3QR6A

Crystal structure analysis of h185f mutant of human clic1
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
236
structure length
236
Chain Sequence
PQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLFIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chloride intracellular channel protein 1
publication title Role of individual histidines in the pH-dependent global stability of human chloride intracellular channel 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 76
structure length 236
sequence length 236
ec nomenclature
pdb deposition date 2011-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13409 GST_N_2 Glutathione S-transferase, N-terminal domain
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3qr6A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3qr6A01
3ERWA 4HZ2A 2WJUA 1BAYA 1GH2A 3GL3A 3L9SA 5B8AA 1O8WA 3R2QA 3CTGA 3ERFA 2VO4A 2I9HA 2WZ9A 3QPMA 1HNCA 2CQ9A 5IMAA 3UOMA 3HD5A 2WGRA 3DD3A 1GRXA 1BYEA 3IDVA 1A8LA 5DAKA 2QSIA 2MMAA 2H1AA 1EP7A 3RHBA 2XBIA 3JCML 1BEDA 4PNGA 5KEJA 1GULA 2FY6A 3E9JB 3GNJA 1M0UA 4Q5NA 3UVTA 3LEFA 3MWHA 4I8BA 1AAZA 3TJBA 3WT2A 2GZZA 1X5DA 4NHWA 4ZB8A 2GT5A 2ALBA 3R3EA 4PGTA 5F0GA 4MF6A 3U6VA 1M9BA 4ID0A 3ISOA 2JU5A 5HFGA 3GURA 3HVXA 1SD9A 1Y6EA 3UVHA 3LWAA 2CX3A 3ED3A 5F05A 2CV4A 5HQPA 3FEUA 2HRKB 5IPGA 22GSA 1A2JA 2FGXA 4WR5A 1G7EA 1ZYQB 5IMFA 1G7OA 2TRXA 4K6XA 4OCFA 2B1LA 3P90A 3LJRA 4JR6A 2YPMA 1XCCA 4OD7A 1A2MA 5G31A 2FWHA 1JLWA 4CHSA 1YDKA 3F4TA 1TDIA 4ML1A 5H5QA 5FWGA 1F9MA 2LRCA 1KEBA 4KCAA 2YP6A 6GSVA 3QAWA 2H19A 5KN0A 1XW6A 5AIXA 1LJRA 4DSQA 5EL8A 2YWMA 1K0AA 1XFLA 4F82A 3KTBA 4IQAA 2AJQB 3A3TA 1A0RP 2OJLA 1SL1B 3P2AA 1C72A 2H0GA 1TXXA 4K1FA 2KUCA 3H79A 1O85A 4ZXGA 2C0EA 1XXUA 1K0OA 4NAXA 1ZZYA 4BWSA 3FW2A 2LNSA 1TI3A 5IMCA 3A5WA 2FA8A 4O7HA 1Z6MA 3IAM2 1TOFA 5IOWA 1VRSD 3ZYWA 2FWEA 4FYUA 5JWRB 2PN8A 4ECJA 1NM3A 4L5OA 1UA5A 4V2LA 3WYWA 3QAGA 4X43A 3TKQA 3LORA 1E2YA 3PH9A 1M2DA 4KX4A 3GX0A 3KM6A 2E2MA 4KCEA 4IKHA 5ECIB 2PBJA 5IQYA 2LV3A 1ERUA 2MBTA 2C3QA 1EGRA 4YQUA 4OWYA 4HU7A 4WBRD 4TXOB 1B4QA 5IO2A 2HNLA 5DQYA 2YCDA 1YF1A 4NV2A 1GP1A 4AF2A 3CSJA 2H01A 1WOUA 3DXBA 2L5LA 5H5RA 1X9MB 12GSA 4OFTA 2WS2A 3GKMA 3EYTA 2HZFA 1DSBA 2MMOA 4P3YB 4CW9A 4PURA 3GSTA 5D9TA 4BVXB 3H8QA 4OFMA 4GQFA 3GMFA 2HSMA 1A0FA 3G9BA 5JWOB 3L9VA 4HDEA 2REMA 1RK4A 2GGTA 5G1KA 2FA4A 4EDYA 5AN1A 1AQWA 3GKNA 3FK8A 3TJGA 5DQSA 2LJAA 5JWQB 1Z5YE 2H6XA 1ABAA 1ZMAA 3M1GA 2HSNB 3PPUA 4TXOA 3LSZA 4MLYA 4L8EA 3CSHA 1R5PA 1EOGA 1K0CA 1OAZA 4MJBA 3MNGA 4IP6A 4GTUA 2VL2C 1XW5A 5D8IA 2H1GA 1WRYA 5GSSA 3BOAA 4V2NA 1GUHA 1AC1A 5ELAA 18GSA 1KTEA 5DJMA 1N8JA 2XPEA 2KLXA 3D5JA 3EU4A 3ZVJD 1V9WA 2XC2A 1K3OA 1OVNA 3QR6A 3EINA 2F9SA 2HRNA 3TKRA 1H4OA 4USSA 4BL7B 4ML6A 1AQXA 4LMWA 5KN2A 1GSSA 1V98A 2CZ2A 1K3YA 4ZL9A 2LJKA 2DJJA 3EU3A 1QFNA 4OFNA 1SJZA 2LJRA 2VCWA 3UMAA 4Q5RA 3CRUA 1USBA 2HRFA 3E0UA 4MZBA 3ZIVA 3NIVA 3KIJA 3HKRA 1GL8A 1FG4A 1X5EA 4MP4A 2R6KA 5JCWA 3LQ7A 4QL9A 4L5LA 3IC8A 1U87A 4ZB9A 4MABA 1PX7A 1TRUA 3QFAC 1QMVA 3RDWA 2GQLA 1PA3A 3KZQA 4FIWA 1TRSA 4AGSA 1S3AA 3VFIA 1GSUA 2H0HA 2C0DA 4BL7A 2KP1A 1S3DA 2EC4A 2VD0A 4MPFA 5GZZB 3FR6A 1F6MC 4BVYA 4LL1B 3GH6A 4GXZA 4L0UA 3KTLA 4HUAA 3M3MA 4XIHA 4DVCA 3DVXA 3UBKA 1GNEA 5D96A 2YN1A 4TW5A 17GSA 2GQMA 2K18A 1HD2A 2WFCA 3HDCA 2G2QA 1JLVA 3WGDA 3ZIJA 1T7PB 5B6MA 2H72A 3CMIA 4TVEA 5DCHA 1MD4A 1TJDA 3GTUA 4TKYA 3VWUA 1JFUA 3UAPA 4PUFC 2H71A 3A2XA 5IMDA 1CQGA 4GSSA 4IJIA 8GSSA 3I43A 2L57A 1TW9A 6GSWA 5D93A 1XWAA 2R4VA 2B6MA 4DSSB 2MYGA 2DIYA 2JL4A 3ME7A 2TRCP 2N5FA 4LMVA 3TKSC 2GVPA 3M9KA 2HSYA 1XVWA 3FYGA 2VL9A 5CAXA 2OE1A 3TB2A 4I6XA 1QQ2A 2RM5A 3D4MA 4YQVA 5ID2B 2H66A 2AHEA 5IMZA 3F3QA 5ABRA 1V2AA 1ZL9A 2VOCA 4MF7A 4TRXA 1KNGA 1RW1A 2V41A 2QC7A 1O81A 2AAWA 1JZWA 2LUSA 4XHMA 1SKSB 1U3IA 3F3RA 1VGLA 2K9FA 2GSQA 2HRAA 2FD3A 1PX6A 3EMPA 2CVDA 3TCOA 2YOIA 4MH3A 2OBKA 3TUEA 2IN3A 3NZNA 1JHBA 3CYNA 4J57E 4HJ2A 2H70A 2GDRA 4EVMA 3GFKA 4OMVA 1NHOA 5IMVA 2ZUPA 3TKSE 1YEXA 2FLSA 3KJYA 4TN8A 2R3XA 4WBJA 2F51A 3BCKA 4O5RA 4RI6A 4IN0A 2CVBA 4V1Ap 5KN3A 4KGIA 1HYUA 4NWYA 2PUKC 3RBTA 5DVBA 4KUNA 5ID2A 1BQ7A 3TJJA 4PTSA 3TRPA 6GSUA 3A2WA 5B6NA 2K8VA 2YANA 3HCZA 2BMXA 2LNTA 3LG6A 3VI5A 1XW9A 1ML6A 2L4QA 3WD6A 4ISDA 4CDOA 3KCMA 2O85A 2PMTA 2NDOA 9GSSA 3DWVA 3UEMA 3C7MA 4F0BA 3SWLA 4OO5A 4KDYA 3A2VA 1X9SB 3TJKA 5EVOA 1NSWA 2RUEA 19GSA 3IHQA 1XIYA 4POLA 2JSZA 1VF1A 3DGQA 3C8EA 1XVQA 3VPQA 2EIQA 2C3NA 2HLSA 2XPDA 2IL3A 1SKRB 1NW2A 4GLTA 20GSA 5ECMB 3FKFA 1HNBA 3HVSA 4I5QA 1F3AA 3IXRA 1F3BA 4D73B 2NVLA 2BTOT 1PL1A 1SYXA 5DALB 3OR5A 2H6YA 3ZREA 2C8UA 4IJ3A 2GLRA 1DE1A 3GN3A 3ZMLA 3HHVA 4OO4A 4HJMA 2IMDA 4K7OA 2IPAA 2YV7A 3BBYA 4PX1A 4GSNA 5ECRB 4XCSA 2NTOA 2HFDA 2L6CA 2BJXA 4BA7A 4MH2A 5GAPD 4GCIA 1PRXA 2YJHA 1GSYA 4XRDA 2E7PA 5J3RA 5A4UA 4WF4A 3KXOA 1RQMA 1SKWB 4J56E 1HQOA 1DUGA 3F6FA 2C4JA 2KOKA 1OYJA 1EP8A 3V1WA 5JCGA 2R5GA 2PVOC 1SK0A 3GIXA 2V2GA 2TIRA 1R26A 4WEYA 3KMNA 1XBSA 1VF2A 4TOPA 2B5YA 3EWLA 5HR1A 3US3A 2HSMB 3DIEA 2LEGA 1BG5A 4K7NA 2IMEA 4RQRA 4D73A 3FRCA 3BD2A 3IR4A 3CSIA 4IGJA 5DALA 2H76A 5IPHA 5G5FA 1MDKA 3PR8A 4KSMA 1HNAA 1FAAA 14GSA 4HEA2 2DMLA 2H1DA 4N0ZA 3EE2A 2LRNA 2VAFA 2VLTA 1ERTA 2HE3A 2ZNMA 1PL2A 2LKUA 2AB6A 3F8UA 1TKDB 2QKEA 2C0GA 3FZ4A 3FY7A 2R2JA 3UBLA 3P7XA 1U3AA 1G6YA 4YQMA 2VCVA 5CYYA 3ZVJA 3ZITA 1SYRA 3Q74A 1URMA 2FHEA 5CRHA 1ZGNA 1B48A 4E8HA 1SU9A 5B8BA 1SD8A 1YY7A 2P5RA 4G0LA 2HSHA 3ZZXA 5ECPB 3C1SA 1K3LA 3CBUA 5JCUA 2AV4A 3H1NA 4LA1A 2VCXA 1F37A 3FZ9A 3TGZA 2DBCA 5J4UA 3EVIA 2B1KA 1U88A 2CAIA 4TXVA 3SBCA 4ZBBA 2J9HA 3S9FA 2DJ0A 2OADA 1OE8A 5BMUA 4ECCA 3TOUA 1S3CA 3HZ8A 3D21A 5EPFA 3LGCA 5CREA 2WULA 3FR9A 1GUKA 2HT9A 1XWCA 4MZWA 3K8NA 2GTUA 2YJ7A 3VK9A 3ME8A 3GHAA 6GSXA 1FB6A 1A2LA 3QCPA 1T1VA 1CQHA 2GS3A 4AJ8A 4NV5A 4GWRA 3HZ4A 5IM9A 2FWGA 3F63A 3WGXA 4K8MA 1EEMA 5HFKA 2YZHA 1TK0B 5HR3A 3F0IA 4XS4A 2DLXA 3KD0A 1JZOA 3ZFBA 3HA9A 1A23A 4MDCA 3GKXA 2JSYA 1QUWA 2PERA 2DIZA 4JZQA 1M99A 1EWXA 3WT1A 2X8HA 4TR1B 1AQVA 4FQUA 3LYPA 4BVYB 4IS0A 1O6JA 2DJ2A 4PNFA 2B7JA 5D9WA 5G30A 1PQNA 4GRFA 5ECQB 3O6TA 5FHIA 2I81A 3CRTA 3ZRDA 4ZBDA 2VL2A 1WIKA 3VURA 7GSSA 3G7JA 4NMUA 4EC0A 3GTUB 4GF0A 3GYKA 1FHEA 3D4TA 2ON5A 5G5EA 3LFLA 4JBBA 2V6OA 2OE0A 2RIIA 2RM6A 2V32A 1GSFA 5B7CA 4JE1A 3M8NA 3BJ5A 1Z9HA 2YWIA 4EKZA 2L59A 16GSA 5ECLB 1YKAA 4EUYA 5A5KA 2L5OA 2WDUA 2GT6A 5L71A 2F3MA 1ERVA 1G6WA 4TR1A 3L9UA 2IMFA 2O8VB 6GSSA 2EIOA 1ZYEA 3I9V2 1OKTA 1EEJA 3RPNA 4AJ6A 1AIUA 5D73A 4NPBA 2OKAA 2IFQA 5AISA 2E2GA 2H75A 1GSQA 2CT6A 4PXOA 5ECKB 1ZOFA 2DJ1A 1EGOA 1TTZA 3ZTLA 4IHUA 4PQIA 1YZXA 4QL7A 5IO0A 2LSTA 4I2TA 3Q19A 3D0ZA 4EE0A 4JRRA 3O76A 1GSDA 1J0FA 1THOA 2VCQA 4JR4A 3HJPA 2O87A 4KA0A 4BPYA 4KE3A 1GLQA 2C1YA 4L0WA 1PGTA 4FYCA 4EF0A 5ECOB 2AUVA 2FCHA 2N5AA 4MJEA 1MTCA 2IMIA 2FUG2 4FH8A 2PVQA 1X5CA 3QFBC 4JEDA 2K6VA 4YAVA 3CXGA 2M80A 4RI7A 2LTKA 1THXA 1TU8A 2MZCA 3ZLPA 3F4SA 2IIYA 2MMNA 4F9ZA 2D2ZA 4N11A 4ECIA 1GTAA 2B7KA 2WB9A 3TJFA 4ZL8A 2I3YA 1PKWA 1MEKA 4V2MA 4POBA 4RQXA 1A24A 5J5NA 3KH7A 3RPPA 4EDZA 1W89A 3I6AA 4O32A 2X8CA 5ENUA 1TU7A 2UZ8A 4K0GA 1EZKA 1TK8B 3MDKA 4YH2A 4KSOA 4Q5QA 1MDJA 3AY8A 4F0CA 3EC3A 3TKSA 3HXSA 2NBSA 4X0XA 1Q4JA 1KBNA 3W8SA 1O73A 4WR4A 3GX8A 1WWJA 4G2EA 5CRDA 1IYHA 2A2SA 2IMKA 1WJKA 1DE2A 1IYIA 2XHFA 3QAVA 4ZIJA 4ILFA 4NHZA 2I1UA 2JADA 4G0IA 4MZCA 1DBYA 2LS5A 4K2DA 3QMXA 2GZPA 3J7Yk 2IJYA 4IBPA 5LD0A 3VLNA 2WRTA 1SJIA 4MMMA 1FW1A 4HI7A 5D9VA 3QDNA 3FZAA 4KB3A 4IQ1A 4PQHA 2XBQA 1M2BA 1O8XA 4ULXA 4E8EA 4MF5A 2VLVA 5IOXA 2H1BA 4IELA 1SK2A 1Q98A 1Z7PA 4XS1A 1ILOA 1T4YA 5LCZA 4MA9A 5HFIA 3C71A 4I97A 1XWKA 5AGYA 2DJ3A 1TRVA 1VF4A 2YWOA 11GSA 2EIRA 1K0BA 1YKCA 4K9ZA 5IIZA 2JZSA 5C04A 4BWQA 5DDLA 2CX4A 4KNDA 3UARA 3KH9A 2CVKA 2A2RA 4HOJA 4HQZA 5F8BA 2NPBA 5FT3A 2PWJA 4H86A 1YQ1A 5J41A 3N9JA 3APSA 3VI7A 3QOUA 2F8FA 3G7YA 4G9HA 2M72A 2CZ3A 3M9JA 2L4CA 3ZFLA 5GAND 3DYRA 3FZ5A 6GSTA 3E3EA 3KMOA 3GA4A 4OCEA 2CAQA 4FYBA 1I5GA 3GV1A 3FHKA 3QD9A 4KF9A 1SL2B 2O89A 3IA1A 3W6GA 1GTUA 1TK5B 3RHCA 1K0NA 4MJCA 1AW9A 3ZL5A 1MD3A 1PKZA 2YV9A 4QQ7A 2M46A 2X8GA 4KW6A 2X99A 1M9AA 3EMXA 1B9YC 5E4WA 3DVWA 3DMLA 1ACVA 3W8JA 3GL5A 1UN2A 1ZCPA 2HRKA 1XWBA 3EURA 4XS6A 3DEXA 1FVKA 1T3BA 3GH9A 1TP9A 5HR2A 1SL0B 3IE3A 4WF5A 3C73A 1OC8A 1FB0A 3UJ1A 4G10A 1R7HA 5C00A 3VWXA 2CA8A 2GSSA 4JU5A 1Y25A 2K8SA 2KP2A 3L0HA 4ZBAA 2I4AA 2JACA 2C3TA 1MDIA 2OBIA 2KHPA 4DSRA 4F2IA 3P8WA 2VCZA 5ECSA 4ZILA 4MJAA 2ES7A 2E0QA 4NXIA 5F07A 2B5XA 1BX9A 2H0IA 3DRNA 2H74A 4F03A 3NOFA 1VF3A 5ELGA 3IBHA 4G19A 3ZMKA 1Z6NA 1GSEA 1ON4A 2HYXA 3IV4A 4XTSA 1B4PA 1OC3A 2PGTA 3MSZA 2C80A 4DEJA 2OA7A 4XS4B 1WMJA 1PN9A 1R5AA 1QGVA 1SJ6A 4ACSA 1T00A 3HJOA 1UC7A 3VWVA 5EY6A 4LL4B 3WGEA 4I2UA 1GUMA 5ECHB 2HZEB 1UVZA 4K0NA 2ON7A 1XWGA 3F9UA 2VIMA 3RAZA 5COHA 3FR3A 4TR3A 1YJ6A 4XRAA 1J08A 3KP9A 6GSYA 1WPIA 5A4WA 1LU4A 2B5EA 1G0TA 4K7IA 3VWWA 4KDUA 4PQ1A 3IOSA 3APQA 3G7IA 1FO5A 3DKSA 3KEBA 3UL3A 1O7UA 2FWFA 2P31A 4GSTA 2DC5A 1FVJA 1WP0A 1V58A 4ZB6A 1N2AA 1XZOA 2J23A 2ZCTA 4IW9A 1LBKA 3L78A 3TKPA 2MBSA 1EV4A 1BJXA 1U6TA 2JZTA 2GSRA 4BVXA 2V6KA 2DSAA 1OE7A 1XOBA 2HZEA 4Q5FA 2LQQA 1YEPA 4IP1A 3L4NA 5DJLA 2QGVA 3PINA 4LLRA 2IFQB 1F2EA 2P5QA 3I69A 1E6BA 1R4WA 2A4VA 4N30A 2VD1A 2IWTA 3TRQA 4O92A 1QK8A 4EO3A 1Z3EA 5J9BA 2VCTA 5HR0A 1GNWA 1K0MA 5DBQA 2DJKA 1AUCA 1EV9A 2VM1A 2PPTA 1GTBA 2AYTA 3HY2A 3TOTA 2P0GA 3GRXA 1K0DA 5D9XA 4GQCA 3D22A 3KGKA 3H93A 5CO3A 4HQSA 2H8LA 2VM2A 1W4VA 2VL3A 1ERWA 4KH7A 3M0FA 5INYA 4N10A 1NHYA 4TR0A 1OC9B 3LYKA 1GTIA 1FOVA 2FNOA 4WKWA 5G2ZA 2YNXA 2PU9C 1SK1A 2B3SA 3F4RA 1B9XC 2Z9SA 4N0VA 4YAPA 1T8EB 3VPTA 4G0KA 1Z7RA 4EL1A 5G1LA 1AXDA 1TI1A 4POKA 2G0FA 4WXTA 3O3TA 3PGTA 4HU9A 3IAS2 2LQOA 2WCIA 3CTFA 4EXJA 3HYPA 3IK7A 1XPVA 3BCIA 5A4VA 2X64A 1V57A 5ECNB 2YZUA 2RUFA 2L6DA 3GUSA 2OE3A 3TRXA 2VLUA 1YF0A 4AJ7A 3TDGA 4ZL7A 5DCGA 1H75A 4ECBA 2HI7A 1GWCA 1I9DA 4V1Ag 4HS1A 1B8XA 4KDXA 2JZRA 1T4ZA 2H73A 5E59A 3F6DA 3LXZA 2VUPA 2GQKA 1JZDA 2DMMA 2V1MA 2O7KA 1OC9A 2C0FA 4WETA 5CP1A 2H6ZA 5CRGA 1QXHA 1X0RA 3C1RA 3N5OA 1X9WB 2N5BA 3UIWA 3GSSA 3IPZA 1PMTA 1M7TA 1PSQA 3Q6OA 5H5SA 2LRTA 4X1UA 4IVFA 1ST9A 1V40A 2HXKA 3J7Yb 1A8YA 5CNWA 4MCUA 3U5RE 2RLIA 4HZ4A 1PD21 2OACA 5DAKB 13GSA 3LXTA 4TR4A 1EOHA 4Z7XA 5LNKe 2YWNA 2R37A 4POMA 3IC4A 3MAKA 5CRWA 1JZRA 3D6IA 3IRAA 5J9CA 3ERGA 1GLPA 2GSTA 4J2FA 4MPGA 5F06A 3APOA 2F8AA 3GKKA 2MMZA 5AIVA 3HJMA 2H30A 1OKDA 3H4KA 5KN1A 1WE0A 1SENA 4KAEA 3IK9A 2GZYA 3HVVA 3KP8A 4DSSA 10GSA 5GSTA 3Q18A 1J9BA 4RUVA 1M2AA 4PUAA 4FO5A 1XOAA 2HQTA 1TRWA 4MK3A
