1GTAA

Crystal structures of a schistosomal drug and vaccine target: glutathione s-transferase from schistosoma japonica and its complex with the leading antischistosomal drug praziquantel
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
218
structure length
218
Chain Sequence
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE
publication title Crystal structures of a schistosomal drug and vaccine target: glutathione S-transferase from Schistosoma japonica and its complex with the leading antischistosomal drug praziquantel.
pubmed doi rcsb
source organism Schistosoma japonicum
molecule tags Glutathione transferase
total genus 71
structure length 218
sequence length 218
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1994-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1gtaA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1gtaA01
2R3XA 3KXOA 2PERA 1UN2A 2H70A 5JCWA 2GZYA 2MYGA 1DSBA 3VFIA 3APQA 4G0LA 2L6DA 3CRUA 1V98A 16GSA 1XBSA 1YF1A 2YV7A 5INYA 4EDZA 1YEPA 2C80A 1SKSB 1ABAA 3VWXA 2H74A 4FQUA 2JACA 2ZCTA 1PGTA 5G1LA 2BJXA 1GTUA 1F37A 2YANA 4HI7A 3C7MA 1A0FA 3GKKA 2H01A 3J7Yk 2K9FA 2VLUA 4JU5A 1SU9A 4CW9A 5JCUA 1NSWA 18GSA 2B5XA 1A8LA 1FB6A 3KH9A 1QXHA 1Q98A 1M0UA 1M7TA 1Z3EA 3L9UA 1SKWB 1V57A 3I69A 5D9TA 3HJMA 1B9XC 3ZFBA 2YJHA 4ACSA 2FWEA 3GA4A 4G0IA 2I81A 2AJQB 2LEGA 4ECBA 3F9UA 17GSA 5G31A 2LNTA 3UARA 1GNEA 4XHMA 4N0VA 2FA8A 3FR9A 3C1RA 4TKYA 1FAAA 5DCGA 2QKEA 2GT6A 4ZIJA 4LMVA 4ZBDA 2C0DA 3CTGA 3GL5A 2HI7A 4PNGA 3PINA 3CBUA 5ECIB 2DJKA 4FYBA 2HZEB 2HE3A 4OMVA 2O7KA 3HDCA 2GGTA 4X0XA 3RHCA 2G0FA 5KN0A 4HOJA 3PH9A 2H76A 1YJ6A 2KP1A 3R3EA 4G19A 4V1Ap 1EZKA 3A2XA 4KA0A 2JSYA 3EMXA 3QFBC 1SJ6A 5AGYA 2HRNA 3QDNA 3D6IA 4ZL8A 1RK4A 2I4AA 3BOAA 3TDGA 2FWGA 4I5QA 5H5RA 5H5QA 2E7PA 4I6XA 4WEYA 4BWSA 1B4PA 1UC7A 4PX1A 2PBJA 2TRXA 2IPAA 4F0CA 2H0HA 1OKTA 1K0BA 2FWFA 4MPGA 3F4TA 4OFMA 1THOA 3LYPA 3A3TA 5ECSA 1X5CA 2YJ7A 1JZRA 1VF3A 5EVOA 2J23A 2WZ9A 4IP1A 1XCCA 1SL2B 2PVOC 5AIVA 5G30A 2CZ3A 1Z6NA 6GSWA 5KN2A 1QFNA 2B5YA 4HS1A 1LU4A 1T3BA 1YKCA 3O3TA 1IYIA 1EGRA 2HXKA 4KSOA 2C8UA 3NOFA 4BWQA 1X0RA 3WGEA 1TI3A 3IBHA 3QOUA 3LGCA 2R4VA 2IN3A 2MBTA 1ST9A 4H86A 5GSSA 5LD0A 2DBCA 1V2AA 1TI1A 3GH9A 5G5FA 1GLPA 3HKRA 7GSSA 4MJCA 3WT2A 2B3SA 3IDVA 2DIYA 2OBKA 3HY2A 1T8EB 4CDOA 4GWRA 3UL3A 3KP9A 3QR6A 2GT5A 4J57E 3ZTLA 2MZCA 1R4WA 4WBJA 3WGDA 2YZUA 2HT9A 2XHFA 2FWHA 1PL1A 5HR3A 3E0UA 2FNOA 4O92A 5F06A 2OA7A 2K6VA 4YQUA 4GQCA 3UOMA 3EURA 3KIJA 3F8UA 5AIXA 3ZVJA 2VCXA 3CMIA 1A2LA 2CVBA 1PKWA 2XC2A 2CA8A 5D9XA 4NV2A 2H19A 3F4RA 1A0RP 1EV4A 3GFKA 6GSTA 4G0KA 3GTUB 4IHUA 1OC9B 4D73A 1AXDA 5IM9A 2H1AA 2OE1A 2F9SA 1GSYA 2LUSA 1VGLA 4BA7A 4TR0A 5IMVA 1WIKA 3US3A 3FY7A 3IAS2 3CRTA 3AY8A 2O8VB 3BBYA 1V58A 4USSA 1EP7A 4XS1A 1EWXA 4XRDA 3ME8A 1B8XA 5F05A 3DKSA 4TN8A 2B7KA 2YPMA 5HR1A 2V41A 3C71A 1GSFA 1EEMA 1TW9A 1WWJA 3V1WA 2LS5A 1XIYA 1K0CA 10GSA 4JEDA 3VWUA 2HFDA 4EL1A 1SYXA 1LBKA 3ZMLA 4GRFA 1B4QA 3GV1A 2C3TA 2V1MA 3QAGA 4OCFA 1ML6A 2HLSA 3IE3A 5DAKA 3VWWA 3ME7A 2C3QA 3CSHA 1DE1A 2QC7A 2H71A 5CO3A 4FYCA 3K8NA 1JLVA 2HRAA 2IWTA 2D2ZA 4IBPA 3VI5A 4WKWA 1C72A 3QD9A 2YWMA 2H66A 4HDEA 1BX9A 3R2QA 4IQ1A 4PXOA 3GYKA 1GLQA 4DSSA 3F3QA 2CVDA 3LXTA 1GH2A 1BYEA 4KDYA 1XWGA 3VPQA 1XVQA 2VO4A 5A4WA 2VM2A 1AW9A 2OKAA 2VCZA 3NIVA 3TKQA 4LLRA 3LJRA 4V2LA 4YAVA 3S9FA 1OYJA 2YWOA 3FR6A 3GX0A 1X9SB 2VD0A 4AF2A 2GTUA 2WJUA 2CAIA 5HFIA 5GSTA 4IVFA 3KM6A 2HZEA 3ZMKA 1ON4A 5J5NA 3QFAC 2CV4A 4MH3A 5E4WA 4Z7XA 1IYHA 5DQYA 3M1GA 3MDKA 3HJPA 1AQVA 4KCEA 2M80A 4LMWA 1O7UA 2YWNA 2LQOA 5ID2A 4RI6A 4POBA 3VI7A 2PPTA 2OACA 3TJJA 3C1SA 3M3MA 2HYXA 2OBIA 3E9JB 6GSXA 3RAZA 2GSRA 2RM6A 2VD1A 3FZ9A 3GKXA 3WYWA 4GTUA 4NXIA 1GULA 1TDIA 4KCAA 2YZHA 1HNCA 1YY7A 1XW6A 5G1KA 3GMFA 2K8SA 2DJ2A 4I2UA 2OJLA 3CXGA 4KB3A 5H5SA 4ZL7A 3L78A 3UVHA 4K8MA 2CT6A 3GRXA 1YZXA 1XZOA 1QQ2A 1KNGA 1GUKA 3LWAA 3Q19A 12GSA 1B9YC 1SJIA 1WRYA 4WXTA 3TKRA 4EKZA 2P0GA 20GSA 1KTEA 1Y25A 4HQSA 3TJBA 2PGTA 2R37A 5IPGA 2HSMA 2GSTA 1BAYA 2LRTA 5ELGA 2H6ZA 1T7PB 5DAKB 2Z9SA 4RUVA 1NHOA 4L0UA 3MAKA 4EO3A 1FW1A 1PMTA 4MZCA 3TRXA 3UJ1A 3H8QA 4KSMA 2CX3A 1SL1B 2KP2A 3L9VA 4XS4B 2C0FA 2N5BA 1JZWA 2IMDA 5DALA 4MDCA 5B8AA 4AJ7A 4DSSB 3HHVA 5D96A 4WR5A 2UZ8A 5ECPB 1UA5A 4NV5A 1ILOA 3I9V2 2GZPA 5ECMB 3HZ8A 2A2SA 3BCKA 1PX6A 1DUGA 5B7CA 4DVCA 2FY6A 2HSYA 5AN1A 1XFLA 3DYRA 3QMXA 4XIHA 2FUG2 2PVQA 5GAND 5A4UA 3DD3A 5ECKB 2YNXA 2CZ2A 1HYUA 1N2AA 4Q5NA 2H6YA 4F82A 4L8EA 3A2WA 2WB9A 4E8HA 3FK8A 1TK0B 2R5GA 2ZUPA 4YH2A 4HU7A 3IAM2 3FR3A 5HQPA 4IELA 4MZWA 1USBA 5IO2A 2NBSA 1EV9A 1FO5A 3P90A 4RQRA 2DJ1A 4RI7A 2BTOT 4TR1A 2LRCA 5CP1A 4F2IA 3L0HA 1VRSD 1J0FA 2QSIA 1M99A 3DVWA 4E8EA 1GTBA 5B8BA 5ID2B 4HZ2A 2LJRA 3IOSA 3GTUA 1BQ7A 1OC9A 1ZZYA 4ECCA 1XW9A 2PUKC 1Z9HA 5ECRB 5GZZB 3PPUA 2NTOA 4IW9A 2PU9C 4PQ1A 1K3LA 3HVVA 1K0AA 4K9ZA 1RQMA 1T1VA 3DVXA 3W8JA 11GSA 3OR5A 3G9BA 2V2GA 2H73A 2MMAA 2FCHA 3O76A 3KCMA 1F3AA 5IO0A 2VIMA 2AUVA 1PKZA 2VL9A 1Z6MA 5HR2A 4IS0A 2EC4A 1ZYEA 1GRXA 2X8CA 1V40A 5D8IA 1ZOFA 4O5RA 1U3IA 3KZQA 4XS6A 1THXA 1OC3A 1SL0B 1XW5A 4WR4A 3ZZXA 2YWIA 1S3CA 1QGVA 1OKDA 1H4OA 1MDIA 3VURA 2HSMB 3APOA 4HJMA 4FH8A 2OE3A 5CRGA 1O81A 4N11A 4PGTA 1K3OA 1SJZA 1J08A 1T4ZA 1EGOA 5F0GA 1GUMA 4POMA 3ERGA 1A23A 6GSSA 6GSVA 1GL8A 2H75A 1U6TA 1JFUA 3GX8A 4OWYA 1GSDA 3D5JA 3N5OA 2M46A 3GUSA 3IV4A 4HZ4A 2DIZA 5DALB 2C4JA 1WOUA 2GDRA 3FYGA 2H0IA 4I8BA 2JL4A 4ZB6A 4OCEA 1OC8A 3GL3A 1W89A 1NW2A 2RUEA 3KD0A 5ECNB 1PN9A 2LV3A 3IK9A 5F8BA 1ACVA 2DSAA 5IMZA 4I2TA 1F6MC 3LORA 2WULA 5DVBA 2VCTA 4EC0A 2MBSA 5D73A 4DSQA 1ZCPA 1M9AA 4NPBA 2IMEA 5FHIA 3TRQA 5HR0A 2CX4A 3G7YA 3IA1A 3LYKA 3QCPA 4MLYA 2WFCA 2NDOA 2HZFA 4Q5QA 2OADA 1Z7PA 4PUAA 3VLNA 4GQFA 2AHEA 1G7EA 3HYPA 4WBRD 4MJAA 3H79A 3ZIVA 1PX7A 1ERUA 2RLIA 4AJ8A 3E3EA 4TR1B 5CRWA 3M0FA 5JCGA 4HQZA 3A2VA 2KHPA 2KUCA 4MH2A 1KBNA 5CYYA 1CQGA 3L4NA 4O32A 4ZXGA 2P5QA 1UVZA 1VF1A 4EUYA 4JZQA 4K7OA 3FZ5A 4OFTA 4JE1A 1XOAA 2O89A 5HFKA 5JWQB 3ZIJA 2IMFA 2K8VA 3M9JA 5HFGA 3TKSE 1T4YA 3RHBA 5EY6A 3IK7A 4MF6A 4KW6A 4X43A 3ZYWA 4QL7A 2YCDA 4FIWA 1X5EA 3KJYA 3LEFA 1WP0A 4HEA2 3CSIA 4BVXB 4GSNA 2N5AA 3RBTA 4X1UA 1CQHA 1W4VA 5KN3A 1RW1A 1GTIA 1FHEA 2P31A 2ALBA 4AGSA 1MTCA 3ERFA 14GSA 1TRSA 1A2MA 4P3YB 3TOTA 1GNWA 2R6KA 2FGXA 3RPPA 3D0ZA 5FWGA 2JZTA 4V2MA 2HRKB 1XVWA 5F07A 1T00A 3F63A 4GSTA 2L5OA 3DXBA 3KP8A 4KX4A 2AV4A 2DMLA 1K0OA 2RM5A 4NWYA 4K0NA 2WGRA 1JLWA 4ULXA 5C04A 4MF7A 3VK9A 3TJFA 5A4VA 1O73A 2TIRA 2YN1A 5CNWA 4PUFC 5IPHA 1PD21 1ERTA 2HQTA 1F2EA 3HVSA 3WT1A 4XRAA 1H75A 5G2ZA 3GSTA 2DMMA 4XS4A 1S3DA 2MMOA 9GSSA 1BG5A 6GSYA 1Y6EA 5FT3A 2H1GA 4MF5A 1TK5B 5KEJA 3D4MA 4K2DA 2B1KA 2RIIA 3HCZA 3UEMA 4KDUA 5B6MA 3W8SA 3RPNA 4G2EA 2M72A 3L9SA 4DSRA 4RQXA 2VLVA 4KAEA 5DQSA 3MWHA 3SWLA 4ZB8A 5EL8A 4ECJA 3A5WA 2PWJA 2VCWA 1BJXA 4HU9A 1EOGA 4YQMA 3IPZA 4FO5A 1HQOA 2PMTA 3SBCA 5IMAA 1WJKA 4IKHA 2HNLA 2REMA 2YOIA 4L0WA 4ML6A 1G6YA 2C1YA 3IXRA 4O7HA 3ZRDA 1YQ1A 3IHQA 4GSSA 1YEXA 4AJ6A 4F03A 3EC3A 2B1LA 4GLTA 1GSEA 1DBYA 4IQAA 1G7OA 2FA4A 1PA3A 2YV9A 2K18A 4GF0A 2XPEA 4XCSA 5COHA 2H0GA 5DDLA 3TJKA 4KH7A 1ZL9A 3UAPA 4ZB9A 4IGJA 2AAWA 2WCIA 4EXJA 3CSJA 2A2RA 4MJEA 1FVKA 3GNJA 4Q5FA 4MJBA 3PR8A 4EE0A 3ISOA 5IMCA 4K7IA 3QAVA 3FEUA 1X5DA 2VLTA 22GSA 3TKPA 2RUFA 3FHKA 1GWCA 3F0IA 5E59A 2V6KA 2IMIA 5ECLB 4K6XA 1EP8A 2L4CA 3KTLA 3LFLA 1B48A 4TW5A 1X9MB 1SD9A 5J3RA 3BJ5A 2LSTA 3ZREA 2EIRA 1OE8A 5ABRA 5IIZA 4HJ2A 4PQIA 4FYUA 2H30A 4F9ZA 3GURA 1M9BA 2LTKA 2O85A 2AB6A 4N10A 3TJGA 4MPFA 4DEJA 4XTSA 1FB0A 1O6JA 2EIQA 3W6GA 3GIXA 2LJAA 1VF2A 1SKRB 3Q18A 4BL7B 2DJJA 2X8HA 4KUNA 4TXOB 2LNSA 2EIOA 3PGTA 5IMDA 2L5LA 2DC5A 4J56E 3GN3A 4POLA 4IJIA 2X64A 1TP9A 5DBQA 3I43A 4MMMA 1YKAA 4OO4A 5DJLA 2MMNA 2L59A 1PL2A 3FRCA 3JCML 3QPMA 2GVPA 3FKFA 4NAXA 3EVIA 1TKDB 1AAZA 5A5KA 1KEBA 3IRAA 2VCVA 5JWRB 3M9KA 4HUAA 3ZVJD 1R7HA 2FD3A 2JZSA 5J4UA 1BEDA 3F6DA 3IC8A 1TRWA 1YF0A 4MZBA 1EOHA 2H6XA 5ECOB 1AQXA 4LA1A 2IFQB 1WPIA 6GSUA 1XXUA 2FHEA 5IQYA 1WE0A 2NVLA 1XWKA 3TUEA 4G10A 2ES7A 1PQNA 13GSA 2AYTA 1QK8A 3EWLA 4MCUA 1N8JA 1TXXA 3F6FA 3LQ7A 2VL3A 5CRDA 4MP4A 5LCZA 1QMVA 4ML1A 1LJRA 1JZOA 4QQ7A 1U88A 2G2QA 3QAWA 2H1BA 4BVXA 4L5LA 4TOPA 2IIYA 4MK3A 4ILFA 5LNKe 1OVNA 3J7Yb 1SK0A 2CAQA 3Q6OA 1AQWA 2F8AA 3GKNA 3UMAA 3DGQA 2ZNMA 1SD8A 1AUCA 4ZBAA 3C73A 3GKMA 2HSNB 4KF9A 2TRCP 3Q74A 1OE7A 3G7JA 2DJ0A 2HRKA 2C0GA 4ECIA 2H72A 2LJKA 1YDKA 2E2MA 4WF4A 2GQKA 1XPVA 4KNDA 1JHBA 1M2AA 2X99A 1SK1A 5D93A 2I3YA 2OE0A 3KMOA 3CTFA 4POKA 4ZBBA 4TRXA 1O8XA 3IR4A 3N9JA 3HJOA 1XOBA 3O6TA 19GSA 3DEXA 2V32A 2H8LA 5IOWA 5DJMA 3EE2A 2F3MA 3WGXA 3NZNA 2MMZA 3P2AA 3UBLA 1GUHA 5DCHA 2C0EA 1G6WA 3CYNA 3FZAA 1X9WB 1TJDA 5GAPD 1ZGNA 5IMFA 4EF0A 3ZFLA 3DIEA 1TK8B 1GP1A 8GSSA 4GXZA 2CQ9A 2N5FA 3DRNA 3TKSC 3EU3A 4PURA 3ED3A 2DJ3A 2IMKA 3ZLPA 4KGIA 2L4QA 4BPYA 4IJ3A 4NMUA 2F8FA 3WD6A 2JADA 3G7IA 5BMUA 3APSA 4LL4B 3TRPA 1I5GA 2DLXA 2VOCA 3MSZA 1AC1A 1TTZA 3HZ4A 4TVEA 1E2YA 2V6OA 2JSZA 2WDUA 1MD4A 4ISDA 2GSSA 4K7NA 3C8EA 1U3AA 3ERWA 2P5RA 1XWAA 1Q4JA 1GSUA 4PTSA 3VPTA 2CVKA 3DMLA 2LRNA 3GSSA 1HNAA 3P7XA 5JWOB 4V2NA 5EPFA 3HD5A 3H4KA 4TR4A 2WS2A 2GS3A 4IN0A 2XPDA 4Q5RA 1Z7RA 4L5OA 1F3BA 3TCOA 3M8NA 1U87A 5J41A 2LQQA 2JZRA 4EVMA 3TKSA 1TU8A 1GSQA 3U5RE 3RDWA 1TU7A 1ERWA 1OAZA 3H93A 4N30A 1J9BA 5ENUA 1A8YA 2VL2C 4KDXA 5KN1A 2L6CA 1S3AA 4K0GA 2IL3A 1EEJA 1F9MA 4JR6A 3HVXA 2A4VA 1MEKA 2C3NA 1A24A 4G9HA 2QGVA 3HA9A 4ID0A 2VCQA 1SYRA 4OFNA 2VM1A 1A2JA 4BVYA 2IJYA 4OO5A 2HSHA 5ECQB 2ON5A 1K0MA 4KE3A 1HNBA 2BMXA 1MDKA 3I6AA 4TR3A 5L71A 1FG4A 2KOKA 1R5PA 4CHSA 4V1Ag 1E6BA 4GCIA 4PNFA 4F0BA 1GSSA 3BCIA 1PSQA 1NHYA 1AIUA 2X8GA 1R26A 3LXZA 5CAXA 5J9BA 4OD7A 4PQHA 5D9VA 5C00A 1MDJA 2B5EA 4I97A 1VF4A 4MA9A 5ECHB 1R5AA 2FLSA 1K0DA 4LL1B 1GTAA 3GH6A 2GSQA 2VUPA 1O85A 2VL2A 3KTBA 1TOFA 3TB2A 4BL7A 3GHAA 3VWVA 4TXOA 1SK2A 1G0TA 3IC4A 1K0NA 2XBIA 2HRFA 3D4TA 2JU5A 1I9DA 2KLXA 1HD2A 2XBQA 1Z5YE 3D22A 3KEBA 2H1DA 2R2JA 3UIWA 4ZL9A 3LSZA 1M2BA 3KH7A 2YP6A 3EMPA 2LKUA 3H1NA 3DWVA 3U6VA 4WF5A 3EYTA 3FZ4A 3P8WA 1K3YA 4YQVA 3ZL5A 1QUWA 3EINA 4ZILA 3KGKA 1TRVA 1O8WA 4NHWA 1V9WA 3TGZA 5AISA 3EU4A 5ELAA 4JBBA 2NPBA 5B6NA 2I1UA 4JR4A 1ZYQB 4NHZA 3UVTA 2IFQA 3FW2A 5CREA 5IOXA 1XWBA 2GLRA 3BD2A 3D21A 2E2GA 2PN8A 1TRUA 5J9CA 1FVJA 4D73B 2VAFA 1URMA 3HXSA 1DE2A 2I9HA 1ERVA 4IP6A 2O87A 4JRRA 1JZDA 1PRXA 3F4SA 1MD3A 4EDYA 3TOUA 2F51A 2GQLA 2ON7A 4YAPA 1FOVA 3UBKA 1WMJA 4QL9A 2J9HA 1ZMAA 5CRHA 3LG6A 2E0QA 2L57A 1NM3A 2GZZA 5D9WA 2GQMA 2WRTA 3KMNA 4J2FA 3MNGA 4MABA 4TXVA 3ZITA 1XWCA 2B7JA 3F3RA 4K1FA 5G5EA 4BVYB 2B6MA 1SENA 1M2DA 4N0ZA 4WETA
