4PI2C

Crystal structure of particulate methane monooxygenase from methylocystis sp. atcc 49242 (rockwell) soaked in zinc
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
241
structure length
228
Chain Sequence
ESVVDLRGMWIGLVLLNVFYLIVRIYEQVFGWRAGLDSFAPEFQTYWMSILWTEIPLELVSGLGLAGYLWKTRDRNVDAVTPREEMRRLVVLVQWLVVYGIAIYWGASFFTEQDGTWHMTVIRDTDFTPSHIIEFYMSYPIYSVIAVGAFFYAKTRIPYFAHGYSLAFLIVAIGPFMIIPNVGLNEWGHTFWFMEFGWMALGVFGVVLQILMRIHALVGKEGVKLLTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords unknown peptide
publication title Effects of zinc on particulate methane monooxygenase activity and structure.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 84
structure length 228
sequence length 241
chains with identical sequence G, K
ec nomenclature ec 1.14.18.3: Methane monooxygenase (particulate).
pdb deposition date 2014-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.50 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Particulate methane monooxygenase subunit c2. Chain: C 4pi2C00
4PI0C 1YEWC 3CHXC 3RFRC 4PHZC 4PI2C 3RGBC
chains in the Genus database with same CATH superfamily
4ECIA 1G6YA 4BVXA 5J4VA 3M0FA 1V40A 5LCZA 4LMVA 2PMTA 1ZGNA 1YQ1A 2VO4A 2YCDA 4F0CA 2VCXA 4AI6A 6GSTA 4GF0A 5AIXA 6GSUA 5JCUA 4IVFA 2OADA 1BAYA 2CAIA 1OKTA 3Q18A 3LG6A 3MDKA 5A1NB 5ELAA 2EFCA 2WVXA 3ERGA 3L0HA 1GSQA 16GSA 3EINA 4ISDA 3TOUA 2DC5A 1K3OA 5F0GA 1TXUA 4GSNA 5F07A 3KM6A 1YY7A 5G5FA 11GSA 1GTAA 5A5HB 4O7HA 5DJLA 1PL2A 1Y6EA 1M99A 2HSNB 3SWLA 4ZB8A 5DAKB 3N5OA 4N3ZA 1TU7A 1FHEA 1GSSA 1K0NA 3GH6A 1GLPA 1A0FA 4ZB6A 1PMTA 4PNFA 5B7CA 17GSA 5F06A 4ECJA 4BVYB 3KXOA 4G0IA 4Q5QA 4ACSA 9GSSA 2C3QA 3FR6A 4E68A 5DDLA 2PERA 1GTIA 1Z9HA 5AIVA 1HQOA 3HJMA 4F03A 3PPUA 4PI0C 1K0CA 2WS2A 1OE7A 2OT3A 4YAPA 4ZB9A 5D9XA 4L5LA 1GUHA 4MF5A 5BMUA 3HMJG 2R6KA 1ML6A 6GSYA 1VF4A 5LD0A 4KDUA 4KX4A 5ECQB 1BX9A 2CAQA 3I6AA 1C72A 1VF1A 1G6WA 12GSA 1TU8A 4HZ4A 3LFLA 3R2QA 3TOTA 4AGSA 3FR3A 1PGTA 5FWGA 4ZBAA 1AXDA 3CHXC 1YEWC 3MAKA 4KDYA 5J40A 5ECPB 3R3EA 5D9TA 1K0MA 5ECIB 4DEJA 1HNBA 3H1NA 4PXOA 4Q5FA 1MD3A 3O3TA 3N9JA 5ECMB 1B4PA 3W8SA 4K0GA 3ZMKA 1F3BA 3F63A 4IW9A 1EV9A 2UZ8A 3IK7A 4AKXB 1EOGA 4PQIA 1HNAA 4OFNA 2C3NA 