chains in the Genus database with same CATH superfamily
3ERWA 4HZ2A 2WJUA 1BAYA 1GH2A 2QA1A 3GL3A 3L9SA 5B8AA 1O8WA 3R2QA 5KOXA 3CTGA 3ERFA 1YVLA 2VO4A 2I9HA 2WZ9A 3QPMA 1HNCA 2CQ9A 5IMAA 3UOMA 3HD5A 2WGRA 3DD3A 1GRXA 1BYEA 3IDVA 1A8LA 5DAKA 2QSIA 2MMAA 2H1AA 1EP7A 3RHBA 2XBIA 3JCML 1BEDA 4PNGA 5KEJA 1GULA 2FY6A 1Y1UA 3E9JB 3GNJA 1M0UA 4Q5NA 3UVTA 3LEFA 3MWHA 4I8BA 1AAZA 3TJBA 3WT2A 2GZZA 1S4BP 1X5DA 4NHWA 4ZB8A 2GT5A 3CQFA 2ALBA 3R3EA 4PGTA 5F0GA 4MF6A 3U6VA 1M9BA 4ID0A 3ISOA 2JU5A 5HFGA 3GURA 3HVXA 1SD9A 1Y6EA 3UVHA 3LWAA 2CX3A 3ED3A 5F05A 2CV4A 5HQPA 3FEUA 2HRKB 5IPGA 22GSA 1A2JA 5KOWA 2FGXA 4WR5A 1G7EA 1ZYQB 5IMFA 1G7OA 2TRXA 4K6XA 4OCFA 2B1LA 3P90A 3LJRA 4JR6A 2YPMA 1XCCA 4OD7A 1A2MA 5G31A 2FWHA 1JLWA 4CHSA 1YDKA 3F4TA 1TDIA 4ML1A 5H5QA 5FWGA 1F9MA 2LRCA 1KEBA 4KCAA 2YP6A 6GSVA 3QAWA 2H19A 5KN0A 1XW6A 5AIXA 1LJRA 4DSQA 5EL8A 2YWMA 1K0AA 1XFLA 4F82A 3KTBA 4IQAA 2AJQB 3A3TA 1A0RP 2OJLA 1SL1B 3P2AA 1C72A 2H0GA 1TXXA 4K1FA 2KUCA 3H79A 1O85A 4ZXGA 2C0EA 1XXUA 1K0OA 4NAXA 1ZZYA 4BWSA 3FW2A 2LNSA 4Z2UA 1TI3A 5IMCA 4AKXB 3A5WA 2FA8A 4O7HA 1Z6MA 3IAM2 1TOFA 5IOWA 1VRSD 3ZYWA 2FWEA 4FYUA 5JWRB 2PN8A 4ECJA 1NM3A 4L5OA 1UA5A 4V2LA 3WYWA 3QAGA 4X43A 3TKQA 3LORA 1E2YA 1S3RA 3PH9A 1M2DA 4KX4A 3GX0A 3KM6A 2E2MA 4KCEA 4IKHA 5ECIB 2PBJA 5IQYA 2LV3A 1ERUA 2MBTA 2C3QA 1EGRA 4YQUA 4OWYA 4HU7A 4WBRD 4TXOB 1B4QA 5IO2A 5BRTA 2HNLA 5DQYA 1BG1A 2YCDA 1YF1A 4NV2A 1GP1A 4AF2A 3CSJA 2H01A 1WOUA 3DXBA 2L5LA 5H5RA 1X9MB 12GSA 4OFTA 2WS2A 3GKMA 3EYTA 2HZFA 1DSBA 2MMOA 4P3YB 4CW9A 4PURA 3GSTA 5D9TA 2O3EA 4BVXB 3H8QA 4OFMA 4GQFA 3GMFA 2HSMA 1A0FA 3G9BA 1SVMA 5JWOB 3L9VA 4HDEA 2REMA 1RK4A 2GGTA 5G1KA 2FA4A 4EDYA 5AN1A 1AQWA 4AKGA 3GKNA 3FK8A 3TJGA 5DQSA 2LJAA 5JWQB 1Z5YE 4YKGA 2H6XA 1ABAA 1ZMAA 3M1GA 2HSNB 3PPUA 4TXOA 2WW3A 3LSZA 2DKIA 4MLYA 4L8EA 3CSHA 1R5PA 1EOGA 1K0CA 1OAZA 4MJBA 4W66A 3MNGA 2WW1A 4IP6A 4GTUA 2VL2C 1XW5A 5D8IA 2H1GA 1WRYA 5GSSA 3BOAA 4V2NA 1GUHA 1AC1A 5ELAA 18GSA 1KTEA 5J4YA 5DJMA 1N8JA 2XPEA 2KLXA 3D5JA 3EU4A 3ZVJD 1V9WA 2XC2A 1K3OA 1OVNA 3QR6A 3EINA 2F9SA 2HRNA 3TKRA 1H4OA 4USSA 4BL7B 4ML6A 1AQXA 4LMWA 5KN2A 1GSSA 1V98A 2CZ2A 1K3YA 4ZL9A 2LJKA 2DJJA 3EU3A 1QFNA 4OFNA 1ZYNA 1SJZA 2LJRA 2VCWA 3UMAA 4Q5RA 3CRUA 1USBA 2HRFA 3E0UA 4MZBA 3ZIVA 3NIVA 3KIJA 3HKRA 1GL8A 1FG4A 4X4JA 1X5EA 4MP4A 2R6KA 5JCWA 3LQ7A 4QL9A 4L5LA 3IC8A 1U87A 4ZB9A 4MABA 1PX7A 1TRUA 3QFAC 1QMVA 3RDWA 2GQLA 1PA3A 3KZQA 4FIWA 1TRSA 4AGSA 1S3AA 3VFIA 1GSUA 2R0CA 2H0HA 2C0DA 5J4VA 4BL7A 5A5HB 2KP1A 1S3DA 2EC4A 2VD0A 4MPFA 5GZZB 3FR6A 1F6MC 4BVYA 4LL1B 3GH6A 4GXZA 4L0UA 3KTLA 4HUAA 3M3MA 4XIHA 4DVCA 3DVXA 3UBKA 1GNEA 5D96A 2YN1A 4TW5A 17GSA 2GQMA 2K18A 1HD2A 2WFCA 3HDCA 2G2QA 1JLVA 3WGDA 3ZIJA 1T7PB 4K5RA 5B6MA 2H72A 4ICYA 3CMIA 4TVEA 5DCHA 1MD4A 1TJDA 3GTUA 4TKYA 3VWUA 1JFUA 3UAPA 4PUFC 2H71A 3A2XA 5IMDA 1CQGA 4GSSA 4IJIA 8GSSA 3I43A 2L57A 1TW9A 3MIXA 6GSWA 5D93A 1XWAA 2R4VA 2B6MA 4DSSB 2MYGA 2DIYA 2JL4A 3ME7A 2TRCP 2N5FA 4LMVA 3TKSC 2GVPA 3M9KA 2HSYA 1XVWA 3FYGA 2VL9A 5CAXA 2OE1A 3TB2A 4I6XA 1SVOA 1QQ2A 4G01A 2RM5A 3D4MA 4YQVA 5ID2B 2H66A 2AHEA 5IMZA 3F3QA 5ABRA 1V2AA 1ZL9A 2VOCA 4BIKA 4MF7A 4TRXA 1KNGA 1RW1A 2V41A 3EPTA 2QC7A 1O81A 2AAWA 1JZWA 2LUSA 4XHMA 1SKSB 1U3IA 3F3RA 1VGLA 2K9FA 2GSQA 2HRAA 2FD3A 1PX6A 3EMPA 2CVDA 3TCOA 2YOIA 4MH3A 2OBKA 3TUEA 2IN3A 3NZNA 1JHBA 3CYNA 4J57E 4HJ2A 2H70A 2GDRA 4EVMA 3TU3B 3GFKA 1XG8A 4OMVA 1NHOA 5IMVA 2ZUPA 3TKSE 1YEXA 2FLSA 3KJYA 4TN8A 2R3XA 4WBJA 2F51A 3BCKA 2WVXA 4O5RA 4RI6A 4IN0A 2CVBA 4V1Ap 5KN3A 4KGIA 1HYUA 4NWYA 3FMWA 2PUKC 3RBTA 5DVBA 4KUNA 5ID2A 1BQ7A 3TJJA 4PTSA 3TRPA 6GSUA 3A2WA 5B6NA 2K8VA 2YANA 3HCZA 2BMXA 2LNTA 3LG6A 3VI5A 1XW9A 1ML6A 2R0PA 2L4QA 3WD6A 4ISDA 4CDOA 3KCMA 2O85A 2PMTA 2NDOA 9GSSA 3DWVA 3UEMA 3C7MA 4F0BA 3SWLA 4OO5A 4KDYA 2EFDA 3A2VA 1X9SB 4EIQA 3TJKA 5EVOA 1NSWA 2RUEA 19GSA 3IHQA 1XIYA 4POLA 2JSZA 1VF1A 3DGQA 3C8EA 1XVQA 3VPQA 2EIQA 2C3NA 2HLSA 2XPDA 2IL3A 1SKRB 1NW2A 4GLTA 20GSA 5ECMB 3FKFA 1HNBA 3HVSA 4I5QA 1F3AA 3IXRA 1F3BA 4D73B 2NVLA 2BTOT 1PL1A 1SYXA 5DALB 3OR5A 2H6YA 3ZREA 2C8UA 4IJ3A 2GLRA 1DE1A 3GN3A 3ZMLA 3HHVA 4OO4A 4HJMA 2IMDA 4K7OA 2IPAA 2YV7A 3BBYA 4PX1A 4GSNA 5ECRB 4XCSA 2NTOA 2HFDA 2L6CA 4O5UA 2BJXA 4BA7A 4MH2A 5GAPD 4GCIA 1PRXA 2YJHA 1GSYA 4XRDA 2E7PA 5J3RA 5A4UA 4WF4A 3KXOA 1RQMA 1SKWB 4AKHA 4J56E 1HQOA 2KOKA 1DUGA 3F6FA 2C4JA 2H1LA 1OYJA 1M3IA 1EP8A 3V1WA 5JCGA 4E68A 2R5GA 2PVOC 1SK0A 3GIXA 2V2GA 2TIRA 1R26A 4WEYA 3KMNA 1XBSA 1VF2A 4TOPA 2B5YA 3EWLA 5HR1A 3US3A 2HSMB 3DIEA 2LEGA 1BG5A 4K7NA 5A34A 2IMEA 4RQRA 4D73A 3FRCA 3BD2A 3IR4A 3CSIA 4IGJA 5DALA 2H76A 5IPHA 5G5FA 1MDKA 3PR8A 4KSMA 1HNAA 1FAAA 5J40A 14GSA 2DMLA 4HEA2 2H1DA 4N0ZA 3EE2A 2LRNA 5BMUB 2VAFA 2VLTA 1ERTA 2HE3A 2ZNMA 1PL2A 2LKUA 2AB6A 3F8UA 4K5SA 1TKDB 2QKEA 2C0GA 2X4AA 3FZ4A 3FY7A 2R2JA 3UBLA 3P7XA 1U3AA 4Z2RA 4N3ZA 1G6YA 2WW0A 3A5IA 4YQMA 1BF5A 2VCVA 5CYYA 3ZVJA 3ZITA 1SYRA 3Q74A 1URMA 2FHEA 5CRHA 1ZGNA 1B48A 4E8HA 1SU9A 5B8BA 1SD8A 1YY7A 2P5RA 4G0LA 2HSHA 3ZZXA 5ECPB 3C1SA 1K3LA 3CBUA 5JCUA 2AV4A 3H1NA 4LA1A 2VCXA 1F37A 3FZ9A 3TGZA 2DBCA 5J4UA 3EVIA 2B1KA 1U88A 1YEWC 2CAIA 4TXVA 3SBCA 4ZBBA 2J9HA 3S9FA 2DJ0A 2OADA 1OE8A 5BMUA 4ECCA 3TOUA 1S3CA 3HZ8A 3D21A 5EPFA 3LGCA 5CREA 2WULA 3FR9A 1GUKA 2HT9A 1XWCA 4MZWA 3K8NA 2GTUA 2YJ7A 3VK9A 3ME8A 3GHAA 6GSXA 1FB6A 1A2LA 3QCPA 1T1VA 1CQHA 2GS3A 4AJ8A 4NV5A 4GWRA 3HZ4A 5IM9A 2WW2A 2FWGA 3F63A 3WGXA 2VKZG 4K8MA 1EEMA 5HFKA 2YZHA 1TK0B 5HR3A 3F0IA 4XS4A 2DLXA 3KD0A 1JZOA 3ZFBA 3HA9A 1A23A 4MDCA 3GKXA 2JSYA 1QUWA 2PERA 2DIZA 4JZQA 1M99A 1EWXA 3WT1A 2X8HA 4TR1B 1AQVA 4FQUA 3LYPA 4BVYB 4IS0A 1O6JA 2DJ2A 4PNFA 3RGBC 2B7JA 5D9WA 5G30A 1PQNA 4GRFA 5ECQB 3O6TA 5FHIA 2I81A 3CRTA 3ZRDA 2WVYA 1FOHA 4ZBDA 2VL2A 1WIKA 3VURA 1PFOA 7GSSA 3G7JA 3RFRC 4NMUA 4FXYP 4EC0A 3GTUB 4GF0A 3GYKA 3IHGA 1FHEA 3D4TA 2ON5A 5G5EA 3LFLA 4JBBA 2V6OA 2OE0A 2RIIA 2RM6A 2V32A 1GSFA 5B7CA 1TXUA 2X49A 4JE1A 3M8NA 3BJ5A 1Z9HA 2YWIA 4EKZA 2L59A 16GSA 5ECLB 1YKAA 4EUYA 5A5KA 2L5OA 2WDUA 1M3JA 2GT6A 5L71A 2F3MA 1ERVA 1G6WA 4TR1A 3L9UA 2IMFA 2O8VB 6GSSA 2EIOA 1ZYEA 3I9V2 1OKTA 1EEJA 3RPNA 4AJ6A 1AIUA 1N25A 5D73A 4NPBA 2OKAA 2IFQA 4Z2TA 5AISA 2E2GA 2H75A 1GSQA 2CT6A 4PXOA 5ECKB 1ZOFA 2DJ1A 1EGOA 1TTZA 3ZTLA 4IHUA 4PQIA 1YZXA 4QL7A 5IO0A 2LSTA 4I2TA 3Q19A 3D0ZA 4EE0A 4JRRA 3O76A 1GSDA 1J0FA 1THOA 2VCQA 4JR4A 3HJPA 2O87A 4KA0A 4BPYA 4KE3A 1GLQA 2C1YA 4L0WA 1PGTA 2WVXB 4FYCA 4EF0A 5ECOB 2AUVA 2FCHA 2N5AA 4MJEA 1MTCA 2IMIA 2FUG2 4FH8A 2PVQA 1X5CA 3QFBC 4JEDA 2K6VA 4YAVA 3CXGA 2M80A 4RI7A 2LTKA 1THXA 1TU8A 2MZCA 3ZLPA 3F4SA 4PI2C 2IIYA 3LW9A 2MMNA 4F9ZA 2D2ZA 4N11A 4ECIA 1GTAA 2B7KA 2WB9A 3TJFA 4ZL8A 2I3YA 1PKWA 1MEKA 4V2MA 4POBA 4RQXA 1A24A 5J5NA 3KH7A 3RPPA 4EDZA 1W89A 3I6AA 4QMKA 4O32A 2X8CA 5ENUA 1TU7A 2UZ8A 4K0GA 1EZKA 1TK8B 3MDKA 4YH2A 4KSOA 4Q5QA 1MDJA 3AY8A 4F0CA 3EC3A 3TKSA 3HXSA 2NBSA 4X0XA 4PHZC 3CWGA 1Q4JA 2DKHA 1KBNA 4HSCX 3W8SA 1O73A 4WR4A 3GX8A 1WWJA 4G2EA 5CRDA 1IYHA 2A2SA 2IMKA 1WJKA 1DE2A 1IYIA 2XHFA 3QAVA 4ZIJA 4ILFA 4NHZA 2I1UA 2JADA 4G0IA 4MZCA 4MNNA 1DBYA 2LS5A 4K2DA 3QMXA 2GZPA 3J7Yk 2IJYA 4IBPA 5LD0A 3VLNA 2WRTA 1SJIA 4MMMA 1FW1A 4HI7A 5D9VA 3QDNA 3FZAA 4KB3A 4IQ1A 4PQHA 2XBQA 1M2BA 1O8XA 4ULXA 4E8EA 4MF5A 2VLVA 5IOXA 2A4HA 2H1BA 4IELA 1SK2A 1Q98A 1Z7PA 4XS1A 1ILOA 1T4YA 5LCZA 4MA9A 5HFIA 3C71A 4I97A 1XWKA 5AGYA 2DJ3A 1TRVA 1VF4A 2YWOA 4A5PA 11GSA 2EIRA 1K0BA 1YKCA 5A34B 4K9ZA 5IIZA 2JZSA 5C04A 4BWQA 5DDLA 2CX4A 4KNDA 3UARA 3KH9A 2CVKA 2A2RA 2EFCA 4HOJA 4HQZA 5F8BA 2NPBA 5FT3A 2PWJA 4H86A 1YQ1A 5A1NB 5J41A 3N9JA 3APSA 3VI7A 3QOUA 4O5QA 2F8FA 3G7YA 4G9HA 2M72A 2CZ3A 3M9JA 2L4CA 3ZFLA 5GAND 3DYRA 3FZ5A 6GSTA 3E3EA 3KMOA 3GA4A 2WZSA 4OCEA 2CAQA 4FYBA 1I5GA 3GV1A 3FHKA 3QD9A 4KF9A 1SL2B 2O89A 3IA1A 3W6GA 1GTUA 1TK5B 3RHCA 1K0NA 4MJCA 1AW9A 3ZL5A 1MD3A 1PKZA 2YV9A 4QQ7A 2M46A 2X8GA 4KW6A 2X99A 1M9AA 3EMXA 1B9YC 5E4WA 3DVWA 3DMLA 1ACVA 3W8JA 3GL5A 1UN2A 1ZCPA 2HRKA 1XWBA 3EURA 4XS6A 3DEXA 1FVKA 5A1NA 1T3BA 3GH9A 1TP9A 5HR2A 1SL0B 3IE3A 4WF5A 3C73A 1OC8A 1FB0A 3UJ1A 4G10A 1R7HA 4CY8A 5C00A 3VWXA 2CA8A 2GSSA 4JU5A 1Y25A 2K8SA 2A2PA 2KP2A 3L0HA 4ZBAA 2I4AA 2JACA 2C3TA 4EIPA 1MDIA 2OBIA 2KHPA 4DSRA 4F2IA 3CHXC 3P8WA 2VCZA 5ECSA 4ZILA 4MJAA 2ES7A 2E0QA 4NXIA 5F07A 2B5XA 1BX9A 2H0IA 3DRNA 2H74A 4F03A 3NOFA 1VF3A 5ELGA 3IBHA 4G19A 3ZMKA 1Z6NA 1GSEA 1ON4A 2HYXA 3IV4A 4XTSA 1B4PA 1OC3A 2PGTA 3MSZA 2C80A 4DEJA 2OA7A 4XS4B 1WMJA 1PN9A 1R5AA 1QGVA 1SJ6A 4ACSA 4PI0C 2EFEA 2R0GA 1T00A 3HJOA 1UC7A 3VWVA 5EY6A 4LL4B 3WGEA 4I2UA 1GUMA 5ECHB 2HZEB 1UVZA 4K0NA 2ON7A 1XWGA 3F9UA 2VIMA 2QA2A 3RAZA 5COHA 3FR3A 4TR3A 1YJ6A 2OT3A 4XRAA 1J08A 3KP9A 6GSYA 1WPIA 5A4WA 1LU4A 2B5EA 1G0TA 4K7IA 3VWWA 1PN0A 4KDUA 4PQ1A 3IOSA 3APQA 3G7IA 1FO5A 