1GTAA

Crystal structures of a schistosomal drug and vaccine target: glutathione s-transferase from schistosoma japonica and its complex with the leading antischistosomal drug praziquantel
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
218
structure length
218
Chain Sequence
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Glutathione transferase
molecule keywords GLUTATHIONE S-TRANSFERASE
publication title Crystal structures of a schistosomal drug and vaccine target: glutathione S-transferase from Schistosoma japonica and its complex with the leading antischistosomal drug praziquantel.
pubmed doi rcsb
source organism Schistosoma japonicum
total genus 71
structure length 218
sequence length 218
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1994-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1gtaA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1gtaA01
1ERUA 2HSYA 2I81A 1PA3A 2IIYA 3G9BA 5CRDA 2FGXA 2PMTA 1HD2A 4HJ2A 3CRUA 1SKRB 5IO0A 4WKWA 2B7JA 2VAFA 3IV4A 3NZNA 1Q98A 3D22A 5B6MA 4XS1A 3GIXA 2DLXA 3LSZA 3KJYA 5DDLA 3KTLA 2WULA 3R3EA 3JCML 3C73A 2HRKB 5IM9A 4X1UA 4N30A 2OJLA 3KGKA 5G1KA 1GWCA 4ZBDA 2CX3A 3KD0A 2LRTA 1XFLA 4WF4A 4F9ZA 3PPUA 2YV9A 2NDOA 4WBJA 2F9SA 2CAQA 2YWOA 3FW2A 1IYHA 1G0TA 1K0DA 5ECOB 4BPYA 2P5QA 1GUHA 3ME7A 4POKA 4KNDA 3TKSE 3UAPA 1JZRA 4MPFA 1O85A 2HRNA 2VIMA 1XOAA 1TXXA 3C7MA 3HJPA 4PUAA 3QFAC 4KW6A 1GL8A 2B1LA 3FZ4A 5D96A 3J7Yk 4HU7A 4ULXA 2K18A 4EXJA 2FUG2 3ZZXA 1V2AA 5D9TA 1V58A 4ZL8A 4DSSA 4IP6A 1M2BA 4IELA 4HUAA 2JZSA 5ECIB 1YZXA 3L78A 1DE1A 4BL7A 2MMAA 5IOXA 2VLUA 2A2SA 2IL3A 2NTOA 4KH7A 2NPBA 2GT6A 1TI3A 4ZXGA 1OC8A 3M8NA 3RPNA 3V1WA 2XPEA 1EGOA 5G5EA 2LSTA 1HQOA 4JEDA 3GFKA 2H71A 5ECPB 4IQ1A 3EWLA 3GL5A 3LYKA 4MP4A 2LEGA 1J08A 3F4TA 3KTBA 1V9WA 1PKZA 3I9V2 3HKRA 1GTUA 2JSYA 2RM6A 2HRKA 5B7CA 3EU3A 2DJJA 3PH9A 1U3AA 5GSTA 2VCTA 1FO5A 2CAIA 4ZBBA 2GTUA 1SL0B 1J9BA 5JCUA 2GSSA 2H01A 3HD5A 2GZPA 3RAZA 3J7Yb 1PQNA 2TIRA 3M0FA 5EL8A 3A2XA 3HZ8A 4NMUA 2WS2A 1B9XC 2IMFA 1TDIA 2AHEA 4MF7A 3LJRA 2LTKA 2C8UA 4POMA 3E3EA 3GSSA 1UN2A 2BMXA 1TU7A 3CSHA 3SBCA 4I6XA 3L0HA 1NSWA 4G9HA 2CZ2A 2KOKA 2PVQA 2KLXA 2B5XA 2WCIA 5F8BA 3Q6OA 5ECMB 3HVSA 3LG6A 5COHA 3BCKA 1WIKA 2XBIA 2FLSA 1JZWA 2YWIA 4MJCA 6GSXA 1XVWA 3WT1A 5J4UA 1O73A 3IDVA 5D93A 2I4AA 4ECJA 4PQIA 4TR4A 3UARA 3MAKA 3NOFA 4YQVA 1AQXA 2VD1A 3FR6A 5EY6A 1XPVA 1U3IA 3QPMA 4PURA 2H0HA 1K3LA 4CDOA 3I69A 2HYXA 2FNOA 4QL9A 2JL4A 5H5SA 1QGVA 1F3BA 4KGIA 3KH7A 4DSQA 2YWMA 4MZCA 5KN1A 2L59A 1X0RA 2O89A 1Z6NA 2HE3A 4ISDA 1QFNA 5IIZA 2XBQA 1THOA 5GAPD 1HNBA 1EV9A 1FOVA 3GURA 4JR4A 4MJAA 1O8XA 5IPHA 5A4VA 3H1NA 4K0NA 1BYEA 4FIWA 4IBPA 4GLTA 1AQWA 1YKAA 3EE2A 5DAKB 2BTOT 4Q5QA 5KN3A 1PL2A 3A2VA 2GVPA 2DJ2A 4EF0A 5AN1A 1T4ZA 1S3AA 2WGRA 2XC2A 4HQSA 5E4WA 1MDKA 3GKXA 1U6TA 1R5PA 1ZOFA 3CYNA 4MF5A 3VPTA 1XW6A 1OE8A 1XVQA 4V2LA 5ECSA 4G10A 3MNGA 1FW1A 2FHEA 3ZITA 4EE0A 1TTZA 4JBBA 1X9MB 2LNTA 5CO3A 5IPGA 2HSHA 3TRQA 2CVKA 5C00A 3RHCA 3O3TA 1EOHA 1K0CA 4F82A 2C0EA 1A8LA 2YANA 1WPIA 3G7YA 3C1RA 2VL3A 4EL1A 5ECHB 2B3SA 3TKPA 2G2QA 1WE0A 4EC0A 1TI1A 5B8AA 3FK8A 3ZVJD 3DVWA 4K7OA 5LD0A 4OMVA 4XS6A 3QAVA 5JCWA 1M0UA 1O81A 1TRSA 1ZGNA 4HI7A 3LXZA 1AAZA 5AIXA 3UJ1A 1SYRA 4NHWA 2CX4A 3TRXA 3ED3A 2FA4A 4CW9A 2Z9SA 2H0GA 2VLTA 2IFQA 1K0NA 3I43A 2OBKA 5FWGA 2LQQA 2RLIA 1ERWA 4XIHA 4QL7A 2VCZA 3W8JA 5G30A 3D4MA 1M9AA 3ZIJA 17GSA 5DAKA 4O5RA 1G6YA 2LUSA 1TK8B 4TR1B 4DVCA 1SKWB 1ZYEA 1B8XA 2OKAA 3HYPA 1A23A 1ACVA 3DGQA 2K9FA 4GTUA 3RHBA 3FZ9A 4GWRA 1M7TA 1Z9HA 4L0UA 1QXHA 4V1Ag 5JWRB 2VCXA 1OC9B 4V1Ap 2DMMA 2O7KA 4OO5A 1ON4A 2VCWA 2H1DA 4MF6A 10GSA 5ECLB 1DE2A 3DKSA 1RW1A 3WGDA 3KP8A 2WDUA 2AAWA 1GP1A 4FYBA 2PUKC 1SYXA 2LRNA 3TKRA 2V6OA 2O8VB 4GCIA 1TK0B 4L8EA 4J56E 3IR4A 3KCMA 2IN3A 5B8BA 4WR5A 4BA7A 2F51A 2JACA 4HJMA 4XS4B 2XPDA 3O76A 1S3DA 3GV1A 5DQSA 1TU8A 3D21A 2MBTA 2P31A 2VCQA 1NW2A 3GKMA 1RQMA 4TKYA 2ZUPA 2C3QA 2JZRA 4LMWA 5KEJA 3FRCA 3ZVJA 3ERWA 4ECIA 4X43A 2H8LA 4HU9A 3FZAA 1Z5YE 5HR1A 2ES7A 4PNFA 1TK5B 3ZLPA 3LWAA 2HXKA 3QD9A 4K6XA 4GSSA 5JWOB 2CZ3A 1V98A 4ZBAA 4ACSA 3KH9A 3M1GA 4KCAA 2V6KA 4D73B 2C4JA 3Q19A 3H8QA 4WETA 4IN0A 4IW9A 2AYTA 5J5NA 2VCVA 2R3XA 2GQMA 3MDKA 5FT3A 2VM1A 5IMZA 5B6NA 4FYUA 3A5WA 4NWYA 1SJZA 1SKSB 3F3QA 1XWKA 2KP2A 3HZ4A 4AJ8A 2KP1A 2DJ3A 2HQTA 4GRFA 3FYGA 2C1YA 2TRCP 5ID2B 2MZCA 2HFDA 2L57A 1M9BA 3BBYA 1HNCA 3FHKA 1MD4A 3APOA 1XWBA 4USSA 1JLVA 2H76A 1R26A 1SK0A 5GZZB 4XCSA 4I8BA 1M99A 4PTSA 1WOUA 5BMUA 4MK3A 3M9KA 4MZBA 2H75A 3DIEA 1PGTA 5GSSA 4XS4A 5G31A 1AC1A 1AIUA 3GN3A 3VWVA 5CRWA 4GXZA 1GLPA 4ZL7A 3ZMLA 2GT5A 1MEKA 1JFUA 4MPGA 3TJKA 2C3NA 1X5EA 4ECBA 4AGSA 4HQZA 2DSAA 5IOWA 1GTIA 1GSYA 3IK9A 3EU4A 2LRCA 3GHAA 5CRHA 3GYKA 3ME8A 1A24A 1W4VA 2YJ7A 5EPFA 3IC4A 1H75A 3TOTA 5A4WA 1SD9A 2NBSA 1A8YA 3ZMKA 1FVJA 2FWHA 2YJHA 4D73A 2OE0A 1SK1A 4RI7A 1T3BA 4OO4A 4DSRA 4PXOA 2I9HA 2VD0A 4XHMA 4ZIJA 5ECKB 3P7XA 3TJBA 2RM5A 3C1SA 3H93A 3HHVA 3GH6A 1ZZYA 2CA8A 2WJUA 1WJKA 2DBCA 4RQRA 4PQHA 2VOCA 1GTBA 2IMKA 2KUCA 1ZMAA 2KHPA 3QOUA 1ST9A 2M46A 3CTFA 1A2LA 3TKSC 4Q5NA 5ID2A 1SK2A 4BWSA 2CV4A 1YDKA 2H1BA 5CP1A 4PNGA 2L4CA 1T4YA 3AY8A 2F8FA 4P3YB 3ISOA 3F0IA 1UVZA 2YN1A 4FYCA 5AISA 5ELAA 2LS5A 4J2FA 4JE1A 6GSTA 4QQ7A 2C0GA 4WBRD 5J9CA 4ML1A 2GSRA 3LXTA 4IGJA 5LNKe 1NHYA 3TOUA 3F6DA 3SWLA 3E9JB 3WT2A 3VURA 1C72A 5J41A 4XRDA 1PX6A 1EZKA 4YAPA 3UVTA 2PERA 2K6VA 3BCIA 1Z7PA 4POLA 3FR9A 22GSA 2K8SA 4OFMA 2L6CA 14GSA 3W8SA 4PX1A 2GLRA 2M72A 2PGTA 2VL2A 2OA7A 1VF2A 4N10A 2HRFA 1DUGA 4KB3A 2O85A 4G0IA 5D8IA 1GSFA 2OE1A 4HOJA 3CSIA 1ILOA 1E6BA 18GSA 3KXOA 3ZFLA 2V32A 3F6FA 4KX4A 1K0BA 3DRNA 3M9JA 5FHIA 3I6AA 3HY2A 3D6IA 4LL1B 3L9SA 1Y6EA 3CRTA 4NHZA 3TCOA 2OBIA 5HFIA 4G0KA 2K8VA 5G5FA 1PMTA 3TDGA 4E8HA 5ELGA 1E2YA 3TGZA 4NV5A 3L9VA 4K0GA 1ML6A 3F4RA 1OYJA 1SD8A 1VRSD 1H4OA 1FB0A 2AB6A 3BD2A 4TR3A 3CTGA 1XW5A 4TRXA 4TR0A 4KAEA 3S9FA 2AJQB 1X5CA 5EVOA 3IE3A 2MMZA 2A2RA 4F0BA 3GKKA 2ALBA 1QK8A 1B4QA 1Z3EA 4I2TA 1OAZA 4YQMA 1S3CA 3D0ZA 5IMVA 2C0DA 1FAAA 1A0FA 3KMNA 5CNWA 3L9UA 1OC3A 5DVBA 1GNEA 1T00A 1NHOA 1T8EB 2H6ZA 3QR6A 2A4VA 3TRPA 3MSZA 1LJRA 1Y25A 4MJEA 1O8WA 2GSQA 2I3YA 3VPQA 5CREA 2OE3A 1LU4A 20GSA 2GDRA 11GSA 2P0GA 1B48A 4V2MA 3TJJA 4HEA2 2X8HA 3HCZA 4KUNA 1GULA 3H4KA 4IJ3A 5G2ZA 2VL2C 1TJDA 3R2QA 4MMMA 4IKHA 2QKEA 1JZOA 3O6TA 1Z6MA 2REMA 3WGEA 1G7OA 3QDNA 3CXGA 16GSA 2H73A 3APQA 4TW5A 4I5QA 1EOGA 1TOFA 1XWAA 1I5GA 1THXA 4HDEA 1ABAA 2FWFA 1B4PA 2X8CA 3FKFA 2YWNA 3NIVA 1USBA 3PR8A 1FB6A 3F3RA 2R5GA 2HSMB 2DIZA 3ZIVA 5D73A 2CQ9A 2EIRA 4GSNA 3EC3A 2GS3A 3ZREA 2B5EA 1O6JA 1TRVA 2YCDA 2ZNMA 2HSNB 1KEBA 2H74A 7GSSA 2B1KA 4LMVA 4ILFA 4ML6A 1R5AA 4YH2A 5D9XA 5D9VA 1JZDA 2AUVA 1YQ1A 2L5LA 3RBTA 1FHEA 2E2MA 4FQUA 3WYWA 4GQCA 5ECQB 3ZTLA 3DXBA 1XXUA 2IMDA 1SL1B 5IQYA 5JWQB 1VF4A 2XHFA 3LFLA 2DJ0A 1VF1A 2MMNA 1CQHA 4KCEA 2X64A 1EEMA 1ZYQB 3TUEA 5LCZA 4MH3A 3EMXA 1EP7A 2ZCTA 4K1FA 2N5BA 1DSBA 4WR4A 2QSIA 4DEJA 3LGCA 3VWXA 1PRXA 1KBNA 1URMA 4NAXA 3MWHA 2HNLA 2R6KA 4KSMA 1GSSA 1K0MA 3IXRA 2B7KA 3GX0A 3BJ5A 3F9UA 1ERTA 1QQ2A 3U6VA 4MLYA 4NV2A 1FG4A 1J0FA 4TXVA 4YQUA 3FY7A 1EV4A 1A0RP 2E0QA 1TRWA 6GSUA 4OD7A 4OFTA 3EINA 2PPTA 2HSMA 1X9WB 4BVXB 5IMDA 4ZILA 3HVVA 1PL1A 3GH9A 3VI7A 1B9YC 2L5OA 1EEJA 1XBSA 3F63A 3ZYWA 1XIYA 4YAVA 3IA1A 4HS1A 3CBUA 2JSZA 4L0WA 2MYGA 2VO4A 5DCGA 2HZFA 4KSOA 3HVXA 4TR1A 1U88A 1BAYA 4RQXA 1T1VA 3IHQA 4LLRA 2PBJA 3IBHA 2ON5A 5DJMA 4F0CA 4IQAA 1VF3A 2VUPA 3QAWA 2HZEB 2J9HA 2YNXA 3QFBC 2R2JA 4KA0A 4NXIA 1M2AA 2EIQA 2WB9A 5KN0A 3RPPA 1K0OA 5DBQA 3DD3A 3F8UA 3KIJA 3EYTA 3ZL5A 5G1LA 3DYRA 2CVBA 2FY6A 1OC9A 4JRRA 8GSSA 3PINA 3QAGA 3ERGA 4HZ4A 3TKSA 2AV4A 1GSDA 5DALB 3GX8A 4EUYA 2JZTA 2LJKA 1T7PB 5IMAA 2CT6A 2FWGA 3CSJA 1YEPA 3GL3A 5ABRA 4IJIA 4WXTA 2PVOC 2PWJA 1Z7RA 1EGRA 4ID0A 1UC7A 1CQGA 1SJ6A 3GTUB 2L6DA 3IRAA 2J23A 2I1UA 3APSA 3UL3A 2N5AA 5F06A 4IS0A 2LJAA 1V40A 1OKDA 1YF1A 1EP8A 2TRXA 3TJGA 1QUWA 3LYPA 4G0LA 4BVXA 2H66A 3GA4A 5HFGA 2YV7A 1A2MA 4KDYA 2F3MA 1X5DA 2FWEA 2H1GA 2FCHA 2VL9A 3DWVA 4N0ZA 1GSQA 1XWCA 3P8WA 2GQLA 4L5LA 1MD3A 1I9DA 3D4TA 1AW9A 3UOMA 4OFNA 4XTSA 1GLQA 1YEXA 3HXSA 2HZEA 3BOAA 2IJYA 5DJLA 5A5KA 4Q5RA 1G6WA 1IYIA 1AUCA 3TKQA 2IPAA 5D9WA 2V41A 4E8EA 4MCUA 5L71A 2C0FA 5CYYA 3GKNA 2YZHA 2GQKA 4IP1A 5DALA 2LKUA 2H19A 1WMJA 4GQFA 1GUMA 5E59A 4LA1A 2PN8A 6GSSA 3OR5A 5IMCA 4TN8A 2H72A 3LEFA 3VWWA 1R7HA 1GRXA 1AQVA 5AIVA 4ZB8A 4XRAA 1YJ6A 2FA8A 4L5OA 4FO5A 2QC7A 4BVYB 4AJ7A 3H79A 1GNWA 3EVIA 3FEUA 2DMLA 3GUSA 1GTAA 3GTUA 3DVXA 5H5RA 4KE3A 3G7IA 4OWYA 1UA5A 1GH2A 1N2AA 2PU9C 1PD21 3UMAA 4PQ1A 3HA9A 3HDCA 2YPMA 2YP6A 4X0XA 2WZ9A 3US3A 2FD3A 2C3TA 4ZB6A 4ECCA 4TOPA 2G0FA 3GNJA 3P90A 3IAS2 1VGLA 4O7HA 2V2GA 1FVKA 1EWXA 4V2NA 3VFIA 1W89A 1SJIA 2GSTA 1A2JA 3M3MA 1MDIA 6GSVA 4EO3A 3RDWA 1JLWA 5AGYA 4H86A 4EKZA 1PN9A 2GZYA 3HJOA 1ZL9A 1BG5A 2O87A 4K8MA 2MBSA 4TXOB 4TVEA 3ZFBA 4RI6A 2MMOA 4N11A 3TJFA 3VI5A 1GSEA 3UVHA 1MTCA 3VWUA 2VLVA 1SENA 3FR3A 1SL2B 5INYA 1SU9A 6GSWA 1YKCA 3QMXA 3EURA 2HLSA 2LQOA 1G7EA 2B5YA 2LJRA 4KDXA 4PGTA 3TB2A 1X9SB 4PUFC 5HR3A 3KMOA 1AXDA 1U87A 5HFKA 3DMLA 4BVYA 1K3OA 3W6GA 3UIWA 4MABA 4EVMA 5GAND 4O92A 12GSA 3KP9A 2X8GA 1NM3A 4Q5FA 2WRTA 2H30A 5ENUA 1XW9A 3LQ7A 2IFQB 1LBKA 3QCPA 1F37A 1MDJA 2P5RA 5HR2A 1PSQA 1PKWA 4GSTA 5HQPA 1F9MA 13GSA 2VM2A 3CMIA 4ZL9A 2IWTA 4ZB9A 2X99A 2QGVA 5HR0A 4MDCA 3P2AA 5IO2A 2L4QA 1BQ7A 4FH8A 1TW9A 1F3AA 4MZWA 1K0AA 3GSTA 2H6YA 4JR6A 5ECNB 1GSUA 6GSYA 3IAM2 5J3RA 4IVFA 4G2EA 5ECRB 4KF9A 1OKTA 1XZOA 4TXOA 5C04A 1XWGA 2RUEA 2GGTA 2YZUA 2N5FA 3KEBA 4RUVA 3GMFA 1O7UA 3HJMA 3IPZA 4EDZA 2ON7A 4J57E 4JU5A 3N9JA 4GF0A 1HYUA 1OE7A 2DC5A 3WD6A 1N8JA 3L4NA 2E2GA 3IOSA 2B6MA 3C71A 1PX7A 1RK4A 1M2DA 2H6XA 3Q18A 1KTEA 2RUFA 4K2DA 4K7IA 4AF2A 3GRXA 3DEXA 2OADA 3UBLA 3PGTA 2RIIA 2GZZA 4K9ZA 4MH2A 1F6MC 1ZCPA 4WEYA 3K8NA 1Q4JA 2HRAA 4F2IA 1DBYA 3F4SA 2IMEA 3UEMA 4IHUA 3G7JA 3C8EA 5CAXA 2H0IA 5A4UA 3WGXA 3VK9A 2LV3A 4LL4B 3A2WA 1XOBA 4HZ2A 1QMVA 1WWJA 3UBKA 3U5RE 5IMFA 5F05A 1BX9A 2DJKA 1GUKA 2WFCA 2V1MA 1TRUA 2DJ1A 2R37A 2CVDA 4JZQA 4MA9A 4BWQA 2HI7A 5DQYA 5KN2A 1F2EA 3D5JA 1JHBA 3LORA 2D2ZA 1HNAA 3E0UA 2H70A 2IMIA 1BEDA 4WF5A 4G19A 3KM6A 4F03A 5JCGA 4OCEA 2EC4A 1YF0A 4KDUA 4I97A 1OVNA 2UZ8A 2DIYA 3N5OA 3EMPA 4AJ6A 1WRYA 4CHSA 2JADA 1TKDB 3IK7A 4POBA 2C80A 2YOIA 3Q74A 1XCCA 2LNSA 2F8AA 2HT9A 3VLNA 2M80A 1TP9A 1K3YA 2OACA 19GSA 4N0VA 5F0GA 2BJXA 4K7NA 5CRGA 2E7PA 4DSSB 4O32A 1ERVA 1KNGA 4NPBA 2NVLA 1BJXA 4I2UA 4Z7XA 4OCFA 2JU5A 3FZ5A 2R4VA 3IC8A 1R4WA 3ZRDA 1WP0A 4BL7B 1V57A 9GSSA 4MJBA 5H5QA 5J9BA 5F07A 4EDYA 3A3TA 5DCHA 2EIOA 2H1AA 3ERFA 1YY7A 3KZQA