1PD21 1SVOA 4QMKA 3VPTA 4NAXA 18GSA 4NHWA 5J4YA 3QAVA 4GSSA 3C8EA 1JZRA 4WR4A 4ID0A 2GLRA 4HOJA 5ECNB 5A1NA 3WYWA 3GX0A 3VLNA 2GSRA 3GUSA 3LXTA 2FHEA 3I69A 1YKCA 5DQSA 2WB9A 1BG1A 2R5GA 3ERFA 5A5HA 5EL8A 5AGYA 3VK9A 4GLTA 4IQ1A 4O92A 2HSNA 4ECBA 4PGTA 4PTSA 5DAKA 4HZ2A 1OYJA 1DUGA 5JCWA 1M0UA 2IMIA 4IELA 1N2AA 1GSDA 1PKWA 3GSTA 2O3EA 4BVYA 3KMOA 1BYEA 4OMVA 3ZFLA 3DD3A 4IJIA 3VI7A 5AN1A 20GSA 2O36A 1RK4A 4QQ7A 4MPGA 6GSWA 1NHYA 2C3TA 4MP4A 1BG5A 3AY8A 5ECKB 5KEJA 1BF5A 4G0LA 4RI6A 4EDZA 3LXZA 5A4VA 2F8FA 1E6BA 4Q5RA 4F0BA 3CRUA 1PX6A 5A4WA 1KBNA 2HNLA 5A4UA 4W66A 2GTUA 4EXJA 3VI5A 2D2ZA 4JBBA 2NTOA 4EDYA 2HSMB 5D9VA 4YH2A 2HRKB 3RBTA 4IS0A 2GSSA 2VCZA 4HJ2A 2HRAA 4PX1A 2IL3A 3BBYA 3CRTA 5ECLB 5ECRB 1YDKA 3QR6A 4GCIA 3RFRC 5A5KA 5A34B 1SVLA 3FR9A 1GULA 5HFKA 2C80A 2VD1A 5G5EA 4G10A 4L8EA 3Q74A 2CA8A 4E8HA 1AQVA 4J2FA 2A2RA 5DALB 5F8BA 1LJRA 4PQHA 3NIVA 3U6VA 3UVHA 3HJOA 4E8EA 3HKRA 6GSSA 1HNCA 4OFTA 3FYGA 1GSUA 3CSJA 4ZB7A 4G0KA 4USSA 1EV4A 2WDUA 4PI2C 5D73A 2J9HA 3UBKA 3GSSA 5ECHB 4AKHA 3GTUB 3UAPA 1YVLA 5IQYA 4AKIA 2ON5A 2HQTA 4FQUA 5FHIA 2YV9A 3WD6A 1PA3A 1GSYA 4ZBDA 4NHZA 1F3AA 4GTUA 5GSSA 1VF2A 19GSA 5GZZB 3LYPA 2PVQA 2R4VA 2LJRA 1TDIA 5D9WA 4G01A 1EEMA 1GLQA 1LBKA 4MF7A 2DSAA 3CSHA 4JEDA 4BL7B 5J5NA 1SVMA 2JL4A 2VCQA 5F05A 2VCVA 3VPQA 5J4UA 1M9BA 1MD4A 3IR4A 4WR5A 5AISA 1V2AA 1GSFA 3TU3B 3IC8A 1GSEA 1GUMA 1GNWA 4G19A 2WW2A 1PL1A 1OE8A 4RI7A 2O5VA 4PUAA 1GWCA 1JLWA 2VCTA 4PHZC 13GSA 2C4JA 2WZSA 2GDRA 4K0NA 4Q5NA 3M1GA 4KH7A 4LMWA 3F6DA 1AW9A 2R3XA 2X64A 2IMKA 3LJRA 3G7JA 3QAGA 4AKGA 2N5FA 4N0VA 5J47A 2HSMA 3PGTA 2WVYA 2HRKA 2WW3A 1PN9A 1Y1UA 4YQVA 1XWKA 4EC0A 3LQ7A 1U3IA 2ON7A 2EFEA 4KDXA 3ZFBA 2CZ3A 4FXYP 5DJMA 1UA5A 1K0OA 3D0ZA 5A34A 7GSSA 4JZQA 1PKZA 1XW5A 3KMNA 1K0DA 1S4BP 2AAWA 1AQXA 4IGJA 1MTCA 1B8XA 2CZ2A 8GSSA 10GSA 2WW1A 4L5OA 3VWXA 1K0AA 1FW1A 3TGZA 4BVXB 5DALA 3O76A 5FT3A 4KF9A 2F3MA 1GUKA 1USBA 2UV8G 4KSMA 5DCGA 1EOHA 1I1IP 4GSTA 2EFDA 4MPFA 4YAVA 3LYKA 2FNOA 4MDCA 22GSA 5EVOA 1Q4JA 1K3LA 3CBUA 4YQMA 4TOPA 3CSIA 3P90A 2EFHA 3F6FA 5ECOB 3GTUA 4ZBBA 4MF6A 2OACA 2WVXB 14GSA 3ZMLA 3Q19A 3M8NA 2AB6A 6GSVA 2VCWA 1JLVA 2V6KA 2C8UA 3M3MA 1G7OA 4PNGA 4YQUA 4KGIA 1K3YA 1IYIA 