3QR6A

Crystal structure analysis of h185f mutant of human clic1
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
236
structure length
236
Chain Sequence
b'PQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLFIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chloride intracellular channel protein 1
publication title Role of individual histidines in the pH-dependent global stability of human chloride intracellular channel 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 76
structure length 236
sequence length 236
ec nomenclature
pdb deposition date 2011-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13409 GST_N_2 Glutathione S-transferase, N-terminal domain
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3qr6A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3qr6A01
1OC9B 3TUEA 1EEMA 2EIOA 4PQIA 4X0XA 5IPGA 2HXKA 1Z5YE 5H5SA 1S3DA 1X9SB 4PURA 1YF1A 4TR0A 1TDIA 3ERFA 3LORA 1HD2A 1GUMA 4NV2A 3O6TA 2HRNA 1QXHA 4XRAA 5KN3A 2GT6A 2PERA 1T3BA 3EU4A 1B9XC 4OFNA 4MF5A 2FA8A 1U6TA 1Z7RA 2IN3A 1T1VA 1T7PB 2O87A 1LBKA 3IK9A 1V2AA 1JZOA 5KEJA 3HXSA 3DMLA 4YAVA 5B6MA 3KJYA 1GSEA 4IQ1A 5ENUA 3TJKA 5DALA 4FYUA 1OAZA 5HR1A 4IS0A 2MMZA 3HA9A 1TI3A 3DEXA 5DBQA 4WR5A 3GIXA 4PTSA 2IL3A 2WGRA 5ECIB 2L57A 4EC0A 4KUNA 4OWYA 3PPUA 2LEGA 4J56E 4AJ7A 1A2MA 2OJLA 5IO2A 3EINA 1Z7PA 5IMZA 3TCOA 3UEMA 5GSTA 3TOUA 1Y6EA 2VO4A 5INYA 3LFLA 4IBPA 5IPHA 3APOA 2B5YA 3P7XA 5HQPA 2I4AA 3WYWA 2GT5A 1PD21 3HY2A 1TK5B 4K0NA 3F8UA 3H1NA 2HZEB 3FR6A 5B8AA 4ISDA 5G1LA 3KH9A 1EGOA 2MZCA 2PVOC 4MP4A 5HFKA 4L5OA 1NHYA 1BG5A 5AIVA 4WKWA 4GXZA 2B1KA 22GSA 1THXA 1B8XA 3KMNA 2M80A 4WF5A 5D9VA 4XCSA 4XS1A 4HS1A 2ZUPA 4WXTA 3DXBA 1MDKA 1K0BA 2FWEA 2NPBA 2FGXA 1SKWB 1F6MC 1X0RA 1QMVA 3ERWA 5JCGA 3TKSC 1AIUA 3D21A 5IMDA 3TJGA 1F9MA 1BYEA 5G31A 3Q74A 3GURA 3F9UA 3IAM2 2DJKA 4G9HA 3RBTA 1HNCA 1SD9A 4I8BA 4FQUA 2P5RA 3FHKA 4JE1A 1ABAA 3GX8A 4MJCA 4HZ2A 4GWRA 3KM6A 4WR4A 1SL2B 4MH2A 3QR6A 2LRCA 1O8WA 1SJ6A 1X5DA 2B7JA 1CQGA 3UMAA 3QDNA 3TDGA 3UIWA 4IW9A 2R4VA 4NXIA 4OMVA 1U87A 3A2WA 1PGTA 1URMA 1DE1A 1T00A 2HRKA 1EZKA 2H73A 2A2RA 3GKKA 1YEXA 3G7IA 3CMIA 5IM9A 3ME8A 4D73A 3KD0A 1R26A 4LMVA 4FIWA 5JWRB 2JSZA 4CHSA 2PPTA 1X9WB 2FD3A 5C04A 4TR3A 3IOSA 4XS4B 2WZ9A 3TGZA 2LSTA 2VM1A 5ABRA 3EURA 4K2DA 3IAS2 4LL1B 4ECJA 3DVXA 1I5GA 1GTUA 4BVYB 1XW6A 1B4PA 2DIYA 4IQAA 1ZZYA 5ECLB 1V40A 4OD7A 5EVOA 3ZTLA 3IE3A 3LEFA 4GSTA 1O8XA 1AQVA 1W4VA 3BOAA 4KDXA 1M9BA 2H8LA 1JZRA 4E8EA 3IRAA 2BTOT 3QFAC 2IFQB 4F0CA 3VWUA 1SL0B 5AN1A 1WPIA 2QC7A 1YY7A 3N5OA 1ZMAA 3ISOA 2N5AA 1FAAA 3HCZA 3VPTA 4FYBA 3ERGA 3U6VA 1PA3A 3G9BA 1XWGA 3L9SA 5ECSA 1TOFA 2N5BA 2KHPA 5E4WA 3DKSA 2GGTA 2KOKA 3HZ4A 1GH2A 4X1UA 5EL8A 4L0UA 2NTOA 1GL8A 3I6AA 3W8JA 1QUWA 4GF0A 3TKQA 2LUSA 1XW9A 4BL7A 5AGYA 4ZIJA 4DEJA 1XPVA 2VL2C 4QQ7A 3L9VA 4IP6A 1HNBA 3VWXA 3V1WA 10GSA 4Q5NA 4HQSA 2OE1A 3EC3A 1YF0A 2E2MA 3ZLPA 3L9UA 4K7IA 3S9FA 2OADA 3M8NA 2H74A 1USBA 3IV4A 1GTIA 1SJIA 3DGQA 3E3EA 4ULXA 1NSWA 1F37A 2V32A 1PMTA 2V6KA 3IR4A 2PGTA 1ERUA 5F05A 5IMVA 4ILFA 4TKYA 1TU8A 3TKPA 4MDCA 4RI6A 4KB3A 3D5JA 2WB9A 2H75A 1PKZA 2VCTA 1K0AA 2QGVA 1AQXA 2CZ3A 1O81A 2KUCA 3VFIA 2R37A 1FVJA 1ML6A 3NOFA 4AJ6A 3QMXA 2WCIA 4V1Ag 3M3MA 2ES7A 3DVWA 3P2AA 3R2QA 1K3YA 3GFKA 1BX9A 4DSSA 3UARA 1GSYA 2V2GA 3EMXA 2JL4A 2IPAA 1SKRB 1YKCA 5H5RA 3GKXA 1OKDA 4EO3A 1XWKA 1ACVA 2OBKA 1DSBA 4BVXA 1O7UA 1VF1A 4ECIA 3MSZA 2LNTA 5BMUA 2MYGA 3J7Yk 1B48A 4HU9A 4ECBA 3OR5A 4RI7A 2E7PA 1X9MB 4EL1A 3TKRA 2RM5A 2HT9A 1TW9A 2X8HA 1T8EB 1K3LA 4YH2A 2GZPA 2FCHA 5EPFA 4OCEA 1YEPA 4K8MA 1H4OA 2VLVA 3A2VA 3LJRA 5HR3A 5J3RA 3F4RA 3ZMKA 2FWGA 3N9JA 2KLXA 4MLYA 2VLUA 2K8VA 2YWNA 1XOBA 1DE2A 1OC3A 3UVHA 2LV3A 2CQ9A 3EYTA 4LL4B 4TN8A 1AQWA 2IMIA 2FWHA 4TR1A 5D96A 1GP1A 5KN1A 3LQ7A 2F8FA 5A5KA 1OVNA 2V41A 2VD0A 1M99A 3ME7A 2VAFA 1A0FA 2VCQA 1EP7A 4IJ3A 1OYJA 2CAQA 5GAPD 2O8VB 3KGKA 3HVXA 3FRCA 4GQFA 4AJ8A 5DDLA 3LYPA 3GTUA 3ZFBA 2DMMA 4FYCA 2V1MA 19GSA 3NZNA 4I97A 2BJXA 1QQ2A 2OBIA 1WRYA 3UJ1A 1EP8A 2F9SA 4XS6A 1A23A 3H79A 1GWCA 3F4SA 1BQ7A 6GSVA 4POKA 3FR9A 1M0UA 3BBYA 2YP6A 3WGXA 3UVTA 3O3TA 2XBIA 3GL3A 1ZYQB 2DJJA 1YKAA 2YJHA 4ZL7A 2XHFA 4JU5A 2RLIA 2E0QA 1JZDA 2GZZA 1OE7A 1RQMA 4OFTA 2QKEA 4O32A 3HVSA 1V98A 4BWSA 5ECHB 5F0GA 4GQCA 4OFMA 1EV4A 2I1UA 2F3MA 1PL1A 5DJMA 1TXXA 2IMEA 5DVBA 3H8QA 3RHBA 3IXRA 2GLRA 3TKSE 2AB6A 1A24A 1VRSD 2G0FA 3M9JA 1FO5A 2VCVA 2PUKC 2EC4A 1KNGA 1GRXA 2L59A 1A8LA 3DWVA 1V9WA 4PNGA 4PQ1A 2NVLA 2PWJA 3C1RA 4ML1A 2M46A 2MMAA 2YJ7A 4O7HA 2H76A 1SJZA 5ECOB 5CYYA 3FYGA 3UBLA 2HZEA 2C80A 4N0VA 1B9YC 1FOVA 5H5QA 3GV1A 2X8GA 1XW5A 4KCAA 4KSOA 1RW1A 5ID2A 2CA8A 5FT3A 3IBHA 3IK7A 2CVDA 2ZNMA 1TTZA 4HEA2 3ZMLA 3GH9A 3VURA 3DIEA 2YWIA 1BEDA 1XWBA 1HNAA 3CTGA 3TOTA 2XC2A 3I69A 5D9TA 1SD8A 3VLNA 13GSA 2WS2A 4KAEA 5ECNB 4V2MA 2H0IA 4NMUA 3F63A 5DALB 2VL3A 1NW2A 1GNEA 1O85A 1LU4A 4G19A 1XFLA 4KW6A 5J9CA 3IPZA 2OACA 2YOIA 5EY6A 2HFDA 1I9DA 1TP9A 3I9V2 1YJ6A 3BCKA 3FY7A 4NAXA 4NWYA 2HSYA 2CAIA 4MH3A 2N5FA 3KXOA 2GSRA 1S3CA 4BPYA 3ZRDA 4V2LA 3TRXA 3KH7A 1X5CA 4KSMA 2YANA 1K0DA 2HSNB 2J9HA 3J7Yb 4XS4A 4FH8A 1GLPA 4GCIA 4ZB9A 3ZVJA 1HQOA 2HLSA 8GSSA 2B3SA 1THOA 1MTCA 4GSSA 1PSQA 2IJYA 1GUKA 1FVKA 3EVIA 2O89A 6GSWA 5DJLA 1ZCPA 14GSA 2WDUA 2K6VA 3P90A 3K8NA 2HE3A 3VI7A 1TRSA 1AC1A 5F06A 2IFQA 4CDOA 2O7KA 2IMFA 4TRXA 3WT1A 3CBUA 4XIHA 4KH7A 1M9AA 3QAVA 3A5WA 2J23A 5ECQB 1N2AA 3UAPA 5CNWA 2CVBA 5DCGA 5DCHA 4KDUA 2WFCA 5ELAA 4ACSA 3QAWA 1R5AA 2VCWA 3EE2A 4LMWA 3APQA 4JBBA 4TXVA 1EEJA 2M72A 1RK4A 4GLTA 1DUGA 4XRDA 2DSAA 3DD3A 1B4QA 2A4VA 3MDKA 2I3YA 2VCXA 4MK3A 2DJ1A 4NPBA 1K0OA 4G10A 1N8JA 1TI1A 3GX0A 1J08A 3FZ5A 1GUHA 4QL9A 4LLRA 5J4UA 4FO5A 4J57E 5CRGA 2GQKA 2TRXA 3QCPA 3GKMA 4XTSA 1LJRA 3LXTA 1F2EA 4POLA 4KDYA 4TVEA 1ERVA 4N30A 3GSTA 2GSQA 3TKSA 3WGEA 5FWGA 2MMOA 4JEDA 2CX3A 2VD1A 4ZXGA 1WOUA 1Q98A 3CSHA 4KGIA 2ALBA 3Q6OA 5B8BA 1EOHA 4MPFA 2C0FA 1PQNA 4ZL8A 4MZWA 5J9BA 3RAZA 1MEKA 2H72A 2H1DA 4JRRA 2C3TA 1XVQA 1FW1A 2H30A 5B6NA 3FW2A 2AYTA 4J2FA 4HUAA 1ZGNA 1Z3EA 1R4WA 1SK1A 5ECPB 4TOPA 2HRFA 4MJAA 4ZB8A 4TXOA 2NBSA 3APSA 5JCUA 2L6CA 4NHWA 3ZVJD 1BAYA 3M0FA 4EE0A 4DSRA 2OA7A 1XOAA 2L4CA 4P3YB 4K9ZA 2XPEA 3TJBA 2RM6A 3KCMA 2C3NA 2YWMA 1JLVA 1T4ZA 3H4KA 5JWQB 2VLTA 4BL7B 1VF4A 3WGDA 1SL1B 1PN9A 1X5EA 5GZZB 2B5EA 3TRQA 1WJKA 1NHOA 2HZFA 2VOCA 1AUCA 2H70A 3GYKA 2X8CA 4ZL9A 1ON4A 3GL5A 3O76A 1WP0A 1Z6MA 3GHAA 4MF6A 2JZTA 3ZYWA 2RUFA 4YQMA 2PBJA 3KP8A 5A4WA 3C7MA 4F2IA 2HSMB 4YQUA 2C0EA 2FLSA 2VIMA 2H6ZA 3F0IA 3TRPA 3HHVA 1ZYEA 5D8IA 5G30A 2F8AA 4PQHA 1K0MA 4AF2A 5DAKA 4KX4A 3G7JA 1UVZA 2AUVA 2HSHA 1AXDA 1QGVA 3PR8A 2H01A 4KCEA 5F07A 3D6IA 1UC7A 1GSFA 5D73A 2VUPA 3LYKA 3GN3A 1Z6NA 4E8HA 5ECRB 4EDYA 1R7HA 5CRWA 4BVXB 2VL2A 2H6YA 1KTEA 4OO5A 2YZUA 4MMMA 2CV4A 2OE3A 3QFBC 3E9JB 3D4MA 3AY8A 4YAPA 2YNXA 3UL3A 5E59A 1MD4A 2P0GA 4ZBAA 4X43A 1XIYA 2JZRA 1OC9A 2C1YA 2REMA 1PRXA 4O5RA 2LRNA 2FNOA 5J41A 3CXGA 4F0BA 4WBJA 3KTBA 3R3EA 1GNWA 1G7OA 16GSA 2B6MA 3QPMA 2FHEA 1JZWA 2I81A 2FWFA 4KNDA 3C8EA 3IHQA 2DMLA 3FZAA 3C73A 1JHBA 4TR1B 2EIRA 2JU5A 11GSA 3IDVA 4HJMA 4RQXA 6GSXA 3C71A 2AV4A 1M2AA 4Q5RA 1IYHA 2XPDA 1GSUA 2AJQB 2LNSA 3F4TA 4AGSA 1Q4JA 3Q18A 1VGLA 4IELA 3VWWA 2YV7A 4JR6A 3GTUB 5HR2A 2P31A 4F03A 3HD5A 5HFGA 2I9HA 1J0FA 5D9WA 1H75A 2Z9SA 5IMCA 3G7YA 3ZL5A 3TJJA 1K3OA 5IOWA 1TK0B 2L4QA 1NM3A 5ECMB 4QL7A 3KMOA 2HI7A 1EOGA 3WD6A 2LQOA 1JLWA 6GSTA 3NIVA 3PINA 2C8UA 3H93A 2R5GA 3F6FA 4MCUA 5D93A 2MBTA 4K6XA 1OKTA 2GDRA 3DYRA 3LGCA 3KP9A 4WETA 2CVKA 2CZ2A 1QFNA 2FA4A 4G2EA 3IA1A 5HR0A 3F3RA 2KP2A 4ZB6A 5AIXA 3L78A 1WMJA 20GSA 2B5XA 4DVCA 4L5LA 3E0UA 2G2QA 4BWQA 1ERTA 3MAKA 3ZREA 2CT6A 2H6XA 1XVWA 1TKDB 1C72A 4CW9A 1PL2A 4POMA 1MD3A 1Y25A 1JFUA 2R2JA 1EGRA 2FUG2 1V57A 3L4NA 1TU7A 3FKFA 5ELGA 1KBNA 2K8SA 3L0HA 5FHIA 3KIJA 2OKAA 2DIZA 3HDCA 4HI7A 6GSYA 2R6KA 3HVVA 1F3AA 3W6GA 2OE0A 5IO0A 1OE8A 2K9FA 4DSQA 3FEUA 1M2DA 2GSSA 1ST9A 2FY6A 3D22A 4HU7A 2ZCTA 4N0ZA 2C0DA 1O73A 4TW5A 5ID2B 1AW9A 4K7OA 5CRDA 1V58A 1FG4A 2LJRA 1CQHA 4I2UA 3MWHA 5G2ZA 4IVFA 1TJDA 2AAWA 3SWLA 2IWTA 2HNLA 4ZBDA 4YQVA 5KN2A 2TIRA 4BVYA 2H0HA 3EU3A 1MDJA 4PUFC 1XWCA 3PGTA 1IYIA 2XBQA 3GKNA 2VCZA 5IMFA 4MPGA 3VPQA 4RUVA 9GSSA 4I6XA 1AAZA 4ID0A 1ERWA 3GRXA 1ZL9A 4HQZA 2GQMA 3BJ5A 4ECCA 4OCFA 4V2NA 2GTUA 5IOXA 1SK0A 1PKWA 5G5FA 3RDWA 4WBRD 2WULA 4MA9A 4L8EA 3D4TA 4PXOA 1G6WA 3CYNA 3I43A 3KEBA 2GQLA 3CRUA 1G0TA 3U5RE 2LKUA 3IC4A 4O92A 3UBKA 3TJFA 2C4JA 1PX6A 1GSQA 1UN2A 5LCZA 1A0RP 1YQ1A 4EUYA 17GSA 1O6JA 4IGJA 2LJAA 18GSA 1TRVA 2HRKB 1KEBA 2VL9A 1EWXA 5C00A 4IN0A 4OO4A 4D73B 1F3BA 2GVPA 3Q19A 4MJBA 2E2GA 4JZQA 2DC5A 3QD9A 4PGTA 2DJ2A 3F3QA 2L6DA 3UOMA 4F9ZA 4KF9A 3HJPA 1K0CA 1YDKA 2WJUA 4I5QA 3ZIVA 4Q5QA 2H1GA 5KN0A 2DJ3A 3C1SA 4PNFA 5COHA 1A2LA 4Q5FA 4WF4A 2TRCP 2H1BA 1XZOA 2IMKA 5CO3A 2GS3A 4PUAA 1ILOA 2ON7A 3RPNA 5GSSA 3HJMA 3FK8A 2RUEA 4G0IA 1M2BA 4PX1A 1QK8A 4H86A 3M1GA 5LD0A 3GNJA 1EV9A 1A8YA 1XCCA 3ZZXA 2MMNA 4POBA 1PX7A 2UZ8A 2HYXA 4IKHA 2H1AA 1G7EA 3LWAA 4EKZA 4I2TA 2PVQA 1M7TA 2YZHA 4RQRA 1XXUA 2K18A 1WWJA 2P5QA 3CSJA 3GA4A 6GSSA 1BJXA 3VI5A 1T4YA 2PN8A 2HSMA 3HJOA 4MJEA 4N11A 2AHEA 3GMFA 5GAND 3P8WA 4LA1A 2A2SA 3HZ8A 2VM2A 1U88A 3GH6A 2H19A 4K1FA 3BCIA 2KP1A 2EIQA 3SBCA 2JZSA 3HKRA 5JWOB 3EWLA 5AISA 3VK9A 2X99A 3LG6A 3QOUA 4XHMA 2H0GA 2QSIA 4HDEA 3HYPA 1SK2A 1TRUA 2O85A 5LNKe 2LQQA 2DLXA 12GSA 3A2XA 4ZBBA 4F82A 2GSTA 2YV9A 2LRTA 4NV5A 4ZILA 1GSDA 1GSSA 5G1KA 2CX4A 1TK8B 2B7KA 5CREA 3CSIA 4K0GA 5CRHA 5F8BA 1TRWA 1E6BA 5B7CA 3M9KA 4NHZA 2JADA 5J5NA 3F6DA 1XBSA 1VF3A 4TXOB 1FB0A 3LSZA 2PU9C 5IIZA 4JR4A 3FZ4A 2YCDA 1Z9HA 4HJ2A 2JACA 4MZBA 4EDZA 3FZ9A 2X64A 1SYRA 3CTFA 3JCML 1U3AA 2IIYA 2H71A 1A2JA 4EVMA 2YN1A 4DSSB 1FHEA 4WEYA 1HYUA 3DRNA 1GTAA 2LS5A 5JCWA 2HRAA 1GTBA 4ML6A 2DBCA 3TB2A 3MNGA 3WT2A 4K7NA 5DQYA 4GTUA 3LXZA 2C0GA 3W8SA 1K0NA 3PH9A 2YWOA 1SKSB 2NDOA 2L5OA 2JSYA 4G0KA 3GUSA 1UA5A 4N10A 3D0ZA 4GSNA 5CAXA 2HQTA 2RIIA 2LJKA 2DJ0A 2YPMA 4HOJA 4Z7XA 3ZIJA 1SENA 5A4UA 3KTLA 2PMTA 7GSSA 1WIKA 3ZFLA 4GRFA 3GSSA 4TR4A 1FB6A 2D2ZA 6GSUA 2H66A 1YZXA 2L5LA 1S3AA 1MDIA 2BMXA 2R3XA 5IQYA 2V6OA 2GZYA 1W89A 5DAKB 4IHUA 4EF0A 1E2YA 1OC8A 3QAGA 1XWAA 3A3TA 3ED3A 5G5EA 4EXJA 3FR3A 1GULA 3VWVA 5A4VA 1SYXA 3KZQA 4G0LA 5CP1A 1R5PA 2MBSA 1GLQA 3CRTA 3RPPA 3BD2A 2F51A 4L0WA 3IC8A 1U3IA 2C3QA 4MZCA 1ZOFA 5IMAA 2ON5A 4USSA 4BA7A 4MABA 2LTKA 4IJIA 1VF2A 4KA0A 3ZITA 1G6YA 1SU9A 4IP1A 2IMDA 2WRTA 4HZ4A 1J9BA 4MF7A 2B1LA 5HFIA 4KE3A 5D9XA 5L71A 3EMPA 1WE0A 3US3A 5ECKB 3RHCA 5DQSA 4V1Ap 1DBYA
