5GZZB

Crystal structure of fin219-sjgst complex with ja
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
216
structure length
216
Chain Sequence
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/transferase
molecule keywords Jasmonic acid-amido synthetase JAR1
publication title Structural basis of jasmonate-amido synthetase FIN219 in complex with glutathione S-transferase FIP1 during the JA signal regulation
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 51
structure length 216
sequence length 216
chains with identical sequence C, D, E, F, G
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2016-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02798 GST_N Glutathione S-transferase, N-terminal domain
B PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5gzzB02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5gzzB01
2RLIA 3VWVA 2E2GA 2D2ZA 4MH3A 2DJ2A 3UMAA 3PR8A 4OFNA 3P7XA 4MK3A 1MTCA 1A8LA 3VFIA 1MDJA 5HFKA 3E3EA 5AIXA 3Q6OA 5GAPD 1A24A 3F4SA 4O32A 3ZTLA 2FWHA 1JZDA 2GSTA 4IN0A 3UBLA 4EDZA 3KP9A 4DSSB 2E0QA 3ERWA 2LS5A 1M2DA 2OACA 3HDCA 1GSQA 1AUCA 2KUCA 1IYHA 3G7IA 5JWQB 1BG5A 1GSEA 3GHAA 4XCSA 4KH7A 3Q19A 1R7HA 3LYPA 3UEMA 1HD2A 1M7TA 4Q5RA 3VPQA 1YF1A 4MJCA 4IKHA 4IHUA 4X43A 4O7HA 2DJ1A 4ZB6A 1K0AA 2O87A 2O85A 3GKKA 4PGTA 1WMJA 2DJJA 4MA9A 3GL5A 5HFGA 4E8EA 2R37A 3ZFBA 2VL2A 1F6MC 2HZFA 6GSUA 2H73A 3G7JA 3UOMA 5DCGA 2VUPA 1TU7A 3GKMA 3UBKA 3IV4A 1C72A 1MD4A 3IC4A 3LYKA 5F06A 1TXXA 2OE3A 3RDWA 2CX3A 4ID0A 1R5AA 5B7CA 3QCPA 4KF9A 4NV2A 3KM6A 4XHMA 4NPBA 1YZXA 2PBJA 1PX6A 3C8EA 5EVOA 1TK8B 2C0DA 1O8XA 4XS4B 3I6AA 4OWYA 1TDIA 4WR4A 4FIWA 4BWSA 10GSA 3GSSA 3M1GA 1EV4A 5H5RA 2C0EA 4PUFC 3R3EA 5ECSA 1I9DA 3UJ1A 1M99A 1M9BA 4QL7A 2VLTA 5C00A 4YQMA 3U5RE 3L78A 1BEDA 3NOFA 2RM6A 4IGJA 5AIVA 3RPNA 1AAZA 2B6MA 4HU9A 4GCIA 2VIMA 1T00A 2H1DA 3WGEA 1AQWA 3QMXA 4ML1A 4GF0A 4HZ4A 5EL8A 5HQPA 2LKUA 2NVLA 3I69A 1FO5A 2WRTA 4KUNA 2F51A 1X9MB 3FZ9A 3D21A 4I97A 1FB6A 1GSYA 3KGKA 4ECJA 2WZ9A 5ECOB 4Q5QA 2C3TA 2HRKB 3F3QA 4KDUA 1EZKA 5G31A 2DBCA 4KSOA 5ECRB 2PVQA 1OVNA 5ECIB 4NHWA 4KDYA 4ACSA 6GSXA 2B3SA 2AB6A 2MMZA 1BAYA 3IDVA 5HFIA 3WT1A 1TRWA 20GSA 4GSSA 5CREA 2A4VA 5ABRA 4XS4A 2FWFA 1S3AA 3G9BA 4K0NA 5ECNB 1A0FA 4KNDA 16GSA 3O6TA 1TI1A 5IQYA 4MABA 2MMOA 2IWTA 2CAQA 2X8CA 5DAKB 3C73A 1WIKA 4O92A 2VOCA 3D6IA 2IMKA 2B1LA 2DJKA 3APOA 4K7IA 2FY6A 1ERWA 2C3QA 1HYUA 4WETA 3TDGA 2V6KA 2GQKA 1SKWB 1XW5A 3UVHA 4ZBDA 5IMVA 4ILFA 2YZHA 1K3YA 1AQXA 4GSNA 2CT6A 3H8QA 3TRQA 4TOPA 1OE8A 5IO2A 4EXJA 5ECMB 2HQTA 4ML6A 3GKXA 3ZVJA 1Z9HA 4AJ7A 1XWBA 2FNOA 4IP6A 4XRDA 3D4TA 2I81A 4X1UA 3ZREA 2YWNA 2Z9SA 2VCTA 1QFNA 2MMAA 3ZMLA 1PKZA 2CVDA 1YKAA 2EC4A 1BJXA 2L4QA 5HR2A 3SBCA 2WGRA 5DBQA 4MLYA 2G2QA 3L9SA 3BCKA 1TRSA 5CRDA 3LORA 3F8UA 4D73A 1PX7A 4V2NA 1B4PA 2PUKC 2BMXA 5DAKA 2YWMA 5GAND 1GUKA 2FWGA 3LFLA 5KEJA 4HU7A 1SJZA 3MSZA 2V32A 5ELGA 1GLQA 1DBYA 2IMIA 3F3RA 4FQUA 4F03A 5D73A 3WD6A 2OE1A 1U88A 1A0RP 2B5XA 4ECBA 5CRWA 4LMVA 4L5OA 1RW1A 4IJ3A 3TKRA 2B5EA 1X5CA 5CRGA 2JZTA 1XVQA 5J3RA 1S3CA 4F0CA 2GZPA 4IVFA 4XS1A 5DCHA 1W89A 4G10A 4JU5A 3BOAA 1FW1A 3H1NA 3HHVA 3MAKA 3GX0A 1B4QA 1AIUA 1ON4A 4GTUA 2E2MA 1TRVA 1KTEA 2L5OA 2YWOA 2OA7A 1X5DA 4MH2A 2CZ3A 3TOUA 2FGXA 3VI7A 2PU9C 2B1KA 3Q74A 4L8EA 1G7OA 3S9FA 1U6TA 1SK2A 3HYPA 5HR3A 5ELAA 4IJIA 2OE0A 2OJLA 3CTGA 2H72A 1PRXA 2DJ0A 1Z5YE 3J7Yb 3LXZA 3W8JA 2H01A 3BD2A 1THXA 3BJ5A 5HR0A 3ED3A 5LNKe 5CAXA 1GTUA 5ID2B 1S3DA 3RAZA 2LNSA 3GL3A 4Z7XA 2FA8A 2CV4A 5IMDA 1PKWA 3APSA 2NBSA 5JWOB 1T7PB 3LGCA 4OO4A 4G0LA 4NMUA 4N0VA 4BWQA 3VWXA 1B48A 1Q4JA 5AN1A 3PINA 3FKFA 2YOIA 4ZBAA 3US3A 3F6DA 2JACA 4G0KA 1GTAA 2OKAA 3IPZA 1GLPA 6GSSA 3BCIA 1XZOA 2GGTA 4JBBA 3LEFA 3UAPA 1K0NA 2BTOT 5IOWA 4MPGA 17GSA 3HVSA 4ZILA 3GTUB 1GH2A 2K18A 5GZZB 4PURA 3VWUA 1YEPA 5B6NA 1EP8A 1XXUA 1J0FA 4ZL8A 3TJGA 4BL7B 1PN9A 2C1YA 3KTBA 1G0TA 4QL9A 3GFKA 3KMOA 2WS2A 4POMA 1VF2A 14GSA 3CRUA 3I9V2 4TR1B 4K7NA 4G19A 3VWWA 3FY7A 4HEA2 1Z7RA 2C80A 3TB2A 2CX4A 3C71A 3GKNA 3GH6A 4G0IA 3FYGA 5ID2A 2O8VB 4KE3A 4K6XA 3EU4A 3QFAC 2YZUA 3R2QA 2YP6A 19GSA 1QXHA 3TKSC 3A5WA 3A2VA 3IAM2 5DJMA 2I3YA 1XW6A 1XVWA 3HVVA 4JZQA 3KMNA 1G6YA 2HSMB 1PD21 1LBKA 5FHIA 2GS3A 1M9AA 1GTIA 4USSA 3J7Yk 5A5KA 2M80A 1G7EA 4OFTA 3E0UA 4MJAA 5CYYA 3TRXA 2YNXA 1M2BA 3QPMA 1A2MA 2HYXA 5HR1A 4YH2A 2DMLA 3DD3A 3G7YA 1U87A 5IIZA 4NAXA 3OR5A 2YPMA 2H8LA 2KLXA 4EL1A 3GTUA 1ABAA 3ZFLA 4E8HA 1ZOFA 3PPUA 4O5RA 1XOAA 4MPFA 4WBJA 1B8XA 1GUHA 4MF6A 5DJLA 5ECLB 2GSQA 4BL7A 3KEBA 4TXVA 4OMVA 3QAGA 2MBTA 1OC9B 2JADA 3F0IA 1NHOA 2QSIA 1GWCA 1CQHA 3MWHA 3UVTA 5F07A 3FEUA 2LRNA 2DC5A 4TR1A 1K3OA 4DSQA 2MYGA 2C8UA 4F9ZA 2V2GA 3IHQA 4LL1B 1X9SB 3IK7A 2VD1A 5G1LA 2RIIA 4KDXA 2O7KA 3D22A 3F6FA 1MEKA 4DSSA 4TXOB 4PUAA 2IFQB 3DGQA 1F37A 5B8BA 1JLVA 3D4MA 2VO4A 1KNGA 1JZWA 2F8AA 1PGTA 5BMUA 3ME8A 2FD3A 4GQFA 3C1SA 3HJMA 3I43A 2P5RA 1YQ1A 3EINA 2R2JA 3ZLPA 1FG4A 2L57A 4ZXGA 1A8YA 1J08A 1U3AA 4XRAA 1EGOA 1R5PA 2CZ2A 2KP1A 1SKRB 4KW6A 1XIYA 4TR4A 1A23A 3HA9A 2BJXA 3IBHA 2H6ZA 4I8BA 3GMFA 5D8IA 4HUAA 5GSSA 2XPEA 2KHPA 2L6CA 2GZZA 1QQ2A 5D93A 2CA8A 3QOUA 2IMDA 2XHFA 3L4NA 5IMCA 2N5AA 3HJPA 3DKSA 2HXKA 2H70A 4MDCA 1V40A 2F3MA 1XBSA 5F0GA 1HNAA 2HRFA 1EEMA 4RQRA 5H5SA 1WJKA 3A3TA 4ISDA 1K3LA 2FCHA 3H4KA 2PGTA 3APQA 5ECHB 2KP2A 4L5LA 2VCVA 2VL9A 1T4YA 2M46A 3F4RA 4HQSA 2AYTA 4F82A 4TXOA 1HNCA 3ZMKA 3TJBA 2IFQA 5CO3A 3TCOA 3M9JA 5EY6A 2H1AA 2VM1A 3F4TA 3RHBA 2IMEA 1SJIA 4XIHA 4WF4A 4J2FA 3HXSA 4KGIA 2I9HA 2R4VA 4RI6A 5DALB 4WXTA 5ENUA 2IMFA 3SWLA 4YQVA 3HKRA 2X64A 3GA4A 5DQYA 1K0OA 4IBPA 4HOJA 3ZIVA 1SENA 2R6KA 1EOHA 2H75A 4TVEA 2HT9A 3KP8A 1AW9A 3EC3A 1XOBA 2H71A 2MBSA 1PQNA 1UN2A 1E2YA 2HRAA 3HD5A 5CRHA 4I6XA 1SL0B 1ZCPA 3H79A 3KZQA 4GWRA 5KN2A 3CYNA 3IXRA 1Z6MA 1SK1A 6GSTA 2P0GA 5E59A 3ZL5A 2CVBA 2VD0A 3TKSA 4WKWA 4NXIA 3FW2A 3EURA 4AF2A 1OKTA 1SK0A 4FO5A 1VF1A 1JFUA 1MDKA 2HRKA 4I2TA 4RUVA 5CNWA 1ZL9A 3IOSA 4Q5NA 1A2LA 1BQ7A 3DXBA 5IMAA 2H66A 3FHKA 1GSFA 5FT3A 1O85A 2XPDA 3TJJA 4ZL7A 1HNBA 3WGDA 1WOUA 4MMMA 2H1GA 2LRCA 1XWCA 3GYKA 4EDYA 4EE0A 3V1WA 5ECQB 3ISOA 4PQIA 3P2AA 4ZB9A 2P5QA 1TRUA 3KXOA 3CXGA 4XS6A 1JHBA 3FR3A 1YEXA 2VLUA 2H1BA 3FZAA 5DALA 1SYXA 2TRCP 5INYA 3DVXA 2VCXA 3M9KA 4TN8A 4IQAA 12GSA 4EF0A 4EVMA 3CTFA 2FHEA 4KAEA 3M8NA 1O81A 2H30A 4V1Ap 5JWRB 3IK9A 4TW5A 1H4OA 1QUWA 4RQXA 2YV7A 1GTBA 3CSIA 2OBKA 1H75A 3F63A 3KH7A 2ZUPA 1IYIA 2JSZA 2JZRA 3ME7A 6GSVA 4HDEA 5IM9A 4POLA 3HVXA 18GSA 2IIYA 2A2SA 3GN3A 3F9UA 4I5QA 2H0HA 3IAS2 2JSYA 3E9JB 2WJUA 2DIYA 2MZCA 4WEYA 5ECKB 3M0FA 3M3MA 4JR6A 1YF0A 1GULA 11GSA 2FWEA 1JZOA 1PSQA 2JZSA 1V58A 3LQ7A 4TR0A 1J9BA 1ZYQB 2GLRA 3GNJA 4POBA 1K0DA 4N0ZA 1TJDA 4G2EA 1DUGA 2L4CA 4K2DA 3AY8A 3TGZA 3HZ4A 2F8FA 5AGYA 4KSMA 5J4UA 4J56E 2YN1A 1K0CA 1SJ6A 1WP0A 1M0UA 1QMVA 3FRCA 2WFCA 3VK9A 4HZ2A 3TKSE 5KN1A 3CBUA 2J9HA 2AV4A 3RHCA 1ERVA 1OYJA 1OC3A 4G9HA 3DVWA 2LV3A 5IMFA 5GSTA 2QKEA 1JLWA 1I5GA 3EE2A 1MD3A 4BVYB 2GSSA 1ZZYA 4PNGA 2K9FA 2X8GA 3MNGA 3TKPA 1GSUA 4ZL9A 4PXOA 5B8AA 2X99A 5IOXA 4NV5A 5LD0A 3D5JA 5JCUA 3CRTA 8GSSA 1WRYA 3ZRDA 1SL1B 1X9WB 3TRPA 2GTUA 3Q18A 1LU4A 2REMA 4JE1A 1X0RA 4F2IA 5IPGA 3WGXA 2R3XA 3EWLA 4L0UA 1K0MA 4HS1A 22GSA 1OC8A 2I1UA 4HJMA 1R4WA 2FA4A 3EVIA 1EOGA 3L0HA 3QFBC 1F9MA 3DIEA 1R26A 6GSYA 2IL3A 4JRRA 2C4JA 1XFLA 4AJ8A 1VF4A 3UARA 4POKA 2C3NA 3U6VA 1BX9A 5KN0A 1EWXA 2WCIA 4MP4A 2CVKA 4IQ1A 1N8JA 1WWJA 4KA0A 4P3YB 1VRSD 2LEGA 1OAZA 1VF3A 5G30A 5JCWA 1DE1A 3DYRA 2EIRA 1GP1A 1O73A 2ALBA 4DEJA 3TKQA 2XC2A 1GSSA 2GT6A 2WB9A 2RM5A 5J41A 4BVYA 3HZ8A 1WPIA 3GUSA 1FOVA 1O8WA 2UZ8A 3A2WA 1QGVA 2CQ9A 2GZYA 4V1Ag 3QAWA 4LLRA 2ES7A 3L9UA 4YAVA 4ZIJA 1XWAA 2LJAA 4H86A 2OADA 5DQSA 5G5FA 2C0GA 3KTLA 1XCCA 2VM2A 2P31A 4WF5A 4KX4A 5AISA 3TOTA 4YQUA 4BPYA 4RI7A 4N10A 4NWYA 2HNLA 1Z3EA 1TTZA 3GRXA 1FVKA 1ZGNA 4K7OA 2LQOA 2PWJA 2AUVA 2DLXA 3LSZA 3NIVA 2R5GA 5A4VA 1V9WA 5D9XA 3BBYA 1V98A 4X0XA 3IA1A 2HLSA 2AJQB 1DE2A 4GRFA 4ULXA 3GIXA 5IMZA 4JEDA 1Z7PA 2LQQA 1T1VA 3KJYA 1CQGA 3HY2A 3N5OA 3QAVA 3DEXA 5COHA 1SL2B 4EO3A 4OCFA 2RUEA 2ON7A 7GSSA 3KIJA 2H76A 1LJRA 3W8SA 5G5EA 3NZNA 4ZB8A 2WULA 5J9CA 2OBIA 2EIQA 1PA3A 1NW2A 1E6BA 1TK0B 4PNFA 4DVCA 2IPAA 3EMXA 1XWKA 4GQCA 1KEBA 4LL4B 4TR3A 4MF5A 2HSMA 5JCGA 1Q98A 2V1MA 4CDOA 4ECCA 3JCML 3LWAA 4YAPA 1EEJA 3EYTA 2K6VA 4FH8A 1N2AA 4HQZA 5D9VA 4IP1A 1GNWA 5H5QA 2HFDA 3HJOA 2PN8A 2N5BA 1YJ6A 4KCAA 1OC9A 1TP9A 3GSTA 4FYBA 2NDOA 4GXZA 5LCZA 2AHEA 2WDUA 1TKDB 2LRTA 3LXTA 4MJBA 1SYRA 2VCQA 2JU5A 1HQOA 4N30A 4MZBA 3K8NA 5C04A 1WE0A 3QR6A 5E4WA 1W4VA 2DMMA 1X5EA 2YANA 2C0FA 1B9YC 1Y25A 1TI3A 2I4AA 2XBIA 2LSTA 3RPPA 1O6JA 5CP1A 1BYEA 2LJRA 2HE3A 3ERGA 3A2XA 1F3BA 4OCEA 5EPFA 3QD9A 1RK4A 2YJ7A 1XPVA 2NPBA 1PL1A 1K0BA 4EC0A 9GSSA 4J57E 1TW9A 5IO0A 2VAFA 2HRNA 2B5YA 2HI7A 5FWGA 1UVZA 1F2EA 3LJRA 1OKDA 3FR6A 1V2AA 1GUMA 1YY7A 3H93A 4TKYA 1JZRA 3DMLA 4MZCA 3PGTA 2GQLA 3DWVA 4V2LA 2VL3A 3GV1A 4D73B 1F3AA 1V57A 2F9SA 2YCDA 1PMTA 2L59A 2PERA 4QQ7A 3UL3A 2DSAA 2JL4A 3ZVJD 2B7KA 1G6WA 4KCEA 5F8BA 1FB0A 3CSJA 5A4UA 1T8EB 1ST9A 3L9VA 5B6MA 2YJHA 2MMNA 1M2AA 3ZZXA 4PTSA 3VPTA 5A4WA 3FK8A 5KN3A 4GSTA 2DIZA 5DVBA 5ECPB 4JR4A 3ZYWA 4OFMA 2PPTA 2IJYA 3IC8A 2TIRA 3N9JA 1PL2A 1ILOA 2ZCTA 1UA5A 1OE7A 3D0ZA 1SD9A 2E7PA 2X8HA 3GURA 2VCWA 1YKCA 2QC7A 3IR4A 1NSWA 4LMWA 4FYUA 3TUEA 2HSHA 4ECIA 3C7MA 3CSHA 1USBA 4OD7A 4OO5A 1ML6A 4ZBBA 1ERTA 1EV9A 2HZEB 1ACVA 1XW9A 2YWIA 1TK5B 3DRNA 3FZ5A 1SU9A 2LJKA 2G0FA 1EP7A 2M72A 3GX8A 5G1KA 4DSRA 2CAIA 4PQHA 4F0BA 2HSYA 2H74A 1GSDA 3VURA 4WBRD 4EKZA 4Q5FA 3KD0A 1AC1A 3KCMA 2K8VA 5IPHA 2A2RA 5DDLA 2IN3A 1A2JA 1GRXA 3CMIA 2VL2C 2YV9A 1T3BA 3O76A 4K9ZA 3RBTA 1NM3A 4I2UA 2FLSA 3GH9A 2XBQA 5D96A 4PQ1A 1FHEA 4IELA 3IRAA 1SD8A 1XWGA 1TOFA 4IS0A 3ZITA 4MF7A 4GLTA 2B7JA 3KH9A 5D9TA 4IW9A 2ON5A 2N5FA 6GSWA 1GL8A 4BVXB 4LA1A 1B9XC 4AGSA 3VLNA 1THOA 2GT5A 2GSRA 2VCZA 1T4ZA 4CW9A 3LG6A 2L6DA 1AQVA 4N11A 1UC7A 1RQMA 3VI5A 3FZ4A 4AJ6A 4MZWA 2ZNMA 4TRXA 3FR9A 3TJFA 1Y6EA 1MDIA 2DJ3A 3C1RA 2HZEA 1O7UA 2V6OA 5D9WA 2FUG2 2RUFA 2AAWA 3MDKA 3HCZA 4XTSA 3O3TA 1VGLA 4K0GA 3W6GA 4PX1A 1ZYEA 3UIWA 4HJ2A 2PMTA 5J5NA 2H0IA 1EGRA 1FAAA 4K8MA 3ZIJA 2HSNB 4BA7A 1TU8A 2H19A 5J9BA 2GDRA 2VLVA 5L71A 4CHSA 2LNTA 1GNEA 2GQMA 4V2MA 2NTOA 4WR5A 5G2ZA 4KB3A 4EUYA 2J23A 1U3IA 3EU3A 1URMA 1Z6NA 4FYCA 1ZMAA 2K8SA 2H0GA 4MCUA 2LTKA 1FVJA 1AXDA 4HI7A 2H6XA 3EMPA 3TJKA 1ERUA 1NHYA 4BVXA 1YDKA 5F05A 3P90A 2QGVA 3IE3A 1KBNA 1DSBA 2L5LA 1SKSB 3P8WA 2LUSA 2O89A 3ERFA 2EIOA 2PVOC 2V41A 4L0WA 2TRXA 4MJEA 3PH9A 3QDNA 2KOKA 3WT2A 2H6YA 4K1FA 13GSA 3WYWA 4NHZA 1QK8A 2GVPA
