4PHZC

Crystal structure of particulate methane monooxygenase from methylocystis sp. atcc 49242 (rockwell)
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
241
structure length
214
Chain Sequence
b'ESVVDLRGMWIGLVLLNVFYLIVRIYEQVFGWRAGLDSFAPEFQTYWMSILWTEIPLELVSGLGLAGYLWKTRDRNVDAVTPREEMRRLVVLVQWLVVYGIAIYWGASFFTEQDGTWHMTVIRDTDFTPSHIIEFYMSYPIYSVIAVGAFFYAKTRIPYFAHGYSLAFLIVAIGPFMIIPNVGWMALGVFGVVLQILMRIHALVGKEGVKLLTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords unknown peptide
publication title Effects of zinc on particulate methane monooxygenase activity and structure.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 76
structure length 214
sequence length 241
chains with identical sequence G, K
ec nomenclature ec 1.14.18.3: Methane monooxygenase (particulate).
pdb deposition date 2014-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.50 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Particulate methane monooxygenase subunit c2. Chain: C 4phzC00
3RFRC 1YEWC 4PI2C 3RGBC 3CHXC 4PI0C 4PHZC
chains in the Genus database with same CATH superfamily
3LXTA 3SWLA 2PMTA 6GSSA 1TU8A 6GSUA 3M3MA 3TOUA 4OFNA 1GWCA 3G7JA 4ZBAA 3IC8A 4EDYA 1SVMA 1GUMA 2A2RA 1BG1A 3AY8A 5F8BA 3Q19A 2WRTA 2HSNA 4L5OA 2CA8A 1LBKA 3CSIA 5DCGA 4EXJA 1HQOA 1K0CA 2H1LA 2HSMB 5DQSA 2F8FA 1VF3A 4YQUA 3RBTA 3Q74A 3VURA 1BAYA 2C3TA 4EC0A 3G7IA 1E6BA 1G6YA 1GTIA 4BVXB 3LXZA 4ZBDA 2GTUA 6GSWA 5A4UA 1U87A 2A2SA 2IL3A 1PKZA 1YQ1A 4AKGA 1SVLA 4YH2A 2UZ8A 2ON7A 1KBNA 5ELAA 1K0OA 4FXYP 5AIVA 2VD0A 1GSEA 1YJ6A 1N2AA 4JBBA 1F3BA 3W8SA 1B48A 3IBHA 1U3IA 3I69A 5J40A 3EINA 1ML6A 4MPFA 2WVYA 3KM6A 2VD1A 4F03A 3NIVA 4N3ZA 4WR4A 4G19A 5DJMA 2JL4A 2GSTA 1MD3A 1SVOA 2AAWA 1F2EA 4HI7A 4QQ7A 5EY6A 4KDUA 3C8EA 1M0UA 3HKRA 4K0GA 1VF2A 4IGJA 3GX0A 4F0CA 5LCZA 3EE2A 3HJOA 4ZXGA 4O7HA 3GURA 5A5KA 2OT3A 1UA5A 4MP4A 2F3MA 3UAPA 1AXDA 4I97A 4G0IA 3L0HA 4YQMA 2GSQA 5J47A 2GLRA 1OKTA 4OMVA 1GSSA 3Q18A 4ZB9A 1TU7A 3FR3A 1OYJA 1YKCA 3F6DA 4PUAA 4PNFA 5ECQB 4ECIA 4PI2C 2VO4A 1XW6A 3CRTA 3LJRA 4PGTA 4KAEA 1K0AA 2VCZA 4AKIA 3KMNA 1MD4A 4KGIA 4KDXA 1JLVA 6GSXA 3LQ7A 2R3XA 5AN1A 5G5EA 16GSA 2HNLA 13GSA 4RI6A 1GSYA 2UV8G 7GSSA 4YAPA 