3QR6A

Crystal structure analysis of h185f mutant of human clic1
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
236
structure length
236
Chain Sequence
PQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLFIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chloride intracellular channel protein 1
publication title Role of individual histidines in the pH-dependent global stability of human chloride intracellular channel 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 76
structure length 236
sequence length 236
ec nomenclature
pdb deposition date 2011-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13409 GST_N_2 Glutathione S-transferase, N-terminal domain
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3qr6A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3qr6A01
4GRFA 4K8MA 3NIVA 1OC9A 3IE3A 4FYUA 1M99A 4MDCA 1SJ6A 2MMZA 1YEPA 3A5WA 3UVTA 4MH2A 4XCSA 3PPUA 1S3DA 3L9SA 2BMXA 4POMA 3GL3A 4HQZA 5B8AA 2PBJA 2A2RA 2ES7A 2IPAA 3APSA 1GNWA 3OR5A 3GL5A 4N30A 1TTZA 4KCEA 2R4VA 2F8AA 1FW1A 2FNOA 1K0MA 2V2GA 3BD2A 3GX8A 3DVXA 2I3YA 2JACA 1G7OA 1UVZA 3M9JA 3FR3A 2MMNA 1FAAA 1M7TA 1B9XC 3VWUA 2XBQA 2QKEA 1NHOA 4JRRA 5ECQB 4DSQA 4N10A 1BAYA 1SENA 4EC0A 2CAQA 1GNEA 3TRXA 1XFLA 5CRDA 4KAEA 1JFUA 3GUSA 1G6WA 1GWCA 3PH9A 5IIZA 2HSHA 2H75A 4TR1B 4ECJA 3F3QA 5A4VA 3KP9A 3IC8A 3P8WA 2HZFA 1T7PB 2YP6A 4EE0A 1RQMA 2C4JA 2FWGA 2DMLA 5JWOB 2CX4A 3L0HA 2GSSA 1OC3A 1T4ZA 2H6ZA 2PPTA 1PMTA 1A0RP 4V2NA 1SYXA 2VAFA 3HZ8A 4XRDA 5C04A 4PQ1A 5AIVA 4FYCA 4RQXA 2HLSA 4ECCA 3C71A 2C0EA 2ON5A 3D6IA 3UJ1A 5CAXA 1EV4A 5KN0A 4JE1A 2P5RA 4AF2A 1Z7RA 2H8LA 2R2JA 2RLIA 3QR6A 1A2JA 2LJRA 3VLNA 3GMFA 4TVEA 4AJ8A 4TXOB 3M1GA 2X8HA 3HZ4A 2F8FA 2PWJA 3VPQA 3ZIJA 3F0IA 4IHUA 4ZB6A 4MJCA 4HZ4A 1KBNA 1PSQA 2VL9A 4BL7B 4IGJA 3HCZA 4JU5A 3HJPA 2X64A 2WCIA 3CMIA 1MEKA 1XCCA 2FLSA 1UA5A 2NBSA 5HFIA 2OE0A 2V1MA 5B6MA 2PVOC 4GTUA 4IW9A 1TP9A 2H1DA 3P90A 3KGKA 4CDOA 2IWTA 1N2AA 3BOAA 3FW2A 2O87A 2A4VA 3TRQA 2GSQA 4YH2A 5GSTA 3ERWA 4ULXA 3GYKA 4ZBBA 4OFTA 4K6XA 4EO3A 3HVSA 4PXOA 2N5BA 1XZOA 2REMA 4OCEA 3FHKA 4K7IA 5G2ZA 2GTUA 1SK2A 2C1YA 4GSSA 4I5QA 5EVOA 3UBLA 1T3BA 1K0DA 3QAGA 3P2AA 3CXGA 4O5RA 1PA3A 3MWHA 4WKWA 3CRUA 2VL3A 1SKSB 2L5LA 4MPGA 3BJ5A 5J41A 1WE0A 5IMVA 1WWJA 3TKSE 5AIXA 4KH7A 2YJ7A 1YQ1A 5D93A 1JZRA 4NXIA 3RHBA 3GTUA 4KDUA 1E2YA 5CO3A 3TB2A 1GLPA 5DALB 2I4AA 1ZOFA 5IPGA 1K0OA 4KCAA 2C8UA 1HQOA 1M9AA 2GLRA 3ME7A 4ML1A 2VUPA 1G6YA 4KGIA 3J7Yb 4EKZA 4XS6A 2B6MA 3IPZA 1RK4A 10GSA 2CVKA 2LUSA 2LNSA 2VLUA 1SK0A 5D9XA 5E59A 4AJ6A 2ZCTA 4PURA 1X5DA 3IV4A 1VRSD 2GDRA 3DGQA 7GSSA 2L6DA 3H8QA 1FVKA 1TRUA 17GSA 2NDOA 3L9UA 4DSRA 4HOJA 3O3TA 4L5LA 1M0UA 3HD5A 2WB9A 3F4TA 4Z7XA 1OKTA 4EL1A 1TOFA 2IFQA 2IL3A 3D4TA 4KUNA 4X0XA 2LS5A 4JZQA 1R5AA 4V1Ap 3TJFA 2PGTA 4IELA 5ECHB 4KSMA 6GSUA 1XBSA 4ZIJA 4D73A 5HQPA 1ERVA 5DCGA 2B7JA 1PL1A 2LJKA 2VM1A 2FUG2 1DE1A 3IC4A 2KOKA 1F6MC 3KH7A 3VFIA 4BPYA 3KTLA 3KIJA 1X9SB 3GSSA 4IQAA 3RDWA 1GTAA 3VWVA 2JSYA 1JZOA 1EGRA 1YY7A 3FEUA 4J57E 1TI1A 2H66A 4HI7A 2IMEA 1Y6EA 3MDKA 4ZILA 3GKKA 4OO5A 4AGSA 4PTSA 2EIRA 2YV9A 1M2DA 2R6KA 1YF1A 3IRAA 5AGYA 3L78A 3Q18A 4Q5QA 2C0DA 1EOHA 1A8YA 4G0KA 1U87A 2DLXA 1O8WA 5HR2A 2GZPA 2IMFA 2HSYA 2GT6A 1GSQA 4RI7A 5HR0A 4DVCA 2P0GA 5EY6A 3F8UA 4HUAA 2B1LA 3GRXA 4ECBA 4G9HA 2LKUA 1FG4A 4PUAA 1JZWA 4EVMA 1GSFA 2AHEA 2P5QA 1XVWA 2MYGA 1TI3A 3FZAA 1J0FA 5AISA 3EINA 4PX1A 1N8JA 1B8XA 4J2FA 4JBBA 2H01A 1NM3A 1TRSA 5L71A 3F6DA 4ZB9A 4D73B 4K0GA 1ZYQB 1AQXA 4JEDA 1TKDB 3SBCA 5IOXA 3TOUA 1BYEA 4HZ2A 3EU4A 5CP1A 3TUEA 2HNLA 2LEGA 4WBRD 3DD3A 1H75A 3GHAA 1QQ2A 2MZCA 2OE1A 3Q74A 2QSIA 4USSA 4PQHA 3CYNA 3G9BA 4NWYA 3DVWA 1ZCPA 4WF4A 3ZIVA 3KM6A 2OBKA 2PN8A 3F3RA 4OFMA 2H72A 9GSSA 4Q5NA 2LV3A 5AN1A 1R5PA 4HQSA 3ISOA 3EMXA 5F06A 2M80A 4IVFA 4X43A 1W89A 2B7KA 2TRCP 3IDVA 5J9CA 4KDXA 1GULA 4K7NA 1VF3A 5ELGA 1F9MA 2C3TA 1XPVA 2MMOA 4WEYA 4TR4A 2VD0A 1AXDA 4ZB8A 4ML6A 3GX0A 5CNWA 1BG5A 1GUMA 2FA4A 4KB3A 3WGXA 2F51A 3GURA 3I9V2 4F0CA 1ML6A 2DSAA 4IP6A 3O76A 4CHSA 3WGDA 1PQNA 1WPIA 1K0NA 3US3A 2HQTA 1XW5A 2CVBA 5LCZA 5DQSA 3UVHA 2VO4A 3TCOA 1MTCA 1XWKA 3WYWA 3Q19A 2AB6A 1EEJA 2K8SA 3H79A 5DBQA 3GH9A 1WJKA 2VOCA 1QUWA 1T00A 2X8GA 3HYPA 4Q5RA 5IMZA 2HRNA 3GN3A 1HNBA 4OCFA 3ZZXA 3LG6A 5D73A 4X1UA 2OACA 5ECIB 3FRCA 4IN0A 2HSNB 2RUFA 4RUVA 3QFBC 1M9BA 2WDUA 4BWQA 1VF2A 5ECKB 5DCHA 2JZRA 4YQMA 3KZQA 1O81A 1GSDA 4EUYA 4TR0A 2VL2A 1HD2A 3GIXA 2V6OA 4IS0A 3H4KA 3DKSA 4HDEA 5F05A 4NHWA 3U5RE 3ZRDA 2TRXA 4N11A 4G0IA 3W8SA 5COHA 1X9WB 3QD9A 4BVYA 2YWIA 5ECSA 4CW9A 1ST9A 2V32A 4MJBA 3QAVA 5ABRA 2I81A 1JZDA 3UARA 1K3OA 1SYRA 2MBSA 4GCIA 5C00A 3VPTA 2EC4A 4KE3A 1OC9B 4L8EA 2C0FA 5EL8A 3G7JA 3CTFA 3O6TA 1UC7A 4XIHA 4J56E 3LXZA 4ZXGA 1S3AA 3D5JA 1A2LA 16GSA 3D0ZA 1RW1A 2VCVA 5JWQB 3AY8A 2VCQA 2IMIA 2GVPA 1ABAA 1V58A 1PGTA 4YQVA 4KNDA 1DSBA 5B8BA 4I2TA 3ZVJD 1GH2A 2XPDA 4KF9A 1U3IA 4ID0A 4NV5A 1DBYA 4ECIA 1U6TA 5ECNB 4MJEA 5ECOB 2O7KA 3I6AA 2M72A 2YN1A 4I2UA 2P31A 3GNJA 4KA0A 1AQVA 1EGOA 1Z6NA 5DJLA 2L59A 4OMVA 1Y25A 3N9JA 3SWLA 4G10A 1QFNA 4PNGA 2VL2C 5IQYA 4NPBA 1GRXA 3LFLA 1VGLA 5F8BA 2CQ9A 5DAKA 3GA4A 3UEMA 1FHEA 3JCML 5IMCA 1XWBA 1FVJA 2DJ1A 1V57A 1Q4JA 2AYTA 3A3TA 4G19A 5HFGA 3C8EA 4BVYB 2H0IA 1A8LA 2C0GA 3HKRA 2KUCA 2OADA 2AJQB 2JZSA 3CSIA 5INYA 4F03A 3DYRA 1F3AA 2PMTA 3HXSA 1XWCA 2DJ0A 1K0CA 1Z7PA 2H76A 4OFNA 3ZFBA 2K6VA 2GGTA 3UMAA 2RIIA 1OE8A 1WOUA 1AIUA 4HS1A 2LRCA 12GSA 1NW2A 3EU3A 3WT2A 1YKCA 2I9HA 5DQYA 4OD7A 1GSUA 3VURA 1WMJA 3GFKA 3ME8A 4HU7A 3QMXA 5G1LA 3IAS2 4DEJA 3KH9A 1HYUA 4TR3A 1A0FA 4HJ2A 5JCWA 14GSA 4IJIA 1XXUA 1EWXA 1K0BA 1R26A 1WIKA 2H30A 5IMAA 2WGRA 5B6NA 2DMMA 2L5OA 4EDYA 2WZ9A 1MD3A 3RBTA 5IO2A 3BBYA 2K18A 2PVQA 4K1FA 4GSTA 2HI7A 1SD9A 1URMA 4NAXA 2F3MA 3H1NA 3LEFA 3LYPA 2JU5A 3TGZA 2HZEA 3BCKA 3KMNA 3VI7A 4BA7A 5B7CA 3DWVA 4QQ7A 2H6YA 3RPNA 2WS2A 2WJUA 5D9VA 2JADA 1X0RA 1MDJA 2DIZA 4QL7A 4BWSA 1A24A 1EEMA 18GSA 4BVXA 5IMDA 2OJLA 3FY7A 3GKNA 2PU9C 5A4UA 2AUVA 1YKAA 3LYKA 2JSZA 1YJ6A 1PD21 4KDYA 6GSXA 3M8NA 5CRWA 1X5CA 2CZ3A 5HR1A 4TRXA 3KEBA 4TXVA 4L0WA 2HE3A 3GKMA 2HSMA 1KTEA 1EZKA 5CREA 1XOBA 3I69A 2GQLA 3TKPA 5IPHA 1LBKA 4G0LA 1M2BA 3J7Yk 3PINA 2PERA 2JZTA 5KN3A 5A4WA 4XRAA 5IM9A 5G5FA 1S3CA 2XPEA 3BCIA 4GF0A 4JR4A 2LSTA 2Z9SA 4IJ3A 3EYTA 3FYGA 2H19A 2KP2A 2LTKA 1AUCA 3GTUB 3IBHA 1SL1B 4PUFC 5IO0A 1TU7A 1PX7A 3FR6A 2E2GA 4TW5A 3N5OA 3MSZA 3M0FA 3MAKA 4WETA 3CSJA 1TK8B 4OO4A 2F9SA 1AAZA 2FWHA 3A2VA 2GQKA 3FK8A 1OYJA 4BVXB 3KTBA 3ED3A 1GTBA 4LMVA 3QCPA 4DSSA 1PX6A 3EE2A 2G0FA 2K8VA 1F2EA 4YQUA 4FH8A 1CQGA 4JR6A 5J5NA 2GZYA 3ZL5A 3R2QA 4H86A 5CYYA 3KP8A 3EMPA 3DRNA 3IOSA 3RHCA 4MP4A 2YZHA 4XS1A 3L4NA 2DBCA 4LA1A 4GQFA 2J9HA 2IFQB 3UIWA 3WT1A 2HSMB 1O6JA 1GSYA 2MMAA 1BJXA 5DDLA 1U88A 4FQUA 2O85A 3ZITA 4PQIA 3VK9A 1JLWA 2FGXA 3IK9A 5HR3A 4MF5A 1O73A 5E4WA 1HNCA 4MCUA 3HDCA 3LQ7A 4ZL9A 5ECMB 2FWFA 3QPMA 2GQMA 3W6GA 4Q5FA 1O8XA 5ENUA 1JHBA 5JCUA 2GZZA 4GQCA 2A2SA 5ELAA 2V6KA 3HJOA 5GAND 5ID2A 4AJ7A 1THOA 3CBUA 2YV7A 5G30A 2OKAA 1USBA 3TKSA 3WD6A 2XC2A 4P3YB 4L5OA 2K9FA 1TW9A 2NVLA 4MF7A 22GSA 2MBTA 5H5RA 4HEA2 4RI6A 2LQQA 4GXZA 3KJYA 2C80A 5D9TA 3HVVA 4PGTA 2J23A 3LGCA 3EC3A 1G7EA 3KMOA 4I6XA 3R3EA 4F0BA 3UOMA 4L0UA 2IJYA 4MA9A 1A2MA 1XOAA 1DE2A 1Z3EA 2HFDA 3VWWA 2GT5A 4IQ1A 1PRXA 2HXKA 3C7MA 3TJGA 2B5XA 2H1AA 3D4MA 5J4UA 3G7IA 4MH3A 1FO5A 3L9VA 5F07A 3KD0A 1EV9A 3TKQA 4KSOA 3F63A 3Q6OA 11GSA 1NSWA 3HJMA 4IP1A 1VF1A 3C1RA 1ERWA 1Z6MA 3C1SA 3ZFLA 3GH6A 3E0UA 1B4PA 3QFAC 13GSA 3LSZA 1TRVA 4TR1A 2VLTA 2HRFA 5J3RA 1Z9HA 2R3XA 1O7UA 2AV4A 2L57A 1TXXA 2FWEA 1EP7A 3PGTA 2BTOT 2H70A 3KXOA 2ALBA 2YWMA 2N5FA 3G7YA 4OWYA 3TJKA 2CX3A 3CTGA 4N0VA 2DJJA 1CQHA 2V41A 2X8CA 5ID2B 1H4OA 3TKSC 4F82A 2R5GA 1OE7A 2GSRA 5GSSA 6GSWA 4IKHA 3TJBA 2HT9A 2YNXA 4POLA 5G31A 1PKZA 2AAWA 4I97A 2VCZA 3QOUA 3U6VA 6GSYA 3UAPA 3DMLA 5KN1A 2TIRA 1IYIA 3IAM2 2DIYA 1EOGA 1GSSA 3LJRA 2WFCA 4QL9A 2WRTA 4MPFA 1A23A 1SL0B 1SL2B 2JL4A 2ON7A 3IA1A 1GTUA 2QGVA 4TXOA 3I43A 1OC8A 2IN3A 2B3SA 3A2XA 1B4QA 2LNTA 3ZTLA 1T8EB 4V2MA 2H0GA 4BL7A 5IOWA 5JCGA 1XW9A 3CRTA 3ZREA 2NTOA 4LL4B 2RUEA 2H74A 1QGVA 4MABA 2GSTA 2HRKA 2FHEA 2M46A 3A2WA 2HYXA 3WGEA 2I1UA 1WP0A 3MNGA 1F37A 3IHQA 3F4RA 5D8IA 4XHMA 1YZXA 1GTIA 2CAIA 1ILOA 1BEDA 1KEBA 1YF0A 1TK0B 4O92A 2CV4A 1GP1A 4HU9A 2FA8A 1W4VA 2RM6A 2YWOA 3HY2A 1MDKA 4F9ZA 1TJDA 3ZVJA 3EURA 4WBJA 2VIMA 1AW9A 2C3NA 4KX4A 1LJRA 3CSHA 3DEXA 4HJMA 2DJ2A 2CA8A 1AC1A 2RM5A 1SKRB 2H1GA 1HNAA 2YWNA 1QXHA 2EIQA 3V1WA 3KCMA 2G2QA 3VI5A 1E6BA 2H71A 1V9WA 1JLVA 1V2AA 2DJ3A 1XW6A 1C72A 5DJMA 1ZYEA 2H0HA 2H1BA 3ZYWA 3APQA 4WF5A 1BX9A 2NPBA 1K3LA 4MLYA 2L6CA 1FB6A 3TKRA 2H6XA 5DALA 3QAWA 2HRKB 5BMUA 1SKWB 2GS3A 4E8EA 3TDGA 1V98A 5KN2A 6GSSA 2FD3A 2IMDA 2XHFA 4MJAA 3DIEA 3GV1A 3EVIA 3D22A 2YZUA 3NOFA 5CRGA 1TU8A 4YAPA 1TK5B 5FT3A 1LU4A 3UL3A 5ECRB 4XS4A 3LXTA 2OBIA 3P7XA 1I9DA 4WXTA 4MZWA 2ZNMA 1MD4A 2ZUPA 3F4SA 4ISDA 1J08A 6GSTA 5DAKB 5D9WA 1V40A 4POKA 2DC5A 1SD8A 4FYBA 2HRAA 4XTSA 2PUKC 1ON4A 1ERTA 3RPPA 2YANA 6GSVA 5D96A 20GSA 1MDIA 4IBPA 5A5KA 1M2AA 1F3BA 1ZMAA 3E9JB 5CRHA 1PN9A 5GAPD 3RAZA 4MZBA 2VCXA 3HVXA 4ZBAA 4ACSA 4ZL7A 3K8NA 2OA7A 5J9BA 1ZZYA 4MMMA 3FR9A 2LRTA 2R37A 1QK8A 3FKFA 4GLTA 2N5AA 2VM2A 3M9KA 3W8JA 2B5EA 2CVDA 4G2EA 1XWAA 2UZ8A 2KHPA 5H5SA 1K3YA 1X5EA 4EXJA 1T4YA 1ERUA 4MZCA 2IIYA 5LNKe 2WULA 2E0QA 3TOTA 3FZ9A 4XS4B 4WR5A 1YEXA 2H73A 4LLRA 5ECLB 4POBA 4V1Ag 4TN8A 5FHIA 5LD0A 4KW6A 3PR8A 2YOIA 3M3MA 3QDNA 1T1VA 1UN2A 3GSTA 2IMKA 4F2IA 3HA9A 4O7HA 4MK3A 1XIYA 2X99A 3E3EA 1IYHA 1FB0A 2HZEB 2L4QA 4MF6A 2O89A 2O8VB 2OE3A 1KNGA 1X9MB 3DXBA 1FOVA 5IMFA 1ZGNA 4K9ZA 2B1KA 1NHYA 1XWGA 1J9BA 3ZMLA 1QMVA 2KLXA 1B9YC 2CZ2A 1G0TA 3TJJA 3H93A 1EP8A 1WRYA 1AQWA 4FIWA 3ERFA 4TKYA 1XVQA 1B48A 1VF4A 4K7OA 3LORA 2FY6A 3ZMKA 1U3AA 3GKXA 3S9FA 4PNFA 5EPFA 4NMUA 1BQ7A 3VWXA 2BJXA 2KP1A 3TRPA 1GLQA 2YJHA 3EWLA 4NHZA 2LQOA 1SU9A 2B5YA 4GSNA 2VD1A 2L4CA 3C73A 2E2MA 1YDKA 2YPMA 2YCDA 1O85A 2EIOA 2DJKA 1TRWA 1DUGA 5HFKA 19GSA 2QC7A 5KEJA 4RQRA 1TDIA 5DVBA 4K2DA 3IR4A 2VCWA 1ZL9A 2E7PA 1R4WA 4GWRA 4O32A 3FZ4A 4ILFA 1GL8A 2C3QA 1Z5YE 2VCTA 1SJIA 1GUKA 2XBIA 5F0GA 4E8HA 3NZNA 4N0ZA 3LWAA 4V2LA 4NV2A 1K0AA 3ZLPA 4DSSB 5FWGA 3D21A 3FZ5A 2VLVA 2CT6A 1OKDA 5H5QA 5JWRB 1R7HA 2LJAA 3F9UA 4TOPA 5G5EA 1GUHA 4ZL8A 2D2ZA 3F6FA 3HHVA 1SJZA 4EF0A 4K0NA 4LMWA 1PKWA 1I5GA 3IK7A 3ERGA 8GSSA 1OAZA 1PL2A 1GSEA 2FCHA 3APOA 5G1KA 1SK1A 1OVNA 3UBKA 4ZBDA 1ACVA 5GZZB 4FO5A 4LL1B 5ECPB 4I8BA 4WR4A 4YAVA 3IXRA 1Q98A 1THXA 4EDZA 2LRNA
