5DALB

Crystal structure of human glutathione transferase pi complexed with a metalloid in the presence of glutathione
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
209
structure length
209
Chain Sequence
PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase P
publication title Visualisation of Organoarsenic Human Glutathione Transferase P1-1 Complexes: Metabolism of Arsenic-based Therapeutics
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 79
structure length 209
sequence length 209
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2015-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02798 GST_N Glutathione S-transferase, N-terminal domain
B PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5dalB02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5dalB01
1MDJA 1SD8A 5GAPD 1A8LA 3EU4A 5ENUA 5DQSA 4F82A 1GTBA 5HR0A 2P31A 1GSUA 1O7UA 2PGTA 3KCMA 5A4VA 1CQGA 2L5OA 3DMLA 4GTUA 1AIUA 3GIXA 4EDZA 1OKDA 2K8SA 2H76A 4MF6A 4ZL7A 3TCOA 2B1KA 2H1BA 4BPYA 5GZZB 3IC8A 3LORA 1RW1A 4NXIA 1FO5A 4YH2A 2IMDA 2B5EA 4LL4B 4N11A 5ECHB 2A2RA 2CAQA 20GSA 2J23A 5CRHA 5AIXA 4POKA 4K7NA 1OC8A 1F37A 3E0UA 2XC2A 4YQVA 3KP9A 3WGDA 2JZRA 4K0GA 4K8MA 4FYUA 2OACA 4PTSA 6GSWA 3ED3A 3F6FA 5DJLA 2RIIA 4ZB9A 4XS1A 2AAWA 4HOJA 5DAKA 4RQXA 4V2LA 4JU5A 4V2MA 2RM5A 1M9AA 2JADA 4Q5NA 2GT5A 4WF4A 2XPDA 1OVNA 1WWJA 3LSZA 4MF7A 5KN2A 4F9ZA 2IFQB 4K7OA 3CSIA 4WR4A 1GSQA 3GURA 1E6BA 3IA1A 4H86A 4O5RA 4FYCA 2HRFA 3GKMA 1F3BA 1YDKA 1GNEA 1X0RA 1XXUA 2DIYA 5KN0A 1EEMA 2DJ3A 2ALBA 2VM1A 5D73A 3HKRA 2HNLA 1ZMAA 3US3A 4HJMA 2GGTA 4HQSA 3IBHA 4MJAA 2FUG2 5G31A 5KN3A 2A4VA 4ISDA 2FNOA 1IYHA 2CAIA 2AHEA 1A2JA 1U3AA 1NSWA 2H73A 5GSSA 3ZREA 1S3CA 2JU5A 2H01A 1U87A 3KEBA 1U88A 2CVKA 2VL2A 5AN1A 3FK8A 1SL2B 2VAFA 17GSA 4MJCA 3KTBA 1R4WA 3TRXA 5J41A 4IHUA 5D9XA 1WP0A 1OC9B 3IAM2 2C0GA 2DSAA 1N2AA 1VF3A 3IR4A 1F9MA 1XVQA 1X5DA 1XCCA 1OKTA 4Q5FA 4AF2A 4F0CA 2O8VB 4ZBBA 2LKUA 3QDNA 1HNCA 1GUMA 3FW2A 2L4CA 4WR5A 1RQMA 2XPEA 2QKEA 1I9DA 4XS6A 1JZRA 3FR9A 2B3SA 2AV4A 1F2EA 2EIRA 2DJ0A 3P8WA 4O32A 2C3QA 5D8IA 3RHCA 3HA9A 2PWJA 5B6NA 2LJRA 2GSSA 5ECSA 1VRSD 3GKXA 4MJEA 2FWGA 1VGLA 4PQIA 4ULXA 1Z7PA 4PX1A 2TRXA 13GSA 3TRQA 1FAAA 1EP8A 1M2AA 2VL2C 22GSA 1YKCA 1GUKA 4FQUA 1TOFA 2OE1A 1OAZA 4TXVA 2C80A 2N5BA 3TKQA 1KBNA 2VL9A 3Q6OA 4FIWA 5J4UA 1XWGA 3EC3A 3KD0A 4HJ2A 2KP2A 2WGRA 4F0BA 3VWWA 1ERVA 3HVVA 2IWTA 2P5RA 5FWGA 5CRGA 2VM2A 2LJKA 5DALA 4L5LA 2R4VA 2WJUA 4NPBA 1SK2A 4RI7A 4DSSA 5AIVA 2WZ9A 3O3TA 2C1YA 2YP6A 3ZYWA 1V58A 1ON4A 2QC7A 5ECLB 2H66A 3G9BA 1XWBA 1WMJA 4O7HA 4PQHA 2HRAA 2ON7A 1PGTA 1DSBA 1CQHA 1EZKA 1JZDA 4Q5RA 2JSZA 2L57A 3LYPA 3CSHA 3A3TA 2HSMA 2X99A 3EMXA 1GSYA 2H8LA 4GSNA 5DVBA 4YAVA 1W89A 4G0LA 1PKZA 3HYPA 3TGZA 4CW9A 2PVQA 2EIQA 1SKRB 3J7Yk 18GSA 3GL5A 3FZAA 5F0GA 1ZZYA 2MMAA 2LS5A 2YWOA 4YAPA 2PPTA 1A23A 5H5RA 3ZZXA 2IMFA 1W4VA 1PX7A 3M0FA 4EF0A 1GP1A 1EV9A 3FY7A 1G0TA 1UC7A 3R3EA 3IE3A 4MCUA 2NBSA 2F9SA 3KXOA 2YV9A 1QGVA 3D4MA 4EL1A 5ECPB 2YCDA 2F8AA 5HQPA 2PERA 2VD0A 2FLSA 4ZL8A 3ZLPA 1AAZA 4N0ZA 3O6TA 2M46A 2HE3A 1GRXA 3UBKA 4TKYA 1SJZA 4OCFA 2VL3A 3CXGA 3RPNA 1NM3A 1I5GA 3M9JA 2AYTA 2WDUA 1ERWA 1MD3A 2IIYA 3DVXA 1XW9A 5AGYA 3D5JA 4USSA 3ME7A 4HQZA 4G9HA 5DALB 2D2ZA 4RI6A 1R7HA 2FD3A 2H0HA 4GXZA 1AUCA 1EWXA 4DSSB 3PINA 4AJ7A 4D73A 1O8XA 1FOVA 1GWCA 5CRWA 2DBCA 5G1LA 2NDOA 2REMA 2LNTA 2LV3A 1XW5A 3WT2A 1V9WA 4G10A 5A4WA 5COHA 3TUEA 3L0HA 3IC4A 3RDWA 3RPPA 3VLNA 2E7PA 3VK9A 5C04A 4DEJA 6GSVA 2C4JA 2GQKA 1GSEA 4KNDA 5LNKe 4LMVA 3IDVA 1H75A 3H93A 3L9VA 5J3RA 4E8EA 5ECQB 1BAYA 3FHKA 1SYXA 2L4QA 1Z6MA 4L8EA 4O92A 1THXA 2HLSA 2LRTA 2C3TA 1Z5YE 1K3YA 1ZGNA 1YEPA 5ECIB 1ZL9A 1F3AA 1XVWA 1GTAA 2DC5A 1RK4A 2A2SA 1WJKA 1XWCA 2H0GA 1WOUA 1O85A 3F4TA 3DD3A 4HUAA 1FB0A 3KIJA 3ZTLA 2HYXA 3IK7A 3F63A 3QOUA 4PXOA 3GKKA 2GVPA 2CVBA 4XHMA 5ECOB 5IO2A 4PNGA 3TJKA 4XIHA 2HSNB 1YEXA 3UARA 2DIZA 2TIRA 3C8EA 3VPQA 3KTLA 1GTIA 4KE3A 1C72A 4EC0A 1QMVA 4TR3A 1YY7A 4HI7A 3VWUA 1GSSA 3VWVA 2MMNA 2HRKB 4K1FA 5EVOA 1X5EA 4G0IA 4LLRA 3IHQA 1X9WB 2H72A 4D73B 2DMMA 7GSSA 2HXKA 5G5FA 3ERWA 4OFMA 4XRAA 1WIKA 3GKNA 8GSSA 2H19A 4TR4A 3I6AA 1BYEA 2FWEA 2MZCA 3C1SA 3GSSA 4BA7A 3G7IA 3MDKA 3SWLA 3IOSA 4DSRA 4QQ7A 1TRVA 4WBJA 1K0AA 5ECKB 1ZCPA 3IV4A 4ZB6A 2P5QA 1QXHA 1MDIA 4FO5A 4ILFA 1IYIA 2NTOA 1DBYA 4K2DA 4IKHA 1B9XC 2BJXA 3CTFA 2ON5A 4POMA 3GX0A 2V2GA 2AUVA 5C00A 5KEJA 3KM6A 2H74A 2YPMA 5IMVA 3QR6A 1E2YA 4XS4A 4I97A 4PUAA 5IIZA 2KP1A 1X9SB 1OE7A 1G6WA 5IQYA 4IP1A 4GQCA 2DJKA 3HVSA 4MF5A 3A2WA 1PL2A 3UBLA 1OC3A 1HNBA 10GSA 3P7XA 1ABAA 4ECBA 3CTGA 2CV4A 2HSHA 2VCWA 5JCGA 4ECJA 5L71A 4OO5A 5CP1A 2H6ZA 1X5CA 1YQ1A 5EL8A 3LEFA 5AISA 5LCZA 2AJQB 3GUSA 6GSTA 3F3QA 2FY6A 1AC1A 1TP9A 3UEMA 3L9UA 4K0NA 2K18A 4G19A 1NW2A 2JSYA 1A0RP 5IM9A 4OFNA 3UVTA 3BCKA 3ZVJA 2MBSA 4YQMA 2C0FA 3FZ5A 5E59A 16GSA 1EOHA 2H6XA 3ZVJD 3HD5A 4MZCA 2I81A 1Y6EA 1AQWA 2V32A 3CRTA 3LYKA 2PVOC 1AQVA 2E0QA 4MP4A 2DJ2A 2HFDA 4F03A 1R5AA 1TXXA 4OD7A 1BX9A 2E2GA 2N5FA 3MNGA 1SD9A 3WT1A 4ZBDA 6GSXA 1F6MC 4NHZA 4NV5A 3FRCA 2LSTA 2VLTA 3UMAA 4IJ3A 2N5AA 1O6JA 2IMEA 4J56E 3ZIJA 1FW1A 5CYYA 1QUWA 2V6OA 1U3IA 3HVXA 1A2MA 2K8VA 4HZ4A 4OMVA 1PMTA 4XS4B 1VF4A 3BD2A 4K7IA 4IGJA 2KLXA 3N5OA 1FG4A 1PN9A 5DAKB 4MABA 5G2ZA 1B4QA 4MZBA 5IPGA 1GLQA 2YJHA 4E8HA 4ML6A 3ZRDA 2V41A 1EV4A 5FHIA 5ECMB 1HYUA 4LMWA 1OYJA 4WXTA 2IJYA 4MH2A 3SBCA 2M72A 3FR6A 2OADA 3GHAA 4NV2A 1EGOA 3MWHA 1ST9A 4I8BA 4V1Ag 5INYA 2F8FA 4PQ1A 2OJLA 2MMOA 1T1VA 3GRXA 1PQNA 4MLYA 4MK3A 1TI3A 3TKSE 3U6VA 1V2AA 1LJRA 4I2TA 5IMCA 1R5PA 3APQA 4CDOA 2GZYA 2LEGA 3TJJA 3W8SA 5G1KA 2G2QA 4OCEA 1M7TA 3RAZA 3U5RE 3LJRA 1SJIA 3L78A 2PN8A 1AQXA 3C71A 2ES7A 1MTCA 4HDEA 3ZITA 2LQOA 4IELA 2L6DA 4IVFA 5HR2A 1VF2A 1M0UA 3APSA 3CYNA 4KUNA 1GLPA 4KW6A 5ID2A 1V57A 1XPVA 4ZXGA 2F3MA 2WULA 1TU8A 3VPTA 2GDRA 1GSFA 5JWQB 2OKAA 2WB9A 4ZILA 5DCHA 1QQ2A 2OBKA 1TJDA 2J9HA 2C0DA 3PPUA 3HY2A 2YOIA 1OE8A 2YWIA 2YWNA 2M80A 3KH9A 2F51A 4ZIJA 3DKSA 2GSQA 2PU9C 3LXTA 1PX6A 4IP6A 3M3MA 3L4NA 2FA4A 3M9KA 1YF0A 5D9WA 5IPHA 3H8QA 2HZEA 2B1LA 2E2MA 5F8BA 3N9JA 4I6XA 3L9SA 1O81A 3P90A 1S3DA 2X64A 3TKPA 5DQYA 1EEJA 5ELAA 1EGRA 1J9BA 3HDCA 4OWYA 2O89A 2MYGA 1GTUA 1K0OA 1NHYA 5HR1A 3QPMA 3E3EA 2QSIA 3HJMA 3UOMA 4TXOA 1N8JA 4LA1A 3MSZA 5HFGA 3O76A 1YJ6A 3ERGA 5DJMA 1JLWA 2X8GA 3KZQA 3IRAA 4IN0A 4ECIA 2L5LA 1M2DA 4DVCA 1AXDA 2YV7A 3ZFBA 1SL0B 3DEXA 4J2FA 3QAVA 4ZBAA 6GSSA 4IW9A 1FB6A 1M2BA 3BJ5A 1TK8B 1USBA 3QAGA 4KF9A 3LQ7A 4MA9A 2PUKC 5ID2B 3QMXA 4Z7XA 1BJXA 3UIWA 4IJIA 2JL4A 2GT6A 3J7Yb 4HU7A 6GSYA 3TJGA 5ELGA 1MDKA 3KJYA 3TKRA 2HSMB 3IPZA 3DRNA 2LJAA 1ZOFA 4IQ1A 1WPIA 3GYKA 2YZHA 3FZ9A 1Z6NA 3HJPA 2K6VA 3CSJA 1Z3EA 1JHBA 4EVMA 3D21A 3UVHA 2H30A 3D4TA 4P3YB 3TKSC 2HZEB 2R37A 2LUSA 1SK0A 1PKWA 3HZ4A 4I5QA 2WS2A 4GSTA 4ID0A 2YWMA 4WETA 4IQAA 4GRFA 5CRDA 5J9BA 1AW9A 5J9CA 2RUFA 2FWFA 2GQMA 2VIMA 1XW6A 3EWLA 2OA7A 1ZYQB 1LU4A 5E4WA 2XHFA 1TI1A 3ZMLA 2VD1A 1YZXA 3VI5A 5JWOB 2GSRA 1SK1A 3C73A 2JZTA 1GSDA 4YQUA 6GSUA 3Q19A 2CX4A 2LRNA 1BEDA 4AJ6A 4BL7A 3APOA 5G30A 4PURA 4AGSA 2Z9SA 2GZPA 1BG5A 4KX4A 1V98A 3QFAC 1G6YA 1GULA 4KSMA 2P0GA 4POLA 3QD9A 4EE0A 4N30A 3KP8A 3GFKA 4ECCA 3IK9A 2B6MA 3GX8A 1JLVA 1NHOA 4WEYA 1YKAA 1J0FA 1URMA 3CMIA 2RLIA 3DWVA 3EURA 2VLUA 4HEA2 5IMZA 1XWKA 2HRNA 4WF5A 2G0FA 5GAND 11GSA 1HD2A 2R2JA 4NMUA 1K0DA 4WKWA 2OE3A 3EYTA 2H0IA 5IOXA 1Z9HA 4KAEA 1ACVA 1K3OA 1SJ6A 1TRWA 4KA0A 2XBQA 3D0ZA 3TRPA 1MEKA 2C3NA 2X8HA 1WRYA 4TR1A 3TJBA 2VO4A 2OE0A 1V40A 3M1GA 3A5WA 2MBTA 3FZ4A 4KCEA 3WYWA 4X43A 2K9FA 2ZCTA 4PNFA 2H1AA 2O7KA 3CBUA 2H70A 2UZ8A 3GN3A 2VCTA 1OC9A 2V6KA 2R5GA 4JRRA 3EU3A 4DSQA 1ILOA 2H6YA 4V1Ap 3UAPA 2CA8A 5FT3A 4G2EA 4RUVA 4EDYA 3ZIVA 3WGEA 3TJFA 2XBIA 4BL7B 1HNAA 1PSQA 2HSYA 2PBJA 3QFBC 4TN8A 2CZ2A 3GL3A 4K9ZA 3C7MA 5H5QA 3RHBA 2GSTA 3P2AA 2DMLA 1T8EB 3F8UA 2B7JA 2BTOT 1MD4A 1ERTA 3ERFA 4CHSA 4OO4A 14GSA 5CO3A 2B5XA 2LTKA 4TRXA 4ZB8A 3LWAA 4XCSA 3W6GA 2FA8A 4K6XA 2VCXA 2CT6A 4MMMA 2KUCA 5CAXA 3M8NA 3ME8A 1UVZA 1GNWA 4KB3A 3ZMKA 4BVXA 3FEUA 3PR8A 2O87A 3UL3A 4BWSA 1M99A 4EUYA 2V1MA 5A5KA 4NHWA 4NAXA 3G7JA 1EP7A 4KGIA 2WCIA 3QCPA 4TR1B 2OBIA 3S9FA 4ACSA 1XZOA 4OFTA 3IAS2 2WFCA 1H4OA 3EINA 4N0VA 3ZL5A 4BVYA 1ERUA 5D93A 4XRDA 2IMKA 1Z7RA 2GQLA 2HQTA 1A0FA 4PUFC 3TOTA 1TTZA 1SKSB 5B8AA 1JFUA 1TRUA 2NPBA 5JCUA 1K0BA 3BCIA 1UA5A 2BMXA 3VWXA 2VUPA 4PGTA 2JACA 3HXSA 1QFNA 2FHEA 4TOPA 3F9UA 5HR3A 4KDYA 1SENA 4Q5QA 3R2QA 1T4YA 3KH7A 1XWAA 5HFIA 2H75A 3I43A 5A4UA 2ZNMA 3F4RA 1T3BA 2LQQA 5F06A 5ABRA 1A24A 1GH2A 5DDLA 2MMZA 3BOAA 3C1RA 2RUEA 4F2IA 2VOCA 2VLVA 1S3AA 5EPFA 3KMNA 3DYRA 1HQOA 3GA4A 2I3YA 2HI7A 4EO3A 2L6CA 1KEBA 1TRSA 2HZFA 2AB6A 3NIVA 4KH7A 4L0UA 3QAWA 1UN2A 5JCWA 2CQ9A 1K3LA 3GMFA 2IL3A 3GTUA 4HZ2A 2YANA 1B8XA 5D96A 1K0NA 2LNSA 5IOWA 1O73A 2ZUPA 1DE2A 4BVXB 1FVKA 2FGXA 3K8NA 3JCML 1XOBA 2LRCA 4MPGA 1PD21 3TDGA 4V2NA 2QGVA 2R6KA 1XOAA 1JZOA 1J08A 3D6IA 3HZ8A 3ZFLA 2EC4A 4I2UA 1M9BA 3F6DA 4GWRA 1ZYEA 1TK0B 2GS3A 1ML6A 4BVYB 1O8WA 5DCGA 4L0WA 1B4PA 3OR5A 2TRCP 4X1UA 4GLTA 2KOKA 5B6MA 3DXBA 3KGKA 1EOGA 3EMPA 5BMUA 5EY6A 4GF0A 3Q18A 2GLRA 1SKWB 1B48A 3LFLA 4EKZA 2I9HA 4GCIA 3GH9A 1VF1A 4KDXA 1PA3A 2DJJA 4AJ8A 4GQFA 5B8BA 2NVLA 4GSSA 3WGXA 1KTEA 9GSSA 1TKDB 3I9V2 1SU9A 3F3RA 3TB2A 5G5EA 5JWRB 1Q4JA 1Y25A 1Q98A 1XBSA 1XFLA 3GH6A 3IXRA 4MH3A 2IN3A 3AY8A 3Q74A 5ECRB 4MJBA 5IO0A 1U6TA 3D22A 4IS0A 3H4KA 3VI7A 2B5YA 1XIYA 5ECNB 1SYRA 1TDIA 3W8JA 2H1GA 1GUHA 4QL7A 3TKSA 4LL1B 2VCZA 3BBYA 5CREA 3EVIA 3CRUA 1PRXA 3H79A 2VCVA 3FYGA 3GTUB 4FYBA 3DVWA 1FVJA 2JZSA 4JE1A 1G7OA 2YNXA 3GNJA 1KNGA 5HFKA 4G0KA 2CZ3A 3F0IA 5D9TA 5B7CA 3WD6A 1YF1A 2FCHA 1T4ZA 3HHVA 1GL8A 1K0MA 3A2VA 4L5OA 5J5NA 3HCZA 1A2LA 3KMOA 4KSOA 4POBA 4ML1A 4TR0A 2C8UA 1THOA 1QK8A 5DBQA 2X8CA 4EXJA 4JR4A 1X9MB 5IMFA 3VURA 5H5SA 4ZL9A 4IBPA 3FKFA 1JZWA 3ISOA 2RM6A 3NOFA 2WRTA 1R26A 3UJ1A 2HRKA 3PH9A 4XTSA 4MZWA 2I4AA 3I69A 2L59A 1T7PB 4HS1A 5D9VA 3VFIA 4TW5A 4MDCA 2C0EA 5KN1A 3HJOA 5IMAA 3LXZA 1G7EA 1PL1A 4J57E 1FHEA 4RQRA 3E9JB 1TK5B 2CX3A 4WBRD 4JR6A 3F4SA 3NZNA 3TOUA 4TVEA 1A8YA 1DUGA 3H1NA 5F07A 5LD0A 4NWYA 1TW9A 2HT9A 4BWQA 3A2XA 4HU9A 4QL9A 4N10A 1DE1A 12GSA 4KCAA 1LBKA 2I1UA 4JEDA 3MAKA 5F05A 2PMTA 1BQ7A 2H71A 1WE0A 1B9YC 2VCQA 2H1DA 4TXOB 1T00A 3GSTA 2O85A 3GV1A 2YZUA 2IMIA 2YN1A 1K0CA 1SL1B 2KHPA 4KDUA 4JBBA 3V1WA 4MPFA 3PGTA 3DIEA 3EE2A 3RBTA 5IMDA 4FH8A 5CNWA 2IPAA 2CVDA 2DJ1A 3G7YA 2GZZA 2DLXA 2R3XA 3DGQA 5GSTA 4X0XA 2B7KA 2EIOA 2GTUA 3LGCA 3LG6A 4JZQA 2IFQA 2YJ7A 1TU7A 2FWHA 3FR3A 19GSA