chains in the Genus database with same CATH superfamily
2R3XA 3KXOA 2PERA 1UN2A 2H70A 2HSNA 5JCWA 2GZYA 2MYGA 1DSBA 3VFIA 3APQA 4G0LA 2L6DA 3CRUA 1V98A 16GSA 1XBSA 1YF1A 2YV7A 5INYA 4EDZA 5KOWA 1YEPA 2O5VA 2C80A 1SKSB 1ABAA 3VWXA 2H74A 4FQUA 2JACA 2ZCTA 1PGTA 5G1LA 2BJXA 1GTUA 1F37A 2YANA 4HI7A 3C7MA 1A0FA 3GKKA 2H01A 1PN0A 3J7Yk 2K9FA 2VLUA 4JU5A 1SU9A 4CW9A 5JCUA 1NSWA 18GSA 2B5XA 1A8LA 1FB6A 3KH9A 1QXHA 1Q98A 1M0UA 1M7TA 1Z3EA 3L9UA 1SKWB 1V57A 3I69A 5D9TA 3HJMA 1B9XC 3ZFBA 2YJHA 4ACSA 4ZB7A 2FWEA 3GA4A 4G0IA 2I81A 2AJQB 2LEGA 4ECBA 3F9UA 17GSA 5G31A 2LNTA 3UARA 1GNEA 4XHMA 4N0VA 2FA8A 3FR9A 3C1RA 4TKYA 2WVZA 1FAAA 5DCGA 2QKEA 2GT6A 4ZIJA 4LMVA 4ZBDA 2C0DA 3CTGA 3GL5A 2HI7A 4PNGA 3PINA 3CBUA 5ECIB 2DJKA 4FYBA 2HZEB 2HE3A 4OMVA 2O7KA 3HDCA 2GGTA 4X0XA 3RHCA 2G0FA 5KN0A 3RFRC 4HOJA 3PH9A 2H76A 4HSCX 1YJ6A 2KP1A 3R3EA 4G19A 4V1Ap 1EZKA 3A2XA 4KA0A 2WZSA 2JSYA 3EMXA 3QFBC 1SJ6A 5AGYA 2HRNA 3QDNA 3D6IA 4ZL8A 1RK4A 2I4AA 3BOAA 3TDGA 2FWGA 4I5QA 5H5RA 5H5QA 2E7PA 4I6XA 4WEYA 4BWSA 1B4PA 1UC7A 4PX1A 2PBJA 2TRXA 2IPAA 4F0CA 2H0HA 1OKTA 1K0BA 2FWFA 4MPGA 3F4TA 4OFMA 5A1NB 1THOA 3LYPA 3A3TA 5ECSA 1X5CA 2YJ7A 4QMKA 1JZRA 1VF3A 5EVOA 2J23A 2WZ9A 4IP1A 1XCCA 1SL2B 2PVOC 5AIVA 5G30A 2CZ3A 1Z6NA 6GSWA 5KN2A 1QFNA 2B5YA 4HS1A 1LU4A 1T3BA 1YKCA 3O3TA 1IYIA 1EGRA 2HXKA 4KSOA 2C8UA 3NOFA 5J4VA 4BWQA 1X0RA 3WGEA 1TI3A 3IBHA 2IN3A 2R4VA 2MBTA 3LGCA 3QOUA 1ST9A 4H86A 5GSSA 5LD0A 2DBCA 1V2AA 2EFEA 1TI1A 3GH9A 5G5FA 1GLPA 3HKRA 7GSSA 4MJCA 3WT2A 2B3SA 3IDVA 2A4HA 2DIYA 2OBKA 3HY2A 4CY8A 1T8EB 4CDOA 4GWRA 4FXYP 3UL3A 3KP9A 3QR6A 2GT5A 4J57E 3ZTLA 2MZCA 1R4WA 1BF5A 4WBJA 3WGDA 2YZUA 3MIXA 2HT9A 4K5RA 2XHFA 2FWHA 1PL1A 5HR3A 3E0UA 2FNOA 4O92A 5F06A 2OA7A 2K6VA 4YQUA 4GQCA 3UOMA 3EURA 3KIJA 3F8UA 5AIXA 4O5UA 3ZVJA 2VCXA 3CMIA 1A2LA 2CVBA 1PKWA 2XC2A 2CA8A 5D9XA 4NV2A 2H19A 3F4RA 3CWGA 2QA2A 1A0RP 1EV4A 3GFKA 6GSTA 4G0KA 3GTUB 4IHUA 1OC9B 4D73A 1AXDA 5IM9A 2H1AA 2OE1A 2F9SA 1GSYA 2LUSA 1VGLA 4BA7A 4TR0A 5IMVA 1WIKA 3US3A 3FY7A 3IAS2 3CRTA 3AY8A 2O8VB 3BBYA 1V58A 4USSA 1EP7A 4XS1A 1EWXA 4XRDA 3ME8A 1B8XA 5F05A 2DKHA 3DKSA 4TN8A 1PFOA 2B7KA 2YPMA 5HR1A 2V41A 3C71A 1GSFA 1EEMA 1TW9A 2WVXA 1WWJA 3V1WA 2LS5A 1XIYA 1K0CA 10GSA 4JEDA 3VWUA 2HFDA 4EL1A 1SYXA 1LBKA 3ZMLA 4GRFA 1B4QA 3GV1A 2C3TA 2V1MA 3QAGA 2VKZG 4OCFA 1ML6A 2HLSA 3IE3A 5DAKA 3VWWA 3ME7A 2C3QA 3CSHA 1DE1A 2QC7A 2H71A 5CO3A 4FYCA 3K8NA 1JLVA 2HRAA 2IWTA 3HVNA 2D2ZA 4IBPA 3VI5A 4WKWA 1C72A 3QD9A 2YWMA 2H66A 4HDEA 1BX9A 3R2QA 4IQ1A 4PXOA 3GYKA 1GLQA 4DSSA 3F3QA 2CVDA 3LXTA 1GH2A 1BYEA 4KDYA 1M3IA 1XWGA 3VPQA 1XVQA 2VO4A 5A4WA 2VM2A 1AW9A 2OKAA 2VCZA 3NIVA 3TKQA 4LLRA 3LJRA 4V2LA 4YAVA 3S9FA 1OYJA 2YWOA 3FR6A 3GX0A 1X9SB 2VD0A 4AF2A 2GTUA 2WJUA 2CAIA 5HFIA 5GSTA 4IVFA 4EIQA 3KM6A 2HZEA 3ZMKA 1ON4A 5J5NA 3QFAC 2CV4A 4MH3A 5E4WA 4Z7XA 1IYHA 5DQYA 3M1GA 3MDKA 3FMWA 3HJPA 1AQVA 4KCEA 2M80A 4O5QA 4LMWA 1O7UA 2YWNA 2LQOA 5ID2A 4RI6A 4POBA 3VI7A 2PPTA 2OACA 3TJJA 3C1SA 3M3MA 2HYXA 2OBIA 3E9JB 6GSXA 3RAZA 2GSRA 2RM6A 2VD1A 3FZ9A 3GKXA 3WYWA 4GTUA 4NXIA 1GULA 1TDIA 2UV8G 4KCAA 2YZHA 1HNCA 1YY7A 1XW6A 5G1KA 3GMFA 2K8SA 2DJ2A 4I2UA 2OJLA 3CXGA 4KB3A 5H5SA 4ZL7A 3L78A 3UVHA 1YVLA 4K8MA 2CT6A 3GRXA 1YZXA 5A1NA 1XZOA 1QQ2A 1KNGA 1GUKA 3LWAA 1S3RA 3Q19A 12GSA 1B9YC 1SJIA 1WRYA 4WXTA 1Y1UA 3TKRA 2H1LA 4EKZA 2P0GA 20GSA 1KTEA 1Y25A 4HQSA 3TJBA 2PGTA 2R37A 1SVMA 5IPGA 2HSMA 2GSTA 1BAYA 2LRTA 5ELGA 2H6ZA 1T7PB 5DAKB 2Z9SA 4RUVA 1NHOA 4L0UA 3MAKA 4EO3A 1FW1A 1PMTA 4MZCA 3TRXA 3UJ1A 3H8QA 2X49A 4KSMA 2CX3A 1SL1B 2KP2A 3LW9A 3L9VA 4XS4B 2C0FA 2N5BA 1JZWA 2IMDA 5DALA 4MDCA 5B8AA 4AJ7A 4DSSB 3HHVA 5J4YA 5D96A 4WR5A 2UZ8A 5ECPB 1UA5A 4NV5A 1ILOA 3I9V2 2GZPA 5ECMB 3HZ8A 2A2SA 3BCKA 1PX6A 1DUGA 5B7CA 5J40A 2FY6A 4DVCA 2HSYA 5AN1A 1XFLA 3DYRA 3A5IA 3QMXA 4XIHA 2FUG2 2PVQA 5GAND 5A4UA 3DD3A 5ECKB 2YNXA 2CZ2A 1HYUA 1N2AA 4Q5NA 2H6YA 4F82A 4L8EA 3A2WA 5A34A 2WB9A 4E8HA 4N3ZA 3FK8A 1TK0B 2R5GA 2ZUPA 4YH2A 4HU7A 3IAM2 3FR3A 5HQPA 4IELA 4MZWA 1USBA 5IO2A 2NBSA 1EV9A 1FO5A 3P90A 4RQRA 2DJ1A 4RI7A 2BTOT 4TR1A 2LRCA 5CP1A 4F2IA 3L0HA 1VRSD 1J0FA 2QSIA 1M99A 3DVWA 4E8EA 1GTBA 5B8BA 5ID2B 4HZ2A 4AKIA 2LJRA 3IOSA 3GTUA 1BQ7A 1OC9A 1ZZYA 4ECCA 1XW9A 2PUKC 1Z9HA 5ECRB 5GZZB 3MYDA 3PPUA 2NTOA 4IW9A 2PU9C 4PQ1A 1K3LA 3HVVA 1K0AA 4K9ZA 1RQMA 1T1VA 3DVXA 3W8JA 11GSA 3OR5A 3G9BA 2V2GA 2H73A 2MMAA 2FCHA 3O76A 2O3EA 3KCMA 1F3AA 5IO0A 2VIMA 2AUVA 1PKZA 2VL9A 5A5HB 1Z6MA 5HR2A 4IS0A 2EC4A 1ZYEA 1GRXA 2X8CA 1V40A 5D8IA 1ZOFA 4O5RA 1U3IA 3KZQA 4XS6A 1THXA 1OC3A 1SL0B 1XW5A 4WR4A 3ZZXA 2YWIA 1S3CA 1QGVA 3IHGA 1OKDA 1H4OA 1MDIA 3VURA 2HSMB 3APOA 5BRTA 4X4JA 4HJMA 4FH8A 2OE3A 5CRGA 1O81A 4N11A 4PGTA 1K3OA 1SJZA 4Z2TA 1J08A 1T4ZA 1EGOA 5F0GA 1GUMA 4POMA 3ERGA 1A23A 6GSSA 4YKFA 6GSVA 1GL8A 2H75A 1U6TA 1JFUA 3GX8A 4OWYA 1GSDA 3D5JA 3N5OA 2M46A 3GUSA 3IV4A 4HZ4A 2DIZA 2OT3A 5DALB 2C4JA 2O36A 1WOUA 2GDRA 3FYGA 2H0IA 4I8BA 2JL4A 4ZB6A 4OCEA 1OC8A 3GL3A 1W89A 1NW2A 2RUEA 3KD0A 5ECNB 1PN9A 2LV3A 3IK9A 5F8BA 1ACVA 2DSAA 5IMZA 4I2TA 4W66A 1F6MC 3LORA 2WULA 5DVBA 2VCTA 4EC0A 2MBSA 5D73A 4DSQA 1ZCPA 1M9AA 4NPBA 2IMEA 5FHIA 3TRQA 5HR0A 2CX4A 3G7YA 3IA1A 3LYKA 1FOHA 5A34B 3QCPA 4MLYA 2WFCA 2NDOA 2HZFA 4Q5QA 2OADA 1Z7PA 4PUAA 3VLNA 4GQFA 2AHEA 3TU3B 1G7EA 3HYPA 4WBRD 4MJAA 3H79A 3ZIVA 1PX7A 1ERUA 2RLIA 4AJ8A 3E3EA 4TR1B 5CRWA 3M0FA 5JCGA 1YEWC 4HQZA 3A2VA 2KHPA 2KUCA 4MH2A 1KBNA 5CYYA 1CQGA 3L4NA 4O32A 4ZXGA 2P5QA 1UVZA 1VF1A 4EUYA 4JZQA 4K7OA 3FZ5A 4OFTA 4JE1A 1XOAA 2O89A 5HFKA 5JWQB 3ZIJA 2IMFA 2K8VA 3M9JA 5HFGA 3TKSE 1T4YA 3RHBA 5EY6A 3IK7A 3EPTA 4MF6A 4KW6A 4X43A 3ZYWA 4QL7A 2YCDA 4FIWA 1X5EA 3KJYA 3LEFA 1WP0A 4HEA2 3CSIA 4BVXB 4GSNA 2N5AA 3RBTA 4X1UA 1CQHA 1W4VA 5KN3A 1RW1A 4K2XA 1SVOA 1GTIA 1FHEA 2P31A 2ALBA 4AGSA 2R0GA 2R0PA 1MTCA 3ERFA 14GSA 1TRSA 1A2MA 4P3YB 3TOTA 1GNWA 2R6KA 2FGXA 3RPPA 3D0ZA 5FWGA 2JZTA 4V2MA 2HRKB 1XVWA 5F07A 1T00A 3F63A 4GSTA 2L5OA 3DXBA 3KP8A 4KX4A 2AV4A 2DMLA 1K0OA 2RM5A 4NWYA 4K0NA 2WGRA 1JLWA 4ULXA 5C04A 4MF7A 3VK9A 3TJFA 5A4VA 1O73A 2TIRA 2YN1A 5CNWA 4PUFC 5IPHA 1PD21 1ERTA 2HQTA 1F2EA 3HVSA 3WT1A 4XRAA 1H75A 5G2ZA 3GSTA 2DMMA 4XS4A 1S3DA 2MMOA 9GSSA 1BG5A 6GSYA 1Y6EA 5FT3A 2H1GA 3CQFA 4MF5A 1TK5B 5KEJA 3D4MA 4K2DA 2B1KA 2RIIA 3HCZA 3UEMA 4PHZC 4KDUA 4EIPA 5B6MA 3W8SA 3RPNA 4G2EA 2M72A 3L9SA 4AKXB 4DSRA 4RQXA 2VLVA 4KAEA 5DQSA 3MWHA 3SWLA 4ZB8A 5EL8A 4ECJA 3A5WA 2PWJA 2VCWA 1BJXA 4HU9A 1EOGA 4YQMA 3IPZA 4FO5A 2WW0A 1HQOA 2PMTA 3SBCA 5IMAA 1WJKA 4IKHA 2HNLA 2REMA 2YOIA 4L0WA 4ML6A 1G6YA 2C1YA 3IXRA 4O7HA 3ZRDA 1YQ1A 3IHQA 4GSSA 1YEXA 4AJ6A 4F03A 3EC3A 2B1LA 4GLTA 1GSEA 1DBYA 4IQAA 1G7OA 2FA4A 1PA3A 2YV9A 2K18A 4GF0A 2XPEA 4XCSA 5COHA 3RGBC 5J47A 2H0GA 5DDLA 3TJKA 4KH7A 1ZL9A 3UAPA 4ZB9A 4IGJA 2AAWA 2WCIA 4EXJA 3CSJA 2A2RA 4MJEA 4PI0C 1BG1A 1FVKA 3GNJA 4Q5FA 4MJBA 3PR8A 4EE0A 5A5HA 3ISOA 5IMCA 4K7IA 3QAVA 3FEUA 1X5DA 2VLTA 22GSA 3TKPA 3CHXC 2RUFA 3FHKA 1GWCA 3F0IA 5E59A 2X4AA 2V6KA 2IMIA 5ECLB 4K6XA 1EP8A 2L4CA 3KTLA 3LFLA 1B48A 4TW5A 1X9MB 1SD9A 5J3RA 3BJ5A 2LSTA 3ZREA 2EIRA 1OE8A 5ABRA 5IIZA 4HJ2A 4PQIA 4FYUA 2H30A 4F9ZA 3GURA 1M9BA 2LTKA 2O85A 2AB6A 2EFCA 4Z2UA 4N10A 3TJGA 4MPFA 4DEJA 4XTSA 1FB0A 1N25A 1O6JA 2EIQA 3W6GA 3GIXA 2LJAA 1VF2A 1SKRB 3Q18A 4BL7B 2DJJA 2X8HA 4KUNA 4TXOB 2LNSA 2EIOA 3PGTA 5IMDA 2L5LA 2DC5A 4J56E 3GN3A 4POLA 4K5SA 4IJIA 2X64A 4Z2RA 1TP9A 5DBQA 3I43A 4MMMA 1YKAA 4OO4A 2A2PA 5DJLA 2MMNA 2L59A 1ZYNA 1PL2A 3FRCA 3JCML 3QPMA 2GVPA 3FKFA 4NAXA 3EVIA 4A5PA 1TKDB 4G01A 1AAZA 5A5KA 1KEBA 3IRAA 2VCVA 5JWRB 3M9KA 4HUAA 3ZVJD 1R7HA 2FD3A 4E68A 2JZSA 5J4UA 1BEDA 3F6DA 3IC8A 1TRWA 1YF0A 4MZBA 1EOHA 1I1IP 2H6XA 5ECOB 1AQXA 4LA1A 2IFQB 1WPIA 6GSUA 1XXUA 2FHEA 5IQYA 1WE0A 2NVLA 1XWKA 3TUEA 4G10A 2ES7A 4CY6A 1PQNA 13GSA 2AYTA 1QK8A 3EWLA 4MCUA 1N8JA 1TXXA 3F6FA 3LQ7A 2VL3A 2DKIA 5CRDA 4MP4A 5LCZA 1QMVA 4ML1A 1LJRA 1JZOA 4QQ7A 1U88A 2G2QA 3QAWA 2H1BA 4GDFA 4BVXA 4L5LA 4TOPA 2IIYA 4MK3A 4ILFA 5LNKe 1OVNA 3J7Yb 2EFDA 1SK0A 2CAQA 3Q6OA 1AQWA 2F8AA 3GKNA 3UMAA 3DGQA 2ZNMA 1SD8A 1AUCA 4ZBAA 3C73A 3GKMA 2HSNB 4KF9A 2TRCP 3Q74A 1OE7A 3G7JA 2DJ0A 2HRKA 2C0GA 4ECIA 1S4BP 4AI6A 2H72A 2LJKA 1YDKA 2E2MA 4WF4A 2GQKA 1XPVA 4KNDA 1JHBA 1M2AA 4ICYA 2X99A 2WW1A 1SK1A 5D93A 2I3YA 2OE0A 3KMOA 3CTFA 4POKA 4ZBBA 4TRXA 1O8XA 3IR4A 3N9JA 3HJOA 1XOBA 3O6TA 19GSA 3HMJG 3DEXA 2V32A 2H8LA 5IOWA 5DJMA 3EE2A 2F3MA 3WGXA 3NZNA 2MMZA 3P2AA 3UBLA 1GUHA 5DCHA 2C0EA 1G6WA 3CYNA 3FZAA 1X9WB 2WW3A 1XG8A 1TJDA 5GAPD 1ZGNA 5IMFA 4EF0A 3ZFLA 3DIEA 1TK8B 1GP1A 8GSSA 4GXZA 2CQ9A 2N5FA 3DRNA 2QA1A 3TKSC 3EU3A 4PURA 3ED3A 2DJ3A 2IMKA 3ZLPA 4KGIA 2WVYA 2L4QA 4BPYA 4IJ3A 4NMUA 2F8FA 3WD6A 2JADA 5KOXA 3G7IA 5BMUA 3APSA 4LL4B 3TRPA 