4BVXB

Crystal structure of the aimp3-mrs n-terminal domain complex with i3c
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
170
structure length
170
Chain Sequence
GHMAAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNDGPSLMGLTTIAAHLVKQANKEYLLGSTAEEKAMVQQWLEYRVTQVDGHSSKNDIHTLLMDLNSYLEDKVYLTGYNFTLADILLYYGLHRFIVDLTVQEKEKYLNVSRWFCHIQHYPGIRQHLSSVVFIKNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords METHIONINE--TRNA LIGASE, CYTOPLASMIC
publication title Assembly of Multi-tRNA Synthetase Complex Via Heterotetrameric Glutathione Transferase-Homology Domains.
pubmed doi rcsb
source organism Homo sapiens
total genus 54
structure length 170
sequence length 170
ec nomenclature
pdb deposition date 2013-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00043 GST_C Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4bvxB02
3.40.30.90 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4bvxB01
5GSSA 1GSSA 4GTUA 1AQWA 4KDUA 11GSA 3AY8A 1TU7A 6GSUA 1EOHA 3FYGA 1GUMA 5AIXA 1GLQA 5F05A 3IBHA 4HZ2A 2F8FA 4F03A 5BMUA 4FQUA 2PERA 7GSSA 1OYJA 3GSTA 3LYPA 2WDUA 3ZMKA 5J4UA 3VPTA 5ECMB 1BX9A 3EINA 1M9BA 17GSA 4MF6A 2GLRA 3N9JA 2IMIA 2HSMB 4G19A 1F3BA 3VLNA 4LMWA 5FWGA 3TGZA 4NHWA 4JZQA 1VF3A 2PVQA 4IW9A 4AGSA 18GSA 1V40A 1XWKA 1PL2A 1HNCA 1Z9HA 1GUKA 1GNEA 3LJRA 1GWCA 1GSDA 4J2FA 1KBNA 1PX7A 2VCQA 3GH6A 4OFMA 4N0VA 1ZL9A 1B48A 1PKZA 1EOGA 3I6AA 5D73A 4EE0A 1HNAA 2C3TA 2ON7A 4PX1A 3UAPA 4ZB6A 2OA7A 1K0BA 4YQMA 2R3XA 4MPGA 1E6BA 1Q4JA 1A0FA 4ZB9A 3CSIA 4HOJA 4MPFA 3BBYA 2FHEA 2JL4A 1BYEA 4TOPA 8GSSA 2FNOA 3KMOA 1MTCA 4IJIA 4G9HA 2GSRA 4ZBAA 2CAIA 2PBJA 5ECIB 3H1NA 4HJ2A 4ECCA 2X64A 3HJOA 4Q5NA 5JCWA 4G0IA 2VCVA 3CSHA 3QAVA 5AIVA 4PUAA 1C72A 1JLWA 5ECRB 2WJUA 4G0LA 2C3QA 4WR5A 2R6KA 3TOUA 3FY7A 4CHSA 4OFNA 1TDIA 3F63A 2HSMA 4K0NA 4K0GA 4RI6A 4KF9A 3O76A 22GSA 3KM6A 4KE3A 1DUGA 3MDKA 3ERGA 5ECNB 2YV9A 3EE2A 1LBKA 1B8XA 2VD0A 1K0MA 4OMVA 3FRCA 2IL3A 3KMNA 4GLTA 4QQ7A 5DALB 5ECLB 4EDYA 5D9TA 1EV9A 3FR3A 1EEMA 3G7JA 4YAPA 5DCGA 5DJMA 1GSQA 4KDXA 1GUHA 1MD4A 3ISOA 5F06A 4F0CA 4KAEA 1ZGNA 1GTUA 4DEJA 1PN9A 1AXDA 1FHEA 2N5FA 4ACSA 1IYHA 10GSA 13GSA 1PD21 1GSUA 3IE3A 4BVYB 2C3NA 3VI5A 5A4VA 5JCUA 1GTIA 5EY6A 2YV7A 5ECQB 1OE7A 1GSEA 1U88A 4ECIA 2OACA 5F8BA 3CRUA 4PQHA 4E8EA 4IVFA 5ELGA 2VCXA 4IQAA 2HNLA 1Y6EA 1AQVA 1M99A 3QAWA 3WD6A 4IS0A 5GZZB 1AW9A 1OE8A 1U3IA 3GSSA 3ZMLA 20GSA 5DDLA 1G6YA 3UARA 3KJYA 5B7CA 3P90A 5J5NA 2DSAA 1IYIA 3QR6A 5A4UA 1RK4A 1K0CA 1HQOA 2HSNB 4USSA 1YJ6A 2UZ8A 4RI7A 4ECBA 6GSVA 3HKRA 1K0OA 1PL1A 2VD1A 1GULA 2GDRA 3L0HA 4NAXA 4EC0A 5G5FA 4Q5FA 2GSQA 3O3TA 3I69A 5DALA 1XWGA 4JBBA 5A4WA 4IELA 3CBUA 3QAGA 5D9VA 2VCTA 3U6VA 4NHZA 1K3LA 5HFKA 4ZXGA 1HNBA 3VURA 5AN1A 3R2QA 1PX6A 5D9XA 3P8WA 1GTBA 4EDZA 6GSYA 2WS2A 2HRAA 4YQUA 4ZBDA 14GSA 4KX4A 1K0NA 1YY7A 2HQTA 3NIVA 4BVYA 2C80A 3DGQA 3SWLA 3C8EA 2CA8A 2A2RA 2ON5A 1VF4A 3PGTA 1U87A 5A5KA 4ZB8A 2CZ3A 1K0DA 3F6FA 3N5OA 4MK3A 6GSTA 5ELAA 5G5EA 1TW9A 2LJRA 5KEJA 3WYWA 4GCIA 4GSSA 4MDCA 4MZWA 2R4VA 4KH7A 5F0GA 9GSSA 1PKWA 3R3EA 2A2SA 3UVHA 1F2EA 3F6DA 2CZ2A 1JLVA 3LQ7A 3LYKA 4OFTA 1VF1A 1PGTA 4L5LA 4LMVA 4YAVA 4IKHA 5GSTA 4PXOA 1YQ1A 1BG5A 4Q5QA 2PMTA 1NHYA 3CRTA 4JEDA 5DJLA 4GF0A 4PQIA 3IC8A 3UBLA 3GTUB 4GSTA 2AHEA 4WR4A 2C8UA 1M0UA 2D2ZA 3LSZA 1K3OA 3VPQA 5IQYA 5AISA 1GNWA 5ECOB 3LXZA 2GSSA 2WB9A 4YQVA 1GSYA 5F07A 3UBKA 3Q18A 4IQ1A 4E8HA 1G6WA 3LG6A 1B4PA 3M1GA 2YCDA 1K0AA 3PPUA 1V2AA 4BL7B 2VO4A 4PGTA 3HJMA 3CSJA 2VCZA 1PA3A 3ERFA 2HRKA 4Q5RA 3VK9A 5EL8A 1LJRA 3G7IA 4G10A 3TOTA 3MAKA 4MF5A 6GSXA 4HI7A 4F0BA 19GSA 3IK7A 3FR6A 4KSMA 1UA5A 2V6KA 4PNFA 4ID0A 5ECSA 4BVXB 1FW1A 2CAQA 1GLPA 5ECPB 12GSA 5DAKB 5DQSA 4MP4A 5FHIA 1M9AA 3LXTA 4GSNA 5D9WA 5ECKB 2AB6A 5ECHB 16GSA 4L8EA 5EVOA 1ML6A 1VF2A 4PURA 4O92A 4KDYA 2R5GA 3VI7A 3GX0A 1PMTA 3FR9A 4HZ4A 1AQXA 2F3MA 3D0ZA 4I97A 1USBA 1MD3A 3M0FA 3VWXA 4KGIA 1YDKA 4YH2A 5FT3A 4EXJA 3GTUA 2HRKB 4G0KA 2IMKA 1OKTA 1G7OA 2OADA 3GURA 3Q74A 1GSFA 3RBTA 4PNGA 1XW6A 5J41A 5AGYA 3M8NA 1N2AA 5LCZA 4ZBBA 3ZFBA 6GSSA 2J9HA 1XW5A 3W8SA 4ISDA 4BL7A 2GTUA 3GUSA 6GSWA 2PGTA 1BAYA 4IBPA 3ZFLA 1EV4A 2C4JA 3IR4A 2WRTA 4L5OA 4IGJA 3Q19A 3KTLA 2AAWA 4ECJA 2DC5A 3DD3A 3KXOA 3LFLA 2GSTA 4BVXA 3M3MA 3PR8A 3IK9A 4O7HA 1YKCA 1GTAA 1K3YA 1R5AA 5DAKA 1TU8A 4MF7A 2NTOA 5LD0A 2CVDA 1F3AA 4PTSA 2VCWA 1JZRA
chains in the Genus database with same CATH superfamily
4KDUA 11GSA 3AY8A 2HZEA 2DJ3A 2NPBA 4POBA 1FAAA 2XBQA 4OD7A 3HMJG 4PI0C 5F05A 4OO5A 2GQLA 3ZIVA 5CO3A 2F8FA 2YWNA 4OO4A 4FQUA 4PI2C 1ERUA 2C1YA 2IIYA 2R0GA 1BX9A 2GLRA 1FOVA 2HLSA 2E7PA 2HSMB 3VLNA 5H5QA 2IMFA 4KB3A 4K9ZA 4RUVA 4JZQA 1A2JA 1V40A 1B9YC 4FIWA 3A5WA 1HNCA 1ACVA 2H19A 3FZ4A 2HRNA 1GUKA 4O5RA 4TW5A 1DE1A 2DBCA 3GH6A 4N0VA 1EOGA 5D73A 4EE0A 1HNAA 3LWAA 2C3TA 1YEPA 4F2IA 4OCFA 3ZRDA 3UAPA 2OA7A 1Z7RA 1TJDA 3NOFA 4V2NA 1RW1A 3MWHA 1JZDA 3ERWA 1Q4JA 1AIUA 4ZB9A 3CSIA 3BBYA 2FHEA 2JL4A 1SYRA 2NVLA 2K8SA 3U5RE 3KMOA 3RAZA 2B5EA 2L59A 1TP9A 1R4WA 3CXGA 3BJ5A 2VM2A 5KN0A 2PBJA 4ZB7A 2FLSA 4HJ2A 2HSYA 2FUG2 3D6IA 5ECRB 2E0QA 2EFEA 1WRYA 3L78A 2OT3A 4MH3A 2CVKA 2C3QA 1SD8A 3TKRA 4OFNA 2HSMA 5A1NB 3GIXA 5IMAA 3HHVA 4K0NA 2FGXA 4RI6A 22GSA 1WP0A 1DUGA 3TKSC 3ERGA 4P3YB 1SVOA 3EE2A 2V41A 3EVIA 4WETA 2IL3A 4GLTA 5DALB 5ECLB 4G01A 1BEDA 1OC3A 1XXUA 3FR3A 4WEYA 5DCGA 5DJMA 3ISOA 4KAEA 4GRFA 1THOA 4ICYA 1FHEA 3UOMA 3HCZA 4ACSA 3H4KA 3FK8A 3IE3A 1PSQA 3KH9A 1Q98A 3UEMA 5CRWA 5EY6A 2L4QA 5HR2A 1OE7A 3QFBC 1OAZA 3KCMA 3UJ1A 4PQHA 3GKMA 3TJBA 5CNWA 2H71A 2HNLA 2B7JA 5GZZB 3ZMLA 2DIZA 4HJMA 2VKZG 3EMXA 3P90A 2DSAA 3VWWA 2LRNA 5EPFA 4DSQA 5A4UA 1ILOA 1T4ZA 2KUCA 1HQOA 4USSA 5A1NA 4XIHA 2KP1A 6GSVA 3VWVA 4MZCA 4WKWA 5E4WA 2VD1A 1XIYA 4KNDA 2GDRA 3RHCA 2L5OA 4K6XA 5G5FA 4N3ZA 1EGRA 2LJAA 5DALA 1XWGA 1O73A 4NHZA 1K3LA 1FB6A 2WULA 4ZXGA 5J40A 1HNBA 3EURA 5AN1A 1QMVA 3L9SA 2WZSA 1PX6A 1J0FA 1ST9A 3P8WA 4ML1A 4AKXB 6GSYA 2K18A 4YQUA 4ZBDA 1K0NA 2HQTA 3DGQA 3SWLA 1ABAA 3C8EA 2A2RA 2DKHA 2X99A 2DJ2A 4XCSA 4ZB8A 3BCIA 4LL1B 2WW2A 3N5OA 2XHFA 3W6GA 5KEJA 2N5BA 1J9BA 4CY6A 4GSSA 2R4VA 4JR6A 9GSSA 2A2SA 3A2WA 4CY8A 2V32A 3A2XA 2CZ2A 1JLVA 1X5CA 1A2LA 3QMXA 4ZL7A 2LQQA 2O36A 4PXOA 1TI1A 1YQ1A 1A0RP 1NHYA 3CRTA 4JEDA 5DJLA 4QMKA 5G30A 1OVNA 1TRUA 4PQIA 3IC8A 2GVPA 4WR4A 3LSZA 1DE2A 1GNWA 5ECOB 5IOXA 3LXZA 4YQVA 1GSYA 3FKFA 3EMPA 4IQ1A 2KHPA 1M2AA 1JHBA 3KH7A 4ML6A 1Z6MA 3UIWA 4BL7B 2I4AA 2H72A 3IPZA 1Z3EA 1PA3A 4G10A 3FZAA 1AC1A 1XWBA 1ZYNA 4HI7A 4F0BA 4H86A 3FR6A 3VFIA 1F6MC 1XOAA 2V6KA 4GXZA 1YF0A 3TJKA 1FW1A 3TRXA 5JWOB 3MNGA 4ZILA 3O6TA 2H1AA 5FHIA 5D9WA 3F4RA 2H6ZA 2OJLA 3TRQA 3GV1A 5IIZA 4AJ7A 2H73A 3FEUA 2CX3A 1SKWB 2QA1A 1TRWA 2C0GA 1XVQA 2KOKA 5ENUA 1XWCA 3CQFA 1YDKA 2LV3A 5FT3A 4EXJA 1R7HA 3L9UA 2OADA 4HUAA 5L71A 1A24A 3H79A 1THXA 5H5RA 5BRTA 3IV4A 4PNGA 1UN2A 2C0DA 2YPMA 2EIRA 2J9HA 4BL7A 2PGTA 3WGXA 4IBPA 1EV4A 4NWYA 2WRTA 4IGJA 2AYTA 3KTLA 3L9VA 4I5QA 4HSCX 2DC5A 2O89A 5C04A 3KXOA 5JWQB 3LFLA 4JE1A 5G2ZA 2C0FA 4MF7A 2LKUA 4OWYA 1SKRB 1ZOFA 4PTSA 3GN3A 4EF0A 1GSSA 4NMUA 1CQHA 2VL2A 1O8XA 2DMLA 2V6OA 5DVBA 3FW2A 1GLQA 4DSRA 2WVYA 3IBHA 4HZ2A 4F03A 7GSSA 1OYJA 3LYPA 3ZMKA 5IPHA 1M9BA 2IMDA 1O8WA 2IMIA 2GT5A 1F3BA 3TB2A 2JZTA 1V98A 2GZPA 1VF3A 2PVQA 4KW6A 18GSA 1XWKA 1PL2A 3CYNA 2LJKA 4MLYA 5KN2A 5IM9A 3GKXA 4KSOA 2MMOA 4WF4A 1A23A 3TKSE 2X8GA 1GSDA 2F51A 1KEBA 4OFMA 5CRGA 1B48A 2E2GA 2ON7A 4FYBA 4AJ8A 3CHXC 2OE1A 1DSBA 4ZB6A 4YQMA 5IMCA 3WT1A 3C73A 1SK1A 4TOPA 4WBRD 8GSSA 1YF1A 5LNKe 4IJIA 4G9HA 1V57A 2GSRA 5DBQA 4K7NA 1JZOA 3H1NA 4ECCA 3EU3A 2X64A 3CTGA 4MJBA 2JSZA 2EIOA 2MMNA 3QAVA 4PUAA 3ED3A 3A2VA 1A8YA 3ZITA 2B1LA 2WJUA 5J47A 2R6KA 3FY7A 