chains in the Genus database with same CATH superfamily
5KOWA 1MDJA 1SD8A 5GAPD 1A8LA 3EU4A 5ENUA 5DQSA 4F82A 1GTBA 5HR0A 5J47A 2P31A 1GSUA 1O7UA 2PGTA 3KCMA 5A4VA 4AKHA 1CQGA 2L5OA 3DMLA 4GTUA 1AIUA 3GIXA 4EDZA 1OKDA 2K8SA 2H76A 4MF6A 4ZL7A 3TCOA 2DKIA 2B1KA 2H1BA 4BPYA 5GZZB 3IC8A 3LORA 1RW1A 4NXIA 1FO5A 4YH2A 2IMDA 2B5EA 4LL4B 4N11A 5ECHB 2A2RA 2CAQA 20GSA 2J23A 5CRHA 5AIXA 4POKA 4K7NA 1OC8A 4EIQA 1F37A 3E0UA 2XC2A 4YQVA 3KP9A 3WGDA 2JZRA 4K0GA 4K8MA 4FYUA 1SVOA 2QA2A 2OACA 4PTSA 6GSWA 3CQFA 3ED3A 3F6FA 5DJLA 2RIIA 4ZB9A 4XS1A 2AAWA 4HOJA 5DAKA 4RQXA 4V2LA 4JU5A 4V2MA 2RM5A 1M9AA 2JADA 4Q5NA 2GT5A 4WF4A 2XPDA 1OVNA 1WWJA 3LSZA 4MF7A 5KN2A 4F9ZA 2IFQB 4K7OA 5A1NA 3CSIA 4WR4A 1GSQA 3GURA 1E6BA 3IA1A 4H86A 4O5RA 4FYCA 2HRFA 3GKMA 1F3BA 1YDKA 1GNEA 1X0RA 1XXUA 2DIYA 5KN0A 1EEMA 2DJ3A 4CY6A 2ALBA 2VM1A 5D73A 3HKRA 2HNLA 1ZMAA 3US3A 4HJMA 2GGTA 4HQSA 3IBHA 4MJAA 2WW0A 2FUG2 5G31A 5KN3A 2A4VA 4ISDA 2FNOA 1IYHA 2CAIA 2AHEA 1A2JA 1U3AA 1NSWA 2H73A 5GSSA 3ZREA 1S3CA 2JU5A 2H01A 1U87A 3KEBA 1U88A 2CVKA 2VL2A 5AN1A 3FK8A 1SL2B 2VAFA 17GSA 4MJCA 3KTBA 1R4WA 4O5QA 3TRXA 5J41A 3A5IA 5D9XA 1WP0A 4IHUA 1OC9B 3IAM2 2C0GA 2DSAA 1N2AA 1VF3A 3IR4A 1F9MA 1XVQA 1X5DA 1XCCA 1OKTA 1TXUA 4Q5FA 4AF2A 4F0CA 2O8VB 4ZBBA 2LKUA 3QDNA 1HNCA 1GUMA 3FW2A 2L4CA 2QA1A 4WR5A 1RQMA 2XPEA 2QKEA 1I9DA 4XS6A 1JZRA 3FR9A 2B3SA 2AV4A 1F2EA 2EIRA 2DJ0A 3P8WA 5A5HA 4O32A 2C3QA 5D8IA 3RHCA 3HA9A 2PWJA 5B6NA 2LJRA 2GSSA 5ECSA 1VRSD 1Y1UA 3GKXA 4MJEA 2FWGA 1VGLA 4PQIA 4ULXA 1Z7PA 4PX1A 2WW3A 2TRXA 13GSA 3TRQA 1FAAA 1EP8A 1M2AA 2VL2C 22GSA 1YKCA 1GUKA 4FQUA 1TOFA 2OE1A 1OAZA 4TXVA 2C80A 2N5BA 3TKQA 1KBNA 2VL9A 3Q6OA 4FIWA 3KD0A 5J4UA 1XWGA 3EC3A 4HJ2A 2R0GA 2KP2A 2WGRA 4F0BA 3VWWA 1ERVA 3HVVA 2IWTA 2P5RA 5FWGA 5CRGA 2VM2A 2LJKA 5DALA 4L5LA 2R4VA 2WJUA 4NPBA 1YVLA 1SK2A 4RI7A 4DSSA 5AIVA 2WZ9A 3O3TA 2C1YA 2YP6A 3ZYWA 1V58A 1ON4A 2QC7A 5ECLB 2H66A 3G9BA 1XWBA 1WMJA 4O7HA 4BIKA 4PQHA 2HRAA 1SVMA 2ON7A 1PGTA 1DSBA 1CQHA 1EZKA 1JZDA 4Q5RA 2JSZA 2L57A 3LYPA 3CSHA 3A3TA 2HSMA 2X99A 3CHXC 3EMXA 1GSYA 2H8LA 4GSNA 5DVBA 4YKFA 4YAVA 1W89A 4G0LA 1PKZA 3HYPA 3TGZA 4CW9A 2PVQA 2EIQA 1SKRB 3J7Yk 18GSA 3GL5A 3FZAA 5F0GA 1ZZYA 2MMAA 2LS5A 2YWOA 4YAPA 2PPTA 1A23A 5H5RA 3ZZXA 2IMFA 1W4VA 1PX7A 3M0FA 4EF0A 1GP1A 1EV9A 3FY7A 1G0TA 1UC7A 3R3EA 4PI0C 3IE3A 4MCUA 2NBSA 2F9SA 3KXOA 2YV9A 1QGVA 3D4MA 4EL1A 5ECPB 2YCDA 2F8AA 5HQPA 2PERA 2VD0A 2FLSA 4ZL8A 3ZLPA 1AAZA 4N0ZA 3O6TA 2M46A 2HE3A 1GRXA 3UBKA 4TKYA 1SJZA 4OCFA 2VL3A 3CXGA 3RPNA 1NM3A 1I5GA 3M9JA 2AYTA 2WDUA 1ERWA 1MD3A 2IIYA 3DVXA 1XW9A 5AGYA 3D5JA 4USSA 3ME7A 4HQZA 4G9HA 5DALB 2D2ZA 4RI6A 1R7HA 2WW1A 2FD3A 2H0HA 4GXZA 1AUCA 1EWXA 4DSSB 3PINA 4AJ7A 4K5SA 4D73A 1O8XA 1FOVA 1GWCA 5CRWA 2DBCA 5G1LA 2NDOA 2REMA 2LNTA 2LV3A 1XW5A 3WT2A 1V9WA 4G10A 5A4WA 5COHA 4K5RA 3TUEA 4Z2TA 3L0HA 3IC4A 3RDWA 5J4VA 3RPPA 3VLNA 4GDFA 2E7PA 3VK9A 5C04A 4DEJA 6GSVA 2C4JA 2GQKA 1GSEA 4KNDA 5LNKe 4LMVA 3IDVA 1H75A 3H93A 3L9VA 5J3RA 4E8EA 5ECQB 1BAYA 3FHKA 1SYXA 2OT3A 2L4QA 1Z6MA 4L8EA 4O92A 1THXA 2HLSA 2LRTA 2C3TA 1Z5YE 1K3YA 1ZGNA 1YEPA 5ECIB 1ZL9A 1F3AA 1XVWA 1GTAA 2DC5A 1RK4A 2A2SA 1WJKA 1XWCA 2H0GA 1WOUA 1O85A 3F4TA 3DD3A 4HUAA 1FB0A 3KIJA 3ZTLA 5J40A 2HYXA 3IK7A 3F63A 3QOUA 4PXOA 3GKKA 2GVPA 2CVBA 4XHMA 2UV8G 5ECOB 5IO2A 4PNGA 3TJKA 4XIHA 2WVXA 2HSNB 1YEXA 3UARA 2DIZA 2TIRA 3C8EA 3VPQA 3KTLA 1GTIA 4KE3A 1C72A 4EC0A 1QMVA 4TR3A 1YY7A 4HI7A 3VWUA 1GSSA 3VWVA 2MMNA 2HRKB 2X4AA 4K1FA 5EVOA 1X5EA 4G0IA 4LLRA 3IHQA 1X9WB 2H72A 4D73B 2DMMA 7GSSA 2HXKA 5G5FA 3ERWA 4OFMA 4XRAA 1WIKA 3GKNA 8GSSA 2H19A 4TR4A 3I6AA 1BYEA 2O3EA 2FWEA 2MZCA 3C1SA 3GSSA 4BA7A 4AI6A 3G7IA 3MDKA 3SWLA 3IOSA 4DSRA 4QQ7A 1TRVA 4WBJA 1K0AA 5ECKB 1ZCPA 3IV4A 4ZB6A 2P5QA 1QXHA 1MDIA 4FO5A 4ILFA 1IYIA 2NTOA 1DBYA 4K2DA 1YEWC 4IKHA 1B9XC 2BJXA 3CTFA 2ON5A 4POMA 3GX0A 2V2GA 2AUVA 5C00A 5KEJA 3KM6A 2H74A 2YPMA 5IMVA 3QR6A 1E2YA 4XS4A 4I97A 4PUAA 5IIZA 2KP1A 1X9SB 1OE7A 1G6WA 5IQYA 4IP1A 4GQCA 2DJKA 3HVSA 4MF5A 3A2WA 1PL2A 3UBLA 1OC3A 1HNBA 10GSA 3P7XA 1ABAA 4ECBA 3CTGA 2CV4A 1ZYNA 2HSHA 2VCWA 2WVXB 5JCGA 4ECJA 5L71A 4OO5A 5CP1A 2H6ZA 1X5CA 1YQ1A 5EL8A 3LEFA 5AISA 5LCZA 2AJQB 3GUSA 6GSTA 3F3QA 2FY6A 1AC1A 1TP9A 3UEMA 1N25A 3MIXA 3L9UA 4K0NA 2K18A 4G19A 1NW2A 2JSYA 1A0RP 4MNNA 5IM9A 4OFNA 3UVTA 3BCKA 3ZVJA 2MBSA 4W66A 4YQMA 2C0FA 4ZB7A 3FZ5A 5E59A 16GSA 1EOHA 2H6XA 3FMWA 3ZVJD 3HD5A 4MZCA 4N3ZA 2I81A 1Y6EA 1AQWA 2V32A 3CRTA 3LYKA 2PVOC 1AQVA 2E0QA 4MP4A 2DJ2A 2HFDA 4F03A 1R5AA 1TXXA 4OD7A 1BX9A 2E2GA 2N5FA 3MNGA 1SD9A 3WT1A 4ZBDA 6GSXA 1F6MC 4NHZA 4NV5A 3FRCA 2LSTA 2VLTA 3UMAA 1S3RA 4IJ3A 2N5AA 2O5VA 1O6JA 2IMEA 4J56E 3ZIJA 1FW1A 3LW9A 5CYYA 1QUWA 2V6OA 1U3IA 3HVXA 1A2MA 2K8VA 4HZ4A 4OMVA 1PMTA 4XS4B 1VF4A 3BD2A 4K7IA 4IGJA 2KLXA 3N5OA 1M3IA 1FG4A 1PN9A 5DAKB 4MABA 5G2ZA 1B4QA 4MZBA 5IPGA 1GLQA 2YJHA 4E8HA 4ML6A 3ZRDA 2V41A 1EV4A 5FHIA 5ECMB 1HYUA 4LMWA 1OYJA 4WXTA 2IJYA 4MH2A 3SBCA 2M72A 3FR6A 2OADA 3GHAA 4NV2A 1EGOA 5A1NB 5J4YA 3MWHA 1ST9A 4I8BA 4V1Ag 5INYA 2F8FA 4PQ1A 2OJLA 2MMOA 1T1VA 4HSCX 3GRXA 1PQNA 4MLYA 4MK3A 1TI3A 3TKSE 3U6VA 1V2AA 1LJRA 4I2TA 5IMCA 5BRTA 1R5PA 3APQA 4CDOA 2GZYA 2LEGA 3TJJA 3W8SA 5G1KA 2G2QA 4OCEA 1M7TA 3RAZA 3U5RE 3LJRA 1SJIA 3L78A 2PN8A 1AQXA 3C71A 2ES7A 4QMKA 1MTCA 4HDEA 3ZITA 2LQOA 4IELA 5KOXA 2L6DA 4IVFA 5HR2A 1VF2A 1M0UA 3APSA 3CYNA 4KUNA 1GLPA 4KW6A 5ID2A 1V57A 1XPVA 4ZXGA 2F3MA 4YKGA 2R0CA 2WULA 1TU8A 3VPTA 2GDRA 1GSFA 5JWQB 2OKAA 3HVNA 2WB9A 4ZILA 5DCHA 1QQ2A 2X49A 2OBKA 1TJDA 2J9HA 4E68A 2C0DA 3PPUA 3HY2A 2YOIA 1OE8A 2YWIA 2YWNA 2M80A 3KH9A 2F51A 4ZIJA 3DKSA 2GSQA 2PU9C 3LXTA 1PX6A 4IP6A 3M3MA 2FA4A 3L4NA 3M9KA 1YF0A 5D9WA 5IPHA 3H8QA 2HZEA 2B1LA 2E2MA 5F8BA 3N9JA 4I6XA 3L9SA 1O81A 3P90A 1S3DA 2X64A 3TKPA 5DQYA 4Z2UA 1EEJA 5ELAA 1EGRA 1J9BA 5A5HB 3HDCA 4OWYA 2O89A 2MYGA 1GTUA 1K0OA 1NHYA 5HR1A 3QPMA 3E3EA 2QSIA 3HJMA 3UOMA 4TXOA 1N8JA 4LA1A 3MSZA 5HFGA 3O76A 1YJ6A 3ERGA 5DJMA 1JLWA 2X8GA 3KZQA 3IRAA 4IN0A 4ECIA 2L5LA 1M2DA 4DVCA 1AXDA 2YV7A 3ZFBA 1SL0B 3HMJG 3DEXA 4J2FA 3QAVA 4ZBAA 6GSSA 4IW9A 1FB6A 4G01A 1M2BA 3BJ5A 1TK8B 1USBA 3QAGA 4KF9A 3LQ7A 4MA9A 2PUKC 5ID2B 3QMXA 4Z7XA 1BJXA 3UIWA 4IJIA 2JL4A 2GT6A 3J7Yb 4AKIA 4HU7A 6GSYA 4PI2C 3TJGA 2EFEA 5ELGA 1MDKA 3KJYA 3TKRA 2HSMB 3IPZA 3DRNA 2LJAA 2R0PA 1ZOFA 4IQ1A 1WPIA 3GYKA 2YZHA 3FZ9A 1Z6NA 2WVYA 3HJPA 2K6VA 3CSJA 1Z3EA 1JHBA 4EVMA 3D21A 3UVHA 2H30A 3D4TA 4P3YB 3TKSC 2HZEB 2R37A 2LUSA 1SK0A 1PKWA 3HZ4A 4I5QA 2WS2A 4GSTA 4ID0A 2YWMA 4WETA 4IQAA 4GRFA 5CRDA 5J9BA 1AW9A 5J9CA 2RUFA 2FWFA 2GQMA 2VIMA 1XW6A 3EWLA 2OA7A 1ZYQB 1LU4A 5E4WA 2XHFA 1TI1A 3ZMLA 2VD1A 1YZXA 3VI5A 5JWOB 2GSRA 1SK1A 3C73A 2JZTA 1GSDA 4YQUA 6GSUA 3Q19A 2CX4A 2LRNA 1BEDA 4AJ6A 4BL7A 3APOA 5G30A 4PURA 4AGSA 2A2PA 2Z9SA 4AKGA 2GZPA 1BG5A 4KX4A 1V98A 3QFAC 1G6YA 1GULA 4KSMA 2P0GA 4POLA 3QD9A 4EE0A 4N30A 3KP8A 3GFKA 4ECCA 3IK9A 2B6MA 3GX8A 1JLVA 1NHOA 4WEYA 1YKAA 1J0FA 1URMA 3CMIA 2RLIA 3DWVA 2H1LA 3EURA 2VLUA 4HEA2 5IMZA 1XWKA 2HRNA 4WF5A 2G0FA 5GAND 11GSA 1HD2A 2R2JA 3IHGA 4NMUA 1K0DA 4WKWA 2OE3A 3EYTA 2H0IA 5IOXA 1Z9HA 4KAEA 1ACVA 1I1IP 1K3OA 1SJ6A 1TRWA 4KA0A 2XBQA 3D0ZA 3TRPA 1MEKA 2C3NA 2X8HA 1WRYA 4TR1A 3TJBA 2VO4A 2OE0A 1V40A 3M1GA 1BG1A 3A5WA 5A34A 2MBTA 3FZ4A 4KCEA 3WYWA 4X43A 2K9FA 2ZCTA 3MYDA 4PNFA 2H1AA 2O7KA 3CBUA 2H70A 2UZ8A 3GN3A 2VCTA 1OC9A 2V6KA 2R5GA 4JRRA 3EU3A 4DSQA 1ILOA 2H6YA 4V1Ap 3UAPA 2CA8A 5FT3A 4G2EA 4RUVA 4EDYA 3ZIVA 1PFOA 3WGEA 3TJFA 2XBIA 2EFHA 4BL7B 1HNAA 1PSQA 2HSYA 2PBJA 3QFBC 4TN8A 2CZ2A 3GL3A 4K9ZA 2WZSA 3C7MA 5H5QA 3RHBA 2GSTA 3P2AA 2DMLA 1T8EB 3F8UA 2B7JA 2BTOT 1MD4A 1ERTA 3ERFA 4CHSA 4OO4A 14GSA 5CO3A 2B5XA 2LTKA 4TRXA 4ZB8A 3LWAA 4CY8A 4XCSA 3W6GA 2FA8A 4K6XA 2VCXA 2CT6A 4MMMA 2KUCA 5CAXA 3M8NA 3RFRC 3ME8A 1UVZA 1GNWA 4KB3A 3ZMKA 4BVXA 3FEUA 3PR8A 2O87A 3UL3A 4BWSA 1M99A 4EUYA 2V1MA 5A5KA 1BF5A 1PN0A 4NHWA 4NAXA 3G7JA 3EPTA 1EP7A 4KGIA 2VKZG 2WCIA 3QCPA 4TR1B 2OBIA 1FOHA 3S9FA 4ACSA 5A34B 1XZOA 4OFTA 3IAS2 2WFCA 1H4OA 3EINA 4N0VA 3ZL5A 4BVYA 1ERUA 5D93A 4XRDA 2WVZA 2IMKA 1Z7RA 2GQLA 2HQTA 1A0FA 4PUFC 3TOTA 1TTZA 1ZYPA 1SKSB 5B8AA 2DKHA 1JFUA 1TRUA 2NPBA 5JCUA 1K0BA 3BCIA 1UA5A 2BMXA 3VWXA 2VUPA 4PGTA 2JACA 3HXSA 1QFNA 2FHEA 4TOPA 3F9UA 5HR3A 4KDYA 1SENA 4Q5QA 3R2QA 1T4YA 4O5UA 3KH7A 2A4HA 1XWAA 5HFIA 2H75A 3I43A 5A4UA 1S4BP 2ZNMA 3F4RA 1T3BA 2LQQA 5F06A 5ABRA 1A24A 1GH2A 5DDLA 2MMZA 3BOAA 3C1RA 2RUEA 4F2IA 2VOCA 2VLVA 1S3AA 5EPFA 3KMNA 3DYRA 1HQOA 3GA4A 2I3YA 2HI7A 4EO3A 2L6CA 1KEBA 1TRSA 2HZFA 2AB6A 3NIVA 4KH7A 4L0UA 3QAWA 1UN2A 3RGBC 4X4JA 5JCWA 2CQ9A 1K3LA 3GMFA 2IL3A 3GTUA 4HZ2A 2YANA 1B8XA 5D96A 1K0NA 2EFDA 2LNSA 5IOWA 1O73A 2ZUPA 1DE2A 4BVXB 1FVKA 2FGXA 3K8NA 3JCML 1XOBA 2LRCA 4MPGA 1PD21 1M3JA 3TDGA 4V2NA 2QGVA 