4ECCA

Chimeric gst containing inserts of kininogen peptides
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
228
structure length
206
Chain Sequence
SPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase, protein binding
molecule keywords chimeric protein between GSHKT10 and domain 5 of kininogen-1
publication title Chimeric glutathione S-transferases containing inserts of kininogen peptides: potential novel protein therapeutics.
pubmed doi rcsb
source organism Schistosoma japonicum
total genus 71
structure length 206
sequence length 228
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2012-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4eccA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4eccA01
1YZXA 1NM3A 3D22A 2JZRA 3UVHA 1T4ZA 2B5XA 16GSA 4OFTA 1DBYA 3C7MA 1DUGA 3HZ4A 2VM2A 1WE0A 2VD0A 1X9WB 1K0MA 2HRAA 2F51A 4NWYA 2OE1A 3A2VA 2PERA 3R3EA 4BL7A 3ME7A 2TRXA 2FWHA 5IPHA 5ABRA 2HSMA 1TDIA 4JBBA 2GLRA 2L5OA 5ECLB 3US3A 2KLXA 1XW9A 5CAXA 1R4WA 2H71A 5A5KA 3F4RA 3TRPA 2GQLA 1M9AA 4PX1A 1GSUA 3KGKA 3LWAA 1U88A 1B9XC 4HU7A 3F0IA 3KCMA 5ECNB 3KXOA 14GSA 1TXXA 1K3LA 4GQFA 3ZTLA 4WETA 4PQIA 2CQ9A 3FZAA 2OBKA 4IS0A 1CQGA 4F0BA 3TRQA 3APQA 5CNWA 4YQUA 4K7NA 5GAND 3E3EA 1O7UA 2HRKB 3P2AA 4TOPA 3TOTA 22GSA 1URMA 4MPFA 3QCPA 3KMNA 1M7TA 2I81A 2HZEA 6GSVA 1T4YA 1PX7A 2O7KA 3F6DA 3KJYA 1OKDA 4XHMA 5FHIA 4KDYA 2YZHA 2V32A 2DJ1A 2NDOA 1QFNA 3GIXA 2GSSA 2WDUA 3BBYA 4MK3A 3L9SA 4XS4B 5IPGA 3FR3A 1SKRB 1GP1A 4KF9A 3UVTA 1THOA 4ZXGA 3ZL5A 3GA4A 2RUFA 2VCVA 2H6YA 4V1Ag 2VCQA 1X5EA 4KB3A 2GS3A 4HI7A 3HJMA 4IKHA 2P0GA 3S9FA 5GAPD 1TRUA 2JU5A 3KD0A 2YWIA 4JEDA 5ECKB 3H1NA 4XIHA 1XWGA 2D2ZA 3DRNA 4PQ1A 1O81A 2FHEA 4ZL8A 1Y6EA 2KP1A 3EYTA 3SWLA 4D73A 1VF3A 2V6OA 4MJCA 4N11A 1TOFA 4G0LA 1VF1A 3W8SA 3CXGA 1G7EA 2F8FA 5EY6A 5GZZB 2K9FA 2EIRA 1LJRA 1SD8A 2LEGA 5EVOA 4IQ1A 2WFCA 1RK4A 4NV2A 1N8JA 3A2XA 4BVYA 3WGEA 1KNGA 4EE0A 3KTBA 3QAGA 3ERWA 2VL3A 1JZRA 2IN3A 4BWQA 2WZ9A 1ERVA 4MJBA 1GTAA 1FW1A 4IVFA 2O85A 1GSYA 2AUVA 2GQMA 5ECSA 2B6MA 1TJDA 2E0QA 5FWGA 1SJIA 1OE7A 1YY7A 4GLTA 4O92A 4DSQA 4WKWA 2VO4A 1HYUA 5ECHB 4IQAA 4TR1B 4WF5A 4IJIA 1BG5A 2ON7A 4I6XA 4DVCA 2GSTA 9GSSA 4ISDA 1JHBA 1FG4A 4KW6A 5ECOB 2CV4A 3RPNA 1SKSB 3E0UA 3EMPA 5FT3A 2B3SA 2OA7A 1FHEA 1OC9B 5HFIA 1F37A 1SL1B 2OBIA 5D9WA 5F0GA 4MP4A 4WEYA 4MDCA 4G0KA 2O89A 2CT6A 1O73A 5D73A 3ZRDA 3RHCA 4YH2A 4EF0A 4F9ZA 4ILFA 2YPMA 4KA0A 3RPPA 5HR0A 1R5PA 2JSZA 4KCEA 3VPTA 3GSTA 1WPIA 4F03A 4XS4A 1MDIA 2FNOA 3UL3A 1ILOA 2H66A 4JZQA 5B8BA 2HNLA 5D93A 3WT1A 1J08A 2DSAA 2H6XA 4V2MA 1YF1A 3EINA 4WF4A 2H0GA 3F3QA 2QC7A 3DMLA 2YOIA 4RI7A 2NTOA 4ZILA 3ZREA 4Q5QA 2YV9A 4EDYA 3QFBC 2DIZA 2KHPA 3LJRA 1Z5YE 7GSSA 1H4OA 5ECIB 2GSQA 4I2UA 3FW2A 1G6WA 4Q5FA 2B5EA 5ECRB 5ID2A 3HKRA 2LRTA 1SK2A 2VIMA 1SYXA 3GYKA 4AJ8A 2XBIA 3TJFA 1LU4A 5C04A 4PTSA 4MA9A 2E2MA 4GCIA 1XWCA 2JSYA 4MJEA 2ZCTA 4H86A 5IMDA 5H5QA 4POLA 2LS5A 5H5SA 4HUAA 5J9CA 4L5LA 1K0NA 2H75A 3ZITA 2V1MA 4BL7B 2REMA 3QMXA 3UIWA 1FVKA 2HSMB 2LRNA 1EP8A 2WJUA 1EV4A 3ZZXA 2L4CA 1PGTA 1GL8A 5CRDA 2HXKA 2VL2A 2HT9A 3C73A 4PQHA 2HYXA 3VI7A 4MF6A 5F05A 3FEUA 2H0HA 4YQVA 2PPTA 3C1SA 18GSA 1BAYA 5J3RA 5B7CA 1TK8B 3LORA 3DIEA 2LNSA 2YV7A 2C80A 1ERWA 5F06A 1XW6A 1TP9A 3I9V2 5DDLA 2LUSA 4WBRD 3CRTA 4E8HA 3GL3A 5GSSA 3DWVA 2OE0A 1HNBA 5JCGA 1XVWA 2H1AA 1K0BA 2AV4A 3QR6A 4HS1A 2C8UA 1EEJA 4XRDA 2H72A 3FKFA 4YAVA 1KBNA 3HVSA 2HZEB 1TRWA 5ELGA 4N10A 2MMAA 3HHVA 2QGVA 2XBQA 1K3YA 4ZIJA 1GNEA 5ENUA 4K7OA 4G9HA 3GV1A 3MWHA 4LMWA 4ZBBA 3FZ4A 4GWRA 2H1DA 1AC1A 2DMLA 2LTKA 1M99A 2A2RA 3FK8A 4KX4A 1JZWA 5B6MA 3O6TA 3JCML 3O76A 2H8LA 2PUKC 2ZUPA 1X5DA 3RHBA 1R26A 3C71A 6GSSA 3N9JA 1XOAA 2YWOA 4OD7A 1GNWA 4L5OA 2XPEA 3VPQA 5GSTA 4IP1A 5LCZA 3TB2A 1K0OA 2OKAA 4GQCA 2DJ0A 5CRHA 5CRWA 4BA7A 2LRCA 2WS2A 3APOA 1F6MC 5AN1A 2KOKA 3UBLA 3MSZA 3PINA 5JWOB 2N5FA 3LQ7A 3KP8A 4K2DA 5HR2A 3QFAC 3HVXA 2CA8A 4D73B 1E2YA 1I9DA 4BVXA 3KZQA 3CRUA 1WWJA 2X99A 3LEFA 1TW9A 1GSDA 1MTCA 1Y25A 5CYYA 3TRXA 1BX9A 4CDOA 3F3RA 4L0WA 3CTFA 3OR5A 4ECIA 4BVYB 4HDEA 6GSUA 2F8AA 6GSTA 2J23A 4IW9A 2JADA 1X9MB 5F07A 2L6CA 3P7XA 2RM6A 3FR9A 4Z7XA 2LJAA 3A3TA 2PGTA 4XS6A 3IR4A 4NAXA 3TJBA 4FO5A 2LJRA 2VCZA 2V6KA 2FA4A 3GMFA 4MZBA 5COHA 2HSYA 1C72A 4FH8A 2MBSA 5F8BA 4ECCA 2PN8A 3IAS2 5CREA 4F82A 1GTUA 1B4QA 1OKTA 5J4UA 2P5RA 1YDKA 2G2QA 4XS1A 4Q5NA 1PA3A 5HFKA 5E4WA 4I97A 4HQZA 4WR5A 3PR8A 4P3YB 3N5OA 5A4UA 3GHAA 5DCHA 2H70A 2XC2A 3TCOA 2LJKA 3K8NA 5IMFA 2HRFA 5ECQB 2F3MA 3MAKA 3SBCA 3HDCA 1B9YC 1EWXA 4Q5RA 1A2JA 3TOUA 3Q6OA 4J2FA 1XPVA 3GKMA 3EMXA 2DIYA 1FVJA 2BMXA 2H6ZA 5HR3A 4KGIA 4G10A 2H30A 3MNGA 1UA5A 5G5EA 4KUNA 1JLVA 3DVXA 1MD4A 1TRVA 4QL7A 3VI5A 2VL9A 4GSNA 5AGYA 2LNTA 3VWVA 5DJLA 2C3TA 3VWXA 1PX6A 2YZUA 1X5CA 3Q19A 4OFNA 3ZIVA 3IPZA 3VLNA 1MDKA 3IK9A 2H01A 1BYEA 3IHQA 4OCEA 3EC3A 1XCCA 2HE3A 2LSTA 1XZOA 4LMVA 3UMAA 4POBA 2FA8A 3TJGA 4FYBA 1W89A 1NSWA 4O7HA 2ALBA 2N5BA 4I8BA 5HR1A 5G1KA 3WGXA 5ID2B 4O5RA 4WXTA 2M72A 5KN2A 4IELA 2HLSA 1J9BA 1YKAA 5IMCA 1U3AA 1UN2A 4K8MA 3DKSA 1AIUA 2AB6A 3IA1A 4FYUA 4ZB9A 3HCZA 3D4MA 4G19A 1OE8A 3UEMA 3P90A 5B6NA 2M80A 3QD9A 5JWRB 1SD9A 2YWNA 1AAZA 2DJ3A 2MBTA 3BCIA 2YCDA 1JFUA 3ME8A 2VCTA 3GRXA 3TJKA 1XIYA 1WP0A 3ISOA 5H5RA 4MABA 1ABAA 1Z6MA 1F3AA 4EDZA 4HEA2 3HYPA 2DC5A 1FB0A 2RIIA 2VM1A 4MJAA 1TK0B 1A8YA 2R4VA 5DJMA 3W6GA 2HFDA 3EVIA 1PN9A 4KH7A 5IOXA 2B1LA 1QK8A 3IC4A 2YANA 3KP9A 2CZ3A 1GLQA 1GTBA 1PD21 5J5NA 4FQUA 3Q74A 2J9HA 2EC4A 1UC7A 4O32A 2GZZA 3J7Yb 1QGVA 1FB6A 5CO3A 3IDVA 5JCUA 2HSNB 2L57A 3RDWA 3QDNA 5HFGA 3H93A 4NHZA 4TXVA 1F3BA 3HXSA 2FGXA 1EGOA 4K9ZA 4TXOB 4DSSA 4HJ2A 2JL4A 5DVBA 3UJ1A 4RI6A 4ECBA 3EURA 5DQSA 4RQRA 1YF0A 4KAEA 1HNAA 2OACA 1SJZA 1GH2A 4OWYA 3GUSA 2AAWA 5IO0A 2HI7A 2HQTA 2L6DA 3M0FA 1BEDA 5IOWA 1J0FA 4GF0A 3DD3A 2XHFA 3BJ5A 3RBTA 5DALA 1T00A 1ZL9A 1XOBA 3LXZA 3L9VA 4G2EA 3M9KA 3CSJA 4MZWA 2FWEA 1WJKA 1ML6A 1JLWA 8GSSA 2I3YA 1QMVA 4I2TA 1HQOA 1HNCA 1JZDA 2H1GA 3APSA 1S3DA 5C00A 3I6AA 2H0IA 4ZB6A 1R5AA 1T1VA 3GX8A 1DSBA 4ZBAA 2FY6A 1GUKA 3C8EA 2YWMA 1XXUA 5G1LA 1T7PB 3GTUA 5IMZA 2B7KA 1ACVA 3ZFBA 1XBSA 1PKZA 3HVVA 1CQHA 1NHYA 1AQVA 1TI3A 4RQXA 3UARA 4MZCA 3KH9A 1YKCA 4BVXB 1A23A 1EV9A 4YQMA 2WB9A 2C4JA 2K18A 3E9JB 13GSA 1KEBA 2JACA 2IJYA 3GNJA 1TU8A 4ECJA 10GSA 3HD5A 2H76A 3NZNA 2P31A 1OAZA 4PXOA 5IIZA 2M46A 3CSIA 1VGLA 4IJ3A 1PKWA 3TJJA 4JRRA 1G6YA 3WYWA 3CYNA 4MCUA 1SYRA 3GURA 3M1GA 1V57A 1ZYQB 1G7OA 4PUFC 4PUAA 2P5QA 3TKSC 4KDUA 4IBPA 2PMTA 3QAVA 2OJLA 2CAIA 4WR4A 3NOFA 2N5AA 1AXDA 3KEBA 3IE3A 1NW2A 4TKYA 3QAWA 1A2MA 4QQ7A 4EXJA 3R2QA 2NVLA 4K1FA 1O85A 2R5GA 1B8XA 5CP1A 2ZNMA 3PH9A 3GH9A 1MEKA 4K7IA 2GZPA 3IK7A 3F63A 2PWJA 3FZ5A 2PVOC 3F8UA 2IWTA 3W8JA 19GSA 4TXOA 1GULA 1T3BA 4NPBA 1KTEA 11GSA 6GSXA 1V9WA 2OE3A 2NPBA 3CSHA 2CZ2A 5IQYA 2YN1A 4MH2A 1XVQA 5DCGA 3ZYWA 1R7HA 3FZ9A 1NHOA 1K0DA 2IMKA 12GSA 1SK0A 2CAQA 1Z7RA 2HRNA 1EEMA 3ZMLA 3TKSE 1BJXA 3V1WA 1XW5A 4TN8A 3IXRA 1LBKA 3IV4A 3H79A 4PNFA 4ACSA 2FCHA 5CRGA 1RW1A 4HZ2A 1M2DA 3L78A 4XTSA 2LKUA 2K8VA 3F9UA 3UBKA 3M9JA 2JZTA 4X43A 5IM9A 5HQPA 4JU5A 1ZZYA 4FYCA 4BWSA 1ERTA 3QPMA 1EOHA 3L9UA 5D8IA 2C3QA 3TDGA 3TUEA 1GLPA 3VWWA 3TKSA 1SJ6A 1U3IA 1GUMA 3Q18A 1Z3EA 2DJKA 1ZOFA 2WULA 5D96A 3PGTA 1YQ1A 3C1RA 3IOSA 3EU4A 2B7JA 3D4TA 1GSEA 1Q4JA 2E7PA 2C1YA 2DBCA 2V2GA 1X0RA 2YJ7A 3GSSA 3HJPA 2VOCA 2GQKA 1V2AA 1QQ2A 4V1Ap 2RM5A 2V41A 3HA9A 2VD1A 1XWAA 4JE1A 1MDJA 3ZVJA 4K6XA 1N2AA 2YNXA 1O6JA 4EC0A 5IMAA 3LG6A 4OO5A 4V2NA 3EWLA 5G2ZA 3EU3A 2I9HA 3VWUA 2X64A 3G7IA 1DE1A 1GTIA 4LLRA 4GRFA 1USBA 2K8SA 5BMUA 1TU7A 5EPFA 2O8VB 2KUCA 2WRTA 4HOJA 1O8XA 3UAPA 2F9SA 1M0UA 3WGDA 4KSMA 1WOUA 3P8WA 4F0CA 3FHKA 3PPUA 5AIVA 4MLYA 1PRXA 2AHEA 2DJJA 1GSSA 4N0ZA 3ERGA 2GVPA 5E59A 4IN0A 4DSSB 5G5FA 2QKEA 1EOGA 1IYIA 3HY2A 2HSHA 4ZL7A 3GH6A 2O87A 3HZ8A 4XRAA 1EGRA 5D9VA 5AISA 2B1KA 3VFIA 4EO3A 1SKWB 1T8EB 1ZCPA 5J9BA 1U6TA 1Z7PA 2L4QA 1QXHA 1ZMAA 4G0IA 1GRXA 3GKXA 5KN1A 4OCFA 17GSA 5DALB 2MMNA 4ML1A 1YJ6A 1OC8A 1PMTA 2IPAA 5JWQB 1G0TA 2K6VA 2ON5A 3D0ZA 3GX0A 4GTUA 2C0EA 4ML6A 2R3XA 4IGJA 1EZKA 4USSA 5B8AA 2EIOA 5A4WA 4K0NA 1PSQA 4X1UA 2QSIA 3LXTA 4CW9A 2G0FA 3I43A 3ZIJA 3GTUB 1W4VA 1FAAA 3ZVJD 1HD2A 3DGQA 4F2IA 4ZBDA 1BQ7A 2MYGA 1H75A 5IMVA 3M3MA 2CVBA 1GUHA 3J7Yk 4KNDA 2VUPA 3KH7A 1SL0B 2FD3A 4MF5A 1XFLA 5G30A 4DSRA 1V58A 4NXIA 4EVMA 4HZ4A 2VLTA 3ERFA 2GGTA 2ES7A 3AY8A 2CX4A 3D21A 1UVZA 20GSA 3L0HA 3RAZA 4LA1A 4CHSA 4AGSA 2X8CA 4ZL9A 5DAKB 3TKPA 4TVEA 4LL4B 1FOVA 2CVKA 1Z9HA 4QL9A 3TGZA 2DJ2A 2A2SA 1E6BA 1WMJA 2AYTA 4BPYA 2DLXA 4HU9A 3GKNA 2XPDA 4AJ7A 1SK1A 2PVQA 5A4VA 3GL5A 2BJXA 3KIJA 3GN3A 4L0UA 2Z9SA 2H19A 4EKZA 3I69A 2CVDA 3NIVA 5EL8A 2FWGA 4NMUA 4KE3A 1I5GA 1ERUA 2MZCA 4KCAA 3IC8A 4DEJA 2TIRA 1GSQA 1QUWA 1XWKA 3MDKA 4JR6A 4OFMA 2PU9C 4HJMA 3U5RE 4ID0A 1M2BA 3ZMKA 2IFQB 1AQXA 2VL2C 2HRKA 3A5WA 1TKDB 2DMMA 3HJOA 1Q98A 4X0XA 5ECMB 1A24A 2VAFA 1AQWA 4K0GA 1K0CA 4N30A 1ON4A 3G7JA 4GSTA 3ZFLA 3M8NA 4AJ6A 4PURA 1AW9A 2A4VA 1AUCA 2MMZA 2HZFA 2GT6A 2GT5A 1TI1A 4MPGA 3WD6A 1PQNA 1GWCA 4ZB8A 4EL1A 5KEJA 1ZGNA 2VLUA 3U6VA 5DQYA 2VLVA 4LL1B 1K3OA 1VF4A 1SENA 2VCWA 3IRAA 3IBHA 4MF7A 2LQOA 6GSWA 2E2GA 3VK9A 4TRXA 2YP6A 1U87A 3F6FA 1EP7A 2C0DA 2R6KA 3H8QA 3EE2A 2B5YA 2WGRA 1Z6NA 1VRSD 4POKA 2R37A 2FWFA 4GXZA 2NBSA 2KP2A 2EIQA 3DEXA 3DXBA 2LV3A 1B4PA 3F4TA 2IIYA 4HQSA 4IP6A 4V2LA 4WBJA 2IMIA 3D6IA 5DBQA 4KSOA 3ED3A 2GDRA 2RUEA 2JZSA 1F9MA 3G9BA 4OO4A 4ULXA 1O8WA 3CMIA 5AIXA 1YEXA 1K0AA 3G7YA 1PL2A 2IMFA 1X9SB 5DAKA 1A0FA 4AF2A 1A8LA 1B48A 4TW5A 2FUG2 1V98A 2I1UA 3GFKA 2R2JA 6GSYA 3A2WA 2IMDA 2UZ8A 5LD0A 1OVNA 4IHUA 1OYJA 2X8HA 2AJQB 2IL3A 2GTUA 1WIKA 3CBUA 3LFLA 4L8EA 1TRSA 3KM6A 3QOUA 1XWBA 2WCIA 4EUYA 1ST9A 1V40A 3H4KA 1M9BA 5KN3A 2L59A 4PNGA 1TTZA 1M2AA 5JCWA 3F4SA 3BOAA 1FO5A 4GSSA 4XCSA 3L4NA 4TR1A 1JZOA 4RUVA 1IYHA 5D9XA 3BD2A 2X8GA 4FIWA 2I4AA 2IFQA 4YAPA 2H73A 2LQQA 1SU9A 3FY7A 1THXA 2CX3A 4KDXA 4MMMA 3TKRA 5LNKe 4MH3A 2RLIA 3D5JA 2C0FA 3KMOA 1A0RP 1OC9A 4TR4A 3LYKA 2FLSA 3WT2A 2BTOT 4E8EA 3IAM2 3FR6A 3FYGA 5G31A 1S3AA 1MD3A 1GSFA 2OADA 1F2EA 4NV5A 2C3NA 4PGTA 3ZLPA 5ECPB 2MMOA 5D9TA 2C0GA 4N0VA 3DYRA 1SL2B 4J56E 4NHWA 3FRCA 4OMVA 5L71A 3KTLA 5J41A 3GKKA 4JR4A 2YJHA 5KN0A 1WRYA 2L5LA 3DVWA 1S3CA 2TRCP 1TK5B 2GZYA 4TR0A 3CTGA 1PL1A 4J57E 4POMA 2H1BA 1YEPA 5INYA 3VURA 2H74A 2GSRA 4TR3A 1RQMA 2IMEA 1DE2A 2PBJA 3LGCA 1VF2A 3LYPA 3UOMA 3BCKA 1ZYEA 2VCXA 5IO2A 1OC3A 3O3TA 3LSZA 1A2LA 3TKQA 5ELAA 4I5QA
