5DALB

Crystal structure of human glutathione transferase pi complexed with a metalloid in the presence of glutathione
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
209
structure length
209
Chain Sequence
PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase P
publication title Visualisation of Organoarsenic Human Glutathione Transferase P1-1 Complexes: Metabolism of Arsenic-based Therapeutics
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 79
structure length 209
sequence length 209
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2015-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02798 GST_N Glutathione S-transferase, N-terminal domain
B PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5dalB02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5dalB01
3HKRA 2C8UA 1PSQA 4D73A 1GLQA 4KCAA 2YCDA 5IO2A 2CT6A 1E6BA 1ZOFA 5KN1A 1ZYEA 3CRUA 2HI7A 1E2YA 3KTLA 4DSSA 2DJ2A 2MMAA 3ZVJD 4KSMA 3NOFA 3EWLA 5CO3A 1FW1A 6GSUA 1DUGA 4HZ2A 4GSSA 4XS1A 3GYKA 4I97A 3UMAA 1QXHA 1S3CA 3WT1A 1LJRA 2VCWA 1BJXA 3O76A 1SD8A 3LG6A 2LV3A 3HZ8A 2LKUA 3H4KA 4MA9A 4OMVA 1MD3A 2HSYA 2H6ZA 1SK1A 2DMMA 5DVBA 4HQZA 2VUPA 5ECRB 3KJYA 1XWKA 1QUWA 3IAM2 2OBKA 3M9JA 4YQMA 4TVEA 4EL1A 4KDXA 2FNOA 2C0FA 2KP2A 2VL2A 3I43A 3BD2A 2YZHA 4JE1A 3DMLA 2H01A 1ZMAA 2YANA 1HNAA 5IOXA 4IP1A 4KB3A 4ZIJA 1HD2A 3KEBA 4JRRA 5ID2B 1FB0A 3UVHA 3U5RE 3TJFA 4EKZA 16GSA 5HR0A 2AYTA 3KM6A 4LLRA 1CQGA 4GSNA 3VPQA 3HYPA 4MZBA 4YAVA 4NAXA 4BA7A 5EPFA 2VCTA 5CRGA 1TRSA 2HNLA 4AF2A 4NPBA 1QMVA 4EXJA 3IV4A 2F8FA 2GSRA 1I5GA 3K8NA 2B5EA 4RQXA 3TJBA 1QGVA 1JFUA 3TRXA 5F05A 4DVCA 3GV1A 3TOTA 4OFNA 4IHUA 1XWBA 1GUKA 3F63A 5B8AA 2VM1A 2F9SA 2GT5A 4TOPA 2B1KA 1A0FA 4GRFA 5JWRB 4BWQA 2L5LA 5E4WA 3ZVJA 2DLXA 2H75A 3E0UA 3HHVA 3KP9A 4O92A 3HVSA 3KZQA 3S9FA 4O32A 4HUAA 3LJRA 5DCGA 1OAZA 4P3YB 1UN2A 2VLVA 3H93A 1OKDA 5ABRA 3UBKA 2HSMB 5D9XA 2FY6A 3FR3A 2VL9A 1QK8A 1SD9A 2H6YA 4NWYA 3EE2A 3CSIA 2B5YA 2LJRA 2B7KA 1MDJA 2V6OA 1GLPA 2MYGA 2FWFA 4RQRA 3KD0A 3SWLA 3HZ4A 1ML6A 4JEDA 13GSA 3FYGA 3ERWA 3UOMA 1BEDA 1OE7A 4XS6A 3FKFA 4WEYA 2C3NA 1ST9A 3J7Yb 1AXDA 1K0DA 2GQKA 3Q6OA 1W89A 4WKWA 3DXBA 4YAPA 3L9UA 3ZL5A 2WULA 2ON7A 2J23A 4G0LA 3F6DA 1JZWA 3DD3A 4I2UA 5ECHB 4V2NA 4KX4A 2WDUA 4LL1B 2L6DA 1G7EA 4BPYA 3C1SA 3DKSA 2VL3A 1FOVA 4GLTA 2LEGA 1YZXA 3F4SA 1YY7A 3H8QA 3L0HA 1DBYA 2YOIA 2YPMA 2X64A 4TR1B 1RW1A 1V58A 2B3SA 4KNDA 5D93A 4FIWA 1EZKA 4KH7A 7GSSA 2CA8A 3W8JA 1PN9A 3FRCA 1LBKA 1XZOA 3M9KA 4V1Ap 4Q5QA 2PBJA 1WMJA 5DDLA 5D73A 3CBUA 2FHEA 2YZUA 2HRKA 3V1WA 5ECSA 4X1UA 2XBQA 2H0HA 2LS5A 1PD21 3ZIJA 1XWAA 2E2MA 1EOHA 4E8HA 1PKWA 3QOUA 1F3AA 3R2QA 3TKRA 3ZREA 4L8EA 3ZFLA 2XPEA 3GH9A 4OO5A 3RHBA 4N11A 5L71A 2H1BA 3LORA 5B7CA 3VURA 2IWTA 4ZL8A 2WGRA 2FLSA 1AAZA 3IC4A 4J57E 4N10A 4K0NA 4MJAA 6GSSA 1R5PA 3C1RA 3O3TA 2V2GA 3G7YA 5HR1A 1A2MA 1OC8A 2GDRA 3APOA 1THOA 1XXUA 4EO3A 1GTBA 3H1NA 1W4VA 2CZ3A 1FVKA 4NHWA 4MJCA 1ERWA 1Y6EA 4K1FA 3M3MA 4LA1A 2HXKA 1A2JA 3TJGA 2OKAA 3AY8A 1N2AA 4K8MA 2O89A 1XPVA 2VD1A 4CDOA 4IGJA 5EVOA 1GSYA 4PQ1A 4PTSA 1G6WA 5FWGA 1YQ1A 2HSHA 4L5LA 2YV7A 1O81A 2IPAA 3TUEA 1H4OA 5IMVA 3VPTA 3EVIA 1FHEA 2HQTA 4ECCA 1CQHA 3EYTA 4Z7XA 1AIUA 2WFCA 1DE2A 5ECKB 4HI7A 4D73B 1V57A 5J9CA 1KTEA 1YF0A 4DSSB 2H72A 2RUFA 3RPPA 2PPTA 3PH9A 2CV4A 3KP8A 3D0ZA 3HJOA 3E3EA 5DJMA 1YKAA 1WOUA 1S3DA 4NV2A 4EDYA 2ZCTA 1WWJA 2H76A 2DIZA 2QGVA 4POLA 3QR6A 3GL5A 1VF3A 2I9HA 3HJPA 1J9BA 2P0GA 3GTUA 4JR4A 1ZGNA 3MDKA 4OCEA 3I69A 1T4ZA 3PPUA 3WGDA 5DCHA 3ERGA 5GSSA 1WJKA 1B4QA 5D9TA 3G9BA 3ME8A 3QFBC 5ECNB 1JZDA 3CMIA 3HDCA 2HRAA 4EDZA 3DVWA 4G0KA 4V2LA 1TU8A 2IIYA 2O7KA 1RQMA 2X99A 3QFAC 2CAQA 4LMWA 5ECIB 2E7PA 3G7JA 2EIOA 4MZWA 4MJEA 1M2BA 2YNXA 2AB6A 1EEMA 2F51A 3HVXA 2L6CA 1O8XA 4XTSA 1BG5A 4ML1A 2YJHA 2KLXA 4X43A 2JZRA 1X5DA 2K8VA 3IPZA 4HDEA 4BWSA 2I4AA 2GLRA 11GSA 5HQPA 1C72A 4NHZA 5ECQB 4O5RA 3VI5A 1MDIA 3C8EA 1GSQA 1URMA 2H6XA 3IOSA 3KGKA 1NSWA 3I6AA 1GSUA 4MF5A 3TKQA 4IJIA 1OC3A 3GMFA 2ON5A 2VIMA 2P5QA 5DALA 4AJ7A 5A4VA 4XCSA 1AW9A 2FWEA 3IA1A 2C0GA 5FHIA 1TK0B 4I5QA 20GSA 3GHAA 4LMVA 2C3QA 2YWNA 1ZCPA 4IQAA 4ID0A 3EURA 2MMZA 4EF0A 2GSTA 2NTOA 1GTIA 5LNKe 2H70A 5IQYA 3TKSA 6GSXA 1FO5A 2VM2A 19GSA 1PA3A 3FZ5A 1A24A 1JZOA 4WETA 1Q4JA 4IJ3A 4KDYA 5ECMB 3EU4A 1XFLA 3KTBA 1PL1A 4POMA 4KE3A 3GX8A 1Z7PA 1TRWA 1RK4A 3KH9A 4PGTA 3PGTA 4WBRD 3HJMA 4I8BA 4TXVA 1TRUA 1GNEA 1G7OA 2QKEA 4GCIA 3UJ1A 2JADA 1PGTA 2JZTA 2XBIA 3CRTA 2YWIA 4TR3A 1A0RP 1GSSA 1JZRA 4MK3A 3GFKA 2HE3A 1K0OA 4PUAA 1AC1A 3M0FA 2IMEA 3QAVA 2CVKA 2F3MA 2H30A 3IBHA 3VWXA 1SK2A 5KN2A 4L5OA 3GNJA 4ZB6A 3IAS2 1Z9HA 4MF7A 4G9HA 5J4UA 1TJDA 1HNBA 4JR6A 2CVDA 2JZSA 2WZ9A 1OC9A 2NVLA 5B8BA 4K7NA 5CP1A 4BL7A 1M9BA 4PNFA 2QC7A 3LFLA 2OA7A 2Z9SA 3WGXA 2J9HA 1M2AA 2BMXA 1SL1B 1OVNA 1F37A 2YN1A 2DMLA 5J9BA 1B8XA 3TOUA 4G2EA 5KN3A 5ENUA 2WCIA 5F8BA 4ILFA 4ML6A 1EV9A 2VLUA 3DRNA 3L9VA 2HRKB 5LD0A 2G2QA 3UBLA 2A2SA 2MZCA 3IHQA 2N5FA 3JCML 3LXTA 2VL2C 3TKSE 4MPFA 3QDNA 3UIWA 1SKSB 2EIRA 4EUYA 1T00A 5AIVA 4XS4A 1TTZA 3IE3A 2JACA 5J3RA 22GSA 4EVMA 2CZ2A 2PERA 2WRTA 4AGSA 5B6MA 2H66A 18GSA 2I81A 4WF4A 1NHYA 2DSAA 1F3BA 5H5QA 3F4RA 4PXOA 5IMZA 2K6VA 2X8HA 1WIKA 4KSOA 3QCPA 4NMUA 3WD6A 1SENA 1K0MA 2H0IA 3C73A 2MBSA 1ZYQB 1DE1A 3LSZA 3CSJA 6GSTA 2ZUPA 4OD7A 2GT6A 1ON4A 3KMNA 2FA4A 1XWCA 5DAKA 2IFQA 4HJMA 3NIVA 4BVXA 14GSA 2WJUA 5ECLB 3N9JA 1X9SB 4NV5A 3GRXA 3H79A 3APSA 3LXZA 3A2VA 3D6IA 3BJ5A 4EC0A 5COHA 2CX4A 4DSRA 4ECJA 2O85A 1WPIA 2VAFA 3P7XA 4HZ4A 1ZL9A 4FYUA 3MAKA 1R5AA 1JHBA 3LYPA 4RI7A 3LEFA 5ELGA 2M80A 4AJ6A 4K0GA 4F9ZA 2ALBA 2M72A 5AIXA 1EP8A 4O7HA 1J0FA 5KEJA 4PQIA 1LU4A 2OBIA 2KOKA 5IPHA 1SL2B 4L0WA 5CRDA 5ECOB 3QAWA 4F0CA 3RHCA 5CRHA 2H1AA 4QL7A 2FWHA 3KIJA 4FYBA 1UC7A 3BCIA 3O6TA 2DJ1A 3GKKA 2WB9A 3GTUB 2P5RA 2MMNA 4V1Ag 1VRSD 4ULXA 4ZL7A 2L4QA 2YWOA 1WRYA 2DJ0A 3TRPA 5E59A 1O85A 5IM9A 4IELA 1GWCA 2D2ZA 2H1GA 3FHKA 5G1KA 3VLNA 4ZL9A 5A4UA 3D21A 3FZ9A 1A23A 1NHOA 3TJKA 3MSZA 4OWYA 4TXOA 3EMPA 2VOCA 4IQ1A 2IJYA 3GKXA 2PN8A 4MJBA 5DBQA 1EV4A 4HJ2A 2XC2A 2NBSA 4XHMA 4QQ7A 4ISDA 1XW5A 1SYRA 3ZFBA 2XPDA 4F0BA 1A8LA 5IOWA 4TKYA 3W6GA 5B6NA 2KHPA 4ZB8A 9GSSA 3GUSA 1TU7A 1F9MA 2LQOA 5H5SA 1GTUA 4HS1A 4ZBAA 1SKWB 4AJ8A 3HA9A 4F2IA 1VGLA 4YH2A 1XW9A 2L57A 2LJAA 5IMAA 1V98A 4ECBA 6GSWA 1F6MC 2HLSA 1SJZA 5G30A 3DEXA 2JL4A 5DALB 1T4YA 2R6KA 4GF0A 1X0RA 2IMIA 2DIYA 4KAEA 1XW6A 5CREA 1SK0A 2LNSA 3EC3A 2OE0A 4RUVA 5HR3A 2K9FA 5AN1A 1SL0B 1BAYA 4Q5FA 2R5GA 2PUKC 3P8WA 5D9VA 1GTAA 2B1LA 2AJQB 4WF5A 3GX0A 5GSTA 5DQYA 1GNWA 5IMFA 3PR8A 3TKPA 1V2AA 3P90A 1M9AA 1KNGA 4KDUA 1BYEA 2R3XA 2H74A 4MH2A 1BX9A 1YJ6A 1M99A 10GSA 2HRNA 3RAZA 1MEKA 1T1VA 2B7JA 4OFTA 1GP1A 2LSTA 1YEPA 5J5NA 4F03A 1T3BA 1OE8A 3RPNA 3QPMA 1XCCA 3FY7A 5HFIA 5F06A 1ZZYA 3PINA 2OJLA 3UARA 4TRXA 2DBCA 3DWVA 4OCFA 4PUFC 4WR5A 3HXSA 3G7IA 4H86A 2R4VA 4FYCA 2AV4A 4POKA 5CRWA 2OE3A 2V32A 1NW2A 2V1MA 2C0EA 2IMDA 5C04A 5HFKA 4JBBA 3WT2A 1U87A 4FQUA 1EEJA 1PKZA 5JWOB 4MDCA 3GSTA 2YP6A 3FZ4A 1OYJA 3C71A 4CW9A 2CX3A 4ACSA 1SKRB 4G0IA 4K2DA 1MTCA 1GH2A 3EU3A 5DJLA 1K3YA 3HVVA 1FG4A 3BOAA 2GZYA 3L9SA 2RIIA 3TDGA 12GSA 3EINA 4EE0A 2K8SA 1OC9B 4NXIA 1IYIA 3VI7A 1R7HA 5INYA 4BL7B 3KCMA 4K7IA 4MABA 2GSQA 1K0NA 5EL8A 4HU7A 3Q18A 2EC4A 3ISOA 3R3EA 1GRXA 3IK9A 2LRNA 2CVBA 3IK7A 3TB2A 4TN8A 1TP9A 3UAPA 5KN0A 3M1GA 3TCOA 3CXGA 5FT3A 4X0XA 3WGEA 1QQ2A 3KXOA 3DGQA 3NZNA 5HR2A 4I6XA 2AHEA 2A4VA 2OE1A 4J56E 1USBA 4MLYA 3US3A 2G0FA 4GWRA 3F3RA 4JZQA 1PL2A 1GULA 2AUVA 5IPGA 1EOGA 2HRFA 3CSHA 2VCXA 3HCZA 4XS4B 2PMTA 4MMMA 2B5XA 1EGOA 3A5WA 4RI6A 1GSFA 3FW2A 1K3OA 2PU9C 1MD4A 1HQOA 5G2ZA 3ZITA 2FD3A 1Y25A 4LL4B 3F8UA 1TDIA 3QD9A 4BVYA 2PVQA 2HZFA 1JLVA 2MMOA 2B6MA 1VF1A 2PWJA 3IXRA 4Q5NA 1O8WA 5CYYA 3CTFA 1SYXA 3LQ7A 3LYKA 3F9UA 1ERUA 1SJIA 4IN0A 3ZMKA 1WE0A 2R2JA 2ES7A 1V9WA 2YV9A 2HYXA 2N5AA 1PQNA 4PURA 4TR4A 4OO4A 1T8EB 3Q74A 4ZILA 3ZLPA 2TRCP 5DAKB 2IFQB 1TOFA 1Q98A 1TW9A 5IIZA 3LWAA 1UA5A 4BVXB 2LRTA 2TRXA 1ILOA 4KUNA 2FWGA 2VO4A 1TI1A 1I9DA 3DYRA 2FUG2 2GGTA 5CNWA 1G6YA 2CAIA 2EIQA 3E9JB 2VCQA 1Z6MA 2X8CA 3A2XA 3TKSC 2H19A 4KGIA 1M2DA 1B48A 2A2RA 2C1YA 2GSSA 3LGCA 3A3TA 2NDOA 1AQVA 4K9ZA 4KW6A 2O87A 2I1UA 2GTUA 1Z3EA 3KMOA 2HT9A 1GL8A 2YWMA 1A2LA 5A4WA 3FEUA 5GZZB 2RLIA 2H8LA 2GQLA 2DJ3A 3GN3A 4IS0A 4MCUA 3D4TA 5D8IA 3D4MA 1F2EA 1X5CA 1M7TA 2LTKA 4WBJA 4HQSA 5G31A 4DEJA 1DSBA 3L4NA 1OKTA 1R4WA 4XRAA 5IMCA 2PVOC 4ZB9A 2HFDA 3F4TA 1Z7RA 5ID2A 5BMUA 3UEMA 3ZZXA 4JU5A 1YDKA 4XRDA 4CHSA 3EMXA 4TW5A 1U3AA 3HD5A 2JSYA 1K0BA 4N0VA 5G5EA 1IYHA 5DQSA 2GQMA 5G5FA 2TIRA 2MBTA 2R37A 3ED3A 5C00A 2YJ7A 1EGRA 3C7MA 4FO5A 2E0QA 1VF4A 4GQCA 3IC8A 4IVFA 1K0CA 3VFIA 4KCEA 1ERTA 4MP4A 4ZXGA 4TXOB 2AAWA 1B9XC 1X9WB 4L0UA 1Z5YE 1XIYA 1TXXA 1YF1A 1XOAA 4MZCA 2REMA 1BQ7A 3TJJA 1YKCA 3BBYA 1XBSA 2X8GA 3M8NA 1GUMA 4PX1A 1KBNA 3ME7A 1TKDB 1EP7A 5JCGA 2H73A 3ZIVA 3VK9A 1B4PA 3F3QA 3ZTLA 3J7Yk 2HSNB 1NM3A 2GS3A 1XWGA 5ECPB 4IKHA 1TRVA 4PQHA 1T7PB 5F07A 5H5RA 3QMXA 1EWXA 2LRCA 1XVQA 3CTGA 1N8JA 5JWQB 3ZMLA 2VCZA 4ZBDA 4G19A 2E2GA 3APQA 4KF9A 3MWHA 2ZNMA 2RUEA 2LJKA 2N5BA 3I9V2 1HYUA 2LUSA 3A2WA 3N5OA 3SBCA 2HSMA 3GKMA 3ERFA 2FA8A 2O8VB 4TR0A 4J2FA 1M0UA 3FK8A 4IP6A 4OFMA 3W8SA 2DC5A 1PRXA 4POBA 3FR9A 4DSQA 1O6JA 4I2TA 4K6XA 2IMKA 4USSA 2FCHA 1G0TA 3D5JA 4WR4A 5EY6A 3GH6A 4ZBBA 2WS2A 2JSZA 2LNTA 1U6TA 3GIXA 3D22A 5J41A 3BCKA 2IN3A 3OR5A 1FAAA 4GTUA 1PX6A 4GSTA 5AGYA 1THXA 4YQVA 2C0DA 2DJKA 2DJJA 2HZEB 1TI3A 1B9YC 1SU9A 1H75A 5IMDA 3RDWA 5JCUA 1GUHA 4HEA2 2NPBA 1K0AA 2BJXA 4F82A 2OADA 5A5KA 2LQQA 2QSIA 4K7OA 2C3TA 1GSEA 1X9MB 1MDKA 4HOJA 3GURA 3ZYWA 2JU5A 1A8YA 4IBPA 5CAXA 3TGZA 2IMFA 3Q19A 1J08A 1SJ6A 3CYNA 3IDVA 4GXZA 2K18A 4TR1A 3DVXA 1ABAA 1KEBA 4XIHA 2V41A 3QAGA 2L59A 3WYWA 1XOBA 3UVTA 1AQWA 3GSSA 1YEXA 3P2AA 1O7UA 2FGXA 3DIEA 5G1LA 2VD0A 3ZRDA 4QL9A 3VWUA 3F0IA 1U88A 8GSSA 2PGTA 5HFGA 2H71A 1Z6NA 4MF6A 3GKNA 5AISA 1TK5B 3MNGA 4GQFA 1U3IA 2BTOT 4WXTA 3GA4A 3RBTA 2GZZA 17GSA 2OACA 1PMTA 1HNCA 1GSDA 2V6KA 4N30A 4V2MA 1JLWA 1V40A 2IL3A 5ELAA 1PX7A 2KP1A 4HU9A 2H0GA 4FH8A 2CQ9A 2VCVA 1S3AA 4IW9A 5D96A 1FVJA 1FB6A 1ERVA 3UL3A 1R26A 2UZ8A 5LCZA 3VWVA 2HZEA 1K3LA 5IO0A 1QFNA 2M46A 4N0ZA 3IR4A 2XHFA 2GVPA 2P31A 3L78A 2H1DA 4Q5RA 1TK8B 2L5OA 4MH3A 3FZAA 2GZPA 2RM5A 3GL3A 1UVZA 2RM6A 2C4JA 3VWWA 3IRAA 2L4CA 6GSYA 1AUCA 4YQUA 4G10A 1X5EA 1VF2A 3KH7A 3HY2A 1AQXA 1XVWA 4BVYB 2C80A 4ECIA 4MPGA 1WP0A 2KUCA 5D9WA 5JCWA 4E8EA 6GSVA 1ACVA 5F0GA 4KA0A 5GAPD 3U6VA 3FR6A 2I3YA 3TRQA 3F6FA 2VLTA 2F8AA 4PNGA 1O73A 5GAND