chains in the Genus database with same CATH superfamily
4GRFA 4K8MA 3NIVA 1OC9A 3IE3A 4FYUA 1M99A 4MDCA 1SJ6A 2MMZA 1YEPA 3HVNA 3A5WA 3UVTA 4MH2A 4XCSA 3PPUA 1S3DA 3L9SA 5KOWA 2BMXA 4POMA 3GL3A 4HQZA 5B8AA 2PBJA 2A2RA 2ES7A 2IPAA 3APSA 1GNWA 3OR5A 5A5HB 5J4YA 3GL5A 4N30A 1TTZA 2WVXB 4KCEA 2R4VA 2F8AA 1FW1A 2FNOA 1K0MA 2V2GA 3BD2A 3GX8A 3DVXA 2I3YA 1Y1UA 2JACA 1G7OA 1UVZA 3M9JA 3FR3A 2MMNA 1FAAA 1M7TA 1B9XC 3VWUA 2XBQA 2QKEA 1NHOA 4JRRA 5ECQB 4DSQA 4N10A 1BAYA 1SENA 4EC0A 2CAQA 1GNEA 3TRXA 1XFLA 5CRDA 4KAEA 1JFUA 3GUSA 1G6WA 1GWCA 3PH9A 5IIZA 2HSHA 2H75A 4TR1B 4ECJA 3F3QA 5A4VA 3KP9A 3IC8A 3P8WA 2HZFA 1T7PB 2YP6A 4EE0A 1RQMA 2C4JA 2FWGA 2DMLA 5JWOB 2CX4A 3L0HA 2GSSA 1OC3A 1T4ZA 3CWGA 2H6ZA 2PPTA 1PMTA 1A0RP 4V2NA 1SYXA 2VAFA 3HZ8A 4XRDA 4X4JA 5C04A 2EFDA 4PQ1A 5AIVA 4FYCA 4RQXA 2HLSA 4ECCA 3C71A 2C0EA 2ON5A 3D6IA 3UJ1A 5CAXA 1EV4A 2DKHA 2R0CA 5KN0A 4FXYP 4JE1A 2P5RA 4AF2A 1Z7RA 2H8LA 2R2JA 2RLIA 3QR6A 1A2JA 2LJRA 3VLNA 3GMFA 4TVEA 4AJ8A 4TXOB 3M1GA 2X8HA 3RGBC 3HZ4A 2F8FA 2PWJA 3VPQA 3ZIJA 3F0IA 4IHUA 4ZB6A 4MJCA 4HZ4A 1KBNA 1PSQA 2VL9A 4BL7B 2UV8G 4IGJA 3HCZA 4JU5A 3HJPA 2X64A 2WCIA 3CMIA 1MEKA 1XCCA 2FLSA 1UA5A 2NBSA 5HFIA 2OE0A 2V1MA 5B6MA 2PVOC 4GTUA 4IW9A 1TP9A 2H1DA 3P90A 3KGKA 4CDOA 2IWTA 1N2AA 3BOAA 3FW2A 1BF5A 2O87A 2A4VA 3TRQA 2GSQA 4YH2A 5GSTA 3ERWA 4ULXA 3GYKA 4ZBBA 4OFTA 4K6XA 1BG1A 4EO3A 3HVSA 4PXOA 2N5BA 1XZOA 2REMA 4OCEA 1SVOA 3FHKA 4K7IA 5G2ZA 2GTUA 1SK2A 2C1YA 4GSSA 4I5QA 5EVOA 3UBLA 1T3BA 1K0DA 3QAGA 3P2AA 3CXGA 4O5RA 1PA3A 3MWHA 4WKWA 3CRUA 4BIKA 2VL3A 1SKSB 2L5LA 4MPGA 3BJ5A 5J41A 1WE0A 5IMVA 1WWJA 3TKSE 5AIXA 4KH7A 2YJ7A 1YQ1A 5D93A 1JZRA 4NXIA 3RHBA 3GTUA 4KDUA 1E2YA 5CO3A 3TB2A 1GLPA 5DALB 4AKGA 2I4AA 1ZOFA 5IPGA 1K0OA 4KCAA 2C8UA 1HQOA 5BMUB 1M9AA 2GLRA 4G01A 3ME7A 4ML1A 2VUPA 1G6YA 4KGIA 3J7Yb 4EKZA 4XS6A 2B6MA 3IPZA 2LUSA 1RK4A 10GSA 2CVKA 2LNSA 2VLUA 1SK0A 5D9XA 5E59A 4AJ6A 2ZCTA 4PURA 1X5DA 3IV4A 1VRSD 2GDRA 3DGQA 7GSSA 2L6DA 3H8QA 1FVKA 1TRUA 17GSA 2NDOA 3L9UA 4DSRA 4HOJA 3O3TA 4L5LA 1M0UA 3HD5A 2WB9A 3F4TA 4Z7XA 1OKTA 4EL1A 1TOFA 2IFQA 2IL3A 3D4TA 4KUNA 4X0XA 2LS5A 4JZQA 1R5AA 4V1Ap 3TJFA 2PGTA 4IELA 5ECHB 4KSMA 6GSUA 1XBSA 3EPTA 4ZIJA 4D73A 5HQPA 1ERVA 5DCGA 2B7JA 1PL1A 2LJKA 2VM1A 2FUG2 1DE1A 3IC4A 2KOKA 1F6MC 3KH7A 3VFIA 4BPYA 3KTLA 3KIJA 1X9SB 3GSSA 4IQAA 3RDWA 1GTAA 3VWVA 4AKHA 2JSYA 1JZOA 1EGRA 1YY7A 3FEUA 4J57E 1TI1A 2H66A 4HI7A 4ICYA 2IMEA 1Y6EA 3MDKA 4ZILA 3GKKA 2EFCA 4OO5A 4AGSA 4PTSA 2EIRA 2YV9A 1M2DA 2R6KA 1YF1A 3IRAA 5AGYA 3L78A 3Q18A 4Q5QA 2C0DA 1EOHA 1A8YA 2WW3A 4G0KA 1U87A 2DLXA 1O8WA 5HR2A 2GZPA 2IMFA 2HSYA 2GT6A 1GSQA 4RI7A 5HR0A 4DVCA 2P0GA 5EY6A 3F8UA 4HUAA 2B1LA 4YKGA 3GRXA 4ZB7A 4ECBA 4G9HA 2LKUA 1FG4A 4PUAA 1JZWA 2X4AA 4EVMA 1GSFA 2AHEA 1YVLA 2P5QA 1XVWA 2MYGA 1TI3A 3FZAA 1J0FA 5AISA 3EINA 4PX1A 1N8JA 1B8XA 4J2FA 4JBBA 2H01A 1NM3A 1TRSA 4K5RA 5L71A 3F6DA 4ZB9A 4D73B 4K0GA 1ZYQB 1AQXA 4JEDA 1TKDB 2H1LA 3SBCA 5IOXA 3TOUA 3RFRC 1BYEA 4HZ2A 3EU4A 5CP1A 3TUEA 2HNLA 2LEGA 4WBRD 3DD3A 1H75A 3GHAA 1QQ2A 2MZCA 2OE1A 3Q74A 1PFOA 4USSA 2QSIA 4PQHA 3CYNA 3G9BA 4NWYA 3DVWA 1ZCPA 4WF4A 3ZIVA 3KM6A 2HSNA 2OBKA 2PN8A 1SVMA 3F3RA 4OFMA 2H72A 9GSSA 1XG8A 4Q5NA 2LV3A 5AN1A 1R5PA 4HQSA 3ISOA 3EMXA 5F06A 2M80A 4IVFA 4X43A 1W89A 2B7KA 2TRCP 3IDVA 5J9CA 4KDXA 1GULA 4K7NA 1VF3A 5ELGA 1F9MA 2C3TA 1XPVA 2MMOA 4WEYA 4TR4A 2VD0A 1AXDA 4ZB8A 4ML6A 3GX0A 5CNWA 1BG5A 1GUMA 2FA4A 4KB3A 3WGXA 2F51A 3GURA 3I9V2 4F0CA 1ML6A 2DSAA 4IP6A 3O76A 4CHSA 3WGDA 1PQNA 1WPIA 1K0NA 3US3A 2HQTA 1XW5A 2CVBA 5LCZA 5DQSA 3UVHA 2VO4A 3TCOA 1MTCA 1XWKA 3WYWA 3Q19A 2AB6A 1EEJA 2K8SA 3H79A 5DBQA 3GH9A 1WJKA 2VOCA 1QUWA 1T00A 2X8GA 3HYPA 4Q5RA 5IMZA 2HRNA 3GN3A 1HNBA 4OCFA 3ZZXA 3LG6A 5D73A 4X1UA 2OACA 5ECIB 3FRCA 4IN0A 2HSNB 2RUFA 4RUVA 3QFBC 1M9BA 2WDUA 4BWQA 1VF2A 5ECKB 5DCHA 2JZRA 4YQMA 3KZQA 1O81A 1GSDA 4EUYA 4TR0A 2VL2A 1HD2A 3GIXA 2V6OA 4IS0A 2WZSA 3H4KA 2X49A 2EFHA 3DKSA 4HDEA 5F05A 4NHWA 3U5RE 3ZRDA 2TRXA 4N11A 4G0IA 3W8SA 5COHA 1TXUA 1X9WB 3QD9A 4BVYA 2YWIA 5ECSA 1ZYNA 4CW9A 1ST9A 2V32A 4MJBA 3QAVA 5ABRA 2I81A 1JZDA 3UARA 1K3OA 1SYRA 2MBSA 4GCIA 5C00A 3VPTA 2EC4A 4KE3A 1OC9B 4L8EA 2C0FA 5EL8A 3G7JA 3CTFA 3O6TA 1UC7A 4XIHA 4J56E 3LXZA 4ZXGA 4AI6A 1S3AA 3D5JA 1A2LA 16GSA 3D0ZA 1RW1A 2VCVA 5JWQB 3AY8A 2VCQA 2IMIA 2GVPA 1ABAA 1V58A 5A34A 1PGTA 4YQVA 4KNDA 1DSBA 5B8BA 4I2TA 3ZVJD 1GH2A 2XPDA 4KF9A 1U3IA 4ID0A 4NV5A 1DBYA 3FMWA 4ECIA 1U6TA 5ECNB 4MJEA 5ECOB 2O7KA 3I6AA 4CY6A 2M72A 2YN1A 3GNJA 2P31A 4I2UA 4KA0A 1AQVA 1EGOA 1Z6NA 5DJLA 2L59A 4OMVA 1Y25A 3N9JA 3SWLA 4G10A 1QFNA 4PNGA 2VL2C 5IQYA 4NPBA 1GRXA 3LFLA 1VGLA 5F8BA 2CQ9A 5DAKA 3GA4A 3UEMA 1FHEA 3JCML 5IMCA 1XWBA 1FVJA 2DJ1A 1V57A 1Q4JA 2AYTA 3A3TA 4G19A 5HFGA 3C8EA 1S3RA 4BVYB 2H0IA 1A8LA 2C0GA 3CHXC 3HKRA 2KUCA 2OADA 2AJQB 2JZSA 3CSIA 5INYA 4F03A 3DYRA 1F3AA 2PMTA 3HXSA 1XWCA 2DJ0A 1K0CA 1Z7PA 2H76A 4OFNA 3ZFBA 2K6VA 4Z2UA 2GGTA 3UMAA 4K5SA 2RIIA 1OE8A 1WOUA 1AIUA 4HS1A 2LRCA 12GSA 1NW2A 3EU3A 3WT2A 1YKCA 2I9HA 5DQYA 4OD7A 1GSUA 3VURA 3HMJG 1WMJA 3GFKA 3ME8A 4HU7A 5A34B 3QMXA 5G1LA 3IAS2 4DEJA 3KH9A 1HYUA 4TR3A 1A0FA 4HJ2A 5JCWA 14GSA 4IJIA 1XXUA 1EWXA 1K0BA 1R26A 2R0PA 1WIKA 2H30A 5IMAA 2WGRA 5B6NA 2DMMA 2L5OA 4EDYA 2WZ9A 1MD3A 3RBTA 5IO2A 3BBYA 2K18A 2PVQA 4K1FA 4GSTA 2HI7A 1SD9A 1URMA 4NAXA 2F3MA 3H1NA 4Z2TA 3LEFA 3LYPA 2JU5A 2QA1A 3TGZA 2HZEA 3BCKA 3KMNA 3VI7A 4BA7A 4CY8A 5B7CA 3DWVA 4QQ7A 2H6YA 3RPNA 2WS2A 2WJUA 5D9VA 2JADA 3LW9A 1X0RA 1MDJA 2DIZA 4QL7A 4BWSA 1A24A 1EEMA 18GSA 4BVXA 5IMDA 2OJLA 3FY7A 3GKNA 2PU9C 1M3IA 5A4UA 2AUVA 1YKAA 3LYKA 2JSZA 1YJ6A 1PD21 4KDYA 6GSXA 3M8NA 4AKIA 5CRWA 1X5CA 2CZ3A 5HR1A 4TRXA 3KEBA 4TXVA 4L0WA 2HE3A 3GKMA 2WW1A 2HSMA 1FOHA 1KTEA 1EZKA 5CREA 1XOBA 3I69A 2GQLA 3TKPA 5IPHA 1LBKA 4G0LA 1M2BA 3J7Yk 3PINA 2PERA 2JZTA 5KN3A 5A4WA 4XRAA 4K2XA 5IM9A 5G5FA 1S3CA 2XPEA 3BCIA 4GF0A 4JR4A 2LSTA 2Z9SA 3EYTA 4IJ3A 3FYGA 2H19A 2KP2A 2LTKA 1AUCA 3GTUB 3IBHA 1SL1B 4PUFC 5IO0A 1TU7A 1PX7A 3FR6A 2E2GA 4TW5A 3N5OA 3MSZA 3M0FA 3MAKA 4WETA 3CSJA 1TK8B 4OO4A 2F9SA 1AAZA 4EIQA 2FWHA 3A2VA 4O5UA 2GQKA 3FK8A 1OYJA 4BVXB 3KTBA 3ED3A 1GTBA 4LMVA 3QCPA 4DSSA 1PX6A 3EE2A 2G0FA 2K8VA 1F2EA 4YQUA 2O5VA 4FH8A 1CQGA 4JR6A 5J5NA 2GZYA 3ZL5A 3R2QA 4H86A 5CYYA 3KP8A 3EMPA 3DRNA 3IOSA 3RHCA 4MP4A 2A2PA 2YZHA 4XS1A 3L4NA 2DBCA 4MNNA 4LA1A 4GQFA 2J9HA 2IFQB 3UIWA 3WT1A 2HSMB 1O6JA 4N3ZA 1GSYA 2MMAA 1BJXA 5DDLA 1U88A 4FQUA 2O85A 3ZITA 4PQIA 3VK9A 1JLWA 2FGXA 3IK9A 4AKXB 5HR3A 4MF5A 1O73A 5E4WA 1HNCA 4MCUA 3HDCA 3LQ7A 4ZL9A 5ECMB 2FWFA 3QPMA 2GQMA 3W6GA 4Q5FA 1O8XA 5ENUA 1JHBA 5JCUA 2GZZA 4GQCA 2A2SA 5ELAA 2V6KA 3HJOA 5GAND 5ID2A 4AJ7A 1THOA 3CBUA 2YV7A 5G30A 2OKAA 1USBA 3TKSA 3WD6A 2XC2A 4Z2RA 4P3YB 4L5OA 2K9FA 5J47A 1TW9A 2NVLA 4MF7A 22GSA 2MBTA 5H5RA 4HEA2 4RI6A 2LQQA 4GXZA 3KJYA 2C80A 5D9TA 3TU3B 3HVVA 4PGTA 2J23A 3LGCA 3EC3A 1G7EA 3KMOA 4I6XA 3R3EA 4F0BA 4E68A 3UOMA 4L0UA 2IJYA 4MA9A 1A2MA 1XOAA 1DE2A 1Z3EA 2HFDA 3VWWA 2GT5A 4IQ1A 1PRXA 2HXKA 4A5PA 3C7MA 3TJGA 2B5XA 2H1AA 3D4MA 5J4UA 3G7IA 4MH3A 1FO5A 3L9VA 5F07A 3KD0A 1M3JA 1EV9A 2OT3A 3TKQA 4KSOA 3F63A 3Q6OA 11GSA 1NSWA 3HJMA 4IP1A 1VF1A 3C1RA 1ERWA 3C1SA 1Z6MA 3ZFLA 3GH6A 3E0UA 1B4PA 3QFAC 13GSA 3LSZA 1TRVA 4TR1A 2VLTA 2HRFA 5J3RA 1Z9HA 2R3XA 1O7UA 2AV4A 2L57A 1TXXA 2FWEA 1EP7A 3PGTA 2BTOT 2H70A 3KXOA 2ALBA 2YWMA 2N5FA 3G7YA 4HSCX 4OWYA 3TJKA 2CX3A 3CTGA 4N0VA 2DJJA 1CQHA 2V41A 2X8CA 5ID2B 1H4OA 3TKSC 4F82A 2R5GA 1OE7A 2GSRA 5GSSA 6GSWA 4IKHA 3TJBA 2WW2A 2HT9A 2YNXA 4POLA 5G31A 1PKZA 2AAWA 4I97A 2VCZA 3QOUA 3U6VA 1N25A 6GSYA 3UAPA 3DMLA 3MYDA 5KN1A 2TIRA 1IYIA 3IAM2 2DIYA 1EOGA 1GSSA 3LJRA 2WFCA 4QL9A 2WRTA 4MPFA 1A23A 1SL0B 1SL2B 2JL4A 2ON7A 3IA1A 1GTUA 2QGVA 4TXOA 3I43A 1OC8A 2IN3A 2B3SA 3A2XA 1B4QA 2LNTA 3ZTLA 1T8EB 4V2MA 2H0GA 4BL7A 5IOWA 5JCGA 1XW9A 3CRTA 3ZREA 2NTOA 4LL4B 2RUEA 2H74A 1QGVA 4MABA 2GSTA 2HRKA 3CQFA 2FHEA 2M46A 3A2WA 2HYXA 3WGEA 2I1UA 1WP0A 3MNGA 1F37A 3IHQA 3F4RA 5D8IA 4XHMA 1YZXA 1GTIA 2CAIA 1ILOA 1BEDA 1KEBA 1YF0A 1TK0B 2O36A 1I1IP 4O92A 2CV4A 1GP1A 4HU9A 2FA8A 1W4VA 2RM6A 2YWOA 3HY2A 1MDKA 4F9ZA 1TJDA 3ZVJA 3EURA 4WBJA 2VIMA 1AW9A 2C3NA 4KX4A 1LJRA 3CSHA 2A4HA 3DEXA 4HJMA 2DJ2A 2CA8A 1AC1A 2RM5A 1SKRB 2H1GA 1HNAA 2YWNA 1QXHA 2EIQA 3V1WA 3KCMA 2G2QA 3VI5A 1E6BA 2H71A 1V9WA 1JLVA 1V2AA 2WVYA 2DJ3A 1XW6A 1C72A 5DJMA 4W66A 1ZYEA 2H0HA 2H1BA 3ZYWA 3APQA 4WF5A 1BX9A 1S4BP 2NPBA 1K3LA 4MLYA 1SVLA 2L6CA 1FB6A 3TKRA 2H6XA 5DALA 3QAWA 2HRKB 5BMUA 1SKWB 2GS3A 4E8EA 1ZYPA 3TDGA 1V98A 5KN2A 6GSSA 2FD3A 2IMDA 2XHFA 4MJAA 3DIEA 3GV1A 3EVIA 3D22A 2YZUA 3NOFA 5CRGA 1TU8A 4YAPA 1TK5B 5FT3A 1LU4A 3UL3A 5ECRB 4XS4A 3LXTA 2OBIA 3P7XA 1I9DA 4WXTA 4MZWA 4PI2C 2ZNMA 1MD4A 2ZUPA 3F4SA 4ISDA 1J08A 6GSTA 5DAKB 