5DALB

Crystal structure of human glutathione transferase pi complexed with a metalloid in the presence of glutathione
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
209
structure length
209
Chain Sequence
PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase P
publication title Visualisation of Organoarsenic Human Glutathione Transferase P1-1 Complexes: Metabolism of Arsenic-based Therapeutics
rcsb
source organism Homo sapiens
total genus 79
structure length 209
sequence length 209
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2015-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02798 GST_N Glutathione S-transferase, N-terminal domain
B PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5dalB02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5dalB01
2KP1A 3RBTA 2YZUA 4Q5FA 4O7HA 3HVXA 2EIOA 3IA1A 4PTSA 1SJIA 4K8MA 3WGEA 4KE3A 2VLVA 3HDCA 1MD3A 3LGCA 4MMMA 4BVXA 4KCAA 2WGRA 1TXXA 2H0GA 1O8XA 3DRNA 3Q74A 2HRKA 2B5XA 1U3AA 2CX3A 3GRXA 5IMVA 1ZZYA 2LUSA 3DVWA 2P5RA 3DGQA 3O76A 1XWGA 2LRTA 3L0HA 18GSA 3A5WA 3KH7A 3TJBA 1HNBA 2C80A 4KDUA 1GSDA 3FY7A 3A2XA 2YANA 5CRGA 2FGXA 3APQA 1R5AA 2GQKA 2AHEA 2LJRA 1B4QA 2GT6A 5IMCA 3A3TA 2C0GA 4FYBA 1EV9A 2PUKC 3UAPA 2H6YA 2MBTA 1BJXA 2DJJA 2B7KA 3CXGA 2WS2A 1UC7A 1GULA 1WJKA 3EE2A 3TKQA 3F6DA 1GLQA 1QUWA 2B7JA 4OMVA 2DIZA 1ZOFA 2IPAA 2YWOA 2H71A 1F3BA 2JL4A 2DMLA 2YV7A 2YWIA 5ECPB 5IIZA 1PA3A 4EKZA 3QAVA 1PKZA 4WF5A 3C8EA 2P0GA 1X9WB 1X0RA 5CP1A 2FY6A 1NHOA 1X5CA 1OAZA 2HSNB 2DJ1A 2AV4A 4ZBBA 2PU9C 5DALB 5H5SA 2F51A 3KTLA 2PERA 4XS1A 1XWAA 3F3RA 4MF6A 2Z9SA 3UOMA 1U87A 3QR6A 2AB6A 4IELA 4HU7A 5IM9A 2VCZA 3I6AA 4IQ1A 3IV4A 4TR4A 1K3OA 3O3TA 3VLNA 3VK9A 3ERFA 4FIWA 4HQZA 3TGZA 1PL1A 3IRAA 1ML6A 1BAYA 1JLVA 1Y25A 4WEYA 4MDCA 4G19A 2DMMA 1ZL9A 3ZVJA 4NV5A 4ZL8A 5AGYA 16GSA 4ZIJA 5AN1A 1XBSA 3TKRA 2H74A 4YQVA 4Q5NA 2BJXA 6GSXA 3NZNA 1TRSA 1DE2A 1AUCA 5IMAA 3RHCA 3LXTA 4ECIA 1GTUA 4MZBA 4KW6A 2WZ9A 1PN9A 4EC0A 2VL9A 2B1LA 4V1Ap 3ED3A 2PGTA 3HVVA 4O92A 1V58A 1W4VA 1SL0B 2N5AA 3GSSA 2DJKA 2IIYA 1Z6NA 3ZMLA 4TXOB 3F4RA 4LA1A 1PD21 3NOFA 4MF5A 3FRCA 1SK1A 4AGSA 1GNWA 3LORA 1BYEA 1EZKA 3F4TA 5ABRA 4FYUA 3LYKA 4O5RA 2C3TA 4L5OA 4RI6A 4EDYA 1KBNA 1TI3A 2DC5A 1ZCPA 5KEJA 1AQVA 3F0IA 3CSJA 3BOAA 6GSSA 1K3LA 5ECKB 2CA8A 2OA7A 4FYCA 3W8JA 2QGVA 2X8HA 3ZIVA 2DJ3A 5J9BA 5DCHA 2TRXA 1FB6A 1ERTA 1A2JA 3KM6A 1G7EA 1FO5A 1QXHA 4YQMA 2KLXA 3PH9A 4ECJA 1CQGA 4MP4A 5JCGA 2VM2A 5CAXA 4JBBA 2IL3A 1PL2A 1KNGA 4MPGA 3WYWA 3HCZA 3P2AA 1XXUA 1F3AA 2GTUA 2RM6A 1ABAA 2A4VA 4MJAA 2WULA 1RW1A 2GSQA 3I43A 3KGKA 5F8BA 3U5RE 2VCQA 1GUHA 3KCMA 2FWHA 1GSEA 1TRUA 1JZDA 1V98A 4EXJA 1PMTA 2HFDA 1OC3A 1S3DA 2BMXA 2GLRA 4JRRA 4CHSA 2MZCA 13GSA 5A4VA 2M72A 5CRHA 2O87A 3U6VA 4ISDA 3IR4A 2H72A 3FZAA 1XIYA 4ZL7A 2ON5A 3LSZA 2P31A 2ZCTA 4XCSA 5JCWA 5CRWA 4IP1A 4V2LA 2N5BA 4GSSA 2PVOC 4POMA 5AISA 5D9VA 4ZB9A 2V6OA 5LNKe 1IYHA 1T00A 2FHEA 4G0LA 1RQMA 3H93A 1J0FA 2L6DA 3Q19A 4JR4A 2JZRA 5G31A 4IS0A 5G1KA 3FKFA 2C0FA 2K18A 3N9JA 1NM3A 1TI1A 4IHUA 2L5LA 3H8QA 2H1BA 2C0EA 4OO4A 3TB2A 4LLRA 2JZTA 3TOTA 1A2MA 1ON4A 4WBRD 2R3XA 4DVCA 2F9SA 5D73A 14GSA 4I2UA 3G7IA 1EGRA 1EEMA 2O8VB 1B8XA 5L71A 4WETA 1S3AA 1J08A 3TKPA 2OE1A 2DJ0A 1ERWA 1AAZA 5EL8A 1JFUA 2V32A 2MMNA 1V57A 5DJMA 4K0NA 3GIXA 3H79A 4DSSB 2AAWA 2HLSA 4IVFA 3IE3A 2I81A 1FW1A 3KEBA 3HJPA 5ECNB 4HOJA 3C71A 3TRQA 4GQFA 1PKWA 2H30A 2XPEA 1OE8A 1K0BA 3G7JA 2H66A 2ON7A 3L9UA 3CTGA 1WE0A 1UVZA 2NVLA 4DSQA 1A2LA 4GQCA 2N5FA 5HFIA 1M2AA 5IO2A 2H6ZA 2ZUPA 3VPTA 1GTIA 1M2BA 3J7Yk 3UMAA 3GNJA 4NAXA 3BCKA 1C72A 1URMA 2H0IA 3GKXA 4F9ZA 1T7PB 5ECLB 2NDOA 5DAKB 1MDKA 3UVTA 4RQXA 1M99A 3C7MA 4KF9A 2JADA 1WIKA 4PQHA 2HRFA 3DD3A 2GSRA 5BMUA 2L6CA 2WJUA 3LXZA 1VF4A 2IJYA 1X9MB 2HRNA 2EC4A 2MMOA 4ZXGA 2PBJA 5AIVA 2H8LA 2H1AA 2O89A 5F06A 3ZTLA 2CQ9A 5EVOA 3GN3A 4K7OA 2YWMA 3PGTA 3D6IA 2OJLA 5DALA 3TRXA 3F8UA 2B6MA 3IXRA 1AXDA 3APSA 4XIHA 2L4CA 1SD8A 2C1YA 3FR9A 3DYRA 12GSA 2P5QA 1YQ1A 3M0FA 4RUVA 3C73A 3DMLA 1EV4A 4QL7A 1FOVA 5ID2B 2IFQB 4AF2A 3D0ZA 2VD0A 1LBKA 2C8UA 5ECQB 9GSSA 2CZ3A 3IAM2 1FAAA 1UN2A 1K0AA 2C4JA 4TR1B 2B1KA 6GSTA 2GSTA 4GSTA 2VIMA 4NWYA 2CZ2A 4I97A 1F9MA 1YZXA 1SYXA 2X8CA 1DUGA 1OE7A 1VGLA 1O85A 2FNOA 5FWGA 3GTUA 3QAWA 3L78A 4G2EA 4BVYA 1NW2A 2LRCA 2V1MA 2VOCA 1OYJA 2MMAA 2K6VA 1WOUA 4NMUA 4EO3A 6GSUA 4YAPA 4J57E 1MD4A 2RLIA 4PURA 3VURA 4XS4B 5IOWA 3QFAC 5ECIB 2YOIA 3UBLA 2J9HA 4WKWA 2HNLA 3DWVA 3HJOA 3M9JA 4N30A 5B7CA 1O73A 1QFNA 1M9AA 1TTZA 4OCFA 2OBKA 2ALBA 4FO5A 2HSMB 3GYKA 3CSIA 4MH3A 3IC8A 2VAFA 2RUFA 3VFIA 1OC9A 3LYPA 2XBQA 1K3YA 2HXKA 4KA0A 3TCOA 1X9SB 1NSWA 5CYYA 5DVBA 4GWRA 2HYXA 1Y6EA 3EWLA 2FLSA 2MYGA 3A2VA 1GUKA 2RUEA 3H1NA 4D73B 3WGDA 2REMA 3FYGA 1AC1A 2KHPA 2HZEA 5LD0A 4L0UA 1EWXA 4BWQA 2PWJA 1TOFA 5HFKA 1WP0A 2YPMA 5GAPD 2GZZA 4K0GA 3QDNA 3V1WA 2JU5A 3GUSA 1GH2A 2D2ZA 1T8EB 1SL2B 1V2AA 4KH7A 3C1SA 1YEPA 1GSQA 5IMZA 2CVKA 3EU4A 1LJRA 4POBA 3UJ1A 2AUVA 3BJ5A 3EYTA 1EOGA 4ZB8A 2I3YA 3MSZA 1R7HA 2FD3A 4PUFC 1MEKA 4GF0A 3A2WA 2IMKA 3VPQA 4POKA 1HNAA 3PINA 2QSIA 1SKSB 4OWYA 3QOUA 1JLWA 1GLPA 4MABA 1CQHA 2F8AA 2WDUA 3O6TA 4GSNA 2QC7A 1XWCA 5F05A 1BX9A 1E6BA 4ID0A 3GX8A 3EINA 1AQWA 4EUYA 5EPFA 2I1UA 4I2TA 1VF2A 3KMNA 3KJYA 2GGTA 4IKHA 1GP1A 5IQYA 3MAKA 2O7KA 1HD2A 2NPBA 2HZFA 3GKNA 5ECSA 2J23A 3TOUA 2CVBA 1XWBA 3M8NA 2GQMA 3F3QA 4KNDA 2E0QA 3F4SA 2E2GA 1FVJA 4BVXB 3RDWA 2HRKB 3DKSA 2GDRA 4IQAA 4CDOA 1SD9A 3LFLA 3ZFLA 3IOSA 4OFTA 5D9XA 4HJ2A 3IPZA 4NHZA 4MJBA 1B4PA 3HZ8A 22GSA 4FQUA 4ZBAA 2VLUA 3BD2A 1DSBA 1XCCA 2FWEA 2IN3A 4KCEA 1B9XC 2WFCA 3TUEA 3EVIA 1PX7A 3N5OA 3EURA 3KP9A 3DEXA 4G0KA 1ZGNA 2M46A 3DXBA 4JE1A 5F0GA 3UVHA 2G0FA 1Z3EA 1K0MA 3W8SA 2DSAA 4BWSA 2LRNA 4ML1A 1N2AA 3IDVA 4OCEA 4TN8A 2EIRA 3FEUA 1EEJA 4PUAA 5D8IA 4HU9A 4ML6A 4BA7A 5IO0A 3LEFA 2VD1A 3L4NA 1WMJA 1GTAA 4KSMA 5FT3A 3GMFA 5DJLA 1TP9A 3WT1A 2UZ8A 4WR4A 5JWOB 3UL3A 3D22A 3ZITA 3GURA 3VWUA 4K6XA 2VLTA 2YP6A 1YY7A 1XOBA 2L5OA 3FR6A 3LJRA 1A8LA 5HQPA 5IPGA 2YV9A 3G7YA 1G6YA 1I5GA 2WB9A 3GKKA 1XOAA 3GV1A 2PN8A 2OKAA 2F3MA 2EIQA 1FHEA 1S3CA 4GLTA 4MLYA 4WR5A 1F37A 3IHQA 1SYRA 5CO3A 2IMDA 2O85A 3L9VA 1A8YA 2LTKA 3KIJA 1MTCA 1TK5B 2YNXA 2R37A 3ZMKA 3FZ5A 5GZZB 3LQ7A 2L59A 4YQUA 3US3A 5F07A 1PRXA 1SJZA 2FA8A 1SJ6A 1A0FA 1G0TA 5COHA 2FCHA 1GSYA 3EC3A 1X5DA 4H86A 2MMZA 3PPUA 3KMOA 2TRCP 1WPIA 2JACA 2GZPA 4HEA2 5D9WA 2LQOA 3CYNA 1ST9A 2E7PA 1GWCA 2DIYA 3HZ4A 8GSSA 4HUAA 4GTUA 1XW5A 5EY6A 3EU3A 4Z7XA 4XS4A 3F63A 2OADA 3BBYA 4MPFA 5G2ZA 3GL3A 2H0HA 2H01A 2VL2C 5GSSA 3ISOA 1HNCA 4LMVA 1O6JA 2NBSA 3E3EA 4L0WA 4F82A 3P8WA 2VL2A 4N0ZA 3F6FA 2C3NA 4NHWA 1JZOA 3JCML 4IP6A 4IBPA 4N11A 4ZBDA 3FR3A 2C3QA 2HI7A 2K9FA 5J41A 4PGTA 2YJ7A 2VUPA 3P90A 3LG6A 2XC2A 1ZYEA 5J3RA 2LNSA 4XTSA 1Q98A 1JHBA 2WCIA 5FHIA 2VL3A 3WT2A 3IK7A 2FWGA 4NPBA 2DBCA 3ME8A 1B9YC 4TR0A 1XPVA 4LL1B 3IBHA 1YF1A 3G9BA 5DDLA 4K1FA 1BEDA 1ZMAA 1K0CA 2CAIA 4K7IA 4GXZA 5CRDA 1M9BA 4IN0A 2CT6A 3QFBC 1EP8A 2YZHA 4TOPA 5H5QA 10GSA 3KH9A 4PXOA 3ERWA 3DVXA 4RI7A 1TU7A 3ZIJA 2K8SA 2AJQB 4YAVA 2H73A 3IK9A 2GZYA 6GSWA 3E0UA 5KN3A 3PR8A 4G10A 2I4AA 5E59A 4XHMA 1AIUA 2DJ2A 4V1Ag 3FHKA 3D5JA 3EMPA 1THXA 3I9V2 4OFNA 5G5FA 2I9HA 1KTEA 3GKMA 4OFMA 1ILOA 1TK8B 4F0CA 1YF0A 5CREA 1Z5YE 2DLXA 4KB3A 4N0VA 1X5EA 2R4VA 1T4ZA 2B3SA 4TW5A 2H1GA 4TXOA 2LJKA 2VO4A 3M9KA 2GS3A 5INYA 2R2JA 3TJFA 3GHAA 4K9ZA 3K8NA 3L9SA 3W6GA 1XVWA 3Q18A 3ERGA 4E8EA 1BQ7A 3Q6OA 5IPHA 2YCDA 1A0RP 3UIWA 6GSYA 2GVPA 4Q5RA 1W89A 2HE3A 4HZ4A 1M0UA 1DBYA 4PNFA 4BL7B 1PQNA 3CSHA 2L57A 4JU5A 1SK0A 3SBCA 2OE3A 5B6MA 4JR6A 4ZILA 2LV3A 2R5GA 2X99A 1GL8A 3CBUA 4TR3A 2RIIA 2YJHA 2XBIA 6GSVA 1R4WA 4J56E 4ECCA 3DIEA 4ZB6A 1XW6A 1OKTA 3I69A 1TK0B 1ACVA 2ES7A 1R5PA 3D4MA 2OBIA 1YDKA 2H75A 2IWTA 2FWFA 4E8HA 2CAQA 1Q4JA 1I9DA 1XWKA 1SENA 1T3BA 1THOA 4X1UA 2L4QA 2NTOA 2HRAA 3MNGA 1IYIA 2LEGA 3FZ4A 3RHBA 5ECHB 4ZL9A 1V9WA 4QL9A 3RAZA 4TXVA 4MJEA 3F9UA 1Z9HA 5G30A 2KP2A 3MWHA 4Q5QA 1MDJA 4MF7A 5IMFA 1GUMA 1M2DA 3TJKA 2LKUA 3ME7A 3TJGA 1TKDB 4LL4B 1OVNA 4GCIA 4HS1A 2A2SA 2LS5A 4TVEA 3QAGA 1WWJA 2YN1A 4TRXA 1K0NA 1A23A 3UARA 4MCUA 4NV2A 5HR0A 1OC8A 3VI7A 4X0XA 3QD9A 5JCUA 5C04A 3GX0A 1V40A 1A24A 1TRWA 5A5KA 3ZRDA 4EDZA 4AJ6A 1YKCA 5D93A 3ZYWA 2AYTA 2PVQA 4KX4A 3J7Yb 4OD7A 1Z7RA 1ERUA 2FA4A 4EF0A 2GQLA 5J5NA 5GAND 3QMXA 4DSSA 1SK2A 1GSSA 3VWXA 4EL1A 1PX6A 1XFLA 3KZQA 4POLA 4IGJA 1EOHA 2XPDA 1AQXA 4NXIA 5KN0A 1JZRA 1Z6MA 2H19A 4QQ7A 3GTUB 3EMXA 4V2MA 4BVYB 2X64A 5D9TA 5B6NA 4FH8A 1B48A 1FG4A 1TDIA 4PQ1A 4BPYA 4F03A 5B8AA 2H76A 1O7UA 2H70A 5DQYA 4WBJA 3KD0A 2MBSA 1E2YA 2VCWA 1GSFA 1F6MC 2LSTA 3HJMA 1HYUA 4HZ2A 1TJDA 2V41A 5HFGA 3TRPA 4PNGA 3KXOA 2TIRA 4MZCA 2FUG2 3WD6A 4WXTA 2JSYA 5DCGA 5DAKA 1FB0A 4GRFA 3RPNA 3LWAA 3M3MA 3HD5A 3VWVA 3HY2A 1O8WA 4K2DA 3HXSA 5HR1A 1O81A 4ACSA 3IC4A 1U6TA 2B5EA 1OC9B 4K7NA 1GSUA 2LJAA 1EGOA 2M80A 1GTBA 3P7XA 5CNWA 3H4KA 4KGIA 3CMIA 1LU4A 2HT9A 1OKDA 4CW9A 4RQRA 4MK3A 1T1VA 4N10A 1G6WA 2OE0A 4KAEA 5ENUA 5LCZA 3FW2A 2JSZA 2HZEB 3IAS2 1HQOA 4JEDA 2K8VA 2WRTA 4KDXA 3GA4A 1QK8A 2XHFA 4USSA 1ERVA 4ILFA 3R3EA 5GSTA 7GSSA 1GRXA 5ID2A 3E9JB 3CTFA 2X8GA 1EP7A 2IFQA 2HSYA 3SWLA 1XZOA 5J4UA 2LQQA 3APOA 4MA9A 5ECOB 4WF4A 3KP8A 3TKSE 3WGXA 4I6XA 2IMIA 11GSA 3TKSC 3ZLPA 2GT5A 4PX1A 4P3YB 4TR1A 5D96A 1BG5A 1R26A 1XW9A 4V2NA 4IW9A 2V6KA 1KEBA 1XVQA 5IMDA 3TKSA 1YEXA 4OO5A 2KOKA 3HKRA 2IMEA 4I5QA 1TRVA 2JZSA 3HVSA 4KUNA 2IMFA 4LMWA 1MDIA 3HHVA 1T4YA 5HR2A 4MZWA 5JWRB 1GNEA 1VF1A 4XS6A 1SKRB 2VCTA 2C0DA 2YWNA 4G0IA 4IJIA 4EVMA 4PQIA 5A4UA 1AW9A 1H4OA 2A2RA 4JZQA 1K0DA 2CVDA 4F0BA 1M7TA 2H1DA 5HR3A 19GSA 1FVKA 3VWWA 1SU9A 1U3IA 3ZREA 1PGTA 1N8JA 2PMTA 3RPPA 3GFKA 2GSSA 5J9CA 4EE0A 3ZFBA 4BL7A 1J9BA 2QKEA 3M1GA 4I8BA 2VCVA 1DE1A 17GSA 3VI5A 5KN1A 5DBQA 1K0OA 3BCIA 3KTBA 3HYPA 4O32A 3ZL5A 2G2QA 2HSMA 3D21A 2CX4A 2VCXA 3FK8A 3ZVJD 4DEJA 4HDEA 4TKYA 5C00A 3D4TA 3S9FA 4ECBA 4ULXA 2KUCA 4HQSA 4IJ3A 4KDYA 5A4WA 5ECMB 1WRYA 3UEMA 3TDGA 3NIVA 3GH9A 1VRSD 2HSHA 5H5RA 1ZYQB 4DSRA 5G1LA 1YKAA 4MH2A 4KSOA 4L8EA 3ZZXA 3AY8A 1QGVA 2ZNMA 3MDKA 3QCPA 4D73A 3TJJA 3OR5A 2RM5A 5G5EA 1SL1B 1RK4A 5B8BA 1U88A 4F2IA 4YH2A 1G7OA 4J2FA 2OACA 2R6KA 2B5YA 3R2QA 3GSTA 20GSA 3QPMA 4HI7A 5DQSA 5ELGA 2V2GA 5ELAA 2H6XA 1SKWB 2CV4A 2VM1A 2LNTA 1TU8A 2F8FA 2BTOT 3FZ9A 1Z7PA 3UBKA 1H75A 4AJ8A 5E4WA 1F2EA 2HQTA 5KN2A 4MJCA 3C1RA 1QQ2A 4AJ7A 4XRAA 1UA5A 4G9HA 1QMVA 1YJ6A 3HA9A 1USBA 1PSQA 3CRUA 3GL5A 5IOXA 2PPTA 1VF3A 2E2MA 4XRDA 4X43A 5JWQB 3GH6A 1JZWA 4HJMA 1NHYA 3CRTA 5AIXA 4L5LA 1TW9A 5ECRB