chains in the Genus database with same CATH superfamily
2RLIA 3VWVA 2E2GA 2D2ZA 4MH3A 2DJ2A 3UMAA 3PR8A 4OFNA 3P7XA 4MK3A 1MTCA 1A8LA 3VFIA 1MDJA 5HFKA 3E3EA 4N3ZA 5AIXA 3Q6OA 5GAPD 1A24A 3F4SA 4O32A 3ZTLA 2FWHA 1JZDA 2HSNA 2GSTA 1PFOA 4IN0A 3UBLA 4EDZA 3KP9A 4DSSB 2E0QA 3ERWA 2EFDA 4PHZC 2LS5A 1M2DA 2OACA 3HDCA 1GSQA 1AUCA 2KUCA 3G7IA 1IYHA 5JWQB 1BG5A 4YKGA 1GSEA 3GHAA 4XCSA 4KH7A 3Q19A 1R7HA 3LYPA 3UEMA 1HD2A 1M7TA 4Q5RA 3VPQA 1YF1A 4MJCA 4IKHA 4IHUA 4X43A 2VKZG 4O7HA 2DJ1A 4ZB6A 1K0AA 2O87A 2O85A 3GKKA 4PGTA 1WMJA 2DJJA 4MA9A 3GL5A 1ZYPA 5HFGA 4E8EA 2R37A 3ZFBA 2VL2A 1F6MC 2HZFA 6GSUA 2H73A 3G7JA 3UOMA 5DCGA 4AI6A 2VUPA 1TU7A 3GKMA 3UBKA 3IV4A 1C72A 1MD4A 3IC4A 3LYKA 5F06A 4K2XA 1TXXA 2OE3A 3RDWA 2CX3A 3FMWA 4ID0A 1R5AA 5B7CA 3QCPA 4KF9A 4NV2A 3KM6A 4XHMA 4NPBA 1YZXA 2EFEA 2PBJA 2WVZA 1PX6A 3C8EA 5EVOA 4K5SA 1TK8B 4AKHA 2C0DA 1O8XA 4XS4B 3I6AA 4OWYA 1TDIA 4WR4A 4FIWA 4BWSA 10GSA 3GSSA 3M1GA 1EV4A 5H5RA 2C0EA 4PUFC 3R3EA 3LW9A 5ECSA 1I9DA 3UJ1A 1M99A 1M9BA 4QL7A 2VLTA 5C00A 4YQMA 3U5RE 3L78A 1BEDA 3NOFA 2RM6A 4IGJA 5AIVA 2UV8G 3RPNA 1AAZA 2B6MA 4HU9A 4GCIA 2VIMA 1T00A 2EFHA 2H1DA 3WGEA 1AQWA 3QMXA 4ML1A 4GF0A 4HZ4A 5EL8A 5HQPA 1XG8A 2LKUA 2NVLA 3I69A 1FO5A 2QA2A 3HMJG 2WRTA 4KUNA 2F51A 1X9MB 3FZ9A 3D21A 4I97A 1FB6A 1GSYA 3KGKA 4ECJA 2WZ9A 5ECOB 4Q5QA 2C3TA 2R0GA 2HRKB 3F3QA 4KDUA 1EZKA 2A4HA 5G31A 2DBCA 4KSOA 5ECRB 2PVQA 1OVNA 5ECIB 4NHWA 4KDYA 4ACSA 6GSXA 2B3SA 2AB6A 2MMZA 1BAYA 3IDVA 5HFIA 3WT1A 1TRWA 20GSA 4GSSA 5A1NB 5CREA 2A4VA 5ABRA 4XS4A 2FWFA 1S3AA 3G9BA 4A5PA 4K0NA 5ECNB 1A0FA 4KNDA 16GSA 3O6TA 1TI1A 5IQYA 4MABA 2MMOA 2IWTA 2CAQA 2X8CA 5DAKB 3C73A 1WIKA 4O92A 2VOCA 3D6IA 2IMKA 2B1LA 2DJKA 3APOA 4K7IA 2FY6A 1ERWA 2C3QA 1HYUA 4WETA 3TDGA 2V6KA 4PI0C 2GQKA 1SKWB 1XW5A 3UVHA 4ZBDA 5IMVA 4ILFA 2YZHA 1K3YA 1AQXA 4GSNA 2CT6A 3H8QA 5J4YA 3TRQA 4TOPA 1OE8A 5IO2A 4EXJA 5ECMB 2HQTA 4GDFA 4ML6A 3GKXA 3ZVJA 1Z9HA 4AJ7A 1XWBA 2FNOA 4IP6A 4XRDA 3D4TA 2I81A 4X1UA 3ZREA 2YWNA 2Z9SA 2VCTA 1QFNA 2MMAA 3ZMLA 1PKZA 2CVDA 1YKAA 2EC4A 1BJXA 2WW0A 2L4QA 5HR2A 5A1NA 3SBCA 2WGRA 1N25A 5DBQA 4MLYA 4X4JA 2G2QA 3L9SA 3BCKA 1TRSA 5CRDA 3LORA 3F8UA 4D73A 1PX7A 4V2NA 1B4PA 2PUKC 2BMXA 5DAKA 2YWMA 5GAND 1GUKA 2FWGA 3LFLA 5KEJA 4HU7A 1SJZA 3MSZA 2V32A 5ELGA 1GLQA 1DBYA 2IMIA 3F3RA 4FQUA 1Y1UA 4F03A 5D73A 3WD6A 2OE1A 1U88A 1A0RP 2B5XA 4ECBA 5CRWA 4LMVA 4L5OA 1RW1A 4IJ3A 3TKRA 2B5EA 1X5CA 5CRGA 2JZTA 1XVQA 5J3RA 1S3CA 4F0CA 2GZPA 4IVFA 4XS1A 5DCHA 1W89A 4G10A 4JU5A 3BOAA 1FW1A 3H1NA 3HHVA 3MAKA 3GX0A 1B4QA 1AIUA 1ON4A 4GTUA 2E2MA 1SVMA 1TRVA 1KTEA 2L5OA 2R0PA 2YWOA 2OA7A 1X5DA 4MH2A 2CZ3A 3TOUA 4CY8A 2FGXA 3VI7A 2PU9C 2B1KA 3Q74A 4L8EA 1G7OA 3S9FA 1U6TA 1SK2A 3HYPA 5HR3A 3TU3B 5ELAA 4IJIA 2OE0A 2OJLA 3CTGA 2H72A 1PRXA 2DJ0A 1Z5YE 3J7Yb 3LXZA 3W8JA 2H01A 3BD2A 1THXA 3BJ5A 5HR0A 3ED3A 2O36A 5LNKe 5CAXA 1GTUA 5ID2B 1S3DA 3RAZA 2LNSA 3GL3A 4Z7XA 2FA8A 2CV4A 5IMDA 1PKWA 3APSA 2NBSA 5JWOB 1T7PB 3LGCA 1SVOA 4OO4A 4G0LA 4NMUA 4N0VA 4BWQA 3VWXA 1B48A 1Q4JA 5AN1A 3PINA 3FKFA 2YOIA 4ZBAA 3US3A 3F6DA 3RGBC 2JACA 4G0KA 1GTAA 2OKAA 2A2PA 3IPZA 1GLPA 3A5IA 6GSSA 3BCIA 1XZOA 2GGTA 4ZB7A 4JBBA 3LEFA 3UAPA 1K0NA 2BTOT 5IOWA 4MPGA 17GSA 3HVSA 3EPTA 4ZILA 3GTUB 1GH2A 2K18A 5GZZB 4PURA 3VWUA 1YEPA 5B6NA 1EP8A 1XXUA 1J0FA 4ZL8A 3TJGA 4BL7B 1PN9A 2C1YA 3KTBA 2X49A 1S4BP 1G0TA 4QL9A 3GFKA 3KMOA 2WS2A 4POMA 1VF2A 14GSA 3CRUA 3I9V2 4TR1B 4K7NA 4G19A 3VWWA 3FY7A 4HEA2 1Z7RA 2C80A 3TB2A 1S3RA 2CX4A 3C71A 3GKNA 3GH6A 1ZYNA 4G0IA 3FYGA 5ID2A 2O8VB 4KE3A 4K6XA 2O3EA 3EU4A 3QFAC 2YZUA 3R2QA 2YP6A 19GSA 1QXHA 3TKSC 3A5WA 3A2VA 3IAM2 5DJMA 2I3YA 1XW6A 1XVWA 3HVVA 5BMUB 4JZQA 4CY6A 3KMNA 1G6YA 2HSMB 1PD21 1LBKA 5FHIA 2GS3A 1M9AA 1GTIA 4USSA 3J7Yk 5A5KA 2M80A 1G7EA 4OFTA 4AKGA 3E0UA 4MJAA 5CYYA 2YNXA 3TRXA 1M2BA 3QPMA 1A2MA 2HYXA 5HR1A 4YH2A 2DMLA 3DD3A 3G7YA 1U87A 5IIZA 4NAXA 3OR5A 2YPMA 2H8LA 2KLXA 2QA1A 4EL1A 3GTUA 4YKFA 1ABAA 3ZFLA 4E8HA 1ZOFA 3PPUA 4O5RA 1BG1A 1XOAA 4MPFA 4WBJA 1B8XA 2O5VA 1GUHA 4MF6A 5DJLA 5ECLB 2GSQA 4BL7A 3KEBA 4TXVA 4OMVA 3QAGA 2MBTA 1FOHA 1OC9B 2JADA 3F0IA 1NHOA 2QSIA 1GWCA 1CQHA 3MWHA 3UVTA 5F07A 3FEUA 2LRNA 2DC5A 4TR1A 1K3OA 4DSQA 2MYGA 2C8UA 4F9ZA 1M3IA 2V2GA 3IHQA 4LL1B 1X9SB 4G01A 3IK7A 2VD1A 5G1LA 2RIIA 4KDXA 2O7KA 3D22A 3F6FA 1MEKA 4DSSA 4TXOB 4PUAA 5J40A 2IFQB 3DGQA 1F37A 1YVLA 5B8BA 1JLVA 3D4MA 2VO4A 1KNGA 1JZWA 2F8AA 1PGTA 5BMUA 3ME8A 2FD3A 4GQFA 3C1SA 3HJMA 3I43A 2P5RA 1YQ1A 3EINA 2R2JA 3ZLPA 1FG4A 2L57A 4ZXGA 1A8YA 1J08A 1U3AA 4XRAA 1EGOA 1R5PA 2CZ2A 2KP1A 1SKRB 4KW6A 1XIYA 4BIKA 4TR4A 1A23A 3HA9A 2BJXA 3IBHA 2H6ZA 4I8BA 3GMFA 5D8IA 4HUAA 5GSSA 2XPEA 2KHPA 2L6CA 2GZZA 1QQ2A 4O5UA 5D93A 2CA8A 3QOUA 2IMDA 2XHFA 3L4NA 5IMCA 2N5AA 3HJPA 3DKSA 2HXKA 2H70A 4MDCA 1V40A 2F3MA 1XBSA 5F0GA 1HNAA 2HRFA 1EEMA 4RQRA 5H5SA 1WJKA 3A3TA 4ISDA 1K3LA 2FCHA 3H4KA 2PGTA 3APQA 5ECHB 2KP2A 4L5LA 2VCVA 2VL9A 1T4YA 2M46A 3HVNA 3F4RA 4HQSA 2AYTA 4F82A 4TXOA 1HNCA 5A5HB 3ZMKA 3TJBA 2IFQA 5CO3A 3TCOA 3M9JA 5EY6A 2H1AA 4Z2RA 2VM1A 2DKIA 3F4TA 3RHBA 2IMEA 1SJIA 4XIHA 4WF4A 4J2FA 3HXSA 4KGIA 2I9HA 2R4VA 4RI6A 5DALB 4WXTA 5ENUA 2IMFA 3SWLA 4YQVA 3HKRA 2X64A 3GA4A 5DQYA 1K0OA 4IBPA 4HOJA 2EFCA 3ZIVA 1SENA 2R6KA 1EOHA 2H75A 4TVEA 2WZSA 2HT9A 3KP8A 1AW9A 3EC3A 1XOBA 2H71A 2MBSA 1PQNA 1UN2A 1E2YA 2HRAA 3HD5A 5CRHA 4I6XA 1SL0B 4Z2UA 1ZCPA 3H79A 3KZQA 4GWRA 5KN2A 3CYNA 3IXRA 1Z6MA 1SK1A 6GSTA 2P0GA 5E59A 3ZL5A 2CVBA 2VD0A 3TKSA 2WVXB 1M3JA 4WKWA 4NXIA 3FW2A 3EURA 4AF2A 1OKTA 1SK0A 4FO5A 1VF1A 1JFUA 1MDKA 2HRKA 4I2TA 4RUVA 5CNWA 1ZL9A 3IOSA 4Q5NA 3RFRC 1A2LA 1BQ7A 3DXBA 5IMAA 2H66A 3FHKA 1GSFA 5FT3A 1O85A 2XPDA 3TJJA 4ZL7A 1HNBA 1BF5A 3WGDA 1WOUA 4MMMA 2H1GA 3IHGA 2LRCA 1XWCA 3GYKA 4EDYA 4EE0A 3V1WA 5ECQB 3ISOA 4PQIA 3P2AA 4ZB9A 2P5QA 2WW1A 1TRUA 3KXOA 3CXGA 4XS6A 1JHBA 3FR3A 1YEXA 2VLUA 2H1BA 3FZAA 5DALA 1SYXA 2TRCP 5INYA 4AKXB 3DVXA 2VCXA 3M9KA 4TN8A 4IQAA 12GSA 4EF0A 4EVMA 3CTFA 2FHEA 4KAEA 3M8NA 1O81A 2H30A 4V1Ap 5JWRB 4EIQA 3IK9A 4TW5A 1H4OA 1QUWA 4RQXA 2YV7A 1GTBA 3CSIA 4PI2C 2OBKA 1H75A 3F63A 3KH7A 2ZUPA 1IYIA 4Z2TA 2JSZA 2JZRA 3ME7A 6GSVA 1TXUA 4HDEA 5IM9A 4POLA 3HVXA 18GSA 2IIYA 2A2SA 3GN3A 3F9UA 4I5QA 2H0HA 3IAS2 2JSYA 3E9JB 2WJUA 2DIYA 2MZCA 2X4AA 4WEYA 5ECKB 3M0FA 3M3MA 4JR6A 1YF0A 1GULA 11GSA 2FWEA 1JZOA 1PSQA 2JZSA 1V58A 3LQ7A 4TR0A 1J9BA 1ZYQB 2GLRA 5J47A 3GNJA 4POBA 1K0DA 4N0ZA 1TJDA 4G2EA 1DUGA 2L4CA 4K2DA 3AY8A 3TGZA 3HZ4A 2F8FA 5AGYA 4KSMA 5J4UA 4J56E 2YN1A 1K0CA 1SJ6A 1WP0A 1M0UA 1QMVA 3FRCA 2WFCA 3VK9A 4HZ2A 3TKSE 5KN1A 4FXYP 3CBUA 2J9HA 2AV4A 3RHCA 1ERVA 1OYJA 1OC3A 4G9HA 3DVWA 2LV3A 5IMFA 5GSTA 2QKEA 1JLWA 1I5GA 3EE2A 1MD3A 4BVYB 2GSSA 1ZZYA 4PNGA 2K9FA 2X8GA 3MNGA 3TKPA 1GSUA 4ZL9A 5A34B 4PXOA 5B8AA 2X99A 5IOXA 4NV5A 5LD0A 3D5JA 5JCUA 3CRTA 8GSSA 1WRYA 3ZRDA 1SL1B 1X9WB 4EIPA 3TRPA 2GTUA 3Q18A 1LU4A 2REMA 4JE1A 1X0RA 4F2IA 5IPGA 3WGXA 2R3XA 3EWLA 4L0UA 2WW3A 1K0MA 4HS1A 22GSA 4E68A 1OC8A 2I1UA 4HJMA 1R4WA 2FA4A 3EVIA 1EOGA 3L0HA 3QFBC 1F9MA 5BRTA 3DIEA 4HSCX 1R26A 6GSYA 2IL3A 4JRRA 2C4JA 1XFLA 4AJ8A 1VF4A 3UARA 4POKA 2C3NA 3U6VA 1BX9A 5KN0A 1EWXA 2WCIA 4MP4A 2CVKA 4IQ1A 1N8JA 1WWJA 4K5RA 4KA0A 4P3YB 1VRSD 2LEGA 1OAZA 1VF3A 5G30A 5JCWA 1DE1A 3DYRA 2EIRA 1GP1A 1O73A 2ALBA 4DEJA 3TKQA 2XC2A 1I1IP 1GSSA 2GT6A 2WB9A 2RM5A 5J41A 4BVYA 3HZ8A 2WVYA 1WPIA 3GUSA 1FOVA 5A34A 1O8WA 2UZ8A 3A2WA 1QGVA 2CQ9A 2GZYA 4V1Ag 3QAWA 4LLRA 2ES7A 3L9UA 4YAVA 4ZIJA 1XWAA 2LJAA 4H86A 2OADA 5DQSA 5G5FA 2C0GA 3KTLA 1XCCA 2VM2A 2P31A 4WF5A 4KX4A 5AISA 3TOTA 4YQUA 4BPYA 4RI7A 4N10A 4NWYA 2HNLA 1Z3EA 1TTZA 3GRXA 2WW2A 1FVKA 1ZGNA 1YEWC 4K7OA 2LQOA 2PWJA 2AUVA 2DLXA 3LSZA 3NIVA 2R5GA 5A4VA 1V9WA 5D9XA 3BBYA 2R0CA 1V98A 4X0XA 3IA1A 2HLSA 2AJQB 1DE2A 4GRFA 4ULXA 3GIXA 5IMZA 4JEDA 1Z7PA 2LQQA 1T1VA 3KJYA 1CQGA 3HY2A 3N5OA 3QAVA 3DEXA 5COHA 1SL2B 4EO3A 4OCFA 2RUEA 2ON7A 7GSSA 3KIJA 2H76A 1LJRA 3W8SA 5G5EA 3NZNA 4ZB8A 2WULA 5J9CA 2OBIA 2EIQA 1PA3A 1NW2A 1E6BA 1TK0B 4PNFA 4DVCA 2IPAA 3EMXA 1XWKA 4GQCA 1KEBA 4LL4B 4TR3A 4MF5A 2HSMA 5JCGA 1Q98A 2V1MA 4CDOA 4ECCA 3JCML 3LWAA 4YAPA 1EEJA 3EYTA 2K6VA 4FH8A 5KOXA 1N2AA 4HQZA 5D9VA 4IP1A 1GNWA 5H5QA 2HFDA 5KOWA 3HJOA 2PN8A 2N5BA 1YJ6A 4KCAA 1OC9A 1TP9A 3GSTA 4FYBA 2NDOA 4GXZA 5LCZA 2AHEA 2WDUA 4O5QA 1TKDB 2LRTA 3LXTA 4MJBA 1SYRA 2VCQA 2JU5A 1HQOA 4N30A 4MZBA 3K8NA 5C04A 1WE0A 3QR6A 1PN0A 5E4WA 1W4VA 2DMMA 1X5EA 2YANA 2C0FA 1B9YC 1Y25A 1TI3A 2I4AA 2XBIA 2LSTA 3RPPA 1O6JA 5CP1A 1BYEA 2LJRA 2HE3A 3ERGA 3A2XA 1F3BA 4OCEA 5EPFA 3QD9A 1RK4A 2YJ7A 1XPVA 2NPBA 1PL1A 1K0BA 4EC0A 9GSSA 4J57E 4AKIA 1TW9A 5IO0A 2VAFA 2HRNA 2B5YA 2HI7A 5FWGA 1UVZA 1F2EA 3LJRA 1OKDA 3FR6A 1V2AA 1GUMA 2DKHA 1YY7A 3H93A 4TKYA 1JZRA 3DMLA 4MZCA 