5EVOA

Structure of dehydroascrobate reductase from pennisetum americanum in complex with two non-native ligands, acetate in the g-site and glycerol in the h-site
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
213
structure length
213
Chain Sequence
b'HMAVEVCVKAAVGAPDILGDCPFSQRVLLTLEEKKITYEMKLVDLSNKPEWFLKISPEGKVPVFNSGDGKWIADSDVITQVIEEKFPTPSLVTPPEYASVGSKIFPSFVKFLKSKDASDGSEKALLDELQALDEHLKAHGPYISGENVSAADLSLGPKLFHLQVALEHFKGWKIPENLTSVHAYTKALFSRESFVKTKPANQYLIAGWAPKVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dehydroascorbate reductase
publication title Non-native ligands define the active site of Pennisetum glaucum (L.) R. Br dehydroascorbate reductase.
pubmed doi rcsb
source organism Cenchrus americanus
molecule tags Oxidoreductase
total genus 67
structure length 213
sequence length 213
ec nomenclature ec 1.8.5.1: Glutathione dehydrogenase (ascorbate).
pdb deposition date 2015-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5evoA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5evoA01
2YV7A 4NV5A 7GSSA 2YWOA 2VLUA 2HSMA 4I2UA 2AB6A 3TJJA 1WP0A 4BL7B 3L9UA 2H8LA 1CQHA 3EURA 4N10A 3UEMA 5F05A 4MZCA 3HD5A 3TJFA 2YWIA 5L71A 1S3AA 1GSDA 1F3AA 1B4PA 1BX9A 4F0CA 5CRGA 6GSTA 5EL8A 1YKAA 5CO3A 1HNCA 3QMXA 3GRXA 2B6MA 3EC3A 4BA7A 3KP9A 4TOPA 2GS3A 4IQAA 4TR3A 2C3TA 1URMA 14GSA 2VCXA 3LYPA 2FA4A 2IIYA 4EDYA 2PPTA 4IJIA 17GSA 2DMLA 3I43A 4DVCA 3ERFA 5IOWA 3GUSA 2V1MA 3I6AA 1SYXA 4YQMA 2GQKA 2OACA 2HI7A 4RQRA 1S3DA 2XC2A 1YZXA 4FIWA 5IMDA 1PX6A 3O6TA 5IMVA 2QC7A 1PKZA 2DJJA 3CYNA 5D9XA 5AN1A 1A0RP 2O89A 4L0UA 4ZBBA 2VM1A 3LXTA 2PBJA 1XW5A 4PQHA 2N5FA 3QAWA 3GSTA 3QR6A 3DVWA 4KUNA 5AISA 3GHAA 4NHWA 3HYPA 4J56E 1AQVA 2K8SA 3WD6A 4MH3A 4AJ7A 3VI5A 3CRTA 4G9HA 3L9SA 2L5OA 4MABA 1TW9A 3IK7A 3VWXA 1GTIA 4F82A 1JZDA 4HJMA 1WRYA 1Z9HA 5IMCA 3WT2A 1KBNA 4PQIA 2VL9A 4POLA 1GNWA 4G19A 2P31A 3J7Yk 4YAPA 1M2AA 3D0ZA 5IOXA 2B7KA 2ES7A 4JZQA 2K6VA 2RM5A 2I4AA 1UC7A 1TKDB 3QD9A 4ZB8A 2OBIA 2F51A 5ECMB 5JWQB 3CSHA 2FNOA 2DMMA 3W8JA 1V57A 3GX8A 4TN8A 4TKYA 2X8CA 3FY7A 2GZZA 3TKQA 1GSEA 1LJRA 2QGVA 3F4SA 1EP8A 3GKXA 3WYWA 3FW2A 2HQTA 1ZCPA 5ELAA 3A2WA 2HRKB 4BVYA 4YQVA 1U87A 4ID0A 3QAGA 2IMKA 5DQSA 3UMAA 1K0AA 4E8EA 2OADA 1ST9A 4ZBDA 2E7PA 2K18A 1CQGA 2FUG2 2R3XA 3SWLA 2GSQA 1TTZA 5ECNB 5DVBA 3G7JA 3D4TA 3G7IA 3NZNA 3P2AA 5E4WA 3TJBA 1THOA 5DDLA 3DXBA 1K0NA 2D2ZA 1GSUA 2LQOA 5DQYA 1XW6A 1FO5A 3MWHA 3M1GA 3TDGA 1PD21 1F9MA 3I9V2 3FR9A 5C04A 2OKAA 1O73A 2L57A 3H79A 4ZBAA 3K8NA 4AGSA 1NW2A 4OFNA 1XBSA 3ZVJD 2EIRA 2PERA 4WR4A 5DJLA 5CREA 2IMEA 3C73A 1J9BA 1YEXA 4KB3A 2H0HA 2F8FA 2JL4A 3TGZA 3IAS2 4ZL8A 3QFAC 5G31A 3ZMKA 3HA9A 1A8LA 3IA1A 1BJXA 1ERUA 1BYEA 6GSVA 4NXIA 4XRAA 5ECSA 2VCQA 2CX3A 2O8VB 4WBJA 2FWHA 3P90A 3LYKA 1FW1A 2LSTA 2VCTA 3MNGA 1GUKA 1EOGA 3KEBA 2H66A 4K1FA 2DLXA 1YJ6A 4ECCA 2FGXA 3F6DA 1NHOA 4K2DA 3LEFA 2DJ2A 3ZYWA 2JADA 2EIOA 2C0EA 1MD4A 4PX1A 1GULA 1YF1A 1SYRA 3CXGA 2YV9A 4JU5A 3DKSA 2WGRA 1OAZA 1OC9B 1HNBA 3UAPA 2PUKC 4POKA 2VM2A 4KX4A 1SL2B 4X1UA 4BWSA 3TKRA 1V40A 2HLSA 3QDNA 1WPIA 2KP2A 1K0DA 1GSYA 4OFTA 4GF0A 2IMDA 4N0ZA 3TOTA 5HFIA 2RUEA 4V2LA 5IPGA 1DUGA 4LLRA 3IC4A 4ZILA 5IO0A 3HXSA 1YQ1A 5EVOA 1ZYQB 1Z3EA 2AJQB 5GSTA 2HZEB 1G6YA 3GYKA 1GP1A 4EXJA 4PUFC 3KTBA 1S3CA 1K3OA 1K3LA 1ON4A 3APSA 5J9CA 3GURA 3ZL5A 2O85A 2GVPA 3FYGA 2YP6A 1SU9A 5CAXA 3FR3A 3FHKA 1ILOA 1VF3A 4PUAA 1GRXA 2E2MA 2BMXA 1JZWA 12GSA 2DJ3A 2LS5A 5KN0A 4EC0A 3IR4A 3V1WA 5B6MA 1GSQA 4HU7A 3WGDA 2VD0A 4PURA 1V98A 4TW5A 2IFQB 2V2GA 4XS1A 1THXA 2H75A 4L5OA 2XBIA 3VK9A 3KP8A 6GSSA 5JCWA 2X8GA 5F06A 4Q5FA 3Q18A 2VO4A 4USSA 1MDIA 1DBYA 5J41A 4YAVA 3DRNA 1FAAA 1TP9A 1EEMA 4NV2A 1EV4A 5KN1A 3GKNA 3FZAA 2L6DA 3VWVA 6GSYA 5DCGA 5IMZA 4PNFA 2VL2C 1WOUA 4G0LA 2R4VA 4G0IA 1TRWA 4L0WA 4AJ8A 4EVMA 2VD1A 3KMOA 3BCKA 1H75A 4BL7A 1XXUA 5B7CA 2HE3A 5DBQA 5CRDA 3IDVA 3TRQA 5J3RA 3UVTA 2R5GA 5G30A 4TVEA 1X5CA 1GSFA 3BOAA 4QQ7A 3EU4A 4I6XA 4GSNA 2ON7A 2HXKA 1EGOA 2LTKA 5GZZB 3FZ9A 3L78A 1GNEA 1A23A 5B8BA 2EIQA 2IMFA 2L5LA 1QUWA 3CSJA 2TIRA 3N9JA 5EPFA 1XWGA 2I81A 1U88A 1R5PA 3HY2A 1T8EB 4K0NA 2HRFA 4KSMA 3RDWA 1GUHA 3VI7A 2LJKA 1XWBA 3C71A 3HJPA 1AW9A 2VLVA 5GAPD 2R37A 5HR3A 5HR0A 3TCOA 1C72A 4KH7A 1B4QA 4JR6A 5CP1A 1EP7A 3APQA 4YQUA 2L4CA 2C0FA 4PGTA 2WFCA 3R2QA 1TOFA 3GN3A 3BJ5A 4ECJA 4G2EA 1Z6MA 2DJ1A 4GWRA 2YN1A 1NHYA 4GQCA 3L4NA 3ZLPA 1PX7A 1SJZA 3PPUA 1ZL9A 3Q74A 3GFKA 2YCDA 4MJAA 3E9JB 3ME7A 1HD2A 2PVOC 5DJMA 4G10A 1Z7PA 2GTUA 3F4RA 3D4MA 1H4OA 2KOKA 19GSA 3P7XA 1A2LA 2RUFA 2NTOA 2QKEA 4MJBA 1GSSA 1R4WA 1K0BA 1GWCA 4E8HA 3DD3A 3KCMA 1IYIA 3KZQA 1Z7RA 2X64A 1LU4A 1T7PB 4Q5QA 1EZKA 4K7NA 3ZVJA 3LG6A 4ZB9A 1PSQA 3FR6A 4GXZA 3GV1A 1EWXA 1PL2A 1ZYEA 4GRFA 2EC4A 2FD3A 2H6YA 1F2EA 1PMTA 2HSHA 3E0UA 4QL9A 1I5GA 3A3TA 2H01A 3C7MA 1BEDA 2DBCA 1JZOA 2CX4A 2QSIA 2VL2A 2JSYA 1AC1A 3W6GA 4O5RA 5FWGA 1A2MA 1RK4A 2CAIA 4TRXA 1U3IA 3M8NA 2CA8A 1QK8A 2RM6A 2K9FA 5H5RA 3IRAA 4KA0A 2CVBA 3KMNA 3GTUB 3N5OA 4V1Ap 2H6XA 3UIWA 2IMIA 3UARA 1B9XC 1UN2A 2BJXA 2WB9A 3TRXA 3GKKA 4F2IA 2JSZA 4PNGA 1UVZA 2A4VA 2DIYA 2H1BA 4GLTA 1BG5A 5LD0A 3M3MA 3KIJA 1FG4A 3LJRA 4I8BA 4X0XA 3NOFA 2PN8A 4K9ZA 2ZCTA 3GMFA 3GH6A 2VUPA 3UL3A 5IIZA 18GSA 1XCCA 2P0GA 3ED3A 4TXOB 3HCZA 5JCGA 3WGEA 4XS6A 1IYHA 2NBSA 4WXTA 2LRNA 2M46A 5ECHB 2YNXA 2F3MA 3C1RA 3C8EA 2HYXA 1PKWA 1Q4JA 2O7KA 1TU7A 1A8YA 2VCVA 2GZYA 1M99A 1SKRB 5DALB 1MTCA 1PN9A 4HZ2A 5DAKB 2R2JA 5GAND 5ID2B 3CTGA 4IQ1A 1SKSB 1OC3A 1BQ7A 1B48A 1YF0A 2KP1A 5GSSA 2OJLA 1ZOFA 2VLTA 3PINA 1T00A 5D93A 2RIIA 1SK2A 2G0FA 4EDZA 4MZBA 1WWJA 3ERGA 2B1KA 3U5RE 1ZGNA 5G2ZA 4AJ6A 2AUVA 2V6OA 4IBPA 3EE2A 3HZ8A 2NDOA 1OYJA 4ULXA 4DEJA 2I1UA 2DSAA 1K0CA 1YKCA 9GSSA 4XIHA 4YH2A 2GSRA 3UVHA 1NM3A 2P5RA 3H4KA 4I97A 4PQ1A 2YJ7A 4K8MA 2B3SA 1U6TA 3QCPA 1OC9A 4OO4A 11GSA 2A2SA 1R7HA 5ENUA 2J23A 1KTEA 3QPMA 20GSA 4OFMA 4POMA 3F3QA 5CRWA 2G2QA 2C80A 3TOUA 3ZZXA 4KAEA 3GH9A 2H71A 1AAZA 1WE0A 1X5DA 4MPFA 1BAYA 1B9YC 1SK0A 2OA7A 3QAVA 2WS2A 4Q5NA 4BVXB 2B7JA 3F3RA 1K3YA 3KTLA 3H93A 4ML1A 10GSA 4XHMA 4FQUA 2GSSA 1RQMA 2LV3A 3IK9A 1T3BA 1FOVA 5INYA 2HZEA 1O7UA 3F63A 2HRAA 4AF2A 5JCUA 2CAQA 2H30A 1XW9A 4BVYB 2C3QA 2H70A 1M2BA 1TXXA 1F3BA 1SKWB 1MDJA 1AUCA 3JCML 2IL3A 2WJUA 2MMZA 1GTAA 5JWOB 2VCZA 3HDCA 4LMWA 4BPYA 4D73B 2H19A 5G1KA 3G7YA 2WCIA 1TK0B 1EGRA 2IN3A 2WZ9A 3SBCA 1GUMA 2YZHA 5ECQB 2IFQA 4H86A 3D6IA 2L59A 5KEJA 1V58A 3D5JA 1X9WB 3LWAA 3IPZA 2GT6A 2GLRA 4IS0A 2FLSA 1GLPA 3RAZA 3EU3A 3ZITA 2LUSA 2ZNMA 4WF5A 2OE1A 3IXRA 1PRXA 3F8UA 4OCEA 4KCEA 5J4UA 3VLNA 5IMAA 4FH8A 3ZREA 1VGLA 4FYUA 4EKZA 4IJ3A 3U6VA 3IV4A 4IP1A 4F03A 2LEGA 2VAFA 3DWVA 4G0KA 4KNDA 4OCFA 3VPQA 2O87A 4KW6A 1OC8A 1HQOA 5LCZA 2AHEA 1RW1A 4CHSA 3TKSA 1XOAA 3HVSA 1ERTA 2F8AA 1SL1B 1QMVA 4PTSA 2IJYA 4HQZA 2HZFA 1W89A 2ALBA 3ZFBA 2FWFA 1N2AA 2ON5A 1XIYA 1AIUA 2YWNA 5H5QA 3UBLA 2OE0A 5J5NA 4DSQA 1ACVA 4WBRD 2M72A 4IN0A 3F6FA 4NAXA 5IM9A 4PXOA 2H74A 4N30A 2XBQA 2OBKA 4XTSA 1QFNA 2HSYA 4XS4B 2E2GA 1SK1A 5A4VA 2Z9SA 2KLXA 2FA8A 1F6MC 2MMOA 2N5AA 4ZB6A 3J7Yb 2FCHA 4ZL7A 1VF2A 4F0BA 3FZ4A 2MYGA 2HFDA 2FWEA 2B5XA 1MEKA 1Y25A 16GSA 4RI7A 2R6KA 3EWLA 2TRCP 5ECKB 4IVFA 2LNSA 2FY6A 1XFLA 3FEUA 4I2TA 4TR1B 4IW9A 2GGTA 1TRVA 1R5AA 4MH2A 5A5KA 4HZ4A 1GH2A 1HYUA 1ZZYA 2V32A 3VWWA 4XCSA 2LRCA 2GQLA 4V2MA 2E0QA 3TJGA 3RHBA 2YOIA 5CNWA 2NPBA 2CT6A 2DJKA 4I5QA 3M9KA 2CVDA 3RPPA 2CQ9A 2M80A 2P5QA 6GSWA 1PA3A 2X99A 3PGTA 3RBTA 3GX0A 3Q19A 3DYRA 3L9VA 4QL7A 1A2JA 2JZRA 2H0GA 1M2DA 4TR0A 5HR1A 3GL5A 3GA4A 2LRTA 4TXVA 4X43A 3CTFA 1XZOA 2GZPA 2YJHA 5FT3A 1JHBA 2XPDA 4KDYA 2VOCA 1AQXA 3EINA 3A5WA 3VFIA 5IO2A 5D8IA 1R26A 3M9JA 4IELA 4ECBA 4J2FA 2JU5A 4LL1B 3UJ1A 4MZWA 3ZMLA 1A24A 2C1YA 1KNGA 1JLWA 3LQ7A 5C00A 4OO5A 3L0HA 1FB6A 4TXOA 1FVKA 1XOBA 1TI3A 3ZIVA 4DSSB 3S9FA 4KGIA 2BTOT 5E59A 3ERWA 3BBYA 2L6CA 2CVKA 3D22A 2X8HA 4HOJA 3TB2A 4JE1A 4KCAA 3I69A 4Z7XA 2HT9A 2HNLA 1I9DA 3UBKA 1YDKA 5DALA 4JR4A 3E3EA 5AIXA 5DAKA 1B8XA 3F9UA 5ID2A 2H6ZA 1JFUA 3KJYA 3RPNA 1E6BA 4MCUA 2IPAA 4MJCA 3KXOA 2LKUA 2DIZA 2YPMA 1O81A 3KGKA 3ZIJA 3KM6A 3IOSA 1G0TA 4N11A 2I9HA 2K8VA 4WKWA 3QFBC 1TU8A 2HRKA 3VWUA 4MLYA 3TJKA 4CDOA 3HVVA 8GSSA 1X5EA 3GIXA 4EL1A 1GLQA 2HSMB 3HZ4A 2GSTA 2GDRA 3FRCA 3VURA 4KDXA 5ABRA 2DC5A 4NHZA 1PGTA 3KD0A 4MF5A 1KEBA 2JZTA 2RLIA 5IQYA 4J57E 1MDKA 1QGVA 2UZ8A 2PVQA 5LNKe 5B8AA 3CSIA 2J9HA 3TUEA 1TK5B 3P8WA 2YWMA 3DGQA 5B6NA 1LBKA 3CMIA 3O3TA 1X9SB 1A0FA 4LMVA 4K7IA 3TKPA 2JZSA 3HKRA 4GQFA 4KE3A 5G5FA 1NSWA 4OMVA 2A2RA 3PR8A 2HSNB 1EOHA 1ERVA 1SD9A 3RHCA 3A2XA 4MF7A 4TR4A 4MMMA 3LSZA 1FB0A 1ERWA 5KN3A 2FWGA 6GSUA 2B5YA 2V41A 1O6JA 4K6XA 4GCIA 4BVXA 3MAKA 5G1LA 3HJOA 3GL3A 1OE8A 1GTBA 1Y6EA 1EEJA 2GT5A 4F9ZA 4MDCA 4NPBA 3EYTA 4N0VA 1J0FA 1SD8A 5G5EA 1SL0B 5ECIB 2B5EA 4GTUA 1TRSA 4HJ2A 5EY6A 2TRXA 1F37A 3EVIA 1T4YA 3ZFLA 2LNTA 5D9WA 3AY8A 5CRHA 4MK3A 4ML6A 1PQNA 1YY7A 1T4ZA 2H73A 1GTUA 1V2AA 2IWTA 2CZ2A 5D9TA 5JWRB 3US3A 1QXHA 4GSSA 4HQSA 3F0IA 3VPTA 3DMLA 3TKSC 4D73A 2H76A 4JEDA 1AXDA 4NMUA 4ZXGA 1G7EA 1M9AA 4HI7A 2LQQA 4V1Ag 2VL3A 1OVNA 4WR5A 3GSSA 2DJ0A 4ZIJA 4OWYA 4HEA2 5AIVA 1TDIA 3ME8A 4P3YB 2H1DA 1M9BA 5F0GA 5HFKA 1X0RA 2V6KA 4IP6A 5ECLB 4IKHA 4ILFA 4KSOA 5D96A 2CV4A 4K0GA 3CBUA 1O8XA 3IE3A 1ML6A 3WT1A 2PGTA 4HDEA 4L5LA 3C1SA 5D73A 5IMFA 4IGJA 1TI1A 3BD2A 3OR5A 3DIEA 3DVXA 4HS1A 13GSA 4LL4B 1QQ2A 1UA5A 2WRTA 3IAM2 1O85A 3LGCA 1ABAA 1JZRA 2GQMA 3H1NA 3EMPA 3LORA 4WETA 5AGYA 1G7OA 3WGXA 1XWCA 3HJMA 4L8EA 3BCIA 2F9SA 1J08A 1XVQA 1T1VA 4V2NA 1ZMAA 1YEPA 2C8UA 2JACA 5ECPB 3NIVA 3FKFA 3FK8A 5HQPA 1O8WA 1FVJA 3IC8A 1OE7A 4K7OA 2PMTA 1SJ6A 1SENA 1XWAA 3EMXA 1DE1A 3LFLA 4O32A 1USBA 4XS4A 1EV9A 4EO3A 5A4UA 2I3YA 2YZUA 4IHUA 4HUAA 3KH7A 4JRRA 4POBA 2C4JA 4MP4A 4HU9A 1VRSD 1Z5YE 3W8SA 4JBBA 3UOMA 1GL8A 2C0DA 3MSZA 4TR1A 3O76A 2B1LA 2KUCA 4WF4A 4Q5RA 3A2VA 1TRUA 4RQXA 4NWYA 2LJAA 2MMNA 4KF9A 1VF4A 1HNAA 1AQWA 5KN2A 3PH9A 6GSXA 4RI6A 3ISOA 4XRDA 2CZ3A 2XHFA 3F4TA 1K0OA 1XVWA 1DE2A 2H1GA 1OKDA 4EF0A 4GSTA 3GKMA 2YANA 4O92A 2HRNA 3HHVA 3G9BA 1N8JA 3GNJA 4ZL9A 4ECIA 4MA9A 3MDKA 2N5BA 2AAWA 1TK8B 3QOUA 5ECOB 1PL1A 1JLVA 1M7TA 1WMJA 2MBSA 3LXZA 22GSA 5A4WA 1XPVA 3APOA 3FZ5A 1MD3A 4EUYA 2AYTA 3HVXA 1VF1A 5F8BA 2KHPA 5ECRB 4RUVA 2NVLA 5BMUA 3IBHA 2AV4A 3ZTLA 4FYCA 2L4QA 2PWJA 1OKTA 2MBTA 4FO5A 5ELGA 4LA1A 1W4VA 1U3AA 2WULA 4BWQA 3TRPA 1XWKA 4CW9A 2XPEA 2VCWA 2OE3A 2H1AA 4ACSA 1V9WA 3Q6OA 2FHEA 5F07A 4FYBA 5DCHA 5D9VA 1G6WA 4KDUA 3DEXA 4MJEA 5CYYA 3R3EA 2REMA 3TKSE 4DSSA 3M0FA 2C3NA 3D21A 1K0MA 2WDUA 1E2YA 1M0UA 2H0IA 5HR2A 5FHIA 3ZRDA 2VIMA 5IPHA 5H5SA 1WJKA 1FHEA 4MPGA 1TJDA 2H72A 1Z6NA 2MZCA 3IHQA 1Q98A 4EE0A 3KH9A 5HFGA 2ZUPA 4WEYA 2PU9C 4DSRA 4O7HA 2LJRA 3GTUA 4MF6A 4OD7A 3H8QA 1WIKA 2C0GA 5J9BA 5COHA 4ISDA 1DSBA 1SJIA 1X9MB 2MMAA 3CRUA