chains in the Genus database with same CATH superfamily
1ERUA 2HSYA 2EFDA 2I81A 4MNNA 1PA3A 2IIYA 3G9BA 5CRDA 2FGXA 2PMTA 1HD2A 4HJ2A 3CRUA 1SKRB 5IO0A 4WKWA 2B7JA 2VAFA 3IV4A 3NZNA 1Q98A 3D22A 5B6MA 4XS1A 3GIXA 2DLXA 5A5HA 3LSZA 3KJYA 5DDLA 3KTLA 2WULA 3R3EA 3JCML 3C73A 2HRKB 5IM9A 5A34A 4X1UA 4N30A 2OJLA 3KGKA 5G1KA 1GWCA 4ZBDA 2CX3A 3KD0A 2LRTA 1XFLA 4WF4A 4F9ZA 2YV9A 3PPUA 2NDOA 4WBJA 2F9SA 2CAQA 2YWOA 3FW2A 1IYHA 1G0TA 1K0DA 5ECOB 4BPYA 2P5QA 1GUHA 3ME7A 4POKA 2WVYA 4KNDA 3TKSE 3UAPA 1JZRA 4MPFA 1O85A 2HRNA 2VIMA 1XOAA 1TXXA 3C7MA 3HJPA 4PUAA 3QFAC 1S4BP 4KW6A 1GL8A 4ZB7A 2B1LA 3FMWA 3FZ4A 5D96A 3J7Yk 4HU7A 4ULXA 2K18A 3CHXC 4EXJA 2FUG2 3ZZXA 1V2AA 5D9TA 1V58A 4ZL8A 4DSSA 1SVOA 4IP6A 1M2BA 3HVNA 4IELA 4HUAA 2JZSA 5ECIB 1YZXA 3L78A 1DE1A 4BL7A 2MMAA 5IOXA 2VLUA 2A2SA 2IL3A 2NTOA 4KH7A 2NPBA 2GT6A 1TI3A 4ZXGA 1OC8A 3M8NA 3RPNA 3V1WA 2XPEA 1EGOA 5G5EA 2LSTA 4CY8A 1HQOA 4JEDA 3GFKA 2H71A 5ECPB 4IQ1A 3EWLA 3GL5A 3LYKA 4MP4A 2LEGA 1J08A 3F4TA 3KTBA 1V9WA 1PKZA 3I9V2 3HKRA 1GTUA 2JSYA 2RM6A 2HRKA 5B7CA 3EU3A 2DJJA 3PH9A 1U3AA 1YEWC 5GSTA 2EFCA 2VCTA 1FO5A 2CAIA 4ZBBA 2GTUA 2WW3A 1SL0B 1J9BA 5JCUA 2R0CA 2GSSA 2H01A 3HD5A 2GZPA 2A4HA 5J4YA 3RAZA 3J7Yb 4O5UA 1PQNA 2TIRA 3M0FA 5EL8A 3A2XA 3HZ8A 4NMUA 2WS2A 1B9XC 2IMFA 1TDIA 4AKGA 2AHEA 4MF7A 3LJRA 2LTKA 2C8UA 4POMA 3E3EA 3GSSA 1UN2A 2BMXA 1TU7A 3CSHA 3SBCA 4I6XA 3L0HA 1NSWA 4G9HA 2CZ2A 2KOKA 2PVQA 2KLXA 2B5XA 2WCIA 5F8BA 3Q6OA 5ECMB 3HVSA 3LG6A 1PFOA 5COHA 3BCKA 1WIKA 2X4AA 2XBIA 2FLSA 1JZWA 2YWIA 4MJCA 6GSXA 1XVWA 3WT1A 5J4UA 2WVZA 1O73A 3IDVA 5D93A 2I4AA 4ECJA 4PQIA 3HMJG 4TR4A 1ZYPA 3UARA 3MAKA 4K5SA 3NOFA 4YQVA 3RGBC 1AQXA 2VD1A 3FR6A 5EY6A 1XPVA 1U3IA 3QPMA 4PURA 2H0HA 1K3LA 4CDOA 3I69A 2HYXA 2FNOA 4QL9A 2JL4A 5H5SA 1QGVA 1F3BA 4KGIA 3KH7A 4DSQA 2YWMA 4MZCA 5KN1A 2L59A 1X0RA 2O89A 1Z6NA 2HE3A 4ISDA 1QFNA 5IIZA 2XBQA 3RFRC 1THOA 5GAPD 1HNBA 1EV9A 1FOVA 3GURA 4JR4A 4MJAA 1O8XA 5IPHA 5A4VA 3H1NA 4K0NA 1BYEA 4FIWA 4IBPA 4GLTA 2R0PA 1AQWA 1YKAA 3EE2A 5DAKB 2BTOT 4Q5QA 5KN3A 1PL2A 3A2VA 4X4JA 2GVPA 2DJ2A 4EF0A 5AN1A 1T4ZA 1S3AA 2WGRA 2XC2A 4HQSA 5E4WA 4O5QA 1MDKA 3GKXA 1U6TA 1R5PA 1ZOFA 3CYNA 4MF5A 3VPTA 1XW6A 1OE8A 1XVQA 4V2LA 5ECSA 4G10A 3MNGA 1FW1A 2FHEA 3ZITA 1ZYNA 4EE0A 1TTZA 4JBBA 1X9MB 2LNTA 5CO3A 5IPGA 2HSHA 3TRQA 2CVKA 5C00A 3RHCA 3O3TA 1EOHA 1K0CA 4F82A 2C0EA 1A8LA 2YANA 1WPIA 3G7YA 3C1RA 2VL3A 4EL1A 5ECHB 2B3SA 3TKPA 2G2QA 4N3ZA 1WE0A 4EC0A 1TI1A 5B8AA 3FK8A 3ZVJD 2WVXB 3DVWA 4K7OA 5LD0A 4OMVA 4XS6A 3QAVA 5JCWA 1M0UA 1O81A 1TRSA 1ZGNA 4HI7A 1AAZA 5AIXA 4PI2C 3UJ1A 1SYRA 4NHWA 2CX4A 3TRXA 3ED3A 2FA4A 4CW9A 2Z9SA 2H0GA 2VLTA 2IFQA 1K0NA 3I43A 2OBKA 5FWGA 2LQQA 2RLIA 1ERWA 4XIHA 4QL7A 2VCZA 3W8JA 5G30A 3D4MA 1M9AA 3ZIJA 17GSA 5DAKA 4O5RA 1G6YA 2LUSA 1TK8B 4TR1B 4DVCA 1SKWB 1ZYEA 1B8XA 2OKAA 3HYPA 1A23A 1ACVA 3DGQA 2K9FA 4GTUA 3RHBA 3FZ9A 4AKXB 4GWRA 1M7TA 1Z9HA 4L0UA 1QXHA 4V1Ag 5JWRB 2VCXA 1OC9B 5A1NB 5J47A 4V1Ap 2DMMA 2O7KA 4OO5A 1ON4A 2O36A 2VCWA 2H1DA 4MF6A 10GSA 5ECLB 1DE2A 3DKSA 1RW1A 3WGDA 3KP8A 2WDUA 2AAWA 1GP1A 4FYBA 2PUKC 1SYXA 2LRNA 3TKRA 2V6OA 2O8VB 4GCIA 5BRTA 1TK0B 4L8EA 4J56E 3IR4A 3KCMA 4AKHA 2IN3A 5BMUB 5B8BA 4WR5A 4BA7A 2F51A 2JACA 4HJMA 4XS4B 2XPDA 3O76A 1S3DA 3GV1A 5DQSA 1TU8A 3D21A 2MBTA 2P31A 2VCQA 1NW2A 3GKMA 1RQMA 4TKYA 2ZUPA 2C3QA 2JZRA 4LMWA 5KEJA 3FRCA 3ZVJA 3ERWA 4ECIA 4X43A 2H8LA 4HU9A 3FZAA 1Z5YE 5HR1A 2ES7A 4PNFA 1TK5B 3ZLPA 4PHZC 2A2PA 3LWAA 2HXKA 3QD9A 4K6XA 4GSSA 5JWOB 2CZ3A 1V98A 4ZBAA 4ACSA 3KH9A 3M1GA 4KCAA 2V6KA 4D73B 2C4JA 3Q19A 3H8QA 4WETA 4IN0A 4IW9A 2AYTA 2X49A 5J5NA 2VCVA 2R3XA 2GQMA 3MDKA 5FT3A 2VM1A 5IMZA 5B6NA 4FYUA 3A5WA 4NWYA 4K2XA 1SJZA 1SKSB 3F3QA 5A1NA 1XWKA 2OT3A 2KP2A 3HZ4A 4AJ8A 2KP1A 2DJ3A 2HQTA 1S3RA 4GRFA 3FYGA 2C1YA 2TRCP 5ID2B 2MZCA 2HFDA 2L57A 1M9BA 3BBYA 1HNCA 3FHKA 1MD4A 3APOA 1XWBA 4USSA 5KOXA 1JLVA 2H76A 1R26A 1SK0A 5GZZB 4XCSA 4I8BA 1M99A 4PTSA 1WOUA 5BMUA 4MK3A 3M9KA 4MZBA 2H75A 3DIEA 1PGTA 5GSSA 4XS4A 5G31A 1AC1A 1AIUA 3GN3A 3VWVA 5CRWA 4GXZA 1GLPA 4ZL7A 3ZMLA 2GT5A 1MEKA 1JFUA 4MPGA 3TJKA 2C3NA 1X5EA 4ECBA 4AGSA 4HQZA 2DSAA 5IOWA 1GTIA 1GSYA 3IK9A 3EU4A 2LRCA 3GHAA 5CRHA 3GYKA 3ME8A 1A24A 1W4VA 2YJ7A 5EPFA 3IC4A 1H75A 3TOTA 4FXYP 5A4WA 1SD9A 2NBSA 1A8YA 2YJHA 3ZMKA 1FVJA 2FWHA 4D73A 2OE0A 1SK1A 4RI7A 1T3BA 4OO4A 4DSRA 4PXOA 2I9HA 2VD0A 4XHMA 4ZIJA 5ECKB 3P7XA 3TJBA 2RM5A 3C1SA 3H93A 3HHVA 3GH6A 1ZZYA 2CA8A 2WJUA 1WJKA 2WZSA 2DBCA 4RQRA 4PQHA 2VOCA 1GTBA 3A5IA 2IMKA 2KUCA 1ZMAA 2KHPA 3QOUA 1ST9A 2M46A 3CTFA 1A2LA 3TKSC 4Q5NA 5ID2A 1SK2A 4BWSA 2CV4A 5J4VA 1YDKA 2H1BA 5CP1A 4PNGA 2L4CA 1T4YA 3AY8A 2F8FA 4P3YB 3ISOA 3F0IA 1UVZA 2YN1A 4FYCA 5AISA 5ELAA 2LS5A 4J2FA 4JE1A 6GSTA 4QQ7A 2C0GA 4WBRD 5J9CA 4ML1A 2GSRA 3LXTA 4IGJA 5LNKe 1NHYA 3TOUA 3F6DA 3SWLA 3E9JB 3WT2A 3VURA 3EPTA 1C72A 5J41A 4XRDA 1PX6A 1EZKA 4YAPA 3UVTA 2UV8G 2PERA 2K6VA 3BCIA 1Z7PA 4POLA 3FR9A 3LW9A 22GSA 2K8SA 4OFMA 2L6CA 14GSA 3W8SA 4PX1A 2GLRA 2M72A 2PGTA 2VL2A 2OA7A 1VF2A 4N10A 2HRFA 1DUGA 4KB3A 2O85A 4G0IA 5D8IA 1GSFA 2OE1A 4HOJA 2O5VA 3CSIA 1ILOA 1E6BA 18GSA 3KXOA 3ZFLA 2V32A 3F6FA 4KX4A 1K0BA 3DRNA 3M9JA 5FHIA 3I6AA 3HY2A 3D6IA 4LL1B 3L9SA 1Y6EA 3CRTA 4NHZA 3TCOA 2OBIA 5HFIA 4G0KA 2K8VA 5G5FA 1PMTA 3TDGA 4E8HA 5ELGA 1E2YA 3TGZA 4NV5A 3L9VA 4K0GA 1ML6A 3F4RA 1OYJA 1SD8A 1VRSD 1H4OA 1FB0A 2AB6A 3BD2A 4TR3A 3CTGA 1XW5A 4TRXA 4TR0A 4KAEA 3S9FA 4Z2RA 1X5CA 4Z2TA 2AJQB 5EVOA 3IE3A 2MMZA 2A2RA 4F0BA 3GKKA 2ALBA 1QK8A 1B4QA 1Z3EA 4I2TA 1OAZA 1BF5A 4YQMA 1S3CA 3D0ZA 5IMVA 2WW0A 2C0DA 4EIPA 1FAAA 1A0FA 3KMNA 5CNWA 3L9UA 4W66A 1OC3A 5DVBA 1GNEA 1T00A 1NHOA 1T8EB 2H6ZA 3QR6A 2A4VA 3TRPA 3MSZA 1LJRA 1Y25A 4MJEA 1O8WA 2GSQA 2I3YA 3VPQA 5CREA 2OE3A 1LU4A 20GSA 2GDRA 11GSA 2P0GA 1B48A 4V2MA 3TJJA 4HEA2 2X8HA 3HCZA 4AKIA 4KUNA 1GULA 3H4KA 4IJ3A 5G2ZA 2VL2C 1TJDA 3R2QA 4MMMA 4IKHA 2QKEA 1JZOA 3O6TA 1Z6MA 2REMA 3WGEA 4YKFA 1G7OA 3QDNA 3IHGA 3CXGA 16GSA 2H73A 3APQA 4TW5A 4I5QA 1EOGA 1TOFA 1XWAA 1I5GA 1THXA 4HDEA 1ABAA 2FWFA 1B4PA 2X8CA 5J40A 3FKFA 2YWNA 3NIVA 4E68A 1USBA 3PR8A 1FB6A 3F3RA 2R5GA 2HSMB 2DIZA 3ZIVA 1FOHA 5D73A 2CQ9A 2EIRA 4GSNA 3EC3A 2GS3A 3ZREA 2B5EA 1O6JA 3TU3B 1TRVA 1N25A 2YCDA 2ZNMA 2HSNB 1KEBA 2H74A 7GSSA 2B1KA 4LMVA 4ILFA 4ML6A 1R5AA 4YH2A 4AI6A 5D9XA 5D9VA 1JZDA 2AUVA 1YQ1A 2L5LA 3RBTA 1FHEA 2E2MA 4FQUA 3WYWA 4GQCA 5ECQB 3ZTLA 3DXBA 1XXUA 2IMDA 1SL1B 5IQYA 5JWQB 4HSCX 1VF4A 2WW1A 2XHFA 3LFLA 2DJ0A 1VF1A 1YVLA 2MMNA 1CQHA 4KCEA 2X64A 1EEMA 1ZYQB 3TUEA 5LCZA 4MH3A 3EMXA 1EP7A 2ZCTA 4K1FA 2N5BA 1DSBA 4WR4A 2QSIA 4DEJA 3LGCA 3VWXA 1PRXA 1KBNA 1URMA 4NAXA 5KOWA 3MWHA 2HNLA 2R6KA 4KSMA 1GSSA 1K0MA 3IXRA 2B7KA 3GX0A 4K5RA 3BJ5A 3F9UA 1ERTA 1QQ2A 1PN0A 3U6VA 4MLYA 4NV2A 1FG4A 1J0FA 2WVXA 4TXVA 4YQUA 3FY7A 1EV4A 1A0RP 2E0QA 1TRWA 6GSUA 3MIXA 4OD7A 4OFTA 3EINA 2VKZG 2PPTA 2HSMA 1X9WB 2QA1A 4BVXB 5IMDA 1SVMA 4ZILA 3HVVA 1PL1A 3GH9A 3VI7A 1B9YC 2L5OA 1EEJA 1XBSA 3F63A 3ZYWA 1XIYA 4YAVA 3IA1A 4HS1A 3CBUA 2JSZA 4L0WA 2MYGA 2VO4A 3CWGA 5DCGA 2HZFA 1TXUA 3HVXA 4KSOA 4TR1A 1U88A 1BAYA 2HSNA 4RQXA 1T1VA 3IHQA 4LLRA 2PBJA 3IBHA 2ON5A 5DJMA 4F0CA 4IQAA 1VF3A 2VUPA 3QAWA 2HZEB 2J9HA 2YNXA 3QFBC 2R2JA 4KA0A 4NXIA 1M2AA 2EIQA 2WB9A 5KN0A 3RPPA 1K0OA 5DBQA 3DD3A 3F8UA 3KIJA 3EYTA 3ZL5A 5G1LA 3DYRA 2CVBA 2FY6A 1OC9A 4JRRA 8GSSA 3PINA 3QAGA 3ERGA 4HZ4A 2H1LA 3TKSA 2AV4A 1GSDA 3GX8A 5DALB 4EUYA 2JZTA 2LJKA 1T7PB 5IMAA 2CT6A 2FWGA 3CSJA 1YEPA 3GL3A 5ABRA 4IJIA 4WXTA 2PVOC 2PWJA 1Z7RA 1EGRA 4ID0A 1UC7A 1CQGA 1SJ6A 1M3JA 3GTUB 2L6DA 4EIQA 3IRAA 2J23A 2I1UA 3APSA 3UL3A 2N5AA 5F06A 4IS0A 2LJAA 2QA2A 1V40A 1OKDA 1YF1A 1EP8A 2TRXA 3TJGA 2R0GA 1QUWA 3LYPA 4G0LA 4BVXA 2H66A 3GA4A 5HFGA 2YV7A 1A2MA 4KDYA 2F3MA 1X5DA 2FWEA 2H1GA 2FCHA 2VL9A 3DWVA 4N0ZA 1GSQA 1XWCA 3P8WA 2GQLA 2O3EA 4L5LA 1MD3A 1I9DA 3D4TA 1AW9A 3UOMA 4OFNA 2WW2A 4XTSA 1GLQA 1YEXA 3HXSA 2HZEA 3BOAA 2IJYA 5DJLA 5A5KA 4Q5RA 1G6WA 1IYIA 1AUCA 3TKQA 2IPAA 5D9WA 2V41A 4ICYA 4E8EA 4MCUA 5L71A 2C0FA 5CYYA 3GKNA 2YZHA 2GQKA 4IP1A 5DALA 2LKUA 2H19A 1WMJA 2DKIA 4GQFA 1GUMA 5E59A 4LA1A 2PN8A 1XG8A 6GSSA 3OR5A 4GDFA 5IMCA 4TN8A 2H72A 3LEFA 3VWWA 1R7HA 1GRXA 1AQVA 5AIVA 4ZB8A 4XRAA 1YJ6A 2FA8A 4L5OA 4FO5A 2QC7A 4BVYB 4AJ7A 3H79A 1GNWA 3EVIA 3FEUA 2DMLA 3GUSA 1GTAA 3GTUA 3DVXA 5H5RA 4KE3A 3G7IA 4OWYA 1UA5A 1GH2A 1N2AA 2PU9C 1PD21 3UMAA 4PQ1A 3HA9A 3HDCA 2YPMA 2YP6A 4X0XA 2WZ9A 3US3A 2FD3A 2C3TA 4ZB6A 4Z2UA 4ECCA 4TOPA 2G0FA 3GNJA 1M3IA 3P90A 3IAS2 1VGLA 4O7HA 2V2GA 1FVKA 1EWXA 4V2NA 3VFIA 1W89A 1SJIA 2GSTA 1A2JA 3M3MA 1MDIA 6GSVA 4EO3A 3RDWA 1JLWA 5AGYA 4H86A 4EKZA 1PN9A 2GZYA 3HJOA 1ZL9A 1BG5A 2O87A 4K8MA 2MBSA 4TXOB 4YKGA 4TVEA 3ZFBA 4RI6A 2MMOA 4N11A 3TJFA 