3DKSA 3KEBA 3UL3A 1O7UA 2FWFA 2P31A 4GSTA 2DC5A 1FVJA 1WP0A 1V58A 4ZB6A 1N2AA 1XZOA 2J23A 2ZCTA 4IW9A 1LBKA 3L78A 3TKPA 2EFHA 2MBSA 1EV4A 1BJXA 1U6TA 2JZTA 2GSRA 4BVXA 2V6KA 2DSAA 1OE7A 1XOBA 2HZEA 4Q5FA 2LQQA 1YEPA 4IP1A 3L4NA 5DJLA 2QGVA 1SVLA 3PINA 4LLRA 2IFQB 1F2EA 2P5QA 4K2XA 3I69A 1E6BA 1R4WA 2A4VA 4N30A 2VD1A 2IWTA 3TRQA 2HSNA 4O92A 1QK8A 4EO3A 1Z3EA 5J9BA 2VCTA 5HR0A 1GNWA 1K0MA 5J47A 5DBQA 2DJKA 1AUCA 1EV9A 2VM1A 2PPTA 1GTBA 2AYTA 3HY2A 3TOTA 2P0GA 3GRXA 1K0DA 5D9XA 4GQCA 3D22A 3KGKA 3H93A 5CO3A 4HQSA 2H8LA 2VM2A 4AKIA 1W4VA 2WVZA 2VL3A 1ERWA 4KH7A 3M0FA 5INYA 4N10A 1NHYA 4TR0A 1OC9B 3LYKA 1GTIA 1FOVA 2FNOA 4WKWA 5G2ZA 2YNXA 2PU9C 1SK1A 2B3SA 3F4RA 1B9XC 2Z9SA 4N0VA 4CY6A 4YAPA 1T8EB 3VPTA 4G0KA 1Z7RA 4EL1A 5G1LA 1ZYPA 1I1IP 1AXDA 1TI1A 4ZB7A 4POKA 2G0FA 4WXTA 3O3TA 3PGTA 4HU9A 3IAS2 2LQOA 2WCIA 3CTFA 4EXJA 3HYPA 3IK7A 1XPVA 3BCIA 5A4VA 2X64A 2O36A 1V57A 5ECNB 2YZUA 2RUFA 2L6DA 3GUSA 2OE3A 3TRXA 2VLUA 1YF0A 4AJ7A 3TDGA 4ZL7A 5DCGA 1H75A 4ECBA 2HI7A 1GWCA 1I9DA 4V1Ag 4HS1A 1B8XA 4KDXA 2JZRA 1T4ZA 2H73A 5E59A 3F6DA 3LXZA 2VUPA 2GQKA 1JZDA 2O5VA 3HVNA 2DMMA 2V1MA 2O7KA 1OC9A 2C0FA 4WETA 5CP1A 2H6ZA 5CRGA 1QXHA 1X0RA 3C1RA 3N5OA 1X9WB 2N5BA 3UIWA 3GSSA 3IPZA 1PMTA 1M7TA 5A5HA 1PSQA 3Q6OA 5H5SA 2LRTA 4X1UA 4IVFA 1ST9A 1V40A 2HXKA 3J7Yb 3HMJG 1A8YA 5CNWA 4MCUA 3U5RE 2RLIA 4HZ4A 1PD21 3MYDA 2OACA 5DAKB 13GSA 3LXTA 4TR4A 1EOHA 4Z7XA 5LNKe 2YWNA 2R37A 4POMA 3IC4A 3MAKA 5CRWA 1JZRA 3D6IA 3IRAA 5J9CA 2UV8G 3ERGA 1GLPA 2GSTA 4J2FA 4MPGA 5F06A 3APOA 2F8AA 3GKKA 2MMZA 5AIVA 4YKFA 3HJMA 2H30A 1OKDA 3H4KA 5KN1A 4GDFA 1WE0A 1SENA 4KAEA 3IK9A 2GZYA 3HVVA 3KP8A 4DSSA 10GSA 5GSTA 3Q18A 1J9BA 4RUVA 1M2AA 4PUAA 4FO5A 1XOAA 4AI6A 2HQTA 1TRWA 4MK3A
chains in the Genus database with same CATH topology
3ERWA 4HZ2A 2WJUA 1BAYA 1GH2A 2QA1A 3GL3A 3L9SA 5B8AA 1O8WA 3R2QA 5KOXA 3CTGA 3ERFA 1YVLA 2VO4A 2I9HA 2WZ9A 3QPMA 1HNCA 2CQ9A 5IMAA 3UOMA 3HD5A 2WGRA 3DD3A 1GRXA 1BYEA 3IDVA 1A8LA 5DAKA 2QSIA 2MMAA 2H1AA 1EP7A 3RHBA 2XBIA 3JCML 1BEDA 4PNGA 5KEJA 1GULA 2FY6A 1Y1UA 3E9JB 3GNJA 1M0UA 4Q5NA 3UVTA 3LEFA 3MWHA 4I8BA 1AAZA 3TJBA 3WT2A 2GZZA 1X5DA 4NHWA 4ZB8A 2GT5A 2ALBA 3R3EA 4PGTA 5F0GA 4MF6A 3U6VA 1M9BA 4ID0A 3ISOA 2JU5A 5HFGA 3GURA 3HVXA 1SD9A 1Y6EA 3UVHA 3LWAA 2CX3A 3ED3A 5F05A 2CV4A 5HQPA 3FEUA 2HRKB 5IPGA 22GSA 1A2JA 5KOWA 2FGXA 4WR5A 1G7EA 1ZYQB 5IMFA 1G7OA 2TRXA 4K6XA 4OCFA 2B1LA 3P90A 3LJRA 4JR6A 2YPMA 1XCCA 4OD7A 1A2MA 5G31A 2FWHA 1JLWA 4CHSA 1YDKA 3F4TA 1TDIA 4ML1A 5H5QA 5FWGA 1F9MA 2LRCA 1KEBA 4KCAA 2YP6A 6GSVA 3QAWA 2H19A 5KN0A 1XW6A 5AIXA 1LJRA 4DSQA 5EL8A 2YWMA 1K0AA 1XFLA 4F82A 3KTBA 4IQAA 2AJQB 3A3TA 1A0RP 2OJLA 1SL1B 3P2AA 1C72A 2H0GA 1TXXA 4K1FA 2KUCA 3H79A 1O85A 4ZXGA 2C0EA 1XXUA 1K0OA 4NAXA 1ZZYA 4BWSA 3FW2A 2LNSA 4Z2UA 1TI3A 5IMCA 4AKXB 3A5WA 2FA8A 4O7HA 1Z6MA 3IAM2 1TOFA 5IOWA 1VRSD 3ZYWA 2FWEA 4FYUA 5JWRB 2PN8A 4ECJA 1NM3A 4L5OA 1UA5A 4V2LA 3WYWA 3QAGA 4X43A 3TKQA 3LORA 1E2YA 3PH9A 1M2DA 4KX4A 3GX0A 3KM6A 2E2MA 4KCEA 4IKHA 5ECIB 2PBJA 5IQYA 2LV3A 1ERUA 2MBTA 2C3QA 1EGRA 4YQUA 4OWYA 4HU7A 4WBRD 4TXOB 1B4QA 5IO2A 5BRTA 2HNLA 5DQYA 1BG1A 2YCDA 1YF1A 4NV2A 1GP1A 4AF2A 3CSJA 2H01A 1WOUA 3DXBA 2L5LA 5H5RA 1X9MB 12GSA 4OFTA 2WS2A 3GKMA 3EYTA 2HZFA 1DSBA 2MMOA 4P3YB 4CW9A 4PURA 3GSTA 5D9TA 4BVXB 3H8QA 4OFMA 4GQFA 3GMFA 2HSMA 1A0FA 3G9BA 1SVMA 5JWOB 3L9VA 4HDEA 2REMA 1RK4A 2GGTA 5G1KA 2FA4A 4EDYA 5AN1A 1AQWA 4AKGA 3GKNA 3FK8A 3TJGA 5DQSA 2LJAA 5JWQB 1Z5YE 4YKGA 2H6XA 1ABAA 1ZMAA 3M1GA 2HSNB 3PPUA 4TXOA 3LSZA 2DKIA 4MLYA 4L8EA 3CSHA 1R5PA 1EOGA 1K0CA 1OAZA 4MJBA 4W66A 3MNGA 4IP6A 4GTUA 2VL2C 1XW5A 5D8IA 2H1GA 1WRYA 5GSSA 3BOAA 4V2NA 1GUHA 1AC1A 5ELAA 18GSA 1KTEA 5J4YA 5DJMA 1N8JA 2XPEA 2KLXA 3D5JA 3EU4A 3ZVJD 1V9WA 2XC2A 1K3OA 1OVNA 3QR6A 3EINA 2F9SA 2HRNA 3TKRA 1H4OA 4USSA 4BL7B 4ML6A 1AQXA 4LMWA 5KN2A 1GSSA 1V98A 2CZ2A 1K3YA 4ZL9A 2LJKA 2DJJA 3EU3A 1QFNA 4OFNA 1ZYNA 1SJZA 2LJRA 2VCWA 3UMAA 4Q5RA 3CRUA 1USBA 2HRFA 3E0UA 4MZBA 3ZIVA 3NIVA 3KIJA 3HKRA 1GL8A 1FG4A 4X4JA 1X5EA 4MP4A 2R6KA 5JCWA 3LQ7A 4QL9A 4L5LA 3IC8A 1U87A 4ZB9A 4MABA 1PX7A 1TRUA 3QFAC 1QMVA 3RDWA 2GQLA 1PA3A 3KZQA 4FIWA 1TRSA 4AGSA 1S3AA 3VFIA 1GSUA 2R0CA 2H0HA 2C0DA 5J4VA 4BL7A 5A5HB 2KP1A 1S3DA 2EC4A 2VD0A 4MPFA 5GZZB 3FR6A 1F6MC 4BVYA 4LL1B 3GH6A 4GXZA 4L0UA 3KTLA 4HUAA 3M3MA 4XIHA 4DVCA 3DVXA 3UBKA 1GNEA 5D96A 2YN1A 4TW5A 17GSA 2GQMA 2K18A 1HD2A 2WFCA 3HDCA 2G2QA 1JLVA 3WGDA 3ZIJA 1T7PB 4K5RA 5B6MA 2H72A 4ICYA 3CMIA 4TVEA 5DCHA 1MD4A 1TJDA 3GTUA 4TKYA 3VWUA 1JFUA 3UAPA 4PUFC 2H71A 3A2XA 5IMDA 1CQGA 4GSSA 4IJIA 8GSSA 3I43A 2L57A 1TW9A 3MIXA 6GSWA 5D93A 1XWAA 2R4VA 2B6MA 4DSSB 2MYGA 2DIYA 2JL4A 3ME7A 2TRCP 2N5FA 4LMVA 3TKSC 2GVPA 3M9KA 2HSYA 1XVWA 3FYGA 2VL9A 5CAXA 2OE1A 3TB2A 4I6XA 1SVOA 1QQ2A 4G01A 2RM5A 3D4MA 4YQVA 5ID2B 2H66A 2AHEA 5IMZA 3F3QA 5ABRA 1V2AA 1ZL9A 2VOCA 4MF7A 4TRXA 1KNGA 1RW1A 2V41A 3EPTA 2QC7A 1O81A 2AAWA 1JZWA 2LUSA 4XHMA 1SKSB 1U3IA 3F3RA 1VGLA 2K9FA 2GSQA 2HRAA 2FD3A 1PX6A 3EMPA 2CVDA 3TCOA 2YOIA 4MH3A 2OBKA 3TUEA 2IN3A 3NZNA 1JHBA 3CYNA 4J57E 4HJ2A 2H70A 2GDRA 4EVMA 3TU3B 3GFKA 4OMVA 1NHOA 5IMVA 2ZUPA 3TKSE 1YEXA 2FLSA 3KJYA 4TN8A 2R3XA 4WBJA 2F51A 3BCKA 4O5RA 4RI6A 4IN0A 2CVBA 4V1Ap 5KN3A 4KGIA 1HYUA 4NWYA 3FMWA 2PUKC 3RBTA 5DVBA 4KUNA 5ID2A 1BQ7A 3TJJA 4PTSA 3TRPA 6GSUA 3A2WA 5B6NA 2K8VA 2YANA 3HCZA 2BMXA 2LNTA 3LG6A 3VI5A 1XW9A 1ML6A 2R0PA 2L4QA 3WD6A 4ISDA 4CDOA 3KCMA 2O85A 2PMTA 2NDOA 9GSSA 3DWVA 3UEMA 3C7MA 4F0BA 3SWLA 4OO5A 4KDYA 2EFDA 3A2VA 1X9SB 4EIQA 3TJKA 5EVOA 1NSWA 2RUEA 19GSA 3IHQA 1XIYA 4POLA 2JSZA 1VF1A 3DGQA 3C8EA 1XVQA 3VPQA 2EIQA 2C3NA 2HLSA 2XPDA 2IL3A 1SKRB 1NW2A 4GLTA 20GSA 5ECMB 3FKFA 1HNBA 3HVSA 4I5QA 1F3AA 3IXRA 1F3BA 4D73B 2NVLA 2BTOT 1PL1A 1SYXA 5DALB 3OR5A 2H6YA 3ZREA 2C8UA 4IJ3A 2GLRA 1DE1A 3GN3A 3ZMLA 3HHVA 4OO4A 4HJMA 2IMDA 4K7OA 2IPAA 2YV7A 3BBYA 4PX1A 4GSNA 5ECRB 4XCSA 2NTOA 2HFDA 2L6CA 4O5UA 2BJXA 4BA7A 4MH2A 5GAPD 4GCIA 1PRXA 2YJHA 1GSYA 4XRDA 2E7PA 5J3RA 5A4UA 4WF4A 3KXOA 1RQMA 1SKWB 4AKHA 4J56E 1HQOA 1DUGA 3F6FA 2C4JA 2H1LA 2KOKA 1OYJA 1EP8A 3V1WA 5JCGA 4E68A 2R5GA 2PVOC 1SK0A 3GIXA 2V2GA 2TIRA 1R26A 4WEYA 3KMNA 1XBSA 1VF2A 4TOPA 2B5YA 3EWLA 5HR1A 3US3A 2HSMB 3DIEA 2LEGA 1BG5A 4K7NA 5A34A 2IMEA 4RQRA 4D73A 3FRCA 3BD2A 3IR4A 3CSIA 4IGJA 5DALA 2H76A 5IPHA 5G5FA 1MDKA 3PR8A 4KSMA 1HNAA 1FAAA 5J40A 14GSA 2DMLA 4HEA2 2H1DA 4N0ZA 3EE2A 2LRNA 5BMUB 2VAFA 2VLTA 1ERTA 2HE3A 2ZNMA 1PL2A 2LKUA 2AB6A 3F8UA 4K5SA 1TKDB 2QKEA 2C0GA 2X4AA 3FZ4A 3FY7A 2R2JA 3UBLA 3P7XA 1U3AA 4Z2RA 4N3ZA 1G6YA 3A5IA 4YQMA 1BF5A 2VCVA 5CYYA 3ZVJA 3ZITA 1SYRA 3Q74A 1URMA 2FHEA 5CRHA 1ZGNA 1B48A 4E8HA 1SU9A 5B8BA 1SD8A 1YY7A 2P5RA 4G0LA 2HSHA 3ZZXA 5ECPB 3C1SA 1K3LA 3CBUA 5JCUA 2AV4A 3H1NA 4LA1A 2VCXA 1F37A 3FZ9A 3TGZA 2DBCA 5J4UA 3EVIA 2B1KA 1U88A 2CAIA 4TXVA 3SBCA 4ZBBA 2J9HA 3S9FA 2DJ0A 2OADA 1OE8A 5BMUA 4ECCA 3TOUA 1S3CA 3HZ8A 3D21A 5EPFA 3LGCA 5CREA 2WULA 3FR9A 1GUKA 2HT9A 1XWCA 4MZWA 3K8NA 2GTUA 2YJ7A 3VK9A 3ME8A 3GHAA 6GSXA 1FB6A 1A2LA 3QCPA 1T1VA 1CQHA 2GS3A 4AJ8A 4NV5A 4GWRA 3HZ4A 5IM9A 2FWGA 3F63A 3WGXA 2VKZG 4K8MA 1EEMA 5HFKA 2YZHA 1TK0B 5HR3A 3F0IA 4XS4A 2DLXA 3KD0A 1JZOA 3ZFBA 3HA9A 1A23A 4MDCA 3GKXA 2JSYA 1QUWA 2PERA 2DIZA 4JZQA 1M99A 1EWXA 3WT1A 2X8HA 4TR1B 1AQVA 4FQUA 3LYPA 4BVYB 4IS0A 1O6JA 2DJ2A 4PNFA 2B7JA 5D9WA 5G30A 1PQNA 4GRFA 5ECQB 3O6TA 5FHIA 2I81A 3CRTA 3ZRDA 1FOHA 4ZBDA 2VL2A 1WIKA 3VURA 7GSSA 3G7JA 4NMUA 4EC0A 3GTUB 4GF0A 3GYKA 3IHGA 1FHEA 3D4TA 2ON5A 5G5EA 3LFLA 4JBBA 2V6OA 2OE0A 2RIIA 2RM6A 2V32A 1GSFA 5B7CA 1TXUA 2X49A 4JE1A 3M8NA 3BJ5A 1Z9HA 2YWIA 4EKZA 2L59A 16GSA 5ECLB 1YKAA 4EUYA 5A5KA 2L5OA 2WDUA 2GT6A 5L71A 2F3MA 1ERVA 1G6WA 4TR1A 3L9UA 2IMFA 2O8VB 6GSSA 2EIOA 1ZYEA 3I9V2 1OKTA 1EEJA 3RPNA 4AJ6A 1AIUA 1N25A 5D73A 4NPBA 2OKAA 2IFQA 4Z2TA 5AISA 2E2GA 2H75A 1GSQA 2CT6A 4PXOA 5ECKB 1ZOFA 2DJ1A 1EGOA 1TTZA 3ZTLA 4IHUA 4PQIA 1YZXA 4QL7A 5IO0A 2LSTA 4I2TA 3Q19A 3D0ZA 4EE0A 4JRRA 3O76A 1GSDA 1J0FA 1THOA 2VCQA 4JR4A 3HJPA 2O87A 4KA0A 4BPYA 4KE3A 1GLQA 2C1YA 4L0WA 1PGTA 4FYCA 4EF0A 5ECOB 2AUVA 2FCHA 2N5AA 4MJEA 1MTCA 2IMIA 2FUG2 4FH8A 2PVQA 1X5CA 3QFBC 4JEDA 2K6VA 4YAVA 3CXGA 2M80A 4RI7A 2LTKA 1THXA 1TU8A 2MZCA 3ZLPA 3F4SA 2IIYA 3LW9A 2MMNA 4F9ZA 2D2ZA 4N11A 4ECIA 1GTAA 2B7KA 2WB9A 3TJFA 4ZL8A 2I3YA 1PKWA 1MEKA 4V2MA 4POBA 4RQXA 1A24A 5J5NA 3KH7A 3RPPA 4EDZA 1W89A 3I6AA 4QMKA 4O32A 2X8CA 5ENUA 1TU7A 2UZ8A 4K0GA 1EZKA 1TK8B 3MDKA 4YH2A 4KSOA 4Q5QA 1MDJA 3AY8A 4F0CA 3EC3A 3TKSA 3HXSA 2NBSA 4X0XA 3CWGA 1Q4JA 2DKHA 1KBNA 3W8SA 1O73A 4WR4A 3GX8A 1WWJA 4G2EA 5CRDA 1IYHA 2A2SA 2IMKA 1WJKA 1DE2A 1IYIA 2XHFA 3QAVA 4ZIJA 4ILFA 4NHZA 2I1UA 2JADA 4G0IA 4MZCA 4MNNA 1DBYA 2LS5A 4K2DA 3QMXA 2GZPA 3J7Yk 2IJYA 4IBPA 5LD0A 3VLNA 2WRTA 1SJIA 4MMMA 1FW1A 4HI7A 5D9VA 3QDNA 3FZAA 4KB3A 4IQ1A 4PQHA 2XBQA 1M2BA 1O8XA 4ULXA 4E8EA 4MF5A 2VLVA 5IOXA 2A4HA 2H1BA 4IELA 1SK2A 1Q98A 1Z7PA 4XS1A 1ILOA 1T4YA 5LCZA 4MA9A 5HFIA 3C71A 4I97A 1XWKA 5AGYA 2DJ3A 1TRVA 1VF4A 2YWOA 4A5PA 11GSA 2EIRA 1K0BA 1YKCA 5A34B 4K9ZA 5IIZA 2JZSA 5C04A 4BWQA 5DDLA 2CX4A 4KNDA 3UARA 3KH9A 2CVKA 2A2RA 2EFCA 4HOJA 4HQZA 5F8BA 2NPBA 5FT3A 2PWJA 4H86A 1YQ1A 5A1NB 5J41A 3N9JA 3APSA 3VI7A 3QOUA 4O5QA 2F8FA 3G7YA 4G9HA 2M72A 2CZ3A 3M9JA 2L4CA 3ZFLA 5GAND 3DYRA 3FZ5A 6GSTA 3E3EA 3KMOA 3GA4A 4OCEA 2CAQA 4FYBA 1I5GA 3GV1A 3FHKA 3QD9A 4KF9A 1SL2B 2O89A 3IA1A 3W6GA 1GTUA 1TK5B 3RHCA 1K0NA 4MJCA 1AW9A 3ZL5A 1MD3A 1PKZA 2YV9A 4QQ7A 2M46A 2X8GA 4KW6A 2X99A 1M9AA 3EMXA 1B9YC 5E4WA 3DVWA 3DMLA 1ACVA 3W8JA 3GL5A 1UN2A 1ZCPA 2HRKA 1XWBA 3EURA 4XS6A 3DEXA 1FVKA 5A1NA 1T3BA 3GH9A 1TP9A 5HR2A 1SL0B 3IE3A 4WF5A 3C73A 1OC8A 1FB0A 