4PI2C

Crystal structure of particulate methane monooxygenase from methylocystis sp. atcc 49242 (rockwell) soaked in zinc
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
241
structure length
228
Chain Sequence
ESVVDLRGMWIGLVLLNVFYLIVRIYEQVFGWRAGLDSFAPEFQTYWMSILWTEIPLELVSGLGLAGYLWKTRDRNVDAVTPREEMRRLVVLVQWLVVYGIAIYWGASFFTEQDGTWHMTVIRDTDFTPSHIIEFYMSYPIYSVIAVGAFFYAKTRIPYFAHGYSLAFLIVAIGPFMIIPNVGLNEWGHTFWFMEFGWMALGVFGVVLQILMRIHALVGKEGVKLLTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords unknown peptide
publication title Effects of zinc on particulate methane monooxygenase activity and structure.
pubmed doi rcsb
total genus 84
structure length 228
sequence length 241
chains with identical sequence G, K
ec nomenclature ec 1.14.18.3: Methane monooxygenase (particulate).
pdb deposition date 2014-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.50 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Particulate methane monooxygenase subunit c2. Chain: C 4pi2C00
3RFRC 3CHXC 4PHZC 1YEWC 4PI0C 4PI2C 3RGBC
chains in the Genus database with same CATH superfamily
4AKIA 2WB9A 4O92A 4GSTA 3FR3A 3GTUB 1U88A 4PNFA 1AW9A 4GDFA 3FR6A 4MF5A 1DUGA 1GNEA 3GSSA 1XWGA 3GSTA 1GSDA 2X64A 3VLNA 4PI0C 4ECJA 4QQ7A 5G5FA 4PXOA 3CWGA 2R4VA 2AB6A 1OYJA 5ECQB 2WZSA 4YAPA 4GLTA 2HRAA 4E8HA 3IK9A 3UVHA 5D9WA 3RGBC 6GSSA 1MD4A 2IMKA 1JLVA 3IBHA 3Q18A 4AKGA 1OKTA 5J41A 1BG1A 2HSMB 1GSYA 3IK7A 3R3EA 2WJUA 2CA8A 4QMKA 5B7CA 3MDKA 2EFDA 1V40A 3FR9A 4MF6A 5D9VA 1U3IA 4ZB6A 2AHEA 2VD0A 4RI6A 1NHYA 4MF7A 1C72A 1K0OA 1YQ1A 3NIVA 5J4VA 2WRTA 4IBPA 1LBKA 1EOGA 1XW6A 3UBKA 3ZMLA 4PURA 4JBBA 1MTCA 2LJRA 4ACSA 5ECRB 5JCUA 16GSA 4K0NA 3LSZA 2HNLA 4GTUA 5J40A 3G7JA 2YV7A 3R2QA 4KDYA 2YV9A 4OMVA 1B48A 1IYIA 4PHZC 4KH7A 1GTAA 2FNOA 3I6AA 2GSRA 3FYGA 4GF0A 5DDLA 1EEMA 5FWGA 1F3AA 2GSQA 3TGZA 4IELA 3GURA 3IC8A 2NTOA 3CHXC 2C3QA 5G5EA 1GNWA 6GSVA 1I1IP 5GSTA 1YDKA 1XWKA 2WS2A 4HZ4A 4USSA 4TOPA 4W66A 1SVLA 1SVMA 1HNAA 2A2SA 2ON5A 3TOTA 4FQUA 4MZWA 4EXJA 1A0FA 1PX6A 3WD6A 2CZ3A 4AGSA 1EV4A 2FHEA 4G9HA 4N3ZA 1F2EA 2GTUA 13GSA 4L8EA 4PNGA 1PA3A 3SWLA 2VCXA 3VPQA 1AQXA 4WR5A 3F6FA 3RBTA 1BF5A 5DAKA 3I69A 5ECPB 2OACA 3CRUA 