chains in the Genus database with same CATH superfamily
1OC9B 3TUEA 1EEMA 2EIOA 4PQIA 4X0XA 5IPGA 2HXKA 1Z5YE 5H5SA 5A5HA 1S3DA 1X9SB 4PURA 1YF1A 4TR0A 1TDIA 3ERFA 3LORA 1HD2A 1GUMA 4NV2A 3O6TA 2HRNA 1QXHA 4XRAA 5KN3A 2GT6A 2PERA 1T3BA 2DKIA 3EU4A 1B9XC 4OFNA 4MF5A 2FA8A 1U6TA 1Z7RA 2IN3A 1T1VA 1T7PB 2O87A 1LBKA 3IK9A 1V2AA 1JZOA 5KEJA 3HXSA 3DMLA 4YAVA 5B6MA 3KJYA 1GSEA 4IQ1A 5ENUA 3TJKA 5DALA 4FYUA 4EIPA 1OAZA 5HR1A 4IS0A 2MMZA 3HA9A 1TI3A 3DEXA 5DBQA 4WR5A 3GIXA 4EIQA 4PTSA 2IL3A 2WGRA 5ECIB 2L57A 4EC0A 4KUNA 4OWYA 3PPUA 2LEGA 4J56E 4AJ7A 3FMWA 1A2MA 2OJLA 5IO2A 3EINA 1Z7PA 5IMZA 3TCOA 3UEMA 5GSTA 3TOUA 1Y6EA 2VO4A 5INYA 3LFLA 4IBPA 5IPHA 3APOA 2B5YA 3P7XA 5HQPA 2I4AA 3WYWA 2GT5A 1PD21 3HY2A 1TK5B 4K0NA 3F8UA 3H1NA 2HZEB 3FR6A 5B8AA 4ISDA 5G1LA 3KH9A 1EGOA 2MZCA 2PVOC 4MP4A 5A34B 5HFKA 4L5OA 1NHYA 1BG5A 5AIVA 4WKWA 4GXZA 2B1KA 22GSA 1THXA 1B8XA 3KMNA 2M80A 4WF5A 5D9VA 5A1NB 4W66A 4XCSA 4XS1A 2WVXB 4HS1A 2ZUPA 4WXTA 5KOXA 3DXBA 1MDKA 1K0BA 2FWEA 2NPBA 2FGXA 3EPTA 1SKWB 1F6MC 1X0RA 1QMVA 3ERWA 5JCGA 3TKSC 1AIUA 3D21A 5IMDA 3TJGA 4PHZC 4N3ZA 1F9MA 1BYEA 5G31A 3Q74A 3GURA 3F9UA 3IAM2 2DJKA 4G9HA 3RBTA 1HNCA 1SD9A 1YEWC 4I8BA 4FQUA 2P5RA 3FHKA 4JE1A 1ABAA 3GX8A 4MJCA 2O3EA 4HZ2A 4GWRA 3KM6A 4WR4A 1SL2B 4MH2A 3QR6A 2LRCA 1O8WA 1SJ6A 1X5DA 2B7JA 1CQGA 3UMAA 3QDNA 3TDGA 3UIWA 4IW9A 2R4VA 4NXIA 4OMVA 1U87A 3A2WA 1PGTA 1URMA 1DE1A 1T00A 2H73A 2HRKA 1EZKA 2A2RA 3GKKA 1YEXA 3G7IA 4Z2UA 3CMIA 5IM9A 3ME8A 4D73A 3KD0A 1R26A 4LMVA 4FIWA 5JWRB 2JSZA 4CHSA 2PPTA 1X9WB 2FD3A 5C04A 4TR3A 3IOSA 4XS4B 2WZ9A 3TGZA 2LSTA 2VM1A 5ABRA 3EURA 4K2DA 3IAS2 4LL1B 4ECJA 3DVXA 1I5GA 1GTUA 3CHXC 4BVYB 1XW6A 1B4PA 2DIYA 4IQAA 1ZZYA 5ECLB 1V40A 4OD7A 1ZYNA 5EVOA 3ZTLA 3IE3A 3LEFA 4GSTA 1O8XA 1AQVA 1W4VA 3BOAA 4KDXA 1M9BA 2H8LA 1JZRA 4E8EA 3IRAA 1M3JA 2BTOT 4K5SA 3QFAC 2IFQB 4F0CA 3VWUA 1S4BP 1SL0B 5AN1A 1WPIA 2QC7A 1YY7A 3N5OA 1ZMAA 3ISOA 2N5AA 1FAAA 3HCZA 3VPTA 4FYBA 3ERGA 3U6VA 1PA3A 3G9BA 1XWGA 3L9SA 5ECSA 1I1IP 1TOFA 2N5BA 2KHPA 5E4WA 3DKSA 2GGTA 2KOKA 3HZ4A 1GH2A 4O5QA 4X1UA 5EL8A 4L0UA 2NTOA 1GL8A 3I6AA 3W8JA 1QUWA 4GF0A 3TKQA 2LUSA 1XW9A 4BL7A 5AGYA 4ZIJA 4DEJA 1XPVA 2VL2C 4QQ7A 3L9VA 4IP6A 1HNBA 4G01A 3VWXA 3V1WA 10GSA 4Q5NA 4HQSA 2OE1A 3EC3A 1YF0A 2E2MA 3ZLPA 3L9UA 4K7IA 3S9FA 2OADA 3M8NA 2H74A 1USBA 3IV4A 1GTIA 1SJIA 3DGQA 3E3EA 4ULXA 1NSWA 1F37A 2V32A 1PMTA 2V6KA 3IR4A 2PGTA 1ERUA 5F05A 5IMVA 4ILFA 4TKYA 1TU8A 3TKPA 4MDCA 4RI6A 4KB3A 3D5JA 2WB9A 2H75A 1PKZA 2VCTA 1K0AA 2QGVA 1AQXA 2CZ3A 1O81A 2KUCA 3VFIA 2R37A 1FVJA 1ML6A 3NOFA 1S3RA 4AJ6A 3QMXA 2WCIA 4V1Ag 3M3MA 2ES7A 3DVWA 3P2AA 3R2QA 1K3YA 3GFKA 1BX9A 4K2XA 3UARA 1GSYA 2V2GA 4DSSA 3EMXA 2JL4A 2IPAA 1SKRB 1YKCA 5H5RA 3GKXA 1OKDA 4EO3A 1XWKA 1ACVA 1TXUA 2OBKA 1PFOA 1DSBA 4BVXA 1O7UA 1VF1A 4ECIA 3MSZA 2LNTA 5BMUA 2MYGA 3J7Yk 1B48A 4HU9A 4ECBA 3OR5A 4RI7A 2E7PA 1X9MB 4EL1A 3TKRA 2RM5A 2HT9A 1TW9A 2X8HA 3LW9A 1T8EB 1K3LA 4YH2A 2GZPA 2FCHA 5EPFA 4OCEA 1YEPA 4K8MA 2O5VA 1H4OA 1M3IA 2VLVA 3A2VA 3LJRA 5HR3A 5J3RA 3F4RA 3ZMKA 2FWGA 3N9JA 2KLXA 4MLYA 2VLUA 2K8VA 2YWNA 1XOBA 1DE2A 1OC3A 3UVHA 2LV3A 2CQ9A 3EYTA 4LL4B 4TN8A 1AQWA 2EFCA 2IMIA 2FWHA 4TR1A 5D96A 1GP1A 5KN1A 3LQ7A 2F8FA 5A5KA 1OVNA 2V41A 2VD0A 1M99A 3ME7A 2VAFA 1A0FA 2VCQA 1EP7A 4IJ3A 1OYJA 2CAQA 4E68A 5GAPD 2O8VB 3KGKA 3HVXA 3FRCA 4BIKA 4GQFA 4AJ8A 5DDLA 3LYPA 3GTUA 3ZFBA 2DMMA 4FYCA 2V1MA 19GSA 3NZNA 4I97A 2BJXA 1QQ2A 2OBIA 1WRYA 3UJ1A 1EP8A 2F9SA 4XS6A 1A23A 3H79A 1GWCA 3F4SA 1BQ7A 6GSVA 5J4YA 4POKA 3FR9A 1M0UA 3BBYA 2YP6A 3WGXA 3UVTA 3O3TA 2XBIA 3GL3A 1ZYQB 2DJJA 1YKAA 2YJHA 4ZL7A 2XHFA 4JU5A 2RLIA 2E0QA 1JZDA 2X49A 2GZZA 1OE7A 1RQMA 4OFTA 2QKEA 4O32A 3HVSA 1V98A 4BWSA 5ECHB 5F0GA 4GQCA 4OFMA 1EV4A 2I1UA 2F3MA 1PL1A 2EFDA 5DJMA 1TXXA 2IMEA 5DVBA 3H8QA 3RHBA 3IXRA 2GLRA 3TKSE 2AB6A 1A24A 1VRSD 2G0FA 3M9JA 1FO5A 2VCVA 2PUKC 2EC4A 1KNGA 1GRXA 2L59A 1A8LA 3DWVA 1V9WA 4PNGA 4PQ1A 2NVLA 2PWJA 3C1RA 4ML1A 2M46A 2MMAA 2YJ7A 4O7HA 2H76A 1SJZA 5ECOB 5CYYA 3FYGA 3UBLA 2HZEA 5BRTA 2C80A 4N0VA 1B9YC 1FOVA 5H5QA 3GV1A 2X8GA 1XW5A 4KCAA 4KSOA 5A34A 1RW1A 5ID2A 2CA8A 5FT3A 3IBHA 3IK7A 2CVDA 2ZNMA 1TTZA 4HEA2 3ZMLA 3GH9A 3VURA 3DIEA 2YWIA 1BEDA 1XWBA 1HNAA 3CTGA 3TOTA 2XC2A 3I69A 5D9TA 1SD8A 3VLNA 13GSA 2WS2A 4KAEA 4MNNA 5ECNB 3MYDA 4V2MA 2H0IA 4NMUA 3F63A 5DALB 2VL3A 1NW2A 1GNEA 1O85A 1LU4A 4G19A 1XFLA 4KW6A 5J9CA 3IPZA 2OACA 2YOIA 5EY6A 5J4VA 2HFDA 1I9DA 1TP9A 3I9V2 1BF5A 1YJ6A 3BCKA 3FY7A 4NAXA 4NWYA 2HSYA 2CAIA 4MH3A 2N5FA 3KXOA 2GSRA 1S3CA 4BPYA 3ZRDA 4V2LA 3TRXA 3KH7A 1X5CA 4AKHA 4KSMA 2YANA 2H1LA 1K0DA 2HSNB 2J9HA 3J7Yb 4XS4A 4FH8A 1GLPA 4GCIA 4ZB9A 3ZVJA 1HQOA 2HLSA 8GSSA 2B3SA 1THOA 1MTCA 4GSSA 1PSQA 2IJYA 1GUKA 1FVKA 3EVIA 2O89A 6GSWA 5DJLA 1ZCPA 14GSA 2WDUA 2K6VA 3P90A 3K8NA 2HE3A 2EFEA 3VI7A 1TRSA 1AC1A 5F06A 2IFQA 4CDOA 4Z2RA 2O7KA 1BG1A 2IMFA 4TRXA 3WT1A 3CBUA 4XIHA 4KH7A 1M9AA 3QAVA 3A5WA 2J23A 5ECQB 1N2AA 3UAPA 5CNWA 2CVBA 5DCGA 5DCHA 4KDUA 2WFCA 5ELAA 4ACSA 3QAWA 1R5AA 2VCWA 1FOHA 3EE2A 4LMWA 3APQA 4JBBA 4TXVA 1EEJA 2M72A 1RK4A 4GLTA 1DUGA 4XRDA 2DSAA 3DD3A 1YVLA 1B4QA 2A4VA 3MDKA 2I3YA 2VCXA 4YKFA 4MK3A 2DJ1A 4NPBA 1K0OA 4G10A 4AKGA 1N8JA 1TI1A 3GX0A 1J08A 3FZ5A 1GUHA 4QL9A 4LLRA 5J4UA 4FO5A 4J57E 5CRGA 2GQKA 2TRXA 3QCPA 3GKMA 4XTSA 1LJRA 3LXTA 1F2EA 4POLA 4KDYA 4TVEA 1ERVA 4N30A 3GSTA 2GSQA 3TKSA 3WGEA 5FWGA 2MMOA 4JEDA 2CX3A 2VD1A 4ZXGA 1WOUA 1Q98A 3CSHA 4KGIA 2ALBA 3Q6OA 5B8BA 1EOHA 4MPFA 2C0FA 1PQNA 4ZL8A 4MZWA 5J9BA 3RAZA 1MEKA 2H72A 2H1DA 4JRRA 4GDFA 2C3TA 1XVQA 1FW1A 2H30A 5B6NA 3FW2A 2AYTA 4J2FA 4HUAA 1ZGNA 1Z3EA 2R0GA 1R4WA 1SK1A 3HMJG 5ECPB 4TOPA 2HRFA 4MJAA 4ZB8A 4TXOA 2WVYA 2NBSA 3APSA 5JCUA 2L6CA 4NHWA 3ZVJD 1BAYA 2O36A 3M0FA 4EE0A 4DSRA 2OA7A 1XOAA 2L4CA 4P3YB 4K9ZA 2XPEA 3TJBA 2RM6A 3KCMA 2C3NA 2YWMA 1JLVA 1T4ZA 3H4KA 5JWQB 2VLTA 4BL7B 1VF4A 3WGDA 1SL1B 1PN9A 1X5EA 5GZZB 2B5EA 3TRQA 1WJKA 1NHOA 2HZFA 2VOCA 1AUCA 2H70A 3CWGA 3GYKA 2X8CA 4ZL9A 1ON4A 3GL5A 3O76A 1WP0A 1Z6MA 3GHAA 4MF6A 2JZTA 3ZYWA 2RUFA 4YQMA 2PBJA 3KP8A 5A4WA 3C7MA 4F2IA 2HSMB 4YQUA 2C0EA 2FLSA 2VIMA 4Z2TA 2H6ZA 3F0IA 3TRPA 3HHVA 1ZYEA 5D8IA 4CY8A 3TU3B 4AI6A 5G30A 2F8AA 4PQHA 2X4AA 1K0MA 4AF2A 5DAKA 4KX4A 3G7JA 1XG8A 1UVZA 2AUVA 2HSHA 1AXDA 1QGVA 3PR8A 3HVNA 2H01A 4KCEA 5F07A 3D6IA 1UC7A 1GSFA 5D73A 2VUPA 3LYKA 2WW0A 3GN3A 1Z6NA 4E8HA 5ECRB 4EDYA 1R7HA 5CRWA 1Y1UA 4BVXB 2VL2A 2H6YA 4PI0C 1KTEA 4OO5A 2QA1A 5BMUB 2YZUA 1SVOA 4MMMA 2CV4A 2OE3A 3QFBC 3E9JB 3D4MA 4AKXB 4O5UA 3AY8A 4YAPA 2YNXA 3UL3A 5E59A 1MD4A 2P0GA 4ZBAA 4X43A 1XIYA 2JZRA 1OC9A 2C1YA 2REMA 1PRXA 4O5RA 2LRNA 1ZYPA 2FNOA 5J41A 4CY6A 3CXGA 4F0BA 4WBJA 3KTBA 3R3EA 1GNWA 1G7OA 16GSA 2B6MA 3QPMA 2FHEA 1JZWA 2I81A 2FWFA 4KNDA 3C8EA 3IHQA 2DMLA 3FZAA 3C73A 1JHBA 4TR1B 2EIRA 1PN0A 2JU5A 11GSA 3IDVA 4HJMA 2UV8G 4RQXA 6GSXA 3C71A 2AV4A 1M2AA 4Q5RA 1IYHA 2XPDA 3MIXA 1GSUA 4ICYA 2AJQB 2LNSA 3F4TA 4AGSA 1Q4JA 3Q18A 1VGLA 4IELA 3VWWA 2YV7A 4JR6A 3GTUB 5HR2A 2P31A 4F03A 3A5IA 3HD5A 5HFGA 2I9HA 1J0FA 5D9WA 1H75A 2Z9SA 5IMCA 3G7YA 3ZL5A 3TJJA 1K3OA 5IOWA 1TK0B 2L4QA 1NM3A 5ECMB 4QL7A 3KMOA 2HI7A 1EOGA 3WD6A 2LQOA 1JLWA 6GSTA 3NIVA 3PINA 2C8UA 3H93A 2R5GA 3F6FA 4MCUA 5D93A 2MBTA 4K6XA 1OKTA 2GDRA 3DYRA 3LGCA 3KP9A 4WETA 2CVKA 2CZ2A 1QFNA 2FA4A 4ZB7A 4G2EA 3IA1A 5HR0A 5A5HB 3F3RA 2KP2A 4ZB6A 5AIXA 5A1NA 3L78A 1WMJA 20GSA 2WVXA 2B5XA 4DVCA 4L5LA 3E0UA 2G2QA 4BWQA 1N25A 2EFHA 1ERTA 3MAKA 3ZREA 2CT6A 2H6XA 1XVWA 1TKDB 1C72A 4CW9A 1PL2A 5J40A 2HSNA 4POMA 1MD3A 1Y25A 1JFUA 2R2JA 1EGRA 2FUG2 1V57A 3L4NA 1TU7A 3FKFA 5ELGA 2OT3A 1KBNA 2K8SA 3L0HA 5FHIA 3KIJA 2OKAA 2DIZA 3HDCA 4HI7A 6GSYA 2R6KA 3HVVA 1F3AA 3W6GA 2OE0A 5IO0A 1OE8A 2QA2A 2VKZG 2K9FA 4DSQA 3FEUA 1M2DA 2GSSA 1ST9A 2FY6A 3D22A 4HU7A 2ZCTA 4N0ZA 2C0DA 1O73A 4TW5A 5ID2B 1AW9A 4K7OA 5CRDA 1V58A 1FG4A 2LJRA 1CQHA 4AKIA 4I2UA 3MWHA 5G2ZA 4IVFA 1TJDA 2AAWA 3SWLA 2IWTA 2HNLA 4ZBDA 4YQVA 5KN2A 2TIRA 4BVYA 3RFRC 2H0HA 3EU3A 1MDJA 4PUFC 1XWCA 3PGTA 1IYIA 2XBQA 3GKNA 2VCZA 2WVZA 4MPGA 5IMFA 3VPQA 4RUVA 9GSSA 4I6XA 4QMKA 1AAZA 4ID0A 1ERWA 3GRXA 1ZL9A 4HQZA 2GQMA 2A4HA 3BJ5A 4ECCA 4OCFA 4V2NA 2GTUA 5IOXA 1SK0A 1PKWA 5G5FA 3RDWA 4WBRD 2WULA 4MA9A 4L8EA 3D4TA 4PXOA 1G6WA 3CYNA 3I43A 3KEBA 2GQLA 3CRUA 1G0TA 3U5RE 4FXYP 2LKUA 3IC4A 4O92A 3UBKA 3TJFA 2C4JA 1PX6A 1GSQA 1UN2A 5LCZA 1A0RP 1YQ1A 4EUYA 17GSA 1O6JA 4IGJA 2LJAA 18GSA 1TRVA 2HRKB 1KEBA 2VL9A 1EWXA 4A5PA 5C00A 4IN0A 4OO4A 4D73B 1F3BA 2GVPA 3Q19A 4MJBA 2E2GA 4JZQA 2DC5A 3QD9A 4PGTA 2DJ2A 3F3QA 2L6DA 3UOMA 4F9ZA 4KF9A 2R0PA 3HJPA 1K0CA 1YDKA 2WJUA 4I5QA 3ZIVA 4Q5QA 2H1GA 5KN0A 2DJ3A 3C1SA 4PNFA 5COHA 1A2LA 4Q5FA 4WF4A 2TRCP 2H1BA 1XZOA 2IMKA 5CO3A 2GS3A 4PUAA 1ILOA 2ON7A 3IHGA 3RPNA 5GSSA 3HJMA 3FK8A 2RUEA 4G0IA 1SVLA 