3UJ1A 4G10A 1R7HA 4CY8A 5C00A 3VWXA 2CA8A 2GSSA 4JU5A 1Y25A 2K8SA 2A2PA 2KP2A 3L0HA 4ZBAA 2I4AA 2JACA 2C3TA 4EIPA 1MDIA 2OBIA 2KHPA 4DSRA 4F2IA 3P8WA 2VCZA 5ECSA 4ZILA 4MJAA 2ES7A 2E0QA 4NXIA 5F07A 2B5XA 1BX9A 2H0IA 3DRNA 2H74A 4F03A 3NOFA 1VF3A 5ELGA 3IBHA 4G19A 3ZMKA 1Z6NA 1GSEA 1ON4A 2HYXA 3IV4A 4XTSA 1B4PA 1OC3A 2PGTA 3MSZA 2C80A 4DEJA 2OA7A 4XS4B 1WMJA 1PN9A 1R5AA 1QGVA 1SJ6A 4ACSA 2EFEA 2R0GA 1T00A 3HJOA 1UC7A 3VWVA 5EY6A 4LL4B 3WGEA 4I2UA 1GUMA 5ECHB 2HZEB 1UVZA 4K0NA 2ON7A 1XWGA 3F9UA 2VIMA 2QA2A 3RAZA 5COHA 3FR3A 4TR3A 1YJ6A 2OT3A 4XRAA 1J08A 3KP9A 6GSYA 1WPIA 5A4WA 1LU4A 2B5EA 1G0TA 4K7IA 3VWWA 1PN0A 4KDUA 4PQ1A 3IOSA 3APQA 3G7IA 1FO5A 3DKSA 3KEBA 3UL3A 1O7UA 2FWFA 2P31A 4GSTA 2DC5A 1FVJA 1WP0A 1V58A 4ZB6A 1N2AA 1XZOA 2J23A 2ZCTA 4IW9A 1LBKA 3L78A 3TKPA 2EFHA 2MBSA 1EV4A 1BJXA 1U6TA 2JZTA 2GSRA 4BVXA 2V6KA 2DSAA 1OE7A 1XOBA 2HZEA 4Q5FA 2LQQA 1YEPA 4IP1A 3L4NA 5DJLA 2QGVA 1SVLA 3PINA 4LLRA 2IFQB 1F2EA 2P5QA 4K2XA 3I69A 1E6BA 1R4WA 2A4VA 4N30A 2VD1A 2IWTA 3TRQA 2HSNA 4O92A 1QK8A 4EO3A 1Z3EA 5J9BA 2VCTA 5HR0A 1GNWA 1K0MA 5J47A 5DBQA 2DJKA 1AUCA 1EV9A 2VM1A 2PPTA 1GTBA 2AYTA 3HY2A 3TOTA 2P0GA 3GRXA 1K0DA 5D9XA 4GQCA 3D22A 3KGKA 3H93A 5CO3A 4HQSA 2H8LA 2VM2A 4AKIA 1W4VA 2VL3A 1ERWA 4KH7A 3M0FA 5INYA 4N10A 1NHYA 4TR0A 1OC9B 3LYKA 1GTIA 1FOVA 2FNOA 4WKWA 5G2ZA 2YNXA 2PU9C 1SK1A 2B3SA 3F4RA 1B9XC 2Z9SA 4N0VA 4CY6A 4YAPA 1T8EB 3VPTA 4G0KA 1Z7RA 4EL1A 5G1LA 1ZYPA 1AXDA 1TI1A 4ZB7A 4POKA 2G0FA 4WXTA 3O3TA 3PGTA 4HU9A 3IAS2 2LQOA 2WCIA 3CTFA 4EXJA 3HYPA 3IK7A 1XPVA 3BCIA 5A4VA 2X64A 1V57A 5ECNB 2YZUA 2RUFA 2L6DA 3GUSA 2OE3A 3TRXA 2VLUA 1YF0A 4AJ7A 3TDGA 4ZL7A 5DCGA 1H75A 4ECBA 2HI7A 1GWCA 1I9DA 4V1Ag 4HS1A 1B8XA 4KDXA 2JZRA 1T4ZA 2H73A 5E59A 3F6DA 3LXZA 2VUPA 2GQKA 1JZDA 2O5VA 2DMMA 2V1MA 2O7KA 1OC9A 2C0FA 4WETA 5CP1A 2H6ZA 5CRGA 1QXHA 1X0RA 3C1RA 3N5OA 1X9WB 2N5BA 3UIWA 3GSSA 3IPZA 1PMTA 1M7TA 5A5HA 1PSQA 3Q6OA 5H5SA 2LRTA 4X1UA 4IVFA 1ST9A 1V40A 2HXKA 3J7Yb 3HMJG 1A8YA 5CNWA 4MCUA 3U5RE 2RLIA 4HZ4A 1PD21 3MYDA 2OACA 5DAKB 13GSA 3LXTA 4TR4A 1EOHA 4Z7XA 5LNKe 2YWNA 2R37A 4POMA 3IC4A 3MAKA 5CRWA 1JZRA 3D6IA 3IRAA 5J9CA 2UV8G 3ERGA 1GLPA 2GSTA 4J2FA 4MPGA 5F06A 3APOA 2F8AA 3GKKA 2MMZA 5AIVA 4YKFA 3HJMA 2H30A 1OKDA 3H4KA 5KN1A 4GDFA 1WE0A 1SENA 4KAEA 3IK9A 2GZYA 3HVVA 3KP8A 4DSSA 10GSA 5GSTA 3Q18A 1J9BA 4RUVA 1M2AA 4PUAA 4FO5A 1XOAA 4AI6A 2HQTA 1TRWA 4MK3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ERW A;  4HZ2 A;  2WJU A;  1BAY A;  1GH2 A;  3GL3 A;  3L9S A;  5B8A A;  1O8W A;  3R2Q A;  3CTG A;  3ERF A;  2VO4 A;  2I9H A;  2WZ9 A;  3QPM A;  1HNC A;  2CQ9 A;  5IMA A;  3UOM A;  3HD5 A;  2WGR A;  3DD3 A;  1GRX A;  1BYE A;  3IDV A;  1A8L A;  5DAK A;  2QSI A;  2MMA A;  2H1A A;  1EP7 A;  3RHB A;  2XBI A;  3JCM L;  1BED A;  4PNG A;  5KEJ A;  1GUL A;  2FY6 A;  3E9J B;  3GNJ A;  1M0U A;  4Q5N A;  3UVT A;  3LEF A;  3MWH A;  4I8B A;  1AAZ A;  3TJB A;  3WT2 A;  2GZZ A;  1X5D A;  4NHW A;  4ZB8 A;  2GT5 A;  2ALB A;  3R3E A;  4PGT A;  5F0G A;  4MF6 A;  3U6V A;  1M9B A;  4ID0 A;  3ISO A;  2JU5 A;  5HFG A;  3GUR A;  3HVX A;  1SD9 A;  1Y6E A;  3UVH A;  3LWA A;  2CX3 A;  3ED3 A;  5F05 A;  2CV4 A;  5HQP A;  3FEU A;  2HRK B;  5IPG A;  22GS A;  1A2J A;  2FGX A;  4WR5 A;  1G7E A;  1ZYQ B;  5IMF A;  1G7O A;  2TRX A;  4K6X A;  4OCF A;  2B1L A;  3P90 A;  3LJR A;  4JR6 A;  2YPM A;  1XCC A;  4OD7 A;  1A2M A;  5G31 A;  2FWH A;  1JLW A;  4CHS A;  1YDK A;  3F4T A;  1TDI A;  4ML1 A;  5H5Q A;  5FWG A;  1F9M A;  2LRC A;  1KEB A;  4KCA A;  2YP6 A;  6GSV A;  3QAW A;  2H19 A;  5KN0 A;  1XW6 A;  5AIX A;  1LJR A;  4DSQ A;  5EL8 A;  2YWM A;  1K0A A;  1XFL A;  4F82 A;  3KTB A;  4IQA A;  2AJQ B;  3A3T A;  1A0R P;  2OJL A;  1SL1 B;  3P2A A;  1C72 A;  2H0G A;  1TXX A;  4K1F A;  2KUC A;  3H79 A;  1O85 A;  4ZXG A;  2C0E A;  1XXU A;  1K0O A;  4NAX A;  1ZZY A;  4BWS A;  3FW2 A;  2LNS A;  1TI3 A;  5IMC A;  3A5W A;  2FA8 A;  4O7H A;  1Z6M A;  3IAM 2;  1TOF A;  5IOW A;  1VRS D;  3ZYW A;  2FWE A;  4FYU A;  5JWR B;  2PN8 A;  4ECJ A;  1NM3 A;  4L5O A;  1UA5 A;  4V2L A;  3WYW A;  3QAG A;  4X43 A;  3TKQ A;  3LOR A;  1E2Y A;  3PH9 A;  1M2D A;  4KX4 A;  3GX0 A;  3KM6 A;  2E2M A;  4KCE A;  4IKH A;  5ECI B;  2PBJ A;  5IQY A;  2LV3 A;  1ERU A;  2MBT A;  2C3Q A;  1EGR A;  4YQU A;  4OWY A;  4HU7 A;  4WBR D;  4TXO B;  1B4Q A;  5IO2 A;  2HNL A;  5DQY A;  2YCD A;  1YF1 A;  4NV2 A;  1GP1 A;  4AF2 A;  3CSJ A;  2H01 A;  1WOU A;  3DXB A;  2L5L A;  5H5R A;  1X9M B;  12GS A;  4OFT A;  2WS2 A;  3GKM A;  3EYT A;  2HZF A;  1DSB A;  2MMO A;  4P3Y B;  4CW9 A;  4PUR A;  3GST A;  5D9T A;  4BVX B;  3H8Q A;  4OFM A;  4GQF A;  3GMF A;  2HSM A;  1A0F A;  3G9B A;  5JWO B;  3L9V A;  4HDE A;  2REM A;  1RK4 A;  2GGT A;  5G1K A;  2FA4 A;  4EDY A;  5AN1 A;  1AQW A;  3GKN A;  3FK8 A;  3TJG A;  5DQS A;  2LJA A;  5JWQ B;  1Z5Y E;  2H6X A;  1ABA A;  1ZMA A;  3M1G A;  2HSN B;  3PPU A;  4TXO A;  3LSZ A;  4MLY A;  4L8E A;  3CSH A;  1R5P A;  1EOG A;  1K0C A;  1OAZ A;  4MJB A;  3MNG A;  4IP6 A;  4GTU A;  2VL2 C;  1XW5 A;  5D8I A;  2H1G A;  1WRY A;  5GSS A;  3BOA A;  4V2N A;  1GUH A;  1AC1 A;  5ELA A;  18GS A;  1KTE A;  5DJM A;  1N8J A;  2XPE A;  2KLX A;  3D5J A;  3EU4 A;  3ZVJ D;  1V9W A;  2XC2 A;  1K3O A;  1OVN A;  3QR6 A;  3EIN A;  2F9S A;  2HRN A;  3TKR A;  1H4O A;  4USS A;  4BL7 B;  4ML6 A;  1AQX A;  4LMW A;  5KN2 A;  1GSS A;  1V98 A;  2CZ2 A;  1K3Y A;  4ZL9 A;  2LJK A;  2DJJ A;  3EU3 A;  1QFN A;  4OFN A;  1SJZ A;  2LJR A;  2VCW A;  3UMA A;  4Q5R A;  3CRU A;  1USB A;  2HRF A;  3E0U A;  4MZB A;  3ZIV A;  3NIV A;  3KIJ A;  3HKR A;  1GL8 A;  1FG4 A;  1X5E A;  4MP4 A;  2R6K A;  5JCW A;  3LQ7 A;  4QL9 A;  4L5L A;  3IC8 A;  1U87 A;  4ZB9 A;  4MAB A;  1PX7 A;  1TRU A;  3QFA C;  1QMV A;  3RDW A;  2GQL A;  1PA3 A;  3KZQ A;  4FIW A;  1TRS A;  4AGS A;  1S3A A;  3VFI A;  1GSU A;  2H0H A;  2C0D A;  4BL7 A;  2KP1 A;  1S3D A;  2EC4 A;  2VD0 A;  4MPF A;  5GZZ B;  3FR6 A;  1F6M C;  4BVY A;  4LL1 B;  3GH6 A;  4GXZ A;  4L0U A;  3KTL A;  4HUA A;  3M3M A;  4XIH A;  4DVC A;  3DVX A;  3UBK A;  1GNE A;  5D96 A;  2YN1 A;  4TW5 A;  17GS A;  2GQM A;  2K18 A;  1HD2 A;  2WFC A;  3HDC A;  2G2Q A;  1JLV A;  3WGD A;  3ZIJ A;  1T7P B;  5B6M A;  2H72 A;  3CMI A;  4TVE A;  5DCH A;  1MD4 A;  1TJD A;  3GTU A;  4TKY A;  3VWU A;  1JFU A;  3UAP A;  4PUF C;  2H71 A;  3A2X A;  5IMD A;  1CQG A;  4GSS A;  4IJI A;  8GSS A;  3I43 A;  2L57 A;  1TW9 A;  6GSW A;  5D93 A;  1XWA A;  2R4V A;  2B6M A;  4DSS B;  2MYG A;  2DIY A;  2JL4 A;  3ME7 A;  2TRC P;  2N5F A;  4LMV A;  3TKS C;  2GVP A;  3M9K A;  2HSY A;  1XVW A;  3FYG A;  2VL9 A;  5CAX A;  2OE1 A;  3TB2 A;  4I6X A;  1QQ2 A;  2RM5 A;  3D4M A;  4YQV A;  5ID2 B;  2H66 A;  2AHE A;  5IMZ A;  3F3Q A;  5ABR A;  1V2A A;  1ZL9 A;  2VOC A;  4MF7 A;  4TRX A;  1KNG A;  1RW1 A;  2V41 A;  2QC7 A;  1O81 A;  2AAW A;  1JZW A;  2LUS A;  4XHM A;  1SKS B;  1U3I A;  3F3R A;  1VGL A;  2K9F A;  2GSQ A;  2HRA A;  2FD3 A;  1PX6 A;  3EMP A;  2CVD A;  3TCO A;  2YOI A;  4MH3 A;  2OBK A;  3TUE A;  2IN3 A;  3NZN A;  1JHB A;  3CYN A;  4J57 E;  4HJ2 A;  2H70 A;  2GDR A;  4EVM A;  3GFK A;  4OMV A;  1NHO A;  5IMV A;  2ZUP A;  3TKS E;  1YEX A;  2FLS A;  3KJY A;  4TN8 A;  2R3X A;  4WBJ A;  2F51 A;  3BCK A;  4O5R A;  4RI6 A;  4IN0 A;  2CVB A;  4V1A p;  5KN3 A;  4KGI A;  1HYU A;  4NWY A;  2PUK C;  3RBT A;  5DVB A;  4KUN A;  5ID2 A;  1BQ7 A;  3TJJ A;  4PTS A;  3TRP A;  6GSU A;  3A2W A;  5B6N A;  2K8V A;  2YAN A;  3HCZ A;  2BMX A;  2LNT A;  3LG6 A;  3VI5 A;  1XW9 A;  1ML6 A;  2L4Q A;  3WD6 A;  4ISD A;  4CDO A;  3KCM A;  2O85 A;  2PMT A;  2NDO A;  9GSS A;  3DWV A;  3UEM A;  3C7M A;  4F0B A;  3SWL A;  4OO5 A;  4KDY A;  3A2V A;  1X9S B;  3TJK A;  5EVO A;  1NSW A;  2RUE A;  19GS A;  3IHQ A;  1XIY A;  4POL A;  2JSZ A;  1VF1 A;  3DGQ A;  3C8E A;  1XVQ A;  3VPQ A;  2EIQ A;  2C3N A;  2HLS A;  2XPD A;  2IL3 A;  1SKR B;  1NW2 A;  4GLT A;  20GS A;  5ECM B;  3FKF A;  1HNB A;  3HVS A;  4I5Q A;  1F3A A;  3IXR A;  1F3B A;  4D73 B;  2NVL A;  2BTO T;  1PL1 A;  1SYX A;  5DAL B;  3OR5 A;  2H6Y A;  3ZRE A;  2C8U A;  4IJ3 A;  2GLR A;  1DE1 A;  3GN3 A;  3ZML A;  3HHV A;  4OO4 A;  4HJM A;  2IMD A;  4K7O A;  2IPA A;  2YV7 A;  3BBY A;  4PX1 A;  4GSN A;  5ECR B;  4XCS A;  2NTO A;  2HFD A;  2L6C A;  2BJX A;  4BA7 A;  4MH2 A;  5GAP D;  4GCI A;  1PRX A;  2YJH A;  1GSY A;  4XRD A;  2E7P A;  5J3R A;  5A4U A;  4WF4 A;  3KXO A;  1RQM A;  1SKW B;  4J56 E;  1HQO A;  1DUG A;  3F6F A;  2C4J A;  2KOK A;  1OYJ A;  1EP8 A;  3V1W A;  5JCG A;  2R5G A;  2PVO C;  1SK0 A;  3GIX A;  2V2G A;  2TIR A;  1R26 A;  4WEY A;  3KMN A;  1XBS A;  1VF2 A;  4TOP A;  2B5Y A;  3EWL A;  5HR1 A;  3US3 A;  2HSM B;  3DIE A;  2LEG A;  1BG5 A;  4K7N A;  2IME A;  4RQR A;  4D73 A;  3FRC A;  3BD2 A;  3IR4 A;  3CSI A;  4IGJ A;  5DAL A;  2H76 A;  5IPH A;  5G5F A;  1MDK A;  3PR8 A;  4KSM A;  1HNA A;  1FAA A;  14GS A;  4HEA 2;  2DML A;  2H1D A;  4N0Z A;  3EE2 A;  2LRN A;  2VAF A;  2VLT A;  1ERT A;  2HE3 A;  2ZNM A;  1PL2 A;  2LKU A;  2AB6 A;  3F8U A;  1TKD B;  2QKE A;  2C0G A;  3FZ4 A;  3FY7 A;  2R2J A;  3UBL A;  3P7X A;  1U3A A;  1G6Y A;  4YQM A;  2VCV A;  5CYY A;  3ZVJ A;  3ZIT A;  1SYR A;  3Q74 A;  1URM A;  2FHE A;  5CRH A;  1ZGN A;  1B48 A;  4E8H A;  1SU9 A;  5B8B A;  1SD8 A;  1YY7 A;  2P5R A;  4G0L A;  2HSH A;  3ZZX A;  5ECP B;  3C1S A;  1K3L A;  3CBU A;  5JCU A;  2AV4 A;  3H1N A;  4LA1 A;  2VCX A;  1F37 A;  3FZ9 A;  3TGZ A;  2DBC A;  5J4U A;  3EVI A;  2B1K A;  1U88 A;  2CAI A;  4TXV A;  3SBC A;  4ZBB A;  2J9H A;  3S9F A;  2DJ0 A;  2OAD A;  1OE8 A;  5BMU