5EVOA

Structure of dehydroascrobate reductase from pennisetum americanum in complex with two non-native ligands, acetate in the g-site and glycerol in the h-site
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
213
structure length
213
Chain Sequence
HMAVEVCVKAAVGAPDILGDCPFSQRVLLTLEEKKITYEMKLVDLSNKPEWFLKISPEGKVPVFNSGDGKWIADSDVITQVIEEKFPTPSLVTPPEYASVGSKIFPSFVKFLKSKDASDGSEKALLDELQALDEHLKAHGPYISGENVSAADLSLGPKLFHLQVALEHFKGWKIPENLTSVHAYTKALFSRESFVKTKPANQYLIAGWAPKVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dehydroascorbate reductase
publication title Non-native ligands define the active site of Pennisetum glaucum (L.) R. Br dehydroascorbate reductase.
pubmed doi rcsb
source organism Cenchrus americanus
molecule tags Oxidoreductase
total genus 67
structure length 213
sequence length 213
ec nomenclature ec 1.8.5.1: Glutathione dehydrogenase (ascorbate).
pdb deposition date 2015-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5evoA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5evoA01
1G6YA 4LMVA 1QXHA 1ZGNA 2VO4A 2YCDA 4I6XA 5D93A 2DLXA 4FIWA 5AIXA 2BJXA 6GSUA 2NVLA 5CRGA 2E0QA 1Z7PA 2HZFA 3MDKA 2CVBA 2AUVA 1YEPA 3ERGA 4ISDA 4KSOA 3EU4A 1LU4A 5F0GA 4N11A 1S3AA 2PPTA 1T00A 1OC3A 1PL2A 1Y6EA 1OC8A 4F9ZA 5DAKB 1A0FA 2BMXA 2B5XA 1PMTA 3WT2A 17GSA 4XRAA 9GSSA 4NWYA 2C3QA 5DDLA 1HQOA 1ERTA 5DVBA 3E9JB 2WS2A 2LTKA 2I3YA 4FO5A 4KX4A 3IHQA 5ECQB 1BX9A 1WJKA 2B1LA 3UMAA 1AAZA 5H5SA 1G6WA 2PN8A 3APQA 4G2EA 1TU8A 4HZ4A 1GRXA 4HDEA 2G2QA 1SJIA 3JCML 4ZBAA 3MAKA 2K8SA 5ECIB 1DSBA 3H1NA 5IMDA 4PXOA 1XPVA 3KP8A 4RQXA 3IC4A 2WZ9A 3ZMKA 1ZMAA 3RHBA 2DJ2A 1V98A 4OO4A 4NHWA 18GSA 3ZITA 2HI7A 3HVXA 1ON4A 2Z9SA 3Q6OA 5IPHA 2GSRA 1TOFA 3LXTA 4ML1A 4N30A 1YKCA 2WB9A 4AJ7A 3HYPA 2H8LA 2R5GA 3F4SA 5EL8A 4OCEA 4P3YB 2RUEA 4K7OA 3US3A 4PTSA 2B6MA 5DAKA 2LNTA 4NPBA 5IOXA 1OYJA 1DUGA 1M0UA 2IMIA 4TW5A 1YEXA 5IIZA 1WOUA 2LRNA 3A2WA 3KMOA 3C7MA 2C1YA 3EMXA 1SYRA 1WP0A 5AN1A 1RK4A 4TR0A 4MPGA 5CNWA 2C3TA 1HYUA 1M2DA 3VFIA 2YWOA 2C0GA 4EDZA 4Q5RA 4F0BA 3CRUA 5A4WA 5A4UA 1R5PA 3OR5A 4EXJA 1SKWB 4LA1A 3L78A 2KUCA 4YH2A 2HRKB 4PUFC 4HJ2A 2IL3A 4ML6A 5ECLB 3GL5A 2FWHA 2H66A 4XHMA 5HFKA 2M46A 2C80A 1TRUA 3Q74A 4E8HA 4MJEA 2A2RA 5DALB 1LJRA 3NIVA 3KTBA 4EKZA 1SD8A 3UVHA 4H86A 2JZRA 2HRFA 3E0UA 3FYGA 3NOFA 1TI3A 4USSA 1X5CA 2WDUA 1FAAA 3I43A 4O5RA 5ID2B 3GTUB 1WWJA 4IP6A 3TUEA 4WF5A 2LQQA 2HSYA 2YV9A 2WULA 3DVXA 1GSYA 4XIHA 2IMFA 4NHZA 2VOCA 2R4VA 2LJRA 2DJJA 4MJCA 1TRSA 2C0EA 5IMAA 2JL4A 2A4VA 1ZYQB 1TRWA 5AISA 5G30A 1GNWA 4G19A 5GAPD 3FZ4A 3IOSA 2E7PA 4K9ZA 4RI7A 4PUAA 1JLWA 3S9FA 4LMWA 3FHKA 4AJ6A 3G7JA 2X64A 1ZCPA 4D73B 5HR1A 4TXOB 2DJ0A 1B4QA 3PGTA 2HT9A 2HRKA 4TR4A 3IA1A 1SKSB 5LNKe 1U3IA 4FYUA 1XWAA 3LWAA 4JZQA 2YZHA 1X9SB 1K0DA 1AQXA 3GNJA 2VM2A 5DALA 2EIQA 3O76A 5FT3A 1DE1A 4KF9A 2IPAA 5DCGA 2GGTA 5INYA 1VGLA 2L6DA 1FB0A 4YAVA 2PWJA 4MDCA 3GKXA 4GQCA 22GSA 1K3LA 3CBUA 3CSIA 1ST9A 5ID2A 3GTUA 4ZBBA 2OACA 2OJLA 4HU9A 14GSA 2H75A 3GKKA 2GQLA 5C04A 3M8NA 2AB6A 4KNDA 6GSVA 1JLVA 2V6KA 4GWRA 1G7OA 3GL3A 3QDNA 3IRAA 1SL1B 3J7Yk 2TRCP 2A2SA 3J7Yb 3HA9A 4ZL7A 3HVSA 2AJQB 1U88A 3QAWA 1GTBA 2YWNA 1QFNA 3IK9A 4MZWA 1FOVA 3ISOA 4I97A 4JRRA 1OAZA 1BJXA 4IKHA 1ABAA 2HLSA 2EC4A 4KE3A 3GURA 3PR8A 5EY6A 1TJDA 1M9AA 4POLA 4D73A 4TXOA 2WJUA 1YZXA 3GMFA 5ELGA 5DBQA 1Z7RA 2YANA 5GSTA 5C00A 1SD9A 3TJGA 2X99A 5G2ZA 1R5AA 3IE3A 1V57A 2FWEA 4CHSA 1F9MA 4MJBA 2H74A 3DXBA 4KUNA 5JWRB 3M0FA 2PMTA 1QK8A 1YQ1A 4GRFA 6GSTA 2YWMA 1A23A 1MEKA 2GT6A 3C71A 1GL8A 1WE0A 2O85A 1BEDA 1OKTA 4XCSA 1A24A 2VLUA 5ELAA 3L0HA 16GSA 3ZLPA 2H1DA 3QFBC 4FH8A 1X5EA 5G5FA 11GSA 4ILFA 4TR3A 3BCIA 1XXUA 1TXXA 2LNSA 3KH9A 1M99A 3GA4A 2NBSA 1KEBA 4IHUA 3GYKA 3TKRA 1GSSA 3GH6A 5CRHA 4J57E 3MWHA 1T4YA 5B7CA 2MMNA 4JE1A 4KB3A 3KXOA 3UOMA 4Q5QA 2CX3A 3DYRA 5AIVA 4F03A 4DSSB 1EP7A 4IP1A 5D9XA 2VLTA 4L5LA 1XOAA 2GQMA 1V9WA 3WT1A 3IPZA 3RHCA 5LD0A 2FA8A 2XBQA 3EU3A 3ZZXA 2YP6A 1XVWA 5E59A 12GSA 2FD3A 2HYXA 3R2QA 5CRDA 3FR3A 1PGTA 5FWGA 3TCOA 2L5OA 1TRVA 3WGXA 2QGVA 4DEJA 1HNBA 5B6MA 1MD3A 3N9JA 2DIYA 2KOKA 4HU7A 3RPNA 1O8XA 3UVTA 2YPMA 2UZ8A 3IK7A 2XC2A 4J56E 3QAVA 4HOJA 3WYWA 3GX0A 3VLNA 3GUSA 5DQSA 3E3EA 5AGYA 2E2MA 4HQZA 4ECBA 3IAS2 4MH2A 3QOUA 4MJAA 3KD0A 1OKDA 2P5QA 4NV2A 1GP1A 3RAZA 3F3RA 1N2AA 2V6OA 3GSTA 5CREA 3KP9A 1BYEA 2MYGA 2VL3A 4OMVA 3ZFLA 4LL4B 4QQ7A 4DSSA 2VM1A 1R4WA 1MDIA 5ECKB 1T7PB 4RI6A 1EGRA 5A4VA 3FW2A 1TKDB 2F8FA 3C73A 1E6BA 4TVEA 3EMPA 3TKSC 2D2ZA 1SL2B 4JBBA 1W4VA 1U3AA 2GSSA 3FKFA 3EYTA 4PX1A 4MH3A 1B9YC 3BBYA 3TKSE 3QR6A 2REMA 3FR9A 2VD1A 4L8EA 2CA8A 1AQVA 4IN0A 3LEFA 5IOWA 3U6VA 2F51A 3HKRA 6GSSA 1HNCA 4G0KA 1HD2A 2LUSA 3HXSA 2GS3A 4XRDA 2CV4A 2H30A 2HE3A 2HQTA 4FQUA 2KHPA 5IO0A 2DJKA 2O87A 1XWCA 4KCEA 3DKSA 2IFQB 1THOA 5GZZB 3LYPA 2LJAA 3A2XA 3QD9A 3D4TA 1GLQA 4MF7A 2DSAA 2MMOA 2VCQA 5F05A 4WR5A 1V2AA 2K9FA 3IC8A 3D22A 5G1KA 1VRSD 1XOBA 5DCHA 1PL1A 2VLVA 1SJ6A 4Q5NA 5B8AA 3M1GA 5HR3A 4KH7A 4PQ1A 2R3XA 3WGDA 3ZL5A 2IMKA 2N5FA 4N0VA 2JU5A 2HZEB 2XHFA 5KN0A 4V2LA 1O73A 1OVNA 2LKUA 2RM5A 3MNGA 4EC0A 3BOAA 2ON7A 1EP8A 2L4CA 2CZ3A 2IIYA 3GKNA 3D0ZA 1K0OA 3EVIA 4WF4A 4MLYA 1JZDA 4IGJA 2ZNMA 1MTCA 8GSSA 3VWXA 1FW1A 3FZ5A 4BVXB 5B6NA 2F3MA 3TJJA 1USBA 4GSTA 3LYKA 2FNOA 2LEGA 4V2MA 3GX8A 1S3CA 2VL9A 2X8HA 3TKSA 2NDOA 2FUG2 1NSWA 5IMFA 3ED3A 2IWTA 2DBCA 1S3DA 3ZMLA 1EGOA 1XZOA 3G7YA 2VCWA 1Z5YE 4AF2A 2C8UA 4WXTA 4PNGA 4YQUA 4KCAA 4KGIA 2VIMA 3V1WA 2H6ZA 2IFQA 1XBSA 2GSQA 3KIJA 1I5GA 3KJYA 4WBJA 4XS6A 4XS4B 2LV3A 2WRTA 1T3BA 2B5YA 5HFIA 1Q98A 5ENUA 2YN1A 5ECSA 3DRNA 2LRCA 1YJ6A 3FRCA 3M9JA 1JFUA 1FG4A 4EO3A 3IBHA 3G7IA 4HI7A 1A2JA 1KTEA 4BWQA 1B48A 3HZ4A 2PBJA 1ZL9A 2YJ7A 2HZEA 4K1FA 5J41A 2V32A 4BWSA 4DVCA 3EE2A 6GSXA 5J9CA 2XBIA 2PUKC 3KTLA 1AQWA 2L4QA 3L9VA 1ZOFA 3LGCA 4PURA 3UARA 5DQYA 1SJZA 4HUAA 1SKRB 2PVOC 2K8VA 1K0BA 1M2BA 4ECIA 1Z6MA 4BVXA 5LCZA 1EZKA 4F0CA 2L6CA 4MMMA 3QPMA 1H4OA 1XWBA 2F8AA 1A2LA 2NPBA 3L4NA 5JCUA 1CQGA 2OADA 4ZL9A 2WFCA 1BAYA 3Q18A 2OBKA 3LG6A 3ZVJD 1NM3A 1X5DA 1O81A 3EINA 4JR6A 3TOUA 3TJBA 1K3OA 1YY7A 1N8JA 3IXRA 3SWLA 3N5OA 1TU7A 4FYCA 1GLPA 4XS4A 1O6JA 3D4MA 3UIWA 4BVYB 1SENA 4ACSA 4G0IA 2L5LA 1XW9A 3FR6A 2F9SA 4CDOA 2PERA 1GTIA 1Z9HA 4K8MA 4NXIA 2MMZA 5J3RA 3PPUA 2H72A 2DMMA 4MCUA 2OE0A 5D8IA 3QFAC 2H01A 3NZNA 5BMUA 6GSYA 1ML6A 1UVZA 2OKAA 4KDUA 2AYTA 3I6AA 1F6MC 5J9BA 3ZTLA 1VF1A 4V1Ag 2V1MA 1QGVA 3M9KA 2FGXA 2RM6A 1JHBA 1WIKA 3RDWA 1WPIA 2TRXA 3GFKA 3W8JA 3R3EA 1K0MA 1BQ7A 4K2DA 1WMJA 4Q5FA 4I2TA 2PU9C 2I81A 3O3TA 1B4PA 3W8SA 2WCIA 2GZYA 2YNXA 4GQFA 5B8BA 2FWFA 2H0GA 2OE3A 1X9MB 2P31A 1F3BA 3HY2A 4IW9A 3TDGA 1EV9A 2O89A 1URMA 1DBYA 1XIYA 1PD21 3ZIVA 4NAXA 2H71A 3IAM2 4GSSA 3C8EA 4WR4A 4ID0A 2GVPA 4V1Ap 3DWVA 2YOIA 3IV4A 2FHEA 3I69A 5G1LA 3ERFA 4I5QA 3VK9A 4QL7A 4IQ1A 2C0FA 3DIEA 3F9UA 4PGTA 2VAFA 5E4WA 3ZRDA 2H6XA 2LS5A 1X9WB 5JCWA 2N5BA 1O7UA 3DEXA 2KLXA 1GSDA 1PKWA 2K6VA 2L59A 4BVYA 2P5RA 1SK1A 3DD3A 4JU5A 3QMXA 5JWQB 3ZREA 4XS1A 1TK0B 2JZSA 6GSWA 4G0LA 2H1GA 1AC1A 3D21A 4WETA 2M72A 4EL1A 2FA4A 4L0UA 2HNLA 2GTUA 3KH7A 4MZBA 4ZILA 4FYBA 2O7KA 3C1SA 2NTOA 2X8CA 3GV1A 3CRTA 1W89A 1YDKA 3FZ9A 5KN2A 5G5EA 3FZAA 3EURA 4G10A 2P0GA 1TTZA 2V2GA 3F4RA 4J2FA 3VWUA 5CAXA 3GH9A 2AV4A 2B7KA 2WGRA 4OFTA 1ILOA 3CSJA 1EV4A 1A8YA 5D73A 2J9HA 2OBIA 3PINA 1JZOA 5IPGA 2IN3A 3EC3A 5H5RA 3WD6A 1PA3A 1F3AA 5GSSA 4TKYA 2IJYA 19GSA 2PVQA 1TDIA 5IM9A 3HZ8A 4JEDA 4BL7B 4V2NA 5JCGA 5J5NA 3VPQA 5J4UA 2VCVA 1MD4A 3IR4A 4OD7A 2ALBA 2TIRA 1GSEA 1GUMA 2VL2C 4TXVA 3CYNA 1SYXA 1GWCA 2VCTA 13GSA 4AJ8A 3O6TA 2GDRA 2C0DA 2FWGA 3F6DA 1AW9A 3LJRA 3HHVA 4KA0A 4LL1B 2DIZA 1UC7A 4HJMA 4F2IA 2EIOA 2DJ1A 3LQ7A 3GKMA 4KDXA 3ZFBA 1THXA 1UA5A 1A8LA 1XW5A 3EWLA 3H79A 1U6TA 2CZ2A 10GSA 3TJFA 1K0AA 2HFDA 3TGZA 3BCKA 2YZUA 5HFGA 2V41A 1GUKA 3HVVA 4OWYA 1MDKA 3KZQA 2OE1A 5EVOA 2QKEA 1Q4JA 1FVKA 2JACA 4YQMA 4TOPA 4K7IA 3F6FA 1XVQA 5ECOB 2LRTA 3Q19A 2FCHA 1J0FA 3MSZA 4POBA 1RQMA 5COHA 4OCFA 1F37A 4TN8A 5CO3A 3I9V2 5GAND 1K3YA 2I4AA 2O8VB 3HDCA 3DGQA 1O8WA 2LJKA 1I9DA 3UL3A 4WKWA 3H8QA 4ZXGA 4BL7A 1XWGA 1GNEA 2KP2A 3A5WA 1XW6A 2LQOA 1XFLA 1B9XC 1PX7A 2H0HA 2JSYA 3K8NA 4EVMA 4LLRA 1PQNA 1T1VA 1EWXA 1F2EA 2GQKA 2XPEA 2GSTA 2B3SA 3VURA 1TI1A 3VWWA 2JZTA 3KEBA 4I2UA 3ERWA 2R37A 2VD0A 4XTSA 4EF0A 2QSIA 3F4TA 2YV7A 5HQPA 1QQ2A 2E2GA 2B1KA 3GIXA 2AHEA 1A0RP 5IMZA 4YQVA 1NW2A 2VL2A 2H76A 2LSTA 1PRXA 1Z6NA 3ME8A 1V40A 3D5JA 3GRXA 3G9BA 3P2AA 3FK8A 2VCXA 4GF0A 1V58A 2G0FA 2VUPA 4TR1B 4IVFA 5JWOB 1GH2A 4K6XA 2JSZA 2CAIA 3APSA 3H93A 1KNGA 2HXKA 2DJ3A 1XCCA 5CYYA 3ME7A 1GSQA 4N10A 2ES7A 2DC5A 4GSNA 5F07A 3KM6A 3BD2A 1GTAA 2H1BA 4TRXA 4O7HA 5DJLA 3LORA 2HSNB 3F3QA 2FLSA 4ZB8A 2H19A 1FHEA 2ZCTA 1K0NA 4ZB6A 4PNFA 1WRYA 5F06A 4ECJA 5KN3A 1E2YA 1SK0A 3UEMA 3CMIA 1AIUA 4F82A 3ZVJA 3HJMA 2JADA 2K18A 1K0CA 4BPYA 1QMVA 1OE7A 3DVWA 4YAPA 4ZB9A 1A2MA 3DMLA 1GUHA 4ZIJA 4MF5A 2L57A 4EUYA 4RQRA 2DMLA 2R6KA 1VF4A 5D96A 3C1RA 2CAQA 2X8GA 1C72A 2BTOT 1MDJA 3LFLA 3TOTA 3HCZA 4AGSA 1AXDA 4KDYA 3BJ5A 5ECPB 5D9TA 1Y25A 1R26A 1SK2A 5ECMB 2EIRA 4NMUA 5CRWA 2H70A 5HR0A 2GZZA 2GT5A 3IDVA 4K0GA 3F63A 2YWIA 1EOGA 4TR1A 4PQIA 1HNAA 4OFNA 2MMAA 3W6GA 2C3NA 1TK8B 1FO5A 3VPTA 3U5RE 5L71A 2MBSA 1JZRA 1R7HA 2GLRA 5ECNB 2RLIA 1OC9B 3ZYWA 4HQSA 4QL9A 1ERVA 1UN2A 3TRQA 4KW6A 4CW9A 4GLTA 4O92A 3TRXA 2R2JA 1ERUA 4HZ2A 3A2VA 1G0TA 5IMVA 4IELA 1SU9A 2H6YA 3P7XA 2CVKA 1O85A 4IJIA 3VI7A 3FEUA 4JR4A 20GSA 4IJ3A 1NHYA 3RPPA 4MP4A 1BG5A 3AY8A 3TRPA 5KEJA 3A3TA 2HRNA 3LXZA 1PX6A 1KBNA 4NV5A 3CXGA 4K7NA 2ZUPA 2N5AA 2H0IA 3VI5A 4ZL8A 4EDYA 5CP1A 2HSMB 5D9VA 3RBTA 2RIIA 4IS0A 2VCZA 4L0WA 1TK5B 2HRAA 2GZPA 5ECRB 1T8EB 4GCIA 3D6IA 5A5KA 1GULA 2QC7A 2H73A 2IMDA 5F8BA 4PQHA 1J08A 3HJOA 4E8EA 3TJKA 3KCMA 2IMEA 2CQ9A 1GSUA 5KN1A 4BA7A 4MA9A 3UBKA 4X43A 1OC9A 4DSRA 3L9UA 3GSSA 2RUFA 5ECHB 2I9HA 3F8UA 3UAPA 1FB6A 5IQYA 2ON5A 4POKA 1J9BA 5EPFA 5FHIA 1M7TA 4ZBDA 4I8BA 4GTUA 1VF2A 2YJHA 3WGEA 4WBRD 2H1AA 2HSHA 5D9WA 1EEMA 1QUWA 1LBKA 3QCPA 3CSHA 4HEA2 3ZIJA 1YKAA 1RW1A 3CTGA 1M9BA 1GSFA 3KGKA 2KP1A 4MZCA 5ABRA 1OE8A 2C4JA 4K0NA 2B7JA 3QAGA 1JZWA 4WEYA 2HSMA 1DE2A 1PN9A 1SL0B 1XWKA 3HJPA 1H75A 2M80A 3GHAA 5DJMA 5HR2A 7GSSA 1PKZA 3KMNA 1Z3EA 2AAWA 3H4KA 1B8XA 5H5QA 4L5OA 1ZYEA 2FY6A 1ZZYA 4KSMA 1EOHA 4MPFA 2MBTA 4OO5A 3SBCA 4ULXA 4DSQA 2J23A 2XPDA 4N0ZA 1ERWA 2I1UA 3F0IA 3P90A 3TKPA 5IO2A 4MF6A 3HD5A 4MABA 3PH9A 1M2AA 3M3MA 5IMCA 4Z7XA 1IYIA 1AUCA 1T4ZA 4G9HA 4HS1A 1YF0A 2PGTA 2CVDA 4MK3A 4GXZA 1TP9A 2B5EA 1X0RA 1CQHA 4O32A 3FY7A 3GN3A 4OFMA 1NHOA 4EE0A 1YF1A 1PSQA 2MZCA 5G31A 3CTFA 4X0XA 3TKQA 4IQAA 4KAEA 4X1UA 1TW9A 2OA7A 2CX4A 4IBPA 4POMA 4RUVA 3VWVA 1VF3A 1GTUA 1EEJA 1FVJA 1IYHA 3TB2A 1ACVA 1G7EA 1U87A 3L9SA 3APOA 4ECCA 2CT6A 3LSZA 3P8WA 3UJ1A 3UBLA