3VI5A 1GSEA 3UVHA 4QMKA 1MTCA 3VWUA 2VLVA 1SENA 3FR3A 4BIKA 1SL2B 5INYA 1SU9A 6GSWA 1YKCA 3QMXA 3EURA 2HLSA 2LQOA 1G7EA 2B5YA 2LJRA 4KDXA 4PGTA 3TB2A 1X9SB 4PUFC 5HR3A 3KMOA 1AXDA 1U87A 5HFKA 3DMLA 4BVYA 1K3OA 3W6GA 3UIWA 4MABA 4EVMA 5GAND 4O92A 12GSA 3KP9A 2X8GA 1NM3A 4Q5FA 2WRTA 2H30A 5ENUA 1XW9A 3LQ7A 2IFQB 1LBKA 3QCPA 1F37A 1MDJA 1BG1A 2P5RA 5HR2A 1PSQA 1PKWA 4GSTA 5HQPA 1F9MA 13GSA 2VM2A 3CMIA 4ZL9A 2IWTA 4ZB9A 2X99A 2QGVA 5HR0A 4MDCA 3P2AA 5IO2A 2L4QA 1BQ7A 4FH8A 1TW9A 1F3AA 4MZWA 1K0AA 3GSTA 2H6YA 4JR6A 5ECNB 1GSUA 6GSYA 3IAM2 3MYDA 5J3RA 4IVFA 4G2EA 5ECRB 4KF9A 1OKTA 1XZOA 4TXOA 2EFHA 5C04A 1XWGA 2RUEA 3CQFA 2GGTA 2YZUA 2N5FA 3KEBA 4RUVA 3GMFA 1O7UA 3HJMA 3IPZA 4EDZA 2ON7A 4CY6A 4J57E 4JU5A 3N9JA 4GF0A 1HYUA 1OE7A 2DC5A 3WD6A 1N8JA 3L4NA 2E2GA 3IOSA 2B6MA 3C71A 1PX7A 1RK4A 1M2DA 2H6XA 3Q18A 1KTEA 2RUFA 4K2DA 4K7IA 4AF2A 3GRXA 3DEXA 2OADA 3UBLA 3PGTA 2RIIA 2GZZA 4K9ZA 4MH2A 1F6MC 1ZCPA 4WEYA 3K8NA 1Q4JA 2HRAA 4F2IA 1DBYA 3F4SA 2IMEA 3UEMA 4IHUA 3G7JA 3C8EA 5CAXA 2H0IA 5A4UA 3WGXA 3VK9A 2LV3A 4LL4B 3A2WA 1XOBA 4HZ2A 1QMVA 1WWJA 3UBKA 4G01A 3U5RE 5IMFA 5F05A 1Y1UA 1BX9A 2DJKA 1GUKA 2WFCA 2V1MA 1TRUA 2DJ1A 2R37A 2CVDA 4JZQA 4MA9A 2EFEA 4BWQA 2HI7A 5A5HB 5DQYA 5KN2A 1F2EA 3D5JA 1JHBA 2DKHA 3LORA 5A34B 2D2ZA 1HNAA 3E0UA 2H70A 2IMIA 1BEDA 4WF5A 4G19A 3KM6A 4F03A 5JCGA 4OCEA 2EC4A 1YF0A 4KDUA 4I97A 4A5PA 1I1IP 1OVNA 2UZ8A 2DIYA 3N5OA 3EMPA 4AJ6A 1WRYA 4CHSA 2JADA 1TKDB 3IK7A 4POBA 2C80A 2YOIA 3Q74A 1XCCA 2LNSA 4PI0C 2F8AA 2HT9A 3VLNA 2M80A 1TP9A 1K3YA 2OACA 19GSA 4N0VA 5F0GA 2BJXA 4K7NA 5CRGA 2E7PA 4DSSB 4O32A 1ERVA 1KNGA 4NPBA 2NVLA 1BJXA 4I2UA 4Z7XA 4OCFA 2JU5A 1SVLA 3FZ5A 2R4VA 3IC8A 1R4WA 3ZRDA 1WP0A 4BL7B 1V57A 9GSSA 4MJBA 5H5QA 5J9BA 5F07A 4EDYA 3A3TA 5DCHA 2EIOA 3KZQA 2H1AA 3ERFA 1YY7A 3LXZA
chains in the Genus database with same CATH topology
1ERUA 2HSYA 2EFDA 2I81A 4MNNA 1PA3A 2IIYA 3G9BA 5CRDA 2FGXA 2PMTA 1HD2A 4HJ2A 3CRUA 1SKRB 5IO0A 4WKWA 2B7JA 2VAFA 3IV4A 3NZNA 1Q98A 3D22A 5B6MA 4XS1A 3GIXA 2DLXA 5A5HA 3LSZA 3KJYA 5DDLA 3KTLA 2WULA 3R3EA 3JCML 3C73A 2HRKB 5IM9A 5A34A 4X1UA 4N30A 2OJLA 3KGKA 5G1KA 1GWCA 4ZBDA 2CX3A 3KD0A 2LRTA 1XFLA 4WF4A 4F9ZA 2YV9A 3PPUA 2NDOA 4WBJA 2F9SA 2CAQA 2YWOA 3FW2A 1IYHA 1G0TA 1K0DA 5ECOB 4BPYA 2P5QA 1GUHA 3ME7A 4POKA 4KNDA 3TKSE 3UAPA 1JZRA 4MPFA 1O85A 2HRNA 2VIMA 1XOAA 1TXXA 3C7MA 3HJPA 4PUAA 3QFAC 4KW6A 1GL8A 4ZB7A 2B1LA 3FMWA 3FZ4A 5D96A 3J7Yk 4HU7A 4ULXA 2K18A 4EXJA 2FUG2 3ZZXA 1V2AA 5D9TA 1V58A 4ZL8A 4DSSA 1SVOA 4IP6A 1M2BA 4IELA 4HUAA 2JZSA 5ECIB 1YZXA 3L78A 1DE1A 4BL7A 2MMAA 5IOXA 2VLUA 2A2SA 2IL3A 2NTOA 4KH7A 2NPBA 2GT6A 1TI3A 4ZXGA 1OC8A 3M8NA 3RPNA 3V1WA 2XPEA 1EGOA 5G5EA 2LSTA 4CY8A 1HQOA 4JEDA 3GFKA 2H71A 5ECPB 4IQ1A 3EWLA 3GL5A 3LYKA 4MP4A 2LEGA 1J08A 3F4TA 3KTBA 1V9WA 1PKZA 3I9V2 3HKRA 1GTUA 2JSYA 2RM6A 2HRKA 5B7CA 3EU3A 2DJJA 3PH9A 1U3AA 5GSTA 2EFCA 2VCTA 1FO5A 2CAIA 4ZBBA 2GTUA 1SL0B 1J9BA 5JCUA 2R0CA 2GSSA 2H01A 3HD5A 2GZPA 2A4HA 5J4YA 3RAZA 3J7Yb 4O5UA 1PQNA 2TIRA 3M0FA 5EL8A 3A2XA 3HZ8A 4NMUA 2WS2A 1B9XC 2IMFA 1TDIA 4AKGA 2AHEA 4MF7A 3LJRA 2LTKA 2C8UA 4POMA 3E3EA 3GSSA 1UN2A 2BMXA 1TU7A 3CSHA 3SBCA 4I6XA 3L0HA 1NSWA 4G9HA 2CZ2A 2KOKA 2PVQA 2KLXA 2B5XA 2WCIA 5F8BA 3Q6OA 5ECMB 3HVSA 3LG6A 5COHA 3BCKA 1WIKA 2X4AA 2XBIA 2FLSA 1JZWA 2YWIA 4MJCA 6GSXA 1XVWA 3WT1A 5J4UA 1O73A 3IDVA 5D93A 2I4AA 4ECJA 4PQIA 3HMJG 4TR4A 1ZYPA 3UARA 3MAKA 4K5SA 3NOFA 4YQVA 1AQXA 2VD1A 3FR6A 5EY6A 1XPVA 1U3IA 3QPMA 4PURA 2H0HA 1K3LA 4CDOA 3I69A 2HYXA 2FNOA 4QL9A 2JL4A 5H5SA 1QGVA 1F3BA 4KGIA 3KH7A 4DSQA 2YWMA 4MZCA 5KN1A 2L59A 1X0RA 2O89A 1Z6NA 2HE3A 4ISDA 1QFNA 5IIZA 2XBQA 1THOA 5GAPD 1HNBA 1EV9A 1FOVA 3GURA 4JR4A 4MJAA 1O8XA 5IPHA 5A4VA 3H1NA 4K0NA 1BYEA 4FIWA 4IBPA 4GLTA 2R0PA 1AQWA 1YKAA 3EE2A 5DAKB 2BTOT 4Q5QA 5KN3A 1PL2A 3A2VA 4X4JA 2GVPA 2DJ2A 4EF0A 5AN1A 1T4ZA 1S3AA 2WGRA 2XC2A 4HQSA 5E4WA 4O5QA 1MDKA 3GKXA 1U6TA 1R5PA 1ZOFA 3CYNA 4MF5A 3VPTA 1XW6A 1OE8A 1XVQA 4V2LA 5ECSA 4G10A 3MNGA 1FW1A 2FHEA 3ZITA 1ZYNA 4EE0A 1TTZA 4JBBA 1X9MB 2LNTA 5CO3A 5IPGA 2HSHA 3TRQA 2CVKA 5C00A 3RHCA 3O3TA 1EOHA 1K0CA 4F82A 2C0EA 1A8LA 2YANA 1WPIA 3G7YA 3C1RA 2VL3A 4EL1A 5ECHB 2B3SA 3TKPA 2G2QA 4N3ZA 1WE0A 4EC0A 1TI1A 5B8AA 3FK8A 3ZVJD 3DVWA 4K7OA 5LD0A 4OMVA 4XS6A 3QAVA 5JCWA 1M0UA 1O81A 1TRSA 1ZGNA 4HI7A 3LXZA 1AAZA 5AIXA 3UJ1A 1SYRA 4NHWA 2CX4A 3TRXA 3ED3A 2FA4A 4CW9A 2Z9SA 2H0GA 2VLTA 2IFQA 1K0NA 3I43A 2OBKA 5FWGA 2LQQA 2RLIA 1ERWA 4XIHA 4QL7A 2VCZA 3W8JA 5G30A 3D4MA 1M9AA 3ZIJA 17GSA 5DAKA 4O5RA 1G6YA 2LUSA 1TK8B 4TR1B 4DVCA 1SKWB 1ZYEA 1B8XA 2OKAA 3HYPA 1A23A 1ACVA 3DGQA 2K9FA 4GTUA 3RHBA 3FZ9A 4AKXB 4GWRA 1M7TA 1Z9HA 4L0UA 1QXHA 4V1Ag 5JWRB 2VCXA 1OC9B 5A1NB 5J47A 4V1Ap 2DMMA 2O7KA 4OO5A 1ON4A 2VCWA 2H1DA 4MF6A 10GSA 5ECLB 1DE2A 3DKSA 1RW1A 3WGDA 3KP8A 2WDUA 2AAWA 1GP1A 4FYBA 2PUKC 1SYXA 2LRNA 3TKRA 2V6OA 2O8VB 4GCIA 5BRTA 1TK0B 4L8EA 4J56E 3IR4A 3KCMA 4AKHA 2IN3A 5BMUB 5B8BA 4WR5A 4BA7A 2F51A 2JACA 4HJMA 4XS4B 2XPDA 3O76A 1S3DA 3GV1A 5DQSA 1TU8A 3D21A 2MBTA 2P31A 2VCQA 1NW2A 3GKMA 1RQMA 4TKYA 2ZUPA 2C3QA 2JZRA 4LMWA 5KEJA 3FRCA 3ZVJA 3ERWA 4ECIA 4X43A 2H8LA 4HU9A 3FZAA 1Z5YE 5HR1A 2ES7A 4PNFA 1TK5B 3ZLPA 2A2PA 3LWAA 2HXKA 3QD9A 4K6XA 4GSSA 5JWOB 2CZ3A 1V98A 4ZBAA 4ACSA 3KH9A 3M1GA 4KCAA 2V6KA 4D73B 2C4JA 3Q19A 3H8QA 4WETA 4IN0A 4IW9A 2AYTA 2X49A 5J5NA 2VCVA 2R3XA 2GQMA 3MDKA 5FT3A 2VM1A 5IMZA 5B6NA 4FYUA 3A5WA 4NWYA 4K2XA 1SJZA 1SKSB 3F3QA 5A1NA 1XWKA 2OT3A 2KP2A 3HZ4A 4AJ8A 2KP1A 2DJ3A 2HQTA 4GRFA 3FYGA 2C1YA 2TRCP 5ID2B 2MZCA 2HFDA 2L57A 1M9BA 3BBYA 1HNCA 3FHKA 1MD4A 3APOA 1XWBA 4USSA 5KOXA 1JLVA 2H76A 1R26A 1SK0A 5GZZB 4XCSA 4I8BA 1M99A 4PTSA 1WOUA 5BMUA 4MK3A 3M9KA 4MZBA 2H75A 3DIEA 1PGTA 5GSSA 4XS4A 5G31A 1AC1A 1AIUA 3GN3A 3VWVA 5CRWA 4GXZA 1GLPA 4ZL7A 3ZMLA 2GT5A 1MEKA 1JFUA 4MPGA 3TJKA 2C3NA 1X5EA 4ECBA 4AGSA 4HQZA 2DSAA 5IOWA 1GTIA 1GSYA 3IK9A 3EU4A 2LRCA 3GHAA 5CRHA 3GYKA 3ME8A 1A24A 1W4VA 2YJ7A 5EPFA 3IC4A 1H75A 3TOTA 5A4WA 1SD9A 2NBSA 1A8YA 2YJHA 3ZMKA 1FVJA 2FWHA 4D73A 2OE0A 1SK1A 4RI7A 1T3BA 4OO4A 4DSRA 4PXOA 2I9HA 2VD0A 4XHMA 4ZIJA 5ECKB 3P7XA 3TJBA 2RM5A 3C1SA 3H93A 3HHVA 3GH6A 1ZZYA 2CA8A 2WJUA 1WJKA 2DBCA 4RQRA 4PQHA 2VOCA 1GTBA 3A5IA 2IMKA 2KUCA 1ZMAA 2KHPA 3QOUA 1ST9A 2M46A 3CTFA 1A2LA 3TKSC 4Q5NA 5ID2A 1SK2A 4BWSA 2CV4A 5J4VA 1YDKA 2H1BA 5CP1A 4PNGA 2L4CA 1T4YA 3AY8A 2F8FA 4P3YB 3ISOA 3F0IA 1UVZA 2YN1A 4FYCA 5AISA 5ELAA 2LS5A 4J2FA 4JE1A 6GSTA 4QQ7A 2C0GA 4WBRD 5J9CA 4ML1A 2GSRA 3LXTA 4IGJA 5LNKe 1NHYA 3TOUA 3F6DA 3SWLA 3E9JB 3WT2A 3VURA 3EPTA 1C72A 5J41A 4XRDA 1PX6A 1EZKA 4YAPA 3UVTA 2UV8G 2PERA 2K6VA 3BCIA 1Z7PA 4POLA 3FR9A 3LW9A 22GSA 2K8SA 4OFMA 2L6CA 14GSA 3W8SA 4PX1A 2GLRA 2M72A 2PGTA 2VL2A 2OA7A 1VF2A 4N10A 2HRFA 1DUGA 4KB3A 2O85A 4G0IA 5D8IA 1GSFA 2OE1A 4HOJA 2O5VA 3CSIA 1ILOA 1E6BA 18GSA 3KXOA 3ZFLA 2V32A 3F6FA 4KX4A 1K0BA 3DRNA 3M9JA 5FHIA 3I6AA 3HY2A 3D6IA 4LL1B 3L9SA 1Y6EA 3CRTA 4NHZA 3TCOA 2OBIA 5HFIA 4G0KA 2K8VA 5G5FA 1PMTA 3TDGA 4E8HA 5ELGA 1E2YA 3TGZA 4NV5A 3L9VA 4K0GA 1ML6A 3F4RA 1OYJA 1SD8A 1VRSD 1H4OA 1FB0A 2AB6A 3BD2A 4TR3A 3CTGA 1XW5A 4TRXA 4TR0A 4KAEA 3S9FA 4Z2RA 1X5CA 4Z2TA 2AJQB 5EVOA 3IE3A 2MMZA 2A2RA 4F0BA 3GKKA 2ALBA 1QK8A 1B4QA 1Z3EA 4I2TA 1OAZA 1BF5A 4YQMA 1S3CA 3D0ZA 5IMVA 2C0DA 4EIPA 1FAAA 1A0FA 3KMNA 5CNWA 3L9UA 4W66A 1OC3A 5DVBA 1GNEA 1T00A 1NHOA 1T8EB 2H6ZA 3QR6A 2A4VA 3TRPA 3MSZA 1LJRA 1Y25A 4MJEA 1O8WA 2GSQA 2I3YA 3VPQA 5CREA 2OE3A 1LU4A 20GSA 2GDRA 11GSA 2P0GA 1B48A 4V2MA 3TJJA 4HEA2 2X8HA 3HCZA 4AKIA 4KUNA 1GULA 3H4KA 4IJ3A 5G2ZA 2VL2C 1TJDA 3R2QA 4MMMA 4IKHA 2QKEA 1JZOA 3O6TA 1Z6MA 2REMA 3WGEA 4YKFA 1G7OA 3QDNA 3IHGA 3CXGA 16GSA 2H73A 3APQA 4TW5A 4I5QA 1EOGA 1TOFA 1XWAA 1I5GA 1THXA 4HDEA 1ABAA 2FWFA 1B4PA 2X8CA 5J40A 3FKFA 2YWNA 3NIVA 4E68A 1USBA 3PR8A 1FB6A 3F3RA 2R5GA 2HSMB 2DIZA 3ZIVA 1FOHA 5D73A 2CQ9A 2EIRA 4GSNA 3EC3A 2GS3A 3ZREA 2B5EA 1O6JA 3TU3B 1TRVA 1N25A 2YCDA 2ZNMA 2HSNB 1KEBA 2H74A 7GSSA 2B1KA 4LMVA 4ILFA 4ML6A 1R5AA 4YH2A 4AI6A 5D9XA 5D9VA 1JZDA 2AUVA 1YQ1A 2L5LA 3RBTA 1FHEA 2E2MA 4FQUA 3WYWA 4GQCA 5ECQB 3ZTLA 3DXBA 1XXUA 2IMDA 1SL1B 5IQYA 5JWQB 1VF4A 2XHFA 3LFLA 2DJ0A 1VF1A 1YVLA 2MMNA 1CQHA 4KCEA 2X64A 1EEMA 1ZYQB 3TUEA 5LCZA 4MH3A 3EMXA 1EP7A 2ZCTA 4K1FA 2N5BA 1DSBA 4WR4A 2QSIA 4DEJA 3LGCA 3VWXA 1PRXA 1KBNA 1URMA 4NAXA 5KOWA 3MWHA 2HNLA 2R6KA 4KSMA 1GSSA 1K0MA 3IXRA 2B7KA 3GX0A 4K5RA 3BJ5A 3F9UA 1ERTA 1QQ2A 1PN0A 3U6VA 4MLYA 4NV2A 1FG4A 1J0FA 4TXVA 4YQUA 3FY7A 1EV4A 1A0RP 2E0QA 1TRWA 6GSUA 3MIXA 4OD7A 4OFTA 3EINA 2VKZG 2PPTA 2HSMA 1X9WB 2QA1A 4BVXB 5IMDA 1SVMA 4ZILA 3HVVA 1PL1A 3GH9A 3VI7A 1B9YC 2L5OA 1EEJA 1XBSA 3F63A 3ZYWA 1XIYA 4YAVA 3IA1A 4HS1A 3CBUA 2JSZA 4L0WA 2MYGA 2VO4A 3CWGA 5DCGA 2HZFA 1TXUA 3HVXA 4KSOA 4TR1A 1U88A 1BAYA 2HSNA 4RQXA 1T1VA 3IHQA 4LLRA 2PBJA 3IBHA 2ON5A 5DJMA 4F0CA 4IQAA 1VF3A 2VUPA 3QAWA 2HZEB 2J9HA 2YNXA 3QFBC 2R2JA 4KA0A 4NXIA 1M2AA 2EIQA 2WB9A 5KN0A 3RPPA 1K0OA 5DBQA 3DD3A 3F8UA 3KIJA 3EYTA 3ZL5A 5G1LA 3DYRA 2CVBA 2FY6A 1OC9A 4JRRA 8GSSA 3PINA 3QAGA 3ERGA 4HZ4A 2H1LA 3TKSA 2AV4A 1GSDA 3GX8A 5DALB 4EUYA 2JZTA 2LJKA 1T7PB 5IMAA 2CT6A 2FWGA 3CSJA 1YEPA 3GL3A 5ABRA 4IJIA 4WXTA 2PVOC 2PWJA 1Z7RA 1EGRA 4ID0A 1UC7A 1CQGA 1SJ6A 3GTUB 2L6DA 4EIQA 3IRAA 2J23A 2I1UA 3APSA 3UL3A 2N5AA 5F06A 4IS0A 2LJAA 2QA2A 1V40A 1OKDA 1YF1A 1EP8A 2TRXA 3TJGA 2R0GA 1QUWA 3LYPA 4G0LA 4BVXA 2H66A 3GA4A 5HFGA 2YV7A 1A2MA 4KDYA 2F3MA 1X5DA 2FWEA 2H1GA 2FCHA 2VL9A 3DWVA 4N0ZA 1GSQA 1XWCA 3P8WA 2GQLA 4L5LA 1MD3A 1I9DA 3D4TA 1AW9A 3UOMA 4OFNA 4XTSA 1GLQA 1YEXA 3HXSA 2HZEA 3BOAA 2IJYA 5DJLA 5A5KA 4Q5RA 1G6WA 1IYIA 1AUCA 3TKQA 2IPAA 5D9WA 2V41A 4ICYA 4E8EA 4MCUA 5L71A 2C0FA 5CYYA 