1F9MA 4CHSA 2WVXB 3DVXA 1TDIA 1T8EB 3IAM2 4J57E 2L4CA 1TXUA 5GAPD 1VRSD 4OCEA 5IPGA 2YV9A 3VWUA 1B8XA 2VD0A 4OMVA 2HFDA 3ZZXA 3ZL5A 3FRCA 2XPDA 4AKIA 3KMNA 2FWFA 3IHQA 4QQ7A 2MMZA 4EDYA 2LTKA 4ZL8A 2FY6A 4YAPA 2L6CA 1NHOA 5J4VA 1U6TA 4HQSA 1R5PA 5F06A 3RFRC 1GTUA 2I9HA 4KUNA 2DJJA 2IMEA 4N30A 1PD21 2HE3A 5DCHA 2C3NA 1QQ2A 1MDKA 1M2DA 2G2QA 4K7OA 1AAZA 4ECIA 1EEJA 2OACA 4E8EA 4IVFA 3DXBA 5ELGA 5J9BA 2WGRA 1SD9A 4IQAA 1V9WA 2AJQB 4IS0A 1AW9A 3GSSA 1TRVA 2PVOC 3KP8A 2BJXA 2FA4A 1G6YA 1FG4A 3TUEA 2OBIA 3W8JA 2LUSA 1FOHA 3D4TA 1OC9B 2WVXA 4WXTA 2HSNB 3APSA 1YJ6A 2AV4A 2UZ8A 4RI7A 3IXRA 4ECBA 1GP1A 5HQPA 3A5IA 1ERTA 3US3A 4O5UA 3WT2A 4NAXA 1M2BA 3ZTLA 4MZBA 3H8QA 2GSQA 5A4WA 3GMFA 2VCTA 3U6VA 1SVLA 3F3RA 2DKIA 4LL4B 3R2QA 2VLVA 3F9UA 4I6XA 2GS3A 4YKFA 2A4HA 4ILFA 2CVBA 4G2EA 3MYDA 1TK5B 2WS2A 1EGOA 1S4BP 1FO5A 2F9SA 1M7TA 2C80A 4AKGA 4QL9A 2ON5A 2TRCP 4IP6A 3EWLA 2LNSA 4LA1A 3E0UA 3HY2A 2B5XA 2P31A 2DJKA 1W4VA 5ELAA 2P0GA 2JACA 1TRSA 3GL3A 3R3EA 3UMAA 3UVHA 2A2PA 4MA9A 4FYUA 4L0WA 4POMA 3KP9A 3LQ7A 1TK8B 4AI6A 1VF1A 1OC9A 1Z5YE 2HSNA 5CP1A 2L5LA 5A5HA 4DSSB 4KA0A 4GF0A 1TKDB 2HRFA 1MDJA 3GTUB 4GSTA 2AHEA 2H8LA 1KTEA 2H1BA 5IQYA 4V1Ap 3C1SA 4AKHA 1SKSB 2WB9A 3UBKA 4K5SA 4NXIA 3Q18A 4E8HA 3IOSA 3LG6A 4XS4B 1B4PA 3M1GA 2O85A 4HS1A 2M80A 3PPUA 5J3RA 1Y25A 4PGTA 1H4OA 4WF5A 2ZUPA 2VCZA 2HRKA 2MMAA 2CT6A 3S9FA 5JCGA 3FZ5A 4AJ6A 3TOTA 3MAKA 2HZFA 4BPYA 2GT6A 3TU3B 1G7EA 4PNFA 4ID0A 1WJKA 5ECSA 4BVXB 3GX8A 2CAQA 2YWIA 3J7Yk 5ECPB 5A34B 2WZ9A 3GHAA 5KOXA 4TRXA 1ZZYA 2AB6A 4IP1A 5ECHB 1XVWA 1ML6A 2H30A 1VF2A 3EPTA 3C71A 4O92A 3VI7A 3GX0A 3D21A 3D0ZA 2OBKA 4RQXA 3DEXA 4F82A 3ZIJA 1XW9A 1WMJA 3M0FA 4DSSA 1BJXA 4KGIA 2FWEA 3GTUA 4MJAA 1SK2A 4K2DA 4G0KA 2IMKA 2P5RA 2PN8A 3GURA 1GH2A 3QOUA 3RBTA 4K8MA 1G0TA 3M8NA 3HVSA 3HDCA 4XS4A 6GSSA 3GUSA 6GSWA 2OE0A 2J23A 1Z6NA 1T1VA 3RDWA 1UVZA 3D22A 4O32A 2IN3A 2ZCTA 2AAWA 3DD3A 2IFQB 1WE0A 3TKSA 5CREA 3DVWA 4BVXA 3PR8A 2RM6A 2LSTA 4IN0A 1YKCA 1S3AA 1K3YA 1R5AA 5A34A 1ZYEA 2NTOA 5ID2B 5LD0A 2CVDA 4TN8A 4MMMA 2RM5A 5CAXA 1AQWA 1TU7A 6GSUA 4TXOB 1EOHA 3FYGA 1GUMA 3IHGA 5AIXA 1VGLA 2H6XA 3ZLPA 3ZREA 4K7IA 3PINA 3ME7A 3GSTA 4FH8A 2WDUA 1SU9A 3VPTA 1SJ6A 5ECMB 3EINA 4I2UA 3N9JA 5FWGA 3TGZA 1EP8A 3QPMA 4AGSA 1EWXA 1HYUA 1ON4A 3F3QA 1GNEA 4J2FA 1KBNA 2VM1A 2L6DA 2TIRA 2H0GA 1ZL9A 4F9ZA 2EFCA 1PKZA 2ES7A 3PH9A 5CRHA 4L0UA 2A4VA 1JZWA 2H0IA 4EUYA 2IFQA 1K0BA 2X8HA 2B1KA 4MPGA 1OKDA 1YZXA 2B3SA 4KCAA 1E6BA 4V2LA 4Z2UA 2YN1A 1A0FA 1M3JA 1B4QA 4EKZA 5ID2A 4MPFA 5KN3A 5CRDA 2CX4A 2FNOA 1MTCA 2FWHA 4HQZA 1Z7PA 3V1WA 2YZHA 2CAIA 1TXXA 4TXOA 5E59A 3HJOA 4Q5NA 2VIMA 3TCOA 4MH2A 4G0IA 1T7PB 3CSHA 5KN1A 3UVTA 3LEFA 3C1RA 4G0LA 3TOUA 3F4SA 5INYA 4GQCA 5IO0A 1RQMA 3I9V2 3APQA 3O76A 3KM6A 3F0IA 4X0XA 3MDKA 5ECNB 4N10A 2DMMA 4ZL9A 1FB0A 1I1IP 1K0MA 1O81A 2EFDA 1EV9A 4PHZC 4KDXA 1GUHA 2B5YA 3E3EA 4EO3A 2O3EA 4F0CA 3L4NA 1ZGNA 4DEJA 4X1UA 1AXDA 4EL1A 2N5FA 2R0CA 1IYHA 10GSA 2PWJA 4BVYB 2VL3A 2CV4A 3VI5A 5JCUA 2GZZA 2GQKA 2YV7A 2QGVA 5ECQB 4HDEA 4PQ1A 2H1LA 2LRTA 1XZOA 5F8BA 3CRUA 3GL5A 2H70A 1XG8A 2I3YA 3F4TA 3QCPA 5IMVA 2VCXA 2JADA 2R37A 1AQVA 2R0PA 4TR3A 3G7YA 3TJJA 3KJYA 5B7CA 4JRRA 5KOWA 5J5NA 1ZYQB 4BWQA 3HA9A 3TJFA 5DQYA 3J7Yb 3P2AA 4K1FA 1QUWA 1FVJA 1KNGA 2LS5A 3GNJA 1ERVA 1HD2A 3L0HA 4EC0A 3E9JB 1QXHA 2OE3A 3I69A 2FWGA 4JBBA 3ME8A 2QC7A 1TTZA 3VURA 3LW9A 3KGKA 3KD0A 4BIKA 1GTBA 4EDZA 2FCHA 14GSA 2GZYA 4BVYA 3CTFA 4JU5A 1NM3A 1GL8A 2ZNMA 3PGTA 1U87A 5A5KA 1K0DA 3F6FA 2YWMA 4MK3A 4Z7XA 6GSTA 3F8UA 4W66A 5G5EA 1TW9A 2XPEA 3GH9A 4GCIA 3BCKA 4MDCA 4KH7A 1PKWA 4FO5A 3NZNA 3LYKA 4OFTA 4K5RA 1PGTA 4YAVA 4LMVA 4IKHA 3QDNA 2KP2A 1BG5A 4XS6A 2H0HA 1SJZA 5HR0A 4CDOA 2PMTA 3DWVA 4MJCA 2RUFA 5G31A 3UBLA 2DLXA 2YP6A 1M0UA 2LQOA 3EYTA 4HU9A 1K3OA 3VPQA 2YOIA 4XRDA 4DVCA 2YWOA 1S3RA 2HT9A 4FYCA 4D73B 4IJ3A 1I9DA 2MBSA 1V2AA 1T00A 1SYXA 2VO4A 4XHMA 2G0FA 3HJMA 3CSJA 2LEGA 3VK9A 1WIKA 1LJRA 3G7IA 6GSXA 2B7KA 1J08A 5G1LA 5D96A 19GSA 1UA5A 1BG1A 2H1GA 1SL0B 1GLPA 5A5HB 3H93A 1M3IA 4MP4A 1M9AA 3LXTA 4GSNA 1A8LA 3DYRA 1NSWA 3RHBA 2O5VA 1QK8A 1YKAA 2YZUA 1PN0A 4NPBA 4L8EA 3TDGA 2XBIA 2VAFA 1FVKA 1PMTA 4N11A 3BOAA 1U3AA 2I1UA 5ABRA 4I97A 3VWXA 4TR1A 3IAS2 5BMUB 3EU4A 2H66A 4YH2A 1X9SB 2HRKB 1OKTA 1G7OA 3FMWA 2HSHA 2X49A 3GKKA 3Q6OA 3UL3A 2WVZA 2REMA 2QKEA 3TJGA 4KCEA 3FHKA 2X8CA 2P5QA 2YANA 2B6MA 1XW6A 5J41A 1N2AA 4D73A 2H74A 2H75A 3IRAA 4ISDA 2K6VA 2GTUA 5IO2A 1XFLA 4HU7A 3QFAC 3ZFLA 1V58A 4Z2RA 3Q19A 1MEKA 4IHUA 2IWTA 1WPIA 3DIEA 1GRXA 3HZ4A 3M3MA 2PPTA 1XBSA 2EIQA 1TOFA 4XS1A 1JZRA 1CQGA 5GSSA 4GTUA 3HVXA 4PUFC 5HR1A 2DJ0A 4TR4A 4V2MA 2XC2A 4WBJA 4Z2TA 1ZYPA 2N5AA 4J56E 5B8BA 5BMUA 2PERA 3ZVJD 5J4UA 4X4JA 4POLA 17GSA 4MF6A 3CWGA 4LLRA 3MSZA 5CYYA 3LORA 2TRXA 4G19A 4LMWA 2JZRA 4QL7A 3HJPA 4NHWA 4IW9A 5J4YA 1Z9HA 2MYGA 1YEWC 3LJRA 1GWCA 5IMFA 1PX7A 2VCQA 3I6AA 1O6JA 2PU9C 1PRXA 4PX1A 3KIJA 1SVMA 1I5GA 2R3XA 1XOBA 3ZYWA 2I81A 3KEBA 2HYXA 5J9CA 4MCUA 4HOJA 2C0EA 3K8NA 2NBSA 1X9MB 1BYEA 1PFOA 4ZBAA 3TKQA 1SL2B 1TI3A 4X43A 2O8VB 5ECIB 4ZIJA 2K8VA 4I8BA 3KTBA 5B6NA 5JCWA 2VCVA 3LGCA 5AIVA 1C72A 1JLWA 3ZVJA 3WGEA 4TKYA 1EZKA 1T4YA 3D5JA 4WR5A 3IC4A 3TKPA 3F63A 4K0GA 1QGVA 4KF9A 1MDIA 3WGDA 4KE3A 2HI7A 1LBKA 2H1DA 1N25A 5D9TA 3HZ8A 1XPVA 1EEMA 3APOA 3G7JA 3GA4A 1GSQA 3M9KA 1UC7A 1MD4A 3EC3A 2VL2C 4EIQA 1X5DA 1PN9A 4YKGA 13GSA 1GSUA 1OC8A 1X0RA 4TXVA 5A4VA 1GTIA 2VUPA 2WCIA 2YJ7A 5IOWA 3MIXA 2K9FA 1GSEA 3RPPA 2LRCA 2Z9SA 5COHA 2UV8G 1U88A 4A5PA 1Y6EA 2IJYA 1F37A 1M99A 3QAWA 3WD6A 2WFCA 3HVVA 5C00A 1SK0A 1OE8A 1U3IA 2X4AA 20GSA 5DDLA 3UARA 2RIIA 2JU5A 2VLUA 4POKA 2LNTA 1IYIA 1QFNA 3QR6A 5JWRB 1RK4A 4K2XA 1K0CA 1LU4A 2O7KA 3JCML 4RQRA 2JZSA 2NDOA 1BF5A 1JFUA 1YEXA 2H01A 3HKRA 4JR4A 5B8AA 3G9BA 3CMIA 2ALBA 1K0OA 1PL1A 4XRAA 1Y1UA 2VCWA 1NW2A 1GULA 1R26A 2FA8A 4Q5FA 3KZQA 3GFKA 3O3TA 5HFIA 4IELA 3CBUA 3QAGA 5D9VA 1XCCA 5HFKA 2JSYA 2M46A 3DKSA 1ERWA 1ZCPA 5D9XA 1URMA 4GDFA 2BMXA 1TK0B 4TVEA 2HRAA 2RLIA 4KX4A 1YY7A 3NIVA 3GYKA 4EIPA 4AF2A 5HR3A 1O85A 2CA8A 5IMZA 1PQNA 1VF4A 3RPNA 2YJHA 2OKAA 2CZ3A 2V2GA 3HYPA 3M9JA 2BTOT 4ULXA 2V1MA 2LJRA 3WYWA 5IMDA 4MZWA 2F8AA 5F0GA 1B9XC 1F2EA 4CW9A 2RUEA 3SBCA 3F6DA 1S3CA 1S3DA 2VL9A 4L5LA 4MJEA 3HD5A 5GSTA 3QD9A 2H6YA 1T3BA 1SL1B 4Q5QA 3FZ9A 5H5SA 3A3TA 2C8UA 2IPAA 2D2ZA 3GKNA 4O5QA 3IDVA 1X5EA 5AISA 1YVLA 4MNNA 2GSSA 5F07A 2M72A 1E2YA 1H75A 2KLXA 5G1KA 2VOCA 2GQMA 1G6WA 2YCDA 1K0AA 3ERFA 4Q5RA 5GAND 5EL8A 3RGBC 2EFHA 4BA7A 1SJIA 4MF5A 2WW3A 2MZCA 1EP7A 2DJ1A 2HXKA 3IK7A 4KSMA 2WW0A 2CQ9A 4NV5A 3HXSA 4HEA2 12GSA 5DAKB 2EC4A 3DRNA 5DQSA 2VLTA 3HVNA 2MBTA 5ECKB 16GSA 2WW1A 5EVOA 2AUVA 4PURA 2HZEB 4KDYA 2R5GA 4HZ4A 3FR9A 1AQXA 2F3MA 1USBA 4N0ZA 1MD3A 4BWSA 2FD3A 2O87A 4EVMA 1BQ7A 2E2MA 3P7XA 3OR5A 2L57A 2R2JA 4GWRA 3IA1A 3Q74A 1GSFA 3BD2A 2H76A 1XWAA 5AGYA 5LCZA 3C7MA 5HFGA 4V1Ag 5B6MA 4ZBBA 1X9WB 1A2MA 3ZFBA 4XTSA 4MABA 1XW5A 3W8SA 3DMLA 1O7UA 2YNXA 4GQFA 4NV2A 3GRXA 2QA2A 2DIYA 1BAYA 2C4JA 1AUCA 1W89A 3IR4A 1DBYA 4L5OA 2QSIA 3TRPA 4E68A 4FXYP 4ECJA 4I2TA 1WWJA 2GGTA 5D93A 1WOUA 1SENA 2GSTA 2PUKC 5D8IA 3I43A 4TR0A 4TR1B 3IK9A 4O7HA 1GTAA 5DAKA 1TU8A 1F3AA 1N8JA 1ZMAA 3D4MA
chains in the Genus database with same CATH topology
