4PHZC

Crystal structure of particulate methane monooxygenase from methylocystis sp. atcc 49242 (rockwell)
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
241
structure length
214
Chain Sequence
ESVVDLRGMWIGLVLLNVFYLIVRIYEQVFGWRAGLDSFAPEFQTYWMSILWTEIPLELVSGLGLAGYLWKTRDRNVDAVTPREEMRRLVVLVQWLVVYGIAIYWGASFFTEQDGTWHMTVIRDTDFTPSHIIEFYMSYPIYSVIAVGAFFYAKTRIPYFAHGYSLAFLIVAIGPFMIIPNVGWMALGVFGVVLQILMRIHALVGKEGVKLLTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords unknown peptide
publication title Effects of zinc on particulate methane monooxygenase activity and structure.
pubmed doi rcsb
total genus 76
structure length 214
sequence length 241
chains with identical sequence G, K
ec nomenclature ec 1.14.18.3: Methane monooxygenase (particulate).
pdb deposition date 2014-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.50 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Particulate methane monooxygenase subunit c2. Chain: C 4phzC00
3RGBC 4PHZC 3CHXC 1YEWC 3RFRC 4PI0C 4PI2C
chains in the Genus database with same CATH superfamily
4IJIA 4YAVA 3WYWA 3BBYA 4NHWA 4GSSA 2HQTA 1BF5A 2AB6A 4WR5A 4FQUA 3LXZA 2WW3A 3VI7A 3LXTA 3CWGA 3MAKA 5ECQB 4EXJA 6GSXA 2GSSA 3VK9A 4F0CA 3Q19A 2VCWA 1F3AA 19GSA 4PURA 1MD4A 1SVMA 1F2EA 2HSMB 2PBJA 5ECLB 3FY7A 1BYEA 3MDKA 4GDFA 3QR6A 4JEDA 4I97A 4EDZA 2GSTA 3GH6A 4IW9A 1PGTA 2VCQA 2N5FA 3KMNA 2VCXA 3AY8A 5J5NA 5LD0A 4TOPA 1EOHA 4GCIA 4KX4A 4NAXA 5ELGA 1K0NA 3KTLA 5D9VA 4MP4A 2WJUA 4ECBA 2PERA 4G10A 1YY7A 2C3QA 4AKHA 1RK4A 1V40A 1PMTA 3KJYA 5D9XA 4DEJA 4BVXA 3M0FA 2VD1A 3QAVA 5A5KA 4GSNA 3CSHA 5IQYA 4HI7A 4HOJA 1E6BA 2F8FA 2WZSA 1KBNA 4QMKA 4IS0A 2AAWA 4PI0C 3HJOA 2A2RA 2HSNB 2WVXA 2AHEA 2C3TA 1HNBA 3UAPA 9GSSA 2GSRA 1GUMA 4J2FA 3GX0A 2FNOA 1PL1A 3M1GA 1HNCA 2A2SA 2VCTA 1LJRA 4IVFA 2UV8G 2VCZA 3UARA 1HQOA 1K0OA 4KE3A 2CAIA 3LYKA 1U3IA 3ISOA 4RI7A 4W66A 5J47A 3GTUB 1U87A 14GSA 4GTUA 2J9HA 3ZMKA 3H1NA 5A4VA 3L0HA 3RBTA 1GUKA 3ZFBA 4WR4A 1PKWA 3TU3B 2ON7A 4L5OA 1Y6EA 4JBBA 4MZWA 4F03A 4MPFA 3Q18A 3FRCA 1VF1A 4MPGA 2X64A 1SVOA 1XW5A 4PX1A 1BG5A 5A1NA 1GTBA 3PGTA 1K0DA 4G0IA 2DSAA 5ECNB 6GSWA 1AQVA 4BVYB 1IYHA 4BL7B 1B48A 1V2AA 5LCZA 2R6KA 1F3BA 