  4PUR A;  4PXO A;  3MNG A;  5CRD A;  1GSS A;  1QFN A;  1OKT A;  2FWE A;  1Z6M A;  5IQY A;  4I2U A;  1AC1 A;  3ED3 A;  2DJ3 A;  3WYW A;  3QDN A;  3C7M A;  4MF5 A;  4V1A g;  3DEX A;  2LRT A;  11GS A;  1XXU A;  2LQO A;  4ZBD A;  1NSW A;  4LMW A;  2MMA A;  4EXJ A;  2L4Q A;  4GQF A;  3QAW A;  1FW1 A;  2HQT A;  3HZ8 A;  1WJK A;  3ZZX A;  1M9B A;  3WD6 A;  1WMJ A;  5AIX A;  3KH7 A;  1K0C A;  4K7I A;  5IOX A;  5DAL A;  2VL2 A;  2NVL A;  2K6V A;  2C3Q A;  2PER A;  4KDY A;  1A8Y A;  4V2N A;  1O8X A;  1YEX A;  2AJQ B;  4HEA 2;  4BWQ A;  1WOU A;  1BQ7 A;  4KGI A;  1ABA A;  3H4K A;  2VM2 A;  3M9J A;  1ZMA A;  2LJK A;  3O3T A;  3LWA A;  3Q18 A;  5IMD A;  2H0G A;  1UVZ A;  1N2A A;  3HJM A;  3FKF A;  1GUK A;  1AIU A;  2YWN A;  2A2R A;  5AIV A;  4Z7X A;  1NHY A;  3UAP A;  1M2D A;  3W6G A;  2VD1 A;  4MPF A;  1I9D A;  3BCK A;  3C71 A;  1ERT A;  1Z7R A;  18GS A;  1PL2 A;  1PX6 A;  3F6D A;  4HU7 A;  4MH2 A;  4IEL A;  3ZVJ A;  2FY6 A;  1F9M A;  1YQ1 A;  3F3Q A;  2TIR A;  3O6T A;  1TK8 B;  5A4U A;  4ECI A;  2M80 A;  1SL2 B;  1SD8 A;  3F63 A;  2KP1 A;  4J56 E;  1M0U A;  1B9X C;  4OMV A;  3LYP A;  1FG4 A;  2GTU A;  3FRC A;  4ZB6 A;  1WP0 A;  4YQU A;  3QFB C;  5J3R A;  1F3A A;  1GSU A;  4K0N A;  4L8E A;  3UMA A;  1G0T A;  2F9S A;  2VL9 A;  1EGR A;  2JAD A;  4O7H A;  1O73 A;  1PA3 A;  1V57 A;  2KP2 A;  4GTU A;  4AJ8 A;  4GF0 A;  2EIQ A;  2MYG A;  2XBQ A;  3HKR A;  4PTS A;  3BOA A;  2CAQ A;  4CDO A;  5J41 A;  3TJF A;  1SJ6 A;  4K9Z A;  4WET A;  1G6Y A;  5ECQ B;  2CA8 A;  3LFL A;  2CVK A;  3FY7 A;  1HD2 A;  2JZR A;  1QQ2 A;  1Z9H A;  1E6B A;  2CQ9 A;  3RHC A;  2MMO A;  3L78 A;  4MAB A;  2HYX A;  1SJI A;  1UN2 A;  2DIZ A;  4NHW A;  1XFL A;  2I3Y A;  4IHU A;  3G7Y A;  4USS A;  2C1Y A;  1QGV A;  2DSA A;  3IR4 A;  1K0M A;  1M9A A;  3D4T A;  3C8E A;  2HE3 A;  5H5Q A;  4HI7 A;  5D9X A;  1PSQ A;  1GSQ A;  3NIV A;  5LNK e;  3MAK A;  1OC9 A;  2I81 A;  1FVJ A;  1IYI A;  2IMK A;  1EWX A;  3W8S A;  1ERW A;  4MZB A;  2X64 A;  2CT6 A;  3GTU B;  2WDU A;  4FO5 A;  3HCZ A;  2B5E A;  4WBR D;  4O32 A;  3UAR A;  2JAC A;  5HQP A;  3P90 A;  3PIN A;  3G7J A;  2J23 A;  1R5A A;  2H72 A;  2JL4 A;  1YKA A;  4AF2 A;  2I4A A;  1U87 A;  5ECR B;  3EIN A;  4F9Z A;  5ECL B;  3F8U A;  4BVY A;  4G10 A;  1XPV A;  4Q5N A;  3RBT A;  5F8B A;  1GWC A;  1ERU A;  1H4O A;  2IFQ A;  3CSJ A;  4TOP A;  2DC5 A;  2H73 A;  5FWG A;  3TCO A;  2XPE A;  1EOG A;  1S3A A;  1PX7 A;  4ZXG A;  4PUF C;  2C80 A;  2VCQ A;  2VCX A;  5ID2 A;  1T00 A;  4OFM A;  4DVC A;  1K0D A;  1B48 A;  22GS A;  3GKX A;  3HY2 A;  2LRC A;  2ON5 A;  3VI7 A;  2H1G A;  3VUR A;  4YQM A;  5IMZ A;  1K3O A;  1V40 A;  4KF9 A;  3GKM A;  3GUS A;  2H1A A;  1EP7 A;  1JFU A;  4NV5 A;  2YZU A;  6GSU A;  1SKS B;  3FR6 A;  6GST A;  1VF3 A;  2HRK A;  2B6M A;  3D21 A;  4MH3 A;  3ZVJ D;  5DAL B;  4IP1 A;  4TN8 A;  3GKN A;  4PQI A;  5FHI A;  1U6T A;  2DJJ A;  4BPY A;  4MF7 A;  2N5A A;  3GH9 A;  1E2Y A;  1FAA A;  1PKW A;  4MZC A;  2Z9S A;  2GSS A;  4RUV A;  1AAZ A;  2XC2 A;  3FHK A;  3SBC A;  1N8J A;  3DVX A;  3WGE A;  3RHB A;  4TR0 A;  2B1K A;  3D6I A;  5HR0 A;  4HU9 A;  4RQX A;  4BVX A;  3FZA A;  4XHM A;  2REM A;  3IV4 A;  1M99 A;  2E2M A;  5DVB A;  4OFT A;  4HOJ A;  1GH2 A;  2DBC A;  2ZCT A;  2OBI A;  2F8A A;  2RM5 A;  3IK9 A;  3CBU A;  3UBL A;  3IRA A;  3C1S A;  1Z7P A;  3I43 A;  2WJU A;  3SWL A;  9GSS A;  2GST A;  3ME7 A;  2H74 A;  3IXR A;  2NPB A;  2C4J A;  3ZIT A;  5A4V A;  3GIX A;  1BG5 A;  5GSS A;  4KW6 A;  3IA1 A;  5E4W A;  1A2J A;  1MDJ A;  1WE0 A;  2HRN A;  3QAG A;  4ACS A;  2FWH A;  1YJ6 A;  2O89 A;  2V41 A;  4BVX B;  2VUP A;  1CQH A;  1S3D A;  4IBP A;  5AGY A;  5ABR A;  4Q5F A;  5EPF A;  1PD2 1;  5G1K A;  2OKA A;  1X9W B;  2YPM A;  5ECN B;  2WGR A;  4LL1 B;  1QXH A;  2YV9 A;  4XCS A;  1WWJ A;  3QCP A;  3IK7 A;  3GX0 A;  8GSS A;  1GUL A;  1GUM A;  2YJH A;  1HQO A;  1AQW A;  3UIW A;  3F6F A;  1CQG A;  3GTU A;  3RPN A;  3BJ5 A;  1TRW A;  4N10 A;  17GS A;  2GSR A;  3ZTL A;  3IDV A;  1OC9 B;  2A2S A;  2HXK A;  2P31 A;  5F06 A;  1TU7 A;  3Q6O A;  5HR1 A;  19GS A;  5J4U A;  1JZD A;  12GS A;  3O76 A;  1GLQ A;  4N0Z A;  4X0X A;  4XRD A;  4TVE A;  4KH7 A;  4WF4 A;  2MBT A;  3LOR A;  1ERV A;  2WFC A;  4KSO A;  2I9H A;  4E8E A;  1QMV A;  2YN1 A;  3CRT A;  5ELA A;  1BX9 A;  2YAN A;  1NM3 A;  3TRX A;  3N5O A;  4MJC A;  4BWS A;  1EP8 A;  3ZIV A;  1XVQ A;  1A2M A;  1TXX A;  3FW2 A;  2BMX A;  2WUL A;  4EVM A;  3M8N A;  4YQV A;  1K3L A;  1GSE A;  5D9T A;  5B6M A;  3UBK A;  2DML A;  1X5E A;  5COH A;  2H70 A;  2GZY A;  1FB6 A;  1LU4 A;  5G5F A;  1F37 A;  3A2X A;  4ML6 A;  2V1M A;  4MMM A;  3LYK A;  1YY7 A;  1O85 A;  13GS A;  3IPZ A;  2H6Z A;  3GX8 A;  3WGD A;  2O87 A;  5J5N A;  5JWQ B;  3UVH A;  5AN1 A;  5BMU A;  2WCI A;  1DE1 A;  1V58 A;  1R26 A;  3ERG A;  3QOU A;  1T7P B;  3U5R E; 