chains in the Genus database with same CATH superfamily
1G6YA 4LMVA 1QXHA 1ZGNA 2VO4A 2YCDA 4I6XA 5D93A 2DLXA 4FIWA 5AIXA 2BJXA 6GSUA 2NVLA 5CRGA 2E0QA 1Z7PA 2HZFA 3MDKA 2CVBA 2AUVA 1YEPA 3ERGA 4ISDA 4KSOA 3EU4A 1LU4A 5F0GA 4N11A 4YKGA 1S3AA 2PPTA 5A5HB 1T00A 1OC3A 1PL2A 1Y6EA 1OC8A 4F9ZA 5DAKB 1A0FA 2BMXA 2B5XA 1PMTA 3WT2A 17GSA 4XRAA 9GSSA 4NWYA 2C3QA 4E68A 5DDLA 1HQOA 1ERTA 5DVBA 3E9JB 2WS2A 2LTKA 2OT3A 2I3YA 4FO5A 4KX4A 3IHQA 5ECQB 1BX9A 1WJKA 2B1LA 3UMAA 1AAZA 5H5SA 1G6WA 2PN8A 3APQA 4G2EA 1TU8A 4HZ4A 1GRXA 4HDEA 2G2QA 1SJIA 3JCML 4ZBAA 3MAKA 2R0GA 2K8SA 4CY6A 5ECIB 1DSBA 3H1NA 5IMDA 4Z2TA 4PXOA 1XPVA 3KP8A 4RQXA 3IC4A 2WZ9A 3ZMKA 1ZMAA 3RHBA 2DJ2A 1V98A 4OO4A 1SVOA 4NHWA 18GSA 3ZITA 2HI7A 3HVXA 1ON4A 2Z9SA 3Q6OA 5IPHA 2GSRA 1TOFA 3LXTA 4ML1A 4N30A 1YKCA 2WB9A 4AJ7A 3HYPA 2H8LA 2R5GA 3CQFA 5A5HA 3F4SA 5EL8A 4OCEA 4P3YB 2RUEA 4K7OA 3US3A 4PTSA 2B6MA 5DAKA 3MIXA 2LNTA 4NPBA 5IOXA 1OYJA 1DUGA 1M0UA 2IMIA 4TW5A 1YEXA 5IIZA 1WOUA 2O3EA 2LRNA 3A2WA 3KMOA 3C7MA 2C1YA 3EMXA 1SYRA 1WP0A 5AN1A 2O36A 1RK4A 4TR0A 4MPGA 5CNWA 2C3TA 1HYUA 1M2DA 3VFIA 2YWOA 4O5QA 2R0PA 2C0GA 4EDZA 4Q5RA 4F0BA 3CRUA 5A4WA 5A4UA 1R5PA 3OR5A 4EXJA 1SKWB 4LA1A 3L78A 2KUCA 4YH2A 2HRKB 4PUFC 4HJ2A 2IL3A 4ML6A 5ECLB 3GL5A 4BIKA 3RFRC 2FWHA 2H66A 4XHMA 5HFKA 2M46A 2C80A 1TRUA 3Q74A 4E8HA 4MJEA 2A2RA 5DALB 1LJRA 3NIVA 3KTBA 4EKZA 1SD8A 3UVHA 4H86A 2JZRA 1PN0A 2HRFA 3E0UA 3FYGA 3NOFA 1TI3A 4USSA 1X5CA 2WDUA 1FAAA 3I43A 4O5RA 4AKHA 5ID2B 3GTUB 1WWJA 4IP6A 3TUEA 4WF5A 2LQQA 3IHGA 2HSYA 4MNNA 2YV9A 2WULA 3DVXA 1GSYA 4XIHA 2IMFA 4NHZA 2VOCA 2R4VA 2LJRA 2DJJA 4MJCA 4G01A 1TRSA 2C0EA 5IMAA 4HSCX 2JL4A 2A4VA 1ZYQB 1TRWA 5AISA 1ZYPA 5G30A 1GNWA 4G19A 5GAPD 2WW2A 3FZ4A 3IOSA 2E7PA 4K9ZA 4RI7A 4PUAA 1JLWA 3S9FA 4LMWA 3FHKA 4AJ6A 3G7JA 2X64A 1ZCPA 4D73B 5HR1A 4TXOB 2DJ0A 1B4QA 3PGTA 2HT9A 2HRKA 4TR4A 3IA1A 1SKSB 5LNKe 1U3IA 4FYUA 2EFEA 1XWAA 3LWAA 4JZQA 2YZHA 1X9SB 1K0DA 1AQXA 3GNJA 2VM2A 5DALA 2EIQA 3O76A 5FT3A 1DE1A 4KF9A 2IPAA 2UV8G 5DCGA 2GGTA 5INYA 1VGLA 2L6DA 1FB0A 4YAVA 2PWJA 4MDCA 3GKXA 4GQCA 22GSA 1K3LA 3CBUA 3CSIA 1ST9A 5ID2A 3GTUA 4ZBBA 2OACA 2WVXB 2OJLA 4HU9A 14GSA 2H75A 3GKKA 2GQLA 5C04A 3M8NA 2AB6A 4KNDA 6GSVA 1JLVA 2V6KA 4GWRA 1G7OA 3GL3A 4Z2RA 3QDNA 1ZYNA 3IRAA 1SL1B 3J7Yk 2TRCP 3UBLA 4X4JA 2A2SA 3J7Yb 3HA9A 4ZL7A 3HVSA 2AJQB 1U88A 3QAWA 1GTBA 4O5UA 2YWNA 1QFNA 3IK9A 4MZWA 1FOVA 4GDFA 3ISOA 4I97A 4JRRA 1OAZA 1BJXA 4IKHA 1ABAA 2HLSA 2EC4A 4KE3A 3GURA 3PR8A 5EY6A 1TJDA 1M9AA 4POLA 4D73A 4TXOA 2WJUA 1YZXA 3GMFA 5ELGA 5DBQA 1Z7RA 2YANA 5GSTA 5C00A 1SD9A 3TJGA 2X99A 5G2ZA 1R5AA 3IE3A 1V57A 2FWEA 4CHSA 1F9MA 4MJBA 2H74A 3DXBA 4KUNA 5JWRB 5J4VA 3M0FA 2DKHA 2PMTA 1QK8A 1YQ1A 4GRFA 6GSTA 2YWMA 1A23A 1MEKA 2GT6A 3C71A 1GL8A 1WE0A 2O85A 1BEDA 1OKTA 4XCSA 1A24A 2VLUA 5ELAA 2EFCA 2WVXA 3L0HA 16GSA 3ZLPA 2H1DA 3QFBC 4FH8A 1X5EA 5G5FA 11GSA 4ILFA 4TR3A 3BCIA 1XXUA 1TXXA 2LNSA 3KH9A 1M99A 3GA4A 2NBSA 1KEBA 4IHUA 3GYKA 3TKRA 1GSSA 3GH6A 5CRHA 4J57E 3MWHA 1T4YA 5B7CA 2MMNA 4JE1A 4KB3A 3KXOA 3UOMA 4Q5QA 2CX3A 3DYRA 5AIVA 4F03A 4DSSB 1EP7A 4IP1A 5D9XA 2VLTA 4L5LA 1XOAA 2GQMA 1V9WA 3WT1A 3HMJG 3IPZA 3RHCA 5LD0A 2FA8A 2XBQA 3EU3A 3ZZXA 2YP6A 1XVWA 5E59A 12GSA 2FD3A 2HYXA 3R2QA 5CRDA 3FR3A 1PGTA 5FWGA 1YEWC 3TCOA 2L5OA 1TRVA 3WGXA 2QGVA 4DEJA 1HNBA 5B6MA 1MD3A 3N9JA 2DIYA 2KOKA 4HU7A 3RPNA 1O8XA 3UVTA 2YPMA 2UZ8A 3IK7A 4AKXB 2XC2A 4QMKA 4J56E 5J4YA 3QAVA 4HOJA 3WYWA 3GX0A 3VLNA 3GUSA 5DQSA 3E3EA 5AGYA 2E2MA 4HQZA 4ECBA 3IAS2 4MH2A 3QOUA 4MJAA 3KD0A 1OKDA 2P5QA 4NV2A 1GP1A 3RAZA 3F3RA 1N2AA 2V6OA 3GSTA 5CREA 3KP9A 1BYEA 2MYGA 2VL3A 4OMVA 3ZFLA 4LL4B 4QQ7A 4DSSA 2VM1A 1R4WA 1MDIA 5ECKB 1BF5A 1T7PB 4RI6A 1EGRA 5A4VA 3FW2A 1TKDB 2F8FA 3C73A 1E6BA 4W66A 4TVEA 3EMPA 3TKSC 2D2ZA 1SL2B 4JBBA 1W4VA 1U3AA 2GSSA 2A4HA 3FKFA 3EYTA 4PX1A 4MH3A 1B9YC 3BBYA 3TKSE 3QR6A 1SVLA 2REMA 3FR9A 2VD1A 4L8EA 2CA8A 1AQVA 4IN0A 3LEFA 5IOWA 3U6VA 2F51A 3HKRA 6GSSA 1HNCA 4G0KA 1HD2A 2LUSA 3HXSA 2GS3A 4XRDA 2CV4A 2H30A 2HE3A 2HQTA 4FQUA 2KHPA 5IO0A 2DJKA 2O87A 1XWCA 4KCEA 3DKSA 2IFQB 1THOA 5GZZB 3LYPA 2LJAA 3A2XA 3QD9A 3D4TA 1GLQA 4MF7A 2DSAA 2MMOA 1SVMA 2VCQA 5F05A 4WR5A 1V2AA 2K9FA 3TU3B 3IC8A 3D22A 5G1KA 1VRSD 1XOBA 5DCHA 1PL1A 2VLVA 1SJ6A 2O5VA 2WZSA 4Q5NA 5B8AA 3M1GA 5HR3A 4KH7A 4PQ1A 2R3XA 3WGDA 3ZL5A 2IMKA 4AKGA 2N5FA 4N0VA 2JU5A 2HZEB 2XHFA 5KN0A 2WVYA 2WW3A 4V2LA 1Y1UA 1O73A 1OVNA 2LKUA 2RM5A 3MNGA 4EC0A 3BOAA 2ON7A 1EP8A 2L4CA 2CZ3A 4FXYP 2IIYA 3D0ZA 1K0OA 3GKNA 3EVIA 4WF4A 4MLYA 1JZDA 4IGJA 2ZNMA 1MTCA 8GSSA 3VWXA 1FW1A 3FZ5A 4BVXB 5B6NA 2F3MA 3TJJA 1USBA 4GSTA 3LYKA 2FNOA 2LEGA 4V2MA 3GX8A 1S3CA 2VL9A 2X8HA 3TKSA 2NDOA 2FUG2 1NSWA 4EIPA 5IMFA 3ED3A 2IWTA 2DBCA 1S3DA 3ZMLA 1EGOA 1XZOA 2X49A 3G7YA 2VCWA 1Z5YE 4AF2A 2C8UA 4WXTA 4PNGA 4YQUA 4KCAA 4KGIA 2VIMA 3V1WA 2H6ZA 2IFQA 1XBSA 2GSQA 3KIJA 1I5GA 3KJYA 4WBJA 4XS6A 4XS4B 2LV3A 2WRTA 2VKZG 1T3BA 2B5YA 5HFIA 1Q98A 5ENUA 2YN1A 5ECSA 3DRNA 2LRCA 1YJ6A 3FRCA 3M9JA 1JFUA 1FG4A 4EO3A 3IBHA 3G7IA 4HI7A 1A2JA 1KTEA 4BWQA 1B48A 5BMUB 3HZ4A 2PBJA 1ZL9A 2YJ7A 4K5RA 2HZEA 4K1FA 5J41A 2WVZA 2V32A 4BWSA 4DVCA 3EE2A 6GSXA 5J9CA 2XBIA 2DKIA 2PUKC 3KTLA 1AQWA 2L4QA 3L9VA 1ZOFA 2QA2A 3LGCA 4PURA 3UARA 5DQYA 1SJZA 4HUAA 1SKRB 2PVOC 2K8VA 1K0BA 1M2BA 4ECIA 1Z6MA 4BVXA 5LCZA 1EZKA 4F0CA 2L6CA 4AI6A 4MMMA 3QPMA 1H4OA 1XWBA 2F8AA 1A2LA 2NPBA 3L4NA 5JCUA 1CQGA 2OADA 4ZL9A 2WFCA 1BAYA 3Q18A 2OBKA 3LG6A 3ZVJD 5A1NB 1NM3A 1X5DA 1O81A 3EINA 4JR6A 3TOUA 3TJBA 1K3OA 1TXUA 1YY7A 1N8JA 3IXRA 3SWLA 3N5OA 4N3ZA 1TU7A 4FYCA 1GLPA 4XS4A 1O6JA 3D4MA 3UIWA 4BVYB 1SENA 4ACSA 4G0IA 2L5LA 1XW9A 3FR6A 2F9SA 4CDOA 2PERA 1GTIA 1Z9HA 4K8MA 4NXIA 2MMZA 1FOHA 5J3RA 3PPUA 2H72A 2DMMA 4MCUA 2OE0A 5D8IA 3QFAC 2H01A 3NZNA 5BMUA 6GSYA 1ML6A 1UVZA 2OKAA 4KDUA 2AYTA 3I6AA 1F6MC 5J9BA 3ZTLA 1VF1A 4V1Ag 2V1MA 1QGVA 3M9KA 2FGXA 2RM6A 1JHBA 1WIKA 3RDWA 1WPIA 2TRXA 3GFKA 3W8JA 3R3EA 1K0MA 1BQ7A 4K2DA 4A5PA 1WMJA 4Q5FA 4I2TA 2PU9C 2I81A 3O3TA 1B4PA 3W8SA 2WCIA 2GZYA 2YNXA 4GQFA 5B8BA 2FWFA 2H0GA 2OE3A 1X9MB 2P31A 1F3BA 3HY2A 4IW9A 3TDGA 1EV9A 2O89A 1URMA 1DBYA 1XIYA 1PD21 3ZIVA 4NAXA 2H71A 3IAM2 4GSSA 3C8EA 4WR4A 4ID0A 2GVPA 4V1Ap 5A1NA 3DWVA 2YOIA 3IV4A 2FHEA 3I69A 5G1LA 4EIQA 3ERFA 4I5QA 3VK9A 4QL7A 4IQ1A 2C0FA 3DIEA 3F9UA 4PGTA 2VAFA 5E4WA 3ZRDA 2H6XA 2LS5A 1X9WB 5JCWA 2N5BA 1O7UA 3DEXA 2KLXA 1GSDA 1PKWA 2K6VA 2L59A 4BVYA 2P5RA 1SK1A 3DD3A 4JU5A 3QMXA 5JWQB 3ZREA 4XS1A 1TK0B 2JZSA 6GSWA 4G0LA 2H1GA 1AC1A 3D21A 4WETA 2M72A 4EL1A 2FA4A 4L0UA 2HNLA 2GTUA 3KH7A 4MZBA 4ZILA 2O7KA 4FYBA 3C1SA 2NTOA 2X8CA 3GV1A 3CRTA 1W89A 1YDKA 3FZ9A 5KN2A 5G5EA 3FZAA 3EURA 4G10A 2P0GA 1TTZA 2V2GA 3F4RA 4J2FA 3VWUA 5CAXA 3GH9A 4K2XA 2AV4A 2B7KA 2WGRA 4OFTA 1ILOA 3CSJA 1EV4A 1A8YA 5D73A 2J9HA 2OBIA 3PINA 1JZOA 5IPGA 4AKIA 2IN3A 3EC3A 5H5RA 3WD6A 1PA3A 1F3AA 5GSSA 4TKYA 2IJYA 19GSA 2PVQA 1TDIA 5IM9A 3HZ8A 4JEDA 4BL7B 4V2NA 5JCGA 5J5NA 3VPQA 5J4UA 2VCVA 1MD4A 3IR4A 4OD7A 2ALBA 2TIRA 1GSEA 1GUMA 2VL2C 4TXVA 3CYNA 1SYXA 1GWCA 2VCTA 13GSA 4AJ8A 3O6TA 2GDRA 2C0DA 2FWGA 3F6DA 1AW9A 3LJRA 3HHVA 4KA0A 4LL1B 2DIZA 1UC7A 4HJMA 4F2IA 2EIOA 2DJ1A 3LQ7A 3GKMA 4KDXA 3ZFBA 1THXA 1UA5A 1A8LA 1XW5A 3EWLA 3H79A 1U6TA 2CZ2A 10GSA 3TJFA 1K0AA 1M3JA 2HFDA 3TGZA 3BCKA 2YZUA 5HFGA 2V41A 1GUKA 3HVVA 4OWYA 1MDKA 3KZQA 2OE1A 5EVOA 2QKEA 1Q4JA 1FVKA 2JACA 4YQMA 4TOPA 4K7IA 3F6FA 1XVQA 5ECOB 2LRTA 3Q19A 2FCHA 1J0FA 3MSZA 4POBA 5KOXA 1RQMA 5COHA 4OCFA 1F37A 4TN8A 5CO3A 4Z2UA 3I9V2 5GAND 1K3YA 2I4AA 2O8VB 3HDCA 3DGQA 1O8WA 2LJKA 1I9DA 3UL3A 4WKWA 3H8QA 3RGBC 4ZXGA 4BL7A 1XWGA 1GNEA 2KP2A 3A5WA 3LW9A 1XW6A 2LQOA 1XFLA 1B9XC 1PX7A 2H0HA 2JSYA 3K8NA 4EVMA 4LLRA 5BRTA 1PQNA 1T1VA 2WW0A 1EWXA 1F2EA 2GQKA 2XPEA 2GSTA 2B3SA 3VURA 1TI1A 3VWWA 2JZTA 3KEBA 4I2UA 3ERWA 2R37A 2VD0A 4XTSA 4EF0A 2QSIA 3F4TA 2YV7A 5HQPA 1QQ2A 2E2GA 2B1KA 3GIXA 2AHEA 2H1LA 1A0RP 5IMZA 4YQVA 1NW2A 2VL2A 2H76A 2LSTA 1PRXA 1Z6NA 3ME8A 1XG8A 1V40A 3D5JA 3GRXA 3G9BA 3P2AA 3FK8A 2VCXA 4GF0A 1V58A 2G0FA 2VUPA 4TR1B 4IVFA 5JWOB 1GH2A 4K6XA 2JSZA 2CAIA 3APSA 3H93A 1KNGA 2HXKA 2DJ3A 1XCCA 5CYYA 3ME7A 1GSQA 4N10A 4ICYA 2ES7A 2DC5A 4GSNA 5F07A 3KM6A 3BD2A 1GTAA 2H1BA 4TRXA 4O7HA 5DJLA 3LORA 2HSNB 3F3QA 2FLSA 4ZB8A 2H19A 1FHEA 2ZCTA 1K0NA 4ZB6A 4PNFA 1WRYA 5F06A 4ECJA 5KN3A 1E2YA 1SK0A 3UEMA 3CMIA 1AIUA 4F82A 3ZVJA 3MYDA 3HJMA 2JADA 2K18A 4PI0C 1K0CA 4BPYA 1QMVA 1OE7A 3DVWA 4YAPA 4ZB9A 1A2MA 3DMLA 1GUHA 4ZIJA 4MF5A 2L57A 4EUYA 4RQRA 2DMLA 2R6KA 1VF4A 5D96A 3C1RA 2CAQA 2X8GA 1C72A 2BTOT 1MDJA 3LFLA 3TOTA 3HCZA 4AGSA 1AXDA 3CHXC 4KDYA 3BJ5A 5J40A 