3QR6A

Crystal structure analysis of h185f mutant of human clic1
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
236
structure length
236
Chain Sequence
PQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLFIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Chloride intracellular channel protein 1
publication title Role of individual histidines in the pH-dependent global stability of human chloride intracellular channel 1.
pubmed doi rcsb
source organism Homo sapiens
total genus 76
structure length 236
sequence length 236
ec nomenclature
pdb deposition date 2011-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13409 GST_N_2 Glutathione S-transferase, N-terminal domain
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3qr6A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3qr6A01
2IMDA 5ID2A 3IA1A 3HY2A 2HZFA 2I9HA 1O73A 4AJ7A 1F37A 3DXBA 5CP1A 5FT3A 5KN3A 3A3TA 1SYRA 3LGCA 4USSA 4V2MA 1MTCA 3PINA 3LXTA 3R3EA 4OD7A 3UARA 3QAVA 1HNBA 3HJOA 3KCMA 2GT5A 4KH7A 3FRCA 3KH7A 4ZB8A 4MJCA 4MPFA 4IELA 2B1LA 2F8FA 3GURA 4PUAA 1R5PA 3DVWA 2NVLA 3TJFA 5KEJA 1TOFA 2VD1A 1GL8A 2C0GA 5CREA 3W8JA 3WGXA 1K3YA 4J56E 3I43A 5ECOB 3QFBC 1N2AA 2GSTA 3FZAA 1BYEA 3FR6A 4MDCA 6GSYA 5IO0A 5HR1A 1GSFA 5CRGA 4I2UA 1YKAA 1NHOA 1PD21 1JFUA 4IBPA 2C3NA 1V9WA 3D21A 2P5QA 1FHEA 3VWUA 2JSZA 2CZ2A 5KN2A 3HD5A 1TP9A 5DQYA 4IGJA 3HXSA 1T4ZA 1CQHA 3DIEA 2OACA 3Q6OA 2VCTA 3VI5A 3ZMKA 1RW1A 2FWHA 1GLPA 2X8HA 4JU5A 1HNAA 1XW5A 3IHQA 4O32A 3VWWA 2HRKA 5ECQB 2CX3A 2KHPA 1X9MB 5ECPB 2N5BA 2N5AA 5HR3A 5D93A 4F0BA 1XVQA 5D9WA 5D9XA 3F9UA 2WB9A 1JZOA 1GULA 1FW1A 3RPNA 4IP1A 1U3AA 4XHMA 4IS0A 2I1UA 1AQWA 2QGVA 1OKTA 2FGXA 5FHIA 1DBYA 4POLA 1AUCA 1ZYQB 2VL9A 2DJ0A 4BVXB 1XWGA 1KNGA 3TJBA 5LCZA 2OE0A 5ABRA 5HQPA 3PH9A 3OR5A 2YANA 4AF2A 2GQLA 3PR8A 2XBQA 4PNGA 3D0ZA 1U6TA 2YZUA 3KXOA 4F82A 3RAZA 1JHBA 5DCHA 2CZ3A 5DAKB 2LUSA 1OC9B 2AV4A 5H5SA 1CQGA 5G5FA 2H76A 5DALA 4KNDA 3NOFA 3DWVA 3ERWA 1A8LA 5JWOB 1YEPA 1IYHA 2YWOA 1T4YA 5JWQB 5HR0A 5IMZA 1SENA 2RM6A 3EWLA 4EF0A 4WR5A 2REMA 2OKAA 5GAND 2NPBA 5EL8A 4AGSA 4JBBA 2LQQA 3QMXA 1K0CA 4FYUA 3HVVA 3GKKA 3H8QA 2B1KA 1WOUA 3F6DA 1B9YC 2O89A 1HQOA 4LMVA 3UVTA 3DMLA 1BG5A 2LQOA 5EVOA 2DLXA 5DQSA 1G7EA 3GH9A 5B6MA 1TJDA 4ILFA 3GKNA 1O7UA 3DRNA 2YV9A 2H1AA 4ECCA 16GSA 3O76A 3GNJA 1XZOA 1J08A 3G7YA 1XPVA 2LJAA 5H5QA 5JWRB 5B8AA 4RQXA 1URMA 3WYWA 2PMTA 4OO4A 4E8HA 3EURA 3TRPA 3GH6A 2J23A 4IQ1A 2K8SA 4F9ZA 4OWYA 1SK1A 2FWGA 2H73A 3KP9A 3TKSA 3APOA 1Z9HA 4DSRA 3CSJA 5ID2B 1K0BA 3RHCA 3WD6A 4PURA 1BX9A 2J9HA 3G7IA 3M0FA 5CAXA 1O8XA 1XXUA 4KE3A 2L59A 2CQ9A 1TKDB 3GMFA 2RUFA 3RPPA 3EMPA 4G2EA 2HE3A 1X9SB 3CXGA 1M2BA 3M3MA 4MP4A 3GHAA 5DBQA 1TK5B 3KMNA 1TI1A 2HRAA 2B3SA 1I5GA 1GSUA 3EC3A 1JZDA 4IN0A 4WETA 1XOBA 2LRTA 2FNOA 1ERUA 1AW9A 1U88A 1YKCA 5ECLB 3GX0A 2ZCTA 5DJMA 4FH8A 1XWAA 5G31A 3KD0A 1GSEA 1V2AA 2IMEA 3F6FA 4J2FA 1B4QA 2CAIA 3QDNA 2VL2C 1V40A 2L6CA 5HFGA 2YJ7A 1TK8B 2R6KA 4QQ7A 2H6ZA 3S9FA 2K18A 1R26A 4PQIA 1VF2A 2TIRA 4JEDA 1GH2A 4FYBA 4RUVA 3VPQA 3TCOA 6GSWA 2V32A 3ZIVA 2HNLA 2IL3A 4L5LA 2B7JA 4L0UA 5IQYA 1X5CA 2AYTA 5LNKe 3HCZA 4KSMA 1A2JA 3F0IA 2YCDA 2R2JA 4KCAA 2VOCA 3ERGA 3IAM2 3W6GA 5AIXA 1J9BA 3CSIA 3QAGA 2LEGA 1TRSA 2HRKB 4K2DA 3MAKA 3I6AA 1YDKA 2A4VA 4XCSA 3TJJA 1SK0A 2GS3A 4ID0A 2WCIA 4L5OA 3EMXA 2NTOA 3GTUB 5IMFA 4ZILA 5GAPD 3L9VA 3CTGA 3FY7A 2DBCA 1EGOA 4WKWA 2GVPA 1J0FA 2DIYA 2LS5A 3MSZA 2ALBA 3APQA 3CRTA 7GSSA 4POMA 3GL5A 4Q5RA 1HD2A 3IXRA 1EZKA 2EIOA 3ZVJD 1XFLA 2VCWA 5J41A 4BWSA 3ME7A 2VAFA 3RHBA 2VLUA 3DGQA 5ELAA 2WGRA 5D9VA 2PU9C 2F9SA 2IMKA 1OE8A 5DVBA 3ZTLA 2R5GA 5A5KA 1R5AA 1X5DA 3APSA 4IJIA 2H71A 2M46A 1ZMAA 1YQ1A 3TDGA 1PX7A 2H0GA 3P8WA 4HJ2A 4GSTA 3SWLA 4RI6A 4NV5A 4I6XA 1TRUA 5G1KA 2PN8A 3UJ1A 4EVMA 1K0MA 4G0IA 1GLQA 2HZEA 3MNGA 4WF5A 5JCWA 1TW9A 2X64A 5IMVA 2BTOT 3GX8A 2O7KA 1M2AA 2IIYA 1NW2A 1PMTA 5C00A 5J9BA 1PKWA 4K7IA 2HFDA 1VGLA 1WMJA 2V2GA 3RBTA 2YV7A 1K3OA 1X5EA 4HS1A 1EWXA 1USBA 2KP1A 4MF7A 1NSWA 3TOUA 3VFIA 5A4VA 3HVXA 1AQVA 1QUWA 2H66A 2MMAA 2R4VA 5ECMB 3D4MA 3RDWA 3M9JA 2I4AA 3US3A 1U3IA 1DSBA 4IJ3A 1QFNA 1WPIA 4MZBA 4AJ6A 2P31A 1V57A 4DSSB 3M9KA 4DEJA 1OC8A 3F4SA 5CRDA 2O8VB 4KDXA 1UVZA 4NPBA 1ABAA 1AC1A 2WDUA 5EPFA 1GUMA 1A24A 2K8VA 3HJMA 4EDYA 4EE0A 3IR4A 3F63A 2IFQA 2AHEA 3IC8A 10GSA 2KP2A 2YPMA 4NHZA 4YQMA 4NXIA 1WP0A 2F3MA 2F51A 2KOKA 2L6DA 1M99A 3GIXA 2BJXA 2DMLA 3KH9A 1ON4A 2VCVA 3VPTA 4MJBA 2GT6A 1AXDA 4P3YB 1SL2B 2EC4A 2V1MA 2LRCA 3N5OA 4YQVA 1TI3A 2L4CA 4DVCA 1ZOFA 2VIMA 2C0EA 3TJGA 1Z6MA 1OVNA 3R2QA 2H72A 1QXHA 2MZCA 2PVQA 3C8EA 3IE3A 2JADA 3A2XA 3QCPA 2NDOA 3VWVA 5AN1A 1KBNA 4G19A 2GZPA 1Z5YE 3DYRA 4JR6A 5CO3A 3GUSA 4ML6A 3UMAA 3QOUA 3UAPA 3M8NA 2O85A 3EINA 4ML1A 2C1YA 2WZ9A 4K0NA 1AQXA 4PTSA 4BVYA 2TRXA 4G10A 1T1VA 4HDEA 2XBIA 4V1Ap 3MWHA 3LORA 4KDYA 1XOAA 5F07A 2YWNA 1M2DA 1PA3A 2H0HA 3IC4A 1W89A 3ZIJA 3Q18A 2H70A 3A5WA 4JR4A 1SD8A 3GTUA 2Z9SA 4OCFA 2ZNMA 2YOIA 4ZB6A 2YN1A 3KIJA 4EL1A 1PL2A 3ZYWA 4POKA 4TXVA 1ERTA 1Z3EA 1U87A 2GZZA 13GSA 2M80A 2HT9A 1X9WB 1PSQA 4GTUA 4CHSA 2VLTA 4V2NA 3HKRA 4LA1A 3P90A 5J4UA 2C4JA 3J7Yb 2HRFA 2LV3A 4GCIA 2HLSA 3JCML 4QL7A 2MBTA 4MA9A 2VM1A 14GSA 3KTLA 2MBSA 2L4QA 1S3AA 3HDCA 4EO3A 2IMIA 5L71A 4XRDA 1QGVA 4MCUA 2H0IA 4LLRA 1N8JA 1TRVA 4KDUA 3DD3A 2WJUA 3QR6A 1BEDA 1GTBA 4WBJA 3CRUA 2HZEB 1ML6A 4XS4A 3TKSC 3LG6A 2FUG2 2PERA 3IAS2 2K9FA 1Z6NA 4MH3A 3C1SA 5J5NA 2V6KA 4GWRA 4V1Ag 3UBKA 1RQMA 3V1WA 1JLWA 3QPMA 4TVEA 2XPDA 2CA8A 3FR9A 1EGRA 1WE0A 2E7PA 1HNCA 2FWEA 1LU4A 4Q5NA 3DVXA 6GSSA 2OBKA 3FKFA 1TRWA 4MZCA 2P0GA 5INYA 3UEMA 2HXKA 2H75A 1GP1A 2VCQA 2JSYA 2OBIA 4F0CA 5IMAA 5D9TA 5F8BA 4GXZA 1YF1A 1BAYA 4ZL9A 4FYCA 4XIHA 1OKDA 4OFTA 1V98A 5ECHB 4DSSA 2H6XA 4MPGA 2HRNA 1T3BA 4HOJA 5CYYA 5J9CA 3PPUA 3EE2A 1F2EA 3A2WA 2DC5A 1FVKA 3L78A 3NIVA 2XHFA 2L5LA 4HU9A 3PGTA 2IFQB 2VLVA 1C72A 2FWFA 3ZFBA 3F8UA 2VM2A 1H4OA 20GSA 3LJRA 3H93A 1S3DA 2I81A 2KLXA 5J3RA 4G0KA 2MMZA 2JZRA 4HUAA 2DJKA 8GSSA 2V6OA 3D4TA 2CX4A 4GF0A 1FAAA 3ZREA 2C8UA 1R4WA 5IO2A 2MMOA 1Z7RA 3KM6A 3LYKA 5BMUA 1XVWA 4KAEA 4MLYA 4OFMA 2B5YA 2PVOC 3IBHA 1MEKA 4N10A 4HU7A 5B7CA 5IMCA 4BWQA 22GSA 1B8XA 1QK8A 3TRXA 1I9DA 1WWJA 3CBUA 1T8EB 4MJEA 3QAWA 4ISDA 4K7NA 2EIRA 4ULXA 3F4TA 1OAZA 1MD3A 1ZYEA 4BVYB 2FCHA 1GTAA 3F3RA 2CVDA 4YH2A 3CMIA 2JL4A 2CAQA 3EU4A 3C7MA 6GSVA 5G2ZA 4RQRA 1XW6A 4K7OA 3ZRDA 2C3TA 1RK4A 1FVJA 1FB6A 1M9BA 4I2TA 5C04A 1M7TA 5HR2A 1ZZYA 1OYJA 4PX1A 1PN9A 4XS6A 5E4WA 1SYXA 2C0FA 1SL1B 3FZ4A 3UVHA 2HSMA 2LNSA 2VL2A 2C0DA 1O8WA 5JCGA 2RM5A 1OC3A 1QQ2A 3TOTA 3GKXA 4TR1A 3TB2A 1T00A 1EP8A 3KJYA 4NAXA 3HZ4A 3VI7A 1R7HA 2E2MA 4HEA2 3D5JA 5EY6A 4NMUA 1Y6EA 5ENUA 1A2LA 11GSA 4TW5A 2CV4A 4KCEA 2MMNA 1K0DA 2X99A 1VF3A 3P2AA 1THOA 4XS4B 4KSOA 1VF1A 2JU5A 2KUCA 2WFCA 2LSTA 2AUVA 1PL1A 4X0XA 3ZFLA 5IOXA 5HFIA 4V2LA 2PBJA 5FWGA 1E2YA 3HYPA 1T7PB 3D6IA 2BMXA 1YZXA 3FW2A 2ON5A 4LL1B 4Q5FA 4TN8A 3QD9A 1SK2A 2WS2A 5A4UA 6GSTA 5F06A 2C3QA 5GSSA 1WJKA 3TRQA 4ECJA 4FO5A 2LJRA 3Q19A 2IN3A 2CVBA 2DIZA 4EC0A 12GSA 4KGIA 4IW9A 1Q4JA 19GSA 4X1UA 1ILOA 2IJYA 3Q74A 2X8GA 3FZ5A 3GA4A 1EOGA 5AISA 4FQUA 1K0OA 3HZ8A 4JZQA 4O92A 2YNXA 3LFLA 2ON7A 4EXJA 5CRWA 3TKSE 2QSIA 2ZUPA 1SJZA 1DE2A 3I69A 1VF4A 4G9HA 3IK7A 3LXZA 2CT6A 1KTEA 5H5RA 2B6MA 17GSA 4YQUA 2R3XA 1MDKA 3GN3A 5IMDA 3GRXA 4O7HA 4ZBDA 2MYGA 2GDRA 4QL9A 4N30A 2V41A 4TR0A 4JRRA 4PXOA 2IMFA 2RLIA 2OADA 4K6XA 4KA0A 5AGYA 1ZL9A 2D2ZA 3AY8A 4MABA 2LRNA 2H1GA 4K0GA 3ZITA 4GLTA 2QC7A 2A2RA 3J7Yk 5IPGA 1O6JA 5KN1A 1SJ6A 4ZL8A 1G6WA 2XPEA 4YAVA 1E6BA 1ZCPA 1ERWA 2HYXA 3KTBA 2YWMA 3U5RE 3C1RA 2B5XA 5G30A 2N5FA 2XC2A 2VCXA 4GSSA 4E8EA 4PQ1A 1QMVA 4F03A 1ERVA 1M0UA 3BOAA 1TTZA 3A2VA 4MF6A 1THXA 1PGTA 3N9JA 4KW6A 4EUYA 4L8EA 1K0NA 3EVIA 1YF0A 4MK3A 2YP6A 1NHYA 1TK0B 2AJQB 3E9JB 4X43A 3LYPA 3KZQA 1EP7A 3O3TA 4KB3A 1B4PA 3EU3A 2VD0A 2E2GA 4RI7A 4EKZA 4Z7XA 1EV4A 2H1DA 3H4KA 4WBRD 3WT2A 1PKZA 5DDLA 1G6YA 4ZL7A 1A8YA 3K8NA 3CYNA 4KUNA 3BJ5A 3GSTA 1DE1A 5CRHA 2GQKA 1EOHA 5ELGA 4OCEA 3TKRA 3KMOA 1A0FA 2H19A 4BA7A 4ECBA 1V58A 4MF5A 5A4WA 3TUEA 4LMWA 2E0QA 5CNWA 1H75A 4ZXGA 1F3BA 4TXOA 2HSMB 3VLNA 2DJ3A 4Q5QA 2VL3A 1JLVA 3FYGA 4K1FA 1F6MC 1FG4A 1UA5A 4I8BA 4ECIA 4WR4A 3ZMLA 2OE3A 3U6VA 2AB6A 2C80A 4N11A 4TR1B 2VUPA 3L4NA 2GQMA 1LJRA 2H30A 3KP8A 4XS1A 5ECIB 3E0UA 3BCKA 2K6VA 5IPHA 4GSNA 4OMVA 2H74A 1FO5A 5G5EA 3IV4A 2O87A 2H01A 3LEFA 5ECKB 3FEUA 4ZBBA 4CDOA 1GSSA 3GKMA 2HSYA 2F8AA 1B9XC 2DJJA 1AAZA 3UL3A 1XWCA 4HZ2A 3TJKA 4PNFA 1XW9A 2B5EA 5ECSA 2PPTA 3GYKA 1XBSA 3IDVA 2CVKA 4GQCA 4TR3A 4BL7A 5KN0A 1WIKA 1S3CA 1F3AA 5JCUA 3EYTA 1GUKA 1X0RA 2JACA 1K0AA 1B48A 4TRXA 3TKPA 3LWAA 2FA8A 2HQTA 2HSHA 3BCIA 6GSUA 2PGTA 4L0WA 1ACVA 4HQSA 3CTFA 3HVSA 3ZVJA 2RIIA 4D73A 1PQNA 4WEYA 4POBA 4MH2A 2ES7A 3L9UA 2AAWA 2GSRA 2P5RA 3IPZA 2FY6A 4I97A 1MDIA 1GUHA 2L57A 2UZ8A 4IVFA 1FB0A 3IRAA 1YJ6A 4EDZA 2WULA 1TXXA 4HZ4A 2B7KA 18GSA 1NM3A 4NWYA 1PX6A 2M72A 2FLSA 5GSTA 4NV2A 2DJ2A 1FOVA 2YZHA 1JZRA 1MDJA 4O5RA 2GTUA 3O6TA 5F05A 1JZWA 5ECRB 2R37A 4H86A 1SD9A 5IOWA 4KF9A 4HQZA 2PWJA 4PGTA 1GTUA 3FZ9A 3W8SA 2FD3A 3HJPA 1YY7A 2DJ1A 5GZZB 3LSZA 2TRCP 4K9ZA 2H1BA 1UC7A 3SBCA 5D96A 2A2SA 5E59A 1GTIA 1ST9A 3GSSA 4K8MA 3L9SA 4F2IA 2PUKC 1M9AA 2JZTA 1BQ7A 1KEBA 4KX4A 3VURA 4GQFA 1AIUA 3H1NA 4ZIJA 3G9BA 2OE1A 4ACSA 2LKUA 3DKSA 1Z7PA 5HFKA 1SJIA 1YEXA 3HHVA 5DJLA 1EEMA 5LD0A 4IKHA 1K3LA 2GSQA 4IHUA 3ME8A 5AIVA 2QKEA 2OJLA 1GSYA 3I9V2 1A0RP 4J57E 4XRAA 4AJ8A 1HYUA 2LTKA 2YJHA 3GL3A 4JE1A 4N0ZA 3MDKA 2OA7A 4G0LA 2EIQA 1LBKA 1DUGA 4TXOB 3ZZXA 1ZGNA 1O81A 1A23A 3VK9A 1OE7A 1F9MA 1W4VA 2VCZA 4CW9A 3TGZA 3CSHA 1Y25A 2HSNB 2DSAA 3VWXA 3HA9A 2HI7A 1BJXA 2H6YA 4WF4A 3G7JA 1SKWB 4ZB9A 5COHA 2IWTA 4LL4B 4BVXA 3UBLA 4MMMA 1WRYA 5D73A 1EEJA 2GLRA 4N0VA 3WT1A 2JZSA 5D8IA 5G1LA 4TKYA 1TU8A 3FK8A 1XWKA 3WGDA 4NHWA 3NZNA 5DALB 1EV9A 1SKSB 5DAKA 1G7OA 3ISOA 1OC9A 3ZL5A 1GNEA 2GSSA 2LJKA 9GSSA 1XCCA 4PQHA 1XWBA 3QFAC 1O85A 4MZWA 2G0FA 3E3EA 2H8LA 1TDIA 4IP6A 3KGKA 5B6NA 4DSQA 1PRXA 4I5QA 3BBYA 2L5OA 2YWIA 2I3YA 4XTSA 1A2MA 1SU9A 1UN2A 2GGTA 2DMMA 4HJMA 4MJAA 4YAPA 2FA4A 4BPYA 3LQ7A 4BL7B 1GSDA 3ERFA 2LNTA 5IM9A 2IPAA 3F4RA 1G0TA 1GRXA 3GFKA 3L0HA 1GNWA 2FHEA 3IK9A 1GSQA 3ZLPA 4FIWA 1SKRB 3C73A 3KEBA 1GWCA 4IQAA 5B8BA 1IYIA 3F3QA 3FR3A 2X8CA 2WRTA 2VO4A 3TKQA 2GZYA 2NBSA 6GSXA 4OO5A 5IIZA 3UOMA 1TU7A 1Q98A 3FHKA 4PUFC 1SL0B 2RUEA 1XIYA 3GV1A 3ED3A 4D73B 4OFNA 2G2QA 1MD4A 3D22A 3DEXA 3UIWA 5ECNB 5DCGA 4TOPA 1VRSD 3C71A 5F0GA 3H79A 4TR4A 4GRFA 3M1GA 3BD2A 4HI7A 4ZBAA 3P7XA 3IOSA 3WGEA 4WXTA