4KDUA 11GSA 3AY8A 2HZEA 2DJ3A 2NPBA 4POBA 1FAAA 2XBQA 4OD7A 3HMJG 5F05A 4OO5A 2GQLA 3ZIVA 5CO3A 2F8FA 2YWNA 4OO4A 4FQUA 1ERUA 2C1YA 2IIYA 2R0GA 1BX9A 2GLRA 1FOVA 2HLSA 2E7PA 2HSMB 3VLNA 5H5QA 2IMFA 4KB3A 4K9ZA 4RUVA 4JZQA 1A2JA 1V40A 1B9YC 4FIWA 3A5WA 1HNCA 1ACVA 2H19A 3FZ4A 2HRNA 1GUKA 4O5RA 4TW5A 1DE1A 2DBCA 3GH6A 4N0VA 1EOGA 5D73A 4EE0A 1HNAA 3LWAA 2C3TA 1YEPA 4F2IA 4OCFA 3ZRDA 3UAPA 2OA7A 1Z7RA 1TJDA 3NOFA 4V2NA 1RW1A 3MWHA 1JZDA 3ERWA 1Q4JA 1AIUA 4ZB9A 3CSIA 3BBYA 2FHEA 2JL4A 1SYRA 2NVLA 2K8SA 3U5RE 3KMOA 3RAZA 2B5EA 2L59A 1TP9A 1R4WA 3CXGA 3BJ5A 2VM2A 5KN0A 2PBJA 4ZB7A 2FLSA 4HJ2A 2HSYA 2FUG2 3D6IA 5ECRB 2E0QA 2EFEA 1WRYA 3L78A 2OT3A 4MH3A 2CVKA 2C3QA 1SD8A 3TKRA 4OFNA 2HSMA 5A1NB 3GIXA 5IMAA 3HHVA 4K0NA 2FGXA 4RI6A 22GSA 1WP0A 1DUGA 3TKSC 3ERGA 4P3YB 1SVOA 3EE2A 2V41A 3EVIA 4WETA 2IL3A 4GLTA 5DALB 5ECLB 4G01A 1BEDA 1OC3A 1XXUA 3FR3A 4WEYA 5DCGA 5DJMA 3ISOA 4KAEA 4GRFA 1THOA 4ICYA 1FHEA 3UOMA 3HCZA 4ACSA 3H4KA 3FK8A 3IE3A 1PSQA 3KH9A 1Q98A 3UEMA 5CRWA 5EY6A 2L4QA 5HR2A 1OE7A 3QFBC 1OAZA 3KCMA 3UJ1A 4PQHA 3GKMA 3TJBA 5CNWA 2H71A 2HNLA 2B7JA 5GZZB 3ZMLA 2DIZA 4HJMA 2VKZG 3EMXA 3P90A 2DSAA 3VWWA 2LRNA 5EPFA 4DSQA 5A4UA 1ILOA 1T4ZA 2KUCA 1HQOA 4USSA 5A1NA 4XIHA 2KP1A 6GSVA 3VWVA 4MZCA 4WKWA 5E4WA 2VD1A 1XIYA 4KNDA 2GDRA 3RHCA 2L5OA 4K6XA 5G5FA 4N3ZA 1EGRA 2LJAA 5DALA 1XWGA 1O73A 4NHZA 1K3LA 1FB6A 2WULA 4ZXGA 5J40A 1HNBA 3EURA 5AN1A 1QMVA 3L9SA 1PX6A 1J0FA 1ST9A 3P8WA 4ML1A 4AKXB 6GSYA 2K18A 4YQUA 4ZBDA 1K0NA 2HQTA 3DGQA 3SWLA 1ABAA 3C8EA 2A2RA 2DKHA 2X99A 2DJ2A 4XCSA 4ZB8A 3BCIA 4LL1B 3N5OA 2XHFA 3W6GA 5KEJA 2N5BA 1J9BA 4CY6A 4GSSA 2R4VA 4JR6A 9GSSA 2A2SA 3A2WA 4CY8A 2V32A 3A2XA 2CZ2A 1JLVA 1X5CA 1A2LA 3QMXA 4ZL7A 2LQQA 4PXOA 1TI1A 1YQ1A 1A0RP 1NHYA 3CRTA 4JEDA 5DJLA 4QMKA 5G30A 1OVNA 1TRUA 4PQIA 3IC8A 2GVPA 4WR4A 3LSZA 1DE2A 1GNWA 5ECOB 5IOXA 3LXZA 4YQVA 1GSYA 3FKFA 3EMPA 4IQ1A 2KHPA 1M2AA 1JHBA 3KH7A 4ML6A 1Z6MA 3UIWA 4BL7B 2I4AA 2H72A 3IPZA 1Z3EA 1PA3A 4G10A 1AC1A 3FZAA 1XWBA 1ZYNA 4HI7A 4F0BA 4H86A 3FR6A 3VFIA 1F6MC 1XOAA 2V6KA 4GXZA 1YF0A 3TJKA 1FW1A 3TRXA 5JWOB 3MNGA 4ZILA 3O6TA 2H1AA 5FHIA 5D9WA 3F4RA 2H6ZA 2OJLA 3TRQA 3GV1A 5IIZA 4AJ7A 2H73A 3FEUA 2CX3A 1SKWB 2QA1A 1TRWA 2C0GA 1XVQA 2KOKA 5ENUA 1XWCA 1YDKA 2LV3A 5FT3A 4EXJA 1R7HA 3L9UA 2OADA 4HUAA 5L71A 1A24A 3H79A 1THXA 5H5RA 5BRTA 3IV4A 4PNGA 1UN2A 2C0DA 2YPMA 2EIRA 2J9HA 4BL7A 2PGTA 3WGXA 4IBPA 1EV4A 4NWYA 2WRTA 4IGJA 2AYTA 3KTLA 3L9VA 4I5QA 2DC5A 2O89A 5C04A 3KXOA 5JWQB 3LFLA 4JE1A 5G2ZA 2C0FA 4MF7A 2LKUA 4OWYA 1SKRB 1ZOFA 4PTSA 3GN3A 4EF0A 1GSSA 4NMUA 1CQHA 2VL2A 1O8XA 2DMLA 2V6OA 5DVBA 3FW2A 1GLQA 4DSRA 3IBHA 4HZ2A 4F03A 7GSSA 1OYJA 3LYPA 3ZMKA 5IPHA 1M9BA 2IMDA 1O8WA 2IMIA 2GT5A 1F3BA 3TB2A 2JZTA 1V98A 2GZPA 1VF3A 2PVQA 4KW6A 18GSA 1XWKA 1PL2A 3CYNA 2LJKA 4MLYA 5KN2A 5IM9A 3GKXA 4KSOA 2MMOA 4WF4A 1A23A 3TKSE 2X8GA 1GSDA 2F51A 1KEBA 4OFMA 5CRGA 1B48A 2E2GA 2ON7A 4FYBA 4AJ8A 2OE1A 1DSBA 4ZB6A 4YQMA 5IMCA 3WT1A 3C73A 1SK1A 4TOPA 4WBRD 8GSSA 1YF1A 5LNKe 4IJIA 4G9HA 1V57A 2GSRA 5DBQA 4K7NA 1JZOA 3H1NA 4ECCA 3EU3A 2X64A 3CTGA 4MJBA 2JSZA 2EIOA 2MMNA 3QAVA 4PUAA 3ED3A 3A2VA 1A8YA 3ZITA 2B1LA 2WJUA 5J47A 2R6KA 3FY7A 1F9MA 4CHSA 3DVXA 1TDIA 1T8EB 3IAM2 4J57E 2L4CA 1TXUA 5GAPD 1VRSD 4OCEA 5IPGA 2YV9A 3VWUA 1B8XA 2VD0A 4OMVA 2HFDA 3ZZXA 3ZL5A 3FRCA 2XPDA 4AKIA 3KMNA 2FWFA 3IHQA 4QQ7A 2MMZA 4EDYA 2LTKA 4ZL8A 2FY6A 4YAPA 2L6CA 1NHOA 5J4VA 1U6TA 4HQSA 1R5PA 5F06A 1GTUA 2I9HA 4KUNA 2DJJA 2IMEA 4N30A 1PD21 2HE3A 5DCHA 2C3NA 1QQ2A 1MDKA 1M2DA 2G2QA 4K7OA 1AAZA 4ECIA 1EEJA 2OACA 4E8EA 4IVFA 3DXBA 5ELGA 5J9BA 2WGRA 1SD9A 4IQAA 1V9WA 2AJQB 4IS0A 1AW9A 3GSSA 1TRVA 3KP8A 2PVOC 2BJXA 2FA4A 1G6YA 1FG4A 3TUEA 2OBIA 3W8JA 2LUSA 1FOHA 3D4TA 1OC9B 4WXTA 2HSNB 3APSA 1YJ6A 2AV4A 2UZ8A 4RI7A 3IXRA 4ECBA 1GP1A 5HQPA 3A5IA 1ERTA 3US3A 4O5UA 3WT2A 4NAXA 1M2BA 3ZTLA 4MZBA 3H8QA 2GSQA 5A4WA 3GMFA 2VCTA 3U6VA 1SVLA 3F3RA 2DKIA 4LL4B 3R2QA 2VLVA 3F9UA 4I6XA 2GS3A 4YKFA 2A4HA 4ILFA 2CVBA 4G2EA 3MYDA 1TK5B 2WS2A 1EGOA 1FO5A 2F9SA 1M7TA 2C80A 4AKGA 4QL9A 2ON5A 2TRCP 4IP6A 3EWLA 2LNSA 4LA1A 3E0UA 3HY2A 2B5XA 2P31A 2DJKA 1W4VA 5ELAA 2P0GA 2JACA 1TRSA 3GL3A 3R3EA 3UMAA 3UVHA 2A2PA 4MA9A 4FYUA 4L0WA 4POMA 3KP9A 3LQ7A 1TK8B 4AI6A 1VF1A 1OC9A 1Z5YE 2HSNA 5CP1A 2L5LA 5A5HA 4DSSB 4KA0A 4GF0A 1TKDB 2HRFA 1MDJA 3GTUB 4GSTA 2AHEA 2H8LA 1KTEA 2H1BA 5IQYA 4V1Ap 3C1SA 4AKHA 1SKSB 2WB9A 3UBKA 4K5SA 4NXIA 3Q18A 4E8HA 3IOSA 3LG6A 4XS4B 1B4PA 3M1GA 2O85A 4HS1A 2M80A 3PPUA 5J3RA 1Y25A 4PGTA 1H4OA 4WF5A 2ZUPA 2VCZA 2HRKA 2MMAA 2CT6A 3S9FA 5JCGA 3FZ5A 4AJ6A 3TOTA 3MAKA 2HZFA 4BPYA 2GT6A 3TU3B 1G7EA 4PNFA 4ID0A 1WJKA 5ECSA 4BVXB 3GX8A 2CAQA 2YWIA 3J7Yk 5ECPB 5A34B 2WZ9A 3GHAA 5KOXA 4TRXA 1ZZYA 2AB6A 4IP1A 5ECHB 1XVWA 1ML6A 2H30A 1VF2A 3EPTA 3C71A 4O92A 3VI7A 3GX0A 3D21A 3D0ZA 2OBKA 4RQXA 3DEXA 4F82A 3ZIJA 1XW9A 1WMJA 3M0FA 4DSSA 1BJXA 4KGIA 2FWEA 3GTUA 4MJAA 1SK2A 4K2DA 4G0KA 2IMKA 2P5RA 2PN8A 3GURA 1GH2A 3QOUA 3RBTA 4K8MA 1G0TA 3M8NA 3HVSA 3HDCA 4XS4A 6GSSA 3GUSA 6GSWA 2OE0A 2J23A 1Z6NA 1T1VA 3RDWA 1UVZA 3D22A 4O32A 2IN3A 2ZCTA 2AAWA 3DD3A 2IFQB 1WE0A 3TKSA 5CREA 3DVWA 4BVXA 3PR8A 2RM6A 2LSTA 4IN0A 1YKCA 1S3AA 1K3YA 1R5AA 5A34A 1ZYEA 2NTOA 5ID2B 5LD0A 2CVDA 4TN8A 4MMMA 2RM5A 5CAXA 1AQWA 1TU7A 6GSUA 4TXOB 1EOHA 3FYGA 1GUMA 3IHGA 5AIXA 1VGLA 2H6XA 3ZLPA 3ZREA 4K7IA 3PINA 3ME7A 3GSTA 4FH8A 2WDUA 1SU9A 3VPTA 1SJ6A 5ECMB 3EINA 4I2UA 3N9JA 5FWGA 3TGZA 1EP8A 3QPMA 4AGSA 1EWXA 1HYUA 1ON4A 3F3QA 1GNEA 4J2FA 1KBNA 2VM1A 2L6DA 2TIRA 2H0GA 1ZL9A 4F9ZA 2EFCA 1PKZA 2ES7A 3PH9A 5CRHA 4L0UA 2A4VA 1JZWA 2H0IA 4EUYA 2IFQA 1K0BA 2X8HA 2B1KA 4MPGA 1OKDA 1YZXA 2B3SA 4KCAA 1E6BA 4V2LA 4Z2UA 2YN1A 1A0FA 1B4QA 4EKZA 5ID2A 4MPFA 5KN3A 5CRDA 2CX4A 2FNOA 1MTCA 2FWHA 4HQZA 1Z7PA 3V1WA 2YZHA 2CAIA 1TXXA 4TXOA 5E59A 3HJOA 4Q5NA 2VIMA 3TCOA 4MH2A 4G0IA 1T7PB 3CSHA 5KN1A 3UVTA 3LEFA 3C1RA 4G0LA 3TOUA 3F4SA 5INYA 4GQCA 5IO0A 1RQMA 3I9V2 3APQA 3O76A 3KM6A 3F0IA 4X0XA 3MDKA 5ECNB 4N10A 2DMMA 4ZL9A 1FB0A 1K0MA 1O81A 2EFDA 1EV9A 4KDXA 1GUHA 2B5YA 3E3EA 4EO3A 4F0CA 3L4NA 1ZGNA 4DEJA 4X1UA 1AXDA 4EL1A 2N5FA 2R0CA 1IYHA 10GSA 2PWJA 4BVYB 2VL3A 2CV4A 3VI5A 5JCUA 2GZZA 2GQKA 2YV7A 2QGVA 5ECQB 4HDEA 4PQ1A 2H1LA 2LRTA 1XZOA 5F8BA 3CRUA 3GL5A 2H70A 2I3YA 3F4TA 3QCPA 5IMVA 2VCXA 2JADA 2R37A 1AQVA 2R0PA 4TR3A 3G7YA 3TJJA 3KJYA 5B7CA 4JRRA 5KOWA 5J5NA 1ZYQB 4BWQA 3HA9A 3TJFA 5DQYA 3J7Yb 3P2AA 4K1FA 1QUWA 1FVJA 1KNGA 2LS5A 3GNJA 1ERVA 1HD2A 3L0HA 4EC0A 3E9JB 1QXHA 2OE3A 3I69A 2FWGA 4JBBA 3ME8A 2QC7A 1TTZA 3VURA 3LW9A 3KGKA 3KD0A 1GTBA 4EDZA 2FCHA 14GSA 2GZYA 4BVYA 3CTFA 4JU5A 1NM3A 1GL8A 2ZNMA 3PGTA 1U87A 5A5KA 1K0DA 3F6FA 2YWMA 4MK3A 4Z7XA 6GSTA 3F8UA 4W66A 5G5EA 1TW9A 2XPEA 3GH9A 4GCIA 3BCKA 4MDCA 4KH7A 1PKWA 4FO5A 3NZNA 3LYKA 4OFTA 4K5RA 1PGTA 4YAVA 4LMVA 4IKHA 3QDNA 2KP2A 1BG5A 4XS6A 2H0HA 1SJZA 5HR0A 4CDOA 2PMTA 3DWVA 4MJCA 2RUFA 5G31A 3UBLA 2DLXA 2YP6A 1M0UA 2LQOA 3EYTA 4HU9A 1K3OA 3VPQA 2YOIA 4XRDA 4DVCA 2YWOA 2HT9A 4FYCA 4D73B 4IJ3A 1I9DA 2MBSA 1V2AA 1T00A 1SYXA 2VO4A 4XHMA 2G0FA 3HJMA 3CSJA 2LEGA 3VK9A 1WIKA 1LJRA 3G7IA 6GSXA 2B7KA 1J08A 5G1LA 5D96A 19GSA 1UA5A 1BG1A 2H1GA 1SL0B 1GLPA 5A5HB 3H93A 4MP4A 1M9AA 3LXTA 4GSNA 1A8LA 3DYRA 1NSWA 3RHBA 2O5VA 1QK8A 1YKAA 2YZUA 1PN0A 4NPBA 4L8EA 3TDGA 2XBIA 2VAFA 1FVKA 1PMTA 4N11A 3BOAA 1U3AA 2I1UA 5ABRA 4I97A 3VWXA 4TR1A 3IAS2 5BMUB 3EU4A 2H66A 4YH2A 1X9SB 2HRKB 1OKTA 1G7OA 3FMWA 2HSHA 2X49A 3GKKA 3Q6OA 3UL3A 2REMA 2QKEA 3TJGA 4KCEA 3FHKA 2X8CA 2P5QA 2YANA 2B6MA 1XW6A 5J41A 1N2AA 4D73A 2H74A 2H75A 3IRAA 4ISDA 2K6VA 2GTUA 5IO2A 1XFLA 4HU7A 3QFAC 3ZFLA 1V58A 4Z2RA 3Q19A 1MEKA 4IHUA 2IWTA 1WPIA 3DIEA 1GRXA 3HZ4A 3M3MA 2PPTA 1XBSA 2EIQA 1TOFA 4XS1A 1JZRA 1CQGA 5GSSA 4GTUA 3HVXA 4PUFC 5HR1A 2DJ0A 4TR4A 4V2MA 2XC2A 4WBJA 4Z2TA 1ZYPA 2N5AA 4J56E 5B8BA 5BMUA 2PERA 3ZVJD 5J4UA 4X4JA 4POLA 17GSA 4MF6A 3CWGA 4LLRA 3MSZA 5CYYA 3LORA 2TRXA 4G19A 4LMWA 2JZRA 4QL7A 3HJPA 4NHWA 4IW9A 5J4YA 1Z9HA 2MYGA 3LJRA 1GWCA 5IMFA 1PX7A 2VCQA 3I6AA 1O6JA 2PU9C 1PRXA 4PX1A 3KIJA 1SVMA 1I5GA 2R3XA 1XOBA 3ZYWA 2I81A 3KEBA 2HYXA 5J9CA 4MCUA 4HOJA 2C0EA 3K8NA 2NBSA 1X9MB 1BYEA 4ZBAA 3TKQA 1SL2B 