1I5GA 2DLXA 1TXUA 2VOCA 3MSZA 1AC1A 1TTZA 3HZ4A 4TVEA 1E2YA 2V6OA 2JSZA 2WDUA 1MD4A 4ISDA 2GSSA 4K7NA 3C8EA 1U3AA 3ERWA 2P5RA 1XWAA 1Q4JA 1GSUA 4PTSA 3VPTA 2CVKA 3DMLA 2LRNA 3GSSA 1HNAA 3P7XA 5JWOB 4V2NA 5EPFA 3HD5A 3H4KA 4TR4A 2WS2A 2GS3A 4IN0A 2XPDA 4Q5RA 1Z7RA 4L5OA 1F3BA 3TCOA 3M8NA 1U87A 5J41A 2LQQA 2JZRA 4EVMA 3TKSA 1TU8A 1GSQA 3U5RE 3RDWA 1TU7A 1ERWA 1OAZA 3H93A 4N30A 1J9BA 5ENUA 1M3JA 1A8YA 2VL2C 4KDXA 5KN1A 2L6CA 1S3AA 4K0GA 2IL3A 1EEJA 1F9MA 4JR6A 3HVXA 2A4VA 1MEKA 2C3NA 1A24A 4G9HA 2QGVA 3HA9A 4ID0A 2VCQA 1SYRA 2VM1A 4OFNA 1A2JA 4BVYA 2IJYA 4OO5A 2HSHA 5ECQB 2ON5A 1K0MA 4KE3A 1HNBA 2BMXA 1MDKA 3I6AA 4TR3A 5L71A 1FG4A 2KOKA 1R5PA 4CHSA 4V1Ag 1E6BA 4GCIA 4PNFA 4F0BA 1GSSA 3BCIA 1PSQA 1NHYA 1AIUA 2X8GA 1R26A 3LXZA 5CAXA 5J9BA 4OD7A 4PQHA 5D9VA 5C00A 1MDJA 2B5EA 4I97A 2EFHA 1VF4A 2WW2A 4MA9A 5ECHB 4MNNA 1R5AA 2FLSA 1K0DA 4LL1B 1GTAA 4AKHA 3GH6A 2GSQA 2VUPA 4AKGA 1O85A 2VL2A 3KTBA 1TOFA 3TB2A 1ZYPA 4BL7A 3GHAA 3VWVA 4TXOA 1SK2A 1G0TA 3IC4A 1K0NA 2XBIA 2HRFA 3D4TA 2JU5A 1I9DA 2KLXA 5BMUB 1HD2A 2XBQA 1Z5YE 3D22A 3KEBA 2H1DA 2R2JA 3UIWA 4ZL9A 3LSZA 1M2BA 3KH7A 2YP6A 3EMPA 2LKUA 3H1NA 3DWVA 3U6VA 4WF5A 3EYTA 3FZ4A 3P8WA 1K3YA 4YQVA 3ZL5A 1QUWA 3EINA 4ZILA 3KGKA 1TRVA 1O8WA 4NHWA 1V9WA 3TGZA 5AISA 3EU4A 5ELAA 4JBBA 2NPBA 5B6NA 2I1UA 2R0CA 4JR4A 1ZYQB 4NHZA 3UVTA 2IFQA 3FW2A 4BIKA 5CREA 5IOXA 1XWBA 2GLRA 3BD2A 3D21A 2E2GA 2PN8A 1TRUA 5J9CA 1FVJA 4D73B 2VAFA 1URMA 3HXSA 1DE2A 2I9HA 1ERVA 4IP6A 2O87A 4JRRA 1JZDA 1PRXA 3F4SA 1MD3A 4EDYA 3TOUA 2F51A 2GQLA 2ON7A 4YAPA 1FOVA 3UBKA 1WMJA 4QL9A 2J9HA 1ZMAA 5CRHA 3LG6A 2E0QA 2L57A 1NM3A 2GZZA 5D9WA 2GQMA 2WRTA 1SVLA 3KMNA 4J2FA 4PI2C 3MNGA 4MABA 4TXVA 3ZITA 4YKGA 1XWCA 2B7JA 3F3RA 4K1FA 5G5EA 4BVYB 2B6MA 2WVXB 1SENA 1M2DA 4N0ZA 4WETA
chains in the Genus database with same CATH topology
2R3XA 3KXOA 2PERA 1UN2A 2H70A 2HSNA 5JCWA 2GZYA 2MYGA 1DSBA 3VFIA 3APQA 4G0LA 2L6DA 3CRUA 1V98A 16GSA 1XBSA 1YF1A 2YV7A 5INYA 4EDZA 5KOWA 1YEPA 2O5VA 2C80A 1SKSB 1ABAA 3VWXA 2H74A 4FQUA 2JACA 2ZCTA 1PGTA 5G1LA 2BJXA 1GTUA 1F37A 2YANA 4HI7A 3C7MA 1A0FA 3GKKA 2H01A 1PN0A 3J7Yk 2K9FA 2VLUA 4JU5A 1SU9A 4CW9A 5JCUA 1NSWA 18GSA 2B5XA 1A8LA 1FB6A 3KH9A 1QXHA 1Q98A 1M0UA 1M7TA 1Z3EA 3L9UA 1SKWB 1V57A 3I69A 5D9TA 3HJMA 1B9XC 3ZFBA 2YJHA 4ACSA 4ZB7A 2FWEA 3GA4A 4G0IA 2I81A 2AJQB 2LEGA 4ECBA 3F9UA 17GSA 5G31A 2LNTA 3UARA 1GNEA 4XHMA 4N0VA 2FA8A 3FR9A 3C1RA 4TKYA 1FAAA 5DCGA 2QKEA 2GT6A 4ZIJA 4LMVA 4ZBDA 2C0DA 3CTGA 3GL5A 2HI7A 4PNGA 3PINA 3CBUA 5ECIB 2DJKA 4FYBA 2HZEB 2HE3A 4OMVA 2O7KA 3HDCA 2GGTA 4X0XA 3RHCA 2G0FA 5KN0A 4HOJA 3PH9A 2H76A 1YJ6A 2KP1A 3R3EA 4G19A 4V1Ap 1EZKA 3A2XA 4KA0A 2JSYA 3EMXA 3QFBC 1SJ6A 5AGYA 2HRNA 3QDNA 3D6IA 4ZL8A 1RK4A 2I4AA 3BOAA 3TDGA 2FWGA 4I5QA 5H5RA 5H5QA 2E7PA 4I6XA 4WEYA 4BWSA 1B4PA 1UC7A 4PX1A 2PBJA 2TRXA 2IPAA 4F0CA 2H0HA 1OKTA 1K0BA 2FWFA 4MPGA 3F4TA 4OFMA 5A1NB 1THOA 3LYPA 3A3TA 5ECSA 1X5CA 2YJ7A 4QMKA 1JZRA 1VF3A 5EVOA 2J23A 2WZ9A 4IP1A 1XCCA 1SL2B 2PVOC 5AIVA 5G30A 2CZ3A 1Z6NA 6GSWA 5KN2A 1QFNA 2B5YA 4HS1A 1LU4A 1T3BA 1YKCA 3O3TA 1IYIA 1EGRA 2HXKA 4KSOA 2C8UA 3NOFA 5J4VA 4BWQA 1X0RA 3WGEA 1TI3A 3IBHA 2IN3A 3LGCA 2R4VA 2MBTA 3QOUA 1ST9A 4H86A 5GSSA 5LD0A 2DBCA 1V2AA 2EFEA 1TI1A 3GH9A 5G5FA 1GLPA 3HKRA 7GSSA 4MJCA 3WT2A 2B3SA 3IDVA 2A4HA 2DIYA 2OBKA 3HY2A 4CY8A 1T8EB 4CDOA 4GWRA 3UL3A 3KP9A 3QR6A 2GT5A 4J57E 3ZTLA 2MZCA 1R4WA 1BF5A 4WBJA 3WGDA 2YZUA 3MIXA 2HT9A 4K5RA 2XHFA 2FWHA 1PL1A 5HR3A 3E0UA 2FNOA 4O92A 5F06A 2OA7A 2K6VA 4YQUA 4GQCA 3UOMA 3EURA 3KIJA 3F8UA 5AIXA 4O5UA 3ZVJA 2VCXA 3CMIA 1A2LA 2CVBA 1PKWA 2XC2A 2CA8A 5D9XA 4NV2A 2H19A 3F4RA 3CWGA 2QA2A 1A0RP 1EV4A 3GFKA 6GSTA 4G0KA 3GTUB 4IHUA 1OC9B 4D73A 1AXDA 5IM9A 2H1AA 2OE1A 2F9SA 1GSYA 2LUSA 1VGLA 4BA7A 4TR0A 5IMVA 1WIKA 3US3A 3FY7A 3IAS2 3CRTA 3AY8A 2O8VB 3BBYA 1V58A 4USSA 1EP7A 4XS1A 1EWXA 4XRDA 3ME8A 1B8XA 5F05A 2DKHA 3DKSA 4TN8A 2B7KA 2YPMA 5HR1A 2V41A 3C71A 1GSFA 1EEMA 1TW9A 1WWJA 3V1WA 2LS5A 1XIYA 1K0CA 10GSA 4JEDA 3VWUA 2HFDA 4EL1A 1SYXA 1LBKA 3ZMLA 4GRFA 1B4QA 3GV1A 2C3TA 2V1MA 3QAGA 2VKZG 4OCFA 1ML6A 2HLSA 3IE3A 5DAKA 3VWWA 3ME7A 2C3QA 3CSHA 1DE1A 2QC7A 2H71A 5CO3A 4FYCA 3K8NA 1JLVA 2HRAA 2IWTA 2D2ZA 4IBPA 3VI5A 4WKWA 1C72A 3QD9A 2YWMA 2H66A 4HDEA 1BX9A 3R2QA 4IQ1A 4PXOA 3GYKA 1GLQA 4DSSA 3F3QA 2CVDA 3LXTA 1GH2A 1BYEA 4KDYA 1XWGA 3VPQA 1XVQA 2VO4A 5A4WA 2VM2A 1AW9A 2OKAA 2VCZA 3NIVA 3TKQA 4LLRA 3LJRA 4V2LA 4YAVA 3S9FA 1OYJA 2YWOA 3FR6A 3GX0A 1X9SB 2VD0A 4AF2A 2GTUA 2WJUA 2CAIA 5HFIA 5GSTA 4IVFA 4EIQA 3KM6A 2HZEA 3ZMKA 1ON4A 5J5NA 3QFAC 2CV4A 4MH3A 5E4WA 4Z7XA 1IYHA 5DQYA 3M1GA 3MDKA 3FMWA 3HJPA 1AQVA 4KCEA 2M80A 4O5QA 4LMWA 1O7UA 2YWNA 2LQOA 5ID2A 4RI6A 4POBA 3VI7A 2PPTA 2OACA 3TJJA 3C1SA 3M3MA 2HYXA 2OBIA 3E9JB 6GSXA 3RAZA 2GSRA 2RM6A 2VD1A 3FZ9A 3GKXA 3WYWA 4GTUA 4NXIA 1GULA 1TDIA 2UV8G 4KCAA 2YZHA 1HNCA 1YY7A 1XW6A 5G1KA 3GMFA 2K8SA 2DJ2A 4I2UA 2OJLA 3CXGA 4KB3A 5H5SA 4ZL7A 3L78A 3UVHA 1YVLA 4K8MA 2CT6A 3GRXA 1YZXA 5A1NA 1XZOA 1QQ2A 1KNGA 1GUKA 3LWAA 3Q19A 12GSA 1B9YC 1SJIA 1WRYA 4WXTA 1Y1UA 3TKRA 2H1LA 4EKZA 2P0GA 20GSA 1KTEA 1Y25A 4HQSA 3TJBA 2PGTA 2R37A 1SVMA 5IPGA 2HSMA 2GSTA 1BAYA 2LRTA 5ELGA 2H6ZA 1T7PB 5DAKB 2Z9SA 4RUVA 1NHOA 4L0UA 3MAKA 4EO3A 1FW1A 1PMTA 4MZCA 3TRXA 3UJ1A 3H8QA 2X49A 4KSMA 2CX3A 1SL1B 2KP2A 3LW9A 3L9VA 4XS4B 2C0FA 2N5BA 1JZWA 2IMDA 5DALA 4MDCA 5B8AA 4AJ7A 4DSSB 3HHVA 5J4YA 5D96A 4WR5A 2UZ8A 5ECPB 1UA5A 4NV5A 1ILOA 3I9V2 2GZPA 5ECMB 3HZ8A 2A2SA 3BCKA 1PX6A 1DUGA 5B7CA 5J40A 2FY6A 4DVCA 2HSYA 5AN1A 1XFLA 3DYRA 3A5IA 3QMXA 4XIHA 2FUG2 2PVQA 5GAND 5A4UA 3DD3A 5ECKB 2YNXA 2CZ2A 1HYUA 1N2AA 4Q5NA 2H6YA 4F82A 4L8EA 3A2WA 5A34A 2WB9A 4E8HA 4N3ZA 3FK8A 1TK0B 2R5GA 2ZUPA 4YH2A 4HU7A 3IAM2 3FR3A 5HQPA 4IELA 4MZWA 1USBA 5IO2A 2NBSA 1EV9A 1FO5A 3P90A 4RQRA 2DJ1A 4RI7A 2BTOT 4TR1A 2LRCA 5CP1A 4F2IA 3L0HA 1VRSD 1J0FA 2QSIA 1M99A 3DVWA 4E8EA 1GTBA 5B8BA 5ID2B 4HZ2A 4AKIA 2LJRA 3IOSA 3GTUA 1BQ7A 1OC9A 1ZZYA 4ECCA 1XW9A 2PUKC 1Z9HA 5ECRB 5GZZB 3MYDA 3PPUA 2NTOA 4IW9A 2PU9C 4PQ1A 1K3LA 3HVVA 1K0AA 4K9ZA 1RQMA 1T1VA 3DVXA 3W8JA 11GSA 3OR5A 3G9BA 2V2GA 2H73A 2MMAA 2FCHA 3O76A 3KCMA 1F3AA 5IO0A 2VIMA 2AUVA 1PKZA 2VL9A 5A5HB 1Z6MA 5HR2A 4IS0A 2EC4A 1ZYEA 1GRXA 2X8CA 1V40A 5D8IA 1ZOFA 4O5RA 1U3IA 3KZQA 4XS6A 1THXA 1OC3A 1SL0B 1XW5A 4WR4A 3ZZXA 2YWIA 1S3CA 1QGVA 3IHGA 1OKDA 1H4OA 1MDIA 3VURA 2HSMB 3APOA 5BRTA 4X4JA 4HJMA 4FH8A 2OE3A 5CRGA 1O81A 4N11A 4PGTA 1K3OA 1SJZA 4Z2TA 1J08A 1T4ZA 1EGOA 5F0GA 1GUMA 4POMA 3ERGA 1A23A 6GSSA 4YKFA 6GSVA 1GL8A 2H75A 1U6TA 1JFUA 3GX8A 4OWYA 1GSDA 3D5JA 3N5OA 2M46A 3GUSA 3IV4A 4HZ4A 2DIZA 2OT3A 5DALB 2C4JA 1WOUA 2GDRA 3FYGA 2H0IA 4I8BA 2JL4A 4ZB6A 4OCEA 1OC8A 3GL3A 1W89A 1NW2A 2RUEA 3KD0A 5ECNB 1PN9A 2LV3A 3IK9A 5F8BA 1ACVA 2DSAA 5IMZA 4I2TA 4W66A 1F6MC 3LORA 2WULA 5DVBA 2VCTA 4EC0A 2MBSA 5D73A 4DSQA 1ZCPA 1M9AA 4NPBA 2IMEA 5FHIA 3TRQA 5HR0A 2CX4A 3G7YA 3IA1A 3LYKA 1FOHA 5A34B 3QCPA 4MLYA 2WFCA 2NDOA 2HZFA 4Q5QA 2OADA 1Z7PA 4PUAA 3VLNA 4GQFA 2AHEA 3TU3B 1G7EA 3HYPA 4WBRD 4MJAA 3H79A 3ZIVA 1PX7A 1ERUA 2RLIA 4AJ8A 3E3EA 4TR1B 5CRWA 3M0FA 5JCGA 4HQZA 3A2VA 2KHPA 2KUCA 4MH2A 1KBNA 5CYYA 1CQGA 3L4NA 4O32A 4ZXGA 2P5QA 1UVZA 1VF1A 4EUYA 4JZQA 4K7OA 3FZ5A 4OFTA 4JE1A 1XOAA 2O89A 5HFKA 5JWQB 3ZIJA 2IMFA 2K8VA 3M9JA 5HFGA 3TKSE 1T4YA 3RHBA 5EY6A 3IK7A 3EPTA 4MF6A 4KW6A 4X43A 3ZYWA 4QL7A 2YCDA 4FIWA 1X5EA 3KJYA 3LEFA 1WP0A 4HEA2 3CSIA 4BVXB 4GSNA 2N5AA 3RBTA 4X1UA 1CQHA 1W4VA 5KN3A 1RW1A 4K2XA 1SVOA 1GTIA 1FHEA 2P31A 2ALBA 4AGSA 2R0GA 2R0PA 1MTCA 3ERFA 14GSA 1TRSA 1A2MA 4P3YB 3TOTA 1GNWA 2R6KA 2FGXA 3RPPA 3D0ZA 5FWGA 2JZTA 4V2MA 2HRKB 1XVWA 5F07A 1T00A 3F63A 4GSTA 2L5OA 3DXBA 3KP8A 4KX4A 2AV4A 2DMLA 1K0OA 2RM5A 4NWYA 4K0NA 2WGRA 1JLWA 4ULXA 5C04A 4MF7A 3VK9A 3TJFA 5A4VA 1O73A 2TIRA 2YN1A 5CNWA 4PUFC 5IPHA 1PD21 1ERTA 2HQTA 1F2EA 3HVSA 3WT1A 4XRAA 1H75A 5G2ZA 3GSTA 2DMMA 4XS4A 1S3DA 2MMOA 9GSSA 1BG5A 6GSYA 1Y6EA 5FT3A 2H1GA 4MF5A 1TK5B 5KEJA 3D4MA 4K2DA 2B1KA 2RIIA 3HCZA 3UEMA 4KDUA 4EIPA 5B6MA 3W8SA 3RPNA 4G2EA 2M72A 3L9SA 4AKXB 4DSRA 4RQXA 2VLVA 4KAEA 5DQSA 3MWHA 3SWLA 4ZB8A 5EL8A 4ECJA 3A5WA 2PWJA 2VCWA 1BJXA 4HU9A 1EOGA 4YQMA 3IPZA 4FO5A 1HQOA 2PMTA 3SBCA 5IMAA 1WJKA 4IKHA 2HNLA 2REMA 2YOIA 4L0WA 4ML6A 1G6YA 2C1YA 3IXRA 4O7HA 3ZRDA 1YQ1A 3IHQA 4GSSA 1YEXA 4AJ6A 4F03A 3EC3A 2B1LA 4GLTA 1GSEA 1DBYA 4IQAA 1G7OA 2FA4A 1PA3A 2YV9A 2K18A 4GF0A 2XPEA 4XCSA 5COHA 5J47A 2H0GA 5DDLA 3TJKA 4KH7A 1ZL9A 3UAPA 4ZB9A 4IGJA 2AAWA 2WCIA 4EXJA 3CSJA 2A2RA 4MJEA 1BG1A 1FVKA 3GNJA 4Q5FA 4MJBA 3PR8A 4EE0A 5A5HA 3ISOA 5IMCA 4K7IA 3QAVA 3FEUA 1X5DA 2VLTA 22GSA 3TKPA 2RUFA 3FHKA 1GWCA 3F0IA 5E59A 2X4AA 2V6KA 2IMIA 5ECLB 4K6XA 1EP8A 2L4CA 3KTLA 3LFLA 1B48A 4TW5A 1X9MB 1SD9A 5J3RA 3BJ5A 2LSTA 3ZREA 2EIRA 1OE8A 5ABRA 5IIZA 4HJ2A 4PQIA 4FYUA 2H30A 4F9ZA 3GURA 1M9BA 2LTKA 2O85A 2AB6A 2EFCA 4Z2UA 4N10A 3TJGA 4MPFA 4DEJA 4XTSA 1FB0A 1N25A 1O6JA 2EIQA 3W6GA 3GIXA 2LJAA 1VF2A 1SKRB 3Q18A 4BL7B 2DJJA 2X8HA 4KUNA 4TXOB 2LNSA 2EIOA 3PGTA 5IMDA 2L5LA 2DC5A 4J56E 3GN3A 4POLA 4K5SA 4IJIA 2X64A 4Z2RA 1TP9A 5DBQA 3I43A 4MMMA 1YKAA 4OO4A 2A2PA 5DJLA 2MMNA 2L59A 1ZYNA 1PL2A 3FRCA 3JCML 3QPMA 2GVPA 3FKFA 4NAXA 3EVIA 4A5PA 1TKDB 4G01A 1AAZA 5A5KA 1KEBA 3IRAA 2VCVA 5JWRB 3M9KA 4HUAA 3ZVJD 1R7HA 2FD3A 4E68A 2JZSA 5J4UA 1BEDA 3F6DA 3IC8A 1TRWA 1YF0A 4MZBA 1EOHA 2H6XA 5ECOB 1AQXA 4LA1A 2IFQB 1WPIA 6GSUA 1XXUA 2FHEA 5IQYA 1WE0A 2NVLA 1XWKA 3TUEA 4G10A 2ES7A 4CY6A 1PQNA 13GSA 2AYTA 1QK8A 3EWLA 4MCUA 1N8JA 1TXXA 3F6FA 3LQ7A 2VL3A 2DKIA 5CRDA 4MP4A 5LCZA 1QMVA 4ML1A 1LJRA 1JZOA 4QQ7A 1U88A 2G2QA 3QAWA 2H1BA 4GDFA 4BVXA 4L5LA 4TOPA 2IIYA 4MK3A 4ILFA 5LNKe 1OVNA 3J7Yb 2EFDA 