2VCZA 3VI7A 3H1NA 2O36A 4GSSA 7GSSA 1OE7A 3LYKA 4OFTA 1Z9HA 3LYPA 1FW1A 3PPUA 4G0IA 1K3LA 4YAVA 2VCTA 2A2RA 3L0HA 1XW5A 1YEWC 2UV8G 3HMJG 4ZB7A 6GSTA 2C8UA 5A4WA 2VCQA 4YH2A 1PKZA 3VPTA 2VO4A 5F05A 2N5FA 2PGTA 5D73A 1YKCA 4AKHA 5F8BA 3LXTA 3O3TA 1K0AA 1PKWA 1YY7A 5DAKB 4HI7A 1TU8A 3KM6A 1K0MA 1V2AA 2HRKA 4IKHA 2PMTA 2YCDA 5KEJA 3QR6A 3CSHA 4ISDA 2C3NA 5BMUA 1PGTA 3Q74A 5J47A 4L5LA 1GUHA 2EFCA 5DJLA 2R3XA 2C80A 4F0CA 3QAVA 4KAEA 3EE2A 1GLQA 1Y1UA 2GSSA 4IQAA 1JLWA 5AN1A 2JL4A 1BAYA 1K0NA 1KBNA 4Q5FA 4KSMA 1M9BA 3Q19A 5ECNB 2HRKB 2CAIA 4K0GA 1PL2A 1IYHA 3IR4A 1K0BA 5DQSA 5DCGA 4G0KA 1GWCA 1HQOA 5BMUB 4MPFA 5JCWA 4YQUA 2O5VA 1GUMA 4ZBBA 2VCVA 2EFEA 3GX0A 3KMNA 3O76A 2R6KA 4ZBAA 4BL7A 3DD3A 1YJ6A 3UAPA 1VF4A 5GZZB 1LJRA 5HFKA 4G10A 2HSNA 18GSA 4RI7A 2WW1A 4Q5NA 4CHSA 4WR4A 3UARA 2WW3A 4NHWA 2WVYA 4I97A 1AQVA 5EL8A 3HJMA 2UZ8A 1TW9A 4E8EA 4KF9A 4G0LA 3VURA 4PUAA 4KGIA 4ECBA 4HJ2A 3F6DA 20GSA 1N25A 5EY6A 3ERFA 5A5KA 1TDIA 3LG6A 10GSA 17GSA 4EDZA 3M0FA 3KJYA 2AAWA 3ZFBA 2PVQA 4BL7B 1HNBA 2WW2A 4ECCA 2GSTA 2WVZA 1ZL9A 4ZB9A 1GSUA 1USBA 3M1GA 2H1LA 1BX9A 2HSNB 3HJOA 3LXZA 3TOUA 3ERGA 1PN9A 2OADA 1GSQA 1Q4JA 1R5AA 4L5OA 6GSXA 19GSA 4PI2C 3U6VA 4F03A 2GDRA 1PD21 3DGQA 4FXYP 2J9HA 4IQ1A 3GH6A 1ML6A 1M0UA 4MPGA 5D9XA 1PMTA 2EFHA 2DSAA 1U87A 9GSSA 4F0BA 5IQYA 2WDUA 2ON7A 4PQHA 3KMOA 1GTIA 2R5GA 3F63A 1ZGNA 2OT3A 1BYEA 4IVFA 4JEDA 1M9AA 3VK9A 4LMVA 1OE8A 2C3TA 5J5NA 3FRCA 3PR8A 5A4VA 6GSWA 1K0DA 6GSUA 1K0CA 3RFRC 1YVLA 4GSNA 3C8EA 5ECHB 3KXOA 5J4UA 3GUSA 4MDCA 5F07A 3PGTA 4ZBDA 3BBYA 1GTBA 3VI5A 4KX4A 3N5OA 5DJMA 1BG5A 5GSSA 4IGJA 4KE3A 4EC0A 1GUKA 5D9TA 2WVXA 4NAXA 3LJRA 12GSA 4IS0A 5J4YA 1G6YA 5A1NA 3LFLA 2C4JA 2OA7A 4OFMA 1TXUA 1TU7A 4YQVA 3HKRA 1M99A 2IMIA 5FHIA 5ECOB 3CSIA 3LQ7A 1MD3A 6GSYA 4PGTA 2V6KA 4G19A 1PX7A 2VKZG 2O3EA 4KDUA 4IJIA 1VF1A 4J2FA 1PL1A 1AQWA 3ZFLA 5A5HA 3QAGA 4IW9A 2WVXB 3ZMKA 1K3YA 3TU3B 4PTSA 1B4PA 4AI6A 3MAKA 5A1NB 1VF2A 3M8NA 1E6BA 1G6WA 1AXDA 3CSJA 5ELAA 4BVYA 3W8SA 2CZ2A 4YQMA 1GSFA 1F3BA 3IE3A 2GLRA 1JZRA 1GSSA 5LD0A 1FHEA 4BVXA 5F0GA 5DALA 1GLPA 4AKXB 3WYWA 1SVOA 4Q5RA 1Y6EA 2VD1A 1N2AA 4ZB8A 4EDYA 4ID0A 5A5HB 2D2ZA 3UBLA 5LCZA 5ECSA 4ZXGA 4ECIA 5ECKB 1EV9A 1HNCA 