2WW0A 2WJUA 3PGTA 5AGYA 4NHWA 4ID0A 1K3LA 1ZGNA 1FHEA 4TOPA 5BMUB 3TOTA 5D9WA 3FYGA 5FT3A 1NHYA 3GTUB 4JEDA 1BF5A 3P8WA 2N5FA 3DD3A 4AKXB 5DDLA 1K0DA 1PD21 4ZB6A 4PI0C 4E8HA 2O5VA 2CZ3A 4AKHA 5ECSA 1GULA 3LYPA 5A34A 1GLPA 5J4VA 4ZB8A 2YCDA 4GCIA 4Q5RA 3ERFA 4PHZC 1GSQA 5A1NB 3UBKA 5G5FA 2J9HA 4CHSA 3GUSA 4RI7A 3VPTA 1PX7A 4G9HA 4EDZA 6GSTA 9GSSA 3FR9A 1PMTA 1C72A 1PL1A 3ZFBA 4ECJA 3CSHA 1JZRA 1IYIA 5F07A 1TDIA 2CAQA 4PTSA 5GZZB 1G7OA 2HRAA 4BVYB 2HSMA 3UBLA 3U6VA 5IQYA 3LG6A 2C80A 3M0FA 4PX1A 2NTOA 5JCWA 2CAIA 4E68A 18GSA 2ON5A 4HOJA 4MPGA 4BVXA 5ECRB 3O76A 5JCUA 1AQWA 4IKHA 3CRUA 2IMKA 4IVFA 4E8EA 3CHXC 4ACSA 5J41A 4GSNA 4GSTA 5D9XA 2LJRA 5AIXA 2WS2A 4NAXA 3ZFLA 1B8XA 2WW2A 3KJYA 2HRKB 5DJLA 3WYWA 4KSMA 1USBA 1XW5A 2EFHA 5A5HB 4OFTA 3RFRC 1HNBA 5ECMB 1TXUA 4USSA 1GSDA 4ISDA 5ECLB 1BG5A 5J4UA 4JZQA 5KEJA 4MF6A 1GUKA 1GLQA 1GTAA 4MZWA 4PQHA 3QR6A 4G0KA 5FWGA 4K0NA 1N25A 5ECPB 4BL7B 1BX9A 2PVQA 2V6KA 2CVDA 19GSA 5AISA 3KXOA 1GUHA 2WDUA 3MDKA 5F06A 1HNCA 1EV4A 3FY7A 1K0BA 3H1NA 3IR4A 2VCWA 1GTBA 1RK4A 1F3AA 1XWKA 14GSA 2EFCA 4IQ1A 1JLWA 8GSSA 20GSA 1IYHA 2VCTA 2C4JA 3LYKA 4DEJA 2C8UA 3VK9A 5ECHB 2O3EA 5F05A 4KH7A 4PURA 1GNEA 5A4WA 1R5AA 4GF0A 3HJMA 1A0FA 2D2ZA 5DALB 4ECCA 3QAVA 4O92A 5ECOB 4PNGA 1HNAA 3VI7A 5ECIB 2R5GA 5GSTA 1BYEA 3CBUA 3ZMLA 5GSSA 1EOGA 3CWGA 2C3NA 2WW1A 4LMWA 5B7CA 3VPQA 2WVXB 1K0MA 5DAKB 3UARA 3KTLA 1ZL9A 4L5LA 2DSAA 2VCVA 1Y1UA 4KE3A 3IK9A 4L8EA 3PR8A 3R3EA 4LMVA 4MF5A 4MDCA 3VI5A 5A4VA 2DC5A 3VLNA 4GSSA 1Q4JA 4WR5A 2R4VA 4PXOA 5J4YA 1GTUA 5ELGA 1PX6A 4Q5FA 6GSYA 3VWXA 4G0LA 4G10A 5BMUA 1B4PA 4G01A 4F0BA 1S4BP 1TW9A 1YDKA 3ISOA 3GTUA 1PA3A 2C3QA 5A34B 1K3OA 1AQVA 2FNOA 5D9VA 2HSNB 4IQAA 1K0NA 2PGTA 1U88A 4W66A 4AGSA 3FRCA 1AW9A 3LSZA 3QAGA 3F63A 4GTUA 2GDRA 5A1NA 2FHEA 4ECBA 4NHZA 11GSA 2WVZA 1G6WA 2VCXA 3RGBC 1Y6EA 3IE3A 3QAWA 4J2FA 2WB9A 1EOHA 3IK7A 1OE8A 1PGTA 10GSA 3CSJA 4BVYA 1K3YA 4Q5NA 4PQIA 1PN9A 3FR6A 1M9BA 3D0ZA 5ECKB 4Q5QA 1XWGA 1PL2A 3P90A 3O3TA 4IBPA 4GDFA 4KX4A 2AB6A 5F0GA 1PKWA 1I1IP 1V40A 3BBYA 1GSFA 1MTCA 1YEWC 2AHEA 4N0VA 3MAKA 1AQXA 3I6AA 2HQTA 1OE7A 2VCQA 3ZMKA 2HRKA 3LFLA 4QMKA 2CZ2A 4KF9A 5FHIA 4YAVA 2OADA 5HFKA 1DUGA 1FW1A 3F6FA 4IS0A 5A5HA 3TGZA 4YQVA 4HZ2A 4HZ4A 4ZB7A 4IW9A 1M99A 3GH6A 3GSTA 3N5OA 2OA7A 1Z9HA 1EEMA 4HJ2A 2GSSA 2PERA 5EL8A 4GLTA 2EFEA 4BL7A 1VF4A 12GSA 5D73A 4IJIA 2R6KA 2OACA 2YV9A 2PBJA 22GSA 3HMJG 4OFMA 1GNWA 3M8NA 1V2AA 3R2QA 2YV7A 5LD0A 1LJRA 5EVOA 5J5NA 1EV9A 3TU3B 1YVLA 17GSA 2GSRA 3M1GA 4EE0A 4KDYA 2WZSA 5DALA 4AI6A 1YY7A 4ZBBA 2O36A 2X64A 3GSSA 3UVHA 3WD6A 2WVXA 2EFDA 5DAKA 2VKZG 1GSUA 4FQUA 2WW3A 4MK3A 3N9JA 4MF7A 5ECNB 6GSVA 3KMOA 1VF1A 4IELA 2IMIA 3ERGA 1M9AA 3DGQA 5D9TA 3PPUA
chains in the Genus database with same CATH topology
3RFRC 1YEWC 4PI2C 3RGBC 3CHXC 4PI0C 4PHZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RFR C;  1YEW C;  4PI2 C;  3RGB C;  3CHX C;  4PI0 C;  4PHZ C; 
#chains in the Genus database with same CATH topology
 3LXT A;  3SWL A;  2PMT A;  6GSS A;  1TU8 A;  6GSU A;  3M3M A;  3TOU A;  4OFN A;  1GWC A;  3G7J A;  4ZBA A;  3IC8 A;  4EDY A;  1SVM A;  1GUM A;  2A2R A;  1BG1 A;  3AY8 A;  5F8B A;  3Q19 A;  2WRT A;  2HSN A;  4L5O A;  2CA8 A;  1LBK A;  3CSI A;  5DCG A;  4EXJ A;  1HQO A;  1K0C A;  2H1L A;  2HSM B;  5DQS A;  2F8F A;  1VF3 A;  4YQU A;  3RBT A;  3Q74 A;  3VUR A;  1BAY A;  2C3T A;  4EC0 A;  3G7I A;  1E6B A;  1G6Y A;  1GTI A;  4BVX B;  3LXZ A;  4ZBD A;  2GTU A;  6GSW A;  5A4U A;  1U87 A;  2A2S A;  2IL3 A;  1PKZ A;  1YQ1 A;  4AKG A;  1SVL A;  4YH2 A;  2UZ8 A;  2ON7 A;  1KBN A;  5ELA A;  1K0O A;  4FXY P;  5AIV A;  2VD0 A;  1GSE A;  1YJ6 A;  1N2A A;  4JBB A;  1F3B A;  3W8S A;  1B48 A;  3IBH A;  1U3I A;  3I69 A;  5J40 A;  3EIN A;  1ML6 A;  4MPF A;  2WVY A;  3KM6 A;  2VD1 A;  4F03 A;  3NIV A;  4N3Z A;  4WR4 A;  4G19 A;  5DJM A;  2JL4 A;  2GST A;  1MD3 A;  1SVO A;  2AAW A;  1F2E A;  4HI7 A;  4QQ7 A;  5EY6 A;  4KDU A;  3C8E A;  1M0U A;  3HKR A;  4K0G A;  1VF2 A;  4IGJ A;  3GX0 A;  4F0C A;  5LCZ A;  3EE2 A;  3HJO A;  4ZXG A;  4O7H A;  3GUR A;  5A5K A;  2OT3 A;  1UA5 A;  4MP4 A;  2F3M A;  3UAP A;  1AXD A;  4I97 A;  4G0I A;  3L0H A;  4YQM A;  2GSQ A;  5J47 A;  2GLR A;  1OKT A;  4OMV A;  1GSS A;  3Q18 A;  4ZB9 A;  1TU7 A;  3FR3 A;  1OYJ A;  1YKC A;  3F6D A;  4PUA A;  4PNF A;  5ECQ B;  4ECI A;  4PI2 C;  2VO4 A;  1XW6 A;  3CRT A;  3LJR A;  4PGT A;  4KAE A;  1K0A A;  2VCZ A;  