3PGTA 2GQLA 3DWVA 4V2LA 2VL3A 3GV1A 4D73B 1F3AA 1V57A 2F9SA 2YCDA 1PMTA 2L59A 2PERA 4QQ7A 3UL3A 2DSAA 2JL4A 1SVLA 3ZVJD 2B7KA 1G6WA 4KCEA 5F8BA 1FB0A 3CSJA 5A4UA 1T8EB 1ST9A 3L9VA 5B6MA 2YJHA 2MMNA 1M2AA 3ZZXA 4PTSA 3VPTA 5A4WA 3FK8A 5KN3A 4GSTA 2DIZA 3CQFA 5DVBA 5ECPB 4JR4A 3ZYWA 4OFMA 2PPTA 2IJYA 3IC8A 2TIRA 3N9JA 1PL2A 1ILOA 2OT3A 3MIXA 2ZCTA 1UA5A 1OE7A 3D0ZA 1SD9A 2E7PA 2X8HA 3GURA 2VCWA 1YKCA 2QC7A 3IR4A 1NSWA 4LMWA 4FYUA 3CWGA 3TUEA 2HSHA 5A5HA 4ECIA 3C7MA 3CSHA 1USBA 4OD7A 4OO5A 1ML6A 4ZBBA 1ERTA 1EV9A 2HZEB 1ACVA 1XW9A 2YWIA 1TK5B 3DRNA 3FZ5A 1SU9A 2LJKA 2G0FA 1EP7A 2M72A 3GX8A 5G1KA 4DSRA 2CAIA 4PQHA 4F0BA 2HSYA 2H74A 1GSDA 3VURA 4WBRD 4EKZA 4Q5FA 3KD0A 3MYDA 1AC1A 3KCMA 2K8VA 5IPHA 2A2RA 5DDLA 2IN3A 1A2JA 1GRXA 3CMIA 3CHXC 2VL2C 2YV9A 1T3BA 3O76A 4MNNA 4K9ZA 3RBTA 1NM3A 4I2UA 2FLSA 3GH9A 2XBQA 5D96A 4PQ1A 1FHEA 2WVXA 4IELA 3IRAA 1SD8A 1XWGA 1TOFA 4IS0A 3ZITA 4MF7A 4GLTA 2B7JA 4ICYA 3KH9A 5D9TA 4IW9A 2ON5A 2N5FA 6GSWA 1GL8A 4BVXB 4LA1A 1B9XC 4AGSA 3VLNA 1THOA 2GT5A 2GSRA 2VCZA 1T4ZA 4CW9A 3LG6A 2L6DA 1AQVA 4N11A 1UC7A 1RQMA 3VI5A 3FZ4A 4AJ6A 4MZWA 2ZNMA 4TRXA 3FR9A 3TJFA 1Y6EA 1MDIA 2DJ3A 3C1RA 2HZEA 1O7UA 2V6OA 5D9WA 4W66A 2FUG2 2RUFA 2AAWA 3MDKA 3HCZA 4XTSA 3O3TA 1VGLA 4K0GA 4QMKA 3W6GA 4PX1A 1ZYEA 3UIWA 4HJ2A 2H1LA 2PMTA 5J5NA 2H0IA 1EGRA 1FAAA 4K8MA 3ZIJA 2HSNB 4BA7A 1TU8A 2H19A 5J9BA 2GDRA 2VLVA 5L71A 4CHSA 2LNTA 1GNEA 2GQMA 4V2MA 2NTOA 4WR5A 5G2ZA 4KB3A 4EUYA 2J23A 1U3IA 3EU3A 1URMA 1Z6NA 4FYCA 1ZMAA 2K8SA 2H0GA 4MCUA 2LTKA 1FVJA 5J4VA 1AXDA 4HI7A 2H6XA 3EMPA 3TJKA 1ERUA 1NHYA 4BVXA 1YDKA 5F05A 3P90A 2QGVA 3IE3A 1KBNA 1DSBA 2L5LA 1SKSB 3P8WA 2LUSA 2O89A 3ERFA 2EIOA 2PVOC 2V41A 4L0WA 2TRXA 4MJEA 3PH9A 3QDNA 2KOKA 3WT2A 2H6YA 4K1FA 13GSA 3WYWA 4NHZA 1QK8A 2GVPA
chains in the Genus database with same CATH topology
2RLIA 3VWVA 2E2GA 2D2ZA 4MH3A 2DJ2A 3UMAA 3PR8A 4OFNA 3P7XA 4MK3A 1MTCA 1A8LA 3VFIA 1MDJA 5HFKA 3E3EA 4N3ZA 5AIXA 3Q6OA 5GAPD 1A24A 3F4SA 4O32A 3ZTLA 2FWHA 1JZDA 2HSNA 2GSTA 4IN0A 3UBLA 4EDZA 3KP9A 4DSSB 2E0QA 3ERWA 2EFDA 2LS5A 1M2DA 2OACA 3HDCA 1GSQA 1AUCA 2KUCA 1IYHA 3G7IA 5JWQB 1BG5A 4YKGA 1GSEA 3GHAA 4XCSA 4KH7A 3Q19A 1R7HA 3LYPA 3UEMA 1HD2A 1M7TA 4Q5RA 3VPQA 1YF1A 4MJCA 4IKHA 4IHUA 4X43A 2VKZG 4O7HA 2DJ1A 4ZB6A 1K0AA 2O87A 2O85A 3GKKA 4PGTA 1WMJA 2DJJA 4MA9A 3GL5A 1ZYPA 5HFGA 4E8EA 2R37A 3ZFBA 2VL2A 1F6MC 2HZFA 6GSUA 2H73A 3G7JA 3UOMA 5DCGA 4AI6A 2VUPA 1TU7A 3GKMA 3UBKA 3IV4A 1C72A 1MD4A 3IC4A 3LYKA 5F06A 4K2XA 1TXXA 2OE3A 3RDWA 2CX3A 3FMWA 4ID0A 1R5AA 5B7CA 3QCPA 4KF9A 4NV2A 3KM6A 4XHMA 4NPBA 1YZXA 2EFEA 2PBJA 1PX6A 3C8EA 5EVOA 4K5SA 1TK8B 4AKHA 2C0DA 1O8XA 4XS4B 3I6AA 4OWYA 1TDIA 4WR4A 4FIWA 4BWSA 10GSA 3GSSA 3M1GA 1EV4A 5H5RA 2C0EA 4PUFC 3R3EA 3LW9A 5ECSA 1I9DA 3UJ1A 1M99A 1M9BA 4QL7A 2VLTA 5C00A 4YQMA 3U5RE 3L78A 1BEDA 3NOFA 2RM6A 4IGJA 5AIVA 2UV8G 3RPNA 1AAZA 2B6MA 4HU9A 4GCIA 2VIMA 1T00A 2EFHA 2H1DA 3WGEA 1AQWA 3QMXA 4ML1A 4GF0A 4HZ4A 5EL8A 5HQPA 2LKUA 2NVLA 3I69A 1FO5A 2QA2A 3HMJG 2WRTA 4KUNA 2F51A 1X9MB 3FZ9A 3D21A 4I97A 1FB6A 1GSYA 3KGKA 4ECJA 2WZ9A 5ECOB 4Q5QA 2C3TA 2R0GA 2HRKB 3F3QA 4KDUA 1EZKA 2A4HA 5G31A 2DBCA 4KSOA 5ECRB 2PVQA 1OVNA 5ECIB 4NHWA 4KDYA 4ACSA 6GSXA 2B3SA 2AB6A 2MMZA 1BAYA 3IDVA 5HFIA 3WT1A 1TRWA 20GSA 4GSSA 5A1NB 5CREA 2A4VA 5ABRA 4XS4A 2FWFA 1S3AA 3G9BA 4A5PA 4K0NA 5ECNB 1A0FA 4KNDA 16GSA 3O6TA 1TI1A 5IQYA 4MABA 2MMOA 2IWTA 2CAQA 2X8CA 5DAKB 3C73A 1WIKA 4O92A 2VOCA 3D6IA 2IMKA 2B1LA 2DJKA 3APOA 4K7IA 2FY6A 1ERWA 2C3QA 1HYUA 4WETA 3TDGA 2V6KA 2GQKA 1SKWB 1XW5A 3UVHA 4ZBDA 5IMVA 4ILFA 2YZHA 1K3YA 1AQXA 4GSNA 2CT6A 3H8QA 5J4YA 3TRQA 4TOPA 1OE8A 5IO2A 4EXJA 5ECMB 2HQTA 4GDFA 4ML6A 3GKXA 3ZVJA 1Z9HA 4AJ7A 1XWBA 2FNOA 4IP6A 4XRDA 3D4TA 2I81A 4X1UA 3ZREA 2YWNA 2Z9SA 2VCTA 1QFNA 2MMAA 3ZMLA 1PKZA 2CVDA 1YKAA 2EC4A 1BJXA 2L4QA 5HR2A 5A1NA 3SBCA 2WGRA 1N25A 5DBQA 4MLYA 4X4JA 2G2QA 3L9SA 3BCKA 1TRSA 5CRDA 3LORA 3F8UA 4D73A 1PX7A 4V2NA 1B4PA 2PUKC 2BMXA 5DAKA 2YWMA 5GAND 1GUKA 2FWGA 3LFLA 5KEJA 4HU7A 1SJZA 3MSZA 2V32A 5ELGA 1GLQA 1DBYA 2IMIA 3F3RA 4FQUA 1Y1UA 4F03A 5D73A 3WD6A 2OE1A 1U88A 1A0RP 2B5XA 4ECBA 5CRWA 4LMVA 4L5OA 1RW1A 4IJ3A 3TKRA 2B5EA 1X5CA 5CRGA 2JZTA 1XVQA 5J3RA 1S3CA 4F0CA 2GZPA 4IVFA 4XS1A 5DCHA 1W89A 4G10A 4JU5A 3BOAA 1FW1A 3H1NA 3HHVA 3MAKA 3GX0A 1B4QA 1AIUA 1ON4A 4GTUA 2E2MA 1SVMA 1TRVA 1KTEA 2L5OA 2R0PA 2YWOA 2OA7A 1X5DA 4MH2A 2CZ3A 3TOUA 4CY8A 2FGXA 3VI7A 2PU9C 2B1KA 3Q74A 4L8EA 1G7OA 3S9FA 1U6TA 1SK2A 3HYPA 5HR3A 3TU3B 5ELAA 4IJIA 2OE0A 2OJLA 3CTGA 2H72A 1PRXA 2DJ0A 1Z5YE 3J7Yb 3LXZA 3W8JA 2H01A 3BD2A 1THXA 3BJ5A 5HR0A 3ED3A 5LNKe 5CAXA 1GTUA 5ID2B 1S3DA 3RAZA 2LNSA 3GL3A 4Z7XA 2FA8A 2CV4A 5IMDA 1PKWA 3APSA 2NBSA 5JWOB 1T7PB 3LGCA 1SVOA 4OO4A 4G0LA 4NMUA 4N0VA 4BWQA 3VWXA 1B48A 1Q4JA 5AN1A 3PINA 3FKFA 2YOIA 4ZBAA 3US3A 3F6DA 2JACA 4G0KA 1GTAA 2OKAA 2A2PA 3IPZA 1GLPA 3A5IA 6GSSA 3BCIA 1XZOA 2GGTA 4ZB7A 4JBBA 3LEFA 3UAPA 1K0NA 2BTOT 5IOWA 4MPGA 17GSA 3HVSA 3EPTA 4ZILA 3GTUB 1GH2A 2K18A 5GZZB 4PURA 3VWUA 1YEPA 5B6NA 1EP8A 1XXUA 1J0FA 4ZL8A 3TJGA 4BL7B 1PN9A 2C1YA 3KTBA 2X49A 1G0TA 4QL9A 3GFKA 3KMOA 2WS2A 4POMA 1VF2A 14GSA 3CRUA 3I9V2 4TR1B 4K7NA 4G19A 3VWWA 3FY7A 4HEA2 1Z7RA 2C80A 3TB2A 2CX4A 3C71A 3GKNA 3GH6A 1ZYNA 4G0IA 3FYGA 5ID2A 2O8VB 4KE3A 4K6XA 3EU4A 3QFAC 2YZUA 3R2QA 2YP6A 19GSA 1QXHA 3TKSC 3A5WA 3A2VA 3IAM2 5DJMA 2I3YA 1XW6A 1XVWA 3HVVA 5BMUB 4JZQA 4CY6A 3KMNA 1G6YA 2HSMB 1PD21 1LBKA 5FHIA 2GS3A 1M9AA 1GTIA 4USSA 3J7Yk 5A5KA 2M80A 1G7EA 4OFTA 4AKGA 3E0UA 4MJAA 5CYYA 2YNXA 3TRXA 1M2BA 3QPMA 1A2MA 2HYXA 5HR1A 4YH2A 2DMLA 3DD3A 3G7YA 1U87A 5IIZA 4NAXA 3OR5A 2YPMA 2H8LA 2KLXA 2QA1A 4EL1A 3GTUA 4YKFA 1ABAA 3ZFLA 4E8HA 1ZOFA 3PPUA 4O5RA 1BG1A 1XOAA 4MPFA 4WBJA 1B8XA 2O5VA 1GUHA 4MF6A 5DJLA 5ECLB 2GSQA 4BL7A 3KEBA 4TXVA 4OMVA 3QAGA 2MBTA 1FOHA 1OC9B 2JADA 3F0IA 1NHOA 2QSIA 1GWCA 1CQHA 3MWHA 3UVTA 5F07A 3FEUA 2LRNA 2DC5A 4TR1A 1K3OA 4DSQA 2MYGA 2C8UA 4F9ZA 2V2GA 3IHQA 4LL1B 1X9SB 4G01A 3IK7A 2VD1A 5G1LA 2RIIA 4KDXA 2O7KA 3D22A 3F6FA 1MEKA 4DSSA 4TXOB 4PUAA 5J40A 2IFQB 3DGQA 1F37A 1YVLA 5B8BA 1JLVA 3D4MA 2VO4A 1KNGA 1JZWA 2F8AA 1PGTA 5BMUA 3ME8A 2FD3A 4GQFA 3C1SA 3HJMA 3I43A 2P5RA 1YQ1A 3EINA 2R2JA 3ZLPA 1FG4A 2L57A 4ZXGA 1A8YA 1J08A 1U3AA 4XRAA 1EGOA 1R5PA 2CZ2A 2KP1A 1SKRB 4KW6A 1XIYA 4TR4A 1A23A 3HA9A 2BJXA 3IBHA 2H6ZA 4I8BA 3GMFA 5D8IA 4HUAA 5GSSA 2XPEA 2KHPA 2L6CA 2GZZA 1QQ2A 4O5UA 5D93A 2CA8A 3QOUA 2IMDA 2XHFA 3L4NA 5IMCA 2N5AA 3HJPA 3DKSA 2HXKA 2H70A 4MDCA 1V40A 2F3MA 1XBSA 5F0GA 1HNAA 2HRFA 1EEMA 4RQRA 5H5SA 1WJKA 3A3TA 4ISDA 1K3LA 2FCHA 3H4KA 2PGTA 3APQA 5ECHB 2KP2A 4L5LA 2VCVA 2VL9A 1T4YA 2M46A 3F4RA 4HQSA 2AYTA 4F82A 4TXOA 1HNCA 5A5HB 3ZMKA 3TJBA 2IFQA 5CO3A 3TCOA 3M9JA 5EY6A 2H1AA 4Z2RA 2VM1A 2DKIA 3F4TA 3RHBA 2IMEA 1SJIA 4XIHA 4WF4A 4J2FA 3HXSA 4KGIA 2I9HA 2R4VA 4RI6A 5DALB 4WXTA 5ENUA 2IMFA 3SWLA 4YQVA 3HKRA 2X64A 3GA4A 5DQYA 1K0OA 4IBPA 4HOJA 2EFCA 3ZIVA 1SENA 2R6KA 1EOHA 2H75A 4TVEA 2HT9A 3KP8A 1AW9A 3EC3A 1XOBA 2H71A 2MBSA 1PQNA 1UN2A 1E2YA 2HRAA 3HD5A 5CRHA 4I6XA 1SL0B 4Z2UA 1ZCPA 3H79A 3KZQA 4GWRA 5KN2A 3CYNA 3IXRA 1Z6MA 1SK1A 6GSTA 2P0GA 5E59A 3ZL5A 2CVBA 2VD0A 3TKSA 4WKWA 4NXIA 3FW2A 3EURA 4AF2A 1OKTA 1SK0A 4FO5A 1VF1A 1JFUA 1MDKA 2HRKA 4I2TA 4RUVA 5CNWA 1ZL9A 3IOSA 4Q5NA 1A2LA 1BQ7A 3DXBA 5IMAA 2H66A 3FHKA 1GSFA 5FT3A 1O85A 2XPDA 3TJJA 4ZL7A 1HNBA 1BF5A 3WGDA 1WOUA 4MMMA 2H1GA 3IHGA 2LRCA 1XWCA 3GYKA 4EDYA 4EE0A 3V1WA 5ECQB 3ISOA 4PQIA 3P2AA 4ZB9A 2P5QA 1TRUA 3KXOA 3CXGA 4XS6A 1JHBA 3FR3A 1YEXA 2VLUA 2H1BA 3FZAA 5DALA 1SYXA 2TRCP 5INYA 4AKXB 3DVXA 2VCXA 3M9KA 4TN8A 4IQAA 12GSA 4EF0A 4EVMA 3CTFA 2FHEA 4KAEA 3M8NA 1O81A 2H30A 4V1Ap 5JWRB 4EIQA 3IK9A 4TW5A 1H4OA 1QUWA 4RQXA 2YV7A 1GTBA 3CSIA 2OBKA 1H75A 3F63A 3KH7A 2ZUPA 1IYIA 4Z2TA 2JSZA 2JZRA 3ME7A 6GSVA 1TXUA 4HDEA 5IM9A 4POLA 3HVXA 18GSA 2IIYA 2A2SA 3GN3A 3F9UA 4I5QA 2H0HA 3IAS2 2JSYA 3E9JB 2WJUA 2DIYA 2MZCA 2X4AA 4WEYA 5ECKB 3M0FA 3M3MA 4JR6A 1YF0A 1GULA 11GSA 2FWEA 1JZOA 1PSQA 2JZSA 1V58A 3LQ7A 4TR0A 1J9BA 1ZYQB 2GLRA 5J47A 3GNJA 4POBA 1K0DA 4N0ZA 1TJDA 4G2EA 1DUGA 2L4CA 4K2DA 3AY8A 3TGZA 3HZ4A 2F8FA 5AGYA 4KSMA 5J4UA 4J56E 2YN1A 1K0CA 1SJ6A 1WP0A 1M0UA 1QMVA 3FRCA 2WFCA 3VK9A 4HZ2A 3TKSE 5KN1A 3CBUA 2J9HA 2AV4A 3RHCA 1ERVA 1OYJA 1OC3A 4G9HA 3DVWA 2LV3A 5IMFA 5GSTA 2QKEA 1JLWA 1I5GA 3EE2A 1MD3A 4BVYB 2GSSA 1ZZYA 4PNGA 2K9FA 2X8GA 3MNGA 3TKPA 1GSUA 4ZL9A 5A34B 4PXOA 5B8AA 2X99A 5IOXA 4NV5A 5LD0A 3D5JA 5JCUA 3CRTA 8GSSA 1WRYA 3ZRDA 1SL1B 1X9WB 4EIPA 3TRPA 2GTUA 3Q18A 1LU4A 2REMA 4JE1A 1X0RA 4F2IA 5IPGA 3WGXA 2R3XA 3EWLA 4L0UA 1K0MA 4HS1A 22GSA 4E68A 1OC8A 2I1UA 4HJMA 1R4WA 2FA4A 3EVIA 1EOGA 3L0HA 3QFBC 1F9MA 5BRTA 3DIEA 1R26A 6GSYA 2IL3A 4JRRA 2C4JA 1XFLA 4AJ8A 1VF4A 3UARA 4POKA 2C3NA 3U6VA 1BX9A 5KN0A 1EWXA 2WCIA 4MP4A 2CVKA 4IQ1A 1N8JA 1WWJA 4K5RA 4KA0A 4P3YB 1VRSD 2LEGA 1OAZA 1VF3A 5G30A 5JCWA 1DE1A 3DYRA 2EIRA 1GP1A 1O73A 2ALBA 4DEJA 3TKQA 2XC2A 1GSSA 2GT6A 2WB9A 2RM5A 5J41A 4BVYA 3HZ8A 1WPIA 3GUSA 1FOVA 5A34A 1O8WA 2UZ8A 3A2WA 1QGVA 2CQ9A 2GZYA 4V1Ag 3QAWA 4LLRA 2ES7A 3L9UA 4YAVA 4ZIJA 1XWAA 2LJAA 4H86A 2OADA 5DQSA 5G5FA 2C0GA 3KTLA 1XCCA 2VM2A 2P31A 4WF5A 4KX4A 5AISA 3TOTA 4YQUA 4BPYA 4RI7A 4N10A 4NWYA 2HNLA 1Z3EA 1TTZA 3GRXA 1FVKA 1ZGNA 4K7OA 2LQOA 2PWJA 2AUVA 2DLXA 3LSZA 3NIVA 2R5GA 5A4VA 1V9WA 5D9XA 3BBYA 2R0CA 1V98A 4X0XA 3IA1A 2HLSA 2AJQB 1DE2A 4GRFA 4ULXA 3GIXA 5IMZA 4JEDA 1Z7PA 2LQQA 1T1VA 3KJYA 1CQGA 3HY2A 3N5OA 3QAVA 3DEXA 5COHA 1SL2B 4EO3A 4OCFA 2RUEA 2ON7A 7GSSA 3KIJA 2H76A 1LJRA 3W8SA 5G5EA 3NZNA 4ZB8A 2WULA 5J9CA 2OBIA 2EIQA 1PA3A 1NW2A 1E6BA 1TK0B 4PNFA 4DVCA 2IPAA 3EMXA 1XWKA 4GQCA 1KEBA 4LL4B 4TR3A 4MF5A 2HSMA 