4PI2C

Crystal structure of particulate methane monooxygenase from methylocystis sp. atcc 49242 (rockwell) soaked in zinc
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
241
structure length
228
Chain Sequence
b'ESVVDLRGMWIGLVLLNVFYLIVRIYEQVFGWRAGLDSFAPEFQTYWMSILWTEIPLELVSGLGLAGYLWKTRDRNVDAVTPREEMRRLVVLVQWLVVYGIAIYWGASFFTEQDGTWHMTVIRDTDFTPSHIIEFYMSYPIYSVIAVGAFFYAKTRIPYFAHGYSLAFLIVAIGPFMIIPNVGLNEWGHTFWFMEFGWMALGVFGVVLQILMRIHALVGKEGVKLLTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords unknown peptide
publication title Effects of zinc on particulate methane monooxygenase activity and structure.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 84
structure length 228
sequence length 241
chains with identical sequence G, K
ec nomenclature ec 1.14.18.3: Methane monooxygenase (particulate).
pdb deposition date 2014-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.50 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Particulate methane monooxygenase subunit c2. Chain: C 4pi2C00
4PHZC 3RFRC 1YEWC 3RGBC 4PI0C 4PI2C 3CHXC
chains in the Genus database with same CATH superfamily
4EE0A 3TOUA 5ECHB 4K0NA 1K0NA 1GNEA 1EV4A 1KBNA 2NTOA 5A5HA 2OACA 1GSYA 1PN9A 2C8UA 5ELGA 1LJRA 2PERA 5F05A 1ZL9A 2PVQA 2WRTA 4AKHA 4JZQA 1JLVA 1EOGA 2GSTA 2YV9A 1TXUA 5HFKA 3GUSA 5LD0A 1K0CA 2YV7A 2FNOA 2C4JA 4GTUA 1N2AA 4AKXB 1GLPA 4ISDA 2WVXB 3VLNA 4JEDA 1N25A 4KF9A 3LSZA 2ON5A 1GUKA 3M1GA 4PXOA 4IS0A 4K0GA 2GSRA 2WW3A 5JCUA 1F2EA 1YDKA 2DC5A 3EINA 1G6YA 1K0BA 5FT3A 2C3NA 4MDCA 3KM6A 16GSA 4BVXA 4IKHA 5A4WA 4KH7A 4EC0A 6GSTA 4PNFA 1K0OA 3P8WA 4KX4A 4YAPA 2O3EA 2F8FA 1Y1UA 2UV8G 11GSA 4Q5NA 4QMKA 5B7CA 1B48A 2R5GA 2ON7A 2R3XA 4PURA 1MD4A 5DJLA 3HKRA 4ID0A 4G01A 4ACSA 4RI7A 4EXJA 1IYIA 4WR4A 4G0KA 3L0HA 5DAKB 1GSDA 3CBUA 3RBTA 1OKTA 1PKWA 4YH2A 2D2ZA 3I6AA 5A5HB 6GSXA 3EE2A 1K0AA 3FR9A 1EEMA 1XWGA 2CZ2A 1GSUA 4YQMA 1U87A 3KMNA 2F3MA 4ZB7A 3VPTA 2V6KA 5D9VA 2VO4A 2WVXA 4HI7A 14GSA 3NIVA 4YQUA 5A1NB 4GSSA 1OE7A 4TOPA 4HZ2A 5KEJA 1AQWA 5G5FA 6GSUA 2HNLA 1VF3A 2J9HA 2VCZA 3LJRA 3CRTA 6GSWA 3ISOA 4BVXB 1FW1A 4G0LA 4L5LA 1PL2A 5J40A 1AQXA 1PX6A 3FR6A 3I69A 1U88A 2HSMA 3GURA 4MPGA 3BBYA 4W66A 1LBKA 