chains in the Genus database with same CATH superfamily
3HKRA 2C8UA 2WVZA 1PSQA 4D73A 1GLQA 4KCAA 2YCDA 5IO2A 2CT6A 1E6BA 1ZOFA 5KN1A 1ZYEA 3CRUA 2HI7A 1E2YA 3KTLA 4DSSA 2DJ2A 2MMAA 3ZVJD 4KSMA 4Z2UA 3NOFA 3EWLA 5CO3A 1FW1A 6GSUA 1DUGA 4ICYA 4HZ2A 4GSSA 4XS1A 3GYKA 4I97A 3UMAA 1QXHA 1S3CA 3WT1A 1LJRA 2VCWA 1BJXA 3O76A 1SD8A 3LG6A 2LV3A 3HZ8A 2LKUA 3H4KA 4MA9A 4OMVA 1MD3A 2HSYA 2H6ZA 1SK1A 2DMMA 4X4JA 4HQZA 5DVBA 2VUPA 5ECRB 3KJYA 1XWKA 1QUWA 3IAM2 2OBKA 3M9JA 4YQMA 1ZYNA 4TVEA 4EL1A 2DKHA 4KDXA 2FNOA 2C0FA 2KP2A 2VL2A 3I43A 3BD2A 2YZHA 4JE1A 3DMLA 2WVXB 2H01A 1ZMAA 2YANA 1HNAA 5IOXA 1FOHA 4IP1A 4KB3A 4ZIJA 1HD2A 3KEBA 4JRRA 5ID2B 5BMUB 1FB0A 3UVHA 3U5RE 3TJFA 4EKZA 5A34B 16GSA 5HR0A 2AYTA 3KM6A 4LLRA 2WW1A 1CQGA 4GSNA 3VPQA 3HYPA 4MZBA 4YAVA 4NAXA 4BA7A 5EPFA 2VCTA 5CRGA 1TRSA 2HNLA 4AF2A 4NPBA 1QMVA 4EXJA 3IV4A 2F8FA 4AKXB 2GSRA 1I5GA 3K8NA 2B5EA 4RQXA 3TJBA 1QGVA 1JFUA 3TRXA 5F05A 4DVCA 4N3ZA 3GV1A 3TOTA 4OFNA 4IHUA 1XWBA 1GUKA 3F63A 5B8AA 2VM1A 2F9SA 2GT5A 4TOPA 2B1KA 5J47A 1A0FA 4GRFA 5JWRB 4BWQA 2L5LA 5E4WA 3ZVJA 2DLXA 2H75A 3E0UA 3HHVA 2H1LA 3KP9A 4O92A 3HVSA 3KZQA 3S9FA 4O32A 4HUAA 3LJRA 5DCGA 4AKIA 1OAZA 4P3YB 1UN2A 2VLVA 3H93A 1OKDA 5ABRA 3UBKA 2HSMB 5D9XA 2FY6A 3FR3A 2VL9A 1QK8A 1SD9A 2H6YA 1BG1A 4NWYA 3EE2A 3CSIA 2B5YA 2LJRA 2B7KA 1MDJA 2V6OA 1GLPA 2MYGA 2FWFA 4RQRA 3KD0A 3SWLA 3HZ4A 4O5QA 1ML6A 4JEDA 13GSA 3FYGA 3ERWA 3UOMA 1BEDA 1PN0A 1OE7A 4K5RA 4XS6A 3FKFA 4WEYA 2C3NA 1ST9A 3J7Yb 1AXDA 1K0DA 2GQKA 3Q6OA 1W89A 4WKWA 3DXBA 4YAPA 3L9UA 3ZL5A 2WULA 2ON7A 2J23A 4G0LA 3F6DA 1JZWA 3DD3A 4I2UA 5ECHB 3IHGA 4V2NA 4KX4A 2WDUA 4LL1B 2L6DA 1G7EA 4BPYA 3C1SA 3DKSA 2VL3A 1FOVA 2EFDA 4GLTA 2LEGA 1YZXA 4AKHA 3F4SA 1YY7A 3H8QA 3L0HA 1DBYA 2YOIA 2YPMA 2X64A 4TR1B 1RW1A 1V58A 4O5UA 3HVNA 2B3SA 4KNDA 5D93A 4FIWA 1EZKA 4KH7A 7GSSA 2CA8A 3W8JA 1PN9A 3FRCA 1LBKA 1XZOA 3M9KA 4V1Ap 3CHXC 4Q5QA 2PBJA 1WMJA 5DDLA 5D73A 3CBUA 2FHEA 2YZUA 2HRKA 3V1WA 5ECSA 4X1UA 2XBQA 2H0HA 2LS5A 1PD21 3ZIJA 1XWAA 2E2MA 1EOHA 5A5HB 4E8HA 1PKWA 3QOUA 1F3AA 3R2QA 3TKRA 3ZREA 4L8EA 3ZFLA 2XPEA 3GH9A 4OO5A 3RHBA 4N11A 5L71A 2H1BA 3LORA 5B7CA 3VURA 2IWTA 4ZL8A 4YKGA 2WGRA 2FLSA 1AAZA 3IC4A 4J57E 4N10A 4K0NA 4MJAA 6GSSA 1R5PA 3C1RA 3O3TA 2V2GA 3G7YA 5HR1A 1A2MA 1OC8A 2GDRA 3APOA 1THOA 1XXUA 4EO3A 1GTBA 3H1NA 1W4VA 2CZ3A 1FVKA 4NHWA 4MJCA 1ERWA 1Y6EA 4K1FA 5A1NA 3M3MA 4LA1A 2HXKA 1A2JA 3TJGA 2OKAA 3AY8A 1N2AA 4K8MA 2A2PA 2O89A 1XPVA 2VD1A 4CDOA 4IGJA 5EVOA 1GSYA 4PQ1A 4PTSA 1G6WA 5FWGA 1YQ1A 2HSHA 4L5LA 2YV7A 1O81A 2IPAA 3TUEA 3RFRC 4FXYP 1H4OA 5IMVA 3VPTA 3EVIA 1FHEA 2HQTA 4ECCA 1CQHA 3EYTA 4Z7XA 1AIUA 2WFCA 1DE2A 5ECKB 4HI7A 4D73B 1V57A 5J9CA 1N25A 1KTEA 1YF0A 4DSSB 2H72A 2RUFA 3MYDA 3RPPA 2PPTA 3PH9A 2CV4A 3KP8A 3D0ZA 3HJOA 3E3EA 5DJMA 1YKAA 1WOUA 1S3DA 4NV2A 4W66A 4EDYA 2ZCTA 1WWJA 2H76A 2DIZA 2QGVA 4POLA 3QR6A 3GL5A 1VF3A 2I9HA 3HJPA 1J9BA 2P0GA 2EFEA 3GTUA 4JR4A 1ZGNA 3MDKA 4OCEA 3I69A 1T4ZA 3PPUA 2VKZG 3WGDA 5DCHA 3ERGA 5GSSA 1WJKA 1B4QA 5D9TA 3G9BA 3ME8A 3QFBC 3MIXA 5ECNB 1TXUA 1JZDA 3CMIA 3HDCA 2HRAA 4EDZA 3DVWA 4G0KA 4V2LA 1TU8A 2IIYA 2O7KA 2X4AA 1RQMA 2X99A 3QFAC 2CAQA 4LMWA 5ECIB 2E7PA 3G7JA 2EIOA 4MZWA 4MJEA 1M2BA 2YNXA 2AB6A 1EEMA 2F51A 3HVXA 2L6CA 1O8XA 4XTSA 1BG5A 4ML1A 2YJHA 2KLXA 4X43A 2JZRA 1X5DA 2K8VA 3IPZA 4HDEA 4BWSA 2I4AA 2GLRA 11GSA 5HQPA 1C72A 4NHZA 5ECQB 4O5RA 3VI5A 1MDIA 3C8EA 1GSQA 1URMA 2H6XA 3IOSA 3KGKA 1NSWA 3I6AA 1GSUA 4MF5A 3TKQA 4IJIA 1OC3A 3GMFA 2ON5A 2VIMA 2P5QA 5DALA 4AJ7A 5KOWA 5A4VA 4XCSA 1AW9A 2FWEA 3IA1A 2C0GA 5FHIA 1TK0B 4I5QA 20GSA 3GHAA 2WW3A 4LMVA 2C3QA 2YWNA 1ZCPA 4IQAA 4ID0A 3EURA 2MMZA 4EF0A 2GSTA 2NTOA 1GTIA 5LNKe 2H70A 5IQYA 3TKSA 6GSXA 1FO5A 2VM2A 19GSA 1PA3A 3FZ5A 1A24A 1JZOA 4WETA 1Q4JA 4IJ3A 4KDYA 5ECMB 3EU4A 1XFLA 3KTBA 1PL1A 4POMA 4KE3A 3GX8A 1Z7PA 1TRWA 1RK4A 3KH9A 4PGTA 3PGTA 4WBRD 3HJMA 4I8BA 4TXVA 1TRUA 1GNEA 2QA1A 1G7OA 2QKEA 4GCIA 3UJ1A 2JADA 1PGTA 2JZTA 4CY6A 2XBIA 3CRTA 2YWIA 4TR3A 1A0RP 1GSSA 1JZRA 4MK3A 3GFKA 2HE3A 1K0OA 4PUAA 1AC1A 3M0FA 2IMEA 3QAVA 2CVKA 2F3MA 2H30A 3IBHA 3VWXA 1XG8A 1SK2A 5KN2A 4L5OA 3GNJA 4ZB6A 3IAS2 1Z9HA 4MF7A 1SVMA 4G9HA 5J4UA 1TJDA 1HNBA 4JR6A 2CVDA 2JZSA 2WZ9A 1OC9A 2NVLA 5B8BA 4K7NA 5CP1A 4BL7A 1M9BA 4PNFA 2QC7A 3LFLA 2OA7A 2Z9SA 3WGXA 2J9HA 1M2AA 2BMXA 1SL1B 1OVNA 1F37A 2YN1A 2DMLA 5J9BA 1B8XA 2WVYA 3TOUA 2R0CA 4G2EA 5KN3A 5ENUA 2WCIA 5F8BA 4ILFA 4ML6A 1EV9A 2VLUA 3DRNA 3L9VA 2HRKB 5LD0A 2G2QA 3UBLA 2A2SA 2MZCA 3IHQA 2N5FA 3JCML 3LXTA 2VL2C 3TKSE 4MPFA 3QDNA 3UIWA 1SKSB 2EIRA 4EUYA 1T00A 5AIVA 4XS4A 1TTZA 3IE3A 3HMJG 2JACA 2WW2A 5J3RA 22GSA 4EVMA 2CZ2A 2PERA 2WRTA 4AGSA 5B6MA 2H66A 18GSA 2I81A 4WF4A 3FMWA 1NHYA 2DSAA 1F3BA 5H5QA 3F4RA 4PXOA 5IMZA 2K6VA 2X8HA 1BF5A 1WIKA 4KSOA 3QCPA 4NMUA 3WD6A 1SENA 1K0MA 2H0IA 3C73A 2MBSA 1ZYQB 1DE1A 3LSZA 3CSJA 6GSTA 2O36A 2ZUPA 4OD7A 2GT6A 1ON4A 3KMNA 5A1NB 2FA4A 1XWCA 5DAKA 2IFQA 4HJMA 3NIVA 4BVXA 14GSA 2WJUA 5ECLB 3N9JA 1X9SB 4NV5A 3GRXA 3H79A 4E68A 3APSA 3LXZA 3A2VA 3D6IA 3BJ5A 4EC0A 5COHA 2CX4A 4DSRA 4ECJA 2O85A 1WPIA 2VAFA 3P7XA 4HZ4A 1ZL9A 4FYUA 2A4HA 3MAKA 1R5AA 1JHBA 3LYPA 4RI7A 3LEFA 5ELGA 2M80A 4AJ6A 4K0GA 4F9ZA 2ALBA 2M72A 5AIXA 1EP8A 4O7HA 1J0FA 5KEJA 2UV8G 4PQIA 4EIPA 1LU4A 2OBIA 2KOKA 5IPHA 1SL2B 4L0WA 5CRDA 5ECOB 3QAWA 4F0CA 3RHCA 5CRHA 2H1AA 4QL7A 2FWHA 3KIJA 4FYBA 1UC7A 3BCIA 3O6TA 2DJ1A 3GKKA 5J40A 2WB9A 3GTUB 2P5RA 2MMNA 4V1Ag 1VRSD 4ULXA 4ZL7A 2L4QA 3CWGA 2YWOA 1WRYA 2DJ0A 3TRPA 5E59A 1O85A 5IM9A 4IELA 1GWCA 2D2ZA 2H1GA 3FHKA 5G1KA 3VLNA 4ZL9A 1YVLA 5A4UA 3D21A 3FZ9A 1A23A 1NHOA 3TJKA 3MSZA 4OWYA 4TXOA 3EMPA 2VOCA 2X49A 4IQ1A 2IJYA 3GKXA 2PN8A 4MJBA 5DBQA 1EV4A 4HJ2A 2XC2A 2NBSA 4XHMA 4QQ7A 4ISDA 1XW5A 1SYRA 3ZFBA 2XPDA 4F0BA 1A8LA 5IOWA 4TKYA 3W6GA 5B6NA 2KHPA 4ZB8A 2HSNA 9GSSA 3GUSA 1TU7A 1F9MA 2LQOA 5H5SA 1GTUA 4HS1A 4ZBAA 4EIQA 4AJ8A 1SKWB 3HA9A 4F2IA 1VGLA 4YH2A 1XW9A 2L57A 2LJAA 5IMAA 1V98A 4ECBA 6GSWA 1F6MC 2HLSA 1SJZA 5G30A 3DEXA 2JL4A 5DALB 1T4YA 2R6KA 4GF0A 1X0RA 2IMIA 2DIYA 4Z2RA 4KAEA 1XW6A 5CREA 1SK0A 4A5PA 4G01A 2LNSA 3EC3A 2OE0A 4RUVA 5HR3A 2K9FA 5AN1A 1SL0B 1BAYA 4Q5FA 2EFCA 2R5GA 2PUKC 3P8WA 5D9VA 1GTAA 2B1LA 2AJQB 4WF5A 3GX0A 5GSTA 5DQYA 1GNWA 5IMFA 3PR8A 3TKPA 1V2AA 3P90A 1M9AA 1KNGA 4KDUA 1BYEA 2R3XA 2H74A 4MH2A 1BX9A 1YJ6A 1M99A 10GSA 2HRNA 3RAZA 1MEKA 1T1VA 2B7JA 4OFTA 1GP1A 2LSTA 1YEPA 5J5NA 4F03A 1T3BA 1OE8A 3RPNA 3QPMA 1XCCA 3FY7A 5HFIA 5F06A 1ZZYA 3PINA 2OJLA 3UARA 4TRXA 2DBCA 3DWVA 4OCFA 4PUFC 4WR5A 3HXSA 3G7IA 4H86A 2R4VA 4FYCA 2AV4A 4POKA 5CRWA 2OE3A 2V32A 1NW2A 2V1MA 4CY8A 2C0EA 2IMDA 5C04A 5HFKA 4JBBA 3WT2A 1U87A 4FQUA 1EEJA 1PKZA 5JWOB 4MDCA 3GSTA 2YP6A 3FZ4A 1OYJA 3C71A 4CW9A 2CX3A 4ACSA 1SKRB 4G0IA 4K2DA 1MTCA 1GH2A 3EU3A 5DJLA 1K3YA 4BIKA 3HVVA 1FG4A 3BOAA 2GZYA 3L9SA 2RIIA 3TDGA 12GSA 3EINA 4EE0A 4AKGA 2K8SA 1OC9B 4NXIA 1IYIA 3VI7A 1R7HA 5INYA 4BL7B 3KCMA 4K7IA 4MABA 2GSQA 1K0NA 5EL8A 4HU7A 3Q18A 2EC4A 3ISOA 3R3EA 1GRXA 3IK9A 2LRNA 2CVBA 3IK7A 3TB2A 4TN8A 1TP9A 3UAPA 5KN0A 3M1GA 3TCOA 3CXGA 5FT3A 4X0XA 3WGEA 1QQ2A 3KXOA 3DGQA 3NZNA 5HR2A 4I6XA 2AHEA 2A4VA 2OE1A 5J4YA 1PFOA 4J56E 3RGBC 1USBA 4MLYA 3US3A 2G0FA 4GWRA 3F3RA 4JZQA 1PL2A 5KOXA 1GULA 2AUVA 5IPGA 1EOGA 2HRFA 3CSHA 2VCXA 3HCZA 4XS4B 2PMTA 4MMMA 4Z2TA 2B5XA 1EGOA 3A5WA 4RI6A 1GSFA 5J4VA 3FW2A 1K3OA 2PU9C 4YKFA 1MD4A 1HQOA 5G2ZA 3ZITA 2FD3A 1Y25A 4LL4B 3F8UA 1TDIA 3QD9A 4BVYA 2PVQA 2HZFA 1JLVA 2MMOA 2B6MA 1VF1A 3IXRA 2PWJA 4Q5NA 4QMKA 1O8WA 5CYYA 3CTFA 1SYXA 3LQ7A 3LYKA 3F9UA 1ERUA 1SJIA 4IN0A 3ZMKA 1WE0A 2R2JA 2ES7A 1V9WA 2YV9A 2HYXA 2N5AA 1PQNA 4PURA 4TR4A 4OO4A 1T8EB 3Q74A 4ZILA 3ZLPA 2TRCP 5DAKB 2IFQB 1TOFA 1Q98A 1TW9A 5IIZA 3LWAA 1UA5A 4BVXB 2LRTA 2TRXA 1ILOA 4KUNA 2FWGA 2VO4A 1TI1A 3LW9A 1I9DA 3DYRA 2FUG2 2GGTA 5CNWA 1G6YA 2CAIA 2EIQA 3E9JB 2VCQA 1Z6MA 2X8CA 3A2XA 1S4BP 3TKSC 2H19A 4KGIA 1M2DA 1B48A 2A2RA 2C1YA 4K2XA 2GSSA 3A5IA 3LGCA 3A3TA 2NDOA 1AQVA 4K9ZA 4KW6A 2O87A 2I1UA 3TU3B 2GTUA 1Z3EA 4PI2C 3KMOA 1SVOA 2HT9A 1GL8A 2YWMA 1A2LA 2R0GA 5A4WA 3FEUA 5GZZB 2RLIA 2H8LA 2GQLA 5BRTA 2DJ3A 3GN3A 4IS0A 4MCUA 3D4TA 5D8IA 3D4MA 1F2EA 1X5CA 1M7TA 2QA2A 2LTKA 2WVXA 4MNNA 4WBJA 4HQSA 5G31A 4DEJA 1DSBA 3L4NA 1OKTA 1R4WA 4XRAA 5IMCA 2PVOC 4ZB9A 2HFDA 3F4TA 1Z7RA 5ID2A 5BMUA 3UEMA 3ZZXA 4JU5A 1YDKA 4XRDA 4CHSA 3EMXA 4TW5A 1U3AA 5A34A 3HD5A 2JSYA 1K0BA 4N0VA 5G5EA 1IYHA 5DQSA 2OT3A 2GQMA 5G5FA 2TIRA 2MBTA 2R37A 3ED3A 5C00A 2YJ7A 1EGRA 3C7MA 4FO5A 2E0QA 1VF4A 4GQCA 3IC8A 4IVFA 1K0CA 3VFIA 4KCEA 1ERTA 4MP4A 4ZXGA 4TXOB 2AAWA 1B9XC 1X9WB 4L0UA 1Z5YE 1XIYA 1TXXA 1YF1A 1XOAA 4MZCA 2REMA 1BQ7A 1SVLA 3TJJA 1YKCA 3BBYA 1XBSA 2X8GA 3M8NA 1GUMA 4PX1A 1KBNA 3ME7A 1TKDB 1EP7A 5JCGA 2H73A 3ZIVA 3VK9A 3CQFA 1B4PA 3F3QA 3ZTLA 3J7Yk 2HSNB 1NM3A 2GS3A 