#chains in the Genus database with same CATH topology
 4PX1 A;  1OKD A;  3P7X A;  4O5U A;  2CZ3 A;  1YVL A;  1T4Y A;  3DKS A;  5DJL A;  1YEP A;  3VWW A;  5DBQ A;  4E68 A;  3F9U A;  4WF5 A;  1MDK A;  1T3B A;  2FUG 2;  2VLV A;  4OD7 A;  4HZ4 A;  1GRX A;  3HD5 A;  5ECK B;  5IO0 A;  4QQ7 A;  4EL1 A;  4JRR A;  5GST A;  1YF1 A;  2H71 A;  4IN0 A;  3TJJ A;  1XOB A;  2G0F A;  1X9S B;  3A5I A;  4F82 A;  5H5S A;  1PN9 A;  3MIX A;  1PRX A;  1XCC A;  1YEW C;  5HR3 A;  3H8Q A;  2PVO C;  2HT9 A;  2VAF A;  1GL8 A;  3FEU A;  2X8C A;  1SD9 A;  1SJZ A;  2H1D A;  4RQR A;  2GZP A;  1EOH A;  1BED A;  3APO A;  4DSQ A;  1Y6E A;  3TRP A;  2VOC A;  3MWH A;  2AYT A;  1U3A A;  2X4A A;  1EV4 A;  3F0I A;  1NHO A;  1R5P A;  2YNX A;  2AB6 A;  5A4W A;  4GDF A;  4XS4 B;  1GSY A;  2IWT A;  1SVO A;  3M1G A;  4NXI A;  3E9J B;  1KTE A;  4X43 A;  3KM6 A;  4DSS A;  4LLR A;  1F2E A;  2DMM A;  4ECC A;  3LEF A;  3EC3 A;  1JLV A;  2K8S A;  2L5L A;  2EFC A;  5E59 A;  4XS1 A;  3CXG A;  5C00 A;  2EIR A;  3FZ9 A;  4JR6 A;  1XWC A;  4YAV A;  4YH2 A;  2H01 A;  3ZMK A;  1T4Z A;  2IMI A;  3LSZ A;  2IMD A;  4K8M A;  2DJK A;  4KB3 A;  1B9Y C;  4HUA A;  3D4M A;  3GFK A;  3US3 A;  4JU5 A;  1DE2 A;  3GKK A;  2A2P A;  4F03 A;  1WIK A;  3UOM A;  1ZOF A;  2HRF A;  3GMF A;  1H75 A;  5ENU A;  4X1U A;  4DSR A;  3EWL A;  1SYX A;  2AHE A;  1YDK A;  1TJD A;  5EVO A;  3ZLP A;  5G30 A;  2OE0 A;  2WB9 A;  2X8G A;  2HZF A;  4EKZ A;  5KN3 A;  3VFI A;  4ECJ A;  2EFD A;  2B3S A;  4POM A;  3DRN A;  1EEJ A;  2R2J A;  3CWG A;  3PPU A;  1Z6N A;  4Z2U A;  5G31 A;  1GSD A;  4JED A;  3DVW A;  2GGT A;  4WR4 A;  2FA4 A;  3IHQ A;  3WGX A;  2KUC A;  2K18 A;  7GSS A;  5IPH A;  2QA1 A;  1GTU A;  4MJB A;  3HJO A;  3S9F A;  2E0Q A;  1ILO A;  2JSZ A;  4OCE A;  2HZE B;  3LXT A;  3HHV A;  1JHB A;  2N5B A;  2RII A;  3GNJ A;  5D96 A;  1FOV A;  2MMZ A;  4NV2 A;  2H6Y A;  2PVQ A;  1UC7 A;  2HFD A;  4KDU A;  5IMV A;  1MTC A;  2LV3 A;  2CAI A;  1EV9 A;  2C0D A;  1XW6 A;  5J9B A;  4F0C A;  2YWO A;  2QSI A;  3RPP A;  4Q5Q A;  4LA1 A;  2DLX A;  4FIW A;  4GXZ A;  3CQF A;  3KIJ A;  3DIE A;  1SKR B;  4ISD A;  3LG6 A;  3ME8 A;  2KLX A;  4KA0 A;  5B7C A;  4OO4 A;  2E2G A;  4PGT A;  3KP9 A;  1XVW A;  2N5F A;  3R3E A;  2OE3 A;  2QKE A;  1KBN A;  2A4V A;  1DSB A;  4NHZ A;  4MLY A;  2GQM A;  5IMA A;  1GP1 A;  2QA2 A;  3PH9 A;  1F3B A;  4MNN A;  3TOT A;  2H8L A;  2HRA A;  3QFA C;  1B8X A;  1AUC A;  3KTL A;  1Z5Y E;  5DAK B;  2OBK A;  1DBY A;  4MCU A;  3H1N A;  4TXO A;  1Z3E A;  5D8I A;  1SVL A;  1LBK A;  1W4V A;  3GL5 A;  2L57 A;  2GDR A;  1OC8 A;  3TKP A;  3IOS A;  2GT5 A;  2ZNM A;  3ZRD A;  1OE8 A;  1HNB A;  1K0O A;  4GLT A;  3A3T A;  2OAC A;  5HFK A;  2PPT A;  4EUY A;  2AAW A;  4K2X A;  5ELG A;  5HFI A;  3TGZ A;  5A5K A;  1A8L A;  4WEY A;  1R4W A;  3F4R A;  3GH6 A;  1OE7 A;  3ISO A;  1G6W A;  3F4T A;  3HA9 A;  4NAX A;  2NBS A;  4N0V A;  1FB0 A;  4AKH A;  1A0F A;  2O7K A;  2HI7 A;  1TI1 A;  5H5R A;  4XS6 A;  5IPG A;  1S4B P;  1A23 A;  1AQV A;  1V9W A;  2QGV A;  5J4V A;  3EUR A;  2OA7 A;  1FO5 A;  1OYJ A;  2YV7 A;  5JCW A;  2P5R A;  3IHG A;  3TKR A;  1EEM A;  4WBJ A;  3N9J A;  5KOW A;  2DJ0 A;  2JU5 A;  3FK8 A;  5KN0 A;  3QPM A;  3UL3 A;  1ZZY A;  3M3M A;  3ZIJ A;  5A34 A;  2LQQ A;  1O8W A;  1Y25 A;  2K8V A;  1I5G A;  3BD2 A;  5F07 A;  5CP1 A;  5LD0 A;  4JR4 A;  2R5G A;  4KE3 A;  2CVD A;  4TRX A;  4CW9 A;  2C3N A;  2HLS A;  1I1I P;  1TRU A;  2H1B A;  3TU3 B;  4L0W A;  3TJB A;  4TKY A;  2GS3 A;  4IKH A;  5J9C A;  2H0H A;  2HSN B;  1O7U A;  4IVF A;  3HVX A;  1PN0 A;  2F51 A;  1ZYQ B;  3CMI A;  4G2E A;  4MZW A;  3HZ4 A;  4L5L A;  5EY6 A;  3F3R A;  4MDC A;  3CHX C;  3VPT A;  4BL7 A;  2F3M A;  2X8H A;  4XRA A;  4YKF A;  3HYP A;  4GST A;  2PGT A;  2X99 A;  4NMU A;  3NOF A;  4ZB8 A;  1ZYN A;  3FR9 A;  1TTZ A;  2R0C A;  2JSY A;  2M46 A;  4J2F A;  4N3Z A;  3MSZ A;  1G7E A;  2LEG A;  1JZW A;  2V2G A;  2GQL A;  2G2Q A;  1GTA A;  3DWV A;  4FYB A;  4HS1 A;  3LQ7 A;  2I1U A;  1TK0 B;  5DCH A;  4ICY A;  20GS A;  5A5H A;  5CRG A;  3M0F A;  1AXD A;  4MPG A;  3UJ1 