5D9WA 1V40A 4POKA 5BRTA 2DC5A 1SD8A 4FYBA 2HRAA 4XTSA 2PUKC 1ON4A 1ERTA 3RPPA 2YANA 6GSVA 5D96A 20GSA 1MDIA 4IBPA 5A5KA 1M2AA 1F3BA 1ZMAA 3E9JB 5CRHA 1PN9A 5GAPD 3RAZA 4MZBA 2VCXA 4PI0C 3HVXA 4ZBAA 4ACSA 4ZL7A 3K8NA 2OA7A 5J9BA 1ZZYA 4MMMA 3FR9A 2LRTA 2R37A 1QK8A 3FKFA 4GLTA 2N5AA 2VM2A 3M9KA 3W8JA 2B5EA 2CVDA 4G2EA 1XWAA 2UZ8A 2KHPA 5H5SA 1K3YA 1X5EA 4EXJA 1T4YA 1ERUA 4MZCA 2IIYA 5LNKe 2WULA 2E0QA 3TOTA 3FZ9A 4XS4B 4WR5A 1YEXA 2H73A 4LLRA 5ECLB 4POBA 2WW0A 4V1Ag 4TN8A 5FHIA 5LD0A 4KW6A 3PR8A 2YOIA 5J4VA 3M3MA 3QDNA 1T1VA 1UN2A 3GSTA 2IMKA 4F2IA 3HA9A 4O7HA 4MK3A 1XIYA 2X99A 3E3EA 1IYHA 1FB0A 2HZEB 2L4QA 4MF6A 2O89A 2O8VB 2OE3A 1KNGA 1X9MB 3DXBA 1FOVA 5IMFA 1ZGNA 4K9ZA 2B1KA 1NHYA 1XWGA 1J9BA 3ZMLA 1QMVA 2KLXA 1B9YC 2CZ2A 1G0TA 3TJJA 3H93A 1EP8A 1WRYA 1PN0A 1AQWA 4FIWA 3ERFA 4TKYA 2VKZG 1XVQA 1B48A 1VF4A 4K7OA 3LORA 2FY6A 3ZMKA 1U3AA 3GKXA 3S9FA 4PNFA 5EPFA 4NMUA 5A1NA 1BQ7A 2R0GA 3VWXA 2BJXA 2KP1A 3TRPA 1GLQA 2YJHA 3EWLA 4NHZA 2LQOA 1SU9A 2B5YA 4GSNA 2VD1A 2L4CA 2O3EA 3C73A 2E2MA 4YKFA 1YDKA 2YPMA 2YCDA 1O85A 2EIOA 2DJKA 1TRWA 1DUGA 5HFKA 19GSA 2QC7A 5KEJA 4RQRA 1TDIA 5DVBA 4K2DA 1YEWC 3IR4A 2VCWA 1ZL9A 2E7PA 1R4WA 4GWRA 4O32A 3FZ4A 4ILFA 1GL8A 2C3QA 1Z5YE 2VCTA 1SJIA 1GUKA 4GDFA 2XBIA 5F0GA 4E8HA 3NZNA 4PHZC 4N0ZA 3LWAA 4V2LA 4NV2A 1K0AA 4QMKA 3ZLPA 4DSSB 5FWGA 3D21A 3FZ5A 2VLVA 2CT6A 1OKDA 5H5QA 2QA2A 5JWRB 1R7HA 2LJAA 3F9UA 4TOPA 5G5EA 4EIPA 1GUHA 5A5HA 4ZL8A 2D2ZA 2WVZA 3F6FA 2DKIA 3HHVA 1SJZA 3A5IA 2WVXA 4EF0A 5A1NB 4K0NA 4LMWA 3IHGA 1PKWA 1I5GA 3IK7A 3ERGA 8GSSA 2EFEA 1OAZA 1PL2A 1GSEA 2FCHA 3APOA 5G1KA 1SK1A 1OVNA 3UBKA 3MIXA 4ZBDA 1ACVA 5GZZB 5J40A 4FO5A 4LL1B 5ECPB 4I8BA 4WR4A 4O5QA 4YAVA 3IXRA 5KOXA 1Q98A 1THXA 4EDZA 2LRNA
chains in the Genus database with same CATH topology
4GRFA 4K8MA 3NIVA 1OC9A 3IE3A 4FYUA 1M99A 4MDCA 1SJ6A 2MMZA 1YEPA 3A5WA 3UVTA 4MH2A 4XCSA 3PPUA 1S3DA 3L9SA 5KOWA 2BMXA 4POMA 3GL3A 4HQZA 5B8AA 2PBJA 2A2RA 2ES7A 2IPAA 3APSA 1GNWA 3OR5A 5A5HB 5J4YA 3GL5A 4N30A 1TTZA 4KCEA 2R4VA 2F8AA 1FW1A 2FNOA 1K0MA 2V2GA 3BD2A 3GX8A 3DVXA 2I3YA 1Y1UA 2JACA 1G7OA 1UVZA 3M9JA 3FR3A 2MMNA 1FAAA 1M7TA 1B9XC 3VWUA 2XBQA 2QKEA 1NHOA 4JRRA 5ECQB 4DSQA 4N10A 1BAYA 1SENA 4EC0A 2CAQA 1GNEA 3TRXA 1XFLA 5CRDA 4KAEA 1JFUA 3GUSA 1G6WA 1GWCA 3PH9A 5IIZA 2HSHA 2H75A 4TR1B 4ECJA 3F3QA 5A4VA 3KP9A 3IC8A 3P8WA 2HZFA 1T7PB 2YP6A 4EE0A 1RQMA 2C4JA 2FWGA 2DMLA 5JWOB 2CX4A 3L0HA 2GSSA 1OC3A 1T4ZA 3CWGA 2H6ZA 2PPTA 1PMTA 1A0RP 4V2NA 1SYXA 2VAFA 3HZ8A 4XRDA 4X4JA 5C04A 2EFDA 4PQ1A 5AIVA 4FYCA 4RQXA 2HLSA 4ECCA 3C71A 2C0EA 2ON5A 3D6IA 3UJ1A 5CAXA 1EV4A 2DKHA 2R0CA 5KN0A 4JE1A 2P5RA 4AF2A 1Z7RA 2H8LA 2R2JA 2RLIA 3QR6A 1A2JA 2LJRA 3VLNA 3GMFA 4TVEA 4AJ8A 4TXOB 3M1GA 2X8HA 3HZ4A 2F8FA 2PWJA 3VPQA 3ZIJA 3F0IA 4IHUA 4ZB6A 4MJCA 4HZ4A 1KBNA 1PSQA 2VL9A 4BL7B 2UV8G 4IGJA 3HCZA 4JU5A 3HJPA 2X64A 2WCIA 3CMIA 1MEKA 1XCCA 2FLSA 1UA5A 2NBSA 5HFIA 2OE0A 2V1MA 5B6MA 2PVOC 4GTUA 4IW9A 1TP9A 2H1DA 3P90A 3KGKA 4CDOA 2IWTA 1N2AA 3BOAA 3FW2A 1BF5A 2O87A 2A4VA 3TRQA 2GSQA 4YH2A 5GSTA 3ERWA 4ULXA 3GYKA 4ZBBA 4OFTA 4K6XA 1BG1A 4EO3A 3HVSA 4PXOA 2N5BA 1XZOA 2REMA 4OCEA 1SVOA 3FHKA 4K7IA 5G2ZA 2GTUA 1SK2A 2C1YA 4GSSA 4I5QA 5EVOA 3UBLA 1T3BA 1K0DA 3QAGA 3P2AA 3CXGA 4O5RA 1PA3A 3MWHA 4WKWA 3CRUA 2VL3A 1SKSB 2L5LA 4MPGA 3BJ5A 5J41A 1WE0A 5IMVA 1WWJA 3TKSE 5AIXA 4KH7A 2YJ7A 1YQ1A 5D93A 1JZRA 4NXIA 3RHBA 3GTUA 4KDUA 1E2YA 5CO3A 3TB2A 1GLPA 5DALB 4AKGA 2I4AA 1ZOFA 5IPGA 1K0OA 4KCAA 2C8UA 1HQOA 5BMUB 1M9AA 2GLRA 4G01A 3ME7A 4ML1A 2VUPA 1G6YA 4KGIA 3J7Yb 4EKZA 4XS6A 2B6MA 3IPZA 1RK4A 10GSA 2CVKA 2LUSA 2LNSA 2VLUA 1SK0A 5D9XA 5E59A 4AJ6A 2ZCTA 4PURA 1X5DA 3IV4A 1VRSD 2GDRA 3DGQA 7GSSA 2L6DA 3H8QA 1FVKA 1TRUA 17GSA 2NDOA 3L9UA 4DSRA 4HOJA 3O3TA 4L5LA 1M0UA 3HD5A 2WB9A 3F4TA 4Z7XA 1OKTA 4EL1A 1TOFA 2IFQA 2IL3A 3D4TA 4KUNA 4X0XA 2LS5A 4JZQA 1R5AA 4V1Ap 3TJFA 2PGTA 4IELA 5ECHB 4KSMA 6GSUA 1XBSA 3EPTA 4ZIJA 4D73A 5HQPA 1ERVA 5DCGA 2B7JA 1PL1A 2LJKA 2VM1A 2FUG2 1DE1A 3IC4A 2KOKA 1F6MC 3KH7A 3VFIA 4BPYA 3KTLA 3KIJA 1X9SB 3GSSA 4IQAA 3RDWA 1GTAA 3VWVA 4AKHA 2JSYA 1JZOA 1EGRA 1YY7A 3FEUA 4J57E 1TI1A 2H66A 4HI7A 4ICYA 2IMEA 1Y6EA 3MDKA 4ZILA 3GKKA 2EFCA 4OO5A 4AGSA 4PTSA 2EIRA 2YV9A 1M2DA 2R6KA 1YF1A 3IRAA 5AGYA 3L78A 3Q18A 4Q5QA 2C0DA 1EOHA 1A8YA 4G0KA 1U87A 2DLXA 1O8WA 5HR2A 2GZPA 2IMFA 2HSYA 2GT6A 1GSQA 4RI7A 5HR0A 4DVCA 2P0GA 5EY6A 3F8UA 4HUAA 2B1LA 4YKGA 3GRXA 4ZB7A 4ECBA 4G9HA 2LKUA 1FG4A 4PUAA 1JZWA 2X4AA 4EVMA 1GSFA 2AHEA 1YVLA 2P5QA 1XVWA 2MYGA 1TI3A 3FZAA 1J0FA 5AISA 3EINA 4PX1A 1N8JA 1B8XA 4J2FA 4JBBA 2H01A 1NM3A 1TRSA 4K5RA 5L71A 3F6DA 4ZB9A 4D73B 4K0GA 1ZYQB 1AQXA 4JEDA 1TKDB 2H1LA 3SBCA 5IOXA 3TOUA 1BYEA 4HZ2A 3EU4A 5CP1A 3TUEA 2HNLA 2LEGA 4WBRD 3DD3A 1H75A 3GHAA 1QQ2A 2MZCA 2OE1A 3Q74A 2QSIA 4USSA 4PQHA 3CYNA 3G9BA 4NWYA 3DVWA 1ZCPA 4WF4A 3ZIVA 3KM6A 2HSNA 2OBKA 2PN8A 1SVMA 3F3RA 4OFMA 2H72A 9GSSA 4Q5NA 2LV3A 5AN1A 1R5PA 4HQSA 3ISOA 3EMXA 5F06A 2M80A 4IVFA 4X43A 1W89A 2B7KA 2TRCP 3IDVA 5J9CA 4KDXA 1GULA 4K7NA 1VF3A 5ELGA 1F9MA 2C3TA 1XPVA 2MMOA 4WEYA 4TR4A 2VD0A 1AXDA 4ZB8A 4ML6A 3GX0A 5CNWA 1BG5A 1GUMA 2FA4A 4KB3A 3WGXA 2F51A 3GURA 3I9V2 4F0CA 1ML6A 2DSAA 4IP6A 3O76A 4CHSA 3WGDA 1PQNA 1WPIA 1K0NA 3US3A 2HQTA 1XW5A 2CVBA 5LCZA 5DQSA 3UVHA 2VO4A 3TCOA 1MTCA 1XWKA 3WYWA 3Q19A 2AB6A 1EEJA 2K8SA 3H79A 5DBQA 3GH9A 1WJKA 2VOCA 1QUWA 1T00A 2X8GA 3HYPA 4Q5RA 5IMZA 2HRNA 3GN3A 1HNBA 4OCFA 3ZZXA 3LG6A 5D73A 4X1UA 2OACA 5ECIB 3FRCA 4IN0A 2HSNB 2RUFA 4RUVA 3QFBC 1M9BA 2WDUA 4BWQA 1VF2A 5ECKB 5DCHA 2JZRA 4YQMA 3KZQA 1O81A 1GSDA 4EUYA 4TR0A 2VL2A 1HD2A 3GIXA 2V6OA 4IS0A 3H4KA 2X49A 2EFHA 3DKSA 4HDEA 5F05A 4NHWA 3U5RE 3ZRDA 2TRXA 4N11A 4G0IA 3W8SA 5COHA 1TXUA 1X9WB 3QD9A 4BVYA 2YWIA 5ECSA 1ZYNA 4CW9A 1ST9A 2V32A 4MJBA 3QAVA 5ABRA 2I81A 1JZDA 3UARA 1K3OA 1SYRA 2MBSA 4GCIA 5C00A 3VPTA 2EC4A 4KE3A 1OC9B 4L8EA 2C0FA 5EL8A 3G7JA 3CTFA 3O6TA 1UC7A 4XIHA 4J56E 3LXZA 4ZXGA 4AI6A 1S3AA 3D5JA 1A2LA 16GSA 3D0ZA 1RW1A 2VCVA 5JWQB 3AY8A 2VCQA 2IMIA 2GVPA 1ABAA 1V58A 5A34A 1PGTA 4YQVA 4KNDA 1DSBA 5B8BA 4I2TA 3ZVJD 1GH2A 2XPDA 4KF9A 1U3IA 4ID0A 4NV5A 1DBYA 3FMWA 4ECIA 1U6TA 5ECNB 4MJEA 5ECOB 2O7KA 3I6AA 4CY6A 2M72A 2YN1A 3GNJA 2P31A 4I2UA 4KA0A 1AQVA 1EGOA 1Z6NA 5DJLA 2L59A 4OMVA 1Y25A 3N9JA 3SWLA 4G10A 1QFNA 4PNGA 2VL2C 5IQYA 4NPBA 1GRXA 3LFLA 1VGLA 5F8BA 2CQ9A 5DAKA 3GA4A 3UEMA 1FHEA 3JCML 5IMCA 1XWBA 1FVJA 2DJ1A 1V57A 1Q4JA 2AYTA 3A3TA 4G19A 5HFGA 3C8EA 4BVYB 2H0IA 1A8LA 2C0GA 3HKRA 2KUCA 2OADA 2AJQB 2JZSA 3CSIA 5INYA 4F03A 3DYRA 1F3AA 2PMTA 3HXSA 1XWCA 2DJ0A 1K0CA 1Z7PA 2H76A 4OFNA 3ZFBA 2K6VA 4Z2UA 2GGTA 3UMAA 4K5SA 2RIIA 1OE8A 1WOUA 1AIUA 4HS1A 2LRCA 12GSA 1NW2A 3EU3A 3WT2A 1YKCA 2I9HA 5DQYA 4OD7A 1GSUA 3VURA 3HMJG 1WMJA 3GFKA 3ME8A 4HU7A 5A34B 3QMXA 5G1LA 3IAS2 4DEJA 3KH9A 1HYUA 4TR3A 1A0FA 4HJ2A 5JCWA 14GSA 4IJIA 1XXUA 1EWXA 1K0BA 1R26A 2R0PA 1WIKA 2H30A 5IMAA 2WGRA 5B6NA 2DMMA 2L5OA 4EDYA 2WZ9A 1MD3A 3RBTA 5IO2A 3BBYA 2K18A 2PVQA 4K1FA 4GSTA 2HI7A 1SD9A 1URMA 4NAXA 2F3MA 3H1NA 4Z2TA 3LEFA 3LYPA 2JU5A 2QA1A 3TGZA 2HZEA 3BCKA 3KMNA 3VI7A 4BA7A 4CY8A 5B7CA 3DWVA 4QQ7A 2H6YA 3RPNA 2WS2A 2WJUA 5D9VA 2JADA 3LW9A 1X0RA 1MDJA 2DIZA 4QL7A 4BWSA 1A24A 1EEMA 18GSA 4BVXA 5IMDA 2OJLA 3FY7A 3GKNA 2PU9C 5A4UA 2AUVA 1YKAA 3LYKA 2JSZA 1YJ6A 1PD21 4KDYA 6GSXA 3M8NA 4AKIA 5CRWA 1X5CA 2CZ3A 5HR1A 4TRXA 3KEBA 4TXVA 4L0WA 2HE3A 3GKMA 2HSMA 1FOHA 1KTEA 1EZKA 5CREA 1XOBA 3I69A 2GQLA 3TKPA 5IPHA 1LBKA 4G0LA 1M2BA 3J7Yk 3PINA 2PERA 2JZTA 5KN3A 5A4WA 4XRAA 4K2XA 5IM9A 5G5FA 1S3CA 2XPEA 3BCIA 4GF0A 4JR4A 2LSTA 2Z9SA 3EYTA 4IJ3A 3FYGA 2H19A 2KP2A 2LTKA 1AUCA 3GTUB 3IBHA 1SL1B 4PUFC 5IO0A 1TU7A 1PX7A 3FR6A 2E2GA 4TW5A 3N5OA 3MSZA 3M0FA 3MAKA 4WETA 3CSJA 1TK8B 4OO4A 2F9SA 1AAZA 4EIQA 2FWHA 3A2VA 4O5UA 2GQKA 3FK8A 1OYJA 4BVXB 3KTBA 3ED3A 1GTBA 4LMVA 3QCPA 4DSSA 1PX6A 3EE2A 2G0FA 2K8VA 1F2EA 4YQUA 2O5VA 4FH8A 1CQGA 4JR6A 5J5NA 2GZYA 3ZL5A 3R2QA 4H86A 5CYYA 3KP8A 3EMPA 3DRNA 3IOSA 3RHCA 4MP4A 2A2PA 2YZHA 4XS1A 3L4NA 2DBCA 4MNNA 4LA1A 4GQFA 2J9HA 2IFQB 3UIWA 3WT1A 2HSMB 1O6JA 4N3ZA 1GSYA 2MMAA 1BJXA 5DDLA 1U88A 4FQUA 2O85A 3ZITA 4PQIA 3VK9A 1JLWA 2FGXA 3IK9A 4AKXB 5HR3A 4MF5A 1O73A 5E4WA 1HNCA 4MCUA 3HDCA 3LQ7A 4ZL9A 5ECMB 2FWFA 3QPMA 2GQMA 3W6GA 4Q5FA 1O8XA 5ENUA 1JHBA 5JCUA 2GZZA 4GQCA 2A2SA 5ELAA 2V6KA 3HJOA 5GAND 5ID2A 4AJ7A 1THOA 3CBUA 2YV7A 5G30A 2OKAA 1USBA 3TKSA 3WD6A 2XC2A 4Z2RA 4P3YB 4L5OA 2K9FA 5J47A 1TW9A 2NVLA 4MF7A 22GSA 2MBTA 5H5RA 4HEA2 4RI6A 2LQQA 4GXZA 3KJYA 2C80A 5D9TA 3TU3B 3HVVA 4PGTA 2J23A 3LGCA 3EC3A 1G7EA 3KMOA 4I6XA 3R3EA 4F0BA 4E68A 3UOMA 4L0UA 2IJYA 4MA9A 1A2MA 1XOAA 1DE2A 1Z3EA 2HFDA 3VWWA 2GT5A 4IQ1A 1PRXA 2HXKA 4A5PA 3C7MA 3TJGA 2B5XA 2H1AA 3D4MA 5J4UA 3G7IA 4MH3A 1FO5A 3L9VA 5F07A 3KD0A 1EV9A 2OT3A 3TKQA 4KSOA 3F63A 3Q6OA 11GSA 1NSWA 3HJMA 4IP1A 1VF1A 3C1RA 1ERWA 3C1SA 1Z6MA 3ZFLA 3GH6A 3E0UA 1B4PA 3QFAC 13GSA 3LSZA 1TRVA 4TR1A 2VLTA 2HRFA 5J3RA 1Z9HA 2R3XA 1O7UA 2AV4A 2L57A 1TXXA 2FWEA 1EP7A 3PGTA 2BTOT 2H70A 3KXOA 2ALBA 2YWMA 2N5FA 3G7YA 4OWYA 3TJKA 2CX3A 3CTGA 4N0VA 2DJJA 1CQHA 2V41A 2X8CA 5ID2B 1H4OA 3TKSC 4F82A 2R5GA 1OE7A 2GSRA 5GSSA 6GSWA 4IKHA 3TJBA 2HT9A 2YNXA 4POLA 5G31A 1PKZA 2AAWA 4I97A 2VCZA 3QOUA 3U6VA 1N25A 6GSYA 3UAPA 3DMLA 3MYDA 5KN1A 2TIRA 1IYIA 3IAM2 2DIYA 1EOGA 1GSSA 3LJRA 2WFCA 4QL9A 2WRTA 4MPFA 1A23A 1SL0B 1SL2B 2JL4A 2ON7A 3IA1A 1GTUA 2QGVA 4TXOA 3I43A 1OC8A 2IN3A 2B3SA 3A2XA 1B4QA 2LNTA 3ZTLA 1T8EB 4V2MA 2H0GA 4BL7A 5IOWA 5JCGA 1XW9A 3CRTA 3ZREA 2NTOA 4LL4B 2RUEA 2H74A 1QGVA 4MABA 2GSTA 2HRKA 2FHEA 2M46A 3A2WA 2HYXA 3WGEA 2I1UA 1WP0A 3MNGA 1F37A 3IHQA 3F4RA 5D8IA 4XHMA 1YZXA 1GTIA 2CAIA 1ILOA 