1TI3A 4X43A 2O8VB 5ECIB 4ZIJA 2K8VA 4I8BA 3KTBA 5B6NA 5JCWA 2VCVA 3LGCA 5AIVA 1C72A 1JLWA 3ZVJA 3WGEA 4TKYA 1EZKA 1T4YA 3D5JA 4WR5A 3IC4A 3TKPA 3F63A 4K0GA 1QGVA 4KF9A 1MDIA 3WGDA 4KE3A 2HI7A 1LBKA 2H1DA 1N25A 5D9TA 3HZ8A 1XPVA 1EEMA 3APOA 3G7JA 3GA4A 1GSQA 3M9KA 1UC7A 1MD4A 3EC3A 2VL2C 4EIQA 1X5DA 1PN9A 4YKGA 13GSA 1GSUA 1OC8A 1X0RA 4TXVA 5A4VA 1GTIA 2VUPA 2WCIA 2YJ7A 5IOWA 3MIXA 2K9FA 1GSEA 3RPPA 2LRCA 2Z9SA 5COHA 2UV8G 1U88A 4A5PA 1Y6EA 2IJYA 1F37A 1M99A 3QAWA 3WD6A 2WFCA 3HVVA 5C00A 1SK0A 1OE8A 1U3IA 2X4AA 20GSA 5DDLA 3UARA 2RIIA 2JU5A 2VLUA 4POKA 2LNTA 1IYIA 1QFNA 3QR6A 5JWRB 1RK4A 4K2XA 1K0CA 1LU4A 2O7KA 3JCML 4RQRA 2JZSA 2NDOA 1BF5A 1JFUA 1YEXA 2H01A 3HKRA 4JR4A 5B8AA 3G9BA 3CMIA 2ALBA 1K0OA 1PL1A 4XRAA 1Y1UA 2VCWA 1NW2A 1GULA 1R26A 2FA8A 4Q5FA 3KZQA 3GFKA 3O3TA 5HFIA 4IELA 3CBUA 3QAGA 5D9VA 1XCCA 5HFKA 2JSYA 2M46A 3DKSA 1ERWA 1ZCPA 5D9XA 1URMA 4GDFA 2BMXA 1TK0B 4TVEA 2HRAA 2RLIA 4KX4A 1YY7A 3NIVA 3GYKA 4EIPA 4AF2A 5HR3A 1O85A 2CA8A 5IMZA 1PQNA 1VF4A 3RPNA 2YJHA 2OKAA 2CZ3A 2V2GA 3HYPA 3M9JA 2BTOT 4ULXA 2V1MA 2LJRA 3WYWA 5IMDA 4MZWA 2F8AA 5F0GA 1B9XC 1F2EA 4CW9A 2RUEA 3SBCA 3F6DA 1S3CA 1S3DA 2VL9A 4L5LA 4MJEA 3HD5A 5GSTA 3QD9A 2H6YA 1T3BA 1SL1B 4Q5QA 3FZ9A 5H5SA 3A3TA 2C8UA 2IPAA 2D2ZA 3GKNA 4O5QA 3IDVA 1X5EA 5AISA 1YVLA 4MNNA 2GSSA 5F07A 2M72A 1E2YA 1H75A 2KLXA 5G1KA 2VOCA 2GQMA 1G6WA 2YCDA 1K0AA 3ERFA 4Q5RA 5GAND 5EL8A 4BA7A 2EFHA 1SJIA 4MF5A 2MZCA 1EP7A 2DJ1A 2HXKA 3IK7A 4KSMA 2CQ9A 4NV5A 3HXSA 4HEA2 12GSA 5DAKB 2EC4A 3DRNA 5DQSA 2VLTA 2MBTA 5ECKB 16GSA 5EVOA 2AUVA 4PURA 2HZEB 4KDYA 2R5GA 4HZ4A 3FR9A 1AQXA 2F3MA 1USBA 4N0ZA 1MD3A 4BWSA 2FD3A 2O87A 4EVMA 1BQ7A 2E2MA 3P7XA 3OR5A 2L57A 2R2JA 4GWRA 3IA1A 3Q74A 1GSFA 3BD2A 2H76A 1XWAA 5AGYA 5LCZA 3C7MA 5HFGA 4V1Ag 5B6MA 4ZBBA 1X9WB 1A2MA 3ZFBA 4XTSA 4MABA 1XW5A 3W8SA 3DMLA 1O7UA 2YNXA 4GQFA 4NV2A 3GRXA 2QA2A 2DIYA 1BAYA 2C4JA 1AUCA 1W89A 3IR4A 1DBYA 4L5OA 2QSIA 3TRPA 4E68A 4ECJA 4I2TA 1WWJA 2GGTA 5D93A 1WOUA 1SENA 2GSTA 2PUKC 5D8IA 3I43A 4TR0A 4TR1B 3IK9A 4O7HA 1GTAA 5DAKA 1TU8A 1F3AA 1N8JA 1ZMAA 3D4MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GSS A;  1GSS A;  4GTU A;  1AQW A;  4KDU A;  11GS A;  3AY8 A;  1TU7 A;  6GSU A;  1EOH A;  3FYG A;  1GUM A;  5AIX A;  1GLQ A;  5F05 A;  3IBH A;  4HZ2 A;  2F8F A;  4F03 A;  5BMU A;  4FQU A;  2PER A;  7GSS A;  1OYJ A;  3GST A;  3LYP A;  2WDU A;  3ZMK A;  5J4U A;  3VPT A;  5ECM B;  1BX9 A;  3EIN A;  1M9B A;  17GS A;  4MF6 A;  2GLR A;  3N9J A;  2IMI A;  2HSM B;  4G19 A;  1F3B A;  3VLN A;  4LMW A;  5FWG A;  3TGZ A;  4NHW A;  4JZQ A;  1VF3 A;  2PVQ A;  4IW9 A;  4AGS A;  18GS A;  1V40 A;  1XWK A;  1PL2 A;  1HNC A;  1Z9H A;  1GUK A;  1GNE A;  3LJR A;  1GWC A;  1GSD A;  4J2F A;  1KBN A;  1PX7 A;  2VCQ A;  3GH6 A;  4OFM A;  4N0V A;  1ZL9 A;  1B48 A;  1PKZ A;  1EOG A;  3I6A A;  5D73 A;  4EE0 A;  1HNA A;  2C3T A;  2ON7 A;  4PX1 A;  3UAP A;  4ZB6 A;  2OA7 A;  1K0B A;  4YQM A;  2R3X A;  4MPG A;  1E6B A;  1Q4J A;  1A0F A;  4ZB9 A;  3CSI A;  4HOJ A;  4MPF A;  3BBY A;  2FHE A;  2JL4 A;  1BYE A;  4TOP A;  8GSS A;  2FNO A;  3KMO A;  1MTC A;  4IJI A;  4G9H A;  2GSR A;  4ZBA A;  2CAI A;  2PBJ A;  5ECI B;  3H1N A;  4HJ2 A;  4ECC A;  2X64 A;  3HJO A;  4Q5N A;  5JCW A;  4G0I A;  2VCV A;  3CSH A;  3QAV A;  5AIV A;  4PUA A;  1C72 A;  1JLW A;  5ECR B;  2WJU A;  4G0L A;  2C3Q A;  4WR5 A;  2R6K A;  3TOU A;  3FY7 A;  4CHS A;  4OFN A;  1TDI A;  3F63 A;  2HSM A;  4K0N A;  4K0G A;  4RI6 A;  4KF9 A;  3O76 A;  22GS A;  3KM6 A;  4KE3 A;  1DUG A;  3MDK A;  3ERG A;  5ECN B;  2YV9 A;  3EE2 A;  1LBK A;  1B8X A;  2VD0 A;  1K0M A;  4OMV A;  3FRC A;  2IL3 A;  3KMN A;  4GLT A;  4QQ7 A;  5DAL B;  5ECL B;  4EDY A;  5D9T A;  1EV9 A;  3FR3 A;  1EEM A;  3G7J A;  4YAP A;  5DCG A;  5DJM A;  1GSQ A;  4KDX A;  1GUH A;  1MD4 A;  3ISO A;  5F06 A;  4F0C A;  4KAE A;  1ZGN A;  1GTU A;  4DEJ A;  1PN9 A;  1AXD A;  1FHE A;  2N5F A;  4ACS A;  1IYH A;  10GS A;  13GS A;  1PD2 1;  1GSU A;  3IE3 A;  4BVY B;  2C3N A;  3VI5 A;  5A4V A;  5JCU A;  1GTI A;  5EY6 A;  2YV7 A;  5ECQ B;  1OE7 A;  1GSE A;  1U88 A;  4ECI A;  2OAC A;  5F8B A;  3CRU A;  4PQH A;  4E8E A;  4IVF A;  5ELG A;  2VCX A;  4IQA A;  2HNL A;  1Y6E A;  1AQV A;  1M99 A;  3QAW A;  3WD6 A;  4IS0 A;  5GZZ B;  1AW9 A;  1OE8 A;  1U3I A;  3GSS A;  3ZML A;  20GS A;  5DDL A;  1G6Y A;  3UAR A;  3KJY A;  5B7C A;  3P90 A;  5J5N A;  2DSA A;  1IYI A;  3QR6 A;  5A4U A;  1RK4 A;  1K0C A;  1HQO A;  2HSN B;  4USS A;  1YJ6 A;  2UZ8 A;  4RI7 A;  4ECB A;  6GSV A;  3HKR A;  1K0O A;  1PL1 A;  2VD1 A;  1GUL A;  2GDR A;  3L0H A;  4NAX A;  4EC0 A;  5G5F A;  4Q5F A;  2GSQ A;  3O3T A;  3I69 A;  5DAL A;  1XWG A;  4JBB A;  5A4W A;  4IEL A;  3CBU A;  3QAG A;  5D9V A;  2VCT A;  3U6V A;  4NHZ A;  1K3L A;  5HFK A;  4ZXG A;  1HNB A;  3VUR A;  5AN1 A;  3R2Q A;  1PX6 A;  5D9X A;  3P8W A;  1GTB A;  4EDZ A;  6GSY A;  2WS2 A;  2HRA A;  4YQU A;  4ZBD A;  14GS A;  4KX4 A;  1K0N A;  1YY7 A;  2HQT A;  3NIV A;  4BVY A;  2C80 A;  3DGQ A;  3SWL A;  3C8E A;  2CA8 A;  2A2R A;  2ON5 A;  1VF4 A;  3PGT A;  1U87 A;  5A5K A;  4ZB8 A;  2CZ3 A;  1K0D A;  3F6F A;  3N5O A;  4MK3 A;  6GST A;  5ELA A;  5G5E A;  1TW9 A;  2LJR A;  5KEJ A;  3WYW A;  4GCI A;  4GSS A;  4MDC A;  4MZW A;  2R4V A;  4KH7 A;  5F0G A;  9GSS A;  1PKW A;  3R3E A;  2A2S A;  3UVH A;  1F2E A;  3F6D A;  2CZ2 A;  1JLV A;  3LQ7 A;  3LYK A;  4OFT A;  1VF1 A;  1PGT A;  4L5L A;  4LMV A;  4YAV A;  4IKH A;  5GST A;  4PXO A;  1YQ1 A;  1BG5 A;  4Q5Q A;  2PMT A;  1NHY A;  3CRT A;  4JED A;  5DJL A;  4GF0 A;  4PQI A;  3IC8 A;  3UBL A;  3GTU B;  4GST A;  2AHE A;  4WR4 A;  2C8U A;  1M0U A;  2D2Z A;  3LSZ A;  1K3O A;  3VPQ A;  5IQY A;  5AIS A;  1GNW A;  5ECO B;  3LXZ A;  2GSS A;  2WB9 A;  4YQV A;  1GSY A;  5F07 A;  3UBK A;  3Q18 A;  4IQ1 A;  4E8H A;  1G6W A;  3LG6 A;  1B4P A;  3M1G A;  2YCD A;  1K0A A;  3PPU A;  1V2A A;  4BL7 B;  2VO4 A;  4PGT A;  3HJM A;  3CSJ A;  2VCZ A;  1PA3 A;  3ERF A;  2HRK A;  4Q5R A;  3VK9 A;  5EL8 A;  1LJR A;  3G7I A;  4G10 A;  3TOT A;  3MAK A;  4MF5 A;  6GSX A;  4HI7 A;  4F0B A;  19GS A;  3IK7 A;  3FR6 A;  4KSM A;  1UA5 A;  2V6K A;  4PNF A;  4ID0 A;  5ECS A;  4BVX B;  1FW1 A;  2CAQ A;  1GLP A;  5ECP B;  12GS A;  5DAK B;  5DQS A;  4MP4 A;  5FHI A;  1M9A A;  3LXT A;  4GSN A;  5D9W A;  5ECK B;  2AB6 A;  5ECH B;  16GS A;  4L8E A;  5EVO A;  1ML6 A;  1VF2 A;  4PUR A;  4O92 A;  4KDY A;  2R5G A;  3VI7 A;  3GX0 A;  1PMT A;  3FR9 A;  4HZ4 A;  1AQX A;  2F3M A;  3D0Z A;  4I97 A;  1USB A;  1MD3 A;  3M0F A;  3VWX A;  4KGI A;  1YDK A;  4YH2 A;  5FT3 A;  4EXJ A;  3GTU A;  2HRK B;  4G0K A;  2IMK A;  1OKT A;  1G7O A;  2OAD A;  3GUR A;  3Q74 A;  1GSF A;  3RBT A;  4PNG A;  1XW6 A;  5J41 A;  5AGY A;  3M8N A;  1N2A A;  5LCZ A;  4ZBB A;  3ZFB A;  6GSS A;  2J9H A;  1XW5 A;  3W8S A;  4ISD A;  4BL7 A;  2GTU A;  3GUS A;  6GSW A;  2PGT A;  1BAY A;  4IBP A;  3ZFL A;  1EV4 A;  2C4J A;  3IR4 A;  2WRT A;  4L5O A;  4IGJ A;  3Q19 A;  3KTL A;  2AAW A;  4ECJ A;  2DC5 A;  3DD3 A;  3KXO A;  3LFL A;  2GST A;  4BVX A;  3M3M A;  3PR8 A;  3IK9 A;  4O7H A;  1YKC A;  1GTA A;  1K3Y A;  1R5A A;  5DAK A;  1TU8 A;  4MF7 A;  2NTO A;  5LD0 A;  2CVD A;  1F3A A;  4PTS A;  2VCW A;  1JZR A; 
#chains in the Genus database with same CATH topology