1SK0A 2CAQA 3Q6OA 1AQWA 2F8AA 3GKNA 3UMAA 3DGQA 2ZNMA 1SD8A 1AUCA 4ZBAA 3C73A 3GKMA 2HSNB 4KF9A 2TRCP 3Q74A 1OE7A 3G7JA 2DJ0A 2HRKA 2C0GA 4ECIA 4AI6A 2H72A 2LJKA 1YDKA 2E2MA 4WF4A 2GQKA 1XPVA 4KNDA 1JHBA 1M2AA 4ICYA 2X99A 1SK1A 5D93A 2I3YA 2OE0A 3KMOA 3CTFA 4POKA 4ZBBA 4TRXA 1O8XA 3IR4A 3N9JA 3HJOA 1XOBA 3O6TA 19GSA 3HMJG 3DEXA 2V32A 2H8LA 5IOWA 5DJMA 3EE2A 2F3MA 3WGXA 3NZNA 2MMZA 3P2AA 3UBLA 1GUHA 5DCHA 2C0EA 1G6WA 3CYNA 3FZAA 1X9WB 1TJDA 5GAPD 1ZGNA 5IMFA 4EF0A 3ZFLA 3DIEA 1TK8B 1GP1A 8GSSA 4GXZA 2CQ9A 2N5FA 3DRNA 2QA1A 3TKSC 3EU3A 4PURA 3ED3A 2DJ3A 2IMKA 3ZLPA 4KGIA 2L4QA 4BPYA 4IJ3A 4NMUA 2F8FA 3WD6A 2JADA 5KOXA 3G7IA 5BMUA 3APSA 4LL4B 3TRPA 1I5GA 2DLXA 1TXUA 2VOCA 3MSZA 1AC1A 1TTZA 3HZ4A 4TVEA 1E2YA 2V6OA 2JSZA 2WDUA 1MD4A 4ISDA 2GSSA 4K7NA 3C8EA 1U3AA 3ERWA 2P5RA 1XWAA 1Q4JA 1GSUA 4PTSA 3VPTA 2CVKA 3DMLA 2LRNA 3GSSA 1HNAA 3P7XA 5JWOB 4V2NA 5EPFA 3HD5A 3H4KA 4TR4A 2WS2A 2GS3A 4IN0A 2XPDA 4Q5RA 1Z7RA 4L5OA 1F3BA 3TCOA 3M8NA 1U87A 5J41A 2LQQA 2JZRA 4EVMA 3TKSA 1TU8A 1GSQA 3U5RE 3RDWA 1TU7A 1ERWA 1OAZA 3H93A 4N30A 1J9BA 5ENUA 1A8YA 2VL2C 4KDXA 5KN1A 2L6CA 1S3AA 4K0GA 2IL3A 1EEJA 1F9MA 4JR6A 3HVXA 2A4VA 1MEKA 2C3NA 1A24A 4G9HA 2QGVA 3HA9A 4ID0A 2VCQA 1SYRA 2VM1A 4OFNA 1A2JA 4BVYA 2IJYA 4OO5A 2HSHA 5ECQB 2ON5A 1K0MA 4KE3A 1HNBA 2BMXA 1MDKA 3I6AA 4TR3A 5L71A 1FG4A 2KOKA 1R5PA 4CHSA 4V1Ag 1E6BA 4GCIA 4PNFA 4F0BA 1GSSA 3BCIA 1PSQA 1NHYA 1AIUA 2X8GA 1R26A 3LXZA 5CAXA 5J9BA 4OD7A 4PQHA 5D9VA 5C00A 1MDJA 2B5EA 4I97A 2EFHA 1VF4A 4MA9A 5ECHB 4MNNA 1R5AA 2FLSA 1K0DA 4LL1B 1GTAA 4AKHA 3GH6A 2GSQA 2VUPA 4AKGA 1O85A 2VL2A 3KTBA 1TOFA 3TB2A 1ZYPA 4BL7A 3GHAA 3VWVA 4TXOA 1SK2A 1G0TA 3IC4A 1K0NA 2XBIA 2HRFA 3D4TA 2JU5A 1I9DA 2KLXA 5BMUB 1HD2A 2XBQA 1Z5YE 3D22A 3KEBA 2H1DA 2R2JA 3UIWA 4ZL9A 3LSZA 1M2BA 3KH7A 2YP6A 3EMPA 2LKUA 3H1NA 3DWVA 3U6VA 4WF5A 3EYTA 3FZ4A 3P8WA 1K3YA 4YQVA 3ZL5A 1QUWA 3EINA 4ZILA 3KGKA 1TRVA 1O8WA 4NHWA 1V9WA 3TGZA 5AISA 3EU4A 5ELAA 4JBBA 2NPBA 5B6NA 2I1UA 2R0CA 4JR4A 1ZYQB 4NHZA 3UVTA 2IFQA 3FW2A 5CREA 5IOXA 1XWBA 2GLRA 3BD2A 3D21A 2E2GA 2PN8A 1TRUA 5J9CA 1FVJA 4D73B 2VAFA 1URMA 3HXSA 1DE2A 2I9HA 1ERVA 4IP6A 2O87A 4JRRA 1JZDA 1PRXA 3F4SA 1MD3A 4EDYA 3TOUA 2F51A 2GQLA 2ON7A 4YAPA 1FOVA 3UBKA 1WMJA 4QL9A 2J9HA 1ZMAA 5CRHA 3LG6A 2E0QA 2L57A 1NM3A 2GZZA 5D9WA 2GQMA 2WRTA 1SVLA 3KMNA 4J2FA 3MNGA 4MABA 4TXVA 3ZITA 4YKGA 1XWCA 2B7JA 3F3RA 4K1FA 5G5EA 4BVYB 2B6MA 1SENA 1M2DA 4N0ZA 4WETA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R3X A;  3KXO A;  2PER A;  1UN2 A;  2H70 A;  5JCW A;  2GZY A;  2MYG A;  1DSB A;  3VFI A;  3APQ A;  4G0L A;  2L6D A;  3CRU A;  1V98 A;  16GS A;  1XBS A;  1YF1 A;  2YV7 A;  5INY A;  4EDZ A;  1YEP A;  2C80 A;  1SKS B;  1ABA A;  3VWX A;  2H74 A;  4FQU A;  2JAC A;  2ZCT A;  1PGT A;  5G1L A;  2BJX A;  1GTU A;  1F37 A;  2YAN A;  4HI7 A;  3C7M A;  1A0F A;  3GKK A;  2H01 A;  3J7Y k;  2K9F A;  2VLU A;  4JU5 A;  1SU9 A;  4CW9 A;  5JCU A;  1NSW A;  18GS A;  2B5X A;  1A8L A;  1FB6 A;  3KH9 A;  1QXH A;  1Q98 A;  1M0U A;  1M7T A;  1Z3E A;  3L9U A;  1SKW B;  1V57 A;  3I69 A;  5D9T A;  3HJM A;  1B9X C;  3ZFB A;  2YJH A;  4ACS A;  2FWE A;  3GA4 A;  4G0I A;  2I81 A;  2AJQ B;  2LEG A;  4ECB A;  3F9U A;  17GS A;  5G31 A;  2LNT A;  3UAR A;  1GNE A;  4XHM A;  4N0V A;  2FA8 A;  3FR9 A;  3C1R A;  4TKY A;  1FAA A;  5DCG A;  2QKE A;  2GT6 A;  4ZIJ A;  4LMV A;  4ZBD A;  2C0D A;  3CTG A;  3GL5 A;  2HI7 A;  4PNG A;  3PIN A;  3CBU A;  5ECI B;  2DJK A;  4FYB A;  2HZE B;  2HE3 A;  4OMV A;  2O7K A;  3HDC A;  2GGT A;  4X0X A;  3RHC A;  2G0F A;  5KN0 A;  4HOJ A;  3PH9 A;  2H76 A;  1YJ6 A;  2KP1 A;  3R3E A;  4G19 A;  4V1A p;  1EZK A;  3A2X A;  4KA0 A;  2JSY A;  3EMX A;  3QFB C;  1SJ6 A;  5AGY A;  2HRN A;  3QDN A;  3D6I A;  4ZL8 A;  1RK4 A;  2I4A A;  3BOA A;  3TDG A;  2FWG A;  4I5Q A;  5H5R A;  5H5Q A;  2E7P A;  4I6X A;  4WEY A;  4BWS A;  1B4P A;  1UC7 A;  4PX1 A;  2PBJ A;  2TRX A;  2IPA A;  4F0C A;  2H0H A;  1OKT A;  1K0B A;  2FWF A;  4MPG A;  3F4T A;  4OFM A;  1THO A;  3LYP A;  3A3T A;  5ECS A;  1X5C A;  2YJ7 A;  1JZR A;  1VF3 A;  5EVO A;  2J23 A;  2WZ9 A;  4IP1 A;  1XCC A;  1SL2 B;  2PVO C;  5AIV A;  5G30 A;  2CZ3 A;  1Z6N A;  6GSW A;  5KN2 A;  1QFN A;  2B5Y A;  4HS1 A;  1LU4 A;  1T3B A;  1YKC A;  3O3T A;  1IYI A;  1EGR A;  2HXK A;  4KSO A;  2C8U A;  3NOF A;  4BWQ A;  1X0R A;  3WGE A;  1TI3 A;  3IBH A;  3QOU A;  3LGC A;  2R4V A;  2IN3 A;  2MBT A;  1ST9 A;  4H86 A;  5GSS A;  5LD0 A;  2DBC A;  1V2A A;  1TI1 A;  3GH9 A;  5G5F A;  1GLP A;  3HKR A;  7GSS A;  4MJC A;  3WT2 A;  2B3S A;  3IDV A;  2DIY A;  2OBK A;  3HY2 A;  1T8E B;  4CDO A;  4GWR A;  3UL3 A;  3KP9 A;  3QR6 A;  2GT5 A;  4J57 E;  3ZTL A;  2MZC A;  1R4W A;  4WBJ A;  3WGD A;  2YZU A;  2HT9 A;  2XHF A;  2FWH A;  1PL1 A;  5HR3 A;  3E0U A;  2FNO A;  4O92 A;  5F06 A;  2OA7 A;  2K6V A;  4YQU A;  4GQC A;  3UOM A;  3EUR A;  3KIJ A;  3F8U A;  5AIX A;  3ZVJ A;  2VCX A;  3CMI A;  1A2L A;  2CVB A;  1PKW A;  2XC2 A;  2CA8 A;  5D9X A;  4NV2 A;  2H19 A;  3F4R A;  1A0R P;  1EV4 A;  3GFK A;  6GST A;  4G0K A;  3GTU B;  4IHU A;  1OC9 B;  4D73 A;  1AXD A;  5IM9 A;  2H1A A;  2OE1 A;  2F9S A;  1GSY A;  2LUS A;  1VGL A;  4BA7 A;  4TR0 A;  5IMV A;  1WIK A;  3US3 A;  3FY7 A;  3IAS 2;  3CRT A;  3AY8 A;  2O8V B;  3BBY A;  1V58 A;  4USS A;  1EP7 A;  4XS1 A;  1EWX A;  4XRD A;  3ME8 A;  1B8X A;  5F05 A;  3DKS A;  4TN8 A;  2B7K A;  2YPM A;  5HR1 A;  2V41 A;  3C71 A;  1GSF A;  1EEM A;  1TW9 A;  1WWJ A;  3V1W A;  2LS5 A;  1XIY A;  1K0C A;  10GS A;  4JED A;  3VWU A;  2HFD A;  4EL1 A;  1SYX A;  1LBK A;  3ZML A;  4GRF A;  1B4Q A;  3GV1 A;  2C3T A;  2V1M A;  3QAG A;  4OCF A;  1ML6 A;  2HLS A;  3IE3 A;  5DAK A;  3VWW A;  3ME7 A;  2C3Q A;  3CSH A;  1DE1 A;  2QC7 A;  2H71 A;  5CO3 A;  4FYC A;  3K8N A;  1JLV A;  2HRA A;  2IWT A;  2D2Z A;  4IBP A;  3VI5 A;  4WKW A;  1C72 A;  3QD9 A;  2YWM A;  2H66 A;  4HDE A;  1BX9 A;  3R2Q A;  4IQ1 A;  4PXO A;  3GYK A;  1GLQ A;  4DSS A;  3F3Q A;  2CVD A;  3LXT A;  1GH2 A;  1BYE A;  4KDY A;  1XWG A;  3VPQ A;  1XVQ A;  2VO4 A;  5A4W A;  2VM2 A;  1AW9 A;  2OKA A;  2VCZ A;  3NIV A;  3TKQ A;  4LLR A;  3LJR A;  4V2L A;  4YAV A;  3S9F A;  1OYJ A;  2YWO A;  3FR6 A;  3GX0 A;  1X9S B;  2VD0 A;  4AF2 A;  2GTU A;  2WJU A;  2CAI A;  5HFI A;  5GST A;  4IVF A;  3KM6 A;  2HZE A;  3ZMK A;  1ON4 A;  5J5N A;  3QFA C;  2CV4 A;  4MH3 A;  5E4W A;  4Z7X A;  1IYH A;  5DQY A;  3M1G A;  3MDK A;  3HJP A;  1AQV A;  4KCE A;  2M80 A;  4LMW A;  1O7U A;  2YWN A;  2LQO A;  5ID2 A;  4RI6 A;  4POB A;  3VI7 A;  2PPT A;  2OAC A;  3TJJ A;  3C1S A;  3M3M A;  2HYX A;  2OBI A;  3E9J B;  6GSX A;  3RAZ A;  2GSR A;  2RM6 A;  2VD1 A;  3FZ9 A;  3GKX A;  3WYW A;  4GTU A;  4NXI A;  1GUL A;  1TDI A;  4KCA A;  2YZH A;  1HNC A;  1YY7 A;  1XW6 A;  5G1K A;  3GMF A;  2K8S A;  2DJ2 A;  4I2U A;  2OJL A;  3CXG A;  4KB3 A;  5H5S A;  4ZL7 A;  3L78 A;  3UVH A;  4K8M A;  2CT6 A;  3GRX A;  1YZX A;  1XZO A;  1QQ2 A;  1KNG A;  1GUK A;  3LWA A;  3Q19 A;  12GS A;  1B9Y C;  1SJI A;  1WRY A;  4WXT A;  3TKR A;  4EKZ A;  2P0G A;  20GS A;  1KTE A;  1Y25 A;  4HQS A;  3TJB A;  2PGT A;  2R37 A;  5IPG A;  2HSM A;  2GST A;  1BAY A;  2LRT A;  5ELG A;  2H6Z A;  1T7P B;  5DAK B;  2Z9S A;  4RUV A;  1NHO A;  4L0U A;  3MAK A;  4EO3 A;  1FW1 A;  1PMT A;  4MZC A;  3TRX A;  3UJ1 A;  3H8Q A;  4KSM A;  2CX3 A;  1SL1 B;  2KP2 A;  3L9V A;  4XS4 B;  2C0F A;  2N5B A;  1JZW A;  2IMD A;  5DAL A;  4MDC A;  5B8A A;  4AJ7 A;  4DSS B;  3HHV A;  5D96 A;  4WR5 A;  2UZ8 A;  5ECP B;  1UA5 A;  4NV5 A;  1ILO A;  3I9V 2;  2GZP A;  5ECM B;  3HZ8 A;  2A2S A;  3BCK A;  1PX6 A;  1DUG A;  5B7C A;  4DVC A;  2FY6 A;  2HSY A;  5AN1 A;  1XFL A;  3DYR A;  3QMX A;  4XIH A;  2FUG 2;  2PVQ A;  5GAN D;  5A4U A;  3DD3 A;  5ECK B;  2YNX A;  2CZ2 A;  1HYU A;  1N2A A;  4Q5N A;  2H6Y A;  4F82 A;  4L8E A;  3A2W A;  2WB9 A;  4E8H A;  3FK8 A;  1TK0 B;  2R5G A;  2ZUP A;  4YH2 A;  4HU7 A;  3IAM 2;  3FR3 A;  5HQP A;  4IEL A;  4MZW A;  1USB A;  5IO2 A;  2NBS A;  1EV9 A;  1FO5 A;  3P90 A;  4RQR A;  2DJ1 A;  4RI7 A;  2BTO T;  4TR1 A;  2LRC A;  5CP1 A;  4F2I A;  3L0H A;  1VRS D;  1J0F A;  2QSI A;  1M99 A;  3DVW A;  4E8E A;  1GTB A;  5B8B A;  5ID2 B;  4HZ2 A;  2LJR A;  3IOS A;  3GTU A;  1BQ7 A;  1OC9 A;  1ZZY A;  4ECC A;  1XW9 A;  2PUK C;  1Z9H A;  5ECR B;  5GZZ B;  3PPU A;  2NTO A;  4IW9 A;  2PU9 C;  4PQ1 A;  1K3L A;  3HVV A;  1K0A A;  4K9Z A;  1RQM A;  1T1V A;  3DVX A;  3W8J A;  11GS A;  3OR5 A;  3G9B A;  2V2G A;  2H73 A;  2MMA A;  2FCH A;  3O76 A;  3KCM A;  1F3A A;  5IO0 A;  2VIM A;  2AUV A;  1PKZ A;  2VL9 A;  1Z6M A;  5HR2 A;  4IS0 A;  2EC4 A;  1ZYE A;  1GRX A;  2X8C A;  1V40 A;  5D8I A;  1ZOF A;  4O5R A;  1U3I A;  3KZQ A;  4XS6 A;  1THX A;  1OC3 A;  1SL0 B;  1XW5 A;  4WR4 A;  3ZZX A;  2YWI A;  1S3C A;  1QGV A;  1OKD A;  1H4O A;  1MDI A;  3VUR A;  2HSM B;  3APO A;  4HJM A;  4FH8 A;  2OE3 A;  5CRG A;  1O81 A;  4N11 A;  4PGT A;  1K3O A;  1SJZ A;  1J08 A;  1T4Z A;  1EGO A;  5F0G A;  1GUM A;  4POM A;  3ERG A;  1A23 A;  6GSS A;  6GSV A;  1GL8 A;  2H75 A;  1U6T A;  1JFU A;  3GX8 A;  4OWY A;  1GSD A;  3D5J A;  3N5O A;  2M46 A;  3GUS A;  3IV4 A;  4HZ4 A;  2DIZ A;  5DAL B;  2C4J A;  1WOU A;  2GDR A;  3FYG A;  2H0I A;  4I8B A;  2JL4 A;  4ZB6 A;  4OCE A;  1OC8 A;  3GL3 A;  1W89 A;  1NW2 A;  2RUE A;  3KD0 A;  5ECN B;  1PN9 A;  2LV3 A;  3IK9 A;  5F8B A;  1ACV A;  2DSA A;  5IMZ A;  4I2T A;  1F6M C;  3LOR A;  2WUL A;  5DVB A;  2VCT A;  4EC0 A;  2MBS A;  5D73 A;  4DSQ A;  1ZCP A;  1M9A A;  4NPB A;  2IME A;  5FHI A;  3TRQ A;  5HR0 A;  2CX4 A;  3G7Y A;  3IA1 A;  3LYK