5JCGA 1Q98A 2V1MA 4CDOA 4ECCA 3JCML 3LWAA 4YAPA 1EEJA 3EYTA 2K6VA 4FH8A 5KOXA 1N2AA 4HQZA 5D9VA 4IP1A 1GNWA 5H5QA 2HFDA 5KOWA 3HJOA 2PN8A 2N5BA 1YJ6A 4KCAA 1OC9A 1TP9A 3GSTA 4FYBA 2NDOA 4GXZA 5LCZA 2AHEA 2WDUA 4O5QA 1TKDB 2LRTA 3LXTA 4MJBA 1SYRA 2VCQA 2JU5A 1HQOA 4N30A 4MZBA 3K8NA 5C04A 1WE0A 3QR6A 1PN0A 5E4WA 1W4VA 2DMMA 1X5EA 2YANA 2C0FA 1B9YC 1Y25A 1TI3A 2I4AA 2XBIA 2LSTA 3RPPA 1O6JA 5CP1A 1BYEA 2LJRA 2HE3A 3ERGA 3A2XA 1F3BA 4OCEA 5EPFA 3QD9A 1RK4A 2YJ7A 1XPVA 2NPBA 1PL1A 1K0BA 4EC0A 9GSSA 4J57E 4AKIA 1TW9A 5IO0A 2VAFA 2HRNA 2B5YA 2HI7A 5FWGA 1UVZA 1F2EA 3LJRA 1OKDA 3FR6A 1V2AA 1GUMA 2DKHA 1YY7A 3H93A 4TKYA 1JZRA 3DMLA 4MZCA 3PGTA 2GQLA 3DWVA 4V2LA 2VL3A 3GV1A 4D73B 1F3AA 1V57A 2F9SA 2YCDA 1PMTA 2L59A 2PERA 4QQ7A 3UL3A 2DSAA 2JL4A 1SVLA 3ZVJD 2B7KA 1G6WA 4KCEA 5F8BA 1FB0A 3CSJA 5A4UA 1T8EB 1ST9A 3L9VA 5B6MA 2YJHA 2MMNA 1M2AA 3ZZXA 4PTSA 3VPTA 5A4WA 3FK8A 5KN3A 4GSTA 2DIZA 5DVBA 5ECPB 4JR4A 3ZYWA 4OFMA 2PPTA 2IJYA 3IC8A 2TIRA 3N9JA 1PL2A 1ILOA 2OT3A 3MIXA 2ZCTA 1UA5A 1OE7A 3D0ZA 1SD9A 2E7PA 2X8HA 3GURA 2VCWA 1YKCA 2QC7A 3IR4A 1NSWA 4LMWA 4FYUA 3CWGA 3TUEA 2HSHA 5A5HA 4ECIA 3C7MA 3CSHA 1USBA 4OD7A 4OO5A 1ML6A 4ZBBA 1ERTA 1EV9A 2HZEB 1ACVA 1XW9A 2YWIA 1TK5B 3DRNA 3FZ5A 1SU9A 2LJKA 2G0FA 1EP7A 2M72A 3GX8A 5G1KA 4DSRA 2CAIA 4PQHA 4F0BA 2HSYA 2H74A 1GSDA 3VURA 4WBRD 4EKZA 4Q5FA 3KD0A 3MYDA 1AC1A 3KCMA 2K8VA 5IPHA 2A2RA 5DDLA 2IN3A 1A2JA 1GRXA 3CMIA 2VL2C 2YV9A 1T3BA 3O76A 4MNNA 4K9ZA 3RBTA 1NM3A 4I2UA 2FLSA 3GH9A 2XBQA 5D96A 4PQ1A 1FHEA 4IELA 3IRAA 1SD8A 1XWGA 1TOFA 4IS0A 3ZITA 4MF7A 4GLTA 2B7JA 4ICYA 3KH9A 5D9TA 4IW9A 2ON5A 2N5FA 6GSWA 1GL8A 4BVXB 4LA1A 1B9XC 4AGSA 3VLNA 1THOA 2GT5A 2GSRA 2VCZA 1T4ZA 4CW9A 3LG6A 2L6DA 1AQVA 4N11A 1UC7A 1RQMA 3VI5A 3FZ4A 4AJ6A 4MZWA 2ZNMA 4TRXA 3FR9A 3TJFA 1Y6EA 1MDIA 2DJ3A 3C1RA 2HZEA 1O7UA 2V6OA 5D9WA 4W66A 2FUG2 2RUFA 2AAWA 3MDKA 3HCZA 4XTSA 3O3TA 1VGLA 4K0GA 4QMKA 3W6GA 4PX1A 1ZYEA 3UIWA 4HJ2A 2H1LA 2PMTA 5J5NA 2H0IA 1EGRA 1FAAA 4K8MA 3ZIJA 2HSNB 4BA7A 1TU8A 2H19A 5J9BA 2GDRA 2VLVA 5L71A 4CHSA 2LNTA 1GNEA 2GQMA 4V2MA 2NTOA 4WR5A 5G2ZA 4KB3A 4EUYA 2J23A 1U3IA 3EU3A 1URMA 1Z6NA 4FYCA 1ZMAA 2K8SA 2H0GA 4MCUA 2LTKA 1FVJA 5J4VA 1AXDA 4HI7A 2H6XA 3EMPA 3TJKA 1ERUA 1NHYA 4BVXA 1YDKA 5F05A 3P90A 2QGVA 3IE3A 1KBNA 1DSBA 2L5LA 1SKSB 3P8WA 2LUSA 2O89A 3ERFA 2EIOA 2PVOC 2V41A 4L0WA 2TRXA 4MJEA 3PH9A 3QDNA 2KOKA 3WT2A 2H6YA 4K1FA 13GSA 3WYWA 4NHZA 1QK8A 2GVPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RLI A;  3VWV A;  2E2G A;  2D2Z A;  4MH3 A;  2DJ2 A;  3UMA A;  3PR8 A;  4OFN A;  3P7X A;  4MK3 A;  1MTC A;  1A8L A;  3VFI A;  1MDJ A;  5HFK A;  3E3E A;  5AIX A;  3Q6O A;  5GAP D;  1A24 A;  3F4S A;  4O32 A;  3ZTL A;  2FWH A;  1JZD A;  2GST A;  4IN0 A;  3UBL A;  4EDZ A;  3KP9 A;  4DSS B;  2E0Q A;  3ERW A;  2LS5 A;  1M2D A;  2OAC A;  3HDC A;  1GSQ A;  1AUC A;  2KUC A;  1IYH A;  3G7I A;  5JWQ B;  1BG5 A;  1GSE A;  3GHA A;  4XCS A;  4KH7 A;  3Q19 A;  1R7H A;  3LYP A;  3UEM A;  1HD2 A;  1M7T A;  4Q5R A;  3VPQ A;  1YF1 A;  4MJC A;  4IKH A;  4IHU A;  4X43 A;  4O7H A;  2DJ1 A;  4ZB6 A;  1K0A A;  2O87 A;  2O85 A;  3GKK A;  4PGT A;  1WMJ A;  2DJJ A;  4MA9 A;  3GL5 A;  5HFG A;  4E8E A;  2R37 A;  3ZFB A;  2VL2 A;  1F6M C;  2HZF A;  6GSU A;  2H73 A;  3G7J A;  3UOM A;  5DCG A;  2VUP A;  1TU7 A;  3GKM A;  3UBK A;  3IV4 A;  1C72 A;  1MD4 A;  3IC4 A;  3LYK A;  5F06 A;  1TXX A;  2OE3 A;  3RDW A;  2CX3 A;  4ID0 A;  1R5A A;  5B7C A;  3QCP A;  4KF9 A;  4NV2 A;  3KM6 A;  4XHM A;  4NPB A;  1YZX A;  2PBJ A;  1PX6 A;  3C8E A;  5EVO A;  1TK8 B;  2C0D A;  1O8X A;  4XS4 B;  3I6A A;  4OWY A;  1TDI A;  4WR4 A;  4FIW A;  4BWS A;  10GS A;  3GSS A;  3M1G A;  1EV4 A;  5H5R A;  2C0E A;  4PUF C;  3R3E A;  5ECS A;  1I9D A;  3UJ1 A;  1M99 A;  1M9B A;  4QL7 A;  2VLT A;  5C00 A;  4YQM A;  3U5R E;  3L78 A;  1BED A;  3NOF A;  2RM6 A;  4IGJ A;  5AIV A;  3RPN A;  1AAZ A;  2B6M A;  4HU9 A;  4GCI A;  2VIM A;  1T00 A;  2H1D A;  3WGE A;  1AQW A;  3QMX A;  4ML1 A;  4GF0 A;  4HZ4 A;  5EL8 A;  5HQP A;  2LKU A;  2NVL A;  3I69 A;  1FO5 A;  2WRT A;  4KUN A;  2F51 A;  1X9M B;  3FZ9 A;  3D21 A;  4I97 A;  1FB6 A;  1GSY A;  3KGK A;  4ECJ A;  2WZ9 A;  5ECO B;  4Q5Q A;  2C3T A;  2HRK B;  3F3Q A;  4KDU A;  1EZK A;  5G31 A;  2DBC A;  4KSO A;  5ECR B;  2PVQ A;  1OVN A;  5ECI B;  4NHW A;  4KDY A;  4ACS A;  6GSX A;  2B3S A;  2AB6 A;  2MMZ A;  1BAY A;  3IDV A;  5HFI A;  3WT1 A;  1TRW A;  20GS A;  4GSS A;  5CRE A;  2A4V A;  5ABR A;  4XS4 A;  2FWF A;  1S3A A;  3G9B A;  4K0N A;  5ECN B;  1A0F A;  4KND A;  16GS A;  3O6T A;  1TI1 A;  5IQY A;  4MAB A;  2MMO A;  2IWT A;  2CAQ A;  2X8C A;  5DAK B;  3C73 A;  1WIK A;  4O92 A;  2VOC A;  3D6I A;  2IMK A;  2B1L A;  2DJK A;  3APO A;  4K7I A;  2FY6 A;  1ERW A;  2C3Q A;  1HYU A;  4WET A;  3TDG A;  2V6K A;  2GQK A;  1SKW B;  1XW5 A;  3UVH A;  4ZBD A;  5IMV A;  4ILF A;  2YZH A;  1K3Y A;  1AQX A;  4GSN A;  2CT6 A;  3H8Q A;  3TRQ A;  4TOP A;  1OE8 A;  5IO2 A;  4EXJ A;  5ECM B;  2HQT A;  4ML6 A;  3GKX A;  3ZVJ A;  1Z9H A;  4AJ7 A;  1XWB A;  2FNO A;  4IP6 A;  4XRD A;  3D4T A;  2I81 A;  4X1U A;  3ZRE A;  2YWN A;  2Z9S A;  2VCT A;  1QFN A;  2MMA A;  3ZML A;  1PKZ A;  2CVD A;  1YKA A;  2EC4 A;  1BJX A;  2L4Q A;  5HR2 A;  3SBC A;  2WGR A;  5DBQ A;  4MLY A;  2G2Q A;  3L9S A;  3BCK A;  1TRS A;  5CRD A;  3LOR A;  3F8U A;  4D73 A;  1PX7 A;  4V2N A;  1B4P A;  2PUK C;  2BMX A;  5DAK A;  2YWM A;  5GAN D;  1GUK A;  2FWG A;  3LFL A;  5KEJ A;  4HU7 A;  1SJZ A;  3MSZ A;  2V32 A;  5ELG A;  1GLQ A;  1DBY A;  2IMI A;  3F3R A;  4FQU A;  4F03 A;  5D73 A;  3WD6 A;  2OE1 A;  1U88 A;  1A0R P;  2B5X A;  4ECB A;  5CRW A;  4LMV A;  4L5O A;  1RW1 A;  4IJ3 A;  3TKR A;  2B5E A;  1X5C A;  5CRG A;  2JZT A;  1XVQ A;  5J3R A;  1S3C A;  4F0C A;  2GZP A;  4IVF A;  4XS1 A;  5DCH A;  1W89 A;  4G10 A;  4JU5 A;  3BOA A;  1FW1 A;  3H1N A;  3HHV A;  3MAK A;  3GX0 A;  1B4Q A;  1AIU A;  1ON4 A;  4GTU A;  2E2M A;  1TRV A;  1KTE A;  2L5O A;  2YWO A;  2OA7 A;  1X5D A;  4MH2 A;  2CZ3 A;  3TOU A;  2FGX A;  3VI7 A;  2PU9 C;  2B1K A;  3Q74 A;  4L8E A;  1G7O A;  3S9F A;  1U6T A;  1SK2 A;  3HYP A;  5HR3 A;  5ELA A;  4IJI A;  2OE0 A;  2OJL A;  3CTG A;  2H72 A;  1PRX A;  2DJ0 A;  1Z5Y E;  3J7Y b;  3LXZ A;  3W8J A;  2H01 A;  3BD2 A;  1THX A;  3BJ5 A;  5HR0 A;  3ED3 A;  5LNK e;  5CAX A;  1GTU A;  5ID2 B;  1S3D A;  3RAZ A;  2LNS A;  3GL3 A;  4Z7X A;  2FA8 A;  2CV4 A;  5IMD A;  1PKW A;  3APS A;  2NBS A;  5JWO B;  1T7P B;  3LGC A;  4OO4 A;  4G0L A;  4NMU A;  4N0V A;  4BWQ A;  3VWX A;  1B48 A;  1Q4J A;  5AN1 A;  3PIN A;  3FKF A;  2YOI A;  4ZBA A;  3US3 A;  3F6D A;  2JAC A;  4G0K A;  1GTA A;  2OKA A;  3IPZ A;  1GLP A;  6GSS A;  3BCI A;  1XZO A;  2GGT A;  4JBB A;  3LEF A;  3UAP A;  1K0N A;  2BTO T;  5IOW A;  4MPG A;  17GS A;  3HVS A;  4ZIL A;  3GTU B;  1GH2 A;  2K18 A;  5GZZ B;  4PUR A;  3VWU A;  1YEP A;  5B6N A;  1EP8 A;  1XXU A;  1J0F A;  4ZL8 A;  3TJG A;  4BL7 B;  1PN9 A;  2C1Y A;  3KTB A;  1G0T A;  4QL9 A;  3GFK A;  3KMO A;  2WS2 A;  4POM A;  1VF2 A;  14GS A;  3CRU A;  3I9V 2;  4TR1 B;  4K7N A;  4G19 A;  3VWW A;  3FY7 A;  4HEA 2;  1Z7R A;  2C80 A;  3TB2 A;  2CX4 A;  3C71 A;  3GKN A;  3GH6 A;  4G0I A;  3FYG A;  5ID2 A;  2O8V B;  4KE3 A;  4K6X A;  3EU4 A;  3QFA C;  2YZU A;  3R2Q A;  2YP6 A;  19GS A;  1QXH A;  3TKS C;  3A5W A;  3A2V A;  3IAM 2;  5DJM A;  2I3Y A;  1XW6 A;  1XVW A;  3HVV A;  4JZQ A;  3KMN A;  1G6Y A;  2HSM B;  1PD2 1;  1LBK A;  5FHI A;  2GS3 A;  1M9A A;  1GTI A;  4USS A;  3J7Y k;  5A5K A;  2M80 A;  1G7E A;  4OFT A;  3E0U A;  4MJA A;  5CYY A;  3TRX A;  2YNX A;  1M2B A;  3QPM A;  1A2M A;  2HYX A;  5HR1 A;  4YH2 A;  2DML A;  3DD3 A;  3G7Y A;  1U87 A;  5IIZ A;  4NAX A;  3OR5 A;  2YPM A;  2H8L A;  2KLX A;  4EL1 A;  3GTU A;  1ABA A;  3ZFL A;  4E8H A;  1ZOF A;  3PPU A;  4O5R A;  1XOA A;  4MPF A;  4WBJ A;  1B8X A;  1GUH A;  4MF6 A;  5DJL A;  5ECL B;  2GSQ A;  4BL7 A;  3KEB A;  4TXV A;  4OMV A;  3QAG A;  2MBT A;  1OC9 B;  2JAD A;  3F0I A;  1NHO A;  2QSI A;  1GWC A;  1CQH A;  3MWH A;  3UVT A;  5F07 A;  3FEU A;  2LRN A;  2DC5 A;  4TR1 A;  1K3O A;  4DSQ A;  2MYG A;  2C8U A;  4F9Z A;  2V2G A;  3IHQ A;  4LL1 B;  1X9S B;  3IK7 A;  2VD1 A;  5G1L A;  2RII A;  4KDX A;  2O7K A;  3D22 A;  3F6F A;  1MEK A;  4DSS A;  4TXO B;  4PUA A;  2IFQ B;  3DGQ A;  1F37 A;  5B8B A;  1JLV A;  3D4M A;  2VO4 A;  1KNG A;  1JZW A;  2F8A A;  1PGT A;  5BMU A;  3ME8 A;  2FD3 A;  4GQF A;  3C1S A;  3HJM A;  3I43 A;  2P5R A;  1YQ1 A;  3EIN A;  2R2J A;  3ZLP A;  1FG4 A;  2L57 A;  4ZXG A;  1A8Y A;  1J08 A;  1U3A A;  4XRA A;  1EGO A;  1R5P A;  2CZ2 A;  2KP1 A;  1SKR B;  4KW6 A;  1XIY A;  4TR4 A;  1A23 A;  3HA9 A;  2BJX A;  3IBH A;  2H6Z A;  4I8B A;  3GMF A;  5D8I A;  4HUA A;  5GSS A;  2XPE A;  2KHP A;  2L6C A;  2GZZ A;  1QQ2 A;  5D93 A;  2CA8 A;  3QOU A;  2IMD A;  2XHF A;  3L4N A;  5IMC A;  2N5A A;  3HJP A;  3DKS A;  2HXK A;  2H70 A;  4MDC A;  1V40 A;  2F3M A;  1XBS A;  5F0G A;  1HNA A;  2HRF A;  1EEM A;  4RQR A;  5H5S A;  1WJK A;  3A3T A;  4ISD A;  1K3L A;  2FCH A;  3H4K A;  2PGT A;  3APQ A;  5ECH B;  2KP2 A;  4L5L A;  2VCV A;  2VL9 A;  1T4Y A;  2M46 A;  3F4R A;  4HQS A;  2AYT A;  4F82 A;  4TXO A;  1HNC A;  3ZMK A;  3TJB A;  2IFQ A;  5CO3 A;  3TCO A;  3M9J A;  5EY6 A;  2H1A A;  2VM1 A;  3F4T A;  3RHB A;  2IME A;  1SJI A;  4XIH A;  4WF4 A;  4J2F A;  3HXS A;  4KGI A;  2I9H A;  2R4V A;  4RI6 A;  5DAL B;  4WXT A;  5ENU A;  2IMF A;  3SWL A;  4YQV A;  3HKR A;  2X64 A;  3GA4 A;  5DQY A;  1K0O A;  4IBP A;  4HOJ A;  3ZIV A;  1SEN A;  2R6K A;  1EOH A;  2H75 A;  4TVE A;  2HT9 A;  