chains in the Genus database with same CATH superfamily
2IMDA 5ID2A 3IA1A 3HY2A 2HZFA 2I9HA 1O73A 4AJ7A 1F37A 3DXBA 5CP1A 5FT3A 5J4VA 5KN3A 3A3TA 1SYRA 3LGCA 4USSA 4V2MA 1MTCA 3PINA 3LXTA 3R3EA 4OD7A 4HSCX 3UARA 3QAVA 1HNBA 3HJOA 3KCMA 2GT5A 4KH7A 3FRCA 3KH7A 2WW0A 4ZB8A 4MJCA 4MPFA 4IELA 2B1LA 2F8FA 3GURA 4PUAA 1R5PA 3DVWA 2A4HA 2NVLA 3TJFA 5KEJA 1TOFA 2VD1A 1GL8A 2C0GA 5CREA 3W8JA 3WGXA 1K3YA 4EIPA 4J56E 3I43A 5ECOB 3QFBC 1N2AA 2GSTA 3FZAA 1BYEA 3FR6A 4MDCA 6GSYA 5IO0A 5HR1A 1GSFA 5CRGA 1ZYPA 4I2UA 2R0GA 1YKAA 1NHOA 1PD21 1JFUA 4CY8A 4IBPA 2C3NA 4PI0C 1V9WA 3D21A 2P5QA 1FHEA 3VWUA 2JSZA 2CZ2A 5KN2A 3HD5A 1TP9A 5DQYA 4IGJA 3HXSA 1T4ZA 1CQHA 3DIEA 2OACA 3Q6OA 2VCTA 3VI5A 3ZMKA 1RW1A 2FWHA 1GLPA 2X8HA 4JU5A 1HNAA 1XW5A 3IHQA 4O32A 3VWWA 2HRKA 5ECQB 2CX3A 2KHPA 1X9MB 5ECPB 2N5BA 2N5AA 5HR3A 5D93A 4F0BA 1XVQA 5D9WA 5D9XA 3F9UA 2WB9A 1JZOA 1GULA 1FW1A 3RPNA 4IP1A 1U3AA 4XHMA 4IS0A 2I1UA 1AQWA 2QGVA 1OKTA 2FGXA 5FHIA 1DBYA 4POLA 1AUCA 1ZYQB 2VL9A 4YKFA 2DJ0A 5A1NA 4BVXB 1XWGA 1KNGA 3TJBA 5LCZA 2OE0A 5ABRA 5HQPA 3PH9A 3OR5A 2YANA 4AF2A 2GQLA 3PR8A 2XBQA 4PNGA 3D0ZA 1U6TA 2YZUA 3KXOA 4F82A 3RAZA 1JHBA 5DCHA 2CZ3A 5DAKB 2LUSA 1OC9B 2AV4A 5H5SA 1CQGA 5G5FA 2H76A 5DALA 4KNDA 3NOFA 3DWVA 3ERWA 1A8LA 5JWOB 1YEPA 1IYHA 2YWOA 1T4YA 5JWQB 5HR0A 5IMZA 1SENA 2RM6A 3EWLA 4EF0A 4WR5A 2REMA 2OKAA 5GAND 2NPBA 5EL8A 4AGSA 4JBBA 2LQQA 3QMXA 1K0CA 4FYUA 3HVVA 3GKKA 3H8QA 2B1KA 1WOUA 3F6DA 1B9YC 2O89A 1HQOA 4LMVA 3UVTA 3DMLA 1BG5A 2LQOA 5EVOA 2DLXA 5DQSA 1G7EA 3GH9A 5B6MA 1TJDA 4ILFA 2OT3A 3GKNA 1O7UA 3DRNA 2YV9A 2H1AA 4ECCA 16GSA 5KOXA 3O76A 3GNJA 2O5VA 1XZOA 1J08A 3G7YA 1XPVA 2X49A 2LJAA 5H5QA 5JWRB 5B8AA 4RQXA 1URMA 1SVLA 3WYWA 2PMTA 4OO4A 4E8HA 3EURA 3TRPA 3GH6A 2J23A 4IQ1A 2K8SA 4F9ZA 4OWYA 1SK1A 2FWGA 2H73A 3KP9A 3TKSA 3APOA 1Z9HA 4DSRA 3CSJA 5ID2B 1K0BA 3RHCA 3WD6A 4PURA 1BX9A 2J9HA 3G7IA 3M0FA 5CAXA 1O8XA 1XXUA 4KE3A 2L59A 1SVMA 2CQ9A 1TKDB 3GMFA 2RUFA 3RPPA 3EMPA 4G2EA 2HE3A 1X9SB 3CXGA 1M2BA 3M3MA 4MP4A 3GHAA 5DBQA 1TK5B 3KMNA 1TI1A 2HRAA 2B3SA 1I5GA 1GSUA 3EC3A 1JZDA 4IN0A 4WETA 1XOBA 2LRTA 2FNOA 1ERUA 1AW9A 1U88A 1YKCA 5ECLB 3GX0A 2ZCTA 5DJMA 4FH8A 1XWAA 5G31A 3KD0A 1GSEA 1V2AA 2IMEA 3F6FA 4J2FA 1B4QA 2CAIA 3QDNA 2VL2C 1V40A 2L6CA 5HFGA 2YJ7A 1TK8B 2R6KA 4QQ7A 2H6ZA 3S9FA 2K18A 1R26A 4PQIA 1VF2A 2TIRA 4JEDA 1GH2A 4FYBA 4RUVA 3VPQA 3TCOA 6GSWA 2V32A 3ZIVA 2HNLA 2IL3A 4L5LA 2B7JA 1YVLA 4L0UA 5IQYA 1X5CA 2QA1A 4YKGA 2AYTA 5LNKe 3HCZA 4KSMA 1A2JA 3F0IA 2YCDA 2R2JA 4KCAA 2VOCA 3ERGA 3IAM2 3W6GA 5AIXA 4Z2UA 1J9BA 3CSIA 3QAGA 2LEGA 4AI6A 1TRSA 2HRKB 4K2DA 3MAKA 3EPTA 3I6AA 2EFEA 1YDKA 2A4VA 4XCSA 3TJJA 1SK0A 2GS3A 4ID0A 2WCIA 5J47A 4L5OA 3EMXA 2NTOA 3GTUB 5IMFA 4ZILA 5GAPD 3L9VA 3CTGA 3FY7A 2DBCA 1EGOA 4WKWA 2GVPA 1J0FA 2DIYA 2LS5A 3MSZA 2ALBA 3APQA 3CRTA 7GSSA 4POMA 3GL5A 4Q5RA 5A1NB 1HD2A 3IXRA 1EZKA 2EIOA 3ZVJD 1XFLA 2VCWA 5J41A 4BWSA 3ME7A 2VAFA 3RHBA 2VLUA 3DGQA 5ELAA 2WGRA 5D9VA 2PU9C 2F9SA 2IMKA 1OE8A 5DVBA 3ZTLA 2R5GA 5A5KA 4N3ZA 1R5AA 1X5DA 4K2XA 3APSA 4IJIA 4AKXB 2H71A 2M46A 1ZMAA 1YQ1A 3TDGA 1PX7A 2H0GA 3P8WA 4HJ2A 4GDFA 4GSTA 3SWLA 4RI6A 4NV5A 4I6XA 1TRUA 5G1KA 2PN8A 3UJ1A 4EVMA 1K0MA 4G0IA 1GLQA 2HZEA 3MNGA 4EIQA 4WF5A 5JCWA 1TW9A 4X4JA 2X64A 5IMVA 2BTOT 3GX8A 2O7KA 5A34A 1M2AA 2IIYA 1NW2A 1BF5A 1PMTA 5C00A 5J9BA 1PKWA 4K7IA 3HVNA 2HFDA 3MYDA 1VGLA 1WMJA 2V2GA 3RBTA 2YV7A 1K3OA 1X5EA 4HS1A 1EWXA 1USBA 2KP1A 4MF7A 1NSWA 3TOUA 3VFIA 5A4VA 3HVXA 1AQVA 1QUWA 2H66A 2MMAA 2R4VA 5ECMB 3D4MA 3RDWA 3M9JA 2I4AA 3US3A 1U3IA 1DSBA 4IJ3A 1QFNA 1WPIA 4MZBA 4AJ6A 2P31A 1YEWC 1V57A 4DSSB 3M9KA 2WVXB 4DEJA 1OC8A 3F4SA 5CRDA 1TXUA 2O8VB 4KDXA 1UVZA 4NPBA 1ABAA 1AC1A 2WDUA 5EPFA 1GUMA 1A24A 2K8VA 3HJMA 4EDYA 4EE0A 3IR4A 3F63A 2IFQA 1PN0A 2AHEA 3IC8A 10GSA 2KP2A 2YPMA 4K5RA 4NHZA 4YQMA 4NXIA 1WP0A 2F3MA 2F51A 2KOKA 2L6DA 1M99A 3GIXA 2BJXA 2DMLA 3TU3B 3KH9A 1ON4A 2VCVA 3VPTA 4MJBA 2GT6A 1AXDA 4P3YB 1SL2B 2EC4A 2V1MA 2LRCA 3N5OA 2R0CA 4YQVA 1TI3A 2WVZA 2EFDA 2L4CA 4DVCA 4Z2TA 1BG1A 1ZOFA 2VIMA 2C0EA 2A2PA 3TJGA 1Z6MA 1OVNA 3R2QA 2H72A 4K5SA 1QXHA 2MZCA 2PVQA 3C8EA 3IE3A 2JADA 3A2XA 3QCPA 2NDOA 3VWVA 5AN1A 4ZB7A 1KBNA 4G19A 2GZPA 1Z5YE 3DYRA 4JR6A 5J40A 5CO3A 3GUSA 4ML6A 3UMAA 3QOUA 3UAPA 3M8NA 2O85A 3EINA 4ML1A 2C1YA 2WZ9A 4K0NA 1AQXA 4PTSA 4BVYA 2TRXA 4G10A 1T1VA 4HDEA 2XBIA 4V1Ap 3MWHA 3LORA 4KDYA 1XOAA 5F07A 2YWNA 1M2DA 1PA3A 1M3JA 2H0HA 3IC4A 1W89A 3ZIJA 3Q18A 2H70A 3A5WA 2X4AA 4JR4A 1SD8A 3GTUA 2Z9SA 4OCFA 2ZNMA 2YOIA 4ZB6A 2YN1A 3KIJA 4EL1A 4W66A 1PL2A 3ZYWA 4POKA 4TXVA 1ERTA 1Z3EA 1U87A 2GZZA 13GSA 2M80A 2HT9A 1X9WB 1PSQA 4GTUA 4CHSA 2VLTA 4V2NA 3HKRA 4LA1A 3P90A 5J4UA 2C4JA 3J7Yb 2WW2A 2HRFA 2LV3A 4GCIA 2HLSA 3JCML 4QL7A 2MBTA 4MA9A 2VM1A 14GSA 3KTLA 2MBSA 2L4QA 1S3AA 3HDCA 4EO3A 2IMIA 5L71A 2WVYA 4XRDA 1QGVA 4MCUA 2H0IA 4LLRA 1N8JA 1TRVA 4KDUA 3DD3A 2WJUA 3QR6A 1BEDA 1GTBA 4WBJA 3CRUA 2HZEB 1ML6A 4XS4A 3TKSC 3LG6A 4FXYP 2FUG2 2PERA 3IAS2 2K9FA 1Z6NA 4MH3A 3C1SA 5A34B 5J5NA 2V6KA 4GWRA 4V1Ag 3UBKA 1RQMA 3V1WA 1JLWA 3QPMA 1FOHA 4TVEA 2XPDA 2R0PA 2CA8A 3FR9A 1EGRA 2WW1A 1WE0A 2E7PA 2FWEA 1HNCA 1LU4A 4Q5NA 3DVXA 6GSSA 2OBKA 3FKFA 1TRWA 4MZCA 2P0GA 2DKHA 5INYA 2EFHA 2HXKA 3UEMA 2H75A 1GP1A 2QA2A 2VCQA 2JSYA 2OBIA 4F0CA 5IMAA 5D9TA 5F8BA 4GXZA 1YF1A 1BAYA 4ZL9A 4FYCA 4XIHA 4QMKA 1OKDA 4OFTA 1V98A 5ECHB 4DSSA 2WVXA 2H6XA 4MPGA 2HRNA 1T3BA 4HOJA 5CYYA 5J9CA 3PPUA 3EE2A 1F2EA 2DKIA 3A2WA 2DC5A 4AKHA 1FVKA 3L78A 3NIVA 2XHFA 2L5LA 4HU9A 3PGTA 2IFQB 2VLVA 1C72A 2FWFA 3ZFBA 3F8UA 2VM2A 1H4OA 20GSA 3LJRA 3H93A 1M3IA 1S3DA 2I81A 2KLXA 1PFOA 5J3RA 4G0KA 2MMZA 2JZRA 4HUAA 2DJKA 8GSSA 2V6OA 3D4TA 2CX4A 4GF0A 1FAAA 3ZREA 2C8UA 1R4WA 5IO2A 2MMOA 1Z7RA 3KM6A 3LYKA 5BMUA 1XVWA 4KAEA 4MLYA 4OFMA 2B5YA 2PVOC 3IBHA 1MEKA 4N10A 4HU7A 5B7CA 5IMCA 4BWQA 22GSA 1B8XA 1QK8A 5BRTA 3TRXA 1I9DA 1WWJA 3CBUA 1T8EB 4MJEA 3QAWA 4ISDA 4K7NA 2EIRA 4ULXA 3F4TA 1OAZA 1MD3A 1ZYEA 4BVYB 2FCHA 1GTAA 3F3RA 2CVDA 4YH2A 3CMIA 2JL4A 4PHZC 2CAQA 3EU4A 3C7MA 6GSVA 5G2ZA 4RQRA 1XW6A 4K7OA 3ZRDA 2C3TA 1RK4A 1FVJA 1FB6A 1M9BA 4I2TA 5C04A 1M7TA 5HR2A 1ZZYA 1OYJA 4PX1A 4O5QA 1PN9A 4XS6A 5E4WA 1SYXA 2C0FA 1SL1B 3FZ4A 3UVHA 2HSMA 2LNSA 2VL2A 2C0DA 1O8WA 3CQFA 5JCGA 2UV8G 2RM5A 1OC3A 1QQ2A 3TOTA 3GKXA 4TR1A 3TB2A 1T00A 2EFCA 1EP8A 3KJYA 4NAXA 3HZ4A 3VI7A 1R7HA 2E2MA 4HEA2 4PI2C 3D5JA 5EY6A 4NMUA 1Y6EA 5ENUA 1A2LA 2WZSA 11GSA 4TW5A 2CV4A 4KCEA 2MMNA 1K0DA 2X99A 1VF3A 3P2AA 1THOA 4XS4B 4KSOA 4AKGA 1VF1A 2JU5A 2KUCA 2WFCA 2LSTA 2AUVA 1PL1A 4X0XA 3ZFLA 5IOXA 5HFIA 4V2LA 2PBJA 5FWGA 1E2YA 3HYPA 1T7PB 3D6IA 2BMXA 1YZXA 3FW2A 2ON5A 4LL1B 4Q5FA 4TN8A 3QD9A 1SK2A 2WS2A 5A4UA 6GSTA 5F06A 2C3QA 5GSSA 1WJKA 3TRQA 4ECJA 4FO5A 2LJRA 3Q19A 2IN3A 2CVBA 2DIZA 4EC0A 12GSA 4KGIA 4IW9A 1Q4JA 19GSA 4X1UA 1ILOA 2IJYA 3Q74A 2X8GA 3FZ5A 3GA4A 1EOGA 5AISA 4FQUA 1K0OA 3HZ8A 4JZQA 4O92A 2YNXA 3LFLA 2ON7A 4EXJA 5CRWA 3TKSE 2QSIA 2ZUPA 3CHXC 1SJZA 1XG8A 1DE2A 3I69A 3LW9A 1VF4A 4G9HA 3IK7A 3LXZA 2CT6A 1KTEA 5H5RA 2B6MA 1SVOA 17GSA 4YQUA 2R3XA 1MDKA 3GN3A 5IMDA 3GRXA 4O7HA 4ZBDA 2MYGA 2GDRA 4QL9A 4N30A 2V41A 4TR0A 4JRRA 4PXOA 2IMFA 2RLIA 2OADA 4K6XA 4KA0A 5AGYA 1ZL9A 2D2ZA 3AY8A 4MABA 2LRNA 2H1GA 4K0GA 3ZITA 4GLTA 2QC7A 2A2RA 3J7Yk 5IPGA 1O6JA 5KN1A 1SJ6A 4BIKA 4ZL8A 1G6WA 2XPEA 4YAVA 1E6BA 1S3RA 4O5UA 1ZCPA 1ERWA 2HYXA 2YWMA 3KTBA 5BMUB 3U5RE 3C1RA 2B5XA 5G30A 2N5FA 2XC2A 2VCXA 4GSSA 4E8EA 4PQ1A 1QMVA 4F03A 1ERVA 1M0UA 3BOAA 1TTZA 3A2VA 4MF6A 1THXA 1PGTA 3N9JA 4KW6A 4EUYA 4L8EA 1K0NA 3EVIA 1YF0A 4MK3A 2YP6A 1NHYA 1TK0B 2AJQB 3E9JB 4X43A 3LYPA 3KZQA 1EP7A 3O3TA 4KB3A 1B4PA 3EU3A 2VD0A 1Y1UA 2E2GA 4ICYA 4RI7A 4EKZA 4Z7XA 1EV4A 2H1DA 4E68A 3H4KA 2H1LA 4WBRD 3WT2A 1PKZA 5DDLA 1G6YA 4ZL7A 1A8YA 3K8NA 3CYNA 4KUNA 3IHGA 3BJ5A 3GSTA 1DE1A 5CRHA 2GQKA 1EOHA 4CY6A 5ELGA 4OCEA 3TKRA 3KMOA 1A0FA 2H19A 4BA7A 4ECBA 1V58A 4MF5A 5A4WA 3TUEA 4LMWA 2E0QA 5CNWA 1H75A 4ZXGA 1F3BA 4TXOA 2HSMB 3VLNA 2DJ3A 4Q5QA 2VL3A 3FMWA 1JLVA 3FYGA 1FG4A 1F6MC 4K1FA 1UA5A 4I8BA 4ECIA 4WR4A 3ZMLA 2OE3A 3U6VA 2AB6A 2C80A 4N11A 4TR1B 2VUPA 3L4NA 2GQMA 1LJRA 2HSNA 2H30A 3KP8A 4XS1A 5ECIB 3E0UA 3BCKA 2K6VA 5IPHA 5A5HB 4GSNA 4OMVA 2H74A 1FO5A 5G5EA 3IV4A 2O87A 2H01A 3LEFA 5ECKB 3FEUA 4ZBBA 4CDOA 1GSSA 3GKMA 2HSYA 2F8AA 1B9XC 2DJJA 1AAZA 3UL3A 4Z2RA 1XWCA 4HZ2A 3RGBC 3TJKA 4PNFA 1XW9A 2B5EA 5ECSA 2PPTA 1ZYNA 3GYKA 1XBSA 3IDVA 2CVKA 4GQCA 4TR3A 4BL7A 5KN0A 1WIKA 1S3CA 1F3AA 5JCUA 3EYTA 1GUKA 1X0RA 2JACA 1K0AA 1B48A 4TRXA 3TKPA 3LWAA 2FA8A 2HQTA 2HSHA 3BCIA 6GSUA 2PGTA 4L0WA 1ACVA 4HQSA 3CTFA 3HVSA 3ZVJA 2RIIA 4D73A 1PQNA 4WEYA 4POBA 4MH2A 4G01A 2ES7A 3L9UA 2AAWA 2GSRA 2P5RA 3IPZA 2O3EA 2FY6A 4I97A 1MDIA 1N25A 1GUHA 2L57A 2UZ8A 4IVFA 1FB0A 3IRAA 1YJ6A 4EDZA 2WULA 1TXXA 