2R6KA 1XOAA 1JZOA 1J08A 3D6IA 3HZ8A 3ZFLA 2EC4A 4I2UA 1M9BA 4FXYP 3F6DA 4GWRA 1ZYEA 1TK0B 2GS3A 1ML6A 4BVYB 1O8WA 5DCGA 4L0WA 1B4PA 3OR5A 2TRCP 4X1UA 4GLTA 2KOKA 5B6MA 3DXBA 3KGKA 1EOGA 3EMPA 5BMUA 5EY6A 4GF0A 3Q18A 2GLRA 1SKWB 1B48A 3LFLA 4EKZA 2I9HA 4GCIA 4A5PA 3GH9A 1VF1A 4KDXA 1PA3A 2DJJA 4AJ8A 4GQFA 5B8BA 2NVLA 4GSSA 3WGXA 1KTEA 9GSSA 1TKDB 3I9V2 1SU9A 3F3RA 3TB2A 5G5EA 5JWRB 1Q4JA 1Y25A 1Q98A 1XBSA 1XFLA 3GH6A 3IXRA 4MH3A 2IN3A 3AY8A 3Q74A 5ECRB 4MJBA 5IO0A 1U6TA 3D22A 4IS0A 3H4KA 3VI7A 2B5YA 1XIYA 5ECNB 1SYRA 1TDIA 3W8JA 2H1GA 1GUHA 4QL7A 3TKSA 4LL1B 2VCZA 3BBYA 5CREA 3EVIA 3CRUA 1PRXA 3H79A 2O36A 2VCVA 3FYGA 3GTUB 4FYBA 3DVWA 1FVJA 2JZSA 4JE1A 1G7OA 2YNXA 3GNJA 1KNGA 5HFKA 4G0KA 2CZ3A 3F0IA 5D9TA 5B7CA 3WD6A 1YF1A 2FCHA 1T4ZA 3HHVA 1GL8A 2WW2A 1K0MA 3A2VA 4L5OA 5J5NA 3HCZA 1A2LA 3KMOA 4KSOA 2HSNA 4POBA 4ML1A 4TR0A 2C8UA 1THOA 1QK8A 5DBQA 2X8CA 4EXJA 4JR4A 1X9MB 5IMFA 3VURA 5H5SA 4ZL9A 4IBPA 3FKFA 1JZWA 3ISOA 2RM6A 3NOFA 2WRTA 1R26A 3UJ1A 2HRKA 3PH9A 4XTSA 4MZWA 2I4AA 3I69A 2L59A 1T7PB 4HS1A 5D9VA 3VFIA 5BMUB 4TW5A 4MDCA 2C0EA 5KN1A 3HJOA 5IMAA 4EIPA 3LXZA 1G7EA 1PL1A 4J57E 4AKXB 1FHEA 4RQRA 3E9JB 1TK5B 2CX3A 4WBRD 4JR6A 3F4SA 3NZNA 3TOUA 4TVEA 1A8YA 1DUGA 3H1NA 5F07A 5LD0A 4NWYA 1TW9A 2HT9A 4BWQA 3A2XA 4HU9A 4QL9A 4N10A 1DE1A 12GSA 4KCAA 1LBKA 2I1UA 4JEDA 3MAKA 5F05A 2PMTA 4ICYA 1BQ7A 4K2XA 2H71A 1WE0A 1B9YC 2VCQA 2H1DA 4TXOB 1T00A 3GSTA 2O85A 4PHZC 3GV1A 2YZUA 2IMIA 2YN1A 1K0CA 1SL1B 2KHPA 4Z2RA 4KDUA 4JBBA 1SVLA 3CWGA 3V1WA 4MPFA 3PGTA 3DIEA 3EE2A 2EFCA 3RBTA 5IMDA 4FH8A 5CNWA 2IPAA 2CVDA 2DJ1A 3G7YA 2GZZA 2DLXA 2R3XA 3DGQA 5GSTA 4X0XA 2B7KA 2EIOA 2GTUA 3TU3B 3LGCA 3LG6A 4JZQA 2IFQA 2YJ7A 1TU7A 1XG8A 2FWHA 3FR3A 19GSA
chains in the Genus database with same CATH topology
5KOWA 1MDJA 1SD8A 5GAPD 1A8LA 3EU4A 5ENUA 5DQSA 4F82A 1GTBA 5HR0A 5J47A 2P31A 1GSUA 1O7UA 2PGTA 3KCMA 5A4VA 4AKHA 1CQGA 2L5OA 3DMLA 4GTUA 1AIUA 3GIXA 4EDZA 1OKDA 2K8SA 2H76A 4MF6A 4ZL7A 3TCOA 2DKIA 2B1KA 2H1BA 4BPYA 5GZZB 3IC8A 3LORA 1RW1A 4NXIA 1FO5A 4YH2A 2IMDA 2B5EA 4LL4B 4N11A 5ECHB 2A2RA 2CAQA 20GSA 2J23A 5CRHA 5AIXA 4POKA 4K7NA 1OC8A 4EIQA 1F37A 3E0UA 2XC2A 4YQVA 3KP9A 3WGDA 2JZRA 4K0GA 4K8MA 4FYUA 1SVOA 2QA2A 2OACA 4PTSA 6GSWA 3ED3A 3F6FA 5DJLA 2RIIA 4ZB9A 4XS1A 2AAWA 4HOJA 5DAKA 4RQXA 4V2LA 4JU5A 4V2MA 2RM5A 1M9AA 2JADA 4Q5NA 2GT5A 4WF4A 2XPDA 1OVNA 1WWJA 3LSZA 4MF7A 5KN2A 4F9ZA 2IFQB 4K7OA 5A1NA 3CSIA 4WR4A 1GSQA 3GURA 1E6BA 3IA1A 4H86A 4O5RA 4FYCA 2HRFA 3GKMA 1F3BA 1YDKA 1GNEA 1X0RA 1XXUA 2DIYA 5KN0A 1EEMA 2DJ3A 4CY6A 2ALBA 2VM1A 5D73A 3HKRA 2HNLA 1ZMAA 3US3A 4HJMA 2GGTA 4HQSA 3IBHA 4MJAA 2FUG2 5G31A 5KN3A 2A4VA 4ISDA 2FNOA 1IYHA 2CAIA 2AHEA 1A2JA 1U3AA 1NSWA 2H73A 5GSSA 3ZREA 1S3CA 2JU5A 2H01A 1U87A 3KEBA 1U88A 2CVKA 2VL2A 5AN1A 3FK8A 1SL2B 2VAFA 17GSA 4MJCA 3KTBA 1R4WA 4O5QA 3TRXA 5J41A 3A5IA 5D9XA 1WP0A 4IHUA 1OC9B 3IAM2 2C0GA 2DSAA 1N2AA 1VF3A 3IR4A 1F9MA 1XVQA 1X5DA 1XCCA 1OKTA 1TXUA 4Q5FA 4AF2A 4F0CA 2O8VB 4ZBBA 2LKUA 3QDNA 1HNCA 1GUMA 3FW2A 2L4CA 2QA1A 4WR5A 1RQMA 2XPEA 2QKEA 1I9DA 4XS6A 1JZRA 3FR9A 2B3SA 2AV4A 1F2EA 2EIRA 2DJ0A 3P8WA 5A5HA 4O32A 2C3QA 5D8IA 3RHCA 3HA9A 2PWJA 5B6NA 2LJRA 2GSSA 5ECSA 1VRSD 1Y1UA 3GKXA 4MJEA 2FWGA 1VGLA 4PQIA 4ULXA 1Z7PA 4PX1A 2TRXA 13GSA 3TRQA 1FAAA 1EP8A 1M2AA 2VL2C 22GSA 1YKCA 1GUKA 4FQUA 1TOFA 2OE1A 1OAZA 4TXVA 2C80A 2N5BA 3TKQA 1KBNA 2VL9A 3Q6OA 4FIWA 3KD0A 5J4UA 1XWGA 3EC3A 4HJ2A 2R0GA 2KP2A 2WGRA 4F0BA 3VWWA 1ERVA 3HVVA 2IWTA 2P5RA 5FWGA 5CRGA 2VM2A 2LJKA 5DALA 4L5LA 2R4VA 2WJUA 4NPBA 1YVLA 1SK2A 4RI7A 4DSSA 5AIVA 2WZ9A 3O3TA 2C1YA 2YP6A 3ZYWA 1V58A 1ON4A 2QC7A 5ECLB 2H66A 3G9BA 1XWBA 1WMJA 4O7HA 4PQHA 2HRAA 1SVMA 2ON7A 1PGTA 1DSBA 1CQHA 1EZKA 1JZDA 4Q5RA 2JSZA 2L57A 3LYPA 3CSHA 3A3TA 2HSMA 2X99A 3EMXA 1GSYA 2H8LA 4GSNA 5DVBA 4YKFA 4YAVA 1W89A 4G0LA 1PKZA 3HYPA 3TGZA 4CW9A 2PVQA 2EIQA 1SKRB 3J7Yk 18GSA 3GL5A 3FZAA 5F0GA 1ZZYA 2MMAA 2LS5A 2YWOA 4YAPA 2PPTA 1A23A 5H5RA 3ZZXA 2IMFA 1W4VA 1PX7A 3M0FA 4EF0A 1GP1A 1EV9A 3FY7A 1G0TA 1UC7A 3R3EA 3IE3A 4MCUA 2NBSA 2F9SA 3KXOA 2YV9A 1QGVA 3D4MA 4EL1A 5ECPB 2YCDA 2F8AA 5HQPA 2PERA 2VD0A 2FLSA 4ZL8A 3ZLPA 1AAZA 4N0ZA 3O6TA 2M46A 2HE3A 1GRXA 3UBKA 4TKYA 1SJZA 4OCFA 2VL3A 3CXGA 3RPNA 1NM3A 1I5GA 3M9JA 2AYTA 2WDUA 1ERWA 1MD3A 2IIYA 3DVXA 1XW9A 5AGYA 3D5JA 4USSA 3ME7A 4HQZA 4G9HA 5DALB 2D2ZA 4RI6A 1R7HA 2FD3A 2H0HA 4GXZA 1AUCA 1EWXA 4DSSB 3PINA 4AJ7A 4K5SA 4D73A 1O8XA 1FOVA 1GWCA 5CRWA 2DBCA 5G1LA 2NDOA 2REMA 2LNTA 2LV3A 1XW5A 3WT2A 1V9WA 4G10A 5A4WA 5COHA 4K5RA 3TUEA 4Z2TA 3L0HA 3IC4A 3RDWA 5J4VA 3RPPA 3VLNA 4GDFA 2E7PA 3VK9A 5C04A 4DEJA 6GSVA 2C4JA 2GQKA 1GSEA 4KNDA 5LNKe 4LMVA 3IDVA 1H75A 3H93A 3L9VA 5J3RA 4E8EA 5ECQB 1BAYA 3FHKA 1SYXA 2OT3A 2L4QA 1Z6MA 4L8EA 4O92A 1THXA 2HLSA 2LRTA 2C3TA 1Z5YE 1K3YA 1ZGNA 1YEPA 5ECIB 1ZL9A 1F3AA 1XVWA 1GTAA 2DC5A 1RK4A 2A2SA 1WJKA 1XWCA 2H0GA 1WOUA 1O85A 3F4TA 3DD3A 4HUAA 1FB0A 3KIJA 3ZTLA 5J40A 2HYXA 3IK7A 3F63A 3QOUA 4PXOA 3GKKA 2GVPA 2CVBA 4XHMA 2UV8G 5ECOB 5IO2A 4PNGA 3TJKA 4XIHA 2HSNB 1YEXA 3UARA 2DIZA 2TIRA 3C8EA 3VPQA 3KTLA 1GTIA 4KE3A 1C72A 4EC0A 1QMVA 4TR3A 1YY7A 4HI7A 3VWUA 1GSSA 3VWVA 2MMNA 2HRKB 2X4AA 4K1FA 5EVOA 1X5EA 4G0IA 4LLRA 3IHQA 1X9WB 2H72A 4D73B 2DMMA 7GSSA 2HXKA 5G5FA 3ERWA 4OFMA 4XRAA 1WIKA 3GKNA 8GSSA 2H19A 4TR4A 3I6AA 1BYEA 2FWEA 2MZCA 3C1SA 3GSSA 4BA7A 4AI6A 3G7IA 3MDKA 3SWLA 3IOSA 4DSRA 4QQ7A 1TRVA 4WBJA 1K0AA 5ECKB 1ZCPA 3IV4A 4ZB6A 2P5QA 1QXHA 1MDIA 4FO5A 4ILFA 1IYIA 2NTOA 1DBYA 4K2DA 4IKHA 1B9XC 2BJXA 3CTFA 2ON5A 4POMA 3GX0A 2V2GA 2AUVA 5C00A 5KEJA 3KM6A 2H74A 2YPMA 5IMVA 3QR6A 1E2YA 4XS4A 4I97A 4PUAA 5IIZA 2KP1A 1X9SB 1OE7A 1G6WA 5IQYA 4IP1A 4GQCA 2DJKA 3HVSA 4MF5A 3A2WA 1PL2A 3UBLA 1OC3A 1HNBA 10GSA 3P7XA 1ABAA 4ECBA 3CTGA 2CV4A 1ZYNA 2HSHA 2VCWA 5JCGA 4ECJA 5L71A 4OO5A 5CP1A 2H6ZA 1X5CA 1YQ1A 5EL8A 3LEFA 5AISA 5LCZA 2AJQB 3GUSA 6GSTA 3F3QA 2FY6A 1AC1A 1TP9A 3UEMA 1N25A 3MIXA 3L9UA 4K0NA 2K18A 4G19A 1NW2A 2JSYA 1A0RP 4MNNA 5IM9A 4OFNA 3UVTA 3BCKA 3ZVJA 2MBSA 4W66A 4YQMA 2C0FA 4ZB7A 3FZ5A 5E59A 16GSA 1EOHA 2H6XA 3FMWA 3ZVJD 3HD5A 4MZCA 4N3ZA 2I81A 1Y6EA 1AQWA 2V32A 3CRTA 3LYKA 2PVOC 1AQVA 2E0QA 4MP4A 2DJ2A 2HFDA 4F03A 1R5AA 1TXXA 4OD7A 1BX9A 2E2GA 2N5FA 3MNGA 1SD9A 3WT1A 4ZBDA 6GSXA 1F6MC 4NHZA 4NV5A 3FRCA 2LSTA 2VLTA 3UMAA 4IJ3A 2N5AA 2O5VA 1O6JA 2IMEA 4J56E 3ZIJA 1FW1A 3LW9A 5CYYA 1QUWA 2V6OA 1U3IA 3HVXA 1A2MA 2K8VA 4HZ4A 4OMVA 1PMTA 4XS4B 1VF4A 3BD2A 4K7IA 4IGJA 2KLXA 3N5OA 1FG4A 1PN9A 5DAKB 4MABA 5G2ZA 1B4QA 4MZBA 5IPGA 1GLQA 2YJHA 4E8HA 4ML6A 3ZRDA 2V41A 1EV4A 5FHIA 5ECMB 1HYUA 4LMWA 1OYJA 4WXTA 2IJYA 4MH2A 3SBCA 2M72A 3FR6A 2OADA 3GHAA 4NV2A 1EGOA 5A1NB 5J4YA 3MWHA 1ST9A 4I8BA 4V1Ag 5INYA 2F8FA 4PQ1A 2OJLA 2MMOA 1T1VA 3GRXA 1PQNA 4MLYA 4MK3A 1TI3A 3TKSE 3U6VA 1V2AA 1LJRA 4I2TA 5IMCA 5BRTA 1R5PA 3APQA 4CDOA 2GZYA 2LEGA 3TJJA 3W8SA 5G1KA 2G2QA 4OCEA 1M7TA 3RAZA 3U5RE 3LJRA 1SJIA 3L78A 2PN8A 1AQXA 3C71A 2ES7A 4QMKA 1MTCA 4HDEA 3ZITA 2LQOA 4IELA 5KOXA 2L6DA 4IVFA 5HR2A 1VF2A 1M0UA 3APSA 3CYNA 4KUNA 1GLPA 4KW6A 5ID2A 1V57A 1XPVA 4ZXGA 2F3MA 4YKGA 2R0CA 2WULA 1TU8A 3VPTA 2GDRA 1GSFA 5JWQB 2OKAA 2WB9A 4ZILA 5DCHA 1QQ2A 2X49A 2OBKA 1TJDA 2J9HA 4E68A 2C0DA 3PPUA 3HY2A 2YOIA 1OE8A 2YWIA 2YWNA 2M80A 3KH9A 2F51A 4ZIJA 3DKSA 2GSQA 2PU9C 3LXTA 1PX6A 4IP6A 3M3MA 3L4NA 2FA4A 3M9KA 1YF0A 5D9WA 5IPHA 3H8QA 2HZEA 2B1LA 2E2MA 5F8BA 3N9JA 4I6XA 3L9SA 1O81A 3P90A 1S3DA 2X64A 3TKPA 5DQYA 4Z2UA 1EEJA 5ELAA 1EGRA 1J9BA 5A5HB 3HDCA 4OWYA 2O89A 2MYGA 1GTUA 1K0OA 1NHYA 5HR1A 3QPMA 3E3EA 2QSIA 3HJMA 3UOMA 4TXOA 1N8JA 4LA1A 3MSZA 5HFGA 3O76A 1YJ6A 3ERGA 5DJMA 1JLWA 2X8GA 3KZQA 3IRAA 4IN0A 4ECIA 2L5LA 1M2DA 4DVCA 1AXDA 2YV7A 3ZFBA 1SL0B 3HMJG 3DEXA 4J2FA 3QAVA 4ZBAA 6GSSA 4IW9A 1FB6A 4G01A 1M2BA 3BJ5A 1TK8B 1USBA 3QAGA 4KF9A 3LQ7A 4MA9A 2PUKC 5ID2B 3QMXA 4Z7XA 1BJXA 3UIWA 4IJIA 2JL4A 2GT6A 3J7Yb 4AKIA 4HU7A 6GSYA 3TJGA 2EFEA 5ELGA 1MDKA 3KJYA 3TKRA 2HSMB 3IPZA 3DRNA 2LJAA 2R0PA 1ZOFA 4IQ1A 1WPIA 3GYKA 2YZHA 3FZ9A 1Z6NA 3HJPA 2K6VA 3CSJA 1Z3EA 1JHBA 4EVMA 3D21A 3UVHA 2H30A 3D4TA 4P3YB 3TKSC 2HZEB 2R37A 2LUSA 1SK0A 1PKWA 3HZ4A 4I5QA 2WS2A 4GSTA 4ID0A 2YWMA 4WETA 4IQAA 4GRFA 5CRDA 5J9BA 1AW9A 5J9CA 2RUFA 2FWFA 2GQMA 2VIMA 1XW6A 3EWLA 2OA7A 1ZYQB 1LU4A 5E4WA 2XHFA 1TI1A 3ZMLA 2VD1A 1YZXA 3VI5A 5JWOB 2GSRA 1SK1A 3C73A 2JZTA 1GSDA 4YQUA 6GSUA 3Q19A 2CX4A 2LRNA 1BEDA 4AJ6A 4BL7A 3APOA 5G30A 4PURA 4AGSA 2A2PA 2Z9SA 4AKGA 2GZPA 1BG5A 4KX4A 1V98A 3QFAC 1G6YA 1GULA 4KSMA 2P0GA 4POLA 3QD9A 4EE0A 4N30A 3KP8A 3GFKA 4ECCA 3IK9A 2B6MA 3GX8A 1JLVA 1NHOA 4WEYA 1YKAA 1J0FA 1URMA 3CMIA 2RLIA 3DWVA 2H1LA 3EURA 2VLUA 4HEA2 5IMZA 1XWKA 2HRNA 4WF5A 2G0FA 5GAND 11GSA 1HD2A 2R2JA 3IHGA 4NMUA 1K0DA 4WKWA 2OE3A 3EYTA 2H0IA 5IOXA 1Z9HA 4KAEA 1ACVA 1K3OA 1SJ6A 1TRWA 4KA0A 2XBQA 3D0ZA 3TRPA 1MEKA 2C3NA 2X8HA 1WRYA 4TR1A 3TJBA 2VO4A 2OE0A 1V40A 3M1GA 1BG1A 3A5WA 5A34A 2MBTA 3FZ4A 4KCEA 3WYWA 4X43A 2K9FA 2ZCTA 3MYDA 4PNFA 2H1AA 2O7KA 3CBUA 2H70A 2UZ8A 3GN3A 2VCTA 1OC9A 2V6KA 2R5GA 4JRRA 3EU3A 4DSQA 1ILOA 2H6YA 4V1Ap 3UAPA 2CA8A 5FT3A 4G2EA 4RUVA 4EDYA 3ZIVA 3WGEA 3TJFA 2XBIA 2EFHA 4BL7B 1HNAA 1PSQA 2HSYA 2PBJA 3QFBC 4TN8A 2CZ2A 3GL3A 4K9ZA 3C7MA 5H5QA 3RHBA 2GSTA 3P2AA 2DMLA 1T8EB 3F8UA 2B7JA 2BTOT 1MD4A 1ERTA 3ERFA 4CHSA 4OO4A 14GSA 5CO3A 2B5XA 2LTKA 4TRXA 4ZB8A 3LWAA 4CY8A 4XCSA 3W6GA 2FA8A 4K6XA 2VCXA 2CT6A 4MMMA 2KUCA 5CAXA 3M8NA 3ME8A 1UVZA 1GNWA 4KB3A 3ZMKA 4BVXA 3FEUA 3PR8A 2O87A 3UL3A 4BWSA 1M99A 4EUYA 2V1MA 5A5KA 1BF5A 1PN0A 4NHWA 4NAXA 3G7JA 3EPTA 1EP7A 4KGIA 2VKZG 2WCIA 3QCPA 4TR1B 2OBIA 1FOHA 3S9FA 4ACSA 5A34B 1XZOA 4OFTA 3IAS2 2WFCA 1H4OA 3EINA 4N0VA 3ZL5A 4BVYA 1ERUA 