4AKI A;  3KMN A;  1MD4 A;  4KGI A;  4KDX A;  1JLV A;  6GSX A;  3LQ7 A;  2R3X A;  5AN1 A;  5G5E A;  16GS A;  2HNL A;  13GS A;  4RI6 A;  1GSY A;  2UV8 G;  7GSS A;  4YAP A;  2WW0 A;  2WJU A;  3PGT A;  5AGY A;  4NHW A;  4ID0 A;  1K3L A;  1ZGN A;  1FHE A;  4TOP A;  5BMU B;  3TOT A;  5D9W A;  3FYG A;  5FT3 A;  1NHY A;  3GTU B;  4JED A;  1BF5 A;  3P8W A;  2N5F A;  3DD3 A;  4AKX B;  5DDL A;  1K0D A;  1PD2 1;  4ZB6 A;  4PI0 C;  4E8H A;  2O5V A;  2CZ3 A;  4AKH A;  5ECS A;  1GUL A;  3LYP A;  5A34 A;  1GLP A;  5J4V A;  4ZB8 A;  2YCD A;  4GCI A;  4Q5R A;  3ERF A;  4PHZ C;  1GSQ A;  5A1N B;  3UBK A;  5G5F A;  2J9H A;  4CHS A;  3GUS A;  4RI7 A;  3VPT A;  1PX7 A;  4G9H A;  4EDZ A;  6GST A;  9GSS A;  3FR9 A;  1PMT A;  1C72 A;  1PL1 A;  3ZFB A;  4ECJ A;  3CSH A;  1JZR A;  1IYI A;  5F07 A;  1TDI A;  2CAQ A;  4PTS A;  5GZZ B;  1G7O A;  2HRA A;  4BVY B;  2HSM A;  3UBL A;  3U6V A;  5IQY A;  3LG6 A;  2C80 A;  3M0F A;  4PX1 A;  2NTO A;  5JCW A;  2CAI A;  4E68 A;  18GS A;  2ON5 A;  4HOJ A;  4MPG A;  4BVX A;  5ECR B;  3O76 A;  5JCU A;  1AQW A;  4IKH A;  3CRU A;  2IMK A;  4IVF A;  4E8E A;  3CHX C;  4ACS A;  5J41 A;  4GSN A;  4GST A;  5D9X A;  2LJR A;  5AIX A;  2WS2 A;  4NAX A;  3ZFL A;  1B8X A;  2WW2 A;  3KJY A;  2HRK B;  5DJL A;  3WYW A;  4KSM A;  1USB A;  1XW5 A;  2EFH A;  5A5H B;  4OFT A;  3RFR C;  1HNB A;  5ECM B;  1TXU A;  4USS A;  1GSD A;  4ISD A;  5ECL B;  1BG5 A;  5J4U A;  4JZQ A;  5KEJ A;  4MF6 A;  1GUK A;  1GLQ A;  1GTA A;  4MZW A;  4PQH A;  3QR6 A;  4G0K A;  5FWG A;  4K0N A;  1N25 A;  5ECP B;  4BL7 B;  1BX9 A;  2PVQ A;  2V6K A;  2CVD A;  19GS A;  5AIS A;  3KXO A;  1GUH A;  2WDU A;  3MDK A;  5F06 A;  1HNC A;  1EV4 A;  3FY7 A;  1K0B A;  3H1N A;  3IR4 A;  2VCW A;  1GTB A;  1RK4 A;  1F3A A;  1XWK A;  14GS A;  2EFC A;  4IQ1 A;  1JLW A;  8GSS A;  20GS A;  1IYH A;  2VCT A;  2C4J A;  3LYK A;  4DEJ A;  2C8U A;  3VK9 A;  5ECH B;  2O3E A;  5F05 A;  4KH7 A;  4PUR A;  1GNE A;  5A4W A;  1R5A A;  4GF0 A;  3HJM A;  1A0F A;  2D2Z A;  5DAL B;  4ECC A;  3QAV A;  4O92 A;  5ECO B;  4PNG A;  1HNA A;  3VI7 A;  5ECI B;  2R5G A;  5GST A;  1BYE A;  3CBU A;  3ZML A;  5GSS A;  1EOG A;  3CWG A;  2C3N A;  2WW1 A;  4LMW A;  