A;  3TKS E;  2C3T A;  2ES7 A;  4MP4 A;  4IS0 A;  4ZL8 A;  2KHP A;  4ZL9 A;  4KAE A;  2B7J A;  2IFQ B;  4J57 E;  4ZB9 A;  4TXV A;  2CV4 A;  3ERW A;  4N30 A;  3L0H A;  5AIS A;  4OWY A;  3VWX A;  2RUE A;  2L59 A;  4Z2R A;  3RDW A;  3WT2 A;  4QL9 A;  1U3I A;  2GLR A;  1Q4J A;  4G0K A;  6GSY A;  5CAX A;  2BTO T;  3HVS A;  3FZ5 A;  3GYK A;  3HMJ G;  2EIO A;  3ERF A;  3TJK A;  4EDZ A;  3Q19 A;  1MD4 A;  2PWJ A;  2YWI A;  5D93 A;  4E8H A;  2DKH A;  5IM9 A;  1VF4 A;  4KDX A;  1SL1 B;  3IBH A;  4GWR A;  1XWG A;  4BA7 A;  2VLT A;  1XBS A;  2LRN A;  1HYU A;  5IMC A;  4PQH A;  2L4C A;  3BBY A;  2LKU A;  3H93 A;  2L6D A;  2VD0 A;  1M2A A;  4K0G A;  3FZ4 A;  1URM A;  1GTB A;  3A2V A;  2HSH A;  2PU9 C;  5G5E A;  1TOF A;  2YJ7 A;  2C0F A;  1X9M B;  2FLS A;  2IME A;  2GZZ A;  3DYR A;  4Q5R A;  5C04 A;  1RW1 A;  1ZGN A;  2TRX A;  3GN3 A;  3HJP A;  2D2Z A;  3GST A;  4L5O A;  6GSS A;  2WW1 A;  2FWG A;  4AI6 A;  1VF2 A;  3LGC A;  3J7Y b;  1TRS A;  3DXB A;  3E3E A;  10GS A;  3L9V A;  3G7I A;  3EU3 A;  1KEB A;  4LMV A;  2H19 A;  1K0B A;  3UEM A;  2YP6 A;  5KN1 A;  4DEJ A;  3VWU A;  2VIM A;  2IL3 A;  5ECM B;  4ECB A;  1GUH A;  3AY8 A;  1IYH A;  3F4S A;  3TOU A;  2H75 A;  2C0E A;  3D22 A;  3PR8 A;  2WVY A;  3CSH A;  3KMN A;  3ZFL A;  3KEB A;  3KCM A;  5ECS A;  4EC0 A;  4MJA A;  2E7P A;  3KD0 A;  3M9K A;  3TB2 A;  1PQN A;  5CRE A;  1TW9 A;  5D73 A;  1XG8 A;  5GZZ B;  3TKS C;  3JCM L;  2DKI A;  2WS2 A;  4K5R A;  2R6K A;  3CRU A;  1UA5 A;  1XWB A;  2LTK A;  4ZBB A;  4BL7 B;  2VLU A;  3GA4 A;  5D9V A;  2PUK C;  2EC4 A;  2FWF A;  1ST9 A;  2PN8 A;  4V1A p;  4YAP A;  2LST A;  3HDC A;  1ZYE A;  3VI5 A;  2B1L A;  3LXZ A;  3KTB A;  1ML6 A;  3J7Y k;  4JBB A;  2OAD A;  2HSN A;  1MDI A;  1MEK A;  5D9W A;  4G19 A;  3ZFB A;  1VF1 A;  4KUN A;  1YF0 A;  1O6J A;  1TK5 B;  3IC4 A;  4TW5 A;  4POB A;  2C0G A;  3VLN A;  2M72 A;  1K0N A;  3DD3 A;  1PL1 A;  2OJL A;  4RI6 A;  14GS A;  3HVV A;  4Z2T A;  3MDK A;  3FR3 A;  2GQK A;  4IJI A;  4OO5 A;  5F0G A;  2FHE A;  1OVN A;  4DSS B;  4O92 A;  4PUA A;  1TRV A;  3C73 A;  3WT1 A;  2JZT A;  3UVT A;  3E0U A;  1XW5 A;  4O5Q A;  3P8W A;  1TU8 A;  2H76 A;  5ECO B;  1T1V A;  4GSS A;  2LUS A;  3VWV A;  3VK9 A;  3GHA A;  1U88 A;  4WR5 A;  4ILF A;  5B8B A;  3NZN A;  4PQ1 A;  2BJX A;  3A5W A;  1SU9 A;  5G1L A;  4IJ3 A;  3DGQ A;  3D0Z A;  1PMT A;  3HXS A;  3C1R A;  2VCZ A;  4D73 B;  2HSM B;  3QD9 A;  5ECI B;  2KOK A;  3KXO A;  4JZQ A;  2DIY A;  1T8E B;  2DJ1 A;  4EDY A;  3L9S A;  1B4P A;  1THX A;  2HZE A;  2IN3 A;  2LJR A;  4AKI A;  2VCT A;  3G9B A;  4AJ7 A;  1W89 A;  4QL7 A;  1YKC A;  4CHS A;  1BAY A;  2RLI A;  4MJE A;  1EGO A;  4V2L A;  3A2W A;  5DQS A;  5JWO B;  4ZL7 A;  1JZR A;  3TRQ A;  1AQX A;  4TXO B;  3EYT A;  1GTI A;  1EZK A;  2YOI A;  4FYU A;  2WVX A;  2H6X A;  1V2A A;  3QAV A;  1OAZ A;  5CRW A;  3GSS A;  2H0I A;  4V2M A;  1F6M C;  1X0R A;  2WZ9 A;  2A4H A;  3L4N A;  2YWM A;  4G0L A;  5CO3 A;  1M7T A;  3I9V 2;  4O5R A;  5KEJ A;  4TR3 A;  4K7O A;  2H66 A;  1JLW A;  4HZ2 A;  5IMF A;  3IAS 2;  3IE3 A;  1XWK A;  3EE2 A;  1M2B A;  4HSC X;  1SYR A;  4KCE A;  5CYY A;  2R0P A;  4AJ6 A;  3BCI A;  1ZYP A;  4HQZ A;  4TR4 A;  5J47 A;  1TKD B;  3KMO A;  2B5X A;  3QMX A;  1TDI A;  3ZML A;  2PMT A;  3APQ A;  2MZC A;  4HDE A;  5JCG A;  3CTG A;  1J9B A;  1SKW B;  2AV4 A;  4CY6 A;  4YKG A;  5F05 A;  4AGS A;  2WVX B;  5L71 A;  2R0G A;  5A5H B;  2RUF A;  1WRY A;  2IJY A;  2O8V B;  2P0G A;  3PGT A;  3OR5 A;  3LW9 A;  1QUW A;  5A34 B;  5DAK A;  1PFO A;  1R7H A;  3P2A A;  4IQ1 A;  2OT3 A;  1JZO A;  1USB A;  1O81 A;  1V98 A;  2RM6 A;  5B6N A;  4K6X A;  3V1W A;  3TUE A;  5CNW A;  2IIY A;  2CX4 A;  4MA9 A;  3GV1 A;  2FD3 A;  4FYC A;  3ZL5 A;  4D73 A;  5GAP D;  4RI7 A;  5GAN D;  5DDL A;  1PGT A;  4I5Q A;  4ZIL A;  4ULX A;  4IQA A;  4WXT A;  4CY8 A;  1X5C A;  3U6V A;  2K9F A;  5J40 A;  2VCW A;  2CVB A;  2FA8 A;  1PKZ A;  4ML1 A;  1GLP A;  3EU4 A;  2DJ2 A;  5LCZ A;  4NWY A;  2PBJ A;  4GRF A;  1KNG A;  3KP8 A;  1DUG A;  3FYG A;  3IC8 A;  5HFG A;  2O36 A;  6GSV A;  1M3I A;  2O85 A;  1HNA A;  4IW9 A;  2UZ8 A;  2ZUP A;  4BVY B;  2XPD A;  4IP6 A;  2TRC P;  4GQC A;  4F0B A;  1J08 A;  2P5Q A;  5A1N A;  4F2I A;  4L0U A;  3TKQ A;  1RQM A;  4P3Y B;  4I2T A;  2V6K A;  3EVI A;  5JCU A;  1BJX A;  2JZS A;  2NDO A;  5DCG A;  1ZCP A;  3TJG A;  4K2D A;  2GVP A;  1LJR A;  3QR6 A;  1FVK A;  2HSY A;  5DJM A;  1XWA A;  1QK8 A;  2C8U A;  2L5O A;  4KND