chains in the Genus database with same CATH superfamily
2YV7A 4NV5A 7GSSA 2YWOA 2VLUA 2HSMA 4I2UA 2AB6A 3TJJA 1WP0A 4BL7B 3L9UA 2H8LA 1CQHA 3EURA 4N10A 3UEMA 5F05A 4MZCA 3HD5A 3TJFA 2YWIA 5L71A 1S3AA 1GSDA 1F3AA 1B4PA 1BX9A 4F0CA 5CRGA 6GSTA 5EL8A 1YKAA 5CO3A 1HNCA 3QMXA 3GRXA 2B6MA 3EC3A 4BA7A 3KP9A 4TOPA 2GS3A 4IQAA 4TR3A 2C3TA 1URMA 14GSA 2VCXA 3LYPA 2FA4A 2IIYA 4EDYA 2HSNA 2PPTA 2WW3A 4IJIA 17GSA 2DMLA 3I43A 4DVCA 3ERFA 5IOWA 3GUSA 2V1MA 3I6AA 1SYXA 4YQMA 2GQKA 2OACA 2HI7A 4RQRA 1S3DA 2XC2A 1YZXA 4FIWA 5IMDA 1PX6A 3O6TA 4E68A 5IMVA 2QC7A 1PKZA 2DJJA 3CYNA 5D9XA 5AN1A 1A0RP 2O89A 4L0UA 5J4VA 4ZBBA 2VM1A 3LXTA 2PBJA 1XW5A 4PQHA 2N5FA 3QAWA 3GSTA 3QR6A 3DVWA 2H1LA 4KUNA 5AISA 3GHAA 4NHWA 3HYPA 4J56E 1AQVA 2K8SA 3WD6A 4MH3A 4AJ7A 3VI5A 3CRTA 4G9HA 3CWGA 3L9SA 2L5OA 4MABA 1TW9A 3IK7A 3VWXA 1GTIA 4F82A 1JZDA 4HJMA 1WRYA 1Z9HA 5IMCA 3WT2A 1KBNA 1PFOA 4PQIA 2VL9A 4POLA 1GNWA 4G19A 4K5SA 2P31A 3J7Yk 4YAPA 1M2AA 3D0ZA 5IOXA 2B7KA 4AKGA 2ES7A 4JZQA 2K6VA 2RM5A 2I4AA 1UC7A 1TKDB 3QD9A 3MIXA 4ZB8A 2OBIA 2F51A 5ECMB 5JWQB 3CSHA 2FNOA 2DMMA 3W8JA 1V57A 3GX8A 4TN8A 4TKYA 2X8CA 3FY7A 5A1NB 3MYDA 2GZZA 3TKQA 1GSEA 1LJRA 2QGVA 3F4SA 1EP8A 3GKXA 3WYWA 3FW2A 2HQTA 1ZCPA 5ELAA 3A2WA 2HRKB 4BVYA 4YQVA 1U87A 4ID0A 3QAGA 2IMKA 5DQSA 1FOHA 3UMAA 1K0AA 4E8EA 2OADA 1ST9A 4ZBDA 2E7PA 2K18A 1CQGA 2FUG2 2R3XA 3SWLA 2GSQA 1TTZA 5ECNB 5DVBA 3G7JA 3D4TA 4Z2UA 3G7IA 3NZNA 3P2AA 5E4WA 3TJBA 1THOA 5DDLA 3DXBA 1K0NA 2D2ZA 1GSUA 2LQOA 5DQYA 4W66A 1XW6A 4PI2C 1FO5A 3MWHA 3M1GA 3TDGA 1PD21 1F9MA 3I9V2 3FR9A 5C04A 2OKAA 1O73A 2L57A 3H79A 4ZBAA 3K8NA 4AGSA 1NW2A 4OFNA 1XBSA 3ZVJD 2EIRA 2PERA 4WR4A 5DJLA 5CREA 2IMEA 3C73A 1J9BA 1YEXA 4KB3A 2H0HA 2F8FA 2JL4A 3TGZA 3IAS2 2A2PA 4ZL8A 1M3JA 3LW9A 3QFAC 5G31A 3ZMKA 3HA9A 1A8LA 3IA1A 1BJXA 1ERUA 1BYEA 6GSVA 4NXIA 4XRAA 5ECSA 2VCQA 2CX3A 5A34B 2O8VB 4WBJA 2FWHA 3P90A 3LYKA 1FW1A 2LSTA 2VCTA 3MNGA 1GUKA 1EOGA 3KEBA 2H66A 4K1FA 2DLXA 1YJ6A 4ECCA 3CQFA 2FGXA 3F6DA 1NHOA 4K5RA 4K2DA 3LEFA 2DJ2A 3ZYWA 2JADA 2EIOA 2C0EA 1MD4A 4PX1A 1GULA 1YF1A 1SYRA 3CXGA 2YV9A 4JU5A 3DKSA 2WGRA 1OAZA 1OC9B 1HNBA 3UAPA 2PUKC 4POKA 2VM2A 4KX4A 1SL2B 4X1UA 4BWSA 3TKRA 1V40A 2HLSA 3QDNA 1WPIA 2KP2A 1K0DA 1GSYA 4OFTA 4GF0A 2IMDA 4N0ZA 3TOTA 5HFIA 2RUEA 4V2LA 5IPGA 2X49A 1DUGA 1ZYNA 4LLRA 3IC4A 4ZILA 5IO0A 3HXSA 1YQ1A 5KOXA 5EVOA 1ZYQB 1Z3EA 2AJQB 5GSTA 2HZEB 1G6YA 3GYKA 1GP1A 1YEWC 4EXJA 4PUFC 3KTBA 1S3CA 1K3OA 1K3LA 1ON4A 3APSA 5J9CA 3GURA 3ZL5A 2O85A 2GVPA 3FYGA 2YP6A 1SU9A 5CAXA 3FR3A 3FHKA 1ILOA 1VF3A 4PUAA 1GRXA 2E2MA 2BMXA 1JZWA 12GSA 2DJ3A 2LS5A 5KN0A 4EC0A 3IR4A 4HSCX 3V1WA 5B6MA 1GSQA 4HU7A 3WGDA 2VD0A 5J4YA 4PURA 1V98A 4TW5A 2IFQB 2V2GA 4XS1A 1THXA 2H75A 4L5OA 2XBIA 3VK9A 3KP8A 6GSSA 5JCWA 2X8GA 5F06A 4Q5FA 3Q18A 2VO4A 4USSA 1MDIA 1DBYA 5J41A 4YAVA 3DRNA 1FAAA 1TP9A 1EEMA 4NV2A 1EV4A 5KN1A 3GKNA 3FZAA 2L6DA 3VWVA 6GSYA 5DCGA 5IMZA 4PNFA 2VL2C 1WOUA 4G0LA 2R4VA 4G0IA 1TRWA 4L0WA 4AJ8A 4EVMA 2VD1A 2X4AA 3KMOA 3BCKA 1H75A 4BL7A 1SVLA 1XXUA 5B7CA 2HE3A 5DBQA 5CRDA 3IDVA 3TRQA 5J3RA 3UVTA 2R5GA 5G30A 4TVEA 1X5CA 1GSFA 3BOAA 4QQ7A 3EU4A 4I6XA 4GSNA 2ON7A 2HXKA 1EGOA 2LTKA 5GZZB 3FZ9A 3L78A 1GNEA 1A23A 5B8BA 2EIQA 2IMFA 2L5LA 1QUWA 3CSJA 2TIRA 3N9JA 5EPFA 1XWGA 2I81A 1U88A 1I1IP 1R5PA 3HY2A 1T8EB 4K0NA 2HRFA 4KSMA 3RDWA 1GUHA 3VI7A 2LJKA 1XWBA 3C71A 3HJPA 1AW9A 1XG8A 2VLVA 5GAPD 2R37A 5HR3A 5HR0A 3TCOA 1C72A 4KH7A 1B4QA 4JR6A 5CP1A 1EP7A 3APQA 4YQUA 2L4CA 2C0FA 4PGTA 2WFCA 1S3RA 3R2QA 1TOFA 2UV8G 3GN3A 3BJ5A 4ECJA 4G2EA 1Z6MA 2DJ1A 4GWRA 2YN1A 1NHYA 4GQCA 3L4NA 3ZLPA 1PX7A 1SJZA 3PPUA 1ZL9A 3Q74A 3GFKA 2YCDA 4MJAA 5BMUB 3E9JB 3ME7A 1HD2A 2PVOC 5DJMA 4G10A 1Z7PA 2GTUA 3F4RA 3D4MA 1H4OA 2KOKA 19GSA 3P7XA 1A2LA 2RUFA 2NTOA 2QKEA 4MJBA 1GSSA 1R4WA 2WVYA 1K0BA 1GWCA 4E8HA 3DD3A 3KCMA 1IYIA 5A5HB 3KZQA 1Z7RA 2X64A 1LU4A 1T7PB 4Q5QA 1EZKA 4K7NA 3ZVJA 3LG6A 4ZB9A 1PSQA 3FR6A 4GXZA 3GV1A 1EWXA 1PL2A 1ZYEA 4GRFA 2EC4A 2WW1A 2FD3A 2H6YA 1F2EA 1PMTA 2HSHA 3E0UA 4QL9A 1I5GA 1M3IA 3A3TA 2H01A 3C7MA 1BEDA 2DBCA 1JZOA 2CX4A 2QSIA 2O3EA 2VL2A 2JSYA 1AC1A 3W6GA 4Z2TA 4O5RA 5FWGA 1A2MA 1RK4A 2CAIA 4TRXA 1U3IA 3M8NA 2CA8A 1QK8A 2RM6A 2K9FA 5H5RA 3IRAA 5A1NA 4KA0A 2CVBA 3KMNA 3GTUB 3N5OA 4V1Ap 2H6XA 3UIWA 2IMIA 3UARA 1B9XC 1UN2A 2BJXA 2WB9A 3TRXA 3GKKA 4F2IA 2JSZA 4PNGA 1UVZA 2A4VA 2DIYA 2H1BA 4GLTA 1BG5A 5LD0A 4BIKA 3M3MA 3KIJA 1FG4A 3LJRA 4I8BA 4X0XA 3NOFA 2PN8A 4K9ZA 2ZCTA 3GMFA 3GH6A 2VUPA 3UL3A 5IIZA 18GSA 1XCCA 2EFCA 2P0GA 3ED3A 4TXOB 3HCZA 5JCGA 3WGEA 4XS6A 4PHZC 1IYHA 2NBSA 4WXTA 2LRNA 2M46A 5ECHB 2YNXA 2F3MA 3C1RA 3C8EA 2HYXA 1PKWA 1Q4JA 2O7KA 4GDFA 1TU7A 1A8YA 2VCVA 2GZYA 1M99A 1SKRB 5DALB 1YVLA 1MTCA 1PN9A 4HZ2A 5DAKB 2R2JA 5GAND 5ID2B 3CTGA 4IQ1A 1SKSB 1OC3A 1BQ7A 1B48A 1YF0A 2KP1A 5GSSA 2OJLA 1ZOFA 2VLTA 3PINA 4O5QA 1T00A 5D93A 2RIIA 1SK2A 2G0FA 4EDZA 4MZBA 1WWJA 3ERGA 2B1KA 3U5RE 1ZGNA 5G2ZA 5A34A 4AJ6A 2AUVA 2V6OA 4IBPA 3EE2A 3HZ8A 2NDOA 1OYJA 4ULXA 4DEJA 2I1UA 2R0GA 2DSAA 1K0CA 1YKCA 3TU3B 9GSSA 4XIHA 4YH2A 2GSRA 3UVHA 1NM3A 2P5RA 3H4KA 4I97A 4PQ1A 2YJ7A 4K8MA 2B3SA 1U6TA 3QCPA 1OC9A 4OO4A 11GSA 2A2SA 1R7HA 5ENUA 2J23A 1KTEA 20GSA 4OFMA 3QPMA 4POMA 3F3QA 5CRWA 2G2QA 2C80A 3TOUA 3ZZXA 4KAEA 3GH9A 2H71A 4AI6A 1AAZA 1WE0A 1X5DA 4MPFA 1BAYA 1B9YC 1SK0A 2OA7A 3QAVA 2WS2A 4Q5NA 4BVXB 2B7JA 3F3RA 1K3YA 3KTLA 3H93A 4ML1A 10GSA 4XHMA 4FQUA 2GSSA 1RQMA 2LV3A 3IK9A 1T3BA 1FOVA 5INYA 2HZEA 1O7UA 3F63A 3RFRC 2HRAA 4MNNA 1Y1UA 4AF2A 5JCUA 4O5UA 2CAQA 2H30A 1XW9A 4BVYB 2C3QA 2H70A 1M2BA 1TXXA 1F3BA 1SKWB 1MDJA 2R0CA 1AUCA 3JCML 2IL3A 2WJUA 2MMZA 1GTAA 5JWOB 2VCZA 3HDCA 4LMWA 4BPYA 4D73B 2H19A 4CY8A 5G1KA 3G7YA 2WCIA 1TK0B 3RGBC 1EGRA 2IN3A 2WZ9A 3SBCA 1GUMA 2YZHA 5ECQB 2IFQA 4H86A 3D6IA 2L59A 5KEJA 1V58A 3D5JA 1X9WB 3LWAA 3FMWA 3IPZA 3A5IA 2GT6A 2GLRA 4IS0A 2FLSA 1GLPA 3RAZA 1S4BP 2WVXA 3EU3A 3ZITA 2LUSA 2ZNMA 4WF5A 2OE1A 3IXRA 1PRXA 3F8UA 2VKZG 4OCEA 4KCEA 5J4UA 3VLNA 5IMAA 4FH8A 3ZREA 1VGLA 4FYUA 4EKZA 4IJ3A 3U6VA 3IV4A 4IP1A 4F03A 2LEGA 2QA2A 2VAFA 3DWVA 4G0KA 4KNDA 4OCFA 3VPQA 2O87A 4KW6A 1OC8A 1HQOA 5LCZA 2AHEA 1RW1A 4CHSA 3TKSA 1XOAA 3HVSA 1ERTA 2F8AA 1SL1B 1QMVA 4PTSA 2IJYA 4HQZA 4K2XA 2HZFA 1W89A 2ALBA 3ZFBA 2FWFA 4EIPA 1N2AA 2ON5A 1XIYA 1AIUA 2YWNA 5H5QA 3UBLA 2OE0A 3HMJG 5J5NA 4DSQA 1ACVA 4WBRD 4X4JA 2M72A 4IN0A 3F6FA 4NAXA 5IM9A 4PXOA 2H74A 4N30A 2XBQA 2OBKA 4XTSA 1QFNA 2HSYA 4XS4B 2E2GA 1SK1A 5A4VA 2Z9SA 2KLXA 2FA8A 1F6MC 2MMOA 2N5AA 4FXYP 4ZB6A 3J7Yb 2FCHA 4ZL7A 1VF2A 4F0BA 3FZ4A 2MYGA 4N3ZA 2HFDA 2FWEA 2B5XA 1MEKA 1Y25A 16GSA 4RI7A 2R6KA 3EWLA 2TRCP 5ECKB 4IVFA 2LNSA 2FY6A 1XFLA 3FEUA 4I2TA 4TR1B 4IW9A 2GGTA 1TRVA 1R5AA 4MH2A 5A5KA 4HZ4A 1GH2A 1HYUA 1ZZYA 2V32A 3VWWA 4XCSA 2LRCA 2GQLA 4V2MA 2E0QA 3TJGA 3RHBA 2YOIA 5CNWA 2NPBA 2CT6A 2DJKA 4I5QA 3M9KA 2CVDA 3RPPA 2CQ9A 4A5PA 2M80A 2P5QA 6GSWA 1PA3A 2X99A 3PGTA 3RBTA 3GX0A 3Q19A 3DYRA 3L9VA 4QL7A 1A2JA 5KOWA 4PI0C 4G01A 2JZRA 2H0GA 1M2DA 4TR0A 5HR1A 3GL5A 3GA4A 2LRTA 4TXVA 5J47A 4X43A 4EIQA 3CTFA 1XZOA 4YKGA 2GZPA 4ZB7A 2YJHA 5FT3A 1JHBA 2XPDA 4KDYA 2WVZA 2VOCA 1AQXA 3EINA 3A5WA 3VFIA 4QMKA 5IO2A 5D8IA 1R26A 3M9JA 4IELA 4ECBA 4J2FA 2JU5A 4LL1B 3UJ1A 4MZWA 3ZMLA 1A24A 2C1YA 1KNGA 1JLWA 3LQ7A 5C00A 4OO5A 3L0HA 1FB6A 1ZYPA 4TXOA 1FVKA 1XOBA 1TI3A 3ZIVA 4DSSB 3S9FA 4KGIA 2BTOT 5E59A 3ERWA 3BBYA 2L6CA 2CVKA 3D22A 2X8HA 4HOJA 3TB2A 2WW0A 4JE1A 4KCAA 3I69A 4Z7XA 2HT9A 2O5VA 2HNLA 1I9DA 3UBKA 1YDKA 5DALA 4JR4A 3E3EA 5AIXA 5DAKA 1B8XA 3F9UA 5ID2A 2H6ZA 1JFUA 3KJYA 3RPNA 1E6BA 2WZSA 4MCUA 2IPAA 4MJCA 3KXOA 2LKUA 2DIZA 2YPMA 1O81A 3KGKA 3ZIJA 3KM6A 3IOSA 1G0TA 4N11A 2I9HA 2K8VA 4WKWA 3QFBC 1TU8A 2HRKA 3VWUA 4MLYA 3TJKA 4CDOA 3HVVA 1TXUA 8GSSA 1X5EA 3GIXA 4EL1A 1GLQA 2HSMB 3HZ4A 2GSTA 2GDRA 3FRCA 3VURA 4KDXA 5ABRA 2DC5A 4NHZA 1PGTA 3KD0A 4MF5A 1KEBA 2JZTA 2RLIA 5IQYA 4J57E 1MDKA 1QGVA 2UZ8A 2PVQA 5LNKe 5B8AA 3CSIA 2J9HA 3TUEA 1TK5B 3P8WA 2O36A 2YWMA 3DGQA 5B6NA 1LBKA 2EFEA 3CMIA 3O3TA 1X9SB 1A0FA 4LMVA 4K7IA 3TKPA 2JZSA 3HKRA 4GQFA 4KE3A 5G5FA 1NSWA 4OMVA 2A2RA 3PR8A 2HSNB 1EOHA 1ERVA 1SD9A 3RHCA 3A2XA 4MF7A 4TR4A 4MMMA 4AKXB 3LSZA 1FB0A 1ERWA 5KN3A 2FWGA 2QA1A 6GSUA 2B5YA 1PN0A 2V41A 1O6JA 4K6XA 4GCIA 1BG1A 4BVXA 3MAKA 5G1LA 3HJOA 3GL3A 4YKFA 1OE8A 1GTBA 1Y6EA 1EEJA 2GT5A 4F9ZA 4MDCA 4NPBA 3EYTA 4N0VA 1J0FA 1SD8A 5G5EA 1SL0B 2R0PA 5ECIB 2B5EA 4GTUA 1TRSA 4HJ2A 5EY6A 2TRXA 1F37A 3EVIA 1T4YA 3ZFLA 2LNTA 5D9WA 3AY8A 5CRHA 4MK3A 4ML6A 1PQNA 1YY7A 1T4ZA 2H73A 1GTUA 1V2AA 2IWTA 2CZ2A 5D9TA 5JWRB 3US3A 1QXHA 4GSSA 4HQSA 3F0IA 3VPTA 3DMLA 3TKSC 4D73A 2H76A 5J40A 