3GKNA 2YZHA 2GQKA 4IP1A 5DALA 2LKUA 2H19A 1WMJA 2DKIA 4GQFA 1GUMA 5E59A 4LA1A 2PN8A 6GSSA 3OR5A 4GDFA 5IMCA 4TN8A 2H72A 3LEFA 3VWWA 1R7HA 1GRXA 1AQVA 5AIVA 4ZB8A 4XRAA 1YJ6A 2FA8A 4L5OA 4FO5A 2QC7A 4BVYB 4AJ7A 3H79A 1GNWA 3EVIA 3FEUA 2DMLA 3GUSA 1GTAA 3GTUA 3DVXA 5H5RA 4KE3A 3G7IA 4OWYA 1UA5A 1GH2A 1N2AA 2PU9C 1PD21 3UMAA 4PQ1A 3HA9A 3HDCA 2YPMA 2YP6A 4X0XA 2WZ9A 3US3A 2FD3A 2C3TA 4ZB6A 4Z2UA 4ECCA 4TOPA 2G0FA 3GNJA 3P90A 3IAS2 1VGLA 4O7HA 2V2GA 1FVKA 1EWXA 4V2NA 3VFIA 1W89A 1SJIA 2GSTA 1A2JA 3M3MA 1MDIA 6GSVA 4EO3A 3RDWA 1JLWA 5AGYA 4H86A 4EKZA 1PN9A 2GZYA 3HJOA 1ZL9A 1BG5A 2O87A 4K8MA 2MBSA 4TXOB 4YKGA 4TVEA 3ZFBA 4RI6A 2MMOA 4N11A 3TJFA 3VI5A 1GSEA 3UVHA 4QMKA 1MTCA 3VWUA 2VLVA 1SENA 3FR3A 1SL2B 5INYA 1SU9A 6GSWA 1YKCA 3QMXA 3EURA 2HLSA 2LQOA 1G7EA 2B5YA 2LJRA 4KDXA 4PGTA 3TB2A 1X9SB 4PUFC 5HR3A 3KMOA 1AXDA 1U87A 5HFKA 3DMLA 4BVYA 1K3OA 3W6GA 3UIWA 4MABA 4EVMA 5GAND 4O92A 12GSA 3KP9A 2X8GA 1NM3A 4Q5FA 2WRTA 2H30A 5ENUA 1XW9A 3LQ7A 2IFQB 1LBKA 3QCPA 1F37A 1MDJA 1BG1A 2P5RA 5HR2A 1PSQA 1PKWA 4GSTA 5HQPA 1F9MA 13GSA 2VM2A 3CMIA 4ZL9A 2IWTA 4ZB9A 2X99A 2QGVA 5HR0A 4MDCA 3P2AA 5IO2A 2L4QA 1BQ7A 4FH8A 1TW9A 1F3AA 4MZWA 1K0AA 3GSTA 2H6YA 4JR6A 5ECNB 1GSUA 6GSYA 3IAM2 3MYDA 5J3RA 4IVFA 4G2EA 5ECRB 4KF9A 1OKTA 1XZOA 4TXOA 2EFHA 5C04A 1XWGA 2RUEA 2GGTA 2YZUA 2N5FA 3KEBA 4RUVA 3GMFA 1O7UA 3HJMA 3IPZA 4EDZA 2ON7A 4CY6A 4J57E 4JU5A 3N9JA 4GF0A 1HYUA 1OE7A 2DC5A 3WD6A 1N8JA 3L4NA 2E2GA 3IOSA 2B6MA 3C71A 1PX7A 1RK4A 1M2DA 2H6XA 3Q18A 1KTEA 2RUFA 4K2DA 4K7IA 4AF2A 3GRXA 3DEXA 2OADA 3UBLA 3PGTA 2RIIA 2GZZA 4K9ZA 4MH2A 1F6MC 1ZCPA 4WEYA 3K8NA 1Q4JA 2HRAA 4F2IA 1DBYA 3F4SA 2IMEA 3UEMA 4IHUA 3G7JA 3C8EA 5CAXA 2H0IA 5A4UA 3WGXA 3VK9A 2LV3A 4LL4B 3A2WA 1XOBA 4HZ2A 1QMVA 1WWJA 3UBKA 4G01A 3U5RE 5IMFA 5F05A 1Y1UA 1BX9A 2DJKA 1GUKA 2WFCA 2V1MA 1TRUA 2DJ1A 2R37A 2CVDA 4JZQA 4MA9A 2EFEA 4BWQA 2HI7A 5A5HB 5DQYA 5KN2A 1F2EA 3D5JA 1JHBA 2DKHA 3LORA 5A34B 2D2ZA 1HNAA 3E0UA 2H70A 2IMIA 1BEDA 4WF5A 4G19A 3KM6A 4F03A 5JCGA 4OCEA 2EC4A 1YF0A 4KDUA 4I97A 4A5PA 1OVNA 2UZ8A 2DIYA 3N5OA 3EMPA 4AJ6A 1WRYA 4CHSA 2JADA 1TKDB 3IK7A 4POBA 2C80A 2YOIA 3Q74A 1XCCA 2LNSA 2F8AA 2HT9A 3VLNA 2M80A 1TP9A 1K3YA 2OACA 19GSA 4N0VA 5F0GA 2BJXA 4K7NA 5CRGA 2E7PA 4DSSB 4O32A 1ERVA 1KNGA 4NPBA 2NVLA 1BJXA 4I2UA 4Z7XA 4OCFA 2JU5A 1SVLA 3FZ5A 2R4VA 3IC8A 1R4WA 3ZRDA 1WP0A 4BL7B 1V57A 9GSSA 4MJBA 5H5QA 5J9BA 5F07A 4EDYA 3A3TA 5DCHA 2EIOA 2H1AA 3ERFA 1YY7A 3KZQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ERU A;  2HSY A;  2I81 A;  1PA3 A;  2IIY A;  3G9B A;  5CRD A;  2FGX A;  2PMT A;  1HD2 A;  4HJ2 A;  3CRU A;  1SKR B;  5IO0 A;  4WKW A;  2B7J A;  2VAF A;  3IV4 A;  3NZN A;  1Q98 A;  3D22 A;  5B6M A;  4XS1 A;  3GIX A;  2DLX A;  3LSZ A;  3KJY A;  5DDL A;  3KTL A;  2WUL A;  3R3E A;  3JCM L;  3C73 A;  2HRK B;  5IM9 A;  4X1U A;  4N30 A;  2OJL A;  3KGK A;  5G1K A;  1GWC A;  4ZBD A;  2CX3 A;  3KD0 A;  2LRT A;  1XFL A;  4WF4 A;  4F9Z A;  3PPU A;  2YV9 A;  2NDO A;  4WBJ A;  2F9S A;  2CAQ A;  2YWO A;  3FW2 A;  1IYH A;  1G0T A;  1K0D A;  5ECO B;  4BPY A;  2P5Q A;  1GUH A;  3ME7 A;  4POK A;  4KND A;  3TKS E;  3UAP A;  1JZR A;  4MPF A;  1O85 A;  2HRN A;  2VIM A;  1XOA A;  1TXX A;  3C7M A;  3HJP A;  4PUA A;  3QFA C;  4KW6 A;  1GL8 A;  2B1L A;  3FZ4 A;  5D96 A;  3J7Y k;  4HU7 A;  4ULX A;  2K18 A;  4EXJ A;  2FUG 2;  3ZZX A;  1V2A A;  5D9T A;  1V58 A;  4ZL8 A;  4DSS A;  4IP6 A;  1M2B A;  4IEL A;  4HUA A;  2JZS A;  5ECI B;  1YZX A;  3L78 A;  1DE1 A;  4BL7 A;  2MMA A;  5IOX A;  2VLU A;  2A2S A;  2IL3 A;  2NTO A;  4KH7 A;  2NPB A;  2GT6 A;  1TI3 A;  4ZXG A;  1OC8 A;  3M8N A;  3RPN A;  3V1W A;  2XPE A;  1EGO A;  5G5E A;  2LST A;  1HQO A;  4JED A;  3GFK A;  2H71 A;  5ECP B;  4IQ1 A;  3EWL A;  3GL5 A;  3LYK A;  4MP4 A;  2LEG A;  1J08 A;  3F4T A;  3KTB A;  1V9W A;  1PKZ A;  3I9V 2;  3HKR A;  1GTU A;  2JSY A;  2RM6 A;  2HRK A;  5B7C A;  3EU3 A;  2DJJ A;  3PH9 A;  1U3A A;  5GST A;  2VCT A;  1FO5 A;  2CAI A;  4ZBB A;  2GTU A;  1SL0 B;  1J9B A;  5JCU A;  2GSS A;  2H01 A;  3HD5 A;  2GZP A;  3RAZ A;  3J7Y b;  1PQN A;  2TIR A;  3M0F A;  5EL8 A;  3A2X A;  3HZ8 A;  4NMU A;  2WS2 A;  1B9X C;  2IMF A;  1TDI A;  2AHE A;  4MF7 A;  3LJR A;  2LTK A;  2C8U A;  4POM A;  3E3E A;  3GSS A;  1UN2 A;  2BMX A;  1TU7 A;  3CSH A;  3SBC A;  4I6X A;  3L0H A;  1NSW A;  4G9H A;  2CZ2 A;  2KOK A;  2PVQ A;  2KLX A;  2B5X A;  2WCI A;  5F8B A;  3Q6O A;  5ECM B;  3HVS A;  3LG6 A;  5COH A;  3BCK A;  1WIK A;  2XBI A;  2FLS A;  1JZW A;  2YWI A;  4MJC A;  6GSX A;  1XVW A;  3WT1 A;  5J4U A;  1O73 A;  3IDV A;  5D93 A;  2I4A A;  4ECJ A;  4PQI A;  4TR4 A;  3UAR A;  3MAK A;  3NOF A;  4YQV A;  1AQX A;  2VD1 A;  3FR6 A;  5EY6 A;  1XPV A;  1U3I A;  3QPM A;  4PUR A;  2H0H A;  1K3L A;  4CDO A;  3I69 A;  2HYX A;  2FNO A;  4QL9 A;  2JL4 A;  5H5S A;  1QGV A;  1F3B A;  4KGI A;  3KH7 A;  4DSQ A;  2YWM A;  4MZC A;  5KN1 A;  2L59 A;  1X0R A;  2O89 A;  1Z6N A;  2HE3 A;  4ISD A;  1QFN A;  5IIZ A;  2XBQ A;  1THO A;  5GAP D;  1HNB A;  1EV9 A;  1FOV A;  3GUR A;  4JR4 A;  4MJA A;  1O8X A;  5IPH A;  5A4V A;  3H1N A;  4K0N A;  1BYE A;  4FIW A;  4IBP A;  4GLT A;  1AQW A;  1YKA A;  3EE2 A;  5DAK B;  2BTO T;  4Q5Q A;  5KN3 A;  1PL2 A;  3A2V A;  2GVP A;  2DJ2 A;  4EF0 A;  5AN1 A;  1T4Z A;  1S3A A;  2WGR A;  2XC2 A;  4HQS A;  5E4W A;  1MDK A;  3GKX A;  1U6T A;  1R5P A;  1ZOF A;  3CYN A;  4MF5 A;  3VPT A;  1XW6 A;  1OE8 A;  1XVQ A;  4V2L A;  5ECS A;  4G10 A;  3MNG A;  1FW1 A;  2FHE A;  3ZIT A;  4EE0 A;  1TTZ A;  4JBB A;  1X9M B;  2LNT A;  5CO3 A;  5IPG A;  2HSH A;  3TRQ A;  2CVK A;  5C00 A;  3RHC A;  3O3T A;  1EOH A;  1K0C A;  4F82 A;  2C0E A;  1A8L A;  2YAN A;  1WPI A;  3G7Y A;  3C1R A;  2VL3 A;  4EL1 A;  5ECH B;  2B3S A;  3TKP A;  2G2Q A;  1WE0 A;  4EC0 A;  1TI1 A;  5B8A A;  3FK8 A;  3ZVJ D;  3DVW A;  4K7O A;  5LD0 A;  4OMV A;  4XS6 A;  3QAV A;  5JCW A;  1M0U A;  1O81 A;  1TRS A;  1ZGN A;  4HI7 A;  3LXZ A;  1AAZ A;  5AIX A;  3UJ1 A;  1SYR A;  4NHW A;  2CX4 A;  3TRX A;  3ED3 A;  2FA4 A;  4CW9 A;  2Z9S A;  2H0G A;  2VLT A;  2IFQ A;  1K0N A;  3I43 A;  2OBK A;  5FWG A;  2LQQ A;  2RLI A;  1ERW A;  4XIH A;  4QL7 A;  2VCZ A;  3W8J A;  5G30 A;  3D4M A;  1M9A A;  3ZIJ A;  17GS A;  5DAK A;  4O5R A;  1G6Y A;  2LUS A;  1TK8 B;  4TR1 B;  4DVC A;  1SKW B;  1ZYE A;  1B8X A;  2OKA A;  3HYP A;  1A23 A;  1ACV A;  3DGQ A;  2K9F A;  4GTU A;  3RHB A;  3FZ9 A;  4GWR A;  1M7T A;  1Z9H A;  4L0U A;  1QXH A;  4V1A g;  5JWR B;  2VCX A;  1OC9 B;  4V1A p;  2DMM A;  2O7K A;  4OO5 A;  1ON4 A;  2VCW A;  2H1D A;  4MF6 A;  10GS A;  5ECL B;  1DE2 A;  3DKS A;  1RW1 A;  3WGD A;  3KP8 A;  2WDU A;  2AAW A;  1GP1 A;  4FYB A;  2PUK C;  1SYX A;  2LRN A;  3TKR A;  2V6O A;  2O8V B;  4GCI A;  1TK0 B;  4L8E A;  4J56 E;  3IR4 A;  3KCM A;  2IN3 A;  5B8B A;  4WR5 A;  4BA7 A;  2F51 A;  2JAC A;  4HJM A;  4XS4 B;  2XPD A;  3O76 A;  1S3D A;  3GV1 A;  5DQS A;  1TU8 A;  3D21 A;  2MBT A;  2P31 A;  2VCQ A;  1NW2 A;  3GKM A;  1RQM A;  4TKY A;  2ZUP A;  2C3Q A;  2JZR A;  4LMW A;  5KEJ A;  3FRC A;  3ZVJ A;  3ERW A;  4ECI A;  4X43 A;  2H8L A;  4HU9 A;  3FZA A;  1Z5Y E;  5HR1 A;  2ES7 A;  4PNF A;  1TK5 B;  3ZLP A;  3LWA A;  2HXK A;  3QD9 A;  4K6X A;  4GSS A;  5JWO B;  2CZ3 A;  1V98 A;  4ZBA A;  4ACS A;  3KH9 A;  3M1G A;  4KCA A;  2V6K A;  4D73 B;  2C4J A;  3Q19 A;  3H8Q A;  4WET A;  4IN0 A;  4IW9 A;  2AYT A;  5J5N A;  2VCV A;  2R3X A;  2GQM A;  3MDK A;  5FT3 A;  2VM1 A;  5IMZ A;  5B6N A;  4FYU A;  3A5W A;  4NWY A;  1SJZ A;  1SKS B;  3F3Q A;  1XWK A;  2KP2 A;  3HZ4 A;  4AJ8 A;  2KP1 A;  2DJ3 A;  2HQT A;  4GRF A;  3FYG A;  2C1Y A;  2TRC P;  5ID2 B;  2MZC A;  2HFD A;  2L57 A;  1M9B A;  3BBY A;  1HNC A;  3FHK A;  1MD4 A;  3APO A;  1XWB A;  4USS A;  1JLV A;  2H76 A;  1R26 A;  1SK0 A;  5GZZ B;  4XCS A;  4I8B A;  1M99 A;  4PTS A;  1WOU A;  5BMU A;  4MK3 A;  3M9K A;  4MZB A;  2H75 A;  3DIE A;  1PGT A;  5GSS A;  4XS4 A;  5G31 A;  1AC1 A;  1AIU A;  3GN3 A;  3VWV A;  5CRW A;  4GXZ A;  1GLP A;  4ZL7 A;  3ZML A;  2GT5 A;  1MEK A;  1JFU A;  4MPG A;  3TJK A;  2C3N A;  1X5E A;  4ECB A;  4AGS A;  4HQZ A;  2DSA A;  5IOW A;  1GTI A;  1GSY A;  3IK9 A;  3EU4 A;  2LRC A;  3GHA A;  5CRH A;  3GYK A;  3ME8 A;  1A24 A;  1W4V A;  2YJ7 A;  5EPF A;  3IC4 A;  1H75 A;  3TOT A;  5A4W A;  1SD9 A;  2NBS A;  1A8Y A;  3ZMK A;  1FVJ A;  2FWH A;  2YJH A;  4D73 A;  2OE0 A;  1SK1 A;  4RI7 A;  1T3B A;  4OO4 A;  4DSR A;  4PXO A;  2I9H A;  2VD0 A;  4XHM A;  4ZIJ A;  5ECK B;  3P7X A;  3TJB A;  2RM5 A;  3C1S A;  3H93 A;  3HHV A;  3GH6 A;  1ZZY A;  2CA8 A;  2WJU A;  1WJK A;  2DBC A;  4RQR A;  4PQH A;  2VOC A;  1GTB A;  2IMK A;  2KUC A;  1ZMA A;  2KHP A;  3QOU A;  1ST9 A;  2M46 A;  3CTF A;  1A2L A;  3TKS C;  4Q5N A;  5ID2 A;  1SK2 A;  4BWS A;  2CV4 A;  1YDK A;  2H1B A;  5CP1 A;  4PNG A;  2L4C A;  1T4Y A;  3AY8 A;  2F8F A;  4P3Y B;  3ISO A;  3F0I A;  1UVZ A;  2YN1 A;  4FYC A;  5AIS A;  5ELA A;  2LS5 A;  4J2F A;  4JE1 A;  6GST A;  4QQ7 A;  2C0G A;  4WBR D;  5J9C A;  4ML1 A;  2GSR A;  3LXT A;  4IGJ A;  5LNK e;  1NHY A;  3TOU A;  3F6D A;  3SWL A;  3E9J B;  3WT2 A;  3VUR A;  1C72 A;  5J41 A;  4XRD A;  1PX6 A;  1EZK A;  4YAP A;  3UVT A;  2PER A;  2K6V A;  3BCI A;  1Z7P A;  4POL A;  3FR9 A;  22GS A;  2K8S A;  4OFM A;  2L6C A;  14GS A;  3W8S A;  4PX1 A;  2GLR A;  2M72 A;  2PGT A;  2VL2 A;  2OA7 A;  1VF2 A;  4N10 A;  2HRF A;  1DUG A;  4KB3 A;  2O85 A;  4G0I A;  5D8I A;  1GSF A;  2OE1 A;  4HOJ A;  3CSI A;  1ILO A;  1E6B A;  18GS A;  3KXO A;  3ZFL A;  2V32 A;  3F6F A;  4KX4 A;  1K0B A;  3DRN A;  3M9J A;  5FHI A;  3I6A A;  3HY2 A;  