5ECPB 5D9TA 1Y25A 1R26A 1SK2A 5ECMB 2EIRA 4NMUA 5CRWA 2H70A 5HR0A 2GZZA 2GT5A 3IDVA 4K0GA 3F63A 2R0CA 2YWIA 1EOGA 4TR1A 4PQIA 1HNAA 4OFNA 2MMAA 3W6GA 2C3NA 1TK8B 1FO5A 3VPTA 3U5RE 5L71A 2MBSA 1JZRA 1R7HA 2GLRA 5ECNB 2RLIA 1OC9B 3ZYWA 4HQSA 4QL9A 1BG1A 1ERVA 1UN2A 3TRQA 4KW6A 4CW9A 4GLTA 4K5SA 4O92A 2HSNA 3TRXA 3FMWA 2R2JA 1ERUA 4HZ2A 3A2VA 1G0TA 5IMVA 4IELA 1SU9A 2H6YA 3P7XA 2CVKA 1O85A 4IJIA 3VI7A 3FEUA 4JR4A 20GSA 4IJ3A 1NHYA 3RPPA 4MP4A 1BG5A 3AY8A 3TRPA 5KEJA 3A3TA 2HRNA 3LXZA 1PX6A 1KBNA 4NV5A 3CXGA 4K7NA 2ZUPA 2N5AA 2H0IA 3VI5A 4ZL8A 4EDYA 5CP1A 2HSMB 5D9VA 3RBTA 2RIIA 4IS0A 2VCZA 4L0WA 1TK5B 2HRAA 2GZPA 5ECRB 1T8EB 4GCIA 3D6IA 5A5KA 5A34B 1GULA 2QC7A 2H73A 2IMDA 5F8BA 4PQHA 4YKFA 1J08A 3HJOA 4E8EA 3TJKA 3KCMA 2IMEA 2CQ9A 1GSUA 5KN1A 4ZB7A 4BA7A 4MA9A 4PI2C 3UBKA 4X43A 1OC9A 4DSRA 3L9UA 3GSSA 2RUFA 5ECHB 2I9HA 3F8UA 3UAPA 1YVLA 1FB6A 5IQYA 2ON5A 4POKA 1J9BA 5EPFA 5FHIA 1M7TA 4ZBDA 4I8BA 4GTUA 1VF2A 2YJHA 3WGEA 4WBRD 2H1AA 2HSHA 5D9WA 1EEMA 1QUWA 1LBKA 3QCPA 3CSHA 4HEA2 3ZIJA 1YKAA 3EPTA 1RW1A 3CTGA 1M9BA 1GSFA 3KGKA 2KP1A 4MZCA 5ABRA 1OE8A 4PHZC 2C4JA 4K0NA 2B7JA 3QAGA 1JZWA 5J47A 4WEYA 2HSMA 1DE2A 1PN9A 1SL0B 1XWKA 3HJPA 1H75A 2M80A 3GHAA 5DJMA 5HR2A 5A34A 7GSSA 1PKZA 3KMNA 1Z3EA 1S4BP 2AAWA 3H4KA 1B8XA 5H5QA 2WW1A 4L5OA 2QA1A 1ZYEA 2FY6A 1ZZYA 4KSMA 1EOHA 1I1IP 2EFDA 4MPFA 2MBTA 4OO5A 3SBCA 4ULXA 4DSQA 4CY8A 2J23A 2XPDA 4N0ZA 1ERWA 2I1UA 3F0IA 2X4AA 3P90A 2EFHA 3TKPA 1S3RA 5IO2A 4MF6A 3HD5A 1M3IA 3A5IA 4MABA 3PH9A 1M2AA 3M3MA 5IMCA 4Z7XA 1IYIA 1AUCA 1T4ZA 4G9HA 4HS1A 1YF0A 2PGTA 2CVDA 4MK3A 4GXZA 1TP9A 2B5EA 1X0RA 1N25A 1CQHA 4O32A 3FY7A 3GN3A 5KOWA 4OFMA 1NHOA 4EE0A 1YF1A 1PSQA 2MZCA 5G31A 3CTFA 4X0XA 3TKQA 4IQAA 4KAEA 4X1UA 1TW9A 2OA7A 2CX4A 4IBPA 1PFOA 4POMA 4RUVA 3CWGA 3VWVA 1VF3A 1GTUA 1EEJA 1FVJA 1IYHA 3TB2A 1ACVA 1G7EA 1U87A 3L9SA 3APOA 4ECCA 2CT6A 3LSZA 3P8WA 3UJ1A 2A2PA 3HVNA
chains in the Genus database with same CATH topology
1G6YA 4LMVA 1QXHA 1ZGNA 2VO4A 2YCDA 4I6XA 5D93A 2DLXA 4FIWA 5AIXA 2BJXA 6GSUA 2NVLA 5CRGA 2E0QA 1Z7PA 2HZFA 3MDKA 2CVBA 2AUVA 1YEPA 3ERGA 4ISDA 4KSOA 3EU4A 1LU4A 5F0GA 4N11A 4YKGA 1S3AA 2PPTA 5A5HB 1T00A 1OC3A 1PL2A 1Y6EA 1OC8A 4F9ZA 5DAKB 1A0FA 2BMXA 2B5XA 1PMTA 3WT2A 17GSA 4XRAA 9GSSA 4NWYA 2C3QA 4E68A 5DDLA 1HQOA 1ERTA 5DVBA 3E9JB 2WS2A 2LTKA 2OT3A 2I3YA 4FO5A 4KX4A 3IHQA 5ECQB 1BX9A 1WJKA 2B1LA 3UMAA 1AAZA 5H5SA 1G6WA 2PN8A 3APQA 4G2EA 1TU8A 4HZ4A 1GRXA 4HDEA 2G2QA 1SJIA 3JCML 4ZBAA 3MAKA 2R0GA 2K8SA 4CY6A 5ECIB 1DSBA 3H1NA 5IMDA 4Z2TA 4PXOA 1XPVA 3KP8A 4RQXA 3IC4A 2WZ9A 3ZMKA 1ZMAA 3RHBA 2DJ2A 1V98A 4OO4A 1SVOA 4NHWA 18GSA 3ZITA 2HI7A 3HVXA 1ON4A 2Z9SA 3Q6OA 5IPHA 2GSRA 1TOFA 3LXTA 4ML1A 4N30A 1YKCA 2WB9A 4AJ7A 3HYPA 2H8LA 2R5GA 5A5HA 3F4SA 5EL8A 4OCEA 4P3YB 2RUEA 4K7OA 3US3A 4PTSA 2B6MA 5DAKA 3MIXA 2LNTA 4NPBA 5IOXA 1OYJA 1DUGA 1M0UA 2IMIA 4TW5A 1YEXA 5IIZA 1WOUA 2LRNA 3A2WA 3KMOA 3C7MA 2C1YA 3EMXA 1SYRA 1WP0A 5AN1A 1RK4A 4TR0A 4MPGA 5CNWA 2C3TA 1HYUA 1M2DA 3VFIA 2YWOA 4O5QA 2R0PA 2C0GA 4EDZA 4Q5RA 4F0BA 3CRUA 5A4WA 5A4UA 1R5PA 3OR5A 4EXJA 1SKWB 4LA1A 3L78A 2KUCA 4YH2A 2HRKB 4PUFC 4HJ2A 2IL3A 4ML6A 5ECLB 3GL5A 2FWHA 2H66A 4XHMA 5HFKA 2M46A 2C80A 1TRUA 3Q74A 4E8HA 4MJEA 2A2RA 5DALB 1LJRA 3NIVA 3KTBA 4EKZA 1SD8A 3UVHA 4H86A 2JZRA 1PN0A 2HRFA 3E0UA 3FYGA 3NOFA 1TI3A 4USSA 1X5CA 2WDUA 1FAAA 3I43A 4O5RA 4AKHA 5ID2B 3GTUB 1WWJA 4IP6A 3TUEA 4WF5A 2LQQA 3IHGA 2HSYA 4MNNA 2YV9A 2WULA 3DVXA 1GSYA 4XIHA 2IMFA 4NHZA 2VOCA 2R4VA 2LJRA 2DJJA 4MJCA 4G01A 1TRSA 2C0EA 5IMAA 2JL4A 2A4VA 1ZYQB 1TRWA 5AISA 1ZYPA 5G30A 1GNWA 4G19A 5GAPD 3FZ4A 3IOSA 2E7PA 4K9ZA 4RI7A 4PUAA 1JLWA 3S9FA 4LMWA 3FHKA 4AJ6A 3G7JA 2X64A 1ZCPA 4D73B 5HR1A 4TXOB 2DJ0A 1B4QA 3PGTA 2HT9A 2HRKA 4TR4A 3IA1A 1SKSB 5LNKe 1U3IA 4FYUA 2EFEA 1XWAA 3LWAA 4JZQA 2YZHA 1X9SB 1K0DA 1AQXA 3GNJA 2VM2A 5DALA 2EIQA 3O76A 5FT3A 1DE1A 4KF9A 2IPAA 2UV8G 5DCGA 2GGTA 5INYA 1VGLA 2L6DA 1FB0A 4YAVA 2PWJA 4MDCA 3GKXA 4GQCA 22GSA 1K3LA 3CBUA 3CSIA 1ST9A 5ID2A 3GTUA 4ZBBA 2OACA 2OJLA 4HU9A 14GSA 2H75A 3GKKA 2GQLA 5C04A 3M8NA 2AB6A 4KNDA 6GSVA 1JLVA 2V6KA 4GWRA 1G7OA 3GL3A 4Z2RA 3QDNA 1ZYNA 3IRAA 1SL1B 3J7Yk 2TRCP 4X4JA 2A2SA 3J7Yb 3HA9A 4ZL7A 3HVSA 2AJQB 1U88A 3QAWA 1GTBA 4O5UA 2YWNA 1QFNA 3IK9A 4MZWA 1FOVA 4GDFA 3ISOA 4I97A 4JRRA 1OAZA 1BJXA 4IKHA 1ABAA 2HLSA 2EC4A 4KE3A 3GURA 3PR8A 5EY6A 1TJDA 1M9AA 4POLA 4D73A 4TXOA 2WJUA 1YZXA 3GMFA 5ELGA 5DBQA 1Z7RA 2YANA 5GSTA 5C00A 1SD9A 3TJGA 2X99A 5G2ZA 1R5AA 3IE3A 1V57A 2FWEA 4CHSA 1F9MA 4MJBA 2H74A 3DXBA 4KUNA 5JWRB 5J4VA 3M0FA 2DKHA 2PMTA 1QK8A 1YQ1A 4GRFA 6GSTA 2YWMA 1A23A 1MEKA 2GT6A 3C71A 1GL8A 1WE0A 2O85A 1BEDA 1OKTA 4XCSA 1A24A 2VLUA 5ELAA 2EFCA 3L0HA 16GSA 3ZLPA 2H1DA 3QFBC 4FH8A 1X5EA 5G5FA 11GSA 4ILFA 4TR3A 3BCIA 1XXUA 1TXXA 2LNSA 3KH9A 1M99A 3GA4A 2NBSA 1KEBA 4IHUA 3GYKA 3TKRA 1GSSA 3GH6A 5CRHA 4J57E 3MWHA 1T4YA 5B7CA 2MMNA 4JE1A 4KB3A 3KXOA 3UOMA 4Q5QA 2CX3A 3DYRA 5AIVA 4F03A 4DSSB 1EP7A 4IP1A 5D9XA 2VLTA 4L5LA 1XOAA 2GQMA 1V9WA 3WT1A 3HMJG 3IPZA 3RHCA 5LD0A 2FA8A 2XBQA 3EU3A 3ZZXA 2YP6A 1XVWA 5E59A 12GSA 2FD3A 2HYXA 3R2QA 5CRDA 3FR3A 1PGTA 5FWGA 3TCOA 2L5OA 1TRVA 3WGXA 2QGVA 4DEJA 1HNBA 5B6MA 1MD3A 3N9JA 2DIYA 2KOKA 4HU7A 3RPNA 1O8XA 3UVTA 2YPMA 2UZ8A 3IK7A 4AKXB 2XC2A 4QMKA 4J56E 5J4YA 3QAVA 4HOJA 3WYWA 3GX0A 3VLNA 3GUSA 5DQSA 3E3EA 5AGYA 2E2MA 4HQZA 4ECBA 3IAS2 4MH2A 3QOUA 4MJAA 3KD0A 1OKDA 2P5QA 4NV2A 1GP1A 3RAZA 3F3RA 1N2AA 2V6OA 3GSTA 5CREA 3KP9A 1BYEA 2MYGA 2VL3A 4OMVA 3ZFLA 4LL4B 4QQ7A 4DSSA 2VM1A 1R4WA 1MDIA 5ECKB 1BF5A 1T7PB 4RI6A 1EGRA 5A4VA 3FW2A 1TKDB 2F8FA 3C73A 1E6BA 4W66A 4TVEA 3EMPA 3TKSC 2D2ZA 1SL2B 4JBBA 1W4VA 1U3AA 2GSSA 2A4HA 3FKFA 3EYTA 4PX1A 4MH3A 1B9YC 3BBYA 3TKSE 3QR6A 1SVLA 2REMA 3FR9A 2VD1A 4L8EA 2CA8A 1AQVA 4IN0A 3LEFA 5IOWA 3U6VA 2F51A 3HKRA 6GSSA 1HNCA 4G0KA 1HD2A 2LUSA 3HXSA 2GS3A 4XRDA 2CV4A 2H30A 2HE3A 2HQTA 4FQUA 2KHPA 5IO0A 2DJKA 2O87A 1XWCA 4KCEA 3DKSA 2IFQB 1THOA 5GZZB 3LYPA 2LJAA 3A2XA 3QD9A 3D4TA 1GLQA 4MF7A 2DSAA 2MMOA 1SVMA 2VCQA 5F05A 4WR5A 1V2AA 2K9FA 3TU3B 3IC8A 3D22A 5G1KA 1VRSD 1XOBA 5DCHA 1PL1A 2VLVA 1SJ6A 2O5VA 4Q5NA 5B8AA 3M1GA 5HR3A 4KH7A 4PQ1A 2R3XA 3WGDA 3ZL5A 2IMKA 4AKGA 2N5FA 4N0VA 2JU5A 2HZEB 2XHFA 5KN0A 4V2LA 1Y1UA 1O73A 1OVNA 2LKUA 2RM5A 3MNGA 4EC0A 3BOAA 2ON7A 1EP8A 2L4CA 2CZ3A 2IIYA 3GKNA 3D0ZA 1K0OA 3EVIA 4WF4A 4MLYA 1JZDA 4IGJA 2ZNMA 1MTCA 8GSSA 3VWXA 1FW1A 3FZ5A 4BVXB 5B6NA 2F3MA 3TJJA 1USBA 4GSTA 3LYKA 2FNOA 2LEGA 4V2MA 3GX8A 1S3CA 2VL9A 2X8HA 3TKSA 2NDOA 2FUG2 1NSWA 4EIPA 5IMFA 3ED3A 2IWTA 2DBCA 1S3DA 3ZMLA 1EGOA 1XZOA 2X49A 3G7YA 2VCWA 1Z5YE 4AF2A 2C8UA 4WXTA 4PNGA 4YQUA 4KCAA 4KGIA 2VIMA 3V1WA 2H6ZA 2IFQA 1XBSA 2GSQA 3KIJA 1I5GA 3KJYA 4WBJA 4XS6A 4XS4B 2LV3A 2WRTA 2VKZG 1T3BA 2B5YA 5HFIA 1Q98A 5ENUA 2YN1A 5ECSA 3DRNA 2LRCA 1YJ6A 3FRCA 3M9JA 1JFUA 1FG4A 4EO3A 3IBHA 3G7IA 4HI7A 1A2JA 1KTEA 4BWQA 1B48A 5BMUB 3HZ4A 2PBJA 1ZL9A 2YJ7A 4K5RA 2HZEA 4K1FA 5J41A 2V32A 4BWSA 4DVCA 3EE2A 6GSXA 5J9CA 2XBIA 2DKIA 2PUKC 3KTLA 1AQWA 2L4QA 3L9VA 1ZOFA 2QA2A 3LGCA 4PURA 3UARA 5DQYA 1SJZA 4HUAA 1SKRB 2PVOC 2K8VA 1K0BA 1M2BA 4ECIA 1Z6MA 4BVXA 5LCZA 1EZKA 4F0CA 2L6CA 4AI6A 4MMMA 3QPMA 1H4OA 1XWBA 2F8AA 1A2LA 2NPBA 3L4NA 5JCUA 1CQGA 2OADA 4ZL9A 2WFCA 1BAYA 3Q18A 2OBKA 3LG6A 3ZVJD 5A1NB 1NM3A 1X5DA 1O81A 3EINA 4JR6A 3TOUA 3TJBA 1K3OA 1TXUA 1YY7A 1N8JA 3IXRA 3SWLA 3N5OA 4N3ZA 1TU7A 4FYCA 1GLPA 4XS4A 1O6JA 3D4MA 3UIWA 4BVYB 1SENA 4ACSA 4G0IA 2L5LA 1XW9A 3FR6A 2F9SA 4CDOA 2PERA 1GTIA 1Z9HA 4K8MA 4NXIA 2MMZA 1FOHA 5J3RA 3PPUA 2H72A 2DMMA 4MCUA 2OE0A 5D8IA 3QFAC 2H01A 3NZNA 5BMUA 6GSYA 1ML6A 1UVZA 2OKAA 4KDUA 2AYTA 3I6AA 1F6MC 5J9BA 3ZTLA 1VF1A 4V1Ag 2V1MA 1QGVA 3M9KA 2FGXA 2RM6A 1JHBA 1WIKA 3RDWA 1WPIA 2TRXA 3GFKA 3W8JA 3R3EA 1K0MA 1BQ7A 4K2DA 4A5PA 1WMJA 4Q5FA 4I2TA 2PU9C 2I81A 3O3TA 1B4PA 3W8SA 2WCIA 2GZYA 2YNXA 4GQFA 5B8BA 2FWFA 2H0GA 2OE3A 1X9MB 2P31A 1F3BA 3HY2A 4IW9A 3TDGA 1EV9A 2O89A 1URMA 1DBYA 1XIYA 1PD21 3ZIVA 4NAXA 2H71A 3IAM2 4GSSA 3C8EA 4WR4A 4ID0A 2GVPA 4V1Ap 5A1NA 3DWVA 2YOIA 3IV4A 2FHEA 3I69A 5G1LA 4EIQA 3ERFA 4I5QA 3VK9A 4QL7A 4IQ1A 2C0FA 3DIEA 3F9UA 4PGTA 2VAFA 5E4WA 3ZRDA 2H6XA 2LS5A 1X9WB 5JCWA 2N5BA 1O7UA 3DEXA 2KLXA 1GSDA 1PKWA 2K6VA 2L59A 4BVYA 2P5RA 1SK1A 3DD3A 4JU5A 3QMXA 5JWQB 3ZREA 4XS1A 1TK0B 2JZSA 6GSWA 4G0LA 2H1GA 1AC1A 3D21A 4WETA 2M72A 4EL1A 2FA4A 4L0UA 2HNLA 2GTUA 3KH7A 4MZBA 4ZILA 2O7KA 4FYBA 3C1SA 2NTOA 2X8CA 3GV1A 3CRTA 1W89A 1YDKA 3FZ9A 5KN2A 5G5EA 3FZAA 3EURA 4G10A 2P0GA 1TTZA 2V2GA 3F4RA 4J2FA 3VWUA 5CAXA 3GH9A 4K2XA 2AV4A 2B7KA 2WGRA 4OFTA 1ILOA 3CSJA 1EV4A 1A8YA 5D73A 2J9HA 2OBIA 3PINA 1JZOA 5IPGA 4AKIA 2IN3A 3EC3A 5H5RA 3WD6A 1PA3A 1F3AA 5GSSA 4TKYA 2IJYA 19GSA 2PVQA 1TDIA 5IM9A 3HZ8A 4JEDA 4BL7B 4V2NA 5JCGA 5J5NA 3VPQA 5J4UA 2VCVA 1MD4A 3IR4A 4OD7A 2ALBA 2TIRA 1GSEA 1GUMA 2VL2C 4TXVA 3CYNA 1SYXA 1GWCA 2VCTA 13GSA 4AJ8A 3O6TA 2GDRA 2C0DA 2FWGA 3F6DA 1AW9A 3LJRA 3HHVA 4KA0A 4LL1B 2DIZA 1UC7A 4HJMA 4F2IA 2EIOA 2DJ1A 3LQ7A 3GKMA 4KDXA 3ZFBA 1THXA 1UA5A 1A8LA 1XW5A 3EWLA 3H79A 1U6TA 2CZ2A 10GSA 3TJFA 1K0AA 2HFDA 3TGZA 3BCKA 2YZUA 5HFGA 2V41A 1GUKA 3HVVA 4OWYA 1MDKA 3KZQA 2OE1A 5EVOA 2QKEA 1Q4JA 1FVKA 2JACA 4YQMA 4TOPA 4K7IA 3F6FA 1XVQA 5ECOB 2LRTA 3Q19A 2FCHA 1J0FA 3MSZA 4POBA 5KOXA 1RQMA 5COHA 4OCFA 1F37A 4TN8A 5CO3A 4Z2UA 3I9V2 5GAND 1K3YA 2I4AA 2O8VB 3HDCA 3DGQA 1O8WA 2LJKA 1I9DA 3UL3A 4WKWA 3H8QA 4ZXGA 4BL7A 1XWGA 1GNEA 2KP2A 3A5WA 3LW9A 1XW6A 2LQOA 1XFLA 1B9XC 1PX7A 2H0HA 2JSYA 3K8NA 4EVMA 4LLRA 5BRTA 1PQNA 1T1VA 1EWXA 1F2EA 2GQKA 2XPEA 2GSTA 2B3SA 3VURA 1TI1A 3VWWA 2JZTA 3KEBA 4I2UA 3ERWA 2R37A 2VD0A 4XTSA 4EF0A 2QSIA 3F4TA 2YV7A 5HQPA 1QQ2A 2E2GA 2B1KA 3GIXA 2AHEA 2H1LA 1A0RP 