3CHXC 4JEDA 1AXDA 4NMUA 4ZXGA 2A4HA 1G7EA 1M9AA 4HI7A 2LQQA 4V1Ag 2VL3A 1OVNA 4WR5A 3GSSA 2DJ0A 4ZIJA 4OWYA 4HEA2 5AIVA 1TDIA 3ME8A 4P3YB 2H1DA 1M9BA 5F0GA 5HFKA 1X0RA 2V6KA 4IP6A 5ECLB 4IKHA 4Z2RA 4ILFA 4KSOA 5D96A 2CV4A 4K0GA 3CBUA 1O8XA 3IE3A 1ML6A 3WT1A 2PGTA 4HDEA 4L5LA 3C1SA 5D73A 5IMFA 4IGJA 1TI1A 3BD2A 3OR5A 3DIEA 3DVXA 4HS1A 13GSA 4LL4B 1QQ2A 1SVOA 1UA5A 2WRTA 3IAM2 1O85A 3LGCA 1ABAA 1JZRA 2GQMA 3H1NA 3EMPA 3LORA 4WETA 5AGYA 1G7OA 3WGXA 1XWCA 3HJMA 4L8EA 3BCIA 2F9SA 1J08A 1XVQA 1T1VA 4V2NA 1ZMAA 1YEPA 2C8UA 2JACA 5ECPB 3NIVA 3FKFA 3FK8A 5HQPA 1O8WA 1N25A 1FVJA 3IC8A 1OE7A 4K7OA 2PMTA 1SJ6A 1SENA 1XWAA 3EMXA 1DE1A 4CY6A 3LFLA 4O32A 1USBA 4XS4A 2EFDA 1EV9A 4EO3A 5A4UA 2DKIA 2I3YA 2YZUA 4IHUA 4HUAA 3KH7A 1BF5A 4JRRA 4POBA 2C4JA 5BRTA 4MP4A 4HU9A 1VRSD 1Z5YE 3W8SA 4JBBA 3UOMA 1GL8A 2C0DA 3MSZA 4TR1A 3O76A 2B1LA 2KUCA 4WF4A 4Q5RA 3A2VA 1TRUA 4RQXA 4NWYA 2LJAA 2MMNA 4KF9A 1VF4A 1HNAA 1AQWA 5KN2A 3PH9A 2WW2A 6GSXA 4RI6A 3ISOA 4XRDA 2CZ3A 2DKHA 2XHFA 3F4TA 1K0OA 1XVWA 1DE2A 2H1GA 1OKDA 4EF0A 4GSTA 3GKMA 2YANA 4O92A 2HRNA 3HHVA 3G9BA 4AKHA 1N8JA 3GNJA 4ZL9A 4ECIA 4MA9A 3MDKA 2N5BA 2AAWA 1TK8B 3QOUA 5ECOB 1PL1A 1JLVA 1M7TA 1WMJA 2MBSA 3LXZA 2WVXB 22GSA 5A4WA 1XPVA 3APOA 3FZ5A 1MD3A 4EUYA 2AYTA 3HVXA 1VF1A 5F8BA 2KHPA 3HVNA 5ECRB 4RUVA 2NVLA 5BMUA 3IBHA 2AV4A 3ZTLA 4FYCA 2L4QA 3IHGA 2PWJA 1OKTA 2MBTA 4FO5A 5ELGA 4LA1A 1W4VA 1U3AA 2WULA 4BWQA 3TRPA 1XWKA 1SVMA 4CW9A 2XPEA 5A5HA 2VCWA 2OE3A 2H1AA 4ACSA 1V9WA 3Q6OA 2FHEA 5F07A 4FYBA 2EFHA 5DCHA 5D9VA 1G6WA 4KDUA 3DEXA 4MJEA 5CYYA 3R3EA 2REMA 3TKSE 4DSSA 3M0FA 2C3NA 3D21A 1K0MA 2WDUA 1E2YA 1M0UA 2H0IA 5HR2A 5FHIA 3ZRDA 2VIMA 5IPHA 5H5SA 1WJKA 1FHEA 4MPGA 1TJDA 2H72A 1Z6NA 2MZCA 3IHQA 1Q98A 4EE0A 3KH9A 5HFGA 2ZUPA 4WEYA 2OT3A 2PU9C 4DSRA 4O7HA 4AKIA 2LJRA 3GTUA 3EPTA 4MF6A 4OD7A 3H8QA 1WIKA 2C0GA 4ICYA 5J9BA 5COHA 4ISDA 1DSBA 1SJIA 1X9MB 2MMAA 3CRUA
chains in the Genus database with same CATH topology
2YV7A 4NV5A 7GSSA 2YWOA 2VLUA 2HSMA 4I2UA 2AB6A 3TJJA 1WP0A 4BL7B 3L9UA 2H8LA 1CQHA 3EURA 4N10A 3UEMA 5F05A 4MZCA 3HD5A 3TJFA 2YWIA 5L71A 1S3AA 1GSDA 1F3AA 1B4PA 1BX9A 4F0CA 5CRGA 6GSTA 5EL8A 1YKAA 5CO3A 1HNCA 3QMXA 3GRXA 2B6MA 3EC3A 4BA7A 3KP9A 4TOPA 2GS3A 4IQAA 4TR3A 2C3TA 1URMA 14GSA 2VCXA 3LYPA 2FA4A 2IIYA 4EDYA 2HSNA 2PPTA 4IJIA 17GSA 2DMLA 3I43A 4DVCA 3ERFA 5IOWA 3GUSA 2V1MA 3I6AA 1SYXA 4YQMA 2GQKA 2OACA 2HI7A 4RQRA 1S3DA 2XC2A 1YZXA 4FIWA 5IMDA 1PX6A 3O6TA 4E68A 5IMVA 2QC7A 1PKZA 2DJJA 3CYNA 5D9XA 5AN1A 1A0RP 2O89A 4L0UA 5J4VA 4ZBBA 2VM1A 3LXTA 2PBJA 1XW5A 4PQHA 2N5FA 3QAWA 3GSTA 3QR6A 3DVWA 2H1LA 4KUNA 5AISA 3GHAA 4NHWA 3HYPA 4J56E 1AQVA 2K8SA 3WD6A 4MH3A 4AJ7A 3VI5A 3CRTA 4G9HA 3CWGA 3L9SA 2L5OA 4MABA 1TW9A 3IK7A 3VWXA 1GTIA 4F82A 1JZDA 4HJMA 1WRYA 1Z9HA 5IMCA 3WT2A 1KBNA 4PQIA 2VL9A 4POLA 1GNWA 4G19A 4K5SA 2P31A 3J7Yk 4YAPA 1M2AA 3D0ZA 5IOXA 2B7KA 4AKGA 2ES7A 4JZQA 2K6VA 2RM5A 2I4AA 1UC7A 1TKDB 3QD9A 3MIXA 4ZB8A 2OBIA 2F51A 5ECMB 5JWQB 3CSHA 2FNOA 2DMMA 3W8JA 1V57A 3GX8A 4TN8A 4TKYA 2X8CA 3FY7A 5A1NB 3MYDA 2GZZA 3TKQA 1GSEA 1LJRA 2QGVA 3F4SA 1EP8A 3GKXA 3WYWA 3FW2A 2HQTA 1ZCPA 5ELAA 3A2WA 2HRKB 4BVYA 4YQVA 1U87A 4ID0A 3QAGA 2IMKA 5DQSA 1FOHA 3UMAA 1K0AA 4E8EA 2OADA 1ST9A 4ZBDA 2E7PA 2K18A 1CQGA 2FUG2 2R3XA 3SWLA 2GSQA 1TTZA 5ECNB 5DVBA 3G7JA 3D4TA 4Z2UA 3G7IA 3NZNA 3P2AA 5E4WA 3TJBA 1THOA 5DDLA 3DXBA 1K0NA 2D2ZA 1GSUA 2LQOA 5DQYA 4W66A 1XW6A 1FO5A 3MWHA 3M1GA 3TDGA 1PD21 1F9MA 3I9V2 3FR9A 5C04A 2OKAA 1O73A 2L57A 3H79A 4ZBAA 3K8NA 4AGSA 1NW2A 4OFNA 1XBSA 3ZVJD 2EIRA 2PERA 4WR4A 5DJLA 5CREA 2IMEA 3C73A 1J9BA 1YEXA 4KB3A 2H0HA 2F8FA 2JL4A 3TGZA 3IAS2 2A2PA 4ZL8A 3LW9A 3QFAC 5G31A 3ZMKA 3HA9A 1A8LA 3IA1A 1BJXA 1ERUA 1BYEA 6GSVA 4NXIA 4XRAA 5ECSA 2VCQA 2CX3A 5A34B 2O8VB 4WBJA 2FWHA 3P90A 3LYKA 1FW1A 2LSTA 2VCTA 3MNGA 1GUKA 1EOGA 3KEBA 2H66A 4K1FA 2DLXA 1YJ6A 4ECCA 2FGXA 3F6DA 1NHOA 4K5RA 4K2DA 3LEFA 2DJ2A 3ZYWA 2JADA 2EIOA 2C0EA 1MD4A 4PX1A 1GULA 1YF1A 1SYRA 3CXGA 2YV9A 4JU5A 3DKSA 2WGRA 1OAZA 1OC9B 1HNBA 3UAPA 2PUKC 4POKA 2VM2A 4KX4A 1SL2B 4X1UA 4BWSA 3TKRA 1V40A 2HLSA 3QDNA 1WPIA 2KP2A 1K0DA 1GSYA 4OFTA 4GF0A 2IMDA 4N0ZA 3TOTA 5HFIA 2RUEA 4V2LA 5IPGA 2X49A 1DUGA 1ZYNA 4LLRA 3IC4A 4ZILA 5IO0A 3HXSA 1YQ1A 5KOXA 5EVOA 1ZYQB 1Z3EA 2AJQB 5GSTA 2HZEB 1G6YA 3GYKA 1GP1A 4EXJA 4PUFC 3KTBA 1S3CA 1K3OA 1K3LA 1ON4A 3APSA 5J9CA 3GURA 3ZL5A 2O85A 2GVPA 3FYGA 2YP6A 1SU9A 5CAXA 3FR3A 3FHKA 1ILOA 1VF3A 4PUAA 1GRXA 2E2MA 2BMXA 1JZWA 12GSA 2DJ3A 2LS5A 5KN0A 4EC0A 3IR4A 3V1WA 5B6MA 1GSQA 4HU7A 3WGDA 2VD0A 5J4YA 4PURA 1V98A 4TW5A 2IFQB 2V2GA 4XS1A 1THXA 2H75A 4L5OA 2XBIA 3VK9A 3KP8A 6GSSA 5JCWA 2X8GA 5F06A 4Q5FA 3Q18A 2VO4A 4USSA 1MDIA 1DBYA 5J41A 4YAVA 3DRNA 1FAAA 1TP9A 1EEMA 4NV2A 1EV4A 5KN1A 3GKNA 3FZAA 2L6DA 3VWVA 6GSYA 5DCGA 5IMZA 4PNFA 2VL2C 1WOUA 4G0LA 2R4VA 4G0IA 1TRWA 4L0WA 4AJ8A 4EVMA 2VD1A 2X4AA 3KMOA 3BCKA 1H75A 4BL7A 1SVLA 1XXUA 5B7CA 2HE3A 5DBQA 5CRDA 3IDVA 3TRQA 5J3RA 3UVTA 2R5GA 5G30A 4TVEA 1X5CA 1GSFA 3BOAA 4QQ7A 3EU4A 4I6XA 4GSNA 2ON7A 2HXKA 1EGOA 2LTKA 5GZZB 3FZ9A 3L78A 1GNEA 1A23A 5B8BA 2EIQA 2IMFA 2L5LA 1QUWA 3CSJA 2TIRA 3N9JA 5EPFA 1XWGA 2I81A 1U88A 1R5PA 3HY2A 1T8EB 4K0NA 2HRFA 4KSMA 3RDWA 1GUHA 3VI7A 2LJKA 1XWBA 3C71A 3HJPA 1AW9A 2VLVA 5GAPD 2R37A 5HR3A 5HR0A 3TCOA 1C72A 4KH7A 1B4QA 4JR6A 5CP1A 1EP7A 3APQA 4YQUA 2L4CA 2C0FA 4PGTA 2WFCA 3R2QA 1TOFA 2UV8G 3GN3A 3BJ5A 4ECJA 4G2EA 1Z6MA 2DJ1A 4GWRA 2YN1A 1NHYA 4GQCA 3L4NA 3ZLPA 1PX7A 1SJZA 3PPUA 1ZL9A 3Q74A 3GFKA 2YCDA 4MJAA 5BMUB 3E9JB 3ME7A 1HD2A 2PVOC 5DJMA 4G10A 1Z7PA 2GTUA 3F4RA 3D4MA 1H4OA 2KOKA 19GSA 3P7XA 1A2LA 2RUFA 2NTOA 2QKEA 4MJBA 1GSSA 1R4WA 1K0BA 1GWCA 4E8HA 3DD3A 3KCMA 1IYIA 5A5HB 3KZQA 1Z7RA 2X64A 1LU4A 1T7PB 4Q5QA 1EZKA 4K7NA 3ZVJA 3LG6A 4ZB9A 1PSQA 3FR6A 4GXZA 3GV1A 1EWXA 1PL2A 1ZYEA 4GRFA 2EC4A 2FD3A 2H6YA 1F2EA 1PMTA 2HSHA 3E0UA 4QL9A 1I5GA 3A3TA 2H01A 3C7MA 1BEDA 2DBCA 1JZOA 2CX4A 2QSIA 2VL2A 2JSYA 1AC1A 3W6GA 4Z2TA 4O5RA 5FWGA 1A2MA 1RK4A 2CAIA 4TRXA 1U3IA 3M8NA 2CA8A 1QK8A 2RM6A 2K9FA 5H5RA 3IRAA 5A1NA 4KA0A 2CVBA 3KMNA 3GTUB 3N5OA 4V1Ap 2H6XA 3UIWA 2IMIA 3UARA 1B9XC 1UN2A 2BJXA 2WB9A 3TRXA 3GKKA 4F2IA 2JSZA 4PNGA 1UVZA 2A4VA 2DIYA 2H1BA 4GLTA 1BG5A 5LD0A 3M3MA 3KIJA 1FG4A 3LJRA 4I8BA 4X0XA 3NOFA 2PN8A 4K9ZA 2ZCTA 3GMFA 3GH6A 2VUPA 3UL3A 5IIZA 18GSA 1XCCA 2EFCA 2P0GA 3ED3A 4TXOB 3HCZA 5JCGA 3WGEA 4XS6A 1IYHA 2NBSA 4WXTA 2LRNA 2M46A 5ECHB 2YNXA 2F3MA 3C1RA 3C8EA 2HYXA 1PKWA 1Q4JA 2O7KA 4GDFA 1TU7A 1A8YA 2VCVA 2GZYA 1M99A 1SKRB 5DALB 1YVLA 1MTCA 1PN9A 4HZ2A 5DAKB 2R2JA 5GAND 5ID2B 3CTGA 4IQ1A 1SKSB 1OC3A 1BQ7A 1B48A 1YF0A 2KP1A 5GSSA 2OJLA 1ZOFA 2VLTA 3PINA 4O5QA 1T00A 5D93A 2RIIA 1SK2A 2G0FA 4EDZA 4MZBA 1WWJA 3ERGA 2B1KA 3U5RE 1ZGNA 5G2ZA 5A34A 4AJ6A 2AUVA 2V6OA 4IBPA 3EE2A 3HZ8A 2NDOA 1OYJA 4ULXA 4DEJA 2I1UA 2R0GA 2DSAA 1K0CA 1YKCA 3TU3B 9GSSA 4XIHA 4YH2A 2GSRA 3UVHA 1NM3A 2P5RA 3H4KA 4I97A 4PQ1A 2YJ7A 4K8MA 2B3SA 1U6TA 3QCPA 1OC9A 4OO4A 11GSA 2A2SA 1R7HA 5ENUA 2J23A 1KTEA 20GSA 4OFMA 3QPMA 4POMA 3F3QA 5CRWA 2G2QA 2C80A 3TOUA 3ZZXA 4KAEA 3GH9A 2H71A 4AI6A 1AAZA 1WE0A 1X5DA 4MPFA 1BAYA 1B9YC 1SK0A 2OA7A 3QAVA 2WS2A 4Q5NA 4BVXB 2B7JA 3F3RA 1K3YA 3KTLA 3H93A 4ML1A 10GSA 4XHMA 4FQUA 2GSSA 1RQMA 2LV3A 3IK9A 1T3BA 1FOVA 5INYA 2HZEA 1O7UA 3F63A 2HRAA 4MNNA 1Y1UA 4AF2A 5JCUA 4O5UA 2CAQA 2H30A 1XW9A 4BVYB 2C3QA 2H70A 1M2BA 1TXXA 1F3BA 1SKWB 1MDJA 2R0CA 1AUCA 3JCML 2IL3A 2WJUA 2MMZA 1GTAA 5JWOB 2VCZA 3HDCA 4LMWA 4BPYA 4D73B 2H19A 4CY8A 5G1KA 3G7YA 2WCIA 1TK0B 1EGRA 2IN3A 2WZ9A 3SBCA 1GUMA 2YZHA 5ECQB 2IFQA 4H86A 3D6IA 2L59A 5KEJA 1V58A 3D5JA 1X9WB 3LWAA 3FMWA 3IPZA 3A5IA 2GT6A 2GLRA 4IS0A 2FLSA 1GLPA 3RAZA 3EU3A 3ZITA 2LUSA 2ZNMA 4WF5A 2OE1A 3IXRA 1PRXA 3F8UA 2VKZG 4OCEA 4KCEA 5J4UA 3VLNA 5IMAA 4FH8A 3ZREA 1VGLA 4FYUA 4EKZA 4IJ3A 3U6VA 3IV4A 4IP1A 4F03A 2LEGA 2QA2A 2VAFA 3DWVA 4G0KA 4KNDA 4OCFA 3VPQA 2O87A 4KW6A 1OC8A 1HQOA 5LCZA 2AHEA 1RW1A 4CHSA 3TKSA 1XOAA 3HVSA 1ERTA 2F8AA 1SL1B 1QMVA 4PTSA 2IJYA 4HQZA 4K2XA 2HZFA 1W89A 2ALBA 3ZFBA 2FWFA 4EIPA 1N2AA 2ON5A 1XIYA 1AIUA 2YWNA 5H5QA 3UBLA 2OE0A 3HMJG 5J5NA 4DSQA 1ACVA 4WBRD 4X4JA 2M72A 4IN0A 3F6FA 4NAXA 5IM9A 4PXOA 2H74A 4N30A 2XBQA 2OBKA 4XTSA 1QFNA 2HSYA 4XS4B 2E2GA 1SK1A 5A4VA 2Z9SA 2KLXA 2FA8A 1F6MC 2MMOA 2N5AA 4ZB6A 3J7Yb 2FCHA 4ZL7A 1VF2A 4F0BA 3FZ4A 2MYGA 4N3ZA 2HFDA 2FWEA 2B5XA 1MEKA 1Y25A 16GSA 4RI7A 2R6KA 3EWLA 2TRCP 5ECKB 4IVFA 2LNSA 2FY6A 1XFLA 3FEUA 4I2TA 4TR1B 4IW9A 2GGTA 1TRVA 1R5AA 4MH2A 5A5KA 4HZ4A 1GH2A 1HYUA 1ZZYA 2V32A 3VWWA 4XCSA 2LRCA 2GQLA 4V2MA 2E0QA 3TJGA 3RHBA 2YOIA 5CNWA 2NPBA 2CT6A 2DJKA 4I5QA 3M9KA 2CVDA 3RPPA 2CQ9A 4A5PA 2M80A 2P5QA 6GSWA 1PA3A 2X99A 3PGTA 3RBTA 3GX0A 3Q19A 3DYRA 3L9VA 4QL7A 1A2JA 5KOWA 4G01A 2JZRA 2H0GA 1M2DA 4TR0A 5HR1A 3GL5A 3GA4A 2LRTA 4TXVA 5J47A 4X43A 4EIQA 3CTFA 1XZOA 4YKGA 2GZPA 4ZB7A 2YJHA 5FT3A 1JHBA 2XPDA 4KDYA 2VOCA 1AQXA 3EINA 3A5WA 3VFIA 4QMKA 5IO2A 5D8IA 1R26A 3M9JA 4IELA 4ECBA 4J2FA 2JU5A 4LL1B 3UJ1A 4MZWA 3ZMLA 1A24A 2C1YA 1KNGA 1JLWA 3LQ7A 5C00A 4OO5A 3L0HA 1FB6A 1ZYPA 4TXOA 1FVKA 1XOBA 1TI3A 3ZIVA 4DSSB 3S9FA 4KGIA 2BTOT 5E59A 3ERWA 3BBYA 2L6CA 2CVKA 3D22A 2X8HA 4HOJA 3TB2A 4JE1A 4KCAA 3I69A 4Z7XA 2HT9A 2O5VA 2HNLA 1I9DA 3UBKA 1YDKA 5DALA 4JR4A 3E3EA 5AIXA 5DAKA 1B8XA 3F9UA 5ID2A 2H6ZA 1JFUA 3KJYA 3RPNA 1E6BA 4MCUA 2IPAA 4MJCA 3KXOA 2LKUA 2DIZA 2YPMA 1O81A 3KGKA 3ZIJA 3KM6A 3IOSA 1G0TA 4N11A 2I9HA 2K8VA 4WKWA 3QFBC 1TU8A 2HRKA 3VWUA 4MLYA 3TJKA 4CDOA 3HVVA 1TXUA 8GSSA 1X5EA 3GIXA 4EL1A 1GLQA 2HSMB 3HZ4A 2GSTA 2GDRA 3FRCA 3VURA 4KDXA 5ABRA 2DC5A 4NHZA 1PGTA 3KD0A 4MF5A 1KEBA 2JZTA 2RLIA 5IQYA 4J57E 1MDKA 1QGVA 2UZ8A 2PVQA 5LNKe 5B8AA 3CSIA 2J9HA 3TUEA 1TK5B 3P8WA 