chains in the Genus database with same CATH superfamily
2KP1A 3RBTA 2YZUA 4Q5FA 4O7HA 3HVXA 2EIOA 3IA1A 4PTSA 1SJIA 4K8MA 3WGEA 4KE3A 2VLVA 3HDCA 1MD3A 3LGCA 4MMMA 4BVXA 4KCAA 2WGRA 1TXXA 2H0GA 1O8XA 3DRNA 3Q74A 2HRKA 2B5XA 1U3AA 2CX3A 1SVMA 2OT3A 3GRXA 5IMVA 1ZZYA 2LUSA 3DVWA 2P5RA 3DGQA 3O76A 1XWGA 2LRTA 3L0HA 18GSA 3A5WA 3KH7A 3TJBA 1HNBA 2C80A 4KDUA 1GSDA 3FY7A 3A2XA 2YANA 5CRGA 2FGXA 3APQA 1R5AA 2GQKA 2AHEA 2LJRA 1B4QA 2GT6A 5IMCA 3A3TA 2C0GA 4FYBA 1EV9A 2PUKC 3UAPA 2H6YA 2MBTA 1BJXA 2DJJA 2B7KA 3CXGA 2WS2A 1UC7A 1GULA 1WJKA 1XG8A 3EE2A 3TKQA 3F6DA 1GLQA 1QUWA 2B7JA 4OMVA 2DIZA 1ZOFA 2IPAA 2YWOA 2H71A 1F3BA 2JL4A 2DMLA 2YV7A 2YWIA 3RFRC 5ECPB 5IIZA 1PA3A 4EKZA 3QAVA 1PKZA 4WF5A 3C8EA 2P0GA 1X9WB 1X0RA 5CP1A 2FY6A 1NHOA 1X5CA 1OAZA 2HSNB 2DJ1A 2AV4A 4ZBBA 2PU9C 5DALB 5H5SA 2F51A 5A5HB 3KTLA 2PERA 1BF5A 4XS1A 1XWAA 3F3RA 4MF6A 2Z9SA 3UOMA 1U87A 3QR6A 2AB6A 4IELA 4HU7A 2DKHA 5IM9A 2VCZA 3I6AA 4IQ1A 3IV4A 4TR4A 1K3OA 3O3TA 3VLNA 3VK9A 3ERFA 4FIWA 2WVXB 4HQZA 3TGZA 1PL1A 3RGBC 3IRAA 1ML6A 1BAYA 1JLVA 1Y25A 4WEYA 4MDCA 4G19A 2DMMA 1ZL9A 3ZVJA 4NV5A 4ZL8A 5AGYA 16GSA 4ZIJA 5AN1A 1XBSA 3TKRA 2H74A 4YQVA 4Q5NA 2BJXA 6GSXA 3NZNA 1TRSA 1DE2A 1AUCA 5IMAA 3RHCA 3LXTA 4ECIA 1GTUA 4MZBA 4KW6A 2WZ9A 1PN9A 4EC0A 2VL9A 2B1LA 4V1Ap 3ED3A 2PGTA 3HVVA 4O92A 1V58A 1W4VA 1SL0B 2N5AA 3GSSA 2DJKA 2IIYA 1Z6NA 3ZMLA 4TXOB 3F4RA 4LA1A 1PD21 3NOFA 4MF5A 3FRCA 1SK1A 4AGSA 1GNWA 3LORA 1BYEA 1EZKA 3F4TA 3CHXC 5ABRA 4FYUA 3LYKA 4O5RA 2C3TA 4L5OA 4RI6A 4EDYA 1KBNA 1TI3A 2DC5A 2DKIA 1ZCPA 5KEJA 1AQVA 3F0IA 3CSJA 3BOAA 6GSSA 1K3LA 5ECKB 2CA8A 2OA7A 4FYCA 3W8JA 2QGVA 2X8HA 3ZIVA 2DJ3A 5J9BA 2UV8G 5DCHA 2TRXA 1FB6A 1ERTA 1A2JA 3KM6A 1G7EA 1FO5A 1QXHA 4YQMA 2KLXA 3PH9A 4ECJA 1CQGA 4MP4A 5JCGA 2VM2A 5CAXA 1S4BP 4JBBA 2IL3A 1PL2A 1KNGA 4MPGA 3WYWA 3HCZA 3P2AA 1XXUA 1F3AA 2GTUA 2RM6A 1ABAA 2A4VA 4MJAA 2WULA 1RW1A 2GSQA 3I43A 3KGKA 5F8BA 3U5RE 2VCQA 1GUHA 3KCMA 2FWHA 1GSEA 1TRUA 1JZDA 1V98A 4EXJA 1PMTA 2HFDA 1OC3A 1S3DA 2BMXA 2GLRA 4JRRA 4CHSA 2MZCA 13GSA 5A4VA 2M72A 5CRHA 2O87A 3U6VA 4ISDA 3IR4A 2H72A 3FZAA 1XIYA 4QMKA 4Z2TA 4ZL7A 2ON5A 3LSZA 2P31A 2ZCTA 4XCSA 5JCWA 5CRWA 4IP1A 4V2LA 2N5BA 4GSSA 2PVOC 4POMA 5AISA 5D9VA 4ZB9A 2V6OA 5LNKe 1IYHA 1T00A 4EIPA 2FHEA 4G0LA 1RQMA 3H93A 1J0FA 4HSCX 2L6DA 3Q19A 4JR4A 2JZRA 5G31A 4Z2UA 4IS0A 5G1KA 3FKFA 2C0FA 2K18A 3N9JA 1NM3A 1TI1A 4IHUA 2L5LA 3H8QA 2H1BA 2C0EA 4OO4A 3TB2A 4LLRA 2JZTA 3TOTA 1A2MA 1ON4A 4WBRD 4MNNA 2R3XA 4DVCA 2F9SA 5KOXA 5D73A 14GSA 4I2UA 3G7IA 5A34A 1EGRA 1EEMA 2O8VB 1B8XA 5L71A 4GDFA 4WETA 1S3AA 1J08A 3TKPA 2OE1A 2WVZA 2DJ0A 1ERWA 1AAZA 5EL8A 1JFUA 2V32A 2MMNA 1V57A 5DJMA 4K0NA 3GIXA 3H79A 4DSSB 2AAWA 2HLSA 4IVFA 3IE3A 2I81A 1FW1A 3KEBA 3HJPA 5ECNB 2WW3A 4HOJA 3C71A 3TRQA 4GQFA 1PKWA 2H30A 4W66A 2XPEA 1OE8A 1K0BA 3G7JA 2H66A 2ON7A 3L9UA 3CTGA 1WE0A 1UVZA 2NVLA 4DSQA 1A2LA 4GQCA 2N5FA 5HFIA 1M2AA 5IO2A 2H6ZA 2ZUPA 3VPTA 1GTIA 1M2BA 3J7Yk 3UMAA 3GNJA 4NAXA 3BCKA 1C72A 1URMA 2H0IA 3GKXA 4F9ZA 1T7PB 5ECLB 2NDOA 2WW0A 5DAKB 1MDKA 3UVTA 4RQXA 1M99A 1M3IA 3C7MA 4KF9A 2JADA 1WIKA 5BRTA 4PQHA 2HRFA 3DD3A 2GSRA 5BMUA 2L6CA 2WJUA 3LXZA 1VF4A 2IJYA 1X9MB 2HRNA 2EC4A 2MMOA 1N25A 4ZXGA 2PBJA 5AIVA 2H8LA 2H1AA 2VKZG 2O89A 5F06A 3ZTLA 2CQ9A 5EVOA 3GN3A 4K7OA 1SVOA 2YWMA 3PGTA 3D6IA 2OJLA 5DALA 5J40A 3TRXA 3F8UA 2B6MA 3IXRA 1AXDA 3APSA 4XIHA 2L4CA 1SD8A 2C1YA 3FR9A 3DYRA 12GSA 2P5QA 1YQ1A 4YKFA 3M0FA 4RUVA 3C73A 3DMLA 1EV4A 4QL7A 1FOVA 5A1NA 5ID2B 2IFQB 4AF2A 4AI6A 3D0ZA 2VD0A 1LBKA 2C8UA 5ECQB 9GSSA 2CZ3A 3IAM2 1FAAA 1UN2A 1K0AA 2C4JA 4TR1B 2B1KA 6GSTA 2GSTA 4GSTA 4PHZC 2VIMA 4NWYA 2CZ2A 4I97A 1F9MA 1YZXA 1SYXA 2X8CA 1DUGA 1OE7A 1VGLA 1O85A 2FNOA 5FWGA 3GTUA 4AKGA 3QAWA 3L78A 4G2EA 4BVYA 1NW2A 2O36A 2LRCA 2V1MA 2VOCA 1OYJA 2MMAA 2K6VA 1WOUA 4NMUA 4EO3A 6GSUA 4YAPA 4J57E 1MD4A 2RLIA 4PURA 3VURA 4XS4B 5IOWA 3QFAC 5ECIB 2YOIA 3UBLA 2J9HA 4WKWA 2HNLA 3DWVA 3HJOA 3M9JA 1YVLA 5B7CA 1O73A 4N30A 1QFNA 4PI0C 1M9AA 2WW2A 1TTZA 4OCFA 2OBKA 2ALBA 4FO5A 2HSMB 3GYKA 3CSIA 4MH3A 3IC8A 2VAFA 2RUFA 3VFIA 1OC9A 3LYPA 2XBQA 1K3YA 2HXKA 4KA0A 3TCOA 1X9SB 1NSWA 5CYYA 5DVBA 4GWRA 2HYXA 1Y6EA 3EWLA 2FLSA 4ZB7A 2MYGA 3A2VA 1GUKA 2RUEA 3H1NA 4D73B 3WGDA 2REMA 3FYGA 1AC1A 1BG1A 2KHPA 2HZEA 5LD0A 4L0UA 1EWXA 4BWQA 2PWJA 1TOFA 5HFKA 1WP0A 2YPMA 5GAPD 2GZZA 4K0GA 3QDNA 1S3RA 2JU5A 3V1WA 3HVNA 3GUSA 1GH2A 2D2ZA 1T8EB 1SL2B 1V2AA 4AKXB 3MYDA 4KH7A 3C1SA 1YEPA 1GSQA 5IMZA 3CWGA 2CVKA 3EU4A 3CQFA 1LJRA 4POBA 3UJ1A 2AUVA 3BJ5A 3EYTA 1EOGA 4ZB8A 2I3YA 3MSZA 1R7HA 2FD3A 4PUFC 4AKIA 1MEKA 4GF0A 3A2WA 2IMKA 3VPQA 4POKA 1HNAA 3PINA 2QSIA 1SKSB 4OWYA 3QOUA 1JLWA 1GLPA 4MABA 1CQHA 1TXUA 2F8AA 2WDUA 3O6TA 4GSNA 2QC7A 1XWCA 5F05A 1BX9A 1E6BA 4ID0A 3GX8A 3EINA 1AQWA 4EUYA 5EPFA 2I1UA 4I2TA 1VF2A 3KMNA 3KJYA 2GGTA 4IKHA 1GP1A 5IQYA 3MAKA 2O7KA 1HD2A 2NPBA 2HZFA 3GKNA 5ECSA 2J23A 3TOUA 2CVBA 1XWBA 3M8NA 2GQMA 3F3QA 4KNDA 2E0QA 4YKGA 3F4SA 2E2GA 1FVJA 4BVXB 3RDWA 2HRKB 3DKSA 2GDRA 4IQAA 2R0PA 4CDOA 1SD9A 3LFLA 3ZFLA 3IOSA 4OFTA 5D9XA 4HJ2A 3IPZA 4NHZA 4MJBA 1B4PA 3HZ8A 22GSA 4FQUA 4ZBAA 2VLUA 3BD2A 1DSBA 1XCCA 2FWEA 2IN3A 4KCEA 2WW1A 1B9XC 2WFCA 3TUEA 3EVIA 1PX7A 3N5OA 3EURA 2X4AA 3KP9A 3DEXA 4G0KA 1ZGNA 2M46A 3DXBA 4JE1A 5F0GA 3UVHA 2G0FA 1Z3EA 1K0MA 3W8SA 2DSAA 4BWSA 2LRNA 4ML1A 1N2AA 3IDVA 4OCEA 4TN8A 2EIRA 3FEUA 1EEJA 4PUAA 5D8IA 3HMJG 4HU9A 4ML6A 4BA7A 5IO0A 3LEFA 2VD1A 3L4NA 1WMJA 1GTAA 4KSMA 5FT3A 3GMFA 5DJLA 1TP9A 3WT1A 2UZ8A 4WR4A 5JWOB 3UL3A 3D22A 3ZITA 3GURA 3VWUA 4K6XA 2VLTA 2YP6A 1YY7A 1XOBA 2L5OA 3FR6A 3LJRA 1A8LA 5HQPA 5IPGA 2YV9A 3G7YA 1G6YA 1I5GA 2WB9A 3GKKA 1XOAA 3GV1A 2PN8A 2OKAA 2F3MA 2EIQA 1FHEA 1S3CA 4GLTA 4MLYA 4WR5A 1F37A 3IHQA 1SYRA 3A5IA 5CO3A 2IMDA 2O85A 3L9VA 1A8YA 2LTKA 3KIJA 3IHGA 1MTCA 1TK5B 4AKHA 2YNXA 2R37A 3ZMKA 3FZ5A 5GZZB 3LQ7A 3MIXA 2L59A 4YQUA 3US3A 4FXYP 5F07A 1PRXA 1SJZA 2FA8A 1SJ6A 1A0FA 1G0TA 5COHA 2FCHA 1GSYA 3EC3A 1X5DA 4H86A 2MMZA 4A5PA 3PPUA 3KMOA 2TRCP 1WPIA 2JACA 2GZPA 1I1IP 4HEA2 5D9WA 2LQOA 3CYNA 1ST9A 2A2PA 2E7PA 1GWCA 2DIYA 3HZ4A 8GSSA 4HUAA 4GTUA 1XW5A 5EY6A 3EU3A 4Z7XA 4XS4A 3F63A 2OADA 3BBYA 4MPFA 5G2ZA 3GL3A 2H0HA 2H01A 2VL2C 5GSSA 3ISOA 1HNCA 4LMVA 1O6JA 2NBSA 3E3EA 4L0WA 4F82A 3P8WA 2VL2A 5J47A 4N0ZA 3F6FA 2C3NA 4NHWA 1JZOA 3JCML 4IP6A 4IBPA 4N11A 4ZBDA 3FR3A 2C3QA 2HI7A 2K9FA 5J41A 4PGTA 2YJ7A 2VUPA 3P90A 3LG6A 4BIKA 2XC2A 1ZYEA 5J3RA 2LNSA 4XTSA 1Q98A 1JHBA 2WCIA 5FHIA 2VL3A 3WT2A 3IK7A 2FWGA 4NPBA 2DBCA 3ME8A 1B9YC 4TR0A 1XPVA 4LL1B 3IBHA 1YF1A 3G9BA 2HSNA 5DDLA 4K1FA 1BEDA 5A5HA 1ZMAA 1K0CA 2CAIA 4K7IA 4GXZA 5CRDA 1M9BA 4IN0A 2CT6A 3QFBC 4O5UA 1EP8A 2YZHA 4TOPA 2WVXA 5H5QA 10GSA 3KH9A 4PXOA 3ERWA 3DVXA 4RI7A 1TU7A 3ZIJA 2K8SA 2R0CA 2AJQB 4YAVA 2H73A 3IK9A 2GZYA 6GSWA 3E0UA 5KN3A 3PR8A 4G10A 2I4AA 5E59A 4XHMA 1AIUA 2DJ2A 3FMWA 2X49A 3LW9A 4V1Ag 3FHKA 3D5JA 3EMPA 1THXA 3I9V2 4OFNA 5G5FA 2I9HA 1KTEA 3GKMA 4OFMA 1ILOA 1TK8B 4F0CA 1YF0A 5CREA 1Z5YE 2DLXA 4KB3A 4N0VA 1X5EA 2R4VA 1SVLA 1T4ZA 5A34B 2B3SA 4TW5A 2H1GA 4TXOA 2LJKA 2VO4A 3M9KA 2GS3A 5INYA 2R2JA 3TJFA 3GHAA 2WZSA 4K9ZA 3K8NA 3L9SA 3W6GA 3TU3B 1XVWA 3Q18A 4EIQA 3ERGA 2EFDA 4E8EA 1BQ7A 3Q6OA 5IPHA 2YCDA 1A0RP 3UIWA 6GSYA 2GVPA 4Q5RA 1W89A 2HE3A 4HZ4A 1M0UA 1DBYA 4PNFA 4BL7B 1PQNA 3CSHA 4X4JA 2L57A 4JU5A 1SK0A 3SBCA 2OE3A 5B6MA 4JR6A 4ZILA 2LV3A 2R5GA 2X99A 1GL8A 3CBUA 4TR3A 2RIIA 2YJHA 2XBIA 6GSVA 4N3ZA 1R4WA 4J56E 4ECCA 3DIEA 4ZB6A 1XW6A 1OKTA 3I69A 1TK0B 1ACVA 2ES7A 1Y1UA 1R5PA 3D4MA 2OBIA 1YDKA 2H75A 2IWTA 2FWFA 4E8HA 5BMUB 2CAQA 1Q4JA 1I9DA 1XWKA 1SENA 1T3BA 1THOA 4X1UA 2L4QA 2NTOA 2HRAA 3MNGA 1IYIA 2LEGA 3FZ4A 3RHBA 5ECHB 4ZL9A 1V9WA 4QL9A 3RAZA 4TXVA 4MJEA 3F9UA 2EFEA 1Z9HA 5G30A 2KP2A 3MWHA 4Q5QA 1MDJA 2EFCA 4MF7A 5IMFA 1GUMA 1M2DA 3TJKA 2LKUA 3ME7A 3TJGA 1TKDB 4LL4B 1OVNA 4GCIA 4HS1A 2A2SA 2LS5A 4TVEA 3QAGA 3EPTA 1WWJA 2YN1A 4TRXA 1K0NA 1A23A 3UARA 4MCUA 4NV2A 5HR0A 1OC8A 3VI7A 4X0XA 3QD9A 5JCUA 5C04A 5A1NB 4K5RA 3GX0A 1V40A 1A24A 1TRWA 4K2XA 5A5KA 3ZRDA 4EDZA 4AJ6A 4Z2RA 1YKCA 5D93A 3ZYWA 2AYTA 2PVQA 4KX4A 3J7Yb 4OD7A 1Z7RA 1ERUA 4G01A 2FA4A 4EF0A 2GQLA 5J5NA 5GAND 3QMXA 4DSSA 1SK2A 1GSSA 3VWXA 4EL1A 1PX6A 1XFLA 3KZQA 4POLA 4IGJA 1EOHA 2XPDA 1AQXA 4NXIA 5KN0A 1JZRA 1Z6MA 2H19A 4QQ7A 3GTUB 3EMXA 4V2MA 4BVYB 2X64A 5D9TA 5B6NA 4FH8A 1B48A 1FG4A 1TDIA 4PQ1A 4BPYA 4F03A 5B8AA 2H76A 1O7UA 2H70A 5DQYA 4WBJA 3KD0A 2MBSA 1E2YA 2VCWA 1GSFA 1F6MC 2LSTA 3HJMA 1PFOA 1HYUA 4HZ2A 1TJDA 2V41A 5HFGA 3TRPA 4PNGA 3KXOA 2TIRA 4MZCA 2FUG2 3WD6A 4WXTA 2JSYA 5DCGA 5DAKA 1FB0A 4GRFA 3RPNA 3LWAA 3M3MA 3HD5A 3VWVA 3HY2A 1O8WA 4K2DA 3HXSA 5HR1A 1O81A 4ACSA 3IC4A 4PI2C 1U6TA 2B5EA 1OC9B 4K7NA 1GSUA 2LJAA 1EGOA 2M80A 1GTBA 3P7XA 5CNWA 3H4KA 4KGIA 3CMIA 1LU4A 2HT9A 1OKDA 4CW9A 4RQRA 