 4KDU A;  11GS A;  3AY8 A;  2HZE A;  2DJ3 A;  2NPB A;  4POB A;  1FAA A;  2XBQ A;  4OD7 A;  3HMJ G;  4PI0 C;  5F05 A;  4OO5 A;  2GQL A;  3ZIV A;  5CO3 A;  2F8F A;  2YWN A;  4OO4 A;  4FQU A;  4PI2 C;  1ERU A;  2C1Y A;  2IIY A;  2R0G A;  1BX9 A;  2GLR A;  1FOV A;  2HLS A;  2E7P A;  2HSM B;  3VLN A;  5H5Q A;  2IMF A;  4KB3 A;  4K9Z A;  4RUV A;  4JZQ A;  1A2J A;  1V40 A;  1B9Y C;  4FIW A;  3A5W A;  1HNC A;  1ACV A;  2H19 A;  3FZ4 A;  2HRN A;  1GUK A;  4O5R A;  4TW5 A;  1DE1 A;  2DBC A;  3GH6 A;  4N0V A;  1EOG A;  5D73 A;  4EE0 A;  1HNA A;  3LWA A;  2C3T A;  1YEP A;  4F2I A;  4OCF A;  3ZRD A;  3UAP A;  2OA7 A;  1Z7R A;  1TJD A;  3NOF A;  4V2N A;  1RW1 A;  3MWH A;  1JZD A;  3ERW A;  1Q4J A;  1AIU A;  4ZB9 A;  3CSI A;  3BBY A;  2FHE A;  2JL4 A;  1SYR A;  2NVL A;  2K8S A;  3U5R E;  3KMO A;  3RAZ A;  2B5E A;  2L59 A;  1TP9 A;  1R4W A;  3CXG A;  3BJ5 A;  2VM2 A;  5KN0 A;  2PBJ A;  4ZB7 A;  2FLS A;  4HJ2 A;  2HSY A;  2FUG 2;  3D6I A;  5ECR B;  2E0Q A;  2EFE A;  1WRY A;  3L78 A;  2OT3 A;  4MH3 A;  2CVK A;  2C3Q A;  1SD8 A;  3TKR A;  4OFN A;  2HSM A;  5A1N B;  3GIX A;  5IMA A;  3HHV A;  4K0N A;  2FGX A;  4RI6 A;  22GS A;  1WP0 A;  1DUG A;  3TKS C;  3ERG A;  4P3Y B;  1SVO A;  3EE2 A;  2V41 A;  3EVI A;  4WET A;  2IL3 A;  4GLT A;  5DAL B;  5ECL B;  4G01 A;  1BED A;  1OC3 A;  1XXU A;  3FR3 A;  4WEY A;  5DCG A;  5DJM A;  3ISO A;  4KAE A;  4GRF A;  1THO A;  4ICY A;  1FHE A;  3UOM A;  3HCZ A;  4ACS A;  3H4K A;  3FK8 A;  3IE3 A;  1PSQ A;  3KH9 A;  1Q98 A;  3UEM A;  5CRW A;  5EY6 A;  2L4Q A;  5HR2 A;  1OE7 A;  3QFB C;  1OAZ A;  3KCM A;  3UJ1 A;  4PQH A;  3GKM A;  3TJB A;  5CNW A;  2H71 A;  2HNL A;  2B7J A;  5GZZ B;  3ZML A;  2DIZ A;  4HJM A;  2VKZ G;  3EMX A;  3P90 A;  2DSA A;  3VWW A;  2LRN A;  5EPF A;  4DSQ A;  5A4U A;  1ILO A;  1T4Z A;  2KUC A;  1HQO A;  4USS A;  5A1N A;  4XIH A;  2KP1 A;  6GSV A;  3VWV A;  4MZC A;  4WKW A;  5E4W A;  2VD1 A;  1XIY A;  4KND A;  2GDR A;  3RHC A;  2L5O A;  4K6X A;  5G5F A;  4N3Z A;  1EGR A;  2LJA A;  5DAL A;  1XWG A;  1O73 A;  4NHZ A;  1K3L A;  1FB6 A;  2WUL A;  4ZXG A;  5J40 A;  1HNB A;  3EUR A;  5AN1 A;  1QMV A;  3L9S A;  2WZS A;  1PX6 A;  1J0F A;  1ST9 A;  3P8W A;  4ML1 A;  4AKX B;  6GSY A;  2K18 A;  4YQU A;  4ZBD A;  1K0N A;  2HQT A;  3DGQ A;  3SWL A;  1ABA A;  3C8E A;  2A2R A;  2DKH A;  2X99 A;  2DJ2 A;  4XCS A;  4ZB8 A;  3BCI A;  4LL1 B;  2WW2 A;  3N5O A;  2XHF A;  3W6G A;  5KEJ A;  2N5B A;  1J9B A;  4CY6 A;  4GSS A;  2R4V A;  4JR6 A;  9GSS A;  2A2S A;  3A2W A;  4CY8 A;  2V32 A;  3A2X A;  2CZ2 A;  1JLV A;  1X5C A;  1A2L A;  3QMX A;  4ZL7 A;  2LQQ A;  2O36 A;  4PXO A;  1TI1 A;  1YQ1 A;  1A0R P;  1NHY A;  3CRT A;  4JED A;  5DJL A;  4QMK A;  5G30 A;  1OVN A;  1TRU A;  4PQI A;  3IC8 A;  2GVP A;  4WR4 A;  3LSZ A;  1DE2 A;  1GNW A;  5ECO B;  5IOX A;  3LXZ A;  4YQV A;  1GSY A;  3FKF A;  3EMP A;  4IQ1 A;  2KHP A;  1M2A A;  1JHB A;  3KH7 A;  4ML6 A;  1Z6M A;  3UIW A;  4BL7 B;  2I4A A;  2H72 A;  3IPZ A;  1Z3E A;  1PA3 A;  4G10 A;  3FZA A;  1AC1 A;  1XWB A;  1ZYN A;  4HI7 A;  4F0B A;  4H86 A;  3FR6 A;  3VFI A;  1F6M C;  1XOA A;  2V6K A;  4GXZ A;  1YF0 A;  3TJK A;  1FW1 A;  3TRX A;  5JWO B;  3MNG A;  4ZIL A;  3O6T A;  2H1A A;  5FHI A;  5D9W A;  3F4R A;  2H6Z A;  2OJL A;  3TRQ A;  3GV1 A;  5IIZ A;  4AJ7 A;  2H73 A;  3FEU A;  2CX3 A;  1SKW B;  2QA1 A;  1TRW A;  2C0G A;  1XVQ A;  2KOK A;  5ENU A;  1XWC A;  3CQF A;  1YDK A;  2LV3 A;  5FT3 A;  4EXJ A;  1R7H A;  3L9U A;  2OAD A;  4HUA A;  5L71 A;  1A24 A;  3H79 A;  1THX A;  5H5R A;  5BRT A;  3IV4 A;  4PNG A;  1UN2 A;  2C0D A;  2YPM A;  2EIR A;  2J9H A;  4BL7 A;  2PGT A;  3WGX A;  4IBP A;  1EV4 A;  4NWY A;  2WRT A;  4IGJ A;  2AYT A;  3KTL A;  3L9V A;  4I5Q A;  4HSC X;  2DC5 A;  2O89 A;  5C04 A;  3KXO A;  5JWQ B;  3LFL A;  4JE1 A;  5G2Z A;  2C0F A;  4MF7 A;  2LKU A;  4OWY A;  1SKR B;  1ZOF A;  4PTS A;  3GN3 A;  4EF0 A;  1GSS A;  4NMU A;  1CQH A;  2VL2 A;  1O8X A;  2DML A;  2V6O A;  5DVB A;  3FW2 A;  1GLQ A;  4DSR A;  2WVY A;  3IBH A;  4HZ2 A;  4F03 A;  7GSS A;  1OYJ A;  3LYP A;  3ZMK A;  5IPH A;  1M9B A;  2IMD A;  1O8W A;  2IMI A;  2GT5 A;  1F3B A;  3TB2 A;  2JZT A;  1V98 A;  2GZP A;  1VF3 A;  2PVQ A;  4KW6 A;  18GS A;  1XWK A;  1PL2 A;  3CYN A;  2LJK A;  4MLY A;  5KN2 A;  5IM9 A;  3GKX A;  4KSO A;  2MMO A;  4WF4 A;  1A23 A;  3TKS E;  2X8G A;  1GSD A;  2F51 A;  1KEB A;  4OFM A;  5CRG A;  1B48 A;  2E2G A;  2ON7 A;  4FYB A;  4AJ8 A;  3CHX C;  2OE1 A;  1DSB A;  4ZB6 A;  4YQM A;  5IMC A;  3WT1 A;  3C73 A;  1SK1 A;  4TOP A;  4WBR D;  8GSS A;  1YF1 A;  5LNK e;  4IJI A;  4G9H A;  1V57 A;  2GSR A;  5DBQ A;  4K7N A;  1JZO A;  3H1N A;  4ECC A;  3EU3 A;  2X64 A;  3CTG A;  4MJB A;  2JSZ A;  2EIO A;  2MMN A;  3QAV A;  4PUA A;  3ED3 A;  3A2V A;  1A8Y A;  3ZIT A;  2B1L A;  2WJU A;  5J47 A;  2R6K A;  3FY7 A;  1F9M A;  4CHS A;  2WVX B;  3DVX A;  1TDI A;  1T8E B;  3IAM 2;  4J57 E;  2L4C A;  1TXU A;  5GAP D;  1VRS D;  4OCE A;  5IPG A;  2YV9 A;  3VWU A;  1B8X A;  2VD0 A;  4OMV A;  2HFD A;  3ZZX A;  3ZL5 A;  3FRC A;  2XPD A;  4AKI A;  3KMN A;  2FWF A;  3IHQ A;  4QQ7 A;  2MMZ A;  4EDY A;  2LTK A;  4ZL8 A;  2FY6 A;  4YAP A;  2L6C A;  1NHO A;  5J4V A;  1U6T A;  4HQS A;  1R5P A;  5F06 A;  3RFR C;  1GTU A;  2I9H A;  4KUN A;  2DJJ A;  2IME A;  4N30 A;  1PD2 1;  2HE3 A;  5DCH A;  2C3N A;  1QQ2 A;  1MDK A;  1M2D A;  2G2Q A;  4K7O A;  1AAZ A;  4ECI A;  1EEJ A;  2OAC A;  4E8E A;  4IVF A;  3DXB A;  5ELG A;  5J9B A;  2WGR A;  1SD9 A;  4IQA A;  1V9W A;  2AJQ B;  4IS0 A;  1AW9 A;  3GSS A;  1TRV A;  2PVO C;  3KP8 A;  2BJX A;  2FA4 A;  1G6Y A;  1FG4 A;  3TUE A;  2OBI A;  3W8J A;  2LUS A;  1FOH A;  3D4T A;  1OC9 B;  2WVX A;  4WXT A;  2HSN B;  3APS A;  1YJ6 A;  2AV4 A;  2UZ8 A;  4RI7 A;  3IXR A;  4ECB A;  1GP1 A;  5HQP A;  3A5I A;  1ERT A;  3US3 A;  4O5U A;  3WT2 A;  4NAX A;  1M2B A;  3ZTL A;  4MZB A;  3H8Q A;  2GSQ A;  5A4W A;  3GMF A;  2VCT A;  3U6V A;  1SVL A;  3F3R A;  2DKI A;  4LL4 B;  3R2Q A;  2VLV A;  3F9U A;  4I6X A;  2GS3 A;  4YKF A;  2A4H A;  4ILF A;  2CVB A;  4G2E A;  3MYD A;  1TK5 B;  2WS2 A;  1EGO A;  1S4B P;  1FO5 A;  2F9S A;  1M7T A;  2C80 A;  4AKG A;  4QL9 A;  2ON5 A;  2TRC P;  4IP6 A;  3EWL A;  2LNS A;  4LA1 A;  3E0U A;  3HY2 A;  2B5X A;  2P31 A;  2DJK A;  1W4V A;  5ELA A;  2P0G A;  2JAC A;  1TRS A;  3GL3 A;  3R3E A;  3UMA A;  3UVH A;  2A2P A;  4MA9 A;  4FYU A;  4L0W A;  4POM A;  3KP9 A;  3LQ7 A;  1TK8 B;  4AI6 A;  1VF1 A;  1OC9 A;  1Z5Y E;  2HSN A;  5CP1 A;  2L5L A;  5A5H A;  4DSS B;  4KA0 A;  4GF0 A;  1TKD B;  2HRF A;  1MDJ A;  3GTU B;  4GST A;  2AHE A;  2H8L A;  1KTE A;  2H1B A;  5IQY A;  4V1A p;  3C1S A;  4AKH A;  1SKS B;  2WB9 A;  3UBK A;  4K5S A;  4NXI A;  3Q18 A;  4E8H A;  3IOS A;  3LG6 A;  4XS4 B;  1B4P A;  3M1G A;  2O85 A;  4HS1 A;  2M80 A;  3PPU A;  5J3R A;  1Y25 A;  4PGT A;  1H4O A;  4WF5 A;  2ZUP A;  2VCZ A;  2HRK A;  2MMA A;  2CT6 A;  3S9F A;  5JCG A;  3FZ5 A;  4AJ6 A;  3TOT A;  3MAK A;  2HZF A;  4BPY A;  2GT6 A;  3TU3 B;  1G7E A;  4PNF A;  4ID0 A;  1WJK A;  5ECS A;  4BVX B;  3GX8 A;  2CAQ A;  2YWI A;  3J7Y k;  5ECP B;  5A34 B;  2WZ9 A;  3GHA A;  5KOX A;  4TRX A;  1ZZY A;  2AB6 A;  4IP1 A;  5ECH B;  1XVW A;  1ML6 A;  2H30 A;  1VF2 A;  3EPT A;  3C71 A;  4O92 A;  3VI7 A;  3GX0 A;  3D21 A;  3D0Z A;  2OBK A;  4RQX A;  3DEX A;  4F82 A;  3ZIJ A;  1XW9 A;  1WMJ A;  3M0F A;  4DSS A;  1BJX A;  4KGI A;  2FWE A;  3GTU A;  4MJA A;  1SK2 A;  4K2D A;  4G0K A;  2IMK A;  2P5R A;  2PN8 A;  3GUR A;  1GH2 A;  3QOU A;  3RBT A;  4K8M A;  1G0T A;  3M8N A;  3HVS A;  3HDC A;  4XS4 A;  6GSS A;  3GUS A;  6GSW A;  2OE0 A;  2J23 A;  1Z6N A;  1T1V A;  3RDW A;  1UVZ A;  3D22 A;  4O32 A;  2IN3 A;  2ZCT A;  2AAW A;  3DD3 A;  2IFQ B;  1WE0 A;  3TKS A;  5CRE A;  3DVW A;  4BVX A;  3PR8 A;  2RM6 A;  2LST A;  4IN0 A;  1YKC A;  1S3A A;  1K3Y A;  1R5A A;  5A34 A;  1ZYE A;  2NTO A;  5ID2 B;  5LD0 A;  2CVD A;  4TN8 A;  4MMM A;  2RM5 A;  5CAX A;  1AQW A;  1TU7 A;  6GSU A;  4TXO B;  1EOH A;  3FYG