5D93A 4XRDA 2IMKA 1Z7RA 2GQLA 2HQTA 1A0FA 4PUFC 3TOTA 1TTZA 1ZYPA 1SKSB 5B8AA 2DKHA 1JFUA 1TRUA 2NPBA 5JCUA 1K0BA 3BCIA 1UA5A 2BMXA 3VWXA 2VUPA 4PGTA 2JACA 3HXSA 1QFNA 2FHEA 4TOPA 3F9UA 5HR3A 4KDYA 1SENA 4Q5QA 3R2QA 1T4YA 4O5UA 3KH7A 2A4HA 1XWAA 5HFIA 2H75A 3I43A 5A4UA 2ZNMA 3F4RA 1T3BA 2LQQA 5F06A 5ABRA 1A24A 1GH2A 5DDLA 2MMZA 3BOAA 3C1RA 2RUEA 4F2IA 2VOCA 2VLVA 1S3AA 5EPFA 3KMNA 3DYRA 1HQOA 3GA4A 2I3YA 2HI7A 4EO3A 2L6CA 1KEBA 1TRSA 2HZFA 2AB6A 3NIVA 4KH7A 4L0UA 3QAWA 1UN2A 4X4JA 5JCWA 2CQ9A 1K3LA 3GMFA 2IL3A 3GTUA 4HZ2A 2YANA 1B8XA 5D96A 1K0NA 2EFDA 2LNSA 5IOWA 1O73A 2ZUPA 1DE2A 4BVXB 1FVKA 2FGXA 3K8NA 3JCML 1XOBA 2LRCA 4MPGA 1PD21 3TDGA 4V2NA 2QGVA 2R6KA 1XOAA 1JZOA 1J08A 3D6IA 3HZ8A 3ZFLA 2EC4A 4I2UA 1M9BA 3F6DA 4GWRA 1ZYEA 1TK0B 2GS3A 1ML6A 4BVYB 1O8WA 5DCGA 4L0WA 1B4PA 3OR5A 2TRCP 4X1UA 4GLTA 2KOKA 5B6MA 3DXBA 3KGKA 1EOGA 3EMPA 5BMUA 5EY6A 4GF0A 3Q18A 2GLRA 1SKWB 1B48A 3LFLA 4EKZA 2I9HA 4GCIA 4A5PA 3GH9A 1VF1A 4KDXA 1PA3A 2DJJA 4AJ8A 4GQFA 5B8BA 2NVLA 4GSSA 3WGXA 1KTEA 9GSSA 1TKDB 3I9V2 1SU9A 3F3RA 3TB2A 5G5EA 5JWRB 1Q4JA 1Y25A 1Q98A 1XBSA 1XFLA 3GH6A 3IXRA 4MH3A 2IN3A 3AY8A 3Q74A 5ECRB 4MJBA 5IO0A 1U6TA 3D22A 4IS0A 3H4KA 3VI7A 2B5YA 1XIYA 5ECNB 1SYRA 1TDIA 3W8JA 2H1GA 1GUHA 4QL7A 3TKSA 4LL1B 2VCZA 3BBYA 5CREA 3EVIA 3CRUA 1PRXA 3H79A 2VCVA 3FYGA 3GTUB 4FYBA 3DVWA 1FVJA 2JZSA 4JE1A 1G7OA 2YNXA 3GNJA 1KNGA 5HFKA 4G0KA 2CZ3A 3F0IA 5D9TA 5B7CA 3WD6A 1YF1A 2FCHA 1T4ZA 3HHVA 1GL8A 1K0MA 3A2VA 4L5OA 5J5NA 3HCZA 1A2LA 3KMOA 4KSOA 2HSNA 4POBA 4ML1A 4TR0A 2C8UA 1THOA 1QK8A 5DBQA 2X8CA 4EXJA 4JR4A 1X9MB 5IMFA 3VURA 5H5SA 4ZL9A 4IBPA 3FKFA 1JZWA 3ISOA 2RM6A 3NOFA 2WRTA 1R26A 3UJ1A 2HRKA 3PH9A 4XTSA 4MZWA 2I4AA 3I69A 2L59A 1T7PB 4HS1A 5D9VA 3VFIA 5BMUB 4TW5A 4MDCA 2C0EA 5KN1A 3HJOA 5IMAA 4EIPA 3LXZA 1G7EA 1PL1A 4J57E 4AKXB 1FHEA 4RQRA 3E9JB 1TK5B 2CX3A 4WBRD 4JR6A 3F4SA 3NZNA 3TOUA 4TVEA 1A8YA 1DUGA 3H1NA 5F07A 5LD0A 4NWYA 1TW9A 2HT9A 4BWQA 3A2XA 4HU9A 4QL9A 4N10A 1DE1A 12GSA 4KCAA 1LBKA 2I1UA 4JEDA 3MAKA 5F05A 2PMTA 4ICYA 1BQ7A 4K2XA 2H71A 1WE0A 1B9YC 2VCQA 2H1DA 4TXOB 1T00A 3GSTA 2O85A 3GV1A 2YZUA 2IMIA 2YN1A 1K0CA 1SL1B 2KHPA 4Z2RA 4KDUA 4JBBA 1SVLA 3CWGA 3V1WA 4MPFA 3PGTA 3DIEA 3EE2A 2EFCA 3RBTA 5IMDA 4FH8A 5CNWA 2IPAA 2CVDA 2DJ1A 3G7YA 2GZZA 2DLXA 2R3XA 3DGQA 5GSTA 4X0XA 2B7KA 2EIOA 2GTUA 3TU3B 3LGCA 3LG6A 4JZQA 2IFQA 2YJ7A 1TU7A 2FWHA 3FR3A 19GSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MDJ A;  1SD8 A;  5GAP D;  1A8L A;  3EU4 A;  5ENU A;  5DQS A;  4F82 A;  1GTB A;  5HR0 A;  2P31 A;  1GSU A;  1O7U A;  2PGT A;  3KCM A;  5A4V A;  1CQG A;  2L5O A;  3DML A;  4GTU A;  1AIU A;  3GIX A;  4EDZ A;  1OKD A;  2K8S A;  2H76 A;  4MF6 A;  4ZL7 A;  3TCO A;  2B1K A;  2H1B A;  4BPY A;  5GZZ B;  3IC8 A;  3LOR A;  1RW1 A;  4NXI A;  1FO5 A;  4YH2 A;  2IMD A;  2B5E A;  4LL4 B;  4N11 A;  5ECH B;  2A2R A;  2CAQ A;  20GS A;  2J23 A;  5CRH A;  5AIX A;  4POK A;  4K7N A;  1OC8 A;  1F37 A;  3E0U A;  2XC2 A;  4YQV A;  3KP9 A;  3WGD A;  2JZR A;  4K0G A;  4K8M A;  4FYU A;  2OAC A;  4PTS A;  6GSW A;  3ED3 A;  3F6F A;  5DJL A;  2RII A;  4ZB9 A;  4XS1 A;  2AAW A;  4HOJ A;  5DAK A;  4RQX A;  4V2L A;  4JU5 A;  4V2M A;  2RM5 A;  1M9A A;  2JAD A;  4Q5N A;  2GT5 A;  4WF4 A;  2XPD A;  1OVN A;  1WWJ A;  3LSZ A;  4MF7 A;  5KN2 A;  4F9Z A;  2IFQ B;  4K7O A;  3CSI A;  4WR4 A;  1GSQ A;  3GUR A;  1E6B A;  3IA1 A;  4H86 A;  4O5R A;  4FYC A;  2HRF A;  3GKM A;  1F3B A;  1YDK A;  1GNE A;  1X0R A;  1XXU A;  2DIY A;  5KN0 A;  1EEM A;  2DJ3 A;  2ALB A;  2VM1 A;  5D73 A;  3HKR A;  2HNL A;  1ZMA A;  3US3 A;  4HJM A;  2GGT A;  4HQS A;  3IBH A;  4MJA A;  2FUG 2;  5G31 A;  5KN3 A;  2A4V A;  4ISD A;  2FNO A;  1IYH A;  2CAI A;  2AHE A;  1A2J A;  1U3A A;  1NSW A;  2H73 A;  5GSS A;  3ZRE A;  1S3C A;  2JU5 A;  2H01 A;  1U87 A;  3KEB A;  1U88 A;  2CVK A;  2VL2 A;  5AN1 A;  3FK8 A;  1SL2 B;  2VAF A;  17GS A;  4MJC A;  3KTB A;  1R4W A;  3TRX A;  5J41 A;  4IHU A;  5D9X A;  1WP0 A;  1OC9 B;  3IAM 2;  2C0G A;  2DSA A;  1N2A A;  1VF3 A;  3IR4 A;  1F9M A;  1XVQ A;  1X5D A;  1XCC A;  1OKT A;  4Q5F A;  4AF2 A;  4F0C A;  2O8V B;  4ZBB A;  2LKU A;  3QDN A;  1HNC A;  1GUM A;  3FW2 A;  2L4C A;  4WR5 A;  1RQM A;  2XPE A;  2QKE A;  1I9D A;  4XS6 A;  1JZR A;  3FR9 A;  2B3S A;  2AV4 A;  1F2E A;  2EIR A;  2DJ0 A;  3P8W A;  4O32 A;  2C3Q A;  5D8I A;  3RHC A;  3HA9 A;  2PWJ A;  5B6N A;  2LJR A;  2GSS A;  5ECS A;  1VRS D;  3GKX A;  4MJE A;  2FWG A;  1VGL A;  4PQI A;  4ULX A;  1Z7P A;  4PX1 A;  2TRX A;  13GS A;  3TRQ A;  1FAA A;  1EP8 A;  1M2A A;  2VL2 C;  22GS A;  1YKC A;  1GUK A;  4FQU A;  1TOF A;  2OE1 A;  1OAZ A;  4TXV A;  2C80 A;  2N5B A;  3TKQ A;  1KBN A;  2VL9 A;  3Q6O A;  4FIW A;  5J4U A;  1XWG A;  3EC3 A;  3KD0 A;  4HJ2 A;  2KP2 A;  2WGR A;  4F0B A;  3VWW A;  1ERV A;  3HVV A;  2IWT A;  2P5R A;  5FWG A;  5CRG A;  2VM2 A;  2LJK A;  5DAL A;  4L5L A;  2R4V A;  2WJU A;  4NPB A;  1SK2 A;  4RI7 A;  4DSS A;  5AIV A;  2WZ9 A;  3O3T A;  2C1Y A;  2YP6 A;  3ZYW A;  1V58 A;  1ON4 A;  2QC7 A;  5ECL B;  2H66 A;  3G9B A;  1XWB A;  1WMJ A;  4O7H A;  4PQH A;  2HRA A;  2ON7 A;  1PGT A;  1DSB A;  1CQH A;  1EZK A;  1JZD A;  4Q5R A;  2JSZ A;  2L57 A;  3LYP A;  3CSH A;  3A3T A;  2HSM A;  2X99 A;  3EMX A;  1GSY A;  2H8L A;  4GSN A;  5DVB A;  4YAV A;  1W89 A;  4G0L A;  1PKZ A;  3HYP A;  3TGZ A;  4CW9 A;  2PVQ A;  2EIQ A;  1SKR B;  3J7Y k;  18GS A;  3GL5 A;  3FZA A;  5F0G A;  1ZZY A;  2MMA A;  2LS5 A;  2YWO A;  4YAP A;  2PPT A;  1A23 A;  5H5R A;  3ZZX A;  2IMF A;  1W4V A;  1PX7 A;  3M0F A;  4EF0 A;  1GP1 A;  1EV9 A;  3FY7 A;  1G0T A;  1UC7 A;  3R3E A;  3IE3 A;  4MCU A;  2NBS A;  2F9S A;  3KXO A;  2YV9 A;  1QGV A;  3D4M A;  4EL1 A;  5ECP B;  2YCD A;  2F8A A;  5HQP A;  2PER A;  2VD0 A;  2FLS A;  4ZL8 A;  3ZLP A;  1AAZ A;  4N0Z A;  3O6T A;  2M46 A;  2HE3 A;  1GRX A;  3UBK A;  4TKY A;  1SJZ A;  4OCF A;  2VL3 A;  3CXG A;  3RPN A;  1NM3 A;  1I5G A;  3M9J A;  2AYT A;  2WDU A;  1ERW A;  1MD3 A;  2IIY A;  3DVX A;  1XW9 A;  5AGY A;  3D5J A;  4USS A;  3ME7 A;  4HQZ A;  4G9H A;  5DAL B;  2D2Z A;  4RI6 A;  1R7H A;  2FD3 A;  2H0H A;  4GXZ A;  1AUC A;  1EWX A;  4DSS B;  3PIN A;  4AJ7 A;  4D73 A;  1O8X A;  1FOV A;  1GWC A;  5CRW A;  2DBC A;  5G1L A;  2NDO A;  2REM A;  2LNT A;  2LV3 A;  1XW5 A;  3WT2 A;  1V9W A;  4G10 A;  5A4W A;  5COH A;  3TUE A;  3L0H A;  3IC4 A;  3RDW A;  3RPP A;  3VLN A;  2E7P A;  3VK9 A;  5C04 A;  4DEJ A;  6GSV A;  2C4J A;  2GQK A;  1GSE A;  4KND A;  5LNK e;  4LMV A;  3IDV A;  1H75 A;  3H93 A;  3L9V A;  5J3R A;  4E8E A;  5ECQ B;  1BAY A;  3FHK A;  1SYX A;  2L4Q A;  1Z6M A;  4L8E A;  4O92 A;  1THX A;  2HLS A;  2LRT A;  2C3T A;  1Z5Y E;  1K3Y A;  1ZGN A;  1YEP A;  5ECI B;  1ZL9 A;  1F3A A;  1XVW A;  1GTA A;  2DC5 A;  1RK4 A;  2A2S A;  1WJK A;  1XWC A;  2H0G A;  1WOU A;  1O85 A;  3F4T A;  3DD3 A;  4HUA A;  1FB0 A;  3KIJ A;  3ZTL A;  2HYX A;  3IK7 A;  3F63 A;  3QOU A;  4PXO A;  3GKK A;  2GVP A;  2CVB A;  4XHM A;  5ECO B;  5IO2 A;  4PNG A;  3TJK A;  4XIH A;  2HSN B;  1YEX A;  3UAR A;  2DIZ A;  2TIR A;  3C8E A;  3VPQ A;  3KTL A;  1GTI A;  4KE3 A;  1C72 A;  4EC0 A;  1QMV A;  4TR3 A;  1YY7 A;  4HI7 A;  3VWU A;  1GSS A;  3VWV A;  2MMN A;  2HRK B;  4K1F A;  5EVO A;  1X5E A;  4G0I A;  4LLR A;  3IHQ A;  1X9W B;  2H72 A;  4D73 B;  2DMM A;  7GSS A;  2HXK A;  5G5F A;  3ERW A;  4OFM A;  4XRA A;  1WIK A;  3GKN A;  8GSS A;  2H19 A;  4TR4 A;  3I6A A;  1BYE A;  2FWE A;  2MZC A;  3C1S A;  3GSS A;  4BA7 A;  3G7I A;  3MDK A;  3SWL A;  3IOS A;  4DSR A;  4QQ7 A;  1TRV A;  4WBJ A;  1K0A A;  5ECK B;  1ZCP A;  3IV4 A;  4ZB6 A;  2P5Q A;  1QXH A;  1MDI A;  4FO5 A;  4ILF A;  1IYI A;  2NTO A;  1DBY A;  4K2D A;  4IKH A;  1B9X C;  2BJX A;  3CTF A;  2ON5 A;  4POM A;  3GX0 A;  2V2G A;  2AUV A;  5C00 A;  5KEJ A;  3KM6 A;  2H74 A;  2YPM A;  5IMV A;  3QR6 A;  1E2Y A;  4XS4 A;  4I97 A;  4PUA A;  5IIZ A;  2KP1 A;  1X9S B;  1OE7 A;  1G6W A;  5IQY A;  4IP1 A;  4GQC A;  2DJK A;  3HVS A;  4MF5 A;  3A2W A;  1PL2 A;  3UBL A;  1OC3 A;  1HNB A;  10GS A;  3P7X A;  1ABA A;  4ECB A;  3CTG A;  2CV4 A;  2HSH A;  2VCW A;  5JCG A;  4ECJ A;  5L71 A;  4OO5 A;  5CP1 A;  2H6Z A;  1X5C A;  1YQ1 A;  5EL8 A;  3LEF A;  5AIS A;  5LCZ A;  2AJQ B;  3GUS A;  6GST A;  3F3Q A;  2FY6 A;  1AC1 A;  1TP9 A;  3UEM A;  3L9U A;  4K0N A;  2K18 A;  4G19 A;  1NW2 A;  2JSY A;  1A0R P;  5IM9 A;  4OFN A;  3UVT A;  3BCK A;  3ZVJ A;  2MBS A;  4YQM A;  2C0F A;  3FZ5 A;  5E59 A;  16GS A;  1EOH A;  2H6X A;  3ZVJ D;  3HD5 A;  4MZC A;  2I81 A;  1Y6E A;  1AQW A;  2V32 A;  3CRT A;  3LYK A;  2PVO C;  1AQV A;  2E0Q A;  4MP4 A;  2DJ2 A;  2HFD A;  4F03 A;  1R5A A;  1TXX A;  4OD7 A;  1BX9 A;  2E2G A;  2N5F A;  3MNG A;  1SD9 A;  3WT1 A;  4ZBD A;  6GSX A;  1F6M C;  4NHZ A;  4NV5 A;  3FRC A;  2LST A;  2VLT A;  3UMA A;  4IJ3 A;  2N5A A;  1O6J A;  2IME A;  4J56 E;  3ZIJ A;  1FW1 A;  5CYY A;  1QUW A;  2V6O A;  1U3I A;  3HVX A;  1A2M A;  2K8V A;  4HZ4 A;  4OMV A;  1PMT A;  4XS4 B;  1VF4 A;  3BD2 A;  4K7I A;  4IGJ A;  2KLX A;  3N5O A;  1FG4 A;  1PN9 A;  5DAK B;  4MAB A;  5G2Z A;  1B4Q A;  4MZB A;  5IPG A;  1GLQ A;  2YJH A;  4E8H A;  4ML6 A;  3ZRD A;  2V41 A;  1EV4 A;  5FHI A;  5ECM B;  1HYU A;  4LMW A;  1OYJ A;  4WXT A;  2IJY A;  4MH2 A;  3SBC A;  2M72 A;  3FR6 A;  2OAD A;  3GHA A;  4NV2 A;  1EGO A;  3MWH A;  1ST9 A;  4I8B A;  4V1A g;  5INY A;  2F8F A;  4PQ1 A;  2OJL A;  2MMO A;  1T1V A;  3GRX A;  1PQN A;  4MLY A;  4MK3 A;  1TI3 A;  3TKS E;  3U6V A;  1V2A A;  1LJR A;  4I2T A;  5IMC A;  1R5P A;  3APQ A;  4CDO A;  2GZY A;  2LEG A;  3TJJ A;  3W8S A;  