4MK3A 2EFHA 1T1VA 4N10A 2O3EA 1G6WA 2OE0A 4KAEA 5ENUA 5LCZA 3FW2A 2JSZA 2HZEB 3IAS2 1ZYNA 1HQOA 4JEDA 2K8VA 2WRTA 4KDXA 3GA4A 1QK8A 2XHFA 4USSA 1ERVA 4ILFA 4ICYA 3R3EA 5GSTA 7GSSA 1GRXA 5ID2A 3E9JB 3CTFA 2X8GA 1EP7A 2IFQA 2HSYA 3SWLA 2O5VA 1XZOA 5J4UA 2LQQA 3APOA 4MA9A 5ECOB 4WF4A 3KP8A 3TKSE 3WGXA 4I6XA 2QA2A 2IMIA 11GSA 3TKSC 3ZLPA 2GT5A 4PX1A 4P3YB 4TR1A 5D96A 1BG5A 1R26A 1XW9A 4V2NA 4IW9A 2V6KA 1KEBA 1XVQA 5IMDA 4E68A 3TKSA 1YEXA 4OO5A 2KOKA 3HKRA 2IMEA 4I5QA 1TRVA 2JZSA 3HVSA 4KUNA 2IMFA 4LMWA 1MDIA 3HHVA 1T4YA 5HR2A 4MZWA 5JWRB 5J4YA 1GNEA 1VF1A 4O5QA 4XS6A 2WVYA 1SKRB 2VCTA 2C0DA 2YWNA 4G0IA 4IJIA 4EVMA 4PQIA 5KOWA 5A4UA 1AW9A 2A4HA 1H4OA 2A2RA 4JZQA 1K0DA 2CVDA 4F0BA 1M7TA 2H1DA 5HR3A 19GSA 1FVKA 3VWWA 2R0GA 1SU9A 1U3IA 3ZREA 5J4VA 1PGTA 1N8JA 2PMTA 3RPPA 3GFKA 2GSSA 5J9CA 4EE0A 3ZFBA 4BL7A 1J9BA 2QKEA 3M1GA 4I8BA 2VCVA 1DE1A 17GSA 3VI5A 5KN1A 5DBQA 1K0OA 3BCIA 3KTBA 1FOHA 4CY8A 3HYPA 1M3JA 4O32A 3ZL5A 2G2QA 2HSMA 3D21A 2CX4A 2VCXA 3FK8A 3ZVJD 4DEJA 4HDEA 4TKYA 5C00A 3D4TA 3S9FA 4ECBA 4ULXA 2KUCA 2H1LA 4HQSA 4IJ3A 4KDYA 5A4WA 5ECMB 1WRYA 3UEMA 3TDGA 3NIVA 3GH9A 1VRSD 2HSHA 5H5RA 1ZYQB 4DSRA 5G1LA 1YKAA 4MH2A 4KSOA 4L8EA 3ZZXA 3AY8A 1QGVA 2ZNMA 3MDKA 3QCPA 4D73A 3TJJA 3OR5A 2RM5A 5G5EA 1SL1B 1RK4A 5B8BA 1U88A 2QA1A 4F2IA 4YH2A 1G7OA 4J2FA 2OACA 2R6KA 2B5YA 3R2QA 3GSTA 20GSA 3QPMA 4HI7A 5DQSA 5ELGA 2V2GA 5ELAA 2H6XA 1SKWB 2CV4A 2VM1A 2LNTA 1TU8A 2F8FA 2BTOT 3FZ9A 4K5SA 1PN0A 1Z7PA 3UBKA 1H75A 4AJ8A 5E4WA 4CY6A 1F2EA 2HQTA 5KN2A 4MJCA 3C1RA 1QQ2A 1ZYPA 4AJ7A 4XRAA 1UA5A 4G9HA 1QMVA 1YJ6A 3HA9A 1USBA 1PSQA 3CRUA 3GL5A 5IOXA 2PPTA 1VF3A 2E2MA 4XRDA 4X43A 5JWQB 1YEWC 3GH6A 1JZWA 4HJMA 1NHYA 3CRTA 5AIXA 4L5LA 1TW9A 5ECRB
chains in the Genus database with same CATH topology
2KP1A 3RBTA 2YZUA 4Q5FA 4O7HA 3HVXA 2EIOA 3IA1A 4PTSA 1SJIA 4K8MA 3WGEA 4KE3A 2VLVA 3HDCA 1MD3A 3LGCA 4MMMA 4BVXA 4KCAA 2WGRA 1TXXA 2H0GA 1O8XA 3DRNA 3Q74A 2HRKA 2B5XA 1U3AA 2CX3A 1SVMA 2OT3A 3GRXA 5IMVA 1ZZYA 2LUSA 3DVWA 2P5RA 3DGQA 3O76A 1XWGA 2LRTA 3L0HA 18GSA 3A5WA 3KH7A 3TJBA 1HNBA 2C80A 4KDUA 1GSDA 3FY7A 3A2XA 2YANA 5CRGA 2FGXA 3APQA 1R5AA 2GQKA 2AHEA 2LJRA 1B4QA 2GT6A 5IMCA 3A3TA 2C0GA 4FYBA 1EV9A 2PUKC 3UAPA 2H6YA 2MBTA 1BJXA 2DJJA 2B7KA 3CXGA 2WS2A 1UC7A 1GULA 1WJKA 3EE2A 3TKQA 3F6DA 1GLQA 1QUWA 2B7JA 4OMVA 2DIZA 1ZOFA 2IPAA 2YWOA 2H71A 1F3BA 2JL4A 2DMLA 2YV7A 2YWIA 5ECPB 5IIZA 1PA3A 4EKZA 3QAVA 1PKZA 4WF5A 3C8EA 2P0GA 1X9WB 1X0RA 5CP1A 2FY6A 1NHOA 1X5CA 1OAZA 2HSNB 2DJ1A 2AV4A 4ZBBA 2PU9C 5DALB 5H5SA 2F51A 5A5HB 3KTLA 2PERA 1BF5A 4XS1A 1XWAA 3F3RA 4MF6A 2Z9SA 3UOMA 1U87A 3QR6A 2AB6A 4IELA 4HU7A 2DKHA 5IM9A 2VCZA 3I6AA 4IQ1A 3IV4A 4TR4A 1K3OA 3O3TA 3VLNA 3VK9A 3ERFA 4FIWA 4HQZA 3TGZA 1PL1A 3IRAA 1ML6A 1BAYA 1JLVA 1Y25A 4WEYA 4MDCA 4G19A 2DMMA 1ZL9A 3ZVJA 4NV5A 4ZL8A 5AGYA 16GSA 4ZIJA 5AN1A 1XBSA 3TKRA 2H74A 4YQVA 4Q5NA 2BJXA 6GSXA 3NZNA 1TRSA 1DE2A 1AUCA 5IMAA 3RHCA 3LXTA 4ECIA 1GTUA 4MZBA 4KW6A 2WZ9A 1PN9A 4EC0A 2VL9A 2B1LA 4V1Ap 3ED3A 2PGTA 3HVVA 4O92A 1V58A 1W4VA 1SL0B 2N5AA 3GSSA 2DJKA 2IIYA 1Z6NA 3ZMLA 4TXOB 3F4RA 4LA1A 1PD21 3NOFA 4MF5A 3FRCA 1SK1A 4AGSA 1GNWA 3LORA 1BYEA 1EZKA 3F4TA 5ABRA 4FYUA 3LYKA 4O5RA 2C3TA 4L5OA 4RI6A 4EDYA 1KBNA 1TI3A 2DC5A 2DKIA 1ZCPA 5KEJA 1AQVA 3F0IA 3CSJA 3BOAA 6GSSA 1K3LA 5ECKB 2CA8A 2OA7A 4FYCA 3W8JA 2QGVA 2X8HA 3ZIVA 2DJ3A 5J9BA 2UV8G 5DCHA 2TRXA 1FB6A 1ERTA 1A2JA 3KM6A 1G7EA 1FO5A 1QXHA 4YQMA 2KLXA 3PH9A 4ECJA 1CQGA 4MP4A 5JCGA 2VM2A 5CAXA 4JBBA 2IL3A 1PL2A 1KNGA 4MPGA 3WYWA 3HCZA 3P2AA 1XXUA 1F3AA 2GTUA 2RM6A 1ABAA 2A4VA 4MJAA 2WULA 1RW1A 2GSQA 3I43A 3KGKA 5F8BA 3U5RE 2VCQA 1GUHA 3KCMA 2FWHA 1GSEA 1TRUA 1JZDA 1V98A 4EXJA 1PMTA 2HFDA 1OC3A 1S3DA 2BMXA 2GLRA 4JRRA 4CHSA 2MZCA 13GSA 5A4VA 2M72A 5CRHA 2O87A 3U6VA 4ISDA 3IR4A 2H72A 3FZAA 1XIYA 4QMKA 4Z2TA 4ZL7A 2ON5A 3LSZA 2P31A 2ZCTA 4XCSA 5JCWA 5CRWA 4IP1A 4V2LA 2N5BA 4GSSA 2PVOC 4POMA 5AISA 5D9VA 4ZB9A 2V6OA 5LNKe 1IYHA 1T00A 4EIPA 2FHEA 4G0LA 1RQMA 3H93A 1J0FA 2L6DA 3Q19A 4JR4A 2JZRA 5G31A 4Z2UA 4IS0A 5G1KA 3FKFA 2C0FA 2K18A 3N9JA 1NM3A 1TI1A 4IHUA 2L5LA 3H8QA 2H1BA 2C0EA 4OO4A 3TB2A 4LLRA 2JZTA 3TOTA 1A2MA 1ON4A 4WBRD 4MNNA 2R3XA 4DVCA 2F9SA 5KOXA 5D73A 14GSA 4I2UA 3G7IA 5A34A 1EGRA 1EEMA 2O8VB 1B8XA 5L71A 4GDFA 4WETA 1S3AA 1J08A 3TKPA 2OE1A 2DJ0A 1ERWA 1AAZA 5EL8A 1JFUA 2V32A 2MMNA 1V57A 5DJMA 4K0NA 3GIXA 3H79A 4DSSB 2AAWA 2HLSA 4IVFA 3IE3A 2I81A 1FW1A 3KEBA 3HJPA 5ECNB 4HOJA 3C71A 3TRQA 4GQFA 1PKWA 2H30A 4W66A 2XPEA 1OE8A 1K0BA 3G7JA 2H66A 2ON7A 3L9UA 3CTGA 1WE0A 1UVZA 2NVLA 4DSQA 1A2LA 4GQCA 2N5FA 5HFIA 1M2AA 5IO2A 2H6ZA 2ZUPA 3VPTA 1GTIA 1M2BA 3J7Yk 3UMAA 3GNJA 4NAXA 3BCKA 1C72A 1URMA 2H0IA 3GKXA 4F9ZA 1T7PB 5ECLB 2NDOA 5DAKB 1MDKA 3UVTA 4RQXA 1M99A 3C7MA 4KF9A 2JADA 1WIKA 5BRTA 4PQHA 2HRFA 3DD3A 2GSRA 5BMUA 2L6CA 2WJUA 3LXZA 1VF4A 2IJYA 1X9MB 2HRNA 2EC4A 2MMOA 1N25A 4ZXGA 2PBJA 5AIVA 2H8LA 2H1AA 2VKZG 2O89A 5F06A 3ZTLA 2CQ9A 5EVOA 3GN3A 4K7OA 1SVOA 2YWMA 3PGTA 3D6IA 2OJLA 5DALA 5J40A 3TRXA 3F8UA 2B6MA 3IXRA 1AXDA 3APSA 4XIHA 2L4CA 1SD8A 2C1YA 3FR9A 3DYRA 12GSA 2P5QA 1YQ1A 4YKFA 3M0FA 4RUVA 3C73A 3DMLA 1EV4A 4QL7A 1FOVA 5A1NA 5ID2B 2IFQB 4AF2A 4AI6A 3D0ZA 2VD0A 1LBKA 2C8UA 5ECQB 9GSSA 2CZ3A 3IAM2 1FAAA 1UN2A 1K0AA 2C4JA 4TR1B 2B1KA 6GSTA 2GSTA 4GSTA 2VIMA 4NWYA 2CZ2A 4I97A 1F9MA 1YZXA 1SYXA 2X8CA 1DUGA 1OE7A 1VGLA 1O85A 2FNOA 5FWGA 3GTUA 4AKGA 3QAWA 3L78A 4G2EA 4BVYA 1NW2A 2LRCA 2V1MA 2VOCA 1OYJA 2MMAA 2K6VA 1WOUA 4NMUA 4EO3A 6GSUA 4YAPA 4J57E 1MD4A 2RLIA 4PURA 3VURA 4XS4B 5IOWA 3QFAC 5ECIB 2YOIA 3UBLA 2J9HA 4WKWA 2HNLA 3DWVA 3HJOA 3M9JA 1YVLA 5B7CA 1O73A 4N30A 1QFNA 1M9AA 1TTZA 4OCFA 2OBKA 2ALBA 4FO5A 2HSMB 3GYKA 3CSIA 4MH3A 3IC8A 2VAFA 2RUFA 3VFIA 1OC9A 3LYPA 2XBQA 1K3YA 2HXKA 4KA0A 3TCOA 1X9SB 1NSWA 5CYYA 5DVBA 4GWRA 2HYXA 1Y6EA 3EWLA 2FLSA 4ZB7A 2MYGA 3A2VA 1GUKA 2RUEA 3H1NA 4D73B 3WGDA 2REMA 3FYGA 1AC1A 1BG1A 2KHPA 2HZEA 5LD0A 4L0UA 1EWXA 4BWQA 2PWJA 1TOFA 5HFKA 1WP0A 2YPMA 5GAPD 2GZZA 4K0GA 3QDNA 3V1WA 2JU5A 3GUSA 1GH2A 2D2ZA 1T8EB 1SL2B 1V2AA 4AKXB 3MYDA 4KH7A 3C1SA 1YEPA 1GSQA 5IMZA 3CWGA 2CVKA 3EU4A 1LJRA 4POBA 3UJ1A 2AUVA 3BJ5A 3EYTA 1EOGA 4ZB8A 2I3YA 3MSZA 1R7HA 2FD3A 4PUFC 4AKIA 1MEKA 4GF0A 3A2WA 2IMKA 3VPQA 4POKA 1HNAA 3PINA 2QSIA 1SKSB 4OWYA 3QOUA 1JLWA 1GLPA 4MABA 1CQHA 1TXUA 2F8AA 2WDUA 3O6TA 4GSNA 2QC7A 1XWCA 5F05A 1BX9A 1E6BA 4ID0A 3GX8A 3EINA 1AQWA 4EUYA 5EPFA 2I1UA 4I2TA 1VF2A 3KMNA 3KJYA 2GGTA 4IKHA 1GP1A 5IQYA 3MAKA 2O7KA 1HD2A 2NPBA 2HZFA 3GKNA 5ECSA 2J23A 3TOUA 2CVBA 1XWBA 3M8NA 2GQMA 3F3QA 4KNDA 2E0QA 4YKGA 3F4SA 2E2GA 1FVJA 4BVXB 3RDWA 2HRKB 3DKSA 2GDRA 4IQAA 2R0PA 4CDOA 1SD9A 3LFLA 3ZFLA 3IOSA 4OFTA 5D9XA 4HJ2A 3IPZA 4NHZA 4MJBA 1B4PA 3HZ8A 22GSA 4FQUA 4ZBAA 2VLUA 3BD2A 1DSBA 1XCCA 2FWEA 2IN3A 4KCEA 1B9XC 2WFCA 3TUEA 3EVIA 1PX7A 3N5OA 3EURA 2X4AA 3KP9A 3DEXA 4G0KA 1ZGNA 2M46A 3DXBA 4JE1A 5F0GA 3UVHA 2G0FA 1Z3EA 1K0MA 3W8SA 2DSAA 4BWSA 2LRNA 4ML1A 1N2AA 3IDVA 4OCEA 4TN8A 2EIRA 3FEUA 1EEJA 4PUAA 5D8IA 3HMJG 4HU9A 4ML6A 4BA7A 5IO0A 3LEFA 2VD1A 3L4NA 1WMJA 1GTAA 4KSMA 5FT3A 3GMFA 5DJLA 1TP9A 3WT1A 2UZ8A 4WR4A 5JWOB 3UL3A 3D22A 3ZITA 3GURA 3VWUA 4K6XA 2VLTA 2YP6A 1YY7A 1XOBA 2L5OA 3FR6A 3LJRA 1A8LA 5HQPA 5IPGA 2YV9A 3G7YA 1G6YA 1I5GA 2WB9A 3GKKA 1XOAA 3GV1A 2PN8A 2OKAA 2F3MA 2EIQA 1FHEA 1S3CA 4GLTA 4MLYA 4WR5A 1F37A 3IHQA 1SYRA 3A5IA 5CO3A 2IMDA 2O85A 3L9VA 1A8YA 2LTKA 3KIJA 3IHGA 1MTCA 1TK5B 4AKHA 2YNXA 2R37A 3ZMKA 3FZ5A 5GZZB 3LQ7A 3MIXA 2L59A 4YQUA 3US3A 5F07A 1PRXA 1SJZA 2FA8A 1SJ6A 1A0FA 1G0TA 5COHA 2FCHA 1GSYA 3EC3A 1X5DA 4H86A 2MMZA 4A5PA 3PPUA 3KMOA 2TRCP 1WPIA 2JACA 2GZPA 4HEA2 5D9WA 2LQOA 3CYNA 1ST9A 2A2PA 2E7PA 1GWCA 2DIYA 3HZ4A 8GSSA 4HUAA 4GTUA 1XW5A 5EY6A 3EU3A 4Z7XA 4XS4A 3F63A 2OADA 3BBYA 4MPFA 5G2ZA 3GL3A 2H0HA 2H01A 2VL2C 5GSSA 3ISOA 1HNCA 4LMVA 1O6JA 2NBSA 3E3EA 4L0WA 4F82A 3P8WA 2VL2A 5J47A 4N0ZA 3F6FA 2C3NA 4NHWA 1JZOA 3JCML 4IP6A 4IBPA 4N11A 4ZBDA 3FR3A 2C3QA 2HI7A 2K9FA 5J41A 4PGTA 2YJ7A 2VUPA 3P90A 3LG6A 2XC2A 1ZYEA 5J3RA 2LNSA 4XTSA 1Q98A 1JHBA 2WCIA 5FHIA 2VL3A 3WT2A 3IK7A 2FWGA 4NPBA 2DBCA 3ME8A 1B9YC 4TR0A 1XPVA 4LL1B 3IBHA 1YF1A 3G9BA 2HSNA 5DDLA 4K1FA 1BEDA 5A5HA 1ZMAA 1K0CA 2CAIA 4K7IA 4GXZA 5CRDA 1M9BA 4IN0A 2CT6A 3QFBC 4O5UA 1EP8A 2YZHA 4TOPA 5H5QA 10GSA 3KH9A 4PXOA 3ERWA 3DVXA 4RI7A 1TU7A 3ZIJA 2K8SA 2R0CA 2AJQB 4YAVA 2H73A 3IK9A 2GZYA 6GSWA 3E0UA 5KN3A 3PR8A 4G10A 2I4AA 5E59A 4XHMA 1AIUA 2DJ2A 3FMWA 2X49A 3LW9A 4V1Ag 3FHKA 3D5JA 3EMPA 1THXA 3I9V2 4OFNA 5G5FA 2I9HA 1KTEA 3GKMA 4OFMA 1ILOA 1TK8B 4F0CA 1YF0A 5CREA 1Z5YE 2DLXA 4KB3A 4N0VA 1X5EA 2R4VA 1SVLA 1T4ZA 5A34B 2B3SA 4TW5A 2H1GA 4TXOA 2LJKA 3M9KA 2VO4A 2GS3A 5INYA 2R2JA 3TJFA 3GHAA 4K9ZA 3K8NA 3L9SA 3W6GA 3TU3B 1XVWA 3Q18A 4EIQA 3ERGA 2EFDA 4E8EA 1BQ7A 3Q6OA 5IPHA 2YCDA 1A0RP 3UIWA 6GSYA 2GVPA 4Q5RA 1W89A 2HE3A 4HZ4A 1M0UA 1DBYA 4PNFA 4BL7B 1PQNA 3CSHA 4X4JA 2L57A 4JU5A 1SK0A 3SBCA 2OE3A 5B6MA 4JR6A 4ZILA 2LV3A 2R5GA 2X99A 1GL8A 3CBUA 4TR3A 2RIIA 2YJHA 2XBIA 6GSVA 4N3ZA 1R4WA 4J56E 4ECCA 3DIEA 4ZB6A 1XW6A 1OKTA 3I69A 1TK0B 1ACVA 2ES7A 1Y1UA 1R5PA 3D4MA 2OBIA 1YDKA 2H75A 2IWTA 2FWFA 4E8HA 5BMUB 2CAQA 1Q4JA 1I9DA 1XWKA 1SENA 1T3BA 1THOA 4X1UA 2L4QA 2NTOA 2HRAA 3MNGA 1IYIA 2LEGA 3FZ4A 3RHBA 5ECHB 4ZL9A 1V9WA 4QL9A 3RAZA 4TXVA 4MJEA 3F9UA 2EFEA 1Z9HA 5G30A 2KP2A 3MWHA 4Q5QA 1MDJA 2EFCA 4MF7A 5IMFA 1GUMA 1M2DA 3TJKA 2LKUA 3ME7A 3TJGA 1TKDB 4LL4B 1OVNA 4GCIA 4HS1A 2A2SA 2LS5A 4TVEA 3QAGA 3EPTA 1WWJA 2YN1A 4TRXA 1K0NA 1A23A 3UARA 4MCUA 4NV2A 5HR0A 1OC8A 3VI7A 4X0XA 3QD9A 5JCUA 5C04A 5A1NB 4K5RA 3GX0A 1V40A 1A24A 1TRWA 4K2XA 5A5KA 3ZRDA 4EDZA 4AJ6A 4Z2RA 1YKCA 5D93A 3ZYWA 2AYTA 2PVQA 