3D6I A;  4LL1 B;  3L9S A;  1Y6E A;  3CRT A;  4NHZ A;  3TCO A;  2OBI A;  5HFI A;  4G0K A;  2K8V A;  5G5F A;  1PMT A;  3TDG A;  4E8H A;  5ELG A;  1E2Y A;  3TGZ A;  4NV5 A;  3L9V A;  4K0G A;  1ML6 A;  3F4R A;  1OYJ A;  1SD8 A;  1VRS D;  1H4O A;  1FB0 A;  2AB6 A;  3BD2 A;  4TR3 A;  3CTG A;  1XW5 A;  4TRX A;  4TR0 A;  4KAE A;  3S9F A;  2AJQ B;  1X5C A;  5EVO A;  3IE3 A;  2MMZ A;  2A2R A;  4F0B A;  3GKK A;  2ALB A;  1QK8 A;  1B4Q A;  1Z3E A;  4I2T A;  1OAZ A;  4YQM A;  1S3C A;  3D0Z A;  5IMV A;  2C0D A;  1FAA A;  1A0F A;  3KMN A;  5CNW A;  3L9U A;  1OC3 A;  5DVB A;  1GNE A;  1T00 A;  1NHO A;  1T8E B;  2H6Z A;  3QR6 A;  2A4V A;  3TRP A;  3MSZ A;  1LJR A;  1Y25 A;  4MJE A;  1O8W A;  2GSQ A;  2I3Y A;  3VPQ A;  5CRE A;  2OE3 A;  1LU4 A;  20GS A;  2GDR A;  11GS A;  2P0G A;  1B48 A;  4V2M A;  3TJJ A;  4HEA 2;  2X8H A;  3HCZ A;  4KUN A;  1GUL A;  3H4K A;  4IJ3 A;  5G2Z A;  2VL2 C;  1TJD A;  3R2Q A;  4MMM A;  4IKH A;  2QKE A;  1JZO A;  3O6T A;  1Z6M A;  2REM A;  3WGE A;  1G7O A;  3QDN A;  3CXG A;  16GS A;  2H73 A;  3APQ A;  4TW5 A;  4I5Q A;  1EOG A;  1TOF A;  1XWA A;  1I5G A;  1THX A;  4HDE A;  1ABA A;  2FWF A;  1B4P A;  2X8C A;  3FKF A;  2YWN A;  3NIV A;  1USB A;  3PR8 A;  1FB6 A;  3F3R A;  2R5G A;  2HSM B;  2DIZ A;  3ZIV A;  5D73 A;  2CQ9 A;  2EIR A;  4GSN A;  3EC3 A;  2GS3 A;  3ZRE A;  2B5E A;  1O6J A;  1TRV A;  2YCD A;  2ZNM A;  2HSN B;  1KEB A;  2H74 A;  7GSS A;  2B1K A;  4LMV A;  4ILF A;  4ML6 A;  1R5A A;  4YH2 A;  5D9X A;  5D9V A;  1JZD A;  2AUV A;  1YQ1 A;  2L5L A;  3RBT A;  1FHE A;  2E2M A;  4FQU A;  3WYW A;  4GQC A;  5ECQ B;  3ZTL A;  3DXB A;  1XXU A;  2IMD A;  1SL1 B;  5IQY A;  5JWQ B;  1VF4 A;  2XHF A;  3LFL A;  2DJ0 A;  1VF1 A;  2MMN A;  1CQH A;  4KCE A;  2X64 A;  1EEM A;  1ZYQ B;  3TUE A;  5LCZ A;  4MH3 A;  3EMX A;  1EP7 A;  2ZCT A;  4K1F A;  2N5B A;  1DSB A;  4WR4 A;  2QSI A;  4DEJ A;  3LGC A;  3VWX A;  1PRX A;  1KBN A;  1URM A;  4NAX A;  3MWH A;  2HNL A;  2R6K A;  4KSM A;  1GSS A;  1K0M A;  3IXR A;  2B7K A;  3GX0 A;  3BJ5 A;  3F9U A;  1ERT A;  1QQ2 A;  3U6V A;  4MLY A;  4NV2 A;  1FG4 A;  1J0F A;  4TXV A;  4YQU A;  3FY7 A;  1EV4 A;  1A0R P;  2E0Q A;  1TRW A;  6GSU A;  4OD7 A;  4OFT A;  3EIN A;  2PPT A;  2HSM A;  1X9W B;  4BVX B;  5IMD A;  4ZIL A;  3HVV A;  1PL1 A;  3GH9 A;  3VI7 A;  1B9Y C;  2L5O A;  1EEJ A;  1XBS A;  3F63 A;  3ZYW A;  1XIY A;  4YAV A;  3IA1 A;  4HS1 A;  3CBU A;  2JSZ A;  4L0W A;  2MYG A;  2VO4 A;  5DCG A;  2HZF A;  4KSO A;  3HVX A;  4TR1 A;  1U88 A;  1BAY A;  4RQX A;  1T1V A;  3IHQ A;  4LLR A;  2PBJ A;  3IBH A;  2ON5 A;  5DJM A;  4F0C A;  4IQA A;  1VF3 A;  2VUP A;  3QAW A;  2HZE B;  2J9H A;  2YNX A;  3QFB C;  2R2J A;  4KA0 A;  4NXI A;  1M2A A;  2EIQ A;  2WB9 A;  5KN0 A;  3RPP A;  1K0O A;  5DBQ A;  3DD3 A;  3F8U A;  3KIJ A;  3EYT A;  3ZL5 A;  5G1L A;  3DYR A;  2CVB A;  2FY6 A;  1OC9 A;  4JRR A;  8GSS A;  3PIN A;  3QAG A;  3ERG A;  4HZ4 A;  3TKS A;  2AV4 A;  1GSD A;  5DAL B;  3GX8 A;  4EUY A;  2JZT A;  2LJK A;  1T7P B;  5IMA A;  2CT6 A;  2FWG A;  3CSJ A;  1YEP A;  3GL3 A;  5ABR A;  4IJI A;  4WXT A;  2PVO C;  2PWJ A;  1Z7R A;  1EGR A;  4ID0 A;  1UC7 A;  1CQG A;  1SJ6 A;  3GTU B;  2L6D A;  3IRA A;  2J23 A;  2I1U A;  3APS A;  3UL3 A;  2N5A A;  5F06 A;  4IS0 A;  2LJA A;  1V40 A;  1OKD A;  1YF1 A;  1EP8 A;  2TRX A;  3TJG A;  1QUW A;  3LYP A;  4G0L A;  4BVX A;  2H66 A;  3GA4 A;  5HFG A;  2YV7 A;  1A2M A;  4KDY A;  2F3M A;  1X5D A;  2FWE A;  2H1G A;  2FCH A;  2VL9 A;  3DWV A;  4N0Z A;  1GSQ A;  1XWC A;  3P8W A;  2GQL A;  4L5L A;  1MD3 A;  1I9D A;  3D4T A;  1AW9 A;  3UOM A;  4OFN A;  4XTS A;  1GLQ A;  1YEX A;  3HXS A;  2HZE A;  3BOA A;  2IJY A;  5DJL A;  5A5K A;  4Q5R A;  1G6W A;  1IYI A;  1AUC A;  3TKQ A;  2IPA A;  5D9W A;  2V41 A;  4E8E A;  4MCU A;  5L71 A;  2C0F A;  5CYY A;  3GKN A;  2YZH A;  2GQK A;  4IP1 A;  5DAL A;  2LKU A;  2H19 A;  1WMJ A;  4GQF A;  1GUM A;  5E59 A;  4LA1 A;  2PN8 A;  6GSS A;  3OR5 A;  5IMC A;  4TN8 A;  2H72 A;  3LEF A;  3VWW A;  1R7H A;  1GRX A;  1AQV A;  5AIV A;  4ZB8 A;  4XRA A;  1YJ6 A;  2FA8 A;  4L5O A;  4FO5 A;  2QC7 A;  4BVY B;  4AJ7 A;  3H79 A;  1GNW A;  3EVI A;  3FEU A;  2DML A;  3GUS A;  1GTA A;  3GTU A;  3DVX A;  5H5R A;  4KE3 A;  3G7I A;  4OWY A;  1UA5 A;  1GH2 A;  1N2A A;  2PU9 C;  1PD2 1;  3UMA A;  4PQ1 A;  3HA9 A;  3HDC A;  2YPM A;  2YP6 A;  4X0X A;  2WZ9 A;  3US3 A;  2FD3 A;  2C3T A;  4ZB6 A;  4ECC A;  4TOP A;  2G0F A;  3GNJ A;  3P90 A;  3IAS 2;  1VGL A;  4O7H A;  2V2G A;  1FVK A;  1EWX A;  4V2N A;  3VFI A;  1W89 A;  1SJI A;  2GST A;  1A2J A;  3M3M A;  1MDI A;  6GSV A;  4EO3 A;  3RDW A;  1JLW A;  5AGY A;  4H86 A;  4EKZ A;  1PN9 A;  2GZY A;  3HJO A;  1ZL9 A;  1BG5 A;  2O87 A;  4K8M A;  2MBS A;  4TXO B;  4TVE A;  3ZFB A;  4RI6 A;  2MMO A;  4N11 A;  3TJF A;  3VI5 A;  1GSE A;  3UVH A;  1MTC A;  3VWU A;  2VLV A;  1SEN A;  3FR3 A;  1SL2 B;  5INY A;  1SU9 A;  6GSW A;  1YKC A;  3QMX A;  3EUR A;  2HLS A;  2LQO A;  1G7E A;  2B5Y A;  2LJR A;  4KDX A;  4PGT A;  3TB2 A;  1X9S B;  4PUF C;  5HR3 A;  3KMO A;  1AXD A;  1U87 A;  5HFK A;  3DML A;  4BVY A;  1K3O A;  3W6G A;  3UIW A;  4MAB A;  4EVM A;  5GAN D;  4O92 A;  12GS A;  3KP9 A;  2X8G A;  1NM3 A;  4Q5F A;  2WRT A;  2H30 A;  5ENU A;  1XW9 A;  3LQ7 A;  2IFQ B;  1LBK A;  3QCP A;  1F37 A;  1MDJ A;  2P5R A;  5HR2 A;  1PSQ A;  1PKW A;  4GST A;  5HQP A;  1F9M A;  13GS A;  2VM2 A;  3CMI A;  4ZL9 A;  2IWT A;  4ZB9 A;  2X99 A;  2QGV A;  5HR0 A;  4MDC A;  3P2A A;  5IO2 A;  2L4Q A;  1BQ7 A;  4FH8 A;  1TW9 A;  1F3A A;  4MZW A;  1K0A A;  3GST A;  2H6Y A;  4JR6 A;  5ECN B;  1GSU A;  6GSY A;  3IAM 2;  5J3R A;  4IVF A;  4G2E A;  5ECR B;  4KF9 A;  1OKT A;  1XZO A;  4TXO A;  5C04 A;  1XWG A;  2RUE A;  2GGT A;  2YZU A;  2N5F A;  3KEB A;  4RUV A;  3GMF A;  1O7U A;  3HJM A;  3IPZ A;  4EDZ A;  2ON7 A;  4J57 E;  4JU5 A;  3N9J A;  4GF0 A;  1HYU A;  1OE7 A;  2DC5 A;  3WD6 A;  1N8J A;  3L4N A;  2E2G A;  3IOS A;  2B6M A;  3C71 A;  1PX7 A;  1RK4 A;  1M2D A;  2H6X A;  3Q18 A;  1KTE A;  2RUF A;  4K2D A;  4K7I A;  4AF2 A;  3GRX A;  3DEX A;  2OAD A;  3UBL A;  3PGT A;  2RII A;  2GZZ A;  4K9Z A;  4MH2 A;  1F6M C;  1ZCP A;  4WEY A;  3K8N A;  1Q4J A;  2HRA A;  4F2I A;  1DBY A;  3F4S A;  2IME A;  3UEM A;  4IHU A;  3G7J A;  3C8E A;  5CAX A;  2H0I A;  5A4U A;  3WGX A;  3VK9 A;  2LV3 A;  4LL4 B;  3A2W A;  1XOB A;  4HZ2 A;  1QMV A;  1WWJ A;  3UBK A;  3U5R E;  5IMF A;  5F05 A;  1BX9 A;  2DJK A;  1GUK A;  2WFC A;  2V1M A;  1TRU A;  2DJ1 A;  2R37 A;  2CVD A;  4JZQ A;  4MA9 A;  4BWQ A;  2HI7 A;  5DQY A;  5KN2 A;  1F2E A;  3D5J A;  1JHB A;  3LOR A;  2D2Z A;  1HNA A;  3E0U A;  2H70 A;  2IMI A;  1BED A;  4WF5 A;  4G19 A;  3KM6 A;  4F03 A;  5JCG A;  4OCE A;  2EC4 A;  1YF0 A;  4KDU A;  4I97 A;  1OVN A;  2UZ8 A;  2DIY A;  3N5O A;  3EMP A;  4AJ6 A;  1WRY A;  4CHS A;  2JAD A;  1TKD B;  3IK7 A;  4POB A;  2C80 A;  2YOI A;  3Q74 A;  1XCC A;  2LNS A;  2F8A A;  2HT9 A;  3VLN A;  2M80 A;  1TP9 A;  1K3Y A;  2OAC A;  19GS A;  4N0V A;  5F0G A;  2BJX A;  4K7N A;  5CRG A;  2E7P A;  4DSS B;  4O32 A;  1ERV A;  1KNG A;  4NPB A;  2NVL A;  1BJX A;  4I2U A;  4Z7X A;  4OCF A;  2JU5 A;  3FZ5 A;  2R4V A;  3IC8 A;  1R4W A;  3ZRD A;  1WP0 A;  4BL7 B;  1V57 A;  9GSS A;  4MJB A;  5H5Q A;  5J9B A;  5F07 A;  4EDY A;  3A3T A;  5DCH A;  2EIO A;  2H1A A;  3ERF A;  1YY7 A;  3KZQ A; 
#chains in the Genus database with same CATH topology
 1ERU A;  2HSY A;  2EFD A;  2I81 A;  4MNN A;  1PA3 A;  2IIY A;  3G9B A;  5CRD A;  2FGX A;  2PMT A;  1HD2 A;  4HJ2 A;  3CRU A;  1SKR B;  5IO0 A;  4WKW A;  2B7J A;  2VAF A;  3IV4 A;  3NZN A;  1Q98 A;  3D22 A;  5B6M A;  4XS1 A;  3GIX A;  2DLX A;  5A5H A;  3LSZ A;  3KJY A;  5DDL A;  3KTL A;  2WUL A;  3R3E A;  3JCM L;  3C73 A;  2HRK B;  5IM9 A;  5A34 A;  4X1U A;  4N30 A;  2OJL A;  3KGK A;  5G1K A;  1GWC A;  4ZBD A;  2CX3 A;  3KD0 A;  2LRT A;  1XFL A;  4WF4 A;  4F9Z A;  2YV9 A;  3PPU A;  2NDO A;  4WBJ A;  2F9S A;  2CAQ A;  2YWO A;  3FW2 A;  1IYH A;  1G0T A;  1K0D A;  5ECO B;  4BPY A;  2P5Q A;  1GUH A;  3ME7 A;  4POK A;  2WVY A;  4KND A;  3TKS E;  3UAP A;  1JZR A;  4MPF A;  1O85 A;  2HRN A;  2VIM A;  1XOA A;  1TXX A;  3C7M A;  3HJP A;  4PUA A;  3QFA C;  1S4B P;  4KW6 A;  1GL8 A;  4ZB7 A;  2B1L A;  3FMW A;  3FZ4 A;  5D96 A;  3J7Y k;  4HU7 A;  4ULX A;  2K18 A;  3CHX C;  4EXJ A;  2FUG 2;  3ZZX A;  1V2A A;  5D9T A;  1V58 A;  4ZL8 A;  4DSS A;  1SVO A;  4IP6 A;  1M2B A;  3HVN A;  4IEL A;  4HUA A;  2JZS A;  5ECI B;  1YZX A;  3L78 A;  1DE1 A;  4BL7 A;  2MMA A;  5IOX A;  2VLU A;  2A2S A;  2IL3 A;  2NTO A;  4KH7 A;  2NPB A;  2GT6 A;  1TI3 A;  4ZXG A;  1OC8 A;  3M8N A;  3RPN A;  3V1W A;  2XPE A;  1EGO A;  5G5E A;  2LST A;  4CY8 A;  1HQO A;  4JED A;  3GFK A;  2H71 A;  5ECP B;  4IQ1 A;  3EWL A;  3GL5 A;  3LYK A;  4MP4 A;  2LEG A;  1J08 A;  3F4T A;  3KTB A;  1V9W A;  1PKZ A;  3I9V 2;  3HKR A;  1GTU A;  2JSY A;  2RM6 A;  2HRK A;  5B7C A;  3EU3 A;  2DJJ A;  3PH9 A;  1U3A A;  1YEW C;  5GST A;  2EFC A;  2VCT A;  1FO5 A;  2CAI A;  4ZBB A;  2GTU A;  2WW3 A;  1SL0 B;  1J9B A;  5JCU A;  2R0C A;  2GSS A;  2H01 A;  3HD5 A;  2GZP A;  2A4H A;  5J4Y A;  3RAZ A;  3J7Y b;  4O5U A;  1PQN A;  2TIR A;  3M0F A;  5EL8 A;  3A2X A;  3HZ8 A;  4NMU A;  2WS2 A;  1B9X C;  2IMF A;  1TDI A;  4AKG A;  2AHE A;  4MF7 A;  3LJR A;  2LTK A;  2C8U A;  4POM A;  3E3E A;  3GSS A;  1UN2 A;  2BMX A;  1TU7 A;  3CSH A;  3SBC A;  4I6X A;  3L0H A;  1NSW A;  4G9H A;  2CZ2 A;  2KOK A;  2PVQ A;  2KLX A;  2B5X A;  2WCI A;  5F8B A;  3Q6O A;  5ECM B;  3HVS A;  3LG6 A;  1PFO A;  5COH A;  3BCK A;  1WIK