5G1K A;  2G2Q A;  4OCE A;  1M7T A;  3RAZ A;  3U5R E;  3LJR A;  1SJI A;  3L78 A;  2PN8 A;  1AQX A;  3C71 A;  2ES7 A;  1MTC A;  4HDE A;  3ZIT A;  2LQO A;  4IEL A;  2L6D A;  4IVF A;  5HR2 A;  1VF2 A;  1M0U A;  3APS A;  3CYN A;  4KUN A;  1GLP A;  4KW6 A;  5ID2 A;  1V57 A;  1XPV A;  4ZXG A;  2F3M A;  2WUL A;  1TU8 A;  3VPT A;  2GDR A;  1GSF A;  5JWQ B;  2OKA A;  2WB9 A;  4ZIL A;  5DCH A;  1QQ2 A;  2OBK A;  1TJD A;  2J9H A;  2C0D A;  3PPU A;  3HY2 A;  2YOI A;  1OE8 A;  2YWI A;  2YWN A;  2M80 A;  3KH9 A;  2F51 A;  4ZIJ A;  3DKS A;  2GSQ A;  2PU9 C;  3LXT A;  1PX6 A;  4IP6 A;  3M3M A;  3L4N A;  2FA4 A;  3M9K A;  1YF0 A;  5D9W A;  5IPH A;  3H8Q A;  2HZE A;  2B1L A;  2E2M A;  5F8B A;  3N9J A;  4I6X A;  3L9S A;  1O81 A;  3P90 A;  1S3D A;  2X64 A;  3TKP A;  5DQY A;  1EEJ A;  5ELA A;  1EGR A;  1J9B A;  3HDC A;  4OWY A;  2O89 A;  2MYG A;  1GTU A;  1K0O A;  1NHY A;  5HR1 A;  3QPM A;  3E3E A;  2QSI A;  3HJM A;  3UOM A;  4TXO A;  1N8J A;  4LA1 A;  3MSZ A;  5HFG A;  3O76 A;  1YJ6 A;  3ERG A;  5DJM A;  1JLW A;  2X8G A;  3KZQ A;  3IRA A;  4IN0 A;  4ECI A;  2L5L A;  1M2D A;  4DVC A;  1AXD A;  2YV7 A;  3ZFB A;  1SL0 B;  3DEX A;  4J2F A;  3QAV A;  4ZBA A;  6GSS A;  4IW9 A;  1FB6 A;  1M2B A;  3BJ5 A;  1TK8 B;  1USB A;  3QAG A;  4KF9 A;  3LQ7 A;  4MA9 A;  2PUK C;  5ID2 B;  3QMX A;  4Z7X A;  1BJX A;  3UIW A;  4IJI A;  2JL4 A;  2GT6 A;  3J7Y b;  4HU7 A;  6GSY A;  3TJG A;  5ELG A;  1MDK A;  3KJY A;  3TKR A;  2HSM B;  3IPZ A;  3DRN A;  2LJA A;  1ZOF A;  4IQ1 A;  1WPI A;  3GYK A;  2YZH A;  3FZ9 A;  1Z6N A;  3HJP A;  2K6V A;  3CSJ A;  1Z3E A;  1JHB A;  4EVM A;  3D21 A;  3UVH A;  2H30 A;  3D4T A;  4P3Y B;  3TKS C;  2HZE B;  2R37 A;  2LUS A;  1SK0 A;  1PKW A;  3HZ4 A;  4I5Q A;  2WS2 A;  4GST A;  4ID0 A;  2YWM A;  4WET A;  4IQA A;  4GRF A;  5CRD A;  5J9B A;  1AW9 A;  5J9C A;  2RUF A;  2FWF A;  2GQM A;  2VIM A;  1XW6 A;  3EWL A;  2OA7 A;  1ZYQ B;  1LU4 A;  5E4W A;  2XHF A;  1TI1 A;  3ZML A;  2VD1 A;  1YZX A;  3VI5 A;  5JWO B;  2GSR A;  1SK1 A;  3C73 A;  2JZT A;  1GSD A;  4YQU A;  6GSU A;  3Q19 A;  2CX4 A;  2LRN A;  1BED A;  4AJ6 A;  4BL7 A;  3APO A;  5G30 A;  4PUR A;  4AGS A;  2Z9S A;  2GZP A;  1BG5 A;  4KX4 A;  1V98 A;  3QFA C;  1G6Y A;  1GUL A;  4KSM A;  2P0G A;  4POL A;  3QD9 A;  4EE0 A;  4N30 A;  3KP8 A;  3GFK A;  4ECC A;  3IK9 A;  2B6M A;  3GX8 A;  1JLV A;  1NHO A;  4WEY A;  1YKA A;  1J0F A;  1URM A;  3CMI A;  2RLI A;  3DWV A;  3EUR A;  2VLU A;  4HEA 2;  5IMZ A;  1XWK A;  2HRN A;  4WF5 A;  2G0F A;  5GAN D;  11GS A;  1HD2 A;  2R2J A;  4NMU A;  1K0D A;  4WKW A;  2OE3 A;  3EYT A;  2H0I A;  5IOX A;  1Z9H A;  4KAE A;  1ACV A;  1K3O A;  1SJ6 A;  1TRW A;  4KA0 A;  2XBQ A;  3D0Z A;  3TRP A;  1MEK A;  2C3N A;  2X8H A;  1WRY A;  4TR1 A;  3TJB A;  2VO4 A;  2OE0 A;  1V40 A;  3M1G A;  3A5W A;  2MBT A;  3FZ4 A;  4KCE A;  3WYW A;  4X43 A;  2K9F A;  2ZCT A;  4PNF A;  2H1A A;  2O7K A;  3CBU A;  2H70 A;  2UZ8 A;  3GN3 A;  2VCT A;  1OC9 A;  2V6K A;  2R5G A;  4JRR A;  3EU3 A;  4DSQ A;  1ILO A;  2H6Y A;  4V1A p;  3UAP A;  2CA8 A;  5FT3 A;  4G2E A;  4RUV A;  4EDY A;  3ZIV A;  3WGE A;  3TJF A;  2XBI A;  4BL7 B;  1HNA A;  1PSQ A;  2HSY A;  2PBJ A;  3QFB C;  4TN8 A;  2CZ2 A;  3GL3 A;  4K9Z A;  3C7M A;  5H5Q A;  3RHB A;  2GST A;  3P2A A;  2DML A;  1T8E B;  3F8U A;  2B7J A;  2BTO T;  1MD4 A;  1ERT A;  3ERF A;  4CHS A;  4OO4 A;  14GS A;  5CO3 A;  2B5X A;  2LTK A;  4TRX A;  4ZB8 A;  3LWA A;  4XCS A;  3W6G A;  2FA8 A;  4K6X A;  2VCX A;  2CT6 A;  4MMM A;  2KUC A;  5CAX A;  3M8N A;  3ME8 A;  1UVZ A;  1GNW A;  4KB3 A;  3ZMK A;  4BVX A;  3FEU A;  3PR8 A;  2O87 A;  3UL3 A;  4BWS A;  1M99 A;  4EUY A;  2V1M A;  5A5K A;  4NHW A;  4NAX A;  3G7J A;  1EP7 A;  4KGI A;  2WCI A;  3QCP A;  4TR1 B;  2OBI A;  3S9F A;  4ACS A;  1XZO A;  4OFT A;  3IAS 2;  2WFC A;  1H4O A;  3EIN A;  4N0V A;  3ZL5 A;  4BVY A;  1ERU A;  5D93 A;  4XRD A;  2IMK A;  1Z7R A;  2GQL A;  2HQT A;  1A0F A;  4PUF C;  3TOT A;  1TTZ A;  1SKS B;  5B8A A;  1JFU A;  1TRU A;  2NPB A;  5JCU A;  1K0B A;  3BCI A;  1UA5 A;  2BMX A;  3VWX A;  2VUP A;  4PGT A;  2JAC A;  3HXS A;  1QFN A;  2FHE A;  4TOP A;  3F9U A;  5HR3 A;  4KDY A;  1SEN A;  4Q5Q A;  3R2Q A;  1T4Y A;  3KH7 A;  1XWA A;  5HFI A;  2H75 A;  3I43 A;  5A4U A;  2ZNM A;  3F4R A;  1T3B A;  2LQQ A;  5F06 A;  5ABR A;  1A24 A;  1GH2 A;  5DDL A;  2MMZ A;  3BOA A;  3C1R A;  2RUE A;  4F2I A;  2VOC A;  2VLV A;  1S3A A;  5EPF A;  3KMN A;  3DYR A;  1HQO A;  3GA4 A;  2I3Y A;  2HI7 A;  4EO3 A;  2L6C A;  1KEB A;  1TRS A;  2HZF A;  2AB6 A;  3NIV A;  4KH7 A;  4L0U A;  3QAW A;  1UN2 A;  5JCW A;  2CQ9 A;  1K3L A;  3GMF A;  2IL3 A;  3GTU A;  4HZ2 A;  2YAN A;  1B8X A;  5D96 A;  1K0N A;  2LNS A;  5IOW A;  1O73 A;  2ZUP A;  1DE2 A;  4BVX B;  1FVK A;  2FGX A;  3K8N A;  3JCM L;  1XOB A;  2LRC A;  4MPG A;  1PD2 1;  3TDG A;  4V2N A;  2QGV A;  2R6K A;  1XOA A;  1JZO A;  1J08 A;  3D6I A;  3HZ8 A;  3ZFL A;  2EC4 A;  4I2U A;  1M9B A;  3F6D A;  4GWR A;  1ZYE A;  1TK0 B;  2GS3 A;  1ML6 A;  4BVY B;  1O8W A;  5DCG A;  4L0W A;  1B4P A;  3OR5 A;  2TRC P;  4X1U A;  4GLT A;  2KOK A;  5B6M A;  3DXB A;  3KGK A;  1EOG A;  3EMP A;  5BMU A;  5EY6 A;  4GF0 A;  3Q18 A;  2GLR A;  1SKW B;  1B48 A;  3LFL A;  4EKZ A;  2I9H A;  4GCI A;  3GH9 A;  1VF1 A;  4KDX A;  1PA3 A;  2DJJ A;  4AJ8 A;  4GQF A;  5B8B A;  2NVL A;  4GSS A;  3WGX A;  1KTE A;  9GSS A;  1TKD B;  3I9V 2;  1SU9 A;  3F3R A;  3TB2 A;  5G5E A;  5JWR B;  1Q4J A;  1Y25 A;  1Q98 A;  1XBS A;  1XFL A;  3GH6 A;  3IXR A;  4MH3 A;  2IN3 A;  3AY8 A;  3Q74 A;  5ECR B;  4MJB A;  5IO0 A;  1U6T A;  3D22 A;  4IS0 A;  3H4K A;  3VI7 A;  2B5Y A;  1XIY A;  5ECN B;  1SYR A;  1TDI A;  3W8J A;  2H1G A;  1GUH A;  4QL7 A;  3TKS A;  4LL1 B;  2VCZ A;  3BBY A;  5CRE A;  3EVI A;  3CRU A;  1PRX A;  3H79 A;  2VCV A;  3FYG A;  3GTU B;  4FYB A;  3DVW A;  1FVJ A;  2JZS A;  4JE1 A;  1G7O A;  2YNX A;  3GNJ A;  1KNG A;  5HFK A;  4G0K A;  2CZ3 A;  3F0I A;  5D9T A;  5B7C A;  3WD6 A;  1YF1 A;  2FCH A;  1T4Z A;  3HHV A;  1GL8 A;  1K0M A;  3A2V A;  4L5O A;  5J5N A;  3HCZ A;  1A2L A;  3KMO A;  4KSO A;  4POB A;  4ML1 A;  4TR0 A;  2C8U A;  1THO A;  1QK8 A;  5DBQ A;  2X8C A;  4EXJ A;  4JR4 A;  1X9M B;  5IMF A;  3VUR A;  5H5S A;  4ZL9 A;  4IBP A;  3FKF A;  1JZW A;  3ISO A;  2RM6 A;  3NOF A;  2WRT A;  1R26 A;  3UJ1 A;  2HRK A;  3PH9 A;  4XTS A;  4MZW A;  2I4A A;  3I69 A;  2L59 A;  1T7P B;  4HS1 A;  5D9V A;  3VFI A;  4TW5 A;  4MDC A;  2C0E A;  5KN1 A;  3HJO A;  5IMA A;  3LXZ A;  1G7E A;  1PL1 A;  4J57 E;  1FHE A;  4RQR A;  3E9J B;  1TK5 B;  2CX3 A;  4WBR D;  4JR6 A;  3F4S A;  3NZN A;  3TOU A;  4TVE A;  1A8Y A;  1DUG A;  3H1N A;  5F07 A;  5LD0 A;  4NWY A;  1TW9 A;  2HT9 A;  4BWQ A;  3A2X A;  4HU9 A;  4QL9 A;  4N10 A;  1DE1 A;  12GS A;  4KCA A;  1LBK A;  2I1U A;  4JED A;  3MAK A;  5F05 A;  2PMT A;  1BQ7 A;  2H71 A;  1WE0 A;  1B9Y C;  2VCQ A;  2H1D A;  4TXO B;  1T00 A;  3GST A;  2O85 A;  3GV1 A;  2YZU A;  2IMI A;  2YN1 A;  1K0C A;  1SL1 B;  2KHP A;  4KDU A;  4JBB A;  3V1W A;  4MPF A;  3PGT A;  3DIE A;  3EE2 A;  3RBT A;  5IMD A;  4FH8 A;  5CNW A;  2IPA A;  2CVD A;  2DJ1 A;  3G7Y A;  2GZZ A;  2DLX A;  2R3X A;  3DGQ A;  5GST A;  4X0X A;  2B7K A;  2EIO A;  2GTU A;  3LGC A;  3LG6 A;  4JZQ A;  2IFQ A;  2YJ7 A;  1TU7 A;  2FWH A;  3FR3 A;  19GS A; 
#chains in the Genus database with same CATH topology
 5KOW A;  1MDJ A;  1SD8 A;  5GAP D;  1A8L A;  3EU4 A;  5ENU A;  5DQS A;  4F82 A;  1GTB A;  5HR0 A;  5J47 A;  2P31 A;  1GSU A;  1O7U A;  2PGT A;  3KCM A;  5A4V A;  4AKH A;  1CQG A;  2L5O A;  3DML A;  4GTU A;  1AIU A;  3GIX A;  4EDZ A;  1OKD A;  2K8S A;  2H76 A;  4MF6 A;  4ZL7 A;  3TCO A;  2DKI A;  2B1K A;  2H1B A;  4BPY A;  5GZZ B;  3IC8 A;  3LOR A;  1RW1 A;  4NXI A;  1FO5 A;  4YH2 A;  2IMD A;  2B5E A;  4LL4 B;  4N11 A;  5ECH B;  2A2R A;  2CAQ A;  20GS A;  2J23 A;  5CRH A;  5AIX A;  4POK A;  4K7N A;  1OC8 A;  4EIQ A;  1F37 A;  3E0U A;  2XC2 A;  4YQV A;  3KP9 A;  3WGD A;  2JZR A;  4K0G A;  4K8M A;  4FYU A;  1SVO A;  2QA2 A;  2OAC A;  4PTS A;  6GSW A;  3CQF A;  3ED3 A;  3F6F A;  5DJL A;  2RII A;  4ZB9 A;  4XS1 A;  2AAW A;  4HOJ A;  5DAK A;  4RQX A;  4V2L A;  4JU5 A;  4V2M A;  2RM5 A;  1M9A A;  2JAD A;  4Q5N A;  2GT5 A;  4WF4 A;  2XPD A;  1OVN A;  1WWJ A;  3LSZ A;  4MF7 A;  5KN2 A;  4F9Z A;  2IFQ B;  4K7O A;  5A1N A;  3CSI A;  4WR4 A;  1GSQ A;  3GUR A;  1E6B A;  3IA1 A;  4H86 A;  4O5R A;  4FYC A;  2HRF A;  3GKM A;  1F3B A;  1YDK A;  1GNE A;  1X0R A;  1XXU A;  2DIY A;  5KN0 A;  1EEM A;  2DJ3 A;  4CY6 A;  2ALB A;  2VM1 A;  5D73 A;  3HKR A;  2HNL A;  1ZMA A;  3US3 A;  4HJM A;  2GGT A;  4HQS A;  3IBH A;  4MJA A;  2WW0 A;  2FUG 2;  5G31 A;  5KN3 A;  2A4V A;  4ISD A;  2FNO A;  1IYH A;  2CAI A;  2AHE A;  1A2J A;  1U3A A;  1NSW A;  2H73 A;  5GSS A;  3ZRE A;  1S3C A;  2JU5 A;  2H01 A;  1U87 A;  3KEB A;  1U88 A;  2CVK A;  2VL2 A;  5AN1 A;  3FK8 A;  1SL2 B;  2VAF A;  17GS A;  4MJC A;  3KTB A;  1R4W A;  4O5Q A;  3TRX A;  5J41 A;  3A5I A;  5D9X A;  1WP0 A;  4IHU A;  1OC9 B;  3IAM 2;  2C0G A;  2DSA A;  1N2A A;  1VF3 A;  3IR4 A;  1F9M A;  1XVQ A;  1X5D A;  1XCC A;  1OKT A;  1TXU A;  4Q5F A;  4AF2 A;  4F0C A;  2O8V B;  4ZBB A;  2LKU A;  3QDN A;  1HNC A;  1GUM A;  3FW2 A;  2L4C A;  2QA1 A;  4WR5 A;  1RQM A;  2XPE A;  2QKE A;  1I9D A;  4XS6 A;  1JZR A;  3FR9 A;  2B3S A;  2AV4 A;  1F2E A;  2EIR A;  2DJ0 A;  3P8W A;  5A5H A;  4O32 A;  2C3Q A;  5D8I A;  3RHC A;  3HA9 A;  2PWJ A;  5B6N A;  2LJR A;  2GSS A;  5ECS A;  1VRS D;  1Y1U A;  3GKX A;  4MJE A;  2FWG A;  1VGL A;  4PQI A;  4ULX A;  1Z7P