A;  3KGK A;  1A0R P;  4IGJ A;  2VL2 C;  3LJR A;  4I8B A;  3APS A;  2B5Y A;  4TR1 B;  5JWR B;  1A2L A;  4MF6 A;  4XS4 A;  4ZBA A;  2J9H A;  1C72 A;  3I6A A;  5G2Z A;  5FT3 A;  4HJ2 A;  4OFN A;  5ECH B;  4FH8 A;  4KCA A;  2ON7 A;  1SK0 A;  3L9U A;  4I6X A;  2V32 A;  3DML A;  4ID0 A;  2MMN A;  2F8F A;  1GSF A;  1SVM A;  1SL0 B;  1XW9 A;  4PNF A;  4NPB A;  4EF0 A;  1Q98 A;  2YCD A;  2YZH A;  2VCV A;  4N11 A;  2HNL A;  3GL3 A;  5IIZ A;  2VO4 A;  5A1N B;  2FNO A;  2VL3 A;  2LS5 A;  3KJY A;  2HRK B;  4GCI A;  1B4Q A;  2R4V A;  4ZIJ A;  2FCH A;  5HR2 A;  1RK4 A;  6GSX A;  2OE1 A;  4HJM A;  2B7K A;  1OC3 A;  3EMX A;  1GNW A;  5J4Y A;  1VGL A;  2HSM A;  4EO3 A;  2R37 A;  3GRX A;  1S3C A;  1A24 A;  4PI0 C;  2GSQ A;  1VRS D;  4K1F A;  3VPQ A;  2IPA A;  1ON4 A;  1ACV A;  1ZL9 A;  1TP9 A;  2EFH A;  4FQU A;  1BYE A;  2VM1 A;  4POK A;  4W66 A;  2FGX A;  2V6O A;  2ALB A;  1GNE A;  3RGB C;  1X5D A;  1SK1 A;  2LNT A;  3KH9 A;  4PHZ C;  2CX3 A;  3RAZ A;  3D5J A;  3K8N A;  6GSW A;  5CRH A;  3GUR A;  3TDG A;  16GS A;  4X4J A;  3H79 A;  1S3R A;  4OCF A;  1FHE A;  1G7O A;  4KX4 A;  3ZRE A;  3ZYW A;  2NTO A;  4HQS A;  5DQY A;  2CZ2 A;  2XHF A;  1FOH A;  3R2Q A;  2EFE A;  1XZO A;  5B8A A;  5IOW A;  5ID2 B;  5KN2 A;  1NW2 A;  1SK2 A;  2L6C A;  4KSM A;  3TKS A;  1K3Y A;  5IO2 A;  4POL A;  3I69 A;  2LNS A;  2R3X A;  1HNC A;  2LJA A;  2MBS A;  4XTS A;  4PNG A;  4EE0 A;  1J0F A;  4MK3 A;  2H30 A;  4G0I A;  3CYN A;  4K7N A;  5EL8 A;  1MD3 A;  1WPI A;  3EPT A;  1TI3 A;  2QC7 A;  1YZX A;  1SEN A;  2XBI A;  3KZQ A;  4TR1 A;  3EMP A;  5ECP B;  3Q74 A;  1K0A A;  1AW9 A;  3IAM 2;  2GT6 A;  2WRT A;  4I97 A;  4GSN A;  3CSI A;  4H86 A;  3CTF A;  1XOA A;  1THO A;  4LL4 B;  4G9H A;  2IMF A;  4WKW A;  3W8J A;  1XIY A;  5INY A;  4XIH A;  4JE1 A;  2AUV A;  4PUR A;  4PXO A;  3MNG A;  5CRD A;  1GSS A;  1QFN A;  1OKT A;  2FWE A;  1Z6M A;  5IQY A;  4I2U A;  1AC1 A;  3ED3 A;  2DJ3 A;  3WYW A;  3QDN A;  3C7M A;  4MF5 A;  4V1A g;  3DEX A;  2LRT A;  11GS A;  1XXU A;  2LQO A;  4ZBD A;  1NSW A;  4LMW A;  2MMA A;  4EXJ A;  1TXU A;  2L4Q A;  3HVN A;  4GQF A;  3QAW A;  1FW1 A;  2HQT A;  3HZ8 A;  1WJK A;  2O5V A;  3ZZX A;  1M9B A;  3WD6 A;  1WMJ A;  5AIX A;  3KH7 A;  1K0C A;  4K7I A;  5IOX A;  5DAL A;  2VL2 A;  2NVL A;  2K6V A;  2C3Q A;  2PER A;  4KDY A;  1A8Y A;  4V2N A;  1O8X A;  1YEX A;  2AJQ B;  4HEA 2;  4BWQ A;  1WOU A;  1BQ7 A;  4KGI A;  1ABA A;  3H4K A;  2VM2 A;  2WZS A;  3M9J A;  1ZMA A;  2LJK A;  3O3T A;  3LWA A;  3Q18 A;  5IMD A;  2H0G A;  1UVZ A;  1N2A A;  3HJM A;  3FKF A;  1GUK A;  1AIU A;  2YWN A;  2A2R A;  5AIV A;  4Z7X A;  1NHY A;  3UAP A;  1M2D A;  3W6G A;  2VD1 A;  4MPF A;  1I9D A;  3BCK A;  3C71 A;  1ERT A;  1Z7R A;  4G01 A;  18GS A;  1PL2 A;  1PX6 A;  3F6D A;  4HU7 A;  4MH2 A;  4IEL A;  3ZVJ A;  4PI2 C;  2FY6 A;  1F9M A;  1YQ1 A;  3F3Q A;  2TIR A;  3O6T A;  1TK8 B;  5A4U A;  4ECI A;  2M80 A;  1SL2 B;  1SD8 A;  3F63 A;  4FXY P;  2KP1 A;  4J56 E;  1M0U A;  1B9X C;  4OMV A;  3LYP A;  1FG4 A;  2GTU A;  3FRC A;  4ZB6 A;  1WP0 A;  4YQU A;  3QFB C;  5J3R A;  1F3A A;  1GSU A;  4K0N A;  4L8E A;  3UMA A;  1G0T A;  2F9S A;  2VL9 A;  1EGR A;  2JAD A;  4O7H A;  1Y1U A;  1O73 A;  1PA3 A;  1M3J A;  1V57 A;  2KP2 A;  4GTU A;  4AJ8 A;  4GF0 A;  2EIQ A;  2MYG A;  2XBQ A;  3HKR A;  4PTS A;  3BOA A;  2CAQ A;  4CDO A;  5J41 A;  3TJF A;  2WW3 A;  1SJ6 A;  4K9Z A;  3RFR C;  4WET A;  1G6Y A;  5ECQ B;  2CA8 A;  3LFL A;  2CVK A;  3FY7 A;  1HD2 A;  2JZR A;  1QQ2 A;  1Z9H A;  1E6B A;  2CQ9 A;  3RHC A;  2MMO A;  3L78 A;  2WW0 A;  4MAB A;  2HYX A;  1SJI A;  1UN2 A;  2DIZ A;  4NHW A;  1XFL A;  2I3Y A;  4IHU A;  3G7Y A;  4USS A;  2C1Y A;  1QGV A;  2DSA A;  3IR4 A;  1K0M A;  1M9A A;  3D4T A;  3C8E A;  2HE3 A;  5H5Q A;  4HI7 A;  5D9X A;  1PSQ A;  1GSQ A;  3NIV A;  5LNK e;  3MAK A;  1OC9 A;  2I81 A;  1FVJ A;  1IYI A;  2IMK A;  1EWX A;  3W8S A;  1ERW A;  4MZB A;  2X64 A;  2CT6 A;  2VKZ G;  3GTU B;  4EIQ A;  2WDU A;  4FO5 A;  3HCZ A;  2B5E A;  4WBR D;  4O32 A;  3UAR A;  2JAC A;  5HQP A;  3P90 A;  3PIN A;  3G7J A;  2J23 A;  1R5A A;  4A5P A;  2H72 A;  2JL4 A;  1YKA A;  4AF2 A;  2I4A A;  1U87 A;  2WVZ A;  5ECR B;  3EIN A;  4F9Z A;  5ECL B;  3F8U A;  4BVY A;  4G10 A;  1XPV A;  4Q5N A;  3RBT A;  5F8B A;  1GWC A;  1ERU A;  1H4O A;  2IFQ A;  3CSJ A;  4TOP A;  2DC5 A;  2H73 A;  5FWG A;  3TCO A;  2XPE A;  1EOG A;  1S3A A;  1PX7 A;  2O3E A;  4ZXG A;  4PUF C;  2C80 A;  2VCQ A;  2VCX