A;  2X4A A;  2XBI A;  2FLS A;  1JZW A;  2YWI A;  4MJC A;  6GSX A;  1XVW A;  3WT1 A;  5J4U A;  2WVZ A;  1O73 A;  3IDV A;  5D93 A;  2I4A A;  4ECJ A;  4PQI A;  3HMJ G;  4TR4 A;  1ZYP A;  3UAR A;  3MAK A;  4K5S A;  3NOF A;  4YQV A;  3RGB C;  1AQX A;  2VD1 A;  3FR6 A;  5EY6 A;  1XPV A;  1U3I A;  3QPM A;  4PUR A;  2H0H A;  1K3L A;  4CDO A;  3I69 A;  2HYX A;  2FNO A;  4QL9 A;  2JL4 A;  5H5S A;  1QGV A;  1F3B A;  4KGI A;  3KH7 A;  4DSQ A;  2YWM A;  4MZC A;  5KN1 A;  2L59 A;  1X0R A;  2O89 A;  1Z6N A;  2HE3 A;  4ISD A;  1QFN A;  5IIZ A;  2XBQ A;  3RFR C;  1THO A;  5GAP D;  1HNB A;  1EV9 A;  1FOV A;  3GUR A;  4JR4 A;  4MJA A;  1O8X A;  5IPH A;  5A4V A;  3H1N A;  4K0N A;  1BYE A;  4FIW A;  4IBP A;  4GLT A;  2R0P A;  1AQW A;  1YKA A;  3EE2 A;  5DAK B;  2BTO T;  4Q5Q A;  5KN3 A;  1PL2 A;  3A2V A;  4X4J A;  2GVP A;  2DJ2 A;  4EF0 A;  5AN1 A;  1T4Z A;  1S3A A;  2WGR A;  2XC2 A;  4HQS A;  5E4W A;  4O5Q A;  1MDK A;  3GKX A;  1U6T A;  1R5P A;  1ZOF A;  3CYN A;  4MF5 A;  3VPT A;  1XW6 A;  1OE8 A;  1XVQ A;  4V2L A;  5ECS A;  4G10 A;  3MNG A;  1FW1 A;  2FHE A;  3ZIT A;  1ZYN A;  4EE0 A;  1TTZ A;  4JBB A;  1X9M B;  2LNT A;  5CO3 A;  5IPG A;  2HSH A;  3TRQ A;  2CVK A;  5C00 A;  3RHC A;  3O3T A;  1EOH A;  1K0C A;  4F82 A;  2C0E A;  1A8L A;  2YAN A;  1WPI A;  3G7Y A;  3C1R A;  2VL3 A;  4EL1 A;  5ECH B;  2B3S A;  3TKP A;  2G2Q A;  4N3Z A;  1WE0 A;  4EC0 A;  1TI1 A;  5B8A A;  3FK8 A;  3ZVJ D;  2WVX B;  3DVW A;  4K7O A;  5LD0 A;  4OMV A;  4XS6 A;  3QAV A;  5JCW A;  1M0U A;  1O81 A;  1TRS A;  1ZGN A;  4HI7 A;  1AAZ A;  5AIX A;  4PI2 C;  3UJ1 A;  1SYR A;  4NHW A;  2CX4 A;  3TRX A;  3ED3 A;  2FA4 A;  4CW9 A;  2Z9S A;  2H0G A;  2VLT A;  2IFQ A;  1K0N A;  3I43 A;  2OBK A;  5FWG A;  2LQQ A;  2RLI A;  1ERW A;  4XIH A;  4QL7 A;  2VCZ A;  3W8J A;  5G30 A;  3D4M A;  1M9A A;  3ZIJ A;  17GS A;  5DAK A;  4O5R A;  1G6Y A;  2LUS A;  1TK8 B;  4TR1 B;  4DVC A;  1SKW B;  1ZYE A;  1B8X A;  2OKA A;  3HYP A;  1A23 A;  1ACV A;  3DGQ A;  2K9F A;  4GTU A;  3RHB A;  3FZ9 A;  4AKX B;  4GWR A;  1M7T A;  1Z9H A;  4L0U A;  1QXH A;  4V1A g;  5JWR B;  2VCX A;  1OC9 B;  5A1N B;  5J47 A;  4V1A p;  2DMM A;  2O7K A;  4OO5 A;  1ON4 A;  2O36 A;  2VCW A;  2H1D A;  4MF6 A;  10GS A;  5ECL B;  1DE2 A;  3DKS A;  1RW1 A;  3WGD A;  3KP8 A;  2WDU A;  2AAW A;  1GP1 A;  4FYB A;  2PUK C;  1SYX A;  2LRN A;  3TKR A;  2V6O A;  2O8V B;  4GCI A;  5BRT A;  1TK0 B;  4L8E A;  4J56 E;  3IR4 A;  3KCM A;  4AKH A;  2IN3 A;  5BMU B;  5B8B A;  4WR5 A;  4BA7 A;  2F51 A;  2JAC A;  4HJM A;  4XS4 B;  2XPD A;  3O76 A;  1S3D A;  3GV1 A;  5DQS A;  1TU8 A;  3D21 A;  2MBT A;  2P31 A;  2VCQ A;  1NW2 A;  3GKM A;  1RQM A;  4TKY A;  2ZUP A;  2C3Q A;  2JZR A;  4LMW A;  5KEJ A;  3FRC A;  3ZVJ A;  3ERW A;  4ECI A;  4X43 A;  2H8L A;  4HU9 A;  3FZA A;  1Z5Y E;  5HR1 A;  2ES7 A;  4PNF A;  1TK5 B;  3ZLP A;  4PHZ C;  2A2P A;  3LWA A;  2HXK A;  3QD9 A;  4K6X A;  4GSS A;  5JWO B;  2CZ3 A;  1V98 A;  4ZBA A;  4ACS A;  3KH9 A;  3M1G A;  4KCA A;  2V6K A;  4D73 B;  2C4J A;  3Q19 A;  3H8Q A;  4WET A;  4IN0 A;  4IW9 A;  2AYT A;  2X49 A;  5J5N A;  2VCV A;  2R3X A;  2GQM A;  3MDK A;  5FT3 A;  2VM1 A;  5IMZ A;  5B6N A;  4FYU A;  3A5W A;  4NWY A;  4K2X A;  1SJZ A;  1SKS B;  3F3Q A;  5A1N A;  1XWK A;  2OT3 A;  2KP2 A;  3HZ4 A;  4AJ8 A;  2KP1 A;  2DJ3 A;  2HQT A;  1S3R A;  4GRF A;  3FYG A;  2C1Y A;  2TRC P;  5ID2 B;  2MZC A;  2HFD A;  2L57 A;  1M9B A;  3BBY A;  1HNC A;  3FHK A;  1MD4 A;  3APO A;  1XWB A;  4USS A;  5KOX A;  1JLV A;  2H76 A;  1R26 A;  1SK0 A;  5GZZ B;  4XCS A;  4I8B A;  1M99 A;  4PTS A;  1WOU A;  5BMU A;  4MK3 A;  3M9K A;  4MZB A;  2H75 A;  3DIE A;  1PGT A;  5GSS A;  4XS4 A;  5G31 A;  1AC1 A;  1AIU A;  3GN3 A;  3VWV A;  5CRW A;  4GXZ A;  1GLP A;  4ZL7 A;  3ZML A;  2GT5 A;  1MEK A;  1JFU A;  4MPG A;  3TJK A;  2C3N A;  1X5E A;  4ECB A;  4AGS A;  4HQZ A;  2DSA A;  5IOW A;  1GTI A;  1GSY A;  3IK9 A;  3EU4 A;  2LRC A;  3GHA A;  5CRH A;  3GYK A;  3ME8 A;  1A24 A;  1W4V A;  2YJ7 A;  5EPF A;  3IC4 A;  1H75 A;  3TOT A;  4FXY P;  5A4W A;  1SD9 A;  2NBS A;  1A8Y A;  2YJH A;  3ZMK A;  1FVJ A;  2FWH A;  4D73 A;  2OE0 A;  1SK1 A;  4RI7 A;  1T3B A;  4OO4 A;  4DSR A;  4PXO A;  2I9H A;  2VD0 A;  4XHM A;  4ZIJ A;  5ECK B;  3P7X A;  3TJB A;  2RM5 A;  3C1S A;  3H93 A;  3HHV A;  3GH6 A;  1ZZY A;  2CA8 A;  2WJU A;  1WJK A;  2WZS A;  2DBC A;  4RQR A;  4PQH A;  2VOC A;  1GTB A;  3A5I A;  2IMK A;  2KUC A;  1ZMA A;  2KHP A;  3QOU A;  1ST9 A;  2M46 A;  3CTF A;  1A2L A;  3TKS C;  4Q5N A;  5ID2 A;  1SK2 A;  4BWS A;  2CV4 A;  5J4V A;  1YDK A;  2H1B A;  5CP1 A;  4PNG A;  2L4C A;  1T4Y A;  3AY8 A;  2F8F A;  4P3Y B;  3ISO A;  3F0I A;  1UVZ A;  2YN1 A;  4FYC A;  5AIS A;  5ELA A;  2LS5 A;  4J2F A;  4JE1 A;  6GST A;  4QQ7 A;  2C0G A;  4WBR D;  5J9C A;  4ML1 A;  2GSR A;  3LXT A;  4IGJ A;  5LNK e;  1NHY A;  3TOU A;  3F6D A;  3SWL A;  3E9J B;  3WT2 A;  3VUR A;  3EPT A;  1C72 A;  5J41 A;  4XRD A;  1PX6 A;  1EZK A;  4YAP A;  3UVT A;  2UV8 G;  2PER A;  2K6V A;  3BCI A;  1Z7P A;  4POL A;  3FR9 A;  3LW9 A;  22GS A;  2K8S A;  4OFM A;  2L6C A;  14GS A;  3W8S A;  4PX1 A;  2GLR A;  2M72 A;  2PGT A;  2VL2 A;  2OA7 A;  1VF2 A;  4N10 A;  2HRF A;  1DUG A;  4KB3 A;  2O85 A;  4G0I A;  5D8I A;  1GSF A;  2OE1 A;  4HOJ A;  2O5V A;  3CSI A;  1ILO A;  1E6B A;  18GS A;  3KXO A;  3ZFL A;  2V32 A;  3F6F A;  4KX4 A;  1K0B A;  3DRN A;  3M9J A;  5FHI A;  3I6A A;  3HY2 A;  3D6I A;  4LL1 B;  3L9S A;  1Y6E A;  3CRT A;  4NHZ A;  3TCO A;  2OBI A;  5HFI A;  4G0K A;  2K8V A;  5G5F A;  1PMT A;  3TDG A;  4E8H A;  5ELG A;  1E2Y A;  3TGZ A;  4NV5 A;  3L9V A;  4K0G A;  1ML6 A;  3F4R A;  1OYJ A;  1SD8 A;  1VRS D;  1H4O A;  1FB0 A;  2AB6 A;  3BD2 A;  4TR3 A;  3CTG A;  1XW5 A;  4TRX A;  4TR0 A;  4KAE A;  3S9F A;  4Z2R A;  1X5C A;  4Z2T A;  2AJQ B;  5EVO A;  3IE3 A;  2MMZ A;  2A2R A;  4F0B A;  3GKK A;  2ALB A;  1QK8 A;  1B4Q A;  1Z3E A;  4I2T A;  1OAZ A;  1BF5 A;  4YQM A;  1S3C A;  3D0Z A;  5IMV A;  2WW0 A;  2C0D A;  4EIP A;  1FAA A;  1A0F A;  3KMN A;  5CNW A;  3L9U A;  4W66 A;  1OC3 A;  5DVB A;  1GNE A;  1T00 A;  1NHO A;  1T8E B;  2H6Z A;  3QR6 A;  2A4V A;  3TRP A;  3MSZ A;  1LJR A;  1Y25 A;  4MJE A;  1O8W A;  2GSQ A;  2I3Y A;  3VPQ A;  5CRE A;  2OE3 A;  1LU4 A;  20GS A;  2GDR A;  11GS A;  2P0G A;  1B48 A;  4V2M A;  3TJJ A;  4HEA 2;  2X8H A;  3HCZ A;  4AKI A;  4KUN A;  1GUL A;  3H4K A;  4IJ3 A;  5G2Z A;  2VL2 C;  1TJD A;  3R2Q A;  4MMM A;  4IKH A;  2QKE A;  1JZO A;  3O6T A;  1Z6M A;  2REM A;  3WGE A;  4YKF A;  1G7O A;  3QDN A;  3IHG A;  3CXG A;  16GS A;  2H73 A;  3APQ A;  4TW5 A;  4I5Q A;  1EOG A;  1TOF A;  1XWA A;  1I5G A;  1THX A;  4HDE A;  1ABA A;  2FWF A;  1B4P A;  2X8C A;  5J40 A;  3FKF A;  2YWN A;  3NIV A;  4E68 A;  1USB A;  3PR8 A;  1FB6 A;  3F3R A;  2R5G A;  2HSM B;  2DIZ A;  3ZIV A;  1FOH A;  5D73 A;  2CQ9 A;  2EIR A;  4GSN A;  3EC3 A;  2GS3 A;  3ZRE A;  2B5E A;  1O6J A;  3TU3 B;  1TRV A;  1N25 A;  2YCD A;  2ZNM A;  2HSN B;  1KEB A;  2H74 A;  7GSS A;  2B1K A;  4LMV A;  4ILF A;  4ML6 A;  1R5A A;  4YH2 A;  4AI6 A;  5D9X A;  5D9V A;  1JZD A;  2AUV A;  1YQ1 A;  2L5L A;  3RBT A;  1FHE A;  2E2M A;  4FQU A;  3WYW A;  4GQC A;  5ECQ B;  3ZTL A;  3DXB A;  1XXU A;  2IMD A;  1SL1 B;  5IQY A;  5JWQ B;  4HSC X;  1VF4 A;  2WW1 A;  2XHF A;  3LFL A;  2DJ0 A;  1VF1 A;  1YVL A;  2MMN A;  1CQH A;  4KCE A;  2X64 A;  1EEM A;  1ZYQ B;  3TUE A;  5LCZ A;  4MH3 A;  3EMX A;  1EP7 A;  2ZCT A;  4K1F A;  2N5B A;  1DSB A;  4WR4 A;  2QSI A;  4DEJ A;  3LGC A;  3VWX A;  1PRX A;  1KBN A;  1URM A;  4NAX A;  5KOW A;  3MWH A;  2HNL A;  2R6K A;  4KSM A;  1GSS A;  1K0M A;  3IXR A;  2B7K A;  3GX0 A;  4K5R A;  3BJ5 A;  3F9U A;  1ERT A;  1QQ2 A;  1PN0 A;  3U6V A;  4MLY A;  4NV2 A;  1FG4 A;  1J0F A;  2WVX A;  4TXV A;  4YQU A;  3FY7 A;  1EV4 A;  1A0R P;  2E0Q A;  1TRW A;  6GSU A;  3MIX A;  4OD7 A;  4OFT A;  3EIN A;  2VKZ G;  2PPT A;  2HSM A;  1X9W B;  2QA1 A;  4BVX B;  5IMD A;  1SVM A;  4ZIL A;  3HVV A;  1PL1 A;  3GH9 A;  3VI7 A;  1B9Y C;  2L5O A;  1EEJ A;  1XBS A;  3F63 A;  3ZYW A;  1XIY A;  4YAV A;  3IA1 A;  4HS1 A;  3CBU A;  2JSZ A;  4L0W A;  2MYG A;  2VO4 A;  3CWG A;  5DCG A;  2HZF A;  1TXU A;  3HVX A;  4KSO A;  4TR1 A;  1U88 A;  1BAY A;  2HSN A;  4RQX A;  1T1V A;  3IHQ A;  4LLR A;  2PBJ A;  3IBH A;  2ON5 A;  5DJM A;  4F0C A;  4IQA A;  1VF3 A;  2VUP A;  3QAW A;  2HZE B;  2J9H A;  2YNX A;  3QFB C;  2R2J A;  4KA0 A;  4NXI A;  1M2A A;  2EIQ A;  2WB9 A;  5KN0 A;  3RPP A;  1K0O A;  5DBQ A;  3DD3 A;  3F8U A;  3KIJ A;  3EYT A;  3ZL5 A;  5G1L A;  3DYR A;  2CVB A;  2FY6 A;  1OC9 A;  4JRR A;  8GSS A;  3PIN A;  3QAG A;  3ERG A;  4HZ4 A;  2H1L A;  3TKS A;  2AV4 A;  1GSD A;  3GX8 A;  5DAL B;  4EUY A;  2JZT A;  2LJK A;  1T7P B;  5IMA A;  2CT6 A;  2FWG A;  3CSJ A;  1YEP A;  3GL3 A;  5ABR A;  4IJI A;  4WXT A;  2PVO C;  2PWJ A;  1Z7R A;  1EGR A;  4ID0 A;  1UC7 A;  1CQG A;  1SJ6 A;  1M3J A;  3GTU B;  2L6D A;  4EIQ A;  3IRA A;  2J23 A;  2I1U A;  3APS A;  3UL3 A;  2N5A A;  5F06 A;  4IS0 A;  2LJA A;  2QA2 A;  1V40 A;  1OKD A;  1YF1 A;  1EP8 A;  2TRX A;  3TJG A;  2R0G A;  1QUW A;  3LYP A;  4G0L A;  4BVX A;  2H66 A;  3GA4 A;  5HFG A;  2YV7 A;  1A2M A;  4KDY A;  2F3M A;  1X5D A;  2FWE A;  2H1G A;  2FCH A;  2VL9 A;  3DWV A;  4N0Z A;  1GSQ A;  1XWC A;  3P8W A;  2GQL A;  2O3E A;  4L5L A;  1MD3 A;  1I9D A;  3D4T A;  1AW9 A;  3UOM A;  4OFN A;  2WW2 A;  4XTS A;  1GLQ A;  1YEX A;  3HXS A;  2HZE A;  3BOA A;  2IJY A;  5DJL A;  5A5K A;  4Q5R A;  1G6W A;  1IYI A;  1AUC A;  3TKQ A;  2IPA A;  5D9W A;  2V41 A;  4ICY A;  4E8E