3KP8 A;  1AW9 A;  3EC3 A;  1XOB A;  2H71 A;  2MBS A;  1PQN A;  1UN2 A;  1E2Y A;  2HRA A;  3HD5 A;  5CRH A;  4I6X A;  1SL0 B;  1ZCP A;  3H79 A;  3KZQ A;  4GWR A;  5KN2 A;  3CYN A;  3IXR A;  1Z6M A;  1SK1 A;  6GST A;  2P0G A;  5E59 A;  3ZL5 A;  2CVB A;  2VD0 A;  3TKS A;  4WKW A;  4NXI A;  3FW2 A;  3EUR A;  4AF2 A;  1OKT A;  1SK0 A;  4FO5 A;  1VF1 A;  1JFU A;  1MDK A;  2HRK A;  4I2T A;  4RUV A;  5CNW A;  1ZL9 A;  3IOS A;  4Q5N A;  1A2L A;  1BQ7 A;  3DXB A;  5IMA A;  2H66 A;  3FHK A;  1GSF A;  5FT3 A;  1O85 A;  2XPD A;  3TJJ A;  4ZL7 A;  1HNB A;  3WGD A;  1WOU A;  4MMM A;  2H1G A;  2LRC A;  1XWC A;  3GYK A;  4EDY A;  4EE0 A;  3V1W A;  5ECQ B;  3ISO A;  4PQI A;  3P2A A;  4ZB9 A;  2P5Q A;  1TRU A;  3KXO A;  3CXG A;  4XS6 A;  1JHB A;  3FR3 A;  1YEX A;  2VLU A;  2H1B A;  3FZA A;  5DAL A;  1SYX A;  2TRC P;  5INY A;  3DVX A;  2VCX A;  3M9K A;  4TN8 A;  4IQA A;  12GS A;  4EF0 A;  4EVM A;  3CTF A;  2FHE A;  4KAE A;  3M8N A;  1O81 A;  2H30 A;  4V1A p;  5JWR B;  3IK9 A;  4TW5 A;  1H4O A;  1QUW A;  4RQX A;  2YV7 A;  1GTB A;  3CSI A;  2OBK A;  1H75 A;  3F63 A;  3KH7 A;  2ZUP A;  1IYI A;  2JSZ A;  2JZR A;  3ME7 A;  6GSV A;  4HDE A;  5IM9 A;  4POL A;  3HVX A;  18GS A;  2IIY A;  2A2S A;  3GN3 A;  3F9U A;  4I5Q A;  2H0H A;  3IAS 2;  2JSY A;  3E9J B;  2WJU A;  2DIY A;  2MZC A;  4WEY A;  5ECK B;  3M0F A;  3M3M A;  4JR6 A;  1YF0 A;  1GUL A;  11GS A;  2FWE A;  1JZO A;  1PSQ A;  2JZS A;  1V58 A;  3LQ7 A;  4TR0 A;  1J9B A;  1ZYQ B;  2GLR A;  3GNJ A;  4POB A;  1K0D A;  4N0Z A;  1TJD A;  4G2E A;  1DUG A;  2L4C A;  4K2D A;  3AY8 A;  3TGZ A;  3HZ4 A;  2F8F A;  5AGY A;  4KSM A;  5J4U A;  4J56 E;  2YN1 A;  1K0C A;  1SJ6 A;  1WP0 A;  1M0U A;  1QMV A;  3FRC A;  2WFC A;  3VK9 A;  4HZ2 A;  3TKS E;  5KN1 A;  3CBU A;  2J9H A;  2AV4 A;  3RHC A;  1ERV A;  1OYJ A;  1OC3 A;  4G9H A;  3DVW A;  2LV3 A;  5IMF A;  5GST A;  2QKE A;  1JLW A;  1I5G A;  3EE2 A;  1MD3 A;  4BVY B;  2GSS A;  1ZZY A;  4PNG A;  2K9F A;  2X8G A;  3MNG A;  3TKP A;  1GSU A;  4ZL9 A;  4PXO A;  5B8A A;  2X99 A;  5IOX A;  4NV5 A;  5LD0 A;  3D5J A;  5JCU A;  3CRT A;  8GSS A;  1WRY A;  3ZRD A;  1SL1 B;  1X9W B;  3TRP A;  2GTU A;  3Q18 A;  1LU4 A;  2REM A;  4JE1 A;  1X0R A;  4F2I A;  5IPG A;  3WGX A;  2R3X A;  3EWL A;  4L0U A;  1K0M A;  4HS1 A;  22GS A;  1OC8 A;  2I1U A;  4HJM A;  1R4W A;  2FA4 A;  3EVI A;  1EOG A;  3L0H A;  3QFB C;  1F9M A;  3DIE A;  1R26 A;  6GSY A;  2IL3 A;  4JRR A;  2C4J A;  1XFL A;  4AJ8 A;  1VF4 A;  3UAR A;  4POK A;  2C3N A;  3U6V A;  1BX9 A;  5KN0 A;  1EWX A;  2WCI A;  4MP4 A;  2CVK A;  4IQ1 A;  1N8J A;  1WWJ A;  4KA0 A;  4P3Y B;  1VRS D;  2LEG A;  1OAZ A;  1VF3 A;  5G30 A;  5JCW A;  1DE1 A;  3DYR A;  2EIR A;  1GP1 A;  1O73 A;  2ALB A;  4DEJ A;  3TKQ A;  2XC2 A;  1GSS A;  2GT6 A;  2WB9 A;  2RM5 A;  5J41 A;  4BVY A;  3HZ8 A;  1WPI A;  3GUS A;  1FOV A;  1O8W A;  2UZ8 A;  3A2W A;  1QGV A;  2CQ9 A;  2GZY A;  4V1A g;  3QAW A;  4LLR A;  2ES7 A;  3L9U A;  4YAV A;  4ZIJ A;  1XWA A;  2LJA A;  4H86 A;  2OAD A;  5DQS A;  5G5F A;  2C0G A;  3KTL A;  1XCC A;  2VM2 A;  2P31 A;  4WF5 A;  4KX4 A;  5AIS A;  3TOT A;  4YQU A;  4BPY A;  4RI7 A;  4N10 A;  4NWY A;  2HNL A;  1Z3E A;  1TTZ A;  3GRX A;  1FVK A;  1ZGN A;  4K7O A;  2LQO A;  2PWJ A;  2AUV A;  2DLX A;  3LSZ A;  3NIV A;  2R5G A;  5A4V A;  1V9W A;  5D9X A;  3BBY A;  1V98 A;  4X0X A;  3IA1 A;  2HLS A;  2AJQ B;  1DE2 A;  4GRF A;  4ULX A;  3GIX A;  5IMZ A;  4JED A;  1Z7P A;  2LQQ A;  1T1V A;  3KJY A;  1CQG A;  3HY2 A;  3N5O A;  3QAV A;  3DEX A;  5COH A;  1SL2 B;  4EO3 A;  4OCF A;  2RUE A;  2ON7 A;  7GSS A;  3KIJ A;  2H76 A;  1LJR A;  3W8S A;  5G5E A;  3NZN A;  4ZB8 A;  2WUL A;  5J9C A;  2OBI A;  2EIQ A;  1PA3 A;  1NW2 A;  1E6B A;  1TK0 B;  4PNF A;  4DVC A;  2IPA A;  3EMX A;  1XWK A;  4GQC A;  1KEB A;  4LL4 B;  4TR3 A;  4MF5 A;  2HSM A;  5JCG A;  1Q98 A;  2V1M A;  4CDO A;  4ECC A;  3JCM L;  3LWA A;  4YAP A;  1EEJ A;  3EYT A;  2K6V A;  4FH8 A;  1N2A A;  4HQZ A;  5D9V A;  4IP1 A;  1GNW A;  5H5Q A;  2HFD A;  3HJO A;  2PN8 A;  2N5B A;  1YJ6 A;  4KCA A;  1OC9 A;  1TP9 A;  3GST A;  4FYB A;  2NDO A;  4GXZ A;  5LCZ A;  2AHE A;  2WDU A;  1TKD B;  2LRT A;  3LXT A;  4MJB A;  1SYR A;  2VCQ A;  2JU5 A;  1HQO A;  4N30 A;  4MZB A;  3K8N A;  5C04 A;  1WE0 A;  3QR6 A;  5E4W A;  1W4V A;  2DMM A;  1X5E A;  2YAN A;  2C0F A;  1B9Y C;  1Y25 A;  1TI3 A;  2I4A A;  2XBI A;  2LST A;  3RPP A;  1O6J A;  5CP1 A;  1BYE A;  2LJR A;  2HE3 A;  3ERG A;  3A2X A;  1F3B A;  4OCE A;  5EPF A;  3QD9 A;  1RK4 A;  2YJ7 A;  1XPV A;  2NPB A;  1PL1 A;  1K0B A;  4EC0 A;  9GSS A;  4J57 E;  1TW9 A;  5IO0 A;  2VAF A;  2HRN A;  2B5Y A;  2HI7 A;  5FWG A;  1UVZ A;  1F2E A;  3LJR A;  1OKD A;  3FR6 A;  1V2A A;  1GUM A;  1YY7 A;  3H93 A;  4TKY A;  1JZR A;  3DML A;  4MZC A;  3PGT A;  2GQL A;  3DWV A;  4V2L A;  2VL3 A;  3GV1 A;  4D73 B;  1F3A A;  1V57 A;  2F9S A;  2YCD A;  1PMT A;  2L59 A;  2PER A;  4QQ7 A;  3UL3 A;  2DSA A;  2JL4 A;  3ZVJ D;  2B7K A;  1G6W A;  4KCE A;  5F8B A;  1FB0 A;  3CSJ A;  5A4U A;  1T8E B;  1ST9 A;  3L9V A;  5B6M A;  2YJH A;  2MMN A;  1M2A A;  3ZZX A;  4PTS A;  3VPT A;  5A4W A;  3FK8 A;  5KN3 A;  4GST A;  2DIZ A;  5DVB A;  5ECP B;  4JR4 A;  3ZYW A;  4OFM A;  2PPT A;  2IJY A;  3IC8 A;  2TIR A;  3N9J A;  1PL2 A;  1ILO A;  2ZCT A;  1UA5 A;  1OE7 A;  3D0Z A;  1SD9 A;  2E7P A;  2X8H A;  3GUR A;  2VCW A;  1YKC A;  2QC7 A;  3IR4 A;  1NSW A;  4LMW A;  4FYU A;  3TUE A;  2HSH A;  4ECI A;  3C7M A;  3CSH A;  1USB A;  4OD7 A;  4OO5 A;  1ML6 A;  4ZBB A;  1ERT A;  1EV9 A;  2HZE B;  1ACV A;  1XW9 A;  2YWI A;  1TK5 B;  3DRN A;  3FZ5 A;  1SU9 A;  2LJK A;  2G0F A;  1EP7 A;  2M72 A;  3GX8 A;  5G1K A;  4DSR A;  2CAI A;  4PQH A;  4F0B A;  2HSY A;  2H74 A;  1GSD A;  3VUR A;  4WBR D;  4EKZ A;  4Q5F A;  3KD0 A;  1AC1 A;  3KCM A;  2K8V A;  5IPH A;  2A2R A;  5DDL A;  2IN3 A;  1A2J A;  1GRX A;  3CMI A;  2VL2 C;  2YV9 A;  1T3B A;  3O76 A;  4K9Z A;  3RBT A;  1NM3 A;  4I2U A;  2FLS A;  3GH9 A;  2XBQ A;  5D96 A;  4PQ1 A;  1FHE A;  4IEL A;  3IRA A;  1SD8 A;  1XWG A;  1TOF A;  4IS0 A;  3ZIT A;  4MF7 A;  4GLT A;  2B7J A;  3KH9 A;  5D9T A;  4IW9 A;  2ON5 A;  2N5F A;  6GSW A;  1GL8 A;  4BVX B;  4LA1 A;  1B9X C;  4AGS A;  3VLN A;  1THO A;  2GT5 A;  2GSR A;  2VCZ A;  1T4Z A;  4CW9 A;  3LG6 A;  2L6D A;  1AQV A;  4N11 A;  1UC7 A;  1RQM A;  3VI5 A;  3FZ4 A;  4AJ6 A;  4MZW A;  2ZNM A;  4TRX A;  3FR9 A;  3TJF A;  1Y6E A;  1MDI A;  2DJ3 A;  3C1R A;  2HZE A;  1O7U A;  2V6O A;  5D9W A;  2FUG 2;  2RUF A;  2AAW A;  3MDK A;  3HCZ A;  4XTS A;  3O3T A;  1VGL A;  4K0G A;  3W6G A;  4PX1 A;  1ZYE A;  3UIW A;  4HJ2 A;  2PMT A;  5J5N A;  2H0I A;  1EGR A;  1FAA A;  4K8M A;  3ZIJ A;  2HSN B;  4BA7 A;  1TU8 A;  2H19 A;  5J9B A;  2GDR A;  2VLV A;  5L71 A;  4CHS A;  2LNT A;  1GNE A;  2GQM A;  4V2M A;  2NTO A;  4WR5 A;  5G2Z A;  4KB3 A;  4EUY A;  2J23 A;  1U3I A;  3EU3 A;  1URM A;  1Z6N A;  4FYC A;  1ZMA A;  2K8S A;  2H0G A;  4MCU A;  2LTK A;  1FVJ A;  1AXD A;  4HI7 A;  2H6X A;  3EMP A;  3TJK A;  1ERU A;  1NHY A;  4BVX A;  1YDK A;  5F05 A;  3P90 A;  2QGV A;  3IE3 A;  1KBN A;  1DSB A;  2L5L A;  1SKS B;  3P8W A;  2LUS A;  2O89 A;  3ERF A;  2EIO A;  2PVO C;  2V41 A;  4L0W A;  2TRX A;  4MJE A;  3PH9 A;  3QDN A;  2KOK A;  3WT2 A;  2H6Y A;  4K1F A;  13GS A;  3WYW A;  4NHZ A;  1QK8 A;  2GVP A; 
#chains in the Genus database with same CATH topology
 2RLI A;  3VWV A;  2E2G A;  2D2Z A;  4MH3 A;  2DJ2 A;  3UMA A;  3PR8 A;  4OFN A;  3P7X A;  4MK3 A;  1MTC A;  1A8L A;  3VFI A;  1MDJ A;  5HFK A;  3E3E A;  4N3Z A;  5AIX A;  3Q6O A;  5GAP D;  1A24 A;  3F4S A;  4O32 A;  3ZTL A;  2FWH A;  1JZD A;  2HSN A;  2GST A;  1PFO A;  4IN0 A;  3UBL A;  4EDZ A;  3KP9 A;  4DSS B;  2E0Q A;  3ERW A;  2EFD A;  4PHZ C;  2LS5 A;  1M2D A;  2OAC A;  3HDC A;  1GSQ A;  1AUC A;  2KUC A;  3G7I A;  1IYH A;  5JWQ B;  1BG5 A;  4YKG A;  1GSE A;  3GHA A;  4XCS A;  4KH7 A;  3Q19 A;  1R7H A;  3LYP A;  3UEM A;  1HD2 A;  1M7T A;  4Q5R A;  3VPQ A;  1YF1 A;  4MJC A;  4IKH A;  4IHU A;  4X43 A;  2VKZ G;  4O7H A;  2DJ1 A;  4ZB6 A;  1K0A A;  2O87 A;  2O85 A;  3GKK A;  4PGT A;  1WMJ A;  2DJJ A;  4MA9 A;  3GL5 A;  1ZYP A;  5HFG A;  4E8E A;  2R37 A;  3ZFB A;  2VL2 A;  1F6M C;  2HZF A;  6GSU A;  2H73 A;  3G7J A;  3UOM A;  5DCG A;  4AI6 A;  2VUP A;  1TU7 A;  3GKM A;  3UBK A;  3IV4 A;  1C72 A;  1MD4 A;  3IC4 A;  3LYK A;  5F06 A;  4K2X A;  1TXX A;  2OE3 A;  3RDW A;  2CX3 A;  3FMW A;  4ID0 A;  1R5A A;  5B7C A;  3QCP A;  4KF9 A;  4NV2 A;  3KM6 A;  4XHM A;  4NPB A;  1YZX A;  2EFE A;  2PBJ A;  2WVZ A;  1PX6 A;  3C8E A;  5EVO A;  4K5S A;  1TK8 B;  4AKH A;  2C0D A;  1O8X A;  4XS4 B;  3I6A A;  4OWY A;  1TDI A;  4WR4 A;  4FIW A;  4BWS A;  10GS A;  3GSS A;  3M1G A;  1EV4 A;  5H5R A;  2C0E A;  4PUF C;  3R3E A;  3LW9 A;  5ECS A;  1I9D A;  3UJ1 A;  1M99 A;  1M9B A;  4QL7 A;  2VLT A;  5C00 A;  4YQM A;  3U5R E;  3L78 A;  1BED A;  3NOF A;  2RM6 A;  4IGJ A;  5AIV A;  2UV8 G;  3RPN A;  1AAZ A;  2B6M A;  4HU9 A;  4GCI A;  2VIM A;  1T00 A;  2EFH A;  2H1D A;  3WGE A;  1AQW A;  3QMX A;  4ML1 A;  4GF0 A;  4HZ4 A;  5EL8 A;  5HQP A;  1XG8 A;  2LKU A;  2NVL A;  3I69 A;  1FO5 A;  2QA2 A;  3HMJ G;  2WRT A;  4KUN A;  2F51 A;  1X9M B;  3FZ9 A;  3D21 A;  4I97 A;  1FB6 A;  1GSY A;  3KGK A;  4ECJ A;  2WZ9 A;  5ECO B;  4Q5Q A;  2C3T A;  2R0G A;  2HRK B;  3F3Q A;  4KDU A;  1EZK A;  2A4H A;  5G31 A;  2DBC A;  4KSO A;  5ECR B;  2PVQ A;  1OVN A;  5ECI B;  4NHW A;  4KDY A;  4ACS A;  6GSX A;  2B3S A;  2AB6 A;  2MMZ A;  1BAY A;  3IDV A;  5HFI A;  3WT1 A;  1TRW A;  20GS A;  4GSS A;  