A;  5ID2 A;  1T00 A;  4QMK A;  4OFM A;  4AKG A;  4DVC A;  1K0D A;  1B48 A;  22GS A;  3GKX A;  3HY2 A;  2LRC A;  2ON5 A;  3VI7 A;  2H1G A;  3VUR A;  4YQM A;  1K3O A;  1V40 A;  4KF9 A;  5IMZ A;  3GKM A;  3GUS A;  2H1A A;  1EP7 A;  2UV8 G;  1JFU A;  4NV5 A;  2YZU A;  6GSU A;  1SKS B;  3FR6 A;  6GST A;  4K5S A;  1VF3 A;  2HRK A;  2B6M A;  3D21 A;  4MH3 A;  3ZVJ D;  5DAL B;  4IP1 A;  4TN8 A;  3GKN A;  4PQI A;  5FHI A;  1U6T A;  2DJJ A;  4BPY A;  4MF7 A;  2N5A A;  3GH9 A;  1E2Y A;  4BIK A;  5KOX A;  1FAA A;  1PKW A;  4MZC A;  2Z9S A;  2GSS A;  4RUV A;  1AAZ A;  2XC2 A;  3FHK A;  3SBC A;  1N8J A;  3DVX A;  3WGE A;  3RHB A;  4TR0 A;  2B1K A;  3D6I A;  5HR0 A;  4HU9 A;  2X49 A;  1BF5 A;  4RQX A;  4BVX A;  3FZA A;  4XHM A;  2REM A;  3IV4 A;  1M99 A;  2E2M A;  5DVB A;  4OFT A;  4HOJ A;  5BMU B;  1GH2 A;  2DBC A;  2ZCT A;  3MYD A;  2OBI A;  2F8A A;  2RM5 A;  2WW2 A;  3IK9 A;  3CBU A;  3UBL A;  3IRA A;  3C1S A;  1Z7P A;  3I43 A;  2WJU A;  3SWL A;  9GSS A;  2GST A;  3ME7 A;  1N25 A;  2H74 A;  3IXR A;  2NPB A;  2C4J A;  3ZIT A;  3FMW A;  5A4V A;  3GIX A;  1BG5 A;  5GSS A;  4KW6 A;  3IA1 A;  5E4W A;  1A2J A;  1MDJ A;  1WE0 A;  2HRN A;  3QAG A;  4ACS A;  2FWH A;  1YJ6 A;  2O89 A;  2V41 A;  4BVX B;  2VUP A;  1CQH A;  1S3D A;  4IBP A;  5AGY A;  5ABR A;  4Q5F A;  5EPF A;  1PD2 1;  5G1K A;  2OKA A;  1X9W B;  2YPM A;  5ECN B;  2WGR A;  4LL1 B;  1BG1 A;  1QXH A;  2YV9 A;  4XCS A;  1WWJ A;  3QCP A;  3IK7 A;  3GX0 A;  8GSS A;  1GUL A;  1GUM A;  2YJH A;  1HQO A;  1AQW A;  5BRT A;  3UIW A;  3F6F A;  4ZB7 A;  1CQG A;  3GTU A;  3RPN A;  3BJ5 A;  1TRW A;  4N10 A;  17GS A;  2GSR A;  3ZTL A;  3IDV A;  1OC9 B;  2A2S A;  2HXK A;  2P31 A;  5F06 A;  1TU7 A;  3Q6O A;  5HR1 A;  19GS A;  4EIP A;  5J4U A;  1JZD A;  12GS A;  3O76 A;  1GLQ A;  4N0Z A;  4X0X A;  4XRD A;  4TVE A;  4KH7 A;  4WF4 A;  2MBT A;  3LOR A;  2H1L A;  1ERV A;  2WFC A;  4KSO A;  2I9H A;  4E8E A;  1QMV A;  2YN1 A;  3CRT A;  5ELA A;  1BX9 A;  2YAN A;  1NM3 A;  3TRX A;  3N5O A;  4MJC A;  4BWS A;  1EP8 A;  3ZIV A;  1XVQ A;  4AKX B;  1A2M A;  1TXX A;  3FW2 A;  2BMX A;  2WUL A;  4EVM A;  3M8N A;  4YQV A;  1K3L A;  1GSE A;  5D9T A;  5B6M A;  3UBK A;  2DML A;  1X5E A;  5COH A;  2H70 A;  2GZY A;  1FB6 A;  1LU4 A;  5G5F A;  1F37 A;  3A2X A;  4ML6 A;  2V1M A;  4MMM A;  3LYK A;  1YY7 A;  1O85 A;  13GS A;  3IPZ A;  2H6Z A;  3GX8 A;  3WGD A;  2O87 A;  5J5N A;  5JWQ B;  3UVH A;  5AN1 A;  5BMU A;  2WCI A;  1DE1 A;  1V58 A;  1R26 A;  3ERG A;  3QOU A;  1T7P B;  3U5R E; 
#chains in the Genus database with same CATH homology
 4PX1 A;  1OKD A;  3P7X A;  4O5U A;  2CZ3 A;  1YVL A;  1T4Y A;  3DKS A;  5DJL A;  1YEP A;  3VWW A;  5DBQ A;  4E68 A;  3F9U A;  4WF5 A;  1MDK A;  1T3B A;  2FUG 2;  2VLV A;  4OD7 A;  4HZ4 A;  1GRX A;  3HD5 A;  5ECK B;  5IO0 A;  4QQ7 A;  4EL1 A;  4JRR A;  5GST A;  1YF1 A;  2H71 A;  4IN0 A;  3TJJ A;  1XOB A;  2G0F A;  1X9S B;  3A5I A;  4F82 A;  5H5S A;  1PN9 A;  3MIX A;  1PRX A;  1XCC A;  5HR3 A;  3H8Q A;  2PVO C;  2HT9 A;  2VAF A;  1GL8 A;  3FEU A;  2X8C A;  1SD9 A;  1SJZ A;  2H1D A;  4RQR A;  2GZP A;  1EOH A;  1BED A;  3APO A;  4DSQ A;  1Y6E A;  3TRP A;  2VOC A;  3MWH A;  2AYT A;  1U3A A;  2X4A A;  1EV4 A;  3F0I A;  1NHO A;  1R5P A;  2YNX A;  2AB6 A;  5A4W A;  4GDF A;  4XS4 B;  1GSY A;  2IWT A;  1SVO A;  3M1G A;  4NXI A;  3E9J B;  1KTE A;  4X43 A;  3KM6 A;  4DSS A;  4LLR A;  1F2E A;  2DMM A;  4ECC A;  3LEF A;  3EC3 A;  1JLV A;  2K8S A;  2L5L A;  2EFC A;  5E59 A;  4XS1 A;  3CXG A;  5C00 A;  2EIR A;  3FZ9 A;  4JR6 A;  1XWC A;  4YAV A;  4YH2 A;  2H01 A;  3ZMK A;  1T4Z A;  2IMI A;  3LSZ A;  2IMD A;  4K8M A;  2DJK A;  4KB3 A;  1B9Y C;  4HUA A;  3D4M A;  3GFK A;  3US3 A;  4JU5 A;  1DE2 A;  3GKK A;  2A2P A;  4F03 A;  1WIK A;  3UOM A;  1ZOF A;  2HRF A;  3GMF A;  1H75 A;  5ENU A;  4X1U A;  4DSR A;  3EWL A;  1SYX A;  2AHE A;  1YDK A;  1TJD A;  5EVO A;  3ZLP A;  5G30 A;  2OE0 A;  2WB9 A;  2X8G A;  2HZF A;  4EKZ A;  5KN3 A;  3VFI A;  4ECJ A;  2EFD A;  2B3S A;  4POM A;  3DRN A;  1EEJ A;  2R2J A;  3CWG A;  3PPU A;  1Z6N A;  4Z2U A;  5G31 A;  1GSD A;  4JED A;  3DVW A;  2GGT A;  4WR4 A;  2FA4 A;  3IHQ A;  3WGX A;  2KUC A;  2K18 A;  7GSS A;  5IPH A;  2QA1 A;  1GTU A;  4MJB A;  3HJO A;  3S9F A;  2E0Q A;  1ILO A;  2JSZ A;  4OCE A;  2HZE B;  3LXT A;  3HHV A;  1JHB A;  2N5B A;  2RII A;  3GNJ A;  5D96 A;  1FOV A;  2MMZ A;  4NV2 A;  2H6Y A;  2PVQ A;  1UC7 A;  2HFD A;  4KDU A;  5IMV A;  