3M3MA 3VWXA 1G7OA 4EE0A 4BVYB 3KTLA 3CBUA 2CAQA 3ISOA 2PERA 4MK3A 4NHZA 4KDXA 4GCIA 5A34A 2CVDA 4E68A 5AIVA 5FT3A 2PBJA 5AGYA 4BVXB 1UA5A 5DALB 4PQIA 1VF3A 4N0VA 5F06A 5ELGA 3CRTA 2HQTA 1GTUA 4G01A 4PX1A 3GTUA 1S4BP 4HZ2A 5ECMB 3P8WA 22GSA 5ECIB 5EVOA 3D0ZA 4JZQA 1K3OA 2F8FA 4MP4A 1GSEA 4Q5QA 2VCWA 1EOHA 3QAWA 1GULA 5ECLB 5A4UA 3G7IA 2WW0A 4HOJA 4LMWA 5A34B 8GSSA 3AY8A 4OFNA 4DEJA 2IL3A 2F3MA 3FY7A 14GSA 5AIXA 3N9JA 1RK4A 4O7HA 3P90A 2DC5A 5AISA 3EINA 1B8XA 11GSA 2HSMA
chains in the Genus database with same CATH topology
3RFRC 3CHXC 4PHZC 1YEWC 4PI0C 4PI2C 3RGBC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RFR C;  3CHX C;  4PHZ C;  1YEW C;  4PI0 C;  4PI2 C;  3RGB C; 
#chains in the Genus database with same CATH topology
 4AKI A;  2WB9 A;  4O92 A;  4GST A;  3FR3 A;  3GTU B;  1U88 A;  4PNF A;  1AW9 A;  4GDF A;  3FR6 A;  4MF5 A;  1DUG A;  1GNE A;  3GSS A;  1XWG A;  3GST A;  1GSD A;  2X64 A;  3VLN A;  4PI0 C;  4ECJ A;  4QQ7 A;  5G5F A;  4PXO A;  3CWG A;  2R4V A;  2AB6 A;  1OYJ A;  5ECQ B;  2WZS A;  4YAP A;  4GLT A;  2HRA A;  4E8H A;  3IK9 A;  3UVH A;  5D9W A;  3RGB C;  6GSS A;  1MD4 A;  2IMK A;  1JLV A;  3IBH A;  3Q18 A;  4AKG A;  1OKT A;  5J41 A;  1BG1 A;  2HSM B;  1GSY A;  3IK7 A;  3R3E A;  2WJU A;  2CA8 A;  4QMK A;  5B7C A;  3MDK A;  2EFD A;  1V40 A;  3FR9 A;  4MF6 A;  5D9V A;  1U3I A;  4ZB6 A;  2AHE A;  2VD0 A;  4RI6 A;  1NHY A;  4MF7 A;  1C72 A;  1K0O A;  1YQ1 A;  3NIV A;  5J4V A;  2WRT A;  4IBP A;  1LBK A;  1EOG A;  1XW6 A;  3UBK A;  3ZML A;  4PUR A;  4JBB A;  1MTC A;  2LJR A;  4ACS A;  5ECR B;  5JCU A;  16GS A;  4K0N A;  3LSZ A;  2HNL A;  4GTU A;  5J40 A;  3G7J A;  2YV7 A;  3R2Q A;  4KDY A;  2YV9 A;  4OMV A;  1B48 A;  1IYI A;  4PHZ C;  4KH7 A;  1GTA A;  2FNO A;  3I6A A;  2GSR A;  3FYG A;  4GF0 A;  5DDL A;  1EEM A;  5FWG A;  1F3A A;  2GSQ A;  3TGZ A;  4IEL A;  3GUR A;  3IC8 A;  2NTO A;  3CHX C;  2C3Q A;  5G5E A;  1GNW A;  6GSV A;  1I1I P;  5GST A;  1YDK A;  1XWK A;  2WS2 A;  4HZ4 A;  4USS A;  4TOP A;  4W66 A;  1SVL A;  1SVM A;  1HNA A;  2A2S A;  2ON5 A;  3TOT A;  4FQU A;  4MZW A;  4EXJ A;  1A0F A;  1PX6 A;  3WD6 A;  2CZ3 A;  4AGS A;  1EV4 A;  2FHE A;  4G9H A;  4N3Z A;  