1BEDA 1KEBA 1YF0A 1TK0B 4O92A 2CV4A 1GP1A 4HU9A 2FA8A 1W4VA 2RM6A 2YWOA 3HY2A 1MDKA 4F9ZA 1TJDA 3ZVJA 3EURA 4WBJA 2VIMA 1AW9A 2C3NA 4KX4A 1LJRA 3CSHA 2A4HA 3DEXA 4HJMA 2DJ2A 2CA8A 1AC1A 2RM5A 1SKRB 2H1GA 1HNAA 2YWNA 1QXHA 2EIQA 3V1WA 3KCMA 2G2QA 3VI5A 1E6BA 2H71A 1V9WA 1JLVA 1V2AA 2DJ3A 1XW6A 1C72A 5DJMA 4W66A 1ZYEA 2H0HA 2H1BA 3ZYWA 3APQA 4WF5A 1BX9A 2NPBA 1K3LA 4MLYA 1SVLA 2L6CA 1FB6A 3TKRA 2H6XA 5DALA 3QAWA 2HRKB 5BMUA 1SKWB 2GS3A 4E8EA 1ZYPA 3TDGA 1V98A 5KN2A 6GSSA 2FD3A 2IMDA 2XHFA 4MJAA 3DIEA 3GV1A 3EVIA 3D22A 2YZUA 3NOFA 5CRGA 1TU8A 4YAPA 1TK5B 5FT3A 1LU4A 3UL3A 5ECRB 4XS4A 3LXTA 2OBIA 3P7XA 1I9DA 4WXTA 4MZWA 2ZNMA 1MD4A 2ZUPA 3F4SA 4ISDA 1J08A 6GSTA 5DAKB 5D9WA 1V40A 4POKA 5BRTA 2DC5A 1SD8A 4FYBA 2HRAA 4XTSA 2PUKC 1ON4A 1ERTA 3RPPA 2YANA 6GSVA 5D96A 20GSA 1MDIA 4IBPA 5A5KA 1M2AA 1F3BA 1ZMAA 3E9JB 5CRHA 1PN9A 5GAPD 3RAZA 4MZBA 2VCXA 3HVXA 4ZBAA 4ACSA 4ZL7A 3K8NA 2OA7A 5J9BA 1ZZYA 4MMMA 3FR9A 2LRTA 2R37A 1QK8A 3FKFA 4GLTA 2N5AA 2VM2A 3M9KA 3W8JA 2B5EA 2CVDA 4G2EA 1XWAA 2UZ8A 2KHPA 5H5SA 1K3YA 1X5EA 4EXJA 1T4YA 1ERUA 4MZCA 2IIYA 5LNKe 2WULA 2E0QA 3TOTA 3FZ9A 4XS4B 4WR5A 1YEXA 2H73A 4LLRA 5ECLB 4POBA 4V1Ag 4TN8A 5FHIA 5LD0A 4KW6A 3PR8A 2YOIA 5J4VA 3M3MA 3QDNA 1T1VA 1UN2A 3GSTA 2IMKA 4F2IA 3HA9A 4O7HA 4MK3A 1XIYA 2X99A 3E3EA 1IYHA 1FB0A 2HZEB 2L4QA 4MF6A 2O89A 2O8VB 2OE3A 1KNGA 1X9MB 3DXBA 1FOVA 5IMFA 1ZGNA 4K9ZA 2B1KA 1NHYA 1XWGA 1J9BA 3ZMLA 1QMVA 2KLXA 1B9YC 2CZ2A 1G0TA 3TJJA 3H93A 1EP8A 1WRYA 1PN0A 1AQWA 4FIWA 3ERFA 4TKYA 2VKZG 1XVQA 1B48A 1VF4A 4K7OA 3LORA 2FY6A 3ZMKA 1U3AA 3GKXA 3S9FA 4PNFA 5EPFA 4NMUA 5A1NA 1BQ7A 2R0GA 3VWXA 2BJXA 2KP1A 3TRPA 1GLQA 2YJHA 3EWLA 4NHZA 2LQOA 1SU9A 2B5YA 4GSNA 2VD1A 2L4CA 3C73A 2E2MA 4YKFA 1YDKA 2YPMA 2YCDA 1O85A 2EIOA 2DJKA 1TRWA 1DUGA 5HFKA 19GSA 2QC7A 5KEJA 4RQRA 1TDIA 5DVBA 4K2DA 3IR4A 2VCWA 1ZL9A 2E7PA 1R4WA 4GWRA 4O32A 3FZ4A 4ILFA 1GL8A 2C3QA 1Z5YE 2VCTA 1SJIA 1GUKA 4GDFA 2XBIA 5F0GA 4E8HA 3NZNA 4N0ZA 3LWAA 4V2LA 4NV2A 1K0AA 4QMKA 3ZLPA 4DSSB 5FWGA 3D21A 3FZ5A 2VLVA 2CT6A 1OKDA 5H5QA 2QA2A 5JWRB 1R7HA 2LJAA 3F9UA 4TOPA 5G5EA 4EIPA 1GUHA 5A5HA 4ZL8A 2D2ZA 3F6FA 2DKIA 3HHVA 1SJZA 3A5IA 4EF0A 5A1NB 4K0NA 4LMWA 3IHGA 1PKWA 1I5GA 3IK7A 3ERGA 8GSSA 2EFEA 1OAZA 1PL2A 1GSEA 2FCHA 3APOA 5G1KA 1SK1A 1OVNA 3UBKA 3MIXA 4ZBDA 1ACVA 5GZZB 5J40A 4FO5A 4LL1B 5ECPB 4I8BA 4WR4A 4O5QA 4YAVA 3IXRA 5KOXA 1Q98A 1THXA 4EDZA 2LRNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GRF A;  4K8M A;  3NIV A;  1OC9 A;  3IE3 A;  4FYU A;  1M99 A;  4MDC A;  1SJ6 A;  2MMZ A;  1YEP A;  3A5W A;  3UVT A;  4MH2 A;  4XCS A;  3PPU A;  1S3D A;  3L9S A;  2BMX A;  4POM A;  3GL3 A;  4HQZ A;  5B8A A;  2PBJ A;  2A2R A;  2ES7 A;  2IPA A;  3APS A;  1GNW A;  3OR5 A;  3GL5 A;  4N30 A;  1TTZ A;  4KCE A;  2R4V A;  2F8A A;  1FW1 A;  2FNO A;  1K0M A;  2V2G A;  3BD2 A;  3GX8 A;  3DVX A;  2I3Y A;  2JAC A;  1G7O A;  1UVZ A;  3M9J A;  3FR3 A;  2MMN A;  1FAA A;  1M7T A;  1B9X C;  3VWU A;  2XBQ A;  2QKE A;  1NHO A;  4JRR A;  5ECQ B;  4DSQ A;  4N10 A;  1BAY A;  1SEN A;  4EC0 A;  2CAQ A;  1GNE A;  3TRX A;  1XFL A;  5CRD A;  4KAE A;  1JFU A;  3GUS A;  1G6W A;  1GWC A;  3PH9 A;  5IIZ A;  2HSH A;  2H75 A;  4TR1 B;  4ECJ A;  3F3Q A;  5A4V A;  3KP9 A;  3IC8 A;  3P8W A;  2HZF A;  1T7P B;  2YP6 A;  4EE0 A;  1RQM A;  2C4J A;  2FWG A;  2DML A;  5JWO B;  2CX4 A;  3L0H A;  2GSS A;  1OC3 A;  1T4Z A;  2H6Z A;  2PPT A;  1PMT A;  1A0R P;  4V2N A;  1SYX A;  2VAF A;  3HZ8 A;  4XRD A;  5C04 A;  4PQ1 A;  5AIV A;  4FYC A;  4RQX A;  2HLS A;  4ECC A;  3C71 A;  2C0E A;  2ON5 A;  3D6I A;  3UJ1 A;  5CAX A;  1EV4 A;  5KN0 A;  4JE1 A;  2P5R A;  4AF2 A;  1Z7R A;  2H8L A;  2R2J A;  2RLI A;  3QR6 A;  1A2J A;  2LJR A;  3VLN A;  3GMF A;  4TVE A;  4AJ8 A;  4TXO B;  3M1G A;  2X8H A;  3HZ4 A;  2F8F A;  2PWJ A;  3VPQ A;  3ZIJ A;  3F0I A;  4IHU A;  4ZB6 A;  4MJC A;  4HZ4 A;  1KBN A;  1PSQ A;  2VL9 A;  4BL7 B;  4IGJ A;  3HCZ A;  4JU5 A;  3HJP A;  2X64 A;  2WCI A;  3CMI A;  1MEK A;  1XCC A;  2FLS A;  1UA5 A;  2NBS A;  5HFI A;  2OE0 A;  2V1M A;  5B6M A;  2PVO C;  4GTU A;  4IW9 A;  1TP9 A;  2H1D A;  3P90 A;  3KGK A;  4CDO A;  2IWT A;  1N2A A;  3BOA A;  3FW2 A;  2O87 A;  2A4V A;  3TRQ A;  2GSQ A;  4YH2 A;  5GST A;  3ERW A;  4ULX A;  3GYK A;  4ZBB A;  4OFT A;  4K6X A;  4EO3 A;  3HVS A;  4PXO A;  2N5B A;  1XZO A;  2REM A;  4OCE A;  3FHK A;  4K7I A;  5G2Z A;  2GTU A;  1SK2 A;  2C1Y A;  4GSS A;  4I5Q A;  5EVO A;  3UBL A;  1T3B A;  1K0D A;  3QAG A;  3P2A A;  3CXG A;  4O5R A;  1PA3 A;  3MWH A;  4WKW A;  3CRU A;  2VL3 A;  1SKS B;  2L5L A;  4MPG A;  3BJ5 A;  5J41 A;  1WE0 A;  5IMV A;  1WWJ A;  3TKS E;  5AIX A;  4KH7 A;  2YJ7 A;  1YQ1 A;  5D93 A;  1JZR A;  4NXI A;  3RHB A;  3GTU A;  4KDU A;  1E2Y A;  5CO3 A;  3TB2 A;  1GLP A;  5DAL B;  2I4A A;  1ZOF A;  5IPG A;  1K0O A;  4KCA A;  2C8U A;  1HQO A;  1M9A A;  2GLR A;  3ME7 A;  4ML1 A;  2VUP A;  1G6Y A;  4KGI A;  3J7Y b;  4EKZ A;  4XS6 A;  2B6M A;  3IPZ A;  1RK4 A;  10GS A;  2CVK A;  2LUS A;  2LNS A;  2VLU A;  1SK0 A;  5D9X A;  5E59 A;  4AJ6 A;  2ZCT A;  4PUR A;  1X5D A;  3IV4 A;  1VRS D;  2GDR A;  3DGQ A;  7GSS A;  2L6D A;  3H8Q A;  1FVK A;  1TRU A;  17GS A;  2NDO A;  3L9U A;  4DSR A;  4HOJ A;  3O3T A;  4L5L A;  1M0U A;  3HD5 A;  2WB9 A;  3F4T A;  4Z7X A;  1OKT A;  4EL1 A;  1TOF A;  2IFQ A;  2IL3 A;  3D4T A;  4KUN A;  4X0X A;  2LS5 A;  4JZQ A;  1R5A A;  4V1A p;  3TJF A;  2PGT A;  4IEL A;  5ECH B;  4KSM A;  6GSU A;  1XBS A;  4ZIJ A;  4D73 A;  5HQP A;  1ERV A;  5DCG A;  2B7J A;  1PL1 A;  2LJK A;  2VM1 A;  2FUG 2;  1DE1 A;  3IC4 A;  2KOK A;  1F6M C;  3KH7 A;  3VFI A;  4BPY A;  3KTL A;  3KIJ A;  1X9S B;  3GSS A;  4IQA A;  3RDW A;  1GTA A;  3VWV A;  2JSY A;  1JZO A;  1EGR A;  1YY7 A;  3FEU A;  4J57 E;  1TI1 A;  2H66 A;  4HI7 A;  2IME A;  1Y6E A;  3MDK A;  4ZIL A;  3GKK A;  4OO5 A;  4AGS A;  4PTS A;  2EIR A;  2YV9 A;  1M2D A;  2R6K A;  1YF1 A;  3IRA A;  5AGY A;  3L78 A;  3Q18 A;  4Q5Q A;  2C0D A;  1EOH A;  1A8Y A;  4G0K A;  1U87 A;  2DLX A;  1O8W A;  5HR2 A;  2GZP A;  2IMF A;  2HSY A;  2GT6 A;  1GSQ A;  4RI7 A;  5HR0 A;  4DVC A;  2P0G A;  5EY6 A;  3F8U A;  4HUA A;  2B1L A;  3GRX A;  4ECB A;  4G9H A;  2LKU A;  1FG4 A;  4PUA A;  1JZW A;  4EVM A;  1GSF A;  2AHE A;  2P5Q A;  1XVW A;  2MYG A;  1TI3 A;  3FZA A;  1J0F A;  5AIS A;  3EIN A;  4PX1 A;  1N8J A;  1B8X A;  4J2F A;  4JBB A;  2H01 A;  1NM3 A;  1TRS A;  5L71 A;  3F6D A;  4ZB9 A;  4D73 B;  4K0G A;  1ZYQ B;  1AQX A;  4JED A;  1TKD B;  3SBC A;  5IOX A;  3TOU A;  1BYE A;  4HZ2 A;  3EU4 A;  5CP1 A;  3TUE A;  2HNL A;  2LEG A;  4WBR D;  3DD3 A;  1H75 A;  3GHA A;  1QQ2 A;  2MZC A;  2OE1 A;  3Q74 A;  2QSI A;  4USS A;  4PQH A;  3CYN A;  3G9B A;  4NWY A;  3DVW A;  1ZCP A;  4WF4 A;  3ZIV A;  3KM6 A;  2OBK A;  2PN8 A;  3F3R A;  4OFM A;  2H72 A;  9GSS A;  4Q5N A;  2LV3 A;  5AN1 A;  1R5P A;  4HQS A;  3ISO A;  3EMX A;  5F06 A;  2M80 A;  4IVF A;  4X43 A;  1W89 A;  2B7K A;  2TRC P;  3IDV A;  5J9C A;  4KDX A;  1GUL A;  4K7N A;  1VF3 A;  5ELG A;  1F9M A;  2C3T A;  1XPV A;  2MMO A;  4WEY A;  4TR4 A;  2VD0 A;  1AXD A;  4ZB8 A;  4ML6 A;  3GX0 A;  5CNW A;  1BG5 A;  1GUM A;  2FA4 A;  4KB3 A;  3WGX A;  2F51 A;  3GUR A;  3I9V 2;  4F0C A;  1ML6 A;  2DSA A;  4IP6 A;  3O76 A;  4CHS A;  3WGD A;  1PQN A;  1WPI A;  1K0N A;  3US3 A;  2HQT A;  1XW5 A;  2CVB A;  5LCZ A;  5DQS A;  3UVH A;  2VO4 A;  3TCO A;  1MTC A;  1XWK A;  3WYW A;  3Q19 A;  2AB6 A;  1EEJ A;  2K8S A;  3H79 A;  5DBQ A;  3GH9 A;  1WJK A;  2VOC A;  1QUW A;  1T00 A;  2X8G A;  3HYP A;  4Q5R A;  5IMZ A;  2HRN A;  3GN3 A;  1HNB A;  4OCF A;  3ZZX A;  3LG6 A;  5D73 A;  4X1U A;  2OAC A;  5ECI B;  3FRC A;  4IN0 A;  2HSN B;  2RUF A;  4RUV A;  3QFB C;  1M9B A;  2WDU A;  4BWQ A;  1VF2 A;  5ECK B;  5DCH A;  2JZR A;  4YQM A;  3KZQ A;  1O81 A;  1GSD A;  4EUY A;  4TR0 A;  2VL2 A;  1HD2 A;  3GIX A;  2V6O A;  4IS0 A;  3H4K A;  3DKS A;  4HDE A;  5F05 A;  4NHW A;  3U5R E;  3ZRD A;  2TRX A;  4N11 A;  4G0I A;  3W8S A;  5COH A;  1X9W B;  3QD9 A;  4BVY A;  2YWI A;  5ECS A;  4CW9 A;  1ST9 A;  2V32 A;  4MJB A;  3QAV A;  5ABR A;  2I81 A;  1JZD A;  3UAR A;  1K3O A;  1SYR A;  2MBS A;  4GCI A;  5C00 A;  3VPT A;  2EC4 A;  4KE3 A;  1OC9 B;  4L8E A;  2C0F A;  5EL8 A;  3G7J A;  3CTF A;  3O6T A;  1UC7 A;  4XIH A;  4J56 E;  3LXZ A;  4ZXG A;  1S3A A;  3D5J A;  1A2L A;  16GS A;  3D0Z A;  1RW1 A;  2VCV A;  5JWQ B;  3AY8 A;  2VCQ A;  2IMI A;  2GVP A;  1ABA A;  1V58 A;  1PGT A;  4YQV A;  4KND A;  1DSB A;  5B8B A;  4I2T A;  3ZVJ D;  1GH2 A;  2XPD A;  4KF9 A;  1U3I A;  4ID0 A;  4NV5 A;  1DBY A;  4ECI A;  1U6T A;  5ECN B;  4MJE A;  5ECO B;  2O7K A;  3I6A A;  2M72 A;  2YN1 A;  4I2U A;  2P31 A;  3GNJ A;  4KA0 A;  1AQV A;  1EGO A;  1Z6N A;  5DJL A;  2L59 A;  4OMV A;  1Y25 A;  3N9J A;  3SWL A;  4G10 A;  1QFN A;  4PNG A;  2VL2 C;  5IQY A;  4NPB A;  1GRX A;  3LFL A;  1VGL A;  5F8B A;  2CQ9 A;  5DAK A;  3GA4 A;  3UEM A;  1FHE A;  3JCM L;  5IMC A;  1XWB A;  1FVJ A;  2DJ1 A;  1V57 A;  1Q4J A;  2AYT A;  3A3T A;  4G19 A;  5HFG A;  3C8E A;  4BVY B;  2H0I A;  1A8L A;  2C0G A;  3HKR A;  2KUC A;  2OAD A;  2AJQ B;  2JZS A;  3CSI A;  5INY A;  4F03 A;  3DYR A;  1F3A A;  2PMT A;  3HXS A;  1XWC A;  2DJ0 A;  1K0C A;  1Z7P A;  2H76 A;  4OFN A;  3ZFB A;  2K6V A;  2GGT A;  3UMA A;  2RII A;  1OE8 A;  1WOU A;  1AIU A;  4HS1 A;  2LRC A;  12GS A;  1NW2 A;  3EU3 A;  3WT2 A;  1YKC A;  2I9H A;  5DQY A;  4OD7 A;  1GSU A;  3VUR A;  1WMJ A;  3GFK A;  3ME8 A;  4HU7 A;  3QMX A;  5G1L A;  3IAS 2;  4DEJ A;  3KH9 A;  1HYU A;  4TR3 A;  1A0F A;  4HJ2 A;  5JCW A;  14GS A;  4IJI A;  1XXU