4KX4A 3J7Yb 4OD7A 1Z7RA 1ERUA 4G01A 2FA4A 4EF0A 2GQLA 5J5NA 5GAND 3QMXA 4DSSA 1SK2A 1GSSA 3VWXA 4EL1A 1PX6A 1XFLA 3KZQA 4POLA 4IGJA 1EOHA 2XPDA 1AQXA 4NXIA 5KN0A 1JZRA 1Z6MA 2H19A 4QQ7A 3GTUB 3EMXA 4V2MA 4BVYB 2X64A 5D9TA 5B6NA 4FH8A 1B48A 1FG4A 1TDIA 4PQ1A 4BPYA 4F03A 5B8AA 2H76A 1O7UA 2H70A 5DQYA 4WBJA 3KD0A 2MBSA 1E2YA 2VCWA 1GSFA 1F6MC 2LSTA 3HJMA 1HYUA 4HZ2A 1TJDA 2V41A 5HFGA 3TRPA 4PNGA 3KXOA 2TIRA 4MZCA 2FUG2 3WD6A 4WXTA 2JSYA 5DCGA 5DAKA 1FB0A 4GRFA 3RPNA 3LWAA 3M3MA 3HD5A 3VWVA 3HY2A 1O8WA 4K2DA 3HXSA 5HR1A 1O81A 4ACSA 3IC4A 1U6TA 2B5EA 1OC9B 4K7NA 1GSUA 2LJAA 1EGOA 2M80A 1GTBA 3P7XA 5CNWA 3H4KA 4KGIA 3CMIA 1LU4A 2HT9A 1OKDA 4CW9A 4RQRA 4MK3A 2EFHA 1T1VA 4N10A 1G6WA 2OE0A 4KAEA 5ENUA 5LCZA 3FW2A 2JSZA 2HZEB 3IAS2 1ZYNA 1HQOA 4JEDA 2K8VA 2WRTA 4KDXA 3GA4A 1QK8A 2XHFA 4USSA 1ERVA 4ILFA 4ICYA 3R3EA 5GSTA 7GSSA 1GRXA 5ID2A 3E9JB 3CTFA 2X8GA 1EP7A 2IFQA 2HSYA 3SWLA 2O5VA 1XZOA 5J4UA 2LQQA 3APOA 4MA9A 5ECOB 4WF4A 3KP8A 3TKSE 3WGXA 4I6XA 2QA2A 2IMIA 11GSA 3TKSC 3ZLPA 2GT5A 4PX1A 4P3YB 4TR1A 5D96A 1BG5A 1R26A 1XW9A 4V2NA 4IW9A 2V6KA 1KEBA 1XVQA 5IMDA 4E68A 3TKSA 1YEXA 4OO5A 2KOKA 3HKRA 2IMEA 4I5QA 1TRVA 2JZSA 3HVSA 4KUNA 2IMFA 4LMWA 1MDIA 3HHVA 1T4YA 5HR2A 4MZWA 5JWRB 5J4YA 1GNEA 1VF1A 4O5QA 4XS6A 1SKRB 2VCTA 2C0DA 2YWNA 4G0IA 4IJIA 4EVMA 4PQIA 5KOWA 5A4UA 1AW9A 2A4HA 1H4OA 2A2RA 4JZQA 1K0DA 2CVDA 4F0BA 1M7TA 2H1DA 5HR3A 19GSA 1FVKA 3VWWA 2R0GA 1SU9A 1U3IA 3ZREA 5J4VA 1PGTA 1N8JA 2PMTA 3RPPA 3GFKA 2GSSA 5J9CA 4EE0A 3ZFBA 4BL7A 1J9BA 2QKEA 3M1GA 4I8BA 2VCVA 1DE1A 17GSA 3VI5A 5KN1A 5DBQA 1K0OA 3BCIA 3KTBA 1FOHA 4CY8A 3HYPA 4O32A 3ZL5A 2G2QA 2HSMA 3D21A 2CX4A 2VCXA 3FK8A 3ZVJD 4DEJA 4HDEA 4TKYA 5C00A 3D4TA 3S9FA 4ECBA 4ULXA 2KUCA 2H1LA 4HQSA 4IJ3A 4KDYA 5A4WA 5ECMB 1WRYA 3UEMA 3TDGA 3NIVA 3GH9A 1VRSD 2HSHA 5H5RA 1ZYQB 4DSRA 5G1LA 1YKAA 4MH2A 4KSOA 4L8EA 3ZZXA 3AY8A 1QGVA 2ZNMA 3MDKA 3QCPA 4D73A 3TJJA 3OR5A 2RM5A 5G5EA 1SL1B 1RK4A 5B8BA 1U88A 2QA1A 4F2IA 4YH2A 1G7OA 4J2FA 2OACA 2R6KA 2B5YA 3R2QA 3GSTA 20GSA 3QPMA 4HI7A 5DQSA 5ELGA 2V2GA 5ELAA 2H6XA 1SKWB 2CV4A 2VM1A 2LNTA 1TU8A 2F8FA 2BTOT 3FZ9A 4K5SA 1PN0A 1Z7PA 3UBKA 1H75A 4AJ8A 5E4WA 4CY6A 1F2EA 2HQTA 5KN2A 4MJCA 3C1RA 1QQ2A 1ZYPA 4AJ7A 4XRAA 1UA5A 4G9HA 1QMVA 1YJ6A 3HA9A 1USBA 1PSQA 3CRUA 3GL5A 5IOXA 2PPTA 1VF3A 2E2MA 4XRDA 4X43A 5JWQB 3GH6A 1JZWA 4HJMA 1NHYA 3CRTA 5AIXA 4L5LA 1TW9A 5ECRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KP1 A;  3RBT A;  2YZU A;  4Q5F A;  4O7H A;  3HVX A;  2EIO A;  3IA1 A;  4PTS A;  1SJI A;  4K8M A;  3WGE A;  4KE3 A;  2VLV A;  3HDC A;  1MD3 A;  3LGC A;  4MMM A;  4BVX A;  4KCA A;  2WGR A;  1TXX A;  2H0G A;  1O8X A;  3DRN A;  3Q74 A;  2HRK A;  2B5X A;  1U3A A;  2CX3 A;  3GRX A;  5IMV A;  1ZZY A;  2LUS A;  3DVW A;  2P5R A;  3DGQ A;  3O76 A;  1XWG A;  2LRT A;  3L0H A;  18GS A;  3A5W A;  3KH7 A;  3TJB A;  1HNB A;  2C80 A;  4KDU A;  1GSD A;  3FY7 A;  3A2X A;  2YAN A;  5CRG A;  2FGX A;  3APQ A;  1R5A A;  2GQK A;  2AHE A;  2LJR A;  1B4Q A;  2GT6 A;  5IMC A;  3A3T A;  2C0G A;  4FYB A;  1EV9 A;  2PUK C;  3UAP A;  2H6Y A;  2MBT A;  1BJX A;  2DJJ A;  2B7K A;  3CXG A;  2WS2 A;  1UC7 A;  1GUL A;  1WJK A;  3EE2 A;  3TKQ A;  3F6D A;  1GLQ A;  1QUW A;  2B7J A;  4OMV A;  2DIZ A;  1ZOF A;  2IPA A;  2YWO A;  2H71 A;  1F3B A;  2JL4 A;  2DML A;  2YV7 A;  2YWI A;  5ECP B;  5IIZ A;  1PA3 A;  4EKZ A;  3QAV A;  1PKZ A;  4WF5 A;  3C8E A;  2P0G A;  1X9W B;  1X0R A;  5CP1 A;  2FY6 A;  1NHO A;  1X5C A;  1OAZ A;  2HSN B;  2DJ1 A;  2AV4 A;  4ZBB A;  2PU9 C;  5DAL B;  5H5S A;  2F51 A;  3KTL A;  2PER A;  4XS1 A;  1XWA A;  3F3R A;  4MF6 A;  2Z9S A;  3UOM A;  1U87 A;  3QR6 A;  2AB6 A;  4IEL A;  4HU7 A;  5IM9 A;  2VCZ A;  3I6A A;  4IQ1 A;  3IV4 A;  4TR4 A;  1K3O A;  3O3T A;  3VLN A;  3VK9 A;  3ERF A;  4FIW A;  4HQZ A;  3TGZ A;  1PL1 A;  3IRA A;  1ML6 A;  1BAY A;  1JLV A;  1Y25 A;  4WEY A;  4MDC A;  4G19 A;  2DMM A;  1ZL9 A;  3ZVJ A;  4NV5 A;  4ZL8 A;  5AGY A;  16GS A;  4ZIJ A;  5AN1 A;  1XBS A;  3TKR A;  2H74 A;  4YQV A;  4Q5N A;  2BJX A;  6GSX A;  3NZN A;  1TRS A;  1DE2 A;  1AUC A;  5IMA A;  3RHC A;  3LXT A;  4ECI A;  1GTU A;  4MZB A;  4KW6 A;  2WZ9 A;  1PN9 A;  4EC0 A;  2VL9 A;  2B1L A;  4V1A p;  3ED3 A;  2PGT A;  3HVV A;  4O92 A;  1V58 A;  1W4V A;  1SL0 B;  2N5A A;  3GSS A;  2DJK A;  2IIY A;  1Z6N A;  3ZML A;  4TXO B;  3F4R A;  4LA1 A;  1PD2 1;  3NOF A;  4MF5 A;  3FRC A;  1SK1 A;  4AGS A;  1GNW A;  3LOR A;  1BYE A;  1EZK A;  3F4T A;  5ABR A;  4FYU A;  3LYK A;  4O5R A;  2C3T A;  4L5O A;  4RI6 A;  4EDY A;  1KBN A;  1TI3 A;  2DC5 A;  1ZCP A;  5KEJ A;  1AQV A;  3F0I A;  3CSJ A;  3BOA A;  6GSS A;  1K3L A;  5ECK B;  2CA8 A;  2OA7 A;  4FYC A;  3W8J A;  2QGV A;  2X8H A;  3ZIV A;  2DJ3 A;  5J9B A;  5DCH A;  2TRX A;  1FB6 A;  1ERT A;  1A2J A;  3KM6 A;  1G7E A;  1FO5 A;  1QXH A;  4YQM A;  2KLX A;  3PH9 A;  4ECJ A;  1CQG A;  4MP4 A;  5JCG A;  2VM2 A;  5CAX A;  4JBB A;  2IL3 A;  1PL2 A;  1KNG A;  4MPG A;  3WYW A;  3HCZ A;  3P2A A;  1XXU A;  1F3A A;  2GTU A;  2RM6 A;  1ABA A;  2A4V A;  4MJA A;  2WUL A;  1RW1 A;  2GSQ A;  3I43 A;  3KGK A;  5F8B A;  3U5R E;  2VCQ A;  1GUH A;  3KCM A;  2FWH A;  1GSE A;  1TRU A;  1JZD A;  1V98 A;  4EXJ A;  1PMT A;  2HFD A;  1OC3 A;  1S3D A;  2BMX A;  2GLR A;  4JRR A;  4CHS A;  2MZC A;  13GS A;  5A4V A;  2M72 A;  5CRH A;  2O87 A;  3U6V A;  4ISD A;  3IR4 A;  2H72 A;  3FZA A;  1XIY A;  4ZL7 A;  2ON5 A;  3LSZ A;  2P31 A;  2ZCT A;  4XCS A;  5JCW A;  5CRW A;  4IP1 A;  4V2L A;  2N5B A;  4GSS A;  2PVO C;  4POM A;  5AIS A;  5D9V A;  4ZB9 A;  2V6O A;  5LNK e;  1IYH A;  1T00 A;  2FHE A;  4G0L A;  1RQM A;  3H93 A;  1J0F A;  2L6D A;  3Q19 A;  4JR4 A;  2JZR A;  5G31 A;  4IS0 A;  5G1K A;  3FKF A;  2C0F A;  2K18 A;  3N9J A;  1NM3 A;  1TI1 A;  4IHU A;  2L5L A;  3H8Q A;  2H1B A;  2C0E A;  4OO4 A;  3TB2 A;  4LLR A;  2JZT A;  3TOT A;  1A2M A;  1ON4 A;  4WBR D;  2R3X A;  4DVC A;  2F9S A;  5D73 A;  14GS A;  4I2U A;  3G7I A;  1EGR A;  1EEM A;  2O8V B;  1B8X A;  5L71 A;  4WET A;  1S3A A;  1J08 A;  3TKP A;  2OE1 A;  2DJ0 A;  1ERW A;  1AAZ A;  5EL8 A;  1JFU A;  2V32 A;  2MMN A;  1V57 A;  5DJM A;  4K0N A;  3GIX A;  3H79 A;  4DSS B;  2AAW A;  2HLS A;  4IVF A;  3IE3 A;  2I81 A;  1FW1 A;  3KEB A;  3HJP A;  5ECN B;  4HOJ A;  3C71 A;  3TRQ A;  4GQF A;  1PKW A;  2H30 A;  2XPE A;  1OE8 A;  1K0B A;  3G7J A;  2H66 A;  2ON7 A;  3L9U A;  3CTG A;  1WE0 A;  1UVZ A;  2NVL A;  4DSQ A;  1A2L A;  4GQC A;  2N5F A;  5HFI A;  1M2A A;  5IO2 A;  2H6Z A;  2ZUP A;  3VPT A;  1GTI A;  1M2B A;  3J7Y k;  3UMA A;  3GNJ A;  4NAX A;  3BCK A;  1C72 A;  1URM A;  2H0I A;  3GKX A;  4F9Z A;  1T7P B;  5ECL B;  2NDO A;  5DAK B;  1MDK A;  3UVT A;  4RQX A;  1M99 A;  3C7M A;  4KF9 A;  2JAD A;  1WIK A;  4PQH A;  2HRF A;  3DD3 A;  2GSR A;  5BMU A;  2L6C A;  2WJU A;  3LXZ A;  1VF4 A;  2IJY A;  1X9M B;  2HRN A;  2EC4 A;  2MMO A;  4ZXG A;  2PBJ A;  5AIV A;  2H8L A;  2H1A A;  2O89 A;  5F06 A;  3ZTL A;  2CQ9 A;  5EVO A;  3GN3 A;  4K7O A;  2YWM A;  3PGT A;  3D6I A;  2OJL A;  5DAL A;  3TRX A;  3F8U A;  2B6M A;  3IXR A;  1AXD A;  3APS A;  4XIH A;  2L4C A;  1SD8 A;  2C1Y A;  3FR9 A;  3DYR A;  12GS A;  2P5Q A;  1YQ1 A;  3M0F A;  4RUV A;  3C73 A;  3DML A;  1EV4 A;  4QL7 A;  1FOV A;  5ID2 B;  2IFQ B;  4AF2 A;  3D0Z A;  2VD0 A;  1LBK A;  2C8U A;  5ECQ B;  9GSS A;  2CZ3 A;  3IAM 2;  1FAA A;  1UN2 A;  1K0A A;  2C4J A;  4TR1 B;  2B1K A;  6GST A;  2GST A;  4GST A;  2VIM A;  4NWY A;  2CZ2 A;  4I97 A;  1F9M A;  1YZX A;  1SYX A;  2X8C A;  1DUG A;  1OE7 A;  1VGL A;  1O85 A;  2FNO A;  5FWG A;  3GTU A;  3QAW A;  3L78 A;  4G2E A;  4BVY A;  1NW2 A;  2LRC A;  2V1M A;  2VOC A;  1OYJ A;  2MMA A;  2K6V A;  1WOU A;  4NMU A;  4EO3 A;  6GSU A;  4YAP A;  4J57 E;  1MD4 A;  2RLI A;  4PUR A;  3VUR A;  4XS4 B;  5IOW A;  3QFA C;  5ECI B;  2YOI A;  3UBL A;  2J9H A;  4WKW A;  2HNL A;  3DWV A;  3HJO A;  3M9J A;  4N30 A;  5B7C A;  1O73 A;  1QFN A;  1M9A A;  1TTZ A;  4OCF A;  2OBK A;  2ALB A;  4FO5 A;  2HSM B;  3GYK A;  3CSI A;  4MH3 A;  3IC8 A;  2VAF A;  2RUF A;  3VFI A;  1OC9 A;  3LYP A;  2XBQ A;  1K3Y A;  2HXK A;  4KA0 A;  3TCO A;  1X9S B;  1NSW A;  5CYY A;  5DVB A;  4GWR A;  2HYX A;  1Y6E A;  3EWL A;  2FLS A;  2MYG A;  3A2V A;  1GUK A;  2RUE A;  3H1N A;  4D73 B;  3WGD A;  2REM A;  3FYG A;  1AC1 A;  2KHP A;  2HZE A;  5LD0 A;  4L0U A;  1EWX A;  4BWQ A;  2PWJ A;  1TOF A;  5HFK A;  1WP0 A;  2YPM A;  5GAP D;  2GZZ A;  4K0G A;  3QDN A;  3V1W A;  2JU5 A;  3GUS A;  1GH2 A;  2D2Z A;  1T8E B;  1SL2 B;  1V2A A;  4KH7 A;  3C1S A;  1YEP A;  1GSQ A;  5IMZ A;  2CVK A;  3EU4 A;  1LJR A;  4POB A;  3UJ1 A;  2AUV A;  3BJ5 A;  3EYT A;  1EOG A;  4ZB8 A;  2I3Y A;  3MSZ A;  1R7H A;  2FD3 A;  4PUF C;  1MEK A;  4GF0 A;  3A2W A;  2IMK A;  3VPQ A;  4POK A;  1HNA A;  3PIN A;  2QSI A;  1SKS B;  4OWY A;  3QOU A;  1JLW A;  1GLP A;  4MAB A;  1CQH A;  2F8A A;  2WDU A;  3O6T A;  4GSN A;  2QC7 A;  1XWC A;  5F05 A;  1BX9 A;  1E6B A;  4ID0 A;  3GX8 A;  3EIN A;  1AQW A;  4EUY A;  5EPF A;  2I1U A;  4I2T A;  1VF2 A;  3KMN A;  3KJY A;  2GGT A;  4IKH A;  1GP1 A;  5IQY A;  3MAK A;  2O7K A;  1HD2 A;  2NPB A;  2HZF A;  3GKN A;  5ECS A;  2J23 A;  3TOU A;  2CVB A;  1XWB A;  3M8N A;  2GQM A;  3F3Q A;  4KND A;  2E0Q A;  3F4S A;  2E2G A;  1FVJ A;  4BVX B;  3RDW A;  2HRK B;  3DKS A;  2GDR A;  4IQA A;  4CDO A;  1SD9 A;  3LFL A;  3ZFL A;  3IOS A;  4OFT A;  5D9X A;  4HJ2 A;  3IPZ A;  4NHZ A;  4MJB A;  1B4P A;  3HZ8 A;  22GS A;  4FQU A;  4ZBA A;  2VLU A;  3BD2 A;  1DSB A;  1XCC A;  2FWE A;  2IN3 A;  4KCE A;  1B9X C;  2WFC A;  3TUE A;  3EVI A;  1PX7 