1F2E A;  2GTU A;  13GS A;  4L8E A;  4PNG A;  1PA3 A;  3SWL A;  2VCX A;  3VPQ A;  1AQX A;  4WR5 A;  3F6F A;  3RBT A;  1BF5 A;  5DAK A;  3I69 A;  5ECP B;  2OAC A;  3CRU A;  2VCZ A;  3VI7 A;  3H1N A;  2O36 A;  4GSS A;  7GSS A;  1OE7 A;  3LYK A;  4OFT A;  1Z9H A;  3LYP A;  1FW1 A;  3PPU A;  4G0I A;  1K3L A;  4YAV A;  2VCT A;  2A2R A;  3L0H A;  1XW5 A;  1YEW C;  2UV8 G;  3HMJ G;  4ZB7 A;  6GST A;  2C8U A;  5A4W A;  2VCQ A;  4YH2 A;  1PKZ A;  3VPT A;  2VO4 A;  5F05 A;  2N5F A;  2PGT A;  5D73 A;  1YKC A;  4AKH A;  5F8B A;  3LXT A;  3O3T A;  1K0A A;  1PKW A;  1YY7 A;  5DAK B;  4HI7 A;  1TU8 A;  3KM6 A;  1K0M A;  1V2A A;  2HRK A;  4IKH A;  2PMT A;  2YCD A;  5KEJ A;  3QR6 A;  3CSH A;  4ISD A;  2C3N A;  5BMU A;  1PGT A;  3Q74 A;  5J47 A;  4L5L A;  1GUH A;  2EFC A;  5DJL A;  2R3X A;  2C80 A;  4F0C A;  3QAV A;  4KAE A;  3EE2 A;  1GLQ A;  1Y1U A;  2GSS A;  4IQA A;  1JLW A;  5AN1 A;  2JL4 A;  1BAY A;  1K0N A;  1KBN A;  4Q5F A;  4KSM A;  1M9B A;  3Q19 A;  5ECN B;  2HRK B;  2CAI A;  4K0G A;  1PL2 A;  1IYH A;  3IR4 A;  1K0B A;  5DQS A;  5DCG A;  4G0K A;  1GWC A;  1HQO A;  5BMU B;  4MPF A;  5JCW A;  4YQU A;  2O5V A;  1GUM A;  4ZBB A;  2VCV A;  2EFE A;  3GX0 A;  3KMN A;  3O76 A;  2R6K A;  4ZBA A;  4BL7 A;  3DD3 A;  1YJ6 A;  3UAP A;  1VF4 A;  5GZZ B;  1LJR A;  5HFK A;  4G10 A;  2HSN A;  18GS A;  4RI7 A;  2WW1 A;  4Q5N A;  4CHS A;  4WR4 A;  3UAR A;  2WW3 A;  4NHW A;  2WVY A;  4I97 A;  1AQV A;  5EL8 A;  3HJM A;  2UZ8 A;  1TW9 A;  4E8E A;  4KF9 A;  4G0L A;  3VUR A;  4PUA A;  4KGI A;  4ECB A;  4HJ2 A;  3F6D A;  20GS A;  1N25 A;  5EY6 A;  3ERF A;  5A5K A;  1TDI A;  3LG6 A;  10GS A;  17GS A;  4EDZ A;  3M0F A;  3KJY A;  2AAW A;  3ZFB A;  2PVQ A;  4BL7 B;  1HNB A;  2WW2 A;  4ECC A;  2GST A;  2WVZ A;  1ZL9 A;  4ZB9 A;  1GSU A;  1USB A;  3M1G A;  2H1L A;  1BX9 A;  2HSN B;  3HJO A;  3LXZ A;  3TOU A;  3ERG A;  1PN9 A;  2OAD A;  1GSQ A;  1Q4J A;  1R5A A;  4L5O A;  6GSX A;  19GS A;  4PI2 C;  3U6V A;  4F03 A;  2GDR A;  1PD2 1;  3DGQ A;  4FXY P;  2J9H A;  4IQ1 A;  3GH6 A;  1ML6 A;  1M0U A;  4MPG A;  5D9X A;  1PMT A;  2EFH A;  2DSA A;  1U87 A;  9GSS A;  4F0B A;  5IQY A;  2WDU A;  2ON7 A;  4PQH A;  3KMO A;  1GTI A;  