A;  4ECC A;  3TOU A;  1S3C A;  3HZ8 A;  3D21 A;  5EPF A;  3LGC A;  5CRE A;  2WUL A;  3FR9 A;  1GUK A;  2HT9 A;  1XWC A;  4MZW A;  3K8N A;  2GTU A;  2YJ7 A;  3VK9 A;  3ME8 A;  3GHA A;  6GSX A;  1FB6 A;  1A2L A;  3QCP A;  1T1V A;  1CQH A;  2GS3 A;  4AJ8 A;  4NV5 A;  4GWR A;  3HZ4 A;  5IM9 A;  2FWG A;  3F63 A;  3WGX A;  4K8M A;  1EEM A;  5HFK A;  2YZH A;  1TK0 B;  5HR3 A;  3F0I A;  4XS4 A;  2DLX A;  3KD0 A;  1JZO A;  3ZFB A;  3HA9 A;  1A23 A;  4MDC A;  3GKX A;  2JSY A;  1QUW A;  2PER A;  2DIZ A;  4JZQ A;  1M99 A;  1EWX A;  3WT1 A;  2X8H A;  4TR1 B;  1AQV A;  4FQU A;  3LYP A;  4BVY B;  4IS0 A;  1O6J A;  2DJ2 A;  4PNF A;  2B7J A;  5D9W A;  5G30 A;  1PQN A;  4GRF A;  5ECQ B;  3O6T A;  5FHI A;  2I81 A;  3CRT A;  3ZRD A;  4ZBD A;  2VL2 A;  1WIK A;  3VUR A;  7GSS A;  3G7J A;  4NMU A;  4EC0 A;  3GTU B;  4GF0 A;  3GYK A;  1FHE A;  3D4T A;  2ON5 A;  5G5E A;  3LFL A;  4JBB A;  2V6O A;  2OE0 A;  2RII A;  2RM6 A;  2V32 A;  1GSF A;  5B7C A;  4JE1 A;  3M8N A;  3BJ5 A;  1Z9H A;  2YWI A;  4EKZ A;  2L59 A;  16GS A;  5ECL B;  1YKA A;  4EUY A;  5A5K A;  2L5O A;  2WDU A;  2GT6 A;  5L71 A;  2F3M A;  1ERV A;  1G6W A;  4TR1 A;  3L9U A;  2IMF A;  2O8V B;  6GSS A;  2EIO A;  1ZYE A;  3I9V 2;  1OKT A;  1EEJ A;  3RPN A;  4AJ6 A;  1AIU A;  5D73 A;  4NPB A;  2OKA A;  2IFQ A;  5AIS A;  2E2G A;  2H75 A;  1GSQ A;  2CT6 A;  4PXO A;  5ECK B;  1ZOF A;  2DJ1 A;  1EGO A;  1TTZ A;  3ZTL A;  4IHU A;  4PQI A;  1YZX A;  4QL7 A;  5IO0 A;  2LST A;  4I2T A;  3Q19 A;  3D0Z A;  4EE0 A;  4JRR A;  3O76 A;  1GSD A;  1J0F A;  1THO A;  2VCQ A;  4JR4 A;  3HJP A;  2O87 A;  4KA0 A;  4BPY A;  4KE3 A;  1GLQ A;  2C1Y A;  4L0W A;  1PGT A;  4FYC A;  4EF0 A;  5ECO B;  2AUV A;  2FCH A;  2N5A A;  4MJE A;  1MTC A;  2IMI A;  2FUG 2;  4FH8 A;  2PVQ A;  1X5C A;  3QFB C;  4JED A;  2K6V A;  4YAV A;  3CXG A;  2M80 A;  4RI7 A;  2LTK A;  1THX A;  1TU8 A;  2MZC A;  3ZLP A;  3F4S A;  2IIY A;  2MMN A;  4F9Z A;  2D2Z A;  4N11 A;  4ECI A;  1GTA A;  2B7K A;  2WB9 A;  3TJF A;  4ZL8 A;  2I3Y A;  1PKW A;  1MEK A;  4V2M A;  4POB A;  4RQX A;  1A24 A;  5J5N A;  3KH7 A;  3RPP A;  4EDZ A;  1W89 A;  3I6A A;  4O32 A;  2X8C A;  5ENU A;  1TU7 A;  2UZ8 A;  4K0G A;  1EZK A;  1TK8 B;  3MDK A;  4YH2 A;  4KSO A;  4Q5Q A;  1MDJ A;  3AY8 A;  4F0C A;  3EC3 A;  3TKS A;  3HXS A;  2NBS A;  4X0X A;  1Q4J A;  1KBN A;  3W8S A;  1O73 A;  4WR4 A;  3GX8 A;  1WWJ A;  4G2E A;  5CRD A;  1IYH A;  2A2S A;  2IMK A;  1WJK A;  1DE2 A;  1IYI A;  2XHF A;  3QAV A;  4ZIJ A;  4ILF A;  4NHZ A;  2I1U A;  2JAD A;  4G0I A;  4MZC A;  1DBY A;  2LS5 A;  4K2D A;  3QMX A;  2GZP A;  3J7Y k;  2IJY A;  4IBP A;  5LD0 A;  3VLN A;  2WRT A;  1SJI A;  4MMM A;  1FW1 A;  4HI7 A;  5D9V A;  3QDN A;  3FZA A;  4KB3 A;  4IQ1 A;  4PQH A;  2XBQ A;  1M2B A;  1O8X A;  4ULX A;  4E8E A;  4MF5 A;  2VLV A;  5IOX A;  2H1B A;  4IEL A;  1SK2 A;  1Q98 A;  1Z7P A;  4XS1 A;  1ILO A;  1T4Y A;  5LCZ A;  4MA9 A;  5HFI A;  3C71 A;  4I97 A;  1XWK A;  5AGY A;  2DJ3 A;  1TRV A;  1VF4 A;  2YWO A;  11GS A;  2EIR A;  1K0B A;  1YKC A;  4K9Z A;  5IIZ A;  2JZS A;  5C04 A;  4BWQ A;  5DDL A;  2CX4 A;  4KND A;  3UAR A;  3KH9 A;  2CVK A;  2A2R A;  4HOJ A;  4HQZ A;  5F8B A;  2NPB A;  5FT3 A;  2PWJ A;  4H86 A;  1YQ1 A;  5J41 A;  3N9J A;  3APS A;  3VI7 A;  3QOU A;  2F8F A;  3G7Y A;  4G9H A;  2M72 A;  2CZ3 A;  3M9J A;  2L4C A;  3ZFL A;  5GAN D;  3DYR A;  3FZ5 A;  6GST A;  3E3E A;  3KMO A;  3GA4 A;  4OCE A;  2CAQ A;  4FYB A;  1I5G A;  3GV1 A;  3FHK A;  3QD9 A;  4KF9 A;  1SL2 B;  2O89 A;  3IA1 A;  3W6G A;  1GTU A;  1TK5 B;  3RHC A;  1K0N A;  4MJC A;  1AW9 A;  3ZL5 A;  1MD3 A;  1PKZ A;  2YV9 A;  4QQ7 A;  2M46 A;  2X8G A;  4KW6 A;  2X99 A;  1M9A A;  3EMX A;  1B9Y C;  5E4W A;  3DVW A;  3DML A;  1ACV A;  3W8J A;  3GL5 A;  1UN2 A;  1ZCP A;  2HRK A;  1XWB A;  3EUR A;  4XS6 A;  3DEX A;  1FVK A;  1T3B A;  3GH9 A;  1TP9 A;  5HR2 A;  1SL0 B;  3IE3 A;  4WF5 A;  3C73 A;  1OC8 A;  1FB0 A;  3UJ1 A;  4G10 A;  1R7H A;  5C00 A;  3VWX A;  2CA8 A;  2GSS A;  4JU5 A;  1Y25 A;  2K8S A;  2KP2 A;  3L0H A;  4ZBA A;  2I4A A;  2JAC A;  2C3T A;  1MDI A;  2OBI A;  2KHP A;  4DSR A;  4F2I A;  3P8W A;  2VCZ A;  5ECS A;  4ZIL A;  4MJA A;  2ES7 A;  2E0Q A;  4NXI A;  5F07 A;  2B5X A;  1BX9 A;  2H0I A;  3DRN A;  2H74 A;  4F03 A;  3NOF A;  1VF3 A;  5ELG A;  3IBH A;  4G19 A;  3ZMK A;  1Z6N A;  1GSE A;  1ON4 A;  2HYX A;  3IV4 A;  4XTS A;  1B4P A;  1OC3 A;  2PGT A;  3MSZ A;  2C80 A;  4DEJ A;  2OA7 A;  4XS4 B;  1WMJ A;  1PN9 A;  1R5A A;  1QGV A;  1SJ6 A;  4ACS A;  1T00 A;  3HJO A;  1UC7 A;  3VWV A;  5EY6 A;  4LL4 B;  3WGE A;  4I2U A;  1GUM A;  5ECH B;  2HZE B;  1UVZ A;  4K0N A;  2ON7 A;  1XWG A;  3F9U A;  2VIM A;  3RAZ A;  5COH A;  3FR3 A;  4TR3 A;  1YJ6 A;  4XRA A;  1J08 A;  3KP9 A;  6GSY A;  1WPI A;  5A4W A;  1LU4 A;  2B5E A;  1G0T A;  4K7I A;  3VWW A;  4KDU A;  4PQ1 A;  3IOS A;  3APQ A;  3G7I A;  1FO5 A;  3DKS A;  3KEB A;  3UL3 A;  1O7U A;  2FWF A;  2P31 A;  4GST A;  2DC5 A;  1FVJ A;  1WP0 A;  1V58 A;  4ZB6 A;  1N2A A;  1XZO A;  2J23 A;  2ZCT A;  4IW9 A;  1LBK A;  3L78 A;  3TKP A;  2MBS A;  1EV4 A;  1BJX A;  1U6T A;  2JZT A;  2GSR A;  4BVX A;  2V6K A;  2DSA A;  1OE7 A;  1XOB A;  2HZE A;  4Q5F A;  2LQQ A;  1YEP A;  4IP1 A;  3L4N A;  5DJL A;  2QGV A;  3PIN A;  4LLR A;  2IFQ B;  1F2E A;  2P5Q A;  3I69 A;  1E6B A;  1R4W A;  2A4V A;  4N30 A;  2VD1 A;  2IWT A;  3TRQ A;  4O92 A;  1QK8 A;  4EO3 A;  1Z3E A;  5J9B A;  2VCT A;  5HR0 A;  1GNW A;  1K0M A;  5DBQ A;  2DJK A;  1AUC A;  1EV9 A;  2VM1 A;  2PPT A;  1GTB A;  2AYT A;  3HY2 A;  3TOT A;  2P0G A;  3GRX A;  1K0D A;  5D9X A;  4GQC A;  3D22 A;  3KGK A;  3H93 A;  5CO3 A;  4HQS A;  2H8L A;  2VM2 A;  1W4V A;  2VL3 A;  1ERW A;  4KH7 A;  3M0F A;  5INY A;  4N10 A;  1NHY A;  4TR0 A;  1OC9 B;  3LYK A;  1GTI A;  1FOV A;  2FNO A;  4WKW A;  5G2Z A;  2YNX A;  2PU9 C;  1SK1 A;  2B3S A;  3F4R A;  1B9X C;  2Z9S A;  4N0V A;  4YAP A;  1T8E B;  3VPT A;  4G0K A;  1Z7R A;  4EL1 A;  5G1L A;  1AXD A;  1TI1 A;  4POK A;  2G0F A;  4WXT A;  3O3T A;  3PGT A;  4HU9 A;  3IAS 2;  2LQO A;  2WCI A;  3CTF A;  4EXJ A;  3HYP A;  3IK7 A;  1XPV A;  3BCI A;  5A4V A;  2X64 A;  1V57 A;  5ECN B;  2YZU A;  2RUF A;  2L6D A;  3GUS A;  2OE3 A;  3TRX A;  2VLU A;  1YF0 A;  4AJ7 A;  3TDG A;  4ZL7 A;  5DCG A;  1H75 A;  4ECB A;  2HI7 A;  1GWC A;  1I9D A;  4V1A g;  4HS1 A;  1B8X A;  4KDX A;  2JZR A;  1T4Z A;  2H73 A;  5E59 A;  3F6D A;  3LXZ A;  2VUP A;  2GQK A;  1JZD A;  2DMM A;  2V1M A;  2O7K A;  1OC9 A;  2C0F A;  4WET A;  5CP1 A;  2H6Z A;  5CRG A;  1QXH A;  1X0R A;  3C1R A;  3N5O A;  1X9W B;  2N5B A;  3UIW A;  3GSS A;  3IPZ A;  1PMT A;  1M7T A;  1PSQ A;  3Q6O A;  5H5S A;  2LRT A;  4X1U A;  4IVF A;  1ST9 A;  1V40 A;  2HXK A;  3J7Y b;  1A8Y A;  5CNW A;  4MCU A;  3U5R E;  2RLI A;  4HZ4 A;  1PD2 1;  2OAC A;  5DAK B;  13GS A;  3LXT A;  4TR4 A;  1EOH A;  4Z7X A;  5LNK e;  2YWN A;  2R37 A;  4POM A;  3IC4 A;  3MAK A;  5CRW A;  1JZR A;  3D6I A;  3IRA A;  5J9C A;  3ERG A;  1GLP A;  2GST A;  4J2F A;  4MPG A;  5F06 A;  3APO A;  2F8A A;  3GKK A;  2MMZ A;  5AIV A;  3HJM A;  2H30 A;  1OKD A;  3H4K A;  5KN1 A;  1WE0 A;  1SEN A;  4KAE A;  3IK9 A;  2GZY A;  3HVV A;  3KP8 A;  4DSS A;  10GS A;  5GST A;  3Q18 A;  1J9B A;  4RUV A;  1M2A A;  4PUA A;  4FO5 A;  1XOA A;  2HQT A;  1TRW A;  4MK3 A; 
#chains in the Genus database with same CATH topology
 3ERW A;  4HZ2 A;  2WJU A;  1BAY A;  1GH2 A;  2QA1 A;  3GL3 A;  3L9S A;  5B8A A;  1O8W A;  3R2Q A;  5KOX A;  3CTG A;  3ERF A;  1YVL A;  2VO4 A;  2I9H A;  2WZ9 A;  3QPM A;  1HNC A;  2CQ9 A;  5IMA A;  3UOM A;  3HD5 A;  2WGR A;  3DD3 A;  1GRX A;  1BYE A;  3IDV A;  1A8L A;  5DAK A;  2QSI A;  2MMA A;  2H1A A;  1EP7 A;  3RHB A;  2XBI A;  3JCM L;  1BED A;  4PNG A;  5KEJ A;  1GUL A;  2FY6 A;  1Y1U A;  3E9J B;  3GNJ A;  1M0U A;  4Q5N A;  3UVT A;  3LEF A;  3MWH A;  4I8B A;  1AAZ A;  3TJB A;  3WT2 A;  2GZZ A;  1S4B P;  1X5D A;  4NHW A;  4ZB8 A;  2GT5 A;  3CQF A;  2ALB A;  3R3E A;  4PGT A;  5F0G A;  4MF6 A;  3U6V A;  1M9B A;  4ID0 A;  3ISO A;  2JU5 A;  5HFG A;  3GUR A;  3HVX A;  1SD9 A;  1Y6E A;  3UVH A;  3LWA A;  2CX3 A;  3ED3 A;  5F05 A;  2CV4 A;  5HQP A;  3FEU A;  2HRK B;  5IPG A;  22GS A;  1A2J A;  5KOW A;  2FGX A;  4WR5 A;  1G7E A;  1ZYQ B;  5IMF A;  1G7O A;  2TRX A;  4K6X A;  4OCF A;  2B1L A;  3P90 A;  3LJR A;  4JR6 A;  2YPM A;  1XCC A;  4OD7 A;  1A2M A;  5G31 A;  2FWH A;  1JLW A;  4CHS A;  1YDK A;  3F4T A;  1TDI A;  4ML1 A;  5H5Q A;  5FWG A;  1F9M A;  2LRC A;  1KEB A;  4KCA A;  2YP6 A;  6GSV A;  3QAW A;  2H19 A;  5KN0 A;  1XW6 A;  5AIX A;  1LJR A;  4DSQ A;  5EL8 A;  2YWM A;  1K0A A;  1XFL A;  4F82 A;  3KTB A;  4IQA A;  2AJQ B;  3A3T A;  1A0R P;  2OJL A;  1SL1 B;  3P2A A;  1C72 A;  2H0G A;  1TXX A;  4K1F A;  2KUC A;  3H79 A;  1O85 A;  4ZXG A;  2C0E A;  1XXU A;  1K0O A;  4NAX A;  1ZZY A;  4BWS A;  3FW2 A;  2LNS A;  4Z2U A;  1TI3 A;  5IMC A;  4AKX B;  3A5W A;  2FA8 A;  4O7H A;  1Z6M A;  3IAM 2;  1TOF A;  5IOW A;  1VRS D;  3ZYW A;  2FWE A;  4FYU A;  5JWR B;  2PN8 A;  4ECJ A;  1NM3 A;  4L5O A;  1UA5 A;  4V2L A;  3WYW A;  3QAG A;  4X43 A;  3TKQ A;  3LOR A;  1E2Y A;  1S3R A;  3PH9 A;  1M2D A;  4KX4 A;  3GX0 A;  3KM6 A;  2E2M A;  4KCE A;  4IKH A;  5ECI B;  2PBJ A;  5IQY A;  2LV3 A;  1ERU A;  2MBT A;  2C3Q A;  1EGR A;  4YQU A;  4OWY A;  4HU7 A;  4WBR D;  4TXO B;  1B4Q A;  5IO2 A;  5BRT A;  2HNL A;  5DQY A;  1BG1 A;  2YCD A;  1YF1 A;  4NV2 A;  1GP1 A;  4AF2 A;  3CSJ A;  2H01 A;  1WOU A;  3DXB A;  2L5L A;  5H5R A;  1X9M B;  12GS A;  4OFT A;  2WS2 A;  3GKM A;  3EYT A;  2HZF A;  1DSB