5A1N B;  5CRE A;  2A4V A;  5ABR A;  4XS4 A;  2FWF A;  1S3A A;  3G9B A;  4A5P A;  4K0N A;  5ECN B;  1A0F A;  4KND A;  16GS A;  3O6T A;  1TI1 A;  5IQY A;  4MAB A;  2MMO A;  2IWT A;  2CAQ A;  2X8C A;  5DAK B;  3C73 A;  1WIK A;  4O92 A;  2VOC A;  3D6I A;  2IMK A;  2B1L A;  2DJK A;  3APO A;  4K7I A;  2FY6 A;  1ERW A;  2C3Q A;  1HYU A;  4WET A;  3TDG A;  2V6K A;  4PI0 C;  2GQK A;  1SKW B;  1XW5 A;  3UVH A;  4ZBD A;  5IMV A;  4ILF A;  2YZH A;  1K3Y A;  1AQX A;  4GSN A;  2CT6 A;  3H8Q A;  5J4Y A;  3TRQ A;  4TOP A;  1OE8 A;  5IO2 A;  4EXJ A;  5ECM B;  2HQT A;  4GDF A;  4ML6 A;  3GKX A;  3ZVJ A;  1Z9H A;  4AJ7 A;  1XWB A;  2FNO A;  4IP6 A;  4XRD A;  3D4T A;  2I81 A;  4X1U A;  3ZRE A;  2YWN A;  2Z9S A;  2VCT A;  1QFN A;  2MMA A;  3ZML A;  1PKZ A;  2CVD A;  1YKA A;  2EC4 A;  1BJX A;  2WW0 A;  2L4Q A;  5HR2 A;  5A1N A;  3SBC A;  2WGR A;  1N25 A;  5DBQ A;  4MLY A;  4X4J A;  2G2Q A;  3L9S A;  3BCK A;  1TRS A;  5CRD A;  3LOR A;  3F8U A;  4D73 A;  1PX7 A;  4V2N A;  1B4P A;  2PUK C;  2BMX A;  5DAK A;  2YWM A;  5GAN D;  1GUK A;  2FWG A;  3LFL A;  5KEJ A;  4HU7 A;  1SJZ A;  3MSZ A;  2V32 A;  5ELG A;  1GLQ A;  1DBY A;  2IMI A;  3F3R A;  4FQU A;  1Y1U A;  4F03 A;  5D73 A;  3WD6 A;  2OE1 A;  1U88 A;  1A0R P;  2B5X A;  4ECB A;  5CRW A;  4LMV A;  4L5O A;  1RW1 A;  4IJ3 A;  3TKR A;  2B5E A;  1X5C A;  5CRG A;  2JZT A;  1XVQ A;  5J3R A;  1S3C A;  4F0C A;  2GZP A;  4IVF A;  4XS1 A;  5DCH A;  1W89 A;  4G10 A;  4JU5 A;  3BOA A;  1FW1 A;  3H1N A;  3HHV A;  3MAK A;  3GX0 A;  1B4Q A;  1AIU A;  1ON4 A;  4GTU A;  2E2M A;  1SVM A;  1TRV A;  1KTE A;  2L5O A;  2R0P A;  2YWO A;  2OA7 A;  1X5D A;  4MH2 A;  2CZ3 A;  3TOU A;  4CY8 A;  2FGX A;  3VI7 A;  2PU9 C;  2B1K A;  3Q74 A;  4L8E A;  1G7O A;  3S9F A;  1U6T A;  1SK2 A;  3HYP A;  5HR3 A;  3TU3 B;  5ELA A;  4IJI A;  2OE0 A;  2OJL A;  3CTG A;  2H72 A;  1PRX A;  2DJ0 A;  1Z5Y E;  3J7Y b;  3LXZ A;  3W8J A;  2H01 A;  3BD2 A;  1THX A;  3BJ5 A;  5HR0 A;  3ED3 A;  2O36 A;  5LNK e;  5CAX A;  1GTU A;  5ID2 B;  1S3D A;  3RAZ A;  2LNS A;  3GL3 A;  4Z7X A;  2FA8 A;  2CV4 A;  5IMD A;  1PKW A;  3APS A;  2NBS A;  5JWO B;  1T7P B;  3LGC A;  1SVO A;  4OO4 A;  4G0L A;  4NMU A;  4N0V A;  4BWQ A;  3VWX A;  1B48 A;  1Q4J A;  5AN1 A;  3PIN A;  3FKF A;  2YOI A;  4ZBA A;  3US3 A;  3F6D A;  3RGB C;  2JAC A;  4G0K A;  1GTA A;  2OKA A;  2A2P A;  3IPZ A;  1GLP A;  3A5I A;  6GSS A;  3BCI A;  1XZO A;  2GGT A;  4ZB7 A;  4JBB A;  3LEF A;  3UAP A;  1K0N A;  2BTO T;  5IOW A;  4MPG A;  17GS A;  3HVS A;  3EPT A;  4ZIL A;  3GTU B;  1GH2 A;  2K18 A;  5GZZ B;  4PUR A;  3VWU A;  1YEP A;  5B6N A;  1EP8 A;  1XXU A;  1J0F A;  4ZL8 A;  3TJG A;  4BL7 B;  1PN9 A;  2C1Y A;  3KTB A;  2X49 A;  1S4B P;  1G0T A;  4QL9 A;  3GFK A;  3KMO A;  2WS2 A;  4POM A;  1VF2 A;  14GS A;  3CRU A;  3I9V 2;  4TR1 B;  4K7N A;  4G19 A;  3VWW A;  3FY7 A;  4HEA 2;  1Z7R A;  2C80 A;  3TB2 A;  1S3R A;  2CX4 A;  3C71 A;  3GKN A;  3GH6 A;  1ZYN A;  4G0I A;  3FYG A;  5ID2 A;  2O8V B;  4KE3 A;  4K6X A;  2O3E A;  3EU4 A;  3QFA C;  2YZU A;  3R2Q A;  2YP6 A;  19GS A;  1QXH A;  3TKS C;  3A5W A;  3A2V A;  3IAM 2;  5DJM A;  2I3Y A;  1XW6 A;  1XVW A;  3HVV A;  5BMU B;  4JZQ A;  4CY6 A;  3KMN A;  1G6Y A;  2HSM B;  1PD2 1;  1LBK A;  5FHI A;  2GS3 A;  1M9A A;  1GTI A;  4USS A;  3J7Y k;  5A5K A;  2M80 A;  1G7E A;  4OFT A;  4AKG A;  3E0U A;  4MJA A;  5CYY A;  2YNX A;  3TRX A;  1M2B A;  3QPM A;  1A2M A;  2HYX A;  5HR1 A;  4YH2 A;  2DML A;  3DD3 A;  3G7Y A;  1U87 A;  5IIZ A;  4NAX A;  3OR5 A;  2YPM A;  2H8L A;  2KLX A;  2QA1 A;  4EL1 A;  3GTU A;  4YKF A;  1ABA A;  3ZFL A;  4E8H A;  1ZOF A;  3PPU A;  4O5R A;  1BG1 A;  1XOA A;  4MPF A;  4WBJ A;  1B8X A;  2O5V A;  1GUH A;  4MF6 A;  5DJL A;  5ECL B;  2GSQ A;  4BL7 A;  3KEB A;  4TXV A;  4OMV A;  3QAG A;  2MBT A;  1FOH A;  1OC9 B;  2JAD A;  3F0I A;  1NHO A;  2QSI A;  1GWC A;  1CQH A;  3MWH A;  3UVT A;  5F07 A;  3FEU A;  2LRN A;  2DC5 A;  4TR1 A;  1K3O A;  4DSQ A;  2MYG A;  2C8U A;  4F9Z A;  1M3I A;  2V2G A;  3IHQ A;  4LL1 B;  1X9S B;  4G01 A;  3IK7 A;  2VD1 A;  5G1L A;  2RII A;  4KDX A;  2O7K A;  3D22 A;  3F6F A;  1MEK A;  4DSS A;  4TXO B;  4PUA A;  5J40 A;  2IFQ B;  3DGQ A;  1F37 A;  1YVL A;  5B8B A;  1JLV A;  3D4M A;  2VO4 A;  1KNG A;  1JZW A;  2F8A A;  1PGT A;  5BMU A;  3ME8 A;  2FD3 A;  4GQF A;  3C1S A;  3HJM A;  3I43 A;  2P5R A;  1YQ1 A;  3EIN A;  2R2J A;  3ZLP A;  1FG4 A;  2L57 A;  4ZXG A;  1A8Y A;  1J08 A;  1U3A A;  4XRA A;  1EGO A;  1R5P A;  2CZ2 A;  2KP1 A;  1SKR B;  4KW6 A;  1XIY A;  4BIK A;  4TR4 A;  1A23 A;  3HA9 A;  2BJX A;  3IBH A;  2H6Z A;  4I8B A;  3GMF A;  5D8I A;  4HUA A;  5GSS A;  2XPE A;  2KHP A;  2L6C A;  2GZZ A;  1QQ2 A;  4O5U A;  5D93 A;  2CA8 A;  3QOU A;  2IMD A;  2XHF A;  3L4N A;  5IMC A;  2N5A A;  3HJP A;  3DKS A;  2HXK A;  2H70 A;  4MDC A;  1V40 A;  2F3M A;  1XBS A;  5F0G A;  1HNA A;  2HRF A;  1EEM A;  4RQR A;  5H5S A;  1WJK A;  3A3T A;  4ISD A;  1K3L A;  2FCH A;  3H4K A;  2PGT A;  3APQ A;  5ECH B;  2KP2 A;  4L5L A;  2VCV A;  2VL9 A;  1T4Y A;  2M46 A;  3HVN A;  3F4R A;  4HQS A;  2AYT A;  4F82 A;  4TXO A;  1HNC A;  5A5H B;  3ZMK A;  3TJB A;  2IFQ A;  5CO3 A;  3TCO A;  3M9J A;  5EY6 A;  2H1A A;  4Z2R A;  2VM1 A;  2DKI A;  3F4T A;  3RHB A;  2IME A;  1SJI A;  4XIH A;  4WF4 A;  4J2F A;  3HXS A;  4KGI A;  2I9H A;  2R4V A;  4RI6 A;  5DAL B;  4WXT A;  5ENU A;  2IMF A;  3SWL A;  4YQV A;  3HKR A;  2X64 A;  3GA4 A;  5DQY A;  1K0O A;  4IBP A;  4HOJ A;  2EFC A;  3ZIV A;  1SEN A;  2R6K A;  1EOH A;  2H75 A;  4TVE A;  2WZS A;  2HT9 A;  3KP8 A;  1AW9 A;  3EC3 A;  1XOB A;  2H71 A;  2MBS A;  1PQN A;  1UN2 A;  1E2Y A;  2HRA A;  3HD5 A;  5CRH A;  4I6X A;  1SL0 B;  4Z2U A;  1ZCP A;  3H79 A;  3KZQ A;  4GWR A;  5KN2 A;  3CYN A;  3IXR A;  1Z6M A;  1SK1 A;  6GST A;  2P0G A;  5E59 A;  3ZL5 A;  2CVB A;  2VD0 A;  3TKS A;  2WVX B;  1M3J A;  4WKW A;  4NXI A;  3FW2 A;  3EUR A;  4AF2 A;  1OKT A;  1SK0 A;  4FO5 A;  1VF1 A;  1JFU A;  1MDK A;  2HRK A;  4I2T A;  4RUV A;  5CNW A;  1ZL9 A;  3IOS A;  4Q5N A;  3RFR C;  1A2L A;  1BQ7 A;  3DXB A;  5IMA A;  2H66 A;  3FHK A;  1GSF A;  5FT3 A;  1O85 A;  2XPD A;  3TJJ A;  4ZL7 A;  1HNB A;  1BF5 A;  3WGD A;  1WOU A;  4MMM A;  2H1G A;  3IHG A;  2LRC A;  1XWC A;  3GYK A;  4EDY A;  4EE0 A;  3V1W A;  5ECQ B;  3ISO A;  4PQI A;  3P2A A;  4ZB9 A;  2P5Q A;  2WW1 A;  1TRU A;  3KXO A;  3CXG A;  4XS6 A;  1JHB A;  3FR3 A;  1YEX A;  2VLU A;  2H1B A;  3FZA A;  5DAL A;  1SYX A;  2TRC P;  5INY A;  4AKX B;  3DVX A;  2VCX A;  3M9K A;  4TN8 A;  4IQA A;  12GS A;  4EF0 A;  4EVM A;  3CTF A;  2FHE A;  4KAE A;  3M8N A;  1O81 A;  2H30 A;  4V1A p;  5JWR B;  4EIQ A;  3IK9 A;  4TW5 A;  1H4O A;  1QUW A;  4RQX A;  2YV7 A;  1GTB A;  3CSI A;  4PI2 C;  2OBK A;  1H75 A;  3F63 A;  3KH7 A;  2ZUP A;  1IYI A;  4Z2T A;  2JSZ A;  2JZR A;  3ME7 A;  6GSV A;  1TXU A;  4HDE A;  5IM9 A;  4POL A;  3HVX A;  18GS A;  2IIY A;  2A2S A;  3GN3 A;  3F9U A;  4I5Q A;  2H0H A;  3IAS 2;  2JSY A;  3E9J B;  2WJU A;  2DIY A;  2MZC A;  2X4A A;  4WEY A;  5ECK B;  3M0F A;  3M3M A;  4JR6 A;  1YF0 A;  1GUL A;  11GS A;  2FWE A;  1JZO A;  1PSQ A;  2JZS A;  1V58 A;  3LQ7 A;  4TR0 A;  1J9B A;  1ZYQ B;  2GLR A;  5J47 A;  3GNJ A;  4POB A;  1K0D A;  4N0Z A;  1TJD A;  4G2E A;  1DUG A;  2L4C A;  4K2D A;  3AY8 A;  3TGZ A;  3HZ4 A;  2F8F A;  5AGY A;  4KSM A;  5J4U A;  4J56 E;  2YN1 A;  1K0C A;  1SJ6 A;  1WP0 A;  1M0U A;  1QMV A;  3FRC A;  2WFC A;  3VK9 A;  4HZ2 A;  3TKS E;  5KN1 A;  4FXY P;  3CBU A;  2J9H A;  2AV4 A;  3RHC A;  1ERV A;  1OYJ A;  1OC3 A;  4G9H A;  3DVW A;  2LV3 A;  5IMF A;  5GST A;  2QKE A;  1JLW A;  1I5G A;  3EE2 A;  1MD3 A;  4BVY B;  2GSS A;  1ZZY A;  4PNG A;  2K9F A;  2X8G A;  3MNG A;  3TKP A;  1GSU A;  4ZL9 A;  5A34 B;  4PXO A;  5B8A A;  2X99 A;  5IOX A;  4NV5 A;  5LD0 A;  3D5J A;  5JCU A;  3CRT A;  8GSS A;  1WRY A;  3ZRD A;  1SL1 B;  1X9W B;  4EIP A;  3TRP A;  2GTU A;  3Q18 A;  1LU4 A;  2REM A;  4JE1 A;  1X0R A;  4F2I A;  5IPG A;  3WGX A;  2R3X A;  3EWL A;  4L0U A;  2WW3 A;  1K0M A;  4HS1 A;  22GS A;  4E68 A;  1OC8 A;  2I1U A;  4HJM A;  1R4W A;  2FA4 A;  3EVI A;  1EOG A;  3L0H A;  3QFB C;  1F9M A;  5BRT A;  3DIE A;  4HSC X;  1R26 A;  6GSY A;  2IL3 A;  4JRR A;  2C4J A;  1XFL A;  4AJ8 A;  1VF4 A;  3UAR A;  4POK A;  2C3N A;  3U6V A;  1BX9 A;  5KN0 A;  1EWX A;  2WCI A;  4MP4 A;  2CVK A;  4IQ1 A;  1N8J A;  1WWJ A;  4K5R A;  4KA0 A;  4P3Y B;  1VRS D;  2LEG A;  1OAZ A;  1VF3 A;  5G30 A;  5JCW A;  1DE1 A;  3DYR A;  2EIR A;  1GP1 A;  1O73 A;  2ALB A;  4DEJ A;  3TKQ A;  2XC2 A;  1I1I P;  1GSS A;  2GT6 A;  2WB9 A;  2RM5 A;  5J41 A;  4BVY A;  3HZ8 A;  2WVY A;  1WPI A;  3GUS A;  1FOV A;  5A34 A;  1O8W A;  2UZ8 A;  3A2W A;  1QGV A;  2CQ9 A;  2GZY A;  4V1A g;  3QAW A;  4LLR A;  2ES7 A;  3L9U A;  4YAV A;  4ZIJ A;  1XWA A;  2LJA A;  4H86 A;  2OAD A;  5DQS A;  5G5F A;  2C0G A;  3KTL A;  1XCC A;  2VM2 A;  2P31 A;  4WF5 A;  4KX4 A;  5AIS A;  3TOT A;  4YQU A;  4BPY A;  4RI7 A;  4N10 A;  4NWY A;  2HNL A;  1Z3E A;  1TTZ A;  3GRX A;  2WW2 A;  1FVK A;  1ZGN A;  1YEW C;  4K7O A;  2LQO A;  2PWJ A;  2AUV A;  2DLX A;  3LSZ A;  3NIV A;  2R5G A;  5A4V A;  1V9W A;  5D9X A;  3BBY A;  2R0C A;  1V98 A;  4X0X A;  3IA1 A;  2HLS A;  2AJQ B;  1DE2 A;  4GRF A;  4ULX A;  3GIX A;  5IMZ A;  4JED A;  1Z7P A;  2LQQ A;  1T1V A;  3KJY A;  1CQG A;  3HY2 A;  3N5O A;  3QAV A;  3DEX A;  5COH A;  1SL2 B;  4EO3 A;  4OCF A;  2RUE A;  2ON7 A;  7GSS A;  3KIJ A;  2H76 A;  1LJR A;  3W8S A;  5G5E A;  3NZN A;  4ZB8 A;  2WUL A;  5J9C A;  2OBI A;  2EIQ A;  1PA3 A;  1NW2 A;  1E6B A;  1TK0 