A;  3N5O A;  3EUR A;  3KP9 A;  3DEX A;  4G0K A;  1ZGN A;  2M46 A;  3DXB A;  4JE1 A;  5F0G A;  3UVH A;  2G0F A;  1Z3E A;  1K0M A;  3W8S A;  2DSA A;  4BWS A;  2LRN A;  4ML1 A;  1N2A A;  3IDV A;  4OCE A;  4TN8 A;  2EIR A;  3FEU A;  1EEJ A;  4PUA A;  5D8I A;  4HU9 A;  4ML6 A;  4BA7 A;  5IO0 A;  3LEF A;  2VD1 A;  3L4N A;  1WMJ A;  1GTA A;  4KSM A;  5FT3 A;  3GMF A;  5DJL A;  1TP9 A;  3WT1 A;  2UZ8 A;  4WR4 A;  5JWO B;  3UL3 A;  3D22 A;  3ZIT A;  3GUR A;  3VWU A;  4K6X A;  2VLT A;  2YP6 A;  1YY7 A;  1XOB A;  2L5O A;  3FR6 A;  3LJR A;  1A8L A;  5HQP A;  5IPG A;  2YV9 A;  3G7Y A;  1G6Y A;  1I5G A;  2WB9 A;  3GKK A;  1XOA A;  3GV1 A;  2PN8 A;  2OKA A;  2F3M A;  2EIQ A;  1FHE A;  1S3C A;  4GLT A;  4MLY A;  4WR5 A;  1F37 A;  3IHQ A;  1SYR A;  5CO3 A;  2IMD A;  2O85 A;  3L9V A;  1A8Y A;  2LTK A;  3KIJ A;  1MTC A;  1TK5 B;  2YNX A;  2R37 A;  3ZMK A;  3FZ5 A;  5GZZ B;  3LQ7 A;  2L59 A;  4YQU A;  3US3 A;  5F07 A;  1PRX A;  1SJZ A;  2FA8 A;  1SJ6 A;  1A0F A;  1G0T A;  5COH A;  2FCH A;  1GSY A;  3EC3 A;  1X5D A;  4H86 A;  2MMZ A;  3PPU A;  3KMO A;  2TRC P;  1WPI A;  2JAC A;  2GZP A;  4HEA 2;  5D9W A;  2LQO A;  3CYN A;  1ST9 A;  2E7P A;  1GWC A;  2DIY A;  3HZ4 A;  8GSS A;  4HUA A;  4GTU A;  1XW5 A;  5EY6 A;  3EU3 A;  4Z7X A;  4XS4 A;  3F63 A;  2OAD A;  3BBY A;  4MPF A;  5G2Z A;  3GL3 A;  2H0H A;  2H01 A;  2VL2 C;  5GSS A;  3ISO A;  1HNC A;  4LMV A;  1O6J A;  2NBS A;  3E3E A;  4L0W A;  4F82 A;  3P8W A;  2VL2 A;  4N0Z A;  3F6F A;  2C3N A;  4NHW A;  1JZO A;  3JCM L;  4IP6 A;  4IBP A;  4N11 A;  4ZBD A;  3FR3 A;  2C3Q A;  2HI7 A;  2K9F A;  5J41 A;  4PGT A;  2YJ7 A;  2VUP A;  3P90 A;  3LG6 A;  2XC2 A;  1ZYE A;  5J3R A;  2LNS A;  4XTS A;  1Q98 A;  1JHB A;  2WCI A;  5FHI A;  2VL3 A;  3WT2 A;  3IK7 A;  2FWG A;  4NPB A;  2DBC A;  3ME8 A;  1B9Y C;  4TR0 A;  1XPV A;  4LL1 B;  3IBH A;  1YF1 A;  3G9B A;  5DDL A;  4K1F A;  1BED A;  1ZMA A;  1K0C A;  2CAI A;  4K7I A;  4GXZ A;  5CRD A;  1M9B A;  4IN0 A;  2CT6 A;  3QFB C;  1EP8 A;  2YZH A;  4TOP A;  5H5Q A;  10GS A;  3KH9 A;  4PXO A;  3ERW A;  3DVX A;  4RI7 A;  1TU7 A;  3ZIJ A;  2K8S A;  2AJQ B;  4YAV A;  2H73 A;  3IK9 A;  2GZY A;  6GSW A;  3E0U A;  5KN3 A;  3PR8 A;  4G10 A;  2I4A A;  5E59 A;  4XHM A;  1AIU A;  2DJ2 A;  4V1A g;  3FHK A;  3D5J A;  3EMP A;  1THX A;  3I9V 2;  4OFN A;  5G5F A;  2I9H A;  1KTE A;  3GKM A;  4OFM A;  1ILO A;  1TK8 B;  4F0C A;  1YF0 A;  5CRE A;  1Z5Y E;  2DLX A;  4KB3 A;  4N0V A;  1X5E A;  2R4V A;  1T4Z A;  2B3S A;  4TW5 A;  2H1G A;  4TXO A;  2LJK A;  2VO4 A;  3M9K A;  2GS3 A;  5INY A;  2R2J A;  3TJF A;  3GHA A;  4K9Z A;  3K8N A;  3L9S A;  3W6G A;  1XVW A;  3Q18 A;  3ERG A;  4E8E A;  1BQ7 A;  3Q6O A;  5IPH A;  2YCD A;  1A0R P;  3UIW A;  6GSY A;  2GVP A;  4Q5R A;  1W89 A;  2HE3 A;  4HZ4 A;  1M0U A;  1DBY A;  4PNF A;  4BL7 B;  1PQN A;  3CSH A;  2L57 A;  4JU5 A;  1SK0 A;  3SBC A;  2OE3 A;  5B6M A;  4JR6 A;  4ZIL A;  2LV3 A;  2R5G A;  2X99 A;  1GL8 A;  3CBU A;  4TR3 A;  2RII A;  2YJH A;  2XBI A;  6GSV A;  1R4W A;  4J56 E;  4ECC A;  3DIE A;  4ZB6 A;  1XW6 A;  1OKT A;  3I69 A;  1TK0 B;  1ACV A;  2ES7 A;  1R5P A;  3D4M A;  2OBI A;  1YDK A;  2H75 A;  2IWT A;  2FWF A;  4E8H A;  2CAQ A;  1Q4J A;  1I9D A;  1XWK A;  1SEN A;  1T3B A;  1THO A;  4X1U A;  2L4Q A;  2NTO A;  2HRA A;  3MNG A;  1IYI A;  2LEG A;  3FZ4 A;  3RHB A;  5ECH B;  4ZL9 A;  1V9W A;  4QL9 A;  3RAZ A;  4TXV A;  4MJE A;  3F9U A;  1Z9H A;  5G30 A;  2KP2 A;  3MWH A;  4Q5Q A;  1MDJ A;  4MF7 A;  5IMF A;  1GUM A;  1M2D A;  3TJK A;  2LKU A;  3ME7 A;  3TJG A;  1TKD B;  4LL4 B;  1OVN A;  4GCI A;  4HS1 A;  2A2S A;  2LS5 A;  4TVE A;  3QAG A;  1WWJ A;  2YN1 A;  4TRX A;  1K0N A;  1A23 A;  3UAR A;  4MCU A;  4NV2 A;  5HR0 A;  1OC8 A;  3VI7 A;  4X0X A;  3QD9 A;  5JCU A;  5C04 A;  3GX0 A;  1V40 A;  1A24 A;  1TRW A;  5A5K A;  3ZRD A;  4EDZ A;  4AJ6 A;  1YKC A;  5D93 A;  3ZYW A;  2AYT A;  2PVQ A;  4KX4 A;  3J7Y b;  4OD7 A;  1Z7R A;  1ERU A;  2FA4 A;  4EF0 A;  2GQL A;  5J5N A;  5GAN D;  3QMX A;  4DSS A;  1SK2 A;  1GSS A;  3VWX A;  4EL1 A;  1PX6 A;  1XFL A;  3KZQ A;  4POL A;  4IGJ A;  1EOH A;  2XPD A;  1AQX A;  4NXI A;  5KN0 A;  1JZR A;  1Z6M A;  2H19 A;  4QQ7 A;  3GTU B;  3EMX A;  4V2M A;  4BVY B;  2X64 A;  5D9T A;  5B6N A;  4FH8 A;  1B48 A;  1FG4 A;  1TDI A;  4PQ1 A;  4BPY A;  4F03 A;  5B8A A;  2H76 A;  1O7U A;  2H70 A;  5DQY A;  4WBJ A;  3KD0 A;  2MBS A;  1E2Y A;  2VCW A;  1GSF A;  1F6M C;  2LST A;  3HJM A;  1HYU A;  4HZ2 A;  1TJD A;  2V41 A;  5HFG A;  3TRP A;  4PNG A;  3KXO A;  2TIR A;  4MZC A;  2FUG 2;  3WD6 A;  4WXT A;  2JSY A;  5DCG A;  5DAK A;  1FB0 A;  4GRF A;  3RPN A;  3LWA A;  3M3M A;  3HD5 A;  3VWV A;  3HY2 A;  1O8W A;  4K2D A;  3HXS A;  5HR1 A;  1O81 A;  4ACS A;  3IC4 A;  1U6T A;  2B5E A;  1OC9 B;  4K7N A;  1GSU A;  2LJA A;  1EGO A;  2M80 A;  1GTB A;  3P7X A;  5CNW A;  3H4K A;  4KGI A;  3CMI A;  1LU4 A;  2HT9 A;  1OKD A;  4CW9 A;  4RQR A;  4MK3 A;  1T1V A;  4N10 A;  1G6W A;  2OE0 A;  4KAE A;  5ENU A;  5LCZ A;  3FW2 A;  2JSZ A;  2HZE B;  3IAS 2;  1HQO A;  4JED A;  2K8V A;  2WRT A;  4KDX A;  3GA4 A;  1QK8 A;  2XHF A;  4USS A;  1ERV A;  4ILF A;  3R3E A;  5GST A;  7GSS A;  1GRX A;  5ID2 A;  3E9J B;  3CTF A;  2X8G A;  1EP7 A;  2IFQ A;  2HSY A;  3SWL A;  1XZO A;  5J4U A;  2LQQ A;  3APO A;  4MA9 A;  5ECO B;  4WF4 A;  3KP8 A;  3TKS E;  3WGX A;  4I6X A;  2IMI A;  11GS A;  3TKS C;  3ZLP A;  2GT5 A;  4PX1 A;  4P3Y B;  4TR1 A;  5D96 A;  1BG5 A;  1R26 A;  1XW9 A;  4V2N A;  4IW9 A;  2V6K A;  1KEB A;  1XVQ A;  5IMD A;  3TKS A;  1YEX A;  4OO5 A;  2KOK A;  3HKR A;  2IME A;  4I5Q A;  1TRV A;  2JZS A;  3HVS A;  4KUN A;  2IMF A;  4LMW A;  1MDI A;  3HHV A;  1T4Y A;  5HR2 A;  4MZW A;  5JWR B;  1GNE A;  1VF1 A;  4XS6 A;  1SKR B;  2VCT A;  2C0D A;  2YWN A;  4G0I A;  4IJI A;  4EVM A;  4PQI A;  5A4U A;  1AW9 A;  1H4O A;  2A2R A;  4JZQ A;  1K0D A;  2CVD A;  4F0B A;  1M7T A;  2H1D A;  5HR3 A;  19GS A;  1FVK A;  3VWW A;  1SU9 A;  1U3I A;  3ZRE A;  1PGT A;  1N8J A;  2PMT A;  3RPP A;  3GFK A;  2GSS A;  5J9C A;  4EE0 A;  3ZFB A;  4BL7 A;  1J9B A;  2QKE A;  3M1G A;  4I8B A;  2VCV A;  1DE1 A;  17GS A;  3VI5 A;  5KN1 A;  5DBQ A;  1K0O A;  3BCI A;  3KTB A;  3HYP A;  4O32 A;  3ZL5 A;  2G2Q A;  2HSM A;  3D21 A;  2CX4 A;  2VCX A;  3FK8 A;  3ZVJ D;  4DEJ A;  4HDE A;  4TKY A;  5C00 A;  3D4T A;  3S9F A;  4ECB A;  4ULX A;  2KUC A;  4HQS A;  4IJ3 A;  4KDY A;  5A4W A;  5ECM B;  1WRY A;  3UEM A;  3TDG A;  3NIV A;  3GH9 A;  1VRS D;  2HSH A;  5H5R A;  1ZYQ B;  4DSR A;  5G1L A;  1YKA A;  4MH2 A;  4KSO A;  4L8E A;  3ZZX A;  3AY8 A;  1QGV A;  2ZNM A;  3MDK A;  3QCP A;  4D73 A;  3TJJ A;  3OR5 A;  2RM5 A;  5G5E A;  1SL1 B;  1RK4 A;  5B8B A;  1U88 A;  4F2I A;  4YH2 A;  1G7O A;  4J2F A;  2OAC A;  2R6K A;  2B5Y A;  3R2Q A;  3GST A;  20GS A;  3QPM A;  4HI7 A;  5DQS A;  5ELG A;  2V2G A;  5ELA A;  2H6X A;  1SKW B;  2CV4 A;  2VM1 A;  2LNT A;  1TU8 A;  2F8F A;  2BTO T;  3FZ9 A;  1Z7P A;  3UBK A;  1H75 A;  4AJ8 A;  5E4W A;  1F2E A;  2HQT A;  5KN2 A;  4MJC A;  3C1R A;  1QQ2 A;  4AJ7 A;  4XRA A;  1UA5 A;  4G9H A;  1QMV A;  1YJ6 A;  3HA9 A;  1USB A;  1PSQ A;  3CRU A;  3GL5 A;  5IOX A;  2PPT A;  1VF3 A;  2E2M A;  4XRD A;  4X43 A;  5JWQ B;  3GH6 A;  1JZW A;  4HJM A;  1NHY A;  3CRT A;  5AIX A;  4L5L A;  1TW9 A;  5ECR B; 
#chains in the Genus database with same CATH topology
 2KP1 A;  3RBT A;  2YZU A;  4Q5F A;  4O7H A;  3HVX A;  2EIO A;  3IA1 A;  4PTS A;  1SJI A;  4K8M A;  3WGE A;  4KE3 A;  2VLV A;  3HDC A;  1MD3 A;  3LGC A;  4MMM A;  4BVX A;  4KCA A;  2WGR A;  1TXX A;  2H0G A;  1O8X A;  3DRN A;  3Q74 A;  2HRK A;  2B5X A;  1U3A A;  2CX3 A;  1SVM A;  2OT3 A;  3GRX A;  5IMV A;  1ZZY A;  2LUS A;  3DVW A;  2P5R A;  3DGQ A;  3O76 A;  1XWG A;  2LRT A;  3L0H A;  18GS A;  3A5W A;  3KH7 A;  3TJB A;  1HNB A;  2C80 A;  4KDU A;  1GSD A;  3FY7 A;  3A2X A;  2YAN A;  5CRG A;  2FGX A;  3APQ A;  1R5A A;  2GQK A;  2AHE A;  2LJR A;  1B4Q A;  2GT6 A;  5IMC A;  3A3T A;  2C0G A;  4FYB A;  1EV9 A;  2PUK C;  3UAP A;  2H6Y A;  2MBT A;  1BJX A;  2DJJ A;  2B7K A;  3CXG A;  2WS2 A;  1UC7 A;  1GUL A;  1WJK A;  1XG8 A;  3EE2 A;  3TKQ A;  3F6D A;  1GLQ A;  1QUW A;  2B7J A;  4OMV A;  2DIZ A;  1ZOF A;  2IPA A;  2YWO A;  2H71 A;  1F3B A;  2JL4 A;  2DML A;  2YV7 A;  2YWI A;  3RFR C;  5ECP B;  5IIZ A;  1PA3 A;  4EKZ A;  3QAV A;  1PKZ A;  4WF5 A;  3C8E A;  2P0G A;  1X9W B;  1X0R A;  5CP1 A;  2FY6 A;  1NHO A;  1X5C A;  1OAZ A;  2HSN B;  2DJ1 A;  2AV4 A;  4ZBB A;  2PU9 C;  5DAL B;  5H5S A;  2F51 A;  5A5H B;  3KTL A;  2PER A;  1BF5 A;  4XS1 A;  1XWA A;  3F3R A;  4MF6 A;  2Z9S A;  3UOM A;  1U87 A;  3QR6 A;  2AB6 A;  4IEL A;  4HU7 A;  2DKH A;  5IM9 A;  2VCZ A;  3I6A A;  4IQ1 A;  3IV4 A;  4TR4 A;  1K3O A;  3O3T A;  3VLN A;  3VK9 A;  3ERF A;  4FIW A;  2WVX B;  4HQZ A;  3TGZ A;  1PL1 A;  3RGB C;  3IRA A;  1ML6 A;  1BAY A;  1JLV A;  1Y25 A;  4WEY A;  4MDC A;  4G19 A;  2DMM A;  1ZL9 A;  3ZVJ A;  4NV5 A;  4ZL8 A;  5AGY A;  16GS A;  4ZIJ A;  5AN1 A;  1XBS A;  3TKR A;  2H74 A;  4YQV A;  4Q5N A;  2BJX A;  6GSX A;  3NZN A;  1TRS A;  1DE2 A;  1AUC A;  5IMA A;  3RHC A;  3LXT A;  4ECI A;  1GTU A;  4MZB A;  4KW6 A;  2WZ9 A;  1PN9 A;  4EC0 A;  2VL9 A;  2B1L A;  4V1A p;  3ED3 A;  2PGT A;  3HVV A;  4O92 A;  1V58 A;  1W4V A;  1SL0 B;  2N5A A;  3GSS A;  2DJK A;  2IIY A;  1Z6N A;  3ZML A;  4TXO B;  3F4R A;  4LA1 A;  1PD2 1;  3NOF A;  4MF5 A;  3FRC A;  1SK1 A;  4AGS A;  1GNW A;  3LOR A;  1BYE A;  1EZK A;  3F4T A;  3CHX C;  5ABR A;  4FYU A;  3LYK A;  4O5R A;  2C3T A;  4L5O A;  4RI6 A;  4EDY A;  1KBN A;  