4G9HA 2GSQA 2PGTA 3DGQA 2CVDA 3KJYA 4MK3A 3RGBC 4ZXGA 2A2SA 4BL7A 1XWGA 2WRTA 2VKZG 1GNEA 1N25A 1U88A 1XW6A 3QAWA 1PX7A 3FY7A 1GTBA 5ECSA 3IK9A 4OFMA 1YJ6A 4MZWA 4GDFA 3ISOA 4I97A 4EE0A 3FRCA 4IKHA 2WW0A 1F2EA 2GSTA 4KE3A 3VURA 3IBHA 3G7IA 4HI7A 1B48A 4IQAA 3GURA 3PR8A 4KAEA 5EY6A 5BMUB 2PBJA 1TW9A 1M9AA 2OA7A 1ZL9A 4IBPA 2VD0A 2WJUA 5J41A 2WVZA 5ELGA 3CWGA 5GSTA 3EE2A 6GSXA 2YV7A 1VF3A 1GTUA 1IYHA 3KTLA 1AQWA 1R5AA 3IE3A 2AHEA 1U87A 4CHSA 2H1LA 4ECCA 3LSZA 4PURA 3P8WA 3UARA 1K0BA 3UBLA
chains in the Genus database with same CATH topology
4PI0C 1YEWC 3CHXC 3RFRC 4PHZC 4PI2C 3RGBC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PI0 C;  1YEW C;  3CHX C;  3RFR C;  4PHZ C;  4PI2 C;  3RGB C; 
#chains in the Genus database with same CATH topology
 4ECI A;  1G6Y A;  4BVX A;  5J4V A;  3M0F A;  1V40 A;  5LCZ A;  4LMV A;  2PMT A;  1ZGN A;  1YQ1 A;  2VO4 A;  2YCD A;  4F0C A;  2VCX A;  4AI6 A;  6GST A;  4GF0 A;  5AIX A;  6GSU A;  5JCU A;  4IVF A;  2OAD A;  1BAY A;  2CAI A;  1OKT A;  3Q18 A;  3LG6 A;  3MDK A;  5A1N B;  5ELA A;  2EFC A;  2WVX A;  3ERG A;  3L0H A;  1GSQ A;  16GS A;  3EIN A;  4ISD A;  3TOU A;  2DC5 A;  1K3O A;  5F0G A;  1TXU A;  4GSN A;  5F07 A;  3KM6 A;  1YY7 A;  5G5F A;  11GS A;  1GTA A;  5A5H B;  4O7H A;  5DJL A;  1PL2 A;  1Y6E A;  1M99 A;  2HSN B;  3SWL A;  4ZB8 A;  5DAK B;  3N5O A;  4N3Z A;  1TU7 A;  1FHE A;  1GSS A;  1K0N A;  3GH6 A;  1GLP A;  1A0F A;  4ZB6 A;  1PMT A;  4PNF A;  5B7C A;  17GS A;  5F06 A;  4ECJ A;  4BVY B;  3KXO A;  4G0I A;  4Q5Q A;  4ACS A;  9GSS A;  2C3Q A;  3FR6 A;  4E68 A;  5DDL A;  2PER A;  1GTI A;  1Z9H A;  5AIV A;  1HQO A;  3HJM A;  4F03 A;  3PPU A;  4PI0 C;  1K0C A;  2WS2 A;  1OE7 A;  2OT3 A;  4YAP A;  4ZB9 A;  5D9X A;  4L5L A;  1GUH A;  4MF5 A;  5BMU A;  3HMJ G;  2R6K A;  1ML6 A;  6GSY A;  1VF4 A;  5LD0 A;  4KDU A;  4KX4 A;  5ECQ B;  1BX9 A;  2CAQ A;  3I6A A;  1C72 A;  1VF1 A;  1G6W A;  12GS A;  1TU8 A;  4HZ4 A;  3LFL A;  3R2Q A;  3TOT A;  4AGS A;  3FR3 A;  1PGT A;  5FWG A;  4ZBA A;  1AXD A;  3CHX C;  1YEW C;  3MAK A;  4KDY A;  5J40 A;  5ECP B;  3R3E A;  5D9T A;  1K0M A;  5ECI B;  4DEJ A;  1HNB A;  3H1N A;  4PXO A;  4Q5F A;  1MD3 A;  3O3T A;  3N9J