chains in the Genus database with same CATH superfamily
1YZXA 1NM3A 3D22A 2JZRA 3UVHA 1T4ZA 2B5XA 16GSA 4HSCX 4OFTA 1DBYA 3C7MA 1DUGA 3HZ4A 2VM2A 1WE0A 2VD0A 1X9WB 1K0MA 2HRAA 2F51A 2WW2A 2A2PA 2OE1A 4NWYA 3A2VA 2PERA 3R3EA 4BL7A 3ME7A 2TRXA 2FWHA 5IPHA 5ABRA 2HSMA 1TDIA 4JBBA 2GLRA 2L5OA 5ECLB 3US3A 2KLXA 1XW9A 5CAXA 1R4WA 2H71A 5A5KA 3F4RA 3TRPA 2GQLA 1M9AA 4PX1A 1GSUA 3KGKA 3LWAA 1U88A 1B9XC 4HU7A 3F0IA 3KCMA 5ECNB 3KXOA 14GSA 1TXXA 1K3LA 3TU3B 4GQFA 3ZTLA 4WETA 4PQIA 2CQ9A 3FZAA 2OBKA 4IS0A 1PN0A 1CQGA 4F0BA 3TRQA 3APQA 5CNWA 4YQUA 4K7NA 5GAND 3E3EA 1O7UA 2HRKB 3P2AA 4TOPA 3TOTA 22GSA 1URMA 4MPFA 3QCPA 3KMNA 1M7TA 2I81A 2HZEA 6GSVA 1T4YA 1PX7A 2O7KA 3F6DA 3KJYA 1OKDA 4XHMA 5FHIA 4KDYA 2YZHA 2V32A 3FMWA 2WW3A 2DJ1A 2NDOA 1QFNA 3GIXA 2GSSA 2WDUA 3BBYA 4MK3A 3L9SA 4XS4B 5IPGA 3FR3A 1SKRB 1GP1A 4KF9A 3UVTA 1THOA 4ZXGA 3ZL5A 3GA4A 2RUFA 2VCVA 2H6YA 3CQFA 4V1Ag 2VCQA 1X5EA 4KB3A 2GS3A 4HI7A 3HJMA 5A1NA 4IKHA 2P0GA 3S9FA 5GAPD 3LW9A 1TRUA 2JU5A 3KD0A 2YWIA 4JEDA 5ECKB 3H1NA 4XIHA 1XWGA 2D2ZA 3DRNA 4PQ1A 1O81A 2FHEA 4ZL8A 1Y6EA 2KP1A 3EYTA 3SWLA 4D73A 1VF3A 2V6OA 4MJCA 4N11A 1TOFA 4G0LA 1VF1A 3W8SA 4MNNA 3CXGA 1G7EA 2F8FA 4PI0C 5EY6A 4FXYP 5GZZB 2K9FA 2EIRA 1LJRA 1SD8A 2LEGA 5EVOA 4IQ1A 2WFCA 1RK4A 4NV2A 1N8JA 3A2XA 4BVYA 3WGEA 1KNGA 4EE0A 3KTBA 3QAGA 4AKGA 3ERWA 2VL3A 1JZRA 2IN3A 4BWQA 2VKZG 2DKHA 2WZ9A 1ERVA 4MJBA 1GTAA 1FW1A 4IVFA 2O85A 1GSYA 2X4AA 2AUVA 2GQMA 5ECSA 4X4JA 2B6MA 1TJDA 4G01A 2E0QA 5FWGA 1SJIA 1OE7A 1YY7A 4GLTA 4O92A 4DSQA 4WKWA 3HVNA 2VO4A 1HYUA 5ECHB 4IQAA 4TR1B 1S3RA 4WF5A 4IJIA 1BG5A 2ON7A 4I6XA 4DVCA 2GSTA 9GSSA 4ISDA 1JHBA 1FG4A 4KW6A 5ECOB 2CV4A 3RPNA 1SKSB 3E0UA 3EMPA 5FT3A 2B3SA 2OA7A 1FHEA 1OC9B 5HFIA 1F37A 1SL1B 2OBIA 5D9WA 5F0GA 2EFDA 4MP4A 4WEYA 4MDCA 4G0KA 2O89A 2CT6A 1O73A 5D73A 3ZRDA 3RHCA 4YH2A 4EF0A 4F9ZA 4ILFA 2YPMA 4KA0A 3RPPA 5HR0A 1R5PA 2JSZA 4KCEA 3VPTA 3GSTA 1WPIA 4F03A 4XS4A 1MDIA 2FNOA 3UL3A 1ILOA 2H66A 4JZQA 5B8BA 2HNLA 5D93A 3WT1A 1J08A 2DSAA 2H6XA 4V2MA 1YF1A 3EINA 4WF4A 2H0GA 3F3QA 2QC7A 3DMLA 2YOIA 4RI7A 2NTOA 4ZILA 3ZREA 4Q5QA 2YV9A 4EDYA 3QFBC 2DIZA 2KHPA 3LJRA 1Z5YE 7GSSA 1H4OA 5ECIB 2GSQA 4I2UA 3FW2A 1G6WA 4Q5FA 2B5EA 5ECRB 5ID2A 3HKRA 2LRTA 1SK2A 2VIMA 1SYXA 3GYKA 4AJ8A 2XBIA 3TJFA 1LU4A 5C04A 4PTSA 4MA9A 2E2MA 4GCIA 1XWCA 2JSYA 4MJEA 2ZCTA 4H86A 5IMDA 5H5QA 4POLA 2LS5A 5H5SA 4HUAA 5J9CA 4L5LA 1K0NA 2OT3A 2H75A 3ZITA 2V1MA 4BL7B 2REMA 3QMXA 3UIWA 1FVKA 2HSMB 2LRNA 1EP8A 2WJUA 1EV4A 3ZZXA 2L4CA 2R0CA 1PGTA 1GL8A 1SVOA 2HXKA 5CRDA 2VL2A 2HT9A 3C73A 4PQHA 2HYXA 3VI7A 3CWGA 4MF6A 5F05A 3FEUA 2H0HA 4YQVA 2PPTA 3C1SA 18GSA 1BAYA 5J3RA 5B7CA 1TK8B 3LORA 3DIEA 2LNSA 2YV7A 4ZB7A 2C80A 1ERWA 5F06A 1XW6A 1TP9A 3I9V2 5DDLA 2LUSA 4WBRD 3CRTA 4E8HA 1XG8A 3GL3A 5GSSA 3DWVA 1ZYNA 2OE0A 1HNBA 5JCGA 4I5QA 1XVWA 2H1AA 1K0BA 2AV4A 3QR6A 4HS1A 4BIKA 2C8UA 1EEJA 4XRDA 2H72A 3FKFA 4YAVA 1KBNA 3HVSA 2HZEB 1TRWA 5ELGA 4N10A 2MMAA 3HHVA 2QGVA 2XBQA 1K3YA 4ZIJA 1GNEA 5ENUA 4K7OA 4G9HA 3GV1A 3MWHA 1PFOA 4LMWA 4ZBBA 3FZ4A 4GWRA 1Y1UA 2H1DA 1AC1A 2DMLA 2LTKA 1M99A 2A2RA 3FK8A 4KX4A 5A34A 2X49A 1JZWA 5B6MA 3O6TA 3JCML 3O76A 2H8LA 2PUKC 2ZUPA 1X5DA 3RHBA 1R26A 3C71A 6GSSA 3N9JA 1XOAA 2YWOA 4OD7A 1GNWA 4L5OA 2XPEA 3VPQA 5GSTA 4IP1A 5LCZA 3TB2A 1K0OA 2OKAA 4GQCA 2DJ0A 5CRHA 2WVZA 5CRWA 4BA7A 2LRCA 2WS2A 3APOA 1F6MC 5AN1A 2KOKA 3UBLA 3MSZA 3PINA 5JWOB 2N5FA 3LQ7A 3KP8A 4K2DA 5HR2A 3QFAC 3HVXA 2CA8A 4D73B 1E2YA 1I9DA 4BVXA 3KZQA 3CRUA 1WWJA 2X99A 3LEFA 1TW9A 1GSDA 1MTCA 1Y25A 5CYYA 3TRXA 1BX9A 4CDOA 3F3RA 4L0WA 3CTFA 3OR5A 4ECIA 2DKIA 4BVYB 4HDEA 6GSUA 2F8AA 6GSTA 2J23A 4IW9A 2JADA 1X9MB 4EIQA 5F07A 1SVMA 2L6CA 3P7XA 2RM6A 3FR9A 4Z7XA 1ZYPA 2LJAA 3A3TA 2PGTA 4XS6A 3IR4A 4NAXA 3TJBA 4FO5A 2LJRA 2VCZA 2V6KA 2FA4A 3GMFA 4MZBA 5COHA 2HSYA 1C72A 4AKHA 4FH8A 2MBSA 5F8BA 4ECCA 2PN8A 3IAS2 5CREA 4F82A 1GTUA 1B4QA 1OKTA 5J4UA 2P5RA 1YDKA 2G2QA 4XS1A 4Q5NA 1PA3A 5HFKA 5E4WA 4I97A 4HQZA 4WR5A 3CHXC 3PR8A 4P3YB 3N5OA 5A4UA 3GHAA 5DCHA 2H70A 2XC2A 3TCOA 2LJKA 3K8NA 5IMFA 2HRFA 5ECQB 2F3MA 3MAKA 3SBCA 3HDCA 1B9YC 1EWXA 4Q5RA 1A2JA 3TOUA 3Q6OA 1I1IP 4J2FA 1XPVA 3GKMA 3EMXA 2DIYA 4YKGA 1FVJA 2BMXA 2H6ZA 5HR3A 4KGIA 4G10A 2H30A 3MNGA 1UA5A 5G5EA 4KUNA 2O5VA 1JLVA 3DVXA 1MD4A 1TRVA 4QL7A 3VI5A 2VL9A 4GSNA 5AGYA 2LNTA 3VWVA 5DJLA 2C3TA 3VWXA 1PX6A 4Z2TA 5BRTA 2YZUA 1X5CA 3Q19A 4OFNA 3ZIVA 3IPZA 3VLNA 2R0GA 1MDKA 3IK9A 2H01A 1BYEA 3IHQA 4OCEA 3EC3A 1XCCA 2HE3A 2LSTA 1XZOA 4LMVA 3UMAA 4POBA 2FA8A 3TJGA 4FYBA 1W89A 1NSWA 4O7HA 2ALBA 2N5BA 4I8BA 5HR1A 5G1KA 3WGXA 5ID2B 4O5RA 4WXTA 2M72A 3RFRC 5KN2A 4IELA 2HLSA 1J9BA 1YKAA 5IMCA 1U3AA 4E68A 1UN2A 4K8MA 3DKSA 1AIUA 2AB6A 3IA1A 4O5UA 4FYUA 4ZB9A 3HCZA 3D4MA 4G19A 1OE8A 4GDFA 3UEMA 3P90A 4ICYA 5B6NA 2M80A 3QD9A 5JWRB 1SD9A 2YWNA 1AAZA 2DJ3A 2MBTA 2EFCA 3BCIA 2YCDA 1JFUA 3ME8A 2VCTA 3GRXA 3TJKA 4N3ZA 1XIYA 1WP0A 3ISOA 5H5RA 4MABA 1ABAA 1Z6MA 1F3AA 4EDZA 4HEA2 3HYPA 2DC5A 1FB0A 2RIIA 2VM1A 4MJAA 2H1LA 1TK0B 1A8YA 2R4VA 5DJMA 3W6GA 3MIXA 2HFDA 3EVIA 1PN9A 4KH7A 5IOXA 2B1LA 1QK8A 3IC4A 2YANA 3KP9A 2CZ3A 1GLQA 1GTBA 1PD21 5J5NA 4FQUA 3Q74A 2J9HA 2EC4A 1UC7A 4O32A 2GZZA 3J7Yb 1QGVA 1FB6A 2WW0A 5CO3A 3IDVA 5JCUA 2HSNB 4CY6A 2L57A 3RDWA 3QDNA 5HFGA 3H93A 4NHZA 4TXVA 2O36A 1F3BA 3HXSA 2FGXA 1EGOA 4K9ZA 4TXOB 4DSSA 4HJ2A 2JL4A 5DVBA 3UJ1A 4RI6A 4ECBA 3EURA 5DQSA 4RQRA 1YF0A 4KAEA 1HNAA 2OACA 1SJZA 1GH2A 4OWYA 3GUSA 2AAWA 5IO0A 2HI7A 2HQTA 2L6DA 3M0FA 1BEDA 5IOWA 1J0FA 5A34B 4GF0A 3DD3A 2XHFA 3BJ5A 3RBTA 5DALA 3HMJG 1T00A 4AKXB 1ZL9A 2WVXB 1XOBA 3LXZA 3L9VA 4G2EA 3M9KA 3CSJA 4MZWA 2FWEA 1WJKA 4YKFA 1ML6A 1JLWA 8GSSA 2I3YA 1QMVA 4I2TA 1HQOA 1HNCA 1JZDA 2H1GA 3APSA 1S3DA 4PHZC 5C00A 3I6AA 2H0IA 4ZB6A 1R5AA 4PI2C 1T1VA 3GX8A 1DSBA 4ZBAA 2FY6A 1GUKA 3C8EA 2YWMA 1XXUA 5G1LA 1T7PB 3GTUA 5IMZA 4QMKA 2B7KA 1ACVA 3ZFBA 1XBSA 1PKZA 3HVVA 4AI6A 1NHYA 1CQHA 1AQVA 1TI3A 4RQXA 3UARA 4MZCA 3KH9A 1YKCA 4BVXB 1A23A 1EV9A 4YQMA 2WB9A 2C4JA 2K18A 3E9JB 13GSA 1KEBA 2JACA 2IJYA 3GNJA 1TU8A 4ECJA 10GSA 3HD5A 2H76A 3NZNA 4W66A 2QA1A 2P31A 1OAZA 4PXOA 5IIZA 2M46A 3CSIA 1VGLA 4IJ3A 1PKWA 3TJJA 4JRRA 1G6YA 3WYWA 3CYNA 4MCUA 1SYRA 3GURA 3M1GA 5J47A 1V57A 1ZYQB 1G7OA 4CY8A 4PUFC 4PUAA 2P5QA 3TKSC 4KDUA 4IBPA 2PMTA 3QAVA 2OJLA 5KOXA 4Z2RA 1YVLA 2CAIA 4WR4A 5J4VA 3NOFA 2N5AA 3A5IA 1AXDA 3KEBA 3IE3A 1NW2A 4TKYA 3QAWA 1A2MA 4QQ7A 4EXJA 3R2QA 2NVLA 4K1FA 1O85A 2R5GA 5BMUB 1B8XA 2O3EA 5CP1A 2ZNMA 4Z2UA 3PH9A 2HSNA 3GH9A 1MEKA 4K7IA 2GZPA 3IK7A 3F63A 2PWJA 3FZ5A 2PVOC 3F8UA 2IWTA 3W8JA 19GSA 4TXOA 1GULA 5KOWA 1T3BA 4NPBA 1KTEA 11GSA 6GSXA 1V9WA 2OE3A 2NPBA 3CSHA 2CZ2A 5IQYA 2YN1A 4MH2A 1XVQA 5DCGA 3RGBC 3ZYWA 1R7HA 3FZ9A 1NHOA 1K0DA 2IMKA 12GSA 1SK0A 2QA2A 2CAQA 1Z7RA 2HRNA 1EEMA 2WVXA 3ZMLA 3TKSE 1BJXA 3V1WA 1XW5A 4TN8A 3IXRA 1LBKA 3IV4A 3H79A 4PNFA 4ACSA 2FCHA 1BG1A 5CRGA 1RW1A 4HZ2A 1M2DA 3EPTA 3L78A 4XTSA 2LKUA 2K8VA 3MYDA 3F9UA 3UBKA 3M9JA 2JZTA 4X43A 5IM9A 5HQPA 4JU5A 1ZZYA 4FYCA 4BWSA 1ERTA 3QPMA 1EOHA 3L9UA 5D8IA 2C3QA 3TDGA 3TUEA 1GLPA 3VWWA 3TKSA 1SJ6A 1U3IA 1GUMA 3Q18A 1Z3EA 2DJKA 1ZOFA 2WULA 5D96A 1BF5A 3PGTA 1YQ1A 3C1RA 3IOSA 3EU4A 2B7JA 3D4TA 1GSEA 1Q4JA 2E7PA 2C1YA 2DBCA 2V2GA 1X0RA 2YJ7A 3GSSA 3HJPA 2VOCA 2GQKA 1V2AA 1QQ2A 4V1Ap 2RM5A 2V41A 3HA9A 2UV8G 2VD1A 1XWAA 4JE1A 1MDJA 3ZVJA 4K6XA 1N2AA 2YNXA 1O6JA 4EC0A 5IMAA 3LG6A 4OO5A 4V2NA 3EWLA 5G2ZA 3EU3A 2I9HA 3VWUA 2X64A 3G7IA 1DE1A 1GTIA 4LLRA 4GRFA 1USBA 2K8SA 5BMUA 1TU7A 5EPFA 2O8VB 2EFHA 2KUCA 2WRTA 4HOJA 1O8XA 3UAPA 2F9SA 1M0UA 3WGDA 4KSMA 1WOUA 3P8WA 4F0CA 3FHKA 3PPUA 5AIVA 4MLYA 1PRXA 2AHEA 2DJJA 1GSSA 4N0ZA 3ERGA 5J4YA 2GVPA 5E59A 4IN0A 4DSSB 5G5FA 2QKEA 1EOGA 1IYIA 3HY2A 2HSHA 4ZL7A 3GH6A 2O87A 3HZ8A 4XRAA 1EGRA 1TXUA 5D9VA 5AISA 2B1KA 3VFIA 4EO3A 1SKWB 1T8EB 1ZCPA 5J9BA 1U6TA 1Z7PA 2L4QA 1QXHA 1ZMAA 4G0IA 1GRXA 3GKXA 5KN1A 4OCFA 17GSA 5DALB 2MMNA 4ML1A 1YJ6A 1OC8A 1PMTA 2IPAA 5JWQB 1G0TA 2K6VA 4EIPA 2ON5A 3D0ZA 3GX0A 4GTUA 2C0EA 2WW1A 5A5HA 4ML6A 2R3XA 4IGJA 1EZKA 4USSA 5B8AA 2EIOA 5A4WA 4K0NA 1PSQA 4X1UA 2QSIA 3LXTA 4CW9A 2G0FA 3I43A 3ZIJA 3GTUB 1W4VA 1FAAA 3ZVJD 1HD2A 3DGQA 4F2IA 4ZBDA 1BQ7A 2MYGA 1H75A 5IMVA 3M3MA 2CVBA 1GUHA 3J7Yk 4KNDA 2VUPA 3KH7A 1SL0B 2FD3A 4MF5A 1XFLA 5G30A 4AKIA 4DSRA 1V58A 4NXIA 4EVMA 4HZ4A 2VLTA 3ERFA 2GGTA 2ES7A 3AY8A 2CX4A 3D21A 1UVZA 1SVLA 20GSA 3L0HA 3RAZA 4LA1A 4CHSA 4AGSA 2X8CA 4ZL9A 5DAKB 3TKPA 4TVEA 4LL4B 1FOVA 2CVKA 1Z9HA 4QL9A 3TGZA 2DJ2A 2A2SA 1E6BA 1WMJA 2AYTA 4BPYA 2DLXA 4HU9A 3GKNA 2XPDA 4AJ7A 1SK1A 2PVQA 5A4VA 3GL5A 2BJXA 3KIJA 3GN3A 4L0UA 2Z9SA 2H19A 4EKZA 3I69A 2CVDA 3NIVA 5EL8A 2FWGA 4NMUA 4KE3A 1I5GA 4A5PA 2WZSA 1ERUA 2MZCA 2EFEA 4KCAA 3IC8A 4DEJA 2TIRA 1GSQA 1QUWA 1XWKA 3MDKA 4JR6A 4OFMA 4K2XA 1M3JA 2PU9C 4HJMA 4K5SA 3U5RE 4ID0A 1M2BA 3ZMKA 2IFQB 1AQXA 2VL2C 2HRKA 