A;  3QCP A;  4MLY A;  2WFC A;  2NDO A;  2HZF A;  4Q5Q A;  2OAD A;  1Z7P A;  4PUA A;  3VLN A;  4GQF A;  2AHE A;  1G7E A;  3HYP A;  4WBR D;  4MJA A;  3H79 A;  3ZIV A;  1PX7 A;  1ERU A;  2RLI A;  4AJ8 A;  3E3E A;  4TR1 B;  5CRW A;  3M0F A;  5JCG A;  4HQZ A;  3A2V A;  2KHP A;  2KUC A;  4MH2 A;  1KBN A;  5CYY A;  1CQG A;  3L4N A;  4O32 A;  4ZXG A;  2P5Q A;  1UVZ A;  1VF1 A;  4EUY A;  4JZQ A;  4K7O A;  3FZ5 A;  4OFT A;  4JE1 A;  1XOA A;  2O89 A;  5HFK A;  5JWQ B;  3ZIJ A;  2IMF A;  2K8V A;  3M9J A;  5HFG A;  3TKS E;  1T4Y A;  3RHB A;  5EY6 A;  3IK7 A;  4MF6 A;  4KW6 A;  4X43 A;  3ZYW A;  4QL7 A;  2YCD A;  4FIW A;  1X5E A;  3KJY A;  3LEF A;  1WP0 A;  4HEA 2;  3CSI A;  4BVX B;  4GSN A;  2N5A A;  3RBT A;  4X1U A;  1CQH A;  1W4V A;  5KN3 A;  1RW1 A;  1GTI A;  1FHE A;  2P31 A;  2ALB A;  4AGS A;  1MTC A;  3ERF A;  14GS A;  1TRS A;  1A2M A;  4P3Y B;  3TOT A;  1GNW A;  2R6K A;  2FGX A;  3RPP A;  3D0Z A;  5FWG A;  2JZT A;  4V2M A;  2HRK B;  1XVW A;  5F07 A;  1T00 A;  3F63 A;  4GST A;  2L5O A;  3DXB A;  3KP8 A;  4KX4 A;  2AV4 A;  2DML A;  1K0O A;  2RM5 A;  4NWY A;  4K0N A;  2WGR A;  1JLW A;  4ULX A;  5C04 A;  4MF7 A;  3VK9 A;  3TJF A;  5A4V A;  1O73 A;  2TIR A;  2YN1 A;  5CNW A;  4PUF C;  5IPH A;  1PD2 1;  1ERT A;  2HQT A;  1F2E A;  3HVS A;  3WT1 A;  4XRA A;  1H75 A;  5G2Z A;  3GST A;  2DMM A;  4XS4 A;  1S3D A;  2MMO A;  9GSS A;  1BG5 A;  6GSY A;  1Y6E A;  5FT3 A;  2H1G A;  4MF5 A;  1TK5 B;  5KEJ A;  3D4M A;  4K2D A;  2B1K A;  2RII A;  3HCZ A;  3UEM A;  4KDU A;  5B6M A;  3W8S A;  3RPN A;  4G2E A;  2M72 A;  3L9S A;  4DSR A;  4RQX A;  2VLV A;  4KAE A;  5DQS A;  3MWH A;  3SWL A;  4ZB8 A;  5EL8 A;  4ECJ A;  3A5W A;  2PWJ A;  2VCW A;  1BJX A;  4HU9 A;  1EOG A;  4YQM A;  3IPZ A;  4FO5 A;  1HQO A;  2PMT A;  3SBC A;  5IMA A;  1WJK A;  4IKH A;  2HNL A;  2REM A;  2YOI A;  4L0W A;  4ML6 A;  1G6Y A;  2C1Y A;  3IXR A;  4O7H A;  3ZRD A;  1YQ1 A;  3IHQ A;  4GSS A;  1YEX A;  4AJ6 A;  4F03 A;  3EC3 A;  2B1L A;  4GLT A;  1GSE A;  1DBY A;  4IQA A;  1G7O A;  2FA4 A;  1PA3 A;  2YV9 A;  2K18 A;  4GF0 A;  2XPE A;  4XCS A;  5COH A;  2H0G A;  5DDL A;  3TJK A;  4KH7 A;  1ZL9 A;  3UAP A;  4ZB9 A;  4IGJ A;  2AAW A;  2WCI A;  4EXJ A;  3CSJ A;  2A2R A;  4MJE A;  1FVK A;  3GNJ A;  4Q5F A;  4MJB A;  3PR8 A;  4EE0 A;  3ISO A;  5IMC A;  4K7I A;  3QAV A;  3FEU A;  1X5D A;  2VLT A;  22GS A;  3TKP A;  2RUF A;  3FHK A;  1GWC A;  3F0I A;  5E59 A;  2V6K A;  2IMI A;  5ECL B;  4K6X A;  1EP8 A;  2L4C A;  3KTL A;  3LFL A;  1B48 A;  4TW5 A;  1X9M B;  1SD9 A;  5J3R A;  3BJ5 A;  2LST A;  3ZRE A;  2EIR A;  1OE8 A;  5ABR A;  5IIZ A;  4HJ2 A;  4PQI A;  4FYU A;  2H30 A;  4F9Z A;  3GUR A;  1M9B A;  2LTK A;  2O85 A;  2AB6 A;  4N10 A;  3TJG A;  4MPF A;  4DEJ A;  4XTS A;  1FB0 A;  1O6J A;  2EIQ A;  3W6G A;  3GIX A;  2LJA A;  1VF2 A;  1SKR B;  3Q18 A;  4BL7 B;  2DJJ A;  2X8H A;  4KUN A;  4TXO B;  2LNS A;  2EIO A;  3PGT A;  5IMD A;  2L5L A;  2DC5 A;  4J56 E;  3GN3 A;  4POL A;  4IJI A;  2X64 A;  1TP9 A;  5DBQ A;  3I43 A;  4MMM A;  1YKA A;  4OO4 A;  5DJL A;  2MMN A;  2L59 A;  1PL2 A;  3FRC A;  3JCM L;  3QPM A;  2GVP A;  3FKF A;  4NAX A;  3EVI A;  1TKD B;  1AAZ A;  5A5K A;  1KEB A;  3IRA A;  2VCV A;  5JWR B;  3M9K A;  4HUA A;  3ZVJ D;  1R7H A;  2FD3 A;  2JZS A;  5J4U A;  1BED A;  3F6D A;  3IC8 A;  1TRW A;  1YF0 A;  4MZB A;  1EOH A;  2H6X A;  5ECO B;  1AQX A;  4LA1 A;  2IFQ B;  1WPI A;  6GSU A;  1XXU A;  2FHE A;  5IQY A;  1WE0 A;  2NVL A;  1XWK A;  3TUE A;  4G10 A;  2ES7 A;  1PQN A;  13GS A;  2AYT A;  1QK8 A;  3EWL A;  4MCU A;  1N8J A;  1TXX A;  3F6F A;  3LQ7 A;  2VL3 A;  5CRD A;  4MP4 A;  5LCZ A;  1QMV A;  4ML1 A;  1LJR A;  1JZO A;  4QQ7 A;  1U88 A;  2G2Q A;  3QAW A;  2H1B A;  4BVX A;  4L5L A;  4TOP A;  2IIY A;  4MK3 A;  4ILF A;  5LNK e;  1OVN A;  3J7Y b;  1SK0 A;  2CAQ A;  3Q6O A;  1AQW A;  2F8A A;  3GKN A;  3UMA A;  3DGQ A;  2ZNM A;  1SD8 A;  1AUC A;  4ZBA A;  3C73 A;  3GKM A;  2HSN B;  4KF9 A;  2TRC P;  3Q74 A;  1OE7 A;  3G7J A;  2DJ0 A;  2HRK A;  2C0G A;  4ECI A;  2H72 A;  2LJK A;  1YDK A;  2E2M A;  4WF4 A;  2GQK A;  1XPV A;  4KND A;  1JHB A;  1M2A A;  2X99 A;  1SK1 A;  5D93 A;  2I3Y A;  2OE0 A;  3KMO A;  3CTF A;  4POK A;  4ZBB A;  4TRX A;  1O8X A;  3IR4 A;  3N9J A;  3HJO A;  1XOB A;  3O6T A;  19GS A;  3DEX A;  2V32 A;  2H8L A;  5IOW A;  5DJM A;  3EE2 A;  2F3M A;  3WGX A;  3NZN A;  2MMZ A;  3P2A A;  3UBL A;  1GUH A;  5DCH A;  2C0E A;  1G6W A;  3CYN A;  3FZA A;  1X9W B;  1TJD A;  5GAP D;  1ZGN A;  5IMF A;  4EF0 A;  3ZFL A;  3DIE A;  1TK8 B;  1GP1 A;  8GSS A;  4GXZ A;  2CQ9 A;  2N5F A;  3DRN A;  3TKS C;  3EU3 A;  4PUR A;  3ED3 A;  2DJ3 A;  2IMK A;  3ZLP A;  4KGI A;  2L4Q A;  4BPY A;  4IJ3 A;  4NMU A;  2F8F A;  3WD6 A;  2JAD A;  3G7I A;  5BMU A;  3APS A;  4LL4 B;  3TRP A;  1I5G A;  2DLX A;  2VOC A;  3MSZ A;  1AC1 A;  1TTZ A;  3HZ4 A;  4TVE A;  1E2Y A;  2V6O A;  2JSZ A;  2WDU A;  1MD4 A;  4ISD A;  2GSS A;  4K7N A;  3C8E A;  1U3A A;  3ERW A;  2P5R A;  1XWA A;  1Q4J A;  1GSU A;  4PTS A;  3VPT A;  2CVK A;  3DML A;  2LRN A;  3GSS A;  1HNA A;  3P7X A;  5JWO B;  4V2N A;  5EPF A;  3HD5 A;  3H4K A;  4TR4 A;  2WS2 A;  2GS3 A;  4IN0 A;  2XPD A;  4Q5R A;  1Z7R A;  4L5O A;  1F3B A;  3TCO A;  3M8N A;  1U87 A;  5J41 A;  2LQQ A;  2JZR A;  4EVM A;  3TKS A;  1TU8 A;  1GSQ A;  3U5R E;  3RDW A;  1TU7 A;  1ERW A;  1OAZ A;  3H93 A;  4N30 A;  1J9B A;  5ENU A;  1A8Y A;  2VL2 C;  4KDX A;  5KN1 A;  2L6C A;  1S3A A;  4K0G A;  2IL3 A;  1EEJ A;  1F9M A;  4JR6 A;  3HVX A;  2A4V A;  1MEK A;  2C3N A;  1A24 A;  4G9H A;  2QGV A;  3HA9 A;  4ID0 A;  2VCQ A;  1SYR A;  4OFN A;  2VM1 A;  1A2J A;  4BVY A;  2IJY A;  4OO5 A;  2HSH A;  5ECQ B;  2ON5 A;  1K0M A;  4KE3 A;  1HNB A;  2BMX A;  1MDK A;  3I6A A;  4TR3 A;  5L71 A;  1FG4 A;  2KOK A;  1R5P A;  4CHS A;  4V1A g;  1E6B A;  4GCI A;  4PNF A;  4F0B A;  1GSS A;  3BCI A;  1PSQ A;  1NHY A;  1AIU A;  2X8G A;  1R26 A;  3LXZ A;  5CAX A;  5J9B A;  4OD7 A;  4PQH A;  5D9V A;  5C00 A;  1MDJ A;  2B5E A;  4I97 A;  1VF4 A;  4MA9 A;  5ECH B;  1R5A A;  2FLS A;  1K0D A;  4LL1 B;  1GTA A;  3GH6 A;  2GSQ A;  2VUP A;  1O85 A;  2VL2 A;  3KTB A;  1TOF A;  3TB2 A;  4BL7 A;  3GHA A;  3VWV A;  4TXO A;  1SK2 A;  1G0T A;  3IC4 A;  1K0N A;  2XBI A;  2HRF A;  3D4T A;  2JU5 A;  1I9D A;  2KLX A;  1HD2 A;  2XBQ A;  1Z5Y E;  3D22 A;  3KEB A;  2H1D A;  2R2J A;  3UIW A;  4ZL9 A;  3LSZ A;  1M2B A;  3KH7 A;  2YP6 A;  3EMP A;  2LKU A;  3H1N A;  3DWV A;  3U6V A;  4WF5 A;  3EYT A;  3FZ4 A;  3P8W A;  1K3Y A;  4YQV A;  3ZL5 A;  1QUW A;  3EIN A;  4ZIL A;  3KGK A;  1TRV A;  1O8W A;  4NHW A;  1V9W A;  3TGZ A;  5AIS A;  3EU4 A;  5ELA A;  4JBB A;  2NPB A;  5B6N A;  2I1U A;  4JR4 A;  1ZYQ B;  4NHZ A;  3UVT A;  2IFQ A;  3FW2 A;  5CRE A;  5IOX A;  1XWB A;  2GLR A;  3BD2 A;  3D21 A;  2E2G A;  2PN8 A;  1TRU A;  5J9C A;  1FVJ A;  4D73 B;  2VAF A;  1URM A;  3HXS A;  1DE2 A;  2I9H A;  1ERV A;  4IP6 A;  2O87 A;  4JRR A;  1JZD A;  1PRX A;  3F4S A;  1MD3 A;  4EDY A;  3TOU A;  2F51 A;  2GQL A;  2ON7 A;  4YAP A;  1FOV A;  3UBK A;  1WMJ A;  4QL9 A;  2J9H A;  1ZMA A;  5CRH A;  3LG6 A;  2E0Q A;  2L57 A;  1NM3 A;  2GZZ A;  5D9W A;  2GQM A;  2WRT A;  3KMN A;  4J2F A;  3MNG A;  4MAB A;  4TXV A;  3ZIT A;  1XWC A;  2B7J A;  3F3R A;  4K1F A;  5G5E A;  4BVY B;  2B6M A;  1SEN A;  1M2D A;  4N0Z A;  4WET A; 
#chains in the Genus database with same CATH topology
 2R3X A;  3KXO A;  2PER A;  1UN2 A;  2H70 A;  2HSN A;  5JCW A;  2GZY A;  2MYG A;  1DSB A;  3VFI A;  3APQ A;  4G0L A;  2L6D A;  3CRU A;  1V98 A;  16GS A;  1XBS A;  1YF1 A;  2YV7 A;  5INY A;  4EDZ A;  5KOW A;  1YEP A;  2O5V A;  2C80 A;  1SKS B;  1ABA A;  3VWX A;  2H74 A;  4FQU A;  2JAC A;  2ZCT A;  1PGT A;  5G1L A;  2BJX A;  1GTU A;  1F37 A;  2YAN A;  4HI7 A;  3C7M A;  1A0F A;  3GKK A;  2H01 A;  1PN0 A;  3J7Y k;  2K9F A;  2VLU A;  4JU5 A;  1SU9 A;  4CW9 A;  5JCU A;  1NSW A;  18GS A;  2B5X A;  1A8L A;  1FB6 A;  3KH9 A;  1QXH A;  1Q98 A;  1M0U A;  1M7T A;  1Z3E A;  3L9U A;  1SKW B;  1V57 A;  3I69 A;  5D9T A;  3HJM A;  1B9X C;  3ZFB A;  2YJH A;  4ACS A;  4ZB7 A;  2FWE A;  3GA4 A;  4G0I A;  2I81 A;  2AJQ B;  2LEG A;  4ECB A;  3F9U A;  17GS A;  5G31 A;  2LNT A;  3UAR A;  1GNE A;  4XHM A;  4N0V A;  2FA8 A;  3FR9 A;  3C1R A;  4TKY A;  2WVZ A;  1FAA A;  5DCG A;  2QKE A;  2GT6 A;  4ZIJ A;  4LMV A;  4ZBD A;  2C0D A;  3CTG A;  3GL5 A;  2HI7 A;  4PNG A;  3PIN A;  3CBU A;  5ECI B;  2DJK A;  4FYB A;  2HZE B;  2HE3 A;  4OMV A;  2O7K A;  3HDC A;  2GGT A;  4X0X A;  3RHC A;  2G0F A;  5KN0 A;  3RFR C;  4HOJ A;  3PH9 A;  2H76 A;  4HSC X;  1YJ6 A;  2KP1 A;  3R3E A;  4G19 A;  4V1A p;  1EZK A;  3A2X A;  4KA0 A;  2WZS A;  2JSY A;  3EMX A;  3QFB C;  1SJ6 A;  5AGY A;  2HRN A;  3QDN A;  3D6I A;  4ZL8 A;  1RK4 A;  2I4A A;  3BOA A;  3TDG A;  2FWG A;  4I5Q A;  5H5R A;  5H5Q A;  2E7P A;  4I6X A;  4WEY A;  4BWS A;  1B4P A;  1UC7 A;  4PX1 A;  2PBJ A;  2TRX A;  2IPA A;  4F0C A;  2H0H A;  1OKT A;  1K0B A;  2FWF A;  4MPG A;  3F4T A;  4OFM A;  5A1N B;  1THO A;  3LYP A;  3A3T A;  5ECS A;  1X5C A;  2YJ7 A;  4QMK A;  1JZR A;  1VF3 A;  5EVO A;  2J23 A;  2WZ9 A;  4IP1 A;  1XCC A;  1SL2 B;  2PVO C;  5AIV A;  5G30 A;  2CZ3 A;  1Z6N A;  6GSW A;  5KN2 A;  1QFN A;  2B5Y A;  4HS1 A;  1LU4 A;  1T3B A;  1YKC A;  3O3T A;  1IYI A;  1EGR A;  2HXK A;  4KSO A;  2C8U A;  3NOF A;  5J4V A;  4BWQ A;  1X0R A;  3WGE A;  1TI3 A;  3IBH A;  2IN3 A;  2R4V A;  2MBT A;  3LGC A;  3QOU A;  1ST9 A;  4H86 A;  5GSS A;  5LD0 A;  2DBC A;  1V2A A;  2EFE A;  1TI1 A;  3GH9 A;  5G5F A;  1GLP A;  3HKR A;  7GSS A;  4MJC A;  