1XWGA 5ECPB 4IKHA 1TRVA 4PQHA 1T7PB 5F07A 5H5RA 3QMXA 1EWXA 2LRCA 4ZB7A 1XVQA 1ZYPA 3CTGA 1N8JA 5JWQB 3ZMLA 2VCZA 4ZBDA 4G19A 2E2GA 3APQA 4KF9A 3MWHA 2ZNMA 2RUEA 2LJKA 2N5BA 3I9V2 2DKIA 1HYUA 2LUSA 3A2WA 3N5OA 3SBCA 2HSMA 3GKMA 3ERFA 2FA8A 2O8VB 1S3RA 4TR0A 4J2FA 1M0UA 3FK8A 4IP6A 4OFMA 3W8SA 2DC5A 1PRXA 4POBA 3FR9A 4DSQA 1O6JA 3EPTA 4I2TA 4K6XA 2IMKA 4USSA 2FCHA 1G0TA 3D5JA 4WR4A 1I1IP 3GH6A 5EY6A 4ZBBA 2WS2A 2JSZA 2LNTA 1U6TA 3GIXA 3D22A 5J41A 3BCKA 2IN3A 3OR5A 1FAAA 4GTUA 1PX6A 4GSTA 5AGYA 1THXA 1M3IA 4YQVA 2C0DA 2DJKA 2DJJA 2HZEB 1TI3A 1B9YC 1SU9A 1H75A 5IMDA 3RDWA 5JCUA 1GUHA 4HEA2 2NPBA 1K0AA 2BJXA 4F82A 2WW0A 2OADA 5A5KA 2LQQA 2QSIA 4K7OA 2C3TA 1GSEA 1X9MB 4PHZC 1MDKA 4HOJA 3GURA 3ZYWA 2JU5A 1A8YA 4IBPA 5CAXA 3TGZA 2IMFA 3Q19A 1J08A 1SJ6A 3CYNA 3IDVA 4GXZA 1Y1UA 1M3JA 2K18A 4TR1A 3DVXA 1ABAA 1KEBA 4XIHA 2V41A 3QAGA 2L59A 3WYWA 1XOBA 3UVTA 1AQWA 3GSSA 1YEXA 3P2AA 2EFHA 1O7UA 2FGXA 3DIEA 5G1LA 2VD0A 4GDFA 3ZRDA 4QL9A 3VWUA 3F0IA 1U88A 8GSSA 2PGTA 5HFGA 2H71A 1Z6NA 4MF6A 3GKNA 5AISA 1TK5B 3MNGA 4GQFA 4AI6A 1U3IA 2BTOT 5A5HA 4WXTA 3GA4A 3RBTA 2GZZA 17GSA 2OACA 1PMTA 1HNCA 1GSDA 2V6KA 4N30A 4V2MA 1JLWA 1V40A 2IL3A 4PI0C 5ELAA 1PX7A 2KP1A 4HU9A 2H0GA 4FH8A 2CQ9A 2VCVA 1S3AA 4IW9A 2R0PA 5D96A 2O3EA 1FB6A 1FVJA 1ERVA 3UL3A 1R26A 2WZSA 2UZ8A 5LCZA 3VWVA 2HZEA 1K3LA 5IO0A 1QFNA 2M46A 4N0ZA 3IR4A 2XHFA 4K5SA 2GVPA 2P31A 3L78A 2H1DA 4Q5RA 1TK8B 2L5OA 4HSCX 4MH3A 3FZAA 2GZPA 2RM5A 3GL3A 1UVZA 2RM6A 2C4JA 3VWWA 3IRAA 2L4CA 6GSYA 1AUCA 4YQUA 4G10A 1X5EA 1VF2A 3KH7A 3HY2A 1AQXA 1XVWA 4BVYB 2C80A 4ECIA 4MPGA 1WP0A 2KUCA 2O5VA 5D9WA 5JCWA 4E8EA 6GSVA 1YEWC 1ACVA 5F0GA 4KA0A 5GAPD 3U6VA 3FR6A 2I3YA 3TRQA 3F6FA 2VLTA 2F8AA 4PNGA 1O73A 5GAND
chains in the Genus database with same CATH topology
3HKRA 2C8UA 1PSQA 4D73A 1GLQA 4KCAA 2YCDA 5IO2A 2CT6A 1E6BA 1ZOFA 5KN1A 1ZYEA 3CRUA 2HI7A 1E2YA 3KTLA 4DSSA 2DJ2A 2MMAA 3ZVJD 4KSMA 4Z2UA 3NOFA 3EWLA 5CO3A 1FW1A 6GSUA 1DUGA 4ICYA 4HZ2A 4GSSA 4XS1A 3GYKA 4I97A 3UMAA 1QXHA 1S3CA 3WT1A 1LJRA 2VCWA 1BJXA 3O76A 1SD8A 3LG6A 2LV3A 3HZ8A 2LKUA 3H4KA 4MA9A 4OMVA 1MD3A 2HSYA 2H6ZA 1SK1A 2DMMA 4X4JA 4HQZA 5DVBA 2VUPA 5ECRB 3KJYA 1XWKA 1QUWA 3IAM2 2OBKA 3M9JA 4YQMA 1ZYNA 4TVEA 4EL1A 2DKHA 4KDXA 2FNOA 2C0FA 2KP2A 2VL2A 3I43A 3BD2A 2YZHA 4JE1A 3DMLA 2H01A 1ZMAA 2YANA 1HNAA 5IOXA 1FOHA 4IP1A 4KB3A 4ZIJA 1HD2A 3KEBA 4JRRA 5ID2B 5BMUB 1FB0A 3UVHA 3U5RE 3TJFA 4EKZA 5A34B 16GSA 5HR0A 2AYTA 3KM6A 4LLRA 1CQGA 4GSNA 3VPQA 3HYPA 4MZBA 4YAVA 4NAXA 4BA7A 5EPFA 2VCTA 5CRGA 1TRSA 2HNLA 4AF2A 4NPBA 1QMVA 4EXJA 3IV4A 2F8FA 4AKXB 2GSRA 1I5GA 3K8NA 2B5EA 4RQXA 3TJBA 1QGVA 1JFUA 3TRXA 5F05A 4DVCA 4N3ZA 3GV1A 3TOTA 4OFNA 4IHUA 1XWBA 1GUKA 3F63A 5B8AA 2VM1A 2F9SA 2GT5A 4TOPA 2B1KA 5J47A 1A0FA 4GRFA 5JWRB 4BWQA 2L5LA 5E4WA 3ZVJA 2DLXA 2H75A 3E0UA 3HHVA 2H1LA 3KP9A 4O92A 3HVSA 3KZQA 3S9FA 4O32A 4HUAA 3LJRA 5DCGA 4AKIA 1OAZA 4P3YB 1UN2A 2VLVA 3H93A 1OKDA 5ABRA 3UBKA 2HSMB 5D9XA 2FY6A 3FR3A 2VL9A 1QK8A 1SD9A 2H6YA 1BG1A 4NWYA 3EE2A 3CSIA 2B5YA 2LJRA 2B7KA 1MDJA 2V6OA 1GLPA 2MYGA 2FWFA 4RQRA 3KD0A 3SWLA 3HZ4A 4O5QA 1ML6A 4JEDA 13GSA 3FYGA 3ERWA 3UOMA 1BEDA 1PN0A 1OE7A 4K5RA 4XS6A 3FKFA 4WEYA 2C3NA 1ST9A 3J7Yb 1AXDA 1K0DA 2GQKA 3Q6OA 1W89A 4WKWA 3DXBA 4YAPA 3L9UA 3ZL5A 2WULA 2ON7A 2J23A 4G0LA 3F6DA 1JZWA 3DD3A 4I2UA 5ECHB 3IHGA 4V2NA 4KX4A 2WDUA 4LL1B 2L6DA 1G7EA 4BPYA 3C1SA 3DKSA 2VL3A 1FOVA 2EFDA 4GLTA 2LEGA 1YZXA 4AKHA 3F4SA 1YY7A 3H8QA 3L0HA 1DBYA 2YOIA 2YPMA 2X64A 4TR1B 1RW1A 1V58A 4O5UA 2B3SA 4KNDA 5D93A 4FIWA 1EZKA 4KH7A 7GSSA 2CA8A 3W8JA 1PN9A 3FRCA 1LBKA 1XZOA 3M9KA 4V1Ap 4Q5QA 2PBJA 1WMJA 5DDLA 5D73A 3CBUA 2FHEA 2YZUA 2HRKA 3V1WA 5ECSA 4X1UA 2XBQA 2H0HA 2LS5A 1PD21 3ZIJA 1XWAA 2E2MA 1EOHA 5A5HB 4E8HA 1PKWA 3QOUA 1F3AA 3R2QA 3TKRA 3ZREA 4L8EA 3ZFLA 2XPEA 3GH9A 4OO5A 3RHBA 4N11A 5L71A 2H1BA 3LORA 5B7CA 3VURA 2IWTA 4ZL8A 4YKGA 2WGRA 2FLSA 1AAZA 3IC4A 4J57E 4N10A 4K0NA 4MJAA 6GSSA 1R5PA 3C1RA 3O3TA 2V2GA 3G7YA 5HR1A 1A2MA 1OC8A 2GDRA 3APOA 1THOA 1XXUA 4EO3A 1GTBA 3H1NA 1W4VA 2CZ3A 1FVKA 4NHWA 4MJCA 1ERWA 1Y6EA 4K1FA 5A1NA 3M3MA 4LA1A 2HXKA 1A2JA 3TJGA 2OKAA 3AY8A 1N2AA 4K8MA 2A2PA 2O89A 1XPVA 2VD1A 4CDOA 4IGJA 5EVOA 1GSYA 4PQ1A 4PTSA 1G6WA 5FWGA 1YQ1A 2HSHA 4L5LA 2YV7A 1O81A 2IPAA 3TUEA 1H4OA 5IMVA 3VPTA 3EVIA 1FHEA 2HQTA 4ECCA 1CQHA 3EYTA 4Z7XA 1AIUA 2WFCA 1DE2A 5ECKB 4HI7A 4D73B 1V57A 5J9CA 1N25A 1KTEA 1YF0A 4DSSB 2H72A 2RUFA 3MYDA 3RPPA 2PPTA 3PH9A 2CV4A 3KP8A 3D0ZA 3HJOA 3E3EA 5DJMA 1YKAA 1WOUA 1S3DA 4NV2A 4W66A 4EDYA 2ZCTA 1WWJA 2H76A 2DIZA 2QGVA 4POLA 3QR6A 3GL5A 1VF3A 2I9HA 3HJPA 1J9BA 2P0GA 2EFEA 3GTUA 4JR4A 1ZGNA 3MDKA 4OCEA 3I69A 1T4ZA 3PPUA 2VKZG 3WGDA 5DCHA 3ERGA 5GSSA 1WJKA 1B4QA 5D9TA 3G9BA 3ME8A 3QFBC 3MIXA 5ECNB 1TXUA 1JZDA 3CMIA 3HDCA 2HRAA 4EDZA 3DVWA 4G0KA 4V2LA 1TU8A 2IIYA 2O7KA 2X4AA 1RQMA 2X99A 3QFAC 2CAQA 4LMWA 5ECIB 2E7PA 3G7JA 2EIOA 4MZWA 4MJEA 1M2BA 2YNXA 2AB6A 1EEMA 2F51A 3HVXA 2L6CA 1O8XA 4XTSA 1BG5A 4ML1A 2YJHA 2KLXA 4X43A 2JZRA 1X5DA 2K8VA 3IPZA 4HDEA 4BWSA 2I4AA 2GLRA 11GSA 5HQPA 1C72A 4NHZA 5ECQB 4O5RA 3VI5A 1MDIA 3C8EA 1GSQA 1URMA 2H6XA 3IOSA 3KGKA 1NSWA 3I6AA 1GSUA 4MF5A 3TKQA 4IJIA 1OC3A 3GMFA 2ON5A 2VIMA 2P5QA 5DALA 4AJ7A 5KOWA 5A4VA 4XCSA 1AW9A 2FWEA 3IA1A 2C0GA 5FHIA 1TK0B 4I5QA 20GSA 3GHAA 4LMVA 2C3QA 2YWNA 1ZCPA 4IQAA 4ID0A 3EURA 2MMZA 4EF0A 2GSTA 2NTOA 1GTIA 5LNKe 2H70A 5IQYA 3TKSA 6GSXA 1FO5A 2VM2A 19GSA 1PA3A 3FZ5A 1A24A 1JZOA 4WETA 1Q4JA 4IJ3A 4KDYA 5ECMB 3EU4A 1XFLA 3KTBA 1PL1A 4POMA 4KE3A 3GX8A 1Z7PA 1TRWA 1RK4A 3KH9A 4PGTA 3PGTA 4WBRD 3HJMA 4I8BA 4TXVA 1TRUA 1GNEA 2QA1A 1G7OA 2QKEA 4GCIA 3UJ1A 2JADA 1PGTA 2JZTA 4CY6A 2XBIA 3CRTA 2YWIA 4TR3A 1A0RP 1GSSA 1JZRA 4MK3A 3GFKA 2HE3A 1K0OA 4PUAA 1AC1A 3M0FA 2IMEA 3QAVA 2CVKA 2F3MA 2H30A 3IBHA 3VWXA 1SK2A 5KN2A 4L5OA 3GNJA 4ZB6A 3IAS2 1Z9HA 4MF7A 1SVMA 4G9HA 5J4UA 1TJDA 1HNBA 4JR6A 2CVDA 2JZSA 2WZ9A 1OC9A 2NVLA 5B8BA 4K7NA 5CP1A 4BL7A 1M9BA 4PNFA 2QC7A 3LFLA 2OA7A 2Z9SA 3WGXA 2J9HA 1M2AA 2BMXA 1SL1B 1OVNA 1F37A 2YN1A 2DMLA 5J9BA 1B8XA 3TOUA 2R0CA 4G2EA 5KN3A 5ENUA 2WCIA 5F8BA 4ILFA 4ML6A 1EV9A 2VLUA 3DRNA 3L9VA 2HRKB 5LD0A 2G2QA 3UBLA 2A2SA 2MZCA 3IHQA 2N5FA 3JCML 3LXTA 2VL2C 3TKSE 4MPFA 3QDNA 3UIWA 1SKSB 2EIRA 4EUYA 1T00A 5AIVA 4XS4A 1TTZA 3IE3A 3HMJG 2JACA 5J3RA 22GSA 4EVMA 2CZ2A 2PERA 2WRTA 4AGSA 5B6MA 2H66A 18GSA 2I81A 4WF4A 3FMWA 1NHYA 2DSAA 1F3BA 5H5QA 3F4RA 4PXOA 5IMZA 2K6VA 2X8HA 1BF5A 1WIKA 4KSOA 3QCPA 4NMUA 3WD6A 1SENA 1K0MA 2H0IA 3C73A 2MBSA 1ZYQB 1DE1A 3LSZA 3CSJA 6GSTA 2ZUPA 4OD7A 2GT6A 1ON4A 3KMNA 5A1NB 2FA4A 1XWCA 5DAKA 2IFQA 4HJMA 3NIVA 4BVXA 14GSA 2WJUA 5ECLB 3N9JA 1X9SB 4NV5A 3GRXA 3H79A 4E68A 3APSA 3LXZA 3A2VA 3D6IA 3BJ5A 4EC0A 5COHA 2CX4A 4DSRA 4ECJA 2O85A 1WPIA 2VAFA 3P7XA 4HZ4A 1ZL9A 4FYUA 2A4HA 3MAKA 1R5AA 1JHBA 3LYPA 4RI7A 3LEFA 5ELGA 2M80A 4AJ6A 4K0GA 4F9ZA 2ALBA 2M72A 5AIXA 1EP8A 4O7HA 1J0FA 5KEJA 2UV8G 4PQIA 4EIPA 1LU4A 2OBIA 2KOKA 5IPHA 1SL2B 4L0WA 5CRDA 5ECOB 3QAWA 4F0CA 3RHCA 5CRHA 2H1AA 4QL7A 2FWHA 3KIJA 4FYBA 1UC7A 3BCIA 3O6TA 2DJ1A 3GKKA 5J40A 2WB9A 3GTUB 2P5RA 2MMNA 4V1Ag 1VRSD 4ULXA 4ZL7A 2L4QA 3CWGA 2YWOA 1WRYA 2DJ0A 3TRPA 5E59A 1O85A 5IM9A 4IELA 1GWCA 2D2ZA 2H1GA 3FHKA 5G1KA 3VLNA 4ZL9A 1YVLA 5A4UA 3D21A 3FZ9A 1A23A 1NHOA 3TJKA 3MSZA 4OWYA 4TXOA 3EMPA 2VOCA 2X49A 4IQ1A 2IJYA 3GKXA 2PN8A 4MJBA 5DBQA 1EV4A 4HJ2A 2XC2A 2NBSA 4XHMA 4QQ7A 4ISDA 1XW5A 1SYRA 3ZFBA 2XPDA 4F0BA 1A8LA 5IOWA 4TKYA 3W6GA 5B6NA 2KHPA 4ZB8A 2HSNA 9GSSA 3GUSA 1TU7A 1F9MA 2LQOA 5H5SA 1GTUA 4HS1A 4ZBAA 4EIQA 4AJ8A 1SKWB 3HA9A 4F2IA 1VGLA 4YH2A 1XW9A 2L57A 2LJAA 5IMAA 1V98A 4ECBA 6GSWA 1F6MC 2HLSA 1SJZA 5G30A 3DEXA 2JL4A 5DALB 1T4YA 2R6KA 4GF0A 1X0RA 2IMIA 2DIYA 4Z2RA 4KAEA 1XW6A 5CREA 1SK0A 4A5PA 4G01A 2LNSA 3EC3A 2OE0A 4RUVA 5HR3A 2K9FA 5AN1A 1SL0B 1BAYA 4Q5FA 2EFCA 2R5GA 2PUKC 3P8WA 5D9VA 1GTAA 2B1LA 2AJQB 4WF5A 3GX0A 5GSTA 5DQYA 1GNWA 5IMFA 3PR8A 3TKPA 1V2AA 3P90A 1M9AA 1KNGA 4KDUA 1BYEA 2R3XA 2H74A 4MH2A 1BX9A 1YJ6A 1M99A 10GSA 2HRNA 3RAZA 1MEKA 1T1VA 2B7JA 4OFTA 1GP1A 2LSTA 1YEPA 5J5NA 4F03A 1T3BA 1OE8A 3RPNA 3QPMA 1XCCA 3FY7A 5HFIA 5F06A 1ZZYA 3PINA 2OJLA 3UARA 4TRXA 2DBCA 3DWVA 4OCFA 4PUFC 4WR5A 3HXSA 3G7IA 4H86A 2R4VA 4FYCA 2AV4A 4POKA 5CRWA 2OE3A 2V32A 1NW2A 2V1MA 4CY8A 2C0EA 2IMDA 5C04A 5HFKA 4JBBA 3WT2A 1U87A 4FQUA 1EEJA 1PKZA 5JWOB 4MDCA 3GSTA 2YP6A 3FZ4A 1OYJA 3C71A 4CW9A 2CX3A 4ACSA 1SKRB 4G0IA 4K2DA 1MTCA 1GH2A 3EU3A 5DJLA 1K3YA 3HVVA 1FG4A 3BOAA 2GZYA 3L9SA 2RIIA 3TDGA 12GSA 3EINA 4EE0A 4AKGA 2K8SA 1OC9B 4NXIA 1IYIA 3VI7A 1R7HA 5INYA 4BL7B 3KCMA 4K7IA 4MABA 2GSQA 1K0NA 5EL8A 4HU7A 3Q18A 2EC4A 3ISOA 3R3EA 1GRXA 3IK9A 2LRNA 2CVBA 3IK7A 3TB2A 4TN8A 1TP9A 3UAPA 5KN0A 3M1GA 3TCOA 3CXGA 5FT3A 4X0XA 3WGEA 1QQ2A 3KXOA 3DGQA 3NZNA 5HR2A 4I6XA 2AHEA 2A4VA 2OE1A 5J4YA 4J56E 1USBA 4MLYA 3US3A 2G0FA 4GWRA 3F3RA 4JZQA 1PL2A 5KOXA 1GULA 2AUVA 5IPGA 1EOGA 2HRFA 3CSHA 2VCXA 3HCZA 4XS4B 2PMTA 4MMMA 4Z2TA 2B5XA 1EGOA 3A5WA 4RI6A 1GSFA 5J4VA 3FW2A 1K3OA 2PU9C 4YKFA 1MD4A 1HQOA 5G2ZA 3ZITA 2FD3A 1Y25A 4LL4B 3F8UA 1TDIA 3QD9A 4BVYA 2PVQA 2HZFA 1JLVA 2MMOA 2B6MA 1VF1A 3IXRA 2PWJA 4Q5NA 4QMKA 1O8WA 5CYYA 3CTFA 1SYXA 3LQ7A 3LYKA 3F9UA 1ERUA 1SJIA 4IN0A 3ZMKA 1WE0A 2R2JA 2ES7A 1V9WA 2YV9A 2HYXA 2N5AA 1PQNA 4PURA 4TR4A 4OO4A 1T8EB 3Q74A 4ZILA 3ZLPA 2TRCP 5DAKB 2IFQB 1TOFA 1Q98A 1TW9A 5IIZA 3LWAA 1UA5A 4BVXB 2LRTA 2TRXA 1ILOA 4KUNA 2FWGA 2VO4A 1TI1A 3LW9A 1I9DA 3DYRA 2FUG2 2GGTA 5CNWA 1G6YA 2CAIA 2EIQA 3E9JB 2VCQA 1Z6MA 2X8CA 3A2XA 3TKSC 2H19A 4KGIA 1M2DA 1B48A 2A2RA 2C1YA 4K2XA 2GSSA 3A5IA 3LGCA 3A3TA 2NDOA 1AQVA 4K9ZA 4KW6A 2O87A 2I1UA 3TU3B 2GTUA 1Z3EA 3KMOA 1SVOA 2HT9A 1GL8A 2YWMA 