1TI3 A;  2DC5 A;  2DKI A;  1ZCP A;  5KEJ A;  1AQV A;  3F0I A;  3CSJ A;  3BOA A;  6GSS A;  1K3L A;  5ECK B;  2CA8 A;  2OA7 A;  4FYC A;  3W8J A;  2QGV A;  2X8H A;  3ZIV A;  2DJ3 A;  5J9B A;  2UV8 G;  5DCH A;  2TRX A;  1FB6 A;  1ERT A;  1A2J A;  3KM6 A;  1G7E A;  1FO5 A;  1QXH A;  4YQM A;  2KLX A;  3PH9 A;  4ECJ A;  1CQG A;  4MP4 A;  5JCG A;  2VM2 A;  5CAX A;  1S4B P;  4JBB A;  2IL3 A;  1PL2 A;  1KNG A;  4MPG A;  3WYW A;  3HCZ A;  3P2A A;  1XXU A;  1F3A A;  2GTU A;  2RM6 A;  1ABA A;  2A4V A;  4MJA A;  2WUL A;  1RW1 A;  2GSQ A;  3I43 A;  3KGK A;  5F8B A;  3U5R E;  2VCQ A;  1GUH A;  3KCM A;  2FWH A;  1GSE A;  1TRU A;  1JZD A;  1V98 A;  4EXJ A;  1PMT A;  2HFD A;  1OC3 A;  1S3D A;  2BMX A;  2GLR A;  4JRR A;  4CHS A;  2MZC A;  13GS A;  5A4V A;  2M72 A;  5CRH A;  2O87 A;  3U6V A;  4ISD A;  3IR4 A;  2H72 A;  3FZA A;  1XIY A;  4QMK A;  4Z2T A;  4ZL7 A;  2ON5 A;  3LSZ A;  2P31 A;  2ZCT A;  4XCS A;  5JCW A;  5CRW A;  4IP1 A;  4V2L A;  2N5B A;  4GSS A;  2PVO C;  4POM A;  5AIS A;  5D9V A;  4ZB9 A;  2V6O A;  5LNK e;  1IYH A;  1T00 A;  4EIP A;  2FHE A;  4G0L A;  1RQM A;  3H93 A;  1J0F A;  4HSC X;  2L6D A;  3Q19 A;  4JR4 A;  2JZR A;  5G31 A;  4Z2U A;  4IS0 A;  5G1K A;  3FKF A;  2C0F A;  2K18 A;  3N9J A;  1NM3 A;  1TI1 A;  4IHU A;  2L5L A;  3H8Q A;  2H1B A;  2C0E A;  4OO4 A;  3TB2 A;  4LLR A;  2JZT A;  3TOT A;  1A2M A;  1ON4 A;  4WBR D;  4MNN A;  2R3X A;  4DVC A;  2F9S A;  5KOX A;  5D73 A;  14GS A;  4I2U A;  3G7I A;  5A34 A;  1EGR A;  1EEM A;  2O8V B;  1B8X A;  5L71 A;  4GDF A;  4WET A;  1S3A A;  1J08 A;  3TKP A;  2OE1 A;  2WVZ A;  2DJ0 A;  1ERW A;  1AAZ A;  5EL8 A;  1JFU A;  2V32 A;  2MMN A;  1V57 A;  5DJM A;  4K0N A;  3GIX A;  3H79 A;  4DSS B;  2AAW A;  2HLS A;  4IVF A;  3IE3 A;  2I81 A;  1FW1 A;  3KEB A;  3HJP A;  5ECN B;  2WW3 A;  4HOJ A;  3C71 A;  3TRQ A;  4GQF A;  1PKW A;  2H30 A;  4W66 A;  2XPE A;  1OE8 A;  1K0B A;  3G7J A;  2H66 A;  2ON7 A;  3L9U A;  3CTG A;  1WE0 A;  1UVZ A;  2NVL A;  4DSQ A;  1A2L A;  4GQC A;  2N5F A;  5HFI A;  1M2A A;  5IO2 A;  2H6Z A;  2ZUP A;  3VPT A;  1GTI A;  1M2B A;  3J7Y k;  3UMA A;  3GNJ A;  4NAX A;  3BCK A;  1C72 A;  1URM A;  2H0I A;  3GKX A;  4F9Z A;  1T7P B;  5ECL B;  2NDO A;  2WW0 A;  5DAK B;  1MDK A;  3UVT A;  4RQX A;  1M99 A;  1M3I A;  3C7M A;  4KF9 A;  2JAD A;  1WIK A;  5BRT A;  4PQH A;  2HRF A;  3DD3 A;  2GSR A;  5BMU A;  2L6C A;  2WJU A;  3LXZ A;  1VF4 A;  2IJY A;  1X9M B;  2HRN A;  2EC4 A;  2MMO A;  1N25 A;  4ZXG A;  2PBJ A;  5AIV A;  2H8L A;  2H1A A;  2VKZ G;  2O89 A;  5F06 A;  3ZTL A;  2CQ9 A;  5EVO A;  3GN3 A;  4K7O A;  1SVO A;  2YWM A;  3PGT A;  3D6I A;  2OJL A;  5DAL A;  5J40 A;  3TRX A;  3F8U A;  2B6M A;  3IXR A;  1AXD A;  3APS A;  4XIH A;  2L4C A;  1SD8 A;  2C1Y A;  3FR9 A;  3DYR A;  12GS A;  2P5Q A;  1YQ1 A;  4YKF A;  3M0F A;  4RUV A;  3C73 A;  3DML A;  1EV4 A;  4QL7 A;  1FOV A;  5A1N A;  5ID2 B;  2IFQ B;  4AF2 A;  4AI6 A;  3D0Z A;  2VD0 A;  1LBK A;  2C8U A;  5ECQ B;  9GSS A;  2CZ3 A;  3IAM 2;  1FAA A;  1UN2 A;  1K0A A;  2C4J A;  4TR1 B;  2B1K A;  6GST A;  2GST A;  4GST A;  4PHZ C;  2VIM A;  4NWY A;  2CZ2 A;  4I97 A;  1F9M A;  1YZX A;  1SYX A;  2X8C A;  1DUG A;  1OE7 A;  1VGL A;  1O85 A;  2FNO A;  5FWG A;  3GTU A;  4AKG A;  3QAW A;  3L78 A;  4G2E A;  4BVY A;  1NW2 A;  2O36 A;  2LRC A;  2V1M A;  2VOC A;  1OYJ A;  2MMA A;  2K6V A;  1WOU A;  4NMU A;  4EO3 A;  6GSU A;  4YAP A;  4J57 E;  1MD4 A;  2RLI A;  4PUR A;  3VUR A;  4XS4 B;  5IOW A;  3QFA C;  5ECI B;  2YOI A;  3UBL A;  2J9H A;  4WKW A;  2HNL A;  3DWV A;  3HJO A;  3M9J A;  1YVL A;  5B7C A;  1O73 A;  4N30 A;  1QFN A;  4PI0 C;  1M9A A;  2WW2 A;  1TTZ A;  4OCF A;  2OBK A;  2ALB A;  4FO5 A;  2HSM B;  3GYK A;  3CSI A;  4MH3 A;  3IC8 A;  2VAF A;  2RUF A;  3VFI A;  1OC9 A;  3LYP A;  2XBQ A;  1K3Y A;  2HXK A;  4KA0 A;  3TCO A;  1X9S B;  1NSW A;  5CYY A;  5DVB A;  4GWR A;  2HYX A;  1Y6E A;  3EWL A;  2FLS A;  4ZB7 A;  2MYG A;  3A2V A;  1GUK A;  2RUE A;  3H1N A;  4D73 B;  3WGD A;  2REM A;  3FYG A;  1AC1 A;  1BG1 A;  2KHP A;  2HZE A;  5LD0 A;  4L0U A;  1EWX A;  4BWQ A;  2PWJ A;  1TOF A;  5HFK A;  1WP0 A;  2YPM A;  5GAP D;  2GZZ A;  4K0G A;  3QDN A;  1S3R A;  2JU5 A;  3V1W A;  3HVN A;  3GUS A;  1GH2 A;  2D2Z A;  1T8E B;  1SL2 B;  1V2A A;  4AKX B;  3MYD A;  4KH7 A;  3C1S A;  1YEP A;  1GSQ A;  5IMZ A;  3CWG A;  2CVK A;  3EU4 A;  3CQF A;  1LJR A;  4POB A;  3UJ1 A;  2AUV A;  3BJ5 A;  3EYT A;  1EOG A;  4ZB8 A;  2I3Y A;  3MSZ A;  1R7H A;  2FD3 A;  4PUF C;  4AKI A;  1MEK A;  4GF0 A;  3A2W A;  2IMK A;  3VPQ A;  4POK A;  1HNA A;  3PIN A;  2QSI A;  1SKS B;  4OWY A;  3QOU A;  1JLW A;  1GLP A;  4MAB A;  1CQH A;  1TXU A;  2F8A A;  2WDU A;  3O6T A;  4GSN A;  2QC7 A;  1XWC A;  5F05 A;  1BX9 A;  1E6B A;  4ID0 A;  3GX8 A;  3EIN A;  1AQW A;  4EUY A;  5EPF A;  2I1U A;  4I2T A;  1VF2 A;  3KMN A;  3KJY A;  2GGT A;  4IKH A;  1GP1 A;  5IQY A;  3MAK A;  2O7K A;  1HD2 A;  2NPB A;  2HZF A;  3GKN A;  5ECS A;  2J23 A;  3TOU A;  2CVB A;  1XWB A;  3M8N A;  2GQM A;  3F3Q A;  4KND A;  2E0Q A;  4YKG A;  3F4S A;  2E2G A;  1FVJ A;  4BVX B;  3RDW A;  2HRK B;  3DKS A;  2GDR A;  4IQA A;  2R0P A;  4CDO A;  1SD9 A;  3LFL A;  3ZFL A;  3IOS A;  4OFT A;  5D9X A;  4HJ2 A;  3IPZ A;  4NHZ A;  4MJB A;  1B4P A;  3HZ8 A;  22GS A;  4FQU A;  4ZBA A;  2VLU A;  3BD2 A;  1DSB A;  1XCC A;  2FWE A;  2IN3 A;  4KCE A;  2WW1 A;  1B9X C;  2WFC A;  3TUE A;  3EVI A;  1PX7 A;  3N5O A;  3EUR A;  2X4A A;  3KP9 A;  3DEX A;  4G0K A;  1ZGN A;  2M46 A;  3DXB A;  4JE1 A;  5F0G A;  3UVH A;  2G0F A;  1Z3E A;  1K0M A;  3W8S A;  2DSA A;  4BWS A;  2LRN A;  4ML1 A;  1N2A A;  3IDV A;  4OCE A;  4TN8 A;  2EIR A;  3FEU A;  1EEJ A;  4PUA A;  5D8I A;  3HMJ G;  4HU9 A;  4ML6 A;  4BA7 A;  5IO0 A;  3LEF A;  2VD1 A;  3L4N A;  1WMJ A;  1GTA A;  4KSM A;  5FT3 A;  3GMF A;  5DJL A;  1TP9 A;  3WT1 A;  2UZ8 A;  4WR4 A;  5JWO B;  3UL3 A;  3D22 A;  3ZIT A;  3GUR A;  3VWU A;  4K6X A;  2VLT A;  2YP6 A;  1YY7 A;  1XOB A;  2L5O A;  3FR6 A;  3LJR A;  1A8L A;  5HQP A;  5IPG A;  2YV9 A;  3G7Y A;  1G6Y A;  1I5G A;  2WB9 A;  3GKK A;  1XOA A;  3GV1 A;  2PN8 A;  2OKA A;  2F3M A;  2EIQ A;  1FHE A;  1S3C A;  4GLT A;  4MLY A;  4WR5 A;  1F37 A;  3IHQ A;  1SYR A;  3A5I A;  5CO3 A;  2IMD A;  2O85 A;  3L9V A;  1A8Y A;  2LTK A;  3KIJ A;  3IHG A;  1MTC A;  1TK5 B;  4AKH A;  2YNX A;  2R37 A;  3ZMK A;  3FZ5 A;  5GZZ B;  3LQ7 A;  3MIX A;  2L59 A;  4YQU A;  3US3 A;  4FXY P;  5F07 A;  1PRX A;  1SJZ A;  2FA8 A;  1SJ6 A;  1A0F A;  1G0T A;  5COH A;  2FCH A;  1GSY A;  3EC3 A;  1X5D A;  4H86 A;  2MMZ A;  4A5P A;  3PPU A;  3KMO A;  2TRC P;  1WPI A;  2JAC A;  2GZP A;  1I1I P;  4HEA 2;  5D9W A;  2LQO A;  3CYN A;  1ST9 A;  2A2P A;  2E7P A;  1GWC A;  2DIY A;  3HZ4 A;  8GSS A;  4HUA A;  4GTU A;  1XW5 A;  5EY6 A;  3EU3 A;  4Z7X A;  4XS4 A;  3F63 A;  2OAD A;  3BBY A;  4MPF A;  5G2Z A;  3GL3 A;  2H0H A;  2H01 A;  2VL2 C;  5GSS A;  3ISO A;  1HNC A;  4LMV A;  1O6J A;  2NBS A;  3E3E A;  4L0W A;  4F82 A;  3P8W A;  2VL2 A;  5J47 A;  4N0Z A;  3F6F A;  2C3N A;  4NHW A;  1JZO A;  3JCM L;  4IP6 A;  4IBP A;  4N11 A;  4ZBD A;  3FR3 A;  2C3Q A;  2HI7 A;  2K9F A;  5J41 A;  4PGT A;  2YJ7 A;  2VUP A;  3P90 A;  3LG6 A;  4BIK A;  2XC2 A;  1ZYE A;  5J3R A;  2LNS A;  4XTS A;  1Q98 A;  1JHB A;  2WCI A;  5FHI A;  2VL3 A;  3WT2 A;  3IK7 A;  2FWG A;  4NPB A;  2DBC A;  3ME8 A;  1B9Y C;  4TR0 A;  1XPV A;  4LL1 B;  3IBH A;  1YF1 A;  3G9B A;  2HSN A;  5DDL A;  4K1F A;  1BED A;  5A5H A;  1ZMA A;  1K0C A;  2CAI A;  4K7I A;  4GXZ A;  5CRD A;  1M9B A;  4IN0 A;  2CT6 A;  3QFB C;  4O5U A;  1EP8 A;  2YZH A;  4TOP A;  2WVX A;  5H5Q A;  10GS A;  3KH9 A;  4PXO A;  3ERW A;  3DVX A;  4RI7 A;  1TU7 A;  3ZIJ A;  2K8S A;  2R0C A;  2AJQ B;  4YAV A;  2H73 A;  3IK9 A;  2GZY A;  6GSW A;  3E0U A;  5KN3 A;  3PR8 A;  4G10 A;  2I4A A;  5E59 A;  4XHM A;  1AIU A;  2DJ2 A;  3FMW A;  2X49 A;  3LW9 A;  4V1A g;  3FHK A;  3D5J A;  3EMP A;  1THX A;  3I9V 2;  4OFN A;  5G5F A;  2I9H A;  1KTE A;  3GKM A;  4OFM A;  1ILO A;  1TK8 B;  4F0C A;  1YF0 A;  5CRE A;  1Z5Y E;  2DLX A;  4KB3 A;  4N0V A;  1X5E A;  2R4V A;  1SVL A;  1T4Z A;  5A34 B;  2B3S A;  4TW5 A;  2H1G A;  4TXO A;  2LJK A;  2VO4 A;  3M9K A;  2GS3 A;  5INY A;  2R2J A;  3TJF A;  3GHA A;  2WZS A;  4K9Z A;  3K8N A;  3L9S A;  3W6G A;  3TU3 B;  1XVW A;  3Q18 A;  4EIQ A;  3ERG A;  2EFD A;  4E8E A;  1BQ7 A;  3Q6O A;  5IPH A;  2YCD A;  1A0R P;  3UIW A;  6GSY A;  2GVP A;  4Q5R A;  1W89 A;  2HE3 A;  4HZ4 A;  1M0U A;  1DBY A;  4PNF A;  4BL7 B;  1PQN A;  3CSH A;  4X4J A;  2L57 A;  4JU5 A;  1SK0 A;  3SBC A;  2OE3 A;  5B6M A;  4JR6 A;  4ZIL A;  2LV3 A;  2R5G A;  2X99 A;  1GL8 A;  3CBU A;  4TR3 A;  2RII A;  2YJH A;  2XBI A;  6GSV A;  4N3Z A;  1R4W A;  4J56 E;  4ECC A;  3DIE A;  4ZB6 A;  1XW6 A;  1OKT A;  3I69 A;  1TK0 B;  1ACV A;  2ES7 A;  1Y1U A;  1R5P A;  3D4M A;  2OBI A;  1YDK A;  2H75 A;  2IWT A;  2FWF A;  4E8H A;  5BMU B;  2CAQ A;  1Q4J A;  1I9D A;  1XWK A;  1SEN A;  1T3B A;  1THO A;  4X1U A;  2L4Q A;  2NTO A;  2HRA A;  3MNG A;  1IYI A;  2LEG A;  3FZ4 A;  3RHB A;  5ECH B;  4ZL9 A;  1V9W A;  4QL9 A;  3RAZ A;  4TXV A;  4MJE A;  3F9U A;  2EFE A;  1Z9H A;  5G30 A;  2KP2 A;  3MWH A;  4Q5Q A;  1MDJ A;  2EFC A;  4MF7 A;  5IMF A;  1GUM A;  1M2D A;  3TJK A;  2LKU A;  3ME7 A;  3TJG A;  1TKD B;  4LL4 B;  1OVN A;  4GCI A;  4HS1 A;  2A2S A;  2LS5 A;  4TVE A;  3QAG A;  3EPT A;  1WWJ A;  2YN1 A;  4TRX A;  1K0N A;  1A23 A;  3UAR A;  4MCU A;  4NV2 A;  5HR0 A;  1OC8 A;  3VI7 A;  4X0X A;  3QD9 A;  5JCU A;  5C04 A;  5A1N B;  4K5R A;  3GX0 A;  1V40 