A;  2MMO A;  4P3Y B;  4CW9 A;  4PUR A;  3GST A;  5D9T A;  2O3E A;  4BVX B;  3H8Q A;  4OFM A;  4GQF A;  3GMF A;  2HSM A;  1A0F A;  3G9B A;  1SVM A;  5JWO B;  3L9V A;  4HDE A;  2REM A;  1RK4 A;  2GGT A;  5G1K A;  2FA4 A;  4EDY A;  5AN1 A;  1AQW A;  4AKG A;  3GKN A;  3FK8 A;  3TJG A;  5DQS A;  2LJA A;  5JWQ B;  1Z5Y E;  4YKG A;  2H6X A;  1ABA A;  1ZMA A;  3M1G A;  2HSN B;  3PPU A;  4TXO A;  2WW3 A;  3LSZ A;  2DKI A;  4MLY A;  4L8E A;  3CSH A;  1R5P A;  1EOG A;  1K0C A;  1OAZ A;  4MJB A;  4W66 A;  3MNG A;  2WW1 A;  4IP6 A;  4GTU A;  2VL2 C;  1XW5 A;  5D8I A;  2H1G A;  1WRY A;  5GSS A;  3BOA A;  4V2N A;  1GUH A;  1AC1 A;  5ELA A;  18GS A;  1KTE A;  5J4Y A;  5DJM A;  1N8J A;  2XPE A;  2KLX A;  3D5J A;  3EU4 A;  3ZVJ D;  1V9W A;  2XC2 A;  1K3O A;  1OVN A;  3QR6 A;  3EIN A;  2F9S A;  2HRN A;  3TKR A;  1H4O A;  4USS A;  4BL7 B;  4ML6 A;  1AQX A;  4LMW A;  5KN2 A;  1GSS A;  1V98 A;  2CZ2 A;  1K3Y A;  4ZL9 A;  2LJK A;  2DJJ A;  3EU3 A;  1QFN A;  4OFN A;  1ZYN A;  1SJZ A;  2LJR A;  2VCW A;  3UMA A;  4Q5R A;  3CRU A;  1USB A;  2HRF A;  3E0U A;  4MZB A;  3ZIV A;  3NIV A;  3KIJ A;  3HKR A;  1GL8 A;  1FG4 A;  4X4J A;  1X5E A;  4MP4 A;  2R6K A;  5JCW A;  3LQ7 A;  4QL9 A;  4L5L A;  3IC8 A;  1U87 A;  4ZB9 A;  4MAB A;  1PX7 A;  1TRU A;  3QFA C;  1QMV A;  3RDW A;  2GQL A;  1PA3 A;  3KZQ A;  4FIW A;  1TRS A;  4AGS A;  1S3A A;  3VFI A;  1GSU A;  2R0C A;  2H0H A;  2C0D A;  5J4V A;  4BL7 A;  5A5H B;  2KP1 A;  1S3D A;  2EC4 A;  2VD0 A;  4MPF A;  5GZZ B;  3FR6 A;  1F6M C;  4BVY A;  4LL1 B;  3GH6 A;  4GXZ A;  4L0U A;  3KTL A;  4HUA A;  3M3M A;  4XIH A;  4DVC A;  3DVX A;  3UBK A;  1GNE A;  5D96 A;  2YN1 A;  4TW5 A;  17GS A;  2GQM A;  2K18 A;  1HD2 A;  2WFC A;  3HDC A;  2G2Q A;  1JLV A;  3WGD A;  3ZIJ A;  1T7P B;  4K5R A;  5B6M A;  2H72 A;  4ICY A;  3CMI A;  4TVE A;  5DCH A;  1MD4 A;  1TJD A;  3GTU A;  4TKY A;  3VWU A;  1JFU A;  3UAP A;  4PUF C;  2H71 A;  3A2X A;  5IMD A;  1CQG A;  4GSS A;  4IJI A;  8GSS A;  3I43 A;  2L57 A;  1TW9 A;  3MIX A;  6GSW A;  5D93 A;  1XWA A;  2R4V A;  2B6M A;  4DSS B;  2MYG A;  2DIY A;  2JL4 A;  3ME7 A;  2TRC P;  2N5F A;  4LMV A;  3TKS C;  2GVP A;  3M9K A;  2HSY A;  1XVW A;  3FYG A;  2VL9 A;  5CAX A;  2OE1 A;  3TB2 A;  4I6X A;  1SVO A;  1QQ2 A;  4G01 A;  2RM5 A;  3D4M A;  4YQV A;  5ID2 B;  2H66 A;  2AHE A;  5IMZ A;  3F3Q A;  5ABR A;  1V2A A;  1ZL9 A;  2VOC A;  4BIK A;  4MF7 A;  4TRX A;  1KNG A;  1RW1 A;  2V41 A;  3EPT A;  2QC7 A;  1O81 A;  2AAW A;  1JZW A;  2LUS A;  4XHM A;  1SKS B;  1U3I A;  3F3R A;  1VGL A;  2K9F A;  2GSQ A;  2HRA A;  2FD3 A;  1PX6 A;  3EMP A;  2CVD A;  3TCO A;  2YOI A;  4MH3 A;  2OBK A;  3TUE A;  2IN3 A;  3NZN A;  1JHB A;  3CYN A;  4J57 E;  4HJ2 A;  2H70 A;  2GDR A;  4EVM A;  3TU3 B;  3GFK A;  1XG8 A;  4OMV A;  1NHO A;  5IMV A;  2ZUP A;  3TKS E;  1YEX A;  2FLS A;  3KJY A;  4TN8 A;  2R3X A;  4WBJ A;  2F51 A;  3BCK A;  2WVX A;  4O5R A;  4RI6 A;  4IN0 A;  2CVB A;  4V1A p;  5KN3 A;  4KGI A;  1HYU A;  4NWY A;  3FMW A;  2PUK C;  3RBT A;  5DVB A;  4KUN A;  5ID2 A;  1BQ7 A;  3TJJ A;  4PTS A;  3TRP A;  6GSU A;  3A2W A;  5B6N A;  2K8V A;  2YAN A;  3HCZ A;  2BMX A;  2LNT A;  3LG6 A;  3VI5 A;  1XW9 A;  1ML6 A;  2R0P A;  2L4Q A;  3WD6 A;  4ISD A;  4CDO A;  3KCM A;  2O85 A;  2PMT A;  2NDO A;  9GSS A;  3DWV A;  3UEM A;  3C7M A;  4F0B A;  3SWL A;  4OO5 A;  4KDY A;  2EFD A;  3A2V A;  1X9S B;  4EIQ A;  3TJK A;  5EVO A;  1NSW A;  2RUE A;  19GS A;  3IHQ A;  1XIY A;  4POL A;  2JSZ A;  1VF1 A;  3DGQ A;  3C8E A;  1XVQ A;  3VPQ A;  2EIQ A;  2C3N A;  2HLS A;  2XPD A;  2IL3 A;  1SKR B;  1NW2 A;  4GLT A;  20GS A;  5ECM B;  3FKF A;  1HNB A;  3HVS A;  4I5Q A;  1F3A A;  3IXR A;  1F3B A;  4D73 B;  2NVL A;  2BTO T;  1PL1 A;  1SYX A;  5DAL B;  3OR5 A;  2H6Y A;  3ZRE A;  2C8U A;  4IJ3 A;  2GLR A;  1DE1 A;  3GN3 A;  3ZML A;  3HHV A;  4OO4 A;  4HJM A;  2IMD A;  4K7O A;  2IPA A;  2YV7 A;  3BBY A;  4PX1 A;  4GSN A;  5ECR B;  4XCS A;  2NTO A;  2HFD A;  2L6C A;  4O5U A;  2BJX A;  4BA7 A;  4MH2 A;  5GAP D;  4GCI A;  1PRX A;  2YJH A;  1GSY A;  4XRD A;  2E7P A;  5J3R A;  5A4U A;  4WF4 A;  3KXO A;  1RQM A;  1SKW B;  4AKH A;  4J56 E;  1HQO A;  2KOK A;  1DUG A;  3F6F A;  2C4J A;  2H1L A;  1OYJ A;  1M3I A;  1EP8 A;  3V1W A;  5JCG A;  4E68 A;  2R5G A;  2PVO C;  1SK0 A;  3GIX A;  2V2G A;  2TIR A;  1R26 A;  4WEY A;  3KMN A;  1XBS A;  1VF2 A;  4TOP A;  2B5Y A;  3EWL A;  5HR1 A;  3US3 A;  2HSM B;  3DIE A;  2LEG A;  1BG5 A;  4K7N A;  5A34 A;  2IME A;  4RQR A;  4D73 A;  3FRC A;  3BD2 A;  3IR4 A;  3CSI A;  4IGJ A;  5DAL A;  2H76 A;  5IPH A;  5G5F A;  1MDK A;  3PR8 A;  4KSM A;  1HNA A;  1FAA A;  5J40 A;  14GS A;  2DML A;  4HEA 2;  2H1D A;  4N0Z A;  3EE2 A;  2LRN A;  5BMU B;  2VAF A;  2VLT A;  1ERT A;  2HE3 A;  2ZNM A;  1PL2 A;  2LKU A;  2AB6 A;  3F8U A;  4K5S A;  1TKD B;  2QKE A;  2C0G A;  2X4A A;  3FZ4 A;  3FY7 A;  2R2J A;  3UBL A;  3P7X A;  1U3A A;  4Z2R A;  4N3Z A;  1G6Y A;  2WW0 A;  3A5I A;  4YQM A;  1BF5 A;  2VCV A;  5CYY A;  3ZVJ A;  3ZIT A;  1SYR A;  3Q74 A;  1URM A;  2FHE A;  5CRH A;  1ZGN A;  1B48 A;  4E8H A;  1SU9 A;  5B8B A;  1SD8 A;  1YY7 A;  2P5R A;  4G0L A;  2HSH A;  3ZZX A;  5ECP B;  3C1S A;  1K3L A;  3CBU A;  5JCU A;  2AV4 A;  3H1N A;  4LA1 A;  2VCX A;  1F37 A;  3FZ9 A;  3TGZ A;  2DBC A;  5J4U A;  3EVI A;  2B1K A;  1U88 A;  1YEW C;  2CAI A;  4TXV A;  3SBC A;  4ZBB A;  2J9H A;  3S9F A;  2DJ0 A;  2OAD A;  1OE8 A;  5BMU A;  4ECC A;  3TOU A;  1S3C A;  3HZ8 A;  3D21 A;  5EPF A;  3LGC A;  5CRE A;  2WUL A;  3FR9 A;  1GUK A;  2HT9 A;  1XWC A;  4MZW A;  3K8N A;  2GTU A;  2YJ7 A;  3VK9 A;  3ME8 A;  3GHA A;  6GSX A;  1FB6 A;  1A2L A;  3QCP A;  1T1V A;  1CQH A;  2GS3 A;  4AJ8 A;  4NV5 A;  4GWR A;  3HZ4 A;  5IM9 A;  2WW2 A;  2FWG A;  3F63 A;  3WGX A;  2VKZ G;  4K8M A;  1EEM A;  5HFK A;  2YZH A;  1TK0 B;  5HR3 A;  3F0I A;  4XS4 A;  2DLX A;  3KD0 A;  1JZO A;  3ZFB A;  3HA9 A;  1A23 A;  4MDC A;  3GKX A;  2JSY A;  1QUW A;  2PER A;  2DIZ A;  4JZQ A;  1M99 A;  1EWX A;  3WT1 A;  2X8H A;  4TR1 B;  1AQV A;  4FQU A;  3LYP A;  4BVY B;  4IS0 A;  1O6J A;  2DJ2 A;  4PNF A;  3RGB C;  2B7J A;  5D9W A;  5G30 A;  1PQN A;  4GRF A;  5ECQ B;  3O6T A;  5FHI A;  2I81 A;  3CRT A;  3ZRD A;  2WVY A;  1FOH A;  4ZBD A;  2VL2 A;  1WIK A;  3VUR A;  1PFO A;  7GSS A;  3G7J A;  3RFR C;  4NMU A;  4FXY P;  4EC0 A;  3GTU B;  4GF0 A;  3GYK A;  3IHG A;  1FHE A;  3D4T A;  2ON5 A;  5G5E A;  3LFL A;  4JBB A;  2V6O A;  2OE0 A;  2RII A;  2RM6 A;  2V32 A;  1GSF A;  5B7C A;  1TXU A;  2X49 A;  4JE1 A;  3M8N A;  3BJ5 A;  1Z9H A;  2YWI A;  4EKZ A;  2L59 A;  16GS A;  5ECL B;  1YKA A;  4EUY A;  5A5K A;  2L5O A;  2WDU A;  1M3J A;  2GT6 A;  5L71 A;  2F3M A;  1ERV A;  1G6W A;  4TR1 A;  3L9U A;  2IMF A;  2O8V B;  6GSS A;  2EIO A;  1ZYE A;  3I9V 2;  1OKT A;  1EEJ A;  3RPN A;  4AJ6 A;  1AIU A;  1N25 A;  5D73 A;  4NPB A;  2OKA A;  2IFQ A;  4Z2T A;  5AIS A;  2E2G A;  2H75 A;  1GSQ A;  2CT6 A;  4PXO A;  5ECK B;  1ZOF A;  2DJ1 A;  1EGO A;  1TTZ A;  3ZTL A;  4IHU A;  4PQI A;  1YZX A;  4QL7 A;  5IO0 A;  2LST A;  4I2T A;  3Q19 A;  3D0Z A;  4EE0 A;  4JRR A;  3O76 A;  1GSD A;  1J0F A;  1THO A;  2VCQ A;  4JR4 A;  3HJP A;  2O87 A;  4KA0 A;  4BPY A;  4KE3 A;  1GLQ A;  2C1Y A;  4L0W A;  1PGT A;  2WVX B;  4FYC A;  4EF0 A;  5ECO B;  2AUV A;  2FCH A;  2N5A A;  4MJE A;  1MTC A;  2IMI A;  2FUG 2;  4FH8 A;  2PVQ A;  1X5C A;  3QFB C;  4JED A;  2K6V A;  4YAV A;  3CXG A;  2M80 A;  4RI7 A;  2LTK A;  1THX A;  1TU8 A;  2MZC A;  3ZLP A;  3F4S A;  4PI2 C;  2IIY A;  3LW9 A;  2MMN A;  4F9Z A;  2D2Z A;  4N11 A;  4ECI A;  1GTA A;  2B7K A;  2WB9 A;  3TJF A;  4ZL8 A;  2I3Y A;  1PKW A;  1MEK A;  4V2M A;  4POB A;  4RQX A;  1A24 A;  5J5N A;  3KH7 A;  3RPP A;  4EDZ A;  1W89 A;  3I6A A;  4QMK A;  4O32 A;  2X8C A;  5ENU A;  1TU7 A;  2UZ8 A;  4K0G A;  1EZK A;  1TK8 B;  3MDK A;  4YH2 A;  4KSO A;  4Q5Q A;  1MDJ A;  3AY8 A;  4F0C A;  3EC3 A;  3TKS A;  3HXS A;  2NBS A;  4X0X A;  4PHZ C;  3CWG A;  1Q4J A;  2DKH A;  1KBN A;  4HSC X;  3W8S A;  1O73 A;  4WR4 A;  3GX8 A;  1WWJ A;  4G2E A;  5CRD A;  1IYH A;  2A2S A;  2IMK A;  1WJK A;  1DE2 A;  1IYI A;  2XHF A;  3QAV A;  4ZIJ A;  4ILF A;  4NHZ A;  2I1U A;  2JAD A;  4G0I A;  4MZC A;  4MNN A;  1DBY A;  2LS5 A;  4K2D A;  3QMX A;  2GZP A;  3J7Y k;  2IJY A;  4IBP A;  5LD0 A;  3VLN A;  2WRT A;  1SJI A;  4MMM A;  1FW1 A;  4HI7 A;  5D9V A;  3QDN A;  3FZA A;  4KB3 A;  4IQ1 A;  4PQH A;  2XBQ A;  1M2B A;  1O8X A;  4ULX A;  4E8E A;  4MF5 A;  2VLV A;  5IOX A;  2A4H A;  2H1B A;  4IEL A;  1SK2 A;  1Q98 A;  1Z7P A;  4XS1 A;  1ILO A;  1T4Y A;  5LCZ A;  4MA9 A;  5HFI A;  3C71 A;  4I97 A;  1XWK A;  5AGY A;  2DJ3 A;  1TRV A;  1VF4 A;  2YWO A;  4A5P A;  11GS A;  2EIR A;  1K0B A;  1YKC A;  5A34 B;  4K9Z A;  5IIZ A;  2JZS A;  5C04 A;  4BWQ A;  5DDL A;  2CX4 A;  4KND A;  3UAR A;  3KH9 A;  2CVK A;  2A2R A;  2EFC A;  4HOJ A;  4HQZ A;  5F8B A;  2NPB A;  5FT3 A;  2PWJ A;  4H86 A;  1YQ1 A;  5A1N B;  5J41 A;  3N9J A;  3APS A;  3VI7 A;  3QOU A;  4O5Q A;  2F8F A;  3G7Y A;  4G9H A;  2M72 A;  2CZ3 A;  3M9J A;  2L4C A;  3ZFL A;  5GAN D;  3DYR A;  3FZ5 A;  6GST A;  3E3E A;  3KMO A;  3GA4 A;  2WZS A;  4OCE A;  2CAQ A;  4FYB A;  1I5G A;  3GV1 A;  3FHK A;  3QD9 A;  4KF9 A;  1SL2 B;  2O89 A;  3IA1 A;  3W6G A;  1GTU A;  1TK5 B;  3RHC A;  1K0N A;  4MJC A;  1AW9 A;  3ZL5 A;  1MD3 A;  1PKZ A;  2YV9 A;  4QQ7 A;  2M46 A;  2X8G A;  4KW6 A;  2X99 A;  1M9A A;  3EMX A;  1B9Y C;  5E4W A;  3DVW A;  3DML A;  1ACV A;  3W8J A;  3GL5 A;  1UN2 A;  1ZCP A;  2HRK A;  1XWB A;  3EUR A;  4XS6 A;  3DEX A;  