1A2LA 2R0GA 5A4WA 3FEUA 5GZZB 2RLIA 2H8LA 2GQLA 5BRTA 2DJ3A 3GN3A 4IS0A 4MCUA 3D4TA 5D8IA 3D4MA 1F2EA 1X5CA 1M7TA 2QA2A 2LTKA 4MNNA 4WBJA 4HQSA 5G31A 4DEJA 1DSBA 3L4NA 1OKTA 1R4WA 4XRAA 5IMCA 2PVOC 4ZB9A 2HFDA 3F4TA 1Z7RA 5ID2A 5BMUA 3UEMA 3ZZXA 4JU5A 1YDKA 4XRDA 4CHSA 3EMXA 4TW5A 1U3AA 5A34A 3HD5A 2JSYA 1K0BA 4N0VA 5G5EA 1IYHA 5DQSA 2OT3A 2GQMA 5G5FA 2TIRA 2MBTA 2R37A 3ED3A 5C00A 2YJ7A 1EGRA 3C7MA 4FO5A 2E0QA 1VF4A 4GQCA 3IC8A 4IVFA 1K0CA 3VFIA 4KCEA 1ERTA 4MP4A 4ZXGA 4TXOB 2AAWA 1B9XC 1X9WB 4L0UA 1Z5YE 1XIYA 1TXXA 1YF1A 1XOAA 4MZCA 2REMA 1BQ7A 1SVLA 3TJJA 1YKCA 3BBYA 1XBSA 2X8GA 3M8NA 1GUMA 4PX1A 1KBNA 3ME7A 1TKDB 1EP7A 5JCGA 2H73A 3ZIVA 3VK9A 1B4PA 3F3QA 3ZTLA 3J7Yk 2HSNB 1NM3A 2GS3A 1XWGA 5ECPB 4IKHA 1TRVA 4PQHA 1T7PB 5F07A 5H5RA 3QMXA 1EWXA 2LRCA 4ZB7A 1XVQA 1ZYPA 3CTGA 1N8JA 5JWQB 3ZMLA 2VCZA 4ZBDA 4G19A 2E2GA 3APQA 4KF9A 3MWHA 2ZNMA 2RUEA 2LJKA 2N5BA 3I9V2 2DKIA 1HYUA 2LUSA 3A2WA 3N5OA 3SBCA 2HSMA 3GKMA 3ERFA 2FA8A 2O8VB 4TR0A 4J2FA 1M0UA 3FK8A 4IP6A 4OFMA 3W8SA 2DC5A 1PRXA 4POBA 3FR9A 4DSQA 1O6JA 3EPTA 4I2TA 4K6XA 2IMKA 4USSA 2FCHA 1G0TA 3D5JA 4WR4A 5EY6A 3GH6A 4ZBBA 2WS2A 2JSZA 2LNTA 1U6TA 3GIXA 3D22A 5J41A 3BCKA 2IN3A 3OR5A 1FAAA 4GTUA 1PX6A 4GSTA 5AGYA 1THXA 4YQVA 2C0DA 2DJKA 2DJJA 2HZEB 1TI3A 1B9YC 1SU9A 1H75A 5IMDA 3RDWA 5JCUA 1GUHA 4HEA2 2NPBA 1K0AA 2BJXA 4F82A 2OADA 5A5KA 2LQQA 2QSIA 4K7OA 2C3TA 1GSEA 1X9MB 1MDKA 4HOJA 3GURA 3ZYWA 2JU5A 1A8YA 4IBPA 5CAXA 3TGZA 2IMFA 3Q19A 1J08A 1SJ6A 3CYNA 3IDVA 4GXZA 1Y1UA 2K18A 4TR1A 3DVXA 1ABAA 1KEBA 4XIHA 2V41A 3QAGA 2L59A 3WYWA 1XOBA 3UVTA 1AQWA 3GSSA 1YEXA 3P2AA 2EFHA 1O7UA 2FGXA 3DIEA 5G1LA 2VD0A 4GDFA 3ZRDA 4QL9A 3VWUA 3F0IA 1U88A 8GSSA 2PGTA 5HFGA 2H71A 1Z6NA 4MF6A 3GKNA 5AISA 1TK5B 3MNGA 4GQFA 4AI6A 1U3IA 2BTOT 5A5HA 4WXTA 3GA4A 3RBTA 2GZZA 17GSA 2OACA 1PMTA 1HNCA 1GSDA 2V6KA 4N30A 4V2MA 1JLWA 1V40A 2IL3A 5ELAA 1PX7A 2KP1A 4HU9A 2H0GA 4FH8A 2CQ9A 2VCVA 1S3AA 4IW9A 2R0PA 5D96A 1FVJA 1FB6A 1ERVA 3UL3A 1R26A 2UZ8A 5LCZA 3VWVA 2HZEA 1K3LA 5IO0A 1QFNA 2M46A 4N0ZA 3IR4A 2XHFA 4K5SA 2GVPA 2P31A 3L78A 2H1DA 4Q5RA 1TK8B 2L5OA 4MH3A 3FZAA 2GZPA 2RM5A 3GL3A 1UVZA 2RM6A 2C4JA 3VWWA 3IRAA 2L4CA 6GSYA 1AUCA 4YQUA 4G10A 1X5EA 1VF2A 3KH7A 3HY2A 1AQXA 1XVWA 4BVYB 2C80A 4ECIA 4MPGA 1WP0A 2KUCA 2O5VA 5D9WA 5JCWA 4E8EA 6GSVA 1ACVA 5F0GA 4KA0A 5GAPD 3U6VA 3FR6A 2I3YA 3TRQA 3F6FA 2VLTA 2F8AA 4PNGA 1O73A 5GAND
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HKR A;  2C8U A;  1PSQ A;  4D73 A;  1GLQ A;  4KCA A;  2YCD A;  5IO2 A;  2CT6 A;  1E6B A;  1ZOF A;  5KN1 A;  1ZYE A;  3CRU A;  2HI7 A;  1E2Y A;  3KTL A;  4DSS A;  2DJ2 A;  2MMA A;  3ZVJ D;  4KSM A;  3NOF A;  3EWL A;  5CO3 A;  1FW1 A;  6GSU A;  1DUG A;  4HZ2 A;  4GSS A;  4XS1 A;  3GYK A;  4I97 A;  3UMA A;  1QXH A;  1S3C A;  3WT1 A;  1LJR A;  2VCW A;  1BJX A;  3O76 A;  1SD8 A;  3LG6 A;  2LV3 A;  3HZ8 A;  2LKU A;  3H4K A;  4MA9 A;  4OMV A;  1MD3 A;  2HSY A;  2H6Z A;  1SK1 A;  2DMM A;  5DVB A;  4HQZ A;  2VUP A;  5ECR B;  3KJY A;  1XWK A;  1QUW A;  3IAM 2;  2OBK A;  3M9J A;  4YQM A;  4TVE A;  4EL1 A;  4KDX A;  2FNO A;  2C0F A;  2KP2 A;  2VL2 A;  3I43 A;  3BD2 A;  2YZH A;  4JE1 A;  3DML A;  2H01 A;  1ZMA A;  2YAN A;  1HNA A;  5IOX A;  4IP1 A;  4KB3 A;  4ZIJ A;  1HD2 A;  3KEB A;  4JRR A;  5ID2 B;  1FB0 A;  3UVH A;  3U5R E;  3TJF A;  4EKZ A;  16GS A;  5HR0 A;  2AYT A;  3KM6 A;  4LLR A;  1CQG A;  4GSN A;  3VPQ A;  3HYP A;  4MZB A;  4YAV A;  4NAX A;  4BA7 A;  5EPF A;  2VCT A;  5CRG A;  1TRS A;  2HNL A;  4AF2 A;  4NPB A;  1QMV A;  4EXJ A;  3IV4 A;  2F8F A;  2GSR A;  1I5G A;  3K8N A;  2B5E A;  4RQX A;  3TJB A;  1QGV A;  1JFU A;  3TRX A;  5F05 A;  4DVC A;  3GV1 A;  3TOT A;  4OFN A;  4IHU A;  1XWB A;  1GUK A;  3F63 A;  5B8A A;  2VM1 A;  2F9S A;  2GT5 A;  4TOP A;  2B1K A;  1A0F A;  4GRF A;  5JWR B;  4BWQ A;  2L5L A;  5E4W A;  3ZVJ A;  2DLX A;  2H75 A;  3E0U A;  3HHV A;  3KP9 A;  4O92 A;  3HVS A;  3KZQ A;  3S9F A;  4O32 A;  4HUA A;  3LJR A;  5DCG A;  1OAZ A;  4P3Y B;  1UN2 A;  2VLV A;  3H93 A;  1OKD A;  5ABR A;  3UBK A;  2HSM B;  5D9X A;  2FY6 A;  3FR3 A;  2VL9 A;  1QK8 A;  1SD9 A;  2H6Y A;  4NWY A;  3EE2 A;  3CSI A;  2B5Y A;  2LJR A;  2B7K A;  1MDJ A;  2V6O A;  1GLP A;  2MYG A;  2FWF A;  4RQR A;  3KD0 A;  3SWL A;  3HZ4 A;  1ML6 A;  4JED A;  13GS A;  3FYG A;  3ERW A;  3UOM A;  1BED A;  1OE7 A;  4XS6 A;  3FKF A;  4WEY A;  2C3N A;  1ST9 A;  3J7Y b;  1AXD A;  1K0D A;  2GQK A;  3Q6O A;  1W89 A;  4WKW A;  3DXB A;  4YAP A;  3L9U A;  3ZL5 A;  2WUL A;  2ON7 A;  2J23 A;  4G0L A;  3F6D A;  1JZW A;  3DD3 A;  4I2U A;  5ECH B;  4V2N A;  4KX4 A;  2WDU A;  4LL1 B;  2L6D A;  1G7E A;  4BPY A;  3C1S A;  3DKS A;  2VL3 A;  1FOV A;  4GLT A;  2LEG A;  1YZX A;  3F4S A;  1YY7 A;  3H8Q A;  3L0H A;  1DBY A;  2YOI A;  2YPM A;  2X64 A;  4TR1 B;  1RW1 A;  1V58 A;  2B3S A;  4KND A;  5D93 A;  4FIW A;  1EZK A;  4KH7 A;  7GSS A;  2CA8 A;  3W8J A;  1PN9 A;  3FRC A;  1LBK A;  1XZO A;  3M9K A;  4V1A p;  4Q5Q A;  2PBJ A;  1WMJ A;  5DDL A;  5D73 A;  3CBU A;  2FHE A;  2YZU A;  2HRK A;  3V1W A;  5ECS A;  4X1U A;  2XBQ A;  2H0H A;  2LS5 A;  1PD2 1;  3ZIJ A;  1XWA A;  2E2M A;  1EOH A;  4E8H A;  1PKW A;  3QOU A;  1F3A A;  3R2Q A;  3TKR A;  3ZRE A;  4L8E A;  3ZFL A;  2XPE A;  3GH9 A;  4OO5 A;  3RHB A;  4N11 A;  5L71 A;  2H1B A;  3LOR A;  5B7C A;  3VUR A;  2IWT A;  4ZL8 A;  2WGR A;  2FLS A;  1AAZ A;  3IC4 A;  4J57 E;  4N10 A;  4K0N A;  4MJA A;  6GSS A;  1R5P A;  3C1R A;  3O3T A;  2V2G A;  3G7Y A;  5HR1 A;  1A2M A;  1OC8 A;  2GDR A;  3APO A;  1THO A;  1XXU A;  4EO3 A;  1GTB A;  3H1N A;  1W4V A;  2CZ3 A;  1FVK A;  4NHW A;  4MJC A;  1ERW A;  1Y6E A;  4K1F A;  3M3M A;  4LA1 A;  2HXK A;  1A2J A;  3TJG A;  2OKA A;  3AY8 A;  1N2A A;  4K8M A;  2O89 A;  1XPV A;  2VD1 A;  4CDO A;  4IGJ A;  5EVO A;  1GSY A;  4PQ1 A;  4PTS A;  1G6W A;  5FWG A;  1YQ1 A;  2HSH A;  4L5L A;  2YV7 A;  1O81 A;  2IPA A;  3TUE A;  1H4O A;  5IMV A;  3VPT A;  3EVI A;  1FHE A;  2HQT A;  4ECC A;  1CQH A;  3EYT A;  4Z7X A;  1AIU A;  2WFC A;  1DE2 A;  5ECK B;  4HI7 A;  4D73 B;  1V57 A;  5J9C A;  1KTE A;  1YF0 A;  4DSS B;  2H72 A;  2RUF A;  3RPP A;  2PPT A;  3PH9 A;  2CV4 A;  3KP8 A;  3D0Z A;  3HJO A;  3E3E A;  5DJM A;  1YKA A;  1WOU A;  1S3D A;  4NV2 A;  4EDY A;  2ZCT A;  1WWJ A;  2H76 A;  2DIZ A;  2QGV A;  4POL A;  3QR6 A;  3GL5 A;  1VF3 A;  2I9H A;  3HJP A;  1J9B A;  2P0G A;  3GTU A;  4JR4 A;  1ZGN A;  3MDK A;  4OCE A;  3I69 A;  1T4Z A;  3PPU A;  3WGD A;  5DCH A;  3ERG A;  5GSS A;  1WJK A;  1B4Q A;  5D9T A;  3G9B A;  3ME8 A;  3QFB C;  5ECN B;  1JZD A;  3CMI A;  3HDC A;  2HRA A;  4EDZ A;  3DVW A;  4G0K A;  4V2L A;  1TU8 A;  2IIY A;  2O7K A;  1RQM A;  2X99 A;  3QFA C;  2CAQ A;  4LMW A;  5ECI B;  2E7P A;  3G7J A;  2EIO A;  4MZW A;  4MJE A;  1M2B A;  2YNX A;  2AB6 A;  1EEM A;  2F51 A;  3HVX A;  2L6C A;  1O8X A;  4XTS A;  1BG5 A;  4ML1 A;  2YJH A;  2KLX A;  4X43 A;  2JZR A;  1X5D A;  2K8V A;  3IPZ A;  4HDE A;  4BWS A;  2I4A A;  2GLR A;  11GS A;  5HQP A;  1C72 A;  4NHZ A;  5ECQ B;  4O5R A;  3VI5 A;  1MDI A;  3C8E A;  1GSQ A;  1URM A;  2H6X A;  3IOS A;  3KGK A;  1NSW A;  3I6A A;  1GSU A;  4MF5 A;  3TKQ A;  4IJI A;  1OC3 A;  3GMF A;  2ON5 A;  2VIM A;  2P5Q A;  5DAL A;  4AJ7 A;  5A4V A;  4XCS A;  1AW9 A;  2FWE A;  3IA1 A;  2C0G A;  5FHI A;  1TK0 B;  4I5Q A;  20GS A;  3GHA A;  4LMV A;  2C3Q A;  2YWN A;  1ZCP A;  4IQA A;  4ID0 A;  3EUR A;  2MMZ A;  4EF0 A;  2GST A;  2NTO A;  1GTI A;  5LNK e;  2H70 A;  5IQY A;  3TKS A;  6GSX A;  1FO5 A;  2VM2 A;  19GS A;  1PA3 A;  3FZ5 A;  1A24 A;  1JZO A;  4WET A;  1Q4J A;  4IJ3 A;  4KDY A;  5ECM B;  3EU4 A;  1XFL A;  3KTB A;  1PL1 A;  4POM A;  4KE3 A;  3GX8 A;  1Z7P A;  1TRW A;  1RK4 A;  3KH9 A;  4PGT A;  3PGT A;  4WBR D;  3HJM A;  4I8B A;  4TXV A;  1TRU A;  1GNE A;  1G7O A;  2QKE A;  4GCI A;  3UJ1 A;  2JAD A;  1PGT A;  2JZT A;  2XBI A;  3CRT A;  2YWI A;  4TR3 A;  1A0R P;  1GSS A;  1JZR A;  4MK3 A;  3GFK A;  2HE3 A;  1K0O A;  4PUA A;  1AC1 A;  3M0F A;  2IME A;  3QAV A;  2CVK A;  2F3M A;  2H30 A;  3IBH A;  3VWX A;  1SK2 A;  5KN2 A;  4L5O A;  3GNJ A;  4ZB6 A;  3IAS 2;  1Z9H A;  4MF7 A;  4G9H A;  5J4U A;  1TJD A;  1HNB A;  4JR6 A;  2CVD A;  2JZS A;  2WZ9 A;  1OC9 A;  2NVL A;  5B8B A;  4K7N A;  5CP1 A;  4BL7 A;  1M9B A;  4PNF A;  2QC7 A;  3LFL A;  2OA7 A;  2Z9S A;  3WGX A;  2J9H A;  1M2A A;  2BMX A;  1SL1 B;  1OVN A;  1F37 A;  2YN1 A;  2DML A;  5J9B A;  1B8X A;  3TOU A;  4G2E A;  5KN3 A;  5ENU A;  2WCI A;  5F8B A;  4ILF A;  4ML6 A;  1EV9 A;  2VLU A;  3DRN A;  3L9V A;  2HRK B;  5LD0 A;  2G2Q A;  3UBL A;  2A2S A;  2MZC A;  3IHQ A;  2N5F A;  3JCM L;  3LXT A;  2VL2 C;  3TKS E;  4MPF A;  3QDN A;  3UIW A;  1SKS B;  2EIR A;  4EUY A;  1T00 A;  5AIV A;  4XS4 A;  1TTZ A;  3IE3 A;  2JAC A;  5J3R A;  22GS A;  4EVM A;  2CZ2 A;  2PER A;  2WRT A;  4AGS A;  5B6M A;  2H66 A;  18GS A;  2I81 A;  4WF4 A;  1NHY A;  2DSA A;  1F3B A;  5H5Q A;  3F4R A;  4PXO A;  5IMZ A;  2K6V A;  2X8H A;  1WIK A;  4KSO A;  3QCP A;  4NMU A;  3WD6 A;  1SEN A;  1K0M A;  2H0I A;  3C73 A;  2MBS A;  1ZYQ B;  1DE1 A;  3LSZ A;  3CSJ A;  6GST A;  2ZUP A;  4OD7 A;  2GT6 A;  1ON4 A;  3KMN A;  2FA4 A;  1XWC A;  5DAK A;  2IFQ A;  4HJM A;  3NIV A;  4BVX A;  14GS A;  2WJU A;  5ECL B;  3N9J A;  1X9S B;  4NV5 A;  3GRX A;  3H79 A;  3APS A;  3LXZ A;  3A2V A;  3D6I A;  3BJ5 A;  4EC0 A;  5COH A;  2CX4 A;  4DSR A;  4ECJ A;  2O85 A;  1WPI A;  2VAF A;  3P7X A;  4HZ4 A;  1ZL9 A;  4FYU A;  3MAK A;  1R5A A;  1JHB A;  3LYP A;  4RI7 A;  3LEF A;  5ELG A;  2M80 A;  4AJ6 A;  4K0G A;  4F9Z A;  2ALB A;  2M72 A;  5AIX A;  