A;  1EWX A;  1K0B A;  1R26 A;  1WIK A;  2H30 A;  5IMA A;  2WGR A;  5B6N A;  2DMM A;  2L5O A;  4EDY A;  2WZ9 A;  1MD3 A;  3RBT A;  5IO2 A;  3BBY A;  2K18 A;  2PVQ A;  4K1F A;  4GST A;  2HI7 A;  1SD9 A;  1URM A;  4NAX A;  2F3M A;  3H1N A;  3LEF A;  3LYP A;  2JU5 A;  3TGZ A;  2HZE A;  3BCK A;  3KMN A;  3VI7 A;  4BA7 A;  5B7C A;  3DWV A;  4QQ7 A;  2H6Y A;  3RPN A;  2WS2 A;  2WJU A;  5D9V A;  2JAD A;  1X0R A;  1MDJ A;  2DIZ A;  4QL7 A;  4BWS A;  1A24 A;  1EEM A;  18GS A;  4BVX A;  5IMD A;  2OJL A;  3FY7 A;  3GKN A;  2PU9 C;  5A4U A;  2AUV A;  1YKA A;  3LYK A;  2JSZ A;  1YJ6 A;  1PD2 1;  4KDY A;  6GSX A;  3M8N A;  5CRW A;  1X5C A;  2CZ3 A;  5HR1 A;  4TRX A;  3KEB A;  4TXV A;  4L0W A;  2HE3 A;  3GKM A;  2HSM A;  1KTE A;  1EZK A;  5CRE A;  1XOB A;  3I69 A;  2GQL A;  3TKP A;  5IPH A;  1LBK A;  4G0L A;  1M2B A;  3J7Y k;  3PIN A;  2PER A;  2JZT A;  5KN3 A;  5A4W A;  4XRA A;  5IM9 A;  5G5F A;  1S3C A;  2XPE A;  3BCI A;  4GF0 A;  4JR4 A;  2LST A;  2Z9S A;  4IJ3 A;  3EYT A;  3FYG A;  2H19 A;  2KP2 A;  2LTK A;  1AUC A;  3GTU B;  3IBH A;  1SL1 B;  4PUF C;  5IO0 A;  1TU7 A;  1PX7 A;  3FR6 A;  2E2G A;  4TW5 A;  3N5O A;  3MSZ A;  3M0F A;  3MAK A;  4WET A;  3CSJ A;  1TK8 B;  4OO4 A;  2F9S A;  1AAZ A;  2FWH A;  3A2V A;  2GQK A;  3FK8 A;  1OYJ A;  4BVX B;  3KTB A;  3ED3 A;  1GTB A;  4LMV A;  3QCP A;  4DSS A;  1PX6 A;  3EE2 A;  2G0F A;  2K8V A;  1F2E A;  4YQU A;  4FH8 A;  1CQG A;  4JR6 A;  5J5N A;  2GZY A;  3ZL5 A;  3R2Q A;  4H86 A;  5CYY A;  3KP8 A;  3EMP A;  3DRN A;  3IOS A;  3RHC A;  4MP4 A;  2YZH A;  4XS1 A;  3L4N A;  2DBC A;  4LA1 A;  4GQF A;  2J9H A;  2IFQ B;  3UIW A;  3WT1 A;  2HSM B;  1O6J A;  1GSY A;  2MMA A;  1BJX A;  5DDL A;  1U88 A;  4FQU A;  2O85 A;  3ZIT A;  4PQI A;  3VK9 A;  1JLW A;  2FGX A;  3IK9 A;  5HR3 A;  4MF5 A;  1O73 A;  5E4W A;  1HNC A;  4MCU A;  3HDC A;  3LQ7 A;  4ZL9 A;  5ECM B;  2FWF A;  3QPM A;  2GQM A;  3W6G A;  4Q5F A;  1O8X A;  5ENU A;  1JHB A;  5JCU A;  2GZZ A;  4GQC A;  2A2S A;  5ELA A;  2V6K A;  3HJO A;  5GAN D;  5ID2 A;  4AJ7 A;  1THO A;  3CBU A;  2YV7 A;  5G30 A;  2OKA A;  1USB A;  3TKS A;  3WD6 A;  2XC2 A;  4P3Y B;  4L5O A;  2K9F A;  1TW9 A;  2NVL A;  4MF7 A;  22GS A;  2MBT A;  5H5R A;  4HEA 2;  4RI6 A;  2LQQ A;  4GXZ A;  3KJY A;  2C80 A;  5D9T A;  3HVV A;  4PGT A;  2J23 A;  3LGC A;  3EC3 A;  1G7E A;  3KMO A;  4I6X A;  3R3E A;  4F0B A;  3UOM A;  4L0U A;  2IJY A;  4MA9 A;  1A2M A;  1XOA A;  1DE2 A;  1Z3E A;  2HFD A;  3VWW A;  2GT5 A;  4IQ1 A;  1PRX A;  2HXK A;  3C7M A;  3TJG A;  2B5X A;  2H1A A;  3D4M A;  5J4U A;  3G7I A;  4MH3 A;  1FO5 A;  3L9V A;  5F07 A;  3KD0 A;  1EV9 A;  3TKQ A;  4KSO A;  3F63 A;  3Q6O A;  11GS A;  1NSW A;  3HJM A;  4IP1 A;  1VF1 A;  3C1R A;  1ERW A;  1Z6M A;  3C1S A;  3ZFL A;  3GH6 A;  3E0U A;  1B4P A;  3QFA C;  13GS A;  3LSZ A;  1TRV A;  4TR1 A;  2VLT A;  2HRF A;  5J3R A;  1Z9H A;  2R3X A;  1O7U A;  2AV4 A;  2L57 A;  1TXX A;  2FWE A;  1EP7 A;  3PGT A;  2BTO T;  2H70 A;  3KXO A;  2ALB A;  2YWM A;  2N5F A;  3G7Y A;  4OWY A;  3TJK A;  2CX3 A;  3CTG A;  4N0V A;  2DJJ A;  1CQH A;  2V41 A;  2X8C A;  5ID2 B;  1H4O A;  3TKS C;  4F82 A;  2R5G A;  1OE7 A;  2GSR A;  5GSS A;  6GSW A;  4IKH A;  3TJB A;  2HT9 A;  2YNX A;  4POL A;  5G31 A;  1PKZ A;  2AAW A;  4I97 A;  2VCZ A;  3QOU A;  3U6V A;  6GSY A;  3UAP A;  3DML A;  5KN1 A;  2TIR A;  1IYI A;  3IAM 2;  2DIY A;  1EOG A;  1GSS A;  3LJR A;  2WFC A;  4QL9 A;  2WRT A;  4MPF A;  1A23 A;  1SL0 B;  1SL2 B;  2JL4 A;  2ON7 A;  3IA1 A;  1GTU A;  2QGV A;  4TXO A;  3I43 A;  1OC8 A;  2IN3 A;  2B3S A;  3A2X A;  1B4Q A;  2LNT A;  3ZTL A;  1T8E B;  4V2M A;  2H0G A;  4BL7 A;  5IOW A;  5JCG A;  1XW9 A;  3CRT A;  3ZRE A;  2NTO A;  4LL4 B;  2RUE A;  2H74 A;  1QGV A;  4MAB A;  2GST A;  2HRK A;  2FHE A;  2M46 A;  3A2W A;  2HYX A;  3WGE A;  2I1U A;  1WP0 A;  3MNG A;  1F37 A;  3IHQ A;  3F4R A;  5D8I A;  4XHM A;  1YZX A;  1GTI A;  2CAI A;  1ILO A;  1BED A;  1KEB A;  1YF0 A;  1TK0 B;  4O92 A;  2CV4 A;  1GP1 A;  4HU9 A;  2FA8 A;  1W4V A;  2RM6 A;  2YWO A;  3HY2 A;  1MDK A;  4F9Z A;  1TJD A;  3ZVJ A;  3EUR A;  4WBJ A;  2VIM A;  1AW9 A;  2C3N A;  4KX4 A;  1LJR A;  3CSH A;  3DEX A;  4HJM A;  2DJ2 A;  2CA8 A;  1AC1 A;  2RM5 A;  1SKR B;  2H1G A;  1HNA A;  2YWN A;  1QXH A;  2EIQ A;  3V1W A;  3KCM A;  2G2Q A;  3VI5 A;  1E6B A;  2H71 A;  1V9W A;  1JLV A;  1V2A A;  2DJ3 A;  1XW6 A;  1C72 A;  5DJM A;  1ZYE A;  2H0H A;  2H1B A;  3ZYW A;  3APQ A;  4WF5 A;  1BX9 A;  2NPB A;  1K3L A;  4MLY A;  2L6C A;  1FB6 A;  3TKR A;  2H6X A;  5DAL A;  3QAW A;  2HRK B;  5BMU A;  1SKW B;  2GS3 A;  4E8E A;  3TDG A;  1V98 A;  5KN2 A;  6GSS A;  2FD3 A;  2IMD A;  2XHF A;  4MJA A;  3DIE A;  3GV1 A;  3EVI A;  3D22 A;  2YZU A;  3NOF A;  5CRG A;  1TU8 A;  4YAP A;  1TK5 B;  5FT3 A;  1LU4 A;  3UL3 A;  5ECR B;  4XS4 A;  3LXT A;  2OBI A;  3P7X A;  1I9D A;  4WXT A;  4MZW A;  2ZNM A;  1MD4 A;  2ZUP A;  3F4S A;  4ISD A;  1J08 A;  6GST A;  5DAK B;  5D9W A;  1V40 A;  4POK A;  2DC5 A;  1SD8 A;  4FYB A;  2HRA A;  4XTS A;  2PUK C;  1ON4 A;  1ERT A;  3RPP A;  2YAN A;  6GSV A;  5D96 A;  20GS A;  1MDI A;  4IBP A;  5A5K A;  1M2A A;  1F3B A;  1ZMA A;  3E9J B;  5CRH A;  1PN9 A;  5GAP D;  3RAZ A;  4MZB A;  2VCX A;  3HVX A;  4ZBA A;  4ACS A;  4ZL7 A;  3K8N A;  2OA7 A;  5J9B A;  1ZZY A;  4MMM A;  3FR9 A;  2LRT A;  2R37 A;  1QK8 A;  3FKF A;  4GLT A;  2N5A A;  2VM2 A;  3M9K A;  3W8J A;  2B5E A;  2CVD A;  4G2E A;  1XWA A;  2UZ8 A;  2KHP A;  5H5S A;  1K3Y A;  1X5E A;  4EXJ A;  1T4Y A;  1ERU A;  4MZC A;  2IIY A;  5LNK e;  2WUL A;  2E0Q A;  3TOT A;  3FZ9 A;  4XS4 B;  4WR5 A;  1YEX A;  2H73 A;  4LLR A;  5ECL B;  4POB A;  4V1A g;  4TN8 A;  5FHI A;  5LD0 A;  4KW6 A;  3PR8 A;  2YOI A;  3M3M A;  3QDN A;  1T1V A;  1UN2 A;  3GST A;  2IMK A;  4F2I A;  3HA9 A;  4O7H A;  4MK3 A;  1XIY A;  2X99 A;  3E3E A;  1IYH A;  1FB0 A;  2HZE B;  2L4Q A;  4MF6 A;  2O89 A;  2O8V B;  2OE3 A;  1KNG A;  1X9M B;  3DXB A;  1FOV A;  5IMF A;  1ZGN A;  4K9Z A;  2B1K A;  1NHY A;  1XWG A;  1J9B A;  3ZML A;  1QMV A;  2KLX A;  1B9Y C;  2CZ2 A;  1G0T A;  3TJJ A;  3H93 A;  1EP8 A;  1WRY A;  1AQW A;  4FIW A;  3ERF A;  4TKY A;  1XVQ A;  1B48 A;  1VF4 A;  4K7O A;  3LOR A;  2FY6 A;  3ZMK A;  1U3A A;  3GKX A;  3S9F A;  4PNF A;  5EPF A;  4NMU A;  1BQ7 A;  3VWX A;  2BJX A;  2KP1 A;  3TRP A;  1GLQ A;  2YJH A;  3EWL A;  4NHZ A;  2LQO A;  1SU9 A;  2B5Y A;  4GSN A;  2VD1 A;  2L4C A;  3C73 A;  2E2M A;  1YDK A;  2YPM A;  2YCD A;  1O85 A;  2EIO A;  2DJK A;  1TRW A;  1DUG A;  5HFK A;  19GS A;  2QC7 A;  5KEJ A;  4RQR A;  1TDI A;  5DVB A;  4K2D A;  3IR4 A;  2VCW A;  1ZL9 A;  2E7P A;  1R4W A;  4GWR A;  4O32 A;  3FZ4 A;  4ILF A;  1GL8 A;  2C3Q A;  1Z5Y E;  2VCT A;  1SJI A;  1GUK A;  2XBI A;  5F0G A;  4E8H A;  3NZN A;  4N0Z A;  3LWA A;  4V2L A;  4NV2 A;  1K0A A;  3ZLP A;  4DSS B;  5FWG A;  3D21 A;  3FZ5 A;  2VLV A;  2CT6 A;  1OKD A;  5H5Q A;  5JWR B;  1R7H A;  2LJA A;  3F9U A;  4TOP A;  5G5E A;  1GUH A;  4ZL8 A;  2D2Z A;  3F6F A;  3HHV A;  1SJZ A;  4EF0 A;  4K0N A;  4LMW A;  1PKW A;  1I5G A;  3IK7 A;  3ERG A;  8GSS A;  1OAZ A;  1PL2 A;  1GSE A;  2FCH A;  3APO A;  5G1K A;  1SK1 A;  1OVN A;  3UBK A;  4ZBD A;  1ACV A;  5GZZ B;  4FO5 A;  4LL1 B;  5ECP B;  4I8B A;  4WR4 A;  4YAV A;  3IXR A;  1Q98 A;  1THX A;  4EDZ A;  2LRN A; 
#chains in the Genus database with same CATH topology
 4GRF A;  4K8M A;  3NIV A;  1OC9 A;  3IE3 A;  4FYU A;  1M99 A;  4MDC A;  1SJ6 A;  2MMZ A;  1YEP A;  3HVN A;  3A5W A;  3UVT A;  4MH2 A;  4XCS A;  3PPU A;  1S3D A;  3L9S A;  5KOW A;  2BMX A;  4POM A;  3GL3 A;  4HQZ A;  5B8A A;  2PBJ A;  2A2R A;  2ES7 A;  2IPA A;  3APS A;  1GNW A;  3OR5 A;  5A5H B;  5J4Y A;  3GL5 A;  4N30 A;  1TTZ A;  2WVX B;  4KCE A;  2R4V A;  2F8A A;  1FW1 A;  2FNO A;  1K0M A;  2V2G A;  3BD2 A;  3GX8 A;  3DVX A;  2I3Y A;  1Y1U A;  2JAC A;  1G7O A;  1UVZ A;  3M9J A;  3FR3 A;  2MMN A;  1FAA A;  1M7T A;  1B9X C;  3VWU A;  2XBQ A;  2QKE A;  1NHO A;  4JRR A;  5ECQ B;  4DSQ A;  4N10 A;  1BAY A;  1SEN A;  4EC0 A;  2CAQ A;  1GNE A;  3TRX A;  1XFL A;  5CRD A;  4KAE A;  1JFU A;  3GUS A;  1G6W A;  1GWC A;  3PH9 A;  5IIZ A;  2HSH A;  2H75 A;  4TR1 B;  4ECJ A;  3F3Q A;  5A4V A;  3KP9 A;  3IC8 A;  3P8W A;  2HZF A;  1T7P B;  2YP6 A;  4EE0 A;  1RQM A;  2C4J A;  2FWG A;  2DML A;  5JWO B;  2CX4 A;  3L0H A;  2GSS A;  1OC3 A;  1T4Z A;  3CWG A;  2H6Z A;  2PPT A;  1PMT A;  1A0R P;  4V2N A;  1SYX A;  2VAF A;  3HZ8 A;  4XRD A;  4X4J A;  5C04 A;  2EFD A;  4PQ1 A;  5AIV A;  4FYC A;  4RQX A;  2HLS A;  4ECC A;  3C71 A;  2C0E A;  2ON5 A;  3D6I A;  3UJ1 A;  5CAX A;  1EV4 A;  2DKH A;  2R0C A;  5KN0 A;  4FXY P;  4JE1 A;  2P5R A;  4AF2 A;  1Z7R A;  2H8L A;  2R2J A;  2RLI A;  3QR6 A;  1A2J A;  2LJR A;  3VLN A;  3GMF A;  4TVE A;  4AJ8 A;  4TXO B;  3M1G A;  2X8H A;  3RGB C;  3HZ4 A;  2F8F A;  2PWJ A;  3VPQ A;  3ZIJ A;  3F0I A;  4IHU A;  4ZB6 A;  4MJC A;  4HZ4 A;  1KBN A;  1PSQ A;  2VL9 A;  4BL7 B;  2UV8 G;  4IGJ A;  3HCZ A;  4JU5 A;  3HJP A;  2X64 A;  2WCI A;  3CMI A;  1MEK A;  1XCC A;  2FLS A;  1UA5 A;  2NBS A;  5HFI A;  2OE0 A;  2V1M A;  5B6M A;  2PVO C;  4GTU A;  4IW9 A;  1TP9 A;  2H1D A;  3P90 A;  3KGK A;  4CDO A;  2IWT A;  1N2A A;  3BOA A;  3FW2 A;  1BF5 A;  2O87 A;  2A4V A;  3TRQ A;  2GSQ A;  4YH2 A;  5GST A;  3ERW A;  4ULX A;  3GYK A;  4ZBB A;  4OFT A;  4K6X A;  1BG1 A;  4EO3 A;  3HVS A;  4PXO A;  2N5B A;  1XZO A;  2REM A;  4OCE A;  1SVO A;  3FHK A;  4K7I A;  5G2Z A;  2GTU A;  1SK2 A;  2C1Y A;  4GSS A;  4I5Q A;  5EVO A;  3UBL A;  1T3B A;  1K0D A;  3QAG A;  3P2A A;  3CXG A;  4O5R