2R5G A;  3F63 A;  1ZGN A;  2OT3 A;  1BYE A;  4IVF A;  4JED A;  1M9A A;  3VK9 A;  4LMV A;  1OE8 A;  2C3T A;  5J5N A;  3FRC A;  3PR8 A;  5A4V A;  6GSW A;  1K0D A;  6GSU A;  1K0C A;  3RFR C;  1YVL A;  4GSN A;  3C8E A;  5ECH B;  3KXO A;  5J4U A;  3GUS A;  4MDC A;  5F07 A;  3PGT A;  4ZBD A;  3BBY A;  1GTB A;  3VI5 A;  4KX4 A;  3N5O A;  5DJM A;  1BG5 A;  5GSS A;  4IGJ A;  4KE3 A;  4EC0 A;  1GUK A;  5D9T A;  2WVX A;  4NAX A;  3LJR A;  12GS A;  4IS0 A;  5J4Y A;  1G6Y A;  5A1N A;  3LFL A;  2C4J A;  2OA7 A;  4OFM A;  1TXU A;  1TU7 A;  4YQV A;  3HKR A;  1M99 A;  2IMI A;  5FHI A;  5ECO B;  3CSI A;  3LQ7 A;  1MD3 A;  6GSY A;  4PGT A;  2V6K A;  4G19 A;  1PX7 A;  2VKZ G;  2O3E A;  4KDU A;  4IJI A;  1VF1 A;  4J2F A;  1PL1 A;  1AQW A;  3ZFL A;  5A5H A;  3QAG A;  4IW9 A;  2WVX B;  3ZMK A;  1K3Y A;  3TU3 B;  4PTS A;  1B4P A;  4AI6 A;  3MAK A;  5A1N B;  1VF2 A;  3M8N A;  1E6B A;  1G6W A;  1AXD A;  3CSJ A;  5ELA A;  4BVY A;  3W8S A;  2CZ2 A;  4YQM A;  1GSF A;  1F3B A;  3IE3 A;  2GLR A;  1JZR A;  1GSS A;  5LD0 A;  1FHE A;  4BVX A;  5F0G A;  5DAL A;  1GLP A;  4AKX B;  3WYW A;  1SVO A;  4Q5R A;  1Y6E A;  2VD1 A;  1N2A A;  4ZB8 A;  4EDY A;  4ID0 A;  5A5H B;  2D2Z A;  3UBL A;  5LCZ A;  5ECS A;  4ZXG A;  4ECI A;  5ECK B;  1EV9 A;  1HNC A;  3M3M A;  3VWX A;  1G7O A;  4EE0 A;  4BVY B;  3KTL A;  3CBU A;  2CAQ A;  3ISO A;  2PER A;  4MK3 A;  4NHZ A;  4KDX A;  4GCI A;  5A34 A;  2CVD A;  4E68 A;  5AIV A;  5FT3 A;  2PBJ A;  5AGY A;  4BVX B;  1UA5 A;  5DAL B;  4PQI A;  1VF3 A;  4N0V A;  5F06 A;  5ELG A;  3CRT A;  2HQT A;  1GTU A;  4G01 A;  4PX1 A;  3GTU A;  1S4B P;  4HZ2 A;  5ECM B;  3P8W A;  22GS A;  5ECI B;  5EVO A;  3D0Z A;  4JZQ A;  1K3O A;  2F8F A;  4MP4 A;  1GSE A;  4Q5Q A;  2VCW A;  1EOH A;  3QAW A;  1GUL A;  5ECL B;  5A4U A;  3G7I A;  2WW0 A;  4HOJ A;  4LMW A;  5A34 B;  8GSS A;  3AY8 A;  4OFN A;  4DEJ A;  2IL3 A;  2F3M A;  3FY7 A;  14GS A;  5AIX A;  3N9J A;  1RK4 A;  4O7H A;  3P90 A;  2DC5 A;  5AIS A;  3EIN A;  1B8X A;  11GS A;  2HSM A; 
#chains in the Genus database with same CATH homology
 3RFR C;  3CHX C;  4PHZ C;  1YEW C;  4PI0 C;  4PI2 C;  3RGB C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...