B;  4PNF A;  4DVC A;  2IPA A;  3EMX A;  1XWK A;  4GQC A;  1KEB A;  4LL4 B;  4TR3 A;  4MF5 A;  2HSM A;  5JCG A;  1Q98 A;  2V1M A;  4CDO A;  4ECC A;  3JCM L;  3LWA A;  4YAP A;  1EEJ A;  3EYT A;  2K6V A;  4FH8 A;  5KOX A;  1N2A A;  4HQZ A;  5D9V A;  4IP1 A;  1GNW A;  5H5Q A;  2HFD A;  5KOW A;  3HJO A;  2PN8 A;  2N5B A;  1YJ6 A;  4KCA A;  1OC9 A;  1TP9 A;  3GST A;  4FYB A;  2NDO A;  4GXZ A;  5LCZ A;  2AHE A;  2WDU A;  4O5Q A;  1TKD B;  2LRT A;  3LXT A;  4MJB A;  1SYR A;  2VCQ A;  2JU5 A;  1HQO A;  4N30 A;  4MZB A;  3K8N A;  5C04 A;  1WE0 A;  3QR6 A;  1PN0 A;  5E4W A;  1W4V A;  2DMM A;  1X5E A;  2YAN A;  2C0F A;  1B9Y C;  1Y25 A;  1TI3 A;  2I4A A;  2XBI A;  2LST A;  3RPP A;  1O6J A;  5CP1 A;  1BYE A;  2LJR A;  2HE3 A;  3ERG A;  3A2X A;  1F3B A;  4OCE A;  5EPF A;  3QD9 A;  1RK4 A;  2YJ7 A;  1XPV A;  2NPB A;  1PL1 A;  1K0B A;  4EC0 A;  9GSS A;  4J57 E;  4AKI A;  1TW9 A;  5IO0 A;  2VAF A;  2HRN A;  2B5Y A;  2HI7 A;  5FWG A;  1UVZ A;  1F2E A;  3LJR A;  1OKD A;  3FR6 A;  1V2A A;  1GUM A;  2DKH A;  1YY7 A;  3H93 A;  4TKY A;  1JZR A;  3DML A;  4MZC A;  3PGT A;  2GQL A;  3DWV A;  4V2L A;  2VL3 A;  3GV1 A;  4D73 B;  1F3A A;  1V57 A;  2F9S A;  2YCD A;  1PMT A;  2L59 A;  2PER A;  4QQ7 A;  3UL3 A;  2DSA A;  2JL4 A;  1SVL A;  3ZVJ D;  2B7K A;  1G6W A;  4KCE A;  5F8B A;  1FB0 A;  3CSJ A;  5A4U A;  1T8E B;  1ST9 A;  3L9V A;  5B6M A;  2YJH A;  2MMN A;  1M2A A;  3ZZX A;  4PTS A;  3VPT A;  5A4W A;  3FK8 A;  5KN3 A;  4GST A;  2DIZ A;  3CQF A;  5DVB A;  5ECP B;  4JR4 A;  3ZYW A;  4OFM A;  2PPT A;  2IJY A;  3IC8 A;  2TIR A;  3N9J A;  1PL2 A;  1ILO A;  2OT3 A;  3MIX A;  2ZCT A;  1UA5 A;  1OE7 A;  3D0Z A;  1SD9 A;  2E7P A;  2X8H A;  3GUR A;  2VCW A;  1YKC A;  2QC7 A;  3IR4 A;  1NSW A;  4LMW A;  4FYU A;  3CWG A;  3TUE A;  2HSH A;  5A5H A;  4ECI A;  3C7M A;  3CSH A;  1USB A;  4OD7 A;  4OO5 A;  1ML6 A;  4ZBB A;  1ERT A;  1EV9 A;  2HZE B;  1ACV A;  1XW9 A;  2YWI A;  1TK5 B;  3DRN A;  3FZ5 A;  1SU9 A;  2LJK A;  2G0F A;  1EP7 A;  2M72 A;  3GX8 A;  5G1K A;  4DSR A;  2CAI A;  4PQH A;  4F0B A;  2HSY A;  2H74 A;  1GSD A;  3VUR A;  4WBR D;  4EKZ A;  4Q5F A;  3KD0 A;  3MYD A;  1AC1 A;  3KCM A;  2K8V A;  5IPH A;  2A2R A;  5DDL A;  2IN3 A;  1A2J A;  1GRX A;  3CMI A;  3CHX C;  2VL2 C;  2YV9 A;  1T3B A;  3O76 A;  4MNN A;  4K9Z A;  3RBT A;  1NM3 A;  4I2U A;  2FLS A;  3GH9 A;  2XBQ A;  5D96 A;  4PQ1 A;  1FHE A;  2WVX A;  4IEL A;  3IRA A;  1SD8 A;  1XWG A;  1TOF A;  4IS0 A;  3ZIT A;  4MF7 A;  4GLT A;  2B7J A;  4ICY A;  3KH9 A;  5D9T A;  4IW9 A;  2ON5 A;  2N5F A;  6GSW A;  1GL8 A;  4BVX B;  4LA1 A;  1B9X C;  4AGS A;  3VLN A;  1THO A;  2GT5 A;  2GSR A;  2VCZ A;  1T4Z A;  4CW9 A;  3LG6 A;  2L6D A;  1AQV A;  4N11 A;  1UC7 A;  1RQM A;  3VI5 A;  3FZ4 A;  4AJ6 A;  4MZW A;  2ZNM A;  4TRX A;  3FR9 A;  3TJF A;  1Y6E A;  1MDI A;  2DJ3 A;  3C1R A;  2HZE A;  1O7U A;  2V6O A;  5D9W A;  4W66 A;  2FUG 2;  2RUF A;  2AAW A;  3MDK A;  3HCZ A;  4XTS A;  3O3T A;  1VGL A;  4K0G A;  4QMK A;  3W6G A;  4PX1 A;  1ZYE A;  3UIW A;  4HJ2 A;  2H1L A;  2PMT A;  5J5N A;  2H0I A;  1EGR A;  1FAA A;  4K8M A;  3ZIJ A;  2HSN B;  4BA7 A;  1TU8 A;  2H19 A;  5J9B A;  2GDR A;  2VLV A;  5L71 A;  4CHS A;  2LNT A;  1GNE A;  2GQM A;  4V2M A;  2NTO A;  4WR5 A;  5G2Z A;  4KB3 A;  4EUY A;  2J23 A;  1U3I A;  3EU3 A;  1URM A;  1Z6N A;  4FYC A;  1ZMA A;  2K8S A;  2H0G A;  4MCU A;  2LTK A;  1FVJ A;  5J4V A;  1AXD A;  4HI7 A;  2H6X A;  3EMP A;  3TJK A;  1ERU A;  1NHY A;  4BVX A;  1YDK A;  5F05 A;  3P90 A;  2QGV A;  3IE3 A;  1KBN A;  1DSB A;  2L5L A;  1SKS B;  3P8W A;  2LUS A;  2O89 A;  3ERF A;  2EIO A;  2PVO C;  2V41 A;  4L0W A;  2TRX A;  4MJE A;  3PH9 A;  3QDN A;  2KOK A;  3WT2 A;  2H6Y A;  4K1F A;  13GS A;  3WYW A;  4NHZ A;  1QK8 A;  2GVP A; 
#chains in the Genus database with same CATH homology
 2RLI A;  3VWV A;  2E2G A;  2D2Z A;  4MH3 A;  2DJ2 A;  3UMA A;  3PR8 A;  4OFN A;  3P7X A;  4MK3 A;  1MTC A;  1A8L A;  3VFI A;  1MDJ A;  5HFK A;  3E3E A;  4N3Z A;  5AIX A;  3Q6O A;  5GAP D;  1A24 A;  3F4S A;  4O32 A;  3ZTL A;  2FWH A;  1JZD A;  2HSN A;  2GST A;  4IN0 A;  3UBL A;  4EDZ A;  3KP9 A;  4DSS B;  2E0Q A;  3ERW A;  2EFD A;  2LS5 A;  1M2D A;  2OAC A;  3HDC A;  1GSQ A;  1AUC A;  2KUC A;  1IYH A;  3G7I A;  5JWQ B;  1BG5 A;  4YKG A;  1GSE A;  3GHA A;  4XCS A;  4KH7 A;  3Q19 A;  1R7H A;  3LYP A;  3UEM A;  1HD2 A;  1M7T A;  4Q5R A;  3VPQ A;  1YF1 A;  4MJC A;  4IKH A;  4IHU A;  4X43 A;  2VKZ G;  4O7H A;  2DJ1 A;  4ZB6 A;  1K0A A;  2O87 A;  2O85 A;  3GKK A;  4PGT A;  1WMJ A;  2DJJ A;  4MA9 A;  3GL5 A;  1ZYP A;  5HFG A;  4E8E A;  2R37 A;  3ZFB A;  2VL2 A;  1F6M C;  2HZF A;  6GSU A;  2H73 A;  3G7J A;  3UOM A;  5DCG A;  4AI6 A;  2VUP A;  1TU7 A;  3GKM A;  3UBK A;  3IV4 A;  1C72 A;  1MD4 A;  3IC4 A;  3LYK A;  5F06 A;  4K2X A;  1TXX A;  2OE3 A;  3RDW A;  2CX3 A;  3FMW A;  4ID0 A;  1R5A A;  5B7C A;  3QCP A;  4KF9 A;  4NV2 A;  3KM6 A;  4XHM A;  4NPB A;  1YZX A;  2EFE A;  2PBJ A;  1PX6 A;  3C8E A;  5EVO A;  4K5S A;  1TK8 B;  4AKH A;  2C0D A;  1O8X A;  4XS4 B;  3I6A A;  4OWY A;  1TDI A;  4WR4 A;  4FIW A;  4BWS A;  10GS A;  3GSS A;  3M1G A;  1EV4 A;  5H5R A;  2C0E A;  4PUF C;  3R3E A;  3LW9 A;  5ECS A;  1I9D A;  3UJ1 A;  1M99 A;  1M9B A;  4QL7 A;  2VLT A;  5C00 A;  4YQM A;  3U5R E;  3L78 A;  1BED A;  3NOF A;  2RM6 A;  4IGJ A;  5AIV A;  2UV8 G;  3RPN A;  1AAZ A;  2B6M A;  4HU9 A;  4GCI A;  2VIM A;  1T00 A;  2EFH A;  2H1D A;  3WGE A;  1AQW A;  3QMX A;  4ML1 A;  4GF0 A;  4HZ4 A;  5EL8 A;  5HQP A;  2LKU A;  2NVL A;  3I69 A;  1FO5 A;  2QA2 A;  3HMJ G;  2WRT A;  4KUN A;  2F51 A;  1X9M B;  3FZ9 A;  3D21 A;  4I97 A;  1FB6 A;  1GSY A;  3KGK A;  4ECJ A;  2WZ9 A;  5ECO B;  4Q5Q A;  2C3T A;  2R0G A;  2HRK B;  3F3Q A;  4KDU A;  1EZK A;  2A4H A;  5G31 A;  2DBC A;  4KSO A;  5ECR B;  2PVQ A;  1OVN A;  5ECI B;  4NHW A;  4KDY A;  4ACS A;  6GSX A;  2B3S A;  2AB6 A;  2MMZ A;  1BAY A;  3IDV A;  5HFI A;  3WT1 A;  1TRW A;  20GS A;  4GSS A;  5A1N B;  5CRE A;  2A4V A;  5ABR A;  4XS4 A;  2FWF A;  1S3A A;  3G9B A;  4A5P A;  4K0N A;  5ECN B;  1A0F A;  4KND A;  16GS A;  3O6T A;  1TI1 A;  5IQY A;  4MAB A;  2MMO A;  2IWT A;  2CAQ A;  2X8C A;  5DAK B;  3C73 A;  1WIK A;  4O92 A;  2VOC A;  3D6I A;  2IMK A;  2B1L A;  2DJK A;  3APO A;  4K7I A;  2FY6 A;  1ERW A;  2C3Q A;  1HYU A;  4WET A;  3TDG A;  2V6K A;  2GQK A;  1SKW B;  1XW5 A;  3UVH A;  4ZBD A;  5IMV A;  4ILF A;  2YZH A;  1K3Y A;  1AQX A;  4GSN A;  2CT6 A;  3H8Q A;  5J4Y A;  3TRQ A;  4TOP A;  1OE8 A;  5IO2 A;  4EXJ A;  5ECM B;  2HQT A;  4GDF A;  4ML6 A;  3GKX A;  3ZVJ A;  1Z9H A;  4AJ7 A;  1XWB A;  2FNO A;  4IP6 A;  4XRD A;  3D4T A;  2I81 A;  4X1U A;  3ZRE A;  2YWN A;  2Z9S A;  2VCT A;  1QFN A;  2MMA A;  3ZML A;  1PKZ A;  2CVD A;  1YKA A;  2EC4 A;  1BJX A;  2L4Q A;  5HR2 A;  5A1N A;  3SBC A;  2WGR A;  1N25 A;  5DBQ A;  4MLY A;  4X4J A;  2G2Q A;  3L9S A;  3BCK A;  1TRS A;  5CRD A;  3LOR A;  3F8U A;  4D73 A;  1PX7 A;  4V2N A;  1B4P A;  2PUK C;  2BMX A;  5DAK A;  2YWM A;  5GAN D;  1GUK A;  2FWG A;  3LFL A;  5KEJ A;  4HU7 A;  1SJZ A;  3MSZ A;  2V32 A;  5ELG A;  1GLQ A;  1DBY A;  2IMI A;  3F3R A;  4FQU A;  1Y1U A;  4F03 A;  5D73 A;  3WD6 A;  2OE1 A;  1U88 A;  1A0R P;  2B5X A;  4ECB A;  5CRW A;  4LMV A;  4L5O A;  1RW1 A;  4IJ3 A;  3TKR A;  2B5E A;  1X5C A;  5CRG A;  2JZT A;  1XVQ A;  5J3R A;  1S3C A;  4F0C A;  2GZP A;  4IVF A;  4XS1 A;  5DCH A;  1W89 A;  4G10 A;  4JU5 A;  3BOA A;  1FW1 A;  3H1N A;  3HHV A;  3MAK A;  3GX0 A;  1B4Q A;  1AIU A;  1ON4 A;  4GTU A;  2E2M A;  1SVM A;  1TRV A;  1KTE A;  2L5O A;  2R0P A;  2YWO A;  2OA7 A;  1X5D A;  4MH2 A;  2CZ3 A;  3TOU A;  4CY8 A;  2FGX A;  3VI7 A;  2PU9 C;  2B1K A;  3Q74 A;  4L8E A;  1G7O A;  3S9F A;  1U6T A;  1SK2 A;  3HYP A;  5HR3 A;  3TU3 B;  5ELA A;  4IJI A;  2OE0 A;  2OJL A;  3CTG A;  2H72 A;  1PRX A;  2DJ0 A;  1Z5Y E;  3J7Y b;  3LXZ A;  3W8J A;  2H01 A;  3BD2 A;  1THX A;  3BJ5 A;  5HR0 A;  3ED3 A;  5LNK e;  5CAX A;  1GTU A;  5ID2 B;  1S3D A;  3RAZ A;  2LNS A;  3GL3 A;  4Z7X A;  2FA8 A;  2CV4 A;  5IMD A;  1PKW A;  3APS A;  2NBS A;  5JWO B;  1T7P B;  3LGC A;  1SVO A;  4OO4 A;  4G0L A;  4NMU A;  4N0V A;  4BWQ A;  3VWX A;  1B48 A;  1Q4J A;  5AN1 A;  3PIN A;  3FKF A;  2YOI A;  4ZBA A;  3US3 A;  3F6D A;  2JAC A;  4G0K A;  1GTA A;  2OKA A;  2A2P A;  3IPZ A;  1GLP A;  3A5I A;  6GSS A;  3BCI A;  1XZO A;  2GGT A;  4ZB7 A;  4JBB A;  3LEF A;  3UAP A;  1K0N A;  2BTO T;  5IOW A;  4MPG A;  17GS A;  3HVS A;  3EPT A;  4ZIL A;  3GTU B;  1GH2 A;  2K18 A;  5GZZ B;  4PUR A;  3VWU A;  1YEP A;  5B6N A;  1EP8 A;  1XXU A;  1J0F A;  4ZL8 A;  3TJG A;  4BL7 B;  1PN9 A;  2C1Y A;  3KTB A;  2X49 A;  1G0T A;  4QL9 A;  3GFK A;  3KMO A;  2WS2 A;  4POM A;  1VF2 A;  14GS A;  3CRU A;  3I9V 2;  4TR1 B;  4K7N A;  4G19 A;  3VWW A;  3FY7 A;  4HEA 2;  1Z7R A;  2C80 A;  3TB2 A;  2CX4 A;  3C71 A;  3GKN A;  3GH6 A;  1ZYN A;  4G0I A;  3FYG A;  5ID2 A;  2O8V B;  4KE3 A;  4K6X A;  3EU4 A;  3QFA C;  2YZU A;  3R2Q A;  2YP6 A;  19GS A;  1QXH A;  3TKS C;  3A5W A;  3A2V A;  3IAM 2;  5DJM A;  2I3Y A;  1XW6 A;  1XVW A;  3HVV A;  5BMU B;  4JZQ A;  4CY6 A;  3KMN A;  1G6Y A;  2HSM B;  1PD2 1;  1LBK A;  5FHI A;  2GS3 A;  1M9A A;  1GTI A;  4USS A;  3J7Y k;  5A5K A;  2M80 A;  1G7E A;  4OFT A;  4AKG A;  3E0U A;  4MJA A;  5CYY A;  2YNX A;  3TRX A;  1M2B A;  3QPM A;  1A2M A;  2HYX A;  5HR1 A;  4YH2 A;  2DML A;  3DD3 A;  3G7Y A;  1U87 A;  5IIZ A;  4NAX A;  3OR5 A;  2YPM A;  2H8L A;  2KLX A;  2QA1 A;  4EL1 A;  3GTU A;  4YKF A;  1ABA A;  3ZFL A;  4E8H A;  1ZOF A;  3PPU A;  4O5R A;  