4HZ4A 2B7KA 18GSA 1NM3A 4NWYA 1PX6A 2M72A 2FLSA 5GSTA 4NV2A 2DJ2A 1FOVA 2YZHA 1JZRA 1MDJA 4O5RA 2GTUA 3O6TA 5F05A 1JZWA 5ECRB 2R37A 4H86A 1SD9A 5IOWA 4KF9A 4HQZA 2PWJA 4PGTA 1GTUA 3FZ9A 3A5IA 3W8SA 2FD3A 3HJPA 1YY7A 2DJ1A 5GZZB 3HMJG 3LSZA 2TRCP 4K9ZA 2H1BA 1UC7A 3SBCA 5D96A 2A2SA 5E59A 1GTIA 1ST9A 3GSSA 4K8MA 2WW3A 3L9SA 4F2IA 2PUKC 1M9AA 2JZTA 1BQ7A 1KEBA 4KX4A 3VURA 4GQFA 1AIUA 3H1NA 4ZIJA 3G9BA 2OE1A 4ACSA 2LKUA 4MNNA 3DKSA 1Z7PA 5HFKA 1SJIA 1YEXA 3HHVA 5DJLA 1EEMA 5LD0A 4IKHA 1K3LA 2GSQA 4IHUA 5J4YA 3ME8A 5AIVA 2QKEA 2OJLA 1GSYA 3I9V2 1A0RP 4J57E 4XRAA 4AJ8A 1HYUA 2LTKA 2YJHA 3GL3A 1I1IP 4JE1A 4N0ZA 3MDKA 2OA7A 4G0LA 2EIQA 1LBKA 1DUGA 4TXOB 3ZZXA 1ZGNA 1O81A 1A23A 3CWGA 3VK9A 1OE7A 1F9MA 1W4VA 2VCZA 4CW9A 3TGZA 3CSHA 1Y25A 2HSNB 2DSAA 3VWXA 3HA9A 2HI7A 1BJXA 2H6YA 4WF4A 3G7JA 1SKWB 4ZB9A 5COHA 2IWTA 4LL4B 4BVXA 3UBLA 4MMMA 1WRYA 5D73A 1EEJA 2GLRA 4N0VA 3WT1A 5KOWA 2JZSA 5D8IA 5G1LA 5A5HA 4TKYA 1TU8A 3FK8A 1XWKA 3WGDA 4NHWA 3NZNA 5DALB 1EV9A 1SKSB 5DAKA 1G7OA 3ISOA 1OC9A 3ZL5A 1GNEA 2GSSA 2LJKA 9GSSA 1XCCA 4A5PA 2VKZG 4PQHA 1XWBA 3QFAC 1O85A 4MZWA 2G0FA 3E3EA 2H8LA 1TDIA 4IP6A 3KGKA 5B6NA 4DSQA 1PRXA 4I5QA 3BBYA 2L5OA 2YWIA 2I3YA 4XTSA 1A2MA 1SU9A 1UN2A 2GGTA 2DMMA 4HJMA 4MJAA 4YAPA 2FA4A 4BPYA 3LQ7A 4BL7B 1GSDA 3ERFA 2LNTA 5IM9A 2IPAA 3F4RA 1G0TA 1GRXA 1S4BP 3GFKA 3L0HA 1GNWA 2FHEA 3IK9A 1GSQA 3ZLPA 4FIWA 1SKRB 3C73A 3KEBA 1GWCA 4IQAA 5B8BA 1IYIA 3F3QA 3FR3A 2X8CA 2WRTA 2VO4A 3TKQA 4AKIA 2GZYA 2O36A 2NBSA 6GSXA 4OO5A 5IIZA 3UOMA 1TU7A 1Q98A 3FHKA 4PUFC 1SL0B 2RUEA 1XIYA 3RFRC 3GV1A 3ED3A 4D73B 4OFNA 2G2QA 1MD4A 3MIXA 3D22A 3DEXA 3UIWA 5ECNB 5DCGA 4TOPA 1VRSD 3C71A 5F0GA 3H79A 4TR4A 4GRFA 3M1GA 3BD2A 4HI7A 4ZBAA 3P7XA 3IOSA 3WGEA 4WXTA
chains in the Genus database with same CATH topology
2IMDA 5ID2A 3IA1A 3HY2A 2HZFA 2I9HA 1O73A 4AJ7A 1F37A 3DXBA 5CP1A 5FT3A 5J4VA 5KN3A 3A3TA 1SYRA 3LGCA 4USSA 4V2MA 1MTCA 3PINA 3LXTA 3R3EA 4OD7A 3UARA 3QAVA 1HNBA 3HJOA 3KCMA 2GT5A 4KH7A 3FRCA 3KH7A 4ZB8A 4MJCA 4MPFA 4IELA 2B1LA 2F8FA 3GURA 4PUAA 1R5PA 3DVWA 2A4HA 2NVLA 3TJFA 5KEJA 1TOFA 2VD1A 1GL8A 2C0GA 5CREA 3W8JA 3WGXA 1K3YA 4EIPA 4J56E 3I43A 5ECOB 3QFBC 1N2AA 2GSTA 3FZAA 1BYEA 3FR6A 4MDCA 6GSYA 5IO0A 5HR1A 1GSFA 5CRGA 1ZYPA 4I2UA 2R0GA 1YKAA 1NHOA 1PD21 1JFUA 4CY8A 4IBPA 2C3NA 1V9WA 3D21A 2P5QA 1FHEA 3VWUA 2JSZA 2CZ2A 5KN2A 3HD5A 1TP9A 5DQYA 4IGJA 3HXSA 1T4ZA 1CQHA 3DIEA 2OACA 3Q6OA 2VCTA 3VI5A 3ZMKA 1RW1A 2FWHA 1GLPA 2X8HA 4JU5A 1HNAA 1XW5A 3IHQA 4O32A 3VWWA 2HRKA 5ECQB 2CX3A 2KHPA 1X9MB 5ECPB 2N5BA 2N5AA 5HR3A 5D93A 4F0BA 1XVQA 5D9WA 5D9XA 3F9UA 2WB9A 1JZOA 1GULA 1FW1A 3RPNA 4IP1A 1U3AA 4XHMA 4IS0A 2I1UA 1AQWA 2QGVA 1OKTA 2FGXA 5FHIA 1DBYA 4POLA 1AUCA 1ZYQB 2VL9A 4YKFA 2DJ0A 5A1NA 4BVXB 1XWGA 1KNGA 3TJBA 5LCZA 2OE0A 5ABRA 5HQPA 3PH9A 3OR5A 2YANA 4AF2A 2GQLA 3PR8A 2XBQA 4PNGA 3D0ZA 1U6TA 2YZUA 3KXOA 4F82A 3RAZA 1JHBA 5DCHA 2CZ3A 5DAKB 2LUSA 1OC9B 2AV4A 5H5SA 1CQGA 5G5FA 2H76A 5DALA 4KNDA 3NOFA 3DWVA 3ERWA 1A8LA 5JWOB 1YEPA 1IYHA 2YWOA 1T4YA 5JWQB 5HR0A 5IMZA 1SENA 2RM6A 3EWLA 4EF0A 4WR5A 2REMA 2OKAA 5GAND 2NPBA 5EL8A 4AGSA 4JBBA 2LQQA 3QMXA 1K0CA 4FYUA 3HVVA 3GKKA 3H8QA 2B1KA 1WOUA 3F6DA 1B9YC 2O89A 1HQOA 4LMVA 3UVTA 3DMLA 1BG5A 2LQOA 5EVOA 2DLXA 5DQSA 1G7EA 3GH9A 5B6MA 1TJDA 4ILFA 2OT3A 3GKNA 1O7UA 3DRNA 2YV9A 2H1AA 4ECCA 16GSA 5KOXA 3O76A 3GNJA 2O5VA 1XZOA 1J08A 3G7YA 1XPVA 2X49A 2LJAA 5H5QA 5JWRB 5B8AA 4RQXA 1URMA 1SVLA 3WYWA 2PMTA 4OO4A 4E8HA 3EURA 3TRPA 3GH6A 2J23A 4IQ1A 2K8SA 4F9ZA 4OWYA 1SK1A 2FWGA 2H73A 3KP9A 3TKSA 3APOA 1Z9HA 4DSRA 3CSJA 5ID2B 1K0BA 3RHCA 3WD6A 4PURA 1BX9A 2J9HA 3G7IA 3M0FA 5CAXA 1O8XA 1XXUA 4KE3A 2L59A 1SVMA 2CQ9A 1TKDB 3GMFA 2RUFA 3RPPA 3EMPA 4G2EA 2HE3A 1X9SB 3CXGA 1M2BA 3M3MA 4MP4A 3GHAA 5DBQA 1TK5B 3KMNA 1TI1A 2HRAA 2B3SA 1I5GA 1GSUA 3EC3A 1JZDA 4IN0A 4WETA 1XOBA 2LRTA 2FNOA 1ERUA 1AW9A 1U88A 1YKCA 5ECLB 3GX0A 2ZCTA 5DJMA 4FH8A 1XWAA 5G31A 3KD0A 1GSEA 1V2AA 2IMEA 3F6FA 4J2FA 1B4QA 2CAIA 3QDNA 2VL2C 1V40A 2L6CA 5HFGA 2YJ7A 1TK8B 2R6KA 4QQ7A 2H6ZA 3S9FA 2K18A 1R26A 4PQIA 1VF2A 2TIRA 4JEDA 1GH2A 4FYBA 4RUVA 3VPQA 3TCOA 6GSWA 2V32A 3ZIVA 2HNLA 2IL3A 4L5LA 2B7JA 1YVLA 4L0UA 5IQYA 1X5CA 2QA1A 4YKGA 2AYTA 5LNKe 3HCZA 4KSMA 1A2JA 3F0IA 2YCDA 2R2JA 4KCAA 2VOCA 3ERGA 3IAM2 3W6GA 5AIXA 4Z2UA 1J9BA 3CSIA 3QAGA 2LEGA 4AI6A 1TRSA 2HRKB 4K2DA 3MAKA 3EPTA 3I6AA 2EFEA 1YDKA 2A4VA 4XCSA 3TJJA 1SK0A 2GS3A 4ID0A 2WCIA 5J47A 4L5OA 3EMXA 2NTOA 3GTUB 5IMFA 4ZILA 5GAPD 3L9VA 3CTGA 3FY7A 2DBCA 1EGOA 4WKWA 2GVPA 1J0FA 2DIYA 3MSZA 2LS5A 2ALBA 3APQA 3CRTA 7GSSA 4POMA 3GL5A 4Q5RA 5A1NB 1HD2A 3IXRA 1EZKA 2EIOA 3ZVJD 1XFLA 2VCWA 5J41A 4BWSA 3ME7A 2VAFA 3RHBA 2VLUA 3DGQA 5ELAA 2WGRA 5D9VA 2PU9C 2F9SA 2IMKA 1OE8A 5DVBA 3ZTLA 2R5GA 5A5KA 4N3ZA 1R5AA 1X5DA 4K2XA 3APSA 4IJIA 4AKXB 2H71A 2M46A 1ZMAA 1YQ1A 3TDGA 1PX7A 2H0GA 3P8WA 4HJ2A 4GDFA 4GSTA 3SWLA 4RI6A 4NV5A 4I6XA 1TRUA 5G1KA 2PN8A 3UJ1A 4EVMA 1K0MA 4G0IA 1GLQA 2HZEA 3MNGA 4EIQA 4WF5A 5JCWA 1TW9A 4X4JA 2X64A 5IMVA 2BTOT 3GX8A 2O7KA 5A34A 1M2AA 2IIYA 1NW2A 1BF5A 1PMTA 5C00A 5J9BA 1PKWA 4K7IA 2HFDA 3MYDA 1VGLA 1WMJA 2V2GA 3RBTA 2YV7A 1K3OA 1X5EA 4HS1A 1EWXA 1USBA 2KP1A 4MF7A 1NSWA 3TOUA 3VFIA 5A4VA 3HVXA 1AQVA 1QUWA 2H66A 2MMAA 2R4VA 5ECMB 3D4MA 3RDWA 3M9JA 2I4AA 3US3A 1U3IA 1DSBA 4IJ3A 1QFNA 1WPIA 4MZBA 4AJ6A 2P31A 1V57A 4DSSB 3M9KA 4DEJA 1OC8A 3F4SA 5CRDA 1TXUA 2O8VB 4KDXA 1UVZA 4NPBA 1ABAA 1AC1A 2WDUA 5EPFA 1GUMA 1A24A 2K8VA 3HJMA 4EDYA 4EE0A 3IR4A 3F63A 2IFQA 1PN0A 2AHEA 3IC8A 10GSA 2KP2A 2YPMA 4K5RA 4NHZA 4YQMA 4NXIA 1WP0A 2F3MA 2F51A 2KOKA 2L6DA 1M99A 3GIXA 2BJXA 2DMLA 3TU3B 3KH9A 1ON4A 2VCVA 3VPTA 4MJBA 2GT6A 1AXDA 4P3YB 1SL2B 2EC4A 2V1MA 2LRCA 3N5OA 2R0CA 4YQVA 1TI3A 2EFDA 2L4CA 4DVCA 4Z2TA 1BG1A 1ZOFA 2VIMA 2C0EA 2A2PA 3TJGA 1Z6MA 1OVNA 3R2QA 2H72A 4K5SA 1QXHA 2MZCA 2PVQA 3C8EA 3IE3A 2JADA 3A2XA 3QCPA 2NDOA 3VWVA 5AN1A 4ZB7A 1KBNA 4G19A 2GZPA 1Z5YE 3DYRA 4JR6A 5J40A 5CO3A 3GUSA 4ML6A 3UMAA 3QOUA 3UAPA 3M8NA 2O85A 3EINA 4ML1A 2C1YA 2WZ9A 4K0NA 1AQXA 4PTSA 4BVYA 2TRXA 4G10A 1T1VA 4HDEA 2XBIA 4V1Ap 3MWHA 3LORA 4KDYA 1XOAA 5F07A 2YWNA 1M2DA 1PA3A 2H0HA 3IC4A 1W89A 3ZIJA 3Q18A 2H70A 3A5WA 2X4AA 4JR4A 1SD8A 3GTUA 2Z9SA 4OCFA 2ZNMA 2YOIA 4ZB6A 2YN1A 3KIJA 4EL1A 4W66A 1PL2A 3ZYWA 4POKA 4TXVA 1ERTA 1Z3EA 1U87A 2GZZA 13GSA 2M80A 2HT9A 1X9WB 1PSQA 4GTUA 4CHSA 2VLTA 4V2NA 3HKRA 4LA1A 3P90A 5J4UA 2C4JA 3J7Yb 2HRFA 2LV3A 4GCIA 2HLSA 3JCML 4QL7A 2MBTA 4MA9A 2VM1A 14GSA 3KTLA 2MBSA 2L4QA 1S3AA 3HDCA 4EO3A 2IMIA 5L71A 4XRDA 1QGVA 4MCUA 2H0IA 4LLRA 1N8JA 1TRVA 4KDUA 3DD3A 2WJUA 3QR6A 1BEDA 1GTBA 4WBJA 3CRUA 2HZEB 1ML6A 4XS4A 3TKSC 3LG6A 2FUG2 2PERA 3IAS2 2K9FA 1Z6NA 4MH3A 3C1SA 5A34B 5J5NA 2V6KA 4GWRA 4V1Ag 3UBKA 1RQMA 3V1WA 1JLWA 3QPMA 1FOHA 4TVEA 2XPDA 2R0PA 2CA8A 3FR9A 1EGRA 1WE0A 2E7PA 1HNCA 2FWEA 1LU4A 4Q5NA 3DVXA 6GSSA 2OBKA 3FKFA 1TRWA 4MZCA 2P0GA 2DKHA 5INYA 2EFHA 2HXKA 3UEMA 2H75A 1GP1A 2QA2A 2VCQA 2JSYA 2OBIA 4F0CA 5IMAA 5D9TA 5F8BA 4GXZA 1YF1A 1BAYA 4ZL9A 4FYCA 4XIHA 4QMKA 1OKDA 4OFTA 1V98A 5ECHB 4DSSA 2H6XA 4MPGA 2HRNA 1T3BA 4HOJA 5CYYA 5J9CA 3PPUA 3EE2A 1F2EA 2DKIA 3A2WA 2DC5A 4AKHA 1FVKA 3L78A 3NIVA 2XHFA 2L5LA 4HU9A 3PGTA 2IFQB 2VLVA 1C72A 2FWFA 3ZFBA 3F8UA 2VM2A 1H4OA 20GSA 3LJRA 3H93A 1S3DA 2I81A 2KLXA 5J3RA 4G0KA 2MMZA 2JZRA 4HUAA 2DJKA 8GSSA 2V6OA 3D4TA 2CX4A 4GF0A 1FAAA 3ZREA 2C8UA 1R4WA 5IO2A 2MMOA 1Z7RA 3KM6A 3LYKA 5BMUA 1XVWA 4KAEA 4MLYA 4OFMA 2B5YA 2PVOC 3IBHA 1MEKA 4N10A 4HU7A 5B7CA 5IMCA 4BWQA 22GSA 1B8XA 1QK8A 5BRTA 3TRXA 1I9DA 1WWJA 3CBUA 1T8EB 4MJEA 3QAWA 4ISDA 4K7NA 2EIRA 4ULXA 3F4TA 1OAZA 1MD3A 1ZYEA 4BVYB 2FCHA 1GTAA 3F3RA 2CVDA 4YH2A 3CMIA 2JL4A 2CAQA 3EU4A 3C7MA 6GSVA 5G2ZA 4RQRA 1XW6A 4K7OA 3ZRDA 2C3TA 1RK4A 1FVJA 1FB6A 1M9BA 4I2TA 5C04A 1M7TA 5HR2A 1ZZYA 1OYJA 4PX1A 4O5QA 1PN9A 4XS6A 5E4WA 1SYXA 2C0FA 1SL1B 3FZ4A 3UVHA 2HSMA 2LNSA 2VL2A 2C0DA 1O8WA 5JCGA 2UV8G 2RM5A 1OC3A 1QQ2A 3TOTA 3GKXA 4TR1A 3TB2A 1T00A 2EFCA 1EP8A 3KJYA 4NAXA 3HZ4A 3VI7A 1R7HA 2E2MA 4HEA2 3D5JA 5EY6A 4NMUA 1Y6EA 5ENUA 1A2LA 11GSA 4TW5A 2CV4A 4KCEA 2MMNA 1K0DA 2X99A 1VF3A 3P2AA 1THOA 4XS4B 4KSOA 4AKGA 1VF1A 2JU5A 2KUCA 2WFCA 2LSTA 2AUVA 1PL1A 4X0XA 3ZFLA 5IOXA 5HFIA 4V2LA 2PBJA 5FWGA 1E2YA 3HYPA 1T7PB 3D6IA 2BMXA 1YZXA 3FW2A 2ON5A 4LL1B 4Q5FA 4TN8A 3QD9A 1SK2A 2WS2A 5A4UA 6GSTA 5F06A 2C3QA 5GSSA 1WJKA 3TRQA 4ECJA 4FO5A 2LJRA 3Q19A 2IN3A 2CVBA 2DIZA 4EC0A 12GSA 4KGIA 4IW9A 1Q4JA 19GSA 4X1UA 1ILOA 2IJYA 3Q74A 2X8GA 3FZ5A 3GA4A 1EOGA 5AISA 4FQUA 1K0OA 3HZ8A 4JZQA 4O92A 2YNXA 3LFLA 2ON7A 4EXJA 5CRWA 3TKSE 2QSIA 2ZUPA 1SJZA 1DE2A 3I69A 3LW9A 1VF4A 4G9HA 3IK7A 3LXZA 2CT6A 1KTEA 5H5RA 2B6MA 1SVOA 17GSA 4YQUA 2R3XA 1MDKA 3GN3A 5IMDA 3GRXA 4O7HA 4ZBDA 2MYGA 2GDRA 4QL9A 4N30A 2V41A 4TR0A 4JRRA 4PXOA 2IMFA 2RLIA 2OADA 4K6XA 4KA0A 5AGYA 1ZL9A 2D2ZA 3AY8A 4MABA 2LRNA 2H1GA 4K0GA 3ZITA 4GLTA 2QC7A 2A2RA 3J7Yk 5IPGA 1O6JA 5KN1A 1SJ6A 4ZL8A 1G6WA 2XPEA 4YAVA 1E6BA 4O5UA 1ZCPA 1ERWA 2HYXA 2YWMA 3KTBA 5BMUB 3U5RE 3C1RA 2B5XA 5G30A 2N5FA 2XC2A 2VCXA 4GSSA 4E8EA 4PQ1A 1QMVA 4F03A 1ERVA 1M0UA 3BOAA 1TTZA 3A2VA 4MF6A 1THXA 1PGTA 3N9JA 4KW6A 4EUYA 4L8EA 1K0NA 3EVIA 1YF0A 4MK3A 2YP6A 1NHYA 1TK0B 2AJQB 3E9JB 4X43A 3LYPA 3KZQA 1EP7A 3O3TA 4KB3A 1B4PA 3EU3A 2VD0A 1Y1UA 2E2GA 4ICYA 4RI7A 4EKZA 4Z7XA 1EV4A 2H1DA 4E68A 3H4KA 2H1LA 4WBRD 3WT2A 1PKZA 5DDLA 1G6YA 4ZL7A 1A8YA 3K8NA 3CYNA 4KUNA 3IHGA 3BJ5A 3GSTA 1DE1A 5CRHA 2GQKA 1EOHA 4CY6A 5ELGA 4OCEA 3TKRA 3KMOA 1A0FA 2H19A 4BA7A 4ECBA 1V58A 4MF5A 5A4WA 3TUEA 4LMWA 2E0QA 5CNWA 1H75A 4ZXGA 1F3BA 4TXOA 2HSMB 3VLNA 2DJ3A 4Q5QA 2VL3A 3FMWA 1JLVA 3FYGA 1FG4A 1F6MC 4K1FA 1UA5A 4I8BA 4ECIA 4WR4A 3ZMLA 2OE3A 