5AGYA 22GSA 2HRAA 4Q5FA 1MD3A 4AGSA 4N3ZA 1K0MA 5DCGA 3TOUA 5G5FA 6GSUA 4ZB6A 1S4BP 2JL4A 1GLPA 5DAKB 1K3OA 1PA3A 4L8EA 6GSSA 4CHSA 3UBLA 2YV9A 5GZZB 1G6WA 4ECJA 3LSZA 4G0LA 3VURA 2NTOA 8GSSA 3LQ7A 3UVHA 1EV4A 5ECIB 1USBA 3G7IA 2EFHA 2F3MA 4G19A 2PVQA 2CZ3A 5EL8A 3W8SA 3Q74A 1GLQA 2GLRA 4ID0A 2IMIA 3WD6A 5BMUA 3R2QA 4ZB8A 1VF3A 3KMOA 3KM6A 3O3TA 5ECOB 2VO4A 3FR3A 1M9BA 1YEWC 4LMWA 1YKCA 1GTUA 5A34A 4KH7A 4F0BA 5D9WA 1GULA 5FWGA 5F05A 4ZBDA 2WS2A 3U6VA 3CRUA 4YAPA 2WW2A 2HRKB 5A1NB 1PKZA 1TU8A 1GSQA 1XW6A 3VWXA 5AISA 4O92A 3IR4A 3HMJG 4ECIA 5ECMB 2OADA 4KGIA 5HFKA 5JCUA 4G9HA 1VF2A 1N25A 4EE0A 5J4YA 1G6YA 5F07A 5ECSA 3F63A 2EFEA 2LJRA 2IL3A 3IE3A 1GWCA 2EFCA 2OT3A 2VD0A 4ISDA 5DALA 5A4UA 4EC0A 5J4VA 5AIXA 1MTCA 5A4WA 4G0KA 3ERFA 1GTAA 2ON5A 4OFTA 4Q5QA 6GSYA 5AN1A 3FR6A 4GLTA 4ZBBA 1K0CA 4GF0A 1K3LA 3N9JA 3TGZA 5F0GA 4FXYP 4G01A 6GSTA 2CZ2A 1C72A 1GSUA 20GSA 1PN9A 16GSA 3M8NA 18GSA 2O3EA 4E8HA 1GSSA 5A34B 1M0UA 4AKXB 3R3EA 2DC5A 2C4JA 1GNWA 5A5HA 3HJMA 4ZB9A 1OE7A 2IMKA 3IBHA 4MF5A 1YVLA 4IQ1A 4KF9A 4QQ7A 2R3XA 5FT3A 1ML6A 17GSA 2VCVA 2WRTA 1JLVA 2WB9A 1XWKA 5ECKB 4BVXB 1ZGNA 1N2AA 1G7OA 4PNGA 1PX6A 4USSA 4EDYA 1JLWA 5D73A 2HSMA 1U88A 3FYGA 1B8XA 13GSA 4PHZC 1EOGA 5B7CA 5J41A 3CRTA 3VPQA 2WDUA 4NHZA 2FHEA 2WVXB 3GSTA 3RGBC 1TU7A 1AQWA 4MF6A 4MK3A 1K0BA 1M99A 1HNAA 1SVLA 5EVOA 3VI5A 1NHYA 4PQIA 5DJMA 4O7HA 5JCWA 5ECPB 3UBKA 2WW1A 3DD3A 4HJ2A 4KDYA 5D9TA 4K0NA 3ZFLA 2O5VA 2D2ZA 2CVDA 3EE2A 1I1IP 4IBPA 1GTIA 3N5OA 5J40A 1K0AA 1EEMA 2YCDA 4IQAA 1FW1A 4ZB7A 3PPUA 4L5LA 1GSDA 3KXOA 2HSNA 1YQ1A 1TXUA 2C8UA 2PGTA 3VPTA 2YV7A 3I69A 5ECHB 5GSSA 4PI2C 5J4UA 3P90A 2CA8A 2OA7A 4KDXA 3LJRA 4OFMA 2WVYA 4PTSA 3NIVA 3CSIA 3GURA 3GTUA 5F06A 3DGQA 3I6AA 4K0GA 3QAWA 5F8BA 3P8WA 4E68A 3GUSA 4ZBAA 3PR8A 1Y1UA 1YJ6A 1AW9A 1OYJA 1Z9HA 2EFDA 2PMTA 7GSSA 4AKIA 1EV9A 2C3NA 1OKTA 1PD21 1PX7A 4HZ4A 6GSVA 1LBKA 2H1LA 1UA5A 3G7JA 3IK9A 4OFNA 3IC8A 4Q5NA 1BX9A 3F6DA 3ERGA 1A0FA 1TDIA 1TW9A 3C8EA 12GSA 2C80A 2O36A 4BVYA 5BMUB 4BL7A 1VF4A 4IGJA 2WVZA 4ACSA 3CHXC 5FHIA 2WW0A 4HZ2A 4KDUA 5ECRB 3LG6A 4KAEA 5DAKA 3EINA 1JZRA 3SWLA 2R5GA 1B4PA 4ECCA 4PXOA 3GSSA 3LYPA 5AIVA 3VLNA 4AKGA 1ZL9A 1PL2A 3M3MA 1GUHA 11GSA 