A;  1A24 A;  1TRW A;  4K2X A;  5A5K A;  3ZRD A;  4EDZ A;  4AJ6 A;  4Z2R A;  1YKC A;  5D93 A;  3ZYW A;  2AYT A;  2PVQ A;  4KX4 A;  3J7Y b;  4OD7 A;  1Z7R A;  1ERU A;  4G01 A;  2FA4 A;  4EF0 A;  2GQL A;  5J5N A;  5GAN D;  3QMX A;  4DSS A;  1SK2 A;  1GSS A;  3VWX A;  4EL1 A;  1PX6 A;  1XFL A;  3KZQ A;  4POL A;  4IGJ A;  1EOH A;  2XPD A;  1AQX A;  4NXI A;  5KN0 A;  1JZR A;  1Z6M A;  2H19 A;  4QQ7 A;  3GTU B;  3EMX A;  4V2M A;  4BVY B;  2X64 A;  5D9T A;  5B6N A;  4FH8 A;  1B48 A;  1FG4 A;  1TDI A;  4PQ1 A;  4BPY A;  4F03 A;  5B8A A;  2H76 A;  1O7U A;  2H70 A;  5DQY A;  4WBJ A;  3KD0 A;  2MBS A;  1E2Y A;  2VCW A;  1GSF A;  1F6M C;  2LST A;  3HJM A;  1PFO A;  1HYU A;  4HZ2 A;  1TJD A;  2V41 A;  5HFG A;  3TRP A;  4PNG A;  3KXO A;  2TIR A;  4MZC A;  2FUG 2;  3WD6 A;  4WXT A;  2JSY A;  5DCG A;  5DAK A;  1FB0 A;  4GRF A;  3RPN A;  3LWA A;  3M3M A;  3HD5 A;  3VWV A;  3HY2 A;  1O8W A;  4K2D A;  3HXS A;  5HR1 A;  1O81 A;  4ACS A;  3IC4 A;  4PI2 C;  1U6T A;  2B5E A;  1OC9 B;  4K7N A;  1GSU A;  2LJA A;  1EGO A;  2M80 A;  1GTB A;  3P7X A;  5CNW A;  3H4K A;  4KGI A;  3CMI A;  1LU4 A;  2HT9 A;  1OKD A;  4CW9 A;  4RQR A;  4MK3 A;  2EFH A;  1T1V A;  4N10 A;  2O3E A;  1G6W A;  2OE0 A;  4KAE A;  5ENU A;  5LCZ A;  3FW2 A;  2JSZ A;  2HZE B;  3IAS 2;  1ZYN A;  1HQO A;  4JED A;  2K8V A;  2WRT A;  4KDX A;  3GA4 A;  1QK8 A;  2XHF A;  4USS A;  1ERV A;  4ILF A;  4ICY A;  3R3E A;  5GST A;  7GSS A;  1GRX A;  5ID2 A;  3E9J B;  3CTF A;  2X8G A;  1EP7 A;  2IFQ A;  2HSY A;  3SWL A;  2O5V A;  1XZO A;  5J4U A;  2LQQ A;  3APO A;  4MA9 A;  5ECO B;  4WF4 A;  3KP8 A;  3TKS E;  3WGX A;  4I6X A;  2QA2 A;  2IMI A;  11GS A;  3TKS C;  3ZLP A;  2GT5 A;  4PX1 A;  4P3Y B;  4TR1 A;  5D96 A;  1BG5 A;  1R26 A;  1XW9 A;  4V2N A;  4IW9 A;  2V6K A;  1KEB A;  1XVQ A;  5IMD A;  4E68 A;  3TKS A;  1YEX A;  4OO5 A;  2KOK A;  3HKR A;  2IME A;  4I5Q A;  1TRV A;  2JZS A;  3HVS A;  4KUN A;  2IMF A;  4LMW A;  1MDI A;  3HHV A;  1T4Y A;  5HR2 A;  4MZW A;  5JWR B;  5J4Y A;  1GNE A;  1VF1 A;  4O5Q A;  4XS6 A;  2WVY A;  1SKR B;  2VCT A;  2C0D A;  2YWN A;  4G0I A;  4IJI A;  4EVM A;  4PQI A;  5KOW A;  5A4U A;  1AW9 A;  2A4H A;  1H4O A;  2A2R A;  4JZQ A;  1K0D A;  2CVD A;  4F0B A;  1M7T A;  2H1D A;  5HR3 A;  19GS A;  1FVK A;  3VWW A;  2R0G A;  1SU9 A;  1U3I A;  3ZRE A;  5J4V A;  1PGT A;  1N8J A;  2PMT A;  3RPP A;  3GFK A;  2GSS A;  5J9C A;  4EE0 A;  3ZFB A;  4BL7 A;  1J9B A;  2QKE A;  3M1G A;  4I8B A;  2VCV A;  1DE1 A;  17GS A;  3VI5 A;  5KN1 A;  5DBQ A;  1K0O A;  3BCI A;  3KTB A;  1FOH A;  4CY8 A;  3HYP A;  1M3J A;  4O32 A;  3ZL5 A;  2G2Q A;  2HSM A;  3D21 A;  2CX4 A;  2VCX A;  3FK8 A;  3ZVJ D;  4DEJ A;  4HDE A;  4TKY A;  5C00 A;  3D4T A;  3S9F A;  4ECB A;  4ULX A;  2KUC A;  2H1L A;  4HQS A;  4IJ3 A;  4KDY A;  5A4W A;  5ECM B;  1WRY A;  3UEM A;  3TDG A;  3NIV A;  3GH9 A;  1VRS D;  2HSH A;  5H5R A;  1ZYQ B;  4DSR A;  5G1L A;  1YKA A;  4MH2 A;  4KSO A;  4L8E A;  3ZZX A;  3AY8 A;  1QGV A;  2ZNM A;  3MDK A;  3QCP A;  4D73 A;  3TJJ A;  3OR5 A;  2RM5 A;  5G5E A;  1SL1 B;  1RK4 A;  5B8B A;  1U88 A;  2QA1 A;  4F2I A;  4YH2 A;  1G7O A;  4J2F A;  2OAC A;  2R6K A;  2B5Y A;  3R2Q A;  3GST A;  20GS A;  3QPM A;  4HI7 A;  5DQS A;  5ELG A;  2V2G A;  5ELA A;  2H6X A;  1SKW B;  2CV4 A;  2VM1 A;  2LNT A;  1TU8 A;  2F8F A;  2BTO T;  3FZ9 A;  4K5S A;  1PN0 A;  1Z7P A;  3UBK A;  1H75 A;  4AJ8 A;  5E4W A;  4CY6 A;  1F2E A;  2HQT A;  5KN2 A;  4MJC A;  3C1R A;  1QQ2 A;  1ZYP A;  4AJ7 A;  4XRA A;  1UA5 A;  4G9H A;  1QMV A;  1YJ6 A;  3HA9 A;  1USB A;  1PSQ A;  3CRU A;  3GL5 A;  5IOX A;  2PPT A;  1VF3 A;  2E2M A;  4XRD A;  4X43 A;  5JWQ B;  1YEW C;  3GH6 A;  1JZW A;  4HJM A;  1NHY A;  3CRT A;  5AIX A;  4L5L A;  1TW9 A;  5ECR B; 
#chains in the Genus database with same CATH homology
 2KP1 A;  3RBT A;  2YZU A;  4Q5F A;  4O7H A;  3HVX A;  2EIO A;  3IA1 A;  4PTS A;  1SJI A;  4K8M A;  3WGE A;  4KE3 A;  2VLV A;  3HDC A;  1MD3 A;  3LGC A;  4MMM A;  4BVX A;  4KCA A;  2WGR A;  1TXX A;  2H0G A;  1O8X A;  3DRN A;  3Q74 A;  2HRK A;  2B5X A;  1U3A A;  2CX3 A;  1SVM A;  2OT3 A;  3GRX A;  5IMV A;  1ZZY A;  2LUS A;  3DVW A;  2P5R A;  3DGQ A;  3O76 A;  1XWG A;  2LRT A;  3L0H A;  18GS A;  3A5W A;  3KH7 A;  3TJB A;  1HNB A;  2C80 A;  4KDU A;  1GSD A;  3FY7 A;  3A2X A;  2YAN A;  5CRG A;  2FGX A;  3APQ A;  1R5A A;  2GQK A;  2AHE A;  2LJR A;  1B4Q A;  2GT6 A;  5IMC A;  3A3T A;  2C0G A;  4FYB A;  1EV9 A;  2PUK C;  3UAP A;  2H6Y A;  2MBT A;  1BJX A;  2DJJ A;  2B7K A;  3CXG A;  2WS2 A;  1UC7 A;  1GUL A;  1WJK A;  3EE2 A;  3TKQ A;  3F6D A;  1GLQ A;  1QUW A;  2B7J A;  4OMV A;  2DIZ A;  1ZOF A;  2IPA A;  2YWO A;  2H71 A;  1F3B A;  2JL4 A;  2DML A;  2YV7 A;  2YWI A;  5ECP B;  5IIZ A;  1PA3 A;  4EKZ A;  3QAV A;  1PKZ A;  4WF5 A;  3C8E A;  2P0G A;  1X9W B;  1X0R A;  5CP1 A;  2FY6 A;  1NHO A;  1X5C A;  1OAZ A;  2HSN B;  2DJ1 A;  2AV4 A;  4ZBB A;  2PU9 C;  5DAL B;  5H5S A;  2F51 A;  5A5H B;  3KTL A;  2PER A;  1BF5 A;  4XS1 A;  1XWA A;  3F3R A;  4MF6 A;  2Z9S A;  3UOM A;  1U87 A;  3QR6 A;  2AB6 A;  4IEL A;  4HU7 A;  2DKH A;  5IM9 A;  2VCZ A;  3I6A A;  4IQ1 A;  3IV4 A;  4TR4 A;  1K3O A;  3O3T A;  3VLN A;  3VK9 A;  3ERF A;  4FIW A;  4HQZ A;  3TGZ A;  1PL1 A;  3IRA A;  1ML6 A;  1BAY A;  1JLV A;  1Y25 A;  4WEY A;  4MDC A;  4G19 A;  2DMM A;  1ZL9 A;  3ZVJ A;  4NV5 A;  4ZL8 A;  5AGY A;  16GS A;  4ZIJ A;  5AN1 A;  1XBS A;  3TKR A;  2H74 A;  4YQV A;  4Q5N A;  2BJX A;  6GSX A;  3NZN A;  1TRS A;  1DE2 A;  1AUC A;  5IMA A;  3RHC A;  3LXT A;  4ECI A;  1GTU A;  4MZB A;  4KW6 A;  2WZ9 A;  1PN9 A;  4EC0 A;  2VL9 A;  2B1L A;  4V1A p;  3ED3 A;  2PGT A;  3HVV A;  4O92 A;  1V58 A;  1W4V A;  1SL0 B;  2N5A A;  3GSS A;  2DJK A;  2IIY A;  1Z6N A;  3ZML A;  4TXO B;  3F4R A;  4LA1 A;  1PD2 1;  3NOF A;  4MF5 A;  3FRC A;  1SK1 A;  4AGS A;  1GNW A;  3LOR A;  1BYE A;  1EZK A;  3F4T A;  5ABR A;  4FYU A;  3LYK A;  4O5R A;  2C3T A;  4L5O A;  4RI6 A;  4EDY A;  1KBN A;  1TI3 A;  2DC5 A;  2DKI A;  1ZCP A;  5KEJ A;  1AQV A;  3F0I A;  3CSJ A;  3BOA A;  6GSS A;  1K3L A;  5ECK B;  2CA8 A;  2OA7 A;  4FYC A;  3W8J A;  2QGV A;  2X8H A;  3ZIV A;  2DJ3 A;  5J9B A;  2UV8 G;  5DCH A;  2TRX A;  1FB6 A;  1ERT A;  1A2J A;  3KM6 A;  1G7E A;  1FO5 A;  1QXH A;  4YQM A;  2KLX A;  3PH9 A;  4ECJ A;  1CQG A;  4MP4 A;  5JCG A;  2VM2 A;  5CAX A;  4JBB A;  2IL3 A;  1PL2 A;  1KNG A;  4MPG A;  3WYW A;  3HCZ A;  3P2A A;  1XXU A;  1F3A A;  2GTU A;  2RM6 A;  1ABA A;  2A4V A;  4MJA A;  2WUL A;  1RW1 A;  2GSQ A;  3I43 A;  3KGK A;  5F8B A;  3U5R E;  2VCQ A;  1GUH A;  3KCM A;  2FWH A;  1GSE A;  1TRU A;  1JZD A;  1V98 A;  4EXJ A;  1PMT A;  2HFD A;  1OC3 A;  1S3D A;  2BMX A;  2GLR A;  4JRR A;  4CHS A;  2MZC A;  13GS A;  5A4V A;  2M72 A;  5CRH A;  2O87 A;  3U6V A;  4ISD A;  3IR4 A;  2H72 A;  3FZA A;  1XIY A;  4QMK A;  4Z2T A;  4ZL7 A;  2ON5 A;  3LSZ A;  2P31 A;  2ZCT A;  4XCS A;  5JCW A;  5CRW A;  4IP1 A;  4V2L A;  2N5B A;  4GSS A;  2PVO C;  4POM A;  5AIS A;  5D9V A;  4ZB9 A;  2V6O A;  5LNK e;  1IYH A;  1T00 A;  4EIP A;  2FHE A;  4G0L A;  1RQM A;  3H93 A;  1J0F A;  2L6D A;  3Q19 A;  4JR4 A;  2JZR A;  5G31 A;  4Z2U A;  4IS0 A;  5G1K A;  3FKF A;  2C0F A;  2K18 A;  3N9J A;  1NM3 A;  1TI1 A;  4IHU A;  2L5L A;  3H8Q A;  2H1B A;  2C0E A;  4OO4 A;  3TB2 A;  4LLR A;  2JZT A;  3TOT A;  1A2M A;  1ON4 A;  4WBR D;  4MNN A;  2R3X A;  4DVC A;  2F9S A;  5KOX A;  5D73 A;  14GS A;  4I2U A;  3G7I A;  5A34 A;  1EGR A;  1EEM A;  2O8V B;  1B8X A;  5L71 A;  4GDF A;  4WET A;  1S3A A;  1J08 A;  3TKP A;  2OE1 A;  2DJ0 A;  1ERW A;  1AAZ A;  5EL8 A;  1JFU A;  2V32 A;  2MMN A;  1V57 A;  5DJM A;  4K0N A;  3GIX A;  3H79 A;  4DSS B;  2AAW A;  2HLS A;  4IVF A;  3IE3 A;  2I81 A;  1FW1 A;  3KEB A;  3HJP A;  5ECN B;  4HOJ A;  3C71 A;  3TRQ A;  4GQF A;  1PKW A;  2H30 A;  4W66 A;  2XPE A;  1OE8 A;  1K0B A;  3G7J A;  2H66 A;  2ON7 A;  3L9U A;  3CTG A;  1WE0 A;  1UVZ A;  2NVL A;  4DSQ A;  1A2L A;  4GQC A;  2N5F A;  5HFI A;  1M2A A;  5IO2 A;  2H6Z A;  2ZUP A;  3VPT A;  1GTI A;  1M2B A;  3J7Y k;  3UMA A;  3GNJ A;  4NAX A;  3BCK A;  1C72 A;  1URM A;  2H0I A;  3GKX A;  4F9Z A;  1T7P B;  5ECL B;  2NDO A;  5DAK B;  1MDK A;  3UVT A;  4RQX A;  1M99 A;  3C7M A;  4KF9 A;  2JAD A;  1WIK A;  5BRT A;  4PQH A;  2HRF A;  3DD3 A;  2GSR A;  5BMU A;  2L6C A;  2WJU A;  3LXZ A;  1VF4 A;  2IJY A;  1X9M B;  2HRN A;  2EC4 A;  2MMO A;  1N25 A;  4ZXG A;  2PBJ A;  5AIV A;  2H8L A;  2H1A A;  2VKZ G;  2O89 A;  5F06 A;  3ZTL A;  2CQ9 A;  5EVO A;  3GN3 A;  4K7O A;  1SVO A;  2YWM A;  3PGT A;  3D6I A;  2OJL A;  5DAL A;  5J40 A;  3TRX A;  3F8U A;  2B6M A;  3IXR A;  1AXD A;  3APS A;  4XIH A;  2L4C A;  1SD8 A;  2C1Y A;  3FR9 A;  3DYR A;  12GS A;  2P5Q A;  1YQ1 A;  4YKF A;  3M0F A;  4RUV A;  3C73 A;  3DML A;  1EV4 A;  4QL7 A;  1FOV A;  5A1N A;  5ID2 B;  2IFQ B;  4AF2 A;  4AI6 A;  3D0Z A;  2VD0 A;  1LBK A;  2C8U A;  5ECQ B;  9GSS A;  2CZ3 A;  3IAM 2;  1FAA A;  1UN2 A;  1K0A A;  2C4J A;  4TR1 B;  2B1K A;  6GST A;  2GST A;  4GST A;  2VIM A;  4NWY A;  2CZ2 A;  4I97 A;  1F9M A;  1YZX A;  1SYX A;  2X8C A;  1DUG A;  1OE7 A;  1VGL A;  1O85 A;  2FNO A;  5FWG A;  3GTU A;  4AKG A;  3QAW A;  3L78 A;  4G2E A;  4BVY A;  1NW2 A;  2LRC A;  2V1M A;  2VOC A;  1OYJ A;  2MMA A;  2K6V A;  1WOU A;  4NMU A;  4EO3 A;  6GSU A;  4YAP A;  4J57 E;  1MD4 A;  2RLI A;  4PUR A;  3VUR A;  4XS4 B;  5IOW A;  3QFA C;  5ECI B;  2YOI A;  3UBL A;  2J9H A;  4WKW A;  2HNL A;  3DWV A;  3HJO A;  3M9J A;  1YVL A;  5B7C A;  1O73 A;  4N30 A;  1QFN A;  1M9A A;  1TTZ A;  4OCF A;  