1MTC A;  2LV3 A;  2CAI A;  1EV9 A;  2C0D A;  1XW6 A;  5J9B A;  4F0C A;  2YWO A;  2QSI A;  3RPP A;  4Q5Q A;  4LA1 A;  2DLX A;  4FIW A;  4GXZ A;  3KIJ A;  3DIE A;  1SKR B;  4ISD A;  3LG6 A;  3ME8 A;  2KLX A;  4KA0 A;  5B7C A;  4OO4 A;  2E2G A;  4PGT A;  3KP9 A;  1XVW A;  2N5F A;  3R3E A;  2OE3 A;  2QKE A;  1KBN A;  2A4V A;  1DSB A;  4NHZ A;  4MLY A;  2GQM A;  5IMA A;  1GP1 A;  2QA2 A;  3PH9 A;  1F3B A;  4MNN A;  3TOT A;  2H8L A;  2HRA A;  3QFA C;  1B8X A;  1AUC A;  3KTL A;  1Z5Y E;  5DAK B;  2OBK A;  1DBY A;  4MCU A;  3H1N A;  4TXO A;  1Z3E A;  5D8I A;  1SVL A;  1LBK A;  1W4V A;  3GL5 A;  2L57 A;  2GDR A;  1OC8 A;  3TKP A;  3IOS A;  2GT5 A;  2ZNM A;  3ZRD A;  1OE8 A;  1HNB A;  1K0O A;  4GLT A;  3A3T A;  2OAC A;  5HFK A;  2PPT A;  4EUY A;  2AAW A;  4K2X A;  5ELG A;  5HFI A;  3TGZ A;  5A5K A;  1A8L A;  4WEY A;  1R4W A;  3F4R A;  3GH6 A;  1OE7 A;  3ISO A;  1G6W A;  3F4T A;  3HA9 A;  4NAX A;  2NBS A;  4N0V A;  1FB0 A;  4AKH A;  1A0F A;  2O7K A;  2HI7 A;  1TI1 A;  5H5R A;  4XS6 A;  5IPG A;  1A23 A;  1AQV A;  1V9W A;  2QGV A;  5J4V A;  3EUR A;  2OA7 A;  1FO5 A;  1OYJ A;  2YV7 A;  5JCW A;  2P5R A;  3IHG A;  3TKR A;  1EEM A;  4WBJ A;  3N9J A;  5KOW A;  2DJ0 A;  2JU5 A;  3FK8 A;  5KN0 A;  3QPM A;  3UL3 A;  1ZZY A;  3M3M A;  3ZIJ A;  5A34 A;  2LQQ A;  1O8W A;  1Y25 A;  2K8V A;  1I5G A;  3BD2 A;  5F07 A;  5CP1 A;  5LD0 A;  4JR4 A;  2R5G A;  4KE3 A;  2CVD A;  4TRX A;  4CW9 A;  2C3N A;  2HLS A;  1TRU A;  2H1B A;  3TU3 B;  4L0W A;  3TJB A;  4TKY A;  2GS3 A;  4IKH A;  5J9C A;  2H0H A;  2HSN B;  1O7U A;  4IVF A;  3HVX A;  1PN0 A;  2F51 A;  1ZYQ B;  3CMI A;  4G2E A;  4MZW A;  3HZ4 A;  4L5L A;  5EY6 A;  3F3R A;  4MDC A;  3VPT A;  4BL7 A;  2F3M A;  2X8H A;  4XRA A;  4YKF A;  3HYP A;  4GST A;  2PGT A;  2X99 A;  4NMU A;  3NOF A;  4ZB8 A;  1ZYN A;  3FR9 A;  1TTZ A;  2R0C A;  2JSY A;  2M46 A;  4J2F A;  4N3Z A;  3MSZ A;  1G7E A;  2LEG A;  1JZW A;  2V2G A;  2GQL A;  2G2Q A;  1GTA A;  3DWV A;  4FYB A;  4HS1 A;  3LQ7 A;  2I1U A;  1TK0 B;  5DCH A;  4ICY A;  20GS A;  5A5H A;  5CRG A;  3M0F A;  1AXD A;  4MPG A;  3UJ1 A;  3TKS E;  2C3T A;  2ES7 A;  4MP4 A;  4IS0 A;  4ZL8 A;  2KHP A;  4ZL9 A;  4KAE A;  2B7J A;  2IFQ B;  4J57 E;  4ZB9 A;  4TXV A;  2CV4 A;  3ERW A;  4N30 A;  3L0H A;  5AIS A;  4OWY A;  3VWX A;  2RUE A;  2L59 A;  4Z2R A;  3RDW A;  3WT2 A;  4QL9 A;  1U3I A;  2GLR A;  1Q4J A;  4G0K A;  6GSY A;  5CAX A;  2BTO T;  3HVS A;  3FZ5 A;  3GYK A;  3HMJ G;  2EIO A;  3ERF A;  3TJK A;  4EDZ A;  3Q19 A;  1MD4 A;  2PWJ A;  2YWI A;  5D93 A;  4E8H A;  2DKH A;  5IM9 A;  1VF4 A;  4KDX A;  1SL1 B;  3IBH A;  4GWR A;  1XWG A;  4BA7 A;  2VLT A;  1XBS A;  2LRN A;  1HYU A;  5IMC A;  4PQH A;  2L4C A;  3BBY A;  2LKU A;  3H93 A;  2L6D A;  2VD0 A;  1M2A A;  4K0G A;  3FZ4 A;  1URM A;  1GTB A;  3A2V A;  2HSH A;  2PU9 C;  5G5E A;  1TOF A;  2YJ7 A;  2C0F A;  1X9M B;  2FLS A;  2IME A;  2GZZ A;  3DYR A;  4Q5R A;  5C04 A;  1RW1 A;  1ZGN A;  2TRX A;  3GN3 A;  3HJP A;  2D2Z A;  3GST A;  4L5O A;  6GSS A;  2FWG A;  4AI6 A;  1VF2 A;  3LGC A;  3J7Y b;  1TRS A;  3DXB A;  3E3E A;  10GS A;  3L9V A;  3G7I A;  3EU3 A;  1KEB A;  4LMV A;  2H19 A;  1K0B A;  3UEM A;  2YP6 A;  5KN1 A;  4DEJ A;  3VWU A;  2VIM A;  2IL3 A;  5ECM B;  4ECB A;  1GUH A;  3AY8 A;  1IYH A;  3F4S A;  3TOU A;  2H75 A;  2C0E A;  3D22 A;  3PR8 A;  3CSH A;  3KMN A;  3ZFL A;  3KEB A;  3KCM A;  5ECS A;  4EC0 A;  4MJA A;  2E7P A;  3KD0 A;  3M9K A;  3TB2 A;  1PQN A;  5CRE A;  1TW9 A;  5D73 A;  5GZZ B;  3TKS C;  3JCM L;  2DKI A;  2WS2 A;  4K5R A;  2R6K A;  3CRU A;  1UA5 A;  1XWB A;  2LTK A;  4ZBB A;  4BL7 B;  2VLU A;  3GA4 A;  5D9V A;  2PUK C;  2EC4 A;  2FWF A;  1ST9 A;  2PN8 A;  4V1A p;  4YAP A;  2LST A;  3HDC A;  1ZYE A;  3VI5 A;  2B1L A;  3LXZ A;  3KTB A;  1ML6 A;  3J7Y k;  4JBB A;  2OAD A;  2HSN A;  1MDI A;  1MEK A;  5D9W A;  4G19 A;  3ZFB A;  1VF1 A;  4KUN A;  1YF0 A;  1O6J A;  1TK5 B;  3IC4 A;  4TW5 A;  4POB A;  2C0G A;  3VLN A;  2M72 A;  1K0N A;  3DD3 A;  1PL1 A;  2OJL A;  4RI6 A;  14GS A;  3HVV A;  4Z2T A;  3MDK A;  3FR3 A;  2GQK A;  4IJI A;  4OO5 A;  5F0G A;  2FHE A;  1OVN A;  4DSS B;  4O92 A;  4PUA A;  1TRV A;  3C73 A;  3WT1 A;  2JZT A;  3UVT A;  3E0U A;  1XW5 A;  4O5Q A;  3P8W A;  1TU8 A;  2H76 A;  5ECO B;  1T1V A;  4GSS A;  2LUS A;  3VWV A;  3VK9 A;  3GHA A;  1U88 A;  4WR5 A;  4ILF A;  5B8B A;  3NZN A;  4PQ1 A;  2BJX A;  3A5W A;  1SU9 A;  5G1L A;  4IJ3 A;  3DGQ A;  3D0Z A;  1PMT A;  3HXS A;  