A;  4MCU A;  5L71 A;  2C0F A;  5CYY A;  3GKN A;  2YZH A;  2GQK A;  4IP1 A;  5DAL A;  2LKU A;  2H19 A;  1WMJ A;  2DKI A;  4GQF A;  1GUM A;  5E59 A;  4LA1 A;  2PN8 A;  1XG8 A;  6GSS A;  3OR5 A;  4GDF A;  5IMC A;  4TN8 A;  2H72 A;  3LEF A;  3VWW A;  1R7H A;  1GRX A;  1AQV A;  5AIV A;  4ZB8 A;  4XRA A;  1YJ6 A;  2FA8 A;  4L5O A;  4FO5 A;  2QC7 A;  4BVY B;  4AJ7 A;  3H79 A;  1GNW A;  3EVI A;  3FEU A;  2DML A;  3GUS A;  1GTA A;  3GTU A;  3DVX A;  5H5R A;  4KE3 A;  3G7I A;  4OWY A;  1UA5 A;  1GH2 A;  1N2A A;  2PU9 C;  1PD2 1;  3UMA A;  4PQ1 A;  3HA9 A;  3HDC A;  2YPM A;  2YP6 A;  4X0X A;  2WZ9 A;  3US3 A;  2FD3 A;  2C3T A;  4ZB6 A;  4Z2U A;  4ECC A;  4TOP A;  2G0F A;  3GNJ A;  1M3I A;  3P90 A;  3IAS 2;  1VGL A;  4O7H A;  2V2G A;  1FVK A;  1EWX A;  4V2N A;  3VFI A;  1W89 A;  1SJI A;  2GST A;  1A2J A;  3M3M A;  1MDI A;  6GSV A;  4EO3 A;  3RDW A;  1JLW A;  5AGY A;  4H86 A;  4EKZ A;  1PN9 A;  2GZY A;  3HJO A;  1ZL9 A;  1BG5 A;  2O87 A;  4K8M A;  2MBS A;  4TXO B;  4YKG A;  4TVE A;  3ZFB A;  4RI6 A;  2MMO A;  4N11 A;  3TJF A;  3VI5 A;  1GSE A;  3UVH A;  4QMK A;  1MTC A;  3VWU A;  2VLV A;  1SEN A;  3FR3 A;  4BIK A;  1SL2 B;  5INY A;  1SU9 A;  6GSW A;  1YKC A;  3QMX A;  3EUR A;  2HLS A;  2LQO A;  1G7E A;  2B5Y A;  2LJR A;  4KDX A;  4PGT A;  3TB2 A;  1X9S B;  4PUF C;  5HR3 A;  3KMO A;  1AXD A;  1U87 A;  5HFK A;  3DML A;  4BVY A;  1K3O A;  3W6G A;  3UIW A;  4MAB A;  4EVM A;  5GAN D;  4O92 A;  12GS A;  3KP9 A;  2X8G A;  1NM3 A;  4Q5F A;  2WRT A;  2H30 A;  5ENU A;  1XW9 A;  3LQ7 A;  2IFQ B;  1LBK A;  3QCP A;  1F37 A;  1MDJ A;  1BG1 A;  2P5R A;  5HR2 A;  1PSQ A;  1PKW A;  4GST A;  5HQP A;  1F9M A;  13GS A;  2VM2 A;  3CMI A;  4ZL9 A;  2IWT A;  4ZB9 A;  2X99 A;  2QGV A;  5HR0 A;  4MDC A;  3P2A A;  5IO2 A;  2L4Q A;  1BQ7 A;  4FH8 A;  1TW9 A;  1F3A A;  4MZW A;  1K0A A;  3GST A;  2H6Y A;  4JR6 A;  5ECN B;  1GSU A;  6GSY A;  3IAM 2;  3MYD A;  5J3R A;  4IVF A;  4G2E A;  5ECR B;  4KF9 A;  1OKT A;  1XZO A;  4TXO A;  2EFH A;  5C04 A;  1XWG A;  2RUE A;  3CQF A;  2GGT A;  2YZU A;  2N5F A;  3KEB A;  4RUV A;  3GMF A;  1O7U A;  3HJM A;  3IPZ A;  4EDZ A;  2ON7 A;  4CY6 A;  4J57 E;  4JU5 A;  3N9J A;  4GF0 A;  1HYU A;  1OE7 A;  2DC5 A;  3WD6 A;  1N8J A;  3L4N A;  2E2G A;  3IOS A;  2B6M A;  3C71 A;  1PX7 A;  1RK4 A;  1M2D A;  2H6X A;  3Q18 A;  1KTE A;  2RUF A;  4K2D A;  4K7I A;  4AF2 A;  3GRX A;  3DEX A;  2OAD A;  3UBL A;  3PGT A;  2RII A;  2GZZ A;  4K9Z A;  4MH2 A;  1F6M C;  1ZCP A;  4WEY A;  3K8N A;  1Q4J A;  2HRA A;  4F2I A;  1DBY A;  3F4S A;  2IME A;  3UEM A;  4IHU A;  3G7J A;  3C8E A;  5CAX A;  2H0I A;  5A4U A;  3WGX A;  3VK9 A;  2LV3 A;  4LL4 B;  3A2W A;  1XOB A;  4HZ2 A;  1QMV A;  1WWJ A;  3UBK A;  4G01 A;  3U5R E;  5IMF A;  5F05 A;  1Y1U A;  1BX9 A;  2DJK A;  1GUK A;  2WFC A;  2V1M A;  1TRU A;  2DJ1 A;  2R37 A;  2CVD A;  4JZQ A;  4MA9 A;  2EFE A;  4BWQ A;  2HI7 A;  5A5H B;  5DQY A;  5KN2 A;  1F2E A;  3D5J A;  1JHB A;  2DKH A;  3LOR A;  5A34 B;  2D2Z A;  1HNA A;  3E0U A;  2H70 A;  2IMI A;  1BED A;  4WF5 A;  4G19 A;  3KM6 A;  4F03 A;  5JCG A;  4OCE A;  2EC4 A;  1YF0 A;  4KDU A;  4I97 A;  4A5P A;  1I1I P;  1OVN A;  2UZ8 A;  2DIY A;  3N5O A;  3EMP A;  4AJ6 A;  1WRY A;  4CHS A;  2JAD A;  1TKD B;  3IK7 A;  4POB A;  2C80 A;  2YOI A;  3Q74 A;  1XCC A;  2LNS A;  4PI0 C;  2F8A A;  2HT9 A;  3VLN A;  2M80 A;  1TP9 A;  1K3Y A;  2OAC A;  19GS A;  4N0V A;  5F0G A;  2BJX A;  4K7N A;  5CRG A;  2E7P A;  4DSS B;  4O32 A;  1ERV A;  1KNG A;  4NPB A;  2NVL A;  1BJX A;  4I2U A;  4Z7X A;  4OCF A;  2JU5 A;  1SVL A;  3FZ5 A;  2R4V A;  3IC8 A;  1R4W A;  3ZRD A;  1WP0 A;  4BL7 B;  1V57 A;  9GSS A;  4MJB A;  5H5Q A;  5J9B A;  5F07 A;  4EDY A;  3A3T A;  5DCH A;  2EIO A;  3KZQ A;  2H1A A;  3ERF A;  1YY7 A;  3LXZ A; 
#chains in the Genus database with same CATH homology
 1ERU A;  2HSY A;  2EFD A;  2I81 A;  4MNN A;  1PA3 A;  2IIY A;  3G9B A;  5CRD A;  2FGX A;  2PMT A;  1HD2 A;  4HJ2 A;  3CRU A;  1SKR B;  5IO0 A;  4WKW A;  2B7J A;  2VAF A;  3IV4 A;  3NZN A;  1Q98 A;  3D22 A;  5B6M A;  4XS1 A;  3GIX A;  2DLX A;  5A5H A;  3LSZ A;  3KJY A;  5DDL A;  3KTL A;  2WUL A;  3R3E A;  3JCM L;  3C73 A;  2HRK B;  5IM9 A;  5A34 A;  4X1U A;  4N30 A;  2OJL A;  3KGK A;  5G1K A;  1GWC A;  4ZBD A;  2CX3 A;  3KD0 A;  2LRT A;  1XFL A;  4WF4 A;  4F9Z A;  2YV9 A;  3PPU A;  2NDO A;  4WBJ A;  2F9S A;  2CAQ A;  2YWO A;  3FW2 A;  1IYH A;  1G0T A;  1K0D A;  5ECO B;  4BPY A;  2P5Q A;  1GUH A;  3ME7 A;  4POK A;  4KND A;  3TKS E;  3UAP A;  1JZR A;  4MPF A;  1O85 A;  2HRN A;  2VIM A;  1XOA A;  1TXX A;  3C7M A;  3HJP A;  4PUA A;  3QFA C;  4KW6 A;  1GL8 A;  4ZB7 A;  2B1L A;  3FMW A;  3FZ4 A;  5D96 A;  3J7Y k;  4HU7 A;  4ULX A;  2K18 A;  4EXJ A;  2FUG 2;  3ZZX A;  1V2A A;  5D9T A;  1V58 A;  4ZL8 A;  4DSS A;  1SVO A;  4IP6 A;  1M2B A;  4IEL A;  4HUA A;  2JZS A;  5ECI B;  1YZX A;  3L78 A;  1DE1 A;  4BL7 A;  2MMA A;  5IOX A;  2VLU A;  2A2S A;  2IL3 A;  2NTO A;  4KH7 A;  2NPB A;  2GT6 A;  1TI3 A;  4ZXG A;  1OC8 A;  3M8N A;  3RPN A;  3V1W A;  2XPE A;  1EGO A;  5G5E A;  2LST A;  4CY8 A;  1HQO A;  4JED A;  3GFK A;  2H71 A;  5ECP B;  4IQ1 A;  3EWL A;  3GL5 A;  3LYK A;  4MP4 A;  2LEG A;  1J08 A;  3F4T A;  3KTB A;  1V9W A;  1PKZ A;  3I9V 2;  3HKR A;  1GTU A;  2JSY A;  2RM6 A;  2HRK A;  5B7C A;  3EU3 A;  2DJJ A;  3PH9 A;  1U3A A;  5GST A;  2EFC A;  2VCT A;  1FO5 A;  2CAI A;  4ZBB A;  2GTU A;  1SL0 B;  1J9B A;  5JCU A;  2R0C A;  2GSS A;  2H01 A;  3HD5 A;  2GZP A;  2A4H A;  5J4Y A;  3RAZ A;  3J7Y b;  4O5U A;  1PQN A;  2TIR A;  3M0F A;  5EL8 A;  3A2X A;  3HZ8 A;  4NMU A;  2WS2 A;  1B9X C;  2IMF A;  1TDI A;  4AKG A;  2AHE A;  4MF7 A;  3LJR A;  2LTK A;  2C8U A;  4POM A;  3E3E A;  3GSS A;  1UN2 A;  2BMX A;  1TU7 A;  3CSH A;  3SBC A;  4I6X A;  3L0H A;  1NSW A;  4G9H A;  2CZ2 A;  2KOK A;  2PVQ A;  2KLX A;  2B5X A;  2WCI A;  5F8B A;  3Q6O A;  5ECM B;  3HVS A;  3LG6 A;  5COH A;  3BCK A;  1WIK A;  2X4A A;  2XBI A;  2FLS A;  1JZW A;  2YWI A;  4MJC A;  6GSX A;  1XVW A;  3WT1 A;  5J4U A;  1O73 A;  3IDV A;  5D93 A;  2I4A A;  4ECJ A;  4PQI A;  3HMJ G;  4TR4 A;  1ZYP A;  3UAR A;  3MAK A;  4K5S A;  3NOF A;  4YQV A;  1AQX A;  2VD1 A;  3FR6 A;  5EY6 A;  1XPV A;  1U3I A;  3QPM A;  4PUR A;  2H0H A;  1K3L A;  4CDO A;  3I69 A;  2HYX A;  2FNO A;  4QL9 A;  2JL4 A;  5H5S A;  1QGV A;  1F3B A;  4KGI A;  3KH7 A;  4DSQ A;  2YWM A;  4MZC A;  5KN1 A;  2L59 A;  1X0R A;  2O89 A;  1Z6N A;  2HE3 A;  4ISD A;  1QFN A;  5IIZ A;  2XBQ A;  1THO A;  5GAP D;  1HNB A;  1EV9 A;  1FOV A;  3GUR A;  4JR4 A;  4MJA A;  1O8X A;  5IPH A;  5A4V A;  3H1N A;  4K0N A;  1BYE A;  4FIW A;  4IBP A;  4GLT A;  2R0P A;  1AQW A;  1YKA A;  3EE2 A;  5DAK B;  2BTO T;  4Q5Q A;  5KN3 A;  1PL2 A;  3A2V A;  4X4J A;  2GVP A;  2DJ2 A;  4EF0 A;  5AN1 A;  1T4Z A;  1S3A A;  2WGR A;  2XC2 A;  4HQS A;  5E4W A;  4O5Q A;  1MDK A;  3GKX A;  1U6T A;  1R5P A;  1ZOF A;  3CYN A;  4MF5 A;  3VPT A;  1XW6 A;  1OE8 A;  1XVQ A;  4V2L A;  5ECS A;  4G10 A;  3MNG A;  1FW1 A;  2FHE A;  3ZIT A;  1ZYN A;  4EE0 A;  1TTZ A;  4JBB A;  1X9M B;  2LNT A;  5CO3 A;  5IPG A;  2HSH A;  3TRQ A;  2CVK A;  5C00 A;  3RHC A;  3O3T A;  1EOH A;  1K0C A;  4F82 A;  2C0E A;  1A8L A;  2YAN A;  1WPI A;  3G7Y A;  3C1R A;  2VL3 A;  4EL1 A;  5ECH B;  2B3S A;  3TKP A;  2G2Q A;  4N3Z A;  1WE0 A;  4EC0 A;  1TI1 A;  5B8A A;  3FK8 A;  3ZVJ D;  3DVW A;  4K7O A;  5LD0 A;  4OMV A;  4XS6 A;  3QAV A;  5JCW A;  1M0U A;  1O81 A;  1TRS A;  1ZGN A;  4HI7 A;  3LXZ A;  1AAZ A;  5AIX A;  3UJ1 A;  1SYR A;  4NHW A;  2CX4 A;  3TRX A;  3ED3 A;  2FA4 A;  4CW9 A;  2Z9S A;  2H0G A;  2VLT A;  2IFQ A;  1K0N A;  3I43 A;  2OBK A;  5FWG A;  2LQQ A;  2RLI A;  1ERW A;  4XIH A;  4QL7 A;  2VCZ A;  3W8J A;  5G30 A;  3D4M A;  1M9A A;  3ZIJ A;  17GS A;  5DAK A;  4O5R A;  1G6Y A;  2LUS A;  1TK8 B;  4TR1 B;  4DVC A;  1SKW B;  1ZYE A;  1B8X A;  2OKA A;  3HYP A;  1A23 A;  1ACV A;  3DGQ A;  2K9F A;  4GTU A;  3RHB A;  3FZ9 A;  4AKX B;  4GWR A;  1M7T A;  1Z9H A;  4L0U A;  1QXH A;  4V1A g;  5JWR B;  2VCX A;  1OC9 B;  5A1N B;  5J47 A;  4V1A p;  2DMM A;  2O7K A;  4OO5 A;  1ON4 A;  2VCW A;  2H1D A;  4MF6 A;  10GS A;  5ECL B;  1DE2 A;  3DKS A;  1RW1 A;  3WGD A;  3KP8 A;  2WDU A;  2AAW A;  1GP1 A;  4FYB A;  2PUK C;  1SYX A;  2LRN A;  3TKR A;  2V6O A;  2O8V B;  4GCI A;  5BRT A;  1TK0 B;  4L8E A;  4J56 E;  3IR4 A;  3KCM A;  4AKH A;  2IN3 A;  5BMU B;  5B8B A;  4WR5 A;  4BA7 A;  2F51 A;  2JAC A;  4HJM A;  4XS4 B;  2XPD A;  3O76 A;  1S3D A;  3GV1 A;  5DQS A;  1TU8 A;  3D21 A;  2MBT A;  2P31 A;  2VCQ A;  1NW2 A;  3GKM A;  1RQM A;  4TKY A;  2ZUP A;  2C3Q A;  2JZR A;  4LMW A;  5KEJ A;  3FRC A;  3ZVJ A;  3ERW A;  4ECI A;  4X43 A;  2H8L A;  4HU9 A;  3FZA A;  1Z5Y E;  5HR1 A;  2ES7 A;  4PNF A;  1TK5 B;  3ZLP A;  2A2P A;  3LWA A;  2HXK A;  3QD9 A;  4K6X A;  4GSS A;  5JWO B;  2CZ3 A;  1V98 A;  4ZBA A;  4ACS A;  3KH9 A;  3M1G A;  4KCA A;  2V6K A;  4D73 B;  2C4J A;  3Q19 A;  3H8Q A;  4WET A;  4IN0 A;  4IW9 A;  2AYT A;  2X49 A;  5J5N A;  2VCV A;  2R3X A;  2GQM A;  3MDK A;  5FT3 A;  2VM1 A;  5IMZ A;  5B6N A;  4FYU A;  3A5W A;  4NWY A;  4K2X A;  1SJZ A;  1SKS B;  3F3Q A;  5A1N A;  1XWK A;  2OT3 A;  2KP2 A;  3HZ4 A;  4AJ8 A;  2KP1 A;  2DJ3 A;  2HQT A;  4GRF A;  3FYG A;  2C1Y A;  2TRC P;  5ID2 B;  2MZC A;  2HFD A;  2L57 A;  1M9B A;  3BBY A;  1HNC A;  3FHK A;  1MD4 A;  3APO A;  1XWB A;  4USS A;  5KOX A;  1JLV A;  2H76 A;  1R26 A;  1SK0 A;  5GZZ B;  4XCS A;  4I8B A;  1M99 A;  4PTS A;  1WOU A;  5BMU A;  4MK3 A;  3M9K A;  4MZB A;  2H75 A;  3DIE A;  1PGT A;  5GSS A;  4XS4 