1EP8 A;  4O7H A;  1J0F A;  5KEJ A;  4PQI A;  1LU4 A;  2OBI A;  2KOK A;  5IPH A;  1SL2 B;  4L0W A;  5CRD A;  5ECO B;  3QAW A;  4F0C A;  3RHC A;  5CRH A;  2H1A A;  4QL7 A;  2FWH A;  3KIJ A;  4FYB A;  1UC7 A;  3BCI A;  3O6T A;  2DJ1 A;  3GKK A;  2WB9 A;  3GTU B;  2P5R A;  2MMN A;  4V1A g;  1VRS D;  4ULX A;  4ZL7 A;  2L4Q A;  2YWO A;  1WRY A;  2DJ0 A;  3TRP A;  5E59 A;  1O85 A;  5IM9 A;  4IEL A;  1GWC A;  2D2Z A;  2H1G A;  3FHK A;  5G1K A;  3VLN A;  4ZL9 A;  5A4U A;  3D21 A;  3FZ9 A;  1A23 A;  1NHO A;  3TJK A;  3MSZ A;  4OWY A;  4TXO A;  3EMP A;  2VOC A;  4IQ1 A;  2IJY A;  3GKX A;  2PN8 A;  4MJB A;  5DBQ A;  1EV4 A;  4HJ2 A;  2XC2 A;  2NBS A;  4XHM A;  4QQ7 A;  4ISD A;  1XW5 A;  1SYR A;  3ZFB A;  2XPD A;  4F0B A;  1A8L A;  5IOW A;  4TKY A;  3W6G A;  5B6N A;  2KHP A;  4ZB8 A;  9GSS A;  3GUS A;  1TU7 A;  1F9M A;  2LQO A;  5H5S A;  1GTU A;  4HS1 A;  4ZBA A;  1SKW B;  4AJ8 A;  3HA9 A;  4F2I A;  1VGL A;  4YH2 A;  1XW9 A;  2L57 A;  2LJA A;  5IMA A;  1V98 A;  4ECB A;  6GSW A;  1F6M C;  2HLS A;  1SJZ A;  5G30 A;  3DEX A;  2JL4 A;  5DAL B;  1T4Y A;  2R6K A;  4GF0 A;  1X0R A;  2IMI A;  2DIY A;  4KAE A;  1XW6 A;  5CRE A;  1SK0 A;  2LNS A;  3EC3 A;  2OE0 A;  4RUV A;  5HR3 A;  2K9F A;  5AN1 A;  1SL0 B;  1BAY A;  4Q5F A;  2R5G A;  2PUK C;  3P8W A;  5D9V A;  1GTA A;  2B1L A;  2AJQ B;  4WF5 A;  3GX0 A;  5GST A;  5DQY A;  1GNW A;  5IMF A;  3PR8 A;  3TKP A;  1V2A A;  3P90 A;  1M9A A;  1KNG A;  4KDU A;  1BYE A;  2R3X A;  2H74 A;  4MH2 A;  1BX9 A;  1YJ6 A;  1M99 A;  10GS A;  2HRN A;  3RAZ A;  1MEK A;  1T1V A;  2B7J A;  4OFT A;  1GP1 A;  2LST A;  1YEP A;  5J5N A;  4F03 A;  1T3B A;  1OE8 A;  3RPN A;  3QPM A;  1XCC A;  3FY7 A;  5HFI A;  5F06 A;  1ZZY A;  3PIN A;  2OJL A;  3UAR A;  4TRX A;  2DBC A;  3DWV A;  4OCF A;  4PUF C;  4WR5 A;  3HXS A;  3G7I A;  4H86 A;  2R4V A;  4FYC A;  2AV4 A;  4POK A;  5CRW A;  2OE3 A;  2V32 A;  1NW2 A;  2V1M A;  2C0E A;  2IMD A;  5C04 A;  5HFK A;  4JBB A;  3WT2 A;  1U87 A;  4FQU A;  1EEJ A;  1PKZ A;  5JWO B;  4MDC A;  3GST A;  2YP6 A;  3FZ4 A;  1OYJ A;  3C71 A;  4CW9 A;  2CX3 A;  4ACS A;  1SKR B;  4G0I A;  4K2D A;  1MTC A;  1GH2 A;  3EU3 A;  5DJL A;  1K3Y A;  3HVV A;  1FG4 A;  3BOA A;  2GZY A;  3L9S A;  2RII A;  3TDG A;  12GS A;  3EIN A;  4EE0 A;  2K8S A;  1OC9 B;  4NXI A;  1IYI A;  3VI7 A;  1R7H A;  5INY A;  4BL7 B;  3KCM A;  4K7I A;  4MAB A;  2GSQ A;  1K0N A;  5EL8 A;  4HU7 A;  3Q18 A;  2EC4 A;  3ISO A;  3R3E A;  1GRX A;  3IK9 A;  2LRN A;  2CVB A;  3IK7 A;  3TB2 A;  4TN8 A;  1TP9 A;  3UAP A;  5KN0 A;  3M1G A;  3TCO A;  3CXG A;  5FT3 A;  4X0X A;  3WGE A;  1QQ2 A;  3KXO A;  3DGQ A;  3NZN A;  5HR2 A;  4I6X A;  2AHE A;  2A4V A;  2OE1 A;  4J56 E;  1USB A;  4MLY A;  3US3 A;  2G0F A;  4GWR A;  3F3R A;  4JZQ A;  1PL2 A;  1GUL A;  2AUV A;  5IPG A;  1EOG A;  2HRF A;  3CSH A;  2VCX A;  3HCZ A;  4XS4 B;  2PMT A;  4MMM A;  2B5X A;  1EGO A;  3A5W A;  4RI6 A;  1GSF A;  3FW2 A;  1K3O A;  2PU9 C;  1MD4 A;  1HQO A;  5G2Z A;  3ZIT A;  2FD3 A;  1Y25 A;  4LL4 B;  3F8U A;  1TDI A;  3QD9 A;  4BVY A;  2PVQ A;  2HZF A;  1JLV A;  2MMO A;  2B6M A;  1VF1 A;  2PWJ A;  3IXR A;  4Q5N A;  1O8W A;  5CYY A;  3CTF A;  1SYX A;  3LQ7 A;  3LYK A;  3F9U A;  1ERU A;  1SJI A;  4IN0 A;  3ZMK A;  1WE0 A;  2R2J A;  2ES7 A;  1V9W A;  2YV9 A;  2HYX A;  2N5A A;  1PQN A;  4PUR A;  4TR4 A;  4OO4 A;  1T8E B;  3Q74 A;  4ZIL A;  3ZLP A;  2TRC P;  5DAK B;  2IFQ B;  1TOF A;  1Q98 A;  1TW9 A;  5IIZ A;  3LWA A;  1UA5 A;  4BVX B;  2LRT A;  2TRX A;  1ILO A;  4KUN A;  2FWG A;  2VO4 A;  1TI1 A;  1I9D A;  3DYR A;  2FUG 2;  2GGT A;  5CNW A;  1G6Y A;  2CAI A;  2EIQ A;  3E9J B;  2VCQ A;  1Z6M A;  2X8C A;  3A2X A;  3TKS C;  2H19 A;  4KGI A;  1M2D A;  1B48 A;  2A2R A;  2C1Y A;  2GSS A;  3LGC A;  3A3T A;  2NDO A;  1AQV A;  4K9Z A;  4KW6 A;  2O87 A;  2I1U A;  2GTU A;  1Z3E A;  3KMO A;  2HT9 A;  1GL8 A;  2YWM A;  1A2L A;  5A4W A;  3FEU A;  5GZZ B;  2RLI A;  2H8L A;  2GQL A;  2DJ3 A;  3GN3 A;  4IS0 A;  4MCU A;  3D4T A;  5D8I A;  3D4M A;  1F2E A;  1X5C A;  1M7T A;  2LTK A;  4WBJ A;  4HQS A;  5G31 A;  4DEJ A;  1DSB A;  3L4N A;  1OKT A;  1R4W A;  4XRA A;  5IMC A;  2PVO C;  4ZB9 A;  2HFD A;  3F4T A;  1Z7R A;  5ID2 A;  5BMU A;  3UEM A;  3ZZX A;  4JU5 A;  1YDK A;  4XRD A;  4CHS A;  3EMX A;  4TW5 A;  1U3A A;  3HD5 A;  2JSY A;  1K0B A;  4N0V A;  5G5E A;  1IYH A;  5DQS A;  2GQM A;  5G5F A;  2TIR A;  2MBT A;  2R37 A;  3ED3 A;  5C00 A;  2YJ7 A;  1EGR A;  3C7M A;  4FO5 A;  2E0Q A;  1VF4 A;  4GQC A;  3IC8 A;  4IVF A;  1K0C A;  3VFI A;  4KCE A;  1ERT A;  4MP4 A;  4ZXG A;  4TXO B;  2AAW A;  1B9X C;  1X9W B;  4L0U A;  1Z5Y E;  1XIY A;  1TXX A;  1YF1 A;  1XOA A;  4MZC A;  2REM A;  1BQ7 A;  3TJJ A;  1YKC A;  3BBY A;  1XBS A;  2X8G A;  3M8N A;  1GUM A;  4PX1 A;  1KBN A;  3ME7 A;  1TKD B;  1EP7 A;  5JCG A;  2H73 A;  3ZIV A;  3VK9 A;  1B4P A;  3F3Q A;  3ZTL A;  3J7Y k;  2HSN B;  1NM3 A;  2GS3 A;  1XWG A;  5ECP B;  4IKH A;  1TRV A;  4PQH A;  1T7P B;  5F07 A;  5H5R A;  3QMX A;  1EWX A;  2LRC A;  1XVQ A;  3CTG A;  1N8J A;  5JWQ B;  3ZML A;  2VCZ A;  4ZBD A;  4G19 A;  2E2G A;  3APQ A;  4KF9 A;  3MWH A;  2ZNM A;  2RUE A;  2LJK A;  2N5B A;  3I9V 2;  1HYU A;  2LUS A;  3A2W A;  3N5O A;  3SBC A;  2HSM A;  3GKM A;  3ERF A;  2FA8 A;  2O8V B;  4TR0 A;  4J2F A;  1M0U A;  3FK8 A;  4IP6 A;  4OFM A;  3W8S A;  2DC5 A;  1PRX A;  4POB A;  3FR9 A;  4DSQ A;  1O6J A;  4I2T A;  4K6X A;  2IMK A;  4USS A;  2FCH A;  1G0T A;  3D5J A;  4WR4 A;  5EY6 A;  3GH6 A;  4ZBB A;  2WS2 A;  2JSZ A;  2LNT A;  1U6T A;  3GIX A;  3D22 A;  5J41 A;  3BCK A;  2IN3 A;  3OR5 A;  1FAA A;  4GTU A;  1PX6 A;  4GST A;  5AGY A;  1THX A;  4YQV A;  2C0D A;  2DJK A;  2DJJ A;  2HZE B;  1TI3 A;  1B9Y C;  1SU9 A;  1H75 A;  5IMD A;  3RDW A;  5JCU A;  1GUH A;  4HEA 2;  2NPB A;  1K0A A;  2BJX A;  4F82 A;  2OAD A;  5A5K A;  2LQQ A;  2QSI A;  4K7O A;  2C3T A;  1GSE A;  1X9M B;  1MDK A;  4HOJ A;  3GUR A;  3ZYW A;  2JU5 A;  1A8Y A;  4IBP A;  5CAX A;  3TGZ A;  2IMF A;  3Q19 A;  1J08 A;  1SJ6 A;  3CYN A;  3IDV A;  4GXZ A;  2K18 A;  4TR1 A;  3DVX A;  1ABA A;  1KEB A;  4XIH A;  2V41 A;  3QAG A;  2L59 A;  3WYW A;  1XOB A;  3UVT A;  1AQW A;  3GSS A;  1YEX A;  3P2A A;  1O7U A;  2FGX A;  3DIE A;  5G1L A;  2VD0 A;  3ZRD A;  4QL9 A;  3VWU A;  3F0I A;  1U88 A;  8GSS A;  2PGT A;  5HFG A;  2H71 A;  1Z6N A;  4MF6 A;  3GKN A;  5AIS A;  1TK5 B;  3MNG A;  4GQF A;  1U3I A;  2BTO T;  4WXT A;  3GA4 A;  3RBT A;  2GZZ A;  17GS A;  2OAC A;  1PMT A;  1HNC A;  1GSD A;  2V6K A;  4N30 A;  4V2M A;  1JLW A;  1V40 A;  2IL3 A;  5ELA A;  1PX7 A;  2KP1 A;  4HU9 A;  2H0G A;  4FH8 A;  2CQ9 A;  2VCV A;  1S3A A;  4IW9 A;  5D96 A;  1FVJ A;  1FB6 A;  1ERV A;  3UL3 A;  1R26 A;  2UZ8 A;  5LCZ A;  3VWV A;  2HZE A;  1K3L A;  5IO0 A;  1QFN A;  2M46 A;  4N0Z A;  3IR4 A;  2XHF A;  2GVP A;  2P31 A;  3L78 A;  2H1D A;  4Q5R A;  1TK8 B;  2L5O A;  4MH3 A;  3FZA A;  2GZP A;  2RM5 A;  3GL3 A;  1UVZ A;  2RM6 A;  2C4J A;  3VWW A;  3IRA A;  2L4C A;  6GSY A;  1AUC A;  4YQU A;  4G10 A;  1X5E A;  1VF2 A;  3KH7 A;  3HY2 A;  1AQX A;  1XVW A;  4BVY B;  2C80 A;  4ECI A;  4MPG A;  1WP0 A;  2KUC A;  5D9W A;  5JCW A;  4E8E A;  6GSV A;  1ACV A;  5F0G A;  4KA0 A;  5GAP D;  3U6V A;  3FR6 A;  2I3Y A;  3TRQ A;  3F6F A;  2VLT A;  2F8A A;  4PNG A;  1O73 A;  5GAN D; 
#chains in the Genus database with same CATH topology
 3HKR A;  2C8U A;  2WVZ A;  1PSQ A;  4D73 A;  1GLQ A;  4KCA A;  2YCD A;  5IO2 A;  2CT6 A;  1E6B A;  1ZOF A;  5KN1 A;  1ZYE A;  3CRU A;  2HI7 A;  1E2Y A;  3KTL A;  4DSS A;  2DJ2 A;  2MMA A;  3ZVJ D;  4KSM A;  4Z2U A;  3NOF A;  3EWL A;  5CO3 A;  1FW1 A;  6GSU A;  1DUG A;  4ICY A;  4HZ2 A;  4GSS A;  4XS1 A;  3GYK A;  4I97 A;  3UMA A;  1QXH A;  1S3C A;  3WT1 A;  1LJR A;  2VCW A;  1BJX A;  3O76 A;  1SD8 A;  3LG6 A;  2LV3 A;  3HZ8 A;  2LKU A;  3H4K A;  4MA9 A;  4OMV A;  1MD3 A;  2HSY A;  2H6Z A;  1SK1 A;  2DMM A;  4X4J A;  4HQZ A;  5DVB A;  2VUP A;  5ECR B;  3KJY A;  1XWK A;  1QUW A;  3IAM 2;  2OBK A;  3M9J A;  4YQM A;  1ZYN A;  4TVE A;  4EL1 A;  2DKH A;  4KDX A;  2FNO A;  2C0F A;  2KP2 A;  2VL2 A;  3I43 A;  3BD2 A;  2YZH A;  4JE1 A;  3DML A;  2WVX B;  2H01 A;  1ZMA A;  2YAN A;  1HNA A;  5IOX A;  1FOH A;  4IP1 A;  4KB3 A;  4ZIJ A;  1HD2 A;  3KEB A;  4JRR A;  5ID2 B;  5BMU B;  1FB0 A;  3UVH A;  3U5R E;  3TJF A;  4EKZ A;  5A34 B;  16GS A;  5HR0 A;  2AYT A;  3KM6 A;  4LLR A;  2WW1 A;  1CQG A;  4GSN A;  3VPQ A;  3HYP A;  4MZB A;  4YAV A;  4NAX A;  4BA7 A;  5EPF A;  2VCT A;  5CRG A;  1TRS A;  2HNL A;  4AF2 A;  4NPB A;  1QMV A;  4EXJ A;  3IV4 A;  2F8F A;  4AKX B;  2GSR A;  1I5G A;  3K8N A;  2B5E A;  4RQX A;  3TJB A;  1QGV A;  1JFU A;  3TRX A;  5F05 A;  4DVC A;  4N3Z A;  3GV1 A;  3TOT A;  4OFN A;  4IHU A;  1XWB A;  1GUK A;  3F63 A;  5B8A A;  2VM1 A;  2F9S A;  2GT5 A;  4TOP A;  2B1K A;  5J47 A;  1A0F A;  4GRF A;  5JWR B;  4BWQ A;  2L5L A;  5E4W A;  3ZVJ A;  2DLX A;  2H75 A;  3E0U A;  3HHV A;  2H1L A;  3KP9 A;  4O92 A;  3HVS A;  3KZQ A;  3S9F A;  4O32 A;  4HUA A;  3LJR A;  5DCG A;  4AKI A;  1OAZ A;  4P3Y B;  1UN2 A;  2VLV A;  3H93 A;  1OKD A;  5ABR A;  3UBK A;  2HSM B;  5D9X A;  2FY6 A;  3FR3 A;  2VL9 A;  1QK8 A;  1SD9 A;  2H6Y A;  1BG1 A;  4NWY A;  3EE2 A;  3CSI A;  2B5Y A;  2LJR A;  2B7K A;  1MDJ A;  2V6O A;  1GLP A;  2MYG A;  2FWF A;  4RQR A;  3KD0 A;  3SWL A;  3HZ4 A;  4O5Q A;  1ML6 A;  4JED A;  13GS A;  3FYG A;  3ERW A;  3UOM A;  1BED A;  1PN0 A;  1OE7 A;  4K5R A;  4XS6 A;  3FKF A;  4WEY A;  2C3N A;  1ST9 A;  3J7Y b;  1AXD A;  1K0D A;  2GQK A;  3Q6O A;  1W89 A;  4WKW A;  3DXB