A;  5ECM B;  1B4P A;  3W8S A;  4K0G A;  3ZMK A;  1F3B A;  3F63 A;  4IW9 A;  1EV9 A;  2UZ8 A;  3IK7 A;  4AKX B;  1EOG A;  4PQI A;  1HNA A;  4OFN A;  2C3N A;  1PD2 1;  1SVO A;  4QMK A;  3VPT A;  4NAX A;  18GS A;  4NHW A;  5J4Y A;  3QAV A;  4GSS A;  3C8E A;  1JZR A;  4WR4 A;  4ID0 A;  2GLR A;  4HOJ A;  5ECN B;  5A1N A;  3WYW A;  3GX0 A;  3VLN A;  2GSR A;  3GUS A;  3LXT A;  2FHE A;  3I69 A;  1YKC A;  5DQS A;  2WB9 A;  1BG1 A;  2R5G A;  3ERF A;  5A5H A;  5EL8 A;  5AGY A;  3VK9 A;  4GLT A;  4IQ1 A;  4O92 A;  2HSN A;  4ECB A;  4PGT A;  4PTS A;  5DAK A;  4HZ2 A;  1OYJ A;  1DUG A;  5JCW A;  1M0U A;  2IMI A;  4IEL A;  1N2A A;  1GSD A;  1PKW A;  3GST A;  2O3E A;  4BVY A;  3KMO A;  1BYE A;  4OMV A;  3ZFL A;  3DD3 A;  4IJI A;  3VI7 A;  5AN1 A;  20GS A;  2O36 A;  1RK4 A;  4QQ7 A;  4MPG A;  6GSW A;  1NHY A;  2C3T A;  4MP4 A;  1BG5 A;  3AY8 A;  5ECK B;  5KEJ A;  1BF5 A;  4G0L A;  4RI6 A;  4EDZ A;  3LXZ A;  5A4V A;  2F8F A;  1E6B A;  4Q5R A;  4F0B A;  3CRU A;  1PX6 A;  5A4W A;  1KBN A;  2HNL A;  5A4U A;  4W66 A;  2GTU A;  4EXJ A;  3VI5 A;  2D2Z A;  4JBB A;  2NTO A;  4EDY A;  2HSM B;  5D9V A;  4YH2 A;  2HRK B;  3RBT A;  4IS0 A;  2GSS A;  2VCZ A;  4HJ2 A;  2HRA A;  4PX1 A;  2IL3 A;  3BBY A;  3CRT A;  5ECL B;  5ECR B;  1YDK A;  3QR6 A;  4GCI A;  3RFR C;  5A5K A;  5A34 B;  1SVL A;  3FR9 A;  1GUL A;  5HFK A;  2C80 A;  2VD1 A;  5G5E A;  4G10 A;  4L8E A;  3Q74 A;  2CA8 A;  4E8H A;  1AQV A;  4J2F A;  2A2R A;  5DAL B;  5F8B A;  1LJR A;  4PQH A;  3NIV A;  3U6V A;  3UVH A;  3HJO A;  4E8E A;  3HKR A;  6GSS A;  1HNC A;  4OFT A;  3FYG A;  1GSU A;  3CSJ A;  4ZB7 A;  4G0K A;  4USS A;  1EV4 A;  2WDU A;  4PI2 C;  5D73 A;  2J9H A;  3UBK A;  3GSS A;  5ECH B;  4AKH A;  3GTU B;  3UAP A;  1YVL A;  5IQY A;  4AKI A;  2ON5 A;  2HQT A;  4FQU A;  5FHI A;  2YV9 A;  3WD6 A;  1PA3 A;  1GSY A;  4ZBD A;  4NHZ A;  1F3A A;  4GTU A;  5GSS A;  1VF2 A;  19GS A;  5GZZ B;  3LYP A;  2PVQ A;  2R4V A;  2LJR A;  1TDI A;  5D9W A;  4G01 A;  1EEM A;  1GLQ A;  1LBK A;  4MF7 A;  2DSA A;  3CSH A;  4JED A;  4BL7 B;  5J5N A;  1SVM A;  2JL4 A;  2VCQ A;  5F05 A;  2VCV A;  3VPQ A;  5J4U A;  1M9B A;  1MD4 A;  3IR4 A;  4WR5 A;  5AIS A;  1V2A A;  1GSF A;  3TU3 