3C1R A;  2VCZ A;  4D73 B;  2HSM B;  3QD9 A;  5ECI B;  2KOK A;  3KXO A;  4JZQ A;  2DIY A;  1T8E B;  2DJ1 A;  4EDY A;  3L9S A;  1B4P A;  1THX A;  2HZE A;  2IN3 A;  2LJR A;  4AKI A;  2VCT A;  3G9B A;  4AJ7 A;  1W89 A;  4QL7 A;  1YKC A;  4CHS A;  1BAY A;  2RLI A;  4MJE A;  1EGO A;  4V2L A;  3A2W A;  5DQS A;  5JWO B;  4ZL7 A;  1JZR A;  3TRQ A;  1AQX A;  4TXO B;  3EYT A;  1GTI A;  1EZK A;  2YOI A;  4FYU A;  2H6X A;  1V2A A;  3QAV A;  1OAZ A;  5CRW A;  3GSS A;  2H0I A;  4V2M A;  1F6M C;  1X0R A;  2WZ9 A;  2A4H A;  3L4N A;  2YWM A;  4G0L A;  5CO3 A;  1M7T A;  3I9V 2;  4O5R A;  5KEJ A;  4TR3 A;  4K7O A;  2H66 A;  1JLW A;  4HZ2 A;  5IMF A;  3IAS 2;  3IE3 A;  1XWK A;  3EE2 A;  1M2B A;  1SYR A;  4KCE A;  5CYY A;  2R0P A;  4AJ6 A;  3BCI A;  1ZYP A;  4HQZ A;  4TR4 A;  5J47 A;  1TKD B;  3KMO A;  2B5X A;  3QMX A;  1TDI A;  3ZML A;  2PMT A;  3APQ A;  2MZC A;  4HDE A;  5JCG A;  3CTG A;  1J9B A;  1SKW B;  2AV4 A;  4CY6 A;  4YKG A;  5F05 A;  4AGS A;  5L71 A;  2R0G A;  5A5H B;  2RUF A;  1WRY A;  2IJY A;  2O8V B;  2P0G A;  3PGT A;  3OR5 A;  3LW9 A;  1QUW A;  5A34 B;  5DAK A;  1R7H A;  3P2A A;  4IQ1 A;  2OT3 A;  1JZO A;  1USB A;  1O81 A;  1V98 A;  2RM6 A;  5B6N A;  4K6X A;  3V1W A;  3TUE A;  5CNW A;  2IIY A;  2CX4 A;  4MA9 A;  3GV1 A;  2FD3 A;  4FYC A;  3ZL5 A;  4D73 A;  5GAP D;  4RI7 A;  5GAN D;  5DDL A;  1PGT A;  4I5Q A;  4ZIL A;  4ULX A;  4IQA A;  4WXT A;  4CY8 A;  1X5C A;  3U6V A;  2K9F A;  5J40 A;  2VCW A;  2CVB A;  2FA8 A;  1PKZ A;  4ML1 A;  1GLP A;  3EU4 A;  2DJ2 A;  5LCZ A;  4NWY A;  2PBJ A;  4GRF A;  1KNG A;  3KP8 A;  1DUG A;  3FYG A;  3IC8 A;  5HFG A;  6GSV A;  2O85 A;  1HNA A;  4IW9 A;  2UZ8 A;  2ZUP A;  4BVY B;  2XPD A;  4IP6 A;  2TRC P;  4GQC A;  4F0B A;  1J08 A;  2P5Q A;  5A1N A;  4F2I A;  4L0U A;  3TKQ A;  1RQM A;  4P3Y B;  4I2T A;  2V6K A;  3EVI A;  5JCU A;  1BJX A;  2JZS A;  2NDO A;  5DCG A;  1ZCP A;  3TJG A;  4K2D A;  2GVP A;  1LJR A;  3QR6 A;  1FVK A;  2HSY A;  5DJM A;  1XWA A;  1QK8 A;  2C8U A;  2L5O A;  4KND A;  3KGK A;  1A0R P;  4IGJ A;  2VL2 C;  3LJR A;  4I8B A;  3APS A;  2B5Y A;  4TR1 B;  5JWR B;  1A2L A;  4MF6 A;  4XS4 A;  4ZBA A;  2J9H A;  1C72 A;  3I6A A;  5G2Z A;  5FT3 A;  4HJ2 A;  4OFN A;  5ECH B;  4FH8 A;  4KCA A;  2ON7 A;  1SK0 A;  3L9U A;  4I6X A;  2V32 A;  3DML A;  4ID0 A;  2MMN A;  2F8F A;  1GSF A;  1SVM A;  1SL0 B;  1XW9 A;  4PNF A;  4NPB A;  4EF0 A;  1Q98 A;  2YCD A;  2YZH A;  2VCV A;  4N11 A;  2HNL A;  3GL3 A;  5IIZ A;  2VO4 A;  5A1N B;  2FNO A;  2VL3 A;  2LS5 A;  3KJY A;  2HRK B;  4GCI A;  1B4Q A;  2R4V A;  4ZIJ A;  2FCH A;  5HR2 A;  1RK4 A;  6GSX A;  2OE1 A;  4HJM A;  2B7K A;  1OC3 A;  3EMX A;  1GNW A;  5J4Y A;  1VGL A;  2HSM A;  4EO3 A;  2R37 A;  3GRX A;  1S3C A;  1A24 A;  2GSQ A;  1VRS D;  4K1F A;  3VPQ A;  2IPA A;  1ON4 A;  1ACV A;  1ZL9 A;  1TP9 A;  2EFH A;  4FQU A;  1BYE A;  2VM1 A;  4POK A;  4W66 A;  2FGX A;  2V6O A;  2ALB A;  1GNE A;  1X5D A;  1SK1 A;  2LNT A;  3KH9 A;  2CX3 A;  3RAZ A;  3D5J A;  3K8N A;  6GSW A;  5CRH A;  3GUR A;  3TDG A;  16GS A;  4X4J A;  3H79 A;  4OCF A;  1FHE A;  1G7O A;  4KX4 A;  3ZRE A;  3ZYW A;  2NTO A;  4HQS A;  5DQY A;  2CZ2 A;  2XHF A;  1FOH A;  3R2Q A;  2EFE A;  1XZO A;  5B8A A;  5IOW A;  5ID2 B;  5KN2 A;  1NW2 A;  1SK2 A;  2L6C A;  4KSM A;  3TKS A;  1K3Y A;  5IO2 A;  4POL A;  3I69 A;  2LNS A;  2R3X A;  1HNC A;  2LJA A;  2MBS A;  4XTS A;  4PNG A;  4EE0 A;  1J0F A;  4MK3 A;  2H30 A;  4G0I A;  3CYN A;  4K7N A;  5EL8 A;  1MD3 A;  1WPI A;  3EPT A;  1TI3 A;  2QC7 A;  1YZX A;  1SEN A;  2XBI A;  3KZQ A;  4TR1 A;  3EMP A;  5ECP B;  3Q74 A;  1K0A A;  1AW9 A;  3IAM 2;  2GT6 A;  2WRT A;  4I97 A;  4GSN A;  3CSI A;  4H86 A;  3CTF A;  1XOA A;  1THO A;  4LL4 B;  4G9H A;  2IMF A;  4WKW A;  3W8J A;  1XIY A;  5INY A;  4XIH A;  4JE1 A;  2AUV A;  4PUR A;  4PXO A;  3MNG A;  5CRD A;  1GSS A;  1QFN A;  1OKT A;  2FWE A;  1Z6M A;  5IQY A;  4I2U A;  1AC1 A;  3ED3 A;  2DJ3 A;  3WYW A;  3QDN A;  3C7M A;  4MF5 A;  4V1A g;  3DEX A;  2LRT A;  11GS A;  1XXU A;  2LQO A;  4ZBD A;  1NSW A;  4LMW A;  2MMA A;  4EXJ A;  1TXU A;  2L4Q A;  4GQF A;  3QAW A;  1FW1 A;  2HQT A;  3HZ8 A;  1WJK A;  2O5V A;  3ZZX A;  1M9B A;  3WD6 A;  1WMJ A;  5AIX A;  3KH7 A;  1K0C A;  4K7I A;  5IOX A;  5DAL A;  2VL2 A;  2NVL A;  2K6V A;  2C3Q A;  2PER A;  4KDY A;  1A8Y A;  4V2N A;  1O8X A;  1YEX A;  2AJQ B;  4HEA 2;  4BWQ A;  1WOU A;  1BQ7 A;  4KGI A;  1ABA A;  3H4K A;  2VM2 A;  3M9J A;  1ZMA A;  2LJK A;  