1FVK A;  5A1N A;  1T3B A;  3GH9 A;  1TP9 A;  5HR2 A;  1SL0 B;  3IE3 A;  4WF5 A;  3C73 A;  1OC8 A;  1FB0 A;  3UJ1 A;  4G10 A;  1R7H A;  4CY8 A;  5C00 A;  3VWX A;  2CA8 A;  2GSS A;  4JU5 A;  1Y25 A;  2K8S A;  2A2P A;  2KP2 A;  3L0H A;  4ZBA A;  2I4A A;  2JAC A;  2C3T A;  4EIP A;  1MDI A;  2OBI A;  2KHP A;  4DSR A;  4F2I A;  3CHX C;  3P8W A;  2VCZ A;  5ECS A;  4ZIL A;  4MJA A;  2ES7 A;  2E0Q A;  4NXI A;  5F07 A;  2B5X A;  1BX9 A;  2H0I A;  3DRN A;  2H74 A;  4F03 A;  3NOF A;  1VF3 A;  5ELG A;  3IBH A;  4G19 A;  3ZMK A;  1Z6N A;  1GSE A;  1ON4 A;  2HYX A;  3IV4 A;  4XTS A;  1B4P A;  1OC3 A;  2PGT A;  3MSZ A;  2C80 A;  4DEJ A;  2OA7 A;  4XS4 B;  1WMJ A;  1PN9 A;  1R5A A;  1QGV A;  1SJ6 A;  4ACS A;  4PI0 C;  2EFE A;  2R0G A;  1T00 A;  3HJO A;  1UC7 A;  3VWV A;  5EY6 A;  4LL4 B;  3WGE A;  4I2U A;  1GUM A;  5ECH B;  2HZE B;  1UVZ A;  4K0N A;  2ON7 A;  1XWG A;  3F9U A;  2VIM A;  2QA2 A;  3RAZ A;  5COH A;  3FR3 A;  4TR3 A;  1YJ6 A;  2OT3 A;  4XRA A;  1J08 A;  3KP9 A;  6GSY A;  1WPI A;  5A4W A;  1LU4 A;  2B5E A;  1G0T A;  4K7I A;  3VWW A;  1PN0 A;  4KDU A;  4PQ1 A;  3IOS A;  3APQ A;  3G7I A;  1FO5 A;  3DKS A;  3KEB A;  3UL3 A;  1O7U A;  2FWF A;  2P31 A;  4GST A;  2DC5 A;  1FVJ A;  1WP0 A;  1V58 A;  4ZB6 A;  1N2A A;  1XZO A;  2J23 A;  2ZCT A;  4IW9 A;  1LBK A;  3L78 A;  3TKP A;  2EFH A;  2MBS A;  1EV4 A;  1BJX A;  1U6T A;  2JZT A;  2GSR A;  4BVX A;  2V6K A;  2DSA A;  1OE7 A;  1XOB A;  2HZE A;  4Q5F A;  2LQQ A;  1YEP A;  4IP1 A;  3L4N A;  5DJL A;  2QGV A;  1SVL A;  3PIN A;  4LLR A;  2IFQ B;  1F2E A;  2P5Q A;  4K2X A;  3I69 A;  1E6B A;  1R4W A;  2A4V A;  4N30 A;  2VD1 A;  2IWT A;  3TRQ A;  2HSN A;  4O92 A;  1QK8 A;  4EO3 A;  1Z3E A;  5J9B A;  2VCT A;  5HR0 A;  1GNW A;  1K0M A;  5J47 A;  5DBQ A;  2DJK A;  1AUC A;  1EV9 A;  2VM1 A;  2PPT A;  1GTB A;  2AYT A;  3HY2 A;  3TOT A;  2P0G A;  3GRX A;  1K0D A;  5D9X A;  4GQC A;  3D22 A;  3KGK A;  3H93 A;  5CO3 A;  4HQS A;  2H8L A;  2VM2 A;  4AKI A;  1W4V A;  2WVZ A;  2VL3 A;  1ERW A;  4KH7 A;  3M0F A;  5INY A;  4N10 A;  1NHY A;  4TR0 A;  1OC9 B;  3LYK A;  1GTI A;  1FOV A;  2FNO A;  4WKW A;  5G2Z A;  2YNX A;  2PU9 C;  1SK1 A;  2B3S A;  3F4R A;  1B9X C;  2Z9S A;  4N0V A;  4CY6 A;  4YAP A;  1T8E B;  3VPT A;  4G0K A;  1Z7R A;  4EL1 A;  5G1L A;  1ZYP A;  1I1I P;  1AXD A;  1TI1 A;  4ZB7 A;  4POK A;  2G0F A;  4WXT A;  3O3T A;  3PGT A;  4HU9 A;  3IAS 2;  2LQO A;  2WCI A;  3CTF A;  4EXJ A;  3HYP A;  3IK7 A;  1XPV A;  3BCI A;  5A4V A;  2X64 A;  2O36 A;  1V57 A;  5ECN B;  2YZU A;  2RUF A;  2L6D A;  3GUS A;  2OE3 A;  3TRX A;  2VLU A;  1YF0 A;  4AJ7 A;  3TDG A;  4ZL7 A;  5DCG A;  1H75 A;  4ECB A;  2HI7 A;  1GWC A;  1I9D A;  4V1A g;  4HS1 A;  1B8X A;  4KDX A;  2JZR A;  1T4Z A;  2H73 A;  5E59 A;  3F6D A;  3LXZ A;  2VUP A;  2GQK A;  1JZD A;  2O5V A;  3HVN A;  2DMM A;  2V1M A;  2O7K A;  1OC9 A;  2C0F A;  4WET A;  5CP1 A;  2H6Z A;  5CRG A;  1QXH A;  1X0R A;  3C1R A;  3N5O A;  1X9W B;  2N5B A;  3UIW A;  3GSS A;  3IPZ A;  1PMT A;  1M7T A;  5A5H A;  1PSQ A;  3Q6O A;  5H5S A;  2LRT A;  4X1U A;  4IVF A;  1ST9 A;  1V40 A;  2HXK A;  3J7Y b;  3HMJ G;  1A8Y A;  5CNW A;  4MCU A;  3U5R E;  2RLI A;  4HZ4 A;  1PD2 1;  3MYD A;  2OAC A;  5DAK B;  13GS A;  3LXT A;  4TR4 A;  1EOH A;  4Z7X A;  5LNK e;  2YWN A;  2R37 A;  4POM A;  3IC4 A;  3MAK A;  5CRW A;  1JZR A;  3D6I A;  3IRA A;  5J9C A;  2UV8 G;  3ERG A;  1GLP A;  2GST A;  4J2F A;  4MPG A;  5F06 A;  3APO A;  2F8A A;  3GKK A;  2MMZ A;  5AIV A;  4YKF A;  3HJM A;  2H30 A;  1OKD A;  3H4K A;  5KN1 A;  4GDF A;  1WE0 A;  1SEN A;  4KAE A;  3IK9 A;  2GZY A;  3HVV A;  3KP8 A;  4DSS A;  10GS A;  5GST A;  3Q18 A;  1J9B A;  4RUV A;  1M2A A;  4PUA A;  4FO5 A;  1XOA A;  4AI6 A;  2HQT A;  1TRW A;  4MK3 A; 
#chains in the Genus database with same CATH homology
 3ERW A;  4HZ2 A;  2WJU A;  1BAY A;  1GH2 A;  2QA1 A;  3GL3 A;  3L9S A;  5B8A A;  1O8W A;  3R2Q A;  5KOX A;  3CTG A;  3ERF A;  1YVL A;  2VO4 A;  2I9H A;  2WZ9 A;  3QPM A;  1HNC A;  2CQ9 A;  5IMA A;  3UOM A;  3HD5 A;  2WGR A;  3DD3 A;  1GRX A;  1BYE A;  3IDV A;  1A8L A;  5DAK A;  2QSI A;  2MMA A;  2H1A A;  1EP7 A;  3RHB A;  2XBI A;  3JCM L;  1BED A;  4PNG A;  5KEJ A;  1GUL A;  2FY6 A;  1Y1U A;  3E9J B;  3GNJ A;  1M0U A;  4Q5N A;  3UVT A;  3LEF A;  3MWH A;  4I8B A;  1AAZ A;  3TJB A;  3WT2 A;  2GZZ A;  1X5D A;  4NHW A;  4ZB8 A;  2GT5 A;  2ALB A;  3R3E A;  4PGT A;  5F0G A;  4MF6 A;  3U6V A;  1M9B A;  4ID0 A;  3ISO A;  2JU5 A;  5HFG A;  3GUR A;  3HVX A;  1SD9 A;  1Y6E A;  3UVH A;  3LWA A;  2CX3 A;  3ED3 A;  5F05 A;  2CV4 A;  5HQP A;  3FEU A;  2HRK B;  5IPG A;  22GS A;  1A2J A;  5KOW A;  2FGX A;  4WR5 A;  1G7E A;  1ZYQ B;  5IMF A;  1G7O A;  2TRX A;  4K6X A;  4OCF A;  2B1L A;  3P90 A;  3LJR A;  4JR6 A;  2YPM A;  1XCC A;  4OD7 A;  1A2M A;  5G31 A;  2FWH A;  1JLW A;  4CHS A;  1YDK A;  3F4T A;  1TDI A;  4ML1 A;  5H5Q A;  5FWG A;  1F9M A;  2LRC A;  1KEB A;  4KCA A;  2YP6 A;  6GSV A;  3QAW A;  2H19 A;  5KN0 A;  1XW6 A;  5AIX A;  1LJR A;  4DSQ A;  5EL8 A;  2YWM A;  1K0A A;  1XFL A;  4F82 A;  3KTB A;  4IQA A;  2AJQ B;  3A3T A;  1A0R P;  2OJL A;  1SL1 B;  3P2A A;  1C72 A;  2H0G A;  1TXX A;  4K1F A;  2KUC A;  3H79 A;  1O85 A;  4ZXG A;  2C0E A;  1XXU A;  1K0O A;  4NAX A;  1ZZY A;  4BWS A;  3FW2 A;  2LNS A;  4Z2U A;  1TI3 A;  5IMC A;  4AKX B;  3A5W A;  2FA8 A;  4O7H A;  1Z6M A;  3IAM 2;  1TOF A;  5IOW A;  1VRS D;  3ZYW A;  2FWE A;  4FYU A;  5JWR B;  2PN8 A;  4ECJ A;  1NM3 A;  4L5O A;  1UA5 A;  4V2L A;  3WYW A;  3QAG A;  4X43 A;  3TKQ A;  3LOR A;  1E2Y A;  3PH9 A;  1M2D A;  4KX4 A;  3GX0 A;  3KM6 A;  2E2M A;  4KCE A;  4IKH A;  5ECI B;  2PBJ A;  5IQY A;  2LV3 A;  1ERU A;  2MBT A;  2C3Q A;  1EGR A;  4YQU A;  4OWY A;  4HU7 A;  4WBR D;  4TXO B;  1B4Q A;  5IO2 A;  5BRT A;  2HNL A;  5DQY A;  1BG1 A;  2YCD A;  1YF1 A;  4NV2 A;  1GP1 A;  4AF2 A;  3CSJ A;  2H01 A;  1WOU A;  3DXB A;  2L5L A;  5H5R A;  1X9M B;  12GS A;  4OFT A;  2WS2 A;  3GKM A;  3EYT A;  2HZF A;  1DSB A;  2MMO A;  4P3Y B;  4CW9 A;  4PUR A;  3GST A;  5D9T A;  4BVX B;  3H8Q A;  4OFM A;  4GQF A;  3GMF A;  2HSM A;  1A0F A;  3G9B A;  1SVM A;  5JWO B;  3L9V A;  4HDE A;  2REM A;  1RK4 A;  2GGT A;  5G1K A;  2FA4 A;  4EDY A;  5AN1 A;  1AQW A;  4AKG A;  3GKN A;  3FK8 A;  3TJG A;  5DQS A;  2LJA A;  5JWQ B;  1Z5Y E;  4YKG A;  2H6X A;  1ABA A;  1ZMA A;  3M1G A;  2HSN B;  3PPU A;  4TXO A;  3LSZ A;  2DKI A;  4MLY A;  4L8E A;  3CSH A;  1R5P A;  1EOG A;  1K0C A;  1OAZ A;  4MJB A;  4W66 A;  3MNG A;  4IP6 A;  4GTU A;  2VL2 C;  1XW5 A;  5D8I A;  2H1G A;  1WRY A;  5GSS A;  3BOA A;  4V2N A;  1GUH A;  1AC1 A;  5ELA A;  18GS A;  1KTE A;  5J4Y A;  5DJM A;  1N8J A;  2XPE A;  2KLX A;  3D5J A;  3EU4 A;  3ZVJ D;  1V9W A;  2XC2 A;  1K3O A;  1OVN A;  3QR6 A;  3EIN A;  2F9S A;  2HRN A;  3TKR A;  1H4O A;  4USS A;  4BL7 B;  4ML6 A;  1AQX A;  4LMW A;  5KN2 A;  1GSS A;  1V98 A;  2CZ2 A;  1K3Y A;  4ZL9 A;  2LJK A;  2DJJ A;  3EU3 A;  1QFN A;  4OFN A;  1ZYN A;  1SJZ A;  2LJR A;  2VCW A;  3UMA A;  4Q5R A;  3CRU A;  1USB A;  2HRF A;  3E0U A;  4MZB A;  3ZIV A;  3NIV A;  3KIJ A;  3HKR A;  1GL8 A;  1FG4 A;  4X4J A;  1X5E A;  4MP4 A;  2R6K A;  5JCW A;  3LQ7 A;  4QL9 A;  4L5L A;  3IC8 A;  1U87 A;  4ZB9 A;  4MAB A;  1PX7 A;  1TRU A;  3QFA C;  1QMV A;  3RDW A;  2GQL A;  1PA3 A;  3KZQ A;  4FIW A;  1TRS A;  4AGS A;  1S3A A;  3VFI A;  1GSU A;  2R0C A;  2H0H A;  2C0D A;  5J4V A;  4BL7 A;  5A5H B;  2KP1 A;  1S3D A;  2EC4 A;  2VD0 A;  4MPF A;  5GZZ B;  3FR6 A;  1F6M C;  4BVY A;  4LL1 B;  3GH6 A;  4GXZ A;  4L0U A;  3KTL A;  4HUA A;  3M3M A;  4XIH A;  4DVC A;  3DVX A;  3UBK A;  1GNE A;  5D96 A;  2YN1 A;  4TW5 A;  17GS A;  2GQM A;  2K18 A;  1HD2 A;  2WFC A;  3HDC A;  2G2Q A;  1JLV A;  3WGD A;  3ZIJ A;  1T7P B;  4K5R A;  5B6M A;  2H72 A;  4ICY A;  3CMI A;  4TVE A;  5DCH A;  1MD4 A;  1TJD A;  3GTU A;  4TKY A;  3VWU A;  1JFU A;  3UAP A;  4PUF C;  2H71 A;  3A2X A;  5IMD A;  1CQG A;  4GSS A;  4IJI A;  8GSS A;  3I43 A;  2L57 A;  1TW9 A;  3MIX A;  6GSW A;  5D93 A;  1XWA A;  2R4V A;  2B6M A;  4DSS B;  2MYG A;  2DIY A;  2JL4 A;  3ME7 A;  2TRC P;  2N5F A;  4LMV A;  3TKS C;  2GVP A;  3M9K A;  2HSY A;  1XVW A;  3FYG A;  2VL9 A;  5CAX A;  2OE1 A;  3TB2 A;  4I6X A;  1SVO A;  1QQ2 A;  4G01 A;  2RM5 A;  3D4M A;  4YQV A;  5ID2 B;  2H66 A;  2AHE A;  5IMZ A;  3F3Q A;  5ABR A;  1V2A A;  1ZL9 A;  2VOC A;  4MF7 A;  4TRX A;  1KNG A;  1RW1 A;  2V41 A;  3EPT A;  2QC7 A;  1O81 A;  2AAW A;  1JZW A;  2LUS A;  4XHM A;  1SKS B;  1U3I A;  3F3R A;  1VGL A;  2K9F A;  2GSQ A;  2HRA A;  2FD3 A;  1PX6 A;  3EMP A;  2CVD A;  3TCO A;  2YOI A;  4MH3 A;  2OBK A;  3TUE A;  2IN3 A;  3NZN A;  1JHB A;  3CYN A;  4J57 E;  4HJ2 A;  2H70 A;  2GDR A;  4EVM A;  3TU3 B;  3GFK A;  4OMV A;  1NHO A;  5IMV A;  2ZUP A;  3TKS E;  1YEX A;  2FLS A;  3KJY A;  4TN8 A;  2R3X A;  4WBJ A;  2F51 A;  3BCK A;  4O5R A;  4RI6 A;  4IN0 A;  2CVB A;  4V1A p;  5KN3 A;  4KGI A;  1HYU A;  4NWY A;  3FMW A;  2PUK C;  3RBT A;  5DVB A;  4KUN A;  5ID2 A;  1BQ7 A;  3TJJ A;  4PTS A;  3TRP A;  6GSU A;  3A2W A;  5B6N A;  2K8V A;  2YAN A;  3HCZ A;  2BMX A;  2LNT A;  3LG6 A;  3VI5 A;  1XW9 A;  1ML6 A;  2R0P A;  2L4Q A;  3WD6 A;  4ISD A;  4CDO A;  3KCM A;  2O85 A;  2PMT A;  2NDO A;  9GSS A;  3DWV A;  3UEM A;  3C7M A;  4F0B A;  3SWL A;  4OO5 A;  4KDY A;  2EFD A;  3A2V A;  1X9S B;  4EIQ A;  3TJK A;  5EVO A;  1NSW A;  2RUE A;  19GS A;  3IHQ A;  1XIY A;  4POL A;  2JSZ A;  1VF1 A;  3DGQ A;  3C8E A;  1XVQ A;  3VPQ A;  2EIQ A;  2C3N A;  2HLS A;  2XPD A;  2IL3 A;  1SKR B;  1NW2 A;  4GLT A;  