3U6VA 2AB6A 2C80A 4N11A 4TR1B 2VUPA 3L4NA 2GQMA 1LJRA 2HSNA 2H30A 3KP8A 4XS1A 5ECIB 3E0UA 3BCKA 2K6VA 5IPHA 5A5HB 4GSNA 4OMVA 2H74A 1FO5A 5G5EA 3IV4A 2O87A 2H01A 3LEFA 5ECKB 3FEUA 4ZBBA 4CDOA 1GSSA 3GKMA 2HSYA 2F8AA 1B9XC 2DJJA 1AAZA 3UL3A 4Z2RA 1XWCA 4HZ2A 3TJKA 4PNFA 1XW9A 2B5EA 5ECSA 2PPTA 1ZYNA 3GYKA 1XBSA 3IDVA 2CVKA 4GQCA 4TR3A 4BL7A 5KN0A 1WIKA 1S3CA 1F3AA 5JCUA 3EYTA 1GUKA 1X0RA 2JACA 1K0AA 1B48A 4TRXA 3TKPA 3LWAA 2FA8A 2HQTA 2HSHA 3BCIA 6GSUA 2PGTA 4L0WA 1ACVA 4HQSA 3CTFA 3HVSA 3ZVJA 2RIIA 4D73A 1PQNA 4WEYA 4POBA 4MH2A 4G01A 2ES7A 3L9UA 2AAWA 2GSRA 2P5RA 3IPZA 2FY6A 4I97A 1MDIA 1N25A 1GUHA 2L57A 2UZ8A 4IVFA 1FB0A 3IRAA 1YJ6A 4EDZA 2WULA 1TXXA 4HZ4A 2B7KA 18GSA 1NM3A 4NWYA 1PX6A 2M72A 2FLSA 5GSTA 4NV2A 2DJ2A 1FOVA 2YZHA 1JZRA 1MDJA 4O5RA 2GTUA 3O6TA 5F05A 1JZWA 5ECRB 2R37A 4H86A 1SD9A 5IOWA 4KF9A 4HQZA 2PWJA 4PGTA 1GTUA 3FZ9A 3A5IA 3W8SA 2FD3A 3HJPA 1YY7A 2DJ1A 5GZZB 3HMJG 3LSZA 2TRCP 4K9ZA 2H1BA 1UC7A 3SBCA 5D96A 2A2SA 5E59A 1GTIA 1ST9A 3GSSA 4K8MA 3L9SA 4F2IA 2PUKC 1M9AA 2JZTA 1BQ7A 1KEBA 4KX4A 3VURA 4GQFA 1AIUA 3H1NA 4ZIJA 3G9BA 2OE1A 4ACSA 2LKUA 4MNNA 3DKSA 1Z7PA 5HFKA 1SJIA 1YEXA 3HHVA 5DJLA 1EEMA 5LD0A 4IKHA 1K3LA 2GSQA 4IHUA 5J4YA 3ME8A 5AIVA 2QKEA 2OJLA 1GSYA 3I9V2 1A0RP 4J57E 4XRAA 4AJ8A 1HYUA 2LTKA 2YJHA 3GL3A 4JE1A 4N0ZA 3MDKA 2OA7A 4G0LA 2EIQA 1LBKA 1DUGA 4TXOB 3ZZXA 1ZGNA 1O81A 1A23A 3CWGA 3VK9A 1OE7A 1F9MA 1W4VA 2VCZA 4CW9A 3TGZA 3CSHA 1Y25A 2HSNB 2DSAA 3VWXA 3HA9A 2HI7A 1BJXA 2H6YA 4WF4A 3G7JA 1SKWB 4ZB9A 5COHA 2IWTA 4LL4B 4BVXA 3UBLA 4MMMA 1WRYA 5D73A 1EEJA 2GLRA 4N0VA 3WT1A 5KOWA 2JZSA 5D8IA 5G1LA 5A5HA 4TKYA 1TU8A 3FK8A 1XWKA 3WGDA 4NHWA 3NZNA 5DALB 1EV9A 1SKSB 5DAKA 1G7OA 3ISOA 1OC9A 3ZL5A 1GNEA 2GSSA 2LJKA 9GSSA 1XCCA 4A5PA 2VKZG 4PQHA 1XWBA 3QFAC 1O85A 4MZWA 2G0FA 3E3EA 2H8LA 1TDIA 4IP6A 3KGKA 5B6NA 4DSQA 1PRXA 4I5QA 3BBYA 2L5OA 2YWIA 2I3YA 4XTSA 1A2MA 1SU9A 1UN2A 2GGTA 2DMMA 4HJMA 4MJAA 4YAPA 2FA4A 4BPYA 3LQ7A 4BL7B 1GSDA 3ERFA 2LNTA 5IM9A 2IPAA 3F4RA 1G0TA 1GRXA 3GFKA 3L0HA 1GNWA 2FHEA 3IK9A 1GSQA 3ZLPA 4FIWA 1SKRB 3C73A 3KEBA 1GWCA 4IQAA 5B8BA 1IYIA 3F3QA 3FR3A 2X8CA 2WRTA 2VO4A 3TKQA 4AKIA 2GZYA 2NBSA 6GSXA 4OO5A 5IIZA 3UOMA 1TU7A 1Q98A 3FHKA 4PUFC 1SL0B 2RUEA 1XIYA 3GV1A 3ED3A 4D73B 4OFNA 2G2QA 1MD4A 3MIXA 3D22A 3DEXA 3UIWA 5ECNB 5DCGA 4TOPA 1VRSD 3C71A 5F0GA 3H79A 4TR4A 4GRFA 3M1GA 3BD2A 4HI7A 4ZBAA 3P7XA 3IOSA 3WGEA 4WXTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IMD A;  5ID2 A;  3IA1 A;  3HY2 A;  2HZF A;  2I9H A;  1O73 A;  4AJ7 A;  1F37 A;  3DXB A;  5CP1 A;  5FT3 A;  5KN3 A;  3A3T A;  1SYR A;  3LGC A;  4USS A;  4V2M A;  1MTC A;  3PIN A;  3LXT A;  3R3E A;  4OD7 A;  3UAR A;  3QAV A;  1HNB A;  3HJO A;  3KCM A;  2GT5 A;  4KH7 A;  3FRC A;  3KH7 A;  4ZB8 A;  4MJC A;  4MPF A;  4IEL A;  2B1L A;  2F8F A;  3GUR A;  4PUA A;  1R5P A;  3DVW A;  2NVL A;  3TJF A;  5KEJ A;  1TOF A;  2VD1 A;  1GL8 A;  2C0G A;  5CRE A;  3W8J A;  3WGX A;  1K3Y A;  4J56 E;  3I43 A;  5ECO B;  3QFB C;  1N2A A;  2GST A;  3FZA A;  1BYE A;  3FR6 A;  4MDC A;  6GSY A;  5IO0 A;  5HR1 A;  1GSF A;  5CRG A;  4I2U A;  1YKA A;  1NHO A;  1PD2 1;  1JFU A;  4IBP A;  2C3N A;  1V9W A;  3D21 A;  2P5Q A;  1FHE A;  3VWU A;  2JSZ A;  2CZ2 A;  5KN2 A;  3HD5 A;  1TP9 A;  5DQY A;  4IGJ A;  3HXS A;  1T4Z A;  1CQH A;  3DIE A;  2OAC A;  3Q6O A;  2VCT A;  3VI5 A;  3ZMK A;  1RW1 A;  2FWH A;  1GLP A;  2X8H A;  4JU5 A;  1HNA A;  1XW5 A;  3IHQ A;  4O32 A;  3VWW A;  2HRK A;  5ECQ B;  2CX3 A;  2KHP A;  1X9M B;  5ECP B;  2N5B A;  2N5A A;  5HR3 A;  5D93 A;  4F0B A;  1XVQ A;  5D9W A;  5D9X A;  3F9U A;  2WB9 A;  1JZO A;  1GUL A;  1FW1 A;  3RPN A;  4IP1 A;  1U3A A;  4XHM A;  4IS0 A;  2I1U A;  1AQW A;  2QGV A;  1OKT A;  2FGX A;  5FHI A;  1DBY A;  4POL A;  1AUC A;  1ZYQ B;  2VL9 A;  2DJ0 A;  4BVX B;  1XWG A;  1KNG A;  3TJB A;  5LCZ A;  2OE0 A;  5ABR A;  5HQP A;  3PH9 A;  3OR5 A;  2YAN A;  4AF2 A;  2GQL A;  3PR8 A;  2XBQ A;  4PNG A;  3D0Z A;  1U6T A;  2YZU A;  3KXO A;  4F82 A;  3RAZ A;  1JHB A;  5DCH A;  2CZ3 A;  5DAK B;  2LUS A;  1OC9 B;  2AV4 A;  5H5S A;  1CQG A;  5G5F A;  2H76 A;  5DAL A;  4KND A;  3NOF A;  3DWV A;  3ERW A;  1A8L A;  5JWO B;  1YEP A;  1IYH A;  2YWO A;  1T4Y A;  5JWQ B;  5HR0 A;  5IMZ A;  1SEN A;  2RM6 A;  3EWL A;  4EF0 A;  4WR5 A;  2REM A;  2OKA A;  5GAN D;  2NPB A;  5EL8 A;  4AGS A;  4JBB A;  2LQQ A;  3QMX A;  1K0C A;  4FYU A;  3HVV A;  3GKK A;  3H8Q A;  2B1K A;  1WOU A;  3F6D A;  1B9Y C;  2O89 A;  1HQO A;  4LMV A;  3UVT A;  3DML A;  1BG5 A;  2LQO A;  5EVO A;  2DLX A;  5DQS A;  1G7E A;  3GH9 A;  5B6M A;  1TJD A;  4ILF A;  3GKN A;  1O7U A;  3DRN A;  2YV9 A;  2H1A A;  4ECC A;  16GS A;  3O76 A;  3GNJ A;  1XZO A;  1J08 A;  3G7Y A;  1XPV A;  2LJA A;  5H5Q A;  5JWR B;  5B8A A;  4RQX A;  1URM A;  3WYW A;  2PMT A;  4OO4 A;  4E8H A;  3EUR A;  3TRP A;  3GH6 A;  2J23 A;  4IQ1 A;  2K8S A;  4F9Z A;  4OWY A;  1SK1 A;  2FWG A;  2H73 A;  3KP9 A;  3TKS A;  3APO A;  1Z9H A;  4DSR A;  3CSJ A;  5ID2 B;  1K0B A;  3RHC A;  3WD6 A;  4PUR A;  1BX9 A;  2J9H A;  3G7I A;  3M0F A;  5CAX A;  1O8X A;  1XXU A;  4KE3 A;  2L59 A;  2CQ9 A;  1TKD B;  3GMF A;  2RUF A;  3RPP A;  3EMP A;  4G2E A;  2HE3 A;  1X9S B;  3CXG A;  1M2B A;  3M3M A;  4MP4 A;  3GHA A;  5DBQ A;  1TK5 B;  3KMN A;  1TI1 A;  2HRA A;  2B3S A;  1I5G A;  1GSU A;  3EC3 A;  1JZD A;  4IN0 A;  4WET A;  1XOB A;  2LRT A;  2FNO A;  1ERU A;  1AW9 A;  1U88 A;  1YKC A;  5ECL B;  3GX0 A;  2ZCT A;  5DJM A;  4FH8 A;  1XWA A;  5G31 A;  3KD0 A;  1GSE A;  1V2A A;  2IME A;  3F6F A;  4J2F A;  1B4Q A;  2CAI A;  3QDN A;  2VL2 C;  1V40 A;  2L6C A;  5HFG A;  2YJ7 A;  1TK8 B;  2R6K A;  4QQ7 A;  2H6Z A;  3S9F A;  2K18 A;  1R26 A;  4PQI A;  1VF2 A;  2TIR A;  4JED A;  1GH2 A;  4FYB A;  4RUV A;  3VPQ A;  3TCO A;  6GSW A;  2V32 A;  3ZIV A;  2HNL A;  2IL3 A;  4L5L A;  2B7J A;  4L0U A;  5IQY A;  1X5C A;  2AYT A;  5LNK e;  3HCZ A;  4KSM A;  1A2J A;  3F0I A;  2YCD A;  2R2J A;  4KCA A;  2VOC A;  3ERG A;  3IAM 2;  3W6G A;  5AIX A;  1J9B A;  3CSI A;  3QAG A;  2LEG A;  1TRS A;  2HRK B;  4K2D A;  3MAK A;  3I6A A;  1YDK A;  2A4V A;  4XCS A;  3TJJ A;  1SK0 A;  2GS3 A;  4ID0 A;  2WCI A;  4L5O A;  3EMX A;  2NTO A;  3GTU B;  5IMF A;  4ZIL A;  5GAP D;  3L9V A;  3CTG A;  3FY7 A;  2DBC A;  1EGO A;  4WKW A;  2GVP A;  1J0F A;  2DIY A;  2LS5 A;  3MSZ A;  2ALB A;  3APQ A;  3CRT A;  7GSS A;  4POM A;  3GL5 A;  4Q5R A;  1HD2 A;  3IXR A;  1EZK A;  2EIO A;  3ZVJ D;  1XFL A;  2VCW A;  5J41 A;  4BWS A;  3ME7 A;  2VAF A;  3RHB A;  2VLU A;  3DGQ A;  5ELA A;  2WGR A;  5D9V A;  2PU9 C;  2F9S A;  2IMK A;  1OE8 A;  5DVB A;  3ZTL A;  2R5G A;  5A5K A;  1R5A A;  1X5D A;  3APS A;  4IJI A;  2H71 A;  2M46 A;  1ZMA A;  1YQ1 A;  3TDG A;  1PX7 A;  2H0G A;  3P8W A;  4HJ2 A;  4GST A;  3SWL A;  4RI6 A;  4NV5 A;  4I6X A;  1TRU A;  5G1K A;  2PN8 A;  3UJ1 A;  4EVM A;  1K0M A;  4G0I A;  1GLQ A;  2HZE A;  3MNG A;  4WF5 A;  5JCW A;  1TW9 A;  2X64 A;  5IMV A;  2BTO T;  3GX8 A;  2O7K A;  1M2A A;  2IIY A;  1NW2 A;  1PMT A;  5C00 A;  5J9B A;  1PKW A;  4K7I A;  2HFD A;  1VGL A;  1WMJ A;  2V2G A;  3RBT A;  2YV7 A;  1K3O A;  1X5E A;  4HS1 A;  1EWX A;  1USB A;  2KP1 A;  4MF7 A;  1NSW A;  3TOU A;  3VFI A;  5A4V A;  3HVX A;  1AQV A;  1QUW A;  2H66 A;  2MMA A;  2R4V A;  5ECM B;  3D4M A;  3RDW A;  3M9J A;  2I4A A;  3US3 A;  1U3I A;  1DSB A;  4IJ3 A;  1QFN A;  1WPI A;  4MZB A;  4AJ6 A;  2P31 A;  1V57 A;  4DSS B;  3M9K A;  4DEJ A;  1OC8 A;  3F4S A;  5CRD A;  2O8V B;  4KDX A;  1UVZ A;  4NPB A;  1ABA A;  1AC1 A;  2WDU A;  5EPF A;  1GUM A;  1A24 A;  2K8V A;  3HJM A;  4EDY A;  4EE0 A;  3IR4 A;  3F63 A;  2IFQ A;  2AHE A;  3IC8 A;  10GS A;  2KP2 A;  2YPM A;  4NHZ A;  4YQM A;  4NXI A;  1WP0 A;  2F3M A;  2F51 A;  2KOK A;  2L6D A;  1M99 A;  3GIX A;  2BJX A;  2DML A;  3KH9 A;  1ON4 A;  2VCV A;  3VPT A;  4MJB A;  2GT6 A;  1AXD A;  4P3Y B;  1SL2 B;  2EC4 A;  2V1M A;  2LRC A;  3N5O A;  4YQV A;  1TI3 A;  2L4C A;  4DVC A;  1ZOF A;  2VIM A;  2C0E A;  3TJG A;  1Z6M A;  1OVN A;  3R2Q A;  2H72 A;  1QXH A;  2MZC A;  2PVQ A;  3C8E A;  3IE3 A;  2JAD A;  3A2X A;  3QCP A;  2NDO A;  3VWV A;  5AN1 A;  1KBN A;  4G19 A;  2GZP A;  1Z5Y E;  3DYR A;  4JR6 A;  5CO3 A;  3GUS A;  4ML6 A;  3UMA A;  3QOU A;  3UAP A;  3M8N A;  2O85 A;  3EIN A;  4ML1 A;  2C1Y A;  2WZ9 A;  4K0N A;  1AQX A;  4PTS A;  4BVY A;  2TRX A;  4G10 A;  1T1V A;  4HDE A;  2XBI A;  4V1A p;  3MWH A;  3LOR A;  4KDY A;  1XOA A;  5F07 A;  2YWN A;  1M2D A;  1PA3 A;  2H0H A;  3IC4 A;  1W89 A;  3ZIJ A;  3Q18 A;  2H70 A;  3A5W A;  4JR4 A;  1SD8 A;  3GTU A;  2Z9S A;  4OCF A;  2ZNM A;  2YOI A;  4ZB6 A;  2YN1 A;  3KIJ A;  4EL1 A;  1PL2 A;  3ZYW A;  4POK A;  4TXV A;  1ERT A;  1Z3E A;  1U87 A;  2GZZ A;  13GS A;  2M80 A;  2HT9 A;  1X9W B;  1PSQ A;  4GTU A;  4CHS A;  2VLT A;  4V2N A;  3HKR A;  4LA1 A;  3P90 A;  5J4U A;  2C4J A;  3J7Y b;  2HRF A;  2LV3 A;  4GCI A;  2HLS A;  3JCM L;  4QL7 A;  2MBT A;  4MA9 A;  2VM1 A;  14GS A;  3KTL A;  2MBS A;  2L4Q A;  1S3A A;  3HDC A;  4EO3 A;  2IMI A;  5L71 A;  4XRD A;  1QGV A;  4MCU A;  2H0I A;  4LLR A;  1N8J A;  1TRV A;  4KDU A;  3DD3 A;  2WJU A;  3QR6 A;  1BED A;  1GTB A;  4WBJ A;  3CRU A;  2HZE B;  1ML6 A;  4XS4 A;  3TKS C;  3LG6 A;  2FUG 2;  2PER A;  3IAS 2;  2K9F A;  1Z6N A;  4MH3 A;  3C1S A;  5J5N A;  2V6K A;  4GWR A;  4V1A g;  3UBK A;  1RQM A;  3V1W A;  1JLW A;  3QPM A;  4TVE A;  2XPD A;  2CA8 A;  3FR9 A;  1EGR A;  1WE0 A;  2E7P A;  1HNC A;  2FWE A;  1LU4 A;  4Q5N A;  3DVX A;  6GSS A;  2OBK A;  3FKF A;  1TRW A;  4MZC A;  2P0G A;  5INY A;  3UEM A;  2HXK A;  2H75 A;  1GP1 A;  2VCQ A;  2JSY A;  2OBI A;  4F0C A;  5IMA A;  5D9T A;  5F8B A;  4GXZ A;  1YF1 A;  1BAY A;  4ZL9 A;  4FYC A;  4XIH A;  1OKD A;  4OFT A;  1V98 A;  5ECH B;  4DSS A;  2H6X A;  4MPG A;  2HRN A;  1T3B A;  4HOJ A;  5CYY A;  5J9C A;  3PPU A;  3EE2 A;  1F2E A;  3A2W A;  2DC5 A;  1FVK A;  3L78 A;  3NIV A;  2XHF A;  2L5L A;  4HU9 A;  3PGT A;  2IFQ B;  2VLV A;  1C72 A;  2FWF A;  3ZFB A;  3F8U A;  2VM2 A;  1H4O A;  20GS A;  3LJR A;  3H93 A;  1S3D A;  2I81 A;  2KLX A;  5J3R A;  4G0K A;  2MMZ A;  2JZR A;  4HUA A;  2DJK A;  8GSS A;  2V6O A;  3D4T A;  2CX4 A;  4GF0 A;  1FAA A;  3ZRE A;  2C8U A;  1R4W A;  5IO2 A;  2MMO A;  1Z7R A;  3KM6 A;  3LYK A;  5BMU A;  1XVW A;  4KAE A;  4MLY A;  4OFM A;  2B5Y A;  2PVO C;  3IBH A;  1MEK A;  4N10 A;  4HU7 A;  5B7C A;  5IMC A;  4BWQ A;  22GS A;  1B8X A;  1QK8 A;  3TRX A;  1I9D A;  1WWJ A;  3CBU A;  1T8E B;  4MJE A;  3QAW A;  4ISD A;  4K7N A;  2EIR A;  4ULX A;  3F4T A;  1OAZ A;  1MD3 A;  1ZYE A;  4BVY B;  2FCH A;  1GTA A;  3F3R A;  2CVD A;  4YH2 A;  3CMI A;  2JL4 A;  2CAQ A;  3EU4 A;  3C7M A;  6GSV A;  5G2Z A;  4RQR A;  1XW6 A;  4K7O A;  3ZRD A;  2C3T A;  1RK4 A;  1FVJ A;  1FB6 A;  1M9B A;  4I2T A;  5C04 A;  1M7T A;  5HR2 A;  1ZZY A;  1OYJ A;  4PX1 A;  1PN9 A;  4XS6 A;  5E4W A;  1SYX A;  2C0F A;  1SL1 B;  3FZ4 A;  3UVH A;  2HSM A;  2LNS A;  2VL2 A;  2C0D A;  1O8W A;  5JCG A;  2RM5 A;  1OC3 A;  1QQ2 A;  3TOT A;  3GKX A;  4TR1 A;  3TB2 A;  1T00 A;  1EP8 A;  3KJY A;  4NAX A;  3HZ4 A;  3VI7 A;  1R7H A;  2E2M A;  4HEA 2;  3D5J A;  5EY6 A;  4NMU A;  1Y6E A;  5ENU A;  1A2L A;  11GS A;  4TW5 A;  2CV4 A;  4KCE A;  2MMN A;  1K0D A;  2X99 A;  1VF3 A;  3P2A A;  1THO A;  4XS4 B;  4KSO A;  1VF1 A;  2JU5 A;  2KUC A;  2WFC A;  2LST A;  2AUV A;  1PL1 A;  4X0X A;  3ZFL A;  5IOX A;  5HFI A;  4V2L A;  2PBJ A;  5FWG A;  1E2Y A;  3HYP A;  1T7P B;  3D6I A;  2BMX A;  1YZX A;  3FW2 A;  2ON5 A;  4LL1 B;  4Q5F A;  4TN8 A;  3QD9 A;  1SK2 A;  2WS2 A;  5A4U A;  6GST A;  5F06 A;  2C3Q A;  5GSS A;  1WJK A;  3TRQ A;  4ECJ A;  4FO5 A;  2LJR A;  3Q19 A;  2IN3 A;  2CVB A;  2DIZ A;  4EC0 A;  12GS A;  4KGI A;  4IW9 A;  1Q4J A;  19GS A;  4X1U A;  1ILO A;  2IJY A;  3Q74 A;  2X8G A;  3FZ5 A;  3GA4 A;  1EOG A;  5AIS A;  4FQU A;  1K0O A;  3HZ8 A;  4JZQ A;  4O92 A;  2YNX A;  3LFL A;  2ON7 A;  4EXJ A;  5CRW A;  3TKS E;  2QSI A;  2ZUP A;  1SJZ A;  1DE2 A;  3I69 A;  1VF4 A;  4G9H A;  3IK7 A;  3LXZ A;  2CT6 A;  1KTE A;  5H5R A;  2B6M A;  17GS A;  4YQU A;  2R3X A;  1MDK A;  3GN3 A;  5IMD A;  3GRX A;  4O7H A;  4ZBD A;  2MYG A;  2GDR A;  4QL9 A;  4N30 A;  2V41 A;  4TR0 A;  4JRR A;  4PXO A;  2IMF A;  2RLI A;  2OAD A;  4K6X A;  4KA0 A;  5AGY A;  1ZL9 A;  2D2Z A;  3AY8 A;  4MAB A;  2LRN A;  2H1G A;  4K0G A;  3ZIT A;  4GLT A;  2QC7 A;  2A2R A;  3J7Y k;  5IPG A;  1O6J A;  5KN1 A;  1SJ6 A;  4ZL8 A;  1G6W A;  2XPE A;  4YAV A;  1E6B A;  1ZCP A;  1ERW A;  2HYX A;  3KTB A;  2YWM A;  3U5R E;  3C1R A;  2B5X A;  5G30 A;  2N5F A;  2XC2 A;  2VCX A;  4GSS A;  4E8E A;  4PQ1 A;  1QMV A;  4F03 A;  1ERV A;  1M0U A;  3BOA A;  1TTZ A;  3A2V A;  4MF6 A;  1THX A;  1PGT A;  3N9J A;  4KW6 A;  4EUY A;  4L8E A;  1K0N A;  3EVI A;  1YF0 A;  4MK3 A;  2YP6 A;  1NHY A;  1TK0 B;  2AJQ B;  3E9J B;  4X43 A;  3LYP A;  3KZQ A;  1EP7 A;  3O3T A;  4KB3 A;  1B4P A;  3EU3 A;  2VD0 A;  2E2G A;  4RI7 A;  4EKZ A;  4Z7X A;  1EV4 A;  2H1D A;  3H4K A;  4WBR D;  3WT2 A;  1PKZ A;  5DDL A;  1G6Y A;  4ZL7 A;  1A8Y A;  3K8N A;  3CYN A;  4KUN A;  3BJ5 A;  3GST A;  1DE1 A;  5CRH A;  2GQK A;  1EOH A;  5ELG A;  4OCE A;  3TKR A;  3KMO A;  1A0F A;  2H19 A;  4BA7 A;  4ECB A;  1V58 A;  4MF5 A;  5A4W A;  3TUE A;  4LMW A;  2E0Q A;  5CNW A;  1H75 A;  4ZXG A;  1F3B A;  4TXO A;  2HSM B;  3VLN A;  2DJ3 A;  4Q5Q A;  2VL3 A;  1JLV A;  3FYG A;  4K1F A;  1F6M C;  1FG4 A;  1UA5 A;  4I8B A;  4ECI A;  4WR4 A;  3ZML A;  2OE3 A;  3U6V A;  2AB6 A;  2C80 A;  4N11 A;  4TR1 B;  2VUP A;  3L4N A;  2GQM A;  1LJR A;  2H30 A;  3KP8 A;  4XS1 A;  5ECI B;  3E0U A;  3BCK A;  2K6V A;  5IPH A;  4GSN A;  4OMV A;  2H74 A;  1FO5 A;  5G5E A;  3IV4 A;  2O87 A;  2H01 A;  3LEF A;  5ECK B;  3FEU A;  4ZBB A;  4CDO A;  1GSS A;  3GKM A;  2HSY A;  2F8A A;  1B9X C;  2DJJ A;  1AAZ A;  3UL3 A;  1XWC A;  4HZ2 A;  3TJK A;  4PNF A;  1XW9 A;  2B5E A;  5ECS A;  2PPT A;  3GYK A;  1XBS A;  3IDV A;  2CVK A;  4GQC A;  4TR3 A;  4BL7 A;  5KN0 A;  1WIK A;  1S3C A;  1F3A A;  5JCU A;  3EYT A;  1GUK A;  1X0R A;  2JAC A;  1K0A A;  1B48 A;  4TRX A;  3TKP A;  3LWA A;  2FA8 A;  2HQT A;  2HSH A;  3BCI A;  6GSU A;  2PGT A;  4L0W A;  1ACV A;  4HQS A;  3CTF A;  3HVS A;  3ZVJ A;  2RII A;  4D73 A;  1PQN A;  4WEY A;  4POB A;  4MH2 A;  2ES7 A;  3L9U A;  2AAW A;  2GSR A;  2P5R A;  3IPZ A;  2FY6 A;  4I97 A;  1MDI A;  1GUH A;  2L57 A;  2UZ8 A;  4IVF A;  1FB0 A;  3IRA A;  1YJ6 A;  4EDZ A;  2WUL A;  1TXX A;  4HZ4 A;  2B7K A;  18GS A;  1NM3 A;  4NWY A;  1PX6 A;  2M72 A;  2FLS A;  5GST A;  4NV2 A;  2DJ2 A;  1FOV A;  2YZH A;  1JZR A;  1MDJ A;  4O5R A;  2GTU A;  3O6T A;  5F05 A;  1JZW A;  5ECR B;  2R37 A;  4H86 A;  1SD9 A;  5IOW A;  4KF9 A;  4HQZ A;  2PWJ A;  4PGT A;  1GTU A;  3FZ9 A;  3W8S A;  2FD3 A;  3HJP A;  1YY7 A;  2DJ1 A;  5GZZ B;  3LSZ A;  2TRC P;  4K9Z A;  2H1B A;  1UC7 A;  3SBC A;  5D96 A;  2A2S A;  5E59 A;  1GTI A;  1ST9 A;  3GSS A;  4K8M A;  3L9S A;  4F2I A;  2PUK C;  1M9A A;  2JZT A;  1BQ7 A;  1KEB A;  4KX4 A;  3VUR A;  4GQF A;  1AIU A;  3H1N A;  4ZIJ A;  3G9B A;  2OE1 A;  4ACS A;  2LKU A;  3DKS A;  1Z7P A;  5HFK A;  1SJI A;  1YEX A;  3HHV A;  5DJL A;  1EEM A;  5LD0 A;  4IKH A;  1K3L A;  2GSQ A;  4IHU A;  3ME8 A;  5AIV A;  2QKE A;  2OJL A;  1GSY A;  3I9V 2;  1A0R P;  4J57 E;  4XRA A;  4AJ8 A;  1HYU A;  2LTK A;  2YJH A;  3GL3 A;  4JE1 A;  4N0Z A;  3MDK A;  2OA7 A;  4G0L A;  2EIQ A;  1LBK A;  1DUG A;  4TXO B;  3ZZX A;  1ZGN A;  1O81 A;  1A23 A;  3VK9 A;  1OE7 A;  1F9M A;  1W4V A;  2VCZ A;  4CW9 A;  3TGZ A;  3CSH A;  1Y25 A;  2HSN B;  2DSA A;  3VWX A;  3HA9 A;  2HI7 A;  1BJX A;  2H6Y A;  4WF4 A;  3G7J A;  1SKW B;  4ZB9 A;  5COH A;  2IWT A;  4LL4 B;  4BVX A;  3UBL A;  4MMM A;  1WRY A;  5D73 A;  1EEJ A;  2GLR A;  4N0V A;  3WT1 A;  2JZS A;  5D8I A;  5G1L A;  4TKY A;  1TU8 A;  3FK8 A;  1XWK A;  3WGD A;  4NHW A;  3NZN A;  5DAL B;  1EV9 A;  1SKS B;  5DAK A;  1G7O A;  3ISO A;  1OC9 A;  3ZL5 A;  1GNE A;  2GSS A;  2LJK A;  9GSS A;  1XCC A;  4PQH A;  1XWB A;  3QFA C;  1O85 A;  4MZW A;  2G0F A;  3E3E A;  2H8L A;  1TDI A;  4IP6 A;  3KGK A;  5B6N A;  4DSQ A;  1PRX A;  4I5Q A;  3BBY A;  2L5O A;  2YWI A;  2I3Y A;  4XTS A;  1A2M A;  1SU9 A;  1UN2 A;  2GGT A;  2DMM A;  4HJM A;  4MJA A;  4YAP A;  2FA4 A;  4BPY A;  3LQ7 A;  4BL7 B;  1GSD A;  3ERF A;  2LNT A;  5IM9 A;  2IPA A;  3F4R A;  1G0T A;  1GRX A;  3GFK A;  3L0H A;  1GNW A;  2FHE A;  3IK9 A;  1GSQ A;  3ZLP A;  4FIW A;  1SKR B;  3C73 A;  3KEB A;  1GWC A;  4IQA A;  5B8B A;  1IYI A;  3F3Q A;  3FR3 A;  2X8C A;  2WRT A;  2VO4 A;  3TKQ A;  2GZY A;  2NBS A;  6GSX A;  4OO5 A;  5IIZ A;  3UOM A;  1TU7 A;  1Q98 A;  3FHK A;  4PUF C;  1SL0 B;  2RUE A;  1XIY A;  3GV1 A;  3ED3 A;  4D73 B;  4OFN A;  2G2Q A;  1MD4 A;  3D22 A;  3DEX A;  3UIW A;  5ECN B;  5DCG A;  4TOP A;  1VRS D;  3C71 A;  5F0G A;  3H79 A;  4TR4 A;  4GRF A;  3M1G A;  3BD2 A;  4HI7 A;  4ZBA A;  3P7X A;  3IOS A;  3WGE A;  4WXT A; 
#chains in the Genus database with same CATH topology
 2IMD A;  5ID2 A;  3IA1 A;  3HY2 A;  2HZF A;  2I9H A;  1O73 A;  4AJ7 A;  1F37 A;  3DXB A;  5CP1 A;  5FT3 A;  5J4V A;  5KN3 A;  3A3T A;  1SYR A;  3LGC A;  4USS A;  4V2M A;  1MTC A;  3PIN A;  3LXT A;  3R3E A;  4OD7 A;  4HSC X;  3UAR A;  3QAV A;  1HNB A;  3HJO A;  3KCM A;  2GT5 A;  4KH7 A;  3FRC A;  3KH7 A;  2WW0 A;  4ZB8 A;  4MJC A;  4MPF A;  4IEL A;  2B1L A;  2F8F A;  3GUR A;  4PUA A;  1R5P A;  3DVW A;  2A4H A;  2NVL A;  3TJF A;  5KEJ A;  1TOF A;  2VD1 A;  1GL8 A;  2C0G A;  5CRE A;  3W8J A;  3WGX A;  1K3Y A;  4EIP A;  4J56 E;  3I43 A;  5ECO B;  3QFB C;  1N2A A;  2GST A;  3FZA A;  1BYE A;  3FR6 A;  4MDC A;  6GSY A;  5IO0 A;  5HR1 A;  1GSF A;  5CRG A;  1ZYP A;  4I2U A;  2R0G A;  1YKA A;  1NHO A;  1PD2 1;  1JFU A;  4CY8 A;  4IBP A;  2C3N A;  4PI0 C;  1V9W A;  3D21 A;  2P5Q A;  1FHE A;  3VWU A;  2JSZ A;  2CZ2 A;  5KN2 A;  3HD5 A;  1TP9 A;  5DQY A;  4IGJ A;  3HXS A;  1T4Z A;  1CQH A;  3DIE A;  2OAC A;  3Q6O A;  2VCT A;  3VI5 A;  3ZMK A;  1RW1 A;  2FWH A;  1GLP A;  2X8H A;  4JU5 A;  1HNA A;  1XW5 A;  3IHQ A;  4O32 A;  3VWW A;  2HRK A;  5ECQ B;  2CX3 A;  2KHP A;  1X9M B;  5ECP B;  2N5B A;  2N5A A;  5HR3 A;  5D93 A;  4F0B A;  1XVQ A;  5D9W A;  5D9X A;  3F9U A;  2WB9 A;  1JZO A;  1GUL A;  1FW1 A;  3RPN A;  4IP1 A;  1U3A A;  4XHM A;  4IS0 A;  2I1U A;  1AQW A;  2QGV A;  1OKT A;  2FGX A;  5FHI A;  1DBY A;  4POL A;  1AUC A;  1ZYQ B;  2VL9 A;  4YKF A;  2DJ0 A;  5A1N A;  4BVX B;  1XWG A;  1KNG A;  3TJB A;  5LCZ A;  2OE0 A;  5ABR A;  5HQP A;  3PH9 A;  3OR5 A;  2YAN A;  4AF2 A;  2GQL A;  3PR8 A;  2XBQ A;  4PNG A;  3D0Z A;  1U6T A;  2YZU A;  3KXO A;  4F82 A;  3RAZ A;  1JHB A;  5DCH A;  2CZ3 A;  5DAK B;  2LUS A;  1OC9 B;  2AV4 A;  5H5S A;  1CQG A;  5G5F A;  2H76 A;  5DAL A;  4KND A;  3NOF A;  3DWV A;  3ERW A;  1A8L A;  5JWO B;  1YEP A;  1IYH A;  2YWO A;  1T4Y A;  5JWQ B;  5HR0 A;  5IMZ A;  1SEN A;  2RM6 A;  3EWL A;  4EF0 A;  4WR5 A;  2REM A;  2OKA A;  5GAN D;  2NPB A;  5EL8 A;  4AGS A;  4JBB A;  2LQQ A;  3QMX A;  1K0C A;  4FYU A;  3HVV A;  3GKK A;  3H8Q A;  2B1K A;  1WOU A;  3F6D A;  1B9Y C;  2O89 A;  1HQO A;  4LMV A;  3UVT A;  3DML A;  1BG5 A;  2LQO A;  5EVO A;  2DLX A;  5DQS A;  