1M2BA 4PX1A 1QK8A 4H86A 3M1GA 5LD0A 3GNJA 1EV9A 1A8YA 1XCCA 3ZZXA 2MMNA 3CQFA 4POBA 1PX7A 2UZ8A 2HYXA 4HSCX 4IKHA 2H1AA 1G7EA 3LWAA 4EKZA 4I2TA 2PVQA 1M7TA 2YZHA 4RQRA 2A2PA 1XXUA 4PI2C 2K18A 1WWJA 2P5QA 3CSJA 3GA4A 6GSSA 2WW3A 1BJXA 3VI5A 1T4YA 2PN8A 2HSMA 3HJOA 4MJEA 4N11A 2AHEA 3GMFA 5GAND 3P8WA 2WW1A 4LA1A 2A2SA 3HZ8A 2VM2A 1U88A 3GH6A 2H19A 4K1FA 3BCIA 2KP1A 2EIQA 3SBCA 2JZSA 3HKRA 5JWOB 3EWLA 5J47A 5AISA 3VK9A 2X99A 3LG6A 3QOUA 4XHMA 2H0GA 2QSIA 4HDEA 3HYPA 1SK2A 1TRUA 2O85A 5LNKe 2LQQA 2DLXA 12GSA 3A2XA 4ZBBA 4F82A 2GSTA 2YV9A 2LRTA 4NV5A 4ZILA 1GSDA 1GSSA 5G1KA 2CX4A 1TK8B 2B7KA 5CREA 3CSIA 4K0GA 4K5RA 5CRHA 5F8BA 1TRWA 1E6BA 5B7CA 3M9KA 4NHZA 2JADA 5J5NA 3F6DA 1XBSA 1VF3A 4TXOB 1FB0A 3LSZA 2PU9C 5IIZA 5KOWA 4JR4A 3FZ4A 2YCDA 1Z9HA 4HJ2A 2JACA 4MZBA 4EDZA 3FZ9A 2X64A 1SYRA 3CTFA 3JCML 1U3AA 2IIYA 2DKHA 2H71A 1A2JA 4EVMA 2YN1A 4DSSB 1FHEA 4WEYA 1HYUA 3DRNA 1GTAA 2LS5A 5JCWA 2HRAA 1GTBA 4ML6A 2DBCA 3TB2A 3MNGA 3WT2A 4K7NA 5DQYA 4GTUA 3LXZA 2C0GA 3W8SA 4X4JA 1K0NA 2WW2A 3PH9A 2YWOA 1SKSB 2NDOA 2L5OA 2JSYA 4G0KA 3GUSA 1UA5A 4N10A 3D0ZA 4GSNA 5CAXA 2HQTA 2RIIA 2LJKA 2DJ0A 2YPMA 4HOJA 4Z7XA 3RGBC 3ZIJA 1SENA 5A4UA 3KTLA 2PMTA 7GSSA 1WIKA 3ZFLA 4GRFA 3GSSA 4TR4A 1FB6A 2D2ZA 6GSUA 2H66A 1YZXA 2WZSA 2L5LA 1S3AA 2R0CA 1MDIA 2BMXA 2R3XA 5IQYA 2V6OA 2GZYA 1W89A 1SVMA 5DAKB 4IHUA 4EF0A 1E2YA 1OC8A 3QAGA 1XWAA 3A3TA 3ED3A 5G5EA 4EXJA 3FR3A 1GULA 3VWVA 5A4VA 1SYXA 3KZQA 4G0LA 5CP1A 1R5PA 2MBSA 1GLQA 3CRTA 3RPPA 3BD2A 2F51A 4L0WA 3IC8A 1U3IA 2C3QA 4MZCA 1ZOFA 5IMAA 2ON5A 4USSA 4BA7A 4MABA 2LTKA 4IJIA 1VF2A 4KA0A 3ZITA 1G6YA 1SU9A 4IP1A 2IMDA 2WRTA 4HZ4A 1J9BA 4MF7A 2B1LA 5HFIA 4KE3A 4YKGA 5D9XA 5L71A 3EMPA 1WE0A 3US3A 5ECKB 3RHCA 5DQSA 4V1Ap 1DBYA
chains in the Genus database with same CATH topology
1OC9B 3TUEA 1EEMA 2EIOA 4PQIA 4X0XA 5IPGA 2HXKA 1Z5YE 5H5SA 5A5HA 1S3DA 1X9SB 4PURA 1YF1A 4TR0A 1TDIA 3ERFA 3LORA 1HD2A 1GUMA 4NV2A 3O6TA 2HRNA 1QXHA 4XRAA 5KN3A 2GT6A 2PERA 1T3BA 2DKIA 3EU4A 1B9XC 4OFNA 4MF5A 2FA8A 1U6TA 1Z7RA 2IN3A 1T1VA 1T7PB 2O87A 1LBKA 3IK9A 1V2AA 1JZOA 5KEJA 3HXSA 3DMLA 4YAVA 5B6MA 3KJYA 1GSEA 4IQ1A 5ENUA 3TJKA 5DALA 4FYUA 4EIPA 1OAZA 5HR1A 4IS0A 2MMZA 3HA9A 1TI3A 3DEXA 5DBQA 4WR5A 3GIXA 4EIQA 4PTSA 2IL3A 2WGRA 5ECIB 2L57A 4EC0A 4KUNA 4OWYA 3PPUA 2LEGA 4J56E 4AJ7A 3FMWA 1A2MA 2OJLA 5IO2A 3EINA 1Z7PA 5IMZA 3TCOA 3UEMA 5GSTA 3TOUA 1Y6EA 2VO4A 5INYA 3LFLA 4IBPA 5IPHA 3APOA 2B5YA 3P7XA 5HQPA 2I4AA 3WYWA 2GT5A 1PD21 3HY2A 1TK5B 4K0NA 3F8UA 3H1NA 2HZEB 3FR6A 5B8AA 4ISDA 5G1LA 3KH9A 1EGOA 2MZCA 2PVOC 4MP4A 5A34B 5HFKA 4L5OA 1NHYA 1BG5A 5AIVA 4WKWA 4GXZA 2B1KA 22GSA 1THXA 1B8XA 3KMNA 2M80A 4WF5A 5D9VA 5A1NB 4W66A 4XCSA 4XS1A 4HS1A 2ZUPA 4WXTA 5KOXA 3DXBA 1MDKA 1K0BA 2FWEA 2NPBA 2FGXA 3EPTA 1SKWB 1F6MC 1X0RA 1QMVA 3ERWA 5JCGA 3TKSC 1AIUA 3D21A 5IMDA 3TJGA 4N3ZA 1F9MA 1BYEA 5G31A 3Q74A 3GURA 3F9UA 3IAM2 2DJKA 4G9HA 3RBTA 1HNCA 1SD9A 4I8BA 4FQUA 2P5RA 3FHKA 4JE1A 1ABAA 3GX8A 4MJCA 4HZ2A 4GWRA 3KM6A 4WR4A 1SL2B 4MH2A 3QR6A 2LRCA 1O8WA 1SJ6A 1X5DA 2B7JA 1CQGA 3UMAA 3QDNA 3TDGA 3UIWA 4IW9A 2R4VA 4NXIA 4OMVA 1U87A 3A2WA 1PGTA 1URMA 1DE1A 1T00A 2H73A 2HRKA 1EZKA 2A2RA 3GKKA 1YEXA 3G7IA 4Z2UA 3CMIA 5IM9A 3ME8A 4D73A 3KD0A 1R26A 4LMVA 4FIWA 5JWRB 2JSZA 4CHSA 2PPTA 1X9WB 2FD3A 5C04A 4TR3A 3IOSA 4XS4B 2WZ9A 3TGZA 2LSTA 2VM1A 5ABRA 3EURA 4K2DA 3IAS2 4LL1B 4ECJA 3DVXA 1I5GA 1GTUA 4BVYB 1XW6A 1B4PA 2DIYA 4IQAA 1ZZYA 5ECLB 1V40A 4OD7A 1ZYNA 5EVOA 3ZTLA 3IE3A 3LEFA 4GSTA 1O8XA 1AQVA 1W4VA 3BOAA 4KDXA 1M9BA 2H8LA 1JZRA 4E8EA 3IRAA 2BTOT 4K5SA 3QFAC 2IFQB 4F0CA 3VWUA 1SL0B 5AN1A 1WPIA 2QC7A 1YY7A 3N5OA 1ZMAA 3ISOA 2N5AA 1FAAA 3HCZA 3VPTA 4FYBA 3ERGA 3U6VA 1PA3A 3G9BA 1XWGA 3L9SA 5ECSA 1TOFA 2N5BA 2KHPA 5E4WA 3DKSA 2GGTA 2KOKA 3HZ4A 1GH2A 4O5QA 4X1UA 5EL8A 4L0UA 2NTOA 1GL8A 3I6AA 3W8JA 1QUWA 4GF0A 3TKQA 2LUSA 1XW9A 4BL7A 5AGYA 4ZIJA 4DEJA 1XPVA 2VL2C 4QQ7A 3L9VA 4IP6A 1HNBA 4G01A 3VWXA 3V1WA 10GSA 4Q5NA 4HQSA 2OE1A 3EC3A 1YF0A 2E2MA 3ZLPA 3L9UA 4K7IA 3S9FA 2OADA 3M8NA 2H74A 1USBA 3IV4A 1GTIA 1SJIA 3DGQA 3E3EA 4ULXA 1NSWA 1F37A 2V32A 1PMTA 2V6KA 3IR4A 2PGTA 1ERUA 5F05A 5IMVA 4ILFA 4TKYA 1TU8A 3TKPA 4MDCA 4RI6A 4KB3A 3D5JA 2WB9A 2H75A 1PKZA 2VCTA 1K0AA 2QGVA 1AQXA 2CZ3A 1O81A 2KUCA 3VFIA 2R37A 1FVJA 1ML6A 3NOFA 4AJ6A 3QMXA 2WCIA 4V1Ag 3M3MA 2ES7A 3DVWA 3P2AA 3R2QA 1K3YA 3GFKA 1BX9A 4K2XA 3UARA 1GSYA 2V2GA 4DSSA 3EMXA 2JL4A 2IPAA 1SKRB 1YKCA 5H5RA 3GKXA 1OKDA 4EO3A 1XWKA 1ACVA 1TXUA 2OBKA 1DSBA 4BVXA 1O7UA 1VF1A 4ECIA 3MSZA 2LNTA 5BMUA 2MYGA 3J7Yk 1B48A 4HU9A 4ECBA 3OR5A 4RI7A 2E7PA 1X9MB 4EL1A 3TKRA 2RM5A 2HT9A 1TW9A 2X8HA 3LW9A 1T8EB 1K3LA 4YH2A 2GZPA 2FCHA 5EPFA 4OCEA 1YEPA 4K8MA 2O5VA 1H4OA 2VLVA 3A2VA 3LJRA 5HR3A 5J3RA 3F4RA 3ZMKA 2FWGA 3N9JA 2KLXA 4MLYA 2VLUA 2K8VA 2YWNA 1XOBA 1DE2A 1OC3A 3UVHA 2LV3A 2CQ9A 3EYTA 4LL4B 4TN8A 1AQWA 2EFCA 2IMIA 2FWHA 4TR1A 5D96A 1GP1A 5KN1A 3LQ7A 2F8FA 5A5KA 1OVNA 2V41A 2VD0A 1M99A 3ME7A 2VAFA 1A0FA 2VCQA 1EP7A 4IJ3A 1OYJA 2CAQA 4E68A 5GAPD 2O8VB 3KGKA 3HVXA 3FRCA 4GQFA 4AJ8A 5DDLA 3LYPA 3GTUA 3ZFBA 2DMMA 4FYCA 2V1MA 19GSA 3NZNA 4I97A 2BJXA 1QQ2A 2OBIA 1WRYA 3UJ1A 1EP8A 2F9SA 4XS6A 1A23A 3H79A 1GWCA 3F4SA 1BQ7A 6GSVA 5J4YA 4POKA 3FR9A 1M0UA 3BBYA 2YP6A 3WGXA 3UVTA 3O3TA 2XBIA 3GL3A 1ZYQB 2DJJA 1YKAA 2YJHA 4ZL7A 2XHFA 4JU5A 2RLIA 2E0QA 1JZDA 2X49A 2GZZA 1OE7A 1RQMA 4OFTA 2QKEA 4O32A 3HVSA 1V98A 4BWSA 5ECHB 5F0GA 4GQCA 4OFMA 1EV4A 2I1UA 2F3MA 1PL1A 2EFDA 5DJMA 1TXXA 2IMEA 5DVBA 3H8QA 3RHBA 3IXRA 2GLRA 3TKSE 2AB6A 1A24A 1VRSD 2G0FA 3M9JA 1FO5A 2VCVA 2PUKC 2EC4A 1KNGA 1GRXA 2L59A 1A8LA 3DWVA 1V9WA 4PNGA 4PQ1A 2NVLA 2PWJA 3C1RA 4ML1A 2M46A 2MMAA 2YJ7A 4O7HA 2H76A 1SJZA 5ECOB 5CYYA 3FYGA 3UBLA 2HZEA 5BRTA 2C80A 4N0VA 1B9YC 1FOVA 5H5QA 3GV1A 2X8GA 1XW5A 4KCAA 4KSOA 5A34A 1RW1A 5ID2A 2CA8A 5FT3A 3IBHA 3IK7A 2CVDA 2ZNMA 1TTZA 4HEA2 3ZMLA 3GH9A 3VURA 3DIEA 2YWIA 1BEDA 1XWBA 1HNAA 3CTGA 3TOTA 2XC2A 3I69A 5D9TA 1SD8A 3VLNA 13GSA 2WS2A 4KAEA 4MNNA 5ECNB 3MYDA 4V2MA 2H0IA 4NMUA 3F63A 5DALB 2VL3A 1NW2A 1GNEA 1O85A 1LU4A 4G19A 1XFLA 4KW6A 5J9CA 3IPZA 2OACA 2YOIA 5EY6A 5J4VA 2HFDA 1I9DA 1TP9A 3I9V2 1BF5A 1YJ6A 3BCKA 3FY7A 4NAXA 4NWYA 2HSYA 2CAIA 4MH3A 2N5FA 3KXOA 2GSRA 1S3CA 4BPYA 3ZRDA 4V2LA 3TRXA 3KH7A 1X5CA 4AKHA 4KSMA 2YANA 2H1LA 1K0DA 2HSNB 2J9HA 3J7Yb 4XS4A 4FH8A 1GLPA 4GCIA 4ZB9A 3ZVJA 1HQOA 2HLSA 8GSSA 2B3SA 1THOA 1MTCA 4GSSA 1PSQA 2IJYA 1GUKA 1FVKA 3EVIA 2O89A 6GSWA 5DJLA 1ZCPA 14GSA 2WDUA 2K6VA 3P90A 3K8NA 2HE3A 2EFEA 3VI7A 1TRSA 1AC1A 5F06A 2IFQA 4CDOA 4Z2RA 2O7KA 1BG1A 2IMFA 4TRXA 3WT1A 3CBUA 4XIHA 4KH7A 1M9AA 3QAVA 3A5WA 2J23A 5ECQB 1N2AA 3UAPA 5CNWA 2CVBA 5DCGA 5DCHA 4KDUA 2WFCA 5ELAA 4ACSA 3QAWA 1R5AA 2VCWA 1FOHA 3EE2A 4LMWA 3APQA 4JBBA 4TXVA 1EEJA 2M72A 1RK4A 4GLTA 1DUGA 4XRDA 2DSAA 3DD3A 1YVLA 1B4QA 2A4VA 3MDKA 2I3YA 2VCXA 4YKFA 4MK3A 2DJ1A 4NPBA 1K0OA 4G10A 4AKGA 1N8JA 1TI1A 3GX0A 1J08A 3FZ5A 1GUHA 4QL9A 4LLRA 5J4UA 4FO5A 4J57E 5CRGA 2GQKA 2TRXA 3QCPA 3GKMA 4XTSA 1LJRA 3LXTA 1F2EA 4POLA 4KDYA 4TVEA 1ERVA 4N30A 3GSTA 2GSQA 3TKSA 3WGEA 5FWGA 2MMOA 4JEDA 2CX3A 2VD1A 4ZXGA 1WOUA 1Q98A 3CSHA 4KGIA 2ALBA 3Q6OA 5B8BA 1EOHA 4MPFA 2C0FA 1PQNA 4ZL8A 4MZWA 5J9BA 3RAZA 1MEKA 2H72A 2H1DA 4JRRA 4GDFA 2C3TA 1XVQA 1FW1A 2H30A 5B6NA 3FW2A 2AYTA 4J2FA 4HUAA 1ZGNA 1Z3EA 2R0GA 1R4WA 1SK1A 3HMJG 5ECPB 4TOPA 2HRFA 4MJAA 4ZB8A 4TXOA 2NBSA 3APSA 5JCUA 2L6CA 4NHWA 3ZVJD 1BAYA 3M0FA 4EE0A 4DSRA 2OA7A 1XOAA 2L4CA 4P3YB 4K9ZA 2XPEA 3TJBA 2RM6A 3KCMA 2C3NA 2YWMA 1JLVA 1T4ZA 3H4KA 5JWQB 2VLTA 4BL7B 1VF4A 3WGDA 1SL1B 1PN9A 1X5EA 5GZZB 2B5EA 3TRQA 1WJKA 1NHOA 2HZFA 2VOCA 1AUCA 2H70A 3CWGA 3GYKA 2X8CA 4ZL9A 1ON4A 3GL5A 3O76A 1WP0A 1Z6MA 3GHAA 4MF6A 2JZTA 3ZYWA 2RUFA 4YQMA 2PBJA 3KP8A 5A4WA 3C7MA 4F2IA 2HSMB 4YQUA 2C0EA 2FLSA 2VIMA 4Z2TA 2H6ZA 3F0IA 3TRPA 3HHVA 1ZYEA 5D8IA 4CY8A 3TU3B 4AI6A 5G30A 2F8AA 4PQHA 2X4AA 1K0MA 4AF2A 5DAKA 4KX4A 3G7JA 1UVZA 2AUVA 2HSHA 1AXDA 1QGVA 3PR8A 2H01A 4KCEA 5F07A 3D6IA 1UC7A 1GSFA 5D73A 2VUPA 3LYKA 3GN3A 1Z6NA 4E8HA 5ECRB 4EDYA 1R7HA 5CRWA 1Y1UA 4BVXB 2VL2A 2H6YA 1KTEA 4OO5A 2QA1A 5BMUB 2YZUA 1SVOA 4MMMA 2CV4A 2OE3A 3QFBC 3E9JB 3D4MA 4AKXB 4O5UA 3AY8A 4YAPA 2YNXA 3UL3A 5E59A 1MD4A 2P0GA 4ZBAA 4X43A 1XIYA 2JZRA 1OC9A 2C1YA 2REMA 1PRXA 4O5RA 2LRNA 1ZYPA 2FNOA 5J41A 4CY6A 3CXGA 4F0BA 4WBJA 3KTBA 3R3EA 1GNWA 1G7OA 16GSA 2B6MA 3QPMA 2FHEA 1JZWA 2I81A 2FWFA 4KNDA 3C8EA 3IHQA 2DMLA 3FZAA 3C73A 1JHBA 4TR1B 2EIRA 1PN0A 2JU5A 11GSA 3IDVA 4HJMA 2UV8G 4RQXA 6GSXA 3C71A 2AV4A 1M2AA 4Q5RA 1IYHA 2XPDA 3MIXA 1GSUA 4ICYA 2AJQB 2LNSA 3F4TA 4AGSA 1Q4JA 3Q18A 1VGLA 4IELA 3VWWA 2YV7A 4JR6A 3GTUB 5HR2A 2P31A 4F03A 3A5IA 3HD5A 5HFGA 2I9HA 1J0FA 5D9WA 1H75A 2Z9SA 5IMCA 3G7YA 3ZL5A 3TJJA 1K3OA 5IOWA 1TK0B 2L4QA 1NM3A 5ECMB 4QL7A 3KMOA 2HI7A 1EOGA 3WD6A 2LQOA 1JLWA 6GSTA 3NIVA 3PINA 2C8UA 3H93A 2R5GA 3F6FA 4MCUA 5D93A 2MBTA 4K6XA 1OKTA 2GDRA 3DYRA 3LGCA 3KP9A 4WETA 2CVKA 2CZ2A 1QFNA 2FA4A 4ZB7A 4G2EA 3IA1A 5HR0A 5A5HB 3F3RA 2KP2A 4ZB6A 5AIXA 5A1NA 3L78A 1WMJA 20GSA 2B5XA 4DVCA 4L5LA 3E0UA 2G2QA 4BWQA 1N25A 2EFHA 1ERTA 3MAKA 3ZREA 2CT6A 2H6XA 1XVWA 1TKDB 1C72A 4CW9A 1PL2A 5J40A 2HSNA 4POMA 1MD3A 1Y25A 1JFUA 2R2JA 1EGRA 2FUG2 1V57A 3L4NA 1TU7A 3FKFA 5ELGA 2OT3A 1KBNA 2K8SA 3L0HA 5FHIA 3KIJA 2OKAA 2DIZA 3HDCA 4HI7A 6GSYA 2R6KA 3HVVA 1F3AA 3W6GA 2OE0A 5IO0A 1OE8A 2QA2A 2VKZG 2K9FA 4DSQA 3FEUA 1M2DA 2GSSA 1ST9A 2FY6A 3D22A 4HU7A 2ZCTA 4N0ZA 2C0DA 1O73A 4TW5A 5ID2B 1AW9A 4K7OA 5CRDA 1V58A 1FG4A 2LJRA 1CQHA 4AKIA 4I2UA 3MWHA 5G2ZA 4IVFA 1TJDA 2AAWA 3SWLA 2IWTA 2HNLA 4ZBDA 4YQVA 5KN2A 2TIRA 4BVYA 2H0HA 3EU3A 1MDJA 4PUFC 1XWCA 3PGTA 1IYIA 2XBQA 3GKNA 2VCZA 5IMFA 4MPGA 3VPQA 4RUVA 