2OBK A;  2ALB A;  4FO5 A;  2HSM B;  3GYK A;  3CSI A;  4MH3 A;  3IC8 A;  2VAF A;  2RUF A;  3VFI A;  1OC9 A;  3LYP A;  2XBQ A;  1K3Y A;  2HXK A;  4KA0 A;  3TCO A;  1X9S B;  1NSW A;  5CYY A;  5DVB A;  4GWR A;  2HYX A;  1Y6E A;  3EWL A;  2FLS A;  4ZB7 A;  2MYG A;  3A2V A;  1GUK A;  2RUE A;  3H1N A;  4D73 B;  3WGD A;  2REM A;  3FYG A;  1AC1 A;  1BG1 A;  2KHP A;  2HZE A;  5LD0 A;  4L0U A;  1EWX A;  4BWQ A;  2PWJ A;  1TOF A;  5HFK A;  1WP0 A;  2YPM A;  5GAP D;  2GZZ A;  4K0G A;  3QDN A;  3V1W A;  2JU5 A;  3GUS A;  1GH2 A;  2D2Z A;  1T8E B;  1SL2 B;  1V2A A;  4AKX B;  3MYD A;  4KH7 A;  3C1S A;  1YEP A;  1GSQ A;  5IMZ A;  3CWG A;  2CVK A;  3EU4 A;  1LJR A;  4POB A;  3UJ1 A;  2AUV A;  3BJ5 A;  3EYT A;  1EOG A;  4ZB8 A;  2I3Y A;  3MSZ A;  1R7H A;  2FD3 A;  4PUF C;  4AKI A;  1MEK A;  4GF0 A;  3A2W A;  2IMK A;  3VPQ A;  4POK A;  1HNA A;  3PIN A;  2QSI A;  1SKS B;  4OWY A;  3QOU A;  1JLW A;  1GLP A;  4MAB A;  1CQH A;  1TXU A;  2F8A A;  2WDU A;  3O6T A;  4GSN A;  2QC7 A;  1XWC A;  5F05 A;  1BX9 A;  1E6B A;  4ID0 A;  3GX8 A;  3EIN A;  1AQW A;  4EUY A;  5EPF A;  2I1U A;  4I2T A;  1VF2 A;  3KMN A;  3KJY A;  2GGT A;  4IKH A;  1GP1 A;  5IQY A;  3MAK A;  2O7K A;  1HD2 A;  2NPB A;  2HZF A;  3GKN A;  5ECS A;  2J23 A;  3TOU A;  2CVB A;  1XWB A;  3M8N A;  2GQM A;  3F3Q A;  4KND A;  2E0Q A;  4YKG A;  3F4S A;  2E2G A;  1FVJ A;  4BVX B;  3RDW A;  2HRK B;  3DKS A;  2GDR A;  4IQA A;  2R0P A;  4CDO A;  1SD9 A;  3LFL A;  3ZFL A;  3IOS A;  4OFT A;  5D9X A;  4HJ2 A;  3IPZ A;  4NHZ A;  4MJB A;  1B4P A;  3HZ8 A;  22GS A;  4FQU A;  4ZBA A;  2VLU A;  3BD2 A;  1DSB A;  1XCC A;  2FWE A;  2IN3 A;  4KCE A;  1B9X C;  2WFC A;  3TUE A;  3EVI A;  1PX7 A;  3N5O A;  3EUR A;  2X4A A;  3KP9 A;  3DEX A;  4G0K A;  1ZGN A;  2M46 A;  3DXB A;  4JE1 A;  5F0G A;  3UVH A;  2G0F A;  1Z3E A;  1K0M A;  3W8S A;  2DSA A;  4BWS A;  2LRN A;  4ML1 A;  1N2A A;  3IDV A;  4OCE A;  4TN8 A;  2EIR A;  3FEU A;  1EEJ A;  4PUA A;  5D8I A;  3HMJ G;  4HU9 A;  4ML6 A;  4BA7 A;  5IO0 A;  3LEF A;  2VD1 A;  3L4N A;  1WMJ A;  1GTA A;  4KSM A;  5FT3 A;  3GMF A;  5DJL A;  1TP9 A;  3WT1 A;  2UZ8 A;  4WR4 A;  5JWO B;  3UL3 A;  3D22 A;  3ZIT A;  3GUR A;  3VWU A;  4K6X A;  2VLT A;  2YP6 A;  1YY7 A;  1XOB A;  2L5O A;  3FR6 A;  3LJR A;  1A8L A;  5HQP A;  5IPG A;  2YV9 A;  3G7Y A;  1G6Y A;  1I5G A;  2WB9 A;  3GKK A;  1XOA A;  3GV1 A;  2PN8 A;  2OKA A;  2F3M A;  2EIQ A;  1FHE A;  1S3C A;  4GLT A;  4MLY A;  4WR5 A;  1F37 A;  3IHQ A;  1SYR A;  3A5I A;  5CO3 A;  2IMD A;  2O85 A;  3L9V A;  1A8Y A;  2LTK A;  3KIJ A;  3IHG A;  1MTC A;  1TK5 B;  4AKH A;  2YNX A;  2R37 A;  3ZMK A;  3FZ5 A;  5GZZ B;  3LQ7 A;  3MIX A;  2L59 A;  4YQU A;  3US3 A;  5F07 A;  1PRX A;  1SJZ A;  2FA8 A;  1SJ6 A;  1A0F A;  1G0T A;  5COH A;  2FCH A;  1GSY A;  3EC3 A;  1X5D A;  4H86 A;  2MMZ A;  4A5P A;  3PPU A;  3KMO A;  2TRC P;  1WPI A;  2JAC A;  2GZP A;  4HEA 2;  5D9W A;  2LQO A;  3CYN A;  1ST9 A;  2A2P A;  2E7P A;  1GWC A;  2DIY A;  3HZ4 A;  8GSS A;  4HUA A;  4GTU A;  1XW5 A;  5EY6 A;  3EU3 A;  4Z7X A;  4XS4 A;  3F63 A;  2OAD A;  3BBY A;  4MPF A;  5G2Z A;  3GL3 A;  2H0H A;  2H01 A;  2VL2 C;  5GSS A;  3ISO A;  1HNC A;  4LMV A;  1O6J A;  2NBS A;  3E3E A;  4L0W A;  4F82 A;  3P8W A;  2VL2 A;  5J47 A;  4N0Z A;  3F6F A;  2C3N A;  4NHW A;  1JZO A;  3JCM L;  4IP6 A;  4IBP A;  4N11 A;  4ZBD A;  3FR3 A;  2C3Q A;  2HI7 A;  2K9F A;  5J41 A;  4PGT A;  2YJ7 A;  2VUP A;  3P90 A;  3LG6 A;  2XC2 A;  1ZYE A;  5J3R A;  2LNS A;  4XTS A;  1Q98 A;  1JHB A;  2WCI A;  5FHI A;  2VL3 A;  3WT2 A;  3IK7 A;  2FWG A;  4NPB A;  2DBC A;  3ME8 A;  1B9Y C;  4TR0 A;  1XPV A;  4LL1 B;  3IBH A;  1YF1 A;  3G9B A;  2HSN A;  5DDL A;  4K1F A;  1BED A;  5A5H A;  1ZMA A;  1K0C A;  2CAI A;  4K7I A;  4GXZ A;  5CRD A;  1M9B A;  4IN0 A;  2CT6 A;  3QFB C;  4O5U A;  1EP8 A;  2YZH A;  4TOP A;  5H5Q A;  10GS A;  3KH9 A;  4PXO A;  3ERW A;  3DVX A;  4RI7 A;  1TU7 A;  3ZIJ A;  2K8S A;  2R0C A;  2AJQ B;  4YAV A;  2H73 A;  3IK9 A;  2GZY A;  6GSW A;  3E0U A;  5KN3 A;  3PR8 A;  4G10 A;  2I4A A;  5E59 A;  4XHM A;  1AIU A;  2DJ2 A;  3FMW A;  2X49 A;  3LW9 A;  4V1A g;  3FHK A;  3D5J A;  3EMP A;  1THX A;  3I9V 2;  4OFN A;  5G5F A;  2I9H A;  1KTE A;  3GKM A;  4OFM A;  1ILO A;  1TK8 B;  4F0C A;  1YF0 A;  5CRE A;  1Z5Y E;  2DLX A;  4KB3 A;  4N0V A;  1X5E A;  2R4V A;  1SVL A;  1T4Z A;  5A34 B;  2B3S A;  4TW5 A;  2H1G A;  4TXO A;  2LJK A;  3M9K A;  2VO4 A;  2GS3 A;  5INY A;  2R2J A;  3TJF A;  3GHA A;  4K9Z A;  3K8N A;  3L9S A;  3W6G A;  3TU3 B;  1XVW A;  3Q18 A;  4EIQ A;  3ERG A;  2EFD A;  4E8E A;  1BQ7 A;  3Q6O A;  5IPH A;  2YCD A;  1A0R P;  3UIW A;  6GSY A;  2GVP A;  4Q5R A;  1W89 A;  2HE3 A;  4HZ4 A;  1M0U A;  1DBY A;  4PNF A;  4BL7 B;  1PQN A;  3CSH A;  4X4J A;  2L57 A;  4JU5 A;  1SK0 A;  3SBC A;  2OE3 A;  5B6M A;  4JR6 A;  4ZIL A;  2LV3 A;  2R5G A;  2X99 A;  1GL8 A;  3CBU A;  4TR3 A;  2RII A;  2YJH A;  2XBI A;  6GSV A;  4N3Z A;  1R4W A;  4J56 E;  4ECC A;  3DIE A;  4ZB6 A;  1XW6 A;  1OKT A;  3I69 A;  1TK0 B;  1ACV A;  2ES7 A;  1Y1U A;  1R5P A;  3D4M A;  2OBI A;  1YDK A;  2H75 A;  2IWT A;  2FWF A;  4E8H A;  5BMU B;  2CAQ A;  1Q4J A;  1I9D A;  1XWK A;  1SEN A;  1T3B A;  1THO A;  4X1U A;  2L4Q A;  2NTO A;  2HRA A;  3MNG A;  1IYI A;  2LEG A;  3FZ4 A;  3RHB A;  5ECH B;  4ZL9 A;  1V9W A;  4QL9 A;  3RAZ A;  4TXV A;  4MJE A;  3F9U A;  2EFE A;  1Z9H A;  5G30 A;  2KP2 A;  3MWH A;  4Q5Q A;  1MDJ A;  2EFC A;  4MF7 A;  5IMF A;  1GUM A;  1M2D A;  3TJK A;  2LKU A;  3ME7 A;  3TJG A;  1TKD B;  4LL4 B;  1OVN A;  4GCI A;  4HS1 A;  2A2S A;  2LS5 A;  4TVE A;  3QAG A;  3EPT A;  1WWJ A;  2YN1 A;  4TRX A;  1K0N A;  1A23 A;  3UAR A;  4MCU A;  4NV2 A;  5HR0 A;  1OC8 A;  3VI7 A;  4X0X A;  3QD9 A;  5JCU A;  5C04 A;  5A1N B;  4K5R A;  3GX0 A;  1V40 A;  1A24 A;  1TRW A;  4K2X A;  5A5K A;  3ZRD A;  4EDZ A;  4AJ6 A;  4Z2R A;  1YKC A;  5D93 A;  3ZYW A;  2AYT A;  2PVQ A;  4KX4 A;  3J7Y b;  4OD7 A;  1Z7R A;  1ERU A;  4G01 A;  2FA4 A;  4EF0 A;  2GQL A;  5J5N A;  5GAN D;  3QMX A;  4DSS A;  1SK2 A;  1GSS A;  3VWX A;  4EL1 A;  1PX6 A;  1XFL A;  3KZQ A;  4POL A;  4IGJ A;  1EOH A;  2XPD A;  1AQX A;  4NXI A;  5KN0 A;  1JZR A;  1Z6M A;  2H19 A;  4QQ7 A;  3GTU B;  3EMX A;  4V2M A;  4BVY B;  2X64 A;  5D9T A;  5B6N A;  4FH8 A;  1B48 A;  1FG4 A;  1TDI A;  4PQ1 A;  4BPY A;  4F03 A;  5B8A A;  2H76 A;  1O7U A;  2H70 A;  5DQY A;  4WBJ A;  3KD0 A;  2MBS A;  1E2Y A;  2VCW A;  1GSF A;  1F6M C;  2LST A;  3HJM A;  1HYU A;  4HZ2 A;  1TJD A;  2V41 A;  5HFG A;  3TRP A;  4PNG A;  3KXO A;  2TIR A;  4MZC A;  2FUG 2;  3WD6 A;  4WXT A;  2JSY A;  5DCG A;  5DAK A;  1FB0 A;  4GRF A;  3RPN A;  3LWA A;  3M3M A;  3HD5 A;  3VWV A;  3HY2 A;  1O8W A;  4K2D A;  3HXS A;  5HR1 A;  1O81 A;  4ACS A;  3IC4 A;  1U6T A;  2B5E A;  1OC9 B;  4K7N A;  1GSU A;  2LJA A;  1EGO A;  2M80 A;  1GTB A;  3P7X A;  5CNW A;  3H4K A;  4KGI A;  3CMI A;  1LU4 A;  2HT9 A;  1OKD A;  4CW9 A;  4RQR A;  4MK3 A;  2EFH A;  1T1V A;  4N10 A;  1G6W A;  2OE0 A;  4KAE A;  5ENU A;  5LCZ A;  3FW2 A;  2JSZ A;  2HZE B;  3IAS 2;  1ZYN A;  1HQO A;  4JED A;  2K8V A;  2WRT A;  4KDX A;  3GA4 A;  1QK8 A;  2XHF A;  4USS A;  1ERV A;  4ILF A;  4ICY A;  3R3E A;  5GST A;  7GSS A;  1GRX A;  5ID2 A;  3E9J B;  3CTF A;  2X8G A;  1EP7 A;  2IFQ A;  2HSY A;  3SWL A;  2O5V A;  1XZO A;  5J4U A;  2LQQ A;  3APO A;  4MA9 A;  5ECO B;  4WF4 A;  3KP8 A;  3TKS E;  3WGX A;  4I6X A;  2QA2 A;  2IMI A;  11GS A;  3TKS C;  3ZLP A;  2GT5 A;  4PX1 A;  4P3Y B;  4TR1 A;  5D96 A;  1BG5 A;  1R26 A;  1XW9 A;  4V2N A;  4IW9 A;  2V6K A;  1KEB A;  1XVQ A;  5IMD A;  4E68 A;  3TKS A;  1YEX A;  4OO5 A;  2KOK A;  3HKR A;  2IME A;  4I5Q A;  1TRV A;  2JZS A;  3HVS A;  4KUN A;  2IMF A;  4LMW A;  1MDI A;  3HHV A;  1T4Y A;  5HR2 A;  4MZW A;  5JWR B;  5J4Y A;  1GNE A;  1VF1 A;  4O5Q A;  4XS6 A;  1SKR B;  2VCT A;  2C0D A;  2YWN A;  4G0I A;  4IJI A;  4EVM A;  4PQI A;  5KOW A;  5A4U A;  1AW9 A;  2A4H A;  1H4O A;  2A2R A;  4JZQ A;  1K0D A;  2CVD A;  4F0B A;  1M7T A;  2H1D A;  5HR3 A;  19GS A;  1FVK A;  3VWW A;  2R0G A;  1SU9 A;  1U3I A;  3ZRE A;  5J4V A;  1PGT A;  1N8J A;  2PMT A;  3RPP A;  3GFK A;  2GSS A;  5J9C A;  4EE0 A;  3ZFB A;  4BL7 A;  1J9B A;  2QKE A;  3M1G A;  4I8B A;  2VCV A;  1DE1 A;  17GS A;  3VI5 A;  5KN1 A;  5DBQ A;  1K0O A;  3BCI A;  3KTB A;  1FOH A;  4CY8 A;  3HYP A;  4O32 A;  3ZL5 A;  2G2Q A;  2HSM A;  3D21 A;  2CX4 A;  2VCX A;  3FK8 A;  3ZVJ D;  4DEJ A;  4HDE A;  4TKY A;  5C00 A;  3D4T A;  3S9F A;  4ECB A;  4ULX A;  2KUC A;  2H1L A;  4HQS A;  4IJ3 A;  4KDY A;  5A4W A;  5ECM B;  1WRY A;  3UEM A;  3TDG A;  3NIV A;  3GH9 A;  1VRS D;  2HSH A;  5H5R A;  1ZYQ B;  4DSR A;  5G1L A;  1YKA A;  4MH2 A;  4KSO A;  4L8E A;  3ZZX A;  3AY8 A;  1QGV A;  2ZNM A;  3MDK A;  3QCP A;  4D73 A;  3TJJ A;  3OR5 A;  2RM5 A;  5G5E A;  1SL1 B;  1RK4 A;  5B8B A;  1U88 A;  2QA1 A;  4F2I A;  4YH2 A;  1G7O A;  4J2F A;  2OAC A;  2R6K A;  2B5Y A;  3R2Q A;  3GST A;  20GS A;  3QPM A;  4HI7 A;  5DQS A;  5ELG A;  2V2G A;  5ELA A;  2H6X A;  1SKW B;  2CV4 A;  2VM1 A;  2LNT A;  1TU8 A;  2F8F A;  2BTO T;  3FZ9 A;  4K5S A;  1PN0 A;  1Z7P A;  3UBK A;  1H75 A;  4AJ8 A;  5E4W A;  4CY6 A;  1F2E A;  2HQT A;  5KN2 A;  4MJC A;  3C1R A;  1QQ2 A;  1ZYP A;  4AJ7 A;  4XRA A;  1UA5 A;  4G9H A;  1QMV A;  1YJ6 A;  3HA9 A;  1USB A;  1PSQ A;  3CRU A;  3GL5 A;  5IOX A;  2PPT A;  1VF3 A;  2E2M A;  4XRD A;  4X43 A;  5JWQ B;  3GH6 A;  1JZW A;  4HJM A;  1NHY A;  3CRT A;  5AIX A;  4L5L A;  1TW9 A;  5ECR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...