1G7E A;  3GH9 A;  5B6M A;  1TJD A;  4ILF A;  2OT3 A;  3GKN A;  1O7U A;  3DRN A;  2YV9 A;  2H1A A;  4ECC A;  16GS A;  5KOX A;  3O76 A;  3GNJ A;  2O5V A;  1XZO A;  1J08 A;  3G7Y A;  1XPV A;  2X49 A;  2LJA A;  5H5Q A;  5JWR B;  5B8A A;  4RQX A;  1URM A;  1SVL A;  3WYW A;  2PMT A;  4OO4 A;  4E8H A;  3EUR A;  3TRP A;  3GH6 A;  2J23 A;  4IQ1 A;  2K8S A;  4F9Z A;  4OWY A;  1SK1 A;  2FWG A;  2H73 A;  3KP9 A;  3TKS A;  3APO A;  1Z9H A;  4DSR A;  3CSJ A;  5ID2 B;  1K0B A;  3RHC A;  3WD6 A;  4PUR A;  1BX9 A;  2J9H A;  3G7I A;  3M0F A;  5CAX A;  1O8X A;  1XXU A;  4KE3 A;  2L59 A;  1SVM A;  2CQ9 A;  1TKD B;  3GMF A;  2RUF A;  3RPP A;  3EMP A;  4G2E A;  2HE3 A;  1X9S B;  3CXG A;  1M2B A;  3M3M A;  4MP4 A;  3GHA A;  5DBQ A;  1TK5 B;  3KMN A;  1TI1 A;  2HRA A;  2B3S A;  1I5G A;  1GSU A;  3EC3 A;  1JZD A;  4IN0 A;  4WET A;  1XOB A;  2LRT A;  2FNO A;  1ERU A;  1AW9 A;  1U88 A;  1YKC A;  5ECL B;  3GX0 A;  2ZCT A;  5DJM A;  4FH8 A;  1XWA A;  5G31 A;  3KD0 A;  1GSE A;  1V2A A;  2IME A;  3F6F A;  4J2F A;  1B4Q A;  2CAI A;  3QDN A;  2VL2 C;  1V40 A;  2L6C A;  5HFG A;  2YJ7 A;  1TK8 B;  2R6K A;  4QQ7 A;  2H6Z A;  3S9F A;  2K18 A;  1R26 A;  4PQI A;  1VF2 A;  2TIR A;  4JED A;  1GH2 A;  4FYB A;  4RUV A;  3VPQ A;  3TCO A;  6GSW A;  2V32 A;  3ZIV A;  2HNL A;  2IL3 A;  4L5L A;  2B7J A;  1YVL A;  4L0U A;  5IQY A;  1X5C A;  2QA1 A;  4YKG A;  2AYT A;  5LNK e;  3HCZ A;  4KSM A;  1A2J A;  3F0I A;  2YCD A;  2R2J A;  4KCA A;  2VOC A;  3ERG A;  3IAM 2;  3W6G A;  5AIX A;  4Z2U A;  1J9B A;  3CSI A;  3QAG A;  2LEG A;  4AI6 A;  1TRS A;  2HRK B;  4K2D A;  3MAK A;  3EPT A;  3I6A A;  2EFE A;  1YDK A;  2A4V A;  4XCS A;  3TJJ A;  1SK0 A;  2GS3 A;  4ID0 A;  2WCI A;  5J47 A;  4L5O A;  3EMX A;  2NTO A;  3GTU B;  5IMF A;  4ZIL A;  5GAP D;  3L9V A;  3CTG A;  3FY7 A;  2DBC A;  1EGO A;  4WKW A;  2GVP A;  1J0F A;  2DIY A;  2LS5 A;  3MSZ A;  2ALB A;  3APQ A;  3CRT A;  7GSS A;  4POM A;  3GL5 A;  4Q5R A;  5A1N B;  1HD2 A;  3IXR A;  1EZK A;  2EIO A;  3ZVJ D;  1XFL A;  2VCW A;  5J41 A;  4BWS A;  3ME7 A;  2VAF A;  3RHB A;  2VLU A;  3DGQ A;  5ELA A;  2WGR A;  5D9V A;  2PU9 C;  2F9S A;  2IMK A;  1OE8 A;  5DVB A;  3ZTL A;  2R5G A;  5A5K A;  4N3Z A;  1R5A A;  1X5D A;  4K2X A;  3APS A;  4IJI A;  4AKX B;  2H71 A;  2M46 A;  1ZMA A;  1YQ1 A;  3TDG A;  1PX7 A;  2H0G A;  3P8W A;  4HJ2 A;  4GDF A;  4GST A;  3SWL A;  4RI6 A;  4NV5 A;  4I6X A;  1TRU A;  5G1K A;  2PN8 A;  3UJ1 A;  4EVM A;  1K0M A;  4G0I A;  1GLQ A;  2HZE A;  3MNG A;  4EIQ A;  4WF5 A;  5JCW A;  1TW9 A;  4X4J A;  2X64 A;  5IMV A;  2BTO T;  3GX8 A;  2O7K A;  5A34 A;  1M2A A;  2IIY A;  1NW2 A;  1BF5 A;  1PMT A;  5C00 A;  5J9B A;  1PKW A;  4K7I A;  3HVN A;  2HFD A;  3MYD A;  1VGL A;  1WMJ A;  2V2G A;  3RBT A;  2YV7 A;  1K3O A;  1X5E A;  4HS1 A;  1EWX A;  1USB A;  2KP1 A;  4MF7 A;  1NSW A;  3TOU A;  3VFI A;  5A4V A;  3HVX A;  1AQV A;  1QUW A;  2H66 A;  2MMA A;  2R4V A;  5ECM B;  3D4M A;  3RDW A;  3M9J A;  2I4A A;  3US3 A;  1U3I A;  1DSB A;  4IJ3 A;  1QFN A;  1WPI A;  4MZB A;  4AJ6 A;  2P31 A;  1YEW C;  1V57 A;  4DSS B;  3M9K A;  2WVX B;  4DEJ A;  1OC8 A;  3F4S A;  5CRD A;  1TXU A;  2O8V B;  4KDX A;  1UVZ A;  4NPB A;  1ABA A;  1AC1 A;  2WDU A;  5EPF A;  1GUM A;  1A24 A;  2K8V A;  3HJM A;  4EDY A;  4EE0 A;  3IR4 A;  3F63 A;  2IFQ A;  1PN0 A;  2AHE A;  3IC8 A;  10GS A;  2KP2 A;  2YPM A;  4K5R A;  4NHZ A;  4YQM A;  4NXI A;  1WP0 A;  2F3M A;  2F51 A;  2KOK A;  2L6D A;  1M99 A;  3GIX A;  2BJX A;  2DML A;  3TU3 B;  3KH9 A;  1ON4 A;  2VCV A;  3VPT A;  4MJB A;  2GT6 A;  1AXD A;  4P3Y B;  1SL2 B;  2EC4 A;  2V1M A;  2LRC A;  3N5O A;  2R0C A;  4YQV A;  1TI3 A;  2WVZ A;  2EFD A;  2L4C A;  4DVC A;  4Z2T A;  1BG1 A;  1ZOF A;  2VIM A;  2C0E A;  2A2P A;  3TJG A;  1Z6M A;  1OVN A;  3R2Q A;  2H72 A;  4K5S A;  1QXH A;  2MZC A;  2PVQ A;  3C8E A;  3IE3 A;  2JAD A;  3A2X A;  3QCP A;  2NDO A;  3VWV A;  5AN1 A;  4ZB7 A;  1KBN A;  4G19 A;  2GZP A;  1Z5Y E;  3DYR A;  4JR6 A;  5J40 A;  5CO3 A;  3GUS A;  4ML6 A;  3UMA A;  3QOU A;  3UAP A;  3M8N A;  2O85 A;  3EIN A;  4ML1 A;  2C1Y A;  2WZ9 A;  4K0N A;  1AQX A;  4PTS A;  4BVY A;  2TRX A;  4G10 A;  1T1V A;  4HDE A;  2XBI A;  4V1A p;  3MWH A;  3LOR A;  4KDY A;  1XOA A;  5F07 A;  2YWN A;  1M2D A;  1PA3 A;  1M3J A;  2H0H A;  3IC4 A;  1W89 A;  3ZIJ A;  3Q18 A;  2H70 A;  3A5W A;  2X4A A;  4JR4 A;  1SD8 A;  3GTU A;  2Z9S A;  4OCF A;  2ZNM A;  2YOI A;  4ZB6 A;  2YN1 A;  3KIJ A;  4EL1 A;  4W66 A;  1PL2 A;  3ZYW A;  4POK A;  4TXV A;  1ERT A;  1Z3E A;  1U87 A;  2GZZ A;  13GS A;  2M80 A;  2HT9 A;  1X9W B;  1PSQ A;  4GTU A;  4CHS A;  2VLT A;  4V2N A;  3HKR A;  4LA1 A;  3P90 A;  5J4U A;  2C4J A;  3J7Y b;  2WW2 A;  2HRF A;  2LV3 A;  4GCI A;  2HLS A;  3JCM L;  4QL7 A;  2MBT A;  4MA9 A;  2VM1 A;  14GS A;  3KTL A;  2MBS A;  2L4Q A;  1S3A A;  3HDC A;  4EO3 A;  2IMI A;  5L71 A;  2WVY A;  4XRD A;  1QGV A;  4MCU A;  2H0I A;  4LLR A;  1N8J A;  1TRV A;  4KDU A;  3DD3 A;  2WJU A;  3QR6 A;  1BED A;  1GTB A;  4WBJ A;  3CRU A;  2HZE B;  1ML6 A;  4XS4 A;  3TKS C;  3LG6 A;  4FXY P;  2FUG 2;  2PER A;  3IAS 2;  2K9F A;  1Z6N A;  4MH3 A;  3C1S A;  5A34 B;  5J5N A;  2V6K A;  4GWR A;  4V1A g;  3UBK A;  1RQM A;  3V1W A;  1JLW A;  3QPM A;  1FOH A;  4TVE A;  2XPD A;  2R0P A;  2CA8 A;  3FR9 A;  1EGR A;  2WW1 A;  1WE0 A;  2E7P A;  2FWE A;  1HNC A;  1LU4 A;  4Q5N A;  3DVX A;  6GSS A;  2OBK A;  3FKF A;  1TRW A;  4MZC A;  2P0G A;  2DKH A;  5INY A;  2EFH A;  2HXK A;  3UEM A;  2H75 A;  1GP1 A;  2QA2 A;  2VCQ A;  2JSY A;  2OBI A;  4F0C A;  5IMA A;  5D9T A;  5F8B A;  4GXZ A;  1YF1 A;  1BAY A;  4ZL9 A;  4FYC A;  4XIH A;  4QMK A;  1OKD A;  4OFT A;  1V98 A;  5ECH B;  4DSS A;  2WVX A;  2H6X A;  4MPG A;  2HRN A;  1T3B A;  4HOJ A;  5CYY A;  5J9C A;  3PPU A;  3EE2 A;  1F2E A;  2DKI A;  3A2W A;  2DC5 A;  4AKH A;  1FVK A;  3L78 A;  3NIV A;  2XHF A;  2L5L A;  4HU9 A;  3PGT A;  2IFQ B;  2VLV A;  1C72 A;  2FWF A;  3ZFB A;  3F8U A;  2VM2 A;  1H4O A;  20GS A;  3LJR A;  3H93 A;  1M3I A;  1S3D A;  2I81 A;  2KLX A;  1PFO A;  5J3R A;  4G0K A;  2MMZ A;  2JZR A;  4HUA A;  2DJK A;  8GSS A;  2V6O A;  3D4T A;  2CX4 A;  4GF0 A;  1FAA A;  3ZRE A;  2C8U A;  1R4W A;  5IO2 A;  2MMO A;  1Z7R A;  3KM6 A;  3LYK A;  5BMU A;  1XVW A;  4KAE A;  4MLY A;  4OFM A;  2B5Y A;  2PVO C;  3IBH A;  1MEK A;  4N10 A;  4HU7 A;  5B7C A;  5IMC A;  4BWQ A;  22GS A;  1B8X A;  1QK8 A;  5BRT A;  3TRX A;  1I9D A;  1WWJ A;  3CBU A;  1T8E B;  4MJE A;  3QAW A;  4ISD A;  4K7N A;  2EIR A;  4ULX A;  3F4T A;  1OAZ A;  1MD3 A;  1ZYE A;  4BVY B;  2FCH A;  1GTA A;  3F3R A;  2CVD A;  4YH2 A;  3CMI A;  2JL4 A;  4PHZ C;  2CAQ A;  3EU4 A;  3C7M A;  6GSV A;  5G2Z A;  4RQR A;  1XW6 A;  4K7O A;  3ZRD A;  2C3T A;  1RK4 A;  1FVJ A;  1FB6 A;  1M9B A;  4I2T A;  5C04 A;  1M7T A;  5HR2 A;  1ZZY A;  1OYJ A;  4PX1 A;  4O5Q A;  1PN9 A;  4XS6 A;  5E4W A;  1SYX A;  2C0F A;  1SL1 B;  3FZ4 A;  3UVH A;  2HSM A;  2LNS A;  2VL2 A;  2C0D A;  1O8W A;  3CQF A;  5JCG A;  2UV8 G;  2RM5 A;  1OC3 A;  1QQ2 A;  3TOT A;  3GKX A;  4TR1 A;  3TB2 A;  1T00 A;  2EFC A;  1EP8 A;  3KJY A;  4NAX A;  3HZ4 A;  3VI7 A;  1R7H A;  2E2M A;  4HEA 2;  4PI2 C;  3D5J A;  5EY6 A;  4NMU A;  1Y6E A;  5ENU A;  1A2L A;  2WZS A;  11GS A;  4TW5 A;  2CV4 A;  4KCE A;  2MMN A;  1K0D A;  2X99 A;  1VF3 A;  3P2A A;  1THO A;  4XS4 B;  4KSO A;  4AKG A;  1VF1 A;  2JU5 A;  2KUC A;  2WFC A;  2LST A;  2AUV A;  1PL1 A;  4X0X A;  3ZFL A;  5IOX A;  5HFI A;  4V2L A;  2PBJ A;  5FWG A;  1E2Y A;  3HYP A;  1T7P B;  3D6I A;  2BMX A;  1YZX A;  3FW2 A;  2ON5 A;  4LL1 B;  4Q5F A;  4TN8 A;  3QD9 A;  1SK2 A;  2WS2 A;  5A4U A;  6GST A;  5F06 A;  2C3Q A;  5GSS A;  1WJK A;  3TRQ A;  4ECJ A;  4FO5 A;  2LJR A;  3Q19 A;  2IN3 A;  2CVB A;  2DIZ A;  4EC0 A;  12GS A;  4KGI A;  4IW9 A;  1Q4J A;  19GS A;  4X1U A;  1ILO A;  2IJY A;  3Q74 A;  2X8G A;  3FZ5 A;  3GA4 A;  1EOG A;  5AIS A;  4FQU A;  1K0O A;  3HZ8 A;  4JZQ A;  4O92 A;  2YNX A;  3LFL A;  2ON7 A;  4EXJ A;  5CRW A;  3TKS E;  2QSI A;  2ZUP A;  3CHX C;  1SJZ A;  1XG8 A;  1DE2 A;  3I69 A;  3LW9 A;  1VF4 A;  4G9H A;  3IK7 A;  3LXZ A;  2CT6 A;  1KTE A;  5H5R A;  2B6M A;  1SVO A;  17GS A;  4YQU A;  2R3X A;  1MDK A;  3GN3 A;  5IMD A;  3GRX A;  4O7H A;  4ZBD A;  2MYG A;  2GDR A;  4QL9 A;  4N30 A;  2V41 A;  4TR0 A;  4JRR A;  4PXO A;  2IMF A;  2RLI A;  2OAD A;  4K6X A;  4KA0 A;  5AGY A;  1ZL9 A;  2D2Z A;  3AY8 A;  4MAB A;  2LRN A;  2H1G A;  4K0G A;  3ZIT A;  4GLT A;  2QC7 A;  2A2R A;  3J7Y k;  5IPG A;  1O6J A;  5KN1 A;  1SJ6 A;  4BIK A;  4ZL8 A;  1G6W A;  2XPE A;  4YAV A;  1E6B A;  1S3R A;  4O5U A;  1ZCP A;  1ERW A;  2HYX A;  2YWM A;  3KTB A;  5BMU B;  3U5R E;  3C1R A;  2B5X A;  5G30 A;  2N5F A;  2XC2 A;  2VCX A;  4GSS A;  4E8E A;  4PQ1 A;  1QMV A;  4F03 A;  1ERV A;  1M0U A;  3BOA A;  1TTZ A;  3A2V A;  4MF6 A;  1THX A;  1PGT A;  3N9J A;  4KW6 A;  4EUY A;  4L8E A;  1K0N A;  3EVI A;  1YF0 A;  4MK3 A;  2YP6 A;  1NHY A;  1TK0 B;  2AJQ B;  3E9J B;  4X43 A;  3LYP A;  3KZQ A;  1EP7 A;  3O3T A;  4KB3 A;  1B4P A;  3EU3 A;  2VD0 A;  1Y1U A;  2E2G A;  4ICY A;  4RI7 A;  4EKZ A;  4Z7X A;  1EV4 A;  2H1D A;  4E68 A;  3H4K A;  2H1L A;  4WBR D;  3WT2 A;  1PKZ A;  5DDL A;  1G6Y A;  4ZL7 A;  1A8Y A;  3K8N A;  3CYN A;  4KUN A;  3IHG A;  3BJ5 A;  3GST A;  1DE1 A;  5CRH A;  2GQK A;  1EOH A;  4CY6 A;  5ELG A;  4OCE A;  3TKR A;  3KMO A;  1A0F A;  2H19 A;  4BA7 A;  4ECB A;  1V58 A;  4MF5 A;  5A4W A;  3TUE A;  4LMW A;  2E0Q A;  5CNW A;  1H75 A;  4ZXG A;  1F3B A;  4TXO A;  2HSM B;  3VLN A;  2DJ3 A;  4Q5Q A;  2VL3 A;  3FMW A;  1JLV A;  