9GSSA 4I6XA 4QMKA 1AAZA 4ID0A 1ERWA 3GRXA 1ZL9A 4HQZA 2GQMA 2A4HA 3BJ5A 4ECCA 4OCFA 4V2NA 2GTUA 5IOXA 1SK0A 1PKWA 5G5FA 3RDWA 4WBRD 2WULA 4MA9A 4L8EA 3D4TA 4PXOA 1G6WA 3CYNA 3I43A 3KEBA 2GQLA 3CRUA 1G0TA 3U5RE 2LKUA 3IC4A 4O92A 3UBKA 3TJFA 2C4JA 1PX6A 1GSQA 1UN2A 5LCZA 1A0RP 1YQ1A 4EUYA 17GSA 1O6JA 4IGJA 2LJAA 18GSA 1TRVA 2HRKB 1KEBA 2VL9A 1EWXA 4A5PA 5C00A 4IN0A 4OO4A 4D73B 1F3BA 2GVPA 3Q19A 4MJBA 2E2GA 4JZQA 2DC5A 3QD9A 4PGTA 2DJ2A 3F3QA 2L6DA 3UOMA 4F9ZA 4KF9A 2R0PA 3HJPA 1K0CA 1YDKA 2WJUA 4I5QA 3ZIVA 4Q5QA 2H1GA 5KN0A 2DJ3A 3C1SA 4PNFA 5COHA 1A2LA 4Q5FA 4WF4A 2TRCP 2H1BA 1XZOA 2IMKA 5CO3A 2GS3A 4PUAA 1ILOA 2ON7A 3IHGA 3RPNA 5GSSA 3HJMA 3FK8A 2RUEA 4G0IA 1SVLA 1M2BA 4PX1A 1QK8A 4H86A 3M1GA 5LD0A 3GNJA 1EV9A 1A8YA 1XCCA 3ZZXA 2MMNA 4POBA 1PX7A 2UZ8A 2HYXA 4IKHA 2H1AA 1G7EA 3LWAA 4EKZA 4I2TA 2PVQA 1M7TA 2YZHA 4RQRA 2A2PA 1XXUA 2K18A 1WWJA 2P5QA 3CSJA 3GA4A 6GSSA 1BJXA 3VI5A 1T4YA 2PN8A 2HSMA 3HJOA 4MJEA 4N11A 2AHEA 3GMFA 5GAND 3P8WA 4LA1A 2A2SA 3HZ8A 2VM2A 1U88A 3GH6A 2H19A 4K1FA 3BCIA 2KP1A 2EIQA 3SBCA 2JZSA 3HKRA 5JWOB 3EWLA 5J47A 5AISA 3VK9A 2X99A 3LG6A 3QOUA 4XHMA 2H0GA 2QSIA 4HDEA 3HYPA 1SK2A 1TRUA 2O85A 5LNKe 2LQQA 2DLXA 12GSA 3A2XA 4ZBBA 4F82A 2GSTA 2YV9A 2LRTA 4NV5A 4ZILA 1GSDA 1GSSA 5G1KA 2CX4A 1TK8B 2B7KA 5CREA 3CSIA 4K0GA 4K5RA 5CRHA 5F8BA 1TRWA 1E6BA 5B7CA 3M9KA 4NHZA 2JADA 5J5NA 3F6DA 1XBSA 1VF3A 4TXOB 1FB0A 3LSZA 2PU9C 5IIZA 5KOWA 4JR4A 3FZ4A 2YCDA 1Z9HA 4HJ2A 2JACA 4MZBA 4EDZA 3FZ9A 2X64A 1SYRA 3CTFA 3JCML 1U3AA 2IIYA 2DKHA 2H71A 1A2JA 4EVMA 2YN1A 4DSSB 1FHEA 4WEYA 1HYUA 3DRNA 1GTAA 2LS5A 5JCWA 2HRAA 1GTBA 4ML6A 2DBCA 3TB2A 3MNGA 3WT2A 4K7NA 5DQYA 4GTUA 3LXZA 2C0GA 3W8SA 4X4JA 1K0NA 3PH9A 2YWOA 1SKSB 2NDOA 2L5OA 2JSYA 4G0KA 3GUSA 1UA5A 4N10A 3D0ZA 4GSNA 5CAXA 2HQTA 2RIIA 2LJKA 2DJ0A 2YPMA 4HOJA 4Z7XA 3ZIJA 1SENA 5A4UA 3KTLA 2PMTA 7GSSA 1WIKA 3ZFLA 4GRFA 3GSSA 4TR4A 1FB6A 2D2ZA 6GSUA 2H66A 1YZXA 2L5LA 1S3AA 2R0CA 1MDIA 2BMXA 2R3XA 5IQYA 2V6OA 2GZYA 1W89A 1SVMA 5DAKB 4IHUA 4EF0A 1E2YA 1OC8A 3QAGA 1XWAA 3A3TA 3ED3A 5G5EA 4EXJA 3FR3A 1GULA 3VWVA 5A4VA 1SYXA 3KZQA 4G0LA 5CP1A 1R5PA 2MBSA 1GLQA 3CRTA 3RPPA 3BD2A 2F51A 4L0WA 3IC8A 1U3IA 2C3QA 4MZCA 1ZOFA 5IMAA 2ON5A 4USSA 4BA7A 4MABA 2LTKA 4IJIA 1VF2A 4KA0A 3ZITA 1G6YA 1SU9A 4IP1A 2IMDA 2WRTA 4HZ4A 1J9BA 4MF7A 2B1LA 5HFIA 4KE3A 4YKGA 5D9XA 5L71A 3EMPA 1WE0A 3US3A 5ECKB 3RHCA 5DQSA 4V1Ap 1DBYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OC9 B;  3TUE A;  1EEM A;  2EIO A;  4PQI A;  4X0X A;  5IPG A;  2HXK A;  1Z5Y E;  5H5S A;  1S3D A;  1X9S B;  4PUR A;  1YF1 A;  4TR0 A;  1TDI A;  3ERF A;  3LOR A;  1HD2 A;  1GUM A;  4NV2 A;  3O6T A;  2HRN A;  1QXH A;  4XRA A;  5KN3 A;  2GT6 A;  2PER A;  1T3B A;  3EU4 A;  1B9X C;  4OFN A;  4MF5 A;  2FA8 A;  1U6T A;  1Z7R A;  2IN3 A;  1T1V A;  1T7P B;  2O87 A;  1LBK A;  3IK9 A;  1V2A A;  1JZO A;  5KEJ A;  3HXS A;  3DML A;  4YAV A;  5B6M A;  3KJY A;  1GSE A;  4IQ1 A;  5ENU A;  3TJK A;  5DAL A;  4FYU A;  1OAZ A;  5HR1 A;  4IS0 A;  2MMZ A;  3HA9 A;  1TI3 A;  3DEX A;  5DBQ A;  4WR5 A;  3GIX A;  4PTS A;  2IL3 A;  2WGR A;  5ECI B;  2L57 A;  4EC0 A;  4KUN A;  4OWY A;  3PPU A;  2LEG A;  4J56 E;  4AJ7 A;  1A2M A;  2OJL A;  5IO2 A;  3EIN A;  1Z7P A;  5IMZ A;  3TCO A;  3UEM A;  5GST A;  3TOU A;  1Y6E A;  2VO4 A;  5INY A;  3LFL A;  4IBP A;  5IPH A;  3APO A;  2B5Y A;  3P7X A;  5HQP A;  2I4A A;  3WYW A;  2GT5 A;  1PD2 1;  3HY2 A;  1TK5 B;  4K0N A;  3F8U A;  3H1N A;  2HZE B;  3FR6 A;  5B8A A;  4ISD A;  5G1L A;  3KH9 A;  1EGO A;  2MZC A;  2PVO C;  4MP4 A;  5HFK A;  4L5O A;  1NHY A;  1BG5 A;  5AIV A;  4WKW A;  4GXZ A;  2B1K A;  22GS A;  1THX A;  1B8X A;  3KMN A;  2M80 A;  4WF5 A;  5D9V A;  4XCS A;  4XS1 A;  4HS1 A;  2ZUP A;  4WXT A;  3DXB A;  1MDK A;  1K0B A;  2FWE A;  2NPB A;  2FGX A;  1SKW B;  1F6M C;  1X0R A;  1QMV A;  3ERW A;  5JCG A;  3TKS C;  1AIU A;  3D21 A;  5IMD A;  3TJG A;  1F9M A;  1BYE A;  5G31 A;  3Q74 A;  3GUR A;  3F9U A;  3IAM 2;  2DJK A;  4G9H A;  3RBT A;  1HNC A;  1SD9 A;  4I8B A;  4FQU A;  2P5R A;  3FHK A;  4JE1 A;  1ABA A;  3GX8 A;  4MJC A;  4HZ2 A;  4GWR A;  3KM6 A;  4WR4 A;  1SL2 B;  4MH2 A;  3QR6 A;  2LRC A;  1O8W A;  1SJ6 A;  1X5D A;  2B7J A;  1CQG A;  3UMA A;  3QDN A;  3TDG A;  3UIW A;  4IW9 A;  2R4V A;  4NXI A;  4OMV A;  1U87 A;  3A2W A;  1PGT A;  1URM A;  1DE1 A;  1T00 A;  2HRK A;  1EZK A;  2H73 A;  2A2R A;  3GKK A;  1YEX A;  3G7I A;  3CMI A;  5IM9 A;  3ME8 A;  4D73 A;  3KD0 A;  1R26 A;  4LMV A;  4FIW A;  5JWR B;  2JSZ A;  4CHS A;  2PPT A;  1X9W B;  2FD3 A;  5C04 A;  4TR3 A;  3IOS A;  4XS4 B;  2WZ9 A;  3TGZ A;  2LST A;  2VM1 A;  5ABR A;  3EUR A;  4K2D A;  3IAS 2;  4LL1 B;  4ECJ A;  3DVX A;  1I5G A;  1GTU A;  4BVY B;  1XW6 A;  1B4P A;  2DIY A;  4IQA A;  1ZZY A;  5ECL B;  1V40 A;  4OD7 A;  5EVO A;  3ZTL A;  3IE3 A;  3LEF A;  4GST A;  1O8X A;  1AQV A;  1W4V A;  3BOA A;  4KDX A;  1M9B A;  2H8L A;  1JZR A;  4E8E A;  3IRA A;  2BTO T;  3QFA C;  2IFQ B;  4F0C A;  3VWU A;  1SL0 B;  5AN1 A;  1WPI A;  2QC7 A;  1YY7 A;  3N5O A;  1ZMA A;  3ISO A;  2N5A A;  1FAA A;  3HCZ A;  3VPT A;  4FYB A;  3ERG A;  3U6V A;  1PA3 A;  3G9B A;  1XWG A;  3L9S A;  5ECS A;  1TOF A;  2N5B A;  2KHP A;  5E4W A;  3DKS A;  2GGT A;  2KOK A;  3HZ4 A;  1GH2 A;  4X1U A;  5EL8 A;  4L0U A;  2NTO A;  1GL8 A;  3I6A A;  3W8J A;  1QUW A;  4GF0 A;  3TKQ A;  2LUS A;  1XW9 A;  4BL7 A;  5AGY A;  4ZIJ A;  4DEJ A;  1XPV A;  2VL2 C;  4QQ7 A;  3L9V A;  4IP6 A;  1HNB A;  3VWX A;  3V1W A;  10GS A;  4Q5N A;  4HQS A;  2OE1 A;  3EC3 A;  1YF0 A;  2E2M A;  3ZLP A;  3L9U A;  4K7I A;  3S9F A;  2OAD A;  3M8N A;  2H74 A;  1USB A;  3IV4 A;  1GTI A;  1SJI A;  3DGQ A;  3E3E A;  4ULX A;  1NSW A;  1F37 A;  2V32 A;  1PMT A;  2V6K A;  3IR4 A;  2PGT A;  1ERU A;  5F05 A;  5IMV A;  4ILF A;  4TKY A;  1TU8 A;  3TKP A;  4MDC A;  4RI6 A;  4KB3 A;  3D5J A;  2WB9 A;  2H75 A;  1PKZ A;  2VCT A;  1K0A A;  2QGV A;  1AQX A;  2CZ3 A;  1O81 A;  2KUC A;  3VFI A;  2R37 A;  1FVJ A;  1ML6 A;  3NOF A;  4AJ6 A;  3QMX A;  2WCI A;  4V1A g;  3M3M A;  2ES7 A;  3DVW A;  3P2A A;  3R2Q A;  1K3Y A;  3GFK A;  1BX9 A;  4DSS A;  3UAR A;  1GSY A;  2V2G A;  3EMX A;  2JL4 A;  2IPA A;  1SKR B;  1YKC A;  5H5R A;  3GKX A;  1OKD A;  4EO3 A;  1XWK A;  1ACV A;  2OBK A;  1DSB A;  4BVX A;  1O7U A;  1VF1 A;  4ECI A;  3MSZ A;  2LNT A;  5BMU A;  2MYG A;  3J7Y k;  1B48 A;  4HU9 A;  4ECB A;  3OR5 A;  4RI7 A;  2E7P A;  1X9M B;  4EL1 A;  3TKR A;  2RM5 A;  2HT9 A;  1TW9 A;  2X8H A;  1T8E B;  1K3L A;  4YH2 A;  2GZP A;  2FCH A;  5EPF A;  4OCE A;  1YEP A;  4K8M A;  1H4O A;  2VLV A;  3A2V A;  3LJR A;  5HR3 A;  5J3R A;  3F4R A;  3ZMK A;  2FWG A;  3N9J A;  2KLX A;  4MLY A;  2VLU A;  2K8V A;  2YWN A;  1XOB A;  1DE2 A;  1OC3 A;  3UVH A;  2LV3 A;  2CQ9 A;  3EYT A;  4LL4 B;  4TN8 A;  1AQW A;  2IMI A;  2FWH A;  4TR1 A;  5D96 A;  1GP1 A;  5KN1 A;  3LQ7 A;  2F8F A;  5A5K A;  1OVN A;  2V41 A;  2VD0 A;  1M99 A;  3ME7 A;  2VAF A;  1A0F A;  2VCQ A;  1EP7 A;  4IJ3 A;  1OYJ A;  2CAQ A;  5GAP D;  2O8V B;  3KGK A;  3HVX A;  3FRC A;  4GQF A;  4AJ8 A;  5DDL A;  3LYP A;  3GTU A;  3ZFB A;  2DMM A;  4FYC A;  2V1M A;  19GS A;  3NZN A;  4I97 A;  2BJX A;  1QQ2 A;  2OBI A;  1WRY A;  3UJ1 A;  1EP8 A;  2F9S A;  4XS6 A;  1A23 A;  3H79 A;  1GWC A;  3F4S A;  1BQ7 A;  6GSV A;  4POK A;  3FR9 A;  1M0U A;  3BBY A;  2YP6 A;  3WGX A;  3UVT A;  3O3T A;  2XBI A;  3GL3 A;  1ZYQ B;  2DJJ A;  1YKA A;  2YJH A;  4ZL7 A;  2XHF A;  4JU5 A;  2RLI A;  2E0Q A;  1JZD A;  2GZZ A;  1OE7 A;  1RQM A;  4OFT A;  2QKE A;  4O32 A;  3HVS A;  1V98 A;  4BWS A;  5ECH B;  5F0G A;  4GQC A;  4OFM A;  1EV4 A;  2I1U A;  2F3M A;  1PL1 A;  5DJM A;  1TXX A;  2IME A;  5DVB A;  3H8Q A;  3RHB A;  3IXR A;  2GLR A;  3TKS E;  2AB6 A;  1A24 A;  1VRS D;  2G0F A;  3M9J A;  1FO5 A;  2VCV A;  2PUK C;  2EC4 A;  1KNG A;  1GRX A;  2L59 A;  1A8L A;  3DWV A;  1V9W A;  4PNG A;  4PQ1 A;  2NVL A;  2PWJ A;  3C1R A;  4ML1 A;  2M46 A;  2MMA A;  2YJ7 A;  4O7H A;  2H76 A;  1SJZ A;  5ECO B;  5CYY A;  3FYG A;  3UBL A;  2HZE A;  2C80 A;  4N0V A;  1B9Y C;  1FOV A;  5H5Q A;  3GV1 A;  2X8G A;  1XW5 A;  4KCA A;  4KSO A;  1RW1 A;  5ID2 A;  2CA8 A;  5FT3 A;  3IBH A;  3IK7 A;  2CVD A;  2ZNM A;  1TTZ A;  4HEA 2;  3ZML A;  3GH9 A;  3VUR A;  3DIE A;  2YWI A;  1BED A;  1XWB A;  1HNA A;  3CTG A;  3TOT A;  2XC2 A;  3I69 A;  5D9T A;  1SD8 A;  3VLN A;  13GS A;  2WS2 A;  4KAE A;  5ECN B;  4V2M A;  2H0I A;  4NMU A;  3F63 A;  5DAL B;  2VL3 A;  1NW2 A;  1GNE A;  1O85 A;  1LU4 A;  4G19 A;  1XFL A;  4KW6 A;  5J9C A;  3IPZ A;  2OAC A;  2YOI A;  5EY6 A;  2HFD A;  1I9D A;  1TP9 A;  3I9V 2;  1YJ6 A;  3BCK A;  3FY7 A;  4NAX A;  4NWY A;  2HSY A;  2CAI A;  4MH3 A;  2N5F A;  3KXO A;  2GSR A;  1S3C A;  4BPY A;  3ZRD A;  4V2L A;  3TRX A;  3KH7 A;  1X5C A;  4KSM A;  2YAN A;  1K0D A;  2HSN B;  2J9H A;  3J7Y b;  4XS4 A;  4FH8 A;  1GLP A;  4GCI A;  4ZB9 A;  3ZVJ A;  1HQO A;  2HLS A;  8GSS A;  2B3S A;  1THO A;  1MTC A;  4GSS A;  1PSQ A;  2IJY A;  1GUK A;  1FVK A;  3EVI A;  2O89 A;  6GSW A;  5DJL A;  1ZCP A;  14GS A;  2WDU A;  2K6V A;  3P90 A;  3K8N A;  2HE3 A;  3VI7 A;  1TRS A;  1AC1 A;  5F06 A;  2IFQ A;  4CDO A;  2O7K A;  2IMF A;  4TRX A;  3WT1 A;  3CBU A;  4XIH A;  4KH7 A;  1M9A A;  3QAV A;  3A5W A;  2J23 A;  5ECQ B;  1N2A A;  3UAP A;  5CNW A;  2CVB A;  5DCG A;  5DCH A;  4KDU A;  2WFC A;  5ELA A;  4ACS A;  3QAW A;  1R5A A;  2VCW A;  3EE2 A;  4LMW A;  3APQ A;  4JBB A;  4TXV A;  1EEJ A;  2M72 A;  1RK4 A;  4GLT A;  1DUG A;  4XRD A;  2DSA A;  3DD3 A;  1B4Q A;  2A4V A;  3MDK A;  2I3Y A;  2VCX A;  4MK3 A;  2DJ1 A;  4NPB