A;  1PA3 A;  3MWH A;  4WKW A;  3CRU A;  4BIK A;  2VL3 A;  1SKS B;  2L5L A;  4MPG A;  3BJ5 A;  5J41 A;  1WE0 A;  5IMV A;  1WWJ A;  3TKS E;  5AIX A;  4KH7 A;  2YJ7 A;  1YQ1 A;  5D93 A;  1JZR A;  4NXI A;  3RHB A;  3GTU A;  4KDU A;  1E2Y A;  5CO3 A;  3TB2 A;  1GLP A;  5DAL B;  4AKG A;  2I4A A;  1ZOF A;  5IPG A;  1K0O A;  4KCA A;  2C8U A;  1HQO A;  5BMU B;  1M9A A;  2GLR A;  4G01 A;  3ME7 A;  4ML1 A;  2VUP A;  1G6Y A;  4KGI A;  3J7Y b;  4EKZ A;  4XS6 A;  2B6M A;  3IPZ A;  2LUS A;  1RK4 A;  10GS A;  2CVK A;  2LNS A;  2VLU A;  1SK0 A;  5D9X A;  5E59 A;  4AJ6 A;  2ZCT A;  4PUR A;  1X5D A;  3IV4 A;  1VRS D;  2GDR A;  3DGQ A;  7GSS A;  2L6D A;  3H8Q A;  1FVK A;  1TRU A;  17GS A;  2NDO A;  3L9U A;  4DSR A;  4HOJ A;  3O3T A;  4L5L A;  1M0U A;  3HD5 A;  2WB9 A;  3F4T A;  4Z7X A;  1OKT A;  4EL1 A;  1TOF A;  2IFQ A;  2IL3 A;  3D4T A;  4KUN A;  4X0X A;  2LS5 A;  4JZQ A;  1R5A A;  4V1A p;  3TJF A;  2PGT A;  4IEL A;  5ECH B;  4KSM A;  6GSU A;  1XBS A;  3EPT A;  4ZIJ A;  4D73 A;  5HQP A;  1ERV A;  5DCG A;  2B7J A;  1PL1 A;  2LJK A;  2VM1 A;  2FUG 2;  1DE1 A;  3IC4 A;  2KOK A;  1F6M C;  3KH7 A;  3VFI A;  4BPY A;  3KTL A;  3KIJ A;  1X9S B;  3GSS A;  4IQA A;  3RDW A;  1GTA A;  3VWV A;  4AKH A;  2JSY A;  1JZO A;  1EGR A;  1YY7 A;  3FEU A;  4J57 E;  1TI1 A;  2H66 A;  4HI7 A;  4ICY A;  2IME A;  1Y6E A;  3MDK A;  4ZIL A;  3GKK A;  2EFC A;  4OO5 A;  4AGS A;  4PTS A;  2EIR A;  2YV9 A;  1M2D A;  2R6K A;  1YF1 A;  3IRA A;  5AGY A;  3L78 A;  3Q18 A;  4Q5Q A;  2C0D A;  1EOH A;  1A8Y A;  2WW3 A;  4G0K A;  1U87 A;  2DLX A;  1O8W A;  5HR2 A;  2GZP A;  2IMF A;  2HSY A;  2GT6 A;  1GSQ A;  4RI7 A;  5HR0 A;  4DVC A;  2P0G A;  5EY6 A;  3F8U A;  4HUA A;  2B1L A;  4YKG A;  3GRX A;  4ZB7 A;  4ECB A;  4G9H A;  2LKU A;  1FG4 A;  4PUA A;  1JZW A;  2X4A A;  4EVM A;  1GSF A;  2AHE A;  1YVL A;  2P5Q A;  1XVW A;  2MYG A;  1TI3 A;  3FZA A;  1J0F A;  5AIS A;  3EIN A;  4PX1 A;  1N8J A;  1B8X A;  4J2F A;  4JBB A;  2H01 A;  1NM3 A;  1TRS A;  4K5R A;  5L71 A;  3F6D A;  4ZB9 A;  4D73 B;  4K0G A;  1ZYQ B;  1AQX A;  4JED A;  1TKD B;  2H1L A;  3SBC A;  5IOX A;  3TOU A;  3RFR C;  1BYE A;  4HZ2 A;  3EU4 A;  5CP1 A;  3TUE A;  2HNL A;  2LEG A;  4WBR D;  3DD3 A;  1H75 A;  3GHA A;  1QQ2 A;  2MZC A;  2OE1 A;  3Q74 A;  1PFO A;  4USS A;  2QSI A;  4PQH A;  3CYN A;  3G9B A;  4NWY A;  3DVW A;  1ZCP A;  4WF4 A;  3ZIV A;  3KM6 A;  2HSN A;  2OBK A;  2PN8 A;  1SVM A;  3F3R A;  4OFM A;  2H72 A;  9GSS A;  1XG8 A;  4Q5N A;  2LV3 A;  5AN1 A;  1R5P A;  4HQS A;  3ISO A;  3EMX A;  5F06 A;  2M80 A;  4IVF A;  4X43 A;  1W89 A;  2B7K A;  2TRC P;  3IDV A;  5J9C A;  4KDX A;  1GUL A;  4K7N A;  1VF3 A;  5ELG A;  1F9M A;  2C3T A;  1XPV A;  2MMO A;  4WEY A;  4TR4 A;  2VD0 A;  1AXD A;  4ZB8 A;  4ML6 A;  3GX0 A;  5CNW A;  1BG5 A;  1GUM A;  2FA4 A;  4KB3 A;  3WGX A;  2F51 A;  3GUR A;  3I9V 2;  4F0C A;  1ML6 A;  2DSA A;  4IP6 A;  3O76 A;  4CHS A;  3WGD A;  1PQN A;  1WPI A;  1K0N A;  3US3 A;  2HQT A;  1XW5 A;  2CVB A;  5LCZ A;  5DQS A;  3UVH A;  2VO4 A;  3TCO A;  1MTC A;  1XWK A;  3WYW A;  3Q19 A;  2AB6 A;  1EEJ A;  2K8S A;  3H79 A;  5DBQ A;  3GH9 A;  1WJK A;  2VOC A;  1QUW A;  1T00 A;  2X8G A;  3HYP A;  4Q5R A;  5IMZ A;  2HRN A;  3GN3 A;  1HNB A;  4OCF A;  3ZZX A;  3LG6 A;  5D73 A;  4X1U A;  2OAC A;  5ECI B;  3FRC A;  4IN0 A;  2HSN B;  2RUF A;  4RUV A;  3QFB C;  1M9B A;  2WDU A;  4BWQ A;  1VF2 A;  5ECK B;  5DCH A;  2JZR A;  4YQM A;  3KZQ A;  1O81 A;  1GSD A;  4EUY A;  4TR0 A;  2VL2 A;  1HD2 A;  3GIX A;  2V6O A;  4IS0 A;  2WZS A;  3H4K A;  2X49 A;  2EFH A;  3DKS A;  4HDE A;  5F05 A;  4NHW A;  3U5R E;  3ZRD A;  2TRX A;  4N11 A;  4G0I A;  3W8S A;  5COH A;  1TXU A;  1X9W B;  3QD9 A;  4BVY A;  2YWI A;  5ECS A;  1ZYN A;  4CW9 A;  1ST9 A;  2V32 A;  4MJB A;  3QAV A;  5ABR A;  2I81 A;  1JZD A;  3UAR A;  1K3O A;  1SYR A;  2MBS A;  4GCI A;  5C00 A;  3VPT A;  2EC4 A;  4KE3 A;  1OC9 B;  4L8E A;  2C0F A;  5EL8 A;  3G7J A;  3CTF A;  3O6T A;  1UC7 A;  4XIH A;  4J56 E;  3LXZ A;  4ZXG A;  4AI6 A;  1S3A A;  3D5J A;  1A2L A;  16GS A;  3D0Z A;  1RW1 A;  2VCV A;  5JWQ B;  3AY8 A;  2VCQ A;  2IMI A;  2GVP A;  1ABA A;  1V58 A;  5A34 A;  1PGT A;  4YQV A;  4KND A;  1DSB A;  5B8B A;  4I2T A;  3ZVJ D;  1GH2 A;  2XPD A;  4KF9 A;  1U3I A;  4ID0 A;  4NV5 A;  1DBY A;  3FMW A;  4ECI A;  1U6T A;  5ECN B;  4MJE A;  5ECO B;  2O7K A;  3I6A A;  4CY6 A;  2M72 A;  2YN1 A;  3GNJ A;  2P31 A;  4I2U A;  4KA0 A;  1AQV A;  1EGO A;  1Z6N A;  5DJL A;  2L59 A;  4OMV A;  1Y25 A;  3N9J A;  3SWL A;  4G10 A;  1QFN A;  4PNG A;  2VL2 C;  5IQY A;  4NPB A;  1GRX A;  3LFL A;  1VGL A;  5F8B A;  2CQ9 A;  5DAK A;  3GA4 A;  3UEM A;  1FHE A;  3JCM L;  5IMC A;  1XWB A;  1FVJ A;  2DJ1 A;  1V57 A;  1Q4J A;  2AYT A;  3A3T A;  4G19 A;  5HFG A;  3C8E A;  1S3R A;  4BVY B;  2H0I A;  1A8L A;  2C0G A;  3CHX C;  3HKR A;  2KUC A;  2OAD A;  2AJQ B;  2JZS A;  3CSI A;  5INY A;  4F03 A;  3DYR A;  1F3A A;  2PMT A;  3HXS A;  1XWC A;  2DJ0 A;  1K0C A;  1Z7P A;  2H76 A;  4OFN A;  3ZFB A;  2K6V A;  4Z2U A;  2GGT A;  3UMA A;  4K5S A;  2RII A;  1OE8 A;  1WOU A;  1AIU A;  4HS1 A;  2LRC A;  12GS A;  1NW2 A;  3EU3 A;  3WT2 A;  1YKC A;  2I9H A;  5DQY A;  4OD7 A;  1GSU A;  3VUR A;  3HMJ G;  1WMJ A;  3GFK A;  3ME8 A;  4HU7 A;  5A34 B;  3QMX A;  5G1L A;  3IAS 2;  4DEJ A;  3KH9 A;  1HYU A;  4TR3 A;  1A0F A;  4HJ2 A;  5JCW A;  14GS A;  4IJI A;  1XXU A;  1EWX A;  1K0B A;  1R26 A;  2R0P A;  1WIK A;  2H30 A;  5IMA A;  2WGR A;  5B6N A;  2DMM A;  2L5O A;  4EDY A;  2WZ9 A;  1MD3 A;  3RBT A;  5IO2 A;  3BBY A;  2K18 A;  2PVQ A;  4K1F A;  4GST A;  2HI7 A;  1SD9 A;  1URM A;  4NAX A;  2F3M A;  3H1N A;  4Z2T A;  3LEF A;  3LYP A;  2JU5 A;  2QA1 A;  3TGZ A;  2HZE A;  3BCK A;  3KMN A;  3VI7 A;  4BA7 A;  4CY8 A;  5B7C A;  3DWV A;  4QQ7 A;  2H6Y A;  3RPN A;  2WS2 A;  2WJU A;  5D9V A;  2JAD A;  3LW9 A;  1X0R A;  1MDJ A;  2DIZ A;  4QL7 A;  4BWS A;  1A24 A;  1EEM A;  18GS A;  4BVX A;  5IMD A;  2OJL A;  3FY7 A;  3GKN A;  2PU9 C;  1M3I A;  5A4U A;  2AUV A;  1YKA A;  3LYK A;  2JSZ A;  1YJ6 A;  1PD2 1;  4KDY A;  6GSX A;  3M8N A;  4AKI A;  5CRW A;  1X5C A;  2CZ3 A;  5HR1 A;  4TRX A;  3KEB A;  4TXV A;  4L0W A;  2HE3 A;  3GKM A;  2WW1 A;  2HSM A;  1FOH A;  1KTE A;  1EZK A;  5CRE A;  1XOB A;  3I69 A;  2GQL A;  3TKP A;  5IPH A;  1LBK A;  4G0L A;  1M2B A;  3J7Y k;  3PIN A;  2PER A;  2JZT A;  5KN3 A;  5A4W A;  4XRA A;  4K2X A;  5IM9 A;  5G5F A;  1S3C A;  2XPE A;  3BCI A;  4GF0 A;  4JR4 A;  2LST A;  2Z9S A;  3EYT A;  4IJ3 A;  3FYG A;  2H19 A;  2KP2 A;  2LTK A;  1AUC A;  3GTU B;  3IBH A;  1SL1 B;  4PUF C;  5IO0 A;  1TU7 A;  1PX7 A;  3FR6 A;  2E2G A;  4TW5 A;  3N5O A;  3MSZ A;  3M0F A;  3MAK A;  4WET A;  3CSJ A;  1TK8 B;  4OO4 A;  2F9S A;  1AAZ A;  4EIQ A;  2FWH A;  3A2V A;  4O5U A;  2GQK A;  3FK8 A;  1OYJ A;  4BVX B;  3KTB A;  3ED3 A;  1GTB A;  4LMV A;  3QCP A;  4DSS A;  1PX6 A;  3EE2 A;  2G0F A;  2K8V A;  1F2E A;  4YQU A;  2O5V A;  4FH8 A;  1CQG A;  4JR6 A;  5J5N A;  2GZY A;  3ZL5 A;  3R2Q A;  4H86 A;  5CYY A;  3KP8 A;  3EMP A;  3DRN A;  3IOS A;  3RHC A;  4MP4 A;  2A2P A;  2YZH A;  4XS1 A;  3L4N A;  2DBC A;  4MNN A;  4LA1 A;  4GQF A;  2J9H A;  2IFQ B;  3UIW A;  3WT1 A;  2HSM B;  1O6J A;  4N3Z A;  1GSY A;  2MMA A;  1BJX A;  5DDL A;  1U88 A;  4FQU A;  2O85 A;  3ZIT A;  4PQI A;  3VK9 A;  1JLW A;  2FGX A;  3IK9 A;  4AKX B;  5HR3 A;  4MF5 A;  1O73 A;  5E4W A;  1HNC A;  4MCU A;  3HDC A;  3LQ7 A;  4ZL9 A;  5ECM B;  2FWF A;  3QPM A;  2GQM A;  3W6G A;  4Q5F A;  1O8X A;  5ENU A;  1JHB A;  5JCU A;  2GZZ A;  4GQC A;  2A2S A;  5ELA A;  2V6K A;  3HJO A;  5GAN D;  5ID2 A;  4AJ7 A;  1THO A;  3CBU A;  2YV7 A;  5G30 A;  2OKA A;  1USB A;  3TKS A;  3WD6 A;  2XC2 A;  4Z2R A;  4P3Y B;  4L5O A;  2K9F A;  5J47 A;  1TW9 A;  2NVL A;  4MF7 A;  22GS A;  2MBT A;  5H5R A;  4HEA 2;  4RI6 A;  2LQQ A;  4GXZ A;  3KJY A;  2C80 A;  5D9T A;  3TU3 B;  3HVV A;  4PGT A;  2J23 A;  3LGC A;  3EC3 A;  1G7E A;  3KMO A;  4I6X A;  3R3E A;  4F0B A;  4E68 A;  3UOM A;  4L0U A;  2IJY A;  4MA9 A;  1A2M A;  1XOA A;  1DE2 A;  1Z3E A;  2HFD A;  3VWW A;  2GT5 A;  4IQ1 A;  1PRX A;  2HXK A;  4A5P A;  3C7M A;  3TJG A;  2B5X A;  2H1A A;  3D4M A;  5J4U A;  3G7I A;  4MH3 A;  1FO5 A;  3L9V A;  5F07 A;  3KD0 A;  1M3J A;  1EV9 A;  2OT3 A;  3TKQ A;  4KSO A;  3F63 A;  3Q6O A;  11GS A;  1NSW A;  3HJM A;  4IP1 A;  1VF1 A;  3C1R A;  1ERW A;  3C1S A;  1Z6M A;  3ZFL A;  3GH6 A;  3E0U A;  1B4P A;  3QFA C;  13GS A;  3LSZ A;  1TRV A;  4TR1 A;  2VLT A;  2HRF A;  5J3R A;  1Z9H A;  2R3X A;  1O7U A;  2AV4 A;  2L57 A;  1TXX A;  2FWE A;  1EP7 A;  3PGT A;  2BTO T;  2H70 A;  3KXO A;  2ALB A;  2YWM A;  2N5F A;  3G7Y A;  4HSC X;  4OWY A;  3TJK A;  2CX3 A;  3CTG A;  4N0V A;  2DJJ A;  1CQH A;  2V41 A;  2X8C A;  5ID2 B;  1H4O A;  3TKS C;  4F82 A;  2R5G A;  1OE7 A;  2GSR A;  5GSS A;  6GSW A;  4IKH A;  3TJB A;  2WW2 A;  2HT9 A;  2YNX A;  4POL A;  5G31 A;  1PKZ A;  2AAW A;  4I97 A;  2VCZ A;  3QOU A;  3U6V A;  1N25 A;  6GSY A;  3UAP A;  3DML A;  3MYD A;  5KN1 A;  2TIR A;  1IYI A;  3IAM 2;  2DIY A;  1EOG A;  1GSS A;  3LJR A;  2WFC A;  4QL9 A;  2WRT A;  4MPF A;  1A23 A;  1SL0 B;  1SL2 B;  2JL4 A;  2ON7 A;  3IA1 A;  1GTU A;  2QGV A;  4TXO A;  3I43 A;  1OC8 A;  2IN3 A;  2B3S A;  3A2X A;  1B4Q A;  2LNT A;  3ZTL A;  1T8E B;  4V2M A;  2H0G A;  4BL7 A;  5IOW A;  5JCG A;  1XW9 A;  3CRT A;  3ZRE A;  2NTO A;  4LL4 B;  2RUE A;  2H74 A;  1QGV A;  4MAB A;  2GST A;  2HRK A;  3CQF A;  2FHE A;  2M46 A;  3A2W A;  2HYX A;  3WGE A;  2I1U A;  1WP0 A;  3MNG A;  1F37 A;  3IHQ A;  3F4R A;  