2YWMA 3DGQA 5B6NA 1LBKA 2EFEA 3CMIA 3O3TA 1X9SB 1A0FA 4LMVA 4K7IA 3TKPA 2JZSA 3HKRA 4GQFA 4KE3A 5G5FA 1NSWA 4OMVA 2A2RA 3PR8A 2HSNB 1EOHA 1ERVA 1SD9A 3RHCA 3A2XA 4MF7A 4TR4A 4MMMA 4AKXB 3LSZA 1FB0A 1ERWA 5KN3A 2FWGA 2QA1A 6GSUA 2B5YA 1PN0A 2V41A 1O6JA 4K6XA 4GCIA 1BG1A 4BVXA 3MAKA 5G1LA 3HJOA 3GL3A 4YKFA 1OE8A 1GTBA 1Y6EA 1EEJA 2GT5A 4F9ZA 4MDCA 4NPBA 3EYTA 4N0VA 1J0FA 1SD8A 5G5EA 1SL0B 2R0PA 5ECIB 2B5EA 4GTUA 1TRSA 4HJ2A 5EY6A 2TRXA 1F37A 3EVIA 1T4YA 3ZFLA 2LNTA 5D9WA 3AY8A 5CRHA 4MK3A 4ML6A 1PQNA 1YY7A 1T4ZA 2H73A 1GTUA 1V2AA 2IWTA 2CZ2A 5D9TA 5JWRB 3US3A 1QXHA 4GSSA 4HQSA 3F0IA 3VPTA 3DMLA 3TKSC 4D73A 2H76A 5J40A 4JEDA 1AXDA 4NMUA 4ZXGA 2A4HA 1G7EA 1M9AA 4HI7A 2LQQA 4V1Ag 2VL3A 1OVNA 4WR5A 3GSSA 2DJ0A 4ZIJA 4OWYA 4HEA2 5AIVA 1TDIA 3ME8A 4P3YB 2H1DA 1M9BA 5F0GA 5HFKA 1X0RA 2V6KA 4IP6A 5ECLB 4IKHA 4Z2RA 4ILFA 4KSOA 5D96A 2CV4A 4K0GA 3CBUA 1O8XA 3IE3A 1ML6A 3WT1A 2PGTA 4HDEA 4L5LA 3C1SA 5D73A 5IMFA 4IGJA 1TI1A 3BD2A 3OR5A 3DIEA 3DVXA 4HS1A 13GSA 4LL4B 1QQ2A 1SVOA 1UA5A 2WRTA 3IAM2 1O85A 3LGCA 1ABAA 1JZRA 2GQMA 3H1NA 3EMPA 3LORA 4WETA 5AGYA 1G7OA 3WGXA 1XWCA 3HJMA 4L8EA 3BCIA 2F9SA 1J08A 1XVQA 1T1VA 4V2NA 1ZMAA 1YEPA 2C8UA 2JACA 5ECPB 3NIVA 3FKFA 3FK8A 5HQPA 1O8WA 1N25A 1FVJA 3IC8A 1OE7A 4K7OA 2PMTA 1SJ6A 1SENA 1XWAA 3EMXA 1DE1A 4CY6A 3LFLA 4O32A 1USBA 4XS4A 2EFDA 1EV9A 4EO3A 5A4UA 2DKIA 2I3YA 2YZUA 4IHUA 4HUAA 3KH7A 1BF5A 4JRRA 4POBA 2C4JA 5BRTA 4MP4A 4HU9A 1VRSD 1Z5YE 3W8SA 4JBBA 3UOMA 1GL8A 2C0DA 3MSZA 4TR1A 3O76A 2B1LA 2KUCA 4WF4A 4Q5RA 3A2VA 1TRUA 4RQXA 4NWYA 2LJAA 2MMNA 4KF9A 1VF4A 1HNAA 1AQWA 5KN2A 3PH9A 6GSXA 4RI6A 3ISOA 4XRDA 2CZ3A 2DKHA 2XHFA 3F4TA 1K0OA 1XVWA 1DE2A 2H1GA 1OKDA 4EF0A 4GSTA 3GKMA 2YANA 4O92A 2HRNA 3HHVA 3G9BA 4AKHA 1N8JA 3GNJA 4ZL9A 4ECIA 4MA9A 3MDKA 2N5BA 2AAWA 1TK8B 3QOUA 5ECOB 1PL1A 1JLVA 1M7TA 1WMJA 2MBSA 3LXZA 22GSA 5A4WA 1XPVA 3APOA 3FZ5A 1MD3A 4EUYA 2AYTA 3HVXA 1VF1A 5F8BA 2KHPA 5ECRB 4RUVA 2NVLA 5BMUA 3IBHA 2AV4A 3ZTLA 4FYCA 2L4QA 3IHGA 2PWJA 1OKTA 2MBTA 4FO5A 5ELGA 4LA1A 1W4VA 1U3AA 2WULA 4BWQA 3TRPA 1XWKA 1SVMA 4CW9A 2XPEA 5A5HA 2VCWA 2OE3A 2H1AA 4ACSA 1V9WA 3Q6OA 2FHEA 5F07A 4FYBA 2EFHA 5DCHA 5D9VA 1G6WA 4KDUA 3DEXA 4MJEA 5CYYA 3R3EA 2REMA 3TKSE 4DSSA 3M0FA 2C3NA 3D21A 1K0MA 2WDUA 1E2YA 1M0UA 2H0IA 5HR2A 5FHIA 3ZRDA 2VIMA 5IPHA 5H5SA 1WJKA 1FHEA 4MPGA 1TJDA 2H72A 1Z6NA 2MZCA 3IHQA 1Q98A 4EE0A 3KH9A 5HFGA 2ZUPA 4WEYA 2OT3A 2PU9C 4DSRA 4O7HA 4AKIA 2LJRA 3GTUA 3EPTA 4MF6A 4OD7A 3H8QA 1WIKA 2C0GA 4ICYA 5J9BA 5COHA 4ISDA 1DSBA 1SJIA 1X9MB 2MMAA 3CRUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YV7 A;  4NV5 A;  7GSS A;  2YWO A;  2VLU A;  2HSM A;  4I2U A;  2AB6 A;  3TJJ A;  1WP0 A;  4BL7 B;  3L9U A;  2H8L A;  1CQH A;  3EUR A;  4N10 A;  3UEM A;  5F05 A;  4MZC A;  3HD5 A;  3TJF A;  2YWI A;  5L71 A;  1S3A A;  1GSD A;  1F3A A;  1B4P A;  1BX9 A;  4F0C A;  5CRG A;  6GST A;  5EL8 A;  1YKA A;  5CO3 A;  1HNC A;  3QMX A;  3GRX A;  2B6M A;  3EC3 A;  4BA7 A;  3KP9 A;  4TOP A;  2GS3 A;  4IQA A;  4TR3 A;  2C3T A;  1URM A;  14GS A;  2VCX A;  3LYP A;  2FA4 A;  2IIY A;  4EDY A;  2PPT A;  4IJI A;  17GS A;  2DML A;  3I43 A;  4DVC A;  3ERF A;  5IOW A;  3GUS A;  2V1M A;  3I6A A;  1SYX A;  4YQM A;  2GQK A;  2OAC A;  2HI7 A;  4RQR A;  1S3D A;  2XC2 A;  1YZX A;  4FIW A;  5IMD A;  1PX6 A;  3O6T A;  5IMV A;  2QC7 A;  1PKZ A;  2DJJ A;  3CYN A;  5D9X A;  5AN1 A;  1A0R P;  2O89 A;  4L0U A;  4ZBB A;  2VM1 A;  3LXT A;  2PBJ A;  1XW5 A;  4PQH A;  2N5F A;  3QAW A;  3GST A;  3QR6 A;  3DVW A;  4KUN A;  5AIS A;  3GHA A;  4NHW A;  3HYP A;  4J56 E;  1AQV A;  2K8S A;  3WD6 A;  4MH3 A;  4AJ7 A;  3VI5 A;  3CRT A;  4G9H A;  3L9S A;  2L5O A;  4MAB A;  1TW9 A;  3IK7 A;  3VWX A;  1GTI A;  4F82 A;  1JZD A;  4HJM A;  1WRY A;  1Z9H A;  5IMC A;  3WT2 A;  1KBN A;  4PQI A;  2VL9 A;  4POL A;  1GNW A;  4G19 A;  2P31 A;  3J7Y k;  4YAP A;  1M2A A;  3D0Z A;  5IOX A;  2B7K A;  2ES7 A;  4JZQ A;  2K6V A;  2RM5 A;  2I4A A;  1UC7 A;  1TKD B;  3QD9 A;  4ZB8 A;  2OBI A;  2F51 A;  5ECM B;  5JWQ B;  3CSH A;  2FNO A;  2DMM A;  3W8J A;  1V57 A;  3GX8 A;  4TN8 A;  4TKY A;  2X8C A;  3FY7 A;  2GZZ A;  3TKQ A;  1GSE A;  1LJR A;  2QGV A;  3F4S A;  1EP8 A;  3GKX A;  3WYW A;  3FW2 A;  2HQT A;  1ZCP A;  5ELA A;  3A2W A;  2HRK B;  4BVY A;  4YQV A;  1U87 A;  4ID0 A;  3QAG A;  2IMK A;  5DQS A;  3UMA A;  1K0A A;  4E8E A;  2OAD A;  1ST9 A;  4ZBD A;  2E7P A;  2K18 A;  1CQG A;  2FUG 2;  2R3X A;  3SWL A;  2GSQ A;  1TTZ A;  5ECN B;  5DVB A;  3G7J A;  3D4T A;  3G7I A;  3NZN A;  3P2A A;  5E4W A;  3TJB A;  1THO A;  5DDL A;  3DXB A;  1K0N A;  2D2Z A;  1GSU A;  2LQO A;  5DQY A;  1XW6 A;  1FO5 A;  3MWH A;  3M1G A;  3TDG A;  1PD2 1;  1F9M A;  3I9V 2;  3FR9 A;  5C04 A;  2OKA A;  1O73 A;  2L57 A;  3H79 A;  4ZBA A;  3K8N A;  4AGS A;  1NW2 A;  4OFN A;  1XBS A;  3ZVJ D;  2EIR A;  2PER A;  4WR4 A;  5DJL A;  5CRE A;  2IME A;  3C73 A;  1J9B A;  1YEX A;  4KB3 A;  2H0H A;  2F8F A;  2JL4 A;  3TGZ A;  3IAS 2;  4ZL8 A;  3QFA C;  5G31 A;  3ZMK A;  3HA9 A;  1A8L A;  3IA1 A;  1BJX A;  1ERU A;  1BYE A;  6GSV A;  4NXI A;  4XRA A;  5ECS A;  2VCQ A;  2CX3 A;  2O8V B;  4WBJ A;  2FWH A;  3P90 A;  3LYK A;  1FW1 A;  2LST A;  2VCT A;  3MNG A;  1GUK A;  1EOG A;  3KEB A;  2H66 A;  4K1F A;  2DLX A;  1YJ6 A;  4ECC A;  2FGX A;  3F6D A;  1NHO A;  4K2D A;  3LEF A;  2DJ2 A;  3ZYW A;  2JAD A;  2EIO A;  2C0E A;  1MD4 A;  4PX1 A;  1GUL A;  1YF1 A;  1SYR A;  3CXG A;  2YV9 A;  4JU5 A;  3DKS A;  2WGR A;  1OAZ A;  1OC9 B;  1HNB A;  3UAP A;  2PUK C;  4POK A;  2VM2 A;  4KX4 A;  1SL2 B;  4X1U A;  4BWS A;  3TKR A;  1V40 A;  2HLS A;  3QDN A;  1WPI A;  2KP2 A;  1K0D A;  1GSY A;  4OFT A;  4GF0 A;  2IMD A;  4N0Z A;  3TOT A;  5HFI A;  2RUE A;  4V2L A;  5IPG A;  1DUG A;  4LLR A;  3IC4 A;  4ZIL A;  5IO0 A;  3HXS A;  1YQ1 A;  5EVO A;  1ZYQ B;  1Z3E A;  2AJQ B;  5GST A;  2HZE B;  1G6Y A;  3GYK A;  1GP1 A;  4EXJ A;  4PUF C;  3KTB A;  1S3C A;  1K3O A;  1K3L A;  1ON4 A;  3APS A;  5J9C A;  3GUR A;  3ZL5 A;  2O85 A;  2GVP A;  3FYG A;  2YP6 A;  1SU9 A;  5CAX A;  3FR3 A;  3FHK A;  1ILO A;  1VF3 A;  4PUA A;  1GRX A;  2E2M A;  2BMX A;  1JZW A;  12GS A;  2DJ3 A;  2LS5 A;  5KN0 A;  4EC0 A;  3IR4 A;  3V1W A;  5B6M A;  1GSQ A;  4HU7 A;  3WGD A;  2VD0 A;  4PUR A;  1V98 A;  4TW5 A;  2IFQ B;  2V2G A;  4XS1 A;  1THX A;  2H75 A;  4L5O A;  2XBI A;  3VK9 A;  3KP8 A;  6GSS A;  5JCW A;  2X8G A;  5F06 A;  4Q5F A;  3Q18 A;  2VO4 A;  4USS A;  1MDI A;  1DBY A;  5J41 A;  4YAV A;  3DRN A;  1FAA A;  1TP9 A;  1EEM A;  4NV2 A;  1EV4 A;  5KN1 A;  3GKN A;  3FZA A;  2L6D A;  3VWV A;  6GSY A;  5DCG A;  5IMZ A;  4PNF A;  2VL2 C;  1WOU A;  4G0L A;  2R4V A;  4G0I A;  1TRW A;  4L0W A;  4AJ8 A;  4EVM A;  2VD1 A;  3KMO A;  3BCK A;  1H75 A;  4BL7 A;  1XXU A;  5B7C A;  2HE3 A;  5DBQ A;  5CRD A;  3IDV A;  3TRQ A;  5J3R A;  3UVT A;  2R5G A;  5G30 A;  4TVE A;  1X5C A;  1GSF A;  3BOA A;  4QQ7 A;  3EU4 A;  4I6X A;  4GSN A;  2ON7 A;  2HXK A;  1EGO A;  2LTK A;  5GZZ B;  3FZ9 A;  3L78 A;  1GNE A;  1A23 A;  5B8B A;  2EIQ A;  2IMF A;  2L5L A;  1QUW A;  3CSJ A;  2TIR A;  3N9J A;  5EPF A;  1XWG A;  2I81 A;  1U88 A;  1R5P A;  3HY2 A;  1T8E B;  4K0N A;  2HRF A;  4KSM A;  3RDW A;  1GUH A;  3VI7 A;  2LJK A;  1XWB A;  3C71 A;  3HJP A;  1AW9 A;  2VLV A;  5GAP D;  2R37 A;  5HR3 A;  5HR0 A;  3TCO A;  1C72 A;  4KH7 A;  1B4Q A;  4JR6 A;  5CP1 A;  1EP7 A;  3APQ A;  4YQU A;  2L4C A;  2C0F A;  4PGT A;  2WFC A;  3R2Q A;  1TOF A;  3GN3 A;  3BJ5 A;  4ECJ A;  4G2E A;  1Z6M A;  2DJ1 A;  4GWR A;  2YN1 A;  1NHY A;  4GQC A;  3L4N A;  3ZLP A;  1PX7 A;  1SJZ A;  3PPU A;  1ZL9 A;  3Q74 A;  3GFK A;  2YCD A;  4MJA A;  3E9J B;  3ME7 A;  1HD2 A;  2PVO C;  5DJM A;  4G10 A;  1Z7P A;  2GTU A;  3F4R A;  3D4M A;  1H4O A;  2KOK A;  19GS A;  3P7X A;  1A2L A;  2RUF A;  2NTO A;  2QKE A;  4MJB A;  1GSS A;  1R4W A;  1K0B A;  1GWC A;  4E8H A;  3DD3 A;  3KCM A;  1IYI A;  3KZQ A;  1Z7R A;  2X64 A;  1LU4 A;  1T7P B;  4Q5Q A;  1EZK A;  4K7N A;  3ZVJ A;  3LG6 A;  4ZB9 A;  1PSQ A;  3FR6 A;  4GXZ A;  3GV1 A;  1EWX A;  1PL2 A;  1ZYE A;  4GRF A;  2EC4 A;  2FD3 A;  2H6Y A;  1F2E A;  1PMT A;  2HSH A;  3E0U A;  4QL9 A;  1I5G A;  3A3T A;  2H01 A;  3C7M A;  1BED A;  2DBC A;  1JZO A;  2CX4 A;  2QSI A;  2VL2 A;  2JSY A;  1AC1 A;  3W6G A;  4O5R A;  5FWG A;  1A2M A;  1RK4 A;  2CAI A;  4TRX A;  1U3I A;  3M8N A;  2CA8 A;  1QK8 A;  2RM6 A;  2K9F A;  5H5R A;  3IRA A;  4KA0 A;  2CVB A;  3KMN A;  3GTU B;  3N5O A;  4V1A p;  2H6X A;  3UIW A;  2IMI A;  3UAR A;  1B9X C;  1UN2 A;  2BJX A;  2WB9 A;  3TRX A;  3GKK A;  4F2I A;  2JSZ A;  4PNG A;  1UVZ A;  2A4V A;  2DIY A;  2H1B A;  4GLT A;  1BG5 A;  5LD0 A;  3M3M A;  3KIJ A;  1FG4 A;  3LJR A;  4I8B A;  4X0X A;  3NOF A;  2PN8 A;  4K9Z A;  2ZCT A;  3GMF A;  3GH6 A;  2VUP A;  3UL3 A;  5IIZ A;  18GS A;  1XCC A;  2P0G A;  3ED3 A;  4TXO B;  3HCZ A;  5JCG A;  3WGE A;  4XS6 A;  1IYH A;  2NBS A;  4WXT A;  2LRN A;  2M46 A;  5ECH B;  2YNX A;  2F3M A;  3C1R A;  3C8E A;  2HYX A;  1PKW A;  1Q4J A;  2O7K A;  1TU7 A;  1A8Y A;  2VCV A;  2GZY A;  1M99 A;  1SKR B;  5DAL B;  1MTC A;  1PN9 A;  4HZ2 A;  5DAK B;  2R2J A;  5GAN D;  5ID2 B;  3CTG A;  4IQ1 A;  1SKS B;  1OC3 A;  1BQ7 A;  1B48 A;  1YF0 A;  2KP1 A;  5GSS A;  2OJL A;  1ZOF A;  2VLT A;  3PIN A;  1T00 A;  5D93 A;  2RII A;  1SK2 A;  2G0F A;  4EDZ A;  4MZB A;  1WWJ A;  3ERG A;  2B1K A;  3U5R E;  1ZGN A;  5G2Z A;  4AJ6 A;  2AUV A;  2V6O A;  4IBP A;  3EE2 A;  3HZ8 A;  2NDO A;  1OYJ A;  4ULX A;  4DEJ A;  2I1U A;  2DSA A;  1K0C A;  1YKC A;  9GSS A;  4XIH A;  4YH2 A;  2GSR A;  3UVH A;  1NM3 A;  2P5R A;  3H4K A;  4I97 A;  4PQ1 A;  2YJ7 