20GS A;  5ECM B;  3FKF A;  1HNB A;  3HVS A;  4I5Q A;  1F3A A;  3IXR A;  1F3B A;  4D73 B;  2NVL A;  2BTO T;  1PL1 A;  1SYX A;  5DAL B;  3OR5 A;  2H6Y A;  3ZRE A;  2C8U A;  4IJ3 A;  2GLR A;  1DE1 A;  3GN3 A;  3ZML A;  3HHV A;  4OO4 A;  4HJM A;  2IMD A;  4K7O A;  2IPA A;  2YV7 A;  3BBY A;  4PX1 A;  4GSN A;  5ECR B;  4XCS A;  2NTO A;  2HFD A;  2L6C A;  4O5U A;  2BJX A;  4BA7 A;  4MH2 A;  5GAP D;  4GCI A;  1PRX A;  2YJH A;  1GSY A;  4XRD A;  2E7P A;  5J3R A;  5A4U A;  4WF4 A;  3KXO A;  1RQM A;  1SKW B;  4AKH A;  4J56 E;  1HQO A;  1DUG A;  3F6F A;  2C4J A;  2H1L A;  2KOK A;  1OYJ A;  1EP8 A;  3V1W A;  5JCG A;  4E68 A;  2R5G A;  2PVO C;  1SK0 A;  3GIX A;  2V2G A;  2TIR A;  1R26 A;  4WEY A;  3KMN A;  1XBS A;  1VF2 A;  4TOP A;  2B5Y A;  3EWL A;  5HR1 A;  3US3 A;  2HSM B;  3DIE A;  2LEG A;  1BG5 A;  4K7N A;  5A34 A;  2IME A;  4RQR A;  4D73 A;  3FRC A;  3BD2 A;  3IR4 A;  3CSI A;  4IGJ A;  5DAL A;  2H76 A;  5IPH A;  5G5F A;  1MDK A;  3PR8 A;  4KSM A;  1HNA A;  1FAA A;  5J40 A;  14GS A;  2DML A;  4HEA 2;  2H1D A;  4N0Z A;  3EE2 A;  2LRN A;  5BMU B;  2VAF A;  2VLT A;  1ERT A;  2HE3 A;  2ZNM A;  1PL2 A;  2LKU A;  2AB6 A;  3F8U A;  4K5S A;  1TKD B;  2QKE A;  2C0G A;  2X4A A;  3FZ4 A;  3FY7 A;  2R2J A;  3UBL A;  3P7X A;  1U3A A;  4Z2R A;  4N3Z A;  1G6Y A;  3A5I A;  4YQM A;  1BF5 A;  2VCV A;  5CYY A;  3ZVJ A;  3ZIT A;  1SYR A;  3Q74 A;  1URM A;  2FHE A;  5CRH A;  1ZGN A;  1B48 A;  4E8H A;  1SU9 A;  5B8B A;  1SD8 A;  1YY7 A;  2P5R A;  4G0L A;  2HSH A;  3ZZX A;  5ECP B;  3C1S A;  1K3L A;  3CBU A;  5JCU A;  2AV4 A;  3H1N A;  4LA1 A;  2VCX A;  1F37 A;  3FZ9 A;  3TGZ A;  2DBC A;  5J4U A;  3EVI A;  2B1K A;  1U88 A;  2CAI A;  4TXV A;  3SBC A;  4ZBB A;  2J9H A;  3S9F A;  2DJ0 A;  2OAD A;  1OE8 A;  5BMU A;  4ECC A;  3TOU A;  1S3C A;  3HZ8 A;  3D21 A;  5EPF A;  3LGC A;  5CRE A;  2WUL A;  3FR9 A;  1GUK A;  2HT9 A;  1XWC A;  4MZW A;  3K8N A;  2GTU A;  2YJ7 A;  3VK9 A;  3ME8 A;  3GHA A;  6GSX A;  1FB6 A;  1A2L A;  3QCP A;  1T1V A;  1CQH A;  2GS3 A;  4AJ8 A;  4NV5 A;  4GWR A;  3HZ4 A;  5IM9 A;  2FWG A;  3F63 A;  3WGX A;  2VKZ G;  4K8M A;  1EEM A;  5HFK A;  2YZH A;  1TK0 B;  5HR3 A;  3F0I A;  4XS4 A;  2DLX A;  3KD0 A;  1JZO A;  3ZFB A;  3HA9 A;  1A23 A;  4MDC A;  3GKX A;  2JSY A;  1QUW A;  2PER A;  2DIZ A;  4JZQ A;  1M99 A;  1EWX A;  3WT1 A;  2X8H A;  4TR1 B;  1AQV A;  4FQU A;  3LYP A;  4BVY B;  4IS0 A;  1O6J A;  2DJ2 A;  4PNF A;  2B7J A;  5D9W A;  5G30 A;  1PQN A;  4GRF A;  5ECQ B;  3O6T A;  5FHI A;  2I81 A;  3CRT A;  3ZRD A;  1FOH A;  4ZBD A;  2VL2 A;  1WIK A;  3VUR A;  7GSS A;  3G7J A;  4NMU A;  4EC0 A;  3GTU B;  4GF0 A;  3GYK A;  3IHG A;  1FHE A;  3D4T A;  2ON5 A;  5G5E A;  3LFL A;  4JBB A;  2V6O A;  2OE0 A;  2RII A;  2RM6 A;  2V32 A;  1GSF A;  5B7C A;  1TXU A;  2X49 A;  4JE1 A;  3M8N A;  3BJ5 A;  1Z9H A;  2YWI A;  4EKZ A;  2L59 A;  16GS A;  5ECL B;  1YKA A;  4EUY A;  5A5K A;  2L5O A;  2WDU A;  2GT6 A;  5L71 A;  2F3M A;  1ERV A;  1G6W A;  4TR1 A;  3L9U A;  2IMF A;  2O8V B;  6GSS A;  2EIO A;  1ZYE A;  3I9V 2;  1OKT A;  1EEJ A;  3RPN A;  4AJ6 A;  1AIU A;  1N25 A;  5D73 A;  4NPB A;  2OKA A;  2IFQ A;  4Z2T A;  5AIS A;  2E2G A;  2H75 A;  1GSQ A;  2CT6 A;  4PXO A;  5ECK B;  1ZOF A;  2DJ1 A;  1EGO A;  1TTZ A;  3ZTL A;  4IHU A;  4PQI A;  1YZX A;  4QL7 A;  5IO0 A;  2LST A;  4I2T A;  3Q19 A;  3D0Z A;  4EE0 A;  4JRR A;  3O76 A;  1GSD A;  1J0F A;  1THO A;  2VCQ A;  4JR4 A;  3HJP A;  2O87 A;  4KA0 A;  4BPY A;  4KE3 A;  1GLQ A;  2C1Y A;  4L0W A;  1PGT A;  4FYC A;  4EF0 A;  5ECO B;  2AUV A;  2FCH A;  2N5A A;  4MJE A;  1MTC A;  2IMI A;  2FUG 2;  4FH8 A;  2PVQ A;  1X5C A;  3QFB C;  4JED A;  2K6V A;  4YAV A;  3CXG A;  2M80 A;  4RI7 A;  2LTK A;  1THX A;  1TU8 A;  2MZC A;  3ZLP A;  3F4S A;  2IIY A;  3LW9 A;  2MMN A;  4F9Z A;  2D2Z A;  4N11 A;  4ECI A;  1GTA A;  2B7K A;  2WB9 A;  3TJF A;  4ZL8 A;  2I3Y A;  1PKW A;  1MEK A;  4V2M A;  4POB A;  4RQX A;  1A24 A;  5J5N A;  3KH7 A;  3RPP A;  4EDZ A;  1W89 A;  3I6A A;  4QMK A;  4O32 A;  2X8C A;  5ENU A;  1TU7 A;  2UZ8 A;  4K0G A;  1EZK A;  1TK8 B;  3MDK A;  4YH2 A;  4KSO A;  4Q5Q A;  1MDJ A;  3AY8 A;  4F0C A;  3EC3 A;  3TKS A;  3HXS A;  2NBS A;  4X0X A;  3CWG A;  1Q4J A;  2DKH A;  1KBN A;  3W8S A;  1O73 A;  4WR4 A;  3GX8 A;  1WWJ A;  4G2E A;  5CRD A;  1IYH A;  2A2S A;  2IMK A;  1WJK A;  1DE2 A;  1IYI A;  2XHF A;  3QAV A;  4ZIJ A;  4ILF A;  4NHZ A;  2I1U A;  2JAD A;  4G0I A;  4MZC A;  4MNN A;  1DBY A;  2LS5 A;  4K2D A;  3QMX A;  2GZP A;  3J7Y k;  2IJY A;  4IBP A;  5LD0 A;  3VLN A;  2WRT A;  1SJI A;  4MMM A;  1FW1 A;  4HI7 A;  5D9V A;  3QDN A;  3FZA A;  4KB3 A;  4IQ1 A;  4PQH A;  2XBQ A;  1M2B A;  1O8X A;  4ULX A;  4E8E A;  4MF5 A;  2VLV A;  5IOX A;  2A4H A;  2H1B A;  4IEL A;  1SK2 A;  1Q98 A;  1Z7P A;  4XS1 A;  1ILO A;  1T4Y A;  5LCZ A;  4MA9 A;  5HFI A;  3C71 A;  4I97 A;  1XWK A;  5AGY A;  2DJ3 A;  1TRV A;  1VF4 A;  2YWO A;  4A5P A;  11GS A;  2EIR A;  1K0B A;  1YKC A;  5A34 B;  4K9Z A;  5IIZ A;  2JZS A;  5C04 A;  4BWQ A;  5DDL A;  2CX4 A;  4KND A;  3UAR A;  3KH9 A;  2CVK A;  2A2R A;  2EFC A;  4HOJ A;  4HQZ A;  5F8B A;  2NPB A;  5FT3 A;  2PWJ A;  4H86 A;  1YQ1 A;  5A1N B;  5J41 A;  3N9J A;  3APS A;  3VI7 A;  3QOU A;  4O5Q A;  2F8F A;  3G7Y A;  4G9H A;  2M72 A;  2CZ3 A;  3M9J A;  2L4C A;  3ZFL A;  5GAN D;  3DYR A;  3FZ5 A;  6GST A;  3E3E A;  3KMO A;  3GA4 A;  4OCE A;  2CAQ A;  4FYB A;  1I5G A;  3GV1 A;  3FHK A;  3QD9 A;  4KF9 A;  1SL2 B;  2O89 A;  3IA1 A;  3W6G A;  1GTU A;  1TK5 B;  3RHC A;  1K0N A;  4MJC A;  1AW9 A;  3ZL5 A;  1MD3 A;  1PKZ A;  2YV9 A;  4QQ7 A;  2M46 A;  2X8G A;  4KW6 A;  2X99 A;  1M9A A;  3EMX A;  1B9Y C;  5E4W A;  3DVW A;  3DML A;  1ACV A;  3W8J A;  3GL5 A;  1UN2 A;  1ZCP A;  2HRK A;  1XWB A;  3EUR A;  4XS6 A;  3DEX A;  1FVK A;  5A1N A;  1T3B A;  3GH9 A;  1TP9 A;  5HR2 A;  1SL0 B;  3IE3 A;  4WF5 A;  3C73 A;  1OC8 A;  1FB0 A;  3UJ1 A;  4G10 A;  1R7H A;  4CY8 A;  5C00 A;  3VWX A;  2CA8 A;  2GSS A;  4JU5 A;  1Y25 A;  2K8S A;  2A2P A;  2KP2 A;  3L0H A;  4ZBA A;  2I4A A;  2JAC A;  2C3T A;  4EIP A;  1MDI A;  2OBI A;  2KHP A;  4DSR A;  4F2I A;  3P8W A;  2VCZ A;  5ECS A;  4ZIL A;  4MJA A;  2ES7 A;  2E0Q A;  4NXI A;  5F07 A;  2B5X A;  1BX9 A;  2H0I A;  3DRN A;  2H74 A;  4F03 A;  3NOF A;  1VF3 A;  5ELG A;  3IBH A;  4G19 A;  3ZMK A;  1Z6N A;  1GSE A;  1ON4 A;  2HYX A;  3IV4 A;  4XTS A;  1B4P A;  1OC3 A;  2PGT A;  3MSZ A;  2C80 A;  4DEJ A;  2OA7 A;  4XS4 B;  1WMJ A;  1PN9 A;  1R5A A;  1QGV A;  1SJ6 A;  4ACS A;  2EFE A;  2R0G A;  1T00 A;  3HJO A;  1UC7 A;  3VWV A;  5EY6 A;  4LL4 B;  3WGE A;  4I2U A;  1GUM A;  5ECH B;  2HZE B;  1UVZ A;  4K0N A;  2ON7 A;  1XWG A;  3F9U A;  2VIM A;  2QA2 A;  3RAZ A;  5COH A;  3FR3 A;  4TR3 A;  1YJ6 A;  2OT3 A;  4XRA A;  1J08 A;  3KP9 A;  6GSY A;  1WPI A;  5A4W A;  1LU4 A;  2B5E A;  1G0T A;  4K7I A;  3VWW A;  1PN0 A;  4KDU A;  4PQ1 A;  3IOS A;  3APQ A;  3G7I A;  1FO5 A;  3DKS A;  3KEB A;  3UL3 A;  1O7U A;  2FWF A;  2P31 A;  4GST A;  2DC5 A;  1FVJ A;  1WP0 A;  1V58 A;  4ZB6 A;  1N2A A;  1XZO A;  2J23 A;  2ZCT A;  4IW9 A;  1LBK A;  3L78 A;  3TKP A;  2EFH A;  2MBS A;  1EV4 A;  1BJX A;  1U6T A;  2JZT A;  2GSR A;  4BVX A;  2V6K A;  2DSA A;  1OE7 A;  1XOB A;  2HZE A;  4Q5F A;  2LQQ A;  1YEP A;  4IP1 A;  3L4N A;  5DJL A;  2QGV A;  1SVL A;  3PIN A;  4LLR A;  2IFQ B;  1F2E A;  2P5Q A;  4K2X A;  3I69 A;  1E6B A;  1R4W A;  2A4V A;  4N30 A;  2VD1 A;  2IWT A;  3TRQ A;  2HSN A;  4O92 A;  1QK8 A;  4EO3 A;  1Z3E A;  5J9B A;  2VCT A;  5HR0 A;  1GNW A;  1K0M A;  5J47 A;  5DBQ A;  2DJK A;  1AUC A;  1EV9 A;  2VM1 A;  2PPT A;  1GTB A;  2AYT A;  3HY2 A;  3TOT A;  2P0G A;  3GRX A;  1K0D A;  5D9X A;  4GQC A;  3D22 A;  3KGK A;  3H93 A;  5CO3 A;  4HQS A;  2H8L A;  2VM2 A;  4AKI A;  1W4V A;  2VL3 A;  1ERW A;  4KH7 A;  3M0F A;  5INY A;  4N10 A;  1NHY A;  4TR0 A;  1OC9 B;  3LYK A;  1GTI A;  1FOV A;  2FNO A;  4WKW A;  5G2Z A;  2YNX A;  2PU9 C;  1SK1 A;  2B3S A;  3F4R A;  1B9X C;  2Z9S A;  4N0V A;  4CY6 A;  4YAP A;  1T8E B;  3VPT A;  4G0K A;  1Z7R A;  4EL1 A;  5G1L A;  1ZYP A;  1AXD A;  1TI1 A;  4ZB7 A;  4POK A;  2G0F A;  4WXT A;  3O3T A;  3PGT A;  4HU9 A;  3IAS 2;  2LQO A;  2WCI A;  3CTF A;  4EXJ A;  3HYP A;  3IK7 A;  1XPV A;  3BCI A;  5A4V A;  2X64 A;  1V57 A;  5ECN B;  2YZU A;  2RUF A;  2L6D A;  3GUS A;  2OE3 A;  3TRX A;  2VLU A;  1YF0 A;  4AJ7 A;  3TDG A;  4ZL7 A;  5DCG A;  1H75 A;  4ECB A;  2HI7 A;  1GWC A;  1I9D A;  4V1A g;  4HS1 A;  1B8X A;  4KDX A;  2JZR A;  1T4Z A;  2H73 A;  5E59 A;  3F6D A;  3LXZ A;  2VUP A;  2GQK A;  1JZD A;  2O5V A;  2DMM A;  2V1M A;  2O7K A;  1OC9 A;  2C0F A;  4WET A;  5CP1 A;  2H6Z A;  5CRG A;  1QXH A;  1X0R A;  3C1R A;  3N5O A;  1X9W B;  2N5B A;  3UIW A;  3GSS A;  3IPZ A;  1PMT A;  1M7T A;  5A5H A;  1PSQ A;  3Q6O A;  5H5S A;  2LRT A;  4X1U A;  4IVF A;  1ST9 A;  1V40 A;  2HXK A;  3J7Y b;  3HMJ G;  1A8Y A;  5CNW A;  4MCU A;  3U5R E;  2RLI A;  4HZ4 A;  1PD2 1;  3MYD A;  2OAC A;  5DAK B;  13GS A;  3LXT A;  4TR4 A;  1EOH A;  4Z7X A;  5LNK e;  2YWN A;  2R37 A;  4POM A;  3IC4 A;  3MAK A;  5CRW A;  1JZR A;  3D6I A;  3IRA A;  5J9C A;  2UV8 G;  3ERG A;  1GLP A;  2GST A;  4J2F A;  4MPG A;  5F06 A;  3APO A;  2F8A A;  3GKK A;  2MMZ A;  5AIV A;  4YKF A;  3HJM A;  2H30 A;  1OKD A;  3H4K A;  5KN1 A;  4GDF A;  1WE0 A;  1SEN A;  4KAE A;  3IK9 A;  2GZY A;  3HVV A;  3KP8 A;  4DSS A;  10GS A;  5GST A;  3Q18 A;  1J9B A;  4RUV A;  1M2A A;  4PUA A;  4FO5 A;  1XOA A;  4AI6 A;  2HQT A;  1TRW A;  4MK3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...