A;  4PX1 A;  2WW3 A;  2TRX A;  13GS A;  3TRQ A;  1FAA A;  1EP8 A;  1M2A A;  2VL2 C;  22GS A;  1YKC A;  1GUK A;  4FQU A;  1TOF A;  2OE1 A;  1OAZ A;  4TXV A;  2C80 A;  2N5B A;  3TKQ A;  1KBN A;  2VL9 A;  3Q6O A;  4FIW A;  3KD0 A;  5J4U A;  1XWG A;  3EC3 A;  4HJ2 A;  2R0G A;  2KP2 A;  2WGR A;  4F0B A;  3VWW A;  1ERV A;  3HVV A;  2IWT A;  2P5R A;  5FWG A;  5CRG A;  2VM2 A;  2LJK A;  5DAL A;  4L5L A;  2R4V A;  2WJU A;  4NPB A;  1YVL A;  1SK2 A;  4RI7 A;  4DSS A;  5AIV A;  2WZ9 A;  3O3T A;  2C1Y A;  2YP6 A;  3ZYW A;  1V58 A;  1ON4 A;  2QC7 A;  5ECL B;  2H66 A;  3G9B A;  1XWB A;  1WMJ A;  4O7H A;  4BIK A;  4PQH A;  2HRA A;  1SVM A;  2ON7 A;  1PGT A;  1DSB A;  1CQH A;  1EZK A;  1JZD A;  4Q5R A;  2JSZ A;  2L57 A;  3LYP A;  3CSH A;  3A3T A;  2HSM A;  2X99 A;  3CHX C;  3EMX A;  1GSY A;  2H8L A;  4GSN A;  5DVB A;  4YKF A;  4YAV A;  1W89 A;  4G0L A;  1PKZ A;  3HYP A;  3TGZ A;  4CW9 A;  2PVQ A;  2EIQ A;  1SKR B;  3J7Y k;  18GS A;  3GL5 A;  3FZA A;  5F0G A;  1ZZY A;  2MMA A;  2LS5 A;  2YWO A;  4YAP A;  2PPT A;  1A23 A;  5H5R A;  3ZZX A;  2IMF A;  1W4V A;  1PX7 A;  3M0F A;  4EF0 A;  1GP1 A;  1EV9 A;  3FY7 A;  1G0T A;  1UC7 A;  3R3E A;  4PI0 C;  3IE3 A;  4MCU A;  2NBS A;  2F9S A;  3KXO A;  2YV9 A;  1QGV A;  3D4M A;  4EL1 A;  5ECP B;  2YCD A;  2F8A A;  5HQP A;  2PER A;  2VD0 A;  2FLS A;  4ZL8 A;  3ZLP A;  1AAZ A;  4N0Z A;  3O6T A;  2M46 A;  2HE3 A;  1GRX A;  3UBK A;  4TKY A;  1SJZ A;  4OCF A;  2VL3 A;  3CXG A;  3RPN A;  1NM3 A;  1I5G A;  3M9J A;  2AYT A;  2WDU A;  1ERW A;  1MD3 A;  2IIY A;  3DVX A;  1XW9 A;  5AGY A;  3D5J A;  4USS A;  3ME7 A;  4HQZ A;  4G9H A;  5DAL B;  2D2Z A;  4RI6 A;  1R7H A;  2WW1 A;  2FD3 A;  2H0H A;  4GXZ A;  1AUC A;  1EWX A;  4DSS B;  3PIN A;  4AJ7 A;  4K5S A;  4D73 A;  1O8X A;  1FOV A;  1GWC A;  5CRW A;  2DBC A;  5G1L A;  2NDO A;  2REM A;  2LNT A;  2LV3 A;  1XW5 A;  3WT2 A;  1V9W A;  4G10 A;  5A4W A;  5COH A;  4K5R A;  3TUE A;  4Z2T A;  3L0H A;  3IC4 A;  3RDW A;  5J4V A;  3RPP A;  3VLN A;  4GDF A;  2E7P A;  3VK9 A;  5C04 A;  4DEJ A;  6GSV A;  2C4J A;  2GQK A;  1GSE A;  4KND A;  5LNK e;  4LMV A;  3IDV A;  1H75 A;  3H93 A;  3L9V A;  5J3R A;  4E8E A;  5ECQ B;  1BAY A;  3FHK A;  1SYX A;  2OT3 A;  2L4Q A;  1Z6M A;  4L8E A;  4O92 A;  1THX A;  2HLS A;  2LRT A;  2C3T A;  1Z5Y E;  1K3Y A;  1ZGN A;  1YEP A;  5ECI B;  1ZL9 A;  1F3A A;  1XVW A;  1GTA A;  2DC5 A;  1RK4 A;  2A2S A;  1WJK A;  1XWC A;  2H0G A;  1WOU A;  1O85 A;  3F4T A;  3DD3 A;  4HUA A;  1FB0 A;  3KIJ A;  3ZTL A;  5J40 A;  2HYX A;  3IK7 A;  3F63 A;  3QOU A;  4PXO A;  3GKK A;  2GVP A;  2CVB A;  4XHM A;  2UV8 G;  5ECO B;  5IO2 A;  4PNG A;  3TJK A;  4XIH A;  2WVX A;  2HSN B;  1YEX A;  3UAR A;  2DIZ A;  2TIR A;  3C8E A;  3VPQ A;  3KTL A;  1GTI A;  4KE3 A;  1C72 A;  4EC0 A;  1QMV A;  4TR3 A;  1YY7 A;  4HI7 A;  3VWU A;  1GSS A;  3VWV A;  2MMN A;  2HRK B;  2X4A A;  4K1F A;  5EVO A;  1X5E A;  4G0I A;  4LLR A;  3IHQ A;  1X9W B;  2H72 A;  4D73 B;  2DMM A;  7GSS A;  2HXK A;  5G5F A;  3ERW A;  4OFM A;  4XRA A;  1WIK A;  3GKN A;  8GSS A;  2H19 A;  4TR4 A;  3I6A A;  1BYE A;  2O3E A;  2FWE A;  2MZC A;  3C1S A;  3GSS A;  4BA7 A;  4AI6 A;  3G7I A;  3MDK A;  3SWL A;  3IOS A;  4DSR A;  4QQ7 A;  1TRV A;  4WBJ A;  1K0A A;  5ECK B;  1ZCP A;  3IV4 A;  4ZB6 A;  2P5Q A;  1QXH A;  1MDI A;  4FO5 A;  4ILF A;  1IYI A;  2NTO A;  1DBY A;  4K2D A;  1YEW C;  4IKH A;  1B9X C;  2BJX A;  3CTF A;  2ON5 A;  4POM A;  3GX0 A;  2V2G A;  2AUV A;  5C00 A;  5KEJ A;  3KM6 A;  2H74 A;  2YPM A;  5IMV A;  3QR6 A;  1E2Y A;  4XS4 A;  4I97 A;  4PUA A;  5IIZ A;  2KP1 A;  1X9S B;  1OE7 A;  1G6W A;  5IQY A;  4IP1 A;  4GQC A;  2DJK A;  3HVS A;  4MF5 A;  3A2W A;  1PL2 A;  3UBL A;  1OC3 A;  1HNB A;  10GS A;  3P7X A;  1ABA A;  4ECB A;  3CTG A;  2CV4 A;  1ZYN A;  2HSH A;  2VCW A;  2WVX B;  5JCG A;  4ECJ A;  5L71 A;  4OO5 A;  5CP1 A;  2H6Z A;  1X5C A;  1YQ1 A;  5EL8 A;  3LEF A;  5AIS A;  5LCZ A;  2AJQ B;  3GUS A;  6GST A;  3F3Q A;  2FY6 A;  1AC1 A;  1TP9 A;  3UEM A;  1N25 A;  3MIX A;  3L9U A;  4K0N A;  2K18 A;  4G19 A;  1NW2 A;  2JSY A;  1A0R P;  4MNN A;  5IM9 A;  4OFN A;  3UVT A;  3BCK A;  3ZVJ A;  2MBS A;  4W66 A;  4YQM A;  2C0F A;  4ZB7 A;  3FZ5 A;  5E59 A;  16GS A;  1EOH A;  2H6X A;  3FMW A;  3ZVJ D;  3HD5 A;  4MZC A;  4N3Z A;  2I81 A;  1Y6E A;  1AQW A;  2V32 A;  3CRT A;  3LYK A;  2PVO C;  1AQV A;  2E0Q A;  4MP4 A;  2DJ2 A;  2HFD A;  4F03 A;  1R5A A;  1TXX A;  4OD7 A;  1BX9 A;  2E2G A;  2N5F A;  3MNG A;  1SD9 A;  3WT1 A;  4ZBD A;  6GSX A;  1F6M C;  4NHZ A;  4NV5 A;  3FRC A;  2LST A;  2VLT A;  3UMA A;  1S3R A;  4IJ3 A;  2N5A A;  2O5V A;  1O6J A;  2IME A;  4J56 E;  3ZIJ A;  1FW1 A;  3LW9 A;  5CYY A;  1QUW A;  2V6O A;  1U3I A;  3HVX A;  1A2M A;  2K8V A;  4HZ4 A;  4OMV A;  1PMT A;  4XS4 B;  1VF4 A;  3BD2 A;  4K7I A;  4IGJ A;  2KLX A;  3N5O A;  1M3I A;  1FG4 A;  1PN9 A;  5DAK B;  4MAB A;  5G2Z A;  1B4Q A;  4MZB A;  5IPG A;  1GLQ A;  2YJH A;  4E8H A;  4ML6 A;  3ZRD A;  2V41 A;  1EV4 A;  5FHI A;  5ECM B;  1HYU A;  4LMW A;  1OYJ A;  4WXT A;  2IJY A;  4MH2 A;  3SBC A;  2M72 A;  3FR6 A;  2OAD A;  3GHA A;  4NV2 A;  1EGO A;  5A1N B;  5J4Y A;  3MWH A;  1ST9 A;  4I8B A;  4V1A g;  5INY A;  2F8F A;  4PQ1 A;  2OJL A;  2MMO A;  1T1V A;  4HSC X;  3GRX A;  1PQN A;  4MLY A;  4MK3 A;  1TI3 A;  3TKS E;  3U6V A;  1V2A A;  1LJR A;  4I2T A;  5IMC A;  5BRT A;  1R5P A;  3APQ A;  4CDO A;  2GZY A;  2LEG A;  3TJJ A;  3W8S A;  5G1K A;  2G2Q A;  4OCE A;  1M7T A;  3RAZ A;  3U5R E;  3LJR A;  1SJI A;  3L78 A;  2PN8 A;  1AQX A;  3C71 A;  2ES7 A;  4QMK A;  1MTC A;  4HDE A;  3ZIT A;  2LQO A;  4IEL A;  5KOX A;  2L6D A;  4IVF A;  5HR2 A;  1VF2 A;  1M0U A;  3APS A;  3CYN A;  4KUN A;  1GLP A;  4KW6 A;  5ID2 A;  1V57 A;  1XPV A;  4ZXG A;  2F3M A;  4YKG A;  2R0C A;  2WUL A;  1TU8 A;  3VPT A;  2GDR A;  1GSF A;  5JWQ B;  2OKA A;  3HVN A;  2WB9 A;  4ZIL A;  5DCH A;  1QQ2 A;  2X49 A;  2OBK A;  1TJD A;  2J9H A;  4E68 A;  2C0D A;  3PPU A;  3HY2 A;  2YOI A;  1OE8 A;  2YWI A;  2YWN A;  2M80 A;  3KH9 A;  2F51 A;  4ZIJ A;  3DKS A;  2GSQ A;  2PU9 C;  3LXT A;  1PX6 A;  4IP6 A;  3M3M A;  2FA4 A;  3L4N A;  3M9K A;  1YF0 A;  5D9W A;  5IPH A;  3H8Q A;  2HZE A;  2B1L A;  2E2M A;  5F8B A;  3N9J A;  4I6X A;  3L9S A;  1O81 A;  3P90 A;  1S3D A;  2X64 A;  3TKP A;  5DQY A;  4Z2U A;  1EEJ A;  5ELA A;  1EGR A;  1J9B A;  5A5H B;  3HDC A;  4OWY A;  2O89 A;  2MYG A;  1GTU A;  1K0O A;  1NHY A;  5HR1 A;  3QPM A;  3E3E A;  2QSI A;  3HJM A;  3UOM A;  4TXO A;  1N8J A;  4LA1 A;  3MSZ A;  5HFG A;  3O76 A;  1YJ6 A;  3ERG A;  5DJM A;  1JLW A;  2X8G A;  3KZQ A;  3IRA A;  4IN0 A;  4ECI A;  2L5L A;  1M2D A;  4DVC A;  1AXD A;  2YV7 A;  3ZFB A;  1SL0 B;  3HMJ G;  3DEX A;  4J2F A;  3QAV A;  4ZBA A;  6GSS A;  4IW9 A;  1FB6 A;  4G01 A;  1M2B A;  3BJ5 A;  1TK8 B;  1USB A;  3QAG A;  4KF9 A;  3LQ7 A;  4MA9 A;  2PUK C;  5ID2 B;  3QMX A;  4Z7X A;  1BJX A;  3UIW A;  4IJI A;  2JL4 A;  2GT6 A;  3J7Y b;  4AKI A;  4HU7 A;  6GSY A;  4PI2 C;  3TJG A;  2EFE A;  5ELG A;  1MDK A;  3KJY A;  3TKR A;  2HSM B;  3IPZ A;  3DRN A;  2LJA A;  2R0P A;  1ZOF A;  4IQ1 A;  1WPI A;  3GYK A;  2YZH A;  3FZ9 A;  1Z6N A;  2WVY A;  3HJP A;  2K6V A;  3CSJ A;  1Z3E A;  1JHB A;  4EVM A;  3D21 A;  3UVH A;  2H30 A;  3D4T A;  4P3Y B;  3TKS C;  2HZE B;  2R37 A;  2LUS A;  1SK0 A;  1PKW A;  3HZ4 A;  4I5Q A;  2WS2 A;  4GST A;  4ID0 A;  2YWM A;  4WET A;  4IQA A;  4GRF A;  5CRD A;  5J9B A;  1AW9 A;  5J9C A;  2RUF A;  2FWF A;  2GQM A;  2VIM A;  1XW6 A;  3EWL A;  2OA7 A;  1ZYQ B;  1LU4 A;  5E4W A;  2XHF A;  1TI1 A;  3ZML A;  2VD1 A;  1YZX A;  3VI5 A;  5JWO B;  2GSR A;  1SK1 A;  3C73 A;  2JZT A;  1GSD A;  4YQU A;  6GSU A;  3Q19 A;  2CX4 A;  2LRN A;  1BED A;  4AJ6 A;  4BL7 A;  3APO A;  5G30 A;  4PUR A;  4AGS A;  2A2P A;  2Z9S A;  4AKG A;  2GZP A;  1BG5 A;  4KX4 A;  1V98 A;  3QFA C;  1G6Y A;  1GUL A;  4KSM A;  2P0G A;  4POL A;  3QD9 A;  4EE0 A;  4N30 A;  3KP8 A;  3GFK A;  4ECC A;  3IK9 A;  2B6M A;  3GX8 A;  1JLV A;  1NHO A;  4WEY A;  1YKA A;  1J0F A;  1URM A;  3CMI A;  2RLI A;  3DWV A;  2H1L A;  3EUR A;  2VLU A;  4HEA 2;  5IMZ A;  1XWK A;  2HRN A;  4WF5 A;  2G0F A;  5GAN D;  11GS A;  1HD2 A;  2R2J A;  3IHG A;  4NMU A;  1K0D A;  4WKW A;  2OE3 A;  3EYT A;  2H0I A;  5IOX A;  1Z9H A;  4KAE A;  1ACV A;  1I1I P;  1K3O A;  1SJ6 A;  1TRW A;  4KA0 A;  2XBQ A;  3D0Z A;  3TRP A;  1MEK A;  2C3N A;  2X8H A;  1WRY A;  4TR1 A;  3TJB A;  2VO4 A;  2OE0 A;  1V40 A;  3M1G A;  1BG1 A;  3A5W A;  5A34 A;  2MBT A;  3FZ4 A;  4KCE A;  3WYW A;  4X43 A;  2K9F A;  2ZCT A;  3MYD A;  4PNF A;  2H1A A;  2O7K A;  3CBU A;  2H70 A;  2UZ8 A;  3GN3 A;  2VCT A;  1OC9 A;  2V6K A;  2R5G A;  4JRR A;  3EU3 A;  4DSQ A;  1ILO A;  2H6Y A;  4V1A p;  3UAP A;  2CA8 A;  5FT3 A;  4G2E A;  4RUV A;  4EDY A;  3ZIV A;  1PFO A;  3WGE A;  3TJF A;  2XBI A;  2EFH A;  4BL7 B;  1HNA A;  1PSQ A;  2HSY A;  2PBJ A;  3QFB C;  4TN8 A;  2CZ2 A;  3GL3 A;  4K9Z A;  2WZS A;  3C7M A;  5H5Q A;  3RHB A;  2GST A;  3P2A A;  2DML A;  1T8E B;  3F8U A;  2B7J A;  2BTO T;  1MD4 A;  1ERT A;  3ERF A;  4CHS A;  4OO4 A;  14GS A;  5CO3 A;  2B5X A;  2LTK A;  4TRX A;  4ZB8 A;  3LWA A;  4CY8 A;  4XCS A;  3W6G A;  2FA8 A;  4K6X A;  2VCX A;  2CT6 A;  4MMM A;  2KUC A;  5CAX A;  3M8N A;  3RFR C;  3ME8 A;  1UVZ A;  1GNW A;  4KB3 A;  3ZMK A;  4BVX A;  3FEU A;  3PR8 A;  2O87 A;  3UL3 A;  4BWS A;  1M99 A;  4EUY A;  2V1M A;  5A5K A;  1BF5 A;  1PN0 A;  4NHW A;  4NAX A;  3G7J A;  3EPT A;  1EP7 A;  4KGI A;  2VKZ G;  2WCI A;  3QCP A;  4TR1 B;  2OBI A;  1FOH A;  3S9F A;  4ACS A;  5A34 B;  1XZO