A;  1GUM A;  3IHG A;  5AIX A;  1VGL A;  2H6X A;  3ZLP A;  3ZRE A;  4K7I A;  3PIN A;  3ME7 A;  3GST A;  4FH8 A;  2WDU A;  1SU9 A;  3VPT A;  1SJ6 A;  5ECM B;  3EIN A;  4I2U A;  3N9J A;  5FWG A;  3TGZ A;  1EP8 A;  3QPM A;  4AGS A;  1EWX A;  1HYU A;  1ON4 A;  3F3Q A;  1GNE A;  4J2F A;  1KBN A;  2VM1 A;  2L6D A;  2TIR A;  2H0G A;  1ZL9 A;  4F9Z A;  2EFC A;  1PKZ A;  2ES7 A;  3PH9 A;  5CRH A;  4L0U A;  2A4V A;  1JZW A;  2H0I A;  4EUY A;  2IFQ A;  1K0B A;  2X8H A;  2B1K A;  4MPG A;  1OKD A;  1YZX A;  2B3S A;  4KCA A;  1E6B A;  4V2L A;  4Z2U A;  2YN1 A;  1A0F A;  1M3J A;  1B4Q A;  4EKZ A;  5ID2 A;  4MPF A;  5KN3 A;  5CRD A;  2CX4 A;  2FNO A;  1MTC A;  2FWH A;  4HQZ A;  1Z7P A;  3V1W A;  2YZH A;  2CAI A;  1TXX A;  4TXO A;  5E59 A;  3HJO A;  4Q5N A;  2VIM A;  3TCO A;  4MH2 A;  4G0I A;  1T7P B;  3CSH A;  5KN1 A;  3UVT A;  3LEF A;  3C1R A;  4G0L A;  3TOU A;  3F4S A;  5INY A;  4GQC A;  5IO0 A;  1RQM A;  3I9V 2;  3APQ A;  3O76 A;  3KM6 A;  3F0I A;  4X0X A;  3MDK A;  5ECN B;  4N10 A;  2DMM A;  4ZL9 A;  1FB0 A;  1I1I P;  1K0M A;  1O81 A;  2EFD A;  1EV9 A;  4PHZ C;  4KDX A;  1GUH A;  2B5Y A;  3E3E A;  4EO3 A;  2O3E A;  4F0C A;  3L4N A;  1ZGN A;  4DEJ A;  4X1U A;  1AXD A;  4EL1 A;  2N5F A;  2R0C A;  1IYH A;  10GS A;  2PWJ A;  4BVY B;  2VL3 A;  2CV4 A;  3VI5 A;  5JCU A;  2GZZ A;  2GQK A;  2YV7 A;  2QGV A;  5ECQ B;  4HDE A;  4PQ1 A;  2H1L A;  2LRT A;  1XZO A;  5F8B A;  3CRU A;  3GL5 A;  2H70 A;  1XG8 A;  2I3Y A;  3F4T A;  3QCP A;  5IMV A;  2VCX A;  2JAD A;  2R37 A;  1AQV A;  2R0P A;  4TR3 A;  3G7Y A;  3TJJ A;  3KJY A;  5B7C A;  4JRR A;  5KOW A;  5J5N A;  1ZYQ B;  4BWQ A;  3HA9 A;  3TJF A;  5DQY A;  3J7Y b;  3P2A A;  4K1F A;  1QUW A;  1FVJ A;  1KNG A;  2LS5 A;  3GNJ A;  1ERV A;  1HD2 A;  3L0H A;  4EC0 A;  3E9J B;  1QXH A;  2OE3 A;  3I69 A;  2FWG A;  4JBB A;  3ME8 A;  2QC7 A;  1TTZ A;  3VUR A;  3LW9 A;  3KGK A;  3KD0 A;  4BIK A;  1GTB A;  4EDZ A;  2FCH A;  14GS A;  2GZY A;  4BVY A;  3CTF A;  4JU5 A;  1NM3 A;  1GL8 A;  2ZNM A;  3PGT A;  1U87 A;  5A5K A;  1K0D A;  3F6F A;  2YWM A;  4MK3 A;  4Z7X A;  6GST A;  3F8U A;  4W66 A;  5G5E A;  1TW9 A;  2XPE A;  3GH9 A;  4GCI A;  3BCK A;  4MDC A;  4KH7 A;  1PKW A;  4FO5 A;  3NZN A;  3LYK A;  4OFT A;  4K5R A;  1PGT A;  4YAV A;  4LMV A;  4IKH A;  3QDN A;  2KP2 A;  1BG5 A;  4XS6 A;  2H0H A;  1SJZ A;  5HR0 A;  4CDO A;  2PMT A;  3DWV A;  4MJC A;  2RUF A;  5G31 A;  3UBL A;  2DLX A;  2YP6 A;  1M0U A;  2LQO A;  3EYT A;  4HU9 A;  1K3O A;  3VPQ A;  2YOI A;  4XRD A;  4DVC A;  2YWO A;  1S3R A;  2HT9 A;  4FYC A;  4D73 B;  4IJ3 A;  1I9D A;  2MBS A;  1V2A A;  1T00 A;  1SYX A;  2VO4 A;  4XHM A;  2G0F A;  3HJM A;  3CSJ A;  2LEG A;  3VK9 A;  1WIK A;  1LJR A;  3G7I A;  6GSX A;  2B7K A;  1J08 A;  5G1L A;  5D96 A;  19GS A;  1UA5 A;  1BG1 A;  2H1G A;  1SL0 B;  1GLP A;  5A5H B;  3H93 A;  1M3I A;  4MP4 A;  1M9A A;  3LXT A;  4GSN A;  1A8L A;  3DYR A;  1NSW A;  3RHB A;  2O5V A;  1QK8 A;  1YKA A;  2YZU A;  1PN0 A;  4NPB A;  4L8E A;  3TDG A;  2XBI A;  2VAF A;  1FVK A;  1PMT A;  4N11 A;  3BOA A;  1U3A A;  2I1U A;  5ABR A;  4I97 A;  3VWX A;  4TR1 A;  3IAS 2;  5BMU B;  3EU4 A;  2H66 A;  4YH2 A;  1X9S B;  2HRK B;  1OKT A;  1G7O A;  3FMW A;  2HSH A;  2X49 A;  3GKK A;  3Q6O A;  3UL3 A;  2WVZ A;  2REM A;  2QKE A;  3TJG A;  4KCE A;  3FHK A;  2X8C A;  2P5Q A;  2YAN A;  2B6M A;  1XW6 A;  5J41 A;  1N2A A;  4D73 A;  2H74 A;  2H75 A;  3IRA A;  4ISD A;  2K6V A;  2GTU A;  5IO2 A;  1XFL A;  4HU7 A;  3QFA C;  3ZFL A;  1V58 A;  4Z2R A;  3Q19 A;  1MEK A;  4IHU A;  2IWT A;  1WPI A;  3DIE A;  1GRX A;  3HZ4 A;  3M3M A;  2PPT A;  1XBS A;  2EIQ A;  1TOF A;  4XS1 A;  1JZR A;  1CQG A;  5GSS A;  4GTU A;  3HVX A;  4PUF C;  5HR1 A;  2DJ0 A;  4TR4 A;  4V2M A;  2XC2 A;  4WBJ A;  4Z2T A;  1ZYP A;  2N5A A;  4J56 E;  5B8B A;  5BMU A;  2PER A;  3ZVJ D;  5J4U A;  4X4J A;  4POL A;  17GS A;  4MF6 A;  3CWG A;  4LLR A;  3MSZ A;  5CYY A;  3LOR A;  2TRX A;  4G19 A;  4LMW A;  2JZR A;  4QL7 A;  3HJP A;  4NHW A;  4IW9 A;  5J4Y A;  1Z9H A;  2MYG A;  1YEW C;  3LJR A;  1GWC A;  5IMF A;  1PX7 A;  2VCQ A;  3I6A A;  1O6J A;  2PU9 C;  1PRX A;  4PX1 A;  3KIJ A;  1SVM A;  1I5G A;  2R3X A;  1XOB A;  3ZYW A;  2I81 A;  3KEB A;  2HYX A;  5J9C A;  4MCU A;  4HOJ A;  2C0E A;  3K8N A;  2NBS A;  1X9M B;  1BYE A;  1PFO A;  4ZBA A;  3TKQ A;  1SL2 B;  1TI3 A;  4X43 A;  2O8V B;  5ECI B;  4ZIJ A;  2K8V A;  4I8B A;  3KTB A;  5B6N A;  5JCW A;  2VCV A;  3LGC A;  5AIV A;  1C72 A;  1JLW A;  3ZVJ A;  3WGE A;  4TKY A;  1EZK A;  1T4Y A;  3D5J A;  4WR5 A;  3IC4 A;  3TKP A;  3F63 A;  4K0G A;  1QGV A;  4KF9 A;  1MDI A;  3WGD A;  4KE3 A;  2HI7 A;  1LBK A;  2H1D A;  1N25 A;  5D9T A;  3HZ8 A;  1XPV A;  1EEM A;  3APO A;  3G7J A;  3GA4 A;  1GSQ A;  3M9K A;  1UC7 A;  1MD4 A;  3EC3 A;  2VL2 C;  4EIQ A;  1X5D A;  1PN9 A;  4YKG A;  13GS A;  1GSU A;  1OC8 A;  1X0R A;  4TXV A;  5A4V A;  1GTI A;  2VUP A;  2WCI A;  2YJ7 A;  5IOW A;  3MIX A;  2K9F A;  1GSE A;  3RPP A;  2LRC A;  2Z9S A;  5COH A;  2UV8 G;  1U88 A;  4A5P A;  1Y6E A;  2IJY A;  1F37 A;  1M99 A;  3QAW A;  3WD6 A;  2WFC A;  3HVV A;  5C00 A;  1SK0 A;  1OE8 A;  1U3I A;  2X4A A;  20GS A;  5DDL A;  3UAR A;  2RII A;  2JU5 A;  2VLU A;  4POK A;  2LNT A;  1IYI A;  1QFN A;  3QR6 A;  5JWR B;  1RK4 A;  4K2X A;  1K0C A;  1LU4 A;  2O7K A;  3JCM L;  4RQR A;  2JZS A;  2NDO A;  1BF5 A;  1JFU A;  1YEX A;  2H01 A;  3HKR A;  4JR4 A;  5B8A A;  3G9B A;  3CMI A;  2ALB A;  1K0O A;  1PL1 A;  4XRA A;  1Y1U A;  2VCW A;  1NW2 A;  1GUL A;  1R26 A;  2FA8 A;  4Q5F A;  3KZQ A;  3GFK A;  3O3T A;  5HFI A;  4IEL A;  3CBU A;  3QAG A;  5D9V A;  1XCC A;  5HFK A;  2JSY A;  2M46 A;  3DKS A;  1ERW A;  1ZCP A;  5D9X A;  1URM A;  4GDF A;  2BMX A;  1TK0 B;  4TVE A;  2HRA A;  2RLI A;  4KX4 A;  1YY7 A;  3NIV A;  3GYK A;  4EIP A;  4AF2 A;  5HR3 A;  1O85 A;  2CA8 A;  5IMZ A;  1PQN A;  1VF4 A;  3RPN A;  2YJH A;  2OKA A;  2CZ3 A;  2V2G A;  3HYP A;  3M9J A;  2BTO T;  4ULX A;  2V1M A;  2LJR A;  3WYW A;  5IMD A;  4MZW A;  2F8A A;  5F0G A;  1B9X C;  1F2E A;  4CW9 A;  2RUE A;  3SBC A;  3F6D A;  1S3C A;  1S3D A;  2VL9 A;  4L5L A;  4MJE A;  3HD5 A;  5GST A;  3QD9 A;  2H6Y A;  1T3B A;  1SL1 B;  4Q5Q A;  3FZ9 A;  5H5S A;  3A3T A;  2C8U A;  2IPA A;  2D2Z A;  3GKN A;  4O5Q A;  3IDV A;  1X5E A;  5AIS A;  1YVL A;  4MNN A;  2GSS A;  5F07 A;  2M72 A;  1E2Y A;  1H75 A;  2KLX A;  5G1K A;  2VOC A;  2GQM A;  1G6W A;  2YCD A;  1K0A A;  3ERF A;  4Q5R A;  5GAN D;  5EL8 A;  3RGB C;  2EFH A;  4BA7 A;  1SJI A;  4MF5 A;  2WW3 A;  2MZC A;  1EP7 A;  2DJ1 A;  2HXK A;  3IK7 A;  4KSM A;  2WW0 A;  2CQ9 A;  4NV5 A;  3HXS A;  4HEA 2;  12GS A;  5DAK B;  2EC4 A;  3DRN A;  5DQS A;  2VLT A;  3HVN A;  2MBT A;  5ECK B;  16GS A;  2WW1 A;  5EVO A;  2AUV A;  4PUR A;  2HZE B;  4KDY A;  2R5G A;  4HZ4 A;  3FR9 A;  1AQX A;  2F3M A;  1USB A;  4N0Z A;  1MD3 A;  4BWS A;  2FD3 A;  2O87 A;  4EVM A;  1BQ7 A;  2E2M A;  3P7X A;  3OR5 A;  2L57 A;  2R2J A;  4GWR A;  3IA1 A;  3Q74 A;  1GSF A;  3BD2 A;  2H76 A;  1XWA A;  5AGY A;  5LCZ A;  3C7M A;  5HFG A;  4V1A g;  5B6M A;  4ZBB A;  1X9W B;  1A2M A;  3ZFB A;  4XTS A;  4MAB A;  1XW5 A;  3W8S A;  3DML A;  1O7U A;  2YNX A;  4GQF A;  4NV2 A;  3GRX A;  2QA2 A;  2DIY A;  1BAY A;  2C4J A;  1AUC A;  1W89 A;  3IR4 A;  1DBY A;  4L5O A;  2QSI A;  3TRP A;  4E68 A;  4FXY P;  4ECJ A;  4I2T A;  1WWJ A;  2GGT A;  5D93 A;  1WOU A;  1SEN A;  2GST A;  2PUK C;  5D8I A;  3I43 A;  4TR0 A;  4TR1 B;  3IK9 A;  4O7H A;  1GTA A;  5DAK A;  1TU8 A;  1F3A A;  1N8J A;  1ZMA A;  3D4M A; 
#chains in the Genus database with same CATH homology