A;  1K0O A;  4G10 A;  1N8J A;  1TI1 A;  3GX0 A;  1J08 A;  3FZ5 A;  1GUH A;  4QL9 A;  4LLR A;  5J4U A;  4FO5 A;  4J57 E;  5CRG A;  2GQK A;  2TRX A;  3QCP A;  3GKM A;  4XTS A;  1LJR A;  3LXT A;  1F2E A;  4POL A;  4KDY A;  4TVE A;  1ERV A;  4N30 A;  3GST A;  2GSQ A;  3TKS A;  3WGE A;  5FWG A;  2MMO A;  4JED A;  2CX3 A;  2VD1 A;  4ZXG A;  1WOU A;  1Q98 A;  3CSH A;  4KGI A;  2ALB A;  3Q6O A;  5B8B A;  1EOH A;  4MPF A;  2C0F A;  1PQN A;  4ZL8 A;  4MZW A;  5J9B A;  3RAZ A;  1MEK A;  2H72 A;  2H1D A;  4JRR A;  2C3T A;  1XVQ A;  1FW1 A;  2H30 A;  5B6N A;  3FW2 A;  2AYT A;  4J2F A;  4HUA A;  1ZGN A;  1Z3E A;  1R4W A;  1SK1 A;  5ECP B;  4TOP A;  2HRF A;  4MJA A;  4ZB8 A;  4TXO A;  2NBS A;  3APS A;  5JCU A;  2L6C A;  4NHW A;  3ZVJ D;  1BAY A;  3M0F A;  4EE0 A;  4DSR A;  2OA7 A;  1XOA A;  2L4C A;  4P3Y B;  4K9Z A;  2XPE A;  3TJB A;  2RM6 A;  3KCM A;  2C3N A;  2YWM A;  1JLV A;  1T4Z A;  3H4K A;  5JWQ B;  2VLT A;  4BL7 B;  1VF4 A;  3WGD A;  1SL1 B;  1PN9 A;  1X5E A;  5GZZ B;  2B5E A;  3TRQ A;  1WJK A;  1NHO A;  2HZF A;  2VOC A;  1AUC A;  2H70 A;  3GYK A;  2X8C A;  4ZL9 A;  1ON4 A;  3GL5 A;  3O76 A;  1WP0 A;  1Z6M A;  3GHA A;  4MF6 A;  2JZT A;  3ZYW A;  2RUF A;  4YQM A;  2PBJ A;  3KP8 A;  5A4W A;  3C7M A;  4F2I A;  2HSM B;  4YQU A;  2C0E A;  2FLS A;  2VIM A;  2H6Z A;  3F0I A;  3TRP A;  3HHV A;  1ZYE A;  5D8I A;  5G30 A;  2F8A A;  4PQH A;  1K0M A;  4AF2 A;  5DAK A;  4KX4 A;  3G7J A;  1UVZ A;  2AUV A;  2HSH A;  1AXD A;  1QGV A;  3PR8 A;  2H01 A;  4KCE A;  5F07 A;  3D6I A;  1UC7 A;  1GSF A;  5D73 A;  2VUP A;  3LYK A;  3GN3 A;  1Z6N A;  4E8H A;  5ECR B;  4EDY A;  1R7H A;  5CRW A;  4BVX B;  2VL2 A;  2H6Y A;  1KTE A;  4OO5 A;  2YZU A;  4MMM A;  2CV4 A;  2OE3 A;  3QFB C;  3E9J B;  3D4M A;  3AY8 A;  4YAP A;  2YNX A;  3UL3 A;  5E59 A;  1MD4 A;  2P0G A;  4ZBA A;  4X43 A;  1XIY A;  2JZR A;  1OC9 A;  2C1Y A;  2REM A;  1PRX A;  4O5R A;  2LRN A;  2FNO A;  5J41 A;  3CXG A;  4F0B A;  4WBJ A;  3KTB A;  3R3E A;  1GNW A;  1G7O A;  16GS A;  2B6M A;  3QPM A;  2FHE A;  1JZW A;  2I81 A;  2FWF A;  4KND A;  3C8E A;  3IHQ A;  2DML A;  3FZA A;  3C73 A;  1JHB A;  4TR1 B;  2EIR A;  2JU5 A;  11GS A;  3IDV A;  4HJM A;  4RQX A;  6GSX A;  3C71 A;  2AV4 A;  1M2A A;  4Q5R A;  1IYH A;  2XPD A;  1GSU A;  2AJQ B;  2LNS A;  3F4T A;  4AGS A;  1Q4J A;  3Q18 A;  1VGL A;  4IEL A;  3VWW A;  2YV7 A;  4JR6 A;  3GTU B;  5HR2 A;  2P31 A;  4F03 A;  3HD5 A;  5HFG A;  2I9H A;  1J0F A;  5D9W A;  1H75 A;  2Z9S A;  5IMC A;  3G7Y A;  3ZL5 A;  3TJJ A;  1K3O A;  5IOW A;  1TK0 B;  2L4Q A;  1NM3 A;  5ECM B;  4QL7 A;  3KMO A;  2HI7 A;  1EOG A;  3WD6 A;  2LQO A;  1JLW A;  6GST A;  3NIV A;  3PIN A;  2C8U A;  3H93 A;  2R5G A;  3F6F A;  4MCU A;  5D93 A;  2MBT A;  4K6X A;  1OKT A;  2GDR A;  3DYR A;  3LGC A;  3KP9 A;  4WET A;  2CVK A;  2CZ2 A;  1QFN A;  2FA4 A;  4G2E A;  3IA1 A;  5HR0 A;  3F3R A;  2KP2 A;  4ZB6 A;  5AIX A;  3L78 A;  1WMJ A;  20GS A;  2B5X A;  4DVC A;  4L5L A;  3E0U A;  2G2Q A;  4BWQ A;  1ERT A;  3MAK A;  3ZRE A;  2CT6 A;  2H6X A;  1XVW A;  1TKD B;  1C72 A;  4CW9 A;  1PL2 A;  4POM A;  1MD3 A;  1Y25 A;  1JFU A;  2R2J A;  1EGR A;  2FUG 2;  1V57 A;  3L4N A;  1TU7 A;  3FKF A;  5ELG A;  1KBN A;  2K8S A;  3L0H A;  5FHI A;  3KIJ A;  2OKA A;  2DIZ A;  3HDC A;  4HI7 A;  6GSY A;  2R6K A;  3HVV A;  1F3A A;  3W6G A;  2OE0 A;  5IO0 A;  1OE8 A;  2K9F A;  4DSQ A;  3FEU A;  1M2D A;  2GSS A;  1ST9 A;  2FY6 A;  3D22 A;  4HU7 A;  2ZCT A;  4N0Z A;  2C0D A;  1O73 A;  4TW5 A;  5ID2 B;  1AW9 A;  4K7O A;  5CRD A;  1V58 A;  1FG4 A;  2LJR A;  1CQH A;  4I2U A;  3MWH A;  5G2Z A;  4IVF A;  1TJD A;  2AAW A;  3SWL A;  2IWT A;  2HNL A;  4ZBD A;  4YQV A;  5KN2 A;  2TIR A;  4BVY A;  2H0H A;  3EU3 A;  1MDJ A;  4PUF C;  1XWC A;  3PGT A;  1IYI A;  2XBQ A;  3GKN A;  2VCZ A;  5IMF A;  4MPG A;  3VPQ A;  4RUV A;  9GSS A;  4I6X A;  1AAZ A;  4ID0 A;  1ERW A;  3GRX A;  1ZL9 A;  4HQZ A;  2GQM A;  3BJ5 A;  4ECC A;  4OCF A;  4V2N A;  2GTU A;  5IOX A;  1SK0 A;  1PKW A;  5G5F A;  3RDW A;  4WBR D;  2WUL A;  4MA9 A;  4L8E A;  3D4T A;  4PXO A;  1G6W A;  3CYN A;  3I43 A;  3KEB A;  2GQL A;  3CRU A;  1G0T A;  3U5R E;  2LKU A;  3IC4 A;  4O92 A;  3UBK A;  3TJF A;  2C4J A;  1PX6 A;  1GSQ A;  1UN2 A;  5LCZ A;  1A0R P;  1YQ1 A;  4EUY A;  17GS A;  1O6J A;  4IGJ A;  2LJA A;  18GS A;  1TRV A;  2HRK B;  1KEB A;  2VL9 A;  1EWX A;  5C00 A;  4IN0 A;  4OO4 A;  4D73 B;  1F3B A;  2GVP A;  3Q19 A;  4MJB A;  2E2G A;  4JZQ A;  2DC5 A;  3QD9 A;  4PGT A;  2DJ2 A;  3F3Q A;  2L6D A;  3UOM A;  4F9Z A;  4KF9 A;  3HJP A;  1K0C A;  1YDK A;  2WJU A;  4I5Q A;  3ZIV A;  4Q5Q A;  2H1G A;  5KN0 A;  2DJ3 A;  3C1S A;  4PNF A;  5COH A;  1A2L A;  4Q5F A;  4WF4 A;  2TRC P;  2H1B A;  1XZO A;  2IMK A;  5CO3 A;  2GS3 A;  4PUA A;  1ILO A;  2ON7 A;  3RPN A;  5GSS A;  3HJM A;  3FK8 A;  2RUE A;  4G0I A;  1M2B A;  4PX1 A;  1QK8 A;  4H86 A;  3M1G A;  5LD0 A;  3GNJ A;  1EV9 A;  1A8Y A;  1XCC A;  3ZZX A;  2MMN A;  4POB A;  1PX7 A;  2UZ8 A;  2HYX A;  4IKH A;  2H1A A;  1G7E A;  3LWA A;  4EKZ A;  4I2T A;  2PVQ A;  1M7T A;  2YZH A;  4RQR A;  1XXU A;  2K18 A;  1WWJ A;  2P5Q A;  3CSJ A;  3GA4 A;  6GSS A;  1BJX A;  3VI5 A;  1T4Y A;  2PN8 A;  2HSM A;  3HJO A;  4MJE A;  4N11 A;  2AHE A;  3GMF A;  5GAN D;  3P8W A;  4LA1 A;  2A2S A;  3HZ8 A;  2VM2 A;  1U88 A;  3GH6 A;  2H19 A;  4K1F A;  3BCI A;  2KP1 A;  2EIQ A;  3SBC A;  2JZS A;  3HKR A;  5JWO B;  3EWL A;  5AIS A;  3VK9 A;  2X99 A;  3LG6 A;  3QOU A;  4XHM A;  2H0G A;  2QSI A;  4HDE A;  3HYP A;  1SK2 A;  1TRU A;  2O85 A;  5LNK e;  2LQQ A;  2DLX A;  12GS A;  3A2X A;  4ZBB A;  4F82 A;  2GST A;  2YV9 A;  2LRT A;  4NV5 A;  4ZIL A;  1GSD A;  1GSS A;  5G1K A;  2CX4 A;  1TK8 B;  2B7K A;  5CRE A;  3CSI A;  4K0G A;  5CRH A;  5F8B A;  1TRW A;  1E6B A;  5B7C A;  3M9K A;  4NHZ A;  2JAD A;  5J5N A;  3F6D A;  1XBS A;  1VF3 A;  4TXO B;  1FB0 A;  3LSZ A;  2PU9 C;  5IIZ A;  4JR4 A;  3FZ4 A;  2YCD A;  1Z9H A;  4HJ2 A;  2JAC A;  4MZB A;  4EDZ A;  3FZ9 A;  2X64 A;  1SYR A;  3CTF A;  3JCM L;  1U3A A;  2IIY A;  2H71 A;  1A2J A;  4EVM A;  2YN1 A;  4DSS B;  1FHE A;  4WEY A;  1HYU A;  3DRN A;  1GTA A;  2LS5 A;  5JCW A;  2HRA A;  1GTB A;  4ML6 A;  2DBC A;  3TB2 A;  3MNG A;  3WT2 A;  4K7N A;  5DQY A;  4GTU A;  3LXZ A;  2C0G A;  3W8S A;  1K0N A;  3PH9 A;  2YWO A;  1SKS B;  2NDO A;  2L5O A;  2JSY A;  4G0K A;  3GUS A;  1UA5 A;  4N10 A;  3D0Z A;  4GSN A;  5CAX A;  2HQT A;  2RII A;  2LJK A;  2DJ0 A;  2YPM A;  4HOJ A;  4Z7X A;  3ZIJ A;  1SEN A;  5A4U A;  3KTL A;  2PMT A;  7GSS A;  1WIK A;  3ZFL A;  4GRF A;  3GSS A;  4TR4 A;  1FB6 A;  2D2Z A;  6GSU A;  2H66 A;  1YZX A;  2L5L A;  1S3A A;  1MDI A;  2BMX A;  2R3X A;  5IQY A;  2V6O A;  2GZY A;  1W89 A;  5DAK B;  4IHU A;  4EF0 A;  1E2Y A;  1OC8 A;  3QAG A;  1XWA A;  3A3T A;  3ED3 A;  5G5E A;  4EXJ A;  3FR3 A;  1GUL A;  3VWV A;  5A4V A;  1SYX A;  3KZQ A;  4G0L A;  5CP1 A;  1R5P A;  2MBS A;  1GLQ A;  3CRT A;  3RPP A;  3BD2 A;  2F51 A;  4L0W A;  3IC8 A;  1U3I A;  2C3Q A;  4MZC A;  1ZOF A;  5IMA A;  2ON5 A;  4USS A;  4BA7 A;  4MAB A;  2LTK A;  4IJI A;  1VF2 A;  4KA0 A;  3ZIT A;  1G6Y A;  1SU9 A;  4IP1 A;  2IMD A;  2WRT A;  4HZ4 A;  1J9B A;  4MF7 A;  2B1L A;  5HFI A;  4KE3 A;  5D9X A;  5L71 A;  3EMP A;  1WE0 A;  3US3 A;  5ECK B;  3RHC A;  5DQS A;  4V1A p;  1DBY A; 
#chains in the Genus database with same CATH topology
 1OC9 B;  3TUE A;  1EEM A;  2EIO A;  4PQI A;  4X0X A;  5IPG A;  2HXK A;  1Z5Y E;  5H5S A;  5A5H A;  1S3D A;  1X9S B;  4PUR A;  1YF1 A;  4TR0 A;  1TDI A;  3ERF A;  3LOR A;  1HD2 A;  1GUM A;  4NV2 A;  3O6T A;  2HRN A;  1QXH A;  4XRA A;  5KN3 A;  2GT6 A;  2PER A;  1T3B A;  2DKI A;  3EU4 A;  1B9X C;  4OFN A;  4MF5 A;  2FA8 A;  1U6T A;  1Z7R A;  2IN3 A;  1T1V A;  1T7P B;  2O87 A;  1LBK A;  3IK9 A;  1V2A A;  1JZO A;  5KEJ A;  3HXS A;  3DML A;  4YAV A;  5B6M A;  3KJY A;  1GSE A;  4IQ1 A;  5ENU A;  3TJK A;  5DAL A;  4FYU A;  4EIP A;  1OAZ A;  5HR1 A;  4IS0 A;  2MMZ A;  3HA9 A;  1TI3 A;  3DEX A;  5DBQ A;  4WR5 A;  3GIX A;  4EIQ A;  4PTS A;  2IL3 A;  2WGR A;  5ECI B;  2L57 A;  4EC0 A;  4KUN A;  4OWY A;  3PPU A;  2LEG A;  4J56 E;  4AJ7 A;  3FMW A;  1A2M A;  2OJL A;  5IO2 A;  3EIN A;  1Z7P A;  5IMZ A;  3TCO A;  3UEM A;  5GST A;  3TOU A;  1Y6E A;  2VO4 A;  5INY A;  3LFL A;  4IBP A;  5IPH A;  3APO A;  2B5Y A;  3P7X A;  5HQP A;  2I4A A;  3WYW A;  2GT5 A;  1PD2 1;  3HY2 A;  1TK5 B;  4K0N A;  3F8U A;  3H1N A;  2HZE B;  3FR6 A;  5B8A A;  4ISD A;  5G1L A;  3KH9 A;  1EGO A;  2MZC A;  2PVO C;  4MP4 A;  5A34 B;  5HFK A;  4L5O A;  1NHY A;  1BG5 A;  5AIV A;  4WKW A;  4GXZ A;  2B1K A;  22GS A;  1THX A;  1B8X A;  3KMN A;  2M80 A;  4WF5 A;  5D9V A;  5A1N B;  4W66 A;  4XCS A;  4XS1 A;  2WVX B;  4HS1 A;  2ZUP A;  4WXT A;  5KOX A;  3DXB A;  1MDK A;  1K0B A;  2FWE A;  2NPB A;  2FGX A;  3EPT A;  1SKW B;  1F6M C;  1X0R A;  1QMV A;  3ERW A;  5JCG A;  3TKS C;  1AIU A;  3D21 A;  5IMD A;  3TJG A;  4PHZ C;  4N3Z A;  1F9M A;  1BYE A;  5G31 A;  3Q74 A;  3GUR A;  3F9U A;  3IAM 2;  2DJK A;  4G9H A;  3RBT A;  1HNC A;  1SD9 A;  1YEW C;  4I8B A;  4FQU A;  2P5R A;  3FHK A;  4JE1 A;  1ABA A;  3GX8 A;  4MJC A;  2O3E A;  4HZ2 A;  4GWR A;  3KM6 A;  4WR4 A;  1SL2 B;  4MH2 A;  3QR6 A;  2LRC A;  1O8W A;  1SJ6 A;  1X5D A;  2B7J A;  1CQG A;  3UMA A;  3QDN A;  3TDG A;  3UIW A;  4IW9 A;  2R4V A;  4NXI A;  4OMV A;  1U87 A;  3A2W A;  1PGT A;  1URM A;  1DE1 A;  1T00 A;  2H73 A;  2HRK A;  1EZK A;  2A2R A;  3GKK A;  1YEX A;  3G7I A;  4Z2U A;  3CMI A;  5IM9 A;  3ME8 A;  4D73 A;  3KD0 A;  1R26 A;  4LMV A;  4FIW A;  5JWR B;  