5D8I A;  4XHM A;  1YZX A;  1GTI A;  2CAI A;  1ILO A;  1BED A;  1KEB A;  1YF0 A;  1TK0 B;  2O36 A;  1I1I P;  4O92 A;  2CV4 A;  1GP1 A;  4HU9 A;  2FA8 A;  1W4V A;  2RM6 A;  2YWO A;  3HY2 A;  1MDK A;  4F9Z A;  1TJD A;  3ZVJ A;  3EUR A;  4WBJ A;  2VIM A;  1AW9 A;  2C3N A;  4KX4 A;  1LJR A;  3CSH A;  2A4H A;  3DEX A;  4HJM A;  2DJ2 A;  2CA8 A;  1AC1 A;  2RM5 A;  1SKR B;  2H1G A;  1HNA A;  2YWN A;  1QXH A;  2EIQ A;  3V1W A;  3KCM A;  2G2Q A;  3VI5 A;  1E6B A;  2H71 A;  1V9W A;  1JLV A;  1V2A A;  2WVY A;  2DJ3 A;  1XW6 A;  1C72 A;  5DJM A;  4W66 A;  1ZYE A;  2H0H A;  2H1B A;  3ZYW A;  3APQ A;  4WF5 A;  1BX9 A;  1S4B P;  2NPB A;  1K3L A;  4MLY A;  1SVL A;  2L6C A;  1FB6 A;  3TKR A;  2H6X A;  5DAL A;  3QAW A;  2HRK B;  5BMU A;  1SKW B;  2GS3 A;  4E8E A;  1ZYP A;  3TDG A;  1V98 A;  5KN2 A;  6GSS A;  2FD3 A;  2IMD A;  2XHF A;  4MJA A;  3DIE A;  3GV1 A;  3EVI A;  3D22 A;  2YZU A;  3NOF A;  5CRG A;  1TU8 A;  4YAP A;  1TK5 B;  5FT3 A;  1LU4 A;  3UL3 A;  5ECR B;  4XS4 A;  3LXT A;  2OBI A;  3P7X A;  1I9D A;  4WXT A;  4MZW A;  4PI2 C;  2ZNM A;  1MD4 A;  2ZUP A;  3F4S A;  4ISD A;  1J08 A;  6GST A;  5DAK B;  5D9W A;  1V40 A;  4POK A;  5BRT A;  2DC5 A;  1SD8 A;  4FYB A;  2HRA A;  4XTS A;  2PUK C;  1ON4 A;  1ERT A;  3RPP A;  2YAN A;  6GSV A;  5D96 A;  20GS A;  1MDI A;  4IBP A;  5A5K A;  1M2A A;  1F3B A;  1ZMA A;  3E9J B;  5CRH A;  1PN9 A;  5GAP D;  3RAZ A;  4MZB A;  2VCX A;  4PI0 C;  3HVX A;  4ZBA A;  4ACS A;  4ZL7 A;  3K8N A;  2OA7 A;  5J9B A;  1ZZY A;  4MMM A;  3FR9 A;  2LRT A;  2R37 A;  1QK8 A;  3FKF A;  4GLT A;  2N5A A;  2VM2 A;  3M9K A;  3W8J A;  2B5E A;  2CVD A;  4G2E A;  1XWA A;  2UZ8 A;  2KHP A;  5H5S A;  1K3Y A;  1X5E A;  4EXJ A;  1T4Y A;  1ERU A;  4MZC A;  2IIY A;  5LNK e;  2WUL A;  2E0Q A;  3TOT A;  3FZ9 A;  4XS4 B;  4WR5 A;  1YEX A;  2H73 A;  4LLR A;  5ECL B;  4POB A;  2WW0 A;  4V1A g;  4TN8 A;  5FHI A;  5LD0 A;  4KW6 A;  3PR8 A;  2YOI A;  5J4V A;  3M3M A;  3QDN A;  1T1V A;  1UN2 A;  3GST A;  2IMK A;  4F2I A;  3HA9 A;  4O7H A;  4MK3 A;  1XIY A;  2X99 A;  3E3E A;  1IYH A;  1FB0 A;  2HZE B;  2L4Q A;  4MF6 A;  2O89 A;  2O8V B;  2OE3 A;  1KNG A;  1X9M B;  3DXB A;  1FOV A;  5IMF A;  1ZGN A;  4K9Z A;  2B1K A;  1NHY A;  1XWG A;  1J9B A;  3ZML A;  1QMV A;  2KLX A;  1B9Y C;  2CZ2 A;  1G0T A;  3TJJ A;  3H93 A;  1EP8 A;  1WRY A;  1PN0 A;  1AQW A;  4FIW A;  3ERF A;  4TKY A;  2VKZ G;  1XVQ A;  1B48 A;  1VF4 A;  4K7O A;  3LOR A;  2FY6 A;  3ZMK A;  1U3A A;  3GKX A;  3S9F A;  4PNF A;  5EPF A;  4NMU A;  5A1N A;  1BQ7 A;  2R0G A;  3VWX A;  2BJX A;  2KP1 A;  3TRP A;  1GLQ A;  2YJH A;  3EWL A;  4NHZ A;  2LQO A;  1SU9 A;  2B5Y A;  4GSN A;  2VD1 A;  2L4C A;  2O3E A;  3C73 A;  2E2M A;  4YKF A;  1YDK A;  2YPM A;  2YCD A;  1O85 A;  2EIO A;  2DJK A;  1TRW A;  1DUG A;  5HFK A;  19GS A;  2QC7 A;  5KEJ A;  4RQR A;  1TDI A;  5DVB A;  4K2D A;  1YEW C;  3IR4 A;  2VCW A;  1ZL9 A;  2E7P A;  1R4W A;  4GWR A;  4O32 A;  3FZ4 A;  4ILF A;  1GL8 A;  2C3Q A;  1Z5Y E;  2VCT A;  1SJI A;  1GUK A;  4GDF A;  2XBI A;  5F0G A;  4E8H A;  3NZN A;  4PHZ C;  4N0Z A;  3LWA A;  4V2L A;  4NV2 A;  1K0A A;  4QMK A;  3ZLP A;  4DSS B;  5FWG A;  3D21 A;  3FZ5 A;  2VLV A;  2CT6 A;  1OKD A;  5H5Q A;  2QA2 A;  5JWR B;  1R7H A;  2LJA A;  3F9U A;  4TOP A;  5G5E A;  4EIP A;  1GUH A;  5A5H A;  4ZL8 A;  2D2Z A;  2WVZ A;  3F6F A;  2DKI A;  3HHV A;  1SJZ A;  3A5I A;  2WVX A;  4EF0 A;  5A1N B;  4K0N A;  4LMW A;  3IHG A;  1PKW A;  1I5G A;  3IK7 A;  3ERG A;  8GSS A;  2EFE A;  1OAZ A;  1PL2 A;  1GSE A;  2FCH A;  3APO A;  5G1K A;  1SK1 A;  1OVN A;  3UBK A;  3MIX A;  4ZBD A;  1ACV A;  5GZZ B;  5J40 A;  4FO5 A;  4LL1 B;  5ECP B;  4I8B A;  4WR4 A;  4O5Q A;  4YAV A;  3IXR A;  5KOX A;  1Q98 A;  1THX A;  4EDZ A;  2LRN A; 
#chains in the Genus database with same CATH homology
 4GRF A;  4K8M A;  3NIV A;  1OC9 A;  3IE3 A;  4FYU A;  1M99 A;  4MDC A;  1SJ6 A;  2MMZ A;  1YEP A;  3A5W A;  3UVT A;  4MH2 A;  4XCS A;  3PPU A;  1S3D A;  3L9S A;  5KOW A;  2BMX A;  4POM A;  3GL3 A;  4HQZ A;  5B8A A;  2PBJ A;  2A2R A;  2ES7 A;  2IPA A;  3APS A;  1GNW A;  3OR5 A;  5A5H B;  5J4Y A;  3GL5 A;  4N30 A;  1TTZ A;  4KCE A;  2R4V A;  2F8A A;  1FW1 A;  2FNO A;  1K0M A;  2V2G A;  3BD2 A;  3GX8 A;  3DVX A;  2I3Y A;  1Y1U A;  2JAC A;  1G7O A;  1UVZ A;  3M9J A;  3FR3 A;  2MMN A;  1FAA A;  1M7T A;  1B9X C;  3VWU A;  2XBQ A;  2QKE A;  1NHO A;  4JRR A;  5ECQ B;  4DSQ A;  4N10 A;  1BAY A;  1SEN A;  4EC0 A;  2CAQ A;  1GNE A;  3TRX A;  1XFL A;  5CRD A;  4KAE A;  1JFU A;  3GUS A;  1G6W A;  1GWC A;  3PH9 A;  5IIZ A;  2HSH A;  2H75 A;  4TR1 B;  4ECJ A;  3F3Q A;  5A4V A;  3KP9 A;  3IC8 A;  3P8W A;  2HZF A;  1T7P B;  2YP6 A;  4EE0 A;  1RQM A;  2C4J A;  2FWG A;  2DML A;  5JWO B;  2CX4 A;  3L0H A;  2GSS A;  1OC3 A;  1T4Z A;  3CWG A;  2H6Z A;  2PPT A;  1PMT A;  1A0R P;  4V2N A;  1SYX A;  2VAF A;  3HZ8 A;  4XRD A;  4X4J A;  5C04 A;  2EFD A;  4PQ1 A;  5AIV A;  4FYC A;  4RQX A;  2HLS A;  4ECC A;  3C71 A;  2C0E A;  2ON5 A;  3D6I A;  3UJ1 A;  5CAX A;  1EV4 A;  2DKH A;  2R0C A;  5KN0 A;  4JE1 A;  2P5R A;  4AF2 A;  1Z7R A;  2H8L A;  2R2J A;  2RLI A;  3QR6 A;  1A2J A;  2LJR A;  3VLN A;  3GMF A;  4TVE A;  4AJ8 A;  4TXO B;  3M1G A;  2X8H A;  3HZ4 A;  2F8F A;  2PWJ A;  3VPQ A;  3ZIJ A;  3F0I A;  4IHU A;  4ZB6 A;  4MJC A;  4HZ4 A;  1KBN A;  1PSQ A;  2VL9 A;  4BL7 B;  2UV8 G;  4IGJ A;  3HCZ A;  4JU5 A;  3HJP A;  2X64 A;  2WCI A;  3CMI A;  1MEK A;  1XCC A;  2FLS A;  1UA5 A;  2NBS A;  5HFI A;  2OE0 A;  2V1M A;  5B6M A;  2PVO C;  4GTU A;  4IW9 A;  1TP9 A;  2H1D A;  3P90 A;  3KGK A;  4CDO A;  2IWT A;  1N2A A;  3BOA A;  3FW2 A;  1BF5 A;  2O87 A;  2A4V A;  3TRQ A;  2GSQ A;  4YH2 A;  5GST A;  3ERW A;  4ULX A;  3GYK A;  4ZBB A;  4OFT A;  4K6X A;  1BG1 A;  4EO3 A;  3HVS A;  4PXO A;  2N5B A;  1XZO A;  2REM A;  4OCE A;  1SVO A;  3FHK A;  4K7I A;  5G2Z A;  2GTU A;  1SK2 A;  2C1Y A;  4GSS A;  4I5Q A;  5EVO A;  3UBL A;  1T3B A;  1K0D A;  3QAG A;  3P2A A;  3CXG A;  4O5R A;  1PA3 A;  3MWH A;  4WKW A;  3CRU A;  2VL3 A;  1SKS B;  2L5L A;  4MPG A;  3BJ5 A;  5J41 A;  1WE0 A;  5IMV A;  1WWJ A;  3TKS E;  5AIX A;  4KH7 A;  2YJ7 A;  1YQ1 A;  5D93 A;  1JZR A;  4NXI A;  3RHB A;  3GTU A;  4KDU A;  1E2Y A;  5CO3 A;  3TB2 A;  1GLP A;  5DAL B;  4AKG A;  2I4A A;  1ZOF A;  5IPG A;  1K0O A;  4KCA A;  2C8U A;  1HQO A;  5BMU B;  1M9A A;  2GLR A;  4G01 A;  3ME7 A;  4ML1 A;  2VUP A;  1G6Y A;  4KGI A;  3J7Y b;  4EKZ A;  4XS6 A;  2B6M A;  3IPZ A;  1RK4 A;  10GS A;  2CVK A;  2LUS A;  2LNS A;  2VLU A;  1SK0 A;  5D9X A;  5E59 A;  4AJ6 A;  2ZCT A;  4PUR A;  1X5D A;  3IV4 A;  1VRS D;  2GDR A;  3DGQ A;  7GSS A;  2L6D A;  3H8Q A;  1FVK A;  1TRU A;  17GS A;  2NDO A;  3L9U A;  4DSR A;  4HOJ A;  3O3T A;  4L5L A;  1M0U A;  3HD5 A;  2WB9 A;  3F4T A;  4Z7X A;  1OKT A;  4EL1 A;  1TOF A;  2IFQ A;  2IL3 A;  3D4T A;  4KUN A;  4X0X A;  2LS5 A;  4JZQ A;  1R5A A;  4V1A p;  3TJF A;  2PGT A;  4IEL A;  5ECH B;  4KSM A;  6GSU A;  1XBS A;  3EPT A;  4ZIJ A;  4D73 A;  5HQP A;  1ERV A;  5DCG A;  2B7J A;  1PL1 A;  2LJK A;  2VM1 A;  2FUG 2;  1DE1 A;  3IC4 A;  2KOK A;  1F6M C;  3KH7 A;  3VFI A;  4BPY A;  3KTL A;  3KIJ A;  1X9S B;  3GSS A;  4IQA A;  3RDW A;  1GTA A;  3VWV A;  4AKH A;  2JSY A;  1JZO A;  1EGR A;  1YY7 A;  3FEU A;  4J57 E;  1TI1 A;  2H66 A;  4HI7 A;  4ICY A;  2IME A;  1Y6E A;  3MDK A;  4ZIL A;  3GKK A;  2EFC A;  4OO5 A;  4AGS A;  4PTS A;  2EIR A;  2YV9 A;  1M2D A;  2R6K A;  1YF1 A;  3IRA A;  5AGY A;  3L78 A;  3Q18 A;  4Q5Q A;  2C0D A;  1EOH A;  1A8Y A;  4G0K A;  1U87 A;  2DLX A;  1O8W A;  5HR2 A;  2GZP A;  2IMF A;  2HSY A;  2GT6 A;  1GSQ A;  4RI7 A;  5HR0 A;  4DVC A;  2P0G A;  5EY6 A;  3F8U A;  4HUA A;  2B1L A;  4YKG A;  3GRX A;  4ZB7 A;  4ECB A;  4G9H A;  2LKU A;  1FG4 A;  4PUA A;  1JZW A;  2X4A A;  4EVM A;  1GSF A;  2AHE A;  1YVL A;  2P5Q A;  1XVW A;  2MYG A;  1TI3 A;  3FZA A;  1J0F A;  5AIS A;  3EIN A;  4PX1 A;  1N8J A;  1B8X A;  4J2F A;  4JBB A;  2H01 A;  1NM3 A;  1TRS A;  4K5R A;  5L71 A;  3F6D A;  4ZB9 A;  4D73 B;  4K0G A;  1ZYQ B;  1AQX A;  4JED A;  1TKD B;  2H1L A;  3SBC A;  5IOX A;  3TOU A;  1BYE A;  4HZ2 A;  3EU4 A;  5CP1 A;  3TUE A;  2HNL A;  2LEG A;  4WBR D;  3DD3 A;  1H75 A;  3GHA A;  1QQ2 A;  2MZC A;  2OE1 A;  3Q74 A;  2QSI A;  4USS A;  4PQH A;  3CYN A;  3G9B A;  4NWY A;  3DVW A;  1ZCP A;  4WF4 A;  3ZIV A;  3KM6 A;  2HSN A;  2OBK A;  2PN8 A;  1SVM A;  3F3R A;  4OFM A;  2H72 A;  9GSS A;  4Q5N A;  2LV3 A;  5AN1 A;  1R5P A;  4HQS A;  3ISO A;  3EMX A;  5F06 A;  2M80 A;  4IVF A;  4X43 A;  1W89 A;  2B7K A;  2TRC P;  3IDV A;  5J9C A;  4KDX A;  1GUL A;  4K7N A;  1VF3 A;  5ELG A;  1F9M A;  2C3T A;  1XPV A;  2MMO A;  4WEY A;  4TR4 A;  2VD0 A;  1AXD A;  4ZB8 A;  4ML6 A;  3GX0 A;  5CNW A;  1BG5 A;  1GUM A;  2FA4 A;  4KB3 A;  3WGX A;  2F51 A;  3GUR A;  3I9V 2;  4F0C A;  1ML6 A;  2DSA A;  4IP6 A;  3O76 A;  4CHS A;  3WGD A;  1PQN A;  1WPI A;  1K0N A;  3US3 A;  2HQT A;  1XW5 A;  2CVB A;  5LCZ A;  5DQS A;  3UVH A;  2VO4 A;  3TCO A;  1MTC A;  1XWK A;  3WYW A;  3Q19 A;  2AB6 A;  1EEJ A;  2K8S A;  3H79 A;  5DBQ A;  3GH9 A;  1WJK A;  2VOC A;  1QUW A;  1T00 A;  2X8G A;  3HYP A;  4Q5R A;  5IMZ A;  2HRN A;  3GN3 A;  1HNB A;  4OCF A;  3ZZX A;  3LG6 A;  5D73 A;  4X1U A;  2OAC A;  5ECI B;  3FRC A;  4IN0 A;  2HSN B;  2RUF A;  4RUV A;  3QFB C;  1M9B A;  2WDU A;  4BWQ A;  1VF2 A;  5ECK B;  5DCH A;  2JZR A;  4YQM A;  3KZQ A;  1O81 A;  1GSD A;  4EUY A;  4TR0 A;  2VL2 A;  1HD2 A;  3GIX A;  2V6O A;  4IS0 A;  3H4K A;  2X49 A;  2EFH A;  3DKS A;  4HDE A;  5F05 A;  4NHW A;  3U5R E;  