A;  5G31 A;  1AC1 A;  1AIU A;  3GN3 A;  3VWV A;  5CRW A;  4GXZ A;  1GLP A;  4ZL7 A;  3ZML A;  2GT5 A;  1MEK A;  1JFU A;  4MPG A;  3TJK A;  2C3N A;  1X5E A;  4ECB A;  4AGS A;  4HQZ A;  2DSA A;  5IOW A;  1GTI A;  1GSY A;  3IK9 A;  3EU4 A;  2LRC A;  3GHA A;  5CRH A;  3GYK A;  3ME8 A;  1A24 A;  1W4V A;  2YJ7 A;  5EPF A;  3IC4 A;  1H75 A;  3TOT A;  5A4W A;  1SD9 A;  2NBS A;  1A8Y A;  2YJH A;  3ZMK A;  1FVJ A;  2FWH A;  4D73 A;  2OE0 A;  1SK1 A;  4RI7 A;  1T3B A;  4OO4 A;  4DSR A;  4PXO A;  2I9H A;  2VD0 A;  4XHM A;  4ZIJ A;  5ECK B;  3P7X A;  3TJB A;  2RM5 A;  3C1S A;  3H93 A;  3HHV A;  3GH6 A;  1ZZY A;  2CA8 A;  2WJU A;  1WJK A;  2DBC A;  4RQR A;  4PQH A;  2VOC A;  1GTB A;  3A5I A;  2IMK A;  2KUC A;  1ZMA A;  2KHP A;  3QOU A;  1ST9 A;  2M46 A;  3CTF A;  1A2L A;  3TKS C;  4Q5N A;  5ID2 A;  1SK2 A;  4BWS A;  2CV4 A;  5J4V A;  1YDK A;  2H1B A;  5CP1 A;  4PNG A;  2L4C A;  1T4Y A;  3AY8 A;  2F8F A;  4P3Y B;  3ISO A;  3F0I A;  1UVZ A;  2YN1 A;  4FYC A;  5AIS A;  5ELA A;  2LS5 A;  4J2F A;  4JE1 A;  6GST A;  4QQ7 A;  2C0G A;  4WBR D;  5J9C A;  4ML1 A;  2GSR A;  3LXT A;  4IGJ A;  5LNK e;  1NHY A;  3TOU A;  3F6D A;  3SWL A;  3E9J B;  3WT2 A;  3VUR A;  3EPT A;  1C72 A;  5J41 A;  4XRD A;  1PX6 A;  1EZK A;  4YAP A;  3UVT A;  2UV8 G;  2PER A;  2K6V A;  3BCI A;  1Z7P A;  4POL A;  3FR9 A;  3LW9 A;  22GS A;  2K8S A;  4OFM A;  2L6C A;  14GS A;  3W8S A;  4PX1 A;  2GLR A;  2M72 A;  2PGT A;  2VL2 A;  2OA7 A;  1VF2 A;  4N10 A;  2HRF A;  1DUG A;  4KB3 A;  2O85 A;  4G0I A;  5D8I A;  1GSF A;  2OE1 A;  4HOJ A;  2O5V A;  3CSI A;  1ILO A;  1E6B A;  18GS A;  3KXO A;  3ZFL A;  2V32 A;  3F6F A;  4KX4 A;  1K0B A;  3DRN A;  3M9J A;  5FHI A;  3I6A A;  3HY2 A;  3D6I A;  4LL1 B;  3L9S A;  1Y6E A;  3CRT A;  4NHZ A;  3TCO A;  2OBI A;  5HFI A;  4G0K A;  2K8V A;  5G5F A;  1PMT A;  3TDG A;  4E8H A;  5ELG A;  1E2Y A;  3TGZ A;  4NV5 A;  3L9V A;  4K0G A;  1ML6 A;  3F4R A;  1OYJ A;  1SD8 A;  1VRS D;  1H4O A;  1FB0 A;  2AB6 A;  3BD2 A;  4TR3 A;  3CTG A;  1XW5 A;  4TRX A;  4TR0 A;  4KAE A;  3S9F A;  4Z2R A;  1X5C A;  4Z2T A;  2AJQ B;  5EVO A;  3IE3 A;  2MMZ A;  2A2R A;  4F0B A;  3GKK A;  2ALB A;  1QK8 A;  1B4Q A;  1Z3E A;  4I2T A;  1OAZ A;  1BF5 A;  4YQM A;  1S3C A;  3D0Z A;  5IMV A;  2C0D A;  4EIP A;  1FAA A;  1A0F A;  3KMN A;  5CNW A;  3L9U A;  4W66 A;  1OC3 A;  5DVB A;  1GNE A;  1T00 A;  1NHO A;  1T8E B;  2H6Z A;  3QR6 A;  2A4V A;  3TRP A;  3MSZ A;  1LJR A;  1Y25 A;  4MJE A;  1O8W A;  2GSQ A;  2I3Y A;  3VPQ A;  5CRE A;  2OE3 A;  1LU4 A;  20GS A;  2GDR A;  11GS A;  2P0G A;  1B48 A;  4V2M A;  3TJJ A;  4HEA 2;  2X8H A;  3HCZ A;  4AKI A;  4KUN A;  1GUL A;  3H4K A;  4IJ3 A;  5G2Z A;  2VL2 C;  1TJD A;  3R2Q A;  4MMM A;  4IKH A;  2QKE A;  1JZO A;  3O6T A;  1Z6M A;  2REM A;  3WGE A;  4YKF A;  1G7O A;  3QDN A;  3IHG A;  3CXG A;  16GS A;  2H73 A;  3APQ A;  4TW5 A;  4I5Q A;  1EOG A;  1TOF A;  1XWA A;  1I5G A;  1THX A;  4HDE A;  1ABA A;  2FWF A;  1B4P A;  2X8C A;  5J40 A;  3FKF A;  2YWN A;  3NIV A;  4E68 A;  1USB A;  3PR8 A;  1FB6 A;  3F3R A;  2R5G A;  2HSM B;  2DIZ A;  3ZIV A;  1FOH A;  5D73 A;  2CQ9 A;  2EIR A;  4GSN A;  3EC3 A;  2GS3 A;  3ZRE A;  2B5E A;  1O6J A;  3TU3 B;  1TRV A;  1N25 A;  2YCD A;  2ZNM A;  2HSN B;  1KEB A;  2H74 A;  7GSS A;  2B1K A;  4LMV A;  4ILF A;  4ML6 A;  1R5A A;  4YH2 A;  4AI6 A;  5D9X A;  5D9V A;  1JZD A;  2AUV A;  1YQ1 A;  2L5L A;  3RBT A;  1FHE A;  2E2M A;  4FQU A;  3WYW A;  4GQC A;  5ECQ B;  3ZTL A;  3DXB A;  1XXU A;  2IMD A;  1SL1 B;  5IQY A;  5JWQ B;  1VF4 A;  2XHF A;  3LFL A;  2DJ0 A;  1VF1 A;  1YVL A;  2MMN A;  1CQH A;  4KCE A;  2X64 A;  1EEM A;  1ZYQ B;  3TUE A;  5LCZ A;  4MH3 A;  3EMX A;  1EP7 A;  2ZCT A;  4K1F A;  2N5B A;  1DSB A;  4WR4 A;  2QSI A;  4DEJ A;  3LGC A;  3VWX A;  1PRX A;  1KBN A;  1URM A;  4NAX A;  5KOW A;  3MWH A;  2HNL A;  2R6K A;  4KSM A;  1GSS A;  1K0M A;  3IXR A;  2B7K A;  3GX0 A;  4K5R A;  3BJ5 A;  3F9U A;  1ERT A;  1QQ2 A;  1PN0 A;  3U6V A;  4MLY A;  4NV2 A;  1FG4 A;  1J0F A;  4TXV A;  4YQU A;  3FY7 A;  1EV4 A;  1A0R P;  2E0Q A;  1TRW A;  6GSU A;  3MIX A;  4OD7 A;  4OFT A;  3EIN A;  2VKZ G;  2PPT A;  2HSM A;  1X9W B;  2QA1 A;  4BVX B;  5IMD A;  1SVM A;  4ZIL A;  3HVV A;  1PL1 A;  3GH9 A;  3VI7 A;  1B9Y C;  2L5O A;  1EEJ A;  1XBS A;  3F63 A;  3ZYW A;  1XIY A;  4YAV A;  3IA1 A;  4HS1 A;  3CBU A;  2JSZ A;  4L0W A;  2MYG A;  2VO4 A;  3CWG A;  5DCG A;  2HZF A;  1TXU A;  3HVX A;  4KSO A;  4TR1 A;  1U88 A;  1BAY A;  2HSN A;  4RQX A;  1T1V A;  3IHQ A;  4LLR A;  2PBJ A;  3IBH A;  2ON5 A;  5DJM A;  4F0C A;  4IQA A;  1VF3 A;  2VUP A;  3QAW A;  2HZE B;  2J9H A;  2YNX A;  3QFB C;  2R2J A;  4KA0 A;  4NXI A;  1M2A A;  2EIQ A;  2WB9 A;  5KN0 A;  3RPP A;  1K0O A;  5DBQ A;  3DD3 A;  3F8U A;  3KIJ A;  3EYT A;  3ZL5 A;  5G1L A;  3DYR A;  2CVB A;  2FY6 A;  1OC9 A;  4JRR A;  8GSS A;  3PIN A;  3QAG A;  3ERG A;  4HZ4 A;  2H1L A;  3TKS A;  2AV4 A;  1GSD A;  3GX8 A;  5DAL B;  4EUY A;  2JZT A;  2LJK A;  1T7P B;  5IMA A;  2CT6 A;  2FWG A;  3CSJ A;  1YEP A;  3GL3 A;  5ABR A;  4IJI A;  4WXT A;  2PVO C;  2PWJ A;  1Z7R A;  1EGR A;  4ID0 A;  1UC7 A;  1CQG A;  1SJ6 A;  3GTU B;  2L6D A;  4EIQ A;  3IRA A;  2J23 A;  2I1U A;  3APS A;  3UL3 A;  2N5A A;  5F06 A;  4IS0 A;  2LJA A;  2QA2 A;  1V40 A;  1OKD A;  1YF1 A;  1EP8 A;  2TRX A;  3TJG A;  2R0G A;  1QUW A;  3LYP A;  4G0L A;  4BVX A;  2H66 A;  3GA4 A;  5HFG A;  2YV7 A;  1A2M A;  4KDY A;  2F3M A;  1X5D A;  2FWE A;  2H1G A;  2FCH A;  2VL9 A;  3DWV A;  4N0Z A;  1GSQ A;  1XWC A;  3P8W A;  2GQL A;  4L5L A;  1MD3 A;  1I9D A;  3D4T A;  1AW9 A;  3UOM A;  4OFN A;  4XTS A;  1GLQ A;  1YEX A;  3HXS A;  2HZE A;  3BOA A;  2IJY A;  5DJL A;  5A5K A;  4Q5R A;  1G6W A;  1IYI A;  1AUC A;  3TKQ A;  2IPA A;  5D9W A;  2V41 A;  4ICY A;  4E8E A;  4MCU A;  5L71 A;  2C0F A;  5CYY A;  3GKN A;  2YZH A;  2GQK A;  4IP1 A;  5DAL A;  2LKU A;  2H19 A;  1WMJ A;  2DKI A;  4GQF A;  1GUM A;  5E59 A;  4LA1 A;  2PN8 A;  6GSS A;  3OR5 A;  4GDF A;  5IMC A;  4TN8 A;  2H72 A;  3LEF A;  3VWW A;  1R7H A;  1GRX A;  1AQV A;  5AIV A;  4ZB8 A;  4XRA A;  1YJ6 A;  2FA8 A;  4L5O A;  4FO5 A;  2QC7 A;  4BVY B;  4AJ7 A;  3H79 A;  1GNW A;  3EVI A;  3FEU A;  2DML A;  3GUS A;  1GTA A;  3GTU A;  3DVX A;  5H5R A;  4KE3 A;  3G7I A;  4OWY A;  1UA5 A;  1GH2 A;  1N2A A;  2PU9 C;  1PD2 1;  3UMA A;  4PQ1 A;  3HA9 A;  3HDC A;  2YPM A;  2YP6 A;  4X0X A;  2WZ9 A;  3US3 A;  2FD3 A;  2C3T A;  4ZB6 A;  4Z2U A;  4ECC A;  4TOP A;  2G0F A;  3GNJ A;  3P90 A;  3IAS 2;  1VGL A;  4O7H A;  2V2G A;  1FVK A;  1EWX A;  4V2N A;  3VFI A;  1W89 A;  1SJI A;  2GST A;  1A2J A;  3M3M A;  1MDI A;  6GSV A;  4EO3 A;  3RDW A;  1JLW A;  5AGY A;  4H86 A;  4EKZ A;  1PN9 A;  2GZY A;  3HJO A;  1ZL9 A;  1BG5 A;  2O87 A;  4K8M A;  2MBS A;  4TXO B;  4YKG A;  4TVE A;  3ZFB A;  4RI6 A;  2MMO A;  4N11 A;  3TJF A;  3VI5 A;  1GSE A;  3UVH A;  4QMK A;  1MTC A;  3VWU A;  2VLV A;  1SEN A;  3FR3 A;  1SL2 B;  5INY A;  1SU9 A;  6GSW A;  1YKC A;  3QMX A;  3EUR A;  2HLS A;  2LQO A;  1G7E A;  2B5Y A;  2LJR A;  4KDX A;  4PGT A;  3TB2 A;  1X9S B;  4PUF C;  5HR3 A;  3KMO A;  1AXD A;  1U87 A;  5HFK A;  3DML A;  4BVY A;  1K3O A;  3W6G A;  3UIW A;  4MAB A;  4EVM A;  5GAN D;  4O92 A;  12GS A;  3KP9 A;  2X8G A;  1NM3 A;  4Q5F A;  2WRT A;  2H30 A;  5ENU A;  1XW9 A;  3LQ7 A;  2IFQ B;  1LBK A;  3QCP A;  1F37 A;  1MDJ A;  1BG1 A;  2P5R A;  5HR2 A;  1PSQ A;  1PKW A;  4GST A;  5HQP A;  1F9M A;  13GS A;  2VM2 A;  3CMI A;  4ZL9 A;  2IWT A;  4ZB9 A;  2X99 A;  2QGV A;  5HR0 A;  4MDC A;  3P2A A;  5IO2 A;  2L4Q A;  1BQ7 A;  4FH8 A;  1TW9 A;  1F3A A;  4MZW A;  1K0A A;  3GST A;  2H6Y A;  4JR6 A;  5ECN B;  1GSU A;  6GSY A;  3IAM 2;  3MYD A;  5J3R A;  4IVF A;  4G2E A;  5ECR B;  4KF9 A;  1OKT A;  1XZO A;  4TXO A;  2EFH A;  5C04 A;  1XWG A;  2RUE A;  2GGT A;  2YZU A;  2N5F A;  3KEB A;  4RUV A;  3GMF A;  1O7U A;  3HJM A;  3IPZ A;  4EDZ A;  2ON7 A;  4CY6 A;  4J57 E;  4JU5 A;  3N9J A;  4GF0 A;  1HYU A;  1OE7 A;  2DC5 A;  3WD6 A;  1N8J A;  3L4N A;  2E2G A;  3IOS A;  2B6M A;  3C71 A;  1PX7 A;  1RK4 A;  1M2D A;  2H6X A;  3Q18 A;  1KTE A;  2RUF A;  4K2D A;  4K7I A;  4AF2 A;  3GRX A;  3DEX A;  2OAD A;  3UBL A;  3PGT A;  2RII A;  2GZZ A;  4K9Z A;  4MH2 A;  1F6M C;  1ZCP A;  4WEY A;  3K8N A;  1Q4J A;  2HRA A;  4F2I A;  1DBY A;  3F4S A;  2IME A;  3UEM A;  4IHU A;  3G7J A;  3C8E A;  5CAX A;  2H0I A;  5A4U A;  3WGX A;  3VK9 A;  2LV3 A;  4LL4 B;  3A2W A;  1XOB A;  4HZ2 A;  1QMV A;  1WWJ A;  3UBK A;  4G01 A;  3U5R E;  5IMF A;  5F05 A;  1Y1U A;  1BX9 A;  2DJK A;  1GUK A;  2WFC A;  2V1M A;  1TRU A;  2DJ1 A;  2R37 A;  2CVD A;  4JZQ A;  4MA9 A;  2EFE A;  4BWQ A;  2HI7 A;  5A5H B;  5DQY A;  5KN2 A;  1F2E A;  3D5J A;  1JHB A;  2DKH A;  3LOR A;  5A34 B;  2D2Z A;  1HNA A;  3E0U A;  2H70 A;  2IMI A;  1BED A;  4WF5 A;  4G19 A;  3KM6 A;  4F03 A;  5JCG A;  4OCE A;  2EC4 A;  1YF0 A;  4KDU A;  4I97 A;  4A5P A;  1OVN A;  2UZ8 A;  2DIY A;  3N5O A;  3EMP A;  4AJ6 A;  1WRY A;  4CHS A;  2JAD A;  1TKD B;  3IK7 A;  4POB A;  2C80 A;  2YOI A;  3Q74 A;  1XCC A;  2LNS A;  2F8A A;  2HT9 A;  3VLN A;  2M80 A;  1TP9 A;  1K3Y A;  2OAC A;  19GS A;  4N0V A;  5F0G A;  2BJX A;  4K7N A;  5CRG A;  2E7P A;  4DSS B;  4O32 A;  1ERV A;  1KNG A;  4NPB A;  2NVL A;  1BJX A;  4I2U A;  4Z7X A;  4OCF A;  2JU5 A;  1SVL A;  3FZ5 A;  2R4V A;  3IC8 A;  1R4W A;  3ZRD A;  1WP0 A;  4BL7 B;  1V57 A;  9GSS A;  4MJB A;  5H5Q A;  5J9B A;  5F07 A;  4EDY A;  3A3T A;  5DCH A;  2EIO A;  2H1A A;  3ERF A;  1YY7 A;  3KZQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...