3A5WA 1TKDB 2DMMA 3HJOA 1Q98A 4X0XA 5ECMB 1A24A 2VAFA 1AQWA 4K0GA 1K0CA 4N30A 1ON4A 3G7JA 4GSTA 3ZFLA 3M8NA 4AJ6A 4PURA 1AW9A 2A4VA 1AUCA 2MMZA 2HZFA 2GT6A 2GT5A 1TI1A 4MPGA 3WD6A 1PQNA 1GWCA 4ZB8A 4EL1A 5KEJA 1ZGNA 2VLUA 3U6VA 5DQYA 2VLVA 4LL1B 1K3OA 1YEWC 1VF4A 1SENA 2VCWA 3IRAA 3IBHA 4MF7A 2LQOA 6GSWA 2E2GA 3VK9A 4TRXA 2YP6A 1U87A 3F6FA 1EP7A 2C0DA 2R6KA 3H8QA 3EE2A 2B5YA 2WGRA 1Z6NA 1VRSD 4POKA 2R37A 2FWFA 4GXZA 2NBSA 2KP2A 2EIQA 3DEXA 3DXBA 2LV3A 1B4PA 3F4TA 2IIYA 4HQSA 4IP6A 4V2LA 4WBJA 2IMIA 3D6IA 5DBQA 4KSOA 3ED3A 2GDRA 2RUEA 2JZSA 1F9MA 3G9BA 4OO4A 4ULXA 3CMIA 1O8WA 5AIXA 1YEXA 1N25A 1K0AA 4K5RA 3G7YA 1PL2A 2IMFA 1X9SB 5DAKA 1FOHA 1A0FA 4AF2A 1A8LA 1B48A 4TW5A 2FUG2 1V98A 2I1UA 3GFKA 2R2JA 6GSYA 3A2WA 2IMDA 2UZ8A 5LD0A 1OVNA 4IHUA 1OYJA 2X8HA 2AJQB 2IL3A 2GTUA 1WIKA 3CBUA 3LFLA 4L8EA 1TRSA 3KM6A 3QOUA 4O5QA 1XWBA 2WCIA 2WVYA 4EUYA 1ST9A 1V40A 3H4KA 1M9BA 5KN3A 2L59A 4PNGA 1TTZA 1M2AA 5JCWA 3F4SA 3BOAA 1FO5A 4GSSA 4XCSA 3L4NA 4TR1A 1JZOA 4RUVA 1IYHA 5D9XA 3BD2A 2X8GA 4FIWA 2I4AA 2IFQA 4YAPA 2H73A 2LQQA 1SU9A 3FY7A 1THXA 2CX3A 4KDXA 4MMMA 3TKRA 5LNKe 3IHGA 4MH3A 2RLIA 3D5JA 2C0FA 3KMOA 1A0RP 1OC9A 4TR4A 3LYKA 2FLSA 3WT2A 2BTOT 4E8EA 3IAM2 3FR6A 3FYGA 5G31A 1S3AA 1MD3A 1GSFA 5J40A 2OADA 1F2EA 4NV5A 2C3NA 4PGTA 3ZLPA 1M3IA 5ECPB 2MMOA 5D9TA 2C0GA 4N0VA 3DYRA 1SL2B 4J56E 4NHWA 3FRCA 4OMVA 5L71A 3KTLA 5J41A 3GKKA 4JR4A 2YJHA 5KN0A 1WRYA 2L5LA 3DVWA 5A5HB 1S3CA 2TRCP 1TK5B 2GZYA 4TR0A 3CTGA 1PL1A 4J57E 4POMA 2R0PA 2H1BA 1YEPA 5INYA 3VURA 2H74A 2GSRA 4TR3A 1RQMA 2IMEA 1DE2A 2PBJA 3LGCA 1VF2A 3LYPA 5A1NB 3UOMA 3BCKA 1ZYEA 2VCXA 5IO2A 1OC3A 3O3TA 3LSZA 1A2LA 3TKQA 1S4BP 5ELAA 2A4HA
chains in the Genus database with same CATH topology
1YZXA 1NM3A 3D22A 2JZRA 3UVHA 1T4ZA 2B5XA 16GSA 4OFTA 1DBYA 3C7MA 1DUGA 3HZ4A 2VM2A 1WE0A 2VD0A 1X9WB 1K0MA 2HRAA 2F51A 4NWYA 2A2PA 2OE1A 3A2VA 2PERA 3R3EA 4BL7A 3ME7A 2TRXA 2FWHA 5IPHA 5ABRA 2HSMA 1TDIA 4JBBA 2GLRA 2L5OA 5ECLB 3US3A 2KLXA 1XW9A 5CAXA 1R4WA 2H71A 5A5KA 3F4RA 3TRPA 2GQLA 1M9AA 4PX1A 1GSUA 3KGKA 3LWAA 1U88A 1B9XC 4HU7A 3F0IA 3KCMA 5ECNB 3KXOA 14GSA 1TXXA 1K3LA 3TU3B 4GQFA 3ZTLA 4WETA 4PQIA 2CQ9A 3FZAA 2OBKA 4IS0A 1PN0A 1CQGA 4F0BA 3TRQA 3APQA 5CNWA 4YQUA 4K7NA 5GAND 3E3EA 1O7UA 2HRKB 3P2AA 4TOPA 3TOTA 22GSA 1URMA 4MPFA 3QCPA 3KMNA 1M7TA 2I81A 2HZEA 6GSVA 1T4YA 1PX7A 2O7KA 3F6DA 3KJYA 1OKDA 4XHMA 5FHIA 4KDYA 2YZHA 2V32A 3FMWA 2DJ1A 2NDOA 1QFNA 3GIXA 2GSSA 2WDUA 3BBYA 4MK3A 3L9SA 4XS4B 5IPGA 3FR3A 1SKRB 1GP1A 4KF9A 3UVTA 1THOA 4ZXGA 3ZL5A 3GA4A 2RUFA 2VCVA 2H6YA 4V1Ag 2VCQA 1X5EA 4KB3A 2GS3A 4HI7A 3HJMA 5A1NA 4IKHA 2P0GA 3S9FA 5GAPD 3LW9A 1TRUA 2JU5A 3KD0A 2YWIA 4JEDA 5ECKB 3H1NA 4XIHA 1XWGA 2D2ZA 3DRNA 4PQ1A 1O81A 2FHEA 4ZL8A 1Y6EA 2KP1A 3EYTA 3SWLA 4D73A 1VF3A 2V6OA 4MJCA 4N11A 1TOFA 4G0LA 1VF1A 3W8SA 4MNNA 3CXGA 1G7EA 2F8FA 5EY6A 5GZZB 2K9FA 2EIRA 1LJRA 1SD8A 2LEGA 5EVOA 4IQ1A 2WFCA 1RK4A 4NV2A 1N8JA 3A2XA 4BVYA 3WGEA 1KNGA 4EE0A 3KTBA 3QAGA 4AKGA 3ERWA 2VL3A 1JZRA 2IN3A 4BWQA 2VKZG 2DKHA 2WZ9A 1ERVA 4MJBA 1GTAA 1FW1A 4IVFA 2O85A 1GSYA 2X4AA 2AUVA 2GQMA 5ECSA 4X4JA 2B6MA 1TJDA 4G01A 2E0QA 5FWGA 1SJIA 1OE7A 1YY7A 4GLTA 4O92A 4DSQA 4WKWA 2VO4A 1HYUA 5ECHB 4IQAA 4TR1B 4WF5A 4IJIA 1BG5A 2ON7A 4I6XA 4DVCA 2GSTA 9GSSA 4ISDA 1JHBA 1FG4A 4KW6A 5ECOB 2CV4A 3RPNA 1SKSB 3E0UA 3EMPA 5FT3A 2B3SA 2OA7A 1FHEA 1OC9B 5HFIA 1F37A 1SL1B 2OBIA 5D9WA 5F0GA 2EFDA 4MP4A 4WEYA 4MDCA 4G0KA 2O89A 2CT6A 1O73A 5D73A 3ZRDA 3RHCA 4YH2A 4EF0A 4F9ZA 4ILFA 2YPMA 4KA0A 3RPPA 5HR0A 1R5PA 2JSZA 4KCEA 3VPTA 3GSTA 1WPIA 4F03A 4XS4A 1MDIA 2FNOA 3UL3A 1ILOA 2H66A 4JZQA 5B8BA 2HNLA 5D93A 3WT1A 1J08A 2DSAA 2H6XA 4V2MA 1YF1A 3EINA 4WF4A 2H0GA 3F3QA 2QC7A 3DMLA 2YOIA 4RI7A 2NTOA 4ZILA 3ZREA 4Q5QA 2YV9A 4EDYA 3QFBC 2DIZA 2KHPA 3LJRA 1Z5YE 7GSSA 1H4OA 5ECIB 2GSQA 4I2UA 3FW2A 1G6WA 4Q5FA 2B5EA 5ECRB 5ID2A 3HKRA 2LRTA 1SK2A 2VIMA 1SYXA 3GYKA 4AJ8A 2XBIA 3TJFA 1LU4A 5C04A 4PTSA 4MA9A 2E2MA 4GCIA 1XWCA 2JSYA 4MJEA 2ZCTA 4H86A 5IMDA 5H5QA 4POLA 2LS5A 5H5SA 4HUAA 5J9CA 4L5LA 1K0NA 2OT3A 2H75A 3ZITA 2V1MA 4BL7B 2REMA 3QMXA 3UIWA 1FVKA 2HSMB 2LRNA 1EP8A 2WJUA 1EV4A 3ZZXA 2L4CA 2R0CA 1PGTA 1GL8A 1SVOA 2HXKA 5CRDA 2VL2A 2HT9A 3C73A 4PQHA 2HYXA 3VI7A 3CWGA 4MF6A 5F05A 3FEUA 2H0HA 4YQVA 2PPTA 3C1SA 18GSA 1BAYA 5J3RA 5B7CA 1TK8B 3LORA 3DIEA 2LNSA 2YV7A 4ZB7A 2C80A 1ERWA 5F06A 1XW6A 1TP9A 3I9V2 5DDLA 2LUSA 4WBRD 3CRTA 4E8HA 3GL3A 5GSSA 3DWVA 1ZYNA 2OE0A 1HNBA 5JCGA 4I5QA 1XVWA 2H1AA 1K0BA 2AV4A 3QR6A 4HS1A 2C8UA 1EEJA 4XRDA 2H72A 3FKFA 4YAVA 1KBNA 3HVSA 2HZEB 1TRWA 5ELGA 4N10A 2MMAA 3HHVA 2QGVA 2XBQA 1K3YA 4ZIJA 1GNEA 5ENUA 4K7OA 4G9HA 3GV1A 3MWHA 4LMWA 4ZBBA 3FZ4A 4GWRA 1Y1UA 2H1DA 1AC1A 2DMLA 2LTKA 1M99A 2A2RA 3FK8A 4KX4A 5A34A 2X49A 1JZWA 5B6MA 3O6TA 3JCML 3O76A 2H8LA 2PUKC 2ZUPA 1X5DA 3RHBA 1R26A 3C71A 6GSSA 3N9JA 1XOAA 2YWOA 4OD7A 1GNWA 4L5OA 2XPEA 3VPQA 5GSTA 4IP1A 5LCZA 3TB2A 1K0OA 2OKAA 4GQCA 2DJ0A 5CRHA 5CRWA 4BA7A 2LRCA 2WS2A 3APOA 1F6MC 5AN1A 2KOKA 3UBLA 3MSZA 3PINA 5JWOB 2N5FA 3LQ7A 3KP8A 4K2DA 5HR2A 3QFAC 3HVXA 2CA8A 4D73B 1E2YA 1I9DA 4BVXA 3KZQA 3CRUA 1WWJA 2X99A 3LEFA 1TW9A 1GSDA 1MTCA 1Y25A 5CYYA 3TRXA 1BX9A 4CDOA 3F3RA 4L0WA 3CTFA 3OR5A 4ECIA 2DKIA 4BVYB 4HDEA 6GSUA 2F8AA 6GSTA 2J23A 4IW9A 2JADA 1X9MB 4EIQA 5F07A 1SVMA 2L6CA 3P7XA 2RM6A 3FR9A 4Z7XA 1ZYPA 2LJAA 3A3TA 2PGTA 4XS6A 3IR4A 4NAXA 3TJBA 4FO5A 2LJRA 2VCZA 2V6KA 2FA4A 3GMFA 4MZBA 5COHA 2HSYA 1C72A 4AKHA 4FH8A 2MBSA 5F8BA 4ECCA 2PN8A 3IAS2 5CREA 4F82A 1GTUA 1B4QA 1OKTA 5J4UA 2P5RA 1YDKA 2G2QA 4XS1A 4Q5NA 1PA3A 5HFKA 5E4WA 4I97A 4HQZA 4WR5A 3PR8A 4P3YB 3N5OA 5A4UA 3GHAA 5DCHA 2H70A 2XC2A 3TCOA 2LJKA 3K8NA 5IMFA 2HRFA 5ECQB 2F3MA 3MAKA 3SBCA 3HDCA 1B9YC 1EWXA 4Q5RA 1A2JA 3TOUA 3Q6OA 4J2FA 1XPVA 3GKMA 3EMXA 2DIYA 4YKGA 1FVJA 2BMXA 2H6ZA 5HR3A 4KGIA 4G10A 2H30A 3MNGA 1UA5A 5G5EA 4KUNA 2O5VA 1JLVA 3DVXA 1MD4A 1TRVA 4QL7A 3VI5A 2VL9A 4GSNA 5AGYA 2LNTA 3VWVA 5DJLA 2C3TA 3VWXA 1PX6A 4Z2TA 5BRTA 2YZUA 1X5CA 3Q19A 4OFNA 3ZIVA 3IPZA 3VLNA 2R0GA 1MDKA 3IK9A 2H01A 1BYEA 3IHQA 4OCEA 3EC3A 1XCCA 2HE3A 2LSTA 1XZOA 4LMVA 3UMAA 4POBA 2FA8A 3TJGA 4FYBA 1W89A 1NSWA 4O7HA 2ALBA 2N5BA 4I8BA 5HR1A 5G1KA 3WGXA 5ID2B 4O5RA 4WXTA 2M72A 5KN2A 4IELA 2HLSA 1J9BA 1YKAA 5IMCA 1U3AA 4E68A 1UN2A 4K8MA 3DKSA 1AIUA 2AB6A 3IA1A 4O5UA 4FYUA 4ZB9A 3HCZA 3D4MA 4G19A 1OE8A 4GDFA 3UEMA 3P90A 4ICYA 5B6NA 2M80A 3QD9A 5JWRB 1SD9A 2YWNA 1AAZA 2DJ3A 2MBTA 2EFCA 3BCIA 2YCDA 1JFUA 3ME8A 2VCTA 3GRXA 3TJKA 4N3ZA 1XIYA 1WP0A 3ISOA 5H5RA 4MABA 1ABAA 1Z6MA 1F3AA 4EDZA 4HEA2 3HYPA 2DC5A 1FB0A 2RIIA 2VM1A 4MJAA 2H1LA 1TK0B 1A8YA 2R4VA 5DJMA 3W6GA 3MIXA 2HFDA 3EVIA 1PN9A 4KH7A 5IOXA 2B1LA 1QK8A 3IC4A 2YANA 3KP9A 2CZ3A 1GLQA 1GTBA 1PD21 5J5NA 4FQUA 3Q74A 2J9HA 2EC4A 1UC7A 4O32A 2GZZA 3J7Yb 1QGVA 1FB6A 5CO3A 3IDVA 5JCUA 2HSNB 4CY6A 2L57A 3RDWA 3QDNA 5HFGA 3H93A 4NHZA 4TXVA 1F3BA 3HXSA 2FGXA 1EGOA 4K9ZA 4TXOB 4DSSA 4HJ2A 2JL4A 5DVBA 3UJ1A 4RI6A 4ECBA 3EURA 5DQSA 4RQRA 1YF0A 4KAEA 1HNAA 2OACA 1SJZA 1GH2A 4OWYA 3GUSA 2AAWA 5IO0A 2HI7A 2HQTA 2L6DA 3M0FA 1BEDA 5IOWA 1J0FA 5A34B 4GF0A 3DD3A 2XHFA 3BJ5A 3RBTA 5DALA 3HMJG 1T00A 4AKXB 1ZL9A 1XOBA 3LXZA 3L9VA 4G2EA 3M9KA 3CSJA 4MZWA 2FWEA 1WJKA 4YKFA 1ML6A 1JLWA 8GSSA 2I3YA 1QMVA 4I2TA 1HQOA 1HNCA 1JZDA 2H1GA 3APSA 1S3DA 5C00A 3I6AA 2H0IA 4ZB6A 1R5AA 1T1VA 3GX8A 1DSBA 4ZBAA 2FY6A 1GUKA 3C8EA 2YWMA 1XXUA 5G1LA 1T7PB 3GTUA 5IMZA 4QMKA 2B7KA 1ACVA 3ZFBA 1XBSA 1PKZA 3HVVA 4AI6A 1NHYA 1CQHA 1AQVA 1TI3A 4RQXA 3UARA 4MZCA 3KH9A 1YKCA 4BVXB 1A23A 1EV9A 4YQMA 2WB9A 2C4JA 2K18A 3E9JB 13GSA 1KEBA 2JACA 2IJYA 3GNJA 1TU8A 4ECJA 10GSA 3HD5A 2H76A 3NZNA 4W66A 2QA1A 2P31A 1OAZA 4PXOA 5IIZA 2M46A 3CSIA 1VGLA 4IJ3A 1PKWA 3TJJA 4JRRA 1G6YA 3WYWA 3CYNA 4MCUA 1SYRA 3GURA 3M1GA 5J47A 1V57A 1ZYQB 1G7OA 4CY8A 4PUFC 4PUAA 2P5QA 3TKSC 4KDUA 4IBPA 2PMTA 3QAVA 2OJLA 5KOXA 4Z2RA 1YVLA 2CAIA 4WR4A 5J4VA 3NOFA 2N5AA 3A5IA 1AXDA 3KEBA 3IE3A 1NW2A 4TKYA 3QAWA 1A2MA 4QQ7A 4EXJA 3R2QA 2NVLA 4K1FA 1O85A 2R5GA 5BMUB 1B8XA 5CP1A 2ZNMA 4Z2UA 3PH9A 2HSNA 3GH9A 1MEKA 4K7IA 2GZPA 3IK7A 3F63A 2PWJA 3FZ5A 2PVOC 3F8UA 2IWTA 3W8JA 19GSA 4TXOA 1GULA 5KOWA 1T3BA 4NPBA 1KTEA 11GSA 6GSXA 1V9WA 2OE3A 2NPBA 3CSHA 2CZ2A 5IQYA 2YN1A 4MH2A 1XVQA 5DCGA 3ZYWA 1R7HA 3FZ9A 1NHOA 1K0DA 2IMKA 12GSA 1SK0A 2QA2A 2CAQA 1Z7RA 2HRNA 1EEMA 3ZMLA 3TKSE 1BJXA 3V1WA 1XW5A 4TN8A 3IXRA 1LBKA 3IV4A 3H79A 4PNFA 4ACSA 2FCHA 1BG1A 5CRGA 1RW1A 4HZ2A 1M2DA 3EPTA 3L78A 4XTSA 2LKUA 2K8VA 3MYDA 3F9UA 3UBKA 3M9JA 2JZTA 4X43A 5IM9A 5HQPA 4JU5A 1ZZYA 4FYCA 4BWSA 1ERTA 3QPMA 1EOHA 3L9UA 5D8IA 2C3QA 3TDGA 3TUEA 1GLPA 3VWWA 3TKSA 1SJ6A 1U3IA 1GUMA 3Q18A 1Z3EA 2DJKA 1ZOFA 2WULA 5D96A 1BF5A 3PGTA 1YQ1A 3C1RA 3IOSA 3EU4A 2B7JA 3D4TA 1GSEA 1Q4JA 2E7PA 2C1YA 2DBCA 2V2GA 1X0RA 2YJ7A 3GSSA 3HJPA 2VOCA 2GQKA 1V2AA 1QQ2A 4V1Ap 2RM5A 2V41A 3HA9A 2UV8G 2VD1A 1XWAA 4JE1A 1MDJA 3ZVJA 4K6XA 1N2AA 2YNXA 1O6JA 4EC0A 5IMAA 3LG6A 4OO5A 4V2NA 3EWLA 5G2ZA 3EU3A 2I9HA 3VWUA 2X64A 3G7IA 1DE1A 1GTIA 4LLRA 4GRFA 1USBA 2K8SA 5BMUA 1TU7A 5EPFA 2O8VB 2EFHA 2KUCA 2WRTA 4HOJA 1O8XA 3UAPA 2F9SA 1M0UA 3WGDA 4KSMA 1WOUA 3P8WA 4F0CA 3FHKA 3PPUA 5AIVA 4MLYA 1PRXA 2AHEA 2DJJA 1GSSA 4N0ZA 3ERGA 5J4YA 2GVPA 5E59A 4IN0A 4DSSB 5G5FA 2QKEA 1EOGA 1IYIA 3HY2A 2HSHA 4ZL7A 3GH6A 2O87A 3HZ8A 4XRAA 1EGRA 1TXUA 5D9VA 5AISA 2B1KA 3VFIA 4EO3A 1SKWB 1T8EB 1ZCPA 5J9BA 1U6TA 1Z7PA 2L4QA 1QXHA 1ZMAA 4G0IA 1GRXA 3GKXA 5KN1A 4OCFA 17GSA 5DALB 2MMNA 4ML1A 1YJ6A 1OC8A 1PMTA 2IPAA 5JWQB 1G0TA 2K6VA 4EIPA 2ON5A 3D0ZA 3GX0A 4GTUA 2C0EA 5A5HA 4ML6A 2R3XA 4IGJA 1EZKA 4USSA 5B8AA 2EIOA 5A4WA 4K0NA 1PSQA 4X1UA 2QSIA 3LXTA 4CW9A 2G0FA 3I43A 3ZIJA 3GTUB 1W4VA 