2AAWA 1F3BA 5F8BA 3TOTA 5ELAA 2GSQA 4MF5A 4ECBA 19GSA 4BVYA 2WJUA 4ZBAA 5F06A 2HQTA 2CAQA 4IVFA 1YEWC 2A2RA 1SVLA 1M0UA 5ECKB 3O3TA 1ZGNA 4YQVA 1V2AA 5AIXA 1PMTA 4KAEA 2JL4A 1AQVA 2PBJA 1VF2A 3MAKA 5A1NA 1GSQA 5LCZA 5AGYA 3VK9A 4PI0C 3WYWA 1JLWA 2O36A 4HOJA 1USBA 4GLTA 1BG5A 4Q5RA 5D9WA 3W8SA 5GZZB 4WR5A 1C72A 5ECNB 5A5KA 1BX9A 1EV9A 1BYEA 2C3TA 2X64A 1SVOA 1YJ6A 2HRKB 1XWKA 1TW9A 2VCWA 6GSYA 1YKCA 2N5FA 2WW0A 3LXTA 1K0DA 3IBHA 5J5NA 3M0FA 4USSA 4N0VA 1MD3A 4OFTA 18GSA 1PKZA 1R5AA 5DJMA 1M9BA 2CA8A 2HSMB 1XW5A 2WDUA 1UA5A 3U6VA 2OT3A 4ZBBA 2CAIA 4HJ2A 3Q18A 5ECQB 3G7JA 3QR6A 1G6WA 4BVYB 3GSTA 3CRUA 3LYPA 3LXZA 3F6FA 3IE3A 3UVHA 3RFRC 2DSAA 4OFMA 3VI7A 4EDZA 3TGZA 4PUAA 3HJMA 3ZMLA 5A4VA 4F0BA 5DQSA 3HJOA 5FWGA 1M99A 2WZSA 2AB6A 3R2QA 4G10A 3HMJG 3GTUA 4G9HA 3IK7A 3ERFA 4KSMA 4MPFA 3MDKA 4IJIA 5BMUB 3ERGA 4AGSA 1GTAA 1Q4JA 5F07A 2VCVA 3VWXA 1GSEA 3DGQA 3IC8A 4L8EA 3TU3B 3Q19A 4ECIA 2H1LA 4AKIA 4PQHA 2IL3A 2VCXA 4IQ1A 4ZB9A 4L5OA 7GSSA 2EFDA 4HZ4A 3H1NA 1S4BP 2HRKA 1IYHA 1HNAA 2WW2A 4KDYA 4N3ZA 5A34A 4NHWA 4ZBDA 1GUHA 5D9XA 5G5EA 2PMTA 1VF4A 1K0MA 3PPUA 4GSTA 4PI2C 1OE8A 5J4VA 3SWLA 3KXOA 2VD1A 1GLQA 5ECRB 5DALB 3UARA 1M9AA 4MZWA 1G7OA 2GDRA 5F0GA 4ZXGA 1GTUA 3CSJA 3VPQA 4AI6A 1B4PA 5D73A 1FHEA 3AY8A 1I1IP 3LYKA 5D9TA 3UAPA 3QAWA 4PGTA 6GSVA 3C8EA 4NHZA 4JBBA 1PL1A 4FQUA 3FRCA 4OFNA 1AW9A 4FXYP 4EDYA 4PNGA 1NHYA 3IR4A 1K3OA 1PD21 2WW1A 4IBPA 5ECIB 4KGIA 3N9JA 5DCGA 3N5OA 4ZB8A 1Y6EA 4IELA 3GTUB 4Q5FA 1TU8A 5AISA 3KJYA 2O5VA 5BMUA 1JZRA 4ECJA 4J2FA 1GNWA 6GSSA 2LJRA 4IGJA 2WB9A 4KDXA 4PX1A 2OADA 5EVOA 2VCQA 4LMWA 3M8NA 4RI6A 1EOHA 2OA7A 4IQAA 1SVMA 4O92A 1HNCA 4E8HA 5J47A 4MK3A 1YY7A 4OMVA 1GTIA 2WVYA 3D0ZA 1VF1A 3O76A 3UBLA 3CHXC 12GSA 4PHZC 5A34B 3KTLA 1AXDA 2AHEA 2VKZG 2C80A 1HNBA 4E68A 2WVZA 1A0FA 2GLRA 2VD0A 4GSNA 1GSSA 5DALA 2CVDA 2FHEA 1PX7A 3F6DA 4Q5QA 3Q74A 3LFLA 4MF6A 2HSNB 5JCWA 3PR8A 4GCIA 3ZMKA 5ECPB 4O7HA 1E6BA 1GWCA 4I97A 5GSTA 1YQ1A 20GSA 2IMIA 4MF7A 2EFCA 5ECMB 17GSA 2CZ3A 2VCTA 4NAXA 3P90A 2HRAA 4CHSA 1BF5A 1GTBA 2R4VA 5EL8A 5J4YA 2YCDA 13GSA 3CSHA 3GSSA 4LMVA 4GDFA 4BL7B 1Z9HA 1K3YA 4KDUA 1XW6A 1MTCA 2IMKA 1GSFA 2A2SA 4IW9A 4E8EA 3LG6A 5AIVA 3LQ7A 4G0IA 2R6KA 3R3EA 3GX0A 