3WT2 A;  2B3S A;  3IDV A;  2A4H A;  2DIY A;  2OBK A;  3HY2 A;  4CY8 A;  1T8E B;  4CDO A;  4GWR A;  4FXY P;  3UL3 A;  3KP9 A;  3QR6 A;  2GT5 A;  4J57 E;  3ZTL A;  2MZC A;  1R4W A;  1BF5 A;  4WBJ A;  3WGD A;  2YZU A;  3MIX A;  2HT9 A;  4K5R A;  2XHF A;  2FWH A;  1PL1 A;  5HR3 A;  3E0U A;  2FNO A;  4O92 A;  5F06 A;  2OA7 A;  2K6V A;  4YQU A;  4GQC A;  3UOM A;  3EUR A;  3KIJ A;  3F8U A;  5AIX A;  4O5U A;  3ZVJ A;  2VCX A;  3CMI A;  1A2L A;  2CVB A;  1PKW A;  2XC2 A;  2CA8 A;  5D9X A;  4NV2 A;  2H19 A;  3F4R A;  3CWG A;  2QA2 A;  1A0R P;  1EV4 A;  3GFK A;  6GST A;  4G0K A;  3GTU B;  4IHU A;  1OC9 B;  4D73 A;  1AXD A;  5IM9 A;  2H1A A;  2OE1 A;  2F9S A;  1GSY A;  2LUS A;  1VGL A;  4BA7 A;  4TR0 A;  5IMV A;  1WIK A;  3US3 A;  3FY7 A;  3IAS 2;  3CRT A;  3AY8 A;  2O8V B;  3BBY A;  1V58 A;  4USS A;  1EP7 A;  4XS1 A;  1EWX A;  4XRD A;  3ME8 A;  1B8X A;  5F05 A;  2DKH A;  3DKS A;  4TN8 A;  1PFO A;  2B7K A;  2YPM A;  5HR1 A;  2V41 A;  3C71 A;  1GSF A;  1EEM A;  1TW9 A;  2WVX A;  1WWJ A;  3V1W A;  2LS5 A;  1XIY A;  1K0C A;  10GS A;  4JED A;  3VWU A;  2HFD A;  4EL1 A;  1SYX A;  1LBK A;  3ZML A;  4GRF A;  1B4Q A;  3GV1 A;  2C3T A;  2V1M A;  3QAG A;  2VKZ G;  4OCF A;  1ML6 A;  2HLS A;  3IE3 A;  5DAK A;  3VWW A;  3ME7 A;  2C3Q A;  3CSH A;  1DE1 A;  2QC7 A;  2H71 A;  5CO3 A;  4FYC A;  3K8N A;  1JLV A;  2HRA A;  2IWT A;  3HVN A;  2D2Z A;  4IBP A;  3VI5 A;  4WKW A;  1C72 A;  3QD9 A;  2YWM A;  2H66 A;  4HDE A;  1BX9 A;  3R2Q A;  4IQ1 A;  4PXO A;  3GYK A;  1GLQ A;  4DSS A;  3F3Q A;  2CVD A;  3LXT A;  1GH2 A;  1BYE A;  4KDY A;  1M3I A;  1XWG A;  3VPQ A;  1XVQ A;  2VO4 A;  5A4W A;  2VM2 A;  1AW9 A;  2OKA A;  2VCZ A;  3NIV A;  3TKQ A;  4LLR A;  3LJR A;  4V2L A;  4YAV A;  3S9F A;  1OYJ A;  2YWO A;  3FR6 A;  3GX0 A;  1X9S B;  2VD0 A;  4AF2 A;  2GTU A;  2WJU A;  2CAI A;  5HFI A;  5GST A;  4IVF A;  4EIQ A;  3KM6 A;  2HZE A;  3ZMK A;  1ON4 A;  5J5N A;  3QFA C;  2CV4 A;  4MH3 A;  5E4W A;  4Z7X A;  1IYH A;  5DQY A;  3M1G A;  3MDK A;  3FMW A;  3HJP A;  1AQV A;  4KCE A;  2M80 A;  4O5Q A;  4LMW A;  1O7U A;  2YWN A;  2LQO A;  5ID2 A;  4RI6 A;  4POB A;  3VI7 A;  2PPT A;  2OAC A;  3TJJ A;  3C1S A;  3M3M A;  2HYX A;  2OBI A;  3E9J B;  6GSX A;  3RAZ A;  2GSR A;  2RM6 A;  2VD1 A;  3FZ9 A;  3GKX A;  3WYW A;  4GTU A;  4NXI A;  1GUL A;  1TDI A;  2UV8 G;  4KCA A;  2YZH A;  1HNC A;  1YY7 A;  1XW6 A;  5G1K A;  3GMF A;  2K8S A;  2DJ2 A;  4I2U A;  2OJL A;  3CXG A;  4KB3 A;  5H5S A;  4ZL7 A;  3L78 A;  3UVH A;  1YVL A;  4K8M A;  2CT6 A;  3GRX A;  1YZX A;  5A1N A;  1XZO A;  1QQ2 A;  1KNG A;  1GUK A;  3LWA A;  1S3R A;  3Q19 A;  12GS A;  1B9Y C;  1SJI A;  1WRY A;  4WXT A;  1Y1U A;  3TKR A;  2H1L A;  4EKZ A;  2P0G A;  20GS A;  1KTE A;  1Y25 A;  4HQS A;  3TJB A;  2PGT A;  2R37 A;  1SVM A;  5IPG A;  2HSM A;  2GST A;  1BAY A;  2LRT A;  5ELG A;  2H6Z A;  1T7P B;  5DAK B;  2Z9S A;  4RUV A;  1NHO A;  4L0U A;  3MAK A;  4EO3 A;  1FW1 A;  1PMT A;  4MZC A;  3TRX A;  3UJ1 A;  3H8Q A;  2X49 A;  4KSM A;  2CX3 A;  1SL1 B;  2KP2 A;  3LW9 A;  3L9V A;  4XS4 B;  2C0F A;  2N5B A;  1JZW A;  2IMD A;  5DAL A;  4MDC A;  5B8A A;  4AJ7 A;  4DSS B;  3HHV A;  5J4Y A;  5D96 A;  4WR5 A;  2UZ8 A;  5ECP B;  1UA5 A;  4NV5 A;  1ILO A;  3I9V 2;  2GZP A;  5ECM B;  3HZ8 A;  2A2S A;  3BCK A;  1PX6 A;  1DUG A;  5B7C A;  5J40 A;  2FY6 A;  4DVC A;  2HSY A;  5AN1 A;  1XFL A;  3DYR A;  3A5I A;  3QMX A;  4XIH A;  2FUG 2;  2PVQ A;  5GAN D;  5A4U A;  3DD3 A;  5ECK B;  2YNX A;  2CZ2 A;  1HYU A;  1N2A A;  4Q5N A;  2H6Y A;  4F82 A;  4L8E A;  3A2W A;  5A34 A;  2WB9 A;  4E8H A;  4N3Z A;  3FK8 A;  1TK0 B;  2R5G A;  2ZUP A;  4YH2 A;  4HU7 A;  3IAM 2;  3FR3 A;  5HQP A;  4IEL A;  4MZW A;  1USB A;  5IO2 A;  2NBS A;  1EV9 A;  1FO5 A;  3P90 A;  4RQR A;  2DJ1 A;  4RI7 A;  2BTO T;  4TR1 A;  2LRC A;  5CP1 A;  4F2I A;  3L0H A;  1VRS D;  1J0F A;  2QSI A;  1M99 A;  3DVW A;  4E8E A;  1GTB A;  5B8B A;  5ID2 B;  4HZ2 A;  4AKI A;  2LJR A;  3IOS A;  3GTU A;  1BQ7 A;  1OC9 A;  1ZZY A;  4ECC A;  1XW9 A;  2PUK C;  1Z9H A;  5ECR B;  5GZZ B;  3MYD A;  3PPU A;  2NTO A;  4IW9 A;  2PU9 C;  4PQ1 A;  1K3L A;  3HVV A;  1K0A A;  4K9Z A;  1RQM A;  1T1V A;  3DVX A;  3W8J A;  11GS A;  3OR5 A;  3G9B A;  2V2G A;  2H73 A;  2MMA A;  2FCH A;  3O76 A;  2O3E A;  3KCM A;  1F3A A;  5IO0 A;  2VIM A;  2AUV A;  1PKZ A;  2VL9 A;  5A5H B;  1Z6M A;  5HR2 A;  4IS0 A;  2EC4 A;  1ZYE A;  1GRX A;  2X8C A;  1V40 A;  5D8I A;  1ZOF A;  4O5R A;  1U3I A;  3KZQ A;  4XS6 A;  1THX A;  1OC3 A;  1SL0 B;  1XW5 A;  4WR4 A;  3ZZX A;  2YWI A;  1S3C A;  1QGV A;  3IHG A;  1OKD A;  1H4O A;  1MDI A;  3VUR A;  2HSM B;  3APO A;  5BRT A;  4X4J A;  4HJM A;  4FH8 A;  2OE3 A;  5CRG A;  1O81 A;  4N11 A;  4PGT A;  1K3O A;  1SJZ A;  4Z2T A;  1J08 A;  1T4Z A;  1EGO A;  5F0G A;  1GUM A;  4POM A;  3ERG A;  1A23 A;  6GSS A;  4YKF A;  6GSV A;  1GL8 A;  2H75 A;  1U6T A;  1JFU A;  3GX8 A;  4OWY A;  1GSD A;  3D5J A;  3N5O A;  2M46 A;  3GUS A;  3IV4 A;  4HZ4 A;  2DIZ A;  2OT3 A;  5DAL B;  2C4J A;  2O36 A;  1WOU A;  2GDR A;  3FYG A;  2H0I A;  4I8B A;  2JL4 A;  4ZB6 A;  4OCE A;  1OC8 A;  3GL3 A;  1W89 A;  1NW2 A;  2RUE A;  3KD0 A;  5ECN B;  1PN9 A;  2LV3 A;  3IK9 A;  5F8B A;  1ACV A;  2DSA A;  5IMZ A;  4I2T A;  4W66 A;  1F6M C;  3LOR A;  2WUL A;  5DVB A;  2VCT A;  4EC0 A;  2MBS A;  5D73 A;  4DSQ A;  1ZCP A;  1M9A A;  4NPB A;  2IME A;  5FHI A;  3TRQ A;  5HR0 A;  2CX4 A;  3G7Y A;  3IA1 A;  3LYK A;  1FOH A;  5A34 B;  3QCP A;  4MLY A;  2WFC A;  2NDO A;  2HZF A;  4Q5Q A;  2OAD A;  1Z7P A;  4PUA A;  3VLN A;  4GQF A;  2AHE A;  3TU3 B;  1G7E A;  3HYP A;  4WBR D;  4MJA A;  3H79 A;  3ZIV A;  1PX7 A;  1ERU A;  2RLI A;  4AJ8 A;  3E3E A;  4TR1 B;  5CRW A;  3M0F A;  5JCG A;  1YEW C;  4HQZ A;  3A2V A;  2KHP A;  2KUC A;  4MH2 A;  1KBN A;  5CYY A;  1CQG A;  3L4N A;  4O32 A;  4ZXG A;  2P5Q A;  1UVZ A;  1VF1 A;  4EUY A;  4JZQ A;  4K7O A;  3FZ5 A;  4OFT A;  4JE1 A;  1XOA A;  2O89 A;  5HFK A;  5JWQ B;  3ZIJ A;  2IMF A;  2K8V A;  3M9J A;  5HFG A;  3TKS E;  1T4Y A;  3RHB A;  5EY6 A;  3IK7 A;  3EPT A;  4MF6 A;  4KW6 A;  4X43 A;  3ZYW A;  4QL7 A;  2YCD A;  4FIW A;  1X5E A;  3KJY A;  3LEF A;  1WP0 A;  4HEA 2;  3CSI A;  4BVX B;  4GSN A;  2N5A A;  3RBT A;  4X1U A;  1CQH A;  1W4V A;  5KN3 A;  1RW1 A;  4K2X A;  1SVO A;  1GTI A;  1FHE A;  2P31 A;  2ALB A;  4AGS A;  2R0G A;  2R0P A;  1MTC A;  3ERF A;  14GS A;  1TRS A;  1A2M A;  4P3Y B;  3TOT A;  1GNW A;  2R6K A;  2FGX A;  3RPP A;  3D0Z A;  5FWG A;  2JZT A;  4V2M A;  2HRK B;  1XVW A;  5F07 A;  1T00 A;  3F63 A;  4GST A;  2L5O A;  3DXB A;  3KP8 A;  4KX4 A;  2AV4 A;  2DML A;  1K0O A;  2RM5 A;  4NWY A;  4K0N A;  2WGR A;  1JLW A;  4ULX A;  5C04 A;  4MF7 A;  3VK9 A;  3TJF A;  5A4V A;  1O73 A;  2TIR A;  2YN1 A;  5CNW A;  4PUF C;  5IPH A;  1PD2 1;  1ERT A;  2HQT A;  1F2E A;  3HVS A;  3WT1 A;  4XRA A;  1H75 A;  5G2Z A;  3GST A;  2DMM A;  4XS4 A;  1S3D A;  2MMO A;  9GSS A;  1BG5 A;  6GSY A;  1Y6E A;  5FT3 A;  2H1G A;  3CQF A;  4MF5 A;  1TK5 B;  5KEJ A;  3D4M A;  4K2D A;  2B1K A;  2RII A;  3HCZ A;  3UEM A;  4PHZ C;  4KDU A;  4EIP A;  5B6M A;  3W8S A;  3RPN A;  4G2E A;  2M72 A;  3L9S A;  4AKX B;  4DSR A;  4RQX A;  2VLV A;  4KAE A;  5DQS A;  3MWH A;  3SWL A;  4ZB8 A;  5EL8 A;  4ECJ A;  3A5W A;  2PWJ A;  2VCW A;  1BJX A;  4HU9 A;  1EOG A;  4YQM A;  3IPZ A;  4FO5 A;  2WW0 A;  1HQO A;  2PMT A;  3SBC A;  5IMA A;  1WJK A;  4IKH A;  2HNL A;  2REM A;  2YOI A;  4L0W A;  4ML6 A;  1G6Y A;  2C1Y A;  3IXR A;  4O7H A;  3ZRD A;  1YQ1 A;  3IHQ A;  4GSS A;  1YEX A;  4AJ6 A;  4F03 A;  3EC3 A;  2B1L A;  4GLT A;  1GSE A;  1DBY A;  4IQA A;  1G7O A;  2FA4 A;  1PA3 A;  2YV9 A;  2K18 A;  4GF0 A;  2XPE A;  4XCS A;  5COH A;  3RGB C;  5J47 A;  2H0G A;  5DDL A;  3TJK A;  4KH7 A;  1ZL9 A;  3UAP A;  4ZB9 A;  4IGJ A;  2AAW A;  2WCI A;  4EXJ A;  3CSJ A;  2A2R A;  4MJE A;  4PI0 C;  1BG1 A;  1FVK A;  3GNJ A;  4Q5F A;  4MJB A;  3PR8 A;  4EE0 A;  5A5H A;  3ISO A;  5IMC A;  4K7I A;  3QAV A;  3FEU A;  1X5D A;  2VLT A;  22GS A;  3TKP A;  3CHX C;  2RUF A;  3FHK A;  1GWC A;  3F0I A;  5E59 A;  2X4A A;  2V6K A;  2IMI A;  5ECL B;  4K6X A;  1EP8 A;  2L4C A;  3KTL A;  3LFL A;  1B48 A;  4TW5 A;  1X9M B;  1SD9 A;  5J3R A;  3BJ5 A;  2LST A;  3ZRE A;  2EIR A;  1OE8 A;  5ABR A;  5IIZ A;  4HJ2 A;  4PQI A;  4FYU A;  2H30 A;  4F9Z A;  3GUR A;  1M9B A;  2LTK A;  2O85 A;  2AB6 A;  2EFC A;  4Z2U A;  4N10 A;  3TJG A;  4MPF A;  4DEJ A;  4XTS A;  1FB0 A;  1N25 A;  1O6J A;  2EIQ A;  3W6G A;  3GIX A;  2LJA A;  1VF2 A;  1SKR B;  3Q18 A;  4BL7 B;  2DJJ A;  2X8H A;  4KUN A;  4TXO B;  2LNS A;  2EIO A;  3PGT A;  5IMD A;  2L5L A;  2DC5 A;  4J56 E;  3GN3 A;  4POL A;  4K5S A;  4IJI A;  2X64 A;  4Z2R A;  1TP9 A;  5DBQ A;  3I43 A;  4MMM A;  1YKA A;  4OO4 A;  2A2P A;  5DJL A;  2MMN A;  2L59 A;  1ZYN A;  1PL2 A;  3FRC A;  3JCM L;  3QPM A;  2GVP A;  3FKF A;  4NAX A;  3EVI A;  4A5P A;  1TKD B;  4G01 A;  1AAZ A;  5A5K A;  1KEB A;  3IRA A;  2VCV A;  5JWR B;  3M9K A;  4HUA A;  3ZVJ D;  1R7H A;  2FD3 A;  4E68 A;  2JZS A;  5J4U A;  1BED A;  3F6D A;  3IC8 A;  1TRW A;  1YF0 A;  4MZB A;  1EOH A;  1I1I P;  2H6X A;  5ECO B;  1AQX A;  4LA1 A;  2IFQ B;  1WPI A;  6GSU A;  1XXU A;  2FHE A;  5IQY A;  1WE0 A;  2NVL A;  1XWK A;  3TUE A;  4G10 A;  2ES7 A;  4CY6 A;  1PQN A;  13GS A;  2AYT A;  1QK8 A;  3EWL A;  4MCU A;  1N8J A;  1TXX A;  3F6F A;  3LQ7 A;  2VL3 A;  2DKI A;  5CRD A;  4MP4 A;  5LCZ A;  1QMV A;  4ML1 A;  1LJR A;  1JZO A;  4QQ7 A;  1U88 A;  2G2Q A;  3QAW A;  2H1B A;  4GDF A;  4BVX A;  4L5L A;  4TOP A;  2IIY A;  4MK3 A;  4ILF A;  5LNK