1FAAA 3ZVJD 1HD2A 3DGQA 4F2IA 4ZBDA 1BQ7A 2MYGA 1H75A 5IMVA 3M3MA 2CVBA 1GUHA 3J7Yk 4KNDA 2VUPA 3KH7A 1SL0B 2FD3A 4MF5A 1XFLA 5G30A 4AKIA 4DSRA 1V58A 4NXIA 4EVMA 4HZ4A 2VLTA 3ERFA 2GGTA 2ES7A 3AY8A 2CX4A 3D21A 1UVZA 1SVLA 20GSA 3L0HA 3RAZA 4LA1A 4CHSA 4AGSA 2X8CA 4ZL9A 5DAKB 3TKPA 4TVEA 4LL4B 1FOVA 2CVKA 1Z9HA 4QL9A 3TGZA 2DJ2A 2A2SA 1E6BA 1WMJA 2AYTA 4BPYA 2DLXA 4HU9A 3GKNA 2XPDA 4AJ7A 1SK1A 2PVQA 5A4VA 3GL5A 2BJXA 3KIJA 3GN3A 4L0UA 2Z9SA 2H19A 4EKZA 3I69A 2CVDA 3NIVA 5EL8A 2FWGA 4NMUA 4KE3A 1I5GA 4A5PA 1ERUA 2MZCA 2EFEA 4KCAA 3IC8A 4DEJA 2TIRA 1GSQA 1QUWA 1XWKA 3MDKA 4JR6A 4OFMA 4K2XA 2PU9C 4HJMA 4K5SA 3U5RE 4ID0A 1M2BA 3ZMKA 2IFQB 1AQXA 2VL2C 2HRKA 3A5WA 1TKDB 2DMMA 3HJOA 1Q98A 4X0XA 5ECMB 1A24A 2VAFA 1AQWA 4K0GA 1K0CA 4N30A 1ON4A 3G7JA 4GSTA 3ZFLA 3M8NA 4AJ6A 4PURA 1AW9A 2A4VA 1AUCA 2MMZA 2HZFA 2GT6A 2GT5A 1TI1A 4MPGA 3WD6A 1PQNA 1GWCA 4ZB8A 4EL1A 5KEJA 1ZGNA 2VLUA 3U6VA 5DQYA 2VLVA 4LL1B 1K3OA 1VF4A 1SENA 2VCWA 3IRAA 3IBHA 4MF7A 2LQOA 6GSWA 2E2GA 3VK9A 4TRXA 2YP6A 1U87A 3F6FA 1EP7A 2C0DA 2R6KA 3H8QA 3EE2A 2B5YA 2WGRA 1Z6NA 1VRSD 4POKA 2R37A 2FWFA 4GXZA 2NBSA 2KP2A 2EIQA 3DEXA 3DXBA 2LV3A 1B4PA 3F4TA 2IIYA 4HQSA 4IP6A 4V2LA 4WBJA 2IMIA 3D6IA 5DBQA 4KSOA 3ED3A 2GDRA 2RUEA 2JZSA 1F9MA 3G9BA 4OO4A 4ULXA 3CMIA 1O8WA 5AIXA 1YEXA 1N25A 1K0AA 4K5RA 3G7YA 1PL2A 2IMFA 1X9SB 5DAKA 1FOHA 1A0FA 4AF2A 1A8LA 1B48A 4TW5A 2FUG2 1V98A 2I1UA 3GFKA 2R2JA 6GSYA 3A2WA 2IMDA 2UZ8A 5LD0A 1OVNA 4IHUA 1OYJA 2X8HA 2AJQB 2IL3A 2GTUA 1WIKA 3CBUA 3LFLA 4L8EA 1TRSA 3KM6A 3QOUA 4O5QA 1XWBA 2WCIA 4EUYA 1ST9A 1V40A 3H4KA 1M9BA 5KN3A 2L59A 4PNGA 1TTZA 1M2AA 5JCWA 3F4SA 3BOAA 1FO5A 4GSSA 4XCSA 3L4NA 4TR1A 1JZOA 4RUVA 1IYHA 5D9XA 3BD2A 2X8GA 4FIWA 2I4AA 2IFQA 4YAPA 2H73A 2LQQA 1SU9A 3FY7A 1THXA 2CX3A 4KDXA 4MMMA 3TKRA 5LNKe 3IHGA 4MH3A 2RLIA 3D5JA 2C0FA 3KMOA 1A0RP 1OC9A 4TR4A 3LYKA 2FLSA 3WT2A 2BTOT 4E8EA 3IAM2 3FR6A 3FYGA 5G31A 1S3AA 1MD3A 1GSFA 5J40A 2OADA 1F2EA 4NV5A 2C3NA 4PGTA 3ZLPA 5ECPB 2MMOA 5D9TA 2C0GA 4N0VA 3DYRA 1SL2B 4J56E 4NHWA 3FRCA 4OMVA 5L71A 3KTLA 5J41A 3GKKA 4JR4A 2YJHA 5KN0A 1WRYA 2L5LA 3DVWA 5A5HB 1S3CA 2TRCP 1TK5B 2GZYA 4TR0A 3CTGA 1PL1A 4J57E 4POMA 2R0PA 2H1BA 1YEPA 5INYA 3VURA 2H74A 2GSRA 4TR3A 1RQMA 2IMEA 1DE2A 2PBJA 3LGCA 1VF2A 3LYPA 5A1NB 3UOMA 3BCKA 1ZYEA 2VCXA 5IO2A 1OC3A 3O3TA 3LSZA 1A2LA 3TKQA 5ELAA 2A4HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YZX A;  1NM3 A;  3D22 A;  2JZR A;  3UVH A;  1T4Z A;  2B5X A;  16GS A;  4OFT A;  1DBY A;  3C7M A;  1DUG A;  3HZ4 A;  2VM2 A;  1WE0 A;  2VD0 A;  1X9W B;  1K0M A;  2HRA A;  2F51 A;  4NWY A;  2OE1 A;  3A2V A;  2PER A;  3R3E A;  4BL7 A;  3ME7 A;  2TRX A;  2FWH A;  5IPH A;  5ABR A;  2HSM A;  1TDI A;  4JBB A;  2GLR A;  2L5O A;  5ECL B;  3US3 A;  2KLX A;  1XW9 A;  5CAX A;  1R4W A;  2H71 A;  5A5K A;  3F4R A;  3TRP A;  2GQL A;  1M9A A;  4PX1 A;  1GSU A;  3KGK A;  3LWA A;  1U88 A;  1B9X C;  4HU7 A;  3F0I A;  3KCM A;  5ECN B;  3KXO A;  14GS A;  1TXX A;  1K3L A;  4GQF A;  3ZTL A;  4WET A;  4PQI A;  2CQ9 A;  3FZA A;  2OBK A;  4IS0 A;  1CQG A;  4F0B A;  3TRQ A;  3APQ A;  5CNW A;  4YQU A;  4K7N A;  5GAN D;  3E3E A;  1O7U A;  2HRK B;  3P2A A;  4TOP A;  3TOT A;  22GS A;  1URM A;  4MPF A;  3QCP A;  3KMN A;  1M7T A;  2I81 A;  2HZE A;  6GSV A;  1T4Y A;  1PX7 A;  2O7K A;  3F6D A;  3KJY A;  1OKD A;  4XHM A;  5FHI A;  4KDY A;  2YZH A;  2V32 A;  2DJ1 A;  2NDO A;  1QFN A;  3GIX A;  2GSS A;  2WDU A;  3BBY A;  4MK3 A;  3L9S A;  4XS4 B;  5IPG A;  3FR3 A;  1SKR B;  1GP1 A;  4KF9 A;  3UVT A;  1THO A;  4ZXG A;  3ZL5 A;  3GA4 A;  2RUF A;  2VCV A;  2H6Y A;  4V1A g;  2VCQ A;  1X5E A;  4KB3 A;  2GS3 A;  4HI7 A;  3HJM A;  4IKH A;  2P0G A;  3S9F A;  5GAP D;  1TRU A;  2JU5 A;  3KD0 A;  2YWI A;  4JED A;  5ECK B;  3H1N A;  4XIH A;  1XWG A;  2D2Z A;  3DRN A;  4PQ1 A;  1O81 A;  2FHE A;  4ZL8 A;  1Y6E A;  2KP1 A;  3EYT A;  3SWL A;  4D73 A;  1VF3 A;  2V6O A;  4MJC A;  4N11 A;  1TOF A;  4G0L A;  1VF1 A;  3W8S A;  3CXG A;  1G7E A;  2F8F A;  5EY6 A;  5GZZ B;  2K9F A;  2EIR A;  1LJR A;  1SD8 A;  2LEG A;  5EVO A;  4IQ1 A;  2WFC A;  1RK4 A;  4NV2 A;  1N8J A;  3A2X A;  4BVY A;  3WGE A;  1KNG A;  4EE0 A;  3KTB A;  3QAG A;  3ERW A;  2VL3 A;  1JZR A;  2IN3 A;  4BWQ A;  2WZ9 A;  1ERV A;  4MJB A;  1GTA A;  1FW1 A;  4IVF A;  2O85 A;  1GSY A;  2AUV A;  2GQM A;  5ECS A;  2B6M A;  1TJD A;  2E0Q A;  5FWG A;  1SJI A;  1OE7 A;  1YY7 A;  4GLT A;  4O92 A;  4DSQ A;  4WKW A;  2VO4 A;  1HYU A;  5ECH B;  4IQA A;  4TR1 B;  4WF5 A;  4IJI A;  1BG5 A;  2ON7 A;  4I6X A;  4DVC A;  2GST A;  9GSS A;  4ISD A;  1JHB A;  1FG4 A;  4KW6 A;  5ECO B;  2CV4 A;  3RPN A;  1SKS B;  3E0U A;  3EMP A;  5FT3 A;  2B3S A;  2OA7 A;  1FHE A;  1OC9 B;  5HFI A;  1F37 A;  1SL1 B;  2OBI A;  5D9W A;  5F0G A;  4MP4 A;  4WEY A;  4MDC A;  4G0K A;  2O89 A;  2CT6 A;  1O73 A;  5D73 A;  3ZRD A;  3RHC A;  4YH2 A;  4EF0 A;  4F9Z A;  4ILF A;  2YPM A;  4KA0 A;  3RPP A;  5HR0 A;  1R5P A;  2JSZ A;  4KCE A;  3VPT A;  3GST A;  1WPI A;  4F03 A;  4XS4 A;  1MDI A;  2FNO A;  3UL3 A;  1ILO A;  2H66 A;  4JZQ A;  5B8B A;  2HNL A;  5D93 A;  3WT1 A;  1J08 A;  2DSA A;  2H6X A;  4V2M A;  1YF1 A;  3EIN A;  4WF4 A;  2H0G A;  3F3Q A;  2QC7 A;  3DML A;  2YOI A;  4RI7 A;  2NTO A;  4ZIL A;  3ZRE A;  4Q5Q A;  2YV9 A;  4EDY A;  3QFB C;  2DIZ A;  2KHP A;  3LJR A;  1Z5Y E;  7GSS A;  1H4O A;  5ECI B;  2GSQ A;  4I2U A;  3FW2 A;  1G6W A;  4Q5F A;  2B5E A;  5ECR B;  5ID2 A;  3HKR A;  2LRT A;  1SK2 A;  2VIM A;  1SYX A;  3GYK A;  4AJ8 A;  2XBI A;  3TJF A;  1LU4 A;  5C04 A;  4PTS A;  4MA9 A;  2E2M A;  4GCI A;  1XWC A;  2JSY A;  4MJE A;  2ZCT A;  4H86 A;  5IMD A;  5H5Q A;  4POL A;  2LS5 A;  5H5S A;  4HUA A;  5J9C A;  4L5L A;  1K0N A;  2H75 A;  3ZIT A;  2V1M A;  4BL7 B;  2REM A;  3QMX A;  3UIW A;  1FVK A;  2HSM B;  2LRN A;  1EP8 A;  2WJU A;  1EV4 A;  3ZZX A;  2L4C A;  1PGT A;  1GL8 A;  5CRD A;  2HXK A;  2VL2 A;  2HT9 A;  3C73 A;  4PQH A;  2HYX A;  3VI7 A;  4MF6 A;  5F05 A;  3FEU A;  2H0H A;  4YQV A;  2PPT A;  3C1S A;  18GS A;  1BAY A;  5J3R A;  5B7C A;  1TK8 B;  3LOR A;  3DIE A;  2LNS A;  2YV7 A;  2C80 A;  1ERW A;  5F06 A;  1XW6 A;  1TP9 A;  3I9V 2;  5DDL A;  2LUS A;  4WBR D;  3CRT A;  4E8H A;  3GL3 A;  5GSS A;  3DWV A;  2OE0 A;  1HNB A;  5JCG A;  1XVW A;  2H1A A;  1K0B A;  2AV4 A;  3QR6 A;  4HS1 A;  2C8U A;  1EEJ A;  4XRD A;  2H72 A;  3FKF A;  4YAV A;  1KBN A;  3HVS A;  2HZE B;  1TRW A;  5ELG A;  4N10 A;  2MMA A;  3HHV A;  2QGV A;  2XBQ A;  1K3Y A;  4ZIJ A;  1GNE A;  5ENU A;  4K7O A;  4G9H A;  3GV1 A;  3MWH A;  4LMW A;  4ZBB A;  3FZ4 A;  4GWR A;  2H1D A;  1AC1 A;  2DML A;  2LTK A;  1M99 A;  2A2R A;  3FK8 A;  4KX4 A;  1JZW A;  5B6M A;  3O6T A;  3JCM L;  3O76 A;  2H8L A;  2PUK C;  2ZUP A;  1X5D A;  3RHB A;  1R26 A;  3C71 A;  6GSS A;  3N9J A;  1XOA A;  2YWO A;  4OD7 A;  1GNW A;  4L5O A;  2XPE A;  3VPQ A;  5GST A;  4IP1 A;  5LCZ A;  3TB2 A;  1K0O A;  2OKA A;  4GQC A;  2DJ0 A;  5CRH A;  5CRW A;  4BA7 A;  2LRC A;  2WS2 A;  3APO A;  1F6M C;  5AN1 A;  2KOK A;  3UBL A;  3MSZ A;  3PIN A;  5JWO B;  2N5F A;  3LQ7 A;  3KP8 A;  4K2D A;  5HR2 A;  3QFA C;  3HVX A;  2CA8 A;  4D73 B;  1E2Y A;  1I9D A;  4BVX A;  3KZQ A;  3CRU A;  1WWJ A;  2X99 A;  3LEF A;  1TW9 A;  1GSD A;  1MTC A;  1Y25 A;  5CYY A;  3TRX A;  1BX9 A;  4CDO A;  3F3R A;  4L0W A;  3CTF A;  3OR5 A;  4ECI A;  4BVY B;  4HDE A;  6GSU A;  2F8A A;  6GST A;  2J23 A;  4IW9 A;  2JAD A;  1X9M B;  5F07 A;  2L6C A;  3P7X A;  2RM6 A;  3FR9 A;  4Z7X A;  2LJA A;  3A3T A;  2PGT A;  4XS6 A;  3IR4 A;  4NAX A;  3TJB A;  4FO5 A;  2LJR A;  2VCZ A;  2V6K A;  2FA4 A;  3GMF A;  4MZB A;  5COH A;  2HSY A;  1C72 A;  4FH8 A;  2MBS A;  5F8B A;  4ECC A;  2PN8 A;  3IAS 2;  5CRE A;  4F82 A;  1GTU A;  1B4Q A;  1OKT A;  5J4U A;  2P5R A;  1YDK A;  2G2Q A;  4XS1 A;  4Q5N A;  1PA3 A;  5HFK A;  5E4W A;  4I97 A;  4HQZ A;  4WR5 A;  3PR8 A;  4P3Y B;  3N5O A;  5A4U A;  3GHA A;  5DCH A;  2H70 A;  2XC2 A;  3TCO A;  2LJK A;  3K8N A;  5IMF A;  2HRF A;  5ECQ B;  2F3M A;  3MAK A;  3SBC A;  3HDC A;  1B9Y C;  1EWX A;  4Q5R A;  1A2J A;  3TOU A;  3Q6O A;  4J2F A;  1XPV A;  3GKM A;  3EMX A;  2DIY A;  1FVJ A;  2BMX A;  2H6Z A;  5HR3 A;  4KGI A;  4G10 A;  2H30 A;  3MNG A;  1UA5 A;  5G5E A;  4KUN A;  1JLV A;  3DVX A;  1MD4 A;  1TRV A;  4QL7 A;  3VI5 A;  2VL9 A;  4GSN A;  5AGY A;  2LNT A;  3VWV A;  5DJL A;  2C3T A;  3VWX A;  1PX6 A;  2YZU A;  1X5C A;  3Q19 A;  4OFN A;  3ZIV A;  3IPZ A;  3VLN A;  1MDK A;  3IK9 A;  2H01 A;  1BYE A;  3IHQ A;  4OCE A;  3EC3 A;  1XCC A;  2HE3 A;  2LST A;  1XZO A;  4LMV A;  3UMA A;  4POB A;  2FA8 A;  3TJG A;  4FYB A;  1W89 A;  1NSW A;  4O7H A;  2ALB A;  2N5B A;  4I8B A;  5HR1 A;  5G1K A;  3WGX A;  5ID2 B;  4O5R A;  4WXT A;  2M72 A;  5KN2 A;  4IEL A;  2HLS A;  1J9B A;  1YKA A;  5IMC A;  1U3A A;  1UN2 A;  4K8M A;  3DKS A;  1AIU A;  2AB6 A;  3IA1 A;  4FYU A;  4ZB9 A;  3HCZ A;  3D4M A;  4G19 A;  1OE8 A;  3UEM A;  3P90 A;  5B6N A;  2M80 A;  3QD9 A;  5JWR B;  1SD9 A;  2YWN A;  1AAZ A;  2DJ3 A;  2MBT A;  3BCI A;  2YCD A;  1JFU A;  3ME8 A;  2VCT A;  3GRX A;  3TJK A;  1XIY A;  1WP0 A;  3ISO A;  5H5R A;  4MAB A;  1ABA A;  1Z6M A;  1F3A A;  4EDZ A;  4HEA 2;  3HYP A;  2DC5 A;  1FB0 A;  2RII A;  2VM1 A;  4MJA A;  1TK0 B;  1A8Y A;  2R4V A;  5DJM A;  3W6G A;  2HFD A;  3EVI A;  1PN9 A;  4KH7 A;  5IOX A;  2B1L A;  1QK8 A;  3IC4 A;  2YAN A;  3KP9 A;  2CZ3 A;  1GLQ A;  1GTB A;  1PD2 1;  5J5N A;  4FQU A;  3Q74 A;  2J9H A;  2EC4 A;  1UC7 A;  4O32 A;  2GZZ A;  3J7Y b;  1QGV A;  1FB6 A;  5CO3 A;  3IDV A;  5JCU A;  2HSN B;  2L57 A;  3RDW A;  3QDN A;  