3ZRD A;  2TRX A;  4N11 A;  4G0I A;  3W8S A;  5COH A;  1TXU A;  1X9W B;  3QD9 A;  4BVY A;  2YWI A;  5ECS A;  1ZYN A;  4CW9 A;  1ST9 A;  2V32 A;  4MJB A;  3QAV A;  5ABR A;  2I81 A;  1JZD A;  3UAR A;  1K3O A;  1SYR A;  2MBS A;  4GCI A;  5C00 A;  3VPT A;  2EC4 A;  4KE3 A;  1OC9 B;  4L8E A;  2C0F A;  5EL8 A;  3G7J A;  3CTF A;  3O6T A;  1UC7 A;  4XIH A;  4J56 E;  3LXZ A;  4ZXG A;  4AI6 A;  1S3A A;  3D5J A;  1A2L A;  16GS A;  3D0Z A;  1RW1 A;  2VCV A;  5JWQ B;  3AY8 A;  2VCQ A;  2IMI A;  2GVP A;  1ABA A;  1V58 A;  5A34 A;  1PGT A;  4YQV A;  4KND A;  1DSB A;  5B8B A;  4I2T A;  3ZVJ D;  1GH2 A;  2XPD A;  4KF9 A;  1U3I A;  4ID0 A;  4NV5 A;  1DBY A;  3FMW A;  4ECI A;  1U6T A;  5ECN B;  4MJE A;  5ECO B;  2O7K A;  3I6A A;  4CY6 A;  2M72 A;  2YN1 A;  3GNJ A;  2P31 A;  4I2U A;  4KA0 A;  1AQV A;  1EGO A;  1Z6N A;  5DJL A;  2L59 A;  4OMV A;  1Y25 A;  3N9J A;  3SWL A;  4G10 A;  1QFN A;  4PNG A;  2VL2 C;  5IQY A;  4NPB A;  1GRX A;  3LFL A;  1VGL A;  5F8B A;  2CQ9 A;  5DAK A;  3GA4 A;  3UEM A;  1FHE A;  3JCM L;  5IMC A;  1XWB A;  1FVJ A;  2DJ1 A;  1V57 A;  1Q4J A;  2AYT A;  3A3T A;  4G19 A;  5HFG A;  3C8E A;  4BVY B;  2H0I A;  1A8L A;  2C0G A;  3HKR A;  2KUC A;  2OAD A;  2AJQ B;  2JZS A;  3CSI A;  5INY A;  4F03 A;  3DYR A;  1F3A A;  2PMT A;  3HXS A;  1XWC A;  2DJ0 A;  1K0C A;  1Z7P A;  2H76 A;  4OFN A;  3ZFB A;  2K6V A;  4Z2U A;  2GGT A;  3UMA A;  4K5S A;  2RII A;  1OE8 A;  1WOU A;  1AIU A;  4HS1 A;  2LRC A;  12GS A;  1NW2 A;  3EU3 A;  3WT2 A;  1YKC A;  2I9H A;  5DQY A;  4OD7 A;  1GSU A;  3VUR A;  3HMJ G;  1WMJ A;  3GFK A;  3ME8 A;  4HU7 A;  5A34 B;  3QMX A;  5G1L A;  3IAS 2;  4DEJ A;  3KH9 A;  1HYU A;  4TR3 A;  1A0F A;  4HJ2 A;  5JCW A;  14GS A;  4IJI A;  1XXU A;  1EWX A;  1K0B A;  1R26 A;  2R0P A;  1WIK A;  2H30 A;  5IMA A;  2WGR A;  5B6N A;  2DMM A;  2L5O A;  4EDY A;  2WZ9 A;  1MD3 A;  3RBT A;  5IO2 A;  3BBY A;  2K18 A;  2PVQ A;  4K1F A;  4GST A;  2HI7 A;  1SD9 A;  1URM A;  4NAX A;  2F3M A;  3H1N A;  4Z2T A;  3LEF A;  3LYP A;  2JU5 A;  2QA1 A;  3TGZ A;  2HZE A;  3BCK A;  3KMN A;  3VI7 A;  4BA7 A;  4CY8 A;  5B7C A;  3DWV A;  4QQ7 A;  2H6Y A;  3RPN A;  2WS2 A;  2WJU A;  5D9V A;  2JAD A;  3LW9 A;  1X0R A;  1MDJ A;  2DIZ A;  4QL7 A;  4BWS A;  1A24 A;  1EEM A;  18GS A;  4BVX A;  5IMD A;  2OJL A;  3FY7 A;  3GKN A;  2PU9 C;  5A4U A;  2AUV A;  1YKA A;  3LYK A;  2JSZ A;  1YJ6 A;  1PD2 1;  4KDY A;  6GSX A;  3M8N A;  4AKI A;  5CRW A;  1X5C A;  2CZ3 A;  5HR1 A;  4TRX A;  3KEB A;  4TXV A;  4L0W A;  2HE3 A;  3GKM A;  2HSM A;  1FOH A;  1KTE A;  1EZK A;  5CRE A;  1XOB A;  3I69 A;  2GQL A;  3TKP A;  5IPH A;  1LBK A;  4G0L A;  1M2B A;  3J7Y k;  3PIN A;  2PER A;  2JZT A;  5KN3 A;  5A4W A;  4XRA A;  4K2X A;  5IM9 A;  5G5F A;  1S3C A;  2XPE A;  3BCI A;  4GF0 A;  4JR4 A;  2LST A;  2Z9S A;  3EYT A;  4IJ3 A;  3FYG A;  2H19 A;  2KP2 A;  2LTK A;  1AUC A;  3GTU B;  3IBH A;  1SL1 B;  4PUF C;  5IO0 A;  1TU7 A;  1PX7 A;  3FR6 A;  2E2G A;  4TW5 A;  3N5O A;  3MSZ A;  3M0F A;  3MAK A;  4WET A;  3CSJ A;  1TK8 B;  4OO4 A;  2F9S A;  1AAZ A;  4EIQ A;  2FWH A;  3A2V A;  4O5U A;  2GQK A;  3FK8 A;  1OYJ A;  4BVX B;  3KTB A;  3ED3 A;  1GTB A;  4LMV A;  3QCP A;  4DSS A;  1PX6 A;  3EE2 A;  2G0F A;  2K8V A;  1F2E A;  4YQU A;  2O5V A;  4FH8 A;  1CQG A;  4JR6 A;  5J5N A;  2GZY A;  3ZL5 A;  3R2Q A;  4H86 A;  5CYY A;  3KP8 A;  3EMP A;  3DRN A;  3IOS A;  3RHC A;  4MP4 A;  2A2P A;  2YZH A;  4XS1 A;  3L4N A;  2DBC A;  4MNN A;  4LA1 A;  4GQF A;  2J9H A;  2IFQ B;  3UIW A;  3WT1 A;  2HSM B;  1O6J A;  4N3Z A;  1GSY A;  2MMA A;  1BJX A;  5DDL A;  1U88 A;  4FQU A;  2O85 A;  3ZIT A;  4PQI A;  3VK9 A;  1JLW A;  2FGX A;  3IK9 A;  4AKX B;  5HR3 A;  4MF5 A;  1O73 A;  5E4W A;  1HNC A;  4MCU A;  3HDC A;  3LQ7 A;  4ZL9 A;  5ECM B;  2FWF A;  3QPM A;  2GQM A;  3W6G A;  4Q5F A;  1O8X A;  5ENU A;  1JHB A;  5JCU A;  2GZZ A;  4GQC A;  2A2S A;  5ELA A;  2V6K A;  3HJO A;  5GAN D;  5ID2 A;  4AJ7 A;  1THO A;  3CBU A;  2YV7 A;  5G30 A;  2OKA A;  1USB A;  3TKS A;  3WD6 A;  2XC2 A;  4Z2R A;  4P3Y B;  4L5O A;  2K9F A;  5J47 A;  1TW9 A;  2NVL A;  4MF7 A;  22GS A;  2MBT A;  5H5R A;  4HEA 2;  4RI6 A;  2LQQ A;  4GXZ A;  3KJY A;  2C80 A;  5D9T A;  3TU3 B;  3HVV A;  4PGT A;  2J23 A;  3LGC A;  3EC3 A;  1G7E A;  3KMO A;  4I6X A;  3R3E A;  4F0B A;  4E68 A;  3UOM A;  4L0U A;  2IJY A;  4MA9 A;  1A2M A;  1XOA A;  1DE2 A;  1Z3E A;  2HFD A;  3VWW A;  2GT5 A;  4IQ1 A;  1PRX A;  2HXK A;  4A5P A;  3C7M A;  3TJG A;  2B5X A;  2H1A A;  3D4M A;  5J4U A;  3G7I A;  4MH3 A;  1FO5 A;  3L9V A;  5F07 A;  3KD0 A;  1EV9 A;  2OT3 A;  3TKQ A;  4KSO A;  3F63 A;  3Q6O A;  11GS A;  1NSW A;  3HJM A;  4IP1 A;  1VF1 A;  3C1R A;  1ERW A;  3C1S A;  1Z6M A;  3ZFL A;  3GH6 A;  3E0U A;  1B4P A;  3QFA C;  13GS A;  3LSZ A;  1TRV A;  4TR1 A;  2VLT A;  2HRF A;  5J3R A;  1Z9H A;  2R3X A;  1O7U A;  2AV4 A;  2L57 A;  1TXX A;  2FWE A;  1EP7 A;  3PGT A;  2BTO T;  2H70 A;  3KXO A;  2ALB A;  2YWM A;  2N5F A;  3G7Y A;  4OWY A;  3TJK A;  2CX3 A;  3CTG A;  4N0V A;  2DJJ A;  1CQH A;  2V41 A;  2X8C A;  5ID2 B;  1H4O A;  3TKS C;  4F82 A;  2R5G A;  1OE7 A;  2GSR A;  5GSS A;  6GSW A;  4IKH A;  3TJB A;  2HT9 A;  2YNX A;  4POL A;  5G31 A;  1PKZ A;  2AAW A;  4I97 A;  2VCZ A;  3QOU A;  3U6V A;  1N25 A;  6GSY A;  3UAP A;  3DML A;  3MYD A;  5KN1 A;  2TIR A;  1IYI A;  3IAM 2;  2DIY A;  1EOG A;  1GSS A;  3LJR A;  2WFC A;  4QL9 A;  2WRT A;  4MPF A;  1A23 A;  1SL0 B;  1SL2 B;  2JL4 A;  2ON7 A;  3IA1 A;  1GTU A;  2QGV A;  4TXO A;  3I43 A;  1OC8 A;  2IN3 A;  2B3S A;  3A2X A;  1B4Q A;  2LNT A;  3ZTL A;  1T8E B;  4V2M A;  2H0G A;  4BL7 A;  5IOW A;  5JCG A;  1XW9 A;  3CRT A;  3ZRE A;  2NTO A;  4LL4 B;  2RUE A;  2H74 A;  1QGV A;  4MAB A;  2GST A;  2HRK A;  2FHE A;  2M46 A;  3A2W A;  2HYX A;  3WGE A;  2I1U A;  1WP0 A;  3MNG A;  1F37 A;  3IHQ A;  3F4R A;  5D8I A;  4XHM A;  1YZX A;  1GTI A;  2CAI A;  1ILO A;  1BED A;  1KEB A;  1YF0 A;  1TK0 B;  4O92 A;  2CV4 A;  1GP1 A;  4HU9 A;  2FA8 A;  1W4V A;  2RM6 A;  2YWO A;  3HY2 A;  1MDK A;  4F9Z A;  1TJD A;  3ZVJ A;  3EUR A;  4WBJ A;  2VIM A;  1AW9 A;  2C3N A;  4KX4 A;  1LJR A;  3CSH A;  2A4H A;  3DEX A;  4HJM A;  2DJ2 A;  2CA8 A;  1AC1 A;  2RM5 A;  1SKR B;  2H1G A;  1HNA A;  2YWN A;  1QXH A;  2EIQ A;  3V1W A;  3KCM A;  2G2Q A;  3VI5 A;  1E6B A;  2H71 A;  1V9W A;  1JLV A;  1V2A A;  2DJ3 A;  1XW6 A;  1C72 A;  5DJM A;  4W66 A;  1ZYE A;  2H0H A;  2H1B A;  3ZYW A;  3APQ A;  4WF5 A;  1BX9 A;  2NPB A;  1K3L A;  4MLY A;  1SVL A;  2L6C A;  1FB6 A;  3TKR A;  2H6X A;  5DAL A;  3QAW A;  2HRK B;  5BMU A;  1SKW B;  2GS3 A;  4E8E A;  1ZYP A;  3TDG A;  1V98 A;  5KN2 A;  6GSS A;  2FD3 A;  2IMD A;  2XHF A;  4MJA A;  3DIE A;  3GV1 A;  3EVI A;  3D22 A;  2YZU A;  3NOF A;  5CRG A;  1TU8 A;  4YAP A;  1TK5 B;  5FT3 A;  1LU4 A;  3UL3 A;  5ECR B;  4XS4 A;  3LXT A;  2OBI A;  3P7X A;  1I9D A;  4WXT A;  4MZW A;  2ZNM A;  1MD4 A;  2ZUP A;  3F4S A;  4ISD A;  1J08 A;  6GST A;  5DAK B;  5D9W A;  1V40 A;  4POK A;  5BRT A;  2DC5 A;  1SD8 A;  4FYB A;  2HRA A;  4XTS A;  2PUK C;  1ON4 A;  1ERT A;  3RPP A;  2YAN A;  6GSV A;  5D96 A;  20GS A;  1MDI A;  4IBP A;  5A5K A;  1M2A A;  1F3B A;  1ZMA A;  3E9J B;  5CRH A;  1PN9 A;  5GAP D;  3RAZ A;  4MZB A;  2VCX A;  3HVX A;  4ZBA A;  4ACS A;  4ZL7 A;  3K8N A;  2OA7 A;  5J9B A;  1ZZY A;  4MMM A;  3FR9 A;  2LRT A;  2R37 A;  1QK8 A;  3FKF A;  4GLT A;  2N5A A;  2VM2 A;  3M9K A;  3W8J A;  2B5E A;  2CVD A;  4G2E A;  1XWA A;  2UZ8 A;  2KHP A;  5H5S A;  1K3Y A;  1X5E A;  4EXJ A;  1T4Y A;  1ERU A;  4MZC A;  2IIY A;  5LNK e;  2WUL A;  2E0Q A;  3TOT A;  3FZ9 A;  4XS4 B;  4WR5 A;  1YEX A;  2H73 A;  4LLR A;  5ECL B;  4POB A;  4V1A g;  4TN8 A;  5FHI A;  5LD0 A;  4KW6 A;  3PR8 A;  2YOI A;  5J4V A;  3M3M A;  3QDN A;  1T1V A;  1UN2 A;  3GST A;  2IMK A;  4F2I A;  3HA9 A;  4O7H A;  4MK3 A;  1XIY A;  2X99 A;  3E3E A;  1IYH A;  1FB0 A;  2HZE B;  2L4Q A;  4MF6 A;  2O89 A;  2O8V B;  2OE3 A;  1KNG A;  1X9M B;  3DXB A;  1FOV A;  5IMF A;  1ZGN A;  4K9Z A;  2B1K A;  1NHY A;  1XWG A;  1J9B A;  3ZML A;  1QMV A;  2KLX A;  1B9Y C;  2CZ2 A;  1G0T A;  3TJJ A;  3H93 A;  1EP8 A;  1WRY A;  1PN0 A;  1AQW A;  4FIW A;  3ERF A;  4TKY A;  2VKZ G;  1XVQ A;  1B48 A;  1VF4 A;  4K7O A;  3LOR A;  2FY6 A;  3ZMK A;  1U3A A;  3GKX A;  3S9F A;  4PNF A;  5EPF A;  4NMU A;  5A1N A;  1BQ7 A;  2R0G A;  3VWX A;  2BJX A;  2KP1 A;  3TRP A;  1GLQ A;  2YJH A;  3EWL A;  4NHZ A;  2LQO A;  1SU9 A;  2B5Y A;  4GSN A;  2VD1 A;  2L4C A;  3C73 A;  2E2M A;  4YKF A;  1YDK A;  2YPM A;  2YCD A;  1O85 A;  2EIO A;  2DJK A;  1TRW A;  1DUG A;  5HFK A;  19GS A;  2QC7 A;  5KEJ A;  4RQR A;  1TDI A;  5DVB A;  4K2D A;  3IR4 A;  2VCW A;  1ZL9 A;  2E7P A;  1R4W A;  4GWR A;  4O32 A;  3FZ4 A;  4ILF A;  1GL8 A;  2C3Q A;  1Z5Y E;  2VCT A;  1SJI A;  1GUK A;  4GDF A;  2XBI A;  5F0G A;  4E8H A;  3NZN A;  4N0Z A;  3LWA A;  4V2L A;  4NV2 A;  1K0A A;  4QMK A;  3ZLP A;  4DSS B;  5FWG A;  3D21 A;  3FZ5 A;  2VLV A;  2CT6 A;  1OKD A;  5H5Q A;  2QA2 A;  5JWR B;  1R7H A;  2LJA A;  3F9U A;  4TOP A;  5G5E A;  4EIP A;  1GUH A;  5A5H A;  4ZL8 A;  2D2Z A;  3F6F A;  2DKI A;  3HHV A;  1SJZ A;  3A5I A;  4EF0 A;  5A1N B;  4K0N A;  4LMW A;  3IHG A;  1PKW A;  1I5G A;  3IK7 A;  3ERG A;  8GSS A;  2EFE A;  1OAZ A;  1PL2 A;  1GSE A;  2FCH A;  3APO A;  5G1K A;  1SK1 A;  1OVN A;  3UBK A;  3MIX A;  4ZBD A;  1ACV A;  5GZZ B;  5J40 A;  4FO5 A;  4LL1 B;  5ECP B;  4I8B A;  4WR4 A;  4O5Q A;  4YAV A;  3IXR A;  5KOX A;  1Q98 A;  1THX A;  4EDZ A;  2LRN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...