3F6FA 4GSTA 5DQSA 2OACA 1Q4JA 1R5AA 1YDKA 4N0VA 5DJLA 1K3YA 1XWGA 5GSTA 1GSYA 5G5EA 1BG1A 3D0ZA 5DALB 3O76A 2GDRA 2HNLA 1GSFA 4E8EA 3QAGA 4YQVA 2GTUA 5ELAA 3ZMLA 2R4VA 1AQXA 3HKRA 5DDLA 2VKZG 2HRKA 10GSA 1AXDA 4LMVA 4PNFA 1DUGA 3LFLA 4YQUA 3RFRC 4KSMA 1OE8A 1GSEA 4JZQA 4AI6A 4PQHA 4MDCA 4RI6A 4MF7A 2GSQA 4IKHA 3IK7A 3FR9A 2UZ8A 1BAYA 4OMVA 4IELA 3TOTA 4PGTA 1GNEA 4PUAA 5KEJA 4ZXGA 1M9AA 5A5HB 4YQMA 1IYIA 2CAQA 2V6KA 3CSJA 3CBUA 4YH2A 4Q5RA 1FHEA 5EY6A
chains in the Genus database with same CATH topology
3RGBC 4PHZC 3CHXC 1YEWC 3RFRC 4PI0C 4PI2C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RGB C;  4PHZ C;  3CHX C;  1YEW C;  3RFR C;  4PI0 C;  4PI2 C; 
#chains in the Genus database with same CATH topology
 4IJI A;  4YAV A;  3WYW A;  3BBY A;  4NHW A;  4GSS A;  2HQT A;  1BF5 A;  2AB6 A;  4WR5 A;  4FQU A;  3LXZ A;  2WW3 A;  3VI7 A;  3LXT A;  3CWG A;  3MAK A;  5ECQ B;  4EXJ A;  6GSX A;  2GSS A;  3VK9 A;  4F0C A;  3Q19 A;  2VCW A;  1F3A A;  19GS A;  4PUR A;  1MD4 A;  1SVM A;  1F2E A;  2HSM B;  2PBJ A;  5ECL B;  3FY7 A;  1BYE A;  3MDK A;  4GDF A;  3QR6 A;  4JED A;  4I97 A;  4EDZ A;  2GST A;  3GH6 A;  4IW9 A;  1PGT A;  2VCQ A;  2N5F A;  3KMN A;  2VCX A;  3AY8 A;  5J5N A;  5LD0 A;  4TOP A;  1EOH A;  4GCI A;  4KX4 A;  4NAX A;  5ELG A;  1K0N A;  3KTL A;  5D9V A;  4MP4 A;  2WJU A;  4ECB A;  2PER A;  4G10 A;  1YY7 A;  2C3Q A;  4AKH A;  1RK4 A;  1V40 A;  1PMT A;  3KJY A;  5D9X A;  4DEJ A;  4BVX A;  3M0F A;  2VD1 A;  3QAV A;  5A5K A;  4GSN A;  3CSH A;  5IQY A;  4HI7 A;  4HOJ A;  1E6B A;  2F8F A;  2WZS A;  1KBN A;  4QMK A;  4IS0 A;  2AAW A;  4PI0 C;  3HJO A;  2A2R A;  2HSN B;  2WVX A;  2AHE A;  2C3T A;  1HNB A;  3UAP A;  9GSS A;  2GSR A;  1GUM A;  4J2F A;  3GX0 A;  2FNO A;  1PL1 A;  3M1G A;  1HNC A;  2A2S A;  2VCT A;  1LJR A;  4IVF A;  2UV8 G;  2VCZ A;  3UAR A;  1HQO A;  1K0O A;  4KE3 A;  2CAI A;  3LYK A;  1U3I A;  3ISO A;  4RI7 A;  4W66 A;  5J47 A;  3GTU B;  1U87 A;  14GS A;  4GTU A;  2J9H A;  3ZMK A;  3H1N A;  5A4V A;  3L0H A;  3RBT A;  1GUK A;  3ZFB A;  4WR4 A;  1PKW A;  3TU3 B;  2ON7 A;  4L5O A;  1Y6E A;  4JBB A;  4MZW A;  4F03 A;  4MPF A;  3Q18 A;  3FRC A;  1VF1 A;  4MPG A;  