5IMZA 4YQVA 1NW2A 2VL2A 2H76A 2LSTA 1PRXA 1Z6NA 3ME8A 1V40A 3D5JA 3GRXA 3G9BA 3P2AA 3FK8A 2VCXA 4GF0A 1V58A 2G0FA 2VUPA 4TR1B 4IVFA 5JWOB 1GH2A 4K6XA 2JSZA 2CAIA 3APSA 3H93A 1KNGA 2HXKA 2DJ3A 1XCCA 5CYYA 3ME7A 1GSQA 4N10A 4ICYA 2ES7A 2DC5A 4GSNA 5F07A 3KM6A 3BD2A 1GTAA 2H1BA 4TRXA 4O7HA 5DJLA 3LORA 2HSNB 3F3QA 2FLSA 4ZB8A 2H19A 1FHEA 2ZCTA 1K0NA 4ZB6A 4PNFA 1WRYA 5F06A 4ECJA 5KN3A 1E2YA 1SK0A 3UEMA 3CMIA 1AIUA 4F82A 3ZVJA 3MYDA 3HJMA 2JADA 2K18A 1K0CA 4BPYA 1QMVA 1OE7A 3DVWA 4YAPA 4ZB9A 1A2MA 3DMLA 1GUHA 4ZIJA 4MF5A 2L57A 4EUYA 4RQRA 2DMLA 2R6KA 1VF4A 5D96A 3C1RA 2CAQA 2X8GA 1C72A 2BTOT 1MDJA 3LFLA 3TOTA 3HCZA 4AGSA 1AXDA 4KDYA 3BJ5A 5J40A 5ECPB 5D9TA 1Y25A 1R26A 1SK2A 5ECMB 2EIRA 4NMUA 5CRWA 2H70A 5HR0A 2GZZA 2GT5A 3IDVA 4K0GA 3F63A 2R0CA 2YWIA 1EOGA 4TR1A 4PQIA 1HNAA 4OFNA 2MMAA 3W6GA 2C3NA 1TK8B 1FO5A 3VPTA 3U5RE 5L71A 2MBSA 1JZRA 1R7HA 2GLRA 5ECNB 2RLIA 1OC9B 3ZYWA 4HQSA 4QL9A 1BG1A 1ERVA 1UN2A 3TRQA 4KW6A 4CW9A 4GLTA 4K5SA 4O92A 2HSNA 3TRXA 3FMWA 2R2JA 1ERUA 4HZ2A 3A2VA 1G0TA 5IMVA 4IELA 1SU9A 2H6YA 3P7XA 2CVKA 1O85A 4IJIA 3VI7A 3FEUA 4JR4A 20GSA 4IJ3A 1NHYA 3RPPA 4MP4A 1BG5A 3AY8A 3TRPA 5KEJA 3A3TA 2HRNA 3LXZA 1PX6A 1KBNA 4NV5A 3CXGA 4K7NA 2ZUPA 2N5AA 2H0IA 3VI5A 4ZL8A 4EDYA 5CP1A 2HSMB 5D9VA 3RBTA 2RIIA 4IS0A 2VCZA 4L0WA 1TK5B 2HRAA 2GZPA 5ECRB 1T8EB 4GCIA 3D6IA 5A5KA 5A34B 1GULA 2QC7A 2H73A 2IMDA 5F8BA 4PQHA 4YKFA 1J08A 3HJOA 4E8EA 3TJKA 3KCMA 2IMEA 2CQ9A 1GSUA 5KN1A 4ZB7A 4BA7A 4MA9A 3UBKA 4X43A 1OC9A 4DSRA 3L9UA 3GSSA 2RUFA 5ECHB 2I9HA 3F8UA 3UAPA 1YVLA 1FB6A 5IQYA 2ON5A 4POKA 1J9BA 5EPFA 5FHIA 1M7TA 4ZBDA 4I8BA 4GTUA 1VF2A 2YJHA 3WGEA 4WBRD 2H1AA 2HSHA 5D9WA 1EEMA 1QUWA 1LBKA 3QCPA 3CSHA 4HEA2 3ZIJA 1YKAA 3EPTA 1RW1A 3CTGA 1M9BA 1GSFA 3KGKA 2KP1A 4MZCA 5ABRA 1OE8A 2C4JA 4K0NA 2B7JA 3QAGA 1JZWA 5J47A 4WEYA 2HSMA 1DE2A 1PN9A 1SL0B 1XWKA 3HJPA 1H75A 2M80A 3GHAA 5DJMA 5HR2A 5A34A 7GSSA 1PKZA 3KMNA 1Z3EA 2AAWA 3H4KA 1B8XA 5H5QA 4L5OA 2QA1A 1ZYEA 2FY6A 1ZZYA 4KSMA 1EOHA 2EFDA 4MPFA 2MBTA 4OO5A 3SBCA 4ULXA 4DSQA 4CY8A 2J23A 2XPDA 4N0ZA 1ERWA 2I1UA 3F0IA 2X4AA 3P90A 2EFHA 3TKPA 5IO2A 4MF6A 3HD5A 3A5IA 4MABA 3PH9A 1M2AA 3M3MA 5IMCA 4Z7XA 1IYIA 1AUCA 1T4ZA 4G9HA 4HS1A 1YF0A 2PGTA 2CVDA 4MK3A 4GXZA 1TP9A 2B5EA 1X0RA 1N25A 1CQHA 4O32A 3FY7A 3GN3A 5KOWA 4OFMA 1NHOA 4EE0A 1YF1A 1PSQA 2MZCA 5G31A 3CTFA 4X0XA 3TKQA 4IQAA 4KAEA 4X1UA 1TW9A 2OA7A 2CX4A 4IBPA 4POMA 4RUVA 3CWGA 3VWVA 1VF3A 1GTUA 1EEJA 1FVJA 1IYHA 3TB2A 1ACVA 1G7EA 1U87A 3L9SA 3APOA 4ECCA 2CT6A 3LSZA 3P8WA 3UJ1A 2A2PA 3UBLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G6Y A;  4LMV A;  1QXH A;  1ZGN A;  2VO4 A;  2YCD A;  4I6X A;  5D93 A;  2DLX A;  4FIW A;  5AIX A;  2BJX A;  6GSU A;  2NVL A;  5CRG A;  2E0Q A;  1Z7P A;  2HZF A;  3MDK A;  2CVB A;  2AUV A;  1YEP A;  3ERG A;  4ISD A;  4KSO A;  3EU4 A;  1LU4 A;  5F0G A;  4N11 A;  1S3A A;  2PPT A;  1T00 A;  1OC3 A;  1PL2 A;  1Y6E A;  1OC8 A;  4F9Z A;  5DAK B;  1A0F A;  2BMX A;  2B5X A;  1PMT A;  3WT2 A;  17GS A;  4XRA A;  9GSS A;  4NWY A;  2C3Q A;  5DDL A;  1HQO A;  1ERT A;  5DVB A;  3E9J B;  2WS2 A;  2LTK A;  2I3Y A;  4FO5 A;  4KX4 A;  3IHQ A;  5ECQ B;  1BX9 A;  1WJK A;  2B1L A;  3UMA A;  1AAZ A;  5H5S A;  1G6W A;  2PN8 A;  3APQ A;  4G2E A;  1TU8 A;  4HZ4 A;  1GRX A;  4HDE A;  2G2Q A;  1SJI A;  3JCM L;  4ZBA A;  3MAK A;  2K8S A;  5ECI B;  1DSB A;  3H1N A;  5IMD A;  4PXO A;  1XPV A;  3KP8 A;  4RQX A;  3IC4 A;  2WZ9 A;  3ZMK A;  1ZMA A;  3RHB A;  2DJ2 A;  1V98 A;  4OO4 A;  4NHW A;  18GS A;  3ZIT A;  2HI7 A;  3HVX A;  1ON4 A;  2Z9S A;  3Q6O A;  5IPH A;  2GSR A;  1TOF A;  3LXT A;  4ML1 A;  4N30 A;  1YKC A;  2WB9 A;  4AJ7 A;  3HYP A;  2H8L A;  2R5G A;  3F4S A;  5EL8 A;  4OCE A;  4P3Y B;  2RUE A;  4K7O A;  3US3 A;  4PTS A;  2B6M A;  5DAK A;  2LNT A;  4NPB A;  5IOX A;  1OYJ A;  1DUG A;  1M0U A;  2IMI A;  4TW5 A;  1YEX A;  5IIZ A;  1WOU A;  2LRN A;  3A2W A;  3KMO A;  3C7M A;  2C1Y A;  3EMX A;  1SYR A;  1WP0 A;  5AN1 A;  1RK4 A;  4TR0 A;  4MPG A;  5CNW A;  2C3T A;  1HYU A;  1M2D A;  3VFI A;  2YWO A;  2C0G A;  4EDZ A;  4Q5R A;  4F0B A;  3CRU A;  5A4W A;  5A4U A;  1R5P A;  3OR5 A;  4EXJ A;  1SKW B;  4LA1 A;  3L78 A;  2KUC A;  4YH2 A;  2HRK B;  4PUF C;  4HJ2 A;  2IL3 A;  4ML6 A;  5ECL B;  3GL5 A;  2FWH A;  2H66 A;  4XHM A;  5HFK A;  2M46 A;  2C80 A;  1TRU A;  3Q74 A;  4E8H A;  4MJE A;  2A2R A;  5DAL B;  1LJR A;  3NIV A;  3KTB A;  4EKZ A;  1SD8 A;  3UVH A;  4H86 A;  2JZR A;  2HRF A;  3E0U A;  3FYG A;  3NOF A;  1TI3 A;  4USS A;  1X5C A;  2WDU A;  1FAA A;  3I43 A;  4O5R A;  5ID2 B;  3GTU B;  1WWJ A;  4IP6 A;  3TUE A;  4WF5 A;  2LQQ A;  2HSY A;  2YV9 A;  2WUL A;  3DVX A;  1GSY A;  4XIH A;  2IMF A;  4NHZ A;  2VOC A;  2R4V A;  2LJR A;  2DJJ A;  4MJC A;  1TRS A;  2C0E A;  5IMA A;  2JL4 A;  2A4V A;  1ZYQ B;  1TRW A;  5AIS A;  5G30 A;  1GNW A;  4G19 A;  5GAP D;  3FZ4 A;  3IOS A;  2E7P A;  4K9Z A;  4RI7 A;  4PUA A;  1JLW A;  3S9F A;  4LMW A;  3FHK A;  4AJ6 A;  3G7J A;  2X64 A;  1ZCP A;  4D73 B;  5HR1 A;  4TXO B;  2DJ0 A;  1B4Q A;  3PGT A;  2HT9 A;  2HRK A;  4TR4 A;  3IA1 A;  1SKS B;  5LNK e;  1U3I A;  4FYU A;  1XWA A;  3LWA A;  4JZQ A;  2YZH A;  1X9S B;  1K0D A;  1AQX A;  3GNJ A;  2VM2 A;  5DAL A;  2EIQ A;  3O76 A;  5FT3 A;  1DE1 A;  4KF9 A;  2IPA A;  5DCG A;  2GGT A;  5INY A;  1VGL A;  2L6D A;  1FB0 A;  4YAV A;  2PWJ A;  4MDC A;  3GKX A;  4GQC A;  22GS A;  1K3L A;  3CBU A;  3CSI A;  1ST9 A;  5ID2 A;  3GTU A;  4ZBB A;  2OAC A;  2OJL A;  4HU9 A;  14GS A;  2H75 A;  3GKK A;  2GQL A;  5C04 A;  3M8N A;  2AB6 A;  4KND A;  6GSV A;  1JLV A;  2V6K A;  4GWR A;  1G7O A;  3GL3 A;  3QDN A;  3IRA A;  1SL1 B;  3J7Y k;  2TRC P;  2A2S A;  3J7Y b;  3HA9 A;  4ZL7 A;  3HVS A;  2AJQ B;  1U88 A;  3QAW A;  1GTB A;  2YWN A;  1QFN A;  3IK9 A;  4MZW A;  1FOV A;  3ISO A;  4I97 A;  4JRR A;  1OAZ A;  1BJX A;  4IKH A;  1ABA A;  2HLS A;  2EC4 A;  4KE3 A;  3GUR A;  3PR8 A;  5EY6 A;  1TJD A;  1M9A A;  4POL A;  4D73 A;  4TXO A;  2WJU A;  1YZX A;  3GMF A;  5ELG A;  5DBQ A;  1Z7R A;  2YAN A;  5GST A;  5C00 A;  1SD9 A;  3TJG A;  2X99 A;  5G2Z A;  1R5A A;  3IE3 A;  1V57 A;  2FWE A;  4CHS A;  1F9M A;  4MJB A;  2H74 A;  3DXB A;  4KUN A;  5JWR B;  3M0F A;  2PMT A;  1QK8 A;  1YQ1 A;  4GRF A;  6GST A;  2YWM A;  1A23 A;  1MEK A;  2GT6 A;  3C71 A;  1GL8 A;  1WE0 A;  2O85 A;  1BED A;  1OKT A;  4XCS A;  1A24 A;  2VLU A;  5ELA A;  3L0H A;  16GS A;  3ZLP A;  2H1D A;  3QFB C;  4FH8 A;  1X5E A;  5G5F A;  11GS A;  4ILF A;  4TR3 A;  3BCI A;  1XXU A;  1TXX A;  2LNS A;  3KH9 A;  1M99 A;  3GA4 A;  2NBS A;  1KEB A;  4IHU A;  3GYK A;  3TKR A;  1GSS A;  3GH6 A;  5CRH A;  4J57 E;  3MWH A;  1T4Y A;  5B7C A;  2MMN A;  4JE1 A;  4KB3 A;  3KXO A;  3UOM A;  4Q5Q A;  2CX3 A;  3DYR A;  5AIV A;  4F03 A;  4DSS B;  1EP7 A;  4IP1 A;  5D9X A;  2VLT A;  4L5L A;  1XOA A;  2GQM A;  1V9W A;  3WT1 A;  3IPZ A;  3RHC A;  5LD0 A;  2FA8 A;  2XBQ A;  3EU3 A;  3ZZX A;  2YP6 A;  1XVW A;  5E59 A;  12GS A;  2FD3 A;  2HYX A;  3R2Q A;  5CRD A;  3FR3 A;  1PGT A;  5FWG A;  3TCO A;  2L5O A;  1TRV A;  3WGX A;  2QGV A;  4DEJ A;  1HNB A;  5B6M A;  1MD3 A;  3N9J A;  2DIY A;  2KOK A;  4HU7 A;  3RPN A;  1O8X A;  3UVT A;  2YPM A;  2UZ8 A;  3IK7 A;  2XC2 A;  4J56 E;  3QAV A;  4HOJ A;  3WYW A;  3GX0 A;  3VLN A;  3GUS A;  5DQS A;  3E3E A;  5AGY A;  2E2M A;  4HQZ A;  4ECB A;  3IAS 2;  4MH2 A;  3QOU A;  4MJA A;  3KD0 A;  1OKD A;  2P5Q A;  4NV2 A;  1GP1 A;  3RAZ A;  3F3R A;  1N2A A;  2V6O A;  3GST A;  5CRE A;  3KP9 A;  1BYE A;  2MYG A;  2VL3 A;  4OMV A;  3ZFL A;  4LL4 B;  4QQ7 A;  4DSS A;  2VM1 A;  1R4W A;  1MDI A;  5ECK B;  1T7P B;  4RI6 A;  1EGR A;  5A4V A;  3FW2 A;  1TKD B;  2F8F A;  3C73 A;  1E6B A;  4TVE A;  3EMP A;  3TKS C;  2D2Z A;  1SL2 B;  4JBB A;  1W4V A;  1U3A A;  2GSS A;  3FKF A;  3EYT A;  4PX1 A;  4MH3 A;  1B9Y C;  3BBY A;  3TKS E;  3QR6 A;  2REM A;  3FR9 A;  2VD1 A;  4L8E A;  2CA8 A;  1AQV A;  4IN0 A;  3LEF A;  5IOW A;  3U6V A;  2F51 A;  3HKR A;  6GSS A;  1HNC A;  4G0K A;  1HD2 A;  2LUS A;  3HXS A;  2GS3 A;  4XRD A;  2CV4 A;  2H30 A;  2HE3 A;  2HQT A;  4FQU A;  2KHP A;  5IO0 A;  2DJK A;  2O87 A;  1XWC A;  4KCE A;  3DKS A;  2IFQ B;  1THO A;  5GZZ B;  3LYP A;  2LJA A;  3A2X A;  3QD9 A;  3D4T A;  1GLQ A;  4MF7 A;  2DSA A;  2MMO A;  2VCQ A;  5F05 A;  4WR5 A;  1V2A A;  2K9F A;  3IC8 A;  3D22 A;  5G1K A;  1VRS D;  1XOB A;  5DCH A;  1PL1 A;  2VLV A;  1SJ6 A;  4Q5N A;  5B8A A;  3M1G A;  5HR3 A;  4KH7 A;  4PQ1 A;  2R3X A;  3WGD A;  3ZL5 A;  2IMK A;  2N5F A;  4N0V A;  2JU5 A;  2HZE B;  2XHF A;  5KN0 A;  4V2L A;  1O73 A;  1OVN A;  2LKU A;  2RM5 A;  3MNG A;  4EC0 A;  3BOA A;  2ON7 A;  1EP8 A;  2L4C A;  2CZ3 A;  2IIY A;  3GKN A;  3D0Z A;  1K0O A;  3EVI A;  4WF4 A;  4MLY A;  1JZD A;  4IGJ A;  2ZNM A;  1MTC A;  8GSS A;  3VWX A;  1FW1 A;  3FZ5 A;  4BVX B;  5B6N A;  2F3M A;  3TJJ A;  1USB A;  4GST A;  3LYK A;  2FNO A;  2LEG A;  4V2M A;  3GX8 A;  1S3C A;  2VL9 A;  2X8H A;  3TKS A;  2NDO A;  2FUG 2;  1NSW A;  5IMF A;  3ED3 A;  2IWT A;  2DBC A;  1S3D A;  3ZML A;  1EGO A;  1XZO A;  3G7Y A;  2VCW A;  1Z5Y E;  4AF2 A;  2C8U A;  4WXT A;  4PNG A;  4YQU A;  4KCA A;  4KGI A;  2VIM A;  3V1W A;  2H6Z A;  2IFQ A;  1XBS A;  2GSQ A;  3KIJ A;  1I5G A;  3KJY A;  4WBJ A;  4XS6 A;  4XS4 B;  2LV3 A;  2WRT A;  1T3B A;  2B5Y A;  5HFI A;  1Q98 A;  5ENU A;  2YN1 A;  5ECS A;  3DRN A;  2LRC A;  1YJ6 A;  3FRC A;  3M9J A;  1JFU A;  1FG4 A;  4EO3 A;  3IBH A;  3G7I A;  4HI7 A;  1A2J A;  1KTE A;  4BWQ A;  1B48 A;  3HZ4 A;  2PBJ A;  1ZL9 A;  2YJ7 A;  2HZE A;  4K1F A;  5J41 A;  2V32 A;  4BWS A;  4DVC A;  3EE2 A;  6GSX A;  5J9C A;  2XBI A;  