1BG1 A;  1XOA A;  4MPF A;  4WBJ A;  1B8X A;  2O5V A;  1GUH A;  4MF6 A;  5DJL A;  5ECL B;  2GSQ A;  4BL7 A;  3KEB A;  4TXV A;  4OMV A;  3QAG A;  2MBT A;  1FOH A;  1OC9 B;  2JAD A;  3F0I A;  1NHO A;  2QSI A;  1GWC A;  1CQH A;  3MWH A;  3UVT A;  5F07 A;  3FEU A;  2LRN A;  2DC5 A;  4TR1 A;  1K3O A;  4DSQ A;  2MYG A;  2C8U A;  4F9Z A;  2V2G A;  3IHQ A;  4LL1 B;  1X9S B;  4G01 A;  3IK7 A;  2VD1 A;  5G1L A;  2RII A;  4KDX A;  2O7K A;  3D22 A;  3F6F A;  1MEK A;  4DSS A;  4TXO B;  4PUA A;  5J40 A;  2IFQ B;  3DGQ A;  1F37 A;  1YVL A;  5B8B A;  1JLV A;  3D4M A;  2VO4 A;  1KNG A;  1JZW A;  2F8A A;  1PGT A;  5BMU A;  3ME8 A;  2FD3 A;  4GQF A;  3C1S A;  3HJM A;  3I43 A;  2P5R A;  1YQ1 A;  3EIN A;  2R2J A;  3ZLP A;  1FG4 A;  2L57 A;  4ZXG A;  1A8Y A;  1J08 A;  1U3A A;  4XRA A;  1EGO A;  1R5P A;  2CZ2 A;  2KP1 A;  1SKR B;  4KW6 A;  1XIY A;  4TR4 A;  1A23 A;  3HA9 A;  2BJX A;  3IBH A;  2H6Z A;  4I8B A;  3GMF A;  5D8I A;  4HUA A;  5GSS A;  2XPE A;  2KHP A;  2L6C A;  2GZZ A;  1QQ2 A;  4O5U A;  5D93 A;  2CA8 A;  3QOU A;  2IMD A;  2XHF A;  3L4N A;  5IMC A;  2N5A A;  3HJP A;  3DKS A;  2HXK A;  2H70 A;  4MDC A;  1V40 A;  2F3M A;  1XBS A;  5F0G A;  1HNA A;  2HRF A;  1EEM A;  4RQR A;  5H5S A;  1WJK A;  3A3T A;  4ISD A;  1K3L A;  2FCH A;  3H4K A;  2PGT A;  3APQ A;  5ECH B;  2KP2 A;  4L5L A;  2VCV A;  2VL9 A;  1T4Y A;  2M46 A;  3F4R A;  4HQS A;  2AYT A;  4F82 A;  4TXO A;  1HNC A;  5A5H B;  3ZMK A;  3TJB A;  2IFQ A;  5CO3 A;  3TCO A;  3M9J A;  5EY6 A;  2H1A A;  4Z2R A;  2VM1 A;  2DKI A;  3F4T A;  3RHB A;  2IME A;  1SJI A;  4XIH A;  4WF4 A;  4J2F A;  3HXS A;  4KGI A;  2I9H A;  2R4V A;  4RI6 A;  5DAL B;  4WXT A;  5ENU A;  2IMF A;  3SWL A;  4YQV A;  3HKR A;  2X64 A;  3GA4 A;  5DQY A;  1K0O A;  4IBP A;  4HOJ A;  2EFC A;  3ZIV A;  1SEN A;  2R6K A;  1EOH A;  2H75 A;  4TVE A;  2HT9 A;  3KP8 A;  1AW9 A;  3EC3 A;  1XOB A;  2H71 A;  2MBS A;  1PQN A;  1UN2 A;  1E2Y A;  2HRA A;  3HD5 A;  5CRH A;  4I6X A;  1SL0 B;  4Z2U A;  1ZCP A;  3H79 A;  3KZQ A;  4GWR A;  5KN2 A;  3CYN A;  3IXR A;  1Z6M A;  1SK1 A;  6GST A;  2P0G A;  5E59 A;  3ZL5 A;  2CVB A;  2VD0 A;  3TKS A;  4WKW A;  4NXI A;  3FW2 A;  3EUR A;  4AF2 A;  1OKT A;  1SK0 A;  4FO5 A;  1VF1 A;  1JFU A;  1MDK A;  2HRK A;  4I2T A;  4RUV A;  5CNW A;  1ZL9 A;  3IOS A;  4Q5N A;  1A2L A;  1BQ7 A;  3DXB A;  5IMA A;  2H66 A;  3FHK A;  1GSF A;  5FT3 A;  1O85 A;  2XPD A;  3TJJ A;  4ZL7 A;  1HNB A;  1BF5 A;  3WGD A;  1WOU A;  4MMM A;  2H1G A;  3IHG A;  2LRC A;  1XWC A;  3GYK A;  4EDY A;  4EE0 A;  3V1W A;  5ECQ B;  3ISO A;  4PQI A;  3P2A A;  4ZB9 A;  2P5Q A;  1TRU A;  3KXO A;  3CXG A;  4XS6 A;  1JHB A;  3FR3 A;  1YEX A;  2VLU A;  2H1B A;  3FZA A;  5DAL A;  1SYX A;  2TRC P;  5INY A;  4AKX B;  3DVX A;  2VCX A;  3M9K A;  4TN8 A;  4IQA A;  12GS A;  4EF0 A;  4EVM A;  3CTF A;  2FHE A;  4KAE A;  3M8N A;  1O81 A;  2H30 A;  4V1A p;  5JWR B;  4EIQ A;  3IK9 A;  4TW5 A;  1H4O A;  1QUW A;  4RQX A;  2YV7 A;  1GTB A;  3CSI A;  2OBK A;  1H75 A;  3F63 A;  3KH7 A;  2ZUP A;  1IYI A;  4Z2T A;  2JSZ A;  2JZR A;  3ME7 A;  6GSV A;  1TXU A;  4HDE A;  5IM9 A;  4POL A;  3HVX A;  18GS A;  2IIY A;  2A2S A;  3GN3 A;  3F9U A;  4I5Q A;  2H0H A;  3IAS 2;  2JSY A;  3E9J B;  2WJU A;  2DIY A;  2MZC A;  2X4A A;  4WEY A;  5ECK B;  3M0F A;  3M3M A;  4JR6 A;  1YF0 A;  1GUL A;  11GS A;  2FWE A;  1JZO A;  1PSQ A;  2JZS A;  1V58 A;  3LQ7 A;  4TR0 A;  1J9B A;  1ZYQ B;  2GLR A;  5J47 A;  3GNJ A;  4POB A;  1K0D A;  4N0Z A;  1TJD A;  4G2E A;  1DUG A;  2L4C A;  4K2D A;  3AY8 A;  3TGZ A;  3HZ4 A;  2F8F A;  5AGY A;  4KSM A;  5J4U A;  4J56 E;  2YN1 A;  1K0C A;  1SJ6 A;  1WP0 A;  1M0U A;  1QMV A;  3FRC A;  2WFC A;  3VK9 A;  4HZ2 A;  3TKS E;  5KN1 A;  3CBU A;  2J9H A;  2AV4 A;  3RHC A;  1ERV A;  1OYJ A;  1OC3 A;  4G9H A;  3DVW A;  2LV3 A;  5IMF A;  5GST A;  2QKE A;  1JLW A;  1I5G A;  3EE2 A;  1MD3 A;  4BVY B;  2GSS A;  1ZZY A;  4PNG A;  2K9F A;  2X8G A;  3MNG A;  3TKP A;  1GSU A;  4ZL9 A;  5A34 B;  4PXO A;  5B8A A;  2X99 A;  5IOX A;  4NV5 A;  5LD0 A;  3D5J A;  5JCU A;  3CRT A;  8GSS A;  1WRY A;  3ZRD A;  1SL1 B;  1X9W B;  4EIP A;  3TRP A;  2GTU A;  3Q18 A;  1LU4 A;  2REM A;  4JE1 A;  1X0R A;  4F2I A;  5IPG A;  3WGX A;  2R3X A;  3EWL A;  4L0U A;  1K0M A;  4HS1 A;  22GS A;  4E68 A;  1OC8 A;  2I1U A;  4HJM A;  1R4W A;  2FA4 A;  3EVI A;  1EOG A;  3L0H A;  3QFB C;  1F9M A;  5BRT A;  3DIE A;  1R26 A;  6GSY A;  2IL3 A;  4JRR A;  2C4J A;  1XFL A;  4AJ8 A;  1VF4 A;  3UAR A;  4POK A;  2C3N A;  3U6V A;  1BX9 A;  5KN0 A;  1EWX A;  2WCI A;  4MP4 A;  2CVK A;  4IQ1 A;  1N8J A;  1WWJ A;  4K5R A;  4KA0 A;  4P3Y B;  1VRS D;  2LEG A;  1OAZ A;  1VF3 A;  5G30 A;  5JCW A;  1DE1 A;  3DYR A;  2EIR A;  1GP1 A;  1O73 A;  2ALB A;  4DEJ A;  3TKQ A;  2XC2 A;  1GSS A;  2GT6 A;  2WB9 A;  2RM5 A;  5J41 A;  4BVY A;  3HZ8 A;  1WPI A;  3GUS A;  1FOV A;  5A34 A;  1O8W A;  2UZ8 A;  3A2W A;  1QGV A;  2CQ9 A;  2GZY A;  4V1A g;  3QAW A;  4LLR A;  2ES7 A;  3L9U A;  4YAV A;  4ZIJ A;  1XWA A;  2LJA A;  4H86 A;  2OAD A;  5DQS A;  5G5F A;  2C0G A;  3KTL A;  1XCC A;  2VM2 A;  2P31 A;  4WF5 A;  4KX4 A;  5AIS A;  3TOT A;  4YQU A;  4BPY A;  4RI7 A;  4N10 A;  4NWY A;  2HNL A;  1Z3E A;  1TTZ A;  3GRX A;  1FVK A;  1ZGN A;  4K7O A;  2LQO A;  2PWJ A;  2AUV A;  2DLX A;  3LSZ A;  3NIV A;  2R5G A;  5A4V A;  1V9W A;  5D9X A;  3BBY A;  2R0C A;  1V98 A;  4X0X A;  3IA1 A;  2HLS A;  2AJQ B;  1DE2 A;  4GRF A;  4ULX A;  3GIX A;  5IMZ A;  4JED A;  1Z7P A;  2LQQ A;  1T1V A;  3KJY A;  1CQG A;  3HY2 A;  3N5O A;  3QAV A;  3DEX A;  5COH A;  1SL2 B;  4EO3 A;  4OCF A;  2RUE A;  2ON7 A;  7GSS A;  3KIJ A;  2H76 A;  1LJR A;  3W8S A;  5G5E A;  3NZN A;  4ZB8 A;  2WUL A;  5J9C A;  2OBI A;  2EIQ A;  1PA3 A;  1NW2 A;  1E6B A;  1TK0 B;  4PNF A;  4DVC A;  2IPA A;  3EMX A;  1XWK A;  4GQC A;  1KEB A;  4LL4 B;  4TR3 A;  4MF5 A;  2HSM A;  5JCG A;  1Q98 A;  2V1M A;  4CDO A;  4ECC A;  3JCM L;  3LWA A;  4YAP A;  1EEJ A;  3EYT A;  2K6V A;  4FH8 A;  5KOX A;  1N2A A;  4HQZ A;  5D9V A;  4IP1 A;  1GNW A;  5H5Q A;  2HFD A;  5KOW A;  3HJO A;  2PN8 A;  2N5B A;  1YJ6 A;  4KCA A;  1OC9 A;  1TP9 A;  3GST A;  4FYB A;  2NDO A;  4GXZ A;  5LCZ A;  2AHE A;  2WDU A;  4O5Q A;  1TKD B;  2LRT A;  3LXT A;  4MJB A;  1SYR A;  2VCQ A;  2JU5 A;  1HQO A;  4N30 A;  4MZB A;  3K8N A;  5C04 A;  1WE0 A;  3QR6 A;  1PN0 A;  5E4W A;  1W4V A;  2DMM A;  1X5E A;  2YAN A;  2C0F A;  1B9Y C;  1Y25 A;  1TI3 A;  2I4A A;  2XBI A;  2LST A;  3RPP A;  1O6J A;  5CP1 A;  1BYE A;  2LJR A;  2HE3 A;  3ERG A;  3A2X A;  1F3B A;  4OCE A;  5EPF A;  3QD9 A;  1RK4 A;  2YJ7 A;  1XPV A;  2NPB A;  1PL1 A;  1K0B A;  4EC0 A;  9GSS A;  4J57 E;  4AKI A;  1TW9 A;  5IO0 A;  2VAF A;  2HRN A;  2B5Y A;  2HI7 A;  5FWG A;  1UVZ A;  1F2E A;  3LJR A;  1OKD A;  3FR6 A;  1V2A A;  1GUM A;  2DKH A;  1YY7 A;  3H93 A;  4TKY A;  1JZR A;  3DML A;  4MZC A;  3PGT A;  2GQL A;  3DWV A;  4V2L A;  2VL3 A;  3GV1 A;  4D73 B;  1F3A A;  1V57 A;  2F9S A;  2YCD A;  1PMT A;  2L59 A;  2PER A;  4QQ7 A;  3UL3 A;  2DSA A;  2JL4 A;  1SVL A;  3ZVJ D;  2B7K A;  1G6W A;  4KCE A;  5F8B A;  1FB0 A;  3CSJ A;  5A4U A;  1T8E B;  1ST9 A;  3L9V A;  5B6M A;  2YJH A;  2MMN A;  1M2A A;  3ZZX A;  4PTS A;  3VPT A;  5A4W A;  3FK8 A;  5KN3 A;  4GST A;  2DIZ A;  5DVB A;  5ECP B;  4JR4 A;  3ZYW A;  4OFM A;  2PPT A;  2IJY A;  3IC8 A;  2TIR A;  3N9J A;  1PL2 A;  1ILO A;  2OT3 A;  3MIX A;  2ZCT A;  1UA5 A;  1OE7 A;  3D0Z A;  1SD9 A;  2E7P A;  2X8H A;  3GUR A;  2VCW A;  1YKC A;  2QC7 A;  3IR4 A;  1NSW A;  4LMW A;  4FYU A;  3CWG A;  3TUE A;  2HSH A;  5A5H A;  4ECI A;  3C7M A;  3CSH A;  1USB A;  4OD7 A;  4OO5 A;  1ML6 A;  4ZBB A;  1ERT A;  1EV9 A;  2HZE B;  1ACV A;  1XW9 A;  2YWI A;  1TK5 B;  3DRN A;  3FZ5 A;  1SU9 A;  2LJK A;  2G0F A;  1EP7 A;  2M72 A;  3GX8 A;  5G1K A;  4DSR A;  2CAI A;  4PQH A;  4F0B A;  2HSY A;  2H74 A;  1GSD A;  3VUR A;  4WBR D;  4EKZ A;  4Q5F A;  3KD0 A;  3MYD A;  1AC1 A;  3KCM A;  2K8V A;  5IPH A;  2A2R A;  5DDL A;  2IN3 A;  1A2J A;  1GRX A;  3CMI A;  2VL2 C;  2YV9 A;  1T3B A;  3O76 A;  4MNN A;  4K9Z A;  3RBT A;  1NM3 A;  4I2U A;  2FLS A;  3GH9 A;  2XBQ A;  5D96 A;  4PQ1 A;  1FHE A;  4IEL A;  3IRA A;  1SD8 A;  1XWG A;  1TOF A;  4IS0 A;  3ZIT A;  4MF7 A;  4GLT A;  2B7J A;  4ICY A;  3KH9 A;  5D9T A;  4IW9 A;  2ON5 A;  2N5F A;  6GSW A;  1GL8 A;  4BVX B;  4LA1 A;  1B9X C;  4AGS A;  3VLN A;  1THO A;  2GT5 A;  2GSR A;  2VCZ A;  1T4Z A;  4CW9 A;  3LG6 A;  2L6D A;  1AQV A;  4N11 A;  1UC7 A;  1RQM A;  3VI5 A;  3FZ4 A;  4AJ6 A;  4MZW A;  2ZNM A;  4TRX A;  3FR9 A;  3TJF A;  1Y6E A;  1MDI A;  2DJ3 A;  3C1R A;  2HZE A;  1O7U A;  2V6O A;  5D9W A;  4W66 A;  2FUG 2;  2RUF A;  2AAW A;  3MDK A;  3HCZ A;  4XTS A;  3O3T A;  1VGL A;  4K0G A;  4QMK A;  3W6G A;  4PX1 A;  1ZYE A;  3UIW A;  4HJ2 A;  2H1L A;  2PMT A;  5J5N A;  2H0I A;  1EGR A;  1FAA A;  4K8M A;  3ZIJ A;  2HSN B;  4BA7 A;  1TU8 A;  2H19 A;  5J9B A;  2GDR A;  2VLV A;  5L71 A;  4CHS A;  2LNT A;  1GNE A;  2GQM A;  4V2M A;  2NTO A;  4WR5 A;  5G2Z A;  4KB3 A;  4EUY A;  2J23 A;  1U3I A;  3EU3 A;  1URM A;  1Z6N A;  4FYC A;  1ZMA A;  2K8S A;  2H0G A;  4MCU A;  2LTK A;  1FVJ A;  5J4V A;  1AXD A;  4HI7 A;  2H6X A;  3EMP A;  3TJK A;  1ERU A;  1NHY A;  4BVX A;  1YDK A;  5F05 A;  3P90 A;  2QGV A;  3IE3 A;  1KBN A;  1DSB A;  2L5L A;  1SKS B;  3P8W A;  2LUS A;  2O89 A;  3ERF A;  2EIO A;  2PVO C;  2V41 A;  4L0W A;  2TRX A;  4MJE A;  3PH9 A;  3QDN A;  2KOK A;  3WT2 A;  2H6Y A;  4K1F A;  13GS A;  3WYW A;  4NHZ A;  1QK8 A;  2GVP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...