5HFG A;  3H93 A;  4NHZ A;  4TXV A;  1F3B A;  3HXS A;  2FGX A;  1EGO A;  4K9Z A;  4TXO B;  4DSS A;  4HJ2 A;  2JL4 A;  5DVB A;  3UJ1 A;  4RI6 A;  4ECB A;  3EUR A;  5DQS A;  4RQR A;  1YF0 A;  4KAE A;  1HNA A;  2OAC A;  1SJZ A;  1GH2 A;  4OWY A;  3GUS A;  2AAW A;  5IO0 A;  2HI7 A;  2HQT A;  2L6D A;  3M0F A;  1BED A;  5IOW A;  1J0F A;  4GF0 A;  3DD3 A;  2XHF A;  3BJ5 A;  3RBT A;  5DAL A;  1T00 A;  1ZL9 A;  1XOB A;  3LXZ A;  3L9V A;  4G2E A;  3M9K A;  3CSJ A;  4MZW A;  2FWE A;  1WJK A;  1ML6 A;  1JLW A;  8GSS A;  2I3Y A;  1QMV A;  4I2T A;  1HQO A;  1HNC A;  1JZD A;  2H1G A;  3APS A;  1S3D A;  5C00 A;  3I6A A;  2H0I A;  4ZB6 A;  1R5A A;  1T1V A;  3GX8 A;  1DSB A;  4ZBA A;  2FY6 A;  1GUK A;  3C8E A;  2YWM A;  1XXU A;  5G1L A;  1T7P B;  3GTU A;  5IMZ A;  2B7K A;  1ACV A;  3ZFB A;  1XBS A;  1PKZ A;  3HVV A;  1CQH A;  1NHY A;  1AQV A;  1TI3 A;  4RQX A;  3UAR A;  4MZC A;  3KH9 A;  1YKC A;  4BVX B;  1A23 A;  1EV9 A;  4YQM A;  2WB9 A;  2C4J A;  2K18 A;  3E9J B;  13GS A;  1KEB A;  2JAC A;  2IJY A;  3GNJ A;  1TU8 A;  4ECJ A;  10GS A;  3HD5 A;  2H76 A;  3NZN A;  2P31 A;  1OAZ A;  4PXO A;  5IIZ A;  2M46 A;  3CSI A;  1VGL A;  4IJ3 A;  1PKW A;  3TJJ A;  4JRR A;  1G6Y A;  3WYW A;  3CYN A;  4MCU A;  1SYR A;  3GUR A;  3M1G A;  1V57 A;  1ZYQ B;  1G7O A;  4PUF C;  4PUA A;  2P5Q A;  3TKS C;  4KDU A;  4IBP A;  2PMT A;  3QAV A;  2OJL A;  2CAI A;  4WR4 A;  3NOF A;  2N5A A;  1AXD A;  3KEB A;  3IE3 A;  1NW2 A;  4TKY A;  3QAW A;  1A2M A;  4QQ7 A;  4EXJ A;  3R2Q A;  2NVL A;  4K1F A;  1O85 A;  2R5G A;  1B8X A;  5CP1 A;  2ZNM A;  3PH9 A;  3GH9 A;  1MEK A;  4K7I A;  2GZP A;  3IK7 A;  3F63 A;  2PWJ A;  3FZ5 A;  2PVO C;  3F8U A;  2IWT A;  3W8J A;  19GS A;  4TXO A;  1GUL A;  1T3B A;  4NPB A;  1KTE A;  11GS A;  6GSX A;  1V9W A;  2OE3 A;  2NPB A;  3CSH A;  2CZ2 A;  5IQY A;  2YN1 A;  4MH2 A;  1XVQ A;  5DCG A;  3ZYW A;  1R7H A;  3FZ9 A;  1NHO A;  1K0D A;  2IMK A;  12GS A;  1SK0 A;  2CAQ A;  1Z7R A;  2HRN A;  1EEM A;  3ZML A;  3TKS E;  1BJX A;  3V1W A;  1XW5 A;  4TN8 A;  3IXR A;  1LBK A;  3IV4 A;  3H79 A;  4PNF A;  4ACS A;  2FCH A;  5CRG A;  1RW1 A;  4HZ2 A;  1M2D A;  3L78 A;  4XTS A;  2LKU A;  2K8V A;  3F9U A;  3UBK A;  3M9J A;  2JZT A;  4X43 A;  5IM9 A;  5HQP A;  4JU5 A;  1ZZY A;  4FYC A;  4BWS A;  1ERT A;  3QPM A;  1EOH A;  3L9U A;  5D8I A;  2C3Q A;  3TDG A;  3TUE A;  1GLP A;  3VWW A;  3TKS A;  1SJ6 A;  1U3I A;  1GUM A;  3Q18 A;  1Z3E A;  2DJK A;  1ZOF A;  2WUL A;  5D96 A;  3PGT A;  1YQ1 A;  3C1R A;  3IOS A;  3EU4 A;  2B7J A;  3D4T A;  1GSE A;  1Q4J A;  2E7P A;  2C1Y A;  2DBC A;  2V2G A;  1X0R A;  2YJ7 A;  3GSS A;  3HJP A;  2VOC A;  2GQK A;  1V2A A;  1QQ2 A;  4V1A p;  2RM5 A;  2V41 A;  3HA9 A;  2VD1 A;  1XWA A;  4JE1 A;  1MDJ A;  3ZVJ A;  4K6X A;  1N2A A;  2YNX A;  1O6J A;  4EC0 A;  5IMA A;  3LG6 A;  4OO5 A;  4V2N A;  3EWL A;  5G2Z A;  3EU3 A;  2I9H A;  3VWU A;  2X64 A;  3G7I A;  1DE1 A;  1GTI A;  4LLR A;  4GRF A;  1USB A;  2K8S A;  5BMU A;  1TU7 A;  5EPF A;  2O8V B;  2KUC A;  2WRT A;  4HOJ A;  1O8X A;  3UAP A;  2F9S A;  1M0U A;  3WGD A;  4KSM A;  1WOU A;  3P8W A;  4F0C A;  3FHK A;  3PPU A;  5AIV A;  4MLY A;  1PRX A;  2AHE A;  2DJJ A;  1GSS A;  4N0Z A;  3ERG A;  2GVP A;  5E59 A;  4IN0 A;  4DSS B;  5G5F A;  2QKE A;  1EOG A;  1IYI A;  3HY2 A;  2HSH A;  4ZL7 A;  3GH6 A;  2O87 A;  3HZ8 A;  4XRA A;  1EGR A;  5D9V A;  5AIS A;  2B1K A;  3VFI A;  4EO3 A;  1SKW B;  1T8E B;  1ZCP A;  5J9B A;  1U6T A;  1Z7P A;  2L4Q A;  1QXH A;  1ZMA A;  4G0I A;  1GRX A;  3GKX A;  5KN1 A;  4OCF A;  17GS A;  5DAL B;  2MMN A;  4ML1 A;  1YJ6 A;  1OC8 A;  1PMT A;  2IPA A;  5JWQ B;  1G0T A;  2K6V A;  2ON5 A;  3D0Z A;  3GX0 A;  4GTU A;  2C0E A;  4ML6 A;  2R3X A;  4IGJ A;  1EZK A;  4USS A;  5B8A A;  2EIO A;  5A4W A;  4K0N A;  1PSQ A;  4X1U A;  2QSI A;  3LXT A;  4CW9 A;  2G0F A;  3I43 A;  3ZIJ A;  3GTU B;  1W4V A;  1FAA A;  3ZVJ D;  1HD2 A;  3DGQ A;  4F2I A;  4ZBD A;  1BQ7 A;  2MYG A;  1H75 A;  5IMV A;  3M3M A;  2CVB A;  1GUH A;  3J7Y k;  4KND A;  2VUP A;  3KH7 A;  1SL0 B;  2FD3 A;  4MF5 A;  1XFL A;  5G30 A;  4DSR A;  1V58 A;  4NXI A;  4EVM A;  4HZ4 A;  2VLT A;  3ERF A;  2GGT A;  2ES7 A;  3AY8 A;  2CX4 A;  3D21 A;  1UVZ A;  20GS A;  3L0H A;  3RAZ A;  4LA1 A;  4CHS A;  4AGS A;  2X8C A;  4ZL9 A;  5DAK B;  3TKP A;  4TVE A;  4LL4 B;  1FOV A;  2CVK A;  1Z9H A;  4QL9 A;  3TGZ A;  2DJ2 A;  2A2S A;  1E6B A;  1WMJ A;  2AYT A;  4BPY A;  2DLX A;  4HU9 A;  3GKN A;  2XPD A;  4AJ7 A;  1SK1 A;  2PVQ A;  5A4V A;  3GL5 A;  2BJX A;  3KIJ A;  3GN3 A;  4L0U A;  2Z9S A;  2H19 A;  4EKZ A;  3I69 A;  2CVD A;  3NIV A;  5EL8 A;  2FWG A;  4NMU A;  4KE3 A;  1I5G A;  1ERU A;  2MZC A;  4KCA A;  3IC8 A;  4DEJ A;  2TIR A;  1GSQ A;  1QUW A;  1XWK A;  3MDK A;  4JR6 A;  4OFM A;  2PU9 C;  4HJM A;  3U5R E;  4ID0 A;  1M2B A;  3ZMK A;  2IFQ B;  1AQX A;  2VL2 C;  2HRK A;  3A5W A;  1TKD B;  2DMM A;  3HJO A;  1Q98 A;  4X0X A;  5ECM B;  1A24 A;  2VAF A;  1AQW A;  4K0G A;  1K0C A;  4N30 A;  1ON4 A;  3G7J A;  4GST A;  3ZFL A;  3M8N A;  4AJ6 A;  4PUR A;  1AW9 A;  2A4V A;  1AUC A;  2MMZ A;  2HZF A;  2GT6 A;  2GT5 A;  1TI1 A;  4MPG A;  3WD6 A;  1PQN A;  1GWC A;  4ZB8 A;  4EL1 A;  5KEJ A;  1ZGN A;  2VLU A;  3U6V A;  5DQY A;  2VLV A;  4LL1 B;  1K3O A;  1VF4 A;  1SEN A;  2VCW A;  3IRA A;  3IBH A;  4MF7 A;  2LQO A;  6GSW A;  2E2G A;  3VK9 A;  4TRX A;  2YP6 A;  1U87 A;  3F6F A;  1EP7 A;  2C0D A;  2R6K A;  3H8Q A;  3EE2 A;  2B5Y A;  2WGR A;  1Z6N A;  1VRS D;  4POK A;  2R37 A;  2FWF A;  4GXZ A;  2NBS A;  2KP2 A;  2EIQ A;  3DEX A;  3DXB A;  2LV3 A;  1B4P A;  3F4T A;  2IIY A;  4HQS A;  4IP6 A;  4V2L A;  4WBJ A;  2IMI A;  3D6I A;  5DBQ A;  4KSO A;  3ED3 A;  2GDR A;  2RUE A;  2JZS A;  1F9M A;  3G9B A;  4OO4 A;  4ULX A;  1O8W A;  3CMI A;  5AIX A;  1YEX A;  1K0A A;  3G7Y A;  1PL2 A;  2IMF A;  1X9S B;  5DAK A;  1A0F A;  4AF2 A;  1A8L A;  1B48 A;  4TW5 A;  2FUG 2;  1V98 A;  2I1U A;  3GFK A;  2R2J A;  6GSY A;  3A2W A;  2IMD A;  2UZ8 A;  5LD0 A;  1OVN A;  4IHU A;  1OYJ A;  2X8H A;  2AJQ B;  2IL3 A;  2GTU A;  1WIK A;  3CBU A;  3LFL A;  4L8E A;  1TRS A;  3KM6 A;  3QOU A;  1XWB A;  2WCI A;  4EUY A;  1ST9 A;  1V40 A;  3H4K A;  1M9B A;  5KN3 A;  2L59 A;  4PNG A;  1TTZ A;  1M2A A;  5JCW A;  3F4S A;  3BOA A;  1FO5 A;  4GSS A;  4XCS A;  3L4N A;  4TR1 A;  1JZO A;  4RUV A;  1IYH A;  5D9X A;  3BD2 A;  2X8G A;  4FIW A;  2I4A A;  2IFQ A;  4YAP A;  2H73 A;  2LQQ A;  1SU9 A;  3FY7 A;  1THX A;  2CX3 A;  4KDX A;  4MMM A;  3TKR A;  5LNK e;  4MH3 A;  2RLI A;  3D5J A;  2C0F A;  3KMO A;  1A0R P;  1OC9 A;  4TR4 A;  3LYK A;  2FLS A;  3WT2 A;  2BTO T;  4E8E A;  3IAM 2;  3FR6 A;  3FYG A;  5G31 A;  1S3A A;  1MD3 A;  1GSF A;  2OAD A;  1F2E A;  4NV5 A;  2C3N A;  4PGT A;  3ZLP A;  5ECP B;  2MMO A;  5D9T A;  2C0G A;  4N0V A;  3DYR A;  1SL2 B;  4J56 E;  4NHW A;  3FRC A;  4OMV A;  5L71 A;  3KTL A;  5J41 A;  3GKK A;  4JR4 A;  2YJH A;  5KN0 A;  1WRY A;  2L5L A;  3DVW A;  1S3C A;  2TRC P;  1TK5 B;  2GZY A;  4TR0 A;  3CTG A;  1PL1 A;  4J57 E;  4POM A;  2H1B A;  1YEP A;  5INY A;  3VUR A;  2H74 A;  2GSR A;  4TR3 A;  1RQM A;  2IME A;  1DE2 A;  2PBJ A;  3LGC A;  1VF2 A;  3LYP A;  3UOM A;  3BCK A;  1ZYE A;  2VCX A;  5IO2 A;  1OC3 A;  3O3T A;  3LSZ A;  1A2L A;  3TKQ A;  5ELA A;  4I5Q A; 
#chains in the Genus database with same CATH topology
 1YZX A;  1NM3 A;  3D22 A;  2JZR A;  3UVH A;  1T4Z A;  2B5X A;  16GS A;  4HSC X;  4OFT A;  1DBY A;  3C7M A;  1DUG A;  3HZ4 A;  2VM2 A;  1WE0 A;  2VD0 A;  1X9W B;  1K0M A;  2HRA A;  2F51 A;  2WW2 A;  2A2P A;  2OE1 A;  4NWY A;  3A2V A;  2PER A;  3R3E A;  4BL7 A;  3ME7 A;  2TRX A;  2FWH A;  5IPH A;  5ABR A;  2HSM A;  1TDI A;  4JBB A;  2GLR A;  2L5O A;  5ECL B;  3US3 A;  2KLX A;  1XW9 A;  5CAX A;  1R4W A;  2H71 A;  5A5K A;  3F4R A;  3TRP A;  2GQL A;  1M9A A;  4PX1 A;  1GSU A;  3KGK A;  3LWA A;  1U88 A;  1B9X C;  4HU7 A;  3F0I A;  3KCM A;  5ECN B;  3KXO A;  14GS A;  1TXX A;  1K3L A;  3TU3 B;  4GQF A;  3ZTL A;  4WET A;  4PQI A;  2CQ9 A;  3FZA A;  2OBK A;  4IS0 A;  1PN0 A;  1CQG A;  4F0B A;  3TRQ A;  3APQ A;  5CNW A;  4YQU A;  4K7N A;  5GAN D;  3E3E A;  1O7U A;  2HRK B;  3P2A A;  4TOP A;  3TOT A;  22GS A;  1URM A;  4MPF A;  3QCP A;  3KMN A;  1M7T A;  2I81 A;  2HZE A;  6GSV A;  1T4Y A;  1PX7 A;  2O7K A;  3F6D A;  3KJY A;  1OKD A;  4XHM A;  5FHI A;  4KDY A;  2YZH A;  2V32 A;  3FMW A;  2WW3 A;  2DJ1 A;  2NDO A;  1QFN A;  3GIX A;  2GSS A;  2WDU A;  3BBY A;  4MK3 A;  3L9S A;  4XS4 B;  5IPG A;  3FR3 A;  1SKR B;  1GP1 A;  4KF9 A;  3UVT A;  1THO A;  4ZXG A;  3ZL5 A;  3GA4 A;  2RUF A;  2VCV A;  2H6Y A;  3CQF A;  4V1A g;  2VCQ A;  1X5E A;  4KB3 A;  2GS3 A;  4HI7 A;  3HJM A;  5A1N A;  4IKH A;  2P0G A;  3S9F A;  5GAP D;  3LW9 A;  1TRU A;  2JU5 A;  3KD0 A;  2YWI A;  4JED A;  5ECK B;  3H1N A;  4XIH A;  1XWG A;  2D2Z A;  3DRN A;  4PQ1 A;  1O81 A;  2FHE A;  4ZL8 A;  1Y6E A;  2KP1 A;  3EYT A;  3SWL A;  4D73 A;  1VF3 A;  2V6O A;  4MJC A;  4N11 A;  1TOF A;  4G0L A;  1VF1 A;  3W8S A;  4MNN A;  3CXG A;  1G7E A;  2F8F A;  4PI0 C;  5EY6 A;  4FXY P;  5GZZ B;  2K9F A;  2EIR A;  1LJR A;  1SD8 A;  2LEG A;  5EVO A;  4IQ1 A;  2WFC A;  1RK4 A;  4NV2 A;  1N8J A;  3A2X A;  4BVY A;  3WGE A;  1KNG A;  4EE0 A;  3KTB A;  3QAG A;  4AKG A;  3ERW A;  2VL3 A;  1JZR A;  2IN3 A;  4BWQ A;  2VKZ G;  2DKH A;  2WZ9 A;  1ERV A;  4MJB A;  1GTA A;  1FW1 A;  4IVF A;  2O85 A;  1GSY A;  2X4A A;  2AUV A;  2GQM A;  5ECS A;  4X4J A;  2B6M A;  1TJD A;  4G01 A;  2E0Q A;  5FWG A;  1SJI A;  1OE7 A;  1YY7 A;  4GLT A;  4O92 A;  4DSQ A;  4WKW A;  3HVN A;  2VO4 