 4KDU A;  11GS A;  3AY8 A;  2HZE A;  2DJ3 A;  2NPB A;  4POB A;  1FAA A;  2XBQ A;  4OD7 A;  3HMJ G;  5F05 A;  4OO5 A;  2GQL A;  3ZIV A;  5CO3 A;  2F8F A;  2YWN A;  4OO4 A;  4FQU A;  1ERU A;  2C1Y A;  2IIY A;  2R0G A;  1BX9 A;  2GLR A;  1FOV A;  2HLS A;  2E7P A;  2HSM B;  3VLN A;  5H5Q A;  2IMF A;  4KB3 A;  4K9Z A;  4RUV A;  4JZQ A;  1A2J A;  1V40 A;  1B9Y C;  4FIW A;  3A5W A;  1HNC A;  1ACV A;  2H19 A;  3FZ4 A;  2HRN A;  1GUK A;  4O5R A;  4TW5 A;  1DE1 A;  2DBC A;  3GH6 A;  4N0V A;  1EOG A;  5D73 A;  4EE0 A;  1HNA A;  3LWA A;  2C3T A;  1YEP A;  4F2I A;  4OCF A;  3ZRD A;  3UAP A;  2OA7 A;  1Z7R A;  1TJD A;  3NOF A;  4V2N A;  1RW1 A;  3MWH A;  1JZD A;  3ERW A;  1Q4J A;  1AIU A;  4ZB9 A;  3CSI A;  3BBY A;  2FHE A;  2JL4 A;  1SYR A;  2NVL A;  2K8S A;  3U5R E;  3KMO A;  3RAZ A;  2B5E A;  2L59 A;  1TP9 A;  1R4W A;  3CXG A;  3BJ5 A;  2VM2 A;  5KN0 A;  2PBJ A;  4ZB7 A;  2FLS A;  4HJ2 A;  2HSY A;  2FUG 2;  3D6I A;  5ECR B;  2E0Q A;  2EFE A;  1WRY A;  3L78 A;  2OT3 A;  4MH3 A;  2CVK A;  2C3Q A;  1SD8 A;  3TKR A;  4OFN A;  2HSM A;  5A1N B;  3GIX A;  5IMA A;  3HHV A;  4K0N A;  2FGX A;  4RI6 A;  22GS A;  1WP0 A;  1DUG A;  3TKS C;  3ERG A;  4P3Y B;  1SVO A;  3EE2 A;  2V41 A;  3EVI A;  4WET A;  2IL3 A;  4GLT A;  5DAL B;  5ECL B;  4G01 A;  1BED A;  1OC3 A;  1XXU A;  3FR3 A;  4WEY A;  5DCG A;  5DJM A;  3ISO A;  4KAE A;  4GRF A;  1THO A;  4ICY A;  1FHE A;  3UOM A;  3HCZ A;  4ACS A;  3H4K A;  3FK8 A;  3IE3 A;  1PSQ A;  3KH9 A;  1Q98 A;  3UEM A;  5CRW A;  5EY6 A;  2L4Q A;  5HR2 A;  1OE7 A;  3QFB C;  1OAZ A;  3KCM A;  3UJ1 A;  4PQH A;  3GKM A;  3TJB A;  5CNW A;  2H71 A;  2HNL A;  2B7J A;  5GZZ B;  3ZML A;  2DIZ A;  4HJM A;  2VKZ G;  3EMX A;  3P90 A;  2DSA A;  3VWW A;  2LRN A;  5EPF A;  4DSQ A;  5A4U A;  1ILO A;  1T4Z A;  2KUC A;  1HQO A;  4USS A;  5A1N A;  4XIH A;  2KP1 A;  6GSV A;  3VWV A;  4MZC A;  4WKW A;  5E4W A;  2VD1 A;  1XIY A;  4KND A;  2GDR A;  3RHC A;  2L5O A;  4K6X A;  5G5F A;  4N3Z A;  1EGR A;  2LJA A;  5DAL A;  1XWG A;  1O73 A;  4NHZ A;  1K3L A;  1FB6 A;  2WUL A;  4ZXG A;  5J40 A;  1HNB A;  3EUR A;  5AN1 A;  1QMV A;  3L9S A;  1PX6 A;  1J0F A;  1ST9 A;  3P8W A;  4ML1 A;  4AKX B;  6GSY A;  2K18 A;  4YQU A;  4ZBD A;  1K0N A;  2HQT A;  3DGQ A;  3SWL A;  1ABA A;  3C8E A;  2A2R A;  2DKH A;  2X99 A;  2DJ2 A;  4XCS A;  4ZB8 A;  3BCI A;  4LL1 B;  3N5O A;  2XHF A;  3W6G A;  5KEJ A;  2N5B A;  1J9B A;  4CY6 A;  4GSS A;  2R4V A;  4JR6 A;  9GSS A;  2A2S A;  3A2W A;  4CY8 A;  2V32 A;  3A2X A;  2CZ2 A;  1JLV A;  1X5C A;  1A2L A;  3QMX A;  4ZL7 A;  2LQQ A;  4PXO A;  1TI1 A;  1YQ1 A;  1A0R P;  1NHY A;  3CRT A;  4JED A;  5DJL A;  4QMK A;  5G30 A;  1OVN A;  1TRU A;  4PQI A;  3IC8 A;  2GVP A;  4WR4 A;  3LSZ A;  1DE2 A;  1GNW A;  5ECO B;  5IOX A;  3LXZ A;  4YQV A;  1GSY A;  3FKF A;  3EMP A;  4IQ1 A;  2KHP A;  1M2A A;  1JHB A;  3KH7 A;  4ML6 A;  1Z6M A;  3UIW A;  4BL7 B;  2I4A A;  2H72 A;  3IPZ A;  1Z3E A;  1PA3 A;  4G10 A;  1AC1 A;  3FZA A;  1XWB A;  1ZYN A;  4HI7 A;  4F0B A;  4H86 A;  3FR6 A;  3VFI A;  1F6M C;  1XOA A;  2V6K A;  4GXZ A;  1YF0 A;  3TJK A;  1FW1 A;  3TRX A;  5JWO B;  3MNG A;  4ZIL A;  3O6T A;  2H1A A;  5FHI A;  5D9W A;  3F4R A;  2H6Z A;  2OJL A;  3TRQ A;  3GV1 A;  5IIZ A;  4AJ7 A;  2H73 A;  3FEU A;  2CX3 A;  1SKW B;  2QA1 A;  1TRW A;  2C0G A;  1XVQ A;  2KOK A;  5ENU A;  1XWC A;  1YDK A;  2LV3 A;  5FT3 A;  4EXJ A;  1R7H A;  3L9U A;  2OAD A;  4HUA A;  5L71 A;  1A24 A;  3H79 A;  1THX A;  5H5R A;  5BRT A;  3IV4 A;  4PNG A;  1UN2 A;  2C0D A;  2YPM A;  2EIR A;  2J9H A;  4BL7 A;  2PGT A;  3WGX A;  4IBP A;  1EV4 A;  4NWY A;  2WRT A;  4IGJ A;  2AYT A;  3KTL A;  3L9V A;  4I5Q A;  2DC5 A;  2O89 A;  5C04 A;  3KXO A;  5JWQ B;  3LFL A;  4JE1 A;  5G2Z A;  2C0F A;  4MF7 A;  2LKU A;  4OWY A;  1SKR B;  1ZOF A;  4PTS A;  3GN3 A;  4EF0 A;  1GSS A;  4NMU A;  1CQH A;  2VL2 A;  1O8X A;  2DML A;  2V6O A;  5DVB A;  3FW2 A;  1GLQ A;  4DSR A;  3IBH A;  4HZ2 A;  4F03 A;  7GSS A;  1OYJ A;  3LYP A;  3ZMK A;  5IPH A;  1M9B A;  2IMD A;  1O8W A;  2IMI A;  2GT5 A;  1F3B A;  3TB2 A;  2JZT A;  1V98 A;  2GZP A;  1VF3 A;  2PVQ A;  4KW6 A;  18GS A;  1XWK A;  1PL2 A;  3CYN A;  2LJK A;  4MLY A;  5KN2 A;  5IM9 A;  3GKX A;  4KSO A;  2MMO A;  4WF4 A;  1A23 A;  3TKS E;  2X8G A;  1GSD A;  2F51 A;  1KEB A;  4OFM A;  5CRG A;  1B48 A;  2E2G A;  2ON7 A;  4FYB A;  4AJ8 A;  2OE1 A;  1DSB A;  4ZB6 A;  4YQM A;  5IMC A;  3WT1 A;  3C73 A;  1SK1 A;  4TOP A;  4WBR D;  8GSS A;  1YF1 A;  5LNK e;  4IJI A;  4G9H A;  1V57 A;  2GSR A;  5DBQ A;  4K7N A;  1JZO A;  3H1N A;  4ECC A;  3EU3 A;  2X64 A;  3CTG A;  4MJB A;  2JSZ A;  2EIO A;  2MMN A;  3QAV A;  4PUA A;  3ED3 A;  3A2V A;  1A8Y A;  3ZIT A;  2B1L A;  2WJU A;  5J47 A;  2R6K A;  3FY7 A;  1F9M A;  4CHS A;  3DVX A;  1TDI A;  1T8E B;  3IAM 2;  4J57 E;  2L4C A;  1TXU A;  5GAP D;  1VRS D;  4OCE A;  5IPG A;  2YV9 A;  3VWU A;  1B8X A;  2VD0 A;  4OMV A;  2HFD A;  3ZZX A;  3ZL5 A;  3FRC A;  2XPD A;  4AKI A;  3KMN A;  2FWF A;  3IHQ A;  4QQ7 A;  2MMZ A;  4EDY A;  2LTK A;  4ZL8 A;  2FY6 A;  4YAP A;  2L6C A;  1NHO A;  5J4V A;  1U6T A;  4HQS A;  1R5P A;  5F06 A;  1GTU A;  2I9H A;  4KUN A;  2DJJ A;  2IME A;  4N30 A;  1PD2 1;  2HE3 A;  5DCH A;  2C3N A;  1QQ2 A;  1MDK A;  1M2D A;  2G2Q A;  4K7O A;  1AAZ A;  4ECI A;  1EEJ A;  2OAC A;  4E8E A;  4IVF A;  3DXB A;  5ELG A;  5J9B A;  2WGR A;  1SD9 A;  4IQA A;  1V9W A;  2AJQ B;  4IS0 A;  1AW9 A;  3GSS A;  1TRV A;  3KP8 A;  2PVO C;  2BJX A;  2FA4 A;  1G6Y A;  1FG4 A;  3TUE A;  2OBI A;  3W8J A;  2LUS A;  1FOH A;  3D4T A;  1OC9 B;  4WXT A;  2HSN B;  3APS A;  1YJ6 A;  2AV4 A;  2UZ8 A;  4RI7 A;  3IXR A;  4ECB A;  1GP1 A;  5HQP A;  3A5I A;  1ERT A;  3US3 A;  4O5U A;  3WT2 A;  4NAX A;  1M2B A;  3ZTL A;  4MZB A;  3H8Q A;  2GSQ A;  5A4W A;  3GMF A;  2VCT A;  3U6V A;  1SVL A;  3F3R A;  2DKI A;  4LL4 B;  3R2Q A;  2VLV A;  3F9U A;  4I6X A;  2GS3 A;  4YKF A;  2A4H A;  4ILF A;  2CVB A;  4G2E A;  3MYD A;  1TK5 B;  2WS2 A;  1EGO A;  1FO5 A;  2F9S A;  1M7T A;  2C80 A;  4AKG A;  4QL9 A;  2ON5 A;  2TRC P;  4IP6 A;  3EWL A;  2LNS A;  4LA1 A;  3E0U A;  3HY2 A;  2B5X A;  2P31 A;  2DJK A;  1W4V A;  5ELA A;  2P0G A;  2JAC A;  1TRS A;  3GL3 A;  3R3E A;  3UMA A;  3UVH A;  2A2P A;  4MA9 A;  4FYU A;  4L0W A;  4POM A;  3KP9 A;  3LQ7 A;  1TK8 B;  4AI6 A;  1VF1 A;  1OC9 A;  1Z5Y E;  2HSN A;  5CP1 A;  2L5L A;  5A5H A;  4DSS B;  4KA0 A;  4GF0 A;  1TKD B;  2HRF A;  1MDJ A;  3GTU B;  4GST A;  2AHE A;  2H8L A;  1KTE A;  2H1B A;  5IQY A;  4V1A p;  3C1S A;  4AKH A;  1SKS B;  2WB9 A;  3UBK A;  4K5S A;  4NXI A;  3Q18 A;  4E8H A;  3IOS A;  3LG6 A;  4XS4 B;  1B4P A;  3M1G A;  2O85 A;  4HS1 A;  2M80 A;  3PPU A;  5J3R A;  1Y25 A;  4PGT A;  1H4O A;  4WF5 A;  2ZUP A;  2VCZ A;  2HRK A;  2MMA A;  2CT6 A;  3S9F A;  5JCG A;  3FZ5 A;  4AJ6 A;  3TOT A;  3MAK A;  2HZF A;  4BPY A;  2GT6 A;  3TU3 B;  1G7E A;  4PNF A;  4ID0 A;  1WJK A;  5ECS A;  4BVX B;  3GX8 A;  2CAQ A;  2YWI A;  3J7Y k;  5ECP B;  5A34 B;  2WZ9 A;  3GHA A;  5KOX A;  4TRX A;  1ZZY A;  2AB6 A;  4IP1 A;  5ECH B;  1XVW A;  1ML6 A;  2H30 A;  1VF2 A;  3EPT A;  3C71 A;  4O92 A;  3VI7 A;  3GX0 A;  3D21 A;  3D0Z A;  2OBK A;  4RQX A;  3DEX A;  4F82 A;  3ZIJ A;  1XW9 A;  1WMJ A;  3M0F A;  4DSS A;  1BJX A;  4KGI A;  2FWE A;  3GTU A;  4MJA A;  1SK2 A;  4K2D A;  4G0K A;  2IMK A;  2P5R A;  2PN8 A;  3GUR A;  1GH2 A;  3QOU A;  3RBT A;  4K8M A;  1G0T A;  3M8N A;  3HVS A;  3HDC A;  4XS4 A;  6GSS A;  3GUS A;  6GSW A;  2OE0 A;  2J23 A;  1Z6N A;  1T1V A;  3RDW A;  1UVZ A;  3D22 A;  4O32 A;  2IN3 A;  2ZCT A;  2AAW A;  3DD3 A;  2IFQ B;  1WE0 A;  3TKS A;  5CRE A;  3DVW A;  4BVX A;  3PR8 A;  2RM6 A;  