A;  4K8M A;  2B3S A;  1U6T A;  3QCP A;  1OC9 A;  4OO4 A;  11GS A;  2A2S A;  1R7H A;  5ENU A;  2J23 A;  1KTE A;  3QPM A;  20GS A;  4OFM A;  4POM A;  3F3Q A;  5CRW A;  2G2Q A;  2C80 A;  3TOU A;  3ZZX A;  4KAE A;  3GH9 A;  2H71 A;  1AAZ A;  1WE0 A;  1X5D A;  4MPF A;  1BAY A;  1B9Y C;  1SK0 A;  2OA7 A;  3QAV A;  2WS2 A;  4Q5N A;  4BVX B;  2B7J A;  3F3R A;  1K3Y A;  3KTL A;  3H93 A;  4ML1 A;  10GS A;  4XHM A;  4FQU A;  2GSS A;  1RQM A;  2LV3 A;  3IK9 A;  1T3B A;  1FOV A;  5INY A;  2HZE A;  1O7U A;  3F63 A;  2HRA A;  4AF2 A;  5JCU A;  2CAQ A;  2H30 A;  1XW9 A;  4BVY B;  2C3Q A;  2H70 A;  1M2B A;  1TXX A;  1F3B A;  1SKW B;  1MDJ A;  1AUC A;  3JCM L;  2IL3 A;  2WJU A;  2MMZ A;  1GTA A;  5JWO B;  2VCZ A;  3HDC A;  4LMW A;  4BPY A;  4D73 B;  2H19 A;  5G1K A;  3G7Y A;  2WCI A;  1TK0 B;  1EGR A;  2IN3 A;  2WZ9 A;  3SBC A;  1GUM A;  2YZH A;  5ECQ B;  2IFQ A;  4H86 A;  3D6I A;  2L59 A;  5KEJ A;  1V58 A;  3D5J A;  1X9W B;  3LWA A;  3IPZ A;  2GT6 A;  2GLR A;  4IS0 A;  2FLS A;  1GLP A;  3RAZ A;  3EU3 A;  3ZIT A;  2LUS A;  2ZNM A;  4WF5 A;  2OE1 A;  3IXR A;  1PRX A;  3F8U A;  4OCE A;  4KCE A;  5J4U A;  3VLN A;  5IMA A;  4FH8 A;  3ZRE A;  1VGL A;  4FYU A;  4EKZ A;  4IJ3 A;  3U6V A;  3IV4 A;  4IP1 A;  4F03 A;  2LEG A;  2VAF A;  3DWV A;  4G0K A;  4KND A;  4OCF A;  3VPQ A;  2O87 A;  4KW6 A;  1OC8 A;  1HQO A;  5LCZ A;  2AHE A;  1RW1 A;  4CHS A;  3TKS A;  1XOA A;  3HVS A;  1ERT A;  2F8A A;  1SL1 B;  1QMV A;  4PTS A;  2IJY A;  4HQZ A;  2HZF A;  1W89 A;  2ALB A;  3ZFB A;  2FWF A;  1N2A A;  2ON5 A;  1XIY A;  1AIU A;  2YWN A;  5H5Q A;  3UBL A;  2OE0 A;  5J5N A;  4DSQ A;  1ACV A;  4WBR D;  2M72 A;  4IN0 A;  3F6F A;  4NAX A;  5IM9 A;  4PXO A;  2H74 A;  4N30 A;  2XBQ A;  2OBK A;  4XTS A;  1QFN A;  2HSY A;  4XS4 B;  2E2G A;  1SK1 A;  5A4V A;  2Z9S A;  2KLX A;  2FA8 A;  1F6M C;  2MMO A;  2N5A A;  4ZB6 A;  3J7Y b;  2FCH A;  4ZL7 A;  1VF2 A;  4F0B A;  3FZ4 A;  2MYG A;  2HFD A;  2FWE A;  2B5X A;  1MEK A;  1Y25 A;  16GS A;  4RI7 A;  2R6K A;  3EWL A;  2TRC P;  5ECK B;  4IVF A;  2LNS A;  2FY6 A;  1XFL A;  3FEU A;  4I2T A;  4TR1 B;  4IW9 A;  2GGT A;  1TRV A;  1R5A A;  4MH2 A;  5A5K A;  4HZ4 A;  1GH2 A;  1HYU A;  1ZZY A;  2V32 A;  3VWW A;  4XCS A;  2LRC A;  2GQL A;  4V2M A;  2E0Q A;  3TJG A;  3RHB A;  2YOI A;  5CNW A;  2NPB A;  2CT6 A;  2DJK A;  4I5Q A;  3M9K A;  2CVD A;  3RPP A;  2CQ9 A;  2M80 A;  2P5Q A;  6GSW A;  1PA3 A;  2X99 A;  3PGT A;  3RBT A;  3GX0 A;  3Q19 A;  3DYR A;  3L9V A;  4QL7 A;  1A2J A;  2JZR A;  2H0G A;  1M2D A;  4TR0 A;  5HR1 A;  3GL5 A;  3GA4 A;  2LRT A;  4TXV A;  4X43 A;  3CTF A;  1XZO A;  2GZP A;  2YJH A;  5FT3 A;  1JHB A;  2XPD A;  4KDY A;  2VOC A;  1AQX A;  3EIN A;  3A5W A;  3VFI A;  5IO2 A;  5D8I A;  1R26 A;  3M9J A;  4IEL A;  4ECB A;  4J2F A;  2JU5 A;  4LL1 B;  3UJ1 A;  4MZW A;  3ZML A;  1A24 A;  2C1Y A;  1KNG A;  1JLW A;  3LQ7 A;  5C00 A;  4OO5 A;  3L0H A;  1FB6 A;  4TXO A;  1FVK A;  1XOB A;  1TI3 A;  3ZIV A;  4DSS B;  3S9F A;  4KGI A;  2BTO T;  5E59 A;  3ERW A;  3BBY A;  2L6C A;  2CVK A;  3D22 A;  2X8H A;  4HOJ A;  3TB2 A;  4JE1 A;  4KCA A;  3I69 A;  4Z7X A;  2HT9 A;  2HNL A;  1I9D A;  3UBK A;  1YDK A;  5DAL A;  4JR4 A;  3E3E A;  5AIX A;  5DAK A;  1B8X A;  3F9U A;  5ID2 A;  2H6Z A;  1JFU A;  3KJY A;  3RPN A;  1E6B A;  4MCU A;  2IPA A;  4MJC A;  3KXO A;  2LKU A;  2DIZ A;  2YPM A;  1O81 A;  3KGK A;  3ZIJ A;  3KM6 A;  3IOS A;  1G0T A;  4N11 A;  2I9H A;  2K8V A;  4WKW A;  3QFB C;  1TU8 A;  2HRK A;  3VWU A;  4MLY A;  3TJK A;  4CDO A;  3HVV A;  8GSS A;  1X5E A;  3GIX A;  4EL1 A;  1GLQ A;  2HSM B;  3HZ4 A;  2GST A;  2GDR A;  3FRC A;  3VUR A;  4KDX A;  5ABR A;  2DC5 A;  4NHZ A;  1PGT A;  3KD0 A;  4MF5 A;  1KEB A;  2JZT A;  2RLI A;  5IQY A;  4J57 E;  1MDK A;  1QGV A;  2UZ8 A;  2PVQ A;  5LNK e;  5B8A A;  3CSI A;  2J9H A;  3TUE A;  1TK5 B;  3P8W A;  2YWM A;  3DGQ A;  5B6N A;  1LBK A;  3CMI A;  3O3T A;  1X9S B;  1A0F A;  4LMV A;  4K7I A;  3TKP A;  2JZS A;  3HKR A;  4GQF A;  4KE3 A;  5G5F A;  1NSW A;  4OMV A;  2A2R A;  3PR8 A;  2HSN B;  1EOH A;  1ERV A;  1SD9 A;  3RHC A;  3A2X A;  4MF7 A;  4TR4 A;  4MMM A;  3LSZ A;  1FB0 A;  1ERW A;  5KN3 A;  2FWG A;  6GSU A;  2B5Y A;  2V41 A;  1O6J A;  4K6X A;  4GCI A;  4BVX A;  3MAK A;  5G1L A;  3HJO A;  3GL3 A;  1OE8 A;  1GTB A;  1Y6E A;  1EEJ A;  2GT5 A;  4F9Z A;  4MDC A;  4NPB A;  3EYT A;  4N0V A;  1J0F A;  1SD8 A;  5G5E A;  1SL0 B;  5ECI B;  2B5E A;  4GTU A;  1TRS A;  4HJ2 A;  5EY6 A;  2TRX A;  1F37 A;  3EVI A;  1T4Y A;  3ZFL A;  2LNT A;  5D9W A;  3AY8 A;  5CRH A;  4MK3 A;  4ML6 A;  1PQN A;  1YY7 A;  1T4Z A;  2H73 A;  1GTU A;  1V2A A;  2IWT A;  2CZ2 A;  5D9T A;  5JWR B;  3US3 A;  1QXH A;  4GSS A;  4HQS A;  3F0I A;  3VPT A;  3DML A;  3TKS C;  4D73 A;  2H76 A;  4JED A;  1AXD A;  4NMU A;  4ZXG A;  1G7E A;  1M9A A;  4HI7 A;  2LQQ A;  4V1A g;  2VL3 A;  1OVN A;  4WR5 A;  3GSS A;  2DJ0 A;  4ZIJ A;  4OWY A;  4HEA 2;  5AIV A;  1TDI A;  3ME8 A;  4P3Y B;  2H1D A;  1M9B A;  5F0G A;  5HFK A;  1X0R A;  2V6K A;  4IP6 A;  5ECL B;  4IKH A;  4ILF A;  4KSO A;  5D96 A;  2CV4 A;  4K0G A;  3CBU A;  1O8X A;  3IE3 A;  1ML6 A;  3WT1 A;  2PGT A;  4HDE A;  4L5L A;  3C1S A;  5D73 A;  5IMF A;  4IGJ A;  1TI1 A;  3BD2 A;  3OR5 A;  3DIE A;  3DVX A;  4HS1 A;  13GS A;  4LL4 B;  1QQ2 A;  1UA5 A;  2WRT A;  3IAM 2;  1O85 A;  3LGC A;  1ABA A;  1JZR A;  2GQM A;  3H1N A;  3EMP A;  3LOR A;  4WET A;  5AGY A;  1G7O A;  3WGX A;  1XWC A;  3HJM A;  4L8E A;  3BCI A;  2F9S A;  1J08 A;  1XVQ A;  1T1V A;  4V2N A;  1ZMA A;  1YEP A;  2C8U A;  2JAC A;  5ECP B;  3NIV A;  3FKF A;  3FK8 A;  5HQP A;  1O8W A;  1FVJ A;  3IC8 A;  1OE7 A;  4K7O A;  2PMT A;  1SJ6 A;  1SEN A;  1XWA A;  3EMX A;  1DE1 A;  3LFL A;  4O32 A;  1USB A;  4XS4 A;  1EV9 A;  4EO3 A;  5A4U A;  2I3Y A;  2YZU A;  4IHU A;  4HUA A;  3KH7 A;  4JRR A;  4POB A;  2C4J A;  4MP4 A;  4HU9 A;  1VRS D;  1Z5Y E;  3W8S A;  4JBB A;  3UOM A;  1GL8 A;  2C0D A;  3MSZ A;  4TR1 A;  3O76 A;  2B1L A;  2KUC A;  4WF4 A;  4Q5R A;  3A2V A;  1TRU A;  4RQX A;  4NWY A;  2LJA A;  2MMN A;  4KF9 A;  1VF4 A;  1HNA A;  1AQW A;  5KN2 A;  3PH9 A;  6GSX A;  4RI6 A;  3ISO A;  4XRD A;  2CZ3 A;  2XHF A;  3F4T A;  1K0O A;  1XVW A;  1DE2 A;  2H1G A;  1OKD A;  4EF0 A;  4GST A;  3GKM A;  2YAN A;  4O92 A;  2HRN A;  3HHV A;  3G9B A;  1N8J A;  3GNJ A;  4ZL9 A;  4ECI A;  4MA9 A;  3MDK A;  2N5B A;  2AAW A;  1TK8 B;  3QOU A;  5ECO B;  1PL1 A;  1JLV A;  1M7T A;  1WMJ A;  2MBS A;  3LXZ A;  22GS A;  5A4W A;  1XPV A;  3APO A;  3FZ5 A;  1MD3 A;  4EUY A;  2AYT A;  3HVX A;  1VF1 A;  5F8B A;  2KHP A;  5ECR B;  4RUV A;  2NVL A;  5BMU A;  3IBH A;  2AV4 A;  3ZTL A;  4FYC A;  2L4Q A;  2PWJ A;  1OKT A;  2MBT A;  4FO5 A;  5ELG A;  4LA1 A;  1W4V A;  1U3A A;  2WUL A;  4BWQ A;  3TRP A;  1XWK A;  4CW9 A;  2XPE A;  2VCW A;  2OE3 A;  2H1A A;  4ACS A;  1V9W A;  3Q6O A;  2FHE A;  5F07 A;  4FYB A;  5DCH A;  5D9V A;  1G6W A;  4KDU A;  3DEX A;  4MJE A;  5CYY A;  3R3E A;  2REM A;  3TKS E;  4DSS A;  3M0F A;  2C3N A;  3D21 A;  1K0M A;  2WDU A;  1E2Y A;  1M0U A;  2H0I A;  5HR2 A;  5FHI A;  3ZRD A;  2VIM A;  5IPH A;  5H5S A;  1WJK A;  1FHE A;  4MPG A;  1TJD A;  2H72 A;  1Z6N A;  2MZC A;  3IHQ A;  1Q98 A;  4EE0 A;  3KH9 A;  5HFG A;  2ZUP A;  4WEY A;  2PU9 C;  4DSR A;  4O7H A;  2LJR A;  3GTU A;  4MF6 A;  4OD7 A;  3H8Q A;  1WIK A;  2C0G A;  5J9B A;  5COH A;  4ISD A;  1DSB A;  1SJI A;  1X9M B;  2MMA A;  3CRU A; 
#chains in the Genus database with same CATH topology
 2YV7 A;  4NV5 A;  7GSS A;  2YWO A;  2VLU A;  2HSM A;  4I2U A;  2AB6 A;  3TJJ A;  1WP0 A;  4BL7 B;  3L9U A;  2H8L A;  1CQH A;  3EUR A;  4N10 A;  3UEM A;  5F05 A;  4MZC A;  3HD5 A;  3TJF A;  2YWI A;  5L71 A;  1S3A A;  1GSD A;  1F3A A;  1B4P A;  1BX9 A;  4F0C A;  5CRG A;  6GST A;  5EL8 A;  1YKA A;  5CO3 A;  1HNC A;  3QMX A;  3GRX A;  2B6M A;  3EC3 A;  4BA7 A;  3KP9 A;  4TOP A;  2GS3 A;  4IQA A;  4TR3 A;  2C3T A;  1URM A;  14GS A;  2VCX A;  3LYP A;  2FA4 A;  2IIY A;  4EDY A;  2HSN A;  2PPT A;  2WW3 A;  4IJI A;  17GS A;  2DML A;  3I43 A;  4DVC A;  3ERF A;  5IOW A;  3GUS A;  2V1M A;  3I6A A;  1SYX A;  4YQM A;  2GQK A;  2OAC A;  2HI7 A;  4RQR A;  1S3D A;  2XC2 A;  1YZX A;  4FIW A;  5IMD A;  1PX6 A;  3O6T A;  4E68 A;  5IMV A;  2QC7 A;  1PKZ A;  2DJJ A;  3CYN A;  5D9X A;  5AN1 A;  1A0R P;  2O89 A;  4L0U A;  5J4V A;  4ZBB A;  2VM1 A;  3LXT A;  2PBJ A;  1XW5 A;  4PQH A;  2N5F A;  3QAW A;  3GST A;  3QR6 A;  3DVW A;  2H1L A;  4KUN A;  5AIS A;  3GHA A;  4NHW A;  3HYP A;  4J56 E;  1AQV A;  2K8S A;  3WD6 A;  4MH3 A;  4AJ7 A;  3VI5 A;  3CRT A;  4G9H A;  3CWG A;  3L9S A;  2L5O A;  4MAB A;  1TW9 A;  3IK7 A;  3VWX A;  1GTI A;  4F82 A;  1JZD A;  4HJM A;  1WRY A;  1Z9H A;  5IMC A;  3WT2 A;  1KBN A;  1PFO A;  4PQI A;  2VL9 A;  4POL A;  1GNW A;  4G19 A;  4K5S A;  2P31 A;  3J7Y k;  4YAP A;  1M2A A;  3D0Z A;  5IOX A;  2B7K A;  4AKG A;  2ES7 A;  4JZQ A;  2K6V A;  2RM5 A;  2I4A A;  1UC7 A;  1TKD B;  3QD9 A;  3MIX A;  4ZB8 A;  2OBI A;  2F51 A;  5ECM B;  5JWQ B;  3CSH A;  2FNO A;  2DMM A;  3W8J A;  1V57 A;  3GX8 A;  4TN8 A;  4TKY A;  2X8C A;  3FY7 A;  5A1N B;  3MYD A;  2GZZ A;  3TKQ A;  1GSE A;  1LJR A;  2QGV A;  3F4S A;  1EP8 A;  3GKX A;  3WYW A;  3FW2 A;  2HQT A;  1ZCP A;  5ELA A;  3A2W A;  2HRK B;  4BVY A;  4YQV A;  1U87 A;  4ID0 A;  3QAG A;  2IMK A;  5DQS A;  1FOH A;  3UMA A;  1K0A A;  4E8E A;  2OAD A;  1ST9 A;  4ZBD A;  2E7P A;  2K18 A;  1CQG A;  2FUG 2;  2R3X A;  3SWL A;  2GSQ A;  1TTZ A;  5ECN B;  5DVB A;  3G7J A;  3D4T A;  4Z2U A;  3G7I A;  3NZN A;  3P2A A;  5E4W A;  3TJB A;  1THO A;  5DDL A;  3DXB A;  1K0N