A;  1HYU A;  5ECH B;  4IQA A;  4TR1 B;  1S3R A;  4WF5 A;  4IJI A;  1BG5 A;  2ON7 A;  4I6X A;  4DVC A;  2GST A;  9GSS A;  4ISD A;  1JHB A;  1FG4 A;  4KW6 A;  5ECO B;  2CV4 A;  3RPN A;  1SKS B;  3E0U A;  3EMP A;  5FT3 A;  2B3S A;  2OA7 A;  1FHE A;  1OC9 B;  5HFI A;  1F37 A;  1SL1 B;  2OBI A;  5D9W A;  5F0G A;  2EFD A;  4MP4 A;  4WEY A;  4MDC A;  4G0K A;  2O89 A;  2CT6 A;  1O73 A;  5D73 A;  3ZRD A;  3RHC A;  4YH2 A;  4EF0 A;  4F9Z A;  4ILF A;  2YPM A;  4KA0 A;  3RPP A;  5HR0 A;  1R5P A;  2JSZ A;  4KCE A;  3VPT A;  3GST A;  1WPI A;  4F03 A;  4XS4 A;  1MDI A;  2FNO A;  3UL3 A;  1ILO A;  2H66 A;  4JZQ A;  5B8B A;  2HNL A;  5D93 A;  3WT1 A;  1J08 A;  2DSA A;  2H6X A;  4V2M A;  1YF1 A;  3EIN A;  4WF4 A;  2H0G A;  3F3Q A;  2QC7 A;  3DML A;  2YOI A;  4RI7 A;  2NTO A;  4ZIL A;  3ZRE A;  4Q5Q A;  2YV9 A;  4EDY A;  3QFB C;  2DIZ A;  2KHP A;  3LJR A;  1Z5Y E;  7GSS A;  1H4O A;  5ECI B;  2GSQ A;  4I2U A;  3FW2 A;  1G6W A;  4Q5F A;  2B5E A;  5ECR B;  5ID2 A;  3HKR A;  2LRT A;  1SK2 A;  2VIM A;  1SYX A;  3GYK A;  4AJ8 A;  2XBI A;  3TJF A;  1LU4 A;  5C04 A;  4PTS A;  4MA9 A;  2E2M A;  4GCI A;  1XWC A;  2JSY A;  4MJE A;  2ZCT A;  4H86 A;  5IMD A;  5H5Q A;  4POL A;  2LS5 A;  5H5S A;  4HUA A;  5J9C A;  4L5L A;  1K0N A;  2OT3 A;  2H75 A;  3ZIT A;  2V1M A;  4BL7 B;  2REM A;  3QMX A;  3UIW A;  1FVK A;  2HSM B;  2LRN A;  1EP8 A;  2WJU A;  1EV4 A;  3ZZX A;  2L4C A;  2R0C A;  1PGT A;  1GL8 A;  1SVO A;  2HXK A;  5CRD A;  2VL2 A;  2HT9 A;  3C73 A;  4PQH A;  2HYX A;  3VI7 A;  3CWG A;  4MF6 A;  5F05 A;  3FEU A;  2H0H A;  4YQV A;  2PPT A;  3C1S A;  18GS A;  1BAY A;  5J3R A;  5B7C A;  1TK8 B;  3LOR A;  3DIE A;  2LNS A;  2YV7 A;  4ZB7 A;  2C80 A;  1ERW A;  5F06 A;  1XW6 A;  1TP9 A;  3I9V 2;  5DDL A;  2LUS A;  4WBR D;  3CRT A;  4E8H A;  1XG8 A;  3GL3 A;  5GSS A;  3DWV A;  1ZYN A;  2OE0 A;  1HNB A;  5JCG A;  4I5Q A;  1XVW A;  2H1A A;  1K0B A;  2AV4 A;  3QR6 A;  4HS1 A;  4BIK A;  2C8U A;  1EEJ A;  4XRD A;  2H72 A;  3FKF A;  4YAV A;  1KBN A;  3HVS A;  2HZE B;  1TRW A;  5ELG A;  4N10 A;  2MMA A;  3HHV A;  2QGV A;  2XBQ A;  1K3Y A;  4ZIJ A;  1GNE A;  5ENU A;  4K7O A;  4G9H A;  3GV1 A;  3MWH A;  1PFO A;  4LMW A;  4ZBB A;  3FZ4 A;  4GWR A;  1Y1U A;  2H1D A;  1AC1 A;  2DML A;  2LTK A;  1M99 A;  2A2R A;  3FK8 A;  4KX4 A;  5A34 A;  2X49 A;  1JZW A;  5B6M A;  3O6T A;  3JCM L;  3O76 A;  2H8L A;  2PUK C;  2ZUP A;  1X5D A;  3RHB A;  1R26 A;  3C71 A;  6GSS A;  3N9J A;  1XOA A;  2YWO A;  4OD7 A;  1GNW A;  4L5O A;  2XPE A;  3VPQ A;  5GST A;  4IP1 A;  5LCZ A;  3TB2 A;  1K0O A;  2OKA A;  4GQC A;  2DJ0 A;  5CRH A;  2WVZ A;  5CRW A;  4BA7 A;  2LRC A;  2WS2 A;  3APO A;  1F6M C;  5AN1 A;  2KOK A;  3UBL A;  3MSZ A;  3PIN A;  5JWO B;  2N5F A;  3LQ7 A;  3KP8 A;  4K2D A;  5HR2 A;  3QFA C;  3HVX A;  2CA8 A;  4D73 B;  1E2Y A;  1I9D A;  4BVX A;  3KZQ A;  3CRU A;  1WWJ A;  2X99 A;  3LEF A;  1TW9 A;  1GSD A;  1MTC A;  1Y25 A;  5CYY A;  3TRX A;  1BX9 A;  4CDO A;  3F3R A;  4L0W A;  3CTF A;  3OR5 A;  4ECI A;  2DKI A;  4BVY B;  4HDE A;  6GSU A;  2F8A A;  6GST A;  2J23 A;  4IW9 A;  2JAD A;  1X9M B;  4EIQ A;  5F07 A;  1SVM A;  2L6C A;  3P7X A;  2RM6 A;  3FR9 A;  4Z7X A;  1ZYP A;  2LJA A;  3A3T A;  2PGT A;  4XS6 A;  3IR4 A;  4NAX A;  3TJB A;  4FO5 A;  2LJR A;  2VCZ A;  2V6K A;  2FA4 A;  3GMF A;  4MZB A;  5COH A;  2HSY A;  1C72 A;  4AKH A;  4FH8 A;  2MBS A;  5F8B A;  4ECC A;  2PN8 A;  3IAS 2;  5CRE A;  4F82 A;  1GTU A;  1B4Q A;  1OKT A;  5J4U A;  2P5R A;  1YDK A;  2G2Q A;  4XS1 A;  4Q5N A;  1PA3 A;  5HFK A;  5E4W A;  4I97 A;  4HQZ A;  4WR5 A;  3CHX C;  3PR8 A;  4P3Y B;  3N5O A;  5A4U A;  3GHA A;  5DCH A;  2H70 A;  2XC2 A;  3TCO A;  2LJK A;  3K8N A;  5IMF A;  2HRF A;  5ECQ B;  2F3M A;  3MAK A;  3SBC A;  3HDC A;  1B9Y C;  1EWX A;  4Q5R A;  1A2J A;  3TOU A;  3Q6O A;  1I1I P;  4J2F A;  1XPV A;  3GKM A;  3EMX A;  2DIY A;  4YKG A;  1FVJ A;  2BMX A;  2H6Z A;  5HR3 A;  4KGI A;  4G10 A;  2H30 A;  3MNG A;  1UA5 A;  5G5E A;  4KUN A;  2O5V A;  1JLV A;  3DVX A;  1MD4 A;  1TRV A;  4QL7 A;  3VI5 A;  2VL9 A;  4GSN A;  5AGY A;  2LNT A;  3VWV A;  5DJL A;  2C3T A;  3VWX A;  1PX6 A;  4Z2T A;  5BRT A;  2YZU A;  1X5C A;  3Q19 A;  4OFN A;  3ZIV A;  3IPZ A;  3VLN A;  2R0G A;  1MDK A;  3IK9 A;  2H01 A;  1BYE A;  3IHQ A;  4OCE A;  3EC3 A;  1XCC A;  2HE3 A;  2LST A;  1XZO A;  4LMV A;  3UMA A;  4POB A;  2FA8 A;  3TJG A;  4FYB A;  1W89 A;  1NSW A;  4O7H A;  2ALB A;  2N5B A;  4I8B A;  5HR1 A;  5G1K A;  3WGX A;  5ID2 B;  4O5R A;  4WXT A;  2M72 A;  3RFR C;  5KN2 A;  4IEL A;  2HLS A;  1J9B A;  1YKA A;  5IMC A;  1U3A A;  4E68 A;  1UN2 A;  4K8M A;  3DKS A;  1AIU A;  2AB6 A;  3IA1 A;  4O5U A;  4FYU A;  4ZB9 A;  3HCZ A;  3D4M A;  4G19 A;  1OE8 A;  4GDF A;  3UEM A;  3P90 A;  4ICY A;  5B6N A;  2M80 A;  3QD9 A;  5JWR B;  1SD9 A;  2YWN A;  1AAZ A;  2DJ3 A;  2MBT A;  2EFC A;  3BCI A;  2YCD A;  1JFU A;  3ME8 A;  2VCT A;  3GRX A;  3TJK A;  4N3Z A;  1XIY A;  1WP0 A;  3ISO A;  5H5R A;  4MAB A;  1ABA A;  1Z6M A;  1F3A A;  4EDZ A;  4HEA 2;  3HYP A;  2DC5 A;  1FB0 A;  2RII A;  2VM1 A;  4MJA A;  2H1L A;  1TK0 B;  1A8Y A;  2R4V A;  5DJM A;  3W6G A;  3MIX A;  2HFD A;  3EVI A;  1PN9 A;  4KH7 A;  5IOX A;  2B1L A;  1QK8 A;  3IC4 A;  2YAN A;  3KP9 A;  2CZ3 A;  1GLQ A;  1GTB A;  1PD2 1;  5J5N A;  4FQU A;  3Q74 A;  2J9H A;  2EC4 A;  1UC7 A;  4O32 A;  2GZZ A;  3J7Y b;  1QGV A;  1FB6 A;  2WW0 A;  5CO3 A;  3IDV A;  5JCU A;  2HSN B;  4CY6 A;  2L57 A;  3RDW A;  3QDN A;  5HFG A;  3H93 A;  4NHZ A;  4TXV A;  2O36 A;  1F3B A;  3HXS A;  2FGX A;  1EGO A;  4K9Z A;  4TXO B;  4DSS A;  4HJ2 A;  2JL4 A;  5DVB A;  3UJ1 A;  4RI6 A;  4ECB A;  3EUR A;  5DQS A;  4RQR A;  1YF0 A;  4KAE A;  1HNA A;  2OAC A;  1SJZ A;  1GH2 A;  4OWY A;  3GUS A;  2AAW A;  5IO0 A;  2HI7 A;  2HQT A;  2L6D A;  3M0F A;  1BED A;  5IOW A;  1J0F A;  5A34 B;  4GF0 A;  3DD3 A;  2XHF A;  3BJ5 A;  3RBT A;  5DAL A;  3HMJ G;  1T00 A;  4AKX B;  1ZL9 A;  2WVX B;  1XOB A;  3LXZ A;  3L9V A;  4G2E A;  3M9K A;  3CSJ A;  4MZW A;  2FWE A;  1WJK A;  4YKF A;  1ML6 A;  1JLW A;  8GSS A;  2I3Y A;  1QMV A;  4I2T A;  1HQO A;  1HNC A;  1JZD A;  2H1G A;  3APS A;  1S3D A;  4PHZ C;  5C00 A;  3I6A A;  2H0I A;  4ZB6 A;  1R5A A;  4PI2 C;  1T1V A;  3GX8 A;  1DSB A;  4ZBA A;  2FY6 A;  1GUK A;  3C8E A;  2YWM A;  1XXU A;  5G1L A;  1T7P B;  3GTU A;  5IMZ A;  4QMK A;  2B7K A;  1ACV A;  3ZFB A;  1XBS A;  1PKZ A;  3HVV A;  4AI6 A;  1NHY A;  1CQH A;  1AQV A;  1TI3 A;  4RQX A;  3UAR A;  4MZC A;  3KH9 A;  1YKC A;  4BVX B;  1A23 A;  1EV9 A;  4YQM A;  2WB9 A;  2C4J A;  2K18 A;  3E9J B;  13GS A;  1KEB A;  2JAC A;  2IJY A;  3GNJ A;  1TU8 A;  4ECJ A;  10GS A;  3HD5 A;  2H76 A;  3NZN A;  4W66 A;  2QA1 A;  2P31 A;  1OAZ A;  4PXO A;  5IIZ A;  2M46 A;  3CSI A;  1VGL A;  4IJ3 A;  1PKW A;  3TJJ A;  4JRR A;  1G6Y A;  3WYW A;  3CYN A;  4MCU A;  1SYR A;  3GUR A;  3M1G A;  5J47 A;  1V57 A;  1ZYQ B;  1G7O A;  4CY8 A;  4PUF C;  4PUA A;  2P5Q A;  3TKS C;  4KDU A;  4IBP A;  2PMT A;  3QAV A;  2OJL A;  5KOX A;  4Z2R A;  1YVL A;  2CAI A;  4WR4 A;  5J4V A;  3NOF A;  2N5A A;  3A5I A;  1AXD A;  3KEB A;  3IE3 A;  1NW2 A;  4TKY A;  3QAW A;  1A2M A;  4QQ7 A;  4EXJ A;  3R2Q A;  2NVL A;  4K1F A;  1O85 A;  2R5G A;  5BMU B;  1B8X A;  2O3E A;  5CP1 A;  2ZNM A;  4Z2U A;  3PH9 A;  2HSN A;  3GH9 A;  1MEK A;  4K7I A;  2GZP A;  3IK7 A;  3F63 A;  2PWJ A;  3FZ5 A;  2PVO C;  3F8U A;  2IWT A;  3W8J A;  19GS A;  4TXO A;  1GUL A;  5KOW A;  1T3B A;  4NPB A;  1KTE A;  11GS A;  6GSX A;  1V9W A;  2OE3 A;  2NPB A;  3CSH A;  2CZ2 A;  5IQY A;  2YN1 A;  4MH2 A;  1XVQ A;  5DCG A;  3RGB C;  3ZYW A;  1R7H A;  3FZ9 A;  1NHO A;  1K0D A;  2IMK A;  12GS A;  1SK0 A;  2QA2 A;  2CAQ A;  1Z7R A;  2HRN A;  1EEM A;  2WVX A;  3ZML A;  3TKS E;  1BJX A;  3V1W A;  1XW5 A;  4TN8 A;  3IXR A;  1LBK A;  3IV4 A;  3H79 A;  4PNF A;  4ACS A;  2FCH A;  1BG1 A;  5CRG A;  1RW1 A;  4HZ2 A;  1M2D A;  3EPT A;  3L78 A;  4XTS A;  2LKU A;  2K8V A;  3MYD A;  3F9U A;  3UBK A;  3M9J A;  2JZT A;  4X43 A;  5IM9 A;  5HQP A;  4JU5 A;  1ZZY A;  4FYC A;  4BWS A;  1ERT A;  3QPM A;  1EOH A;  3L9U A;  5D8I A;  2C3Q A;  3TDG A;  3TUE A;  1GLP A;  3VWW A;  3TKS A;  1SJ6 A;  1U3I A;  1GUM A;  3Q18 A;  1Z3E A;  2DJK A;  1ZOF A;  2WUL A;  5D96 A;  1BF5 A;  3PGT A;  1YQ1 A;  3C1R A;  3IOS A;  3EU4 A;  2B7J A;  3D4T A;  1GSE A;  1Q4J A;  2E7P A;  2C1Y A;  2DBC A;  2V2G A;  1X0R A;  2YJ7 A;  3GSS A;  3HJP A;  2VOC A;  2GQK A;  1V2A A;  1QQ2 A;  4V1A p;  2RM5 A;  2V41 A;  3HA9 A;  2UV8 G;  2VD1 A;  1XWA A;  4JE1 A;  1MDJ A;  3ZVJ A;  4K6X A;  1N2A A;  2YNX A;  1O6J A;  4EC0 A;  5IMA A;  3LG6 A;  4OO5 A;  4V2N A;  3EWL A;  5G2Z A;  3EU3 A;  2I9H A;  3VWU A;  2X64 A;  3G7I A;  1DE1 A;  1GTI A;  4LLR A;  4GRF A;  1USB A;  2K8S A;  5BMU A;  1TU7 A;  5EPF A;  2O8V B;  2EFH A;  2KUC A;  2WRT A;  4HOJ A;  1O8X A;  3UAP A;  2F9S A;  1M0U A;  3WGD A;  4KSM A;  1WOU A;  3P8W A;  4F0C A;  3FHK A;  3PPU A;  5AIV A;  4MLY A;  1PRX A;  2AHE A;  2DJJ A;  1GSS A;  4N0Z A;  3ERG A;  5J4Y A;  2GVP A;  5E59 A;  4IN0 A;  4DSS B;  5G5F A;  2QKE A;  1EOG A;  1IYI A;  3HY2 A;  2HSH A;  4ZL7 A;  3GH6 A;  2O87 A;  3HZ8 A;  4XRA A;  1EGR A;  1TXU A;  5D9V A;  5AIS A;  2B1K A;  3VFI A;  4EO3 A;  1SKW B;  1T8E B;  1ZCP A;  5J9B A;  1U6T A;  1Z7P A;  2L4Q A;  1QXH A;  1ZMA A;  4G0I A;  1GRX A;  3GKX A;  5KN1 A;  4OCF A;  17GS A;  5DAL B;  2MMN A;  4ML1 A;  1YJ6 A;  1OC8 A;  1PMT A;  2IPA A;  5JWQ B;  1G0T A;  2K6V A;  4EIP A;  2ON5 A;  3D0Z A;  3GX0 A;  4GTU A;  2C0E A;  2WW1 A;  5A5H A;  4ML6 A;  