3O3T A;  3LWA A;  3Q18 A;  5IMD A;  2H0G A;  1UVZ A;  1N2A A;  3HJM A;  3FKF A;  1GUK A;  1AIU A;  2YWN A;  2A2R A;  5AIV A;  4Z7X A;  1NHY A;  3UAP A;  1M2D A;  3W6G A;  2VD1 A;  4MPF A;  1I9D A;  3BCK A;  3C71 A;  1ERT A;  1Z7R A;  4G01 A;  18GS A;  1PL2 A;  1PX6 A;  3F6D A;  4HU7 A;  4MH2 A;  4IEL A;  3ZVJ A;  2FY6 A;  1F9M A;  1YQ1 A;  3F3Q A;  2TIR A;  3O6T A;  1TK8 B;  5A4U A;  4ECI A;  2M80 A;  1SL2 B;  1SD8 A;  3F63 A;  2KP1 A;  4J56 E;  1M0U A;  1B9X C;  4OMV A;  3LYP A;  1FG4 A;  2GTU A;  3FRC A;  4ZB6 A;  1WP0 A;  4YQU A;  3QFB C;  5J3R A;  1F3A A;  1GSU A;  4K0N A;  4L8E A;  3UMA A;  1G0T A;  2F9S A;  2VL9 A;  1EGR A;  2JAD A;  4O7H A;  1Y1U A;  1O73 A;  1PA3 A;  1V57 A;  2KP2 A;  4GTU A;  4AJ8 A;  4GF0 A;  2EIQ A;  2MYG A;  2XBQ A;  3HKR A;  4PTS A;  3BOA A;  2CAQ A;  4CDO A;  5J41 A;  3TJF A;  1SJ6 A;  4K9Z A;  4WET A;  1G6Y A;  5ECQ B;  2CA8 A;  3LFL A;  2CVK A;  3FY7 A;  1HD2 A;  2JZR A;  1QQ2 A;  1Z9H A;  1E6B A;  2CQ9 A;  3RHC A;  2MMO A;  3L78 A;  4MAB A;  2HYX A;  1SJI A;  1UN2 A;  2DIZ A;  4NHW A;  1XFL A;  2I3Y A;  4IHU A;  3G7Y A;  4USS A;  2C1Y A;  1QGV A;  2DSA A;  3IR4 A;  1K0M A;  1M9A A;  3D4T A;  3C8E A;  2HE3 A;  5H5Q A;  4HI7 A;  5D9X A;  1PSQ A;  1GSQ A;  3NIV A;  5LNK e;  3MAK A;  1OC9 A;  2I81 A;  1FVJ A;  1IYI A;  2IMK A;  1EWX A;  3W8S A;  1ERW A;  4MZB A;  2X64 A;  2CT6 A;  2VKZ G;  3GTU B;  4EIQ A;  2WDU A;  4FO5 A;  3HCZ A;  2B5E A;  4WBR D;  4O32 A;  3UAR A;  2JAC A;  5HQP A;  3P90 A;  3PIN A;  3G7J A;  2J23 A;  1R5A A;  4A5P A;  2H72 A;  2JL4 A;  1YKA A;  4AF2 A;  2I4A A;  1U87 A;  5ECR B;  3EIN A;  4F9Z A;  5ECL B;  3F8U A;  4BVY A;  4G10 A;  1XPV A;  4Q5N A;  3RBT A;  5F8B A;  1GWC A;  1ERU A;  1H4O A;  2IFQ A;  3CSJ A;  4TOP A;  2DC5 A;  2H73 A;  5FWG A;  3TCO A;  2XPE A;  1EOG A;  1S3A A;  1PX7 A;  4ZXG A;  4PUF C;  2C80 A;  2VCQ A;  2VCX A;  5ID2 A;  1T00 A;  4QMK A;  4OFM A;  4AKG A;  4DVC A;  1K0D A;  1B48 A;  22GS A;  3GKX A;  3HY2 A;  2LRC A;  2ON5 A;  3VI7 A;  2H1G A;  3VUR A;  4YQM A;  1K3O A;  1V40 A;  4KF9 A;  5IMZ A;  3GKM A;  3GUS A;  2H1A A;  1EP7 A;  2UV8 G;  1JFU A;  4NV5 A;  2YZU A;  6GSU A;  1SKS B;  3FR6 A;  6GST A;  4K5S A;  1VF3 A;  2HRK A;  2B6M A;  3D21 A;  4MH3 A;  3ZVJ D;  5DAL B;  4IP1 A;  4TN8 A;  3GKN A;  4PQI A;  5FHI A;  1U6T A;  2DJJ A;  4BPY A;  4MF7 A;  2N5A A;  3GH9 A;  1E2Y A;  5KOX A;  1FAA A;  1PKW A;  4MZC A;  2Z9S A;  2GSS A;  4RUV A;  1AAZ A;  2XC2 A;  3FHK A;  3SBC A;  1N8J A;  3DVX A;  3WGE A;  3RHB A;  4TR0 A;  2B1K A;  3D6I A;  5HR0 A;  4HU9 A;  2X49 A;  1BF5 A;  4RQX A;  4BVX A;  3FZA A;  4XHM A;  2REM A;  3IV4 A;  1M99 A;  2E2M A;  5DVB A;  4OFT A;  4HOJ A;  5BMU B;  1GH2 A;  2DBC A;  2ZCT A;  3MYD A;  2OBI A;  2F8A A;  2RM5 A;  3IK9 A;  3CBU A;  3UBL A;  3IRA A;  3C1S A;  1Z7P A;  3I43 A;  2WJU A;  3SWL A;  9GSS A;  2GST A;  3ME7 A;  1N25 A;  2H74 A;  3IXR A;  2NPB A;  2C4J A;  3ZIT A;  3FMW A;  5A4V A;  3GIX A;  1BG5 A;  5GSS A;  4KW6 A;  3IA1 A;  5E4W A;  1A2J A;  1MDJ A;  1WE0 A;  2HRN A;  3QAG A;  4ACS A;  2FWH A;  1YJ6 A;  2O89 A;  2V41 A;  4BVX B;  2VUP A;  1CQH A;  1S3D A;  4IBP A;  5AGY A;  5ABR A;  4Q5F A;  5EPF A;  1PD2 1;  5G1K A;  2OKA A;  1X9W B;  2YPM A;  5ECN B;  2WGR A;  4LL1 B;  1BG1 A;  1QXH A;  2YV9 A;  4XCS A;  1WWJ A;  3QCP A;  3IK7 A;  3GX0 A;  8GSS A;  1GUL A;  1GUM A;  2YJH A;  1HQO A;  1AQW A;  5BRT A;  3UIW A;  3F6F A;  4ZB7 A;  1CQG A;  3GTU A;  3RPN A;  3BJ5 A;  1TRW A;  4N10 A;  17GS A;  2GSR A;  3ZTL A;  3IDV A;  1OC9 B;  2A2S A;  2HXK A;  2P31 A;  5F06 A;  1TU7 A;  3Q6O A;  5HR1 A;  19GS A;  4EIP A;  5J4U A;  1JZD A;  12GS A;  3O76 A;  1GLQ A;  4N0Z A;  4X0X A;  4XRD A;  4TVE A;  4KH7 A;  4WF4 A;  2MBT A;  3LOR A;  2H1L A;  1ERV A;  2WFC A;  4KSO A;  2I9H A;  4E8E A;  1QMV A;  2YN1 A;  3CRT A;  5ELA A;  1BX9 A;  2YAN A;  1NM3 A;  3TRX A;  3N5O A;  4MJC A;  4BWS A;  1EP8 A;  3ZIV A;  1XVQ A;  4AKX B;  1A2M A;  1TXX A;  3FW2 A;  2BMX A;  2WUL A;  4EVM A;  3M8N A;  4YQV A;  1K3L A;  1GSE A;  5D9T A;  5B6M A;  3UBK A;  2DML A;  1X5E A;  5COH A;  2H70 A;  2GZY A;  1FB6 A;  1LU4 A;  5G5F A;  1F37 A;  3A2X A;  4ML6 A;  2V1M A;  4MMM A;  3LYK A;  1YY7 A;  1O85 A;  13GS A;  3IPZ A;  2H6Z A;  3GX8 A;  3WGD A;  2O87 A;  5J5N A;  5JWQ B;  3UVH A;  5AN1 A;  5BMU A;  2WCI A;  1DE1 A;  1V58 A;  1R26 A;  3ERG A;  3QOU A;  1T7P B;  3U5R E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...