A;  4OFT A;  3IAS 2;  2WFC A;  1H4O A;  3EIN A;  4N0V A;  3ZL5 A;  4BVY A;  1ERU A;  5D93 A;  4XRD A;  2WVZ A;  2IMK A;  1Z7R A;  2GQL A;  2HQT A;  1A0F A;  4PUF C;  3TOT A;  1TTZ A;  1ZYP A;  1SKS B;  5B8A A;  2DKH A;  1JFU A;  1TRU A;  2NPB A;  5JCU A;  1K0B A;  3BCI A;  1UA5 A;  2BMX A;  3VWX A;  2VUP A;  4PGT A;  2JAC A;  3HXS A;  1QFN A;  2FHE A;  4TOP A;  3F9U A;  5HR3 A;  4KDY A;  1SEN A;  4Q5Q A;  3R2Q A;  1T4Y A;  4O5U A;  3KH7 A;  2A4H A;  1XWA A;  5HFI A;  2H75 A;  3I43 A;  5A4U A;  1S4B P;  2ZNM A;  3F4R A;  1T3B A;  2LQQ A;  5F06 A;  5ABR A;  1A24 A;  1GH2 A;  5DDL A;  2MMZ A;  3BOA A;  3C1R A;  2RUE A;  4F2I A;  2VOC A;  2VLV A;  1S3A A;  5EPF A;  3KMN A;  3DYR A;  1HQO A;  3GA4 A;  2I3Y A;  2HI7 A;  4EO3 A;  2L6C A;  1KEB A;  1TRS A;  2HZF A;  2AB6 A;  3NIV A;  4KH7 A;  4L0U A;  3QAW A;  1UN2 A;  3RGB C;  4X4J A;  5JCW A;  2CQ9 A;  1K3L A;  3GMF A;  2IL3 A;  3GTU A;  4HZ2 A;  2YAN A;  1B8X A;  5D96 A;  1K0N A;  2EFD A;  2LNS A;  5IOW A;  1O73 A;  2ZUP A;  1DE2 A;  4BVX B;  1FVK A;  2FGX A;  3K8N A;  3JCM L;  1XOB A;  2LRC A;  4MPG A;  1PD2 1;  1M3J A;  3TDG A;  4V2N A;  2QGV A;  2R6K A;  1XOA A;  1JZO A;  1J08 A;  3D6I A;  3HZ8 A;  3ZFL A;  2EC4 A;  4I2U A;  1M9B A;  4FXY P;  3F6D A;  4GWR A;  1ZYE A;  1TK0 B;  2GS3 A;  1ML6 A;  4BVY B;  1O8W A;  5DCG A;  4L0W A;  1B4P A;  3OR5 A;  2TRC P;  4X1U A;  4GLT A;  2KOK A;  5B6M A;  3DXB A;  3KGK A;  1EOG A;  3EMP A;  5BMU A;  5EY6 A;  4GF0 A;  3Q18 A;  2GLR A;  1SKW B;  1B48 A;  3LFL A;  4EKZ A;  2I9H A;  4GCI A;  4A5P A;  3GH9 A;  1VF1 A;  4KDX A;  1PA3 A;  2DJJ A;  4AJ8 A;  4GQF A;  5B8B A;  2NVL A;  4GSS A;  3WGX A;  1KTE A;  9GSS A;  1TKD B;  3I9V 2;  1SU9 A;  3F3R A;  3TB2 A;  5G5E A;  5JWR B;  1Q4J A;  1Y25 A;  1Q98 A;  1XBS A;  1XFL A;  3GH6 A;  3IXR A;  4MH3 A;  2IN3 A;  3AY8 A;  3Q74 A;  5ECR B;  4MJB A;  5IO0 A;  1U6T A;  3D22 A;  4IS0 A;  3H4K A;  3VI7 A;  2B5Y A;  1XIY A;  5ECN B;  1SYR A;  1TDI A;  3W8J A;  2H1G A;  1GUH A;  4QL7 A;  3TKS A;  4LL1 B;  2VCZ A;  3BBY A;  5CRE A;  3EVI A;  3CRU A;  1PRX A;  3H79 A;  2O36 A;  2VCV A;  3FYG A;  3GTU B;  4FYB A;  3DVW A;  1FVJ A;  2JZS A;  4JE1 A;  1G7O A;  2YNX A;  3GNJ A;  1KNG A;  5HFK A;  4G0K A;  2CZ3 A;  3F0I A;  5D9T A;  5B7C A;  3WD6 A;  1YF1 A;  2FCH A;  1T4Z A;  3HHV A;  1GL8 A;  2WW2 A;  1K0M A;  3A2V A;  4L5O A;  5J5N A;  3HCZ A;  1A2L A;  3KMO A;  4KSO A;  2HSN A;  4POB A;  4ML1 A;  4TR0 A;  2C8U A;  1THO A;  1QK8 A;  5DBQ A;  2X8C A;  4EXJ A;  4JR4 A;  1X9M B;  5IMF A;  3VUR A;  5H5S A;  4ZL9 A;  4IBP A;  3FKF A;  1JZW A;  3ISO A;  2RM6 A;  3NOF A;  2WRT A;  1R26 A;  3UJ1 A;  2HRK A;  3PH9 A;  4XTS A;  4MZW A;  2I4A A;  3I69 A;  2L59 A;  1T7P B;  4HS1 A;  5D9V A;  3VFI A;  5BMU B;  4TW5 A;  4MDC A;  2C0E A;  5KN1 A;  3HJO A;  5IMA A;  4EIP A;  3LXZ A;  1G7E A;  1PL1 A;  4J57 E;  4AKX B;  1FHE A;  4RQR A;  3E9J B;  1TK5 B;  2CX3 A;  4WBR D;  4JR6 A;  3F4S A;  3NZN A;  3TOU A;  4TVE A;  1A8Y A;  1DUG A;  3H1N A;  5F07 A;  5LD0 A;  4NWY A;  1TW9 A;  2HT9 A;  4BWQ A;  3A2X A;  4HU9 A;  4QL9 A;  4N10 A;  1DE1 A;  12GS A;  4KCA A;  1LBK A;  2I1U A;  4JED A;  3MAK A;  5F05 A;  2PMT A;  4ICY A;  1BQ7 A;  4K2X A;  2H71 A;  1WE0 A;  1B9Y C;  2VCQ A;  2H1D A;  4TXO B;  1T00 A;  3GST A;  2O85 A;  4PHZ C;  3GV1 A;  2YZU A;  2IMI A;  2YN1 A;  1K0C A;  1SL1 B;  2KHP A;  4Z2R A;  4KDU A;  4JBB A;  1SVL A;  3CWG A;  3V1W A;  4MPF A;  3PGT A;  3DIE A;  3EE2 A;  2EFC A;  3RBT A;  5IMD A;  4FH8 A;  5CNW A;  2IPA A;  2CVD A;  2DJ1 A;  3G7Y A;  2GZZ A;  2DLX A;  2R3X A;  3DGQ A;  5GST A;  4X0X A;  2B7K A;  2EIO A;  2GTU A;  3TU3 B;  3LGC A;  3LG6 A;  4JZQ A;  2IFQ A;  2YJ7 A;  1TU7 A;  1XG8 A;  2FWH A;  3FR3 A;  19GS A; 
#chains in the Genus database with same CATH homology
 5KOW A;  1MDJ A;  1SD8 A;  5GAP D;  1A8L A;  3EU4 A;  5ENU A;  5DQS A;  4F82 A;  1GTB A;  5HR0 A;  5J47 A;  2P31 A;  1GSU A;  1O7U A;  2PGT A;  3KCM A;  5A4V A;  4AKH A;  1CQG A;  2L5O A;  3DML A;  4GTU A;  1AIU A;  3GIX A;  4EDZ A;  1OKD A;  2K8S A;  2H76 A;  4MF6 A;  4ZL7 A;  3TCO A;  2DKI A;  2B1K A;  2H1B A;  4BPY A;  5GZZ B;  3IC8 A;  3LOR A;  1RW1 A;  4NXI A;  1FO5 A;  4YH2 A;  2IMD A;  2B5E A;  4LL4 B;  4N11 A;  5ECH B;  2A2R A;  2CAQ A;  20GS A;  2J23 A;  5CRH A;  5AIX A;  4POK A;  4K7N A;  1OC8 A;  4EIQ A;  1F37 A;  3E0U A;  2XC2 A;  4YQV A;  3KP9 A;  3WGD A;  2JZR A;  4K0G A;  4K8M A;  4FYU A;  1SVO A;  2QA2 A;  2OAC A;  4PTS A;  6GSW A;  3ED3 A;  3F6F A;  5DJL A;  2RII A;  4ZB9 A;  4XS1 A;  2AAW A;  4HOJ A;  5DAK A;  4RQX A;  4V2L A;  4JU5 A;  4V2M A;  2RM5 A;  1M9A A;  2JAD A;  4Q5N A;  2GT5 A;  4WF4 A;  2XPD A;  1OVN A;  1WWJ A;  3LSZ A;  4MF7 A;  5KN2 A;  4F9Z A;  2IFQ B;  4K7O A;  5A1N A;  3CSI A;  4WR4 A;  1GSQ A;  3GUR A;  1E6B A;  3IA1 A;  4H86 A;  4O5R A;  4FYC A;  2HRF A;  3GKM A;  1F3B A;  1YDK A;  1GNE A;  1X0R A;  1XXU A;  2DIY A;  5KN0 A;  1EEM A;  2DJ3 A;  4CY6 A;  2ALB A;  2VM1 A;  5D73 A;  3HKR A;  2HNL A;  1ZMA A;  3US3 A;  4HJM A;  2GGT A;  4HQS A;  3IBH A;  4MJA A;  2FUG 2;  5G31 A;  5KN3 A;  2A4V A;  4ISD A;  2FNO A;  1IYH A;  2CAI A;  2AHE A;  1A2J A;  1U3A A;  1NSW A;  2H73 A;  5GSS A;  3ZRE A;  1S3C A;  2JU5 A;  2H01 A;  1U87 A;  3KEB A;  1U88 A;  2CVK A;  2VL2 A;  5AN1 A;  3FK8 A;  1SL2 B;  2VAF A;  17GS A;  4MJC A;  3KTB A;  1R4W A;  4O5Q A;  3TRX A;  5J41 A;  3A5I A;  5D9X A;  1WP0 A;  4IHU A;  1OC9 B;  3IAM 2;  2C0G A;  2DSA A;  1N2A A;  1VF3 A;  3IR4 A;  1F9M A;  1XVQ A;  1X5D A;  1XCC A;  1OKT A;  1TXU A;  4Q5F A;  4AF2 A;  4F0C A;  2O8V B;  4ZBB A;  2LKU A;  3QDN A;  1HNC A;  1GUM A;  3FW2 A;  2L4C A;  2QA1 A;  4WR5 A;  1RQM A;  2XPE A;  2QKE A;  1I9D A;  4XS6 A;  1JZR A;  3FR9 A;  2B3S A;  2AV4 A;  1F2E A;  2EIR A;  2DJ0 A;  3P8W A;  5A5H A;  4O32 A;  2C3Q A;  5D8I A;  3RHC A;  3HA9 A;  2PWJ A;  5B6N A;  2LJR A;  2GSS A;  5ECS A;  1VRS D;  1Y1U A;  3GKX A;  4MJE A;  2FWG A;  1VGL A;  4PQI A;  4ULX A;  1Z7P A;  4PX1 A;  2TRX A;  13GS A;  3TRQ A;  1FAA A;  1EP8 A;  1M2A A;  2VL2 C;  22GS A;  1YKC A;  1GUK A;  4FQU A;  1TOF A;  2OE1 A;  1OAZ A;  4TXV A;  2C80 A;  2N5B A;  3TKQ A;  1KBN A;  2VL9 A;  3Q6O A;  4FIW A;  3KD0 A;  5J4U A;  1XWG A;  3EC3 A;  4HJ2 A;  2R0G A;  2KP2 A;  2WGR A;  4F0B A;  3VWW A;  1ERV A;  3HVV A;  2IWT A;  2P5R A;  5FWG A;  5CRG A;  2VM2 A;  2LJK A;  5DAL A;  4L5L A;  2R4V A;  2WJU A;  4NPB A;  1YVL A;  1SK2 A;  4RI7 A;  4DSS A;  5AIV A;  2WZ9 A;  3O3T A;  2C1Y A;  2YP6 A;  3ZYW A;  1V58 A;  1ON4 A;  2QC7 A;  5ECL B;  2H66 A;  3G9B A;  1XWB A;  1WMJ A;  4O7H A;  4PQH A;  2HRA A;  1SVM A;  2ON7 A;  1PGT A;  1DSB A;  1CQH A;  1EZK A;  1JZD A;  4Q5R A;  2JSZ A;  2L57 A;  3LYP A;  3CSH A;  3A3T A;  2HSM A;  2X99 A;  3EMX A;  1GSY A;  2H8L A;  4GSN A;  5DVB A;  4YKF A;  4YAV A;  1W89 A;  4G0L A;  1PKZ A;  3HYP A;  3TGZ A;  4CW9 A;  2PVQ A;  2EIQ A;  1SKR B;  3J7Y k;  18GS A;  3GL5 A;  3FZA A;  5F0G A;  1ZZY A;  2MMA A;  2LS5 A;  2YWO A;  4YAP A;  2PPT A;  1A23 A;  5H5R A;  3ZZX A;  2IMF A;  1W4V A;  1PX7 A;  3M0F A;  4EF0 A;  1GP1 A;  1EV9 A;  3FY7 A;  1G0T A;  1UC7 A;  3R3E A;  3IE3 A;  4MCU A;  2NBS A;  2F9S A;  3KXO A;  2YV9 A;  1QGV A;  3D4M A;  4EL1 A;  5ECP B;  2YCD A;  2F8A A;  5HQP A;  2PER A;  2VD0 A;  2FLS A;  4ZL8 A;  3ZLP A;  1AAZ A;  4N0Z A;  3O6T A;  2M46 A;  2HE3 A;  1GRX A;  3UBK A;  4TKY A;  1SJZ A;  4OCF A;  2VL3 A;  3CXG A;  3RPN A;  1NM3 A;  1I5G A;  3M9J A;  2AYT A;  2WDU A;  1ERW A;  1MD3 A;  2IIY A;  3DVX A;  1XW9 A;  5AGY A;  3D5J A;  4USS A;  3ME7 A;  4HQZ A;  4G9H A;  5DAL B;  2D2Z A;  4RI6 A;  1R7H A;  2FD3 A;  2H0H A;  4GXZ A;  1AUC A;  1EWX A;  4DSS B;  3PIN A;  4AJ7 A;  4K5S A;  4D73 A;  1O8X A;  1FOV A;  1GWC A;  5CRW A;  2DBC A;  5G1L A;  2NDO A;  2REM A;  2LNT A;  2LV3 A;  1XW5 A;  3WT2 A;  1V9W A;  4G10 A;  5A4W A;  5COH A;  4K5R A;  3TUE A;  4Z2T A;  3L0H A;  3IC4 A;  3RDW A;  5J4V A;  3RPP A;  3VLN A;  4GDF A;  2E7P A;  3VK9 A;  5C04 A;  4DEJ A;  6GSV A;  2C4J A;  2GQK A;  1GSE A;  4KND A;  5LNK e;  4LMV A;  3IDV A;  1H75 A;  3H93 A;  3L9V A;  5J3R A;  4E8E A;  5ECQ B;  1BAY A;  3FHK A;  1SYX A;  2OT3 A;  2L4Q A;  1Z6M A;  4L8E A;  4O92 A;  1THX A;  2HLS A;  2LRT A;  2C3T A;  1Z5Y E;  1K3Y A;  1ZGN A;  1YEP A;  5ECI B;  1ZL9 A;  1F3A A;  1XVW A;  1GTA A;  2DC5 A;  1RK4 A;  2A2S A;  1WJK A;  1XWC A;  2H0G A;  1WOU A;  1O85 A;  3F4T A;  3DD3 A;  4HUA A;  1FB0 A;  3KIJ A;  3ZTL A;  5J40 A;  2HYX A;  3IK7 A;  3F63 A;  3QOU A;  4PXO A;  3GKK A;  2GVP A;  2CVB A;  4XHM A;  2UV8 G;  5ECO B;  5IO2 A;  4PNG A;  3TJK A;  4XIH A;  2HSN B;  1YEX A;  3UAR A;  2DIZ A;  2TIR A;  3C8E A;  3VPQ A;  3KTL A;  1GTI A;  4KE3 A;  1C72 A;  4EC0 A;  1QMV A;  4TR3 A;  1YY7 A;  4HI7 A;  3VWU A;  1GSS A;  3VWV A;  2MMN A;  2HRK B;  2X4A A;  4K1F A;  5EVO A;  1X5E A;  4G0I A;  4LLR A;  3IHQ A;  1X9W B;  2H72 A;  4D73 B;  2DMM A;  7GSS A;  2HXK A;  5G5F A;  3ERW A;  4OFM A;  4XRA A;  1WIK A;  3GKN A;  8GSS A;  2H19 A;  4TR4 A;  3I6A A;  1BYE A;  2FWE A;  2MZC A;  3C1S A;  3GSS A;  4BA7 A;  4AI6 A;  3G7I A;  3MDK A;  3SWL A;  3IOS A;  4DSR A;  4QQ7 A;  1TRV A;  4WBJ A;  1K0A A;  5ECK B;  1ZCP A;  3IV4 A;  4ZB6 A;  2P5Q A;  1QXH A;  1MDI A;  4FO5 A;  4ILF A;  1IYI A;  2NTO A;  1DBY A;  4K2D A;  4IKH A;  1B9X C;  2BJX A;  3CTF A;  2ON5 A;  4POM A;  3GX0 A;  2V2G A;  2AUV A;  5C00 A;  5KEJ A;  3KM6 A;  2H74 A;  2YPM A;  5IMV A;  3QR6 A;  1E2Y A;  4XS4 A;  4I97 A;  4PUA A;  5IIZ A;  2KP1 A;  1X9S B;  1OE7 A;  1G6W A;  