B;  3IC8 A;  1GSE A;  1GUM A;  1GNW A;  4G19 A;  2WW2 A;  1PL1 A;  1OE8 A;  4RI7 A;  2O5V A;  4PUA A;  1GWC A;  1JLW A;  2VCT A;  4PHZ C;  13GS A;  2C4J A;  2WZS A;  2GDR A;  4K0N A;  4Q5N A;  3M1G A;  4KH7 A;  4LMW A;  3F6D A;  1AW9 A;  2R3X A;  2X64 A;  2IMK A;  3LJR A;  3G7J A;  3QAG A;  4AKG A;  2N5F A;  4N0V A;  5J47 A;  2HSM A;  3PGT A;  2WVY A;  2HRK A;  2WW3 A;  1PN9 A;  1Y1U A;  4YQV A;  1XWK A;  4EC0 A;  3LQ7 A;  1U3I A;  2ON7 A;  2EFE A;  4KDX A;  3ZFB A;  2CZ3 A;  4FXY P;  5DJM A;  1UA5 A;  1K0O A;  3D0Z A;  5A34 A;  7GSS A;  4JZQ A;  1PKZ A;  1XW5 A;  3KMN A;  1K0D A;  1S4B P;  2AAW A;  1AQX A;  4IGJ A;  1MTC A;  1B8X A;  2CZ2 A;  8GSS A;  10GS A;  2WW1 A;  4L5O A;  3VWX A;  1K0A A;  1FW1 A;  3TGZ A;  4BVX B;  5DAL A;  3O76 A;  5FT3 A;  4KF9 A;  2F3M A;  1GUK A;  1USB A;  2UV8 G;  4KSM A;  5DCG A;  1EOH A;  1I1I P;  4GST A;  2EFD A;  4MPF A;  4YAV A;  3LYK A;  2FNO A;  4MDC A;  22GS A;  5EVO A;  1Q4J A;  1K3L A;  3CBU A;  4YQM A;  4TOP A;  3CSI A;  3P90 A;  2EFH A;  3F6F A;  5ECO B;  3GTU A;  4ZBB A;  4MF6 A;  2OAC A;  2WVX B;  14GS A;  3ZML A;  3Q19 A;  3M8N A;  2AB6 A;  6GSV A;  2VCW A;  1JLV A;  2V6K A;  2C8U A;  3M3M A;  1G7O A;  4PNG A;  4YQU A;  4KGI A;  1K3Y A;  1IYI A;  4G9H A;  2GSQ A;  2PGT A;  3DGQ A;  2CVD A;  3KJY A;  4MK3 A;  3RGB C;  4ZXG A;  2A2S A;  4BL7 A;  1XWG A;  2WRT A;  2VKZ G;  1GNE A;  1N25 A;  1U88 A;  1XW6 A;  3QAW A;  1PX7 A;  3FY7 A;  1GTB A;  5ECS A;  3IK9 A;  4OFM A;  1YJ6 A;  4MZW A;  4GDF A;  3ISO A;  4I97 A;  4EE0 A;  3FRC A;  4IKH A;  2WW0 A;  1F2E A;  2GST A;  4KE3 A;  3VUR A;  3IBH A;  3G7I A;  4HI7 A;  1B48 A;  4IQA A;  3GUR A;  3PR8 A;  4KAE A;  5EY6 A;  5BMU B;  2PBJ A;  1TW9 A;  1M9A A;  2OA7 A;  1ZL9 A;  4IBP A;  2VD0 A;  2WJU A;  5J41 A;  2WVZ A;  5ELG A;  3CWG A;  5GST A;  3EE2 A;  6GSX A;  2YV7 A;  1VF3 A;  1GTU A;  1IYH A;  3KTL A;  1AQW A;  1R5A A;  3IE3 A;  2AHE A;  1U87 A;  4CHS A;  2H1L A;  4ECC A;  3LSZ A;  4PUR A;  3P8W A;  3UAR A;  1K0B A;  3UBL A; 
#chains in the Genus database with same CATH homology
 4PI0 C;  1YEW C;  3CHX C;  3RFR C;  4PHZ C;  4PI2 C;  3RGB C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...