2JSZ A;  4CHS A;  2PPT A;  1X9W B;  2FD3 A;  5C04 A;  4TR3 A;  3IOS A;  4XS4 B;  2WZ9 A;  3TGZ A;  2LST A;  2VM1 A;  5ABR A;  3EUR A;  4K2D A;  3IAS 2;  4LL1 B;  4ECJ A;  3DVX A;  1I5G A;  1GTU A;  3CHX C;  4BVY B;  1XW6 A;  1B4P A;  2DIY A;  4IQA A;  1ZZY A;  5ECL B;  1V40 A;  4OD7 A;  1ZYN A;  5EVO A;  3ZTL A;  3IE3 A;  3LEF A;  4GST A;  1O8X A;  1AQV A;  1W4V A;  3BOA A;  4KDX A;  1M9B A;  2H8L A;  1JZR A;  4E8E A;  3IRA A;  1M3J A;  2BTO T;  4K5S A;  3QFA C;  2IFQ B;  4F0C A;  3VWU A;  1S4B P;  1SL0 B;  5AN1 A;  1WPI A;  2QC7 A;  1YY7 A;  3N5O A;  1ZMA A;  3ISO A;  2N5A A;  1FAA A;  3HCZ A;  3VPT A;  4FYB A;  3ERG A;  3U6V A;  1PA3 A;  3G9B A;  1XWG A;  3L9S A;  5ECS A;  1I1I P;  1TOF A;  2N5B A;  2KHP A;  5E4W A;  3DKS A;  2GGT A;  2KOK A;  3HZ4 A;  1GH2 A;  4O5Q A;  4X1U A;  5EL8 A;  4L0U A;  2NTO A;  1GL8 A;  3I6A A;  3W8J A;  1QUW A;  4GF0 A;  3TKQ A;  2LUS A;  1XW9 A;  4BL7 A;  5AGY A;  4ZIJ A;  4DEJ A;  1XPV A;  2VL2 C;  4QQ7 A;  3L9V A;  4IP6 A;  1HNB A;  4G01 A;  3VWX A;  3V1W A;  10GS A;  4Q5N A;  4HQS A;  2OE1 A;  3EC3 A;  1YF0 A;  2E2M A;  3ZLP A;  3L9U A;  4K7I A;  3S9F A;  2OAD A;  3M8N A;  2H74 A;  1USB A;  3IV4 A;  1GTI A;  1SJI A;  3DGQ A;  3E3E A;  4ULX A;  1NSW A;  1F37 A;  2V32 A;  1PMT A;  2V6K A;  3IR4 A;  2PGT A;  1ERU A;  5F05 A;  5IMV A;  4ILF A;  4TKY A;  1TU8 A;  3TKP A;  4MDC A;  4RI6 A;  4KB3 A;  3D5J A;  2WB9 A;  2H75 A;  1PKZ A;  2VCT A;  1K0A A;  2QGV A;  1AQX A;  2CZ3 A;  1O81 A;  2KUC A;  3VFI A;  2R37 A;  1FVJ A;  1ML6 A;  3NOF A;  1S3R A;  4AJ6 A;  3QMX A;  2WCI A;  4V1A g;  3M3M A;  2ES7 A;  3DVW A;  3P2A A;  3R2Q A;  1K3Y A;  3GFK A;  1BX9 A;  4K2X A;  3UAR A;  1GSY A;  2V2G A;  4DSS A;  3EMX A;  2JL4 A;  2IPA A;  1SKR B;  1YKC A;  5H5R A;  3GKX A;  1OKD A;  4EO3 A;  1XWK A;  1ACV A;  1TXU A;  2OBK A;  1PFO A;  1DSB A;  4BVX A;  1O7U A;  1VF1 A;  4ECI A;  3MSZ A;  2LNT A;  5BMU A;  2MYG A;  3J7Y k;  1B48 A;  4HU9 A;  4ECB A;  3OR5 A;  4RI7 A;  2E7P A;  1X9M B;  4EL1 A;  3TKR A;  2RM5 A;  2HT9 A;  1TW9 A;  2X8H A;  3LW9 A;  1T8E B;  1K3L A;  4YH2 A;  2GZP A;  2FCH A;  5EPF A;  4OCE A;  1YEP A;  4K8M A;  2O5V A;  1H4O A;  1M3I A;  2VLV A;  3A2V A;  3LJR A;  5HR3 A;  5J3R A;  3F4R A;  3ZMK A;  2FWG A;  3N9J A;  2KLX A;  4MLY A;  2VLU A;  2K8V A;  2YWN A;  1XOB A;  1DE2 A;  1OC3 A;  3UVH A;  2LV3 A;  2CQ9 A;  3EYT A;  4LL4 B;  4TN8 A;  1AQW A;  2EFC A;  2IMI A;  2FWH A;  4TR1 A;  5D96 A;  1GP1 A;  5KN1 A;  3LQ7 A;  2F8F A;  5A5K A;  1OVN A;  2V41 A;  2VD0 A;  1M99 A;  3ME7 A;  2VAF A;  1A0F A;  2VCQ A;  1EP7 A;  4IJ3 A;  1OYJ A;  2CAQ A;  4E68 A;  5GAP D;  2O8V B;  3KGK A;  3HVX A;  3FRC A;  4BIK A;  4GQF A;  4AJ8 A;  5DDL A;  3LYP A;  3GTU A;  3ZFB A;  2DMM A;  4FYC A;  2V1M A;  19GS A;  3NZN A;  4I97 A;  2BJX A;  1QQ2 A;  2OBI A;  1WRY A;  3UJ1 A;  1EP8 A;  2F9S A;  4XS6 A;  1A23 A;  3H79 A;  1GWC A;  3F4S A;  1BQ7 A;  6GSV A;  5J4Y A;  4POK A;  3FR9 A;  1M0U A;  3BBY A;  2YP6 A;  3WGX A;  3UVT A;  3O3T A;  2XBI A;  3GL3 A;  1ZYQ B;  2DJJ A;  1YKA A;  2YJH A;  4ZL7 A;  2XHF A;  4JU5 A;  2RLI A;  2E0Q A;  1JZD A;  2X49 A;  2GZZ A;  1OE7 A;  1RQM A;  4OFT A;  2QKE A;  4O32 A;  3HVS A;  1V98 A;  4BWS A;  5ECH B;  5F0G A;  4GQC A;  4OFM A;  1EV4 A;  2I1U A;  2F3M A;  1PL1 A;  2EFD A;  5DJM A;  1TXX A;  2IME A;  5DVB A;  3H8Q A;  3RHB A;  3IXR A;  2GLR A;  3TKS E;  2AB6 A;  1A24 A;  1VRS D;  2G0F A;  3M9J A;  1FO5 A;  2VCV A;  2PUK C;  2EC4 A;  1KNG A;  1GRX A;  2L59 A;  1A8L A;  3DWV A;  1V9W A;  4PNG A;  4PQ1 A;  2NVL A;  2PWJ A;  3C1R A;  4ML1 A;  2M46 A;  2MMA A;  2YJ7 A;  4O7H A;  2H76 A;  1SJZ A;  5ECO B;  5CYY A;  3FYG A;  3UBL A;  2HZE A;  5BRT A;  2C80 A;  4N0V A;  1B9Y C;  1FOV A;  5H5Q A;  3GV1 A;  2X8G A;  1XW5 A;  4KCA A;  4KSO A;  5A34 A;  1RW1 A;  5ID2 A;  2CA8 A;  5FT3 A;  3IBH A;  3IK7 A;  2CVD A;  2ZNM A;  1TTZ A;  4HEA 2;  3ZML A;  3GH9 A;  3VUR A;  3DIE A;  2YWI A;  1BED A;  1XWB A;  1HNA A;  3CTG A;  3TOT A;  2XC2 A;  3I69 A;  5D9T A;  1SD8 A;  3VLN A;  13GS A;  2WS2 A;  4KAE A;  4MNN A;  5ECN B;  3MYD A;  4V2M A;  2H0I A;  4NMU A;  3F63 A;  5DAL B;  2VL3 A;  1NW2 A;  1GNE A;  1O85 A;  1LU4 A;  4G19 A;  1XFL A;  4KW6 A;  5J9C A;  3IPZ A;  2OAC A;  2YOI A;  5EY6 A;  5J4V A;  2HFD A;  1I9D A;  1TP9 A;  3I9V 2;  1BF5 A;  1YJ6 A;  3BCK A;  3FY7 A;  4NAX A;  4NWY A;  2HSY A;  2CAI A;  4MH3 A;  2N5F A;  3KXO A;  2GSR A;  1S3C A;  4BPY A;  3ZRD A;  4V2L A;  3TRX A;  3KH7 A;  1X5C A;  4AKH A;  4KSM A;  2YAN A;  2H1L A;  1K0D A;  2HSN B;  2J9H A;  3J7Y b;  4XS4 A;  4FH8 A;  1GLP A;  4GCI A;  4ZB9 A;  3ZVJ A;  1HQO A;  2HLS A;  8GSS A;  2B3S A;  1THO A;  1MTC A;  4GSS A;  1PSQ A;  2IJY A;  1GUK A;  1FVK A;  3EVI A;  2O89 A;  6GSW A;  5DJL A;  1ZCP A;  14GS A;  2WDU A;  2K6V A;  3P90 A;  3K8N A;  2HE3 A;  2EFE A;  3VI7 A;  1TRS A;  1AC1 A;  5F06 A;  2IFQ A;  4CDO A;  4Z2R A;  2O7K A;  1BG1 A;  2IMF A;  4TRX A;  3WT1 A;  3CBU A;  4XIH A;  4KH7 A;  1M9A A;  3QAV A;  3A5W A;  2J23 A;  5ECQ B;  1N2A A;  3UAP A;  5CNW A;  2CVB A;  5DCG A;  5DCH A;  4KDU A;  2WFC A;  5ELA A;  4ACS A;  3QAW A;  1R5A A;  2VCW A;  1FOH A;  3EE2 A;  4LMW A;  3APQ A;  4JBB A;  4TXV A;  1EEJ A;  2M72 A;  1RK4 A;  4GLT A;  1DUG A;  4XRD A;  2DSA A;  3DD3 A;  1YVL A;  1B4Q A;  2A4V A;  3MDK A;  2I3Y A;  2VCX A;  4YKF A;  4MK3 A;  2DJ1 A;  4NPB A;  1K0O A;  4G10 A;  4AKG A;  1N8J A;  1TI1 A;  3GX0 A;  1J08 A;  3FZ5 A;  1GUH A;  4QL9 A;  4LLR A;  5J4U A;  4FO5 A;  4J57 E;  5CRG A;  2GQK A;  2TRX A;  3QCP A;  3GKM A;  4XTS A;  1LJR A;  3LXT A;  1F2E A;  4POL A;  4KDY A;  4TVE A;  1ERV A;  4N30 A;  3GST A;  2GSQ A;  3TKS A;  3WGE A;  5FWG A;  2MMO A;  4JED A;  2CX3 A;  2VD1 A;  4ZXG A;  1WOU A;  1Q98 A;  3CSH A;  4KGI A;  2ALB A;  3Q6O A;  5B8B A;  1EOH A;  4MPF A;  2C0F A;  1PQN A;  4ZL8 A;  4MZW A;  5J9B A;  3RAZ A;  1MEK A;  2H72 A;  2H1D A;  4JRR A;  4GDF A;  2C3T A;  1XVQ A;  1FW1 A;  2H30 A;  5B6N A;  3FW2 A;  2AYT A;  4J2F A;  4HUA A;  1ZGN A;  1Z3E A;  2R0G A;  1R4W A;  1SK1 A;  3HMJ G;  5ECP B;  4TOP A;  2HRF A;  4MJA A;  4ZB8 A;  4TXO A;  2WVY A;  2NBS A;  3APS A;  5JCU A;  2L6C A;  4NHW A;  3ZVJ D;  1BAY A;  2O36 A;  3M0F A;  4EE0 A;  4DSR A;  2OA7 A;  1XOA A;  2L4C A;  4P3Y B;  4K9Z A;  2XPE A;  3TJB A;  2RM6 A;  3KCM A;  2C3N A;  2YWM A;  1JLV A;  1T4Z A;  3H4K A;  5JWQ B;  2VLT A;  4BL7 B;  1VF4 A;  3WGD A;  1SL1 B;  1PN9 A;  1X5E A;  5GZZ B;  2B5E A;  3TRQ A;  1WJK A;  1NHO A;  2HZF A;  2VOC A;  1AUC A;  2H70 A;  3CWG A;  3GYK A;  2X8C A;  4ZL9 A;  1ON4 A;  3GL5 A;  3O76 A;  1WP0 A;  1Z6M A;  3GHA A;  4MF6 A;  2JZT A;  3ZYW A;  2RUF A;  4YQM A;  2PBJ A;  3KP8 A;  5A4W A;  3C7M A;  4F2I A;  2HSM B;  4YQU A;  2C0E A;  2FLS A;  2VIM A;  4Z2T A;  2H6Z A;  3F0I A;  3TRP A;  3HHV A;  1ZYE A;  5D8I A;  4CY8 A;  3TU3 B;  4AI6 A;  5G30 A;  2F8A A;  4PQH A;  2X4A A;  1K0M A;  4AF2 A;  5DAK A;  4KX4 A;  3G7J A;  1XG8 A;  1UVZ A;  2AUV A;  2HSH A;  1AXD A;  1QGV A;  3PR8 A;  3HVN A;  2H01 A;  4KCE A;  5F07 A;  3D6I A;  1UC7 A;  1GSF A;  5D73 A;  2VUP A;  3LYK A;  2WW0 A;  3GN3 A;  1Z6N A;  4E8H A;  5ECR B;  4EDY A;  1R7H A;  5CRW A;  1Y1U A;  4BVX B;  2VL2 A;  2H6Y A;  4PI0 C;  1KTE A;  4OO5 A;  2QA1 A;  5BMU B;  2YZU A;  1SVO A;  4MMM A;  2CV4 A;  2OE3 A;  3QFB C;  3E9J B;  3D4M A;  4AKX B;  4O5U A;  3AY8 A;  4YAP A;  2YNX A;  3UL3 A;  5E59 A;  1MD4 A;  2P0G A;  4ZBA A;  4X43 A;  1XIY A;  2JZR A;  1OC9 A;  2C1Y A;  2REM A;  1PRX A;  4O5R A;  2LRN A;  1ZYP A;  2FNO A;  5J41 A;  4CY6 A;  3CXG A;  4F0B A;  4WBJ A;  3KTB A;  3R3E A;  1GNW A;  1G7O A;  16GS A;  2B6M A;  3QPM A;  2FHE A;  1JZW A;  2I81 A;  2FWF A;  4KND A;  3C8E A;  3IHQ A;  2DML A;  3FZA A;  3C73 A;  1JHB A;  4TR1 B;  2EIR A;  1PN0 A;  2JU5 A;  11GS A;  3IDV A;  4HJM A;  2UV8 G;  4RQX A;  6GSX A;  3C71 A;  2AV4 A;  1M2A A;  4Q5R A;  1IYH A;  2XPD A;  3MIX A;  1GSU A;  4ICY A;  2AJQ B;  2LNS A;  3F4T A;  4AGS A;  1Q4J A;  3Q18 A;  1VGL A;  4IEL A;  3VWW A;  2YV7 A;  4JR6 A;  3GTU B;  5HR2 A;  2P31 A;  4F03 A;  3A5I A;  3HD5 A;  5HFG A;  2I9H A;  1J0F A;  5D9W A;  1H75 A;  2Z9S A;  5IMC A;  3G7Y A;  3ZL5 A;  3TJJ A;  1K3O A;  5IOW A;  1TK0 B;  2L4Q A;  1NM3 A;  5ECM B;  4QL7 A;  3KMO A;  2HI7 A;  1EOG A;  3WD6 A;  2LQO A;  1JLW A;  6GST A;  3NIV A;  3PIN A;  2C8U A;  3H93 A;  2R5G A;  3F6F A;  4MCU A;  5D93 A;  2MBT A;  4K6X A;  1OKT A;  2GDR A;  3DYR A;  3LGC A;  3KP9 A;  4WET A;  2CVK A;  2CZ2 A;  1QFN A;  2FA4 A;  4ZB7 A;  4G2E A;  3IA1 A;  5HR0 A;  5A5H B;  3F3R A;  2KP2 A;  4ZB6 A;  5AIX A;  5A1N A;  3L78 A;  1WMJ A;  20GS A;  2WVX A;  2B5X A;  4DVC A;  4L5L A;  3E0U A;  2G2Q A;  4BWQ A;  1N25 A;  2EFH A;  1ERT A;  3MAK A;  3ZRE A;  2CT6 A;  2H6X A;  1XVW A;  1TKD B;  1C72 A;  4CW9 A;  1PL2 A;  5J40 A;  2HSN A;  4POM A;  1MD3 A;  1Y25 A;  1JFU A;  2R2J A;  1EGR A;  2FUG 2;  1V57 A;  3L4N A;  1TU7 A;  3FKF A;  5ELG A;  2OT3 A;  1KBN A;  2K8S A;  3L0H A;  5FHI A;  3KIJ A;  2OKA A;  2DIZ A;  3HDC A;  4HI7 A;  6GSY A;  2R6K A;  3HVV A;  1F3A A;  3W6G A;  2OE0 A;  5IO0 A;  1OE8 A;  2QA2 A;  2VKZ G;  2K9F A;  4DSQ A;  3FEU A;  1M2D A;  2GSS A;  1ST9 A;  2FY6 A;  3D22 A;  4HU7 A;  2ZCT A;  4N0Z A;  2C0D A;  1O73 A;  4TW5 A;  5ID2 B;  1AW9 A;  4K7O A;  5CRD A;  1V58 A;  1FG4 A;  2LJR A;  1CQH A;  4AKI A;  4I2U A;  3MWH A;  5G2Z A;  4IVF A;  1TJD A;  2AAW A;  3SWL A;  2IWT A;  2HNL A;  4ZBD A;  4YQV A;  5KN2 A;  2TIR A;  4BVY A;  3RFR C;  2H0H A;  3EU3 A;  1MDJ A;  4PUF C;  1XWC A;  3PGT A;  