5B7C A;  3VPQ A;  2WVX B;  1K0M A;  5DAK B;  3UAR A;  3KTL A;  1ZL9 A;  4L5L A;  2DSA A;  2VCV A;  1Y1U A;  4KE3 A;  3IK9 A;  4L8E A;  3PR8 A;  3R3E A;  4LMV A;  4MF5 A;  4MDC A;  3VI5 A;  5A4V A;  2DC5 A;  3VLN A;  4GSS A;  1Q4J A;  4WR5 A;  2R4V A;  4PXO A;  5J4Y A;  1GTU A;  5ELG A;  1PX6 A;  4Q5F A;  6GSY A;  3VWX A;  4G0L A;  4G10 A;  5BMU A;  1B4P A;  4G01 A;  4F0B A;  1S4B P;  1TW9 A;  1YDK A;  3ISO A;  3GTU A;  1PA3 A;  2C3Q A;  5A34 B;  1K3O A;  1AQV A;  2FNO A;  5D9V A;  2HSN B;  4IQA A;  1K0N A;  2PGT A;  1U88 A;  4W66 A;  4AGS A;  3FRC A;  1AW9 A;  3LSZ A;  3QAG A;  3F63 A;  4GTU A;  2GDR A;  5A1N A;  2FHE A;  4ECB A;  4NHZ A;  11GS A;  2WVZ A;  1G6W A;  2VCX A;  3RGB C;  1Y6E A;  3IE3 A;  3QAW A;  4J2F A;  2WB9 A;  1EOH A;  3IK7 A;  1OE8 A;  1PGT A;  10GS A;  3CSJ A;  4BVY A;  1K3Y A;  4Q5N A;  4PQI A;  1PN9 A;  3FR6 A;  1M9B A;  3D0Z A;  5ECK B;  4Q5Q A;  1XWG A;  1PL2 A;  3P90 A;  3O3T A;  4IBP A;  4GDF A;  4KX4 A;  2AB6 A;  5F0G A;  1PKW A;  1I1I P;  1V40 A;  3BBY A;  1GSF A;  1MTC A;  1YEW C;  2AHE A;  4N0V A;  3MAK A;  1AQX A;  3I6A A;  2HQT A;  1OE7 A;  2VCQ A;  3ZMK A;  2HRK A;  3LFL A;  4QMK A;  2CZ2 A;  4KF9 A;  5FHI A;  4YAV A;  2OAD A;  5HFK A;  1DUG A;  1FW1 A;  3F6F A;  4IS0 A;  5A5H A;  3TGZ A;  4YQV A;  4HZ2 A;  4HZ4 A;  4ZB7 A;  4IW9 A;  1M99 A;  3GH6 A;  3GST A;  3N5O A;  2OA7 A;  1Z9H A;  1EEM A;  4HJ2 A;  2GSS A;  2PER A;  5EL8 A;  4GLT A;  2EFE A;  4BL7 A;  1VF4 A;  12GS A;  5D73 A;  4IJI A;  2R6K A;  2OAC A;  2YV9 A;  2PBJ A;  22GS A;  3HMJ G;  4OFM A;  1GNW A;  3M8N A;  1V2A A;  3R2Q A;  2YV7 A;  5LD0 A;  1LJR A;  5EVO A;  5J5N A;  1EV9 A;  3TU3 B;  1YVL A;  17GS A;  2GSR A;  3M1G A;  4EE0 A;  4KDY A;  2WZS A;  5DAL A;  4AI6 A;  1YY7 A;  4ZBB A;  2O36 A;  2X64 A;  3GSS A;  3UVH A;  3WD6 A;  2WVX A;  2EFD A;  5DAK A;  2VKZ G;  1GSU A;  4FQU A;  2WW3 A;  4MK3 A;  3N9J A;  4MF7 A;  5ECN B;  6GSV A;  3KMO A;  1VF1 A;  4IEL A;  2IMI A;  3ERG A;  1M9A A;  3DGQ A;  5D9T A;  3PPU A; 
#chains in the Genus database with same CATH homology
 3RFR C;  1YEW C;  4PI2 C;  3RGB C;  3CHX C;  4PI0 C;  4PHZ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...