5IQYA 3KMOA 1PGTA 3FR3A 4GF0A 3FY7A 4DEJA 4YAVA 1OYJA 5ECLB 1GULA 3VI5A 4QQ7A 4F03A 9GSSA 1BG1A 4F0CA 3F63A 1HQOA 1BAYA 3RGBC 2EFEA 5J41A 4AKGA 2PGTA 1ML6A 1DUGA 3G7IA 5FHIA 1B8XA 3QAGA 3M3MA 1F3AA 1U3IA 8GSSA 1V40A 22GSA 5DDLA 2GTUA 1GUMA 5A4UA 5AN1A 3CWGA 4ZB6A 1YVLA 1PA3A 5GSSA 2HSNA 5J4UA 3DD3A 3ZFLA 3CSIA 2UZ8A 3GH6A 2WS2A 5EY6A 4KE3A 10GSA 1K3LA 3UBKA 4ECCA 3VURA 3QAVA 5ECSA 5ECOB 2C3QA 2EFHA 2GSSA 4G19A 3IK9A 4MP4A 3FYGA 4BL7A 1TU7A 3PGTA 1TDIA 4PTSA 1RK4A 3WD6A 4PQIA 5DAKA 3ZFBA
chains in the Genus database with same CATH topology
4PHZC 3RFRC 1YEWC 3RGBC 4PI0C 4PI2C 3CHXC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PHZ C;  3RFR C;  1YEW C;  3RGB C;  4PI0 C;  4PI2 C;  3CHX C; 
#chains in the Genus database with same CATH topology
 4EE0 A;  3TOU A;  5ECH B;  4K0N A;  1K0N A;  1GNE A;  1EV4 A;  1KBN A;  2NTO A;  5A5H A;  2OAC A;  1GSY A;  1PN9 A;  2C8U A;  5ELG A;  1LJR A;  2PER A;  5F05 A;  1ZL9 A;  2PVQ A;  2WRT A;  4AKH A;  4JZQ A;  1JLV A;  1EOG A;  2GST A;  2YV9 A;  1TXU A;  5HFK A;  3GUS A;  5LD0 A;  1K0C A;  2YV7 A;  2FNO A;  2C4J A;  4GTU A;  1N2A A;  4AKX B;  1GLP A;  4ISD A;  2WVX B;  3VLN A;  4JED A;  1N25 A;  4KF9 A;  3LSZ A;  2ON5 A;  1GUK A;  3M1G A;  4PXO A;  4IS0 A;  4K0G A;  2GSR A;  2WW3 A;  5JCU A;  1F2E A;  1YDK A;  2DC5 A;  3EIN A;  1G6Y A;  1K0B A;  5FT3 A;  2C3N A;  4MDC A;  3KM6 A;  16GS A;  4BVX A;  4IKH A;  5A4W A;  4KH7 A;  4EC0 A;  6GST A;  4PNF A;  1K0O A;  3P8W A;  4KX4 A;  4YAP A;  2O3E A;  2F8F A;  1Y1U A;  2UV8 G;  11GS A;  4Q5N A;  4QMK A;  5B7C A;  1B48 A;  2R5G A;  2ON7 A;  2R3X A;  4PUR A;  1MD4 A;  5DJL A;  3HKR A;  4ID0 A;  4G01 A;  4ACS A;  4RI7 A;  4EXJ A;  1IYI A;  4WR4 A;  4G0K A;  3L0H A;  5DAK B;  1GSD A;  3CBU A;  3RBT A;  1OKT A;  1PKW A;  4YH2 A;  2D2Z A;  3I6A A;  5A5H B;  6GSX A;  3EE2 A;  1K0A A;  3FR9 A;  1EEM A;  1XWG A;  2CZ2 A;  1GSU A;  4YQM A;  1U87 A;  3KMN A;  2F3M A;  4ZB7 A;  3VPT A;  2V6K A;  5D9V A;  2VO4 A;  2WVX A;  4HI7 A;  14GS A;  3NIV A;  4YQU A;  5A1N B;  4GSS A;  1OE7 A;  4TOP A;  4HZ2 A;  5KEJ A;  1AQW A;  5G5F A;  6GSU A;  2HNL A;  1VF3 A;  2J9H A;  2VCZ A;  3LJR A;  3CRT A;  6GSW A;  3ISO A;  4BVX