2LST A;  4IN0 A;  1YKC A;  1S3A A;  1K3Y A;  1R5A A;  5A34 A;  1ZYE A;  2NTO A;  5ID2 B;  5LD0 A;  2CVD A;  4TN8 A;  4MMM A;  2RM5 A;  5CAX A;  1AQW A;  1TU7 A;  6GSU A;  4TXO B;  1EOH A;  3FYG A;  1GUM A;  3IHG A;  5AIX A;  1VGL A;  2H6X A;  3ZLP A;  3ZRE A;  4K7I A;  3PIN A;  3ME7 A;  3GST A;  4FH8 A;  2WDU A;  1SU9 A;  3VPT A;  1SJ6 A;  5ECM B;  3EIN A;  4I2U A;  3N9J A;  5FWG A;  3TGZ A;  1EP8 A;  3QPM A;  4AGS A;  1EWX A;  1HYU A;  1ON4 A;  3F3Q A;  1GNE A;  4J2F A;  1KBN A;  2VM1 A;  2L6D A;  2TIR A;  2H0G A;  1ZL9 A;  4F9Z A;  2EFC A;  1PKZ A;  2ES7 A;  3PH9 A;  5CRH A;  4L0U A;  2A4V A;  1JZW A;  2H0I A;  4EUY A;  2IFQ A;  1K0B A;  2X8H A;  2B1K A;  4MPG A;  1OKD A;  1YZX A;  2B3S A;  4KCA A;  1E6B A;  4V2L A;  4Z2U A;  2YN1 A;  1A0F A;  1B4Q A;  4EKZ A;  5ID2 A;  4MPF A;  5KN3 A;  5CRD A;  2CX4 A;  2FNO A;  1MTC A;  2FWH A;  4HQZ A;  1Z7P A;  3V1W A;  2YZH A;  2CAI A;  1TXX A;  4TXO A;  5E59 A;  3HJO A;  4Q5N A;  2VIM A;  3TCO A;  4MH2 A;  4G0I A;  1T7P B;  3CSH A;  5KN1 A;  3UVT A;  3LEF A;  3C1R A;  4G0L A;  3TOU A;  3F4S A;  5INY A;  4GQC A;  5IO0 A;  1RQM A;  3I9V 2;  3APQ A;  3O76 A;  3KM6 A;  3F0I A;  4X0X A;  3MDK A;  5ECN B;  4N10 A;  2DMM A;  4ZL9 A;  1FB0 A;  1K0M A;  1O81 A;  2EFD A;  1EV9 A;  4KDX A;  1GUH A;  2B5Y A;  3E3E A;  4EO3 A;  4F0C A;  3L4N A;  1ZGN A;  4DEJ A;  4X1U A;  1AXD A;  4EL1 A;  2N5F A;  2R0C A;  1IYH A;  10GS A;  2PWJ A;  4BVY B;  2VL3 A;  2CV4 A;  3VI5 A;  5JCU A;  2GZZ A;  2GQK A;  2YV7 A;  2QGV A;  5ECQ B;  4HDE A;  4PQ1 A;  2H1L A;  2LRT A;  1XZO A;  5F8B A;  3CRU A;  3GL5 A;  2H70 A;  2I3Y A;  3F4T A;  3QCP A;  5IMV A;  2VCX A;  2JAD A;  2R37 A;  1AQV A;  2R0P A;  4TR3 A;  3G7Y A;  3TJJ A;  3KJY A;  5B7C A;  4JRR A;  5KOW A;  5J5N A;  1ZYQ B;  4BWQ A;  3HA9 A;  3TJF A;  5DQY A;  3J7Y b;  3P2A A;  4K1F A;  1QUW A;  1FVJ A;  1KNG A;  2LS5 A;  3GNJ A;  1ERV A;  1HD2 A;  3L0H A;  4EC0 A;  3E9J B;  1QXH A;  2OE3 A;  3I69 A;  2FWG A;  4JBB A;  3ME8 A;  2QC7 A;  1TTZ A;  3VUR A;  3LW9 A;  3KGK A;  3KD0 A;  1GTB A;  4EDZ A;  2FCH A;  14GS A;  2GZY A;  4BVY A;  3CTF A;  4JU5 A;  1NM3 A;  1GL8 A;  2ZNM A;  3PGT A;  1U87 A;  5A5K A;  1K0D A;  3F6F A;  2YWM A;  4MK3 A;  4Z7X A;  6GST A;  3F8U A;  4W66 A;  5G5E A;  1TW9 A;  2XPE A;  3GH9 A;  4GCI A;  3BCK A;  4MDC A;  4KH7 A;  1PKW A;  4FO5 A;  3NZN A;  3LYK A;  4OFT A;  4K5R A;  1PGT A;  4YAV A;  4LMV A;  4IKH A;  3QDN A;  2KP2 A;  1BG5 A;  4XS6 A;  2H0H A;  1SJZ A;  5HR0 A;  4CDO A;  2PMT A;  3DWV A;  4MJC A;  2RUF A;  5G31 A;  3UBL A;  2DLX A;  2YP6 A;  1M0U A;  2LQO A;  3EYT A;  4HU9 A;  1K3O A;  3VPQ A;  2YOI A;  4XRD A;  4DVC A;  2YWO A;  2HT9 A;  4FYC A;  4D73 B;  4IJ3 A;  1I9D A;  2MBS A;  1V2A A;  1T00 A;  1SYX A;  2VO4 A;  4XHM A;  2G0F A;  3HJM A;  3CSJ A;  2LEG A;  3VK9 A;  1WIK A;  1LJR A;  3G7I A;  6GSX A;  2B7K A;  1J08 A;  5G1L A;  5D96 A;  19GS A;  1UA5 A;  1BG1 A;  2H1G A;  1SL0 B;  1GLP A;  5A5H B;  3H93 A;  4MP4 A;  1M9A A;  3LXT A;  4GSN A;  1A8L A;  3DYR A;  1NSW A;  3RHB A;  2O5V A;  1QK8 A;  1YKA A;  2YZU A;  1PN0 A;  4NPB A;  4L8E A;  3TDG A;  2XBI A;  2VAF A;  1FVK A;  1PMT A;  4N11 A;  3BOA A;  1U3A A;  2I1U A;  5ABR A;  4I97 A;  3VWX A;  4TR1 A;  3IAS 2;  5BMU B;  3EU4 A;  2H66 A;  4YH2 A;  1X9S B;  2HRK B;  1OKT A;  1G7O A;  3FMW A;  2HSH A;  2X49 A;  3GKK A;  3Q6O A;  3UL3 A;  2REM A;  2QKE A;  3TJG A;  4KCE A;  3FHK A;  2X8C A;  2P5Q A;  2YAN A;  2B6M A;  1XW6 A;  5J41 A;  1N2A A;  4D73 A;  2H74 A;  2H75 A;  3IRA A;  4ISD A;  2K6V A;  2GTU A;  5IO2 A;  1XFL A;  4HU7 A;  3QFA C;  3ZFL A;  1V58 A;  4Z2R A;  3Q19 A;  1MEK A;  4IHU A;  2IWT A;  1WPI A;  3DIE A;  1GRX A;  3HZ4 A;  3M3M A;  2PPT A;  1XBS A;  2EIQ A;  1TOF A;  4XS1 A;  1JZR A;  1CQG A;  5GSS A;  4GTU A;  3HVX A;  4PUF C;  5HR1 A;  2DJ0 A;  4TR4 A;  4V2M A;  2XC2 A;  4WBJ A;  4Z2T A;  1ZYP A;  2N5A A;  4J56 E;  5B8B A;  5BMU A;  2PER A;  3ZVJ D;  5J4U A;  4X4J A;  4POL A;  17GS A;  4MF6 A;  3CWG A;  4LLR A;  3MSZ A;  5CYY A;  3LOR A;  2TRX A;  4G19 A;  4LMW A;  2JZR A;  4QL7 A;  3HJP A;  4NHW A;  4IW9 A;  5J4Y A;  1Z9H A;  2MYG A;  3LJR A;  1GWC A;  5IMF A;  1PX7 A;  2VCQ A;  3I6A A;  1O6J A;  2PU9 C;  1PRX A;  4PX1 A;  3KIJ A;  1SVM A;  1I5G A;  2R3X A;  1XOB A;  3ZYW A;  2I81 A;  3KEB A;  2HYX A;  5J9C A;  4MCU A;  4HOJ A;  2C0E A;  3K8N A;  2NBS A;  1X9M B;  1BYE A;  4ZBA A;  3TKQ A;  1SL2 B;  1TI3 A;  4X43 A;  2O8V B;  5ECI B;  4ZIJ A;  2K8V A;  4I8B A;  3KTB A;  5B6N A;  5JCW A;  2VCV A;  3LGC A;  5AIV A;  1C72 A;  1JLW A;  3ZVJ A;  3WGE A;  4TKY A;  1EZK A;  1T4Y A;  3D5J A;  4WR5 A;  3IC4 A;  3TKP A;  3F63 A;  4K0G A;  1QGV A;  4KF9 A;  1MDI A;  3WGD A;  4KE3 A;  2HI7 A;  1LBK A;  2H1D A;  1N25 A;  5D9T A;  3HZ8 A;  1XPV A;  1EEM A;  3APO A;  3G7J A;  3GA4 A;  1GSQ A;  3M9K A;  1UC7 A;  1MD4 A;  3EC3 A;  2VL2 C;  4EIQ A;  1X5D A;  1PN9 A;  4YKG A;  13GS A;  1GSU A;  1OC8 A;  1X0R A;  4TXV A;  5A4V A;  1GTI A;  2VUP A;  2WCI A;  2YJ7 A;  5IOW A;  3MIX A;  2K9F A;  1GSE A;  3RPP A;  2LRC A;  2Z9S A;  5COH A;  2UV8 G;  1U88 A;  4A5P A;  1Y6E A;  2IJY A;  1F37 A;  1M99 A;  3QAW A;  3WD6 A;  2WFC A;  3HVV A;  5C00 A;  1SK0 A;  1OE8 A;  1U3I A;  2X4A A;  20GS A;  5DDL A;  3UAR A;  2RII A;  2JU5 A;  2VLU A;  4POK A;  2LNT A;  1IYI A;  1QFN A;  3QR6 A;  5JWR B;  1RK4 A;  4K2X A;  1K0C A;  1LU4 A;  2O7K A;  3JCM L;  4RQR A;  2JZS A;  2NDO A;  1BF5 A;  1JFU A;  1YEX A;  2H01 A;  3HKR A;  4JR4 A;  5B8A A;  3G9B A;  3CMI A;  2ALB A;  1K0O A;  1PL1 A;  4XRA A;  1Y1U A;  2VCW A;  1NW2 A;  1GUL A;  1R26 A;  2FA8 A;  4Q5F A;  3KZQ A;  3GFK A;  3O3T A;  5HFI A;  4IEL A;  3CBU A;  3QAG A;  5D9V A;  1XCC A;  5HFK A;  2JSY A;  2M46 A;  3DKS A;  1ERW A;  1ZCP A;  5D9X A;  1URM A;  4GDF A;  2BMX A;  1TK0 B;  4TVE A;  2HRA A;  2RLI A;  4KX4 A;  1YY7 A;  3NIV A;  3GYK A;  4EIP A;  4AF2 A;  5HR3 A;  1O85 A;  2CA8 A;  5IMZ A;  1PQN A;  1VF4 A;  3RPN A;  2YJH A;  2OKA A;  2CZ3 A;  2V2G A;  3HYP A;  3M9J A;  2BTO T;  4ULX A;  2V1M A;  2LJR A;  3WYW A;  5IMD A;  4MZW A;  2F8A A;  5F0G A;  1B9X C;  1F2E A;  4CW9 A;  2RUE A;  3SBC A;  3F6D A;  1S3C A;  1S3D A;  2VL9 A;  4L5L A;  4MJE A;  3HD5 A;  5GST A;  3QD9 A;  2H6Y A;  1T3B A;  1SL1 B;  4Q5Q A;  3FZ9 A;  5H5S A;  3A3T A;  2C8U A;  2IPA A;  2D2Z A;  3GKN A;  4O5Q A;  3IDV A;  1X5E A;  5AIS A;  1YVL A;  4MNN A;  2GSS A;  5F07 A;  2M72 A;  1E2Y A;  1H75 A;  2KLX A;  5G1K A;  2VOC A;  2GQM A;  1G6W A;  2YCD A;  1K0A A;  3ERF A;  4Q5R A;  5GAN D;  5EL8 A;  4BA7 A;  2EFH A;  1SJI A;  4MF5 A;  2MZC A;  1EP7 A;  2DJ1 A;  2HXK A;  3IK7 A;  4KSM A;  2CQ9 A;  4NV5 A;  3HXS A;  4HEA 2;  12GS A;  5DAK B;  2EC4 A;  3DRN A;  5DQS A;  2VLT A;  2MBT A;  5ECK B;  16GS A;  5EVO A;  2AUV A;  4PUR A;  2HZE B;  4KDY A;  2R5G A;  4HZ4 A;  3FR9 A;  1AQX A;  2F3M A;  1USB A;  4N0Z A;  1MD3 A;  4BWS A;  2FD3 A;  2O87 A;  4EVM A;  1BQ7 A;  2E2M A;  3P7X A;  3OR5 A;  2L57 A;  2R2J A;  4GWR A;  3IA1 A;  3Q74 A;  1GSF A;  3BD2 A;  2H76 A;  1XWA A;  5AGY A;  5LCZ A;  3C7M A;  5HFG A;  4V1A g;  5B6M A;  4ZBB A;  1X9W B;  1A2M A;  3ZFB A;  4XTS A;  4MAB A;  1XW5 A;  3W8S A;  3DML A;  1O7U A;  2YNX A;  4GQF A;  4NV2 A;  3GRX A;  2QA2 A;  2DIY A;  1BAY A;  2C4J A;  1AUC A;  1W89 A;  3IR4 A;  1DBY A;  4L5O A;  2QSI A;  3TRP A;  4E68 A;  4ECJ A;  4I2T A;  1WWJ A;  2GGT A;  5D93 A;  1WOU A;  1SEN A;  2GST A;  2PUK C;  5D8I A;  3I43 A;  4TR0 A;  4TR1 B;  3IK9 A;  4O7H A;  1GTA A;  5DAK A;  1TU8 A;  1F3A A;  1N8J A;  1ZMA A;  3D4M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...