2X64 A;  1SVO A;  1XW5 A;  4PX1 A;  1BG5 A;  5A1N A;  1GTB A;  3PGT A;  1K0D A;  4G0I A;  2DSA A;  5ECN B;  6GSW A;  1AQV A;  4BVY B;  1IYH A;  4BL7 B;  1B48 A;  1V2A A;  5LCZ A;  2R6K A;  1F3B A;  5AGY A;  22GS A;  2HRA A;  4Q5F A;  1MD3 A;  4AGS A;  4N3Z A;  1K0M A;  5DCG A;  3TOU A;  5G5F A;  6GSU A;  4ZB6 A;  1S4B P;  2JL4 A;  1GLP A;  5DAK B;  1K3O A;  1PA3 A;  4L8E A;  6GSS A;  4CHS A;  3UBL A;  2YV9 A;  5GZZ B;  1G6W A;  4ECJ A;  3LSZ A;  4G0L A;  3VUR A;  2NTO A;  8GSS A;  3LQ7 A;  3UVH A;  1EV4 A;  5ECI B;  1USB A;  3G7I A;  2EFH A;  2F3M A;  4G19 A;  2PVQ A;  2CZ3 A;  5EL8 A;  3W8S A;  3Q74 A;  1GLQ A;  2GLR A;  4ID0 A;  2IMI A;  3WD6 A;  5BMU A;  3R2Q A;  4ZB8 A;  1VF3 A;  3KMO A;  3KM6 A;  3O3T A;  5ECO B;  2VO4 A;  3FR3 A;  1M9B A;  1YEW C;  4LMW A;  1YKC A;  1GTU A;  5A34 A;  4KH7 A;  4F0B A;  5D9W A;  1GUL A;  5FWG A;  5F05 A;  4ZBD A;  2WS2 A;  3U6V A;  3CRU A;  4YAP A;  2WW2 A;  2HRK B;  5A1N B;  1PKZ A;  1TU8 A;  1GSQ A;  1XW6 A;  3VWX A;  5AIS A;  4O92 A;  3IR4 A;  3HMJ G;  4ECI A;  5ECM B;  2OAD A;  4KGI A;  5HFK A;  5JCU A;  4G9H A;  1VF2 A;  1N25 A;  4EE0 A;  5J4Y A;  1G6Y A;  5F07 A;  5ECS A;  3F63 A;  2EFE A;  2LJR A;  2IL3 A;  3IE3 A;  1GWC A;  2EFC A;  2OT3 A;  2VD0 A;  4ISD A;  5DAL A;  5A4U A;  4EC0 A;  5J4V A;  5AIX A;  1MTC A;  5A4W A;  4G0K A;  3ERF A;  1GTA A;  2ON5 A;  4OFT A;  4Q5Q A;  6GSY A;  5AN1 A;  3FR6 A;  4GLT A;  4ZBB A;  1K0C A;  4GF0 A;  1K3L A;  3N9J A;  3TGZ A;  5F0G A;  4FXY P;  4G01 A;  6GST A;  2CZ2 A;  1C72 A;  1GSU A;  20GS A;  1PN9 A;  16GS A;  3M8N A;  18GS A;  2O3E A;  4E8H A;  1GSS A;  5A34 B;  1M0U A;  4AKX B;  3R3E A;  2DC5 A;  2C4J A;  1GNW A;  5A5H A;  3HJM A;  4ZB9 A;  1OE7 A;  2IMK A;  3IBH A;  4MF5 A;  1YVL A;  4IQ1 A;  4KF9 A;  4QQ7 A;  2R3X A;  5FT3 A;  1ML6 A;  17GS A;  2VCV A;  2WRT A;  1JLV A;  2WB9 A;  1XWK A;  5ECK B;  4BVX B;  1ZGN A;  1N2A A;  1G7O A;  4PNG A;  1PX6 A;  4USS A;  4EDY A;  1JLW A;  5D73 A;  2HSM A;  1U88 A;  3FYG A;  1B8X A;  13GS A;  4PHZ C;  1EOG A;  5B7C A;  5J41 A;  3CRT A;  3VPQ A;  2WDU A;  4NHZ A;  2FHE A;  2WVX B;  3GST A;  3RGB C;  1TU7 A;  1AQW A;  4MF6 A;  4MK3 A;  1K0B A;  1M99 