A;  2D2Z A;  1GSU A;  2LQO A;  5DQY A;  4W66 A;  1XW6 A;  4PI2 C;  1FO5 A;  3MWH A;  3M1G A;  3TDG A;  1PD2 1;  1F9M A;  3I9V 2;  3FR9 A;  5C04 A;  2OKA A;  1O73 A;  2L57 A;  3H79 A;  4ZBA A;  3K8N A;  4AGS A;  1NW2 A;  4OFN A;  1XBS A;  3ZVJ D;  2EIR A;  2PER A;  4WR4 A;  5DJL A;  5CRE A;  2IME A;  3C73 A;  1J9B A;  1YEX A;  4KB3 A;  2H0H A;  2F8F A;  2JL4 A;  3TGZ A;  3IAS 2;  2A2P A;  4ZL8 A;  1M3J A;  3LW9 A;  3QFA C;  5G31 A;  3ZMK A;  3HA9 A;  1A8L A;  3IA1 A;  1BJX A;  1ERU A;  1BYE A;  6GSV A;  4NXI A;  4XRA A;  5ECS A;  2VCQ A;  2CX3 A;  5A34 B;  2O8V B;  4WBJ A;  2FWH A;  3P90 A;  3LYK A;  1FW1 A;  2LST A;  2VCT A;  3MNG A;  1GUK A;  1EOG A;  3KEB A;  2H66 A;  4K1F A;  2DLX A;  1YJ6 A;  4ECC A;  3CQF A;  2FGX A;  3F6D A;  1NHO A;  4K5R A;  4K2D A;  3LEF A;  2DJ2 A;  3ZYW A;  2JAD A;  2EIO A;  2C0E A;  1MD4 A;  4PX1 A;  1GUL A;  1YF1 A;  1SYR A;  3CXG A;  2YV9 A;  4JU5 A;  3DKS A;  2WGR A;  1OAZ A;  1OC9 B;  1HNB A;  3UAP A;  2PUK C;  4POK A;  2VM2 A;  4KX4 A;  1SL2 B;  4X1U A;  4BWS A;  3TKR A;  1V40 A;  2HLS A;  3QDN A;  1WPI A;  2KP2 A;  1K0D A;  1GSY A;  4OFT A;  4GF0 A;  2IMD A;  4N0Z A;  3TOT A;  5HFI A;  2RUE A;  4V2L A;  5IPG A;  2X49 A;  1DUG A;  1ZYN A;  4LLR A;  3IC4 A;  4ZIL A;  5IO0 A;  3HXS A;  1YQ1 A;  5KOX A;  5EVO A;  1ZYQ B;  1Z3E A;  2AJQ B;  5GST A;  2HZE B;  1G6Y A;  3GYK A;  1GP1 A;  1YEW C;  4EXJ A;  4PUF C;  3KTB A;  1S3C A;  1K3O A;  1K3L A;  1ON4 A;  3APS A;  5J9C A;  3GUR A;  3ZL5 A;  2O85 A;  2GVP A;  3FYG A;  2YP6 A;  1SU9 A;  5CAX A;  3FR3 A;  3FHK A;  1ILO A;  1VF3 A;  4PUA A;  1GRX A;  2E2M A;  2BMX A;  1JZW A;  12GS A;  2DJ3 A;  2LS5 A;  5KN0 A;  4EC0 A;  3IR4 A;  4HSC X;  3V1W A;  5B6M A;  1GSQ A;  4HU7 A;  3WGD A;  2VD0 A;  5J4Y A;  4PUR A;  1V98 A;  4TW5 A;  2IFQ B;  2V2G A;  4XS1 A;  1THX A;  2H75 A;  4L5O A;  2XBI A;  3VK9 A;  3KP8 A;  6GSS A;  5JCW A;  2X8G A;  5F06 A;  4Q5F A;  3Q18 A;  2VO4 A;  4USS A;  1MDI A;  1DBY A;  5J41 A;  4YAV A;  3DRN A;  1FAA A;  1TP9 A;  1EEM A;  4NV2 A;  1EV4 A;  5KN1 A;  3GKN A;  3FZA A;  2L6D A;  3VWV A;  6GSY A;  5DCG A;  5IMZ A;  4PNF A;  2VL2 C;  1WOU A;  4G0L A;  2R4V A;  4G0I A;  1TRW A;  4L0W A;  4AJ8 A;  4EVM A;  2VD1 A;  2X4A A;  3KMO A;  3BCK A;  1H75 A;  4BL7 A;  1SVL A;  1XXU A;  5B7C A;  2HE3 A;  5DBQ A;  5CRD A;  3IDV A;  3TRQ A;  5J3R A;  3UVT A;  2R5G A;  5G30 A;  4TVE A;  1X5C A;  1GSF A;  3BOA A;  4QQ7 A;  3EU4 A;  4I6X A;  4GSN A;  2ON7 A;  2HXK A;  1EGO A;  2LTK A;  5GZZ B;  3FZ9 A;  3L78 A;  1GNE A;  1A23 A;  5B8B A;  2EIQ A;  2IMF A;  2L5L A;  1QUW A;  3CSJ A;  2TIR A;  3N9J A;  5EPF A;  1XWG A;  2I81 A;  1U88 A;  1I1I P;  1R5P A;  3HY2 A;  1T8E B;  4K0N A;  2HRF A;  4KSM A;  3RDW A;  1GUH A;  3VI7 A;  2LJK A;  1XWB A;  3C71 A;  3HJP A;  1AW9 A;  1XG8 A;  2VLV A;  5GAP D;  2R37 A;  5HR3 A;  5HR0 A;  3TCO A;  1C72 A;  4KH7 A;  1B4Q A;  4JR6 A;  5CP1 A;  1EP7 A;  3APQ A;  4YQU A;  2L4C A;  2C0F A;  4PGT A;  2WFC A;  1S3R A;  3R2Q A;  1TOF A;  2UV8 G;  3GN3 A;  3BJ5 A;  4ECJ A;  4G2E A;  1Z6M A;  2DJ1 A;  4GWR A;  2YN1 A;  1NHY A;  4GQC A;  3L4N A;  3ZLP A;  1PX7 A;  1SJZ A;  3PPU A;  1ZL9 A;  3Q74 A;  3GFK A;  2YCD A;  4MJA A;  5BMU B;  3E9J B;  3ME7 A;  1HD2 A;  2PVO C;  5DJM A;  4G10 A;  1Z7P A;  2GTU A;  3F4R A;  3D4M A;  1H4O A;  2KOK A;  19GS A;  3P7X A;  1A2L A;  2RUF A;  2NTO A;  2QKE A;  4MJB A;  1GSS A;  1R4W A;  2WVY A;  1K0B A;  1GWC A;  4E8H A;  3DD3 A;  3KCM A;  1IYI A;  5A5H B;  3KZQ A;  1Z7R A;  2X64 A;  1LU4 A;  1T7P B;  4Q5Q A;  1EZK A;  4K7N A;  3ZVJ A;  3LG6 A;  4ZB9 A;  1PSQ A;  3FR6 A;  4GXZ A;  3GV1 A;  1EWX A;  1PL2 A;  1ZYE A;  4GRF A;  2EC4 A;  2WW1 A;  2FD3 A;  2H6Y A;  1F2E A;  1PMT A;  2HSH A;  3E0U A;  4QL9 A;  1I5G A;  1M3I A;  3A3T A;  2H01 A;  3C7M A;  1BED A;  2DBC A;  1JZO A;  2CX4 A;  2QSI A;  2O3E A;  2VL2 A;  2JSY A;  1AC1 A;  3W6G A;  4Z2T A;  4O5R A;  5FWG A;  1A2M A;  1RK4 A;  2CAI A;  4TRX A;  1U3I A;  3M8N A;  2CA8 A;  1QK8 A;  2RM6 A;  2K9F A;  5H5R A;  3IRA A;  5A1N A;  4KA0 A;  2CVB A;  3KMN A;  3GTU B;  3N5O A;  4V1A p;  2H6X A;  3UIW A;  2IMI A;  3UAR A;  1B9X C;  1UN2 A;  2BJX A;  2WB9 A;  3TRX A;  3GKK A;  4F2I A;  2JSZ A;  4PNG A;  1UVZ A;  2A4V A;  2DIY A;  2H1B A;  4GLT A;  1BG5 A;  5LD0 A;  4BIK A;  3M3M A;  3KIJ A;  1FG4 A;  3LJR A;  4I8B A;  4X0X A;  3NOF A;  2PN8 A;  4K9Z A;  2ZCT A;  3GMF A;  3GH6 A;  2VUP A;  3UL3 A;  5IIZ A;  18GS A;  1XCC A;  2EFC A;  2P0G A;  3ED3 A;  4TXO B;  3HCZ A;  5JCG A;  3WGE A;  4XS6 A;  4PHZ C;  1IYH A;  2NBS A;  4WXT A;  2LRN A;  2M46 A;  5ECH B;  2YNX A;  2F3M A;  3C1R A;  3C8E A;  2HYX A;  1PKW A;  1Q4J A;  2O7K A;  4GDF A;  1TU7 A;  1A8Y A;  2VCV A;  2GZY A;  1M99 A;  1SKR B;  5DAL B;  1YVL A;  1MTC A;  1PN9 A;  4HZ2 A;  5DAK B;  2R2J A;  5GAN D;  5ID2 B;  3CTG A;  4IQ1 A;  1SKS B;  1OC3 A;  1BQ7 A;  1B48 A;  1YF0 A;  2KP1 A;  5GSS A;  2OJL A;  1ZOF A;  2VLT A;  3PIN A;  4O5Q A;  1T00 A;  5D93 A;  2RII A;  1SK2 A;  2G0F A;  4EDZ A;  4MZB A;  1WWJ A;  3ERG A;  2B1K A;  3U5R E;  1ZGN A;  5G2Z A;  5A34 A;  4AJ6 A;  2AUV A;  2V6O A;  4IBP A;  3EE2 A;  3HZ8 A;  2NDO A;  1OYJ A;  4ULX A;  4DEJ A;  2I1U A;  2R0G A;  2DSA A;  1K0C A;  1YKC A;  3TU3 B;  9GSS A;  4XIH A;  4YH2 A;  2GSR A;  3UVH A;  1NM3 A;  2P5R A;  3H4K A;  4I97 A;  4PQ1 A;  2YJ7 A;  4K8M A;  2B3S A;  1U6T A;  3QCP A;  1OC9 A;  4OO4 A;  11GS A;  2A2S A;  1R7H A;  5ENU A;  2J23 A;  1KTE A;  20GS A;  4OFM A;  3QPM A;  4POM A;  3F3Q A;  5CRW A;  2G2Q A;  2C80 A;  3TOU A;  3ZZX A;  4KAE A;  3GH9 A;  2H71 A;  4AI6 A;  1AAZ A;  1WE0 A;  1X5D A;  4MPF A;  1BAY A;  1B9Y C;  1SK0 A;  2OA7 A;  3QAV A;  2WS2 A;  4Q5N A;  4BVX B;  2B7J A;  3F3R A;  1K3Y A;  3KTL A;  3H93 A;  4ML1 A;  10GS A;  4XHM A;  4FQU A;  2GSS A;  1RQM A;  2LV3 A;  3IK9 A;  1T3B A;  1FOV A;  5INY A;  2HZE A;  1O7U A;  3F63 A;  3RFR C;  2HRA A;  4MNN A;  1Y1U A;  4AF2 A;  5JCU A;  4O5U A;  2CAQ A;  2H30 A;  1XW9 A;  4BVY B;  2C3Q A;  2H70 A;  1M2B A;  1TXX A;  1F3B A;  1SKW B;  1MDJ A;  2R0C A;  1AUC A;  3JCM L;  2IL3 A;  2WJU A;  2MMZ A;  1GTA A;  5JWO B;  2VCZ A;  3HDC A;  4LMW A;  4BPY A;  4D73 B;  2H19 A;  4CY8 A;  5G1K A;  3G7Y A;  2WCI A;  1TK0 B;  3RGB C;  1EGR A;  2IN3 A;  2WZ9 A;  3SBC A;  1GUM A;  2YZH A;  5ECQ B;  2IFQ A;  4H86 A;  3D6I A;  2L59 A;  5KEJ A;  1V58 A;  3D5J A;  1X9W B;  3LWA A;  3FMW A;  3IPZ A;  3A5I A;  2GT6 A;  2GLR A;  4IS0 A;  2FLS A;  1GLP A;  3RAZ A;  1S4B P;  2WVX A;  3EU3 A;  3ZIT A;  2LUS A;  2ZNM A;  4WF5 A;  2OE1 A;  3IXR A;  1PRX A;  3F8U A;  2VKZ G;  4OCE A;  4KCE A;  5J4U A;  3VLN A;  5IMA A;  4FH8 A;  3ZRE A;  1VGL A;  4FYU A;  4EKZ A;  4IJ3 A;  3U6V A;  3IV4 A;  4IP1 A;  4F03 A;  2LEG A;  2QA2 A;  2VAF A;  3DWV A;  4G0K A;  4KND A;  4OCF A;  3VPQ A;  2O87 A;  4KW6 A;  1OC8 A;  1HQO A;  5LCZ A;  2AHE A;  1RW1 A;  4CHS A;  3TKS A;  1XOA A;  3HVS A;  1ERT A;  2F8A A;  1SL1 B;  1QMV A;  4PTS A;  2IJY A;  4HQZ A;  4K2X A;  2HZF A;  1W89 A;  2ALB A;  3ZFB A;  2FWF A;  4EIP A;  1N2A A;  2ON5 A;  1XIY A;  1AIU A;  2YWN A;  5H5Q A;  3UBL A;  2OE0 A;  3HMJ G;  5J5N A;  4DSQ A;  1ACV A;  4WBR D;  4X4J A;  2M72 A;  4IN0 A;  3F6F A;  4NAX A;  5IM9 A;  4PXO A;  2H74 A;  4N30 A;  2XBQ A;  2OBK A;  4XTS A;  1QFN A;  2HSY A;  4XS4 B;  2E2G A;  1SK1 A;  5A4V A;  2Z9S A;  2KLX A;  2FA8 A;  1F6M C;  2MMO A;  2N5A A;  4FXY P;  4ZB6 A;  3J7Y b;  2FCH A;  4ZL7 A;  1VF2 A;  4F0B A;  3FZ4 A;  2MYG A;  4N3Z A;  2HFD A;  2FWE A;  2B5X A;  1MEK A;  1Y25 A;  16GS A;  4RI7 A;  2R6K A;  3EWL A;  2TRC P;  5ECK B;  4IVF A;  2LNS A;  2FY6 A;  1XFL A;  3FEU A;  4I2T A;  4TR1 B;  4IW9 A;  2GGT A;  1TRV A;  1R5A A;  4MH2 A;  5A5K A;  4HZ4 A;  1GH2 A;  1HYU A;  1ZZY A;  2V32 A;  3VWW A;  4XCS A;  2LRC A;  2GQL A;  4V2M A;  2E0Q A;  3TJG A;  3RHB A;  2YOI A;  5CNW A;  2NPB A;  2CT6 A;  2DJK A;  4I5Q A;  3M9K A;  2CVD A;  3RPP A;  2CQ9 A;  4A5P A;  2M80 A;  2P5Q A;  6GSW A;  1PA3 A;  2X99 A;  3PGT A;  3RBT A;  3GX0 A;  3Q19 A;  3DYR A;  3L9V A;  4QL7 A;  1A2J A;  5KOW A;  4PI0 C;  4G01 A;  2JZR A;  2H0G A;  1M2D A;  4TR0 A;  5HR1 A;  3GL5 A;  3GA4 A;  2LRT A;  4TXV A;  5J47 A;  4X43 A;  4EIQ A;  3CTF A;  1XZO A;  4YKG A;  2GZP A;  4ZB7 A;  2YJH A;  5FT3 A;  1JHB A;  2XPD A;  4KDY A;  2WVZ A;  2VOC A;  1AQX A;  3EIN A;  3A5W A;  3VFI A;  4QMK A;  5IO2 A;  5D8I A;  1R26 A;  3M9J A;  4IEL A;  4ECB A;  4J2F A;  2JU5 A;  4LL1 B;  3UJ1 A;  4MZW A;  3ZML A;  1A24 A;  2C1Y A;  1KNG A;  1JLW A;  3LQ7 A;  5C00 A;  4OO5 A;  3L0H A;  1FB6 A;  1ZYP A;  4TXO A;  1FVK A;  1XOB A;  1TI3 A;  3ZIV A;  4DSS B;  3S9F A;  4KGI A;  2BTO T;  5E59 A;  3ERW A;  3BBY A;  2L6C A;  2CVK A;  3D22 A;  2X8H A;  4HOJ A;  3TB2 A;  2WW0 A;  4JE1 A;  4KCA A;  3I69 A;  4Z7X A;  2HT9 A;  2O5V A;  2HNL A;  1I9D A;  3UBK A;  1YDK A;  5DAL A;  4JR4 A;  3E3E A;  5AIX A;  5DAK A;  1B8X A;  3F9U A;  5ID2 A;  2H6Z A;  1JFU A;  3KJY A;  3RPN A;  1E6B A;  2WZS A;  4MCU A;  2IPA A;  4MJC A;  3KXO A;  2LKU A;  2DIZ A;  2YPM A;  1O81 A;  3KGK A;  3ZIJ A;  3KM6 A;  3IOS A;  1G0T A;  4N11 A;  2I9H A;  2K8V A;  4WKW A;  3QFB C;  1TU8 A;  2HRK A;  3VWU A;  4MLY A;  3TJK A;  4CDO A;  3HVV A;  1TXU A;  8GSS A;  1X5E A;  3GIX A;  4EL1 A;  1GLQ A;  2HSM B;  3HZ4 A;  2GST A;  2GDR A;  3FRC A;  3VUR A;  4KDX A;  5ABR A;  2DC5 A;  4NHZ A;  1PGT A;  3KD0 A;  4MF5 A;  1KEB A;  2JZT A;  2RLI A;  5IQY A;  4J57 E;  1MDK A;  1QGV A;  2UZ8 A;  2PVQ A;  5LNK e;  5B8A A;  3CSI A;  2J9H A;  3TUE A;  1TK5 B;  3P8W A;  2O36 A;  2YWM A;  3DGQ A;  