e;  1OVN A;  3J7Y b;  2EFD A;  1SK0 A;  2CAQ A;  3Q6O A;  1AQW A;  2F8A A;  3GKN A;  3UMA A;  3DGQ A;  2ZNM A;  1SD8 A;  1AUC A;  4ZBA A;  3C73 A;  3GKM A;  2HSN B;  4KF9 A;  2TRC P;  3Q74 A;  1OE7 A;  3G7J A;  2DJ0 A;  2HRK A;  2C0G A;  4ECI A;  1S4B P;  4AI6 A;  2H72 A;  2LJK A;  1YDK A;  2E2M A;  4WF4 A;  2GQK A;  1XPV A;  4KND A;  1JHB A;  1M2A A;  4ICY A;  2X99 A;  2WW1 A;  1SK1 A;  5D93 A;  2I3Y A;  2OE0 A;  3KMO A;  3CTF A;  4POK A;  4ZBB A;  4TRX A;  1O8X A;  3IR4 A;  3N9J A;  3HJO A;  1XOB A;  3O6T A;  19GS A;  3HMJ G;  3DEX A;  2V32 A;  2H8L A;  5IOW A;  5DJM A;  3EE2 A;  2F3M A;  3WGX A;  3NZN A;  2MMZ A;  3P2A A;  3UBL A;  1GUH A;  5DCH A;  2C0E A;  1G6W A;  3CYN A;  3FZA A;  1X9W B;  2WW3 A;  1XG8 A;  1TJD A;  5GAP D;  1ZGN A;  5IMF A;  4EF0 A;  3ZFL A;  3DIE A;  1TK8 B;  1GP1 A;  8GSS A;  4GXZ A;  2CQ9 A;  2N5F A;  3DRN A;  2QA1 A;  3TKS C;  3EU3 A;  4PUR A;  3ED3 A;  2DJ3 A;  2IMK A;  3ZLP A;  4KGI A;  2WVY A;  2L4Q A;  4BPY A;  4IJ3 A;  4NMU A;  2F8F A;  3WD6 A;  2JAD A;  5KOX A;  3G7I A;  5BMU A;  3APS A;  4LL4 B;  3TRP A;  1I5G A;  2DLX A;  1TXU A;  2VOC A;  3MSZ A;  1AC1 A;  1TTZ A;  3HZ4 A;  4TVE A;  1E2Y A;  2V6O A;  2JSZ A;  2WDU A;  1MD4 A;  4ISD A;  2GSS A;  4K7N A;  3C8E A;  1U3A A;  3ERW A;  2P5R A;  1XWA A;  1Q4J A;  1GSU A;  4PTS A;  3VPT A;  2CVK A;  3DML A;  2LRN A;  3GSS A;  1HNA A;  3P7X A;  5JWO B;  4V2N A;  5EPF A;  3HD5 A;  3H4K A;  4TR4 A;  2WS2 A;  2GS3 A;  4IN0 A;  2XPD A;  4Q5R A;  1Z7R A;  4L5O A;  1F3B A;  3TCO A;  3M8N A;  1U87 A;  5J41 A;  2LQQ A;  2JZR A;  4EVM A;  3TKS A;  1TU8 A;  1GSQ A;  3U5R E;  3RDW A;  1TU7 A;  1ERW A;  1OAZ A;  3H93 A;  4N30 A;  1J9B A;  5ENU A;  1M3J A;  1A8Y A;  2VL2 C;  4KDX A;  5KN1 A;  2L6C A;  1S3A A;  4K0G A;  2IL3 A;  1EEJ A;  1F9M A;  4JR6 A;  3HVX A;  2A4V A;  1MEK A;  2C3N A;  1A24 A;  4G9H A;  2QGV A;  3HA9 A;  4ID0 A;  2VCQ A;  1SYR A;  2VM1 A;  4OFN A;  1A2J A;  4BVY A;  2IJY A;  4OO5 A;  2HSH A;  5ECQ B;  2ON5 A;  1K0M A;  4KE3 A;  1HNB A;  2BMX A;  1MDK A;  3I6A A;  4TR3 A;  5L71 A;  1FG4 A;  2KOK A;  1R5P A;  4CHS A;  4V1A g;  1E6B A;  4GCI A;  4PNF A;  4F0B A;  1GSS A;  3BCI A;  1PSQ A;  1NHY A;  1AIU A;  2X8G A;  1R26 A;  3LXZ A;  5CAX A;  5J9B A;  4OD7 A;  4PQH A;  5D9V A;  5C00 A;  1MDJ A;  2B5E A;  4I97 A;  2EFH A;  1VF4 A;  2WW2 A;  4MA9 A;  5ECH B;  4MNN A;  1R5A A;  2FLS A;  1K0D A;  4LL1 B;  1GTA A;  4AKH A;  3GH6 A;  2GSQ A;  2VUP A;  4AKG A;  1O85 A;  2VL2 A;  3KTB A;  1TOF A;  3TB2 A;  1ZYP A;  4BL7 A;  3GHA A;  3VWV A;  4TXO A;  1SK2 A;  1G0T A;  3IC4 A;  1K0N A;  2XBI A;  2HRF A;  3D4T A;  2JU5 A;  1I9D A;  2KLX A;  5BMU B;  1HD2 A;  2XBQ A;  1Z5Y E;  3D22 A;  3KEB A;  2H1D A;  2R2J A;  3UIW A;  4ZL9 A;  3LSZ A;  1M2B A;  3KH7 A;  2YP6 A;  3EMP A;  2LKU A;  3H1N A;  3DWV A;  3U6V A;  4WF5 A;  3EYT A;  3FZ4 A;  3P8W A;  1K3Y A;  4YQV A;  3ZL5 A;  1QUW A;  3EIN A;  4ZIL A;  3KGK A;  1TRV A;  1O8W A;  4NHW A;  1V9W A;  3TGZ A;  5AIS A;  3EU4 A;  5ELA A;  4JBB A;  2NPB A;  5B6N A;  2I1U A;  2R0C A;  4JR4 A;  1ZYQ B;  4NHZ A;  3UVT A;  2IFQ A;  3FW2 A;  4BIK A;  5CRE A;  5IOX A;  1XWB A;  2GLR A;  3BD2 A;  3D21 A;  2E2G A;  2PN8 A;  1TRU A;  5J9C A;  1FVJ A;  4D73 B;  2VAF A;  1URM A;  3HXS A;  1DE2 A;  2I9H A;  1ERV A;  4IP6 A;  2O87 A;  4JRR A;  1JZD A;  1PRX A;  3F4S A;  1MD3 A;  4EDY A;  3TOU A;  2F51 A;  2GQL A;  2ON7 A;  4YAP A;  1FOV A;  3UBK A;  1WMJ A;  4QL9 A;  2J9H A;  1ZMA A;  5CRH A;  3LG6 A;  2E0Q A;  2L57 A;  1NM3 A;  2GZZ A;  5D9W A;  2GQM A;  2WRT A;  1SVL A;  3KMN A;  4J2F A;  4PI2 C;  3MNG A;  4MAB A;  4TXV A;  3ZIT A;  4YKG A;  1XWC A;  2B7J A;  3F3R A;  4K1F A;  5G5E A;  4BVY B;  2B6M A;  2WVX B;  1SEN A;  1M2D A;  4N0Z A;  4WET A; 
#chains in the Genus database with same CATH homology
 2R3X A;  3KXO A;  2PER A;  1UN2 A;  2H70 A;  2HSN A;  5JCW A;  2GZY A;  2MYG A;  1DSB A;  3VFI A;  3APQ A;  4G0L A;  2L6D A;  3CRU A;  1V98 A;  16GS A;  1XBS A;  1YF1 A;  2YV7 A;  5INY A;  4EDZ A;  5KOW A;  1YEP A;  2O5V A;  2C80 A;  1SKS B;  1ABA A;  3VWX A;  2H74 A;  4FQU A;  2JAC A;  2ZCT A;  1PGT A;  5G1L A;  2BJX A;  1GTU A;  1F37 A;  2YAN A;  4HI7 A;  3C7M A;  1A0F A;  3GKK A;  2H01 A;  1PN0 A;  3J7Y k;  2K9F A;  2VLU A;  4JU5 A;  1SU9 A;  4CW9 A;  5JCU A;  1NSW A;  18GS A;  2B5X A;  1A8L A;  1FB6 A;  3KH9 A;  1QXH A;  1Q98 A;  1M0U A;  1M7T A;  1Z3E A;  3L9U A;  1SKW B;  1V57 A;  3I69 A;  5D9T A;  3HJM A;  1B9X C;  3ZFB A;  2YJH A;  4ACS A;  4ZB7 A;  2FWE A;  3GA4 A;  4G0I A;  2I81 A;  2AJQ B;  2LEG A;  4ECB A;  3F9U A;  17GS A;  5G31 A;  2LNT A;  3UAR A;  1GNE A;  4XHM A;  4N0V A;  2FA8 A;  3FR9 A;  3C1R A;  4TKY A;  1FAA A;  5DCG A;  2QKE A;  2GT6 A;  4ZIJ A;  4LMV A;  4ZBD A;  2C0D A;  3CTG A;  3GL5 A;  2HI7 A;  4PNG A;  3PIN A;  3CBU A;  5ECI B;  2DJK A;  4FYB A;  2HZE B;  2HE3 A;  4OMV A;  2O7K A;  3HDC A;  2GGT A;  4X0X A;  3RHC A;  2G0F A;  5KN0 A;  4HOJ A;  3PH9 A;  2H76 A;  1YJ6 A;  2KP1 A;  3R3E A;  4G19 A;  4V1A p;  1EZK A;  3A2X A;  4KA0 A;  2JSY A;  3EMX A;  3QFB C;  1SJ6 A;  5AGY A;  2HRN A;  3QDN A;  3D6I A;  4ZL8 A;  1RK4 A;  2I4A A;  3BOA A;  3TDG A;  2FWG A;  4I5Q A;  5H5R A;  5H5Q A;  2E7P A;  4I6X A;  4WEY A;  4BWS A;  1B4P A;  1UC7 A;  4PX1 A;  2PBJ A;  2TRX A;  2IPA A;  4F0C A;  2H0H A;  1OKT A;  1K0B A;  2FWF A;  4MPG A;  3F4T A;  4OFM A;  5A1N B;  1THO A;  3LYP A;  3A3T A;  5ECS A;  1X5C A;  2YJ7 A;  4QMK A;  1JZR A;  1VF3 A;  5EVO A;  2J23 A;  2WZ9 A;  4IP1 A;  1XCC A;  1SL2 B;  2PVO C;  5AIV A;  5G30 A;  2CZ3 A;  1Z6N A;  6GSW A;  5KN2 A;  1QFN A;  2B5Y A;  4HS1 A;  1LU4 A;  1T3B A;  1YKC A;  3O3T A;  1IYI A;  1EGR A;  2HXK A;  4KSO A;  2C8U A;  3NOF A;  5J4V A;  4BWQ A;  1X0R A;  3WGE A;  1TI3 A;  3IBH A;  2IN3 A;  3LGC A;  2R4V A;  2MBT A;  3QOU A;  1ST9 A;  4H86 A;  5GSS A;  5LD0 A;  2DBC A;  1V2A A;  2EFE A;  1TI1 A;  3GH9 A;  5G5F A;  1GLP A;  3HKR A;  7GSS A;  4MJC A;  3WT2 A;  2B3S A;  3IDV A;  2A4H A;  2DIY A;  2OBK A;  3HY2 A;  4CY8 A;  1T8E B;  4CDO A;  4GWR A;  3UL3 A;  3KP9 A;  3QR6 A;  2GT5 A;  4J57 E;  3ZTL A;  2MZC A;  1R4W A;  1BF5 A;  4WBJ A;  3WGD A;  2YZU A;  3MIX A;  2HT9 A;  4K5R A;  2XHF A;  2FWH A;  1PL1 A;  5HR3 A;  3E0U A;  2FNO A;  4O92 A;  5F06 A;  2OA7 A;  2K6V A;  4YQU A;  4GQC A;  3UOM A;  3EUR A;  3KIJ A;  3F8U A;  5AIX A;  4O5U A;  3ZVJ A;  2VCX A;  3CMI A;  1A2L A;  2CVB A;  1PKW A;  2XC2 A;  2CA8 A;  5D9X A;  4NV2 A;  2H19 A;  3F4R A;  3CWG A;  2QA2 A;  1A0R P;  1EV4 A;  3GFK A;  6GST A;  4G0K A;  3GTU B;  4IHU A;  1OC9 B;  4D73 A;  1AXD A;  5IM9 A;  2H1A A;  2OE1 A;  2F9S A;  1GSY A;  2LUS A;  1VGL A;  4BA7 A;  4TR0 A;  5IMV A;  1WIK A;  3US3 A;  3FY7 A;  3IAS 2;  3CRT A;  3AY8 A;  2O8V B;  3BBY A;  1V58 A;  4USS A;  1EP7 A;  4XS1 A;  1EWX A;  4XRD A;  3ME8 A;  1B8X A;  5F05 A;  2DKH A;  3DKS A;  4TN8 A;  2B7K A;  2YPM A;  5HR1 A;  2V41 A;  3C71 A;  1GSF A;  1EEM A;  1TW9 A;  1WWJ A;  3V1W A;  2LS5 A;  1XIY A;  1K0C A;  10GS A;  4JED A;  3VWU A;  2HFD A;  4EL1 A;  1SYX A;  1LBK A;  3ZML A;  4GRF A;  1B4Q A;  3GV1 A;  2C3T A;  2V1M A;  3QAG A;  2VKZ G;  4OCF A;  1ML6 A;  2HLS A;  3IE3 A;  5DAK A;  3VWW A;  3ME7 A;  2C3Q A;  3CSH A;  1DE1 A;  2QC7 A;  2H71 A;  5CO3 A;  4FYC A;  3K8N A;  1JLV A;  2HRA A;  2IWT A;  2D2Z A;  4IBP A;  3VI5 A;  4WKW A;  1C72 A;  3QD9 A;  2YWM A;  2H66 A;  4HDE A;  1BX9 A;  3R2Q A;  4IQ1 A;  4PXO A;  3GYK A;  1GLQ A;  4DSS A;  3F3Q A;  2CVD A;  3LXT A;  1GH2 A;  1BYE A;  4KDY A;  1XWG A;  3VPQ A;  1XVQ A;  2VO4 A;  5A4W A;  2VM2 A;  1AW9 A;  2OKA A;  2VCZ A;  3NIV A;  3TKQ A;  4LLR A;  3LJR A;  4V2L A;  4YAV A;  3S9F A;  1OYJ A;  2YWO A;  3FR6 A;  3GX0 A;  1X9S B;  2VD0 A;  4AF2 A;  2GTU A;  2WJU A;  2CAI A;  5HFI A;  5GST A;  4IVF A;  4EIQ A;  3KM6 A;  2HZE A;  3ZMK A;  1ON4 A;  5J5N A;  3QFA C;  2CV4 A;  4MH3 A;  5E4W A;  4Z7X A;  1IYH A;  5DQY A;  3M1G A;  3MDK A;  3FMW A;  3HJP A;  1AQV A;  4KCE A;  2M80 A;  4O5Q A;  4LMW A;  1O7U A;  2YWN A;  2LQO A;  5ID2 A;  4RI6 A;  4POB A;  3VI7 A;  2PPT A;  2OAC A;  3TJJ A;  3C1S A;  3M3M A;  2HYX A;  2OBI A;  3E9J B;  6GSX A;  3RAZ A;  2GSR A;  2RM6 A;  2VD1 A;  3FZ9 A;  3GKX A;  3WYW A;  4GTU A;  4NXI A;  1GUL A;  1TDI A;  2UV8 G;  4KCA A;  2YZH A;  1HNC A;  1YY7 A;  1XW6 A;  5G1K A;  3GMF A;  2K8S A;  2DJ2 A;  4I2U A;  2OJL A;  3CXG A;  4KB3 A;  5H5S A;  4ZL7 A;  3L78 A;  3UVH A;  1YVL A;  4K8M A;  2CT6 A;  3GRX A;  1YZX A;  5A1N A;  1XZO A;  1QQ2 A;  1KNG A;  1GUK A;  3LWA A;  3Q19 A;  12GS A;  1B9Y C;  1SJI A;  1WRY A;  4WXT A;  1Y1U A;  3TKR A;  2H1L A;  4EKZ A;  2P0G A;  20GS A;  1KTE A;  1Y25 A;  4HQS A;  3TJB A;  2PGT A;  2R37 A;  1SVM A;  5IPG A;  2HSM A;  2GST A;  1BAY A;  2LRT A;  5ELG A;  2H6Z A;  1T7P B;  5DAK B;  2Z9S A;  4RUV A;  1NHO A;  4L0U A;  3MAK A;  4EO3 A;  1FW1 A;  1PMT A;  4MZC A;  3TRX A;  3UJ1 A;  3H8Q A;  2X49 A;  4KSM A;  2CX3 A;  1SL1 B;  2KP2 A;  3LW9 A;  3L9V A;  4XS4 B;  2C0F A;  2N5B A;  1JZW A;  2IMD A;  5DAL A;  4MDC A;  5B8A A;  4AJ7 A;  4DSS B;  3HHV A;  5J4Y A;  5D96 A;  4WR5 A;  2UZ8 A;  5ECP B;  1UA5 A;  4NV5 A;  1ILO A;  3I9V 2;  2GZP A;  5ECM B;  3HZ8 A;  2A2S A;  3BCK A;  1PX6 A;  1DUG A;  5B7C A;  5J40 A;  2FY6 A;  4DVC A;  2HSY A;  5AN1 A;  1XFL A;  3DYR A;  3A5I A;  3QMX A;  4XIH A;  2FUG 2;  2PVQ A;  5GAN D;  5A4U A;  3DD3 A;  5ECK B;  2YNX A;  2CZ2 A;  1HYU A;  1N2A A;  4Q5N A;  2H6Y A;  4F82 A;  4L8E A;  3A2W A;  5A34 A;  2WB9 A;  4E8H A;  4N3Z A;  3FK8 A;  1TK0 B;  2R5G A;  2ZUP A;  