B;  1FW1 A;  4G0L A;  4L5L A;  1PL2 A;  5J40 A;  1AQX A;  1PX6 A;  3FR6 A;  3I69 A;  1U88 A;  2HSM A;  3GUR A;  4MPG A;  3BBY A;  4W66 A;  1LBK A;  2AAW A;  1F3B A;  5F8B A;  3TOT A;  5ELA A;  2GSQ A;  4MF5 A;  4ECB A;  19GS A;  4BVY A;  2WJU A;  4ZBA A;  5F06 A;  2HQT A;  2CAQ A;  4IVF A;  1YEW C;  2A2R A;  1SVL A;  1M0U A;  5ECK B;  3O3T A;  1ZGN A;  4YQV A;  1V2A A;  5AIX A;  1PMT A;  4KAE A;  2JL4 A;  1AQV A;  2PBJ A;  1VF2 A;  3MAK A;  5A1N A;  1GSQ A;  5LCZ A;  5AGY A;  3VK9 A;  4PI0 C;  3WYW A;  1JLW A;  2O36 A;  4HOJ A;  1USB A;  4GLT A;  1BG5 A;  4Q5R A;  5D9W A;  3W8S A;  5GZZ B;  4WR5 A;  1C72 A;  5ECN B;  5A5K A;  1BX9 A;  1EV9 A;  1BYE A;  2C3T A;  2X64 A;  1SVO A;  1YJ6 A;  2HRK B;  1XWK A;  1TW9 A;  2VCW A;  6GSY A;  1YKC A;  2N5F A;  2WW0 A;  3LXT A;  1K0D A;  3IBH A;  5J5N A;  3M0F A;  4USS A;  4N0V A;  1MD3 A;  4OFT A;  18GS A;  1PKZ A;  1R5A A;  5DJM A;  1M9B A;  2CA8 A;  2HSM B;  1XW5 A;  2WDU A;  1UA5 A;  3U6V A;  2OT3 A;  4ZBB A;  2CAI A;  4HJ2 A;  3Q18 A;  5ECQ B;  3G7J A;  3QR6 A;  1G6W A;  4BVY B;  3GST A;  3CRU A;  3LYP A;  3LXZ A;  3F6F A;  3IE3 A;  3UVH A;  3RFR C;  2DSA A;  4OFM A;  3VI7 A;  4EDZ A;  3TGZ A;  4PUA A;  3HJM A;  3ZML A;  5A4V A;  4F0B A;  5DQS A;  3HJO A;  5FWG A;  1M99 A;  2WZS A;  2AB6 A;  3R2Q A;  4G10 A;  3HMJ G;  3GTU A;  4G9H A;  3IK7 A;  3ERF A;  4KSM A;  4MPF A;  3MDK A;  4IJI A;  5BMU B;  3ERG A;  4AGS A;  1GTA A;  1Q4J A;  5F07 A;  2VCV A;  3VWX A;  1GSE A;  3DGQ A;  3IC8 A;  4L8E A;  3TU3 B;  3Q19 A;  4ECI A;  2H1L A;  4AKI A;  4PQH A;  2IL3 A;  2VCX A;  4IQ1 A;  4ZB9 A;  4L5O A;  7GSS A;  2EFD A;  4HZ4 A;  3H1N A;  1S4B P;  2HRK A;  1IYH A;  1HNA A;  2WW2 A;  4KDY A;  4N3Z A;  5A34 A;  4NHW A;  4ZBD A;  1GUH A;  5D9X A;  5G5E A;  2PMT A;  1VF4 A;  1K0M A;  3PPU A;  4GST A;  4PI2 C;  1OE8 A;  5J4V A;  3SWL A;  3KXO A;  2VD1 A;  1GLQ A;  5ECR B;  5DAL B;  3UAR A;  1M9A A;  4MZW A;  1G7O A;  2GDR A;  5F0G A;  4ZXG A;  1GTU A;  3CSJ A;  3VPQ A;  4AI6 A;  1B4P A;  5D73 A;  1FHE A;  3AY8 A;  1I1I P;  3LYK A;  5D9T A;  3UAP A;  3QAW A;  4PGT A;  6GSV A;  3C8E A;  4NHZ A;  4JBB A;  1PL1 A;  4FQU A;  3FRC A;  4OFN A;  1AW9 A;  4FXY P;  4EDY