5B6N A;  1LBK A;  2EFE A;  3CMI A;  3O3T A;  1X9S B;  1A0F A;  4LMV A;  4K7I A;  3TKP A;  2JZS A;  3HKR A;  4GQF A;  4KE3 A;  5G5F A;  1NSW A;  4OMV A;  2A2R A;  3PR8 A;  2HSN B;  1EOH A;  1ERV A;  1SD9 A;  3RHC A;  3A2X A;  4MF7 A;  4TR4 A;  4MMM A;  4AKX B;  3LSZ A;  1FB0 A;  1ERW A;  5KN3 A;  2FWG A;  2QA1 A;  6GSU A;  2B5Y A;  1PN0 A;  2V41 A;  1O6J A;  4K6X A;  4GCI A;  1BG1 A;  4BVX A;  3MAK A;  5G1L A;  3HJO A;  3GL3 A;  4YKF A;  1OE8 A;  1GTB A;  1Y6E A;  1EEJ A;  2GT5 A;  4F9Z A;  4MDC A;  4NPB A;  3EYT A;  4N0V A;  1J0F A;  1SD8 A;  5G5E A;  1SL0 B;  2R0P A;  5ECI B;  2B5E A;  4GTU A;  1TRS A;  4HJ2 A;  5EY6 A;  2TRX A;  1F37 A;  3EVI A;  1T4Y A;  3ZFL A;  2LNT A;  5D9W A;  3AY8 A;  5CRH A;  4MK3 A;  4ML6 A;  1PQN A;  1YY7 A;  1T4Z A;  2H73 A;  1GTU A;  1V2A A;  2IWT A;  2CZ2 A;  5D9T A;  5JWR B;  3US3 A;  1QXH A;  4GSS A;  4HQS A;  3F0I A;  3VPT A;  3DML A;  3TKS C;  4D73 A;  2H76 A;  5J40 A;  3CHX C;  4JED A;  1AXD A;  4NMU A;  4ZXG A;  2A4H A;  1G7E A;  1M9A A;  4HI7 A;  2LQQ A;  4V1A g;  2VL3 A;  1OVN A;  4WR5 A;  3GSS A;  2DJ0 A;  4ZIJ A;  4OWY A;  4HEA 2;  5AIV A;  1TDI A;  3ME8 A;  4P3Y B;  2H1D A;  1M9B A;  5F0G A;  5HFK A;  1X0R A;  2V6K A;  4IP6 A;  5ECL B;  4IKH A;  4Z2R A;  4ILF A;  4KSO A;  5D96 A;  2CV4 A;  4K0G A;  3CBU A;  1O8X A;  3IE3 A;  1ML6 A;  3WT1 A;  2PGT A;  4HDE A;  4L5L A;  3C1S A;  5D73 A;  5IMF A;  4IGJ A;  1TI1 A;  3BD2 A;  3OR5 A;  3DIE A;  3DVX A;  4HS1 A;  13GS A;  4LL4 B;  1QQ2 A;  1SVO A;  1UA5 A;  2WRT A;  3IAM 2;  1O85 A;  3LGC A;  1ABA A;  1JZR A;  2GQM A;  3H1N A;  3EMP A;  3LOR A;  4WET A;  5AGY A;  1G7O A;  3WGX A;  1XWC A;  3HJM A;  4L8E A;  3BCI A;  2F9S A;  1J08 A;  1XVQ A;  1T1V A;  4V2N A;  1ZMA A;  1YEP A;  2C8U A;  2JAC A;  5ECP B;  3NIV A;  3FKF A;  3FK8 A;  5HQP A;  1O8W A;  1N25 A;  1FVJ A;  3IC8 A;  1OE7 A;  4K7O A;  2PMT A;  1SJ6 A;  1SEN A;  1XWA A;  3EMX A;  1DE1 A;  4CY6 A;  3LFL A;  4O32 A;  1USB A;  4XS4 A;  2EFD A;  1EV9 A;  4EO3 A;  5A4U A;  2DKI A;  2I3Y A;  2YZU A;  4IHU A;  4HUA A;  3KH7 A;  1BF5 A;  4JRR A;  4POB A;  2C4J A;  5BRT A;  4MP4 A;  4HU9 A;  1VRS D;  1Z5Y E;  3W8S A;  4JBB A;  3UOM A;  1GL8 A;  2C0D A;  3MSZ A;  4TR1 A;  3O76 A;  2B1L A;  2KUC A;  4WF4 A;  4Q5R A;  3A2V A;  1TRU A;  4RQX A;  4NWY A;  2LJA A;  2MMN A;  4KF9 A;  1VF4 A;  1HNA A;  1AQW A;  5KN2 A;  3PH9 A;  2WW2 A;  6GSX A;  4RI6 A;  3ISO A;  4XRD A;  2CZ3 A;  2DKH A;  2XHF A;  3F4T A;  1K0O A;  1XVW A;  1DE2 A;  2H1G A;  1OKD A;  4EF0 A;  4GST A;  3GKM A;  2YAN A;  4O92 A;  2HRN A;  3HHV A;  3G9B A;  4AKH A;  1N8J A;  3GNJ A;  4ZL9 A;  4ECI A;  4MA9 A;  3MDK A;  2N5B A;  2AAW A;  1TK8 B;  3QOU A;  5ECO B;  1PL1 A;  1JLV A;  1M7T A;  1WMJ A;  2MBS A;  3LXZ A;  2WVX B;  22GS A;  5A4W A;  1XPV A;  3APO A;  3FZ5 A;  1MD3 A;  4EUY A;  2AYT A;  3HVX A;  1VF1 A;  5F8B A;  2KHP A;  3HVN A;  5ECR B;  4RUV A;  2NVL A;  5BMU A;  3IBH A;  2AV4 A;  3ZTL A;  4FYC A;  2L4Q A;  3IHG A;  2PWJ A;  1OKT A;  2MBT A;  4FO5 A;  5ELG A;  4LA1 A;  1W4V A;  1U3A A;  2WUL A;  4BWQ A;  3TRP A;  1XWK A;  1SVM A;  4CW9 A;  2XPE A;  5A5H A;  2VCW A;  2OE3 A;  2H1A A;  4ACS A;  1V9W A;  3Q6O A;  2FHE A;  5F07 A;  4FYB A;  2EFH A;  5DCH A;  5D9V A;  1G6W A;  4KDU A;  3DEX A;  4MJE A;  5CYY A;  3R3E A;  2REM A;  3TKS E;  4DSS A;  3M0F A;  2C3N A;  3D21 A;  1K0M A;  2WDU A;  1E2Y A;  1M0U A;  2H0I A;  5HR2 A;  5FHI A;  3ZRD A;  2VIM A;  5IPH A;  5H5S A;  1WJK A;  1FHE A;  4MPG A;  1TJD A;  2H72 A;  1Z6N A;  2MZC A;  3IHQ A;  1Q98 A;  4EE0 A;  3KH9 A;  5HFG A;  2ZUP A;  4WEY A;  2OT3 A;  2PU9 C;  4DSR A;  4O7H A;  4AKI A;  2LJR A;  3GTU A;  3EPT A;  4MF6 A;  4OD7 A;  3H8Q A;  1WIK A;  2C0G A;  4ICY A;  5J9B A;  5COH A;  4ISD A;  1DSB A;  1SJI A;  1X9M B;  2MMA A;  3CRU A; 
#chains in the Genus database with same CATH homology
 2YV7 A;  4NV5 A;  7GSS A;  2YWO A;  2VLU A;  2HSM A;  4I2U A;  2AB6 A;  3TJJ A;  1WP0 A;  4BL7 B;  3L9U A;  2H8L A;  1CQH A;  3EUR A;  4N10 A;  3UEM A;  5F05 A;  4MZC A;  3HD5 A;  3TJF A;  2YWI A;  5L71 A;  1S3A A;  1GSD A;  1F3A A;  1B4P A;  1BX9 A;  4F0C A;  5CRG A;  6GST A;  5EL8 A;  1YKA A;  5CO3 A;  1HNC A;  3QMX A;  3GRX A;  2B6M A;  3EC3 A;  4BA7 A;  3KP9 A;  4TOP A;  2GS3 A;  4IQA A;  4TR3 A;  2C3T A;  1URM A;  14GS A;  2VCX A;  3LYP A;  2FA4 A;  2IIY A;  4EDY A;  2HSN A;  2PPT A;  4IJI A;  17GS A;  2DML A;  3I43 A;  4DVC A;  3ERF A;  5IOW A;  3GUS A;  2V1M A;  3I6A A;  1SYX A;  4YQM A;  2GQK A;  2OAC A;  2HI7 A;  4RQR A;  1S3D A;  2XC2 A;  1YZX A;  4FIW A;  5IMD A;  1PX6 A;  3O6T A;  4E68 A;  5IMV A;  2QC7 A;  1PKZ A;  2DJJ A;  3CYN A;  5D9X A;  5AN1 A;  1A0R P;  2O89 A;  4L0U A;  5J4V A;  4ZBB A;  2VM1 A;  3LXT A;  2PBJ A;  1XW5 A;  4PQH A;  2N5F A;  3QAW A;  3GST A;  3QR6 A;  3DVW A;  2H1L A;  4KUN A;  5AIS A;  3GHA A;  4NHW A;  3HYP A;  4J56 E;  1AQV A;  2K8S A;  3WD6 A;  4MH3 A;  4AJ7 A;  3VI5 A;  3CRT A;  4G9H A;  3CWG A;  3L9S A;  2L5O A;  4MAB A;  1TW9 A;  3IK7 A;  3VWX A;  1GTI A;  4F82 A;  1JZD A;  4HJM A;  1WRY A;  1Z9H A;  5IMC A;  3WT2 A;  1KBN A;  4PQI A;  2VL9 A;  4POL A;  1GNW A;  4G19 A;  4K5S A;  2P31 A;  3J7Y k;  4YAP A;  1M2A A;  3D0Z A;  5IOX A;  2B7K A;  4AKG A;  2ES7 A;  4JZQ A;  2K6V A;  2RM5 A;  2I4A A;  1UC7 A;  1TKD B;  3QD9 A;  3MIX A;  4ZB8 A;  2OBI A;  2F51 A;  5ECM B;  5JWQ B;  3CSH A;  2FNO A;  2DMM A;  3W8J A;  1V57 A;  3GX8 A;  4TN8 A;  4TKY A;  2X8C A;  3FY7 A;  5A1N B;  3MYD A;  2GZZ A;  3TKQ A;  1GSE A;  1LJR A;  2QGV A;  3F4S A;  1EP8 A;  3GKX A;  3WYW A;  3FW2 A;  2HQT A;  1ZCP A;  5ELA A;  3A2W A;  2HRK B;  4BVY A;  4YQV A;  1U87 A;  4ID0 A;  3QAG A;  2IMK A;  5DQS A;  1FOH A;  3UMA A;  1K0A A;  4E8E A;  2OAD A;  1ST9 A;  4ZBD A;  2E7P A;  2K18 A;  1CQG A;  2FUG 2;  2R3X A;  3SWL A;  2GSQ A;  1TTZ A;  5ECN B;  5DVB A;  3G7J A;  3D4T A;  4Z2U A;  3G7I A;  3NZN A;  3P2A A;  5E4W A;  3TJB A;  1THO A;  5DDL A;  3DXB A;  1K0N A;  2D2Z A;  1GSU A;  2LQO A;  5DQY A;  4W66 A;  1XW6 A;  1FO5 A;  3MWH A;  3M1G A;  3TDG A;  1PD2 1;  1F9M A;  3I9V 2;  3FR9 A;  5C04 A;  2OKA A;  1O73 A;  2L57 A;  3H79 A;  4ZBA A;  3K8N A;  4AGS A;  1NW2 A;  4OFN A;  1XBS A;  3ZVJ D;  2EIR A;  2PER A;  4WR4 A;  5DJL A;  5CRE A;  2IME A;  3C73 A;  1J9B A;  1YEX A;  4KB3 A;  2H0H A;  2F8F A;  2JL4 A;  3TGZ A;  3IAS 2;  2A2P A;  4ZL8 A;  3LW9 A;  3QFA C;  5G31 A;  3ZMK A;  3HA9 A;  1A8L A;  3IA1 A;  1BJX A;  1ERU A;  1BYE A;  6GSV A;  4NXI A;  4XRA A;  5ECS A;  2VCQ A;  2CX3 A;  5A34 B;  2O8V B;  4WBJ A;  2FWH A;  3P90 A;  3LYK A;  1FW1 A;  2LST A;  2VCT A;  3MNG A;  1GUK A;  1EOG A;  3KEB A;  2H66 A;  4K1F A;  2DLX A;  1YJ6 A;  4ECC A;  2FGX A;  3F6D A;  1NHO A;  4K5R A;  4K2D A;  3LEF A;  2DJ2 A;  3ZYW A;  2JAD A;  2EIO A;  2C0E A;  1MD4 A;  4PX1 A;  1GUL A;  1YF1 A;  1SYR A;  3CXG A;  2YV9 A;  4JU5 A;  3DKS A;  2WGR A;  1OAZ A;  1OC9 B;  1HNB A;  3UAP A;  2PUK C;  4POK A;  2VM2 A;  4KX4 A;  1SL2 B;  4X1U A;  4BWS A;  3TKR A;  1V40 A;  2HLS A;  3QDN A;  1WPI A;  2KP2 A;  1K0D A;  1GSY A;  4OFT A;  4GF0 A;  2IMD A;  4N0Z A;  3TOT A;  5HFI A;  2RUE A;  4V2L A;  5IPG A;  2X49 A;  1DUG A;  1ZYN A;  4LLR A;  3IC4 A;  4ZIL A;  5IO0 A;  3HXS A;  1YQ1 A;  5KOX A;  5EVO A;  1ZYQ B;  1Z3E A;  2AJQ B;  5GST A;  2HZE B;  1G6Y A;  3GYK A;  1GP1 A;  4EXJ A;  4PUF C;  3KTB A;  1S3C A;  1K3O A;  1K3L A;  1ON4 A;  3APS A;  5J9C A;  3GUR A;  3ZL5 A;  2O85 A;  2GVP A;  3FYG A;  2YP6 A;  1SU9 A;  5CAX A;  3FR3 A;  3FHK A;  1ILO A;  1VF3 A;  4PUA A;  1GRX A;  2E2M A;  2BMX A;  1JZW A;  12GS A;  2DJ3 A;  2LS5 A;  5KN0 A;  4EC0 A;  3IR4 A;  3V1W A;  5B6M A;  1GSQ A;  4HU7 A;  3WGD A;  2VD0 A;  5J4Y A;  4PUR A;  1V98 A;  4TW5 A;  2IFQ B;  2V2G A;  4XS1 A;  1THX A;  2H75 A;  4L5O A;  2XBI A;  3VK9 A;  3KP8 A;  6GSS A;  5JCW A;  2X8G A;  5F06 A;  4Q5F A;  3Q18 A;  2VO4 A;  4USS A;  1MDI A;  1DBY A;  5J41 A;  4YAV A;  3DRN A;  1FAA A;  1TP9 A;  1EEM A;  4NV2 A;  1EV4 A;  5KN1 A;  3GKN A;  3FZA A;  2L6D A;  3VWV A;  6GSY A;  5DCG A;  5IMZ A;  4PNF A;  2VL2 C;  1WOU A;  4G0L A;  2R4V A;  4G0I A;  1TRW A;  4L0W A;  4AJ8 A;  4EVM A;  2VD1 A;  2X4A A;  3KMO A;  3BCK A;  1H75 A;  4BL7 A;  1SVL A;  1XXU A;  5B7C A;  2HE3 A;  5DBQ A;  5CRD A;  3IDV A;  3TRQ A;  5J3R A;  3UVT A;  2R5G A;  5G30 A;  4TVE A;  1X5C A;  1GSF A;  3BOA A;  4QQ7 A;  3EU4 A;  4I6X A;  4GSN A;  2ON7 A;  2HXK A;  1EGO A;  2LTK A;  5GZZ B;  3FZ9 A;  3L78 A;  1GNE A;  1A23 A;  5B8B A;  2EIQ A;  2IMF A;  2L5L A;  1QUW A;  3CSJ A;  2TIR A;  3N9J A;  5EPF A;  1XWG A;  2I81 A;  1U88 A;  1R5P A;  3HY2 A;  1T8E B;  4K0N A;  2HRF A;  4KSM A;  3RDW A;  1GUH A;  3VI7 A;  2LJK A;  1XWB A;  3C71 A;  3HJP A;  1AW9 A;  2VLV A;  5GAP D;  2R37 A;  5HR3 A;  5HR0 A;  3TCO A;  1C72 A;  4KH7 A;  1B4Q A;  4JR6 A;  5CP1 A;  1EP7 A;  3APQ A;  4YQU A;  2L4C A;  2C0F A;  4PGT A;  2WFC A;  3R2Q A;  1TOF A;  2UV8 G;  3GN3 A;  3BJ5 A;  4ECJ A;  4G2E A;  1Z6M A;  2DJ1 A;  4GWR A;  2YN1 A;  1NHY A;  4GQC A;  3L4N A;  3ZLP A;  1PX7 A;  1SJZ A;  3PPU A;  1ZL9 A;  3Q74 A;  3GFK A;  2YCD A;  4MJA A;  5BMU B;  3E9J B;  3ME7 A;  1HD2 A;  2PVO C;  5DJM A;  4G10 A;  1Z7P A;  2GTU A;  3F4R A;  3D4M A;  1H4O A;  2KOK A;  19GS A;  3P7X A;  1A2L A;  2RUF A;  2NTO A;  2QKE A;  4MJB A;  1GSS A;  1R4W A;  1K0B A;  1GWC A;  4E8H A;  3DD3 A;  3KCM A;  1IYI A;  5A5H B;  3KZQ A;  1Z7R A;  2X64 A;  1LU4 A;  1T7P B;  4Q5Q A;  1EZK A;  4K7N A;  3ZVJ A;  3LG6 A;  4ZB9 A;  1PSQ A;  3FR6 A;  4GXZ A;  3GV1 A;  1EWX A;  1PL2 A;  1ZYE A;  4GRF A;  2EC4 A;  