A;  1HNA A;  1SVL A;  5EVO A;  3VI5 A;  1NHY A;  4PQI A;  5DJM A;  4O7H A;  5JCW A;  5ECP B;  3UBK A;  2WW1 A;  3DD3 A;  4HJ2 A;  4KDY A;  5D9T A;  4K0N A;  3ZFL A;  2O5V A;  2D2Z A;  2CVD A;  3EE2 A;  1I1I P;  4IBP A;  1GTI A;  3N5O A;  5J40 A;  1K0A A;  1EEM A;  2YCD A;  4IQA A;  1FW1 A;  4ZB7 A;  3PPU A;  4L5L A;  1GSD A;  3KXO A;  2HSN A;  1YQ1 A;  1TXU A;  2C8U A;  2PGT A;  3VPT A;  2YV7 A;  3I69 A;  5ECH B;  5GSS A;  4PI2 C;  5J4U A;  3P90 A;  2CA8 A;  2OA7 A;  4KDX A;  3LJR A;  4OFM A;  2WVY A;  4PTS A;  3NIV A;  3CSI A;  3GUR A;  3GTU A;  5F06 A;  3DGQ A;  3I6A A;  4K0G A;  3QAW A;  5F8B A;  3P8W A;  4E68 A;  3GUS A;  4ZBA A;  3PR8 A;  1Y1U A;  1YJ6 A;  1AW9 A;  1OYJ A;  1Z9H A;  2EFD A;  2PMT A;  7GSS A;  4AKI A;  1EV9 A;  2C3N A;  1OKT A;  1PD2 1;  1PX7 A;  4HZ4 A;  6GSV A;  1LBK A;  2H1L A;  1UA5 A;  3G7J A;  3IK9 A;  4OFN A;  3IC8 A;  4Q5N A;  1BX9 A;  3F6D A;  3ERG A;  1A0F A;  1TDI A;  1TW9 A;  3C8E A;  12GS A;  2C80 A;  2O36 A;  4BVY A;  5BMU B;  4BL7 A;  1VF4 A;  4IGJ A;  2WVZ A;  4ACS A;  3CHX C;  5FHI A;  2WW0 A;  4HZ2 A;  4KDU A;  5ECR B;  3LG6 A;  4KAE A;  5DAK A;  3EIN A;  1JZR A;  3SWL A;  2R5G A;  1B4P A;  4ECC A;  4PXO A;  3GSS A;  3LYP A;  5AIV A;  3VLN A;  4AKG A;  1ZL9 A;  1PL2 A;  3M3M A;  1GUH A;  11GS A;  3F6F A;  4GST A;  5DQS A;  2OAC A;  1Q4J A;  1R5A A;  1YDK A;  4N0V A;  5DJL A;  1K3Y A;  1XWG A;  5GST A;  1GSY A;  5G5E A;  1BG1 A;  3D0Z A;  5DAL B;  3O76 A;  2GDR A;  2HNL A;  1GSF A;  4E8E A;  3QAG A;  4YQV A;  2GTU A;  5ELA A;  3ZML A;  2R4V A;  1AQX A;  3HKR A;  5DDL A;  2VKZ G;  2HRK A;  10GS A;  1AXD A;  4LMV A;  4PNF A;  1DUG A;  3LFL A;  4YQU A;  3RFR C;  4KSM A;  1OE8 A;  1GSE A;  4JZQ A;  4AI6 A;  4PQH A;  4MDC A;  4RI6 A;  4MF7 A;  2GSQ A;  4IKH A;  3IK7 A;  3FR9 A;  2UZ8 A;  1BAY A;  4OMV A;  4IEL A;  3TOT A;  4PGT A;  1GNE A;  4PUA A;  5KEJ A;  4ZXG A;  1M9A A;  5A5H B;  4YQM A;  1IYI A;  2CAQ A;  2V6K A;  3CSJ A;  3CBU A;  4YH2 A;  4Q5R A;  1FHE A;  5EY6 A; 
#chains in the Genus database with same CATH homology
 3RGB C;  4PHZ C;  3CHX C;  1YEW C;  3RFR C;  4PI0 C;  4PI2 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...