4YH2 A;  4HU7 A;  3IAM 2;  3FR3 A;  5HQP A;  4IEL A;  4MZW A;  1USB A;  5IO2 A;  2NBS A;  1EV9 A;  1FO5 A;  3P90 A;  4RQR A;  2DJ1 A;  4RI7 A;  2BTO T;  4TR1 A;  2LRC A;  5CP1 A;  4F2I A;  3L0H A;  1VRS D;  1J0F A;  2QSI A;  1M99 A;  3DVW A;  4E8E A;  1GTB A;  5B8B A;  5ID2 B;  4HZ2 A;  4AKI A;  2LJR A;  3IOS A;  3GTU A;  1BQ7 A;  1OC9 A;  1ZZY A;  4ECC A;  1XW9 A;  2PUK C;  1Z9H A;  5ECR B;  5GZZ B;  3MYD A;  3PPU A;  2NTO A;  4IW9 A;  2PU9 C;  4PQ1 A;  1K3L A;  3HVV A;  1K0A A;  4K9Z A;  1RQM A;  1T1V A;  3DVX A;  3W8J A;  11GS A;  3OR5 A;  3G9B A;  2V2G A;  2H73 A;  2MMA A;  2FCH A;  3O76 A;  3KCM A;  1F3A A;  5IO0 A;  2VIM A;  2AUV A;  1PKZ A;  2VL9 A;  5A5H B;  1Z6M A;  5HR2 A;  4IS0 A;  2EC4 A;  1ZYE A;  1GRX A;  2X8C A;  1V40 A;  5D8I A;  1ZOF A;  4O5R A;  1U3I A;  3KZQ A;  4XS6 A;  1THX A;  1OC3 A;  1SL0 B;  1XW5 A;  4WR4 A;  3ZZX A;  2YWI A;  1S3C A;  1QGV A;  3IHG A;  1OKD A;  1H4O A;  1MDI A;  3VUR A;  2HSM B;  3APO A;  5BRT A;  4X4J A;  4HJM A;  4FH8 A;  2OE3 A;  5CRG A;  1O81 A;  4N11 A;  4PGT A;  1K3O A;  1SJZ A;  4Z2T A;  1J08 A;  1T4Z A;  1EGO A;  5F0G A;  1GUM A;  4POM A;  3ERG A;  1A23 A;  6GSS A;  4YKF A;  6GSV A;  1GL8 A;  2H75 A;  1U6T A;  1JFU A;  3GX8 A;  4OWY A;  1GSD A;  3D5J A;  3N5O A;  2M46 A;  3GUS A;  3IV4 A;  4HZ4 A;  2DIZ A;  2OT3 A;  5DAL B;  2C4J A;  1WOU A;  2GDR A;  3FYG A;  2H0I A;  4I8B A;  2JL4 A;  4ZB6 A;  4OCE A;  1OC8 A;  3GL3 A;  1W89 A;  1NW2 A;  2RUE A;  3KD0 A;  5ECN B;  1PN9 A;  2LV3 A;  3IK9 A;  5F8B A;  1ACV A;  2DSA A;  5IMZ A;  4I2T A;  4W66 A;  1F6M C;  3LOR A;  2WUL A;  5DVB A;  2VCT A;  4EC0 A;  2MBS A;  5D73 A;  4DSQ A;  1ZCP A;  1M9A A;  4NPB A;  2IME A;  5FHI A;  3TRQ A;  5HR0 A;  2CX4 A;  3G7Y A;  3IA1 A;  3LYK A;  1FOH A;  5A34 B;  3QCP A;  4MLY A;  2WFC A;  2NDO A;  2HZF A;  4Q5Q A;  2OAD A;  1Z7P A;  4PUA A;  3VLN A;  4GQF A;  2AHE A;  3TU3 B;  1G7E A;  3HYP A;  4WBR D;  4MJA A;  3H79 A;  3ZIV A;  1PX7 A;  1ERU A;  2RLI A;  4AJ8 A;  3E3E A;  4TR1 B;  5CRW A;  3M0F A;  5JCG A;  4HQZ A;  3A2V A;  2KHP A;  2KUC A;  4MH2 A;  1KBN A;  5CYY A;  1CQG A;  3L4N A;  4O32 A;  4ZXG A;  2P5Q A;  1UVZ A;  1VF1 A;  4EUY A;  4JZQ A;  4K7O A;  3FZ5 A;  4OFT A;  4JE1 A;  1XOA A;  2O89 A;  5HFK A;  5JWQ B;  3ZIJ A;  2IMF A;  2K8V A;  3M9J A;  5HFG A;  3TKS E;  1T4Y A;  3RHB A;  5EY6 A;  3IK7 A;  3EPT A;  4MF6 A;  4KW6 A;  4X43 A;  3ZYW A;  4QL7 A;  2YCD A;  4FIW A;  1X5E A;  3KJY A;  3LEF A;  1WP0 A;  4HEA 2;  3CSI A;  4BVX B;  4GSN A;  2N5A A;  3RBT A;  4X1U A;  1CQH A;  1W4V A;  5KN3 A;  1RW1 A;  4K2X A;  1SVO A;  1GTI A;  1FHE A;  2P31 A;  2ALB A;  4AGS A;  2R0G A;  2R0P A;  1MTC A;  3ERF A;  14GS A;  1TRS A;  1A2M A;  4P3Y B;  3TOT A;  1GNW A;  2R6K A;  2FGX A;  3RPP A;  3D0Z A;  5FWG A;  2JZT A;  4V2M A;  2HRK B;  1XVW A;  5F07 A;  1T00 A;  3F63 A;  4GST A;  2L5O A;  3DXB A;  3KP8 A;  4KX4 A;  2AV4 A;  2DML A;  1K0O A;  2RM5 A;  4NWY A;  4K0N A;  2WGR A;  1JLW A;  4ULX A;  5C04 A;  4MF7 A;  3VK9 A;  3TJF A;  5A4V A;  1O73 A;  2TIR A;  2YN1 A;  5CNW A;  4PUF C;  5IPH A;  1PD2 1;  1ERT A;  2HQT A;  1F2E A;  3HVS A;  3WT1 A;  4XRA A;  1H75 A;  5G2Z A;  3GST A;  2DMM A;  4XS4 A;  1S3D A;  2MMO A;  9GSS A;  1BG5 A;  6GSY A;  1Y6E A;  5FT3 A;  2H1G A;  4MF5 A;  1TK5 B;  5KEJ A;  3D4M A;  4K2D A;  2B1K A;  2RII A;  3HCZ A;  3UEM A;  4KDU A;  4EIP A;  5B6M A;  3W8S A;  3RPN A;  4G2E A;  2M72 A;  3L9S A;  4AKX B;  4DSR A;  4RQX A;  2VLV A;  4KAE A;  5DQS A;  3MWH A;  3SWL A;  4ZB8 A;  5EL8 A;  4ECJ A;  3A5W A;  2PWJ A;  2VCW A;  1BJX A;  4HU9 A;  1EOG A;  4YQM A;  3IPZ A;  4FO5 A;  1HQO A;  2PMT A;  3SBC A;  5IMA A;  1WJK A;  4IKH A;  2HNL A;  2REM A;  2YOI A;  4L0W A;  4ML6 A;  1G6Y A;  2C1Y A;  3IXR A;  4O7H A;  3ZRD A;  1YQ1 A;  3IHQ A;  4GSS A;  1YEX A;  4AJ6 A;  4F03 A;  3EC3 A;  2B1L A;  4GLT A;  1GSE A;  1DBY A;  4IQA A;  1G7O A;  2FA4 A;  1PA3 A;  2YV9 A;  2K18 A;  4GF0 A;  2XPE A;  4XCS A;  5COH A;  5J47 A;  2H0G A;  5DDL A;  3TJK A;  4KH7 A;  1ZL9 A;  3UAP A;  4ZB9 A;  4IGJ A;  2AAW A;  2WCI A;  4EXJ A;  3CSJ A;  2A2R A;  4MJE A;  1BG1 A;  1FVK A;  3GNJ A;  4Q5F A;  4MJB A;  3PR8 A;  4EE0 A;  5A5H A;  3ISO A;  5IMC A;  4K7I A;  3QAV A;  3FEU A;  1X5D A;  2VLT A;  22GS A;  3TKP A;  2RUF A;  3FHK A;  1GWC A;  3F0I A;  5E59 A;  2X4A A;  2V6K A;  2IMI A;  5ECL B;  4K6X A;  1EP8 A;  2L4C A;  3KTL A;  3LFL A;  1B48 A;  4TW5 A;  1X9M B;  1SD9 A;  5J3R A;  3BJ5 A;  2LST A;  3ZRE A;  2EIR A;  1OE8 A;  5ABR A;  5IIZ A;  4HJ2 A;  4PQI A;  4FYU A;  2H30 A;  4F9Z A;  3GUR A;  1M9B A;  2LTK A;  2O85 A;  2AB6 A;  2EFC A;  4Z2U A;  4N10 A;  3TJG A;  4MPF A;  4DEJ A;  4XTS A;  1FB0 A;  1N25 A;  1O6J A;  2EIQ A;  3W6G A;  3GIX A;  2LJA A;  1VF2 A;  1SKR B;  3Q18 A;  4BL7 B;  2DJJ A;  2X8H A;  4KUN A;  4TXO B;  2LNS A;  2EIO A;  3PGT A;  5IMD A;  2L5L A;  2DC5 A;  4J56 E;  3GN3 A;  4POL A;  4K5S A;  4IJI A;  2X64 A;  4Z2R A;  1TP9 A;  5DBQ A;  3I43 A;  4MMM A;  1YKA A;  4OO4 A;  2A2P A;  5DJL A;  2MMN A;  2L59 A;  1ZYN A;  1PL2 A;  3FRC A;  3JCM L;  3QPM A;  2GVP A;  3FKF A;  4NAX A;  3EVI A;  4A5P A;  1TKD B;  4G01 A;  1AAZ A;  5A5K A;  1KEB A;  3IRA A;  2VCV A;  5JWR B;  3M9K A;  4HUA A;  3ZVJ D;  1R7H A;  2FD3 A;  4E68 A;  2JZS A;  5J4U A;  1BED A;  3F6D A;  3IC8 A;  1TRW A;  1YF0 A;  4MZB A;  1EOH A;  2H6X A;  5ECO B;  1AQX A;  4LA1 A;  2IFQ B;  1WPI A;  6GSU A;  1XXU A;  2FHE A;  5IQY A;  1WE0 A;  2NVL A;  1XWK A;  3TUE A;  4G10 A;  2ES7 A;  4CY6 A;  1PQN A;  13GS A;  2AYT A;  1QK8 A;  3EWL A;  4MCU A;  1N8J A;  1TXX A;  3F6F A;  3LQ7 A;  2VL3 A;  2DKI A;  5CRD A;  4MP4 A;  5LCZ A;  1QMV A;  4ML1 A;  1LJR A;  1JZO A;  4QQ7 A;  1U88 A;  2G2Q A;  3QAW A;  2H1B A;  4GDF A;  4BVX A;  4L5L A;  4TOP A;  2IIY A;  4MK3 A;  4ILF A;  5LNK e;  1OVN A;  3J7Y b;  2EFD A;  1SK0 A;  2CAQ A;  3Q6O A;  1AQW A;  2F8A A;  3GKN A;  3UMA A;  3DGQ A;  2ZNM A;  1SD8 A;  1AUC A;  4ZBA A;  3C73 A;  3GKM A;  2HSN B;  4KF9 A;  2TRC P;  3Q74 A;  1OE7 A;  3G7J A;  2DJ0 A;  2HRK A;  2C0G A;  4ECI A;  4AI6 A;  2H72 A;  2LJK A;  1YDK A;  2E2M A;  4WF4 A;  2GQK A;  1XPV A;  4KND A;  1JHB A;  1M2A A;  4ICY A;  2X99 A;  1SK1 A;  5D93 A;  2I3Y A;  2OE0 A;  3KMO A;  3CTF A;  4POK A;  4ZBB A;  4TRX A;  1O8X A;  3IR4 A;  3N9J A;  3HJO A;  1XOB A;  3O6T A;  19GS A;  3HMJ G;  3DEX A;  2V32 A;  2H8L A;  5IOW A;  5DJM A;  3EE2 A;  2F3M A;  3WGX A;  3NZN A;  2MMZ A;  3P2A A;  3UBL A;  1GUH A;  5DCH A;  2C0E A;  1G6W A;  3CYN A;  3FZA A;  1X9W B;  1TJD A;  5GAP D;  1ZGN A;  5IMF A;  4EF0 A;  3ZFL A;  3DIE A;  1TK8 B;  1GP1 A;  8GSS A;  4GXZ A;  2CQ9 A;  2N5F A;  3DRN A;  2QA1 A;  3TKS C;  3EU3 A;  4PUR A;  3ED3 A;  2DJ3 A;  2IMK A;  3ZLP A;  4KGI A;  2L4Q A;  4BPY A;  4IJ3 A;  4NMU A;  2F8F A;  3WD6 A;  2JAD A;  5KOX A;  3G7I A;  5BMU A;  3APS A;  4LL4 B;  3TRP A;  1I5G A;  2DLX A;  1TXU A;  2VOC A;  3MSZ A;  1AC1 A;  1TTZ A;  3HZ4 A;  4TVE A;  1E2Y A;  2V6O A;  2JSZ A;  2WDU A;  1MD4 A;  4ISD A;  2GSS A;  4K7N A;  3C8E A;  1U3A A;  3ERW A;  2P5R A;  1XWA A;  1Q4J A;  1GSU A;  4PTS A;  3VPT A;  2CVK A;  3DML A;  2LRN A;  3GSS A;  1HNA A;  3P7X A;  5JWO B;  4V2N A;  5EPF A;  3HD5 A;  3H4K A;  4TR4 A;  2WS2 A;  2GS3 A;  4IN0 A;  2XPD A;  4Q5R A;  1Z7R A;  4L5O A;  1F3B A;  3TCO A;  3M8N A;  1U87 A;  5J41 A;  2LQQ A;  2JZR A;  4EVM A;  3TKS A;  1TU8 A;  1GSQ A;  3U5R E;  3RDW A;  1TU7 A;  1ERW A;  1OAZ A;  3H93 A;  4N30 A;  1J9B A;  5ENU A;  1A8Y A;  2VL2 C;  4KDX A;  5KN1 A;  2L6C A;  1S3A A;  4K0G A;  2IL3 A;  1EEJ A;  1F9M A;  4JR6 A;  3HVX A;  2A4V A;  1MEK A;  2C3N A;  1A24 A;  4G9H A;  2QGV A;  3HA9 A;  4ID0 A;  2VCQ A;  1SYR A;  2VM1 A;  4OFN A;  1A2J A;  4BVY A;  2IJY A;  4OO5 A;  2HSH A;  5ECQ B;  2ON5 A;  1K0M A;  4KE3 A;  1HNB A;  2BMX A;  1MDK A;  3I6A A;  4TR3 A;  5L71 A;  1FG4 A;  2KOK A;  1R5P A;  4CHS A;  4V1A g;  1E6B A;  4GCI A;  4PNF A;  4F0B A;  1GSS A;  3BCI A;  1PSQ A;  1NHY A;  1AIU A;  2X8G A;  1R26 A;  3LXZ A;  5CAX A;  5J9B A;  4OD7 A;  4PQH A;  5D9V A;  5C00 A;  1MDJ A;  2B5E A;  4I97 A;  2EFH A;  1VF4 A;  4MA9 A;  5ECH B;  4MNN A;  1R5A A;  2FLS A;  1K0D A;  4LL1 B;  1GTA A;  4AKH A;  3GH6 A;  2GSQ A;  2VUP A;  4AKG A;  1O85 A;  2VL2 A;  3KTB A;  1TOF A;  3TB2 A;  1ZYP A;  4BL7 A;  3GHA A;  3VWV A;  4TXO A;  1SK2 A;  1G0T A;  3IC4 A;  1K0N A;  2XBI A;  2HRF A;  3D4T A;  2JU5 A;  1I9D A;  2KLX A;  5BMU B;  1HD2 A;  2XBQ A;  1Z5Y E;  3D22 A;  3KEB A;  2H1D A;  2R2J A;  3UIW A;  4ZL9 A;  3LSZ A;  1M2B A;  3KH7 A;  2YP6 A;  3EMP A;  2LKU A;  3H1N A;  3DWV A;  3U6V A;  4WF5 A;  3EYT A;  3FZ4 A;  3P8W A;  1K3Y A;  4YQV A;  3ZL5 A;  1QUW A;  3EIN A;  4ZIL A;  3KGK A;  1TRV A;  1O8W A;  4NHW A;  1V9W A;  3TGZ A;  5AIS A;  3EU4 A;  5ELA A;  4JBB A;  2NPB A;  5B6N A;  2I1U A;  2R0C A;  4JR4 A;  1ZYQ B;  4NHZ A;  3UVT A;  2IFQ A;  3FW2 A;  5CRE A;  5IOX A;  1XWB A;  2GLR A;  3BD2 A;  3D21 A;  2E2G A;  2PN8 A;  1TRU A;  5J9C A;  1FVJ A;  4D73 B;  2VAF A;  1URM A;  3HXS A;  1DE2 A;  2I9H A;  1ERV A;  4IP6 A;  2O87 A;  4JRR A;  1JZD A;  1PRX A;  3F4S A;  1MD3 A;  4EDY A;  3TOU A;  2F51 A;  2GQL A;  2ON7 A;  4YAP A;  1FOV A;  3UBK A;  1WMJ A;  4QL9 A;  2J9H A;  1ZMA A;  5CRH A;  3LG6 A;  2E0Q A;  2L57 A;  1NM3 A;  2GZZ A;  5D9W A;  2GQM A;  2WRT A;  1SVL A;  3KMN A;  4J2F A;  3MNG A;  4MAB A;  4TXV A;  3ZIT A;  4YKG A;  1XWC A;  2B7J A;  3F3R A;  4K1F A;  5G5E A;  4BVY B;  2B6M A;  1SEN A;  1M2D A;  4N0Z A;  4WET A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...