2FD3 A;  2H6Y A;  1F2E A;  1PMT A;  2HSH A;  3E0U A;  4QL9 A;  1I5G A;  3A3T A;  2H01 A;  3C7M A;  1BED A;  2DBC A;  1JZO A;  2CX4 A;  2QSI A;  2VL2 A;  2JSY A;  1AC1 A;  3W6G A;  4Z2T A;  4O5R A;  5FWG A;  1A2M A;  1RK4 A;  2CAI A;  4TRX A;  1U3I A;  3M8N A;  2CA8 A;  1QK8 A;  2RM6 A;  2K9F A;  5H5R A;  3IRA A;  5A1N A;  4KA0 A;  2CVB A;  3KMN A;  3GTU B;  3N5O A;  4V1A p;  2H6X A;  3UIW A;  2IMI A;  3UAR A;  1B9X C;  1UN2 A;  2BJX A;  2WB9 A;  3TRX A;  3GKK A;  4F2I A;  2JSZ A;  4PNG A;  1UVZ A;  2A4V A;  2DIY A;  2H1B A;  4GLT A;  1BG5 A;  5LD0 A;  3M3M A;  3KIJ A;  1FG4 A;  3LJR A;  4I8B A;  4X0X A;  3NOF A;  2PN8 A;  4K9Z A;  2ZCT A;  3GMF A;  3GH6 A;  2VUP A;  3UL3 A;  5IIZ A;  18GS A;  1XCC A;  2EFC A;  2P0G A;  3ED3 A;  4TXO B;  3HCZ A;  5JCG A;  3WGE A;  4XS6 A;  1IYH A;  2NBS A;  4WXT A;  2LRN A;  2M46 A;  5ECH B;  2YNX A;  2F3M A;  3C1R A;  3C8E A;  2HYX A;  1PKW A;  1Q4J A;  2O7K A;  4GDF A;  1TU7 A;  1A8Y A;  2VCV A;  2GZY A;  1M99 A;  1SKR B;  5DAL B;  1YVL A;  1MTC A;  1PN9 A;  4HZ2 A;  5DAK B;  2R2J A;  5GAN D;  5ID2 B;  3CTG A;  4IQ1 A;  1SKS B;  1OC3 A;  1BQ7 A;  1B48 A;  1YF0 A;  2KP1 A;  5GSS A;  2OJL A;  1ZOF A;  2VLT A;  3PIN A;  4O5Q A;  1T00 A;  5D93 A;  2RII A;  1SK2 A;  2G0F A;  4EDZ A;  4MZB A;  1WWJ A;  3ERG A;  2B1K A;  3U5R E;  1ZGN A;  5G2Z A;  5A34 A;  4AJ6 A;  2AUV A;  2V6O A;  4IBP A;  3EE2 A;  3HZ8 A;  2NDO A;  1OYJ A;  4ULX A;  4DEJ A;  2I1U A;  2R0G A;  2DSA A;  1K0C A;  1YKC A;  3TU3 B;  9GSS A;  4XIH A;  4YH2 A;  2GSR A;  3UVH A;  1NM3 A;  2P5R A;  3H4K A;  4I97 A;  4PQ1 A;  2YJ7 A;  4K8M A;  2B3S A;  1U6T A;  3QCP A;  1OC9 A;  4OO4 A;  11GS A;  2A2S A;  1R7H A;  5ENU A;  2J23 A;  1KTE A;  20GS A;  4OFM A;  3QPM A;  4POM A;  3F3Q A;  5CRW A;  2G2Q A;  2C80 A;  3TOU A;  3ZZX A;  4KAE A;  3GH9 A;  2H71 A;  4AI6 A;  1AAZ A;  1WE0 A;  1X5D A;  4MPF A;  1BAY A;  1B9Y C;  1SK0 A;  2OA7 A;  3QAV A;  2WS2 A;  4Q5N A;  4BVX B;  2B7J A;  3F3R A;  1K3Y A;  3KTL A;  3H93 A;  4ML1 A;  10GS A;  4XHM A;  4FQU A;  2GSS A;  1RQM A;  2LV3 A;  3IK9 A;  1T3B A;  1FOV A;  5INY A;  2HZE A;  1O7U A;  3F63 A;  2HRA A;  4MNN A;  1Y1U A;  4AF2 A;  5JCU A;  4O5U A;  2CAQ A;  2H30 A;  1XW9 A;  4BVY B;  2C3Q A;  2H70 A;  1M2B A;  1TXX A;  1F3B A;  1SKW B;  1MDJ A;  2R0C A;  1AUC A;  3JCM L;  2IL3 A;  2WJU A;  2MMZ A;  1GTA A;  5JWO B;  2VCZ A;  3HDC A;  4LMW A;  4BPY A;  4D73 B;  2H19 A;  4CY8 A;  5G1K A;  3G7Y A;  2WCI A;  1TK0 B;  1EGR A;  2IN3 A;  2WZ9 A;  3SBC A;  1GUM A;  2YZH A;  5ECQ B;  2IFQ A;  4H86 A;  3D6I A;  2L59 A;  5KEJ A;  1V58 A;  3D5J A;  1X9W B;  3LWA A;  3FMW A;  3IPZ A;  3A5I A;  2GT6 A;  2GLR A;  4IS0 A;  2FLS A;  1GLP A;  3RAZ A;  3EU3 A;  3ZIT A;  2LUS A;  2ZNM A;  4WF5 A;  2OE1 A;  3IXR A;  1PRX A;  3F8U A;  2VKZ G;  4OCE A;  4KCE A;  5J4U A;  3VLN A;  5IMA A;  4FH8 A;  3ZRE A;  1VGL A;  4FYU A;  4EKZ A;  4IJ3 A;  3U6V A;  3IV4 A;  4IP1 A;  4F03 A;  2LEG A;  2QA2 A;  2VAF A;  3DWV A;  4G0K A;  4KND A;  4OCF A;  3VPQ A;  2O87 A;  4KW6 A;  1OC8 A;  1HQO A;  5LCZ A;  2AHE A;  1RW1 A;  4CHS A;  3TKS A;  1XOA A;  3HVS A;  1ERT A;  2F8A A;  1SL1 B;  1QMV A;  4PTS A;  2IJY A;  4HQZ A;  4K2X A;  2HZF A;  1W89 A;  2ALB A;  3ZFB A;  2FWF A;  4EIP A;  1N2A A;  2ON5 A;  1XIY A;  1AIU A;  2YWN A;  5H5Q A;  3UBL A;  2OE0 A;  3HMJ G;  5J5N A;  4DSQ A;  1ACV A;  4WBR D;  4X4J A;  2M72 A;  4IN0 A;  3F6F A;  4NAX A;  5IM9 A;  4PXO A;  2H74 A;  4N30 A;  2XBQ A;  2OBK A;  4XTS A;  1QFN A;  2HSY A;  4XS4 B;  2E2G A;  1SK1 A;  5A4V A;  2Z9S A;  2KLX A;  2FA8 A;  1F6M C;  2MMO A;  2N5A A;  4ZB6 A;  3J7Y b;  2FCH A;  4ZL7 A;  1VF2 A;  4F0B A;  3FZ4 A;  2MYG A;  4N3Z A;  2HFD A;  2FWE A;  2B5X A;  1MEK A;  1Y25 A;  16GS A;  4RI7 A;  2R6K A;  3EWL A;  2TRC P;  5ECK B;  4IVF A;  2LNS A;  2FY6 A;  1XFL A;  3FEU A;  4I2T A;  4TR1 B;  4IW9 A;  2GGT A;  1TRV A;  1R5A A;  4MH2 A;  5A5K A;  4HZ4 A;  1GH2 A;  1HYU A;  1ZZY A;  2V32 A;  3VWW A;  4XCS A;  2LRC A;  2GQL A;  4V2M A;  2E0Q A;  3TJG A;  3RHB A;  2YOI A;  5CNW A;  2NPB A;  2CT6 A;  2DJK A;  4I5Q A;  3M9K A;  2CVD A;  3RPP A;  2CQ9 A;  4A5P A;  2M80 A;  2P5Q A;  6GSW A;  1PA3 A;  2X99 A;  3PGT A;  3RBT A;  3GX0 A;  3Q19 A;  3DYR A;  3L9V A;  4QL7 A;  1A2J A;  5KOW A;  4G01 A;  2JZR A;  2H0G A;  1M2D A;  4TR0 A;  5HR1 A;  3GL5 A;  3GA4 A;  2LRT A;  4TXV A;  5J47 A;  4X43 A;  4EIQ A;  3CTF A;  1XZO A;  4YKG A;  2GZP A;  4ZB7 A;  2YJH A;  5FT3 A;  1JHB A;  2XPD A;  4KDY A;  2VOC A;  1AQX A;  3EIN A;  3A5W A;  3VFI A;  4QMK A;  5IO2 A;  5D8I A;  1R26 A;  3M9J A;  4IEL A;  4ECB A;  4J2F A;  2JU5 A;  4LL1 B;  3UJ1 A;  4MZW A;  3ZML A;  1A24 A;  2C1Y A;  1KNG A;  1JLW A;  3LQ7 A;  5C00 A;  4OO5 A;  3L0H A;  1FB6 A;  1ZYP A;  4TXO A;  1FVK A;  1XOB A;  1TI3 A;  3ZIV A;  4DSS B;  3S9F A;  4KGI A;  2BTO T;  5E59 A;  3ERW A;  3BBY A;  2L6C A;  2CVK A;  3D22 A;  2X8H A;  4HOJ A;  3TB2 A;  4JE1 A;  4KCA A;  3I69 A;  4Z7X A;  2HT9 A;  2O5V A;  2HNL A;  1I9D A;  3UBK A;  1YDK A;  5DAL A;  4JR4 A;  3E3E A;  5AIX A;  5DAK A;  1B8X A;  3F9U A;  5ID2 A;  2H6Z A;  1JFU A;  3KJY A;  3RPN A;  1E6B A;  4MCU A;  2IPA A;  4MJC A;  3KXO A;  2LKU A;  2DIZ A;  2YPM A;  1O81 A;  3KGK A;  3ZIJ A;  3KM6 A;  3IOS A;  1G0T A;  4N11 A;  2I9H A;  2K8V A;  4WKW A;  3QFB C;  1TU8 A;  2HRK A;  3VWU A;  4MLY A;  3TJK A;  4CDO A;  3HVV A;  1TXU A;  8GSS A;  1X5E A;  3GIX A;  4EL1 A;  1GLQ A;  2HSM B;  3HZ4 A;  2GST A;  2GDR A;  3FRC A;  3VUR A;  4KDX A;  5ABR A;  2DC5 A;  4NHZ A;  1PGT A;  3KD0 A;  4MF5 A;  1KEB A;  2JZT A;  2RLI A;  5IQY A;  4J57 E;  1MDK A;  1QGV A;  2UZ8 A;  2PVQ A;  5LNK e;  5B8A A;  3CSI A;  2J9H A;  3TUE A;  1TK5 B;  3P8W A;  2YWM A;  3DGQ A;  5B6N A;  1LBK A;  2EFE A;  3CMI A;  3O3T A;  1X9S B;  1A0F A;  4LMV A;  4K7I A;  3TKP A;  2JZS A;  3HKR A;  4GQF A;  4KE3 A;  5G5F A;  1NSW A;  4OMV A;  2A2R A;  3PR8 A;  2HSN B;  1EOH A;  1ERV A;  1SD9 A;  3RHC A;  3A2X A;  4MF7 A;  4TR4 A;  4MMM A;  4AKX B;  3LSZ A;  1FB0 A;  1ERW A;  5KN3 A;  2FWG A;  2QA1 A;  6GSU A;  2B5Y A;  1PN0 A;  2V41 A;  1O6J A;  4K6X A;  4GCI A;  1BG1 A;  4BVX A;  3MAK A;  5G1L A;  3HJO A;  3GL3 A;  4YKF A;  1OE8 A;  1GTB A;  1Y6E A;  1EEJ A;  2GT5 A;  4F9Z A;  4MDC A;  4NPB A;  3EYT A;  4N0V A;  1J0F A;  1SD8 A;  5G5E A;  1SL0 B;  2R0P A;  5ECI B;  2B5E A;  4GTU A;  1TRS A;  4HJ2 A;  5EY6 A;  2TRX A;  1F37 A;  3EVI A;  1T4Y A;  3ZFL A;  2LNT A;  5D9W A;  3AY8 A;  5CRH A;  4MK3 A;  4ML6 A;  1PQN A;  1YY7 A;  1T4Z A;  2H73 A;  1GTU A;  1V2A A;  2IWT A;  2CZ2 A;  5D9T A;  5JWR B;  3US3 A;  1QXH A;  4GSS A;  4HQS A;  3F0I A;  3VPT A;  3DML A;  3TKS C;  4D73 A;  2H76 A;  5J40 A;  4JED A;  1AXD A;  4NMU A;  4ZXG A;  2A4H A;  1G7E A;  1M9A A;  4HI7 A;  2LQQ A;  4V1A g;  2VL3 A;  1OVN A;  4WR5 A;  3GSS A;  2DJ0 A;  4ZIJ A;  4OWY A;  4HEA 2;  5AIV A;  1TDI A;  3ME8 A;  4P3Y B;  2H1D A;  1M9B A;  5F0G A;  5HFK A;  1X0R A;  2V6K A;  4IP6 A;  5ECL B;  4IKH A;  4Z2R A;  4ILF A;  4KSO A;  5D96 A;  2CV4 A;  4K0G A;  3CBU A;  1O8X A;  3IE3 A;  1ML6 A;  3WT1 A;  2PGT A;  4HDE A;  4L5L A;  3C1S A;  5D73 A;  5IMF A;  4IGJ A;  1TI1 A;  3BD2 A;  3OR5 A;  3DIE A;  3DVX A;  4HS1 A;  13GS A;  4LL4 B;  1QQ2 A;  1SVO A;  1UA5 A;  2WRT A;  3IAM 2;  1O85 A;  3LGC A;  1ABA A;  1JZR A;  2GQM A;  3H1N A;  3EMP A;  3LOR A;  4WET A;  5AGY A;  1G7O A;  3WGX A;  1XWC A;  3HJM A;  4L8E A;  3BCI A;  2F9S A;  1J08 A;  1XVQ A;  1T1V A;  4V2N A;  1ZMA A;  1YEP A;  2C8U A;  2JAC A;  5ECP B;  3NIV A;  3FKF A;  3FK8 A;  5HQP A;  1O8W A;  1N25 A;  1FVJ A;  3IC8 A;  1OE7 A;  4K7O A;  2PMT A;  1SJ6 A;  1SEN A;  1XWA A;  3EMX A;  1DE1 A;  4CY6 A;  3LFL A;  4O32 A;  1USB A;  4XS4 A;  2EFD A;  1EV9 A;  4EO3 A;  5A4U A;  2DKI A;  2I3Y A;  2YZU A;  4IHU A;  4HUA A;  3KH7 A;  1BF5 A;  4JRR A;  4POB A;  2C4J A;  5BRT A;  4MP4 A;  4HU9 A;  1VRS D;  1Z5Y E;  3W8S A;  4JBB A;  3UOM A;  1GL8 A;  2C0D A;  3MSZ A;  4TR1 A;  3O76 A;  2B1L A;  2KUC A;  4WF4 A;  4Q5R A;  3A2V A;  1TRU A;  4RQX A;  4NWY A;  2LJA A;  2MMN A;  4KF9 A;  1VF4 A;  1HNA A;  1AQW A;  5KN2 A;  3PH9 A;  6GSX A;  4RI6 A;  3ISO A;  4XRD A;  2CZ3 A;  2DKH A;  2XHF A;  3F4T A;  1K0O A;  1XVW A;  1DE2 A;  2H1G A;  1OKD A;  4EF0 A;  4GST A;  3GKM A;  2YAN A;  4O92 A;  2HRN A;  3HHV A;  3G9B A;  4AKH A;  1N8J A;  3GNJ A;  4ZL9 A;  4ECI A;  4MA9 A;  3MDK A;  2N5B A;  2AAW A;  1TK8 B;  3QOU A;  5ECO B;  1PL1 A;  1JLV A;  1M7T A;  1WMJ A;  2MBS A;  3LXZ A;  22GS A;  5A4W A;  1XPV A;  3APO A;  3FZ5 A;  1MD3 A;  4EUY A;  2AYT A;  3HVX A;  1VF1 A;  5F8B A;  2KHP A;  5ECR B;  4RUV A;  2NVL A;  5BMU A;  3IBH A;  2AV4 A;  3ZTL A;  4FYC A;  2L4Q A;  3IHG A;  2PWJ A;  1OKT A;  2MBT A;  4FO5 A;  5ELG A;  4LA1 A;  1W4V A;  1U3A A;  2WUL A;  4BWQ A;  3TRP A;  1XWK A;  1SVM A;  4CW9 A;  2XPE A;  5A5H A;  2VCW A;  2OE3 A;  2H1A A;  4ACS A;  1V9W A;  3Q6O A;  2FHE A;  5F07 A;  4FYB A;  2EFH A;  5DCH A;  5D9V A;  1G6W A;  4KDU A;  3DEX A;  4MJE A;  5CYY A;  3R3E A;  2REM A;  3TKS E;  4DSS A;  3M0F A;  2C3N A;  3D21 A;  1K0M A;  2WDU A;  1E2Y A;  1M0U A;  2H0I A;  5HR2 A;  5FHI A;  3ZRD A;  2VIM A;  5IPH A;  5H5S A;  1WJK A;  1FHE A;  4MPG A;  1TJD A;  2H72 A;  1Z6N A;  2MZC A;  3IHQ A;  1Q98 A;  4EE0 A;  3KH9 A;  5HFG A;  2ZUP A;  4WEY A;  2OT3 A;  2PU9 C;  4DSR A;  4O7H A;  4AKI A;  2LJR A;  3GTU A;  3EPT A;  4MF6 A;  4OD7 A;  3H8Q A;  1WIK A;  2C0G A;  4ICY A;  5J9B A;  5COH A;  4ISD A;  1DSB A;  1SJI A;  1X9M B;  2MMA A;  3CRU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...