2PUK C;  3KTL A;  1AQW A;  2L4Q A;  3L9V A;  1ZOF A;  3LGC A;  4PUR A;  3UAR A;  5DQY A;  1SJZ A;  4HUA A;  1SKR B;  2PVO C;  2K8V A;  1K0B A;  1M2B A;  4ECI A;  1Z6M A;  4BVX A;  5LCZ A;  1EZK A;  4F0C A;  2L6C A;  4MMM A;  3QPM A;  1H4O A;  1XWB A;  2F8A A;  1A2L A;  2NPB A;  3L4N A;  5JCU A;  1CQG A;  2OAD A;  4ZL9 A;  2WFC A;  1BAY A;  3Q18 A;  2OBK A;  3LG6 A;  3ZVJ D;  1NM3 A;  1X5D A;  1O81 A;  3EIN A;  4JR6 A;  3TOU A;  3TJB A;  1K3O A;  1YY7 A;  1N8J A;  3IXR A;  3SWL A;  3N5O A;  1TU7 A;  4FYC A;  1GLP A;  4XS4 A;  1O6J A;  3D4M A;  3UIW A;  4BVY B;  1SEN A;  4ACS A;  4G0I A;  2L5L A;  1XW9 A;  3FR6 A;  2F9S A;  4CDO A;  2PER A;  1GTI A;  1Z9H A;  4K8M A;  4NXI A;  2MMZ A;  5J3R A;  3PPU A;  2H72 A;  2DMM A;  4MCU A;  2OE0 A;  5D8I A;  3QFA C;  2H01 A;  3NZN A;  5BMU A;  6GSY A;  1ML6 A;  1UVZ A;  2OKA A;  4KDU A;  2AYT A;  3I6A A;  1F6M C;  5J9B A;  3ZTL A;  1VF1 A;  4V1A g;  2V1M A;  1QGV A;  3M9K A;  2FGX A;  2RM6 A;  1JHB A;  1WIK A;  3RDW A;  1WPI A;  2TRX A;  3GFK A;  3W8J A;  3R3E A;  1K0M A;  1BQ7 A;  4K2D A;  1WMJ A;  4Q5F A;  4I2T A;  2PU9 C;  2I81 A;  3O3T A;  1B4P A;  3W8S A;  2WCI A;  2GZY A;  2YNX A;  4GQF A;  5B8B A;  2FWF A;  2H0G A;  2OE3 A;  1X9M B;  2P31 A;  1F3B A;  3HY2 A;  4IW9 A;  3TDG A;  1EV9 A;  2O89 A;  1URM A;  1DBY A;  1XIY A;  1PD2 1;  3ZIV A;  4NAX A;  2H71 A;  3IAM 2;  4GSS A;  3C8E A;  4WR4 A;  4ID0 A;  2GVP A;  4V1A p;  3DWV A;  2YOI A;  3IV4 A;  2FHE A;  3I69 A;  5G1L A;  3ERF A;  4I5Q A;  3VK9 A;  4QL7 A;  4IQ1 A;  2C0F A;  3DIE A;  3F9U A;  4PGT A;  2VAF A;  5E4W A;  3ZRD A;  2H6X A;  2LS5 A;  1X9W B;  5JCW A;  2N5B A;  1O7U A;  3DEX A;  2KLX A;  1GSD A;  1PKW A;  2K6V A;  2L59 A;  4BVY A;  2P5R A;  1SK1 A;  3DD3 A;  4JU5 A;  3QMX A;  5JWQ B;  3ZRE A;  4XS1 A;  1TK0 B;  2JZS A;  6GSW A;  4G0L A;  2H1G A;  1AC1 A;  3D21 A;  4WET A;  2M72 A;  4EL1 A;  2FA4 A;  4L0U A;  2HNL A;  2GTU A;  3KH7 A;  4MZB A;  4ZIL A;  4FYB A;  2O7K A;  3C1S A;  2NTO A;  2X8C A;  3GV1 A;  3CRT A;  1W89 A;  1YDK A;  3FZ9 A;  5KN2 A;  5G5E A;  3FZA A;  3EUR A;  4G10 A;  2P0G A;  1TTZ A;  2V2G A;  3F4R A;  4J2F A;  3VWU A;  5CAX A;  3GH9 A;  2AV4 A;  2B7K A;  2WGR A;  4OFT A;  1ILO A;  3CSJ A;  1EV4 A;  1A8Y A;  5D73 A;  2J9H A;  2OBI A;  3PIN A;  1JZO A;  5IPG A;  2IN3 A;  3EC3 A;  5H5R A;  3WD6 A;  1PA3 A;  1F3A A;  5GSS A;  4TKY A;  2IJY A;  19GS A;  2PVQ A;  1TDI A;  5IM9 A;  3HZ8 A;  4JED A;  4BL7 B;  4V2N A;  5JCG A;  5J5N A;  3VPQ A;  5J4U A;  2VCV A;  1MD4 A;  3IR4 A;  4OD7 A;  2ALB A;  2TIR A;  1GSE A;  1GUM A;  2VL2 C;  4TXV A;  3CYN A;  1SYX A;  1GWC A;  2VCT A;  13GS A;  4AJ8 A;  3O6T A;  2GDR A;  2C0D A;  2FWG A;  3F6D A;  1AW9 A;  3LJR A;  3HHV A;  4KA0 A;  4LL1 B;  2DIZ A;  1UC7 A;  4HJM A;  4F2I A;  2EIO A;  2DJ1 A;  3LQ7 A;  3GKM A;  4KDX A;  3ZFB A;  1THX A;  1UA5 A;  1A8L A;  1XW5 A;  3EWL A;  3H79 A;  1U6T A;  2CZ2 A;  10GS A;  3TJF A;  1K0A A;  2HFD A;  3TGZ A;  3BCK A;  2YZU A;  5HFG A;  2V41 A;  1GUK A;  3HVV A;  4OWY A;  1MDK A;  3KZQ A;  2OE1 A;  5EVO A;  2QKE A;  1Q4J A;  1FVK A;  2JAC A;  4YQM A;  4TOP A;  4K7I A;  3F6F A;  1XVQ A;  5ECO B;  2LRT A;  3Q19 A;  2FCH A;  1J0F A;  3MSZ A;  4POB A;  1RQM A;  5COH A;  4OCF A;  1F37 A;  4TN8 A;  5CO3 A;  3I9V 2;  5GAN D;  1K3Y A;  2I4A A;  2O8V B;  3HDC A;  3DGQ A;  1O8W A;  2LJK A;  1I9D A;  3UL3 A;  4WKW A;  3H8Q A;  4ZXG A;  4BL7 A;  1XWG A;  1GNE A;  2KP2 A;  3A5W A;  1XW6 A;  2LQO A;  1XFL A;  1B9X C;  1PX7 A;  2H0H A;  2JSY A;  3K8N A;  4EVM A;  4LLR A;  1PQN A;  1T1V A;  1EWX A;  1F2E A;  2GQK A;  2XPE A;  2GST A;  2B3S A;  3VUR A;  1TI1 A;  3VWW A;  2JZT A;  3KEB A;  4I2U A;  3ERW A;  2R37 A;  2VD0 A;  4XTS A;  4EF0 A;  2QSI A;  3F4T A;  2YV7 A;  5HQP A;  1QQ2 A;  2E2G A;  2B1K A;  3GIX A;  2AHE A;  1A0R P;  5IMZ A;  4YQV A;  1NW2 A;  2VL2 A;  2H76 A;  2LST A;  1PRX A;  1Z6N A;  3ME8 A;  1V40 A;  3D5J A;  3GRX A;  3G9B A;  3P2A A;  3FK8 A;  2VCX A;  4GF0 A;  1V58 A;  2G0F A;  2VUP A;  4TR1 B;  4IVF A;  5JWO B;  1GH2 A;  4K6X A;  2JSZ A;  2CAI A;  3APS A;  3H93 A;  1KNG A;  2HXK A;  2DJ3 A;  1XCC A;  5CYY A;  3ME7 A;  1GSQ A;  4N10 A;  2ES7 A;  2DC5 A;  4GSN A;  5F07 A;  3KM6 A;  3BD2 A;  1GTA A;  2H1B A;  4TRX A;  4O7H A;  5DJL A;  3LOR A;  2HSN B;  3F3Q A;  2FLS A;  4ZB8 A;  2H19 A;  1FHE A;  2ZCT A;  1K0N A;  4ZB6 A;  4PNF A;  1WRY A;  5F06 A;  4ECJ A;  5KN3 A;  1E2Y A;  1SK0 A;  3UEM A;  3CMI A;  1AIU A;  4F82 A;  3ZVJ A;  3HJM A;  2JAD A;  2K18 A;  1K0C A;  4BPY A;  1QMV A;  1OE7 A;  3DVW A;  4YAP A;  4ZB9 A;  1A2M A;  3DML A;  1GUH A;  4ZIJ A;  4MF5 A;  2L57 A;  4EUY A;  4RQR A;  2DML A;  2R6K A;  1VF4 A;  5D96 A;  3C1R A;  2CAQ A;  2X8G A;  1C72 A;  2BTO T;  1MDJ A;  3LFL A;  3TOT A;  3HCZ A;  4AGS A;  1AXD A;  4KDY A;  3BJ5 A;  5ECP B;  5D9T A;  1Y25 A;  1R26 A;  1SK2 A;  5ECM B;  2EIR A;  4NMU A;  5CRW A;  2H70 A;  5HR0 A;  2GZZ A;  2GT5 A;  3IDV A;  4K0G A;  3F63 A;  2YWI A;  1EOG A;  4TR1 A;  4PQI A;  1HNA A;  4OFN A;  2MMA A;  3W6G A;  2C3N A;  1TK8 B;  1FO5 A;  3VPT A;  3U5R E;  5L71 A;  2MBS A;  1JZR A;  1R7H A;  2GLR A;  5ECN B;  2RLI A;  1OC9 B;  3ZYW A;  4HQS A;  4QL9 A;  1ERV A;  1UN2 A;  3TRQ A;  4KW6 A;  4CW9 A;  4GLT A;  4O92 A;  3TRX A;  2R2J A;  1ERU A;  4HZ2 A;  3A2V A;  1G0T A;  5IMV A;  4IEL A;  1SU9 A;  2H6Y A;  3P7X A;  2CVK A;  1O85 A;  4IJI A;  3VI7 A;  3FEU A;  4JR4 A;  20GS A;  4IJ3 A;  1NHY A;  3RPP A;  4MP4 A;  1BG5 A;  3AY8 A;  3TRP A;  5KEJ A;  3A3T A;  2HRN A;  3LXZ A;  1PX6 A;  1KBN A;  4NV5 A;  3CXG A;  4K7N A;  2ZUP A;  2N5A A;  2H0I A;  3VI5 A;  4ZL8 A;  4EDY A;  5CP1 A;  2HSM B;  5D9V A;  3RBT A;  2RII A;  4IS0 A;  2VCZ A;  4L0W A;  1TK5 B;  2HRA A;  2GZP A;  5ECR B;  1T8E B;  4GCI A;  3D6I A;  5A5K A;  1GUL A;  2QC7 A;  2H73 A;  2IMD A;  5F8B A;  4PQH A;  1J08 A;  3HJO A;  4E8E A;  3TJK A;  3KCM A;  2IME A;  2CQ9 A;  1GSU A;  5KN1 A;  4BA7 A;  4MA9 A;  3UBK A;  4X43 A;  1OC9 A;  4DSR A;  3L9U A;  3GSS A;  2RUF A;  5ECH B;  2I9H A;  3F8U A;  3UAP A;  1FB6 A;  5IQY A;  2ON5 A;  4POK A;  1J9B A;  5EPF A;  5FHI A;  1M7T A;  4ZBD A;  4I8B A;  4GTU A;  1VF2 A;  2YJH A;  3WGE A;  4WBR D;  2H1A A;  2HSH A;  5D9W A;  1EEM A;  1QUW A;  1LBK A;  3QCP A;  3CSH A;  4HEA 2;  3ZIJ A;  1YKA A;  1RW1 A;  3CTG A;  1M9B A;  1GSF A;  3KGK A;  2KP1 A;  4MZC A;  5ABR A;  1OE8 A;  2C4J A;  4K0N A;  2B7J A;  3QAG A;  1JZW A;  4WEY A;  2HSM A;  1DE2 A;  1PN9 A;  1SL0 B;  1XWK A;  3HJP A;  1H75 A;  2M80 A;  3GHA A;  5DJM A;  5HR2 A;  7GSS A;  1PKZ A;  3KMN A;  1Z3E A;  2AAW A;  3H4K A;  1B8X A;  5H5Q A;  4L5O A;  1ZYE A;  2FY6 A;  1ZZY A;  4KSM A;  1EOH A;  4MPF A;  2MBT A;  4OO5 A;  3SBC A;  4ULX A;  4DSQ A;  2J23 A;  2XPD A;  4N0Z A;  1ERW A;  2I1U A;  3F0I A;  3P90 A;  3TKP A;  5IO2 A;  4MF6 A;  3HD5 A;  4MAB A;  3PH9 A;  1M2A A;  3M3M A;  5IMC A;  4Z7X A;  1IYI A;  1AUC A;  1T4Z A;  4G9H A;  4HS1 A;  1YF0 A;  2PGT A;  2CVD A;  4MK3 A;  4GXZ A;  1TP9 A;  2B5E A;  1X0R A;  1CQH A;  4O32 A;  3FY7 A;  3GN3 A;  4OFM A;  1NHO A;  4EE0 A;  1YF1 A;  1PSQ A;  2MZC A;  5G31 A;  3CTF A;  4X0X A;  3TKQ A;  4IQA A;  4KAE A;  4X1U A;  1TW9 A;  2OA7 A;  2CX4 A;  4IBP A;  4POM A;  4RUV A;  3VWV A;  1VF3 A;  1GTU A;  1EEJ A;  1FVJ A;  1IYH A;  3TB2 A;  1ACV A;  1G7E A;  1U87 A;  3L9S A;  3APO A;  4ECC A;  2CT6 A;  3LSZ A;  3P8W A;  3UJ1 A;  3UBL A; 
#chains in the Genus database with same CATH topology
 1G6Y A;  4LMV A;  1QXH A;  1ZGN A;  2VO4 A;  2YCD A;  4I6X A;  5D93 A;  2DLX A;  4FIW A;  5AIX A;  2BJX A;  6GSU A;  2NVL A;  5CRG A;  2E0Q A;  1Z7P A;  2HZF A;  3MDK A;  2CVB A;  2AUV A;  1YEP A;  3ERG A;  4ISD A;  4KSO A;  3EU4 A;  1LU4 A;  5F0G A;  4N11 A;  4YKG A;  1S3A A;  2PPT A;  5A5H B;  1T00 A;  1OC3 A;  1PL2 A;  1Y6E A;  1OC8 A;  4F9Z A;  5DAK B;  1A0F A;  2BMX A;  2B5X A;  1PMT A;  3WT2 A;  17GS A;  4XRA A;  9GSS A;  4NWY A;  2C3Q A;  4E68 A;  5DDL A;  1HQO A;  1ERT A;  5DVB A;  3E9J B;  2WS2 A;  2LTK A;  2OT3 A;  2I3Y A;  4FO5 A;  4KX4 A;  3IHQ A;  5ECQ B;  1BX9 A;  1WJK A;  2B1L A;  3UMA A;  1AAZ A;  5H5S A;  1G6W A;  2PN8 A;  3APQ A;  4G2E A;  1TU8 A;  4HZ4 A;  1GRX A;  4HDE A;  2G2Q A;  1SJI A;  3JCM L;  4ZBA A;  3MAK A;  2R0G A;  2K8S A;  4CY6 A;  5ECI B;  1DSB A;  3H1N A;  5IMD A;  4Z2T A;  4PXO A;  1XPV A;  3KP8 A;  4RQX A;  3IC4 A;  2WZ9 A;  3ZMK A;  1ZMA A;  3RHB A;  2DJ2 A;  1V98 A;  4OO4 A;  1SVO A;  4NHW A;  18GS A;  3ZIT A;  2HI7 A;  3HVX A;  1ON4 A;  2Z9S A;  3Q6O A;  5IPH A;  2GSR A;  1TOF A;  3LXT A;  4ML1 A;  4N30 A;  1YKC A;  2WB9 A;  4AJ7 A;  3HYP A;  2H8L A;  2R5G A;  3CQF A;  5A5H A;  3F4S A;  5EL8 A;  4OCE A;  4P3Y B;  2RUE A;  4K7O A;  3US3 A;  4PTS A;  2B6M A;  5DAK A;  3MIX A;  2LNT A;  4NPB A;  5IOX A;  1OYJ A;  1DUG A;  1M0U A;  2IMI A;  4TW5 A;  1YEX A;  5IIZ A;  1WOU A;  2O3E A;  2LRN A;  3A2W A;  3KMO A;  3C7M A;  2C1Y A;  3EMX A;  1SYR A;  1WP0 A;  5AN1 A;  2O36 A;  1RK4 A;  4TR0 A;  4MPG A;  5CNW A;  2C3T A;  1HYU A;  1M2D A;  3VFI A;  2YWO A;  4O5Q A;  2R0P A;  2C0G A;  4EDZ A;  4Q5R A;  4F0B A;  3CRU A;  5A4W A;  5A4U A;  1R5P A;  3OR5 A;  4EXJ A;  1SKW B;  4LA1 A;  3L78 A;  2KUC A;  4YH2 A;  2HRK B;  4PUF C;  4HJ2 A;  2IL3 A;  4ML6 A;  5ECL B;  3GL5 A;  4BIK A;  3RFR C;  2FWH A;  2H66 A;  4XHM A;  5HFK A;  2M46 A;  2C80 A;  1TRU A;  3Q74 A;  4E8H A;  4MJE A;  2A2R A;  5DAL B;  1LJR A;  3NIV A;  3KTB A;  4EKZ A;  1SD8 A;  3UVH A;  4H86 A;  2JZR A;  1PN0 A;  2HRF A;  3E0U A;  3FYG A;  3NOF A;  1TI3 A;  4USS A;  1X5C A;  2WDU A;  1FAA A;  3I43 