1IYI A;  2XBQ A;  3GKN A;  2VCZ A;  2WVZ A;  4MPG A;  5IMF A;  3VPQ A;  4RUV A;  9GSS A;  4I6X A;  4QMK A;  1AAZ A;  4ID0 A;  1ERW A;  3GRX A;  1ZL9 A;  4HQZ A;  2GQM A;  2A4H A;  3BJ5 A;  4ECC A;  4OCF A;  4V2N A;  2GTU A;  5IOX A;  1SK0 A;  1PKW A;  5G5F A;  3RDW A;  4WBR D;  2WUL A;  4MA9 A;  4L8E A;  3D4T A;  4PXO A;  1G6W A;  3CYN A;  3I43 A;  3KEB A;  2GQL A;  3CRU A;  1G0T A;  3U5R E;  4FXY P;  2LKU A;  3IC4 A;  4O92 A;  3UBK A;  3TJF A;  2C4J A;  1PX6 A;  1GSQ A;  1UN2 A;  5LCZ A;  1A0R P;  1YQ1 A;  4EUY A;  17GS A;  1O6J A;  4IGJ A;  2LJA A;  18GS A;  1TRV A;  2HRK B;  1KEB A;  2VL9 A;  1EWX A;  4A5P A;  5C00 A;  4IN0 A;  4OO4 A;  4D73 B;  1F3B A;  2GVP A;  3Q19 A;  4MJB A;  2E2G A;  4JZQ A;  2DC5 A;  3QD9 A;  4PGT A;  2DJ2 A;  3F3Q A;  2L6D A;  3UOM A;  4F9Z A;  4KF9 A;  2R0P A;  3HJP A;  1K0C A;  1YDK A;  2WJU A;  4I5Q A;  3ZIV A;  4Q5Q A;  2H1G A;  5KN0 A;  2DJ3 A;  3C1S A;  4PNF A;  5COH A;  1A2L A;  4Q5F A;  4WF4 A;  2TRC P;  2H1B A;  1XZO A;  2IMK A;  5CO3 A;  2GS3 A;  4PUA A;  1ILO A;  2ON7 A;  3IHG A;  3RPN A;  5GSS A;  3HJM A;  3FK8 A;  2RUE A;  4G0I A;  1SVL A;  1M2B A;  4PX1 A;  1QK8 A;  4H86 A;  3M1G A;  5LD0 A;  3GNJ A;  1EV9 A;  1A8Y A;  1XCC A;  3ZZX A;  2MMN A;  3CQF A;  4POB A;  1PX7 A;  2UZ8 A;  2HYX A;  4HSC X;  4IKH A;  2H1A A;  1G7E A;  3LWA A;  4EKZ A;  4I2T A;  2PVQ A;  1M7T A;  2YZH A;  4RQR A;  2A2P A;  1XXU A;  4PI2 C;  2K18 A;  1WWJ A;  2P5Q A;  3CSJ A;  3GA4 A;  6GSS A;  2WW3 A;  1BJX A;  3VI5 A;  1T4Y A;  2PN8 A;  2HSM A;  3HJO A;  4MJE A;  4N11 A;  2AHE A;  3GMF A;  5GAN D;  3P8W A;  2WW1 A;  4LA1 A;  2A2S A;  3HZ8 A;  2VM2 A;  1U88 A;  3GH6 A;  2H19 A;  4K1F A;  3BCI A;  2KP1 A;  2EIQ A;  3SBC A;  2JZS A;  3HKR A;  5JWO B;  3EWL A;  5J47 A;  5AIS A;  3VK9 A;  2X99 A;  3LG6 A;  3QOU A;  4XHM A;  2H0G A;  2QSI A;  4HDE A;  3HYP A;  1SK2 A;  1TRU A;  2O85 A;  5LNK e;  2LQQ A;  2DLX A;  12GS A;  3A2X A;  4ZBB A;  4F82 A;  2GST A;  2YV9 A;  2LRT A;  4NV5 A;  4ZIL A;  1GSD A;  1GSS A;  5G1K A;  2CX4 A;  1TK8 B;  2B7K A;  5CRE A;  3CSI A;  4K0G A;  4K5R A;  5CRH A;  5F8B A;  1TRW A;  1E6B A;  5B7C A;  3M9K A;  4NHZ A;  2JAD A;  5J5N A;  3F6D A;  1XBS A;  1VF3 A;  4TXO B;  1FB0 A;  3LSZ A;  2PU9 C;  5IIZ A;  5KOW A;  4JR4 A;  3FZ4 A;  2YCD A;  1Z9H A;  4HJ2 A;  2JAC A;  4MZB A;  4EDZ A;  3FZ9 A;  2X64 A;  1SYR A;  3CTF A;  3JCM L;  1U3A A;  2IIY A;  2DKH A;  2H71 A;  1A2J A;  4EVM A;  2YN1 A;  4DSS B;  1FHE A;  4WEY A;  1HYU A;  3DRN A;  1GTA A;  2LS5 A;  5JCW A;  2HRA A;  1GTB A;  4ML6 A;  2DBC A;  3TB2 A;  3MNG A;  3WT2 A;  4K7N A;  5DQY A;  4GTU A;  3LXZ A;  2C0G A;  3W8S A;  4X4J A;  1K0N A;  2WW2 A;  3PH9 A;  2YWO A;  1SKS B;  2NDO A;  2L5O A;  2JSY A;  4G0K A;  3GUS A;  1UA5 A;  4N10 A;  3D0Z A;  4GSN A;  5CAX A;  2HQT A;  2RII A;  2LJK A;  2DJ0 A;  2YPM A;  4HOJ A;  4Z7X A;  3RGB C;  3ZIJ A;  1SEN A;  5A4U A;  3KTL A;  2PMT A;  7GSS A;  1WIK A;  3ZFL A;  4GRF A;  3GSS A;  4TR4 A;  1FB6 A;  2D2Z A;  6GSU A;  2H66 A;  1YZX A;  2WZS A;  2L5L A;  1S3A A;  2R0C A;  1MDI A;  2BMX A;  2R3X A;  5IQY A;  2V6O A;  2GZY A;  1W89 A;  1SVM A;  5DAK B;  4IHU A;  4EF0 A;  1E2Y A;  1OC8 A;  3QAG A;  1XWA A;  3A3T A;  3ED3 A;  5G5E A;  4EXJ A;  3FR3 A;  1GUL A;  3VWV A;  5A4V A;  1SYX A;  3KZQ A;  4G0L A;  5CP1 A;  1R5P A;  2MBS A;  1GLQ A;  3CRT A;  3RPP A;  3BD2 A;  2F51 A;  4L0W A;  3IC8 A;  1U3I A;  2C3Q A;  4MZC A;  1ZOF A;  5IMA A;  2ON5 A;  4USS A;  4BA7 A;  4MAB A;  2LTK A;  4IJI A;  1VF2 A;  4KA0 A;  3ZIT A;  1G6Y A;  1SU9 A;  4IP1 A;  2IMD A;  2WRT A;  4HZ4 A;  1J9B A;  4MF7 A;  2B1L A;  5HFI A;  4KE3 A;  4YKG A;  5D9X A;  5L71 A;  3EMP A;  1WE0 A;  3US3 A;  5ECK B;  3RHC A;  5DQS A;  4V1A p;  1DBY A; 
#chains in the Genus database with same CATH homology
 1OC9 B;  3TUE A;  1EEM A;  2EIO A;  4PQI A;  4X0X A;  5IPG A;  2HXK A;  1Z5Y E;  5H5S A;  5A5H A;  1S3D A;  1X9S B;  4PUR A;  1YF1 A;  4TR0 A;  1TDI A;  3ERF A;  3LOR A;  1HD2 A;  1GUM A;  4NV2 A;  3O6T A;  2HRN A;  1QXH A;  4XRA A;  5KN3 A;  2GT6 A;  2PER A;  1T3B A;  2DKI A;  3EU4 A;  1B9X C;  4OFN A;  4MF5 A;  2FA8 A;  1U6T A;  1Z7R A;  2IN3 A;  1T1V A;  1T7P B;  2O87 A;  1LBK A;  3IK9 A;  1V2A A;  1JZO A;  5KEJ A;  3HXS A;  3DML A;  4YAV A;  5B6M A;  3KJY A;  1GSE A;  4IQ1 A;  5ENU A;  3TJK A;  5DAL A;  4FYU A;  4EIP A;  1OAZ A;  5HR1 A;  4IS0 A;  2MMZ A;  3HA9 A;  1TI3 A;  3DEX A;  5DBQ A;  4WR5 A;  3GIX A;  4EIQ A;  4PTS A;  2IL3 A;  2WGR A;  5ECI B;  2L57 A;  4EC0 A;  4KUN A;  4OWY A;  3PPU A;  2LEG A;  4J56 E;  4AJ7 A;  3FMW A;  1A2M A;  2OJL A;  5IO2 A;  3EIN A;  1Z7P A;  5IMZ A;  3TCO A;  3UEM A;  5GST A;  3TOU A;  1Y6E A;  2VO4 A;  5INY A;  3LFL A;  4IBP A;  5IPH A;  3APO A;  2B5Y A;  3P7X A;  5HQP A;  2I4A A;  3WYW A;  2GT5 A;  1PD2 1;  3HY2 A;  1TK5 B;  4K0N A;  3F8U A;  3H1N A;  2HZE B;  3FR6 A;  5B8A A;  4ISD A;  5G1L A;  3KH9 A;  1EGO A;  2MZC A;  2PVO C;  4MP4 A;  5A34 B;  5HFK A;  4L5O A;  1NHY A;  1BG5 A;  5AIV A;  4WKW A;  4GXZ A;  2B1K A;  22GS A;  1THX A;  1B8X A;  3KMN A;  2M80 A;  4WF5 A;  5D9V A;  5A1N B;  4W66 A;  4XCS A;  4XS1 A;  4HS1 A;  2ZUP A;  4WXT A;  5KOX A;  3DXB A;  1MDK A;  1K0B A;  2FWE A;  2NPB A;  2FGX A;  3EPT A;  1SKW B;  1F6M C;  1X0R A;  1QMV A;  3ERW A;  5JCG A;  3TKS C;  1AIU A;  3D21 A;  5IMD A;  3TJG A;  4N3Z A;  1F9M A;  1BYE A;  5G31 A;  3Q74 A;  3GUR A;  3F9U A;  3IAM 2;  2DJK A;  4G9H A;  3RBT A;  1HNC A;  1SD9 A;  4I8B A;  4FQU A;  2P5R A;  3FHK A;  4JE1 A;  1ABA A;  3GX8 A;  4MJC A;  4HZ2 A;  4GWR A;  3KM6 A;  4WR4 A;  1SL2 B;  4MH2 A;  3QR6 A;  2LRC A;  1O8W A;  1SJ6 A;  1X5D A;  2B7J A;  1CQG A;  3UMA A;  3QDN A;  3TDG A;  3UIW A;  4IW9 A;  2R4V A;  4NXI A;  4OMV A;  1U87 A;  3A2W A;  1PGT A;  1URM A;  1DE1 A;  1T00 A;  2H73 A;  2HRK A;  1EZK A;  2A2R A;  3GKK A;  1YEX A;  3G7I A;  4Z2U A;  3CMI A;  5IM9 A;  3ME8 A;  4D73 A;  3KD0 A;  1R26 A;  4LMV A;  4FIW A;  5JWR B;  2JSZ A;  4CHS A;  2PPT A;  1X9W B;  2FD3 A;  5C04 A;  4TR3 A;  3IOS A;  4XS4 B;  2WZ9 A;  3TGZ A;  2LST A;  2VM1 A;  5ABR A;  3EUR A;  4K2D A;  3IAS 2;  4LL1 B;  4ECJ A;  3DVX A;  1I5G A;  1GTU A;  4BVY B;  1XW6 A;  1B4P A;  2DIY A;  4IQA A;  1ZZY A;  5ECL B;  1V40 A;  4OD7 A;  1ZYN A;  5EVO A;  3ZTL A;  3IE3 A;  3LEF A;  4GST A;  1O8X A;  1AQV A;  1W4V A;  3BOA A;  4KDX A;  1M9B A;  2H8L A;  1JZR A;  4E8E A;  3IRA A;  2BTO T;  4K5S A;  3QFA C;  2IFQ B;  4F0C A;  3VWU A;  1SL0 B;  5AN1 A;  1WPI A;  2QC7 A;  1YY7 A;  3N5O A;  1ZMA A;  3ISO A;  2N5A A;  1FAA A;  3HCZ A;  3VPT A;  4FYB A;  3ERG A;  3U6V A;  1PA3 A;  3G9B A;  1XWG A;  3L9S A;  5ECS A;  1TOF A;  2N5B A;  2KHP A;  5E4W A;  3DKS A;  2GGT A;  2KOK A;  3HZ4 A;  1GH2 A;  4O5Q A;  4X1U A;  5EL8 A;  4L0U A;  2NTO A;  1GL8 A;  3I6A A;  3W8J A;  1QUW A;  4GF0 A;  3TKQ A;  2LUS A;  1XW9 A;  4BL7 A;  5AGY A;  4ZIJ A;  4DEJ A;  1XPV A;  2VL2 C;  4QQ7 A;  3L9V A;  4IP6 A;  1HNB A;  4G01 A;  3VWX A;  3V1W A;  10GS A;  4Q5N A;  4HQS A;  2OE1 A;  3EC3 A;  1YF0 A;  2E2M A;  3ZLP A;  3L9U A;  4K7I A;  3S9F A;  2OAD A;  3M8N A;  2H74 A;  1USB A;  3IV4 A;  1GTI A;  1SJI A;  3DGQ A;  3E3E A;  4ULX A;  1NSW A;  1F37 A;  2V32 A;  1PMT A;  2V6K A;  3IR4 A;  2PGT A;  1ERU A;  5F05 A;  5IMV A;  4ILF A;  4TKY A;  1TU8 A;  3TKP A;  4MDC A;  4RI6 A;  4KB3 A;  3D5J A;  2WB9 A;  2H75 A;  1PKZ A;  2VCT A;  1K0A A;  2QGV A;  1AQX A;  2CZ3 A;  1O81 A;  2KUC A;  3VFI A;  2R37 A;  1FVJ A;  1ML6 A;  3NOF A;  4AJ6 A;  3QMX A;  2WCI A;  4V1A g;  3M3M A;  2ES7 A;  3DVW A;  3P2A A;  3R2Q A;  1K3Y A;  3GFK A;  1BX9 A;  4K2X A;  3UAR A;  1GSY A;  2V2G A;  4DSS A;  3EMX A;  2JL4 A;  2IPA A;  1SKR B;  1YKC A;  5H5R A;  3GKX A;  1OKD A;  4EO3 A;  1XWK A;  1ACV A;  1TXU A;  2OBK A;  1DSB A;  4BVX A;  1O7U A;  1VF1 A;  4ECI A;  3MSZ A;  2LNT A;  5BMU A;  2MYG A;  3J7Y k;  1B48 A;  4HU9 A;  4ECB A;  3OR5 A;  4RI7 A;  2E7P A;  1X9M B;  4EL1 A;  3TKR A;  2RM5 A;  2HT9 A;  1TW9 A;  2X8H A;  3LW9 A;  1T8E B;  1K3L A;  4YH2 A;  2GZP A;  2FCH A;  5EPF A;  4OCE A;  1YEP A;  4K8M A;  2O5V A;  1H4O A;  2VLV A;  3A2V A;  3LJR A;  5HR3 A;  5J3R A;  3F4R A;  3ZMK A;  2FWG A;  3N9J A;  2KLX A;  4MLY A;  2VLU A;  2K8V A;  2YWN A;  1XOB A;  1DE2 A;  1OC3 A;  3UVH A;  2LV3 A;  2CQ9 A;  3EYT A;  4LL4 B;  4TN8 A;  1AQW A;  2EFC A;  2IMI A;  2FWH A;  4TR1 A;  5D96 A;  1GP1 A;  5KN1 A;  3LQ7 A;  2F8F A;  5A5K A;  1OVN A;  2V41 A;  2VD0 A;  1M99 A;  3ME7 A;  2VAF A;  1A0F A;  2VCQ A;  1EP7 A;  4IJ3 A;  1OYJ A;  2CAQ A;  4E68 A;  5GAP D;  2O8V B;  3KGK A;  3HVX A;  3FRC A;  4GQF A;  4AJ8 A;  5DDL A;  3LYP A;  3GTU A;  3ZFB A;  2DMM A;  4FYC A;  2V1M A;  19GS A;  3NZN A;  4I97 A;  2BJX A;  1QQ2 A;  2OBI A;  1WRY A;  3UJ1 A;  1EP8 A;  2F9S A;  4XS6 A;  1A23 A;  3H79 A;  1GWC A;  3F4S A;  1BQ7 A;  6GSV A;  5J4Y A;  4POK A;  3FR9 A;  1M0U A;  3BBY A;  2YP6 A;  3WGX A;  3UVT A;  3O3T A;  2XBI A;  3GL3 A;  1ZYQ B;  2DJJ A;  1YKA A;  2YJH A;  4ZL7 A;  2XHF A;  4JU5 A;  2RLI A;  2E0Q A;  1JZD A;  2X49 A;  2GZZ A;  1OE7 A;  1RQM A;  4OFT A;  2QKE A;  4O32 A;  3HVS A;  1V98 A;  4BWS A;  5ECH B;  5F0G A;  4GQC A;  4OFM A;  1EV4 A;  2I1U A;  2F3M A;  1PL1 A;  2EFD A;  5DJM A;  1TXX A;  2IME A;  5DVB A;  3H8Q A;  3RHB A;  3IXR A;  2GLR A;  3TKS E;  2AB6 A;  1A24 A;  1VRS D;  2G0F A;  3M9J A;  1FO5 A;  2VCV A;  2PUK C;  2EC4 A;  1KNG A;  1GRX A;  2L59 A;  1A8L A;  3DWV A;  1V9W A;  4PNG A;  4PQ1 A;  2NVL A;  2PWJ A;  3C1R A;  4ML1 A;  2M46 A;  2MMA A;  2YJ7 A;  4O7H A;  2H76 A;  