A;  4YAP A;  3L9U A;  3ZL5 A;  2WUL A;  2ON7 A;  2J23 A;  4G0L A;  3F6D A;  1JZW A;  3DD3 A;  4I2U A;  5ECH B;  3IHG A;  4V2N A;  4KX4 A;  2WDU A;  4LL1 B;  2L6D A;  1G7E A;  4BPY A;  3C1S A;  3DKS A;  2VL3 A;  1FOV A;  2EFD A;  4GLT A;  2LEG A;  1YZX A;  4AKH A;  3F4S A;  1YY7 A;  3H8Q A;  3L0H A;  1DBY A;  2YOI A;  2YPM A;  2X64 A;  4TR1 B;  1RW1 A;  1V58 A;  4O5U A;  3HVN A;  2B3S A;  4KND A;  5D93 A;  4FIW A;  1EZK A;  4KH7 A;  7GSS A;  2CA8 A;  3W8J A;  1PN9 A;  3FRC A;  1LBK A;  1XZO A;  3M9K A;  4V1A p;  3CHX C;  4Q5Q A;  2PBJ A;  1WMJ A;  5DDL A;  5D73 A;  3CBU A;  2FHE A;  2YZU A;  2HRK A;  3V1W A;  5ECS A;  4X1U A;  2XBQ A;  2H0H A;  2LS5 A;  1PD2 1;  3ZIJ A;  1XWA A;  2E2M A;  1EOH A;  5A5H B;  4E8H A;  1PKW A;  3QOU A;  1F3A A;  3R2Q A;  3TKR A;  3ZRE A;  4L8E A;  3ZFL A;  2XPE A;  3GH9 A;  4OO5 A;  3RHB A;  4N11 A;  5L71 A;  2H1B A;  3LOR A;  5B7C A;  3VUR A;  2IWT A;  4ZL8 A;  4YKG A;  2WGR A;  2FLS A;  1AAZ A;  3IC4 A;  4J57 E;  4N10 A;  4K0N A;  4MJA A;  6GSS A;  1R5P A;  3C1R A;  3O3T A;  2V2G A;  3G7Y A;  5HR1 A;  1A2M A;  1OC8 A;  2GDR A;  3APO A;  1THO A;  1XXU A;  4EO3 A;  1GTB A;  3H1N A;  1W4V A;  2CZ3 A;  1FVK A;  4NHW A;  4MJC A;  1ERW A;  1Y6E A;  4K1F A;  5A1N A;  3M3M A;  4LA1 A;  2HXK A;  1A2J A;  3TJG A;  2OKA A;  3AY8 A;  1N2A A;  4K8M A;  2A2P A;  2O89 A;  1XPV A;  2VD1 A;  4CDO A;  4IGJ A;  5EVO A;  1GSY A;  4PQ1 A;  4PTS A;  1G6W A;  5FWG A;  1YQ1 A;  2HSH A;  4L5L A;  2YV7 A;  1O81 A;  2IPA A;  3TUE A;  3RFR C;  4FXY P;  1H4O A;  5IMV A;  3VPT A;  3EVI A;  1FHE A;  2HQT A;  4ECC A;  1CQH A;  3EYT A;  4Z7X A;  1AIU A;  2WFC A;  1DE2 A;  5ECK B;  4HI7 A;  4D73 B;  1V57 A;  5J9C A;  1N25 A;  1KTE A;  1YF0 A;  4DSS B;  2H72 A;  2RUF A;  3MYD A;  3RPP A;  2PPT A;  3PH9 A;  2CV4 A;  3KP8 A;  3D0Z A;  3HJO A;  3E3E A;  5DJM A;  1YKA A;  1WOU A;  1S3D A;  4NV2 A;  4W66 A;  4EDY A;  2ZCT A;  1WWJ A;  2H76 A;  2DIZ A;  2QGV A;  4POL A;  3QR6 A;  3GL5 A;  1VF3 A;  2I9H A;  3HJP A;  1J9B A;  2P0G A;  2EFE A;  3GTU A;  4JR4 A;  1ZGN A;  3MDK A;  4OCE A;  3I69 A;  1T4Z A;  3PPU A;  2VKZ G;  3WGD A;  5DCH A;  3ERG A;  5GSS A;  1WJK A;  1B4Q A;  5D9T A;  3G9B A;  3ME8 A;  3QFB C;  3MIX A;  5ECN B;  1TXU A;  1JZD A;  3CMI A;  3HDC A;  2HRA A;  4EDZ A;  3DVW A;  4G0K A;  4V2L A;  1TU8 A;  2IIY A;  2O7K A;  2X4A A;  1RQM A;  2X99 A;  3QFA C;  2CAQ A;  4LMW A;  5ECI B;  2E7P A;  3G7J A;  2EIO A;  4MZW A;  4MJE A;  1M2B A;  2YNX A;  2AB6 A;  1EEM A;  2F51 A;  3HVX A;  2L6C A;  1O8X A;  4XTS A;  1BG5 A;  4ML1 A;  2YJH A;  2KLX A;  4X43 A;  2JZR A;  1X5D A;  2K8V A;  3IPZ A;  4HDE A;  4BWS A;  2I4A A;  2GLR A;  11GS A;  5HQP A;  1C72 A;  4NHZ A;  5ECQ B;  4O5R A;  3VI5 A;  1MDI A;  3C8E A;  1GSQ A;  1URM A;  2H6X A;  3IOS A;  3KGK A;  1NSW A;  3I6A A;  1GSU A;  4MF5 A;  3TKQ A;  4IJI A;  1OC3 A;  3GMF A;  2ON5 A;  2VIM A;  2P5Q A;  5DAL A;  4AJ7 A;  5KOW A;  5A4V A;  4XCS A;  1AW9 A;  2FWE A;  3IA1 A;  2C0G A;  5FHI A;  1TK0 B;  4I5Q A;  20GS A;  3GHA A;  2WW3 A;  4LMV A;  2C3Q A;  2YWN A;  1ZCP A;  4IQA A;  4ID0 A;  3EUR A;  2MMZ A;  4EF0 A;  2GST A;  2NTO A;  1GTI A;  5LNK e;  2H70 A;  5IQY A;  3TKS A;  6GSX A;  1FO5 A;  2VM2 A;  19GS A;  1PA3 A;  3FZ5 A;  1A24 A;  1JZO A;  4WET A;  1Q4J A;  4IJ3 A;  4KDY A;  5ECM B;  3EU4 A;  1XFL A;  3KTB A;  1PL1 A;  4POM A;  4KE3 A;  3GX8 A;  1Z7P A;  1TRW A;  1RK4 A;  3KH9 A;  4PGT A;  3PGT A;  4WBR D;  3HJM A;  4I8B A;  4TXV A;  1TRU A;  1GNE A;  2QA1 A;  1G7O A;  2QKE A;  4GCI A;  3UJ1 A;  2JAD A;  1PGT A;  2JZT A;  4CY6 A;  2XBI A;  3CRT A;  2YWI A;  4TR3 A;  1A0R P;  1GSS A;  1JZR A;  4MK3 A;  3GFK A;  2HE3 A;  1K0O A;  4PUA A;  1AC1 A;  3M0F A;  2IME A;  3QAV A;  2CVK A;  2F3M A;  2H30 A;  3IBH A;  3VWX A;  1XG8 A;  1SK2 A;  5KN2 A;  4L5O A;  3GNJ A;  4ZB6 A;  3IAS 2;  1Z9H A;  4MF7 A;  1SVM A;  4G9H A;  5J4U A;  1TJD A;  1HNB A;  4JR6 A;  2CVD A;  2JZS A;  2WZ9 A;  1OC9 A;  2NVL A;  5B8B A;  4K7N A;  5CP1 A;  4BL7 A;  1M9B A;  4PNF A;  2QC7 A;  3LFL A;  2OA7 A;  2Z9S A;  3WGX A;  2J9H A;  1M2A A;  2BMX A;  1SL1 B;  1OVN A;  1F37 A;  2YN1 A;  2DML A;  5J9B A;  1B8X A;  2WVY A;  3TOU A;  2R0C A;  4G2E A;  5KN3 A;  5ENU A;  2WCI A;  5F8B A;  4ILF A;  4ML6 A;  1EV9 A;  2VLU A;  3DRN A;  3L9V A;  2HRK B;  5LD0 A;  2G2Q A;  3UBL A;  2A2S A;  2MZC A;  3IHQ A;  2N5F A;  3JCM L;  3LXT A;  2VL2 C;  3TKS E;  4MPF A;  3QDN A;  3UIW A;  1SKS B;  2EIR A;  4EUY A;  1T00 A;  5AIV A;  4XS4 A;  1TTZ A;  3IE3 A;  3HMJ G;  2JAC A;  2WW2 A;  5J3R A;  22GS A;  4EVM A;  2CZ2 A;  2PER A;  2WRT A;  4AGS A;  5B6M A;  2H66 A;  18GS A;  2I81 A;  4WF4 A;  3FMW A;  1NHY A;  2DSA A;  1F3B A;  5H5Q A;  3F4R A;  4PXO A;  5IMZ A;  2K6V A;  2X8H A;  1BF5 A;  1WIK A;  4KSO A;  3QCP A;  4NMU A;  3WD6 A;  1SEN A;  1K0M A;  2H0I A;  3C73 A;  2MBS A;  1ZYQ B;  1DE1 A;  3LSZ A;  3CSJ A;  6GST A;  2O36 A;  2ZUP A;  4OD7 A;  2GT6 A;  1ON4 A;  3KMN A;  5A1N B;  2FA4 A;  1XWC A;  5DAK A;  2IFQ A;  4HJM A;  3NIV A;  4BVX A;  14GS A;  2WJU A;  5ECL B;  3N9J A;  1X9S B;  4NV5 A;  3GRX A;  3H79 A;  4E68 A;  3APS A;  3LXZ A;  3A2V A;  3D6I A;  3BJ5 A;  4EC0 A;  5COH A;  2CX4 A;  4DSR A;  4ECJ A;  2O85 A;  1WPI A;  2VAF A;  3P7X A;  4HZ4 A;  1ZL9 A;  4FYU A;  2A4H A;  3MAK A;  1R5A A;  1JHB A;  3LYP A;  4RI7 A;  3LEF A;  5ELG A;  2M80 A;  4AJ6 A;  4K0G A;  4F9Z A;  2ALB A;  2M72 A;  5AIX A;  1EP8 A;  4O7H A;  1J0F A;  5KEJ A;  2UV8 G;  4PQI A;  4EIP A;  1LU4 A;  2OBI A;  2KOK A;  5IPH A;  1SL2 B;  4L0W A;  5CRD A;  5ECO B;  3QAW A;  4F0C A;  3RHC A;  5CRH A;  2H1A A;  4QL7 A;  2FWH A;  3KIJ A;  4FYB A;  1UC7 A;  3BCI A;  3O6T A;  2DJ1 A;  3GKK A;  5J40 A;  2WB9 A;  3GTU B;  2P5R A;  2MMN A;  4V1A g;  1VRS D;  4ULX A;  4ZL7 A;  2L4Q A;  3CWG A;  2YWO A;  1WRY A;  2DJ0 A;  3TRP A;  5E59 A;  1O85 A;  5IM9 A;  4IEL A;  1GWC A;  2D2Z A;  2H1G A;  3FHK A;  5G1K A;  3VLN A;  4ZL9 A;  1YVL A;  5A4U A;  3D21 A;  3FZ9 A;  1A23 A;  1NHO A;  3TJK A;  3MSZ A;  4OWY A;  4TXO A;  3EMP A;  2VOC A;  2X49 A;  4IQ1 A;  2IJY A;  3GKX A;  2PN8 A;  4MJB A;  5DBQ A;  1EV4 A;  4HJ2 A;  2XC2 A;  2NBS A;  4XHM A;  4QQ7 A;  4ISD A;  1XW5 A;  1SYR A;  3ZFB A;  2XPD A;  4F0B A;  1A8L A;  5IOW A;  4TKY A;  3W6G A;  5B6N A;  2KHP A;  4ZB8 A;  2HSN A;  9GSS A;  3GUS A;  1TU7 A;  1F9M A;  2LQO A;  5H5S A;  1GTU A;  4HS1 A;  4ZBA A;  4EIQ A;  4AJ8 A;  1SKW B;  3HA9 A;  4F2I A;  1VGL A;  4YH2 A;  1XW9 A;  2L57 A;  2LJA A;  5IMA A;  1V98 A;  4ECB A;  6GSW A;  1F6M C;  2HLS A;  1SJZ A;  5G30 A;  3DEX A;  2JL4 A;  5DAL B;  1T4Y A;  2R6K A;  4GF0 A;  1X0R A;  2IMI A;  2DIY A;  4Z2R A;  4KAE A;  1XW6 A;  5CRE A;  1SK0 A;  4A5P A;  4G01 A;  2LNS A;  3EC3 A;  2OE0 A;  4RUV A;  5HR3 A;  2K9F A;  5AN1 A;  1SL0 B;  1BAY A;  4Q5F A;  2EFC A;  2R5G A;  2PUK C;  3P8W A;  5D9V A;  1GTA A;  2B1L A;  2AJQ B;  4WF5 A;  3GX0 A;  5GST A;  5DQY A;  1GNW A;  5IMF A;  3PR8 A;  3TKP A;  1V2A A;  3P90 A;  1M9A A;  1KNG A;  4KDU A;  1BYE A;  2R3X A;  2H74 A;  4MH2 A;  1BX9 A;  1YJ6 A;  1M99 A;  10GS A;  2HRN A;  3RAZ A;  1MEK A;  1T1V A;  2B7J A;  4OFT A;  1GP1 A;  2LST A;  1YEP A;  5J5N A;  4F03 A;  1T3B A;  1OE8 A;  3RPN A;  3QPM A;  1XCC A;  3FY7 A;  5HFI A;  5F06 A;  1ZZY A;  3PIN A;  2OJL A;  3UAR A;  4TRX A;  2DBC A;  3DWV A;  4OCF A;  4PUF C;  4WR5 A;  3HXS A;  3G7I A;  4H86 A;  2R4V A;  4FYC A;  2AV4 A;  4POK A;  5CRW A;  2OE3 A;  2V32 A;  1NW2 A;  2V1M A;  4CY8 A;  2C0E A;  2IMD A;  5C04 A;  5HFK A;  4JBB A;  3WT2 A;  1U87 A;  4FQU A;  1EEJ A;  1PKZ A;  5JWO B;  4MDC A;  3GST A;  2YP6 A;  3FZ4 A;  1OYJ A;  3C71 A;  4CW9 A;  2CX3 A;  4ACS A;  1SKR B;  4G0I A;  4K2D A;  1MTC A;  1GH2 A;  3EU3 A;  5DJL A;  1K3Y A;  4BIK A;  3HVV A;  1FG4 A;  3BOA A;  2GZY A;  3L9S A;  2RII A;  3TDG A;  12GS A;  3EIN A;  4EE0 A;  4AKG A;  2K8S A;  1OC9 B;  4NXI A;  1IYI A;  3VI7 A;  1R7H A;  5INY A;  4BL7 B;  3KCM A;  4K7I A;  4MAB A;  2GSQ A;  1K0N A;  5EL8 A;  4HU7 A;  3Q18 A;  2EC4 A;  3ISO A;  3R3E A;  1GRX A;  3IK9 A;  2LRN A;  2CVB A;  3IK7 A;  3TB2 A;  4TN8 A;  1TP9 A;  3UAP A;  5KN0 A;  3M1G A;  3TCO A;  3CXG A;  5FT3 A;  4X0X A;  3WGE A;  1QQ2 A;  3KXO A;  3DGQ A;  3NZN A;  5HR2 A;  4I6X A;  2AHE A;  2A4V A;  2OE1 A;  5J4Y A;  1PFO A;  4J56 E;  3RGB C;  1USB A;  4MLY A;  3US3 A;  2G0F A;  4GWR A;  3F3R A;  4JZQ A;  1PL2 A;  5KOX A;  1GUL A;  2AUV A;  5IPG A;  1EOG A;  2HRF A;  3CSH A;  2VCX A;  3HCZ A;  4XS4 B;  2PMT A;  4MMM A;  4Z2T A;  2B5X A;  1EGO A;  3A5W A;  4RI6 A;  1GSF A;  5J4V A;  3FW2 A;  1K3O A;  2PU9 C;  4YKF A;  1MD4 A;  1HQO A;  5G2Z A;  3ZIT A;  2FD3 A;  1Y25 A;  4LL4 B;  3F8U A;  1TDI A;  3QD9 A;  4BVY A;  2PVQ A;  2HZF A;  1JLV A;  2MMO A;  2B6M A;  1VF1 A;  3IXR A;  2PWJ A;  4Q5N A;  4QMK A;  1O8W A;  5CYY A;  3CTF A;  1SYX A;  3LQ7 A;  3LYK A;  3F9U A;  1ERU A;  1SJI A;  4IN0 A;  3ZMK A;  1WE0 A;  2R2J A;  2ES7 A;  1V9W A;  2YV9 A;  2HYX A;  2N5A A;  1PQN A;  4PUR A;  4TR4 A;  4OO4 A;  1T8E B;  3Q74 A;  4ZIL A;  3ZLP A;  2TRC P;  5DAK B;  2IFQ B;  1TOF A;  1Q98 A;  1TW9 A;  5IIZ A;  3LWA A;  1UA5 A;  4BVX B;  2LRT A;  2TRX A;  1ILO A;  4KUN A;  2FWG A;  2VO4 A;  1TI1 A;  3LW9 A;  1I9D A;  3DYR A;  2FUG 2;  2GGT A;  5CNW A;  1G6Y A;  2CAI A;  2EIQ A;  3E9J B;  2VCQ A;  1Z6M A;  2X8C A;  3A2X A;  1S4B P;  3TKS C;  2H19 A;  4KGI A;  1M2D A;  1B48 A;  2A2R A;  2C1Y A;  4K2X A;  2GSS A;  3A5I A;  3LGC A;  3A3T A;  2NDO A;  1AQV A;  4K9Z A;  4KW6 A;  2O87 A;  2I1U A;  3TU3 B;  2GTU A;  1Z3E A;  4PI2 