A;  4O5R A;  4AKH A;  5ID2 B;  3GTU B;  1WWJ A;  4IP6 A;  3TUE A;  4WF5 A;  2LQQ A;  3IHG A;  2HSY A;  4MNN A;  2YV9 A;  2WUL A;  3DVX A;  1GSY A;  4XIH A;  2IMF A;  4NHZ A;  2VOC A;  2R4V A;  2LJR A;  2DJJ A;  4MJC A;  4G01 A;  1TRS A;  2C0E A;  5IMA A;  4HSC X;  2JL4 A;  2A4V A;  1ZYQ B;  1TRW A;  5AIS A;  1ZYP A;  5G30 A;  1GNW A;  4G19 A;  5GAP D;  2WW2 A;  3FZ4 A;  3IOS A;  2E7P A;  4K9Z A;  4RI7 A;  4PUA A;  1JLW A;  3S9F A;  4LMW A;  3FHK A;  4AJ6 A;  3G7J A;  2X64 A;  1ZCP A;  4D73 B;  5HR1 A;  4TXO B;  2DJ0 A;  1B4Q A;  3PGT A;  2HT9 A;  2HRK A;  4TR4 A;  3IA1 A;  1SKS B;  5LNK e;  1U3I A;  4FYU A;  2EFE A;  1XWA A;  3LWA A;  4JZQ A;  2YZH A;  1X9S B;  1K0D A;  1AQX A;  3GNJ A;  2VM2 A;  5DAL A;  2EIQ A;  3O76 A;  5FT3 A;  1DE1 A;  4KF9 A;  2IPA A;  2UV8 G;  5DCG A;  2GGT A;  5INY A;  1VGL A;  2L6D A;  1FB0 A;  4YAV A;  2PWJ A;  4MDC A;  3GKX A;  4GQC A;  22GS A;  1K3L A;  3CBU A;  3CSI A;  1ST9 A;  5ID2 A;  3GTU A;  4ZBB A;  2OAC A;  2WVX B;  2OJL A;  4HU9 A;  14GS A;  2H75 A;  3GKK A;  2GQL A;  5C04 A;  3M8N A;  2AB6 A;  4KND A;  6GSV A;  1JLV A;  2V6K A;  4GWR A;  1G7O A;  3GL3 A;  4Z2R A;  3QDN A;  1ZYN A;  3IRA A;  1SL1 B;  3J7Y k;  2TRC P;  3UBL A;  4X4J A;  2A2S A;  3J7Y b;  3HA9 A;  4ZL7 A;  3HVS A;  2AJQ B;  1U88 A;  3QAW A;  1GTB A;  4O5U A;  2YWN A;  1QFN A;  3IK9 A;  4MZW A;  1FOV A;  4GDF A;  3ISO A;  4I97 A;  4JRR A;  1OAZ A;  1BJX A;  4IKH A;  1ABA A;  2HLS A;  2EC4 A;  4KE3 A;  3GUR A;  3PR8 A;  5EY6 A;  1TJD A;  1M9A A;  4POL A;  4D73 A;  4TXO A;  2WJU A;  1YZX A;  3GMF A;  5ELG A;  5DBQ A;  1Z7R A;  2YAN A;  5GST A;  5C00 A;  1SD9 A;  3TJG A;  2X99 A;  5G2Z A;  1R5A A;  3IE3 A;  1V57 A;  2FWE A;  4CHS A;  1F9M A;  4MJB A;  2H74 A;  3DXB A;  4KUN A;  5JWR B;  5J4V A;  3M0F A;  2DKH A;  2PMT A;  1QK8 A;  1YQ1 A;  4GRF A;  6GST A;  2YWM A;  1A23 A;  1MEK A;  2GT6 A;  3C71 A;  1GL8 A;  1WE0 A;  2O85 A;  1BED A;  1OKT A;  4XCS A;  1A24 A;  2VLU A;  5ELA A;  2EFC A;  2WVX A;  3L0H A;  16GS A;  3ZLP A;  2H1D A;  3QFB C;  4FH8 A;  1X5E A;  5G5F A;  11GS A;  4ILF A;  4TR3 A;  3BCI A;  1XXU A;  1TXX A;  2LNS A;  3KH9 A;  1M99 A;  3GA4 A;  2NBS A;  1KEB A;  4IHU A;  3GYK A;  3TKR A;  1GSS A;  3GH6 A;  5CRH A;  4J57 E;  3MWH A;  1T4Y A;  5B7C A;  2MMN A;  4JE1 A;  4KB3 A;  3KXO A;  3UOM A;  4Q5Q A;  2CX3 A;  3DYR A;  5AIV A;  4F03 A;  4DSS B;  1EP7 A;  4IP1 A;  5D9X A;  2VLT A;  4L5L A;  1XOA A;  2GQM A;  1V9W A;  3WT1 A;  3HMJ G;  3IPZ A;  3RHC A;  5LD0 A;  2FA8 A;  2XBQ A;  3EU3 A;  3ZZX A;  2YP6 A;  1XVW A;  5E59 A;  12GS A;  2FD3 A;  2HYX A;  3R2Q A;  5CRD A;  3FR3 A;  1PGT A;  5FWG A;  1YEW C;  3TCO A;  2L5O A;  1TRV A;  3WGX A;  2QGV A;  4DEJ A;  1HNB A;  5B6M A;  1MD3 A;  3N9J A;  2DIY A;  2KOK A;  4HU7 A;  3RPN A;  1O8X A;  3UVT A;  2YPM A;  2UZ8 A;  3IK7 A;  4AKX B;  2XC2 A;  4QMK A;  4J56 E;  5J4Y A;  3QAV A;  4HOJ A;  3WYW A;  3GX0 A;  3VLN A;  3GUS A;  5DQS A;  3E3E A;  5AGY A;  2E2M A;  4HQZ A;  4ECB A;  3IAS 2;  4MH2 A;  3QOU A;  4MJA A;  3KD0 A;  1OKD A;  2P5Q A;  4NV2 A;  1GP1 A;  3RAZ A;  3F3R A;  1N2A A;  2V6O A;  3GST A;  5CRE A;  3KP9 A;  1BYE A;  2MYG A;  2VL3 A;  4OMV A;  3ZFL A;  4LL4 B;  4QQ7 A;  4DSS A;  2VM1 A;  1R4W A;  1MDI A;  5ECK B;  1BF5 A;  1T7P B;  4RI6 A;  1EGR A;  5A4V A;  3FW2 A;  1TKD B;  2F8F A;  3C73 A;  1E6B A;  4W66 A;  4TVE A;  3EMP A;  3TKS C;  2D2Z A;  1SL2 B;  4JBB A;  1W4V A;  1U3A A;  2GSS A;  2A4H A;  3FKF A;  3EYT A;  4PX1 A;  4MH3 A;  1B9Y C;  3BBY A;  3TKS E;  3QR6 A;  1SVL A;  2REM A;  3FR9 A;  2VD1 A;  4L8E A;  2CA8 A;  1AQV A;  4IN0 A;  3LEF A;  5IOW A;  3U6V A;  2F51 A;  3HKR A;  6GSS A;  1HNC A;  4G0K A;  1HD2 A;  2LUS A;  3HXS A;  2GS3 A;  4XRD A;  2CV4 A;  2H30 A;  2HE3 A;  2HQT A;  4FQU A;  2KHP A;  5IO0 A;  2DJK A;  2O87 A;  1XWC A;  4KCE A;  3DKS A;  2IFQ B;  1THO A;  5GZZ B;  3LYP A;  2LJA A;  3A2X A;  3QD9 A;  3D4T A;  1GLQ A;  4MF7 A;  2DSA A;  2MMO A;  1SVM A;  2VCQ A;  5F05 A;  4WR5 A;  1V2A A;  2K9F A;  3TU3 B;  3IC8 A;  3D22 A;  5G1K A;  1VRS D;  1XOB A;  5DCH A;  1PL1 A;  2VLV A;  1SJ6 A;  2O5V A;  2WZS A;  4Q5N A;  5B8A A;  3M1G A;  5HR3 A;  4KH7 A;  4PQ1 A;  2R3X A;  3WGD A;  3ZL5 A;  2IMK A;  4AKG A;  2N5F A;  4N0V A;  2JU5 A;  2HZE B;  2XHF A;  5KN0 A;  2WVY A;  2WW3 A;  4V2L A;  1Y1U A;  1O73 A;  1OVN A;  2LKU A;  2RM5 A;  3MNG A;  4EC0 A;  3BOA A;  2ON7 A;  1EP8 A;  2L4C A;  2CZ3 A;  4FXY P;  2IIY A;  3D0Z A;  1K0O A;  3GKN A;  3EVI A;  4WF4 A;  4MLY A;  1JZD A;  4IGJ A;  2ZNM A;  1MTC A;  8GSS A;  3VWX A;  1FW1 A;  3FZ5 A;  4BVX B;  5B6N A;  2F3M A;  3TJJ A;  1USB A;  4GST A;  3LYK A;  2FNO A;  2LEG A;  4V2M A;  3GX8 A;  1S3C A;  2VL9 A;  2X8H A;  3TKS A;  2NDO A;  2FUG 2;  1NSW A;  4EIP A;  5IMF A;  3ED3 A;  2IWT A;  2DBC A;  1S3D A;  3ZML A;  1EGO A;  1XZO A;  2X49 A;  3G7Y A;  2VCW A;  1Z5Y E;  4AF2 A;  2C8U A;  4WXT A;  4PNG A;  4YQU A;  4KCA A;  4KGI A;  2VIM A;  3V1W A;  2H6Z A;  2IFQ A;  1XBS A;  2GSQ A;  3KIJ A;  1I5G A;  3KJY A;  4WBJ A;  4XS6 A;  4XS4 B;  2LV3 A;  2WRT A;  2VKZ G;  1T3B A;  2B5Y A;  5HFI A;  1Q98 A;  5ENU A;  2YN1 A;  5ECS A;  3DRN A;  2LRC A;  1YJ6 A;  3FRC A;  3M9J A;  1JFU A;  1FG4 A;  4EO3 A;  3IBH A;  3G7I A;  4HI7 A;  1A2J A;  1KTE A;  4BWQ A;  1B48 A;  5BMU B;  3HZ4 A;  2PBJ A;  1ZL9 A;  2YJ7 A;  4K5R A;  2HZE A;  4K1F A;  5J41 A;  2WVZ A;  2V32 A;  4BWS A;  4DVC A;  3EE2 A;  6GSX A;  5J9C A;  2XBI A;  2DKI A;  2PUK C;  3KTL A;  1AQW A;  2L4Q A;  3L9V A;  1ZOF A;  2QA2 A;  3LGC A;  4PUR A;  3UAR A;  5DQY A;  1SJZ A;  4HUA A;  1SKR B;  2PVO C;  2K8V A;  1K0B A;  1M2B A;  4ECI A;  1Z6M A;  4BVX A;  5LCZ A;  1EZK A;  4F0C A;  2L6C A;  4AI6 A;  4MMM A;  3QPM A;  1H4O A;  1XWB A;  2F8A A;  1A2L A;  2NPB A;  3L4N A;  5JCU A;  1CQG A;  2OAD A;  4ZL9 A;  2WFC A;  1BAY A;  3Q18 A;  2OBK A;  3LG6 A;  3ZVJ D;  5A1N B;  1NM3 A;  1X5D A;  1O81 A;  3EIN A;  4JR6 A;  3TOU A;  3TJB A;  1K3O A;  1TXU A;  1YY7 A;  1N8J A;  3IXR A;  3SWL A;  3N5O A;  4N3Z A;  1TU7 A;  4FYC A;  1GLP A;  4XS4 A;  1O6J A;  3D4M A;  3UIW A;  4BVY B;  1SEN A;  4ACS A;  4G0I A;  2L5L A;  1XW9 A;  3FR6 A;  2F9S A;  4CDO A;  2PER A;  1GTI A;  1Z9H A;  4K8M A;  4NXI A;  2MMZ A;  1FOH A;  5J3R A;  3PPU A;  2H72 A;  2DMM A;  4MCU A;  2OE0 A;  5D8I A;  3QFA C;  2H01 A;  3NZN A;  5BMU A;  6GSY A;  1ML6 A;  1UVZ A;  2OKA A;  4KDU A;  2AYT A;  3I6A A;  1F6M C;  5J9B A;  3ZTL A;  1VF1 A;  4V1A g;  2V1M A;  1QGV A;  3M9K A;  2FGX A;  2RM6 A;  1JHB A;  1WIK A;  3RDW A;  1WPI A;  2TRX A;  3GFK A;  3W8J A;  3R3E A;  1K0M A;  1BQ7 A;  4K2D A;  4A5P A;  1WMJ A;  4Q5F A;  4I2T A;  2PU9 C;  2I81 A;  3O3T A;  1B4P A;  3W8S A;  2WCI A;  2GZY A;  2YNX A;  4GQF A;  5B8B A;  2FWF A;  2H0G A;  2OE3 A;  1X9M B;  2P31 A;  1F3B A;  3HY2 A;  4IW9 A;  3TDG A;  1EV9 A;  2O89 A;  1URM A;  1DBY A;  1XIY A;  1PD2 1;  3ZIV A;  4NAX A;  2H71 A;  3IAM 2;  4GSS A;  3C8E A;  4WR4 A;  4ID0 A;  2GVP A;  4V1A p;  5A1N A;  3DWV A;  2YOI A;  3IV4 A;  2FHE A;  3I69 A;  5G1L A;  4EIQ A;  3ERF A;  4I5Q A;  3VK9 A;  4QL7 A;  4IQ1 A;  2C0F A;  3DIE A;  3F9U A;  4PGT A;  2VAF A;  5E4W A;  3ZRD A;  2H6X A;  2LS5 A;  1X9W B;  5JCW A;  2N5B A;  1O7U A;  3DEX A;  2KLX A;  1GSD A;  1PKW A;  2K6V A;  2L59 A;  4BVY A;  2P5R A;  1SK1 A;  3DD3 A;  4JU5 A;  3QMX A;  5JWQ B;  3ZRE A;  4XS1 A;  1TK0 B;  2JZS A;  6GSW A;  4G0L A;  2H1G A;  1AC1 A;  3D21 A;  4WET A;  2M72 A;  4EL1 A;  2FA4 A;  4L0U A;  2HNL A;  2GTU A;  3KH7 A;  4MZB A;  4ZIL A;  2O7K A;  4FYB A;  3C1S A;  2NTO A;  2X8C A;  3GV1 A;  3CRT A;  1W89 A;  1YDK A;  3FZ9 A;  5KN2 A;  5G5E A;  3FZA A;  3EUR A;  4G10 A;  2P0G A;  1TTZ A;  2V2G A;  3F4R A;  4J2F A;  3VWU A;  5CAX A;  3GH9 A;  4K2X A;  2AV4 A;  2B7K A;  2WGR A;  4OFT A;  1ILO A;  3CSJ A;  1EV4 A;  1A8Y A;  5D73 A;  2J9H A;  2OBI A;  3PIN A;  1JZO A;  5IPG A;  4AKI A;  2IN3 A;  3EC3 A;  5H5R A;  3WD6 A;  1PA3 A;  1F3A A;  5GSS A;  4TKY A;  2IJY A;  19GS A;  2PVQ A;  1TDI A;  5IM9 A;  3HZ8 A;  4JED A;  4BL7 B;  4V2N A;  5JCG A;  5J5N A;  3VPQ A;  5J4U A;  2VCV A;  1MD4 A;  3IR4 A;  4OD7 A;  2ALB A;  2TIR A;  1GSE A;  1GUM A;  2VL2 C;  4TXV A;  3CYN A;  1SYX A;  1GWC A;  2VCT A;  13GS A;  4AJ8 A;  3O6T A;  2GDR A;  2C0D A;  2FWG A;  3F6D A;  1AW9 A;  3LJR A;  3HHV A;  4KA0 A;  4LL1 B;  2DIZ A;  1UC7 A;  4HJM A;  4F2I A;  2EIO A;  2DJ1 A;  3LQ7 A;  3GKM A;  4KDX A;  3ZFB A;  1THX A;  1UA5 A;  1A8L A;  1XW5 A;  3EWL A;  3H79 A;  1U6T A;  2CZ2 A;  10GS A;  3TJF A;  1K0A A;  1M3J A;  2HFD A;  3TGZ A;  3BCK A;  2YZU A;  5HFG A;  2V41 A;  1GUK A;  3HVV A;  4OWY A;  1MDK A;  3KZQ A;  2OE1 A;  5EVO A;  2QKE A;  1Q4J A;  1FVK A;  2JAC A;  4YQM A;  4TOP A;  4K7I A;  3F6F A;  1XVQ A;  5ECO B;  2LRT A;  3Q19 A;  2FCH A;  1J0F A;  3MSZ A;  4POB A;  5KOX A;  1RQM A;  5COH A;  4OCF A;  1F37 A;  4TN8 A;  5CO3 A;  4Z2U A;  3I9V 2;  5GAN D;  1K3Y A;  2I4A A;  2O8V B;  3HDC A;  3DGQ A;  1O8W A;  2LJK A;  1I9D A;  3UL3 A;  4WKW A;  3H8Q A;  3RGB C;  4ZXG A;  4BL7 A;  1XWG A;  1GNE A;  2KP2 A;  3A5W A;  3LW9 A;  1XW6 A;  2LQO A;  1XFL A;  1B9X C;  1PX7 A;  2H0H A;  2JSY A;  3K8N A;  4EVM A;  4LLR A;  5BRT A;  1PQN A;  1T1V A;  2WW0 A;  1EWX A;  1F2E A;  2GQK A;  2XPE A;  2GST A;  2B3S A;  3VUR A;  1TI1 A;  3VWW A;  2JZT A;  3KEB A;  4I2U A;  3ERW A;  2R37 A;  2VD0 A;  4XTS A;  4EF0 A;  2QSI A;  3F4T A;  2YV7 A;  5HQP A;  1QQ2 A;  2E2G A;  2B1K A;  3GIX A;  2AHE A;  2H1L A;  1A0R P;  5IMZ A;  4YQV A;  1NW2 A;  2VL2 A;  2H76 A;  2LST A;  1PRX A;  1Z6N A;  3ME8 A;  