1SJZ A;  5ECO B;  5CYY A;  3FYG A;  3UBL A;  2HZE A;  5BRT A;  2C80 A;  4N0V A;  1B9Y C;  1FOV A;  5H5Q A;  3GV1 A;  2X8G A;  1XW5 A;  4KCA A;  4KSO A;  5A34 A;  1RW1 A;  5ID2 A;  2CA8 A;  5FT3 A;  3IBH A;  3IK7 A;  2CVD A;  2ZNM A;  1TTZ A;  4HEA 2;  3ZML A;  3GH9 A;  3VUR A;  3DIE A;  2YWI A;  1BED A;  1XWB A;  1HNA A;  3CTG A;  3TOT A;  2XC2 A;  3I69 A;  5D9T A;  1SD8 A;  3VLN A;  13GS A;  2WS2 A;  4KAE A;  4MNN A;  5ECN B;  3MYD A;  4V2M A;  2H0I A;  4NMU A;  3F63 A;  5DAL B;  2VL3 A;  1NW2 A;  1GNE A;  1O85 A;  1LU4 A;  4G19 A;  1XFL A;  4KW6 A;  5J9C A;  3IPZ A;  2OAC A;  2YOI A;  5EY6 A;  5J4V A;  2HFD A;  1I9D A;  1TP9 A;  3I9V 2;  1BF5 A;  1YJ6 A;  3BCK A;  3FY7 A;  4NAX A;  4NWY A;  2HSY A;  2CAI A;  4MH3 A;  2N5F A;  3KXO A;  2GSR A;  1S3C A;  4BPY A;  3ZRD A;  4V2L A;  3TRX A;  3KH7 A;  1X5C A;  4AKH A;  4KSM A;  2YAN A;  2H1L A;  1K0D A;  2HSN B;  2J9H A;  3J7Y b;  4XS4 A;  4FH8 A;  1GLP A;  4GCI A;  4ZB9 A;  3ZVJ A;  1HQO A;  2HLS A;  8GSS A;  2B3S A;  1THO A;  1MTC A;  4GSS A;  1PSQ A;  2IJY A;  1GUK A;  1FVK A;  3EVI A;  2O89 A;  6GSW A;  5DJL A;  1ZCP A;  14GS A;  2WDU A;  2K6V A;  3P90 A;  3K8N A;  2HE3 A;  2EFE A;  3VI7 A;  1TRS A;  1AC1 A;  5F06 A;  2IFQ A;  4CDO A;  4Z2R A;  2O7K A;  1BG1 A;  2IMF A;  4TRX A;  3WT1 A;  3CBU A;  4XIH A;  4KH7 A;  1M9A A;  3QAV A;  3A5W A;  2J23 A;  5ECQ B;  1N2A A;  3UAP A;  5CNW A;  2CVB A;  5DCG A;  5DCH A;  4KDU A;  2WFC A;  5ELA A;  4ACS A;  3QAW A;  1R5A A;  2VCW A;  1FOH A;  3EE2 A;  4LMW A;  3APQ A;  4JBB A;  4TXV A;  1EEJ A;  2M72 A;  1RK4 A;  4GLT A;  1DUG A;  4XRD A;  2DSA A;  3DD3 A;  1YVL A;  1B4Q A;  2A4V A;  3MDK A;  2I3Y A;  2VCX A;  4YKF A;  4MK3 A;  2DJ1 A;  4NPB A;  1K0O A;  4G10 A;  4AKG A;  1N8J A;  1TI1 A;  3GX0 A;  1J08 A;  3FZ5 A;  1GUH A;  4QL9 A;  4LLR A;  5J4U A;  4FO5 A;  4J57 E;  5CRG A;  2GQK A;  2TRX A;  3QCP A;  3GKM A;  4XTS A;  1LJR A;  3LXT A;  1F2E A;  4POL A;  4KDY A;  4TVE A;  1ERV A;  4N30 A;  3GST A;  2GSQ A;  3TKS A;  3WGE A;  5FWG A;  2MMO A;  4JED A;  2CX3 A;  2VD1 A;  4ZXG A;  1WOU A;  1Q98 A;  3CSH A;  4KGI A;  2ALB A;  3Q6O A;  5B8B A;  1EOH A;  4MPF A;  2C0F A;  1PQN A;  4ZL8 A;  4MZW A;  5J9B A;  3RAZ A;  1MEK A;  2H72 A;  2H1D A;  4JRR A;  4GDF A;  2C3T A;  1XVQ A;  1FW1 A;  2H30 A;  5B6N A;  3FW2 A;  2AYT A;  4J2F A;  4HUA A;  1ZGN A;  1Z3E A;  2R0G A;  1R4W A;  1SK1 A;  3HMJ G;  5ECP B;  4TOP A;  2HRF A;  4MJA A;  4ZB8 A;  4TXO A;  2NBS A;  3APS A;  5JCU A;  2L6C A;  4NHW A;  3ZVJ D;  1BAY A;  3M0F A;  4EE0 A;  4DSR A;  2OA7 A;  1XOA A;  2L4C A;  4P3Y B;  4K9Z A;  2XPE A;  3TJB A;  2RM6 A;  3KCM A;  2C3N A;  2YWM A;  1JLV A;  1T4Z A;  3H4K A;  5JWQ B;  2VLT A;  4BL7 B;  1VF4 A;  3WGD A;  1SL1 B;  1PN9 A;  1X5E A;  5GZZ B;  2B5E A;  3TRQ A;  1WJK A;  1NHO A;  2HZF A;  2VOC A;  1AUC A;  2H70 A;  3CWG A;  3GYK A;  2X8C A;  4ZL9 A;  1ON4 A;  3GL5 A;  3O76 A;  1WP0 A;  1Z6M A;  3GHA A;  4MF6 A;  2JZT A;  3ZYW A;  2RUF A;  4YQM A;  2PBJ A;  3KP8 A;  5A4W A;  3C7M A;  4F2I A;  2HSM B;  4YQU A;  2C0E A;  2FLS A;  2VIM A;  4Z2T A;  2H6Z A;  3F0I A;  3TRP A;  3HHV A;  1ZYE A;  5D8I A;  4CY8 A;  3TU3 B;  4AI6 A;  5G30 A;  2F8A A;  4PQH A;  2X4A A;  1K0M A;  4AF2 A;  5DAK A;  4KX4 A;  3G7J A;  1UVZ A;  2AUV A;  2HSH A;  1AXD A;  1QGV A;  3PR8 A;  2H01 A;  4KCE A;  5F07 A;  3D6I A;  1UC7 A;  1GSF A;  5D73 A;  2VUP A;  3LYK A;  3GN3 A;  1Z6N A;  4E8H A;  5ECR B;  4EDY A;  1R7H A;  5CRW A;  1Y1U A;  4BVX B;  2VL2 A;  2H6Y A;  1KTE A;  4OO5 A;  2QA1 A;  5BMU B;  2YZU A;  1SVO A;  4MMM A;  2CV4 A;  2OE3 A;  3QFB C;  3E9J B;  3D4M A;  4AKX B;  4O5U A;  3AY8 A;  4YAP A;  2YNX A;  3UL3 A;  5E59 A;  1MD4 A;  2P0G A;  4ZBA A;  4X43 A;  1XIY A;  2JZR A;  1OC9 A;  2C1Y A;  2REM A;  1PRX A;  4O5R A;  2LRN A;  1ZYP A;  2FNO A;  5J41 A;  4CY6 A;  3CXG A;  4F0B A;  4WBJ A;  3KTB A;  3R3E A;  1GNW A;  1G7O A;  16GS A;  2B6M A;  3QPM A;  2FHE A;  1JZW A;  2I81 A;  2FWF A;  4KND A;  3C8E A;  3IHQ A;  2DML A;  3FZA A;  3C73 A;  1JHB A;  4TR1 B;  2EIR A;  1PN0 A;  2JU5 A;  11GS A;  3IDV A;  4HJM A;  2UV8 G;  4RQX A;  6GSX A;  3C71 A;  2AV4 A;  1M2A A;  4Q5R A;  1IYH A;  2XPD A;  3MIX A;  1GSU A;  4ICY A;  2AJQ B;  2LNS A;  3F4T A;  4AGS A;  1Q4J A;  3Q18 A;  1VGL A;  4IEL A;  3VWW A;  2YV7 A;  4JR6 A;  3GTU B;  5HR2 A;  2P31 A;  4F03 A;  3A5I A;  3HD5 A;  5HFG A;  2I9H A;  1J0F A;  5D9W A;  1H75 A;  2Z9S A;  5IMC A;  3G7Y A;  3ZL5 A;  3TJJ A;  1K3O A;  5IOW A;  1TK0 B;  2L4Q A;  1NM3 A;  5ECM B;  4QL7 A;  3KMO A;  2HI7 A;  1EOG A;  3WD6 A;  2LQO A;  1JLW A;  6GST A;  3NIV A;  3PIN A;  2C8U A;  3H93 A;  2R5G A;  3F6F A;  4MCU A;  5D93 A;  2MBT A;  4K6X A;  1OKT A;  2GDR A;  3DYR A;  3LGC A;  3KP9 A;  4WET A;  2CVK A;  2CZ2 A;  1QFN A;  2FA4 A;  4ZB7 A;  4G2E A;  3IA1 A;  5HR0 A;  5A5H B;  3F3R A;  2KP2 A;  4ZB6 A;  5AIX A;  5A1N A;  3L78 A;  1WMJ A;  20GS A;  2B5X A;  4DVC A;  4L5L A;  3E0U A;  2G2Q A;  4BWQ A;  1N25 A;  2EFH A;  1ERT A;  3MAK A;  3ZRE A;  2CT6 A;  2H6X A;  1XVW A;  1TKD B;  1C72 A;  4CW9 A;  1PL2 A;  5J40 A;  2HSN A;  4POM A;  1MD3 A;  1Y25 A;  1JFU A;  2R2J A;  1EGR A;  2FUG 2;  1V57 A;  3L4N A;  1TU7 A;  3FKF A;  5ELG A;  2OT3 A;  1KBN A;  2K8S A;  3L0H A;  5FHI A;  3KIJ A;  2OKA A;  2DIZ A;  3HDC A;  4HI7 A;  6GSY A;  2R6K A;  3HVV A;  1F3A A;  3W6G A;  2OE0 A;  5IO0 A;  1OE8 A;  2QA2 A;  2VKZ G;  2K9F A;  4DSQ A;  3FEU A;  1M2D A;  2GSS A;  1ST9 A;  2FY6 A;  3D22 A;  4HU7 A;  2ZCT A;  4N0Z A;  2C0D A;  1O73 A;  4TW5 A;  5ID2 B;  1AW9 A;  4K7O A;  5CRD A;  1V58 A;  1FG4 A;  2LJR A;  1CQH A;  4AKI A;  4I2U A;  3MWH A;  5G2Z A;  4IVF A;  1TJD A;  2AAW A;  3SWL A;  2IWT A;  2HNL A;  4ZBD A;  4YQV A;  5KN2 A;  2TIR A;  4BVY A;  2H0H A;  3EU3 A;  1MDJ A;  4PUF C;  1XWC A;  3PGT A;  1IYI A;  2XBQ A;  3GKN A;  2VCZ A;  5IMF A;  4MPG A;  3VPQ A;  4RUV A;  9GSS A;  4I6X A;  4QMK A;  1AAZ A;  4ID0 A;  1ERW A;  3GRX A;  1ZL9 A;  4HQZ A;  2GQM A;  2A4H A;  3BJ5 A;  4ECC A;  4OCF A;  4V2N A;  2GTU A;  5IOX A;  1SK0 A;  1PKW A;  5G5F A;  3RDW A;  4WBR D;  2WUL A;  4MA9 A;  4L8E A;  3D4T A;  4PXO A;  1G6W A;  3CYN A;  3I43 A;  3KEB A;  2GQL A;  3CRU A;  1G0T A;  3U5R E;  2LKU A;  3IC4 A;  4O92 A;  3UBK A;  3TJF A;  2C4J A;  1PX6 A;  1GSQ A;  1UN2 A;  5LCZ A;  1A0R P;  1YQ1 A;  4EUY A;  17GS A;  1O6J A;  4IGJ A;  2LJA A;  18GS A;  1TRV A;  2HRK B;  1KEB A;  2VL9 A;  1EWX A;  4A5P A;  5C00 A;  4IN0 A;  4OO4 A;  4D73 B;  1F3B A;  2GVP A;  3Q19 A;  4MJB A;  2E2G A;  4JZQ A;  2DC5 A;  3QD9 A;  4PGT A;  2DJ2 A;  3F3Q A;  2L6D A;  3UOM A;  4F9Z A;  4KF9 A;  2R0P A;  3HJP A;  1K0C A;  1YDK A;  2WJU A;  4I5Q A;  3ZIV A;  4Q5Q A;  2H1G A;  5KN0 A;  2DJ3 A;  3C1S A;  4PNF A;  5COH A;  1A2L A;  4Q5F A;  4WF4 A;  2TRC P;  2H1B A;  1XZO A;  2IMK A;  5CO3 A;  2GS3 A;  4PUA A;  1ILO A;  2ON7 A;  3IHG A;  3RPN A;  5GSS A;  3HJM A;  3FK8 A;  2RUE A;  4G0I A;  1SVL A;  1M2B A;  4PX1 A;  1QK8 A;  4H86 A;  3M1G A;  5LD0 A;  3GNJ A;  1EV9 A;  1A8Y A;  1XCC A;  3ZZX A;  2MMN A;  4POB A;  1PX7 A;  2UZ8 A;  2HYX A;  4IKH A;  2H1A A;  1G7E A;  3LWA A;  4EKZ A;  4I2T A;  2PVQ A;  1M7T A;  2YZH A;  4RQR A;  2A2P A;  1XXU A;  2K18 A;  1WWJ A;  2P5Q A;  3CSJ A;  3GA4 A;  6GSS A;  1BJX A;  3VI5 A;  1T4Y A;  2PN8 A;  2HSM A;  3HJO A;  4MJE A;  4N11 A;  2AHE A;  3GMF A;  5GAN D;  3P8W A;  4LA1 A;  2A2S A;  3HZ8 A;  2VM2 A;  1U88 A;  3GH6 A;  2H19 A;  4K1F A;  3BCI A;  2KP1 A;  2EIQ A;  3SBC A;  2JZS A;  3HKR A;  5JWO B;  3EWL A;  5J47 A;  5AIS A;  3VK9 A;  2X99 A;  3LG6 A;  3QOU A;  4XHM A;  2H0G A;  2QSI A;  4HDE A;  3HYP A;  1SK2 A;  1TRU A;  2O85 A;  5LNK e;  2LQQ A;  2DLX A;  12GS A;  3A2X A;  4ZBB A;  4F82 A;  2GST A;  2YV9 A;  2LRT A;  4NV5 A;  4ZIL A;  1GSD A;  1GSS A;  5G1K A;  2CX4 A;  1TK8 B;  2B7K A;  5CRE A;  3CSI A;  4K0G A;  4K5R A;  5CRH A;  5F8B A;  1TRW A;  1E6B A;  5B7C A;  3M9K A;  4NHZ A;  2JAD A;  5J5N A;  3F6D A;  1XBS A;  1VF3 A;  4TXO B;  1FB0 A;  3LSZ A;  2PU9 C;  5IIZ A;  5KOW A;  4JR4 A;  3FZ4 A;  2YCD A;  1Z9H A;  4HJ2 A;  2JAC A;  4MZB A;  4EDZ A;  3FZ9 A;  2X64 A;  1SYR A;  3CTF A;  3JCM L;  1U3A A;  2IIY A;  2DKH A;  2H71 A;  1A2J A;  4EVM A;  2YN1 A;  4DSS B;  1FHE A;  4WEY A;  1HYU A;  3DRN A;  1GTA A;  2LS5 A;  5JCW A;  2HRA A;  1GTB A;  4ML6 A;  2DBC A;  3TB2 A;  3MNG A;  3WT2 A;  4K7N A;  5DQY A;  4GTU A;  3LXZ A;  2C0G A;  3W8S A;  4X4J A;  1K0N A;  3PH9 A;  2YWO A;  1SKS B;  2NDO A;  2L5O A;  2JSY A;  4G0K A;  3GUS A;  1UA5 A;  4N10 A;  3D0Z A;  4GSN A;  5CAX A;  2HQT A;  2RII A;  2LJK A;  2DJ0 A;  2YPM A;  4HOJ A;  4Z7X A;  3ZIJ A;  1SEN A;  5A4U A;  3KTL A;  2PMT A;  7GSS A;  1WIK A;  3ZFL A;  4GRF A;  3GSS A;  4TR4 A;  1FB6 A;  2D2Z A;  6GSU A;  2H66 A;  1YZX A;  2L5L A;  1S3A A;  2R0C A;  1MDI A;  2BMX A;  2R3X A;  5IQY A;  2V6O A;  2GZY A;  1W89 A;  1SVM A;  5DAK B;  4IHU A;  4EF0 A;  1E2Y A;  1OC8 A;  3QAG A;  1XWA A;  3A3T A;  3ED3 A;  5G5E A;  4EXJ A;  3FR3 A;  1GUL A;  3VWV A;  5A4V A;  1SYX A;  3KZQ A;  4G0L A;  5CP1 A;  1R5P A;  2MBS A;  1GLQ A;  3CRT A;  3RPP A;  3BD2 A;  2F51 A;  4L0W A;  3IC8 A;  1U3I A;  2C3Q A;  4MZC A;  1ZOF A;  5IMA A;  2ON5 A;  4USS A;  4BA7 A;  4MAB A;  2LTK A;  4IJI A;  1VF2 A;  4KA0 A;  3ZIT A;  1G6Y A;  1SU9 A;  4IP1 A;  2IMD A;  2WRT A;  4HZ4 A;  1J9B A;  4MF7 A;  2B1L A;  5HFI A;  4KE3 A;  4YKG A;  5D9X A;  5L71 A;  3EMP A;  1WE0 A;  3US3 A;  5ECK B;  3RHC A;  5DQS A;  4V1A p;  1DBY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...