C;  3KMO A;  1SVO A;  2HT9 A;  1GL8 A;  2YWM A;  1A2L A;  2R0G A;  5A4W A;  3FEU A;  5GZZ B;  2RLI A;  2H8L A;  2GQL A;  5BRT A;  2DJ3 A;  3GN3 A;  4IS0 A;  4MCU A;  3D4T A;  5D8I A;  3D4M A;  1F2E A;  1X5C A;  1M7T A;  2QA2 A;  2LTK A;  2WVX A;  4MNN A;  4WBJ A;  4HQS A;  5G31 A;  4DEJ A;  1DSB A;  3L4N A;  1OKT A;  1R4W A;  4XRA A;  5IMC A;  2PVO C;  4ZB9 A;  2HFD A;  3F4T A;  1Z7R A;  5ID2 A;  5BMU A;  3UEM A;  3ZZX A;  4JU5 A;  1YDK A;  4XRD A;  4CHS A;  3EMX A;  4TW5 A;  1U3A A;  5A34 A;  3HD5 A;  2JSY A;  1K0B A;  4N0V A;  5G5E A;  1IYH A;  5DQS A;  2OT3 A;  2GQM A;  5G5F A;  2TIR A;  2MBT A;  2R37 A;  3ED3 A;  5C00 A;  2YJ7 A;  1EGR A;  3C7M A;  4FO5 A;  2E0Q A;  1VF4 A;  4GQC A;  3IC8 A;  4IVF A;  1K0C A;  3VFI A;  4KCE A;  1ERT A;  4MP4 A;  4ZXG A;  4TXO B;  2AAW A;  1B9X C;  1X9W B;  4L0U A;  1Z5Y E;  1XIY A;  1TXX A;  1YF1 A;  1XOA A;  4MZC A;  2REM A;  1BQ7 A;  1SVL A;  3TJJ A;  1YKC A;  3BBY A;  1XBS A;  2X8G A;  3M8N A;  1GUM A;  4PX1 A;  1KBN A;  3ME7 A;  1TKD B;  1EP7 A;  5JCG A;  2H73 A;  3ZIV A;  3VK9 A;  3CQF A;  1B4P A;  3F3Q A;  3ZTL A;  3J7Y k;  2HSN B;  1NM3 A;  2GS3 A;  1XWG A;  5ECP B;  4IKH A;  1TRV A;  4PQH A;  1T7P B;  5F07 A;  5H5R A;  3QMX A;  1EWX A;  2LRC A;  4ZB7 A;  1XVQ A;  1ZYP A;  3CTG A;  1N8J A;  5JWQ B;  3ZML A;  2VCZ A;  4ZBD A;  4G19 A;  2E2G A;  3APQ A;  4KF9 A;  3MWH A;  2ZNM A;  2RUE A;  2LJK A;  2N5B A;  3I9V 2;  2DKI A;  1HYU A;  2LUS A;  3A2W A;  3N5O A;  3SBC A;  2HSM A;  3GKM A;  3ERF A;  2FA8 A;  2O8V B;  1S3R A;  4TR0 A;  4J2F A;  1M0U A;  3FK8 A;  4IP6 A;  4OFM A;  3W8S A;  2DC5 A;  1PRX A;  4POB A;  3FR9 A;  4DSQ A;  1O6J A;  3EPT A;  4I2T A;  4K6X A;  2IMK A;  4USS A;  2FCH A;  1G0T A;  3D5J A;  4WR4 A;  1I1I P;  3GH6 A;  5EY6 A;  4ZBB A;  2WS2 A;  2JSZ A;  2LNT A;  1U6T A;  3GIX A;  3D22 A;  5J41 A;  3BCK A;  2IN3 A;  3OR5 A;  1FAA A;  4GTU A;  1PX6 A;  4GST A;  5AGY A;  1THX A;  1M3I A;  4YQV A;  2C0D A;  2DJK A;  2DJJ A;  2HZE B;  1TI3 A;  1B9Y C;  1SU9 A;  1H75 A;  5IMD A;  3RDW A;  5JCU A;  1GUH A;  4HEA 2;  2NPB A;  1K0A A;  2BJX A;  4F82 A;  2WW0 A;  2OAD A;  5A5K A;  2LQQ A;  2QSI A;  4K7O A;  2C3T A;  1GSE A;  1X9M B;  4PHZ C;  1MDK A;  4HOJ A;  3GUR A;  3ZYW A;  2JU5 A;  1A8Y A;  4IBP A;  5CAX A;  3TGZ A;  2IMF A;  3Q19 A;  1J08 A;  1SJ6 A;  3CYN A;  3IDV A;  4GXZ A;  1Y1U A;  1M3J A;  2K18 A;  4TR1 A;  3DVX A;  1ABA A;  1KEB A;  4XIH A;  2V41 A;  3QAG A;  2L59 A;  3WYW A;  1XOB A;  3UVT A;  1AQW A;  3GSS A;  1YEX A;  3P2A A;  2EFH A;  1O7U A;  2FGX A;  3DIE A;  5G1L A;  2VD0 A;  4GDF A;  3ZRD A;  4QL9 A;  3VWU A;  3F0I A;  1U88 A;  8GSS A;  2PGT A;  5HFG A;  2H71 A;  1Z6N A;  4MF6 A;  3GKN A;  5AIS A;  1TK5 B;  3MNG A;  4GQF A;  4AI6 A;  1U3I A;  2BTO T;  5A5H A;  4WXT A;  3GA4 A;  3RBT A;  2GZZ A;  17GS A;  2OAC A;  1PMT A;  1HNC A;  1GSD A;  2V6K A;  4N30 A;  4V2M A;  1JLW A;  1V40 A;  2IL3 A;  4PI0 C;  5ELA A;  1PX7 A;  2KP1 A;  4HU9 A;  2H0G A;  4FH8 A;  2CQ9 A;  2VCV A;  1S3A A;  4IW9 A;  2R0P A;  5D96 A;  2O3E A;  1FB6 A;  1FVJ A;  1ERV A;  3UL3 A;  1R26 A;  2WZS A;  2UZ8 A;  5LCZ A;  3VWV A;  2HZE A;  1K3L A;  5IO0 A;  1QFN A;  2M46 A;  4N0Z A;  3IR4 A;  2XHF A;  4K5S A;  2GVP A;  2P31 A;  3L78 A;  2H1D A;  4Q5R A;  1TK8 B;  2L5O A;  4HSC X;  4MH3 A;  3FZA A;  2GZP A;  2RM5 A;  3GL3 A;  1UVZ A;  2RM6 A;  2C4J A;  3VWW A;  3IRA A;  2L4C A;  6GSY A;  1AUC A;  4YQU A;  4G10 A;  1X5E A;  1VF2 A;  3KH7 A;  3HY2 A;  1AQX A;  1XVW A;  4BVY B;  2C80 A;  4ECI A;  4MPG A;  1WP0 A;  2KUC A;  2O5V A;  5D9W A;  5JCW A;  4E8E A;  6GSV A;  1YEW C;  1ACV A;  5F0G A;  4KA0 A;  5GAP D;  3U6V A;  3FR6 A;  2I3Y A;  3TRQ A;  3F6F A;  2VLT A;  2F8A A;  4PNG A;  1O73 A;  5GAN D; 
#chains in the Genus database with same CATH homology
 3HKR A;  2C8U A;  1PSQ A;  4D73 A;  1GLQ A;  4KCA A;  2YCD A;  5IO2 A;  2CT6 A;  1E6B A;  1ZOF A;  5KN1 A;  1ZYE A;  3CRU A;  2HI7 A;  1E2Y A;  3KTL A;  4DSS A;  2DJ2 A;  2MMA A;  3ZVJ D;  4KSM A;  4Z2U A;  3NOF A;  3EWL A;  5CO3 A;  1FW1 A;  6GSU A;  1DUG A;  4ICY A;  4HZ2 A;  4GSS A;  4XS1 A;  3GYK A;  4I97 A;  3UMA A;  1QXH A;  1S3C A;  3WT1 A;  1LJR A;  2VCW A;  1BJX A;  3O76 A;  1SD8 A;  3LG6 A;  2LV3 A;  3HZ8 A;  2LKU A;  3H4K A;  4MA9 A;  4OMV A;  1MD3 A;  2HSY A;  2H6Z A;  1SK1 A;  2DMM A;  4X4J A;  4HQZ A;  5DVB A;  2VUP A;  5ECR B;  3KJY A;  1XWK A;  1QUW A;  3IAM 2;  2OBK A;  3M9J A;  4YQM A;  1ZYN A;  4TVE A;  4EL1 A;  2DKH A;  4KDX A;  2FNO A;  2C0F A;  2KP2 A;  2VL2 A;  3I43 A;  3BD2 A;  2YZH A;  4JE1 A;  3DML A;  2H01 A;  1ZMA A;  2YAN A;  1HNA A;  5IOX A;  1FOH A;  4IP1 A;  4KB3 A;  4ZIJ A;  1HD2 A;  3KEB A;  4JRR A;  5ID2 B;  5BMU B;  1FB0 A;  3UVH A;  3U5R E;  3TJF A;  4EKZ A;  5A34 B;  16GS A;  5HR0 A;  2AYT A;  3KM6 A;  4LLR A;  1CQG A;  4GSN A;  3VPQ A;  3HYP A;  4MZB A;  4YAV A;  4NAX A;  4BA7 A;  5EPF A;  2VCT A;  5CRG A;  1TRS A;  2HNL A;  4AF2 A;  4NPB A;  1QMV A;  4EXJ A;  3IV4 A;  2F8F A;  4AKX B;  2GSR A;  1I5G A;  3K8N A;  2B5E A;  4RQX A;  3TJB A;  1QGV A;  1JFU A;  3TRX A;  5F05 A;  4DVC A;  4N3Z A;  3GV1 A;  3TOT A;  4OFN A;  4IHU A;  1XWB A;  1GUK A;  3F63 A;  5B8A A;  2VM1 A;  2F9S A;  2GT5 A;  4TOP A;  2B1K A;  5J47 A;  1A0F A;  4GRF A;  5JWR B;  4BWQ A;  2L5L A;  5E4W A;  3ZVJ A;  2DLX A;  2H75 A;  3E0U A;  3HHV A;  2H1L A;  3KP9 A;  4O92 A;  3HVS A;  3KZQ A;  3S9F A;  4O32 A;  4HUA A;  3LJR A;  5DCG A;  4AKI A;  1OAZ A;  4P3Y B;  1UN2 A;  2VLV A;  3H93 A;  1OKD A;  5ABR A;  3UBK A;  2HSM B;  5D9X A;  2FY6 A;  3FR3 A;  2VL9 A;  1QK8 A;  1SD9 A;  2H6Y A;  1BG1 A;  4NWY A;  3EE2 A;  3CSI A;  2B5Y A;  2LJR A;  2B7K A;  1MDJ A;  2V6O A;  1GLP A;  2MYG A;  2FWF A;  4RQR A;  3KD0 A;  3SWL A;  3HZ4 A;  4O5Q A;  1ML6 A;  4JED A;  13GS A;  3FYG A;  3ERW A;  3UOM A;  1BED A;  1PN0 A;  1OE7 A;  4K5R A;  4XS6 A;  3FKF A;  4WEY A;  2C3N A;  1ST9 A;  3J7Y b;  1AXD A;  1K0D A;  2GQK A;  3Q6O A;  1W89 A;  4WKW A;  3DXB A;  4YAP A;  3L9U A;  3ZL5 A;  2WUL A;  2ON7 A;  2J23 A;  4G0L A;  3F6D A;  1JZW A;  3DD3 A;  4I2U A;  5ECH B;  3IHG A;  4V2N A;  4KX4 A;  2WDU A;  4LL1 B;  2L6D A;  1G7E A;  4BPY A;  3C1S A;  3DKS A;  2VL3 A;  1FOV A;  2EFD A;  4GLT A;  2LEG A;  1YZX A;  4AKH A;  3F4S A;  1YY7 A;  3H8Q A;  3L0H A;  1DBY A;  2YOI A;  2YPM A;  2X64 A;  4TR1 B;  1RW1 A;  1V58 A;  4O5U A;  2B3S A;  4KND A;  5D93 A;  4FIW A;  1EZK A;  4KH7 A;  7GSS A;  2CA8 A;  3W8J A;  1PN9 A;  3FRC A;  1LBK A;  1XZO A;  3M9K A;  4V1A p;  4Q5Q A;  2PBJ A;  1WMJ A;  5DDL A;  5D73 A;  3CBU A;  2FHE A;  2YZU A;  2HRK A;  3V1W A;  5ECS A;  4X1U A;  2XBQ A;  2H0H A;  2LS5 A;  1PD2 1;  3ZIJ A;  1XWA A;  2E2M A;  1EOH A;  5A5H B;  4E8H A;  1PKW A;  3QOU A;  1F3A A;  3R2Q A;  3TKR A;  3ZRE A;  4L8E A;  3ZFL A;  2XPE A;  3GH9 A;  4OO5 A;  3RHB A;  4N11 A;  5L71 A;  2H1B A;  3LOR A;  5B7C A;  3VUR A;  2IWT A;  4ZL8 A;  4YKG A;  2WGR A;  2FLS A;  1AAZ A;  3IC4 A;  4J57 E;  4N10 A;  4K0N A;  4MJA A;  6GSS A;  1R5P A;  3C1R A;  3O3T A;  2V2G A;  3G7Y A;  5HR1 A;  1A2M A;  1OC8 A;  2GDR A;  3APO A;  1THO A;  1XXU A;  4EO3 A;  1GTB A;  3H1N A;  1W4V A;  2CZ3 A;  1FVK A;  4NHW A;  4MJC A;  1ERW A;  1Y6E A;  4K1F A;  5A1N A;  3M3M A;  4LA1 A;  2HXK A;  1A2J A;  3TJG A;  2OKA A;  3AY8 A;  1N2A A;  4K8M A;  2A2P A;  2O89 A;  1XPV A;  2VD1 A;  4CDO A;  4IGJ A;  5EVO A;  1GSY A;  4PQ1 A;  4PTS A;  1G6W A;  5FWG A;  1YQ1 A;  2HSH A;  4L5L A;  2YV7 A;  1O81 A;  2IPA A;  3TUE A;  1H4O A;  5IMV A;  3VPT A;  3EVI A;  1FHE A;  2HQT A;  4ECC A;  1CQH A;  3EYT A;  4Z7X A;  1AIU A;  2WFC A;  1DE2 A;  5ECK B;  4HI7 A;  4D73 B;  1V57 A;  5J9C A;  1N25 A;  1KTE A;  1YF0 A;  4DSS B;  2H72 A;  2RUF A;  3MYD A;  3RPP A;  2PPT A;  3PH9 A;  2CV4 A;  3KP8 A;  3D0Z A;  3HJO A;  3E3E A;  5DJM A;  1YKA A;  1WOU A;  1S3D A;  4NV2 A;  4W66 A;  4EDY A;  2ZCT A;  1WWJ A;  2H76 A;  2DIZ A;  2QGV A;  4POL A;  3QR6 A;  3GL5 A;  1VF3 A;  2I9H A;  3HJP A;  1J9B A;  2P0G A;  2EFE A;  3GTU A;  4JR4 A;  1ZGN A;  3MDK A;  4OCE A;  3I69 A;  1T4Z A;  3PPU A;  2VKZ G;  3WGD A;  5DCH A;  3ERG A;  5GSS A;  1WJK A;  1B4Q A;  5D9T A;  3G9B A;  3ME8 A;  3QFB C;  3MIX A;  5ECN B;  1TXU A;  1JZD A;  3CMI A;  3HDC A;  2HRA A;  4EDZ A;  3DVW A;  4G0K A;  4V2L A;  1TU8 A;  2IIY A;  2O7K A;  2X4A A;  1RQM A;  2X99 A;  3QFA C;  2CAQ A;  4LMW A;  5ECI B;  2E7P A;  3G7J A;  2EIO A;  4MZW A;  4MJE A;  1M2B A;  2YNX A;  2AB6 A;  1EEM A;  2F51 A;  3HVX A;  2L6C A;  1O8X A;  4XTS A;  1BG5 A;  4ML1 A;  2YJH A;  2KLX A;  4X43 A;  2JZR A;  1X5D A;  2K8V A;  3IPZ A;  4HDE A;  4BWS A;  2I4A A;  2GLR A;  11GS A;  5HQP A;  1C72 A;  4NHZ A;  5ECQ B;  4O5R A;  3VI5 A;  1MDI A;  3C8E A;  1GSQ A;  1URM A;  2H6X A;  3IOS A;  3KGK A;  1NSW A;  3I6A A;  1GSU A;  4MF5 A;  3TKQ A;  4IJI A;  1OC3 A;  3GMF A;  2ON5 A;  2VIM A;  2P5Q A;  5DAL A;  4AJ7 A;  5KOW A;  5A4V A;  4XCS A;  1AW9 A;  2FWE A;  3IA1 A;  2C0G A;  5FHI A;  1TK0 B;  4I5Q A;  20GS A;  3GHA A;  4LMV A;  2C3Q A;  2YWN A;  1ZCP A;  4IQA A;  4ID0 A;  3EUR A;  2MMZ A;  4EF0 A;  2GST A;  2NTO A;  1GTI A;  5LNK e;  2H70 A;  5IQY A;  3TKS A;  6GSX A;  1FO5 A;  2VM2 A;  19GS A;  1PA3 A;  3FZ5 A;  1A24 A;  1JZO A;  4WET A;  1Q4J A;  4IJ3 A;  4KDY A;  5ECM B;  3EU4 A;  1XFL A;  3KTB A;  1PL1 A;  4POM A;  4KE3 A;  3GX8 A;  1Z7P A;  1TRW A;  1RK4 A;  3KH9 A;  4PGT A;  3PGT A;  4WBR D;  3HJM A;  4I8B A;  4TXV A;  1TRU A;  1GNE A;  2QA1 A;  1G7O A;  2QKE A;  4GCI A;  3UJ1 A;  2JAD A;  1PGT A;  2JZT A;  4CY6 A;  2XBI A;  