1XG8 A;  1V40 A;  3D5J A;  3GRX A;  3G9B A;  3P2A A;  3FK8 A;  2VCX A;  4GF0 A;  1V58 A;  2G0F A;  2VUP A;  4TR1 B;  4IVF A;  5JWO B;  1GH2 A;  4K6X A;  2JSZ A;  2CAI A;  3APS A;  3H93 A;  1KNG A;  2HXK A;  2DJ3 A;  1XCC A;  5CYY A;  3ME7 A;  1GSQ A;  4N10 A;  4ICY A;  2ES7 A;  2DC5 A;  4GSN A;  5F07 A;  3KM6 A;  3BD2 A;  1GTA A;  2H1B A;  4TRX A;  4O7H A;  5DJL A;  3LOR A;  2HSN B;  3F3Q A;  2FLS A;  4ZB8 A;  2H19 A;  1FHE A;  2ZCT A;  1K0N A;  4ZB6 A;  4PNF A;  1WRY A;  5F06 A;  4ECJ A;  5KN3 A;  1E2Y A;  1SK0 A;  3UEM A;  3CMI A;  1AIU A;  4F82 A;  3ZVJ A;  3MYD A;  3HJM A;  2JAD A;  2K18 A;  4PI0 C;  1K0C A;  4BPY A;  1QMV A;  1OE7 A;  3DVW A;  4YAP A;  4ZB9 A;  1A2M A;  3DML A;  1GUH A;  4ZIJ A;  4MF5 A;  2L57 A;  4EUY A;  4RQR A;  2DML A;  2R6K A;  1VF4 A;  5D96 A;  3C1R A;  2CAQ A;  2X8G A;  1C72 A;  2BTO T;  1MDJ A;  3LFL A;  3TOT A;  3HCZ A;  4AGS A;  1AXD A;  3CHX C;  4KDY A;  3BJ5 A;  5J40 A;  5ECP B;  5D9T A;  1Y25 A;  1R26 A;  1SK2 A;  5ECM B;  2EIR A;  4NMU A;  5CRW A;  2H70 A;  5HR0 A;  2GZZ A;  2GT5 A;  3IDV A;  4K0G A;  3F63 A;  2R0C A;  2YWI A;  1EOG A;  4TR1 A;  4PQI A;  1HNA A;  4OFN A;  2MMA A;  3W6G A;  2C3N A;  1TK8 B;  1FO5 A;  3VPT A;  3U5R E;  5L71 A;  2MBS A;  1JZR A;  1R7H A;  2GLR A;  5ECN B;  2RLI A;  1OC9 B;  3ZYW A;  4HQS A;  4QL9 A;  1BG1 A;  1ERV A;  1UN2 A;  3TRQ A;  4KW6 A;  4CW9 A;  4GLT A;  4K5S A;  4O92 A;  2HSN A;  3TRX A;  3FMW A;  2R2J A;  1ERU A;  4HZ2 A;  3A2V A;  1G0T A;  5IMV A;  4IEL A;  1SU9 A;  2H6Y A;  3P7X A;  2CVK A;  1O85 A;  4IJI A;  3VI7 A;  3FEU A;  4JR4 A;  20GS A;  4IJ3 A;  1NHY A;  3RPP A;  4MP4 A;  1BG5 A;  3AY8 A;  3TRP A;  5KEJ A;  3A3T A;  2HRN A;  3LXZ A;  1PX6 A;  1KBN A;  4NV5 A;  3CXG A;  4K7N A;  2ZUP A;  2N5A A;  2H0I A;  3VI5 A;  4ZL8 A;  4EDY A;  5CP1 A;  2HSM B;  5D9V A;  3RBT A;  2RII A;  4IS0 A;  2VCZ A;  4L0W A;  1TK5 B;  2HRA A;  2GZP A;  5ECR B;  1T8E B;  4GCI A;  3D6I A;  5A5K A;  5A34 B;  1GUL A;  2QC7 A;  2H73 A;  2IMD A;  5F8B A;  4PQH A;  4YKF A;  1J08 A;  3HJO A;  4E8E A;  3TJK A;  3KCM A;  2IME A;  2CQ9 A;  1GSU A;  5KN1 A;  4ZB7 A;  4BA7 A;  4MA9 A;  4PI2 C;  3UBK A;  4X43 A;  1OC9 A;  4DSR A;  3L9U A;  3GSS A;  2RUF A;  5ECH B;  2I9H A;  3F8U A;  3UAP A;  1YVL A;  1FB6 A;  5IQY A;  2ON5 A;  4POK A;  1J9B A;  5EPF A;  5FHI A;  1M7T A;  4ZBD A;  4I8B A;  4GTU A;  1VF2 A;  2YJH A;  3WGE A;  4WBR D;  2H1A A;  2HSH A;  5D9W A;  1EEM A;  1QUW A;  1LBK A;  3QCP A;  3CSH A;  4HEA 2;  3ZIJ A;  1YKA A;  3EPT A;  1RW1 A;  3CTG A;  1M9B A;  1GSF A;  3KGK A;  2KP1 A;  4MZC A;  5ABR A;  1OE8 A;  4PHZ C;  2C4J A;  4K0N A;  2B7J A;  3QAG A;  1JZW A;  5J47 A;  4WEY A;  2HSM A;  1DE2 A;  1PN9 A;  1SL0 B;  1XWK A;  3HJP A;  1H75 A;  2M80 A;  3GHA A;  5DJM A;  5HR2 A;  5A34 A;  7GSS A;  1PKZ A;  3KMN A;  1Z3E A;  1S4B P;  2AAW A;  3H4K A;  1B8X A;  5H5Q A;  2WW1 A;  4L5O A;  2QA1 A;  1ZYE A;  2FY6 A;  1ZZY A;  4KSM A;  1EOH A;  1I1I P;  2EFD A;  4MPF A;  2MBT A;  4OO5 A;  3SBC A;  4ULX A;  4DSQ A;  4CY8 A;  2J23 A;  2XPD A;  4N0Z A;  1ERW A;  2I1U A;  3F0I A;  2X4A A;  3P90 A;  2EFH A;  3TKP A;  1S3R A;  5IO2 A;  4MF6 A;  3HD5 A;  1M3I A;  3A5I A;  4MAB A;  3PH9 A;  1M2A A;  3M3M A;  5IMC A;  4Z7X A;  1IYI A;  1AUC A;  1T4Z A;  4G9H A;  4HS1 A;  1YF0 A;  2PGT A;  2CVD A;  4MK3 A;  4GXZ A;  1TP9 A;  2B5E A;  1X0R A;  1N25 A;  1CQH A;  4O32 A;  3FY7 A;  3GN3 A;  5KOW A;  4OFM A;  1NHO A;  4EE0 A;  1YF1 A;  1PSQ A;  2MZC A;  5G31 A;  3CTF A;  4X0X A;  3TKQ A;  4IQA A;  4KAE A;  4X1U A;  1TW9 A;  2OA7 A;  2CX4 A;  4IBP A;  1PFO A;  4POM A;  4RUV A;  3CWG A;  3VWV A;  1VF3 A;  1GTU A;  1EEJ A;  1FVJ A;  1IYH A;  3TB2 A;  1ACV A;  1G7E A;  1U87 A;  3L9S A;  3APO A;  4ECC A;  2CT6 A;  3LSZ A;  3P8W A;  3UJ1 A;  2A2P A;  3HVN A; 
#chains in the Genus database with same CATH homology
 1G6Y A;  4LMV A;  1QXH A;  1ZGN A;  2VO4 A;  2YCD A;  4I6X A;  5D93 A;  2DLX A;  4FIW A;  5AIX A;  2BJX A;  6GSU A;  2NVL A;  5CRG A;  2E0Q A;  1Z7P A;  2HZF A;  3MDK A;  2CVB A;  2AUV A;  1YEP A;  3ERG A;  4ISD A;  4KSO A;  3EU4 A;  1LU4 A;  5F0G A;  4N11 A;  4YKG A;  1S3A A;  2PPT A;  5A5H B;  1T00 A;  1OC3 A;  1PL2 A;  1Y6E A;  1OC8 A;  4F9Z A;  5DAK B;  1A0F A;  2BMX A;  2B5X A;  1PMT A;  3WT2 A;  17GS A;  4XRA A;  9GSS A;  4NWY A;  2C3Q A;  4E68 A;  5DDL A;  1HQO A;  1ERT A;  5DVB A;  3E9J B;  2WS2 A;  2LTK A;  2OT3 A;  2I3Y A;  4FO5 A;  4KX4 A;  3IHQ A;  5ECQ B;  1BX9 A;  1WJK A;  2B1L A;  3UMA A;  1AAZ A;  5H5S A;  1G6W A;  2PN8 A;  3APQ A;  4G2E A;  1TU8 A;  4HZ4 A;  1GRX A;  4HDE A;  2G2Q A;  1SJI A;  3JCM L;  4ZBA A;  3MAK A;  2R0G A;  2K8S A;  4CY6 A;  5ECI B;  1DSB A;  3H1N A;  5IMD A;  4Z2T A;  4PXO A;  1XPV A;  3KP8 A;  4RQX A;  3IC4 A;  2WZ9 A;  3ZMK A;  1ZMA A;  3RHB A;  2DJ2 A;  1V98 A;  4OO4 A;  1SVO A;  4NHW A;  18GS A;  3ZIT A;  2HI7 A;  3HVX A;  1ON4 A;  2Z9S A;  3Q6O A;  5IPH A;  2GSR A;  1TOF A;  3LXT A;  4ML1 A;  4N30 A;  1YKC A;  2WB9 A;  4AJ7 A;  3HYP A;  2H8L A;  2R5G A;  5A5H A;  3F4S A;  5EL8 A;  4OCE A;  4P3Y B;  2RUE A;  4K7O A;  3US3 A;  4PTS A;  2B6M A;  5DAK A;  3MIX A;  2LNT A;  4NPB A;  5IOX A;  1OYJ A;  1DUG A;  1M0U A;  2IMI A;  4TW5 A;  1YEX A;  5IIZ A;  1WOU A;  2LRN A;  3A2W A;  3KMO A;  3C7M A;  2C1Y A;  3EMX A;  1SYR A;  1WP0 A;  5AN1 A;  1RK4 A;  4TR0 A;  4MPG A;  5CNW A;  2C3T A;  1HYU A;  1M2D A;  3VFI A;  2YWO A;  4O5Q A;  2R0P A;  2C0G A;  4EDZ A;  4Q5R A;  4F0B A;  3CRU A;  5A4W A;  5A4U A;  1R5P A;  3OR5 A;  4EXJ A;  1SKW B;  4LA1 A;  3L78 A;  2KUC A;  4YH2 A;  2HRK B;  4PUF C;  4HJ2 A;  2IL3 A;  4ML6 A;  5ECL B;  3GL5 A;  2FWH A;  2H66 A;  4XHM A;  5HFK A;  2M46 A;  2C80 A;  1TRU A;  3Q74 A;  4E8H A;  4MJE A;  2A2R A;  5DAL B;  1LJR A;  3NIV A;  3KTB A;  4EKZ A;  1SD8 A;  3UVH A;  4H86 A;  2JZR A;  1PN0 A;  2HRF A;  3E0U A;  3FYG A;  3NOF A;  1TI3 A;  4USS A;  1X5C A;  2WDU A;  1FAA A;  3I43 A;  4O5R A;  4AKH A;  5ID2 B;  3GTU B;  1WWJ A;  4IP6 A;  3TUE A;  4WF5 A;  2LQQ A;  3IHG A;  2HSY A;  4MNN A;  2YV9 A;  2WUL A;  3DVX A;  1GSY A;  4XIH A;  2IMF A;  4NHZ A;  2VOC A;  2R4V A;  2LJR A;  2DJJ A;  4MJC A;  4G01 A;  1TRS A;  2C0E A;  5IMA A;  2JL4 A;  2A4V A;  1ZYQ B;  1TRW A;  5AIS A;  1ZYP A;  5G30 A;  1GNW A;  4G19 A;  5GAP D;  3FZ4 A;  3IOS A;  2E7P A;  4K9Z A;  4RI7 A;  4PUA A;  1JLW A;  3S9F A;  4LMW A;  3FHK A;  4AJ6 A;  3G7J A;  2X64 A;  1ZCP A;  4D73 B;  5HR1 A;  4TXO B;  2DJ0 A;  1B4Q A;  3PGT A;  2HT9 A;  2HRK A;  4TR4 A;  3IA1 A;  1SKS B;  5LNK e;  1U3I A;  4FYU A;  2EFE A;  1XWA A;  3LWA A;  4JZQ A;  2YZH A;  1X9S B;  1K0D A;  1AQX A;  3GNJ A;  2VM2 A;  5DAL A;  2EIQ A;  3O76 A;  5FT3 A;  1DE1 A;  4KF9 A;  2IPA A;  2UV8 G;  5DCG A;  2GGT A;  5INY A;  1VGL A;  2L6D A;  1FB0 A;  4YAV A;  2PWJ A;  4MDC A;  3GKX A;  4GQC A;  22GS A;  1K3L A;  3CBU A;  3CSI A;  1ST9 A;  5ID2 A;  3GTU A;  4ZBB A;  2OAC A;  2OJL A;  4HU9 A;  14GS A;  2H75 A;  3GKK A;  2GQL A;  5C04 A;  3M8N A;  2AB6 A;  4KND A;  6GSV A;  1JLV A;  2V6K A;  4GWR A;  1G7O A;  3GL3 A;  4Z2R A;  3QDN A;  1ZYN A;  3IRA A;  1SL1 B;  3J7Y k;  2TRC P;  4X4J A;  2A2S A;  3J7Y b;  3HA9 A;  4ZL7 A;  3HVS A;  2AJQ B;  1U88 A;  3QAW A;  1GTB A;  4O5U A;  2YWN A;  1QFN A;  3IK9 A;  4MZW A;  1FOV A;  4GDF A;  3ISO A;  4I97 A;  4JRR A;  1OAZ A;  1BJX A;  4IKH A;  1ABA A;  2HLS A;  2EC4 A;  4KE3 A;  3GUR A;  3PR8 A;  5EY6 A;  1TJD A;  1M9A A;  4POL A;  4D73 A;  4TXO A;  2WJU A;  1YZX A;  3GMF A;  5ELG A;  5DBQ A;  1Z7R A;  2YAN A;  5GST A;  5C00 A;  1SD9 A;  3TJG A;  2X99 A;  5G2Z A;  1R5A A;  3IE3 A;  1V57 A;  2FWE A;  4CHS A;  1F9M A;  4MJB A;  2H74 A;  3DXB A;  4KUN A;  5JWR B;  5J4V A;  3M0F A;  2DKH A;  2PMT A;  1QK8 A;  1YQ1 A;  4GRF A;  6GST A;  2YWM A;  1A23 A;  1MEK A;  2GT6 A;  3C71 A;  1GL8 A;  1WE0 A;  2O85 A;  1BED A;  1OKT A;  4XCS A;  1A24 A;  2VLU A;  5ELA A;  2EFC A;  3L0H A;  16GS A;  3ZLP A;  2H1D A;  3QFB C;  4FH8 A;  1X5E A;  5G5F A;  11GS A;  4ILF A;  4TR3 A;  3BCI A;  1XXU A;  1TXX A;  2LNS A;  3KH9 A;  1M99 A;  3GA4 A;  2NBS A;  1KEB A;  4IHU A;  3GYK A;  3TKR A;  1GSS A;  3GH6 A;  5CRH A;  4J57 E;  3MWH A;  1T4Y A;  5B7C A;  2MMN A;  4JE1 A;  4KB3 A;  3KXO A;  3UOM A;  4Q5Q A;  2CX3 A;  3DYR A;  5AIV A;  4F03 A;  4DSS B;  1EP7 A;  4IP1 A;  5D9X A;  2VLT A;  4L5L A;  1XOA A;  2GQM A;  1V9W A;  3WT1 A;  3HMJ G;  3IPZ A;  3RHC A;  5LD0 A;  2FA8 A;  2XBQ A;  3EU3 A;  3ZZX A;  2YP6 A;  1XVW A;  5E59 A;  12GS A;  2FD3 A;  2HYX A;  3R2Q A;  5CRD A;  3FR3 A;  1PGT A;  5FWG A;  3TCO A;  2L5O A;  1TRV A;  3WGX A;  2QGV A;  4DEJ A;  1HNB A;  5B6M A;  1MD3 A;  3N9J A;  2DIY A;  2KOK A;  4HU7 A;  3RPN A;  1O8X A;  3UVT A;  2YPM A;  2UZ8 A;  3IK7 A;  4AKX B;  2XC2 A;  4QMK A;  4J56 E;  5J4Y A;  3QAV A;  4HOJ A;  3WYW A;  3GX0 A;  3VLN A;  3GUS A;  5DQS A;  3E3E A;  5AGY A;  2E2M A;  4HQZ A;  4ECB A;  3IAS 2;  4MH2 A;  3QOU A;  4MJA A;  3KD0 A;  1OKD A;  2P5Q A;  4NV2 A;  1GP1 A;  3RAZ A;  3F3R A;  1N2A A;  2V6O A;  3GST A;  5CRE A;  3KP9 A;  1BYE A;  2MYG A;  2VL3 A;  4OMV A;  3ZFL A;  4LL4 B;  4QQ7 A;  4DSS A;  2VM1 A;  1R4W A;  1MDI A;  5ECK B;  1BF5 A;  1T7P B;  4RI6 A;  1EGR A;  5A4V A;  3FW2 A;  1TKD B;  2F8F A;  3C73 A;  1E6B A;  4W66 A;  4TVE A;  3EMP A;  3TKS C;  2D2Z A;  1SL2 B;  4JBB A;  1W4V A;  1U3A A;  2GSS A;  2A4H A;  3FKF A;  3EYT A;  4PX1 A;  4MH3 A;  1B9Y C;  3BBY A;  3TKS E;  3QR6 A;  1SVL A;  2REM A;  3FR9 A;  2VD1 A;  4L8E A;  2CA8 A;  1AQV A;  4IN0 A;  3LEF A;  5IOW A;  3U6V A;  2F51 A;  3HKR A;  6GSS A;  1HNC A;  