3FYG A;  1FG4 A;  1F6M C;  4K1F A;  1UA5 A;  4I8B A;  4ECI A;  4WR4 A;  3ZML A;  2OE3 A;  3U6V A;  2AB6 A;  2C80 A;  4N11 A;  4TR1 B;  2VUP A;  3L4N A;  2GQM A;  1LJR A;  2HSN A;  2H30 A;  3KP8 A;  4XS1 A;  5ECI B;  3E0U A;  3BCK A;  2K6V A;  5IPH A;  5A5H B;  4GSN A;  4OMV A;  2H74 A;  1FO5 A;  5G5E A;  3IV4 A;  2O87 A;  2H01 A;  3LEF A;  5ECK B;  3FEU A;  4ZBB A;  4CDO A;  1GSS A;  3GKM A;  2HSY A;  2F8A A;  1B9X C;  2DJJ A;  1AAZ A;  3UL3 A;  4Z2R A;  1XWC A;  4HZ2 A;  3RGB C;  3TJK A;  4PNF A;  1XW9 A;  2B5E A;  5ECS A;  2PPT A;  1ZYN A;  3GYK A;  1XBS A;  3IDV A;  2CVK A;  4GQC A;  4TR3 A;  4BL7 A;  5KN0 A;  1WIK A;  1S3C A;  1F3A A;  5JCU A;  3EYT A;  1GUK A;  1X0R A;  2JAC A;  1K0A A;  1B48 A;  4TRX A;  3TKP A;  3LWA A;  2FA8 A;  2HQT A;  2HSH A;  3BCI A;  6GSU A;  2PGT A;  4L0W A;  1ACV A;  4HQS A;  3CTF A;  3HVS A;  3ZVJ A;  2RII A;  4D73 A;  1PQN A;  4WEY A;  4POB A;  4MH2 A;  4G01 A;  2ES7 A;  3L9U A;  2AAW A;  2GSR A;  2P5R A;  3IPZ A;  2O3E A;  2FY6 A;  4I97 A;  1MDI A;  1N25 A;  1GUH A;  2L57 A;  2UZ8 A;  4IVF A;  1FB0 A;  3IRA A;  1YJ6 A;  4EDZ A;  2WUL A;  1TXX A;  4HZ4 A;  2B7K A;  18GS A;  1NM3 A;  4NWY A;  1PX6 A;  2M72 A;  2FLS A;  5GST A;  4NV2 A;  2DJ2 A;  1FOV A;  2YZH A;  1JZR A;  1MDJ A;  4O5R A;  2GTU A;  3O6T A;  5F05 A;  1JZW A;  5ECR B;  2R37 A;  4H86 A;  1SD9 A;  5IOW A;  4KF9 A;  4HQZ A;  2PWJ A;  4PGT A;  1GTU A;  3FZ9 A;  3A5I A;  3W8S A;  2FD3 A;  3HJP A;  1YY7 A;  2DJ1 A;  5GZZ B;  3HMJ G;  3LSZ A;  2TRC P;  4K9Z A;  2H1B A;  1UC7 A;  3SBC A;  5D96 A;  2A2S A;  5E59 A;  1GTI A;  1ST9 A;  3GSS A;  4K8M A;  2WW3 A;  3L9S A;  4F2I A;  2PUK C;  1M9A A;  2JZT A;  1BQ7 A;  1KEB A;  4KX4 A;  3VUR A;  4GQF A;  1AIU A;  3H1N A;  4ZIJ A;  3G9B A;  2OE1 A;  4ACS A;  2LKU A;  4MNN A;  3DKS A;  1Z7P A;  5HFK A;  1SJI A;  1YEX A;  3HHV A;  5DJL A;  1EEM A;  5LD0 A;  4IKH A;  1K3L A;  2GSQ A;  4IHU A;  5J4Y A;  3ME8 A;  5AIV A;  2QKE A;  2OJL A;  1GSY A;  3I9V 2;  1A0R P;  4J57 E;  4XRA A;  4AJ8 A;  1HYU A;  2LTK A;  2YJH A;  3GL3 A;  1I1I P;  4JE1 A;  4N0Z A;  3MDK A;  2OA7 A;  4G0L A;  2EIQ A;  1LBK A;  1DUG A;  4TXO B;  3ZZX A;  1ZGN A;  1O81 A;  1A23 A;  3CWG A;  3VK9 A;  1OE7 A;  1F9M A;  1W4V A;  2VCZ A;  4CW9 A;  3TGZ A;  3CSH A;  1Y25 A;  2HSN B;  2DSA A;  3VWX A;  3HA9 A;  2HI7 A;  1BJX A;  2H6Y A;  4WF4 A;  3G7J A;  1SKW B;  4ZB9 A;  5COH A;  2IWT A;  4LL4 B;  4BVX A;  3UBL A;  4MMM A;  1WRY A;  5D73 A;  1EEJ A;  2GLR A;  4N0V A;  3WT1 A;  5KOW A;  2JZS A;  5D8I A;  5G1L A;  5A5H A;  4TKY A;  1TU8 A;  3FK8 A;  1XWK A;  3WGD A;  4NHW A;  3NZN A;  5DAL B;  1EV9 A;  1SKS B;  5DAK A;  1G7O A;  3ISO A;  1OC9 A;  3ZL5 A;  1GNE A;  2GSS A;  2LJK A;  9GSS A;  1XCC A;  4A5P A;  2VKZ G;  4PQH A;  1XWB A;  3QFA C;  1O85 A;  4MZW A;  2G0F A;  3E3E A;  2H8L A;  1TDI A;  4IP6 A;  3KGK A;  5B6N A;  4DSQ A;  1PRX A;  4I5Q A;  3BBY A;  2L5O A;  2YWI A;  2I3Y A;  4XTS A;  1A2M A;  1SU9 A;  1UN2 A;  2GGT A;  2DMM A;  4HJM A;  4MJA A;  4YAP A;  2FA4 A;  4BPY A;  3LQ7 A;  4BL7 B;  1GSD A;  3ERF A;  2LNT A;  5IM9 A;  2IPA A;  3F4R A;  1G0T A;  1GRX A;  1S4B P;  3GFK A;  3L0H A;  1GNW A;  2FHE A;  3IK9 A;  1GSQ A;  3ZLP A;  4FIW A;  1SKR B;  3C73 A;  3KEB A;  1GWC A;  4IQA A;  5B8B A;  1IYI A;  3F3Q A;  3FR3 A;  2X8C A;  2WRT A;  2VO4 A;  3TKQ A;  4AKI A;  2GZY A;  2O36 A;  2NBS A;  6GSX A;  4OO5 A;  5IIZ A;  3UOM A;  1TU7 A;  1Q98 A;  3FHK A;  4PUF C;  1SL0 B;  2RUE A;  1XIY A;  3RFR C;  3GV1 A;  3ED3 A;  4D73 B;  4OFN A;  2G2Q A;  1MD4 A;  3MIX A;  3D22 A;  3DEX A;  3UIW A;  5ECN B;  5DCG A;  4TOP A;  1VRS D;  3C71 A;  5F0G A;  3H79 A;  4TR4 A;  4GRF A;  3M1G A;  3BD2 A;  4HI7 A;  4ZBA A;  3P7X A;  3IOS A;  3WGE A;  4WXT A; 
#chains in the Genus database with same CATH homology
 2IMD A;  5ID2 A;  3IA1 A;  3HY2 A;  2HZF A;  2I9H A;  1O73 A;  4AJ7 A;  1F37 A;  3DXB A;  5CP1 A;  5FT3 A;  5J4V A;  5KN3 A;  3A3T A;  1SYR A;  3LGC A;  4USS A;  4V2M A;  1MTC A;  3PIN A;  3LXT A;  3R3E A;  4OD7 A;  3UAR A;  3QAV A;  1HNB A;  3HJO A;  3KCM A;  2GT5 A;  4KH7 A;  3FRC A;  3KH7 A;  4ZB8 A;  4MJC A;  4MPF A;  4IEL A;  2B1L A;  2F8F A;  3GUR A;  4PUA A;  1R5P A;  3DVW A;  2A4H A;  2NVL A;  3TJF A;  5KEJ A;  1TOF A;  2VD1 A;  1GL8 A;  2C0G A;  5CRE A;  3W8J A;  3WGX A;  1K3Y A;  4EIP A;  4J56 E;  3I43 A;  5ECO B;  3QFB C;  1N2A A;  2GST A;  3FZA A;  1BYE A;  3FR6 A;  4MDC A;  6GSY A;  5IO0 A;  5HR1 A;  1GSF A;  5CRG A;  1ZYP A;  4I2U A;  2R0G A;  1YKA A;  1NHO A;  1PD2 1;  1JFU A;  4CY8 A;  4IBP A;  2C3N A;  1V9W A;  3D21 A;  2P5Q A;  1FHE A;  3VWU A;  2JSZ A;  2CZ2 A;  5KN2 A;  3HD5 A;  1TP9 A;  5DQY A;  4IGJ A;  3HXS A;  1T4Z A;  1CQH A;  3DIE A;  2OAC A;  3Q6O A;  2VCT A;  3VI5 A;  3ZMK A;  1RW1 A;  2FWH A;  1GLP A;  2X8H A;  4JU5 A;  1HNA A;  1XW5 A;  3IHQ A;  4O32 A;  3VWW A;  2HRK A;  5ECQ B;  2CX3 A;  2KHP A;  1X9M B;  5ECP B;  2N5B A;  2N5A A;  5HR3 A;  5D93 A;  4F0B A;  1XVQ A;  5D9W A;  5D9X A;  3F9U A;  2WB9 A;  1JZO A;  1GUL A;  1FW1 A;  3RPN A;  4IP1 A;  1U3A A;  4XHM A;  4IS0 A;  2I1U A;  1AQW A;  2QGV A;  1OKT A;  2FGX A;  5FHI A;  1DBY A;  4POL A;  1AUC A;  1ZYQ B;  2VL9 A;  4YKF A;  2DJ0 A;  5A1N A;  4BVX B;  1XWG A;  1KNG A;  3TJB A;  5LCZ A;  2OE0 A;  5ABR A;  5HQP A;  3PH9 A;  3OR5 A;  2YAN A;  4AF2 A;  2GQL A;  3PR8 A;  2XBQ A;  4PNG A;  3D0Z A;  1U6T A;  2YZU A;  3KXO A;  4F82 A;  3RAZ A;  1JHB A;  5DCH A;  2CZ3 A;  5DAK B;  2LUS A;  1OC9 B;  2AV4 A;  5H5S A;  1CQG A;  5G5F A;  2H76 A;  5DAL A;  4KND A;  3NOF A;  3DWV A;  3ERW A;  1A8L A;  5JWO B;  1YEP A;  1IYH A;  2YWO A;  1T4Y A;  5JWQ B;  5HR0 A;  5IMZ A;  1SEN A;  2RM6 A;  3EWL A;  4EF0 A;  4WR5 A;  2REM A;  2OKA A;  5GAN D;  2NPB A;  5EL8 A;  4AGS A;  4JBB A;  2LQQ A;  3QMX A;  1K0C A;  4FYU A;  3HVV A;  3GKK A;  3H8Q A;  2B1K A;  1WOU A;  3F6D A;  1B9Y C;  2O89 A;  1HQO A;  4LMV A;  3UVT A;  3DML A;  1BG5 A;  2LQO A;  5EVO A;  2DLX A;  5DQS A;  1G7E A;  3GH9 A;  5B6M A;  1TJD A;  4ILF A;  2OT3 A;  3GKN A;  1O7U A;  3DRN A;  2YV9 A;  2H1A A;  4ECC A;  16GS A;  5KOX A;  3O76 A;  3GNJ A;  2O5V A;  1XZO A;  1J08 A;  3G7Y A;  1XPV A;  2X49 A;  2LJA A;  5H5Q A;  5JWR B;  5B8A A;  4RQX A;  1URM A;  1SVL A;  3WYW A;  2PMT A;  4OO4 A;  4E8H A;  3EUR A;  3TRP A;  3GH6 A;  2J23 A;  4IQ1 A;  2K8S A;  4F9Z A;  4OWY A;  1SK1 A;  2FWG A;  2H73 A;  3KP9 A;  3TKS A;  3APO A;  1Z9H A;  4DSR A;  3CSJ A;  5ID2 B;  1K0B A;  3RHC A;  3WD6 A;  4PUR A;  1BX9 A;  2J9H A;  3G7I A;  3M0F A;  5CAX A;  1O8X A;  1XXU A;  4KE3 A;  2L59 A;  1SVM A;  2CQ9 A;  1TKD B;  3GMF A;  2RUF A;  3RPP A;  3EMP A;  4G2E A;  2HE3 A;  1X9S B;  3CXG A;  1M2B A;  3M3M A;  4MP4 A;  3GHA A;  5DBQ A;  1TK5 B;  3KMN A;  1TI1 A;  2HRA A;  2B3S A;  1I5G A;  1GSU A;  3EC3 A;  1JZD A;  4IN0 A;  4WET A;  1XOB A;  2LRT A;  2FNO A;  1ERU A;  1AW9 A;  1U88 A;  1YKC A;  5ECL B;  3GX0 A;  2ZCT A;  5DJM A;  4FH8 A;  1XWA A;  5G31 A;  3KD0 A;  1GSE A;  1V2A A;  2IME A;  3F6F A;  4J2F A;  1B4Q A;  2CAI A;  3QDN A;  2VL2 C;  1V40 A;  2L6C A;  5HFG A;  2YJ7 A;  1TK8 B;  2R6K A;  4QQ7 A;  2H6Z A;  3S9F A;  2K18 A;  1R26 A;  4PQI A;  1VF2 A;  2TIR A;  4JED A;  1GH2 A;  4FYB A;  4RUV A;  3VPQ A;  3TCO A;  6GSW A;  2V32 A;  3ZIV A;  2HNL A;  2IL3 A;  4L5L A;  2B7J A;  1YVL A;  4L0U A;  5IQY A;  1X5C A;  2QA1 A;  4YKG A;  2AYT A;  5LNK e;  3HCZ A;  4KSM A;  1A2J A;  3F0I A;  2YCD A;  2R2J A;  4KCA A;  2VOC A;  3ERG A;  3IAM 2;  3W6G A;  5AIX A;  4Z2U A;  1J9B A;  3CSI A;  3QAG A;  2LEG A;  4AI6 A;  1TRS A;  2HRK B;  4K2D A;  3MAK A;  3EPT A;  3I6A A;  2EFE A;  1YDK A;  2A4V A;  4XCS A;  3TJJ A;  1SK0 A;  2GS3 A;  4ID0 A;  2WCI A;  5J47 A;  4L5O A;  3EMX A;  2NTO A;  3GTU B;  5IMF A;  4ZIL A;  5GAP D;  3L9V A;  3CTG A;  3FY7 A;  2DBC A;  1EGO A;  4WKW A;  2GVP A;  1J0F A;  2DIY A;  3MSZ A;  2LS5 A;  2ALB A;  3APQ A;  3CRT A;  7GSS A;  4POM A;  3GL5 A;  4Q5R A;  5A1N B;  1HD2 A;  3IXR A;  1EZK A;  2EIO A;  3ZVJ D;  1XFL A;  2VCW A;  5J41 A;  4BWS A;  3ME7 A;  2VAF A;  3RHB A;  2VLU A;  3DGQ A;  5ELA A;  2WGR A;  5D9V A;  2PU9 C;  2F9S A;  2IMK A;  1OE8 A;  5DVB A;  3ZTL A;  2R5G A;  5A5K A;  4N3Z A;  1R5A A;  1X5D A;  4K2X A;  3APS A;  4IJI A;  4AKX B;  2H71 A;  2M46 A;  1ZMA A;  1YQ1 A;  3TDG A;  1PX7 A;  2H0G A;  3P8W A;  4HJ2 A;  4GDF A;  4GST A;  3SWL A;  4RI6 A;  4NV5 A;  4I6X A;  1TRU A;  5G1K A;  2PN8 A;  3UJ1 A;  4EVM A;  1K0M A;  4G0I A;  1GLQ A;  2HZE A;  3MNG A;  4EIQ A;  4WF5 A;  5JCW A;  1TW9 A;  4X4J A;  2X64 A;  5IMV A;  2BTO T;  3GX8 A;  2O7K A;  5A34 A;  1M2A A;  2IIY A;  1NW2 A;  1BF5 A;  1PMT A;  5C00 A;  5J9B A;  1PKW A;  4K7I A;  2HFD A;  3MYD A;  1VGL A;  1WMJ A;  2V2G A;  3RBT A;  2YV7 A;  1K3O A;  1X5E A;  4HS1 A;  1EWX A;  1USB A;  2KP1 A;  4MF7 A;  1NSW A;  3TOU A;  3VFI A;  5A4V A;  3HVX A;  1AQV A;  1QUW A;  2H66 A;  2MMA A;  2R4V A;  5ECM B;  3D4M A;  3RDW A;  3M9J A;  2I4A A;  3US3 A;  1U3I A;  1DSB A;  4IJ3 A;  1QFN A;  1WPI A;  4MZB A;  4AJ6 A;  2P31 A;  1V57 A;  4DSS B;  3M9K A;  4DEJ A;  1OC8 A;  3F4S A;  5CRD A;  1TXU A;  2O8V B;  4KDX A;  1UVZ A;  4NPB A;  1ABA A;  1AC1 A;  2WDU A;  5EPF A;  1GUM A;  1A24 A;  2K8V A;  3HJM A;  4EDY A;  4EE0 A;  3IR4 A;  3F63 A;  2IFQ A;  1PN0 A;  2AHE A;  3IC8 A;  10GS A;  2KP2 A;  2YPM A;  4K5R A;  4NHZ A;  4YQM A;  4NXI A;  1WP0 A;  2F3M A;  2F51 A;  2KOK A;  2L6D A;  1M99 A;  3GIX A;  2BJX A;  2DML A;  3TU3 B;  3KH9 A;  1ON4 A;  2VCV A;  3VPT A;  4MJB A;  2GT6 A;  1AXD A;  4P3Y B;  1SL2 