5IQY A;  4IP1 A;  4GQC A;  2DJK A;  3HVS A;  4MF5 A;  3A2W A;  1PL2 A;  3UBL A;  1OC3 A;  1HNB A;  10GS A;  3P7X A;  1ABA A;  4ECB A;  3CTG A;  2CV4 A;  1ZYN A;  2HSH A;  2VCW A;  5JCG A;  4ECJ A;  5L71 A;  4OO5 A;  5CP1 A;  2H6Z A;  1X5C A;  1YQ1 A;  5EL8 A;  3LEF A;  5AIS A;  5LCZ A;  2AJQ B;  3GUS A;  6GST A;  3F3Q A;  2FY6 A;  1AC1 A;  1TP9 A;  3UEM A;  1N25 A;  3MIX A;  3L9U A;  4K0N A;  2K18 A;  4G19 A;  1NW2 A;  2JSY A;  1A0R P;  4MNN A;  5IM9 A;  4OFN A;  3UVT A;  3BCK A;  3ZVJ A;  2MBS A;  4W66 A;  4YQM A;  2C0F A;  4ZB7 A;  3FZ5 A;  5E59 A;  16GS A;  1EOH A;  2H6X A;  3FMW A;  3ZVJ D;  3HD5 A;  4MZC A;  4N3Z A;  2I81 A;  1Y6E A;  1AQW A;  2V32 A;  3CRT A;  3LYK A;  2PVO C;  1AQV A;  2E0Q A;  4MP4 A;  2DJ2 A;  2HFD A;  4F03 A;  1R5A A;  1TXX A;  4OD7 A;  1BX9 A;  2E2G A;  2N5F A;  3MNG A;  1SD9 A;  3WT1 A;  4ZBD A;  6GSX A;  1F6M C;  4NHZ A;  4NV5 A;  3FRC A;  2LST A;  2VLT A;  3UMA A;  4IJ3 A;  2N5A A;  2O5V A;  1O6J A;  2IME A;  4J56 E;  3ZIJ A;  1FW1 A;  3LW9 A;  5CYY A;  1QUW A;  2V6O A;  1U3I A;  3HVX A;  1A2M A;  2K8V A;  4HZ4 A;  4OMV A;  1PMT A;  4XS4 B;  1VF4 A;  3BD2 A;  4K7I A;  4IGJ A;  2KLX A;  3N5O A;  1FG4 A;  1PN9 A;  5DAK B;  4MAB A;  5G2Z A;  1B4Q A;  4MZB A;  5IPG A;  1GLQ A;  2YJH A;  4E8H A;  4ML6 A;  3ZRD A;  2V41 A;  1EV4 A;  5FHI A;  5ECM B;  1HYU A;  4LMW A;  1OYJ A;  4WXT A;  2IJY A;  4MH2 A;  3SBC A;  2M72 A;  3FR6 A;  2OAD A;  3GHA A;  4NV2 A;  1EGO A;  5A1N B;  5J4Y A;  3MWH A;  1ST9 A;  4I8B A;  4V1A g;  5INY A;  2F8F A;  4PQ1 A;  2OJL A;  2MMO A;  1T1V A;  3GRX A;  1PQN A;  4MLY A;  4MK3 A;  1TI3 A;  3TKS E;  3U6V A;  1V2A A;  1LJR A;  4I2T A;  5IMC A;  5BRT A;  1R5P A;  3APQ A;  4CDO A;  2GZY A;  2LEG A;  3TJJ A;  3W8S A;  5G1K A;  2G2Q A;  4OCE A;  1M7T A;  3RAZ A;  3U5R E;  3LJR A;  1SJI A;  3L78 A;  2PN8 A;  1AQX A;  3C71 A;  2ES7 A;  4QMK A;  1MTC A;  4HDE A;  3ZIT A;  2LQO A;  4IEL A;  5KOX A;  2L6D A;  4IVF A;  5HR2 A;  1VF2 A;  1M0U A;  3APS A;  3CYN A;  4KUN A;  1GLP A;  4KW6 A;  5ID2 A;  1V57 A;  1XPV A;  4ZXG A;  2F3M A;  4YKG A;  2R0C A;  2WUL A;  1TU8 A;  3VPT A;  2GDR A;  1GSF A;  5JWQ B;  2OKA A;  2WB9 A;  4ZIL A;  5DCH A;  1QQ2 A;  2X49 A;  2OBK A;  1TJD A;  2J9H A;  4E68 A;  2C0D A;  3PPU A;  3HY2 A;  2YOI A;  1OE8 A;  2YWI A;  2YWN A;  2M80 A;  3KH9 A;  2F51 A;  4ZIJ A;  3DKS A;  2GSQ A;  2PU9 C;  3LXT A;  1PX6 A;  4IP6 A;  3M3M A;  3L4N A;  2FA4 A;  3M9K A;  1YF0 A;  5D9W A;  5IPH A;  3H8Q A;  2HZE A;  2B1L A;  2E2M A;  5F8B A;  3N9J A;  4I6X A;  3L9S A;  1O81 A;  3P90 A;  1S3D A;  2X64 A;  3TKP A;  5DQY A;  4Z2U A;  1EEJ A;  5ELA A;  1EGR A;  1J9B A;  5A5H B;  3HDC A;  4OWY A;  2O89 A;  2MYG A;  1GTU A;  1K0O A;  1NHY A;  5HR1 A;  3QPM A;  3E3E A;  2QSI A;  3HJM A;  3UOM A;  4TXO A;  1N8J A;  4LA1 A;  3MSZ A;  5HFG A;  3O76 A;  1YJ6 A;  3ERG A;  5DJM A;  1JLW A;  2X8G A;  3KZQ A;  3IRA A;  4IN0 A;  4ECI A;  2L5L A;  1M2D A;  4DVC A;  1AXD A;  2YV7 A;  3ZFB A;  1SL0 B;  3HMJ G;  3DEX A;  4J2F A;  3QAV A;  4ZBA A;  6GSS A;  4IW9 A;  1FB6 A;  4G01 A;  1M2B A;  3BJ5 A;  1TK8 B;  1USB A;  3QAG A;  4KF9 A;  3LQ7 A;  4MA9 A;  2PUK C;  5ID2 B;  3QMX A;  4Z7X A;  1BJX A;  3UIW A;  4IJI A;  2JL4 A;  2GT6 A;  3J7Y b;  4AKI A;  4HU7 A;  6GSY A;  3TJG A;  2EFE A;  5ELG A;  1MDK A;  3KJY A;  3TKR A;  2HSM B;  3IPZ A;  3DRN A;  2LJA A;  2R0P A;  1ZOF A;  4IQ1 A;  1WPI A;  3GYK A;  2YZH A;  3FZ9 A;  1Z6N A;  3HJP A;  2K6V A;  3CSJ A;  1Z3E A;  1JHB A;  4EVM A;  3D21 A;  3UVH A;  2H30 A;  3D4T A;  4P3Y B;  3TKS C;  2HZE B;  2R37 A;  2LUS A;  1SK0 A;  1PKW A;  3HZ4 A;  4I5Q A;  2WS2 A;  4GST A;  4ID0 A;  2YWM A;  4WET A;  4IQA A;  4GRF A;  5CRD A;  5J9B A;  1AW9 A;  5J9C A;  2RUF A;  2FWF A;  2GQM A;  2VIM A;  1XW6 A;  3EWL A;  2OA7 A;  1ZYQ B;  1LU4 A;  5E4W A;  2XHF A;  1TI1 A;  3ZML A;  2VD1 A;  1YZX A;  3VI5 A;  5JWO B;  2GSR A;  1SK1 A;  3C73 A;  2JZT A;  1GSD A;  4YQU A;  6GSU A;  3Q19 A;  2CX4 A;  2LRN A;  1BED A;  4AJ6 A;  4BL7 A;  3APO A;  5G30 A;  4PUR A;  4AGS A;  2A2P A;  2Z9S A;  4AKG A;  2GZP A;  1BG5 A;  4KX4 A;  1V98 A;  3QFA C;  1G6Y A;  1GUL A;  4KSM A;  2P0G A;  4POL A;  3QD9 A;  4EE0 A;  4N30 A;  3KP8 A;  3GFK A;  4ECC A;  3IK9 A;  2B6M A;  3GX8 A;  1JLV A;  1NHO A;  4WEY A;  1YKA A;  1J0F A;  1URM A;  3CMI A;  2RLI A;  3DWV A;  2H1L A;  3EUR A;  2VLU A;  4HEA 2;  5IMZ A;  1XWK A;  2HRN A;  4WF5 A;  2G0F A;  5GAN D;  11GS A;  1HD2 A;  2R2J A;  3IHG A;  4NMU A;  1K0D A;  4WKW A;  2OE3 A;  3EYT A;  2H0I A;  5IOX A;  1Z9H A;  4KAE A;  1ACV A;  1K3O A;  1SJ6 A;  1TRW A;  4KA0 A;  2XBQ A;  3D0Z A;  3TRP A;  1MEK A;  2C3N A;  2X8H A;  1WRY A;  4TR1 A;  3TJB A;  2VO4 A;  2OE0 A;  1V40 A;  3M1G A;  1BG1 A;  3A5W A;  5A34 A;  2MBT A;  3FZ4 A;  4KCE A;  3WYW A;  4X43 A;  2K9F A;  2ZCT A;  3MYD A;  4PNF A;  2H1A A;  2O7K A;  3CBU A;  2H70 A;  2UZ8 A;  3GN3 A;  2VCT A;  1OC9 A;  2V6K A;  2R5G A;  4JRR A;  3EU3 A;  4DSQ A;  1ILO A;  2H6Y A;  4V1A p;  3UAP A;  2CA8 A;  5FT3 A;  4G2E A;  4RUV A;  4EDY A;  3ZIV A;  3WGE A;  3TJF A;  2XBI A;  2EFH A;  4BL7 B;  1HNA A;  1PSQ A;  2HSY A;  2PBJ A;  3QFB C;  4TN8 A;  2CZ2 A;  3GL3 A;  4K9Z A;  3C7M A;  5H5Q A;  3RHB A;  2GST A;  3P2A A;  2DML A;  1T8E B;  3F8U A;  2B7J A;  2BTO T;  1MD4 A;  1ERT A;  3ERF A;  4CHS A;  4OO4 A;  14GS A;  5CO3 A;  2B5X A;  2LTK A;  4TRX A;  4ZB8 A;  3LWA A;  4CY8 A;  4XCS A;  3W6G A;  2FA8 A;  4K6X A;  2VCX A;  2CT6 A;  4MMM A;  2KUC A;  5CAX A;  3M8N A;  3ME8 A;  1UVZ A;  1GNW A;  4KB3 A;  3ZMK A;  4BVX A;  3FEU A;  3PR8 A;  2O87 A;  3UL3 A;  4BWS A;  1M99 A;  4EUY A;  2V1M A;  5A5K A;  1BF5 A;  1PN0 A;  4NHW A;  4NAX A;  3G7J A;  3EPT A;  1EP7 A;  4KGI A;  2VKZ G;  2WCI A;  3QCP A;  4TR1 B;  2OBI A;  1FOH A;  3S9F A;  4ACS A;  5A34 B;  1XZO A;  4OFT A;  3IAS 2;  2WFC A;  1H4O A;  3EIN A;  4N0V A;  3ZL5 A;  4BVY A;  1ERU A;  5D93 A;  4XRD A;  2IMK A;  1Z7R A;  2GQL A;  2HQT A;  1A0F A;  4PUF C;  3TOT A;  1TTZ A;  1ZYP A;  1SKS B;  5B8A A;  2DKH A;  1JFU A;  1TRU A;  2NPB A;  5JCU A;  1K0B A;  3BCI A;  1UA5 A;  2BMX A;  3VWX A;  2VUP A;  4PGT A;  2JAC A;  3HXS A;  1QFN A;  2FHE A;  4TOP A;  3F9U A;  5HR3 A;  4KDY A;  1SEN A;  4Q5Q A;  3R2Q A;  1T4Y A;  4O5U A;  3KH7 A;  2A4H A;  1XWA A;  5HFI A;  2H75 A;  3I43 A;  5A4U A;  2ZNM A;  3F4R A;  1T3B A;  2LQQ A;  5F06 A;  5ABR A;  1A24 A;  1GH2 A;  5DDL A;  2MMZ A;  3BOA A;  3C1R A;  2RUE A;  4F2I A;  2VOC A;  2VLV A;  1S3A A;  5EPF A;  3KMN A;  3DYR A;  1HQO A;  3GA4 A;  2I3Y A;  2HI7 A;  4EO3 A;  2L6C A;  1KEB A;  1TRS A;  2HZF A;  2AB6 A;  3NIV A;  4KH7 A;  4L0U A;  3QAW A;  1UN2 A;  4X4J A;  5JCW A;  2CQ9 A;  1K3L A;  3GMF A;  2IL3 A;  3GTU A;  4HZ2 A;  2YAN A;  1B8X A;  5D96 A;  1K0N A;  2EFD A;  2LNS A;  5IOW A;  1O73 A;  2ZUP A;  1DE2 A;  4BVX B;  1FVK A;  2FGX A;  3K8N A;  3JCM L;  1XOB A;  2LRC A;  4MPG A;  1PD2 1;  3TDG A;  4V2N A;  2QGV A;  2R6K A;  1XOA A;  1JZO A;  1J08 A;  3D6I A;  3HZ8 A;  3ZFL A;  2EC4 A;  4I2U A;  1M9B A;  3F6D A;  4GWR A;  1ZYE A;  1TK0 B;  2GS3 A;  1ML6 A;  4BVY B;  1O8W A;  5DCG A;  4L0W A;  1B4P A;  3OR5 A;  2TRC P;  4X1U A;  4GLT A;  2KOK A;  5B6M A;  3DXB A;  3KGK A;  1EOG A;  3EMP A;  5BMU A;  5EY6 A;  4GF0 A;  3Q18 A;  2GLR A;  1SKW B;  1B48 A;  3LFL A;  4EKZ A;  2I9H A;  4GCI A;  4A5P A;  3GH9 A;  1VF1 A;  4KDX A;  1PA3 A;  2DJJ A;  4AJ8 A;  4GQF A;  5B8B A;  2NVL A;  4GSS A;  3WGX A;  1KTE A;  9GSS A;  1TKD B;  3I9V 2;  1SU9 A;  3F3R A;  3TB2 A;  5G5E A;  5JWR B;  1Q4J A;  1Y25 A;  1Q98 A;  1XBS A;  1XFL A;  3GH6 A;  3IXR A;  4MH3 A;  2IN3 A;  3AY8 A;  3Q74 A;  5ECR B;  4MJB A;  5IO0 A;  1U6T A;  3D22 A;  4IS0 A;  3H4K A;  3VI7 A;  2B5Y A;  1XIY A;  5ECN B;  1SYR A;  1TDI A;  3W8J A;  2H1G A;  1GUH A;  4QL7 A;  3TKS A;  4LL1 B;  2VCZ A;  3BBY A;  5CRE A;  3EVI A;  3CRU A;  1PRX A;  3H79 A;  2VCV A;  3FYG A;  3GTU B;  4FYB A;  3DVW A;  1FVJ A;  2JZS A;  4JE1 A;  1G7O A;  2YNX A;  3GNJ A;  1KNG A;  5HFK A;  4G0K A;  2CZ3 A;  3F0I A;  5D9T A;  5B7C A;  3WD6 A;  1YF1 A;  2FCH A;  1T4Z A;  3HHV A;  1GL8 A;  1K0M A;  3A2V A;  4L5O A;  5J5N A;  3HCZ A;  1A2L A;  3KMO A;  4KSO A;  2HSN A;  4POB A;  4ML1 A;  4TR0 A;  2C8U A;  1THO A;  1QK8 A;  5DBQ A;  2X8C A;  4EXJ A;  4JR4 A;  1X9M B;  5IMF A;  3VUR A;  5H5S A;  4ZL9 A;  4IBP A;  3FKF A;  1JZW A;  3ISO A;  2RM6 A;  3NOF A;  2WRT A;  1R26 A;  3UJ1 A;  2HRK A;  3PH9 A;  4XTS A;  4MZW A;  2I4A A;  3I69 A;  2L59 A;  1T7P B;  4HS1 A;  5D9V A;  3VFI A;  5BMU B;  4TW5 A;  4MDC A;  2C0E A;  5KN1 A;  3HJO A;  5IMA A;  4EIP A;  3LXZ A;  1G7E A;  1PL1 A;  4J57 E;  4AKX B;  1FHE A;  4RQR A;  3E9J B;  1TK5 B;  2CX3 A;  4WBR D;  4JR6 A;  3F4S A;  3NZN A;  3TOU A;  4TVE A;  1A8Y A;  1DUG A;  3H1N A;  5F07 A;  5LD0 A;  4NWY A;  1TW9 A;  2HT9 A;  4BWQ A;  3A2X A;  4HU9 A;  4QL9 A;  4N10 A;  1DE1 A;  12GS A;  4KCA A;  1LBK A;  2I1U A;  4JED A;  3MAK A;  5F05 A;  2PMT A;  4ICY A;  1BQ7 A;  4K2X A;  2H71 A;  1WE0 A;  1B9Y C;  2VCQ A;  2H1D A;  4TXO B;  1T00 A;  3GST A;  2O85 A;  3GV1 A;  2YZU A;  2IMI A;  2YN1 A;  1K0C A;  1SL1 B;  2KHP A;  4Z2R A;  4KDU A;  4JBB A;  1SVL A;  3CWG A;  3V1W A;  4MPF A;  3PGT A;  3DIE A;  3EE2 A;  2EFC A;  3RBT A;  5IMD A;  4FH8 A;  5CNW A;  2IPA A;  2CVD A;  2DJ1 A;  3G7Y A;  2GZZ A;  2DLX A;  2R3X A;  3DGQ A;  5GST A;  4X0X A;  2B7K A;  2EIO A;  2GTU A;  3TU3 B;  3LGC A;  3LG6 A;  4JZQ A;  2IFQ A;  2YJ7 A;  1TU7 A;  2FWH A;  3FR3 A;  19GS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...