2R3X A;  4IGJ A;  1EZK A;  4USS A;  5B8A A;  2EIO A;  5A4W A;  4K0N A;  1PSQ A;  4X1U A;  2QSI A;  3LXT A;  4CW9 A;  2G0F A;  3I43 A;  3ZIJ A;  3GTU B;  1W4V A;  1FAA A;  3ZVJ D;  1HD2 A;  3DGQ A;  4F2I A;  4ZBD A;  1BQ7 A;  2MYG A;  1H75 A;  5IMV A;  3M3M A;  2CVB A;  1GUH A;  3J7Y k;  4KND A;  2VUP A;  3KH7 A;  1SL0 B;  2FD3 A;  4MF5 A;  1XFL A;  5G30 A;  4AKI A;  4DSR A;  1V58 A;  4NXI A;  4EVM A;  4HZ4 A;  2VLT A;  3ERF A;  2GGT A;  2ES7 A;  3AY8 A;  2CX4 A;  3D21 A;  1UVZ A;  1SVL A;  20GS A;  3L0H A;  3RAZ A;  4LA1 A;  4CHS A;  4AGS A;  2X8C A;  4ZL9 A;  5DAK B;  3TKP A;  4TVE A;  4LL4 B;  1FOV A;  2CVK A;  1Z9H A;  4QL9 A;  3TGZ A;  2DJ2 A;  2A2S A;  1E6B A;  1WMJ A;  2AYT A;  4BPY A;  2DLX A;  4HU9 A;  3GKN A;  2XPD A;  4AJ7 A;  1SK1 A;  2PVQ A;  5A4V A;  3GL5 A;  2BJX A;  3KIJ A;  3GN3 A;  4L0U A;  2Z9S A;  2H19 A;  4EKZ A;  3I69 A;  2CVD A;  3NIV A;  5EL8 A;  2FWG A;  4NMU A;  4KE3 A;  1I5G A;  4A5P A;  2WZS A;  1ERU A;  2MZC A;  2EFE A;  4KCA A;  3IC8 A;  4DEJ A;  2TIR A;  1GSQ A;  1QUW A;  1XWK A;  3MDK A;  4JR6 A;  4OFM A;  4K2X A;  1M3J A;  2PU9 C;  4HJM A;  4K5S A;  3U5R E;  4ID0 A;  1M2B A;  3ZMK A;  2IFQ B;  1AQX A;  2VL2 C;  2HRK A;  3A5W A;  1TKD B;  2DMM A;  3HJO A;  1Q98 A;  4X0X A;  5ECM B;  1A24 A;  2VAF A;  1AQW A;  4K0G A;  1K0C A;  4N30 A;  1ON4 A;  3G7J A;  4GST A;  3ZFL A;  3M8N A;  4AJ6 A;  4PUR A;  1AW9 A;  2A4V A;  1AUC A;  2MMZ A;  2HZF A;  2GT6 A;  2GT5 A;  1TI1 A;  4MPG A;  3WD6 A;  1PQN A;  1GWC A;  4ZB8 A;  4EL1 A;  5KEJ A;  1ZGN A;  2VLU A;  3U6V A;  5DQY A;  2VLV A;  4LL1 B;  1K3O A;  1YEW C;  1VF4 A;  1SEN A;  2VCW A;  3IRA A;  3IBH A;  4MF7 A;  2LQO A;  6GSW A;  2E2G A;  3VK9 A;  4TRX A;  2YP6 A;  1U87 A;  3F6F A;  1EP7 A;  2C0D A;  2R6K A;  3H8Q A;  3EE2 A;  2B5Y A;  2WGR A;  1Z6N A;  1VRS D;  4POK A;  2R37 A;  2FWF A;  4GXZ A;  2NBS A;  2KP2 A;  2EIQ A;  3DEX A;  3DXB A;  2LV3 A;  1B4P A;  3F4T A;  2IIY A;  4HQS A;  4IP6 A;  4V2L A;  4WBJ A;  2IMI A;  3D6I A;  5DBQ A;  4KSO A;  3ED3 A;  2GDR A;  2RUE A;  2JZS A;  1F9M A;  3G9B A;  4OO4 A;  4ULX A;  3CMI A;  1O8W A;  5AIX A;  1YEX A;  1N25 A;  1K0A A;  4K5R A;  3G7Y A;  1PL2 A;  2IMF A;  1X9S B;  5DAK A;  1FOH A;  1A0F A;  4AF2 A;  1A8L A;  1B48 A;  4TW5 A;  2FUG 2;  1V98 A;  2I1U A;  3GFK A;  2R2J A;  6GSY A;  3A2W A;  2IMD A;  2UZ8 A;  5LD0 A;  1OVN A;  4IHU A;  1OYJ A;  2X8H A;  2AJQ B;  2IL3 A;  2GTU A;  1WIK A;  3CBU A;  3LFL A;  4L8E A;  1TRS A;  3KM6 A;  3QOU A;  4O5Q A;  1XWB A;  2WCI A;  2WVY A;  4EUY A;  1ST9 A;  1V40 A;  3H4K A;  1M9B A;  5KN3 A;  2L59 A;  4PNG A;  1TTZ A;  1M2A A;  5JCW A;  3F4S A;  3BOA A;  1FO5 A;  4GSS A;  4XCS A;  3L4N A;  4TR1 A;  1JZO A;  4RUV A;  1IYH A;  5D9X A;  3BD2 A;  2X8G A;  4FIW A;  2I4A A;  2IFQ A;  4YAP A;  2H73 A;  2LQQ A;  1SU9 A;  3FY7 A;  1THX A;  2CX3 A;  4KDX A;  4MMM A;  3TKR A;  5LNK e;  3IHG A;  4MH3 A;  2RLI A;  3D5J A;  2C0F A;  3KMO A;  1A0R P;  1OC9 A;  4TR4 A;  3LYK A;  2FLS A;  3WT2 A;  2BTO T;  4E8E A;  3IAM 2;  3FR6 A;  3FYG A;  5G31 A;  1S3A A;  1MD3 A;  1GSF A;  5J40 A;  2OAD A;  1F2E A;  4NV5 A;  2C3N A;  4PGT A;  3ZLP A;  1M3I A;  5ECP B;  2MMO A;  5D9T A;  2C0G A;  4N0V A;  3DYR A;  1SL2 B;  4J56 E;  4NHW A;  3FRC A;  4OMV A;  5L71 A;  3KTL A;  5J41 A;  3GKK A;  4JR4 A;  2YJH A;  5KN0 A;  1WRY A;  2L5L A;  3DVW A;  5A5H B;  1S3C A;  2TRC P;  1TK5 B;  2GZY A;  4TR0 A;  3CTG A;  1PL1 A;  4J57 E;  4POM A;  2R0P A;  2H1B A;  1YEP A;  5INY A;  3VUR A;  2H74 A;  2GSR A;  4TR3 A;  1RQM A;  2IME A;  1DE2 A;  2PBJ A;  3LGC A;  1VF2 A;  3LYP A;  5A1N B;  3UOM A;  3BCK A;  1ZYE A;  2VCX A;  5IO2 A;  1OC3 A;  3O3T A;  3LSZ A;  1A2L A;  3TKQ A;  1S4B P;  5ELA A;  2A4H A; 
#chains in the Genus database with same CATH homology
 1YZX A;  1NM3 A;  3D22 A;  2JZR A;  3UVH A;  1T4Z A;  2B5X A;  16GS A;  4OFT A;  1DBY A;  3C7M A;  1DUG A;  3HZ4 A;  2VM2 A;  1WE0 A;  2VD0 A;  1X9W B;  1K0M A;  2HRA A;  2F51 A;  4NWY A;  2A2P A;  2OE1 A;  3A2V A;  2PER A;  3R3E A;  4BL7 A;  3ME7 A;  2TRX A;  2FWH A;  5IPH A;  5ABR A;  2HSM A;  1TDI A;  4JBB A;  2GLR A;  2L5O A;  5ECL B;  3US3 A;  2KLX A;  1XW9 A;  5CAX A;  1R4W A;  2H71 A;  5A5K A;  3F4R A;  3TRP A;  2GQL A;  1M9A A;  4PX1 A;  1GSU A;  3KGK A;  3LWA A;  1U88 A;  1B9X C;  4HU7 A;  3F0I A;  3KCM A;  5ECN B;  3KXO A;  14GS A;  1TXX A;  1K3L A;  3TU3 B;  4GQF A;  3ZTL A;  4WET A;  4PQI A;  2CQ9 A;  3FZA A;  2OBK A;  4IS0 A;  1PN0 A;  1CQG A;  4F0B A;  3TRQ A;  3APQ A;  5CNW A;  4YQU A;  4K7N A;  5GAN D;  3E3E A;  1O7U A;  2HRK B;  3P2A A;  4TOP A;  3TOT A;  22GS A;  1URM A;  4MPF A;  3QCP A;  3KMN A;  1M7T A;  2I81 A;  2HZE A;  6GSV A;  1T4Y A;  1PX7 A;  2O7K A;  3F6D A;  3KJY A;  1OKD A;  4XHM A;  5FHI A;  4KDY A;  2YZH A;  2V32 A;  3FMW A;  2DJ1 A;  2NDO A;  1QFN A;  3GIX A;  2GSS A;  2WDU A;  3BBY A;  4MK3 A;  3L9S A;  4XS4 B;  5IPG A;  3FR3 A;  1SKR B;  1GP1 A;  4KF9 A;  3UVT A;  1THO A;  4ZXG A;  3ZL5 A;  3GA4 A;  2RUF A;  2VCV A;  2H6Y A;  4V1A g;  2VCQ A;  1X5E A;  4KB3 A;  2GS3 A;  4HI7 A;  3HJM A;  5A1N A;  4IKH A;  2P0G A;  3S9F A;  5GAP D;  3LW9 A;  1TRU A;  2JU5 A;  3KD0 A;  2YWI A;  4JED A;  5ECK B;  3H1N A;  4XIH A;  1XWG A;  2D2Z A;  3DRN A;  4PQ1 A;  1O81 A;  2FHE A;  4ZL8 A;  1Y6E A;  2KP1 A;  3EYT A;  3SWL A;  4D73 A;  1VF3 A;  2V6O A;  4MJC A;  4N11 A;  1TOF A;  4G0L A;  1VF1 A;  3W8S A;  4MNN A;  3CXG A;  1G7E A;  2F8F A;  5EY6 A;  5GZZ B;  2K9F A;  2EIR A;  1LJR A;  1SD8 A;  2LEG A;  5EVO A;  4IQ1 A;  2WFC A;  1RK4 A;  4NV2 A;  1N8J A;  3A2X A;  4BVY A;  3WGE A;  1KNG A;  4EE0 A;  3KTB A;  3QAG A;  4AKG A;  3ERW A;  2VL3 A;  1JZR A;  2IN3 A;  4BWQ A;  2VKZ G;  2DKH A;  2WZ9 A;  1ERV A;  4MJB A;  1GTA A;  1FW1 A;  4IVF A;  2O85 A;  1GSY A;  2X4A A;  2AUV A;  2GQM A;  5ECS A;  4X4J A;  2B6M A;  1TJD A;  4G01 A;  2E0Q A;  5FWG A;  1SJI A;  1OE7 A;  1YY7 A;  4GLT A;  4O92 A;  4DSQ A;  4WKW A;  2VO4 A;  1HYU A;  5ECH B;  4IQA A;  4TR1 B;  4WF5 A;  4IJI A;  1BG5 A;  2ON7 A;  4I6X A;  4DVC A;  2GST A;  9GSS A;  4ISD A;  1JHB A;  1FG4 A;  4KW6 A;  5ECO B;  2CV4 A;  3RPN A;  1SKS B;  3E0U A;  3EMP A;  5FT3 A;  2B3S A;  2OA7 A;  1FHE A;  1OC9 B;  5HFI A;  1F37 A;  1SL1 B;  2OBI A;  5D9W A;  5F0G A;  2EFD A;  4MP4 A;  4WEY A;  4MDC A;  4G0K A;  2O89 A;  2CT6 A;  1O73 A;  5D73 A;  3ZRD A;  3RHC A;  4YH2 A;  4EF0 A;  4F9Z A;  4ILF A;  2YPM A;  4KA0 A;  3RPP A;  5HR0 A;  1R5P A;  2JSZ A;  4KCE A;  3VPT A;  3GST A;  1WPI A;  4F03 A;  4XS4 A;  1MDI A;  2FNO A;  3UL3 A;  1ILO A;  2H66 A;  4JZQ A;  5B8B A;  2HNL A;  5D93 A;  3WT1 A;  1J08 A;  2DSA A;  2H6X A;  4V2M A;  1YF1 A;  3EIN A;  4WF4 A;  2H0G A;  3F3Q A;  2QC7 A;  3DML A;  2YOI A;  4RI7 A;  2NTO A;  4ZIL A;  3ZRE A;  4Q5Q A;  2YV9 A;  4EDY A;  3QFB C;  2DIZ A;  2KHP A;  3LJR A;  1Z5Y E;  7GSS A;  1H4O A;  5ECI B;  2GSQ A;  4I2U A;  3FW2 A;  1G6W A;  4Q5F A;  2B5E A;  5ECR B;  5ID2 A;  3HKR A;  2LRT A;  1SK2 A;  2VIM A;  1SYX A;  3GYK A;  4AJ8 A;  2XBI A;  3TJF A;  1LU4 A;  5C04 A;  4PTS A;  4MA9 A;  2E2M A;  4GCI A;  1XWC A;  2JSY A;  4MJE A;  2ZCT A;  4H86 A;  5IMD A;  5H5Q A;  4POL A;  2LS5 A;  5H5S A;  4HUA A;  5J9C A;  4L5L A;  1K0N A;  2OT3 A;  2H75 A;  3ZIT A;  2V1M A;  4BL7 B;  2REM A;  3QMX A;  3UIW A;  1FVK A;  2HSM B;  2LRN A;  1EP8 A;  2WJU A;  1EV4 A;  3ZZX A;  2L4C A;  2R0C A;  1PGT A;  1GL8 A;  1SVO A;  2HXK A;  5CRD A;  2VL2 A;  2HT9 A;  3C73 A;  4PQH A;  2HYX A;  3VI7 A;  3CWG A;  4MF6 A;  5F05 A;  3FEU A;  2H0H A;  4YQV A;  2PPT A;  3C1S A;  18GS A;  1BAY A;  5J3R A;  5B7C A;  1TK8 B;  3LOR A;  3DIE A;  2LNS A;  2YV7 A;  4ZB7 A;  2C80 A;  1ERW A;  5F06 A;  1XW6 A;  1TP9 A;  3I9V 2;  5DDL A;  2LUS A;  4WBR D;  3CRT A;  4E8H A;  3GL3 A;  5GSS A;  3DWV A;  1ZYN A;  2OE0 A;  1HNB A;  5JCG A;  4I5Q A;  1XVW A;  2H1A A;  1K0B A;  2AV4 A;  3QR6 A;  4HS1 A;  2C8U A;  1EEJ A;  4XRD A;  2H72 A;  3FKF A;  4YAV A;  1KBN A;  3HVS A;  2HZE B;  1TRW A;  5ELG A;  4N10 A;  2MMA A;  3HHV A;  2QGV A;  2XBQ A;  1K3Y A;  4ZIJ A;  1GNE A;  5ENU A;  4K7O A;  4G9H A;  3GV1 A;  3MWH A;  4LMW A;  4ZBB A;  3FZ4 A;  4GWR A;  1Y1U A;  2H1D A;  1AC1 A;  2DML A;  2LTK A;  1M99 A;  2A2R A;  3FK8 A;  4KX4 A;  5A34 A;  2X49 A;  1JZW A;  5B6M A;  3O6T A;  3JCM L;  3O76 A;  2H8L A;  2PUK C;  2ZUP A;  1X5D A;  3RHB A;  1R26 A;  3C71 A;  6GSS A;  3N9J A;  1XOA A;  2YWO A;  4OD7 A;  1GNW A;  4L5O A;  2XPE A;  3VPQ A;  5GST A;  4IP1 A;  5LCZ A;  3TB2 A;  1K0O A;  2OKA A;  4GQC A;  2DJ0 A;  5CRH A;  5CRW A;  4BA7 A;  2LRC A;  2WS2 A;  3APO A;  1F6M C;  5AN1 A;  2KOK A;  3UBL A;  3MSZ A;  3PIN A;  5JWO B;  2N5F A;  3LQ7 A;  3KP8 A;  4K2D A;  5HR2 A;  3QFA C;  3HVX A;  2CA8 A;  4D73 B;  1E2Y A;  1I9D A;  4BVX A;  3KZQ A;  3CRU A;  1WWJ A;  2X99 A;  3LEF A;  1TW9 A;  1GSD A;  1MTC A;  1Y25 A;  5CYY A;  3TRX A;  1BX9 A;  4CDO A;  3F3R A;  4L0W A;  3CTF A;  3OR5 A;  4ECI A;  2DKI A;  4BVY B;  4HDE A;  6GSU A;  2F8A A;  6GST A;  2J23 A;  4IW9 A;  2JAD A;  1X9M B;  4EIQ A;  5F07 A;  1SVM A;  2L6C A;  3P7X A;  2RM6 A;  3FR9 A;  4Z7X A;  1ZYP A;  2LJA A;  3A3T A;  2PGT A;  4XS6 A;  3IR4 A;  4NAX A;  3TJB A;  4FO5 A;  2LJR A;  2VCZ A;  2V6K A;  2FA4 A;  3GMF A;  4MZB A;  5COH A;  2HSY A;  1C72 A;  4AKH A;  4FH8 A;  2MBS A;  5F8B A;  4ECC A;  2PN8 A;  3IAS 2;  5CRE A;  4F82 A;  1GTU A;  1B4Q A;  1OKT A;  5J4U A;  2P5R A;  1YDK A;  2G2Q A;  4XS1 A;  4Q5N A;  1PA3 A;  5HFK A;  5E4W A;  4I97 A;  4HQZ A;  4WR5 A;  3PR8 A;  4P3Y B;  3N5O A;  5A4U A;  