B;  2EC4 A;  2V1M A;  2LRC A;  3N5O A;  2R0C A;  4YQV A;  1TI3 A;  2EFD A;  2L4C A;  4DVC A;  4Z2T A;  1BG1 A;  1ZOF A;  2VIM A;  2C0E A;  2A2P A;  3TJG A;  1Z6M A;  1OVN A;  3R2Q A;  2H72 A;  4K5S A;  1QXH A;  2MZC A;  2PVQ A;  3C8E A;  3IE3 A;  2JAD A;  3A2X A;  3QCP A;  2NDO A;  3VWV A;  5AN1 A;  4ZB7 A;  1KBN A;  4G19 A;  2GZP A;  1Z5Y E;  3DYR A;  4JR6 A;  5J40 A;  5CO3 A;  3GUS A;  4ML6 A;  3UMA A;  3QOU A;  3UAP A;  3M8N A;  2O85 A;  3EIN A;  4ML1 A;  2C1Y A;  2WZ9 A;  4K0N A;  1AQX A;  4PTS A;  4BVY A;  2TRX A;  4G10 A;  1T1V A;  4HDE A;  2XBI A;  4V1A p;  3MWH A;  3LOR A;  4KDY A;  1XOA A;  5F07 A;  2YWN A;  1M2D A;  1PA3 A;  2H0H A;  3IC4 A;  1W89 A;  3ZIJ A;  3Q18 A;  2H70 A;  3A5W A;  2X4A A;  4JR4 A;  1SD8 A;  3GTU A;  2Z9S A;  4OCF A;  2ZNM A;  2YOI A;  4ZB6 A;  2YN1 A;  3KIJ A;  4EL1 A;  4W66 A;  1PL2 A;  3ZYW A;  4POK A;  4TXV A;  1ERT A;  1Z3E A;  1U87 A;  2GZZ A;  13GS A;  2M80 A;  2HT9 A;  1X9W B;  1PSQ A;  4GTU A;  4CHS A;  2VLT A;  4V2N A;  3HKR A;  4LA1 A;  3P90 A;  5J4U A;  2C4J A;  3J7Y b;  2HRF A;  2LV3 A;  4GCI A;  2HLS A;  3JCM L;  4QL7 A;  2MBT A;  4MA9 A;  2VM1 A;  14GS A;  3KTL A;  2MBS A;  2L4Q A;  1S3A A;  3HDC A;  4EO3 A;  2IMI A;  5L71 A;  4XRD A;  1QGV A;  4MCU A;  2H0I A;  4LLR A;  1N8J A;  1TRV A;  4KDU A;  3DD3 A;  2WJU A;  3QR6 A;  1BED A;  1GTB A;  4WBJ A;  3CRU A;  2HZE B;  1ML6 A;  4XS4 A;  3TKS C;  3LG6 A;  2FUG 2;  2PER A;  3IAS 2;  2K9F A;  1Z6N A;  4MH3 A;  3C1S A;  5A34 B;  5J5N A;  2V6K A;  4GWR A;  4V1A g;  3UBK A;  1RQM A;  3V1W A;  1JLW A;  3QPM A;  1FOH A;  4TVE A;  2XPD A;  2R0P A;  2CA8 A;  3FR9 A;  1EGR A;  1WE0 A;  2E7P A;  1HNC A;  2FWE A;  1LU4 A;  4Q5N A;  3DVX A;  6GSS A;  2OBK A;  3FKF A;  1TRW A;  4MZC A;  2P0G A;  2DKH A;  5INY A;  2EFH A;  2HXK A;  3UEM A;  2H75 A;  1GP1 A;  2QA2 A;  2VCQ A;  2JSY A;  2OBI A;  4F0C A;  5IMA A;  5D9T A;  5F8B A;  4GXZ A;  1YF1 A;  1BAY A;  4ZL9 A;  4FYC A;  4XIH A;  4QMK A;  1OKD A;  4OFT A;  1V98 A;  5ECH B;  4DSS A;  2H6X A;  4MPG A;  2HRN A;  1T3B A;  4HOJ A;  5CYY A;  5J9C A;  3PPU A;  3EE2 A;  1F2E A;  2DKI A;  3A2W A;  2DC5 A;  4AKH A;  1FVK A;  3L78 A;  3NIV A;  2XHF A;  2L5L A;  4HU9 A;  3PGT A;  2IFQ B;  2VLV A;  1C72 A;  2FWF A;  3ZFB A;  3F8U A;  2VM2 A;  1H4O A;  20GS A;  3LJR A;  3H93 A;  1S3D A;  2I81 A;  2KLX A;  5J3R A;  4G0K A;  2MMZ A;  2JZR A;  4HUA A;  2DJK A;  8GSS A;  2V6O A;  3D4T A;  2CX4 A;  4GF0 A;  1FAA A;  3ZRE A;  2C8U A;  1R4W A;  5IO2 A;  2MMO A;  1Z7R A;  3KM6 A;  3LYK A;  5BMU A;  1XVW A;  4KAE A;  4MLY A;  4OFM A;  2B5Y A;  2PVO C;  3IBH A;  1MEK A;  4N10 A;  4HU7 A;  5B7C A;  5IMC A;  4BWQ A;  22GS A;  1B8X A;  1QK8 A;  5BRT A;  3TRX A;  1I9D A;  1WWJ A;  3CBU A;  1T8E B;  4MJE A;  3QAW A;  4ISD A;  4K7N A;  2EIR A;  4ULX A;  3F4T A;  1OAZ A;  1MD3 A;  1ZYE A;  4BVY B;  2FCH A;  1GTA A;  3F3R A;  2CVD A;  4YH2 A;  3CMI A;  2JL4 A;  2CAQ A;  3EU4 A;  3C7M A;  6GSV A;  5G2Z A;  4RQR A;  1XW6 A;  4K7O A;  3ZRD A;  2C3T A;  1RK4 A;  1FVJ A;  1FB6 A;  1M9B A;  4I2T A;  5C04 A;  1M7T A;  5HR2 A;  1ZZY A;  1OYJ A;  4PX1 A;  4O5Q A;  1PN9 A;  4XS6 A;  5E4W A;  1SYX A;  2C0F A;  1SL1 B;  3FZ4 A;  3UVH A;  2HSM A;  2LNS A;  2VL2 A;  2C0D A;  1O8W A;  5JCG A;  2UV8 G;  2RM5 A;  1OC3 A;  1QQ2 A;  3TOT A;  3GKX A;  4TR1 A;  3TB2 A;  1T00 A;  2EFC A;  1EP8 A;  3KJY A;  4NAX A;  3HZ4 A;  3VI7 A;  1R7H A;  2E2M A;  4HEA 2;  3D5J A;  5EY6 A;  4NMU A;  1Y6E A;  5ENU A;  1A2L A;  11GS A;  4TW5 A;  2CV4 A;  4KCE A;  2MMN A;  1K0D A;  2X99 A;  1VF3 A;  3P2A A;  1THO A;  4XS4 B;  4KSO A;  4AKG A;  1VF1 A;  2JU5 A;  2KUC A;  2WFC A;  2LST A;  2AUV A;  1PL1 A;  4X0X A;  3ZFL A;  5IOX A;  5HFI A;  4V2L A;  2PBJ A;  5FWG A;  1E2Y A;  3HYP A;  1T7P B;  3D6I A;  2BMX A;  1YZX A;  3FW2 A;  2ON5 A;  4LL1 B;  4Q5F A;  4TN8 A;  3QD9 A;  1SK2 A;  2WS2 A;  5A4U A;  6GST A;  5F06 A;  2C3Q A;  5GSS A;  1WJK A;  3TRQ A;  4ECJ A;  4FO5 A;  2LJR A;  3Q19 A;  2IN3 A;  2CVB A;  2DIZ A;  4EC0 A;  12GS A;  4KGI A;  4IW9 A;  1Q4J A;  19GS A;  4X1U A;  1ILO A;  2IJY A;  3Q74 A;  2X8G A;  3FZ5 A;  3GA4 A;  1EOG A;  5AIS A;  4FQU A;  1K0O A;  3HZ8 A;  4JZQ A;  4O92 A;  2YNX A;  3LFL A;  2ON7 A;  4EXJ A;  5CRW A;  3TKS E;  2QSI A;  2ZUP A;  1SJZ A;  1DE2 A;  3I69 A;  3LW9 A;  1VF4 A;  4G9H A;  3IK7 A;  3LXZ A;  2CT6 A;  1KTE A;  5H5R A;  2B6M A;  1SVO A;  17GS A;  4YQU A;  2R3X A;  1MDK A;  3GN3 A;  5IMD A;  3GRX A;  4O7H A;  4ZBD A;  2MYG A;  2GDR A;  4QL9 A;  4N30 A;  2V41 A;  4TR0 A;  4JRR A;  4PXO A;  2IMF A;  2RLI A;  2OAD A;  4K6X A;  4KA0 A;  5AGY A;  1ZL9 A;  2D2Z A;  3AY8 A;  4MAB A;  2LRN A;  2H1G A;  4K0G A;  3ZIT A;  4GLT A;  2QC7 A;  2A2R A;  3J7Y k;  5IPG A;  1O6J A;  5KN1 A;  1SJ6 A;  4ZL8 A;  1G6W A;  2XPE A;  4YAV A;  1E6B A;  4O5U A;  1ZCP A;  1ERW A;  2HYX A;  2YWM A;  3KTB A;  5BMU B;  3U5R E;  3C1R A;  2B5X A;  5G30 A;  2N5F A;  2XC2 A;  2VCX A;  4GSS A;  4E8E A;  4PQ1 A;  1QMV A;  4F03 A;  1ERV A;  1M0U A;  3BOA A;  1TTZ A;  3A2V A;  4MF6 A;  1THX A;  1PGT A;  3N9J A;  4KW6 A;  4EUY A;  4L8E A;  1K0N A;  3EVI A;  1YF0 A;  4MK3 A;  2YP6 A;  1NHY A;  1TK0 B;  2AJQ B;  3E9J B;  4X43 A;  3LYP A;  3KZQ A;  1EP7 A;  3O3T A;  4KB3 A;  1B4P A;  3EU3 A;  2VD0 A;  1Y1U A;  2E2G A;  4ICY A;  4RI7 A;  4EKZ A;  4Z7X A;  1EV4 A;  2H1D A;  4E68 A;  3H4K A;  2H1L A;  4WBR D;  3WT2 A;  1PKZ A;  5DDL A;  1G6Y A;  4ZL7 A;  1A8Y A;  3K8N A;  3CYN A;  4KUN A;  3IHG A;  3BJ5 A;  3GST A;  1DE1 A;  5CRH A;  2GQK A;  1EOH A;  4CY6 A;  5ELG A;  4OCE A;  3TKR A;  3KMO A;  1A0F A;  2H19 A;  4BA7 A;  4ECB A;  1V58 A;  4MF5 A;  5A4W A;  3TUE A;  4LMW A;  2E0Q A;  5CNW A;  1H75 A;  4ZXG A;  1F3B A;  4TXO A;  2HSM B;  3VLN A;  2DJ3 A;  4Q5Q A;  2VL3 A;  3FMW A;  1JLV A;  3FYG A;  1FG4 A;  1F6M C;  4K1F A;  1UA5 A;  4I8B A;  4ECI A;  4WR4 A;  3ZML A;  2OE3 A;  3U6V A;  2AB6 A;  2C80 A;  4N11 A;  4TR1 B;  2VUP A;  3L4N A;  2GQM A;  1LJR A;  2HSN A;  2H30 A;  3KP8 A;  4XS1 A;  5ECI B;  3E0U A;  3BCK A;  2K6V A;  5IPH A;  5A5H B;  4GSN A;  4OMV A;  2H74 A;  1FO5 A;  5G5E A;  3IV4 A;  2O87 A;  2H01 A;  3LEF A;  5ECK B;  3FEU A;  4ZBB A;  4CDO A;  1GSS A;  3GKM A;  2HSY A;  2F8A A;  1B9X C;  2DJJ A;  1AAZ A;  3UL3 A;  4Z2R A;  1XWC A;  4HZ2 A;  3TJK A;  4PNF A;  1XW9 A;  2B5E A;  5ECS A;  2PPT A;  1ZYN A;  3GYK A;  1XBS A;  3IDV A;  2CVK A;  4GQC A;  4TR3 A;  4BL7 A;  5KN0 A;  1WIK A;  1S3C A;  1F3A A;  5JCU A;  3EYT A;  1GUK A;  1X0R A;  2JAC A;  1K0A A;  1B48 A;  4TRX A;  3TKP A;  3LWA A;  2FA8 A;  2HQT A;  2HSH A;  3BCI A;  6GSU A;  2PGT A;  4L0W A;  1ACV A;  4HQS A;  3CTF A;  3HVS A;  3ZVJ A;  2RII A;  4D73 A;  1PQN A;  4WEY A;  4POB A;  4MH2 A;  4G01 A;  2ES7 A;  3L9U A;  2AAW A;  2GSR A;  2P5R A;  3IPZ A;  2FY6 A;  4I97 A;  1MDI A;  1N25 A;  1GUH A;  2L57 A;  2UZ8 A;  4IVF A;  1FB0 A;  3IRA A;  1YJ6 A;  4EDZ A;  2WUL A;  1TXX A;  4HZ4 A;  2B7K A;  18GS A;  1NM3 A;  4NWY A;  1PX6 A;  2M72 A;  2FLS A;  5GST A;  4NV2 A;  2DJ2 A;  1FOV A;  2YZH A;  1JZR A;  1MDJ A;  4O5R A;  2GTU A;  3O6T A;  5F05 A;  1JZW A;  5ECR B;  2R37 A;  4H86 A;  1SD9 A;  5IOW A;  4KF9 A;  4HQZ A;  2PWJ A;  4PGT A;  1GTU A;  3FZ9 A;  3A5I A;  3W8S A;  2FD3 A;  3HJP A;  1YY7 A;  2DJ1 A;  5GZZ B;  3HMJ G;  3LSZ A;  2TRC P;  4K9Z A;  2H1B A;  1UC7 A;  3SBC A;  5D96 A;  2A2S A;  5E59 A;  1GTI A;  1ST9 A;  3GSS A;  4K8M A;  3L9S A;  4F2I A;  2PUK C;  1M9A A;  2JZT A;  1BQ7 A;  1KEB A;  4KX4 A;  3VUR A;  4GQF A;  1AIU A;  3H1N A;  4ZIJ A;  3G9B A;  2OE1 A;  4ACS A;  2LKU A;  4MNN A;  3DKS A;  1Z7P A;  5HFK A;  1SJI A;  1YEX A;  3HHV A;  5DJL A;  1EEM A;  5LD0 A;  4IKH A;  1K3L A;  2GSQ A;  4IHU A;  5J4Y A;  3ME8 A;  5AIV A;  2QKE A;  2OJL A;  1GSY A;  3I9V 2;  1A0R P;  4J57 E;  4XRA A;  4AJ8 A;  1HYU A;  2LTK A;  2YJH A;  3GL3 A;  4JE1 A;  4N0Z A;  3MDK A;  2OA7 A;  4G0L A;  2EIQ A;  1LBK A;  1DUG A;  4TXO B;  3ZZX A;  1ZGN A;  1O81 A;  1A23 A;  3CWG A;  3VK9 A;  1OE7 A;  1F9M A;  1W4V A;  2VCZ A;  4CW9 A;  3TGZ A;  3CSH A;  1Y25 A;  2HSN B;  2DSA A;  3VWX A;  3HA9 A;  2HI7 A;  1BJX A;  2H6Y A;  4WF4 A;  3G7J A;  1SKW B;  4ZB9 A;  5COH A;  2IWT A;  4LL4 B;  4BVX A;  3UBL A;  4MMM A;  1WRY A;  5D73 A;  1EEJ A;  2GLR A;  4N0V A;  3WT1 A;  5KOW A;  2JZS A;  5D8I A;  5G1L A;  5A5H A;  4TKY A;  1TU8 A;  3FK8 A;  1XWK A;  3WGD A;  4NHW A;  3NZN A;  5DAL B;  1EV9 A;  1SKS B;  5DAK A;  1G7O A;  3ISO A;  1OC9 A;  3ZL5 A;  1GNE A;  2GSS A;  2LJK A;  9GSS A;  1XCC A;  4A5P A;  2VKZ G;  4PQH A;  1XWB A;  3QFA C;  1O85 A;  4MZW A;  2G0F A;  3E3E A;  2H8L A;  1TDI A;  4IP6 A;  3KGK A;  5B6N A;  4DSQ A;  1PRX A;  4I5Q A;  3BBY A;  2L5O A;  2YWI A;  2I3Y A;  4XTS A;  1A2M A;  1SU9 A;  1UN2 A;  2GGT A;  2DMM A;  4HJM A;  4MJA A;  4YAP A;  2FA4 A;  4BPY A;  3LQ7 A;  4BL7 B;  1GSD A;  3ERF A;  2LNT A;  5IM9 A;  2IPA A;  3F4R A;  1G0T A;  1GRX A;  3GFK A;  3L0H A;  1GNW A;  2FHE A;  3IK9 A;  1GSQ A;  3ZLP A;  4FIW A;  1SKR B;  3C73 A;  3KEB A;  1GWC A;  4IQA A;  5B8B A;  1IYI A;  3F3Q A;  3FR3 A;  2X8C A;  2WRT A;  2VO4 A;  3TKQ A;  4AKI A;  2GZY A;  2NBS A;  6GSX A;  4OO5 A;  5IIZ A;  3UOM A;  1TU7 A;  1Q98 A;  3FHK A;  4PUF C;  1SL0 B;  2RUE A;  1XIY A;  3GV1 A;  3ED3 A;  4D73 B;  4OFN A;  2G2Q A;  1MD4 A;  3MIX A;  3D22 A;  3DEX A;  3UIW A;  5ECN B;  5DCG A;  4TOP A;  1VRS D;  3C71 A;  5F0G A;  3H79 A;  4TR4 A;  4GRF A;  3M1G A;  3BD2 A;  4HI7 A;  4ZBA A;  3P7X A;  3IOS A;  3WGE A;  4WXT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...