4G0K A;  1HD2 A;  2LUS A;  3HXS A;  2GS3 A;  4XRD A;  2CV4 A;  2H30 A;  2HE3 A;  2HQT A;  4FQU A;  2KHP A;  5IO0 A;  2DJK A;  2O87 A;  1XWC A;  4KCE A;  3DKS A;  2IFQ B;  1THO A;  5GZZ B;  3LYP A;  2LJA A;  3A2X A;  3QD9 A;  3D4T A;  1GLQ A;  4MF7 A;  2DSA A;  2MMO A;  1SVM A;  2VCQ A;  5F05 A;  4WR5 A;  1V2A A;  2K9F A;  3TU3 B;  3IC8 A;  3D22 A;  5G1K A;  1VRS D;  1XOB A;  5DCH A;  1PL1 A;  2VLV A;  1SJ6 A;  2O5V A;  4Q5N A;  5B8A A;  3M1G A;  5HR3 A;  4KH7 A;  4PQ1 A;  2R3X A;  3WGD A;  3ZL5 A;  2IMK A;  4AKG A;  2N5F A;  4N0V A;  2JU5 A;  2HZE B;  2XHF A;  5KN0 A;  4V2L A;  1Y1U A;  1O73 A;  1OVN A;  2LKU A;  2RM5 A;  3MNG A;  4EC0 A;  3BOA A;  2ON7 A;  1EP8 A;  2L4C A;  2CZ3 A;  2IIY A;  3GKN A;  3D0Z A;  1K0O A;  3EVI A;  4WF4 A;  4MLY A;  1JZD A;  4IGJ A;  2ZNM A;  1MTC A;  8GSS A;  3VWX A;  1FW1 A;  3FZ5 A;  4BVX B;  5B6N A;  2F3M A;  3TJJ A;  1USB A;  4GST A;  3LYK A;  2FNO A;  2LEG A;  4V2M A;  3GX8 A;  1S3C A;  2VL9 A;  2X8H A;  3TKS A;  2NDO A;  2FUG 2;  1NSW A;  4EIP A;  5IMF A;  3ED3 A;  2IWT A;  2DBC A;  1S3D A;  3ZML A;  1EGO A;  1XZO A;  2X49 A;  3G7Y A;  2VCW A;  1Z5Y E;  4AF2 A;  2C8U A;  4WXT A;  4PNG A;  4YQU A;  4KCA A;  4KGI A;  2VIM A;  3V1W A;  2H6Z A;  2IFQ A;  1XBS A;  2GSQ A;  3KIJ A;  1I5G A;  3KJY A;  4WBJ A;  4XS6 A;  4XS4 B;  2LV3 A;  2WRT A;  2VKZ G;  1T3B A;  2B5Y A;  5HFI A;  1Q98 A;  5ENU A;  2YN1 A;  5ECS A;  3DRN A;  2LRC A;  1YJ6 A;  3FRC A;  3M9J A;  1JFU A;  1FG4 A;  4EO3 A;  3IBH A;  3G7I A;  4HI7 A;  1A2J A;  1KTE A;  4BWQ A;  1B48 A;  5BMU B;  3HZ4 A;  2PBJ A;  1ZL9 A;  2YJ7 A;  4K5R A;  2HZE A;  4K1F A;  5J41 A;  2V32 A;  4BWS A;  4DVC A;  3EE2 A;  6GSX A;  5J9C A;  2XBI A;  2DKI A;  2PUK C;  3KTL A;  1AQW A;  2L4Q A;  3L9V A;  1ZOF A;  2QA2 A;  3LGC A;  4PUR A;  3UAR A;  5DQY A;  1SJZ A;  4HUA A;  1SKR B;  2PVO C;  2K8V A;  1K0B A;  1M2B A;  4ECI A;  1Z6M A;  4BVX A;  5LCZ A;  1EZK A;  4F0C A;  2L6C A;  4AI6 A;  4MMM A;  3QPM A;  1H4O A;  1XWB A;  2F8A A;  1A2L A;  2NPB A;  3L4N A;  5JCU A;  1CQG A;  2OAD A;  4ZL9 A;  2WFC A;  1BAY A;  3Q18 A;  2OBK A;  3LG6 A;  3ZVJ D;  5A1N B;  1NM3 A;  1X5D A;  1O81 A;  3EIN A;  4JR6 A;  3TOU A;  3TJB A;  1K3O A;  1TXU A;  1YY7 A;  1N8J A;  3IXR A;  3SWL A;  3N5O A;  4N3Z A;  1TU7 A;  4FYC A;  1GLP A;  4XS4 A;  1O6J A;  3D4M A;  3UIW A;  4BVY B;  1SEN A;  4ACS A;  4G0I A;  2L5L A;  1XW9 A;  3FR6 A;  2F9S A;  4CDO A;  2PER A;  1GTI A;  1Z9H A;  4K8M A;  4NXI A;  2MMZ A;  1FOH A;  5J3R A;  3PPU A;  2H72 A;  2DMM A;  4MCU A;  2OE0 A;  5D8I A;  3QFA C;  2H01 A;  3NZN A;  5BMU A;  6GSY A;  1ML6 A;  1UVZ A;  2OKA A;  4KDU A;  2AYT A;  3I6A A;  1F6M C;  5J9B A;  3ZTL A;  1VF1 A;  4V1A g;  2V1M A;  1QGV A;  3M9K A;  2FGX A;  2RM6 A;  1JHB A;  1WIK A;  3RDW A;  1WPI A;  2TRX A;  3GFK A;  3W8J A;  3R3E A;  1K0M A;  1BQ7 A;  4K2D A;  4A5P A;  1WMJ A;  4Q5F A;  4I2T A;  2PU9 C;  2I81 A;  3O3T A;  1B4P A;  3W8S A;  2WCI A;  2GZY A;  2YNX A;  4GQF A;  5B8B A;  2FWF A;  2H0G A;  2OE3 A;  1X9M B;  2P31 A;  1F3B A;  3HY2 A;  4IW9 A;  3TDG A;  1EV9 A;  2O89 A;  1URM A;  1DBY A;  1XIY A;  1PD2 1;  3ZIV A;  4NAX A;  2H71 A;  3IAM 2;  4GSS A;  3C8E A;  4WR4 A;  4ID0 A;  2GVP A;  4V1A p;  5A1N A;  3DWV A;  2YOI A;  3IV4 A;  2FHE A;  3I69 A;  5G1L A;  4EIQ A;  3ERF A;  4I5Q A;  3VK9 A;  4QL7 A;  4IQ1 A;  2C0F A;  3DIE A;  3F9U A;  4PGT A;  2VAF A;  5E4W A;  3ZRD A;  2H6X A;  2LS5 A;  1X9W B;  5JCW A;  2N5B A;  1O7U A;  3DEX A;  2KLX A;  1GSD A;  1PKW A;  2K6V A;  2L59 A;  4BVY A;  2P5R A;  1SK1 A;  3DD3 A;  4JU5 A;  3QMX A;  5JWQ B;  3ZRE A;  4XS1 A;  1TK0 B;  2JZS A;  6GSW A;  4G0L A;  2H1G A;  1AC1 A;  3D21 A;  4WET A;  2M72 A;  4EL1 A;  2FA4 A;  4L0U A;  2HNL A;  2GTU A;  3KH7 A;  4MZB A;  4ZIL A;  2O7K A;  4FYB A;  3C1S A;  2NTO A;  2X8C A;  3GV1 A;  3CRT A;  1W89 A;  1YDK A;  3FZ9 A;  5KN2 A;  5G5E A;  3FZA A;  3EUR A;  4G10 A;  2P0G A;  1TTZ A;  2V2G A;  3F4R A;  4J2F A;  3VWU A;  5CAX A;  3GH9 A;  4K2X A;  2AV4 A;  2B7K A;  2WGR A;  4OFT A;  1ILO A;  3CSJ A;  1EV4 A;  1A8Y A;  5D73 A;  2J9H A;  2OBI A;  3PIN A;  1JZO A;  5IPG A;  4AKI A;  2IN3 A;  3EC3 A;  5H5R A;  3WD6 A;  1PA3 A;  1F3A A;  5GSS A;  4TKY A;  2IJY A;  19GS A;  2PVQ A;  1TDI A;  5IM9 A;  3HZ8 A;  4JED A;  4BL7 B;  4V2N A;  5JCG A;  5J5N A;  3VPQ A;  5J4U A;  2VCV A;  1MD4 A;  3IR4 A;  4OD7 A;  2ALB A;  2TIR A;  1GSE A;  1GUM A;  2VL2 C;  4TXV A;  3CYN A;  1SYX A;  1GWC A;  2VCT A;  13GS A;  4AJ8 A;  3O6T A;  2GDR A;  2C0D A;  2FWG A;  3F6D A;  1AW9 A;  3LJR A;  3HHV A;  4KA0 A;  4LL1 B;  2DIZ A;  1UC7 A;  4HJM A;  4F2I A;  2EIO A;  2DJ1 A;  3LQ7 A;  3GKM A;  4KDX A;  3ZFB A;  1THX A;  1UA5 A;  1A8L A;  1XW5 A;  3EWL A;  3H79 A;  1U6T A;  2CZ2 A;  10GS A;  3TJF A;  1K0A A;  2HFD A;  3TGZ A;  3BCK A;  2YZU A;  5HFG A;  2V41 A;  1GUK A;  3HVV A;  4OWY A;  1MDK A;  3KZQ A;  2OE1 A;  5EVO A;  2QKE A;  1Q4J A;  1FVK A;  2JAC A;  4YQM A;  4TOP A;  4K7I A;  3F6F A;  1XVQ A;  5ECO B;  2LRT A;  3Q19 A;  2FCH A;  1J0F A;  3MSZ A;  4POB A;  5KOX A;  1RQM A;  5COH A;  4OCF A;  1F37 A;  4TN8 A;  5CO3 A;  4Z2U A;  3I9V 2;  5GAN D;  1K3Y A;  2I4A A;  2O8V B;  3HDC A;  3DGQ A;  1O8W A;  2LJK A;  1I9D A;  3UL3 A;  4WKW A;  3H8Q A;  4ZXG A;  4BL7 A;  1XWG A;  1GNE A;  2KP2 A;  3A5W A;  3LW9 A;  1XW6 A;  2LQO A;  1XFL A;  1B9X C;  1PX7 A;  2H0H A;  2JSY A;  3K8N A;  4EVM A;  4LLR A;  5BRT A;  1PQN A;  1T1V A;  1EWX A;  1F2E A;  2GQK A;  2XPE A;  2GST A;  2B3S A;  3VUR A;  1TI1 A;  3VWW A;  2JZT A;  3KEB A;  4I2U A;  3ERW A;  2R37 A;  2VD0 A;  4XTS A;  4EF0 A;  2QSI A;  3F4T A;  2YV7 A;  5HQP A;  1QQ2 A;  2E2G A;  2B1K A;  3GIX A;  2AHE A;  2H1L A;  1A0R P;  5IMZ A;  4YQV A;  1NW2 A;  2VL2 A;  2H76 A;  2LST A;  1PRX A;  1Z6N A;  3ME8 A;  1V40 A;  3D5J A;  3GRX A;  3G9B A;  3P2A A;  3FK8 A;  2VCX A;  4GF0 A;  1V58 A;  2G0F A;  2VUP A;  4TR1 B;  4IVF A;  5JWO B;  1GH2 A;  4K6X A;  2JSZ A;  2CAI A;  3APS A;  3H93 A;  1KNG A;  2HXK A;  2DJ3 A;  1XCC A;  5CYY A;  3ME7 A;  1GSQ A;  4N10 A;  4ICY A;  2ES7 A;  2DC5 A;  4GSN A;  5F07 A;  3KM6 A;  3BD2 A;  1GTA A;  2H1B A;  4TRX A;  4O7H A;  5DJL A;  3LOR A;  2HSN B;  3F3Q A;  2FLS A;  4ZB8 A;  2H19 A;  1FHE A;  2ZCT A;  1K0N A;  4ZB6 A;  4PNF A;  1WRY A;  5F06 A;  4ECJ A;  5KN3 A;  1E2Y A;  1SK0 A;  3UEM A;  3CMI A;  1AIU A;  4F82 A;  3ZVJ A;  3MYD A;  3HJM A;  2JAD A;  2K18 A;  1K0C A;  4BPY A;  1QMV A;  1OE7 A;  3DVW A;  4YAP A;  4ZB9 A;  1A2M A;  3DML A;  1GUH A;  4ZIJ A;  4MF5 A;  2L57 A;  4EUY A;  4RQR A;  2DML A;  2R6K A;  1VF4 A;  5D96 A;  3C1R A;  2CAQ A;  2X8G A;  1C72 A;  2BTO T;  1MDJ A;  3LFL A;  3TOT A;  3HCZ A;  4AGS A;  1AXD A;  4KDY A;  3BJ5 A;  5J40 A;  5ECP B;  5D9T A;  1Y25 A;  1R26 A;  1SK2 A;  5ECM B;  2EIR A;  4NMU A;  5CRW A;  2H70 A;  5HR0 A;  2GZZ A;  2GT5 A;  3IDV A;  4K0G A;  3F63 A;  2R0C A;  2YWI A;  1EOG A;  4TR1 A;  4PQI A;  1HNA A;  4OFN A;  2MMA A;  3W6G A;  2C3N A;  1TK8 B;  1FO5 A;  3VPT A;  3U5R E;  5L71 A;  2MBS A;  1JZR A;  1R7H A;  2GLR A;  5ECN B;  2RLI A;  1OC9 B;  3ZYW A;  4HQS A;  4QL9 A;  1BG1 A;  1ERV A;  1UN2 A;  3TRQ A;  4KW6 A;  4CW9 A;  4GLT A;  4K5S A;  4O92 A;  2HSN A;  3TRX A;  3FMW A;  2R2J A;  1ERU A;  4HZ2 A;  3A2V A;  1G0T A;  5IMV A;  4IEL A;  1SU9 A;  2H6Y A;  3P7X A;  2CVK A;  1O85 A;  4IJI A;  3VI7 A;  3FEU A;  4JR4 A;  20GS A;  4IJ3 A;  1NHY A;  3RPP A;  4MP4 A;  1BG5 A;  3AY8 A;  3TRP A;  5KEJ A;  3A3T A;  2HRN A;  3LXZ A;  1PX6 A;  1KBN A;  4NV5 A;  3CXG A;  4K7N A;  2ZUP A;  2N5A A;  2H0I A;  3VI5 A;  4ZL8 A;  4EDY A;  5CP1 A;  2HSM B;  5D9V A;  3RBT A;  2RII A;  4IS0 A;  2VCZ A;  4L0W A;  1TK5 B;  2HRA A;  2GZP A;  5ECR B;  1T8E B;  4GCI A;  3D6I A;  5A5K A;  5A34 B;  1GUL A;  2QC7 A;  2H73 A;  2IMD A;  5F8B A;  4PQH A;  4YKF A;  1J08 A;  3HJO A;  4E8E A;  3TJK A;  3KCM A;  2IME A;  2CQ9 A;  1GSU A;  5KN1 A;  4ZB7 A;  4BA7 A;  4MA9 A;  3UBK A;  4X43 A;  1OC9 A;  4DSR A;  3L9U A;  3GSS A;  2RUF A;  5ECH B;  2I9H A;  3F8U A;  3UAP A;  1YVL A;  1FB6 A;  5IQY A;  2ON5 A;  4POK A;  1J9B A;  5EPF A;  5FHI A;  1M7T A;  4ZBD A;  4I8B A;  4GTU A;  1VF2 A;  2YJH A;  3WGE A;  4WBR D;  2H1A A;  2HSH A;  5D9W A;  1EEM A;  1QUW A;  1LBK A;  3QCP A;  3CSH A;  4HEA 2;  3ZIJ A;  1YKA A;  3EPT A;  1RW1 A;  3CTG A;  1M9B A;  1GSF A;  3KGK A;  2KP1 A;  4MZC A;  5ABR A;  1OE8 A;  2C4J A;  4K0N A;  2B7J A;  3QAG A;  1JZW A;  5J47 A;  4WEY A;  2HSM A;  1DE2 A;  1PN9 A;  1SL0 B;  1XWK A;  3HJP A;  1H75 A;  2M80 A;  3GHA A;  5DJM A;  5HR2 A;  5A34 A;  7GSS A;  1PKZ A;  3KMN A;  1Z3E A;  2AAW A;  3H4K A;  1B8X A;  5H5Q A;  4L5O A;  2QA1 A;  1ZYE A;  2FY6 A;  1ZZY A;  4KSM A;  1EOH A;  2EFD A;  4MPF A;  2MBT A;  4OO5 A;  3SBC A;  4ULX A;  4DSQ A;  4CY8 A;  2J23 A;  2XPD A;  4N0Z A;  1ERW A;  2I1U A;  3F0I A;  2X4A A;  3P90 A;  2EFH A;  3TKP A;  5IO2 A;  4MF6 A;  3HD5 A;  3A5I A;  4MAB A;  3PH9 A;  1M2A A;  3M3M A;  5IMC A;  4Z7X A;  1IYI A;  1AUC A;  1T4Z A;  4G9H A;  4HS1 A;  1YF0 A;  2PGT A;  2CVD A;  4MK3 A;  4GXZ A;  1TP9 A;  2B5E A;  1X0R A;  1N25 A;  1CQH A;  4O32 A;  3FY7 A;  3GN3 A;  5KOW A;  4OFM A;  1NHO A;  4EE0 A;  1YF1 A;  1PSQ A;  2MZC A;  5G31 A;  3CTF A;  4X0X A;  3TKQ A;  4IQA A;  4KAE A;  4X1U A;  1TW9 A;  2OA7 A;  2CX4 A;  4IBP A;  4POM A;  4RUV A;  3CWG A;  3VWV A;  1VF3 A;  1GTU A;  1EEJ A;  1FVJ A;  1IYH A;  3TB2 A;  1ACV A;  1G7E A;  1U87 A;  3L9S A;  3APO A;  4ECC A;  2CT6 A;  3LSZ A;  3P8W A;  3UJ1 A;  2A2P A;  3UBL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...