3GHA A;  5DCH A;  2H70 A;  2XC2 A;  3TCO A;  2LJK A;  3K8N A;  5IMF A;  2HRF A;  5ECQ B;  2F3M A;  3MAK A;  3SBC A;  3HDC A;  1B9Y C;  1EWX A;  4Q5R A;  1A2J A;  3TOU A;  3Q6O A;  4J2F A;  1XPV A;  3GKM A;  3EMX A;  2DIY A;  4YKG A;  1FVJ A;  2BMX A;  2H6Z A;  5HR3 A;  4KGI A;  4G10 A;  2H30 A;  3MNG A;  1UA5 A;  5G5E A;  4KUN A;  2O5V A;  1JLV A;  3DVX A;  1MD4 A;  1TRV A;  4QL7 A;  3VI5 A;  2VL9 A;  4GSN A;  5AGY A;  2LNT A;  3VWV A;  5DJL A;  2C3T A;  3VWX A;  1PX6 A;  4Z2T A;  5BRT A;  2YZU A;  1X5C A;  3Q19 A;  4OFN A;  3ZIV A;  3IPZ A;  3VLN A;  2R0G A;  1MDK A;  3IK9 A;  2H01 A;  1BYE A;  3IHQ A;  4OCE A;  3EC3 A;  1XCC A;  2HE3 A;  2LST A;  1XZO A;  4LMV A;  3UMA A;  4POB A;  2FA8 A;  3TJG A;  4FYB A;  1W89 A;  1NSW A;  4O7H A;  2ALB A;  2N5B A;  4I8B A;  5HR1 A;  5G1K A;  3WGX A;  5ID2 B;  4O5R A;  4WXT A;  2M72 A;  5KN2 A;  4IEL A;  2HLS A;  1J9B A;  1YKA A;  5IMC A;  1U3A A;  4E68 A;  1UN2 A;  4K8M A;  3DKS A;  1AIU A;  2AB6 A;  3IA1 A;  4O5U A;  4FYU A;  4ZB9 A;  3HCZ A;  3D4M A;  4G19 A;  1OE8 A;  4GDF A;  3UEM A;  3P90 A;  4ICY A;  5B6N A;  2M80 A;  3QD9 A;  5JWR B;  1SD9 A;  2YWN A;  1AAZ A;  2DJ3 A;  2MBT A;  2EFC A;  3BCI A;  2YCD A;  1JFU A;  3ME8 A;  2VCT A;  3GRX A;  3TJK A;  4N3Z A;  1XIY A;  1WP0 A;  3ISO A;  5H5R A;  4MAB A;  1ABA A;  1Z6M A;  1F3A A;  4EDZ A;  4HEA 2;  3HYP A;  2DC5 A;  1FB0 A;  2RII A;  2VM1 A;  4MJA A;  2H1L A;  1TK0 B;  1A8Y A;  2R4V A;  5DJM A;  3W6G A;  3MIX A;  2HFD A;  3EVI A;  1PN9 A;  4KH7 A;  5IOX A;  2B1L A;  1QK8 A;  3IC4 A;  2YAN A;  3KP9 A;  2CZ3 A;  1GLQ A;  1GTB A;  1PD2 1;  5J5N A;  4FQU A;  3Q74 A;  2J9H A;  2EC4 A;  1UC7 A;  4O32 A;  2GZZ A;  3J7Y b;  1QGV A;  1FB6 A;  5CO3 A;  3IDV A;  5JCU A;  2HSN B;  4CY6 A;  2L57 A;  3RDW A;  3QDN A;  5HFG A;  3H93 A;  4NHZ A;  4TXV A;  1F3B A;  3HXS A;  2FGX A;  1EGO A;  4K9Z A;  4TXO B;  4DSS A;  4HJ2 A;  2JL4 A;  5DVB A;  3UJ1 A;  4RI6 A;  4ECB A;  3EUR A;  5DQS A;  4RQR A;  1YF0 A;  4KAE A;  1HNA A;  2OAC A;  1SJZ A;  1GH2 A;  4OWY A;  3GUS A;  2AAW A;  5IO0 A;  2HI7 A;  2HQT A;  2L6D A;  3M0F A;  1BED A;  5IOW A;  1J0F A;  5A34 B;  4GF0 A;  3DD3 A;  2XHF A;  3BJ5 A;  3RBT A;  5DAL A;  3HMJ G;  1T00 A;  4AKX B;  1ZL9 A;  1XOB A;  3LXZ A;  3L9V A;  4G2E A;  3M9K A;  3CSJ A;  4MZW A;  2FWE A;  1WJK A;  4YKF A;  1ML6 A;  1JLW A;  8GSS A;  2I3Y A;  1QMV A;  4I2T A;  1HQO A;  1HNC A;  1JZD A;  2H1G A;  3APS A;  1S3D A;  5C00 A;  3I6A A;  2H0I A;  4ZB6 A;  1R5A A;  1T1V A;  3GX8 A;  1DSB A;  4ZBA A;  2FY6 A;  1GUK A;  3C8E A;  2YWM A;  1XXU A;  5G1L A;  1T7P B;  3GTU A;  5IMZ A;  4QMK A;  2B7K A;  1ACV A;  3ZFB A;  1XBS A;  1PKZ A;  3HVV A;  4AI6 A;  1NHY A;  1CQH A;  1AQV A;  1TI3 A;  4RQX A;  3UAR A;  4MZC A;  3KH9 A;  1YKC A;  4BVX B;  1A23 A;  1EV9 A;  4YQM A;  2WB9 A;  2C4J A;  2K18 A;  3E9J B;  13GS A;  1KEB A;  2JAC A;  2IJY A;  3GNJ A;  1TU8 A;  4ECJ A;  10GS A;  3HD5 A;  2H76 A;  3NZN A;  4W66 A;  2QA1 A;  2P31 A;  1OAZ A;  4PXO A;  5IIZ A;  2M46 A;  3CSI A;  1VGL A;  4IJ3 A;  1PKW A;  3TJJ A;  4JRR A;  1G6Y A;  3WYW A;  3CYN A;  4MCU A;  1SYR A;  3GUR A;  3M1G A;  5J47 A;  1V57 A;  1ZYQ B;  1G7O A;  4CY8 A;  4PUF C;  4PUA A;  2P5Q A;  3TKS C;  4KDU A;  4IBP A;  2PMT A;  3QAV A;  2OJL A;  5KOX A;  4Z2R A;  1YVL A;  2CAI A;  4WR4 A;  5J4V A;  3NOF A;  2N5A A;  3A5I A;  1AXD A;  3KEB A;  3IE3 A;  1NW2 A;  4TKY A;  3QAW A;  1A2M A;  4QQ7 A;  4EXJ A;  3R2Q A;  2NVL A;  4K1F A;  1O85 A;  2R5G A;  5BMU B;  1B8X A;  5CP1 A;  2ZNM A;  4Z2U A;  3PH9 A;  2HSN A;  3GH9 A;  1MEK A;  4K7I A;  2GZP A;  3IK7 A;  3F63 A;  2PWJ A;  3FZ5 A;  2PVO C;  3F8U A;  2IWT A;  3W8J A;  19GS A;  4TXO A;  1GUL A;  5KOW A;  1T3B A;  4NPB A;  1KTE A;  11GS A;  6GSX A;  1V9W A;  2OE3 A;  2NPB A;  3CSH A;  2CZ2 A;  5IQY A;  2YN1 A;  4MH2 A;  1XVQ A;  5DCG A;  3ZYW A;  1R7H A;  3FZ9 A;  1NHO A;  1K0D A;  2IMK A;  12GS A;  1SK0 A;  2QA2 A;  2CAQ A;  1Z7R A;  2HRN A;  1EEM A;  3ZML A;  3TKS E;  1BJX A;  3V1W A;  1XW5 A;  4TN8 A;  3IXR A;  1LBK A;  3IV4 A;  3H79 A;  4PNF A;  4ACS A;  2FCH A;  1BG1 A;  5CRG A;  1RW1 A;  4HZ2 A;  1M2D A;  3EPT A;  3L78 A;  4XTS A;  2LKU A;  2K8V A;  3MYD A;  3F9U A;  3UBK A;  3M9J A;  2JZT A;  4X43 A;  5IM9 A;  5HQP A;  4JU5 A;  1ZZY A;  4FYC A;  4BWS A;  1ERT A;  3QPM A;  1EOH A;  3L9U A;  5D8I A;  2C3Q A;  3TDG A;  3TUE A;  1GLP A;  3VWW A;  3TKS A;  1SJ6 A;  1U3I A;  1GUM A;  3Q18 A;  1Z3E A;  2DJK A;  1ZOF A;  2WUL A;  5D96 A;  1BF5 A;  3PGT A;  1YQ1 A;  3C1R A;  3IOS A;  3EU4 A;  2B7J A;  3D4T A;  1GSE A;  1Q4J A;  2E7P A;  2C1Y A;  2DBC A;  2V2G A;  1X0R A;  2YJ7 A;  3GSS A;  3HJP A;  2VOC A;  2GQK A;  1V2A A;  1QQ2 A;  4V1A p;  2RM5 A;  2V41 A;  3HA9 A;  2UV8 G;  2VD1 A;  1XWA A;  4JE1 A;  1MDJ A;  3ZVJ A;  4K6X A;  1N2A A;  2YNX A;  1O6J A;  4EC0 A;  5IMA A;  3LG6 A;  4OO5 A;  4V2N A;  3EWL A;  5G2Z A;  3EU3 A;  2I9H A;  3VWU A;  2X64 A;  3G7I A;  1DE1 A;  1GTI A;  4LLR A;  4GRF A;  1USB A;  2K8S A;  5BMU A;  1TU7 A;  5EPF A;  2O8V B;  2EFH A;  2KUC A;  2WRT A;  4HOJ A;  1O8X A;  3UAP A;  2F9S A;  1M0U A;  3WGD A;  4KSM A;  1WOU A;  3P8W A;  4F0C A;  3FHK A;  3PPU A;  5AIV A;  4MLY A;  1PRX A;  2AHE A;  2DJJ A;  1GSS A;  4N0Z A;  3ERG A;  5J4Y A;  2GVP A;  5E59 A;  4IN0 A;  4DSS B;  5G5F A;  2QKE A;  1EOG A;  1IYI A;  3HY2 A;  2HSH A;  4ZL7 A;  3GH6 A;  2O87 A;  3HZ8 A;  4XRA A;  1EGR A;  1TXU A;  5D9V A;  5AIS A;  2B1K A;  3VFI A;  4EO3 A;  1SKW B;  1T8E B;  1ZCP A;  5J9B A;  1U6T A;  1Z7P A;  2L4Q A;  1QXH A;  1ZMA A;  4G0I A;  1GRX A;  3GKX A;  5KN1 A;  4OCF A;  17GS A;  5DAL B;  2MMN A;  4ML1 A;  1YJ6 A;  1OC8 A;  1PMT A;  2IPA A;  5JWQ B;  1G0T A;  2K6V A;  4EIP A;  2ON5 A;  3D0Z A;  3GX0 A;  4GTU A;  2C0E A;  5A5H A;  4ML6 A;  2R3X A;  4IGJ A;  1EZK A;  4USS A;  5B8A A;  2EIO A;  5A4W A;  4K0N A;  1PSQ A;  4X1U A;  2QSI A;  3LXT A;  4CW9 A;  2G0F A;  3I43 A;  3ZIJ A;  3GTU B;  1W4V A;  1FAA A;  3ZVJ D;  1HD2 A;  3DGQ A;  4F2I A;  4ZBD A;  1BQ7 A;  2MYG A;  1H75 A;  5IMV A;  3M3M A;  2CVB A;  1GUH A;  3J7Y k;  4KND A;  2VUP A;  3KH7 A;  1SL0 B;  2FD3 A;  4MF5 A;  1XFL A;  5G30 A;  4AKI A;  4DSR A;  1V58 A;  4NXI A;  4EVM A;  4HZ4 A;  2VLT A;  3ERF A;  2GGT A;  2ES7 A;  3AY8 A;  2CX4 A;  3D21 A;  1UVZ A;  1SVL A;  20GS A;  3L0H A;  3RAZ A;  4LA1 A;  4CHS A;  4AGS A;  2X8C A;  4ZL9 A;  5DAK B;  3TKP A;  4TVE A;  4LL4 B;  1FOV A;  2CVK A;  1Z9H A;  4QL9 A;  3TGZ A;  2DJ2 A;  2A2S A;  1E6B A;  1WMJ A;  2AYT A;  4BPY A;  2DLX A;  4HU9 A;  3GKN A;  2XPD A;  4AJ7 A;  1SK1 A;  2PVQ A;  5A4V A;  3GL5 A;  2BJX A;  3KIJ A;  3GN3 A;  4L0U A;  2Z9S A;  2H19 A;  4EKZ A;  3I69 A;  2CVD A;  3NIV A;  5EL8 A;  2FWG A;  4NMU A;  4KE3 A;  1I5G A;  4A5P A;  1ERU A;  2MZC A;  2EFE A;  4KCA A;  3IC8 A;  4DEJ A;  2TIR A;  1GSQ A;  1QUW A;  1XWK A;  3MDK A;  4JR6 A;  4OFM A;  4K2X A;  2PU9 C;  4HJM A;  4K5S A;  3U5R E;  4ID0 A;  1M2B A;  3ZMK A;  2IFQ B;  1AQX A;  2VL2 C;  2HRK A;  3A5W A;  1TKD B;  2DMM A;  3HJO A;  1Q98 A;  4X0X A;  5ECM B;  1A24 A;  2VAF A;  1AQW A;  4K0G A;  1K0C A;  4N30 A;  1ON4 A;  3G7J A;  4GST A;  3ZFL A;  3M8N A;  4AJ6 A;  4PUR A;  1AW9 A;  2A4V A;  1AUC A;  2MMZ A;  2HZF A;  2GT6 A;  2GT5 A;  1TI1 A;  4MPG A;  3WD6 A;  1PQN A;  1GWC A;  4ZB8 A;  4EL1 A;  5KEJ A;  1ZGN A;  2VLU A;  3U6V A;  5DQY A;  2VLV A;  4LL1 B;  1K3O A;  1VF4 A;  1SEN A;  2VCW A;  3IRA A;  3IBH A;  4MF7 A;  2LQO A;  6GSW A;  2E2G A;  3VK9 A;  4TRX A;  2YP6 A;  1U87 A;  3F6F A;  1EP7 A;  2C0D A;  2R6K A;  3H8Q A;  3EE2 A;  2B5Y A;  2WGR A;  1Z6N A;  1VRS D;  4POK A;  2R37 A;  2FWF A;  4GXZ A;  2NBS A;  2KP2 A;  2EIQ A;  3DEX A;  3DXB A;  2LV3 A;  1B4P A;  3F4T A;  2IIY A;  4HQS A;  4IP6 A;  4V2L A;  4WBJ A;  2IMI A;  3D6I A;  5DBQ A;  4KSO A;  3ED3 A;  2GDR A;  2RUE A;  2JZS A;  1F9M A;  3G9B A;  4OO4 A;  4ULX A;  3CMI A;  1O8W A;  5AIX A;  1YEX A;  1N25 A;  1K0A A;  4K5R A;  3G7Y A;  1PL2 A;  2IMF A;  1X9S B;  5DAK A;  1FOH A;  1A0F A;  4AF2 A;  1A8L A;  1B48 A;  4TW5 A;  2FUG 2;  1V98 A;  2I1U A;  3GFK A;  2R2J A;  6GSY A;  3A2W A;  2IMD A;  2UZ8 A;  5LD0 A;  1OVN A;  4IHU A;  1OYJ A;  2X8H A;  2AJQ B;  2IL3 A;  2GTU A;  1WIK A;  3CBU A;  3LFL A;  4L8E A;  1TRS A;  3KM6 A;  3QOU A;  4O5Q A;  1XWB A;  2WCI A;  4EUY A;  1ST9 A;  1V40 A;  3H4K A;  1M9B A;  5KN3 A;  2L59 A;  4PNG A;  1TTZ A;  1M2A A;  5JCW A;  3F4S A;  3BOA A;  1FO5 A;  4GSS A;  4XCS A;  3L4N A;  4TR1 A;  1JZO A;  4RUV A;  1IYH A;  5D9X A;  3BD2 A;  2X8G A;  4FIW A;  2I4A A;  2IFQ A;  4YAP A;  2H73 A;  2LQQ A;  1SU9 A;  3FY7 A;  1THX A;  2CX3 A;  4KDX A;  4MMM A;  3TKR A;  5LNK e;  3IHG A;  4MH3 A;  2RLI A;  3D5J A;  2C0F A;  3KMO A;  1A0R P;  1OC9 A;  4TR4 A;  3LYK A;  2FLS A;  3WT2 A;  2BTO T;  4E8E A;  3IAM 2;  3FR6 A;  3FYG A;  5G31 A;  1S3A A;  1MD3 A;  1GSF A;  5J40 A;  2OAD A;  1F2E A;  4NV5 A;  2C3N A;  4PGT A;  3ZLP A;  5ECP B;  2MMO A;  5D9T A;  2C0G A;  4N0V A;  3DYR A;  1SL2 B;  4J56 E;  4NHW A;  3FRC A;  4OMV A;  5L71 A;  3KTL A;  5J41 A;  3GKK A;  4JR4 A;  2YJH A;  5KN0 A;  1WRY A;  2L5L A;  3DVW A;  5A5H B;  1S3C A;  2TRC P;  1TK5 B;  2GZY A;  4TR0 A;  3CTG A;  1PL1 A;  4J57 E;  4POM A;  2R0P A;  2H1B A;  1YEP A;  5INY A;  3VUR A;  2H74 A;  2GSR A;  4TR3 A;  1RQM A;  2IME A;  1DE2 A;  2PBJ A;  3LGC A;  1VF2 A;  3LYP A;  5A1N B;  3UOM A;  3BCK A;  1ZYE A;  2VCX A;  5IO2 A;  1OC3 A;  3O3T A;  3LSZ A;  1A2L A;  3TKQ A;  5ELA A;  2A4H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...