3CRT A;  2YWI A;  4TR3 A;  1A0R P;  1GSS A;  1JZR A;  4MK3 A;  3GFK A;  2HE3 A;  1K0O A;  4PUA A;  1AC1 A;  3M0F A;  2IME A;  3QAV A;  2CVK A;  2F3M A;  2H30 A;  3IBH A;  3VWX A;  1SK2 A;  5KN2 A;  4L5O A;  3GNJ A;  4ZB6 A;  3IAS 2;  1Z9H A;  4MF7 A;  1SVM A;  4G9H A;  5J4U A;  1TJD A;  1HNB A;  4JR6 A;  2CVD A;  2JZS A;  2WZ9 A;  1OC9 A;  2NVL A;  5B8B A;  4K7N A;  5CP1 A;  4BL7 A;  1M9B A;  4PNF A;  2QC7 A;  3LFL A;  2OA7 A;  2Z9S A;  3WGX A;  2J9H A;  1M2A A;  2BMX A;  1SL1 B;  1OVN A;  1F37 A;  2YN1 A;  2DML A;  5J9B A;  1B8X A;  3TOU A;  2R0C A;  4G2E A;  5KN3 A;  5ENU A;  2WCI A;  5F8B A;  4ILF A;  4ML6 A;  1EV9 A;  2VLU A;  3DRN A;  3L9V A;  2HRK B;  5LD0 A;  2G2Q A;  3UBL A;  2A2S A;  2MZC A;  3IHQ A;  2N5F A;  3JCM L;  3LXT A;  2VL2 C;  3TKS E;  4MPF A;  3QDN A;  3UIW A;  1SKS B;  2EIR A;  4EUY A;  1T00 A;  5AIV A;  4XS4 A;  1TTZ A;  3IE3 A;  3HMJ G;  2JAC A;  5J3R A;  22GS A;  4EVM A;  2CZ2 A;  2PER A;  2WRT A;  4AGS A;  5B6M A;  2H66 A;  18GS A;  2I81 A;  4WF4 A;  3FMW A;  1NHY A;  2DSA A;  1F3B A;  5H5Q A;  3F4R A;  4PXO A;  5IMZ A;  2K6V A;  2X8H A;  1BF5 A;  1WIK A;  4KSO A;  3QCP A;  4NMU A;  3WD6 A;  1SEN A;  1K0M A;  2H0I A;  3C73 A;  2MBS A;  1ZYQ B;  1DE1 A;  3LSZ A;  3CSJ A;  6GST A;  2ZUP A;  4OD7 A;  2GT6 A;  1ON4 A;  3KMN A;  5A1N B;  2FA4 A;  1XWC A;  5DAK A;  2IFQ A;  4HJM A;  3NIV A;  4BVX A;  14GS A;  2WJU A;  5ECL B;  3N9J A;  1X9S B;  4NV5 A;  3GRX A;  3H79 A;  4E68 A;  3APS A;  3LXZ A;  3A2V A;  3D6I A;  3BJ5 A;  4EC0 A;  5COH A;  2CX4 A;  4DSR A;  4ECJ A;  2O85 A;  1WPI A;  2VAF A;  3P7X A;  4HZ4 A;  1ZL9 A;  4FYU A;  2A4H A;  3MAK A;  1R5A A;  1JHB A;  3LYP A;  4RI7 A;  3LEF A;  5ELG A;  2M80 A;  4AJ6 A;  4K0G A;  4F9Z A;  2ALB A;  2M72 A;  5AIX A;  1EP8 A;  4O7H A;  1J0F A;  5KEJ A;  2UV8 G;  4PQI A;  4EIP A;  1LU4 A;  2OBI A;  2KOK A;  5IPH A;  1SL2 B;  4L0W A;  5CRD A;  5ECO B;  3QAW A;  4F0C A;  3RHC A;  5CRH A;  2H1A A;  4QL7 A;  2FWH A;  3KIJ A;  4FYB A;  1UC7 A;  3BCI A;  3O6T A;  2DJ1 A;  3GKK A;  5J40 A;  2WB9 A;  3GTU B;  2P5R A;  2MMN A;  4V1A g;  1VRS D;  4ULX A;  4ZL7 A;  2L4Q A;  3CWG A;  2YWO A;  1WRY A;  2DJ0 A;  3TRP A;  5E59 A;  1O85 A;  5IM9 A;  4IEL A;  1GWC A;  2D2Z A;  2H1G A;  3FHK A;  5G1K A;  3VLN A;  4ZL9 A;  1YVL A;  5A4U A;  3D21 A;  3FZ9 A;  1A23 A;  1NHO A;  3TJK A;  3MSZ A;  4OWY A;  4TXO A;  3EMP A;  2VOC A;  2X49 A;  4IQ1 A;  2IJY A;  3GKX A;  2PN8 A;  4MJB A;  5DBQ A;  1EV4 A;  4HJ2 A;  2XC2 A;  2NBS A;  4XHM A;  4QQ7 A;  4ISD A;  1XW5 A;  1SYR A;  3ZFB A;  2XPD A;  4F0B A;  1A8L A;  5IOW A;  4TKY A;  3W6G A;  5B6N A;  2KHP A;  4ZB8 A;  2HSN A;  9GSS A;  3GUS A;  1TU7 A;  1F9M A;  2LQO A;  5H5S A;  1GTU A;  4HS1 A;  4ZBA A;  4EIQ A;  4AJ8 A;  1SKW B;  3HA9 A;  4F2I A;  1VGL A;  4YH2 A;  1XW9 A;  2L57 A;  2LJA A;  5IMA A;  1V98 A;  4ECB A;  6GSW A;  1F6M C;  2HLS A;  1SJZ A;  5G30 A;  3DEX A;  2JL4 A;  5DAL B;  1T4Y A;  2R6K A;  4GF0 A;  1X0R A;  2IMI A;  2DIY A;  4Z2R A;  4KAE A;  1XW6 A;  5CRE A;  1SK0 A;  4A5P A;  4G01 A;  2LNS A;  3EC3 A;  2OE0 A;  4RUV A;  5HR3 A;  2K9F A;  5AN1 A;  1SL0 B;  1BAY A;  4Q5F A;  2EFC A;  2R5G A;  2PUK C;  3P8W A;  5D9V A;  1GTA A;  2B1L A;  2AJQ B;  4WF5 A;  3GX0 A;  5GST A;  5DQY A;  1GNW A;  5IMF A;  3PR8 A;  3TKP A;  1V2A A;  3P90 A;  1M9A A;  1KNG A;  4KDU A;  1BYE A;  2R3X A;  2H74 A;  4MH2 A;  1BX9 A;  1YJ6 A;  1M99 A;  10GS A;  2HRN A;  3RAZ A;  1MEK A;  1T1V A;  2B7J A;  4OFT A;  1GP1 A;  2LST A;  1YEP A;  5J5N A;  4F03 A;  1T3B A;  1OE8 A;  3RPN A;  3QPM A;  1XCC A;  3FY7 A;  5HFI A;  5F06 A;  1ZZY A;  3PIN A;  2OJL A;  3UAR A;  4TRX A;  2DBC A;  3DWV A;  4OCF A;  4PUF C;  4WR5 A;  3HXS A;  3G7I A;  4H86 A;  2R4V A;  4FYC A;  2AV4 A;  4POK A;  5CRW A;  2OE3 A;  2V32 A;  1NW2 A;  2V1M A;  4CY8 A;  2C0E A;  2IMD A;  5C04 A;  5HFK A;  4JBB A;  3WT2 A;  1U87 A;  4FQU A;  1EEJ A;  1PKZ A;  5JWO B;  4MDC A;  3GST A;  2YP6 A;  3FZ4 A;  1OYJ A;  3C71 A;  4CW9 A;  2CX3 A;  4ACS A;  1SKR B;  4G0I A;  4K2D A;  1MTC A;  1GH2 A;  3EU3 A;  5DJL A;  1K3Y A;  3HVV A;  1FG4 A;  3BOA A;  2GZY A;  3L9S A;  2RII A;  3TDG A;  12GS A;  3EIN A;  4EE0 A;  4AKG A;  2K8S A;  1OC9 B;  4NXI A;  1IYI A;  3VI7 A;  1R7H A;  5INY A;  4BL7 B;  3KCM A;  4K7I A;  4MAB A;  2GSQ A;  1K0N A;  5EL8 A;  4HU7 A;  3Q18 A;  2EC4 A;  3ISO A;  3R3E A;  1GRX A;  3IK9 A;  2LRN A;  2CVB A;  3IK7 A;  3TB2 A;  4TN8 A;  1TP9 A;  3UAP A;  5KN0 A;  3M1G A;  3TCO A;  3CXG A;  5FT3 A;  4X0X A;  3WGE A;  1QQ2 A;  3KXO A;  3DGQ A;  3NZN A;  5HR2 A;  4I6X A;  2AHE A;  2A4V A;  2OE1 A;  5J4Y A;  4J56 E;  1USB A;  4MLY A;  3US3 A;  2G0F A;  4GWR A;  3F3R A;  4JZQ A;  1PL2 A;  5KOX A;  1GUL A;  2AUV A;  5IPG A;  1EOG A;  2HRF A;  3CSH A;  2VCX A;  3HCZ A;  4XS4 B;  2PMT A;  4MMM A;  4Z2T A;  2B5X A;  1EGO A;  3A5W A;  4RI6 A;  1GSF A;  5J4V A;  3FW2 A;  1K3O A;  2PU9 C;  4YKF A;  1MD4 A;  1HQO A;  5G2Z A;  3ZIT A;  2FD3 A;  1Y25 A;  4LL4 B;  3F8U A;  1TDI A;  3QD9 A;  4BVY A;  2PVQ A;  2HZF A;  1JLV A;  2MMO A;  2B6M A;  1VF1 A;  3IXR A;  2PWJ A;  4Q5N A;  4QMK A;  1O8W A;  5CYY A;  3CTF A;  1SYX A;  3LQ7 A;  3LYK A;  3F9U A;  1ERU A;  1SJI A;  4IN0 A;  3ZMK A;  1WE0 A;  2R2J A;  2ES7 A;  1V9W A;  2YV9 A;  2HYX A;  2N5A A;  1PQN A;  4PUR A;  4TR4 A;  4OO4 A;  1T8E B;  3Q74 A;  4ZIL A;  3ZLP A;  2TRC P;  5DAK B;  2IFQ B;  1TOF A;  1Q98 A;  1TW9 A;  5IIZ A;  3LWA A;  1UA5 A;  4BVX B;  2LRT A;  2TRX A;  1ILO A;  4KUN A;  2FWG A;  2VO4 A;  1TI1 A;  3LW9 A;  1I9D A;  3DYR A;  2FUG 2;  2GGT A;  5CNW A;  1G6Y A;  2CAI A;  2EIQ A;  3E9J B;  2VCQ A;  1Z6M A;  2X8C A;  3A2X A;  3TKS C;  2H19 A;  4KGI A;  1M2D A;  1B48 A;  2A2R A;  2C1Y A;  4K2X A;  2GSS A;  3A5I A;  3LGC A;  3A3T A;  2NDO A;  1AQV A;  4K9Z A;  4KW6 A;  2O87 A;  2I1U A;  3TU3 B;  2GTU A;  1Z3E A;  3KMO A;  1SVO A;  2HT9 A;  1GL8 A;  2YWM A;  1A2L A;  2R0G A;  5A4W A;  3FEU A;  5GZZ B;  2RLI A;  2H8L A;  2GQL A;  5BRT A;  2DJ3 A;  3GN3 A;  4IS0 A;  4MCU A;  3D4T A;  5D8I A;  3D4M A;  1F2E A;  1X5C A;  1M7T A;  2QA2 A;  2LTK A;  4MNN A;  4WBJ A;  4HQS A;  5G31 A;  4DEJ A;  1DSB A;  3L4N A;  1OKT A;  1R4W A;  4XRA A;  5IMC A;  2PVO C;  4ZB9 A;  2HFD A;  3F4T A;  1Z7R A;  5ID2 A;  5BMU A;  3UEM A;  3ZZX A;  4JU5 A;  1YDK A;  4XRD A;  4CHS A;  3EMX A;  4TW5 A;  1U3A A;  5A34 A;  3HD5 A;  2JSY A;  1K0B A;  4N0V A;  5G5E A;  1IYH A;  5DQS A;  2OT3 A;  2GQM A;  5G5F A;  2TIR A;  2MBT A;  2R37 A;  3ED3 A;  5C00 A;  2YJ7 A;  1EGR A;  3C7M A;  4FO5 A;  2E0Q A;  1VF4 A;  4GQC A;  3IC8 A;  4IVF A;  1K0C A;  3VFI A;  4KCE A;  1ERT A;  4MP4 A;  4ZXG A;  4TXO B;  2AAW A;  1B9X C;  1X9W B;  4L0U A;  1Z5Y E;  1XIY A;  1TXX A;  1YF1 A;  1XOA A;  4MZC A;  2REM A;  1BQ7 A;  1SVL A;  3TJJ A;  1YKC A;  3BBY A;  1XBS A;  2X8G A;  3M8N A;  1GUM A;  4PX1 A;  1KBN A;  3ME7 A;  1TKD B;  1EP7 A;  5JCG A;  2H73 A;  3ZIV A;  3VK9 A;  1B4P A;  3F3Q A;  3ZTL A;  3J7Y k;  2HSN B;  1NM3 A;  2GS3 A;  1XWG A;  5ECP B;  4IKH A;  1TRV A;  4PQH A;  1T7P B;  5F07 A;  5H5R A;  3QMX A;  1EWX A;  2LRC A;  4ZB7 A;  1XVQ A;  1ZYP A;  3CTG A;  1N8J A;  5JWQ B;  3ZML A;  2VCZ A;  4ZBD A;  4G19 A;  2E2G A;  3APQ A;  4KF9 A;  3MWH A;  2ZNM A;  2RUE A;  2LJK A;  2N5B A;  3I9V 2;  2DKI A;  1HYU A;  2LUS A;  3A2W A;  3N5O A;  3SBC A;  2HSM A;  3GKM A;  3ERF A;  2FA8 A;  2O8V B;  4TR0 A;  4J2F A;  1M0U A;  3FK8 A;  4IP6 A;  4OFM A;  3W8S A;  2DC5 A;  1PRX A;  4POB A;  3FR9 A;  4DSQ A;  1O6J A;  3EPT A;  4I2T A;  4K6X A;  2IMK A;  4USS A;  2FCH A;  1G0T A;  3D5J A;  4WR4 A;  5EY6 A;  3GH6 A;  4ZBB A;  2WS2 A;  2JSZ A;  2LNT A;  1U6T A;  3GIX A;  3D22 A;  5J41 A;  3BCK A;  2IN3 A;  3OR5 A;  1FAA A;  4GTU A;  1PX6 A;  4GST A;  5AGY A;  1THX A;  4YQV A;  2C0D A;  2DJK A;  2DJJ A;  2HZE B;  1TI3 A;  1B9Y C;  1SU9 A;  1H75 A;  5IMD A;  3RDW A;  5JCU A;  1GUH A;  4HEA 2;  2NPB A;  1K0A A;  2BJX A;  4F82 A;  2OAD A;  5A5K A;  2LQQ A;  2QSI A;  4K7O A;  2C3T A;  1GSE A;  1X9M B;  1MDK A;  4HOJ A;  3GUR A;  3ZYW A;  2JU5 A;  1A8Y A;  4IBP A;  5CAX A;  3TGZ A;  2IMF A;  3Q19 A;  1J08 A;  1SJ6 A;  3CYN A;  3IDV A;  4GXZ A;  1Y1U A;  2K18 A;  4TR1 A;  3DVX A;  1ABA A;  1KEB A;  4XIH A;  2V41 A;  3QAG A;  2L59 A;  3WYW A;  1XOB A;  3UVT A;  1AQW A;  3GSS A;  1YEX A;  3P2A A;  2EFH A;  1O7U A;  2FGX A;  3DIE A;  5G1L A;  2VD0 A;  4GDF A;  3ZRD A;  4QL9 A;  3VWU A;  3F0I A;  1U88 A;  8GSS A;  2PGT A;  5HFG A;  2H71 A;  1Z6N A;  4MF6 A;  3GKN A;  5AIS A;  1TK5 B;  3MNG A;  4GQF A;  4AI6 A;  1U3I A;  2BTO T;  5A5H A;  4WXT A;  3GA4 A;  3RBT A;  2GZZ A;  17GS A;  2OAC A;  1PMT A;  1HNC A;  1GSD A;  2V6K A;  4N30 A;  4V2M A;  1JLW A;  1V40 A;  2IL3 A;  5ELA A;  1PX7 A;  2KP1 A;  4HU9 A;  2H0G A;  4FH8 A;  2CQ9 A;  2VCV A;  1S3A A;  4IW9 A;  2R0P A;  5D96 A;  1FVJ A;  1FB6 A;  1ERV A;  3UL3 A;  1R26 A;  2UZ8 A;  5LCZ A;  3VWV A;  2HZE A;  1K3L A;  5IO0 A;  1QFN A;  2M46 A;  4N0Z A;  3IR4 A;  2XHF A;  4K5S A;  2GVP A;  2P31 A;  3L78 A;  2H1D A;  4Q5R A;  1TK8 B;  2L5O A;  4MH3 A;  3FZA A;  2GZP A;  2RM5 A;  3GL3 A;  1UVZ A;  2RM6 A;  2C4J A;  3VWW A;  3IRA A;  2L4C A;  6GSY A;  1AUC A;  4YQU A;  4G10 A;  1X5E A;  1VF2 A;  3KH7 A;  3HY2 A;  1AQX A;  1XVW A;  4BVY B;  2C80 A;  4ECI A;  4MPG A;  1WP0 A;  2KUC A;  2O5V A;  5D9W A;  5JCW A;  4E8E A;  6GSV A;  1ACV A;  5F0G A;  4KA0 A;  5GAP D;  3U6V A;  3FR6 A;  2I3Y A;  3TRQ A;  3F6F A;  2VLT A;  2F8A A;  4PNG A;  1O73 A;  5GAN D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...