A;  4PNG A;  1NHY A;  3IR4 A;  1K3O A;  1PD2 1;  2WW1 A;  4IBP A;  5ECI B;  4KGI A;  3N9J A;  5DCG A;  3N5O A;  4ZB8 A;  1Y6E A;  4IEL A;  3GTU B;  4Q5F A;  1TU8 A;  5AIS A;  3KJY A;  2O5V A;  5BMU A;  1JZR A;  4ECJ A;  4J2F A;  1GNW A;  6GSS A;  2LJR A;  4IGJ A;  2WB9 A;  4KDX A;  4PX1 A;  2OAD A;  5EVO A;  2VCQ A;  4LMW A;  3M8N A;  4RI6 A;  1EOH A;  2OA7 A;  4IQA A;  1SVM A;  4O92 A;  1HNC A;  4E8H A;  5J47 A;  4MK3 A;  1YY7 A;  4OMV A;  1GTI A;  2WVY A;  3D0Z A;  1VF1 A;  3O76 A;  3UBL A;  3CHX C;  12GS A;  4PHZ C;  5A34 B;  3KTL A;  1AXD A;  2AHE A;  2VKZ G;  2C80 A;  1HNB A;  4E68 A;  2WVZ A;  1A0F A;  2GLR A;  2VD0 A;  4GSN A;  1GSS A;  5DAL A;  2CVD A;  2FHE A;  1PX7 A;  3F6D A;  4Q5Q A;  3Q74 A;  3LFL A;  4MF6 A;  2HSN B;  5JCW A;  3PR8 A;  4GCI A;  3ZMK A;  5ECP B;  4O7H A;  1E6B A;  1GWC A;  4I97 A;  5GST A;  1YQ1 A;  20GS A;  2IMI A;  4MF7 A;  2EFC A;  5ECM B;  17GS A;  2CZ3 A;  2VCT A;  4NAX A;  3P90 A;  2HRA A;  4CHS A;  1BF5 A;  1GTB A;  2R4V A;  5EL8 A;  5J4Y A;  2YCD A;  13GS A;  3CSH A;  3GSS A;  4LMV A;  4GDF A;  4BL7 B;  1Z9H A;  1K3Y A;  4KDU A;  1XW6 A;  1MTC A;  2IMK A;  1GSF A;  2A2S A;  4IW9 A;  4E8E A;  3LG6 A;  5AIV A;  3LQ7 A;  4G0I A;  2R6K A;  3R3E A;  3GX0 A;  5IQY A;  3KMO A;  1PGT A;  3FR3 A;  4GF0 A;  3FY7 A;  4DEJ A;  4YAV A;  1OYJ A;  5ECL B;  1GUL A;  3VI5 A;  4QQ7 A;  4F03 A;  9GSS A;  1BG1 A;  4F0C A;  3F63 A;  1HQO A;  1BAY A;  3RGB C;  2EFE A;  5J41 A;  4AKG A;  2PGT A;  1ML6 A;  1DUG A;  3G7I A;  5FHI A;  1B8X A;  3QAG A;  3M3M A;  1F3A A;  1U3I A;  8GSS A;  1V40 A;  22GS A;  5DDL A;  2GTU A;  1GUM A;  5A4U A;  5AN1 A;  3CWG A;  4ZB6 A;  1YVL A;  1PA3 A;  5GSS A;  2HSN A;  5J4U A;  3DD3 A;  3ZFL A;  3CSI A;  2UZ8 A;  3GH6 A;  2WS2 A;  5EY6 A;  4KE3 A;  10GS A;  1K3L A;  3UBK A;  4ECC A;  3VUR A;  3QAV A;  5ECS A;  5ECO B;  2C3Q A;  2EFH A;  2GSS A;  4G19 A;  3IK9 A;  4MP4 A;  3FYG A;  4BL7 A;  1TU7 A;  3PGT A;  1TDI A;  4PTS A;  1RK4 A;  3WD6 A;  4PQI A;  5DAK A;  3ZFB A; 
#chains in the Genus database with same CATH homology
 4PHZ C;  3RFR C;  1YEW C;  3RGB C;  4PI0 C;  4PI2 C;  3CHX C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...